data_3I7L
# 
_entry.id   3I7L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I7L         
RCSB  RCSB054064   
WWPDB D_1000054064 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7H 'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX'    unspecified 
PDB 3I7K 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX'    unspecified 
PDB 3I7N 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1'  unspecified 
PDB 3I7O 'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1'  unspecified 
PDB 3I7P 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I89 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I8C 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' unspecified 
PDB 3I8E 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I7L 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I7L 
_cell.length_a           63.780 
_cell.length_b           134.149 
_cell.length_c           182.561 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I7L 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1' 127399.766 1 ? ? ?                ? 
2 polymer syn 'DNA damage-binding protein 2' 1620.920   1 ? ? 'Residues 68-81' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
2 'Damage-specific DNA-binding protein 2, DDB p48 subunit, DDBb, UV-damaged DNA-binding protein 2, UV-DDB 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no SIVRTLHQHKLGRA SIVRTLHQHKLGRA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    SER n 
2 2    ILE n 
2 3    VAL n 
2 4    ARG n 
2 5    THR n 
2 6    LEU n 
2 7    HIS n 
2 8    GLN n 
2 9    HIS n 
2 10   LYS n 
2 11   LEU n 
2 12   GLY n 
2 13   ARG n 
2 14   ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1  ? 
2 UNP DDB2_HUMAN Q92466 2 SIVRTLHQHKLGRA 68 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I7L A 4 ? 1143 ? Q16531 1  ? 1140 ? 1  1140 
2 2 3I7L B 1 ? 14   ? Q92466 68 ? 81   ? 68 81   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I7L GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1 
1 3I7L SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2 
1 3I7L HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3 
1 3I7L TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4 
1 3I7L ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5 
1 3I7L VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I7L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.03 
_exptl_crystal.density_percent_sol   59.36 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005 M DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I7L 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             48.74 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   35953 
_reflns.number_all                   39401 
_reflns.percent_possible_obs         91.2 
_reflns.pdbx_Rmerge_I_obs            0.091 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.87 
_reflns_shell.percent_possible_all   86.3 
_reflns_shell.Rmerge_I_obs           0.589 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2427 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3I7L 
_refine.ls_number_reflns_obs                     35953 
_refine.ls_number_reflns_all                     39401 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.74 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    95.97 
_refine.ls_R_factor_obs                          0.249 
_refine.ls_R_factor_all                          0.269 
_refine.ls_R_factor_R_work                       0.247 
_refine.ls_R_factor_R_free                       0.289 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1894 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.908 
_refine.correlation_coeff_Fo_to_Fc_free          0.884 
_refine.B_iso_mean                               77.702 
_refine.aniso_B[1][1]                            -1.72 
_refine.aniso_B[2][2]                            -2.32 
_refine.aniso_B[3][3]                            4.03 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.691 
_refine.pdbx_overall_ESU_R_Free                  0.414 
_refine.overall_SU_ML                            0.320 
_refine.overall_SU_B                             15.913 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8840 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8840 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        48.74 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015  0.022  ? 9001  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.649  1.965  ? 12189 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.093  5.000  ? 1123  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   41.114 24.681 ? 408   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   21.069 15.000 ? 1595  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   17.336 15.000 ? 50    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.110  0.200  ? 1405  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 6715  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.261  0.200  ? 4369  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.320  0.200  ? 5965  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.197  0.200  ? 315   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.180  0.200  ? 27    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.078  0.200  ? 2     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.872 
_refine_ls_shell.number_reflns_R_work             2427 
_refine_ls_shell.R_factor_R_work                  0.363 
_refine_ls_shell.percent_reflns_obs               89.88 
_refine_ls_shell.R_factor_R_free                  0.478 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             123 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2427 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3I7L 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, DNA damage-binding protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I7L 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;DDB1, DDB2, H-Box Motif, Cytoplasm, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, Alternative splicing, Disease mutation, WD repeat, Xeroderma pigmentosum, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 253  ? GLN A 258  ? PRO A 250  GLN A 255  5 ? 6  
HELX_P HELX_P2  2  ALA A 384  ? GLU A 387  ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P3  3  SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P4  4  GLU A 1072 ? SER A 1078 ? GLU A 1069 SER A 1075 1 ? 7  
HELX_P HELX_P5  5  GLY A 1094 ? SER A 1099 ? GLY A 1091 SER A 1096 1 ? 6  
HELX_P HELX_P6  6  PHE A 1100 ? ASP A 1102 ? PHE A 1097 ASP A 1099 5 ? 3  
HELX_P HELX_P7  7  SER A 1104 ? VAL A 1111 ? SER A 1101 VAL A 1108 1 ? 8  
HELX_P HELX_P8  8  THR A 1128 ? THR A 1140 ? THR A 1125 THR A 1137 1 ? 13 
HELX_P HELX_P9  9  ARG A 1141 ? HIS A 1143 ? ARG A 1138 HIS A 1140 5 ? 3  
HELX_P HELX_P10 10 SER B 1    ? LEU B 11   ? SER B 68   LEU B 78   1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            21 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            316 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             18 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             313 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.063 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           574 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            571 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    575 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     572 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       5.95 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
K ? 4 ? 
L ? 2 ? 
M ? 3 ? 
N ? 4 ? 
O ? 4 ? 
P ? 4 ? 
Q ? 3 ? 
R ? 5 ? 
S ? 4 ? 
T ? 4 ? 
U ? 4 ? 
V ? 4 ? 
W ? 4 ? 
X ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? parallel      
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
X 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
A 2 GLN A 1028 ? THR A 1035 ? GLN A 1025 THR A 1032 
A 3 ILE A 1040 ? SER A 1045 ? ILE A 1037 SER A 1042 
A 4 ASN A 7    ? GLN A 13   ? ASN A 4    GLN A 10   
A 5 PHE A 1091 ? ASP A 1093 ? PHE A 1088 ASP A 1090 
B 1 GLY A 20   ? GLY A 24   ? GLY A 17   GLY A 21   
B 2 ASN A 33   ? ALA A 37   ? ASN A 30   ALA A 34   
B 3 ARG A 41   ? VAL A 47   ? ARG A 38   VAL A 44   
B 4 LEU A 52   ? GLY A 59   ? LEU A 49   GLY A 56   
C 1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C 2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C 3 ASN A 88   ? LYS A 95   ? ASN A 85   LYS A 92   
C 4 ASP A 102  ? ASN A 110  ? ASP A 99   ASN A 107  
D 1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D 2 MET A 133  ? ARG A 137  ? MET A 130  ARG A 134  
D 3 LYS A 144  ? PRO A 147  ? LYS A 141  PRO A 144  
D 4 PHE A 158  ? ASN A 159  ? PHE A 155  ASN A 156  
E 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
E 2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
E 3 GLY A 190  ? SER A 199  ? GLY A 187  SER A 196  
E 4 GLU A 204  ? LYS A 207  ? GLU A 201  LYS A 204  
F 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
F 2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
F 3 GLY A 190  ? SER A 199  ? GLY A 187  SER A 196  
F 4 GLU A 213  ? VAL A 215  ? GLU A 210  VAL A 212  
G 1 MET A 221  ? ALA A 224  ? MET A 218  ALA A 221  
G 2 ALA A 232  ? GLY A 236  ? ALA A 229  GLY A 233  
G 3 SER A 239  ? ASN A 244  ? SER A 236  ASN A 241  
G 4 LYS A 247  ? ILE A 251  ? LYS A 244  ILE A 248  
H 1 ILE A 261  ? ARG A 266  ? ILE A 258  ARG A 263  
H 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
H 3 ARG A 282  ? GLU A 291  ? ARG A 279  GLU A 288  
H 4 THR A 299  ? GLU A 310  ? THR A 296  GLU A 307  
I 1 ALA A 314  ? TYR A 319  ? ALA A 311  TYR A 316  
I 2 VAL A 324  ? SER A 329  ? VAL A 321  SER A 326  
I 3 SER A 334  ? LEU A 339  ? SER A 331  LEU A 336  
I 4 VAL A 350  ? PHE A 356  ? VAL A 347  PHE A 353  
J 1 ILE A 362  ? VAL A 368  ? ILE A 359  VAL A 365  
J 2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
J 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
J 4 LEU A 713  ? ILE A 715  ? LEU A 710  ILE A 712  
K 1 ILE A 362  ? VAL A 368  ? ILE A 359  VAL A 365  
K 2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
K 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
K 4 VAL A 718  ? PRO A 719  ? VAL A 715  PRO A 716  
L 1 THR A 460  ? PHE A 462  ? THR A 457  PHE A 459  
L 2 ILE A 474  ? THR A 475  ? ILE A 471  THR A 472  
M 1 ALA A 514  ? VAL A 515  ? ALA A 511  VAL A 512  
M 2 ALA A 518  ? LEU A 519  ? ALA A 515  LEU A 516  
M 3 THR A 535  ? GLU A 536  ? THR A 532  GLU A 533  
N 1 VAL A 541  ? ASP A 545  ? VAL A 538  ASP A 542  
N 2 LEU A 558  ? LEU A 563  ? LEU A 555  LEU A 560  
N 3 SER A 568  ? LYS A 573  ? SER A 565  LYS A 570  
N 4 HIS A 581  ? MET A 584  ? HIS A 578  MET A 581  
O 1 PRO A 591  ? MET A 596  ? PRO A 588  MET A 593  
O 2 LEU A 605  ? LEU A 609  ? LEU A 602  LEU A 606  
O 3 ALA A 613  ? PHE A 617  ? ALA A 610  PHE A 614  
O 4 ARG A 629  ? THR A 633  ? ARG A 626  THR A 630  
P 1 VAL A 640  ? ARG A 645  ? VAL A 637  ARG A 642  
P 2 THR A 650  ? CYS A 655  ? THR A 647  CYS A 652  
P 3 THR A 660  ? SER A 664  ? THR A 657  SER A 661  
P 4 LEU A 669  ? ASN A 673  ? LEU A 666  ASN A 670  
Q 1 TYR A 681  ? PRO A 684  ? TYR A 678  PRO A 681  
Q 2 LEU A 694  ? ALA A 697  ? LEU A 691  ALA A 694  
Q 3 LEU A 702  ? GLY A 705  ? LEU A 699  GLY A 702  
R 1 SER A 723  ? GLN A 730  ? SER A 720  GLN A 727  
R 2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
R 3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
R 4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
R 5 SER A 765  ? SER A 767  ? SER A 762  SER A 764  
S 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
S 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
S 3 GLY A 849  ? GLN A 855  ? GLY A 846  GLN A 852  
S 4 GLN A 862  ? VAL A 869  ? GLN A 859  VAL A 866  
T 1 SER A 875  ? GLU A 878  ? SER A 872  GLU A 875  
T 2 LEU A 883  ? SER A 886  ? LEU A 880  SER A 883  
T 3 VAL A 891  ? TRP A 896  ? VAL A 888  TRP A 893  
T 4 VAL A 902  ? ARG A 903  ? VAL A 899  ARG A 900  
U 1 SER A 875  ? GLU A 878  ? SER A 872  GLU A 875  
U 2 LEU A 883  ? SER A 886  ? LEU A 880  SER A 883  
U 3 VAL A 891  ? TRP A 896  ? VAL A 888  TRP A 893  
U 4 ASN A 907  ? HIS A 908  ? ASN A 904  HIS A 905  
V 1 THR A 919  ? LYS A 920  ? THR A 916  LYS A 917  
V 2 ILE A 924  ? LEU A 925  ? ILE A 921  LEU A 922  
V 3 LEU A 934  ? LYS A 939  ? LEU A 931  LYS A 936  
V 4 ASN A 944  ? ARG A 950  ? ASN A 941  ARG A 947  
W 1 MET A 957  ? ILE A 962  ? MET A 954  ILE A 959  
W 2 PHE A 968  ? GLU A 972  ? PHE A 965  GLU A 969  
W 3 ASN A 976  ? LYS A 982  ? ASN A 973  LYS A 979  
W 4 LEU A 995  ? HIS A 1002 ? LEU A 992  HIS A 999  
X 1 PHE A 1079 ? HIS A 1080 ? PHE A 1076 HIS A 1077 
X 2 THR A 1085 ? GLU A 1086 ? THR A 1082 GLU A 1083 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 1011 ? N CYS A 1008 O LEU A 1032 ? O LEU A 1029 
A 2 3 N GLN A 1028 ? N GLN A 1025 O SER A 1045 ? O SER A 1042 
A 3 4 O ILE A 1040 ? O ILE A 1037 N ALA A 12   ? N ALA A 9    
A 4 5 N VAL A 9    ? N VAL A 6    O ILE A 1092 ? O ILE A 1089 
B 1 2 N GLY A 24   ? N GLY A 21   O ASN A 33   ? O ASN A 30   
B 2 3 N ILE A 36   ? N ILE A 33   O GLU A 43   ? O GLU A 40   
B 3 4 N VAL A 46   ? N VAL A 43   O ARG A 53   ? O ARG A 50   
C 1 2 N GLU A 68   ? N GLU A 65   O PHE A 81   ? O PHE A 78   
C 2 3 N LEU A 80   ? N LEU A 77   O LEU A 92   ? O LEU A 89   
C 3 4 N ALA A 89   ? N ALA A 86   O GLY A 109  ? O GLY A 106  
D 1 2 N ILE A 126  ? N ILE A 123  O GLY A 135  ? O GLY A 132  
D 2 3 N LEU A 136  ? N LEU A 133  O LYS A 144  ? O LYS A 141  
D 3 4 N VAL A 145  ? N VAL A 142  O PHE A 158  ? O PHE A 155  
E 1 2 N ILE A 168  ? N ILE A 165  O VAL A 184  ? O VAL A 181  
E 2 3 N ILE A 181  ? N ILE A 178  O TYR A 196  ? O TYR A 193  
E 3 4 N GLU A 197  ? N GLU A 194  O ASN A 206  ? O ASN A 203  
F 1 2 N ILE A 168  ? N ILE A 165  O VAL A 184  ? O VAL A 181  
F 2 3 N ILE A 181  ? N ILE A 178  O TYR A 196  ? O TYR A 193  
F 3 4 N VAL A 193  ? N VAL A 190  O GLU A 213  ? O GLU A 210  
G 1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
G 2 3 N GLY A 236  ? N GLY A 233  O SER A 239  ? O SER A 236  
G 3 4 N TYR A 242  ? N TYR A 239  O LEU A 249  ? O LEU A 246  
H 1 2 N CYS A 263  ? N CYS A 260  O GLY A 277  ? O GLY A 274  
H 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
H 3 4 N LEU A 287  ? N LEU A 284  O ARG A 304  ? O ARG A 301  
I 1 2 N THR A 318  ? N THR A 315  O PHE A 326  ? O PHE A 323  
I 2 3 N VAL A 327  ? N VAL A 324  O GLN A 335  ? O GLN A 332  
I 3 4 N SER A 334  ? N SER A 331  O PHE A 356  ? O PHE A 353  
J 1 2 N VAL A 368  ? N VAL A 365  O GLN A 377  ? O GLN A 374  
J 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
J 3 4 N ARG A 394  ? N ARG A 391  O HIS A 714  ? O HIS A 711  
K 1 2 N VAL A 368  ? N VAL A 365  O GLN A 377  ? O GLN A 374  
K 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
K 3 4 N LEU A 390  ? N LEU A 387  O VAL A 718  ? O VAL A 715  
L 1 2 N PHE A 461  ? N PHE A 458  O ILE A 474  ? O ILE A 471  
M 1 2 N VAL A 515  ? N VAL A 512  O ALA A 518  ? O ALA A 515  
M 2 3 N LEU A 519  ? N LEU A 516  O THR A 535  ? O THR A 532  
N 1 2 N ALA A 542  ? N ALA A 539  O GLY A 562  ? O GLY A 559  
N 2 3 N CYS A 559  ? N CYS A 556  O LEU A 572  ? O LEU A 569  
N 3 4 N ALA A 569  ? N ALA A 566  O GLU A 583  ? O GLU A 580  
O 1 2 N ARG A 592  ? N ARG A 589  O ALA A 608  ? O ALA A 605  
O 2 3 N LEU A 605  ? N LEU A 602  O PHE A 617  ? O PHE A 614  
O 3 4 N LEU A 614  ? N LEU A 611  O VAL A 632  ? O VAL A 629  
P 1 2 N VAL A 640  ? N VAL A 637  O CYS A 655  ? O CYS A 652  
P 2 3 N VAL A 652  ? N VAL A 649  O ILE A 662  ? O ILE A 659  
P 3 4 N TYR A 663  ? N TYR A 660  O VAL A 670  ? O VAL A 667  
Q 1 2 N CYS A 683  ? N CYS A 680  O ALA A 695  ? O ALA A 692  
Q 2 3 N LEU A 696  ? N LEU A 693  O THR A 703  ? O THR A 700  
R 1 2 N ARG A 725  ? N ARG A 722  O LEU A 739  ? O LEU A 736  
R 2 3 N ARG A 742  ? N ARG A 739  O VAL A 791  ? O VAL A 788  
R 3 4 N ILE A 796  ? N ILE A 793  O HIS A 806  ? O HIS A 803  
R 4 5 O GLN A 809  ? O GLN A 806  N SER A 767  ? N SER A 764  
S 1 2 N TYR A 815  ? N TYR A 812  O ALA A 837  ? O ALA A 834  
S 2 3 N THR A 836  ? N THR A 833  O ARG A 850  ? O ARG A 847  
S 3 4 N GLN A 855  ? N GLN A 852  O GLN A 862  ? O GLN A 859  
T 1 2 N SER A 875  ? N SER A 872  O SER A 886  ? O SER A 883  
T 2 3 N LEU A 883  ? N LEU A 880  O TYR A 894  ? O TYR A 891  
T 3 4 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
U 1 2 N SER A 875  ? N SER A 872  O SER A 886  ? O SER A 883  
U 2 3 N LEU A 883  ? N LEU A 880  O TYR A 894  ? O TYR A 891  
U 3 4 N VAL A 891  ? N VAL A 888  O HIS A 908  ? O HIS A 905  
V 1 2 N LYS A 920  ? N LYS A 917  O ILE A 924  ? O ILE A 921  
V 2 3 N LEU A 925  ? N LEU A 922  O LEU A 936  ? O LEU A 933  
V 3 4 N LYS A 939  ? N LYS A 936  O ASN A 944  ? O ASN A 941  
W 1 2 N SER A 958  ? N SER A 955  O ALA A 971  ? O ALA A 968  
W 2 3 N PHE A 968  ? N PHE A 965  O CYS A 980  ? O CYS A 977  
W 3 4 N LEU A 977  ? N LEU A 974  O PHE A 1001 ? O PHE A 998  
X 1 2 N PHE A 1079 ? N PHE A 1076 O GLU A 1086 ? O GLU A 1083 
# 
_database_PDB_matrix.entry_id          3I7L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I7L 
_atom_sites.fract_transf_matrix[1][1]   0.015679 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007454 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005478 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 4    ? 24.136  25.973 11.077  1.00 113.06 ? 1    MET A N   1 
ATOM 2    C CA  . MET A 1 4    ? 23.213  26.074 9.901   1.00 113.06 ? 1    MET A CA  1 
ATOM 3    C C   . MET A 1 4    ? 21.812  26.647 10.241  1.00 113.06 ? 1    MET A C   1 
ATOM 4    O O   . MET A 1 4    ? 20.814  26.297 9.594   1.00 113.06 ? 1    MET A O   1 
ATOM 5    C CB  . MET A 1 4    ? 23.101  24.721 9.167   1.00 161.31 ? 1    MET A CB  1 
ATOM 6    C CG  . MET A 1 4    ? 22.646  23.534 10.030  1.00 161.31 ? 1    MET A CG  1 
ATOM 7    S SD  . MET A 1 4    ? 22.057  22.101 9.086   1.00 161.31 ? 1    MET A SD  1 
ATOM 8    C CE  . MET A 1 4    ? 20.341  22.523 8.792   1.00 161.31 ? 1    MET A CE  1 
ATOM 9    N N   . SER A 1 5    ? 21.752  27.532 11.240  1.00 140.64 ? 2    SER A N   1 
ATOM 10   C CA  . SER A 1 5    ? 20.499  28.197 11.641  1.00 140.64 ? 2    SER A CA  1 
ATOM 11   C C   . SER A 1 5    ? 20.447  29.648 11.160  1.00 140.64 ? 2    SER A C   1 
ATOM 12   O O   . SER A 1 5    ? 21.411  30.390 11.333  1.00 140.64 ? 2    SER A O   1 
ATOM 13   C CB  . SER A 1 5    ? 20.338  28.154 13.162  1.00 101.74 ? 2    SER A CB  1 
ATOM 14   O OG  . SER A 1 5    ? 19.239  28.940 13.604  1.00 101.74 ? 2    SER A OG  1 
ATOM 15   N N   . TYR A 1 6    ? 19.322  30.053 10.569  1.00 55.49  ? 3    TYR A N   1 
ATOM 16   C CA  . TYR A 1 6    ? 19.184  31.432 10.027  1.00 55.49  ? 3    TYR A CA  1 
ATOM 17   C C   . TYR A 1 6    ? 17.996  32.233 10.596  1.00 55.49  ? 3    TYR A C   1 
ATOM 18   O O   . TYR A 1 6    ? 16.821  31.943 10.297  1.00 55.49  ? 3    TYR A O   1 
ATOM 19   C CB  . TYR A 1 6    ? 19.125  31.424 8.500   1.00 70.32  ? 3    TYR A CB  1 
ATOM 20   C CG  . TYR A 1 6    ? 20.118  30.496 7.841   1.00 70.32  ? 3    TYR A CG  1 
ATOM 21   C CD1 . TYR A 1 6    ? 21.495  30.732 7.934   1.00 70.32  ? 3    TYR A CD1 1 
ATOM 22   C CD2 . TYR A 1 6    ? 19.683  29.378 7.129   1.00 70.32  ? 3    TYR A CD2 1 
ATOM 23   C CE1 . TYR A 1 6    ? 22.420  29.885 7.325   1.00 70.32  ? 3    TYR A CE1 1 
ATOM 24   C CE2 . TYR A 1 6    ? 20.596  28.521 6.518   1.00 70.32  ? 3    TYR A CE2 1 
ATOM 25   C CZ  . TYR A 1 6    ? 21.963  28.782 6.616   1.00 70.32  ? 3    TYR A CZ  1 
ATOM 26   O OH  . TYR A 1 6    ? 22.866  27.935 6.015   1.00 70.32  ? 3    TYR A OH  1 
ATOM 27   N N   . ASN A 1 7    ? 18.326  33.245 11.401  1.00 47.21  ? 4    ASN A N   1 
ATOM 28   C CA  . ASN A 1 7    ? 17.347  34.007 12.164  1.00 47.21  ? 4    ASN A CA  1 
ATOM 29   C C   . ASN A 1 7    ? 17.510  35.512 12.013  1.00 47.21  ? 4    ASN A C   1 
ATOM 30   O O   . ASN A 1 7    ? 18.560  35.990 11.549  1.00 47.21  ? 4    ASN A O   1 
ATOM 31   C CB  . ASN A 1 7    ? 17.453  33.634 13.632  1.00 49.63  ? 4    ASN A CB  1 
ATOM 32   C CG  . ASN A 1 7    ? 16.681  32.386 13.967  1.00 49.63  ? 4    ASN A CG  1 
ATOM 33   O OD1 . ASN A 1 7    ? 15.451  32.375 13.899  1.00 49.63  ? 4    ASN A OD1 1 
ATOM 34   N ND2 . ASN A 1 7    ? 17.400  31.319 14.345  1.00 49.63  ? 4    ASN A ND2 1 
ATOM 35   N N   . TYR A 1 8    ? 16.490  36.247 12.450  1.00 56.70  ? 5    TYR A N   1 
ATOM 36   C CA  . TYR A 1 8    ? 16.373  37.685 12.225  1.00 56.70  ? 5    TYR A CA  1 
ATOM 37   C C   . TYR A 1 8    ? 15.632  38.376 13.400  1.00 56.70  ? 5    TYR A C   1 
ATOM 38   O O   . TYR A 1 8    ? 14.457  38.045 13.692  1.00 56.70  ? 5    TYR A O   1 
ATOM 39   C CB  . TYR A 1 8    ? 15.604  37.881 10.914  1.00 39.96  ? 5    TYR A CB  1 
ATOM 40   C CG  . TYR A 1 8    ? 15.401  39.295 10.427  1.00 39.96  ? 5    TYR A CG  1 
ATOM 41   C CD1 . TYR A 1 8    ? 16.187  39.816 9.410   1.00 39.96  ? 5    TYR A CD1 1 
ATOM 42   C CD2 . TYR A 1 8    ? 14.375  40.101 10.950  1.00 39.96  ? 5    TYR A CD2 1 
ATOM 43   C CE1 . TYR A 1 8    ? 15.981  41.122 8.941   1.00 39.96  ? 5    TYR A CE1 1 
ATOM 44   C CE2 . TYR A 1 8    ? 14.176  41.399 10.501  1.00 39.96  ? 5    TYR A CE2 1 
ATOM 45   C CZ  . TYR A 1 8    ? 14.978  41.893 9.499   1.00 39.96  ? 5    TYR A CZ  1 
ATOM 46   O OH  . TYR A 1 8    ? 14.772  43.153 9.047   1.00 39.96  ? 5    TYR A OH  1 
ATOM 47   N N   . VAL A 1 9    ? 16.307  39.326 14.063  1.00 42.48  ? 6    VAL A N   1 
ATOM 48   C CA  . VAL A 1 9    ? 15.688  40.087 15.125  1.00 42.48  ? 6    VAL A CA  1 
ATOM 49   C C   . VAL A 1 9    ? 15.540  41.554 14.755  1.00 42.48  ? 6    VAL A C   1 
ATOM 50   O O   . VAL A 1 9    ? 16.527  42.218 14.365  1.00 42.48  ? 6    VAL A O   1 
ATOM 51   C CB  . VAL A 1 9    ? 16.413  39.899 16.509  1.00 35.19  ? 6    VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 9    ? 16.605  38.440 16.818  1.00 35.19  ? 6    VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 9    ? 17.761  40.513 16.528  1.00 35.19  ? 6    VAL A CG2 1 
ATOM 54   N N   . VAL A 1 10   ? 14.305  42.055 14.862  1.00 33.82  ? 7    VAL A N   1 
ATOM 55   C CA  . VAL A 1 10   ? 14.016  43.512 14.791  1.00 33.82  ? 7    VAL A CA  1 
ATOM 56   C C   . VAL A 1 10   ? 13.319  44.085 16.040  1.00 33.82  ? 7    VAL A C   1 
ATOM 57   O O   . VAL A 1 10   ? 12.551  43.392 16.718  1.00 33.82  ? 7    VAL A O   1 
ATOM 58   C CB  . VAL A 1 10   ? 13.143  43.909 13.586  1.00 62.43  ? 7    VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 10   ? 14.007  44.159 12.415  1.00 62.43  ? 7    VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 10   ? 12.082  42.862 13.275  1.00 62.43  ? 7    VAL A CG2 1 
ATOM 61   N N   . THR A 1 11   ? 13.568  45.364 16.315  1.00 34.21  ? 8    THR A N   1 
ATOM 62   C CA  . THR A 1 11   ? 12.838  46.044 17.354  1.00 34.21  ? 8    THR A CA  1 
ATOM 63   C C   . THR A 1 11   ? 11.501  46.505 16.825  1.00 34.21  ? 8    THR A C   1 
ATOM 64   O O   . THR A 1 11   ? 11.402  47.035 15.706  1.00 34.21  ? 8    THR A O   1 
ATOM 65   C CB  . THR A 1 11   ? 13.506  47.312 17.760  1.00 16.72  ? 8    THR A CB  1 
ATOM 66   O OG1 . THR A 1 11   ? 14.865  47.068 18.195  1.00 16.72  ? 8    THR A OG1 1 
ATOM 67   C CG2 . THR A 1 11   ? 12.635  48.002 18.838  1.00 16.72  ? 8    THR A CG2 1 
ATOM 68   N N   . ALA A 1 12   ? 10.482  46.339 17.658  1.00 59.59  ? 9    ALA A N   1 
ATOM 69   C CA  . ALA A 1 12   ? 9.126   46.691 17.303  1.00 59.59  ? 9    ALA A CA  1 
ATOM 70   C C   . ALA A 1 12   ? 8.805   47.970 18.039  1.00 59.59  ? 9    ALA A C   1 
ATOM 71   O O   . ALA A 1 12   ? 8.161   48.869 17.492  1.00 59.59  ? 9    ALA A O   1 
ATOM 72   C CB  . ALA A 1 12   ? 8.177   45.576 17.722  1.00 16.08  ? 9    ALA A CB  1 
ATOM 73   N N   . GLN A 1 13   ? 9.258   48.028 19.292  1.00 27.00  ? 10   GLN A N   1 
ATOM 74   C CA  . GLN A 1 13   ? 9.062   49.159 20.163  1.00 27.00  ? 10   GLN A CA  1 
ATOM 75   C C   . GLN A 1 13   ? 10.374  49.356 20.833  1.00 27.00  ? 10   GLN A C   1 
ATOM 76   O O   . GLN A 1 13   ? 10.953  48.390 21.318  1.00 27.00  ? 10   GLN A O   1 
ATOM 77   C CB  . GLN A 1 13   ? 8.024   48.842 21.212  1.00 32.78  ? 10   GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13   ? 8.025   49.850 22.377  1.00 32.78  ? 10   GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13   ? 7.859   51.300 21.929  1.00 32.78  ? 10   GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13   ? 7.021   51.617 21.051  1.00 32.78  ? 10   GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13   ? 8.645   52.202 22.540  1.00 32.78  ? 10   GLN A NE2 1 
ATOM 82   N N   . LYS A 1 14   ? 10.878  50.590 20.828  1.00 38.65  ? 11   LYS A N   1 
ATOM 83   C CA  . LYS A 1 14   ? 12.107  50.889 21.545  1.00 38.65  ? 11   LYS A CA  1 
ATOM 84   C C   . LYS A 1 14   ? 11.960  50.733 23.075  1.00 38.65  ? 11   LYS A C   1 
ATOM 85   O O   . LYS A 1 14   ? 10.810  50.758 23.594  1.00 38.65  ? 11   LYS A O   1 
ATOM 86   C CB  . LYS A 1 14   ? 12.598  52.269 21.184  1.00 48.59  ? 11   LYS A CB  1 
ATOM 87   C CG  . LYS A 1 14   ? 13.330  52.252 19.900  1.00 48.59  ? 11   LYS A CG  1 
ATOM 88   C CD  . LYS A 1 14   ? 13.558  53.636 19.372  1.00 48.59  ? 11   LYS A CD  1 
ATOM 89   C CE  . LYS A 1 14   ? 14.174  53.528 18.004  1.00 48.59  ? 11   LYS A CE  1 
ATOM 90   N NZ  . LYS A 1 14   ? 14.332  54.854 17.254  1.00 48.59  ? 11   LYS A NZ  1 
ATOM 91   N N   . PRO A 1 15   ? 13.110  50.541 23.797  1.00 27.10  ? 12   PRO A N   1 
ATOM 92   C CA  . PRO A 1 15   ? 13.089  50.592 25.257  1.00 27.10  ? 12   PRO A CA  1 
ATOM 93   C C   . PRO A 1 15   ? 12.494  51.915 25.741  1.00 27.10  ? 12   PRO A C   1 
ATOM 94   O O   . PRO A 1 15   ? 12.830  52.977 25.221  1.00 27.10  ? 12   PRO A O   1 
ATOM 95   C CB  . PRO A 1 15   ? 14.564  50.489 25.638  1.00 46.02  ? 12   PRO A CB  1 
ATOM 96   C CG  . PRO A 1 15   ? 15.280  50.828 24.408  1.00 46.02  ? 12   PRO A CG  1 
ATOM 97   C CD  . PRO A 1 15   ? 14.465  50.269 23.320  1.00 46.02  ? 12   PRO A CD  1 
ATOM 98   N N   . THR A 1 16   ? 11.591  51.819 26.710  1.00 33.80  ? 13   THR A N   1 
ATOM 99   C CA  . THR A 1 16   ? 10.880  52.969 27.192  1.00 33.80  ? 13   THR A CA  1 
ATOM 100  C C   . THR A 1 16   ? 11.173  53.197 28.627  1.00 33.80  ? 13   THR A C   1 
ATOM 101  O O   . THR A 1 16   ? 10.923  54.261 29.119  1.00 33.80  ? 13   THR A O   1 
ATOM 102  C CB  . THR A 1 16   ? 9.378   52.811 27.068  1.00 32.97  ? 13   THR A CB  1 
ATOM 103  O OG1 . THR A 1 16   ? 8.991   51.595 27.707  1.00 32.97  ? 13   THR A OG1 1 
ATOM 104  C CG2 . THR A 1 16   ? 8.937   52.814 25.584  1.00 32.97  ? 13   THR A CG2 1 
ATOM 105  N N   . ALA A 1 17   ? 11.702  52.207 29.309  1.00 46.69  ? 14   ALA A N   1 
ATOM 106  C CA  . ALA A 1 17   ? 12.184  52.419 30.666  1.00 46.69  ? 14   ALA A CA  1 
ATOM 107  C C   . ALA A 1 17   ? 13.410  53.381 30.678  1.00 46.69  ? 14   ALA A C   1 
ATOM 108  O O   . ALA A 1 17   ? 14.241  53.305 29.782  1.00 46.69  ? 14   ALA A O   1 
ATOM 109  C CB  . ALA A 1 17   ? 12.503  51.063 31.298  1.00 11.39  ? 14   ALA A CB  1 
ATOM 110  N N   . VAL A 1 18   ? 13.488  54.294 31.654  1.00 38.96  ? 15   VAL A N   1 
ATOM 111  C CA  . VAL A 1 18   ? 14.541  55.313 31.718  1.00 38.96  ? 15   VAL A CA  1 
ATOM 112  C C   . VAL A 1 18   ? 15.568  54.822 32.680  1.00 38.96  ? 15   VAL A C   1 
ATOM 113  O O   . VAL A 1 18   ? 15.231  54.539 33.800  1.00 38.96  ? 15   VAL A O   1 
ATOM 114  C CB  . VAL A 1 18   ? 14.086  56.700 32.298  1.00 27.98  ? 15   VAL A CB  1 
ATOM 115  C CG1 . VAL A 1 18   ? 15.284  57.596 32.506  1.00 27.98  ? 15   VAL A CG1 1 
ATOM 116  C CG2 . VAL A 1 18   ? 13.182  57.443 31.365  1.00 27.98  ? 15   VAL A CG2 1 
ATOM 117  N N   . ASN A 1 19   ? 16.834  54.801 32.262  1.00 46.02  ? 16   ASN A N   1 
ATOM 118  C CA  . ASN A 1 19   ? 17.886  54.184 33.054  1.00 46.02  ? 16   ASN A CA  1 
ATOM 119  C C   . ASN A 1 19   ? 18.804  55.198 33.705  1.00 46.02  ? 16   ASN A C   1 
ATOM 120  O O   . ASN A 1 19   ? 19.478  54.894 34.690  1.00 46.02  ? 16   ASN A O   1 
ATOM 121  C CB  . ASN A 1 19   ? 18.653  53.160 32.197  1.00 58.54  ? 16   ASN A CB  1 
ATOM 122  C CG  . ASN A 1 19   ? 17.786  51.930 31.836  1.00 58.54  ? 16   ASN A CG  1 
ATOM 123  O OD1 . ASN A 1 19   ? 17.504  51.661 30.648  1.00 58.54  ? 16   ASN A OD1 1 
ATOM 124  N ND2 . ASN A 1 19   ? 17.322  51.199 32.872  1.00 58.54  ? 16   ASN A ND2 1 
ATOM 125  N N   . GLY A 1 20   ? 18.812  56.420 33.159  1.00 27.52  ? 17   GLY A N   1 
ATOM 126  C CA  . GLY A 1 20   ? 19.734  57.497 33.610  1.00 27.52  ? 17   GLY A CA  1 
ATOM 127  C C   . GLY A 1 20   ? 19.241  58.826 33.074  1.00 27.52  ? 17   GLY A C   1 
ATOM 128  O O   . GLY A 1 20   ? 18.474  58.866 32.127  1.00 27.52  ? 17   GLY A O   1 
ATOM 129  N N   . CYS A 1 21   ? 19.635  59.927 33.679  1.00 44.66  ? 18   CYS A N   1 
ATOM 130  C CA  . CYS A 1 21   ? 19.197  61.216 33.183  1.00 44.66  ? 18   CYS A CA  1 
ATOM 131  C C   . CYS A 1 21   ? 20.039  62.284 33.827  1.00 44.66  ? 18   CYS A C   1 
ATOM 132  O O   . CYS A 1 21   ? 20.173  62.318 35.054  1.00 44.66  ? 18   CYS A O   1 
ATOM 133  C CB  . CYS A 1 21   ? 17.698  61.443 33.432  1.00 51.56  ? 18   CYS A CB  1 
ATOM 134  S SG  . CYS A 1 21   ? 17.184  61.532 35.174  1.00 51.56  ? 18   CYS A SG  1 
ATOM 135  N N   . VAL A 1 22   ? 20.624  63.135 32.988  1.00 52.61  ? 19   VAL A N   1 
ATOM 136  C CA  . VAL A 1 22   ? 21.568  64.157 33.416  1.00 52.61  ? 19   VAL A CA  1 
ATOM 137  C C   . VAL A 1 22   ? 21.154  65.504 32.802  1.00 52.61  ? 19   VAL A C   1 
ATOM 138  O O   . VAL A 1 22   ? 20.593  65.563 31.692  1.00 52.61  ? 19   VAL A O   1 
ATOM 139  C CB  . VAL A 1 22   ? 22.991  63.813 32.923  1.00 54.74  ? 19   VAL A CB  1 
ATOM 140  C CG1 . VAL A 1 22   ? 23.217  64.398 31.494  1.00 54.74  ? 19   VAL A CG1 1 
ATOM 141  C CG2 . VAL A 1 22   ? 24.063  64.321 33.871  1.00 54.74  ? 19   VAL A CG2 1 
ATOM 142  N N   . THR A 1 23   ? 21.483  66.578 33.510  1.00 61.44  ? 20   THR A N   1 
ATOM 143  C CA  . THR A 1 23   ? 21.168  67.932 33.089  1.00 61.44  ? 20   THR A CA  1 
ATOM 144  C C   . THR A 1 23   ? 22.437  68.795 32.899  1.00 61.44  ? 20   THR A C   1 
ATOM 145  O O   . THR A 1 23   ? 23.436  68.604 33.592  1.00 61.44  ? 20   THR A O   1 
ATOM 146  C CB  . THR A 1 23   ? 20.208  68.566 34.100  1.00 51.36  ? 20   THR A CB  1 
ATOM 147  O OG1 . THR A 1 23   ? 19.742  69.810 33.589  1.00 51.36  ? 20   THR A OG1 1 
ATOM 148  C CG2 . THR A 1 23   ? 20.873  68.788 35.452  1.00 51.36  ? 20   THR A CG2 1 
ATOM 149  N N   . GLY A 1 24   ? 22.404  69.733 31.955  1.00 42.70  ? 21   GLY A N   1 
ATOM 150  C CA  . GLY A 1 24   ? 23.568  70.600 31.659  1.00 42.70  ? 21   GLY A CA  1 
ATOM 151  C C   . GLY A 1 24   ? 23.534  71.287 30.281  1.00 42.70  ? 21   GLY A C   1 
ATOM 152  O O   . GLY A 1 24   ? 22.465  71.493 29.681  1.00 42.70  ? 21   GLY A O   1 
ATOM 153  N N   . HIS A 1 25   ? 24.730  71.607 29.771  1.00 45.53  ? 22   HIS A N   1 
ATOM 154  C CA  . HIS A 1 25   ? 24.937  72.591 28.704  1.00 45.53  ? 22   HIS A CA  1 
ATOM 155  C C   . HIS A 1 25   ? 25.732  71.990 27.581  1.00 45.53  ? 22   HIS A C   1 
ATOM 156  O O   . HIS A 1 25   ? 26.911  72.267 27.405  1.00 45.53  ? 22   HIS A O   1 
ATOM 157  C CB  . HIS A 1 25   ? 25.645  73.812 29.268  1.00 69.54  ? 22   HIS A CB  1 
ATOM 158  C CG  . HIS A 1 25   ? 24.921  74.440 30.413  1.00 69.54  ? 22   HIS A CG  1 
ATOM 159  N ND1 . HIS A 1 25   ? 25.298  74.247 31.725  1.00 69.54  ? 22   HIS A ND1 1 
ATOM 160  C CD2 . HIS A 1 25   ? 23.828  75.240 30.448  1.00 69.54  ? 22   HIS A CD2 1 
ATOM 161  C CE1 . HIS A 1 25   ? 24.482  74.920 32.519  1.00 69.54  ? 22   HIS A CE1 1 
ATOM 162  N NE2 . HIS A 1 25   ? 23.580  75.529 31.769  1.00 69.54  ? 22   HIS A NE2 1 
ATOM 163  N N   . PHE A 1 26   ? 25.053  71.171 26.806  1.00 60.13  ? 23   PHE A N   1 
ATOM 164  C CA  . PHE A 1 26   ? 25.700  70.226 25.935  1.00 60.13  ? 23   PHE A CA  1 
ATOM 165  C C   . PHE A 1 26   ? 25.464  70.644 24.494  1.00 60.13  ? 23   PHE A C   1 
ATOM 166  O O   . PHE A 1 26   ? 26.333  70.478 23.638  1.00 60.13  ? 23   PHE A O   1 
ATOM 167  C CB  . PHE A 1 26   ? 25.130  68.835 26.250  1.00 49.61  ? 23   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 26   ? 25.614  67.747 25.354  1.00 49.61  ? 23   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 26   ? 26.935  67.346 25.372  1.00 49.61  ? 23   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 26   ? 24.725  67.088 24.513  1.00 49.61  ? 23   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 26   ? 27.369  66.325 24.551  1.00 49.61  ? 23   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 26   ? 25.142  66.075 23.687  1.00 49.61  ? 23   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 26   ? 26.466  65.687 23.697  1.00 49.61  ? 23   PHE A CZ  1 
ATOM 174  N N   . THR A 1 27   ? 24.279  71.194 24.251  1.00 73.26  ? 24   THR A N   1 
ATOM 175  C CA  . THR A 1 27   ? 23.886  71.733 22.968  1.00 73.26  ? 24   THR A CA  1 
ATOM 176  C C   . THR A 1 27   ? 24.626  73.045 22.721  1.00 73.26  ? 24   THR A C   1 
ATOM 177  O O   . THR A 1 27   ? 25.169  73.254 21.630  1.00 73.26  ? 24   THR A O   1 
ATOM 178  C CB  . THR A 1 27   ? 22.369  71.945 22.935  1.00 53.55  ? 24   THR A CB  1 
ATOM 179  O OG1 . THR A 1 27   ? 21.719  70.670 23.030  1.00 53.55  ? 24   THR A OG1 1 
ATOM 180  C CG2 . THR A 1 27   ? 21.928  72.596 21.631  1.00 53.55  ? 24   THR A CG2 1 
ATOM 181  N N   . SER A 1 28   ? 24.626  73.911 23.741  1.00 77.65  ? 25   SER A N   1 
ATOM 182  C CA  . SER A 1 28   ? 25.468  75.119 23.833  1.00 77.65  ? 25   SER A CA  1 
ATOM 183  C C   . SER A 1 28   ? 25.556  75.577 25.288  1.00 77.65  ? 25   SER A C   1 
ATOM 184  O O   . SER A 1 28   ? 24.947  74.958 26.154  1.00 77.65  ? 25   SER A O   1 
ATOM 185  C CB  . SER A 1 28   ? 24.950  76.254 22.936  1.00 59.38  ? 25   SER A CB  1 
ATOM 186  O OG  . SER A 1 28   ? 23.616  76.597 23.222  1.00 59.38  ? 25   SER A OG  1 
ATOM 187  N N   . ALA A 1 29   ? 26.313  76.644 25.563  1.00 73.52  ? 26   ALA A N   1 
ATOM 188  C CA  . ALA A 1 29   ? 26.452  77.162 26.947  1.00 73.52  ? 26   ALA A CA  1 
ATOM 189  C C   . ALA A 1 29   ? 25.244  77.995 27.404  1.00 73.52  ? 26   ALA A C   1 
ATOM 190  O O   . ALA A 1 29   ? 24.769  77.858 28.532  1.00 73.52  ? 26   ALA A O   1 
ATOM 191  C CB  . ALA A 1 29   ? 27.776  77.931 27.131  1.00 47.92  ? 26   ALA A CB  1 
ATOM 192  N N   . GLU A 1 30   ? 24.759  78.855 26.520  1.00 106.68 ? 27   GLU A N   1 
ATOM 193  C CA  . GLU A 1 30   ? 23.451  79.447 26.690  1.00 106.68 ? 27   GLU A CA  1 
ATOM 194  C C   . GLU A 1 30   ? 22.552  78.377 26.134  1.00 106.68 ? 27   GLU A C   1 
ATOM 195  O O   . GLU A 1 30   ? 22.436  78.244 24.921  1.00 106.68 ? 27   GLU A O   1 
ATOM 196  C CB  . GLU A 1 30   ? 23.297  80.739 25.875  1.00 111.33 ? 27   GLU A CB  1 
ATOM 197  C CG  . GLU A 1 30   ? 24.577  81.543 25.695  1.00 111.33 ? 27   GLU A CG  1 
ATOM 198  C CD  . GLU A 1 30   ? 25.579  80.853 24.776  1.00 111.33 ? 27   GLU A CD  1 
ATOM 199  O OE1 . GLU A 1 30   ? 26.794  81.106 24.935  1.00 111.33 ? 27   GLU A OE1 1 
ATOM 200  O OE2 . GLU A 1 30   ? 25.155  80.051 23.906  1.00 111.33 ? 27   GLU A OE2 1 
ATOM 201  N N   . ASP A 1 31   ? 21.960  77.596 27.033  1.00 71.92  ? 28   ASP A N   1 
ATOM 202  C CA  . ASP A 1 31   ? 21.128  76.411 26.726  1.00 71.92  ? 28   ASP A CA  1 
ATOM 203  C C   . ASP A 1 31   ? 21.157  75.508 27.951  1.00 71.92  ? 28   ASP A C   1 
ATOM 204  O O   . ASP A 1 31   ? 22.223  75.298 28.548  1.00 71.92  ? 28   ASP A O   1 
ATOM 205  C CB  . ASP A 1 31   ? 21.662  75.610 25.537  1.00 76.32  ? 28   ASP A CB  1 
ATOM 206  C CG  . ASP A 1 31   ? 20.777  75.700 24.294  1.00 76.32  ? 28   ASP A CG  1 
ATOM 207  O OD1 . ASP A 1 31   ? 20.102  76.728 24.064  1.00 76.32  ? 28   ASP A OD1 1 
ATOM 208  O OD2 . ASP A 1 31   ? 20.779  74.722 23.517  1.00 76.32  ? 28   ASP A OD2 1 
ATOM 209  N N   . LEU A 1 32   ? 19.991  75.000 28.343  1.00 86.02  ? 29   LEU A N   1 
ATOM 210  C CA  . LEU A 1 32   ? 19.910  74.022 29.424  1.00 86.02  ? 29   LEU A CA  1 
ATOM 211  C C   . LEU A 1 32   ? 19.280  72.749 28.904  1.00 86.02  ? 29   LEU A C   1 
ATOM 212  O O   . LEU A 1 32   ? 18.125  72.741 28.493  1.00 86.02  ? 29   LEU A O   1 
ATOM 213  C CB  . LEU A 1 32   ? 19.132  74.567 30.615  1.00 34.93  ? 29   LEU A CB  1 
ATOM 214  C CG  . LEU A 1 32   ? 18.818  73.570 31.750  1.00 34.93  ? 29   LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 32   ? 20.083  73.128 32.562  1.00 34.93  ? 29   LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 32   ? 17.747  74.033 32.716  1.00 34.93  ? 29   LEU A CD2 1 
ATOM 217  N N   . ASN A 1 33   ? 20.057  71.677 28.917  1.00 49.08  ? 30   ASN A N   1 
ATOM 218  C CA  . ASN A 1 33   ? 19.642  70.403 28.332  1.00 49.08  ? 30   ASN A CA  1 
ATOM 219  C C   . ASN A 1 33   ? 19.212  69.386 29.357  1.00 49.08  ? 30   ASN A C   1 
ATOM 220  O O   . ASN A 1 33   ? 19.532  69.503 30.560  1.00 49.08  ? 30   ASN A O   1 
ATOM 221  C CB  . ASN A 1 33   ? 20.793  69.778 27.566  1.00 46.44  ? 30   ASN A CB  1 
ATOM 222  C CG  . ASN A 1 33   ? 21.252  70.631 26.448  1.00 46.44  ? 30   ASN A CG  1 
ATOM 223  O OD1 . ASN A 1 33   ? 20.522  70.821 25.483  1.00 46.44  ? 30   ASN A OD1 1 
ATOM 224  N ND2 . ASN A 1 33   ? 22.462  71.176 26.564  1.00 46.44  ? 30   ASN A ND2 1 
ATOM 225  N N   . LEU A 1 34   ? 18.505  68.374 28.865  1.00 50.64  ? 31   LEU A N   1 
ATOM 226  C CA  . LEU A 1 34   ? 18.254  67.178 29.639  1.00 50.64  ? 31   LEU A CA  1 
ATOM 227  C C   . LEU A 1 34   ? 18.521  65.966 28.772  1.00 50.64  ? 31   LEU A C   1 
ATOM 228  O O   . LEU A 1 34   ? 17.847  65.760 27.752  1.00 50.64  ? 31   LEU A O   1 
ATOM 229  C CB  . LEU A 1 34   ? 16.818  67.162 30.149  1.00 46.75  ? 31   LEU A CB  1 
ATOM 230  C CG  . LEU A 1 34   ? 16.279  65.799 30.554  1.00 46.75  ? 31   LEU A CG  1 
ATOM 231  C CD1 . LEU A 1 34   ? 16.535  65.526 32.015  1.00 46.75  ? 31   LEU A CD1 1 
ATOM 232  C CD2 . LEU A 1 34   ? 14.824  65.745 30.237  1.00 46.75  ? 31   LEU A CD2 1 
ATOM 233  N N   . LEU A 1 35   ? 19.508  65.173 29.176  1.00 51.58  ? 32   LEU A N   1 
ATOM 234  C CA  . LEU A 1 35   ? 19.785  63.924 28.476  1.00 51.58  ? 32   LEU A CA  1 
ATOM 235  C C   . LEU A 1 35   ? 19.120  62.766 29.188  1.00 51.58  ? 32   LEU A C   1 
ATOM 236  O O   . LEU A 1 35   ? 19.386  62.479 30.364  1.00 51.58  ? 32   LEU A O   1 
ATOM 237  C CB  . LEU A 1 35   ? 21.292  63.684 28.319  1.00 37.96  ? 32   LEU A CB  1 
ATOM 238  C CG  . LEU A 1 35   ? 22.084  64.489 27.277  1.00 37.96  ? 32   LEU A CG  1 
ATOM 239  C CD1 . LEU A 1 35   ? 21.895  65.980 27.445  1.00 37.96  ? 32   LEU A CD1 1 
ATOM 240  C CD2 . LEU A 1 35   ? 23.557  64.190 27.379  1.00 37.96  ? 32   LEU A CD2 1 
ATOM 241  N N   . ILE A 1 36   ? 18.229  62.103 28.470  1.00 42.92  ? 33   ILE A N   1 
ATOM 242  C CA  . ILE A 1 36   ? 17.573  60.913 29.019  1.00 42.92  ? 33   ILE A CA  1 
ATOM 243  C C   . ILE A 1 36   ? 18.222  59.654 28.460  1.00 42.92  ? 33   ILE A C   1 
ATOM 244  O O   . ILE A 1 36   ? 18.259  59.479 27.236  1.00 42.92  ? 33   ILE A O   1 
ATOM 245  C CB  . ILE A 1 36   ? 16.094  60.898 28.684  1.00 38.50  ? 33   ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 36   ? 15.386  61.987 29.496  1.00 38.50  ? 33   ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 36   ? 15.533  59.515 28.976  1.00 38.50  ? 33   ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 36   ? 13.988  62.304 29.038  1.00 38.50  ? 33   ILE A CD1 1 
ATOM 249  N N   . ALA A 1 37   ? 18.778  58.806 29.323  1.00 53.31  ? 34   ALA A N   1 
ATOM 250  C CA  . ALA A 1 37   ? 19.255  57.509 28.836  1.00 53.31  ? 34   ALA A CA  1 
ATOM 251  C C   . ALA A 1 37   ? 18.160  56.460 28.970  1.00 53.31  ? 34   ALA A C   1 
ATOM 252  O O   . ALA A 1 37   ? 17.493  56.327 30.014  1.00 53.31  ? 34   ALA A O   1 
ATOM 253  C CB  . ALA A 1 37   ? 20.519  57.052 29.548  1.00 18.23  ? 34   ALA A CB  1 
ATOM 254  N N   . LYS A 1 38   ? 17.945  55.735 27.894  1.00 64.25  ? 35   LYS A N   1 
ATOM 255  C CA  . LYS A 1 38   ? 17.065  54.623 27.987  1.00 64.25  ? 35   LYS A CA  1 
ATOM 256  C C   . LYS A 1 38   ? 17.977  53.416 28.133  1.00 64.25  ? 35   LYS A C   1 
ATOM 257  O O   . LYS A 1 38   ? 18.458  53.139 29.223  1.00 64.25  ? 35   LYS A O   1 
ATOM 258  C CB  . LYS A 1 38   ? 16.132  54.586 26.798  1.00 40.26  ? 35   LYS A CB  1 
ATOM 259  C CG  . LYS A 1 38   ? 15.313  55.908 26.611  1.00 40.26  ? 35   LYS A CG  1 
ATOM 260  C CD  . LYS A 1 38   ? 13.987  55.910 27.321  1.00 40.26  ? 35   LYS A CD  1 
ATOM 261  C CE  . LYS A 1 38   ? 13.303  57.280 27.207  1.00 40.26  ? 35   LYS A CE  1 
ATOM 262  N NZ  . LYS A 1 38   ? 12.064  57.356 26.318  1.00 40.26  ? 35   LYS A NZ  1 
ATOM 263  N N   . ASN A 1 39   ? 18.295  52.717 27.066  1.00 49.67  ? 36   ASN A N   1 
ATOM 264  C CA  . ASN A 1 39   ? 19.219  51.598 27.247  1.00 49.67  ? 36   ASN A CA  1 
ATOM 265  C C   . ASN A 1 39   ? 20.356  51.786 26.239  1.00 49.67  ? 36   ASN A C   1 
ATOM 266  O O   . ASN A 1 39   ? 21.458  52.262 26.562  1.00 49.67  ? 36   ASN A O   1 
ATOM 267  C CB  . ASN A 1 39   ? 18.423  50.291 27.045  1.00 29.60  ? 36   ASN A CB  1 
ATOM 268  C CG  . ASN A 1 39   ? 19.208  49.073 27.300  1.00 29.60  ? 36   ASN A CG  1 
ATOM 269  O OD1 . ASN A 1 39   ? 20.029  49.031 28.189  1.00 29.60  ? 36   ASN A OD1 1 
ATOM 270  N ND2 . ASN A 1 39   ? 18.965  48.044 26.509  1.00 29.60  ? 36   ASN A ND2 1 
ATOM 271  N N   . THR A 1 40   ? 20.030  51.465 24.998  1.00 40.07  ? 37   THR A N   1 
ATOM 272  C CA  . THR A 1 40   ? 20.912  51.620 23.884  1.00 40.07  ? 37   THR A CA  1 
ATOM 273  C C   . THR A 1 40   ? 20.643  52.965 23.183  1.00 40.07  ? 37   THR A C   1 
ATOM 274  O O   . THR A 1 40   ? 21.333  53.329 22.247  1.00 40.07  ? 37   THR A O   1 
ATOM 275  C CB  . THR A 1 40   ? 20.703  50.428 22.912  1.00 32.29  ? 37   THR A CB  1 
ATOM 276  O OG1 . THR A 1 40   ? 19.304  50.132 22.775  1.00 32.29  ? 37   THR A OG1 1 
ATOM 277  C CG2 . THR A 1 40   ? 21.384  49.212 23.434  1.00 32.29  ? 37   THR A CG2 1 
ATOM 278  N N   . ARG A 1 41   ? 19.663  53.714 23.684  1.00 38.41  ? 38   ARG A N   1 
ATOM 279  C CA  . ARG A 1 41   ? 19.223  55.010 23.117  1.00 38.41  ? 38   ARG A CA  1 
ATOM 280  C C   . ARG A 1 41   ? 19.568  56.185 24.036  1.00 38.41  ? 38   ARG A C   1 
ATOM 281  O O   . ARG A 1 41   ? 19.561  56.043 25.263  1.00 38.41  ? 38   ARG A O   1 
ATOM 282  C CB  . ARG A 1 41   ? 17.702  55.007 22.931  1.00 47.88  ? 38   ARG A CB  1 
ATOM 283  C CG  . ARG A 1 41   ? 17.181  53.836 22.149  1.00 47.88  ? 38   ARG A CG  1 
ATOM 284  C CD  . ARG A 1 41   ? 16.768  54.238 20.783  1.00 47.88  ? 38   ARG A CD  1 
ATOM 285  N NE  . ARG A 1 41   ? 17.815  54.197 19.773  1.00 47.88  ? 38   ARG A NE  1 
ATOM 286  C CZ  . ARG A 1 41   ? 17.681  54.772 18.587  1.00 47.88  ? 38   ARG A CZ  1 
ATOM 287  N NH1 . ARG A 1 41   ? 16.567  55.421 18.298  1.00 47.88  ? 38   ARG A NH1 1 
ATOM 288  N NH2 . ARG A 1 41   ? 18.646  54.724 17.697  1.00 47.88  ? 38   ARG A NH2 1 
ATOM 289  N N   . LEU A 1 42   ? 19.835  57.341 23.427  1.00 35.97  ? 39   LEU A N   1 
ATOM 290  C CA  . LEU A 1 42   ? 20.191  58.553 24.138  1.00 35.97  ? 39   LEU A CA  1 
ATOM 291  C C   . LEU A 1 42   ? 19.256  59.650 23.691  1.00 35.97  ? 39   LEU A C   1 
ATOM 292  O O   . LEU A 1 42   ? 19.145  59.863 22.484  1.00 35.97  ? 39   LEU A O   1 
ATOM 293  C CB  . LEU A 1 42   ? 21.623  58.942 23.765  1.00 44.76  ? 39   LEU A CB  1 
ATOM 294  C CG  . LEU A 1 42   ? 22.198  60.298 24.179  1.00 44.76  ? 39   LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 42   ? 22.119  60.518 25.711  1.00 44.76  ? 39   LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 42   ? 23.622  60.376 23.730  1.00 44.76  ? 39   LEU A CD2 1 
ATOM 297  N N   . GLU A 1 43   ? 18.596  60.363 24.617  1.00 46.62  ? 40   GLU A N   1 
ATOM 298  C CA  . GLU A 1 43   ? 17.610  61.411 24.252  1.00 46.62  ? 40   GLU A CA  1 
ATOM 299  C C   . GLU A 1 43   ? 18.050  62.765 24.708  1.00 46.62  ? 40   GLU A C   1 
ATOM 300  O O   . GLU A 1 43   ? 18.273  62.979 25.899  1.00 46.62  ? 40   GLU A O   1 
ATOM 301  C CB  . GLU A 1 43   ? 16.264  61.142 24.872  1.00 37.15  ? 40   GLU A CB  1 
ATOM 302  C CG  . GLU A 1 43   ? 15.249  60.579 23.920  1.00 37.15  ? 40   GLU A CG  1 
ATOM 303  C CD  . GLU A 1 43   ? 14.175  59.708 24.612  1.00 37.15  ? 40   GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 43   ? 13.589  60.202 25.624  1.00 37.15  ? 40   GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 43   ? 13.922  58.557 24.121  1.00 37.15  ? 40   GLU A OE2 1 
ATOM 306  N N   . ILE A 1 44   ? 18.164  63.690 23.757  1.00 56.32  ? 41   ILE A N   1 
ATOM 307  C CA  . ILE A 1 44   ? 18.616  65.059 24.024  1.00 56.32  ? 41   ILE A CA  1 
ATOM 308  C C   . ILE A 1 44   ? 17.470  66.050 23.800  1.00 56.32  ? 41   ILE A C   1 
ATOM 309  O O   . ILE A 1 44   ? 16.972  66.154 22.685  1.00 56.32  ? 41   ILE A O   1 
ATOM 310  C CB  . ILE A 1 44   ? 19.830  65.442 23.119  1.00 36.46  ? 41   ILE A CB  1 
ATOM 311  C CG1 . ILE A 1 44   ? 20.679  64.206 22.800  1.00 36.46  ? 41   ILE A CG1 1 
ATOM 312  C CG2 . ILE A 1 44   ? 20.676  66.588 23.749  1.00 36.46  ? 41   ILE A CG2 1 
ATOM 313  C CD1 . ILE A 1 44   ? 22.137  64.512 22.487  1.00 36.46  ? 41   ILE A CD1 1 
ATOM 314  N N   . TYR A 1 45   ? 17.072  66.746 24.879  1.00 52.28  ? 42   TYR A N   1 
ATOM 315  C CA  . TYR A 1 45   ? 16.031  67.797 24.881  1.00 52.28  ? 42   TYR A CA  1 
ATOM 316  C C   . TYR A 1 45   ? 16.638  69.124 25.337  1.00 52.28  ? 42   TYR A C   1 
ATOM 317  O O   . TYR A 1 45   ? 17.656  69.131 26.015  1.00 52.28  ? 42   TYR A O   1 
ATOM 318  C CB  . TYR A 1 45   ? 14.836  67.457 25.827  1.00 38.84  ? 42   TYR A CB  1 
ATOM 319  C CG  . TYR A 1 45   ? 14.157  66.143 25.541  1.00 38.84  ? 42   TYR A CG  1 
ATOM 320  C CD1 . TYR A 1 45   ? 14.695  64.936 26.021  1.00 38.84  ? 42   TYR A CD1 1 
ATOM 321  C CD2 . TYR A 1 45   ? 13.009  66.089 24.769  1.00 38.84  ? 42   TYR A CD2 1 
ATOM 322  C CE1 . TYR A 1 45   ? 14.116  63.724 25.740  1.00 38.84  ? 42   TYR A CE1 1 
ATOM 323  C CE2 . TYR A 1 45   ? 12.421  64.869 24.478  1.00 38.84  ? 42   TYR A CE2 1 
ATOM 324  C CZ  . TYR A 1 45   ? 12.982  63.695 24.982  1.00 38.84  ? 42   TYR A CZ  1 
ATOM 325  O OH  . TYR A 1 45   ? 12.403  62.493 24.710  1.00 38.84  ? 42   TYR A OH  1 
ATOM 326  N N   . VAL A 1 46   ? 15.991  70.236 24.974  1.00 47.29  ? 43   VAL A N   1 
ATOM 327  C CA  . VAL A 1 46   ? 16.292  71.537 25.561  1.00 47.29  ? 43   VAL A CA  1 
ATOM 328  C C   . VAL A 1 46   ? 15.171  71.966 26.479  1.00 47.29  ? 43   VAL A C   1 
ATOM 329  O O   . VAL A 1 46   ? 14.003  72.010 26.057  1.00 47.29  ? 43   VAL A O   1 
ATOM 330  C CB  . VAL A 1 46   ? 16.439  72.644 24.509  1.00 67.78  ? 43   VAL A CB  1 
ATOM 331  C CG1 . VAL A 1 46   ? 16.908  73.928 25.177  1.00 67.78  ? 43   VAL A CG1 1 
ATOM 332  C CG2 . VAL A 1 46   ? 17.401  72.224 23.386  1.00 67.78  ? 43   VAL A CG2 1 
ATOM 333  N N   . VAL A 1 47   ? 15.519  72.293 27.722  1.00 40.55  ? 44   VAL A N   1 
ATOM 334  C CA  . VAL A 1 47   ? 14.515  72.785 28.680  1.00 40.55  ? 44   VAL A CA  1 
ATOM 335  C C   . VAL A 1 47   ? 13.880  74.085 28.242  1.00 40.55  ? 44   VAL A C   1 
ATOM 336  O O   . VAL A 1 47   ? 14.582  75.075 28.041  1.00 40.55  ? 44   VAL A O   1 
ATOM 337  C CB  . VAL A 1 47   ? 15.099  73.015 30.097  1.00 51.98  ? 44   VAL A CB  1 
ATOM 338  C CG1 . VAL A 1 47   ? 14.002  73.503 31.055  1.00 51.98  ? 44   VAL A CG1 1 
ATOM 339  C CG2 . VAL A 1 47   ? 15.743  71.728 30.599  1.00 51.98  ? 44   VAL A CG2 1 
ATOM 340  N N   . THR A 1 48   ? 12.560  74.098 28.133  1.00 65.41  ? 45   THR A N   1 
ATOM 341  C CA  . THR A 1 48   ? 11.853  75.326 27.790  1.00 65.41  ? 45   THR A CA  1 
ATOM 342  C C   . THR A 1 48   ? 10.860  75.687 28.875  1.00 65.41  ? 45   THR A C   1 
ATOM 343  O O   . THR A 1 48   ? 10.466  74.836 29.656  1.00 65.41  ? 45   THR A O   1 
ATOM 344  C CB  . THR A 1 48   ? 11.068  75.183 26.466  1.00 62.65  ? 45   THR A CB  1 
ATOM 345  O OG1 . THR A 1 48   ? 10.106  74.119 26.594  1.00 62.65  ? 45   THR A OG1 1 
ATOM 346  C CG2 . THR A 1 48   ? 12.016  74.919 25.276  1.00 62.65  ? 45   THR A CG2 1 
ATOM 347  N N   . ALA A 1 49   ? 10.447  76.954 28.892  1.00 69.57  ? 46   ALA A N   1 
ATOM 348  C CA  . ALA A 1 49   ? 9.329   77.437 29.714  1.00 69.57  ? 46   ALA A CA  1 
ATOM 349  C C   . ALA A 1 49   ? 8.148   76.462 29.759  1.00 69.57  ? 46   ALA A C   1 
ATOM 350  O O   . ALA A 1 49   ? 7.547   76.288 30.800  1.00 69.57  ? 46   ALA A O   1 
ATOM 351  C CB  . ALA A 1 49   ? 8.867   78.807 29.212  1.00 74.90  ? 46   ALA A CB  1 
ATOM 352  N N   . GLU A 1 50   ? 7.831   75.831 28.630  1.00 113.88 ? 47   GLU A N   1 
ATOM 353  C CA  . GLU A 1 50   ? 6.738   74.857 28.573  1.00 113.88 ? 47   GLU A CA  1 
ATOM 354  C C   . GLU A 1 50   ? 7.108   73.432 29.054  1.00 113.88 ? 47   GLU A C   1 
ATOM 355  O O   . GLU A 1 50   ? 6.328   72.799 29.778  1.00 113.88 ? 47   GLU A O   1 
ATOM 356  C CB  . GLU A 1 50   ? 6.079   74.843 27.181  1.00 176.63 ? 47   GLU A CB  1 
ATOM 357  C CG  . GLU A 1 50   ? 7.034   74.820 25.978  1.00 176.63 ? 47   GLU A CG  1 
ATOM 358  C CD  . GLU A 1 50   ? 7.250   73.425 25.390  1.00 176.63 ? 47   GLU A CD  1 
ATOM 359  O OE1 . GLU A 1 50   ? 6.372   72.543 25.567  1.00 176.63 ? 47   GLU A OE1 1 
ATOM 360  O OE2 . GLU A 1 50   ? 8.299   73.215 24.732  1.00 176.63 ? 47   GLU A OE2 1 
ATOM 361  N N   . GLY A 1 51   ? 8.292   72.946 28.666  1.00 85.40  ? 48   GLY A N   1 
ATOM 362  C CA  . GLY A 1 51   ? 8.736   71.584 28.989  1.00 85.40  ? 48   GLY A CA  1 
ATOM 363  C C   . GLY A 1 51   ? 10.040  71.213 28.304  1.00 85.40  ? 48   GLY A C   1 
ATOM 364  O O   . GLY A 1 51   ? 11.087  71.773 28.619  1.00 85.40  ? 48   GLY A O   1 
ATOM 365  N N   . LEU A 1 52   ? 9.988   70.279 27.358  1.00 46.98  ? 49   LEU A N   1 
ATOM 366  C CA  . LEU A 1 52   ? 11.202  69.808 26.696  1.00 46.98  ? 49   LEU A CA  1 
ATOM 367  C C   . LEU A 1 52   ? 11.173  70.027 25.180  1.00 46.98  ? 49   LEU A C   1 
ATOM 368  O O   . LEU A 1 52   ? 10.200  69.651 24.495  1.00 46.98  ? 49   LEU A O   1 
ATOM 369  C CB  . LEU A 1 52   ? 11.455  68.324 27.020  1.00 54.07  ? 49   LEU A CB  1 
ATOM 370  C CG  . LEU A 1 52   ? 11.943  67.779 28.391  1.00 54.07  ? 49   LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 52   ? 12.733  68.802 29.307  1.00 54.07  ? 49   LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 52   ? 10.804  67.155 29.148  1.00 54.07  ? 49   LEU A CD2 1 
ATOM 373  N N   . ARG A 1 53   ? 12.229  70.637 24.643  1.00 51.71  ? 50   ARG A N   1 
ATOM 374  C CA  . ARG A 1 53   ? 12.357  70.701 23.185  1.00 51.71  ? 50   ARG A CA  1 
ATOM 375  C C   . ARG A 1 53   ? 13.116  69.465 22.702  1.00 51.71  ? 50   ARG A C   1 
ATOM 376  O O   . ARG A 1 53   ? 14.322  69.316 22.921  1.00 51.71  ? 50   ARG A O   1 
ATOM 377  C CB  . ARG A 1 53   ? 13.028  71.989 22.699  1.00 99.72  ? 50   ARG A CB  1 
ATOM 378  C CG  . ARG A 1 53   ? 13.191  72.038 21.170  1.00 99.72  ? 50   ARG A CG  1 
ATOM 379  C CD  . ARG A 1 53   ? 14.087  73.170 20.697  1.00 99.72  ? 50   ARG A CD  1 
ATOM 380  N NE  . ARG A 1 53   ? 13.468  74.436 21.039  1.00 99.72  ? 50   ARG A NE  1 
ATOM 381  C CZ  . ARG A 1 53   ? 13.855  75.226 22.035  1.00 99.72  ? 50   ARG A CZ  1 
ATOM 382  N NH1 . ARG A 1 53   ? 14.902  74.906 22.779  1.00 99.72  ? 50   ARG A NH1 1 
ATOM 383  N NH2 . ARG A 1 53   ? 13.196  76.353 22.278  1.00 99.72  ? 50   ARG A NH2 1 
ATOM 384  N N   . PRO A 1 54   ? 12.402  68.533 22.084  1.00 47.47  ? 51   PRO A N   1 
ATOM 385  C CA  . PRO A 1 54   ? 13.155  67.464 21.458  1.00 47.47  ? 51   PRO A CA  1 
ATOM 386  C C   . PRO A 1 54   ? 14.180  68.035 20.470  1.00 47.47  ? 51   PRO A C   1 
ATOM 387  O O   . PRO A 1 54   ? 13.804  68.734 19.518  1.00 47.47  ? 51   PRO A O   1 
ATOM 388  C CB  . PRO A 1 54   ? 12.068  66.676 20.719  1.00 40.82  ? 51   PRO A CB  1 
ATOM 389  C CG  . PRO A 1 54   ? 10.870  66.876 21.521  1.00 40.82  ? 51   PRO A CG  1 
ATOM 390  C CD  . PRO A 1 54   ? 10.950  68.323 21.965  1.00 40.82  ? 51   PRO A CD  1 
ATOM 391  N N   . VAL A 1 55   ? 15.454  67.759 20.720  1.00 50.57  ? 52   VAL A N   1 
ATOM 392  C CA  . VAL A 1 55   ? 16.514  68.063 19.753  1.00 50.57  ? 52   VAL A CA  1 
ATOM 393  C C   . VAL A 1 55   ? 17.190  66.829 19.116  1.00 50.57  ? 52   VAL A C   1 
ATOM 394  O O   . VAL A 1 55   ? 17.224  66.734 17.903  1.00 50.57  ? 52   VAL A O   1 
ATOM 395  C CB  . VAL A 1 55   ? 17.580  69.110 20.297  1.00 43.87  ? 52   VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 55   ? 17.593  69.176 21.811  1.00 43.87  ? 52   VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 55   ? 18.971  68.810 19.776  1.00 43.87  ? 52   VAL A CG2 1 
ATOM 398  N N   . LYS A 1 56   ? 17.740  65.899 19.897  1.00 62.55  ? 53   LYS A N   1 
ATOM 399  C CA  . LYS A 1 56   ? 18.418  64.753 19.270  1.00 62.55  ? 53   LYS A CA  1 
ATOM 400  C C   . LYS A 1 56   ? 18.327  63.402 19.988  1.00 62.55  ? 53   LYS A C   1 
ATOM 401  O O   . LYS A 1 56   ? 18.610  63.285 21.185  1.00 62.55  ? 53   LYS A O   1 
ATOM 402  C CB  . LYS A 1 56   ? 19.882  65.080 18.942  1.00 64.14  ? 53   LYS A CB  1 
ATOM 403  C CG  . LYS A 1 56   ? 20.593  64.015 18.101  1.00 64.14  ? 53   LYS A CG  1 
ATOM 404  C CD  . LYS A 1 56   ? 20.296  64.095 16.605  1.00 64.14  ? 53   LYS A CD  1 
ATOM 405  C CE  . LYS A 1 56   ? 21.236  63.183 15.805  1.00 64.14  ? 53   LYS A CE  1 
ATOM 406  N NZ  . LYS A 1 56   ? 21.095  63.347 14.319  1.00 64.14  ? 53   LYS A NZ  1 
ATOM 407  N N   . GLU A 1 57   ? 17.953  62.379 19.222  1.00 43.40  ? 54   GLU A N   1 
ATOM 408  C CA  . GLU A 1 57   ? 17.908  61.017 19.703  1.00 43.40  ? 54   GLU A CA  1 
ATOM 409  C C   . GLU A 1 57   ? 18.777  60.206 18.767  1.00 43.40  ? 54   GLU A C   1 
ATOM 410  O O   . GLU A 1 57   ? 18.536  60.215 17.569  1.00 43.40  ? 54   GLU A O   1 
ATOM 411  C CB  . GLU A 1 57   ? 16.466  60.495 19.673  1.00 46.43  ? 54   GLU A CB  1 
ATOM 412  C CG  . GLU A 1 57   ? 16.170  59.339 20.643  1.00 46.43  ? 54   GLU A CG  1 
ATOM 413  C CD  . GLU A 1 57   ? 16.117  57.971 19.971  1.00 46.43  ? 54   GLU A CD  1 
ATOM 414  O OE1 . GLU A 1 57   ? 15.519  57.024 20.526  1.00 46.43  ? 54   GLU A OE1 1 
ATOM 415  O OE2 . GLU A 1 57   ? 16.664  57.837 18.868  1.00 46.43  ? 54   GLU A OE2 1 
ATOM 416  N N   . VAL A 1 58   ? 19.782  59.520 19.311  1.00 66.80  ? 55   VAL A N   1 
ATOM 417  C CA  . VAL A 1 58   ? 20.578  58.542 18.557  1.00 66.80  ? 55   VAL A CA  1 
ATOM 418  C C   . VAL A 1 58   ? 20.489  57.170 19.214  1.00 66.80  ? 55   VAL A C   1 
ATOM 419  O O   . VAL A 1 58   ? 19.845  57.027 20.261  1.00 66.80  ? 55   VAL A O   1 
ATOM 420  C CB  . VAL A 1 58   ? 22.065  58.921 18.520  1.00 45.41  ? 55   VAL A CB  1 
ATOM 421  C CG1 . VAL A 1 58   ? 22.219  60.368 18.127  1.00 45.41  ? 55   VAL A CG1 1 
ATOM 422  C CG2 . VAL A 1 58   ? 22.742  58.647 19.904  1.00 45.41  ? 55   VAL A CG2 1 
ATOM 423  N N   . GLY A 1 59   ? 21.154  56.178 18.608  1.00 36.12  ? 56   GLY A N   1 
ATOM 424  C CA  . GLY A 1 59   ? 21.388  54.886 19.235  1.00 36.12  ? 56   GLY A CA  1 
ATOM 425  C C   . GLY A 1 59   ? 22.864  54.688 19.524  1.00 36.12  ? 56   GLY A C   1 
ATOM 426  O O   . GLY A 1 59   ? 23.732  55.263 18.869  1.00 36.12  ? 56   GLY A O   1 
ATOM 427  N N   . MET A 1 60   ? 23.148  53.882 20.536  1.00 31.03  ? 57   MET A N   1 
ATOM 428  C CA  . MET A 1 60   ? 24.499  53.411 20.808  1.00 31.03  ? 57   MET A CA  1 
ATOM 429  C C   . MET A 1 60   ? 24.529  51.884 20.577  1.00 31.03  ? 57   MET A C   1 
ATOM 430  O O   . MET A 1 60   ? 23.452  51.252 20.499  1.00 31.03  ? 57   MET A O   1 
ATOM 431  C CB  . MET A 1 60   ? 24.968  53.839 22.206  1.00 48.03  ? 57   MET A CB  1 
ATOM 432  C CG  . MET A 1 60   ? 25.231  55.352 22.287  1.00 48.03  ? 57   MET A CG  1 
ATOM 433  S SD  . MET A 1 60   ? 26.410  55.899 23.569  1.00 48.03  ? 57   MET A SD  1 
ATOM 434  C CE  . MET A 1 60   ? 27.961  55.585 22.703  1.00 48.03  ? 57   MET A CE  1 
ATOM 435  N N   . TYR A 1 61   ? 25.735  51.330 20.392  1.00 47.95  ? 58   TYR A N   1 
ATOM 436  C CA  . TYR A 1 61   ? 25.947  49.888 20.225  1.00 47.95  ? 58   TYR A CA  1 
ATOM 437  C C   . TYR A 1 61   ? 26.400  49.236 21.534  1.00 47.95  ? 58   TYR A C   1 
ATOM 438  O O   . TYR A 1 61   ? 27.454  48.595 21.596  1.00 47.95  ? 58   TYR A O   1 
ATOM 439  C CB  . TYR A 1 61   ? 26.962  49.600 19.124  1.00 56.30  ? 58   TYR A CB  1 
ATOM 440  C CG  . TYR A 1 61   ? 26.436  49.751 17.713  1.00 56.30  ? 58   TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 61   ? 25.087  49.514 17.403  1.00 56.30  ? 58   TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 61   ? 27.305  50.085 16.672  1.00 56.30  ? 58   TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 61   ? 24.612  49.639 16.086  1.00 56.30  ? 58   TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 61   ? 26.850  50.225 15.363  1.00 56.30  ? 58   TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 61   ? 25.507  50.003 15.063  1.00 56.30  ? 58   TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 61   ? 25.090  50.140 13.746  1.00 56.30  ? 58   TYR A OH  1 
ATOM 447  N N   . GLY A 1 62   ? 25.557  49.389 22.560  1.00 38.06  ? 59   GLY A N   1 
ATOM 448  C CA  . GLY A 1 62   ? 25.818  48.947 23.920  1.00 38.06  ? 59   GLY A CA  1 
ATOM 449  C C   . GLY A 1 62   ? 24.792  49.600 24.816  1.00 38.06  ? 59   GLY A C   1 
ATOM 450  O O   . GLY A 1 62   ? 24.154  50.583 24.424  1.00 38.06  ? 59   GLY A O   1 
ATOM 451  N N   . LYS A 1 63   ? 24.611  49.014 26.000  1.00 26.79  ? 60   LYS A N   1 
ATOM 452  C CA  . LYS A 1 63   ? 23.794  49.531 27.091  1.00 26.79  ? 60   LYS A CA  1 
ATOM 453  C C   . LYS A 1 63   ? 24.502  50.677 27.841  1.00 26.79  ? 60   LYS A C   1 
ATOM 454  O O   . LYS A 1 63   ? 25.564  50.453 28.447  1.00 26.79  ? 60   LYS A O   1 
ATOM 455  C CB  . LYS A 1 63   ? 23.569  48.421 28.090  1.00 34.11  ? 60   LYS A CB  1 
ATOM 456  C CG  . LYS A 1 63   ? 23.338  47.043 27.484  1.00 34.11  ? 60   LYS A CG  1 
ATOM 457  C CD  . LYS A 1 63   ? 22.008  46.449 27.950  1.00 34.11  ? 60   LYS A CD  1 
ATOM 458  C CE  . LYS A 1 63   ? 22.153  45.777 29.287  1.00 34.11  ? 60   LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 63   ? 21.754  46.728 30.367  1.00 34.11  ? 60   LYS A NZ  1 
ATOM 460  N N   . ILE A 1 64   ? 23.920  51.887 27.838  1.00 32.52  ? 61   ILE A N   1 
ATOM 461  C CA  . ILE A 1 64   ? 24.499  52.980 28.622  1.00 32.52  ? 61   ILE A CA  1 
ATOM 462  C C   . ILE A 1 64   ? 24.469  52.717 30.147  1.00 32.52  ? 61   ILE A C   1 
ATOM 463  O O   . ILE A 1 64   ? 23.414  52.551 30.764  1.00 32.52  ? 61   ILE A O   1 
ATOM 464  C CB  . ILE A 1 64   ? 23.839  54.306 28.305  1.00 21.34  ? 61   ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 64   ? 24.205  54.760 26.878  1.00 21.34  ? 61   ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 64   ? 24.276  55.370 29.327  1.00 21.34  ? 61   ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 64   ? 23.190  55.609 26.258  1.00 21.34  ? 61   ILE A CD1 1 
ATOM 468  N N   . ALA A 1 65   ? 25.649  52.681 30.746  1.00 39.21  ? 62   ALA A N   1 
ATOM 469  C CA  . ALA A 1 65   ? 25.793  52.278 32.139  1.00 39.21  ? 62   ALA A CA  1 
ATOM 470  C C   . ALA A 1 65   ? 26.314  53.415 33.037  1.00 39.21  ? 62   ALA A C   1 
ATOM 471  O O   . ALA A 1 65   ? 26.056  53.427 34.241  1.00 39.21  ? 62   ALA A O   1 
ATOM 472  C CB  . ALA A 1 65   ? 26.705  51.066 32.227  1.00 11.53  ? 62   ALA A CB  1 
ATOM 473  N N   . VAL A 1 66   ? 27.083  54.333 32.455  1.00 39.43  ? 63   VAL A N   1 
ATOM 474  C CA  . VAL A 1 66   ? 27.439  55.596 33.118  1.00 39.43  ? 63   VAL A CA  1 
ATOM 475  C C   . VAL A 1 66   ? 27.198  56.739 32.141  1.00 39.43  ? 63   VAL A C   1 
ATOM 476  O O   . VAL A 1 66   ? 27.548  56.645 30.957  1.00 39.43  ? 63   VAL A O   1 
ATOM 477  C CB  . VAL A 1 66   ? 28.926  55.637 33.553  1.00 33.50  ? 63   VAL A CB  1 
ATOM 478  C CG1 . VAL A 1 66   ? 29.316  57.049 34.067  1.00 33.50  ? 63   VAL A CG1 1 
ATOM 479  C CG2 . VAL A 1 66   ? 29.253  54.506 34.590  1.00 33.50  ? 63   VAL A CG2 1 
ATOM 480  N N   . MET A 1 67   ? 26.591  57.814 32.618  1.00 46.77  ? 64   MET A N   1 
ATOM 481  C CA  . MET A 1 67   ? 26.371  58.977 31.750  1.00 46.77  ? 64   MET A CA  1 
ATOM 482  C C   . MET A 1 67   ? 26.507  60.252 32.561  1.00 46.77  ? 64   MET A C   1 
ATOM 483  O O   . MET A 1 67   ? 25.676  60.543 33.429  1.00 46.77  ? 64   MET A O   1 
ATOM 484  C CB  . MET A 1 67   ? 25.038  58.902 31.005  1.00 42.44  ? 64   MET A CB  1 
ATOM 485  C CG  . MET A 1 67   ? 24.606  60.195 30.378  1.00 42.44  ? 64   MET A CG  1 
ATOM 486  S SD  . MET A 1 67   ? 23.084  60.002 29.464  1.00 42.44  ? 64   MET A SD  1 
ATOM 487  C CE  . MET A 1 67   ? 21.836  60.106 30.724  1.00 42.44  ? 64   MET A CE  1 
ATOM 488  N N   . GLU A 1 68   ? 27.594  60.975 32.301  1.00 41.47  ? 65   GLU A N   1 
ATOM 489  C CA  . GLU A 1 68   ? 27.898  62.189 33.007  1.00 41.47  ? 65   GLU A CA  1 
ATOM 490  C C   . GLU A 1 68   ? 28.388  63.266 32.083  1.00 41.47  ? 65   GLU A C   1 
ATOM 491  O O   . GLU A 1 68   ? 29.009  62.966 31.067  1.00 41.47  ? 65   GLU A O   1 
ATOM 492  C CB  . GLU A 1 68   ? 28.873  61.932 34.141  1.00 75.96  ? 65   GLU A CB  1 
ATOM 493  C CG  . GLU A 1 68   ? 28.159  61.638 35.456  1.00 75.96  ? 65   GLU A CG  1 
ATOM 494  C CD  . GLU A 1 68   ? 27.208  62.750 35.916  1.00 75.96  ? 65   GLU A CD  1 
ATOM 495  O OE1 . GLU A 1 68   ? 26.769  62.674 37.085  1.00 75.96  ? 65   GLU A OE1 1 
ATOM 496  O OE2 . GLU A 1 68   ? 26.883  63.687 35.131  1.00 75.96  ? 65   GLU A OE2 1 
ATOM 497  N N   . LEU A 1 69   ? 28.046  64.511 32.414  1.00 53.95  ? 66   LEU A N   1 
ATOM 498  C CA  . LEU A 1 69   ? 28.504  65.686 31.669  1.00 53.95  ? 66   LEU A CA  1 
ATOM 499  C C   . LEU A 1 69   ? 29.639  66.348 32.446  1.00 53.95  ? 66   LEU A C   1 
ATOM 500  O O   . LEU A 1 69   ? 29.646  66.314 33.693  1.00 53.95  ? 66   LEU A O   1 
ATOM 501  C CB  . LEU A 1 69   ? 27.357  66.687 31.403  1.00 38.10  ? 66   LEU A CB  1 
ATOM 502  C CG  . LEU A 1 69   ? 26.344  66.447 30.271  1.00 38.10  ? 66   LEU A CG  1 
ATOM 503  C CD1 . LEU A 1 69   ? 25.141  67.345 30.385  1.00 38.10  ? 66   LEU A CD1 1 
ATOM 504  C CD2 . LEU A 1 69   ? 26.944  66.607 28.874  1.00 38.10  ? 66   LEU A CD2 1 
ATOM 505  N N   . PHE A 1 70   ? 30.600  66.920 31.706  1.00 58.42  ? 67   PHE A N   1 
ATOM 506  C CA  . PHE A 1 70   ? 31.777  67.579 32.301  1.00 58.42  ? 67   PHE A CA  1 
ATOM 507  C C   . PHE A 1 70   ? 32.295  68.662 31.394  1.00 58.42  ? 67   PHE A C   1 
ATOM 508  O O   . PHE A 1 70   ? 31.926  68.713 30.217  1.00 58.42  ? 67   PHE A O   1 
ATOM 509  C CB  . PHE A 1 70   ? 32.912  66.597 32.673  1.00 51.53  ? 67   PHE A CB  1 
ATOM 510  C CG  . PHE A 1 70   ? 33.527  65.864 31.496  1.00 51.53  ? 67   PHE A CG  1 
ATOM 511  C CD1 . PHE A 1 70   ? 34.872  66.061 31.155  1.00 51.53  ? 67   PHE A CD1 1 
ATOM 512  C CD2 . PHE A 1 70   ? 32.779  64.940 30.732  1.00 51.53  ? 67   PHE A CD2 1 
ATOM 513  C CE1 . PHE A 1 70   ? 35.461  65.359 30.053  1.00 51.53  ? 67   PHE A CE1 1 
ATOM 514  C CE2 . PHE A 1 70   ? 33.357  64.245 29.638  1.00 51.53  ? 67   PHE A CE2 1 
ATOM 515  C CZ  . PHE A 1 70   ? 34.696  64.456 29.304  1.00 51.53  ? 67   PHE A CZ  1 
ATOM 516  N N   . ARG A 1 71   ? 33.138  69.527 31.973  1.00 74.02  ? 68   ARG A N   1 
ATOM 517  C CA  . ARG A 1 71   ? 33.767  70.656 31.289  1.00 74.02  ? 68   ARG A CA  1 
ATOM 518  C C   . ARG A 1 71   ? 35.270  70.660 31.532  1.00 74.02  ? 68   ARG A C   1 
ATOM 519  O O   . ARG A 1 71   ? 35.731  71.102 32.597  1.00 74.02  ? 68   ARG A O   1 
ATOM 520  C CB  . ARG A 1 71   ? 33.203  71.981 31.791  1.00 87.97  ? 68   ARG A CB  1 
ATOM 521  C CG  . ARG A 1 71   ? 31.694  72.130 31.707  1.00 87.97  ? 68   ARG A CG  1 
ATOM 522  C CD  . ARG A 1 71   ? 31.272  73.517 32.189  1.00 87.97  ? 68   ARG A CD  1 
ATOM 523  N NE  . ARG A 1 71   ? 30.492  74.216 31.165  1.00 87.97  ? 68   ARG A NE  1 
ATOM 524  C CZ  . ARG A 1 71   ? 30.991  74.687 30.027  1.00 87.97  ? 68   ARG A CZ  1 
ATOM 525  N NH1 . ARG A 1 71   ? 32.277  74.529 29.743  1.00 87.97  ? 68   ARG A NH1 1 
ATOM 526  N NH2 . ARG A 1 71   ? 30.192  75.306 29.178  1.00 87.97  ? 68   ARG A NH2 1 
ATOM 527  N N   . PRO A 1 72   ? 36.045  70.159 30.551  1.00 108.47 ? 69   PRO A N   1 
ATOM 528  C CA  . PRO A 1 72   ? 37.498  70.241 30.616  1.00 108.47 ? 69   PRO A CA  1 
ATOM 529  C C   . PRO A 1 72   ? 37.980  71.663 30.373  1.00 108.47 ? 69   PRO A C   1 
ATOM 530  O O   . PRO A 1 72   ? 37.268  72.464 29.770  1.00 108.47 ? 69   PRO A O   1 
ATOM 531  C CB  . PRO A 1 72   ? 37.955  69.330 29.467  1.00 65.56  ? 69   PRO A CB  1 
ATOM 532  C CG  . PRO A 1 72   ? 36.738  68.544 29.057  1.00 65.56  ? 69   PRO A CG  1 
ATOM 533  C CD  . PRO A 1 72   ? 35.601  69.460 29.331  1.00 65.56  ? 69   PRO A CD  1 
ATOM 534  N N   . LYS A 1 73   ? 39.186  71.953 30.854  1.00 86.74  ? 70   LYS A N   1 
ATOM 535  C CA  . LYS A 1 73   ? 39.848  73.253 30.681  1.00 86.74  ? 70   LYS A CA  1 
ATOM 536  C C   . LYS A 1 73   ? 39.611  73.895 29.317  1.00 86.74  ? 70   LYS A C   1 
ATOM 537  O O   . LYS A 1 73   ? 39.855  73.291 28.271  1.00 86.74  ? 70   LYS A O   1 
ATOM 538  C CB  . LYS A 1 73   ? 41.346  73.109 30.934  1.00 82.98  ? 70   LYS A CB  1 
ATOM 539  C CG  . LYS A 1 73   ? 41.958  71.846 30.307  1.00 82.98  ? 70   LYS A CG  1 
ATOM 540  C CD  . LYS A 1 73   ? 43.248  71.437 31.011  1.00 82.98  ? 70   LYS A CD  1 
ATOM 541  C CE  . LYS A 1 73   ? 43.806  70.145 30.450  1.00 82.98  ? 70   LYS A CE  1 
ATOM 542  N NZ  . LYS A 1 73   ? 45.006  69.733 31.224  1.00 82.98  ? 70   LYS A NZ  1 
ATOM 543  N N   . GLY A 1 74   ? 39.113  75.125 29.353  1.00 82.06  ? 71   GLY A N   1 
ATOM 544  C CA  . GLY A 1 74   ? 38.854  75.882 28.141  1.00 82.06  ? 71   GLY A CA  1 
ATOM 545  C C   . GLY A 1 74   ? 38.065  75.078 27.132  1.00 82.06  ? 71   GLY A C   1 
ATOM 546  O O   . GLY A 1 74   ? 38.609  74.593 26.142  1.00 82.06  ? 71   GLY A O   1 
ATOM 547  N N   . GLU A 1 75   ? 36.780  74.914 27.429  1.00 110.21 ? 72   GLU A N   1 
ATOM 548  C CA  . GLU A 1 75   ? 35.799  74.338 26.520  1.00 110.21 ? 72   GLU A CA  1 
ATOM 549  C C   . GLU A 1 75   ? 34.550  75.197 26.663  1.00 110.21 ? 72   GLU A C   1 
ATOM 550  O O   . GLU A 1 75   ? 34.102  75.457 27.778  1.00 110.21 ? 72   GLU A O   1 
ATOM 551  C CB  . GLU A 1 75   ? 35.480  72.896 26.912  1.00 82.64  ? 72   GLU A CB  1 
ATOM 552  C CG  . GLU A 1 75   ? 36.590  71.889 26.663  1.00 82.64  ? 72   GLU A CG  1 
ATOM 553  C CD  . GLU A 1 75   ? 36.463  71.179 25.336  1.00 82.64  ? 72   GLU A CD  1 
ATOM 554  O OE1 . GLU A 1 75   ? 37.329  70.342 25.032  1.00 82.64  ? 72   GLU A OE1 1 
ATOM 555  O OE2 . GLU A 1 75   ? 35.505  71.446 24.592  1.00 82.64  ? 72   GLU A OE2 1 
ATOM 556  N N   . SER A 1 76   ? 34.000  75.651 25.543  1.00 77.96  ? 73   SER A N   1 
ATOM 557  C CA  . SER A 1 76   ? 32.815  76.506 25.562  1.00 77.96  ? 73   SER A CA  1 
ATOM 558  C C   . SER A 1 76   ? 31.560  75.831 26.138  1.00 77.96  ? 73   SER A C   1 
ATOM 559  O O   . SER A 1 76   ? 30.796  76.459 26.880  1.00 77.96  ? 73   SER A O   1 
ATOM 560  C CB  . SER A 1 76   ? 32.511  76.999 24.156  1.00 57.38  ? 73   SER A CB  1 
ATOM 561  O OG  . SER A 1 76   ? 32.121  75.920 23.321  1.00 57.38  ? 73   SER A OG  1 
ATOM 562  N N   . LYS A 1 77   ? 31.355  74.564 25.772  1.00 72.93  ? 74   LYS A N   1 
ATOM 563  C CA  . LYS A 1 77   ? 30.204  73.781 26.196  1.00 72.93  ? 74   LYS A CA  1 
ATOM 564  C C   . LYS A 1 77   ? 30.653  72.452 26.833  1.00 72.93  ? 74   LYS A C   1 
ATOM 565  O O   . LYS A 1 77   ? 31.842  72.114 26.812  1.00 72.93  ? 74   LYS A O   1 
ATOM 566  C CB  . LYS A 1 77   ? 29.272  73.538 25.008  1.00 69.05  ? 74   LYS A CB  1 
ATOM 567  C CG  . LYS A 1 77   ? 29.768  72.497 24.022  1.00 69.05  ? 74   LYS A CG  1 
ATOM 568  C CD  . LYS A 1 77   ? 28.806  72.337 22.863  1.00 69.05  ? 74   LYS A CD  1 
ATOM 569  C CE  . LYS A 1 77   ? 29.315  73.077 21.628  1.00 69.05  ? 74   LYS A CE  1 
ATOM 570  N NZ  . LYS A 1 77   ? 28.178  73.584 20.796  1.00 69.05  ? 74   LYS A NZ  1 
ATOM 571  N N   . ASP A 1 78   ? 29.698  71.705 27.392  1.00 58.51  ? 75   ASP A N   1 
ATOM 572  C CA  . ASP A 1 78   ? 29.981  70.457 28.094  1.00 58.51  ? 75   ASP A CA  1 
ATOM 573  C C   . ASP A 1 78   ? 30.358  69.364 27.134  1.00 58.51  ? 75   ASP A C   1 
ATOM 574  O O   . ASP A 1 78   ? 30.072  69.440 25.930  1.00 58.51  ? 75   ASP A O   1 
ATOM 575  C CB  . ASP A 1 78   ? 28.752  69.982 28.864  1.00 91.24  ? 75   ASP A CB  1 
ATOM 576  C CG  . ASP A 1 78   ? 28.529  70.743 30.150  1.00 91.24  ? 75   ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 78   ? 27.886  70.158 31.045  1.00 91.24  ? 75   ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 78   ? 28.971  71.910 30.269  1.00 91.24  ? 75   ASP A OD2 1 
ATOM 579  N N   . LEU A 1 79   ? 31.006  68.338 27.667  1.00 56.95  ? 76   LEU A N   1 
ATOM 580  C CA  . LEU A 1 79   ? 31.194  67.114 26.918  1.00 56.95  ? 76   LEU A CA  1 
ATOM 581  C C   . LEU A 1 79   ? 30.459  66.003 27.605  1.00 56.95  ? 76   LEU A C   1 
ATOM 582  O O   . LEU A 1 79   ? 30.113  66.096 28.788  1.00 56.95  ? 76   LEU A O   1 
ATOM 583  C CB  . LEU A 1 79   ? 32.675  66.778 26.763  1.00 42.70  ? 76   LEU A CB  1 
ATOM 584  C CG  . LEU A 1 79   ? 33.501  67.712 25.851  1.00 42.70  ? 76   LEU A CG  1 
ATOM 585  C CD1 . LEU A 1 79   ? 34.950  67.267 25.849  1.00 42.70  ? 76   LEU A CD1 1 
ATOM 586  C CD2 . LEU A 1 79   ? 32.919  67.825 24.412  1.00 42.70  ? 76   LEU A CD2 1 
ATOM 587  N N   . LEU A 1 80   ? 30.217  64.944 26.848  1.00 43.64  ? 77   LEU A N   1 
ATOM 588  C CA  . LEU A 1 80   ? 29.424  63.816 27.347  1.00 43.64  ? 77   LEU A CA  1 
ATOM 589  C C   . LEU A 1 80   ? 30.292  62.594 27.558  1.00 43.64  ? 77   LEU A C   1 
ATOM 590  O O   . LEU A 1 80   ? 30.939  62.107 26.635  1.00 43.64  ? 77   LEU A O   1 
ATOM 591  C CB  . LEU A 1 80   ? 28.277  63.499 26.375  1.00 34.11  ? 77   LEU A CB  1 
ATOM 592  C CG  . LEU A 1 80   ? 27.261  62.442 26.847  1.00 34.11  ? 77   LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 80   ? 26.699  62.724 28.285  1.00 34.11  ? 77   LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 80   ? 26.156  62.233 25.814  1.00 34.11  ? 77   LEU A CD2 1 
ATOM 595  N N   . PHE A 1 81   ? 30.316  62.110 28.787  1.00 48.26  ? 78   PHE A N   1 
ATOM 596  C CA  . PHE A 1 81   ? 31.008  60.860 29.045  1.00 48.26  ? 78   PHE A CA  1 
ATOM 597  C C   . PHE A 1 81   ? 30.034  59.699 29.140  1.00 48.26  ? 78   PHE A C   1 
ATOM 598  O O   . PHE A 1 81   ? 29.010  59.789 29.808  1.00 48.26  ? 78   PHE A O   1 
ATOM 599  C CB  . PHE A 1 81   ? 31.809  60.910 30.321  1.00 33.19  ? 78   PHE A CB  1 
ATOM 600  C CG  . PHE A 1 81   ? 32.443  59.612 30.642  1.00 33.19  ? 78   PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 81   ? 33.430  59.081 29.793  1.00 33.19  ? 78   PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 81   ? 32.032  58.873 31.773  1.00 33.19  ? 78   PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 81   ? 34.050  57.845 30.085  1.00 33.19  ? 78   PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 81   ? 32.617  57.635 32.071  1.00 33.19  ? 78   PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 81   ? 33.642  57.114 31.232  1.00 33.19  ? 78   PHE A CZ  1 
ATOM 606  N N   . ILE A 1 82   ? 30.379  58.602 28.479  1.00 53.07  ? 79   ILE A N   1 
ATOM 607  C CA  . ILE A 1 82   ? 29.524  57.435 28.429  1.00 53.07  ? 79   ILE A CA  1 
ATOM 608  C C   . ILE A 1 82   ? 30.353  56.171 28.513  1.00 53.07  ? 79   ILE A C   1 
ATOM 609  O O   . ILE A 1 82   ? 31.451  56.089 27.960  1.00 53.07  ? 79   ILE A O   1 
ATOM 610  C CB  . ILE A 1 82   ? 28.687  57.417 27.169  1.00 41.83  ? 79   ILE A CB  1 
ATOM 611  C CG1 . ILE A 1 82   ? 27.552  58.423 27.297  1.00 41.83  ? 79   ILE A CG1 1 
ATOM 612  C CG2 . ILE A 1 82   ? 28.118  56.008 26.920  1.00 41.83  ? 79   ILE A CG2 1 
ATOM 613  C CD1 . ILE A 1 82   ? 26.268  58.000 26.602  1.00 41.83  ? 79   ILE A CD1 1 
ATOM 614  N N   . LEU A 1 83   ? 29.812  55.195 29.224  1.00 49.82  ? 80   LEU A N   1 
ATOM 615  C CA  . LEU A 1 83   ? 30.475  53.935 29.426  1.00 49.82  ? 80   LEU A CA  1 
ATOM 616  C C   . LEU A 1 83   ? 29.444  52.840 29.219  1.00 49.82  ? 80   LEU A C   1 
ATOM 617  O O   . LEU A 1 83   ? 28.414  52.852 29.876  1.00 49.82  ? 80   LEU A O   1 
ATOM 618  C CB  . LEU A 1 83   ? 31.045  53.859 30.854  1.00 33.21  ? 80   LEU A CB  1 
ATOM 619  C CG  . LEU A 1 83   ? 31.770  52.520 31.098  1.00 33.21  ? 80   LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 83   ? 32.962  52.404 30.141  1.00 33.21  ? 80   LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 83   ? 32.207  52.347 32.544  1.00 33.21  ? 80   LEU A CD2 1 
ATOM 622  N N   . THR A 1 84   ? 29.687  51.892 28.330  1.00 45.15  ? 81   THR A N   1 
ATOM 623  C CA  . THR A 1 84   ? 28.688  50.865 28.124  1.00 45.15  ? 81   THR A CA  1 
ATOM 624  C C   . THR A 1 84   ? 28.983  49.732 29.073  1.00 45.15  ? 81   THR A C   1 
ATOM 625  O O   . THR A 1 84   ? 30.081  49.668 29.649  1.00 45.15  ? 81   THR A O   1 
ATOM 626  C CB  . THR A 1 84   ? 28.716  50.326 26.705  1.00 34.64  ? 81   THR A CB  1 
ATOM 627  O OG1 . THR A 1 84   ? 29.881  49.538 26.541  1.00 34.64  ? 81   THR A OG1 1 
ATOM 628  C CG2 . THR A 1 84   ? 28.799  51.426 25.725  1.00 34.64  ? 81   THR A CG2 1 
ATOM 629  N N   . ALA A 1 85   ? 28.033  48.822 29.222  1.00 30.55  ? 82   ALA A N   1 
ATOM 630  C CA  . ALA A 1 85   ? 28.213  47.660 30.074  1.00 30.55  ? 82   ALA A CA  1 
ATOM 631  C C   . ALA A 1 85   ? 29.274  46.662 29.576  1.00 30.55  ? 82   ALA A C   1 
ATOM 632  O O   . ALA A 1 85   ? 29.729  45.789 30.353  1.00 30.55  ? 82   ALA A O   1 
ATOM 633  C CB  . ALA A 1 85   ? 26.922  46.941 30.250  1.00 8.84   ? 82   ALA A CB  1 
ATOM 634  N N   . LYS A 1 86   ? 29.653  46.735 28.303  1.00 71.93  ? 83   LYS A N   1 
ATOM 635  C CA  . LYS A 1 86   ? 30.723  45.873 27.816  1.00 71.93  ? 83   LYS A CA  1 
ATOM 636  C C   . LYS A 1 86   ? 32.035  46.600 27.890  1.00 71.93  ? 83   LYS A C   1 
ATOM 637  O O   . LYS A 1 86   ? 33.034  46.119 27.369  1.00 71.93  ? 83   LYS A O   1 
ATOM 638  C CB  . LYS A 1 86   ? 30.485  45.435 26.393  1.00 23.48  ? 83   LYS A CB  1 
ATOM 639  C CG  . LYS A 1 86   ? 29.368  44.445 26.172  1.00 23.48  ? 83   LYS A CG  1 
ATOM 640  C CD  . LYS A 1 86   ? 29.464  44.108 24.716  1.00 23.48  ? 83   LYS A CD  1 
ATOM 641  C CE  . LYS A 1 86   ? 28.330  43.275 24.202  1.00 23.48  ? 83   LYS A CE  1 
ATOM 642  N NZ  . LYS A 1 86   ? 28.667  41.819 24.284  1.00 23.48  ? 83   LYS A NZ  1 
ATOM 643  N N   . TYR A 1 87   ? 32.011  47.756 28.552  1.00 42.82  ? 84   TYR A N   1 
ATOM 644  C CA  . TYR A 1 87   ? 33.217  48.542 28.903  1.00 42.82  ? 84   TYR A CA  1 
ATOM 645  C C   . TYR A 1 87   ? 33.766  49.419 27.749  1.00 42.82  ? 84   TYR A C   1 
ATOM 646  O O   . TYR A 1 87   ? 34.954  49.688 27.699  1.00 42.82  ? 84   TYR A O   1 
ATOM 647  C CB  . TYR A 1 87   ? 34.312  47.670 29.577  1.00 45.94  ? 84   TYR A CB  1 
ATOM 648  C CG  . TYR A 1 87   ? 33.810  46.902 30.787  1.00 45.94  ? 84   TYR A CG  1 
ATOM 649  C CD1 . TYR A 1 87   ? 33.177  45.658 30.657  1.00 45.94  ? 84   TYR A CD1 1 
ATOM 650  C CD2 . TYR A 1 87   ? 33.946  47.417 32.052  1.00 45.94  ? 84   TYR A CD2 1 
ATOM 651  C CE1 . TYR A 1 87   ? 32.675  44.963 31.769  1.00 45.94  ? 84   TYR A CE1 1 
ATOM 652  C CE2 . TYR A 1 87   ? 33.467  46.731 33.174  1.00 45.94  ? 84   TYR A CE2 1 
ATOM 653  C CZ  . TYR A 1 87   ? 32.830  45.509 33.026  1.00 45.94  ? 84   TYR A CZ  1 
ATOM 654  O OH  . TYR A 1 87   ? 32.367  44.857 34.149  1.00 45.94  ? 84   TYR A OH  1 
ATOM 655  N N   . ASN A 1 88   ? 32.883  49.857 26.844  1.00 49.47  ? 85   ASN A N   1 
ATOM 656  C CA  . ASN A 1 88   ? 33.180  50.887 25.847  1.00 49.47  ? 85   ASN A CA  1 
ATOM 657  C C   . ASN A 1 88   ? 33.052  52.261 26.468  1.00 49.47  ? 85   ASN A C   1 
ATOM 658  O O   . ASN A 1 88   ? 31.995  52.651 26.929  1.00 49.47  ? 85   ASN A O   1 
ATOM 659  C CB  . ASN A 1 88   ? 32.231  50.810 24.639  1.00 47.01  ? 85   ASN A CB  1 
ATOM 660  C CG  . ASN A 1 88   ? 32.161  49.414 24.016  1.00 47.01  ? 85   ASN A CG  1 
ATOM 661  O OD1 . ASN A 1 88   ? 31.193  48.680 24.222  1.00 47.01  ? 85   ASN A OD1 1 
ATOM 662  N ND2 . ASN A 1 88   ? 33.196  49.037 23.270  1.00 47.01  ? 85   ASN A ND2 1 
ATOM 663  N N   . ALA A 1 89   ? 34.143  53.004 26.479  1.00 42.96  ? 86   ALA A N   1 
ATOM 664  C CA  . ALA A 1 89   ? 34.139  54.331 27.033  1.00 42.96  ? 86   ALA A CA  1 
ATOM 665  C C   . ALA A 1 89   ? 34.300  55.210 25.849  1.00 42.96  ? 86   ALA A C   1 
ATOM 666  O O   . ALA A 1 89   ? 34.991  54.824 24.917  1.00 42.96  ? 86   ALA A O   1 
ATOM 667  C CB  . ALA A 1 89   ? 35.308  54.498 27.957  1.00 54.60  ? 86   ALA A CB  1 
ATOM 668  N N   . CYS A 1 90   ? 33.644  56.370 25.859  1.00 43.99  ? 87   CYS A N   1 
ATOM 669  C CA  . CYS A 1 90   ? 33.905  57.448 24.879  1.00 43.99  ? 87   CYS A CA  1 
ATOM 670  C C   . CYS A 1 90   ? 33.494  58.802 25.432  1.00 43.99  ? 87   CYS A C   1 
ATOM 671  O O   . CYS A 1 90   ? 32.584  58.890 26.214  1.00 43.99  ? 87   CYS A O   1 
ATOM 672  C CB  . CYS A 1 90   ? 33.155  57.206 23.580  1.00 41.94  ? 87   CYS A CB  1 
ATOM 673  S SG  . CYS A 1 90   ? 31.397  57.129 23.858  1.00 41.94  ? 87   CYS A SG  1 
ATOM 674  N N   . ILE A 1 91   ? 34.184  59.851 25.027  1.00 52.51  ? 88   ILE A N   1 
ATOM 675  C CA  . ILE A 1 91   ? 33.710  61.209 25.234  1.00 52.51  ? 88   ILE A CA  1 
ATOM 676  C C   . ILE A 1 91   ? 32.960  61.694 23.973  1.00 52.51  ? 88   ILE A C   1 
ATOM 677  O O   . ILE A 1 91   ? 33.431  61.552 22.849  1.00 52.51  ? 88   ILE A O   1 
ATOM 678  C CB  . ILE A 1 91   ? 34.872  62.139 25.597  1.00 43.17  ? 88   ILE A CB  1 
ATOM 679  C CG1 . ILE A 1 91   ? 35.391  61.800 26.993  1.00 43.17  ? 88   ILE A CG1 1 
ATOM 680  C CG2 . ILE A 1 91   ? 34.464  63.601 25.512  1.00 43.17  ? 88   ILE A CG2 1 
ATOM 681  C CD1 . ILE A 1 91   ? 36.733  62.498 27.341  1.00 43.17  ? 88   ILE A CD1 1 
ATOM 682  N N   . LEU A 1 92   ? 31.779  62.248 24.165  1.00 41.81  ? 89   LEU A N   1 
ATOM 683  C CA  . LEU A 1 92   ? 30.969  62.658 23.037  1.00 41.81  ? 89   LEU A CA  1 
ATOM 684  C C   . LEU A 1 92   ? 30.737  64.161 23.048  1.00 41.81  ? 89   LEU A C   1 
ATOM 685  O O   . LEU A 1 92   ? 30.724  64.790 24.123  1.00 41.81  ? 89   LEU A O   1 
ATOM 686  C CB  . LEU A 1 92   ? 29.635  61.902 23.030  1.00 43.41  ? 89   LEU A CB  1 
ATOM 687  C CG  . LEU A 1 92   ? 29.653  60.372 22.790  1.00 43.41  ? 89   LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 92   ? 28.254  59.768 23.047  1.00 43.41  ? 89   LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 92   ? 30.150  59.951 21.388  1.00 43.41  ? 89   LEU A CD2 1 
ATOM 690  N N   . GLU A 1 93   ? 30.571  64.720 21.845  1.00 58.15  ? 90   GLU A N   1 
ATOM 691  C CA  . GLU A 1 93   ? 30.345  66.156 21.641  1.00 58.15  ? 90   GLU A CA  1 
ATOM 692  C C   . GLU A 1 93   ? 29.161  66.459 20.729  1.00 58.15  ? 90   GLU A C   1 
ATOM 693  O O   . GLU A 1 93   ? 28.894  65.748 19.758  1.00 58.15  ? 90   GLU A O   1 
ATOM 694  C CB  . GLU A 1 93   ? 31.605  66.811 21.068  1.00 67.30  ? 90   GLU A CB  1 
ATOM 695  C CG  . GLU A 1 93   ? 31.608  68.323 21.151  1.00 67.30  ? 90   GLU A CG  1 
ATOM 696  C CD  . GLU A 1 93   ? 32.615  68.982 20.222  1.00 67.30  ? 90   GLU A CD  1 
ATOM 697  O OE1 . GLU A 1 93   ? 33.534  68.309 19.704  1.00 67.30  ? 90   GLU A OE1 1 
ATOM 698  O OE2 . GLU A 1 93   ? 32.489  70.203 20.015  1.00 67.30  ? 90   GLU A OE2 1 
ATOM 699  N N   . TYR A 1 94   ? 28.476  67.546 21.046  1.00 71.62  ? 91   TYR A N   1 
ATOM 700  C CA  . TYR A 1 94   ? 27.364  68.029 20.240  1.00 71.62  ? 91   TYR A CA  1 
ATOM 701  C C   . TYR A 1 94   ? 27.805  69.094 19.238  1.00 71.62  ? 91   TYR A C   1 
ATOM 702  O O   . TYR A 1 94   ? 28.279  70.163 19.616  1.00 71.62  ? 91   TYR A O   1 
ATOM 703  C CB  . TYR A 1 94   ? 26.253  68.566 21.148  1.00 85.77  ? 91   TYR A CB  1 
ATOM 704  C CG  . TYR A 1 94   ? 24.974  68.845 20.417  1.00 85.77  ? 91   TYR A CG  1 
ATOM 705  C CD1 . TYR A 1 94   ? 23.952  67.910 20.387  1.00 85.77  ? 91   TYR A CD1 1 
ATOM 706  C CD2 . TYR A 1 94   ? 24.793  70.039 19.748  1.00 85.77  ? 91   TYR A CD2 1 
ATOM 707  C CE1 . TYR A 1 94   ? 22.784  68.163 19.716  1.00 85.77  ? 91   TYR A CE1 1 
ATOM 708  C CE2 . TYR A 1 94   ? 23.631  70.300 19.073  1.00 85.77  ? 91   TYR A CE2 1 
ATOM 709  C CZ  . TYR A 1 94   ? 22.629  69.362 19.054  1.00 85.77  ? 91   TYR A CZ  1 
ATOM 710  O OH  . TYR A 1 94   ? 21.476  69.639 18.355  1.00 85.77  ? 91   TYR A OH  1 
ATOM 711  N N   . LYS A 1 95   ? 27.645  68.789 17.959  1.00 52.75  ? 92   LYS A N   1 
ATOM 712  C CA  . LYS A 1 95   ? 28.057  69.706 16.882  1.00 52.75  ? 92   LYS A CA  1 
ATOM 713  C C   . LYS A 1 95   ? 26.909  69.944 15.921  1.00 52.75  ? 92   LYS A C   1 
ATOM 714  O O   . LYS A 1 95   ? 26.354  68.990 15.377  1.00 52.75  ? 92   LYS A O   1 
ATOM 715  C CB  . LYS A 1 95   ? 29.295  69.170 16.139  1.00 97.96  ? 92   LYS A CB  1 
ATOM 716  C CG  . LYS A 1 95   ? 30.014  70.194 15.231  1.00 97.96  ? 92   LYS A CG  1 
ATOM 717  C CD  . LYS A 1 95   ? 31.420  69.726 14.771  1.00 97.96  ? 92   LYS A CD  1 
ATOM 718  C CE  . LYS A 1 95   ? 32.533  70.095 15.780  1.00 97.96  ? 92   LYS A CE  1 
ATOM 719  N NZ  . LYS A 1 95   ? 33.935  69.870 15.285  1.00 97.96  ? 92   LYS A NZ  1 
ATOM 720  N N   . GLN A 1 96   ? 26.546  71.211 15.727  1.00 90.36  ? 93   GLN A N   1 
ATOM 721  C CA  . GLN A 1 96   ? 25.339  71.529 14.959  1.00 90.36  ? 93   GLN A CA  1 
ATOM 722  C C   . GLN A 1 96   ? 25.561  71.777 13.459  1.00 90.36  ? 93   GLN A C   1 
ATOM 723  O O   . GLN A 1 96   ? 24.697  71.431 12.640  1.00 90.36  ? 93   GLN A O   1 
ATOM 724  C CB  . GLN A 1 96   ? 24.488  72.630 15.617  1.00 94.59  ? 93   GLN A CB  1 
ATOM 725  C CG  . GLN A 1 96   ? 23.072  72.687 15.027  1.00 94.59  ? 93   GLN A CG  1 
ATOM 726  C CD  . GLN A 1 96   ? 22.011  73.151 16.007  1.00 94.59  ? 93   GLN A CD  1 
ATOM 727  O OE1 . GLN A 1 96   ? 21.906  74.342 16.326  1.00 94.59  ? 93   GLN A OE1 1 
ATOM 728  N NE2 . GLN A 1 96   ? 21.196  72.210 16.474  1.00 94.59  ? 93   GLN A NE2 1 
ATOM 729  N N   . SER A 1 97   ? 26.689  72.380 13.105  1.00 120.78 ? 94   SER A N   1 
ATOM 730  C CA  . SER A 1 97   ? 26.997  72.691 11.710  1.00 120.78 ? 94   SER A CA  1 
ATOM 731  C C   . SER A 1 97   ? 25.897  72.306 10.712  1.00 120.78 ? 94   SER A C   1 
ATOM 732  O O   . SER A 1 97   ? 25.678  71.127 10.435  1.00 120.78 ? 94   SER A O   1 
ATOM 733  C CB  . SER A 1 97   ? 28.320  72.036 11.301  1.00 90.15  ? 94   SER A CB  1 
ATOM 734  O OG  . SER A 1 97   ? 29.426  72.818 11.718  1.00 90.15  ? 94   SER A OG  1 
ATOM 735  N N   . GLY A 1 98   ? 25.222  73.318 10.171  1.00 67.25  ? 95   GLY A N   1 
ATOM 736  C CA  . GLY A 1 98   ? 24.268  73.150 9.068   1.00 67.25  ? 95   GLY A CA  1 
ATOM 737  C C   . GLY A 1 98   ? 22.944  73.271 9.789   1.00 67.25  ? 95   GLY A C   1 
ATOM 738  O O   . GLY A 1 98   ? 22.828  73.974 10.794  1.00 67.25  ? 95   GLY A O   1 
ATOM 739  N N   . GLU A 1 99   ? 21.931  72.610 9.247   1.00 123.44 ? 96   GLU A N   1 
ATOM 740  C CA  . GLU A 1 99   ? 20.683  72.419 9.966   1.00 123.44 ? 96   GLU A CA  1 
ATOM 741  C C   . GLU A 1 99   ? 20.581  70.949 10.353  1.00 123.44 ? 96   GLU A C   1 
ATOM 742  O O   . GLU A 1 99   ? 19.560  70.483 10.862  1.00 123.44 ? 96   GLU A O   1 
ATOM 743  C CB  . GLU A 1 99   ? 19.502  72.877 9.117   1.00 164.42 ? 96   GLU A CB  1 
ATOM 744  C CG  . GLU A 1 99   ? 19.249  74.369 9.235   1.00 164.42 ? 96   GLU A CG  1 
ATOM 745  C CD  . GLU A 1 99   ? 19.228  75.080 7.893   1.00 164.42 ? 96   GLU A CD  1 
ATOM 746  O OE1 . GLU A 1 99   ? 19.321  76.329 7.883   1.00 164.42 ? 96   GLU A OE1 1 
ATOM 747  O OE2 . GLU A 1 99   ? 19.127  74.395 6.850   1.00 164.42 ? 96   GLU A OE2 1 
ATOM 748  N N   . SER A 1 100  ? 21.676  70.236 10.113  1.00 83.58  ? 97   SER A N   1 
ATOM 749  C CA  . SER A 1 100  ? 21.803  68.828 10.438  1.00 83.58  ? 97   SER A CA  1 
ATOM 750  C C   . SER A 1 100  ? 22.719  68.672 11.660  1.00 83.58  ? 97   SER A C   1 
ATOM 751  O O   . SER A 1 100  ? 23.780  69.303 11.739  1.00 83.58  ? 97   SER A O   1 
ATOM 752  C CB  . SER A 1 100  ? 22.366  68.081 9.235   1.00 74.77  ? 97   SER A CB  1 
ATOM 753  O OG  . SER A 1 100  ? 23.567  68.693 8.820   1.00 74.77  ? 97   SER A OG  1 
ATOM 754  N N   . ILE A 1 101  ? 22.287  67.837 12.610  1.00 45.90  ? 98   ILE A N   1 
ATOM 755  C CA  . ILE A 1 101  ? 23.024  67.642 13.866  1.00 45.90  ? 98   ILE A CA  1 
ATOM 756  C C   . ILE A 1 101  ? 23.900  66.397 13.879  1.00 45.90  ? 98   ILE A C   1 
ATOM 757  O O   . ILE A 1 101  ? 23.519  65.368 13.337  1.00 45.90  ? 98   ILE A O   1 
ATOM 758  C CB  . ILE A 1 101  ? 22.081  67.548 15.066  1.00 48.26  ? 98   ILE A CB  1 
ATOM 759  C CG1 . ILE A 1 101  ? 21.093  68.726 15.082  1.00 48.26  ? 98   ILE A CG1 1 
ATOM 760  C CG2 . ILE A 1 101  ? 22.896  67.470 16.348  1.00 48.26  ? 98   ILE A CG2 1 
ATOM 761  C CD1 . ILE A 1 101  ? 19.851  68.481 14.221  1.00 48.26  ? 98   ILE A CD1 1 
ATOM 762  N N   . ASP A 1 102  ? 25.068  66.503 14.511  1.00 70.01  ? 99   ASP A N   1 
ATOM 763  C CA  . ASP A 1 102  ? 25.979  65.368 14.601  1.00 70.01  ? 99   ASP A CA  1 
ATOM 764  C C   . ASP A 1 102  ? 26.615  65.218 15.967  1.00 70.01  ? 99   ASP A C   1 
ATOM 765  O O   . ASP A 1 102  ? 27.101  66.181 16.550  1.00 70.01  ? 99   ASP A O   1 
ATOM 766  C CB  . ASP A 1 102  ? 27.034  65.416 13.496  1.00 90.07  ? 99   ASP A CB  1 
ATOM 767  C CG  . ASP A 1 102  ? 26.527  64.823 12.200  1.00 90.07  ? 99   ASP A CG  1 
ATOM 768  O OD1 . ASP A 1 102  ? 26.514  63.577 12.089  1.00 90.07  ? 99   ASP A OD1 1 
ATOM 769  O OD2 . ASP A 1 102  ? 26.131  65.598 11.300  1.00 90.07  ? 99   ASP A OD2 1 
ATOM 770  N N   . ILE A 1 103  ? 26.597  63.990 16.470  1.00 43.93  ? 100  ILE A N   1 
ATOM 771  C CA  . ILE A 1 103  ? 27.146  63.684 17.784  1.00 43.93  ? 100  ILE A CA  1 
ATOM 772  C C   . ILE A 1 103  ? 28.500  62.978 17.667  1.00 43.93  ? 100  ILE A C   1 
ATOM 773  O O   . ILE A 1 103  ? 28.589  61.756 17.439  1.00 43.93  ? 100  ILE A O   1 
ATOM 774  C CB  . ILE A 1 103  ? 26.127  62.912 18.629  1.00 51.46  ? 100  ILE A CB  1 
ATOM 775  C CG1 . ILE A 1 103  ? 24.990  63.865 18.956  1.00 51.46  ? 100  ILE A CG1 1 
ATOM 776  C CG2 . ILE A 1 103  ? 26.761  62.413 19.918  1.00 51.46  ? 100  ILE A CG2 1 
ATOM 777  C CD1 . ILE A 1 103  ? 23.843  63.204 19.532  1.00 51.46  ? 100  ILE A CD1 1 
ATOM 778  N N   . ILE A 1 104  ? 29.554  63.769 17.822  1.00 45.12  ? 101  ILE A N   1 
ATOM 779  C CA  . ILE A 1 104  ? 30.895  63.314 17.476  1.00 45.12  ? 101  ILE A CA  1 
ATOM 780  C C   . ILE A 1 104  ? 31.685  62.762 18.666  1.00 45.12  ? 101  ILE A C   1 
ATOM 781  O O   . ILE A 1 104  ? 31.527  63.210 19.817  1.00 45.12  ? 101  ILE A O   1 
ATOM 782  C CB  . ILE A 1 104  ? 31.704  64.384 16.658  1.00 66.83  ? 101  ILE A CB  1 
ATOM 783  C CG1 . ILE A 1 104  ? 33.106  63.864 16.326  1.00 66.83  ? 101  ILE A CG1 1 
ATOM 784  C CG2 . ILE A 1 104  ? 31.785  65.712 17.382  1.00 66.83  ? 101  ILE A CG2 1 
ATOM 785  C CD1 . ILE A 1 104  ? 33.132  62.489 15.569  1.00 66.83  ? 101  ILE A CD1 1 
ATOM 786  N N   . THR A 1 105  ? 32.512  61.765 18.356  1.00 50.16  ? 102  THR A N   1 
ATOM 787  C CA  . THR A 1 105  ? 33.406  61.133 19.303  1.00 50.16  ? 102  THR A CA  1 
ATOM 788  C C   . THR A 1 105  ? 34.735  61.865 19.350  1.00 50.16  ? 102  THR A C   1 
ATOM 789  O O   . THR A 1 105  ? 35.561  61.769 18.420  1.00 50.16  ? 102  THR A O   1 
ATOM 790  C CB  . THR A 1 105  ? 33.657  59.706 18.878  1.00 55.83  ? 102  THR A CB  1 
ATOM 791  O OG1 . THR A 1 105  ? 32.397  59.118 18.555  1.00 55.83  ? 102  THR A OG1 1 
ATOM 792  C CG2 . THR A 1 105  ? 34.341  58.906 19.980  1.00 55.83  ? 102  THR A CG2 1 
ATOM 793  N N   . ARG A 1 106  ? 34.911  62.600 20.441  1.00 50.49  ? 103  ARG A N   1 
ATOM 794  C CA  . ARG A 1 106  ? 36.165  63.199 20.794  1.00 50.49  ? 103  ARG A CA  1 
ATOM 795  C C   . ARG A 1 106  ? 37.215  62.147 21.101  1.00 50.49  ? 103  ARG A C   1 
ATOM 796  O O   . ARG A 1 106  ? 38.382  62.316 20.705  1.00 50.49  ? 103  ARG A O   1 
ATOM 797  C CB  . ARG A 1 106  ? 35.983  64.104 22.004  1.00 58.51  ? 103  ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106  ? 35.454  65.464 21.645  1.00 58.51  ? 103  ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106  ? 36.434  66.222 20.753  1.00 58.51  ? 103  ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106  ? 36.482  67.645 21.063  1.00 58.51  ? 103  ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106  ? 37.130  68.189 22.094  1.00 58.51  ? 103  ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106  ? 37.791  67.447 22.974  1.00 58.51  ? 103  ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106  ? 37.104  69.504 22.269  1.00 58.51  ? 103  ARG A NH2 1 
ATOM 804  N N   . ALA A 1 107  ? 36.815  61.080 21.811  1.00 58.07  ? 104  ALA A N   1 
ATOM 805  C CA  . ALA A 1 107  ? 37.745  60.029 22.255  1.00 58.07  ? 104  ALA A CA  1 
ATOM 806  C C   . ALA A 1 107  ? 37.026  58.774 22.675  1.00 58.07  ? 104  ALA A C   1 
ATOM 807  O O   . ALA A 1 107  ? 35.877  58.852 23.112  1.00 58.07  ? 104  ALA A O   1 
ATOM 808  C CB  . ALA A 1 107  ? 38.574  60.510 23.407  1.00 18.86  ? 104  ALA A CB  1 
ATOM 809  N N   . HIS A 1 108  ? 37.716  57.630 22.572  1.00 48.74  ? 105  HIS A N   1 
ATOM 810  C CA  . HIS A 1 108  ? 37.116  56.331 22.858  1.00 48.74  ? 105  HIS A CA  1 
ATOM 811  C C   . HIS A 1 108  ? 38.163  55.243 23.139  1.00 48.74  ? 105  HIS A C   1 
ATOM 812  O O   . HIS A 1 108  ? 39.341  55.409 22.858  1.00 48.74  ? 105  HIS A O   1 
ATOM 813  C CB  . HIS A 1 108  ? 36.211  55.910 21.709  1.00 53.76  ? 105  HIS A CB  1 
ATOM 814  C CG  . HIS A 1 108  ? 36.943  55.305 20.563  1.00 53.76  ? 105  HIS A CG  1 
ATOM 815  N ND1 . HIS A 1 108  ? 38.112  55.839 20.065  1.00 53.76  ? 105  HIS A ND1 1 
ATOM 816  C CD2 . HIS A 1 108  ? 36.678  54.207 19.813  1.00 53.76  ? 105  HIS A CD2 1 
ATOM 817  C CE1 . HIS A 1 108  ? 38.536  55.099 19.055  1.00 53.76  ? 105  HIS A CE1 1 
ATOM 818  N NE2 . HIS A 1 108  ? 37.687  54.100 18.884  1.00 53.76  ? 105  HIS A NE2 1 
ATOM 819  N N   . GLY A 1 109  ? 37.717  54.132 23.712  1.00 45.99  ? 106  GLY A N   1 
ATOM 820  C CA  . GLY A 1 109  ? 38.565  52.991 23.993  1.00 45.99  ? 106  GLY A CA  1 
ATOM 821  C C   . GLY A 1 109  ? 37.783  52.032 24.857  1.00 45.99  ? 106  GLY A C   1 
ATOM 822  O O   . GLY A 1 109  ? 36.790  52.425 25.477  1.00 45.99  ? 106  GLY A O   1 
ATOM 823  N N   . ASN A 1 110  ? 38.209  50.772 24.901  1.00 50.27  ? 107  ASN A N   1 
ATOM 824  C CA  . ASN A 1 110  ? 37.586  49.801 25.795  1.00 50.27  ? 107  ASN A CA  1 
ATOM 825  C C   . ASN A 1 110  ? 38.377  49.604 27.066  1.00 50.27  ? 107  ASN A C   1 
ATOM 826  O O   . ASN A 1 110  ? 39.551  49.222 27.019  1.00 50.27  ? 107  ASN A O   1 
ATOM 827  C CB  . ASN A 1 110  ? 37.401  48.450 25.130  1.00 32.75  ? 107  ASN A CB  1 
ATOM 828  C CG  . ASN A 1 110  ? 36.589  47.497 25.996  1.00 32.75  ? 107  ASN A CG  1 
ATOM 829  O OD1 . ASN A 1 110  ? 37.069  47.054 27.044  1.00 32.75  ? 107  ASN A OD1 1 
ATOM 830  N ND2 . ASN A 1 110  ? 35.342  47.211 25.590  1.00 32.75  ? 107  ASN A ND2 1 
ATOM 831  N N   . VAL A 1 111  ? 37.757  49.843 28.206  1.00 51.57  ? 108  VAL A N   1 
ATOM 832  C CA  . VAL A 1 111  ? 38.456  49.842 29.473  1.00 51.57  ? 108  VAL A CA  1 
ATOM 833  C C   . VAL A 1 111  ? 38.210  48.624 30.332  1.00 51.57  ? 108  VAL A C   1 
ATOM 834  O O   . VAL A 1 111  ? 38.073  48.737 31.520  1.00 51.57  ? 108  VAL A O   1 
ATOM 835  C CB  . VAL A 1 111  ? 38.070  51.041 30.286  1.00 41.28  ? 108  VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 111  ? 38.835  52.214 29.871  1.00 41.28  ? 108  VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 111  ? 36.655  51.295 30.127  1.00 41.28  ? 108  VAL A CG2 1 
ATOM 838  N N   . GLN A 1 112  ? 38.193  47.466 29.715  1.00 70.59  ? 109  GLN A N   1 
ATOM 839  C CA  . GLN A 1 112  ? 37.863  46.231 30.360  1.00 70.59  ? 109  GLN A CA  1 
ATOM 840  C C   . GLN A 1 112  ? 39.076  45.421 30.653  1.00 70.59  ? 109  GLN A C   1 
ATOM 841  O O   . GLN A 1 112  ? 39.983  45.353 29.852  1.00 70.59  ? 109  GLN A O   1 
ATOM 842  C CB  . GLN A 1 112  ? 37.021  45.428 29.414  1.00 79.00  ? 109  GLN A CB  1 
ATOM 843  C CG  . GLN A 1 112  ? 37.635  44.142 29.052  1.00 79.00  ? 109  GLN A CG  1 
ATOM 844  C CD  . GLN A 1 112  ? 37.236  43.701 27.695  1.00 79.00  ? 109  GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 112  ? 36.096  43.357 27.458  1.00 79.00  ? 109  GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 112  ? 38.175  43.708 26.783  1.00 79.00  ? 109  GLN A NE2 1 
ATOM 847  N N   . ASP A 1 113  ? 39.098  44.746 31.782  1.00 89.64  ? 110  ASP A N   1 
ATOM 848  C CA  . ASP A 1 113  ? 40.354  44.131 32.178  1.00 89.64  ? 110  ASP A CA  1 
ATOM 849  C C   . ASP A 1 113  ? 40.166  42.638 32.125  1.00 89.64  ? 110  ASP A C   1 
ATOM 850  O O   . ASP A 1 113  ? 39.045  42.160 32.299  1.00 89.64  ? 110  ASP A O   1 
ATOM 851  C CB  . ASP A 1 113  ? 40.721  44.545 33.593  1.00 63.82  ? 110  ASP A CB  1 
ATOM 852  C CG  . ASP A 1 113  ? 41.043  46.018 33.698  1.00 63.82  ? 110  ASP A CG  1 
ATOM 853  O OD1 . ASP A 1 113  ? 42.042  46.469 33.107  1.00 63.82  ? 110  ASP A OD1 1 
ATOM 854  O OD2 . ASP A 1 113  ? 40.293  46.740 34.372  1.00 63.82  ? 110  ASP A OD2 1 
ATOM 855  N N   . ARG A 1 114  ? 41.234  41.885 31.878  1.00 74.78  ? 111  ARG A N   1 
ATOM 856  C CA  . ARG A 1 114  ? 41.126  40.434 32.005  1.00 74.78  ? 111  ARG A CA  1 
ATOM 857  C C   . ARG A 1 114  ? 40.979  40.033 33.486  1.00 74.78  ? 111  ARG A C   1 
ATOM 858  O O   . ARG A 1 114  ? 40.049  39.312 33.838  1.00 74.78  ? 111  ARG A O   1 
ATOM 859  C CB  . ARG A 1 114  ? 42.289  39.720 31.313  1.00 120.70 ? 111  ARG A CB  1 
ATOM 860  C CG  . ARG A 1 114  ? 41.921  39.180 29.939  1.00 120.70 ? 111  ARG A CG  1 
ATOM 861  C CD  . ARG A 1 114  ? 42.113  40.209 28.839  1.00 120.70 ? 111  ARG A CD  1 
ATOM 862  N NE  . ARG A 1 114  ? 43.476  40.184 28.306  1.00 120.70 ? 111  ARG A NE  1 
ATOM 863  C CZ  . ARG A 1 114  ? 43.893  39.386 27.324  1.00 120.70 ? 111  ARG A CZ  1 
ATOM 864  N NH1 . ARG A 1 114  ? 43.058  38.526 26.752  1.00 120.70 ? 111  ARG A NH1 1 
ATOM 865  N NH2 . ARG A 1 114  ? 45.153  39.444 26.914  1.00 120.70 ? 111  ARG A NH2 1 
ATOM 866  N N   . ILE A 1 115  ? 41.875  40.519 34.350  1.00 136.96 ? 112  ILE A N   1 
ATOM 867  C CA  . ILE A 1 115  ? 41.694  40.332 35.796  1.00 136.96 ? 112  ILE A CA  1 
ATOM 868  C C   . ILE A 1 115  ? 40.543  41.199 36.300  1.00 136.96 ? 112  ILE A C   1 
ATOM 869  O O   . ILE A 1 115  ? 40.626  42.430 36.315  1.00 136.96 ? 112  ILE A O   1 
ATOM 870  C CB  . ILE A 1 115  ? 42.986  40.578 36.657  1.00 68.31  ? 112  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 115  ? 43.679  41.901 36.306  1.00 68.31  ? 112  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 115  ? 43.951  39.426 36.525  1.00 68.31  ? 112  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 115  ? 44.222  42.652 37.531  1.00 68.31  ? 112  ILE A CD1 1 
ATOM 874  N N   . GLY A 1 116  ? 39.456  40.550 36.689  1.00 52.71  ? 113  GLY A N   1 
ATOM 875  C CA  . GLY A 1 116  ? 38.273  41.277 37.214  1.00 52.71  ? 113  GLY A CA  1 
ATOM 876  C C   . GLY A 1 116  ? 36.966  40.521 37.504  1.00 52.71  ? 113  GLY A C   1 
ATOM 877  O O   . GLY A 1 116  ? 36.385  39.863 36.608  1.00 52.71  ? 113  GLY A O   1 
ATOM 878  N N   . ARG A 1 117  ? 36.505  40.643 38.757  1.00 61.60  ? 114  ARG A N   1 
ATOM 879  C CA  . ARG A 1 117  ? 35.187  40.126 39.191  1.00 61.60  ? 114  ARG A CA  1 
ATOM 880  C C   . ARG A 1 117  ? 34.207  41.279 39.380  1.00 61.60  ? 114  ARG A C   1 
ATOM 881  O O   . ARG A 1 117  ? 34.304  41.988 40.369  1.00 61.60  ? 114  ARG A O   1 
ATOM 882  C CB  . ARG A 1 117  ? 35.292  39.267 40.468  1.00 114.04 ? 114  ARG A CB  1 
ATOM 883  C CG  . ARG A 1 117  ? 36.047  39.912 41.640  1.00 114.04 ? 114  ARG A CG  1 
ATOM 884  C CD  . ARG A 1 117  ? 36.584  38.855 42.625  1.00 114.04 ? 114  ARG A CD  1 
ATOM 885  N NE  . ARG A 1 117  ? 37.455  39.403 43.680  1.00 114.04 ? 114  ARG A NE  1 
ATOM 886  C CZ  . ARG A 1 117  ? 38.792  39.353 43.688  1.00 114.04 ? 114  ARG A CZ  1 
ATOM 887  N NH1 . ARG A 1 117  ? 39.466  38.783 42.695  1.00 114.04 ? 114  ARG A NH1 1 
ATOM 888  N NH2 . ARG A 1 117  ? 39.465  39.879 44.703  1.00 114.04 ? 114  ARG A NH2 1 
ATOM 889  N N   . PRO A 1 118  ? 33.275  41.471 38.413  1.00 41.23  ? 115  PRO A N   1 
ATOM 890  C CA  . PRO A 1 118  ? 32.304  42.578 38.344  1.00 41.23  ? 115  PRO A CA  1 
ATOM 891  C C   . PRO A 1 118  ? 31.632  42.774 39.678  1.00 41.23  ? 115  PRO A C   1 
ATOM 892  O O   . PRO A 1 118  ? 30.800  41.963 40.007  1.00 41.23  ? 115  PRO A O   1 
ATOM 893  C CB  . PRO A 1 118  ? 31.252  42.059 37.350  1.00 41.12  ? 115  PRO A CB  1 
ATOM 894  C CG  . PRO A 1 118  ? 32.023  41.216 36.400  1.00 41.12  ? 115  PRO A CG  1 
ATOM 895  C CD  . PRO A 1 118  ? 33.111  40.554 37.264  1.00 41.12  ? 115  PRO A CD  1 
ATOM 896  N N   . SER A 1 119  ? 31.973  43.817 40.435  1.00 60.87  ? 116  SER A N   1 
ATOM 897  C CA  . SER A 1 119  ? 31.503  43.927 41.817  1.00 60.87  ? 116  SER A CA  1 
ATOM 898  C C   . SER A 1 119  ? 29.979  43.913 41.992  1.00 60.87  ? 116  SER A C   1 
ATOM 899  O O   . SER A 1 119  ? 29.229  43.990 41.016  1.00 60.87  ? 116  SER A O   1 
ATOM 900  C CB  . SER A 1 119  ? 32.114  45.145 42.512  1.00 57.05  ? 116  SER A CB  1 
ATOM 901  O OG  . SER A 1 119  ? 32.113  46.285 41.693  1.00 57.05  ? 116  SER A OG  1 
ATOM 902  N N   . GLU A 1 120  ? 29.529  43.759 43.234  1.00 120.65 ? 117  GLU A N   1 
ATOM 903  C CA  . GLU A 1 120  ? 28.129  43.970 43.591  1.00 120.65 ? 117  GLU A CA  1 
ATOM 904  C C   . GLU A 1 120  ? 27.903  45.477 43.493  1.00 120.65 ? 117  GLU A C   1 
ATOM 905  O O   . GLU A 1 120  ? 28.843  46.261 43.655  1.00 120.65 ? 117  GLU A O   1 
ATOM 906  C CB  . GLU A 1 120  ? 27.867  43.464 45.014  1.00 167.75 ? 117  GLU A CB  1 
ATOM 907  C CG  . GLU A 1 120  ? 26.419  43.556 45.505  1.00 167.75 ? 117  GLU A CG  1 
ATOM 908  C CD  . GLU A 1 120  ? 26.311  43.605 47.031  1.00 167.75 ? 117  GLU A CD  1 
ATOM 909  O OE1 . GLU A 1 120  ? 27.075  42.889 47.718  1.00 167.75 ? 117  GLU A OE1 1 
ATOM 910  O OE2 . GLU A 1 120  ? 25.458  44.364 47.546  1.00 167.75 ? 117  GLU A OE2 1 
ATOM 911  N N   . THR A 1 121  ? 26.665  45.875 43.229  1.00 52.47  ? 118  THR A N   1 
ATOM 912  C CA  . THR A 1 121  ? 26.315  47.279 42.902  1.00 52.47  ? 118  THR A CA  1 
ATOM 913  C C   . THR A 1 121  ? 26.869  47.800 41.566  1.00 52.47  ? 118  THR A C   1 
ATOM 914  O O   . THR A 1 121  ? 26.890  49.019 41.349  1.00 52.47  ? 118  THR A O   1 
ATOM 915  C CB  . THR A 1 121  ? 26.599  48.337 44.051  1.00 79.37  ? 118  THR A CB  1 
ATOM 916  O OG1 . THR A 1 121  ? 28.007  48.509 44.252  1.00 79.37  ? 118  THR A OG1 1 
ATOM 917  C CG2 . THR A 1 121  ? 25.888  47.969 45.374  1.00 79.37  ? 118  THR A CG2 1 
ATOM 918  N N   . GLY A 1 122  ? 27.298  46.884 40.688  1.00 62.37  ? 119  GLY A N   1 
ATOM 919  C CA  . GLY A 1 122  ? 27.752  47.193 39.319  1.00 62.37  ? 119  GLY A CA  1 
ATOM 920  C C   . GLY A 1 122  ? 28.760  48.317 39.119  1.00 62.37  ? 119  GLY A C   1 
ATOM 921  O O   . GLY A 1 122  ? 29.563  48.634 40.013  1.00 62.37  ? 119  GLY A O   1 
ATOM 922  N N   . ILE A 1 123  ? 28.706  48.931 37.935  1.00 31.84  ? 120  ILE A N   1 
ATOM 923  C CA  . ILE A 1 123  ? 29.686  49.944 37.502  1.00 31.84  ? 120  ILE A CA  1 
ATOM 924  C C   . ILE A 1 123  ? 29.400  51.326 38.079  1.00 31.84  ? 120  ILE A C   1 
ATOM 925  O O   . ILE A 1 123  ? 28.289  51.810 38.034  1.00 31.84  ? 120  ILE A O   1 
ATOM 926  C CB  . ILE A 1 123  ? 29.680  50.068 35.969  1.00 25.41  ? 120  ILE A CB  1 
ATOM 927  C CG1 . ILE A 1 123  ? 29.975  48.733 35.316  1.00 25.41  ? 120  ILE A CG1 1 
ATOM 928  C CG2 . ILE A 1 123  ? 30.703  51.086 35.479  1.00 25.41  ? 120  ILE A CG2 1 
ATOM 929  C CD1 . ILE A 1 123  ? 29.833  48.784 33.825  1.00 25.41  ? 120  ILE A CD1 1 
ATOM 930  N N   . ILE A 1 124  ? 30.403  51.986 38.614  1.00 47.53  ? 121  ILE A N   1 
ATOM 931  C CA  . ILE A 1 124  ? 30.213  53.362 39.036  1.00 47.53  ? 121  ILE A CA  1 
ATOM 932  C C   . ILE A 1 124  ? 31.205  54.190 38.243  1.00 47.53  ? 121  ILE A C   1 
ATOM 933  O O   . ILE A 1 124  ? 32.375  53.851 38.163  1.00 47.53  ? 121  ILE A O   1 
ATOM 934  C CB  . ILE A 1 124  ? 30.436  53.536 40.555  1.00 37.98  ? 121  ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 124  ? 29.382  52.740 41.339  1.00 37.98  ? 121  ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 124  ? 30.389  54.970 40.931  1.00 37.98  ? 121  ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 124  ? 29.731  52.492 42.892  1.00 37.98  ? 121  ILE A CD1 1 
ATOM 938  N N   . GLY A 1 125  ? 30.730  55.265 37.638  1.00 43.14  ? 122  GLY A N   1 
ATOM 939  C CA  . GLY A 1 125  ? 31.619  56.130 36.905  1.00 43.14  ? 122  GLY A CA  1 
ATOM 940  C C   . GLY A 1 125  ? 31.572  57.509 37.510  1.00 43.14  ? 122  GLY A C   1 
ATOM 941  O O   . GLY A 1 125  ? 30.554  58.187 37.403  1.00 43.14  ? 122  GLY A O   1 
ATOM 942  N N   . ILE A 1 126  ? 32.657  57.953 38.120  1.00 50.89  ? 123  ILE A N   1 
ATOM 943  C CA  . ILE A 1 126  ? 32.663  59.306 38.609  1.00 50.89  ? 123  ILE A CA  1 
ATOM 944  C C   . ILE A 1 126  ? 33.724  60.181 37.953  1.00 50.89  ? 123  ILE A C   1 
ATOM 945  O O   . ILE A 1 126  ? 34.750  59.664 37.466  1.00 50.89  ? 123  ILE A O   1 
ATOM 946  C CB  . ILE A 1 126  ? 32.784  59.339 40.108  1.00 34.38  ? 123  ILE A CB  1 
ATOM 947  C CG1 . ILE A 1 126  ? 34.086  58.673 40.556  1.00 34.38  ? 123  ILE A CG1 1 
ATOM 948  C CG2 . ILE A 1 126  ? 31.601  58.668 40.713  1.00 34.38  ? 123  ILE A CG2 1 
ATOM 949  C CD1 . ILE A 1 126  ? 34.181  58.553 42.028  1.00 34.38  ? 123  ILE A CD1 1 
ATOM 950  N N   . ILE A 1 127  ? 33.448  61.494 37.911  1.00 45.97  ? 124  ILE A N   1 
ATOM 951  C CA  . ILE A 1 127  ? 34.420  62.506 37.468  1.00 45.97  ? 124  ILE A CA  1 
ATOM 952  C C   . ILE A 1 127  ? 34.720  63.537 38.552  1.00 45.97  ? 124  ILE A C   1 
ATOM 953  O O   . ILE A 1 127  ? 33.801  64.099 39.160  1.00 45.97  ? 124  ILE A O   1 
ATOM 954  C CB  . ILE A 1 127  ? 33.943  63.240 36.236  1.00 38.50  ? 124  ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127  ? 34.082  62.348 35.024  1.00 38.50  ? 124  ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127  ? 34.799  64.444 35.963  1.00 38.50  ? 124  ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127  ? 32.957  62.542 34.029  1.00 38.50  ? 124  ILE A CD1 1 
ATOM 958  N N   . ASP A 1 128  ? 36.014  63.790 38.762  1.00 67.71  ? 125  ASP A N   1 
ATOM 959  C CA  . ASP A 1 128  ? 36.476  64.734 39.772  1.00 67.71  ? 125  ASP A CA  1 
ATOM 960  C C   . ASP A 1 128  ? 36.114  66.166 39.384  1.00 67.71  ? 125  ASP A C   1 
ATOM 961  O O   . ASP A 1 128  ? 36.032  66.490 38.193  1.00 67.71  ? 125  ASP A O   1 
ATOM 962  C CB  . ASP A 1 128  ? 37.981  64.575 40.017  1.00 77.10  ? 125  ASP A CB  1 
ATOM 963  C CG  . ASP A 1 128  ? 38.799  65.726 39.464  1.00 77.10  ? 125  ASP A CG  1 
ATOM 964  O OD1 . ASP A 1 128  ? 38.775  66.827 40.067  1.00 77.10  ? 125  ASP A OD1 1 
ATOM 965  O OD2 . ASP A 1 128  ? 39.491  65.518 38.443  1.00 77.10  ? 125  ASP A OD2 1 
ATOM 966  N N   . PRO A 1 129  ? 35.876  67.021 40.396  1.00 54.97  ? 126  PRO A N   1 
ATOM 967  C CA  . PRO A 1 129  ? 35.420  68.404 40.180  1.00 54.97  ? 126  PRO A CA  1 
ATOM 968  C C   . PRO A 1 129  ? 36.332  69.316 39.296  1.00 54.97  ? 126  PRO A C   1 
ATOM 969  O O   . PRO A 1 129  ? 35.836  70.253 38.639  1.00 54.97  ? 126  PRO A O   1 
ATOM 970  C CB  . PRO A 1 129  ? 35.285  68.946 41.611  1.00 71.42  ? 126  PRO A CB  1 
ATOM 971  C CG  . PRO A 1 129  ? 35.078  67.714 42.460  1.00 71.42  ? 126  PRO A CG  1 
ATOM 972  C CD  . PRO A 1 129  ? 35.980  66.701 41.836  1.00 71.42  ? 126  PRO A CD  1 
ATOM 973  N N   . GLU A 1 130  ? 37.638  69.048 39.282  1.00 68.04  ? 127  GLU A N   1 
ATOM 974  C CA  . GLU A 1 130  ? 38.550  69.850 38.469  1.00 68.04  ? 127  GLU A CA  1 
ATOM 975  C C   . GLU A 1 130  ? 38.787  69.255 37.069  1.00 68.04  ? 127  GLU A C   1 
ATOM 976  O O   . GLU A 1 130  ? 39.478  69.839 36.245  1.00 68.04  ? 127  GLU A O   1 
ATOM 977  C CB  . GLU A 1 130  ? 39.841  70.168 39.237  1.00 103.50 ? 127  GLU A CB  1 
ATOM 978  C CG  . GLU A 1 130  ? 39.678  71.362 40.203  1.00 103.50 ? 127  GLU A CG  1 
ATOM 979  C CD  . GLU A 1 130  ? 40.842  71.531 41.188  1.00 103.50 ? 127  GLU A CD  1 
ATOM 980  O OE1 . GLU A 1 130  ? 40.585  71.860 42.369  1.00 103.50 ? 127  GLU A OE1 1 
ATOM 981  O OE2 . GLU A 1 130  ? 42.012  71.337 40.794  1.00 103.50 ? 127  GLU A OE2 1 
ATOM 982  N N   . CYS A 1 131  ? 38.155  68.118 36.804  1.00 58.39  ? 128  CYS A N   1 
ATOM 983  C CA  . CYS A 1 131  ? 38.283  67.400 35.538  1.00 58.39  ? 128  CYS A CA  1 
ATOM 984  C C   . CYS A 1 131  ? 39.703  66.884 35.213  1.00 58.39  ? 128  CYS A C   1 
ATOM 985  O O   . CYS A 1 131  ? 40.105  66.785 34.049  1.00 58.39  ? 128  CYS A O   1 
ATOM 986  C CB  . CYS A 1 131  ? 37.697  68.201 34.375  1.00 67.51  ? 128  CYS A CB  1 
ATOM 987  S SG  . CYS A 1 131  ? 35.910  68.245 34.399  1.00 67.51  ? 128  CYS A SG  1 
ATOM 988  N N   . ARG A 1 132  ? 40.453  66.541 36.252  1.00 85.44  ? 129  ARG A N   1 
ATOM 989  C CA  . ARG A 1 132  ? 41.761  65.947 36.056  1.00 85.44  ? 129  ARG A CA  1 
ATOM 990  C C   . ARG A 1 132  ? 41.590  64.479 35.647  1.00 85.44  ? 129  ARG A C   1 
ATOM 991  O O   . ARG A 1 132  ? 42.376  63.944 34.850  1.00 85.44  ? 129  ARG A O   1 
ATOM 992  C CB  . ARG A 1 132  ? 42.634  66.116 37.312  1.00 92.29  ? 129  ARG A CB  1 
ATOM 993  C CG  . ARG A 1 132  ? 43.229  67.523 37.467  1.00 92.29  ? 129  ARG A CG  1 
ATOM 994  C CD  . ARG A 1 132  ? 43.793  67.803 38.872  1.00 92.29  ? 129  ARG A CD  1 
ATOM 995  N NE  . ARG A 1 132  ? 45.030  67.060 39.160  1.00 92.29  ? 129  ARG A NE  1 
ATOM 996  C CZ  . ARG A 1 132  ? 45.774  67.183 40.266  1.00 92.29  ? 129  ARG A CZ  1 
ATOM 997  N NH1 . ARG A 1 132  ? 45.445  68.042 41.235  1.00 92.29  ? 129  ARG A NH1 1 
ATOM 998  N NH2 . ARG A 1 132  ? 46.869  66.439 40.399  1.00 92.29  ? 129  ARG A NH2 1 
ATOM 999  N N   . MET A 1 133  ? 40.534  63.845 36.150  1.00 78.65  ? 130  MET A N   1 
ATOM 1000 C CA  . MET A 1 133  ? 40.387  62.409 35.971  1.00 78.65  ? 130  MET A CA  1 
ATOM 1001 C C   . MET A 1 133  ? 38.959  61.879 36.041  1.00 78.65  ? 130  MET A C   1 
ATOM 1002 O O   . MET A 1 133  ? 38.058  62.515 36.586  1.00 78.65  ? 130  MET A O   1 
ATOM 1003 C CB  . MET A 1 133  ? 41.200  61.692 37.034  1.00 53.19  ? 130  MET A CB  1 
ATOM 1004 C CG  . MET A 1 133  ? 40.558  61.821 38.365  1.00 53.19  ? 130  MET A CG  1 
ATOM 1005 S SD  . MET A 1 133  ? 41.384  60.861 39.580  1.00 53.19  ? 130  MET A SD  1 
ATOM 1006 C CE  . MET A 1 133  ? 42.916  61.786 39.687  1.00 53.19  ? 130  MET A CE  1 
ATOM 1007 N N   . ILE A 1 134  ? 38.782  60.685 35.497  1.00 44.74  ? 131  ILE A N   1 
ATOM 1008 C CA  . ILE A 1 134  ? 37.552  59.956 35.644  1.00 44.74  ? 131  ILE A CA  1 
ATOM 1009 C C   . ILE A 1 134  ? 37.862  58.709 36.458  1.00 44.74  ? 131  ILE A C   1 
ATOM 1010 O O   . ILE A 1 134  ? 38.822  57.967 36.162  1.00 44.74  ? 131  ILE A O   1 
ATOM 1011 C CB  . ILE A 1 134  ? 36.982  59.530 34.284  1.00 48.95  ? 131  ILE A CB  1 
ATOM 1012 C CG1 . ILE A 1 134  ? 36.537  60.744 33.486  1.00 48.95  ? 131  ILE A CG1 1 
ATOM 1013 C CG2 . ILE A 1 134  ? 35.820  58.542 34.460  1.00 48.95  ? 131  ILE A CG2 1 
ATOM 1014 C CD1 . ILE A 1 134  ? 36.018  60.375 32.105  1.00 48.95  ? 131  ILE A CD1 1 
ATOM 1015 N N   . GLY A 1 135  ? 37.040  58.484 37.476  1.00 52.64  ? 132  GLY A N   1 
ATOM 1016 C CA  . GLY A 1 135  ? 37.189  57.324 38.335  1.00 52.64  ? 132  GLY A CA  1 
ATOM 1017 C C   . GLY A 1 135  ? 36.165  56.273 37.986  1.00 52.64  ? 132  GLY A C   1 
ATOM 1018 O O   . GLY A 1 135  ? 34.984  56.588 37.778  1.00 52.64  ? 132  GLY A O   1 
ATOM 1019 N N   . LEU A 1 136  ? 36.630  55.031 37.916  1.00 43.75  ? 133  LEU A N   1 
ATOM 1020 C CA  . LEU A 1 136  ? 35.840  53.909 37.463  1.00 43.75  ? 133  LEU A CA  1 
ATOM 1021 C C   . LEU A 1 136  ? 35.951  52.818 38.505  1.00 43.75  ? 133  LEU A C   1 
ATOM 1022 O O   . LEU A 1 136  ? 37.052  52.477 38.905  1.00 43.75  ? 133  LEU A O   1 
ATOM 1023 C CB  . LEU A 1 136  ? 36.410  53.397 36.150  1.00 44.14  ? 133  LEU A CB  1 
ATOM 1024 C CG  . LEU A 1 136  ? 35.745  53.726 34.818  1.00 44.14  ? 133  LEU A CG  1 
ATOM 1025 C CD1 . LEU A 1 136  ? 35.374  55.202 34.710  1.00 44.14  ? 133  LEU A CD1 1 
ATOM 1026 C CD2 . LEU A 1 136  ? 36.617  53.286 33.649  1.00 44.14  ? 133  LEU A CD2 1 
ATOM 1027 N N   . ARG A 1 137  ? 34.826  52.294 38.982  1.00 42.09  ? 134  ARG A N   1 
ATOM 1028 C CA  . ARG A 1 137  ? 34.848  51.106 39.810  1.00 42.09  ? 134  ARG A CA  1 
ATOM 1029 C C   . ARG A 1 137  ? 34.146  50.006 39.045  1.00 42.09  ? 134  ARG A C   1 
ATOM 1030 O O   . ARG A 1 137  ? 32.916  49.917 39.072  1.00 42.09  ? 134  ARG A O   1 
ATOM 1031 C CB  . ARG A 1 137  ? 34.171  51.345 41.142  1.00 41.47  ? 134  ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 137  ? 34.500  50.307 42.235  1.00 41.47  ? 134  ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 137  ? 33.900  48.930 41.976  1.00 41.47  ? 134  ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 137  ? 32.436  48.906 42.006  1.00 41.47  ? 134  ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 137  ? 31.696  48.638 43.081  1.00 41.47  ? 134  ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 137  ? 32.237  48.349 44.273  1.00 41.47  ? 134  ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 137  ? 30.392  48.661 42.959  1.00 41.47  ? 134  ARG A NH2 1 
ATOM 1038 N N   . LEU A 1 138  ? 34.928  49.178 38.350  1.00 41.83  ? 135  LEU A N   1 
ATOM 1039 C CA  . LEU A 1 138  ? 34.364  48.086 37.566  1.00 41.83  ? 135  LEU A CA  1 
ATOM 1040 C C   . LEU A 1 138  ? 34.392  46.804 38.393  1.00 41.83  ? 135  LEU A C   1 
ATOM 1041 O O   . LEU A 1 138  ? 33.356  46.152 38.601  1.00 41.83  ? 135  LEU A O   1 
ATOM 1042 C CB  . LEU A 1 138  ? 35.097  47.922 36.221  1.00 35.32  ? 135  LEU A CB  1 
ATOM 1043 C CG  . LEU A 1 138  ? 35.477  49.193 35.421  1.00 35.32  ? 135  LEU A CG  1 
ATOM 1044 C CD1 . LEU A 1 138  ? 36.314  48.917 34.173  1.00 35.32  ? 135  LEU A CD1 1 
ATOM 1045 C CD2 . LEU A 1 138  ? 34.273  50.046 35.077  1.00 35.32  ? 135  LEU A CD2 1 
ATOM 1046 N N   . TYR A 1 139  ? 35.566  46.458 38.907  1.00 53.15  ? 136  TYR A N   1 
ATOM 1047 C CA  . TYR A 1 139  ? 35.688  45.232 39.669  1.00 53.15  ? 136  TYR A CA  1 
ATOM 1048 C C   . TYR A 1 139  ? 36.120  45.415 41.129  1.00 53.15  ? 136  TYR A C   1 
ATOM 1049 O O   . TYR A 1 139  ? 36.721  46.444 41.505  1.00 53.15  ? 136  TYR A O   1 
ATOM 1050 C CB  . TYR A 1 139  ? 36.687  44.347 38.963  1.00 56.31  ? 136  TYR A CB  1 
ATOM 1051 C CG  . TYR A 1 139  ? 36.650  44.412 37.456  1.00 56.31  ? 136  TYR A CG  1 
ATOM 1052 C CD1 . TYR A 1 139  ? 37.446  45.318 36.759  1.00 56.31  ? 136  TYR A CD1 1 
ATOM 1053 C CD2 . TYR A 1 139  ? 35.843  43.528 36.721  1.00 56.31  ? 136  TYR A CD2 1 
ATOM 1054 C CE1 . TYR A 1 139  ? 37.434  45.350 35.352  1.00 56.31  ? 136  TYR A CE1 1 
ATOM 1055 C CE2 . TYR A 1 139  ? 35.829  43.554 35.328  1.00 56.31  ? 136  TYR A CE2 1 
ATOM 1056 C CZ  . TYR A 1 139  ? 36.623  44.469 34.664  1.00 56.31  ? 136  TYR A CZ  1 
ATOM 1057 O OH  . TYR A 1 139  ? 36.594  44.494 33.313  1.00 56.31  ? 136  TYR A OH  1 
ATOM 1058 N N   . ASP A 1 140  ? 35.831  44.410 41.953  1.00 53.47  ? 137  ASP A N   1 
ATOM 1059 C CA  . ASP A 1 140  ? 36.325  44.418 43.333  1.00 53.47  ? 137  ASP A CA  1 
ATOM 1060 C C   . ASP A 1 140  ? 37.852  44.489 43.411  1.00 53.47  ? 137  ASP A C   1 
ATOM 1061 O O   . ASP A 1 140  ? 38.546  43.868 42.604  1.00 53.47  ? 137  ASP A O   1 
ATOM 1062 C CB  . ASP A 1 140  ? 35.838  43.193 44.092  1.00 59.84  ? 137  ASP A CB  1 
ATOM 1063 C CG  . ASP A 1 140  ? 34.359  43.242 44.378  1.00 59.84  ? 137  ASP A CG  1 
ATOM 1064 O OD1 . ASP A 1 140  ? 33.825  44.348 44.521  1.00 59.84  ? 137  ASP A OD1 1 
ATOM 1065 O OD2 . ASP A 1 140  ? 33.725  42.176 44.474  1.00 59.84  ? 137  ASP A OD2 1 
ATOM 1066 N N   . GLY A 1 141  ? 38.359  45.268 44.371  1.00 47.49  ? 138  GLY A N   1 
ATOM 1067 C CA  . GLY A 1 141  ? 39.790  45.343 44.681  1.00 47.49  ? 138  GLY A CA  1 
ATOM 1068 C C   . GLY A 1 141  ? 40.591  46.242 43.758  1.00 47.49  ? 138  GLY A C   1 
ATOM 1069 O O   . GLY A 1 141  ? 41.815  46.436 43.937  1.00 47.49  ? 138  GLY A O   1 
ATOM 1070 N N   . LEU A 1 142  ? 39.926  46.787 42.750  1.00 37.62  ? 139  LEU A N   1 
ATOM 1071 C CA  . LEU A 1 142  ? 40.609  47.672 41.844  1.00 37.62  ? 139  LEU A CA  1 
ATOM 1072 C C   . LEU A 1 142  ? 39.814  48.939 41.717  1.00 37.62  ? 139  LEU A C   1 
ATOM 1073 O O   . LEU A 1 142  ? 38.591  48.924 41.866  1.00 37.62  ? 139  LEU A O   1 
ATOM 1074 C CB  . LEU A 1 142  ? 40.815  47.014 40.468  1.00 32.90  ? 139  LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 142  ? 41.472  45.616 40.386  1.00 32.90  ? 139  LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 142  ? 41.297  44.952 39.026  1.00 32.90  ? 139  LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 142  ? 42.933  45.667 40.805  1.00 32.90  ? 139  LEU A CD2 1 
ATOM 1078 N N   . PHE A 1 143  ? 40.529  50.036 41.492  1.00 42.87  ? 140  PHE A N   1 
ATOM 1079 C CA  . PHE A 1 143  ? 39.963  51.315 41.105  1.00 42.87  ? 140  PHE A CA  1 
ATOM 1080 C C   . PHE A 1 143  ? 40.658  51.672 39.804  1.00 42.87  ? 140  PHE A C   1 
ATOM 1081 O O   . PHE A 1 143  ? 41.881  51.622 39.736  1.00 42.87  ? 140  PHE A O   1 
ATOM 1082 C CB  . PHE A 1 143  ? 40.283  52.345 42.184  1.00 38.93  ? 140  PHE A CB  1 
ATOM 1083 C CG  . PHE A 1 143  ? 39.642  53.671 41.954  1.00 38.93  ? 140  PHE A CG  1 
ATOM 1084 C CD1 . PHE A 1 143  ? 38.248  53.800 41.937  1.00 38.93  ? 140  PHE A CD1 1 
ATOM 1085 C CD2 . PHE A 1 143  ? 40.418  54.807 41.746  1.00 38.93  ? 140  PHE A CD2 1 
ATOM 1086 C CE1 . PHE A 1 143  ? 37.648  55.037 41.708  1.00 38.93  ? 140  PHE A CE1 1 
ATOM 1087 C CE2 . PHE A 1 143  ? 39.823  56.037 41.538  1.00 38.93  ? 140  PHE A CE2 1 
ATOM 1088 C CZ  . PHE A 1 143  ? 38.435  56.145 41.516  1.00 38.93  ? 140  PHE A CZ  1 
ATOM 1089 N N   . LYS A 1 144  ? 39.909  51.978 38.750  1.00 53.44  ? 141  LYS A N   1 
ATOM 1090 C CA  . LYS A 1 144  ? 40.534  52.338 37.469  1.00 53.44  ? 141  LYS A CA  1 
ATOM 1091 C C   . LYS A 1 144  ? 40.503  53.853 37.285  1.00 53.44  ? 141  LYS A C   1 
ATOM 1092 O O   . LYS A 1 144  ? 39.649  54.527 37.844  1.00 53.44  ? 141  LYS A O   1 
ATOM 1093 C CB  . LYS A 1 144  ? 39.846  51.628 36.293  1.00 31.16  ? 141  LYS A CB  1 
ATOM 1094 C CG  . LYS A 1 144  ? 40.686  51.641 34.965  1.00 31.16  ? 141  LYS A CG  1 
ATOM 1095 C CD  . LYS A 1 144  ? 39.970  50.885 33.850  1.00 31.16  ? 141  LYS A CD  1 
ATOM 1096 C CE  . LYS A 1 144  ? 40.943  49.931 33.173  1.00 31.16  ? 141  LYS A CE  1 
ATOM 1097 N NZ  . LYS A 1 144  ? 40.338  48.733 32.520  1.00 31.16  ? 141  LYS A NZ  1 
ATOM 1098 N N   . VAL A 1 145  ? 41.430  54.396 36.508  1.00 62.37  ? 142  VAL A N   1 
ATOM 1099 C CA  . VAL A 1 145  ? 41.561  55.845 36.389  1.00 62.37  ? 142  VAL A CA  1 
ATOM 1100 C C   . VAL A 1 145  ? 41.927  56.259 34.959  1.00 62.37  ? 142  VAL A C   1 
ATOM 1101 O O   . VAL A 1 145  ? 43.004  55.907 34.450  1.00 62.37  ? 142  VAL A O   1 
ATOM 1102 C CB  . VAL A 1 145  ? 42.627  56.350 37.385  1.00 49.32  ? 142  VAL A CB  1 
ATOM 1103 C CG1 . VAL A 1 145  ? 42.885  57.838 37.229  1.00 49.32  ? 142  VAL A CG1 1 
ATOM 1104 C CG2 . VAL A 1 145  ? 42.220  56.027 38.809  1.00 49.32  ? 142  VAL A CG2 1 
ATOM 1105 N N   . ILE A 1 146  ? 41.027  57.001 34.315  1.00 49.24  ? 143  ILE A N   1 
ATOM 1106 C CA  . ILE A 1 146  ? 41.292  57.565 32.970  1.00 49.24  ? 143  ILE A CA  1 
ATOM 1107 C C   . ILE A 1 146  ? 41.593  59.062 33.032  1.00 49.24  ? 143  ILE A C   1 
ATOM 1108 O O   . ILE A 1 146  ? 40.662  59.843 33.134  1.00 49.24  ? 143  ILE A O   1 
ATOM 1109 C CB  . ILE A 1 146  ? 40.083  57.403 32.017  1.00 36.69  ? 143  ILE A CB  1 
ATOM 1110 C CG1 . ILE A 1 146  ? 39.321  56.118 32.325  1.00 36.69  ? 143  ILE A CG1 1 
ATOM 1111 C CG2 . ILE A 1 146  ? 40.528  57.529 30.510  1.00 36.69  ? 143  ILE A CG2 1 
ATOM 1112 C CD1 . ILE A 1 146  ? 38.001  55.975 31.545  1.00 36.69  ? 143  ILE A CD1 1 
ATOM 1113 N N   . PRO A 1 147  ? 42.881  59.457 32.960  1.00 65.42  ? 144  PRO A N   1 
ATOM 1114 C CA  . PRO A 1 147  ? 43.328  60.867 33.086  1.00 65.42  ? 144  PRO A CA  1 
ATOM 1115 C C   . PRO A 1 147  ? 42.855  61.725 31.921  1.00 65.42  ? 144  PRO A C   1 
ATOM 1116 O O   . PRO A 1 147  ? 42.958  61.300 30.772  1.00 65.42  ? 144  PRO A O   1 
ATOM 1117 C CB  . PRO A 1 147  ? 44.859  60.774 33.045  1.00 48.07  ? 144  PRO A CB  1 
ATOM 1118 C CG  . PRO A 1 147  ? 45.186  59.341 33.239  1.00 48.07  ? 144  PRO A CG  1 
ATOM 1119 C CD  . PRO A 1 147  ? 44.012  58.548 32.728  1.00 48.07  ? 144  PRO A CD  1 
ATOM 1120 N N   . LEU A 1 148  ? 42.362  62.920 32.227  1.00 60.77  ? 145  LEU A N   1 
ATOM 1121 C CA  . LEU A 1 148  ? 41.687  63.755 31.243  1.00 60.77  ? 145  LEU A CA  1 
ATOM 1122 C C   . LEU A 1 148  ? 42.559  64.836 30.610  1.00 60.77  ? 145  LEU A C   1 
ATOM 1123 O O   . LEU A 1 148  ? 42.103  65.967 30.410  1.00 60.77  ? 145  LEU A O   1 
ATOM 1124 C CB  . LEU A 1 148  ? 40.464  64.415 31.872  1.00 67.67  ? 145  LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 148  ? 39.084  63.762 31.800  1.00 67.67  ? 145  LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 148  ? 39.063  62.451 32.508  1.00 67.67  ? 145  LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 148  ? 38.064  64.700 32.429  1.00 67.67  ? 145  LEU A CD2 1 
ATOM 1128 N N   . ASP A 1 149  ? 43.804  64.500 30.279  1.00 83.91  ? 146  ASP A N   1 
ATOM 1129 C CA  . ASP A 1 149  ? 44.644  65.433 29.534  1.00 83.91  ? 146  ASP A CA  1 
ATOM 1130 C C   . ASP A 1 149  ? 44.366  65.353 28.036  1.00 83.91  ? 146  ASP A C   1 
ATOM 1131 O O   . ASP A 1 149  ? 44.199  64.270 27.481  1.00 83.91  ? 146  ASP A O   1 
ATOM 1132 C CB  . ASP A 1 149  ? 46.133  65.252 29.859  1.00 88.86  ? 146  ASP A CB  1 
ATOM 1133 C CG  . ASP A 1 149  ? 46.567  63.814 29.817  1.00 88.86  ? 146  ASP A CG  1 
ATOM 1134 O OD1 . ASP A 1 149  ? 46.676  63.269 28.702  1.00 88.86  ? 146  ASP A OD1 1 
ATOM 1135 O OD2 . ASP A 1 149  ? 46.808  63.236 30.899  1.00 88.86  ? 146  ASP A OD2 1 
ATOM 1136 N N   . ARG A 1 150  ? 44.329  66.527 27.413  1.00 70.83  ? 147  ARG A N   1 
ATOM 1137 C CA  . ARG A 1 150  ? 43.924  66.745 26.024  1.00 70.83  ? 147  ARG A CA  1 
ATOM 1138 C C   . ARG A 1 150  ? 44.506  65.789 24.995  1.00 70.83  ? 147  ARG A C   1 
ATOM 1139 O O   . ARG A 1 150  ? 43.988  65.697 23.885  1.00 70.83  ? 147  ARG A O   1 
ATOM 1140 C CB  . ARG A 1 150  ? 44.223  68.191 25.618  1.00 169.52 ? 147  ARG A CB  1 
ATOM 1141 C CG  . ARG A 1 150  ? 43.095  69.175 25.896  1.00 169.52 ? 147  ARG A CG  1 
ATOM 1142 C CD  . ARG A 1 150  ? 42.001  69.050 24.847  1.00 169.52 ? 147  ARG A CD  1 
ATOM 1143 N NE  . ARG A 1 150  ? 41.422  70.344 24.488  1.00 169.52 ? 147  ARG A NE  1 
ATOM 1144 C CZ  . ARG A 1 150  ? 41.895  71.152 23.539  1.00 169.52 ? 147  ARG A CZ  1 
ATOM 1145 N NH1 . ARG A 1 150  ? 42.973  70.817 22.839  1.00 169.52 ? 147  ARG A NH1 1 
ATOM 1146 N NH2 . ARG A 1 150  ? 41.290  72.305 23.289  1.00 169.52 ? 147  ARG A NH2 1 
ATOM 1147 N N   . ASP A 1 151  ? 45.577  65.082 25.342  1.00 130.93 ? 148  ASP A N   1 
ATOM 1148 C CA  . ASP A 1 151  ? 46.010  63.945 24.534  1.00 130.93 ? 148  ASP A CA  1 
ATOM 1149 C C   . ASP A 1 151  ? 45.044  62.793 24.808  1.00 130.93 ? 148  ASP A C   1 
ATOM 1150 O O   . ASP A 1 151  ? 43.833  62.994 24.861  1.00 130.93 ? 148  ASP A O   1 
ATOM 1151 C CB  . ASP A 1 151  ? 47.459  63.560 24.853  1.00 168.75 ? 148  ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 151  ? 48.469  64.561 24.306  1.00 168.75 ? 148  ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 151  ? 48.164  65.253 23.311  1.00 168.75 ? 148  ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 151  ? 49.578  64.651 24.871  1.00 168.75 ? 148  ASP A OD2 1 
ATOM 1155 N N   . ASN A 1 152  ? 45.571  61.590 24.973  1.00 82.63  ? 149  ASN A N   1 
ATOM 1156 C CA  . ASN A 1 152  ? 44.780  60.462 25.471  1.00 82.63  ? 149  ASN A CA  1 
ATOM 1157 C C   . ASN A 1 152  ? 43.445  60.232 24.741  1.00 82.63  ? 149  ASN A C   1 
ATOM 1158 O O   . ASN A 1 152  ? 42.448  59.875 25.364  1.00 82.63  ? 149  ASN A O   1 
ATOM 1159 C CB  . ASN A 1 152  ? 44.572  60.611 26.991  1.00 56.58  ? 149  ASN A CB  1 
ATOM 1160 C CG  . ASN A 1 152  ? 44.020  59.338 27.654  1.00 56.58  ? 149  ASN A CG  1 
ATOM 1161 O OD1 . ASN A 1 152  ? 44.511  58.226 27.453  1.00 56.58  ? 149  ASN A OD1 1 
ATOM 1162 N ND2 . ASN A 1 152  ? 42.993  59.514 28.454  1.00 56.58  ? 149  ASN A ND2 1 
ATOM 1163 N N   . LYS A 1 153  ? 43.437  60.419 23.421  1.00 49.60  ? 150  LYS A N   1 
ATOM 1164 C CA  . LYS A 1 153  ? 42.215  60.257 22.623  1.00 49.60  ? 150  LYS A CA  1 
ATOM 1165 C C   . LYS A 1 153  ? 41.783  58.791 22.614  1.00 49.60  ? 150  LYS A C   1 
ATOM 1166 O O   . LYS A 1 153  ? 40.592  58.476 22.427  1.00 49.60  ? 150  LYS A O   1 
ATOM 1167 C CB  . LYS A 1 153  ? 42.391  60.784 21.194  1.00 76.27  ? 150  LYS A CB  1 
ATOM 1168 C CG  . LYS A 1 153  ? 42.516  62.300 21.073  1.00 76.27  ? 150  LYS A CG  1 
ATOM 1169 C CD  . LYS A 1 153  ? 42.438  62.726 19.608  1.00 76.27  ? 150  LYS A CD  1 
ATOM 1170 C CE  . LYS A 1 153  ? 43.001  64.129 19.368  1.00 76.27  ? 150  LYS A CE  1 
ATOM 1171 N NZ  . LYS A 1 153  ? 44.505  64.172 19.229  1.00 76.27  ? 150  LYS A NZ  1 
ATOM 1172 N N   . GLU A 1 154  ? 42.766  57.915 22.836  1.00 46.01  ? 151  GLU A N   1 
ATOM 1173 C CA  . GLU A 1 154  ? 42.542  56.479 23.008  1.00 46.01  ? 151  GLU A CA  1 
ATOM 1174 C C   . GLU A 1 154  ? 42.089  56.078 24.446  1.00 46.01  ? 151  GLU A C   1 
ATOM 1175 O O   . GLU A 1 154  ? 41.691  54.940 24.692  1.00 46.01  ? 151  GLU A O   1 
ATOM 1176 C CB  . GLU A 1 154  ? 43.775  55.686 22.552  1.00 86.13  ? 151  GLU A CB  1 
ATOM 1177 C CG  . GLU A 1 154  ? 44.048  55.811 21.047  1.00 86.13  ? 151  GLU A CG  1 
ATOM 1178 C CD  . GLU A 1 154  ? 45.227  54.982 20.571  1.00 86.13  ? 151  GLU A CD  1 
ATOM 1179 O OE1 . GLU A 1 154  ? 46.107  54.672 21.391  1.00 86.13  ? 151  GLU A OE1 1 
ATOM 1180 O OE2 . GLU A 1 154  ? 45.282  54.640 19.371  1.00 86.13  ? 151  GLU A OE2 1 
ATOM 1181 N N   . LEU A 1 155  ? 42.135  57.034 25.372  1.00 62.16  ? 152  LEU A N   1 
ATOM 1182 C CA  . LEU A 1 155  ? 41.613  56.866 26.730  1.00 62.16  ? 152  LEU A CA  1 
ATOM 1183 C C   . LEU A 1 155  ? 42.334  55.786 27.563  1.00 62.16  ? 152  LEU A C   1 
ATOM 1184 O O   . LEU A 1 155  ? 41.708  54.967 28.232  1.00 62.16  ? 152  LEU A O   1 
ATOM 1185 C CB  . LEU A 1 155  ? 40.076  56.697 26.711  1.00 46.35  ? 152  LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 155  ? 39.247  57.903 26.207  1.00 46.35  ? 152  LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 155  ? 37.749  57.641 26.323  1.00 46.35  ? 152  LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 155  ? 39.602  59.186 26.942  1.00 46.35  ? 152  LEU A CD2 1 
ATOM 1189 N N   . LYS A 1 156  ? 43.664  55.803 27.536  1.00 51.47  ? 153  LYS A N   1 
ATOM 1190 C CA  . LYS A 1 156  ? 44.451  54.848 28.304  1.00 51.47  ? 153  LYS A CA  1 
ATOM 1191 C C   . LYS A 1 156  ? 44.150  54.995 29.795  1.00 51.47  ? 153  LYS A C   1 
ATOM 1192 O O   . LYS A 1 156  ? 43.856  56.082 30.260  1.00 51.47  ? 153  LYS A O   1 
ATOM 1193 C CB  . LYS A 1 156  ? 45.938  55.031 28.025  1.00 73.76  ? 153  LYS A CB  1 
ATOM 1194 C CG  . LYS A 1 156  ? 46.382  54.518 26.664  1.00 73.76  ? 153  LYS A CG  1 
ATOM 1195 C CD  . LYS A 1 156  ? 46.322  55.618 25.593  1.00 73.76  ? 153  LYS A CD  1 
ATOM 1196 C CE  . LYS A 1 156  ? 47.239  55.287 24.393  1.00 73.76  ? 153  LYS A CE  1 
ATOM 1197 N NZ  . LYS A 1 156  ? 47.041  56.235 23.239  1.00 73.76  ? 153  LYS A NZ  1 
ATOM 1198 N N   . ALA A 1 157  ? 44.212  53.895 30.534  1.00 41.28  ? 154  ALA A N   1 
ATOM 1199 C CA  . ALA A 1 157  ? 43.927  53.907 31.959  1.00 41.28  ? 154  ALA A CA  1 
ATOM 1200 C C   . ALA A 1 157  ? 44.960  53.117 32.778  1.00 41.28  ? 154  ALA A C   1 
ATOM 1201 O O   . ALA A 1 157  ? 45.565  52.136 32.280  1.00 41.28  ? 154  ALA A O   1 
ATOM 1202 C CB  . ALA A 1 157  ? 42.561  53.306 32.187  1.00 29.94  ? 154  ALA A CB  1 
ATOM 1203 N N   . PHE A 1 158  ? 45.146  53.521 34.033  1.00 60.84  ? 155  PHE A N   1 
ATOM 1204 C CA  . PHE A 1 158  ? 45.779  52.641 35.009  1.00 60.84  ? 155  PHE A CA  1 
ATOM 1205 C C   . PHE A 1 158  ? 44.784  52.221 36.115  1.00 60.84  ? 155  PHE A C   1 
ATOM 1206 O O   . PHE A 1 158  ? 43.768  52.888 36.368  1.00 60.84  ? 155  PHE A O   1 
ATOM 1207 C CB  . PHE A 1 158  ? 47.076  53.255 35.572  1.00 61.83  ? 155  PHE A CB  1 
ATOM 1208 C CG  . PHE A 1 158  ? 46.864  54.495 36.393  1.00 61.83  ? 155  PHE A CG  1 
ATOM 1209 C CD1 . PHE A 1 158  ? 46.966  54.451 37.785  1.00 61.83  ? 155  PHE A CD1 1 
ATOM 1210 C CD2 . PHE A 1 158  ? 46.560  55.716 35.783  1.00 61.83  ? 155  PHE A CD2 1 
ATOM 1211 C CE1 . PHE A 1 158  ? 46.769  55.601 38.557  1.00 61.83  ? 155  PHE A CE1 1 
ATOM 1212 C CE2 . PHE A 1 158  ? 46.351  56.876 36.549  1.00 61.83  ? 155  PHE A CE2 1 
ATOM 1213 C CZ  . PHE A 1 158  ? 46.462  56.818 37.940  1.00 61.83  ? 155  PHE A CZ  1 
ATOM 1214 N N   . ASN A 1 159  ? 45.063  51.092 36.749  1.00 34.35  ? 156  ASN A N   1 
ATOM 1215 C CA  . ASN A 1 159  ? 44.320  50.654 37.924  1.00 34.35  ? 156  ASN A CA  1 
ATOM 1216 C C   . ASN A 1 159  ? 45.129  50.932 39.206  1.00 34.35  ? 156  ASN A C   1 
ATOM 1217 O O   . ASN A 1 159  ? 46.335  50.990 39.147  1.00 34.35  ? 156  ASN A O   1 
ATOM 1218 C CB  . ASN A 1 159  ? 44.013  49.160 37.816  1.00 82.59  ? 156  ASN A CB  1 
ATOM 1219 C CG  . ASN A 1 159  ? 42.906  48.866 36.842  1.00 82.59  ? 156  ASN A CG  1 
ATOM 1220 O OD1 . ASN A 1 159  ? 43.147  48.403 35.733  1.00 82.59  ? 156  ASN A OD1 1 
ATOM 1221 N ND2 . ASN A 1 159  ? 41.675  49.125 37.256  1.00 82.59  ? 156  ASN A ND2 1 
ATOM 1222 N N   . ILE A 1 160  ? 44.468  51.053 40.355  1.00 58.39  ? 157  ILE A N   1 
ATOM 1223 C CA  . ILE A 1 160  ? 45.167  51.268 41.611  1.00 58.39  ? 157  ILE A CA  1 
ATOM 1224 C C   . ILE A 1 160  ? 44.653  50.329 42.702  1.00 58.39  ? 157  ILE A C   1 
ATOM 1225 O O   . ILE A 1 160  ? 43.679  50.649 43.354  1.00 58.39  ? 157  ILE A O   1 
ATOM 1226 C CB  . ILE A 1 160  ? 44.973  52.720 42.094  1.00 28.92  ? 157  ILE A CB  1 
ATOM 1227 C CG1 . ILE A 1 160  ? 45.279  53.721 40.956  1.00 28.92  ? 157  ILE A CG1 1 
ATOM 1228 C CG2 . ILE A 1 160  ? 45.828  52.977 43.310  1.00 28.92  ? 157  ILE A CG2 1 
ATOM 1229 C CD1 . ILE A 1 160  ? 45.182  55.240 41.317  1.00 28.92  ? 157  ILE A CD1 1 
ATOM 1230 N N   . ARG A 1 161  ? 45.302  49.192 42.936  1.00 57.96  ? 158  ARG A N   1 
ATOM 1231 C CA  . ARG A 1 161  ? 44.790  48.222 43.928  1.00 57.96  ? 158  ARG A CA  1 
ATOM 1232 C C   . ARG A 1 161  ? 44.117  48.871 45.145  1.00 57.96  ? 158  ARG A C   1 
ATOM 1233 O O   . ARG A 1 161  ? 44.727  49.629 45.895  1.00 57.96  ? 158  ARG A O   1 
ATOM 1234 C CB  . ARG A 1 161  ? 45.861  47.223 44.388  1.00 84.59  ? 158  ARG A CB  1 
ATOM 1235 C CG  . ARG A 1 161  ? 45.367  46.287 45.501  1.00 84.59  ? 158  ARG A CG  1 
ATOM 1236 C CD  . ARG A 1 161  ? 46.443  45.338 45.995  1.00 84.59  ? 158  ARG A CD  1 
ATOM 1237 N NE  . ARG A 1 161  ? 47.652  46.052 46.425  1.00 84.59  ? 158  ARG A NE  1 
ATOM 1238 C CZ  . ARG A 1 161  ? 48.088  46.134 47.680  1.00 84.59  ? 158  ARG A CZ  1 
ATOM 1239 N NH1 . ARG A 1 161  ? 47.433  45.542 48.673  1.00 84.59  ? 158  ARG A NH1 1 
ATOM 1240 N NH2 . ARG A 1 161  ? 49.192  46.813 47.939  1.00 84.59  ? 158  ARG A NH2 1 
ATOM 1241 N N   . LEU A 1 162  ? 42.841  48.554 45.312  1.00 39.42  ? 159  LEU A N   1 
ATOM 1242 C CA  . LEU A 1 162  ? 42.013  49.125 46.359  1.00 39.42  ? 159  LEU A CA  1 
ATOM 1243 C C   . LEU A 1 162  ? 41.913  48.125 47.534  1.00 39.42  ? 159  LEU A C   1 
ATOM 1244 O O   . LEU A 1 162  ? 41.348  47.014 47.370  1.00 39.42  ? 159  LEU A O   1 
ATOM 1245 C CB  . LEU A 1 162  ? 40.638  49.427 45.766  1.00 63.93  ? 159  LEU A CB  1 
ATOM 1246 C CG  . LEU A 1 162  ? 39.525  50.134 46.529  1.00 63.93  ? 159  LEU A CG  1 
ATOM 1247 C CD1 . LEU A 1 162  ? 40.030  51.329 47.342  1.00 63.93  ? 159  LEU A CD1 1 
ATOM 1248 C CD2 . LEU A 1 162  ? 38.488  50.570 45.489  1.00 63.93  ? 159  LEU A CD2 1 
ATOM 1249 N N   . GLU A 1 163  ? 42.497  48.501 48.688  1.00 40.31  ? 160  GLU A N   1 
ATOM 1250 C CA  . GLU A 1 163  ? 42.583  47.593 49.850  1.00 40.31  ? 160  GLU A CA  1 
ATOM 1251 C C   . GLU A 1 163  ? 41.191  47.067 50.219  1.00 40.31  ? 160  GLU A C   1 
ATOM 1252 O O   . GLU A 1 163  ? 41.051  45.926 50.695  1.00 40.31  ? 160  GLU A O   1 
ATOM 1253 C CB  . GLU A 1 163  ? 43.231  48.282 51.050  1.00 111.18 ? 160  GLU A CB  1 
ATOM 1254 C CG  . GLU A 1 163  ? 43.776  47.318 52.104  1.00 111.18 ? 160  GLU A CG  1 
ATOM 1255 C CD  . GLU A 1 163  ? 45.060  46.626 51.664  1.00 111.18 ? 160  GLU A CD  1 
ATOM 1256 O OE1 . GLU A 1 163  ? 45.839  47.235 50.896  1.00 111.18 ? 160  GLU A OE1 1 
ATOM 1257 O OE2 . GLU A 1 163  ? 45.297  45.473 52.093  1.00 111.18 ? 160  GLU A OE2 1 
ATOM 1258 N N   . GLU A 1 164  ? 40.162  47.883 49.962  1.00 59.76  ? 161  GLU A N   1 
ATOM 1259 C CA  . GLU A 1 164  ? 38.801  47.535 50.373  1.00 59.76  ? 161  GLU A CA  1 
ATOM 1260 C C   . GLU A 1 164  ? 38.035  46.862 49.244  1.00 59.76  ? 161  GLU A C   1 
ATOM 1261 O O   . GLU A 1 164  ? 37.609  47.504 48.283  1.00 59.76  ? 161  GLU A O   1 
ATOM 1262 C CB  . GLU A 1 164  ? 38.051  48.759 50.885  1.00 61.62  ? 161  GLU A CB  1 
ATOM 1263 C CG  . GLU A 1 164  ? 38.636  49.363 52.158  1.00 61.62  ? 161  GLU A CG  1 
ATOM 1264 C CD  . GLU A 1 164  ? 39.888  50.205 51.926  1.00 61.62  ? 161  GLU A CD  1 
ATOM 1265 O OE1 . GLU A 1 164  ? 40.039  50.806 50.844  1.00 61.62  ? 161  GLU A OE1 1 
ATOM 1266 O OE2 . GLU A 1 164  ? 40.729  50.278 52.847  1.00 61.62  ? 161  GLU A OE2 1 
ATOM 1267 N N   . LEU A 1 165  ? 37.861  45.554 49.357  1.00 46.31  ? 162  LEU A N   1 
ATOM 1268 C CA  . LEU A 1 165  ? 37.215  44.805 48.283  1.00 46.31  ? 162  LEU A CA  1 
ATOM 1269 C C   . LEU A 1 165  ? 35.681  44.750 48.217  1.00 46.31  ? 162  LEU A C   1 
ATOM 1270 O O   . LEU A 1 165  ? 35.164  44.057 47.332  1.00 46.31  ? 162  LEU A O   1 
ATOM 1271 C CB  . LEU A 1 165  ? 37.850  43.406 48.100  1.00 58.81  ? 162  LEU A CB  1 
ATOM 1272 C CG  . LEU A 1 165  ? 38.282  42.583 49.306  1.00 58.81  ? 162  LEU A CG  1 
ATOM 1273 C CD1 . LEU A 1 165  ? 37.277  42.766 50.497  1.00 58.81  ? 162  LEU A CD1 1 
ATOM 1274 C CD2 . LEU A 1 165  ? 38.486  41.100 48.912  1.00 58.81  ? 162  LEU A CD2 1 
ATOM 1275 N N   . HIS A 1 166  ? 34.950  45.433 49.108  1.00 48.97  ? 163  HIS A N   1 
ATOM 1276 C CA  . HIS A 1 166  ? 33.457  45.515 48.969  1.00 48.97  ? 163  HIS A CA  1 
ATOM 1277 C C   . HIS A 1 166  ? 32.866  46.958 49.087  1.00 48.97  ? 163  HIS A C   1 
ATOM 1278 O O   . HIS A 1 166  ? 32.262  47.329 50.093  1.00 48.97  ? 163  HIS A O   1 
ATOM 1279 C CB  . HIS A 1 166  ? 32.754  44.522 49.914  1.00 71.08  ? 163  HIS A CB  1 
ATOM 1280 C CG  . HIS A 1 166  ? 31.264  44.415 49.714  1.00 71.08  ? 163  HIS A CG  1 
ATOM 1281 N ND1 . HIS A 1 166  ? 30.481  45.465 49.278  1.00 71.08  ? 163  HIS A ND1 1 
ATOM 1282 C CD2 . HIS A 1 166  ? 30.409  43.385 49.943  1.00 71.08  ? 163  HIS A CD2 1 
ATOM 1283 C CE1 . HIS A 1 166  ? 29.217  45.079 49.226  1.00 71.08  ? 163  HIS A CE1 1 
ATOM 1284 N NE2 . HIS A 1 166  ? 29.146  43.821 49.623  1.00 71.08  ? 163  HIS A NE2 1 
ATOM 1285 N N   . VAL A 1 167  ? 33.048  47.767 48.050  1.00 35.18  ? 164  VAL A N   1 
ATOM 1286 C CA  . VAL A 1 167  ? 32.529  49.132 48.070  1.00 35.18  ? 164  VAL A CA  1 
ATOM 1287 C C   . VAL A 1 167  ? 31.007  49.235 47.713  1.00 35.18  ? 164  VAL A C   1 
ATOM 1288 O O   . VAL A 1 167  ? 30.555  48.652 46.716  1.00 35.18  ? 164  VAL A O   1 
ATOM 1289 C CB  . VAL A 1 167  ? 33.380  50.062 47.157  1.00 49.88  ? 164  VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 167  ? 32.769  51.453 47.088  1.00 49.88  ? 164  VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 167  ? 34.826  50.132 47.663  1.00 49.88  ? 164  VAL A CG2 1 
ATOM 1292 N N   . ILE A 1 168  ? 30.254  49.983 48.526  1.00 44.16  ? 165  ILE A N   1 
ATOM 1293 C CA  . ILE A 1 168  ? 28.841  50.314 48.253  1.00 44.16  ? 165  ILE A CA  1 
ATOM 1294 C C   . ILE A 1 168  ? 28.647  51.501 47.268  1.00 44.16  ? 165  ILE A C   1 
ATOM 1295 O O   . ILE A 1 168  ? 27.952  51.348 46.255  1.00 44.16  ? 165  ILE A O   1 
ATOM 1296 C CB  . ILE A 1 168  ? 28.020  50.517 49.576  1.00 47.78  ? 165  ILE A CB  1 
ATOM 1297 C CG1 . ILE A 1 168  ? 27.584  49.161 50.113  1.00 47.78  ? 165  ILE A CG1 1 
ATOM 1298 C CG2 . ILE A 1 168  ? 26.740  51.307 49.350  1.00 47.78  ? 165  ILE A CG2 1 
ATOM 1299 C CD1 . ILE A 1 168  ? 28.596  48.493 50.995  1.00 47.78  ? 165  ILE A CD1 1 
ATOM 1300 N N   . ASP A 1 169  ? 29.258  52.653 47.556  1.00 42.02  ? 166  ASP A N   1 
ATOM 1301 C CA  . ASP A 1 169  ? 29.135  53.815 46.686  1.00 42.02  ? 166  ASP A CA  1 
ATOM 1302 C C   . ASP A 1 169  ? 30.359  54.710 46.850  1.00 42.02  ? 166  ASP A C   1 
ATOM 1303 O O   . ASP A 1 169  ? 30.991  54.703 47.907  1.00 42.02  ? 166  ASP A O   1 
ATOM 1304 C CB  . ASP A 1 169  ? 27.854  54.593 47.009  1.00 53.54  ? 166  ASP A CB  1 
ATOM 1305 C CG  . ASP A 1 169  ? 27.509  55.642 45.967  1.00 53.54  ? 166  ASP A CG  1 
ATOM 1306 O OD1 . ASP A 1 169  ? 28.071  55.624 44.844  1.00 53.54  ? 166  ASP A OD1 1 
ATOM 1307 O OD2 . ASP A 1 169  ? 26.646  56.485 46.273  1.00 53.54  ? 166  ASP A OD2 1 
ATOM 1308 N N   . VAL A 1 170  ? 30.704  55.467 45.810  1.00 60.31  ? 167  VAL A N   1 
ATOM 1309 C CA  . VAL A 1 170  ? 31.881  56.321 45.829  1.00 60.31  ? 167  VAL A CA  1 
ATOM 1310 C C   . VAL A 1 170  ? 31.547  57.624 45.132  1.00 60.31  ? 167  VAL A C   1 
ATOM 1311 O O   . VAL A 1 170  ? 30.755  57.621 44.170  1.00 60.31  ? 167  VAL A O   1 
ATOM 1312 C CB  . VAL A 1 170  ? 33.074  55.663 45.067  1.00 56.67  ? 167  VAL A CB  1 
ATOM 1313 C CG1 . VAL A 1 170  ? 34.318  56.554 45.096  1.00 56.67  ? 167  VAL A CG1 1 
ATOM 1314 C CG2 . VAL A 1 170  ? 33.420  54.313 45.654  1.00 56.67  ? 167  VAL A CG2 1 
ATOM 1315 N N   . LYS A 1 171  ? 32.151  58.720 45.613  1.00 51.45  ? 168  LYS A N   1 
ATOM 1316 C CA  . LYS A 1 171  ? 32.145  60.022 44.924  1.00 51.45  ? 168  LYS A CA  1 
ATOM 1317 C C   . LYS A 1 171  ? 33.493  60.704 45.057  1.00 51.45  ? 168  LYS A C   1 
ATOM 1318 O O   . LYS A 1 171  ? 34.187  60.469 46.050  1.00 51.45  ? 168  LYS A O   1 
ATOM 1319 C CB  . LYS A 1 171  ? 31.127  60.970 45.568  1.00 49.49  ? 168  LYS A CB  1 
ATOM 1320 C CG  . LYS A 1 171  ? 29.699  60.547 45.485  1.00 49.49  ? 168  LYS A CG  1 
ATOM 1321 C CD  . LYS A 1 171  ? 29.091  60.821 44.119  1.00 49.49  ? 168  LYS A CD  1 
ATOM 1322 C CE  . LYS A 1 171  ? 28.075  59.746 43.777  1.00 49.49  ? 168  LYS A CE  1 
ATOM 1323 N NZ  . LYS A 1 171  ? 27.477  59.046 44.971  1.00 49.49  ? 168  LYS A NZ  1 
ATOM 1324 N N   . PHE A 1 172  ? 33.850  61.570 44.101  1.00 52.28  ? 169  PHE A N   1 
ATOM 1325 C CA  . PHE A 1 172  ? 34.939  62.549 44.319  1.00 52.28  ? 169  PHE A CA  1 
ATOM 1326 C C   . PHE A 1 172  ? 34.448  63.718 45.201  1.00 52.28  ? 169  PHE A C   1 
ATOM 1327 O O   . PHE A 1 172  ? 33.339  64.237 44.982  1.00 52.28  ? 169  PHE A O   1 
ATOM 1328 C CB  . PHE A 1 172  ? 35.505  63.101 42.998  1.00 52.76  ? 169  PHE A CB  1 
ATOM 1329 C CG  . PHE A 1 172  ? 36.462  62.169 42.290  1.00 52.76  ? 169  PHE A CG  1 
ATOM 1330 C CD1 . PHE A 1 172  ? 36.070  61.495 41.133  1.00 52.76  ? 169  PHE A CD1 1 
ATOM 1331 C CD2 . PHE A 1 172  ? 37.761  61.987 42.753  1.00 52.76  ? 169  PHE A CD2 1 
ATOM 1332 C CE1 . PHE A 1 172  ? 36.967  60.618 40.441  1.00 52.76  ? 169  PHE A CE1 1 
ATOM 1333 C CE2 . PHE A 1 172  ? 38.660  61.143 42.091  1.00 52.76  ? 169  PHE A CE2 1 
ATOM 1334 C CZ  . PHE A 1 172  ? 38.266  60.444 40.928  1.00 52.76  ? 169  PHE A CZ  1 
ATOM 1335 N N   . LEU A 1 173  ? 35.265  64.115 46.193  1.00 48.56  ? 170  LEU A N   1 
ATOM 1336 C CA  . LEU A 1 173  ? 34.963  65.239 47.122  1.00 48.56  ? 170  LEU A CA  1 
ATOM 1337 C C   . LEU A 1 173  ? 35.225  66.617 46.500  1.00 48.56  ? 170  LEU A C   1 
ATOM 1338 O O   . LEU A 1 173  ? 36.265  66.829 45.844  1.00 48.56  ? 170  LEU A O   1 
ATOM 1339 C CB  . LEU A 1 173  ? 35.817  65.143 48.396  1.00 51.66  ? 170  LEU A CB  1 
ATOM 1340 C CG  . LEU A 1 173  ? 35.557  64.190 49.575  1.00 51.66  ? 170  LEU A CG  1 
ATOM 1341 C CD1 . LEU A 1 173  ? 34.541  64.738 50.540  1.00 51.66  ? 170  LEU A CD1 1 
ATOM 1342 C CD2 . LEU A 1 173  ? 35.109  62.845 49.073  1.00 51.66  ? 170  LEU A CD2 1 
ATOM 1343 N N   . TYR A 1 174  ? 34.304  67.556 46.724  1.00 68.86  ? 171  TYR A N   1 
ATOM 1344 C CA  . TYR A 1 174  ? 34.523  68.968 46.359  1.00 68.86  ? 171  TYR A CA  1 
ATOM 1345 C C   . TYR A 1 174  ? 35.492  69.646 47.329  1.00 68.86  ? 171  TYR A C   1 
ATOM 1346 O O   . TYR A 1 174  ? 35.801  69.095 48.396  1.00 68.86  ? 171  TYR A O   1 
ATOM 1347 C CB  . TYR A 1 174  ? 33.203  69.743 46.317  1.00 70.86  ? 171  TYR A CB  1 
ATOM 1348 C CG  . TYR A 1 174  ? 32.374  69.502 45.060  1.00 70.86  ? 171  TYR A CG  1 
ATOM 1349 C CD1 . TYR A 1 174  ? 31.236  68.677 45.080  1.00 70.86  ? 171  TYR A CD1 1 
ATOM 1350 C CD2 . TYR A 1 174  ? 32.722  70.107 43.853  1.00 70.86  ? 171  TYR A CD2 1 
ATOM 1351 C CE1 . TYR A 1 174  ? 30.476  68.474 43.922  1.00 70.86  ? 171  TYR A CE1 1 
ATOM 1352 C CE2 . TYR A 1 174  ? 31.971  69.906 42.697  1.00 70.86  ? 171  TYR A CE2 1 
ATOM 1353 C CZ  . TYR A 1 174  ? 30.856  69.093 42.734  1.00 70.86  ? 171  TYR A CZ  1 
ATOM 1354 O OH  . TYR A 1 174  ? 30.135  68.915 41.575  1.00 70.86  ? 171  TYR A OH  1 
ATOM 1355 N N   . GLY A 1 175  ? 35.984  70.823 46.937  1.00 79.52  ? 172  GLY A N   1 
ATOM 1356 C CA  . GLY A 1 175  ? 36.857  71.654 47.783  1.00 79.52  ? 172  GLY A CA  1 
ATOM 1357 C C   . GLY A 1 175  ? 38.070  70.915 48.317  1.00 79.52  ? 172  GLY A C   1 
ATOM 1358 O O   . GLY A 1 175  ? 38.359  70.947 49.528  1.00 79.52  ? 172  GLY A O   1 
ATOM 1359 N N   . CYS A 1 176  ? 38.761  70.242 47.400  1.00 105.21 ? 173  CYS A N   1 
ATOM 1360 C CA  . CYS A 1 176  ? 39.866  69.362 47.737  1.00 105.21 ? 173  CYS A CA  1 
ATOM 1361 C C   . CYS A 1 176  ? 41.106  69.725 46.939  1.00 105.21 ? 173  CYS A C   1 
ATOM 1362 O O   . CYS A 1 176  ? 41.019  70.032 45.742  1.00 105.21 ? 173  CYS A O   1 
ATOM 1363 C CB  . CYS A 1 176  ? 39.477  67.900 47.484  1.00 59.97  ? 173  CYS A CB  1 
ATOM 1364 S SG  . CYS A 1 176  ? 38.923  66.980 48.970  1.00 59.97  ? 173  CYS A SG  1 
ATOM 1365 N N   . GLN A 1 177  ? 42.260  69.680 47.604  1.00 91.86  ? 174  GLN A N   1 
ATOM 1366 C CA  . GLN A 1 177  ? 43.519  70.045 46.951  1.00 91.86  ? 174  GLN A CA  1 
ATOM 1367 C C   . GLN A 1 177  ? 44.011  69.008 45.953  1.00 91.86  ? 174  GLN A C   1 
ATOM 1368 O O   . GLN A 1 177  ? 44.263  69.325 44.784  1.00 91.86  ? 174  GLN A O   1 
ATOM 1369 C CB  . GLN A 1 177  ? 44.592  70.458 47.966  1.00 101.07 ? 174  GLN A CB  1 
ATOM 1370 C CG  . GLN A 1 177  ? 44.649  71.981 48.134  1.00 101.07 ? 174  GLN A CG  1 
ATOM 1371 C CD  . GLN A 1 177  ? 44.697  72.727 46.779  1.00 101.07 ? 174  GLN A CD  1 
ATOM 1372 O OE1 . GLN A 1 177  ? 45.735  72.768 46.110  1.00 101.07 ? 174  GLN A OE1 1 
ATOM 1373 N NE2 . GLN A 1 177  ? 43.568  73.318 46.382  1.00 101.07 ? 174  GLN A NE2 1 
ATOM 1374 N N   . ALA A 1 178  ? 44.123  67.768 46.405  1.00 86.77  ? 175  ALA A N   1 
ATOM 1375 C CA  . ALA A 1 178  ? 44.282  66.673 45.464  1.00 86.77  ? 175  ALA A CA  1 
ATOM 1376 C C   . ALA A 1 178  ? 42.948  65.958 45.261  1.00 86.77  ? 175  ALA A C   1 
ATOM 1377 O O   . ALA A 1 178  ? 42.121  65.900 46.181  1.00 86.77  ? 175  ALA A O   1 
ATOM 1378 C CB  . ALA A 1 178  ? 45.374  65.694 45.926  1.00 42.49  ? 175  ALA A CB  1 
ATOM 1379 N N   . PRO A 1 179  ? 42.714  65.452 44.040  1.00 64.99  ? 176  PRO A N   1 
ATOM 1380 C CA  . PRO A 1 179  ? 41.636  64.506 43.789  1.00 64.99  ? 176  PRO A CA  1 
ATOM 1381 C C   . PRO A 1 179  ? 41.464  63.564 44.984  1.00 64.99  ? 176  PRO A C   1 
ATOM 1382 O O   . PRO A 1 179  ? 42.390  62.831 45.331  1.00 64.99  ? 176  PRO A O   1 
ATOM 1383 C CB  . PRO A 1 179  ? 42.158  63.727 42.587  1.00 67.33  ? 176  PRO A CB  1 
ATOM 1384 C CG  . PRO A 1 179  ? 43.016  64.727 41.822  1.00 67.33  ? 176  PRO A CG  1 
ATOM 1385 C CD  . PRO A 1 179  ? 43.444  65.793 42.804  1.00 67.33  ? 176  PRO A CD  1 
ATOM 1386 N N   . THR A 1 180  ? 40.299  63.629 45.627  1.00 62.64  ? 177  THR A N   1 
ATOM 1387 C CA  . THR A 1 180  ? 39.976  62.766 46.764  1.00 62.64  ? 177  THR A CA  1 
ATOM 1388 C C   . THR A 1 180  ? 38.630  62.076 46.602  1.00 62.64  ? 177  THR A C   1 
ATOM 1389 O O   . THR A 1 180  ? 37.638  62.696 46.249  1.00 62.64  ? 177  THR A O   1 
ATOM 1390 C CB  . THR A 1 180  ? 40.002  63.538 48.085  1.00 65.30  ? 177  THR A CB  1 
ATOM 1391 O OG1 . THR A 1 180  ? 41.246  64.233 48.175  1.00 65.30  ? 177  THR A OG1 1 
ATOM 1392 C CG2 . THR A 1 180  ? 39.859  62.587 49.272  1.00 65.30  ? 177  THR A CG2 1 
ATOM 1393 N N   . ILE A 1 181  ? 38.645  60.779 46.872  1.00 68.38  ? 178  ILE A N   1 
ATOM 1394 C CA  . ILE A 1 181  ? 37.505  59.894 46.780  1.00 68.38  ? 178  ILE A CA  1 
ATOM 1395 C C   . ILE A 1 181  ? 36.856  59.861 48.141  1.00 68.38  ? 178  ILE A C   1 
ATOM 1396 O O   . ILE A 1 181  ? 37.486  60.203 49.147  1.00 68.38  ? 178  ILE A O   1 
ATOM 1397 C CB  . ILE A 1 181  ? 37.989  58.475 46.527  1.00 64.18  ? 178  ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 181  ? 38.468  58.286 45.113  1.00 64.18  ? 178  ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 181  ? 36.901  57.474 46.741  1.00 64.18  ? 178  ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 181  ? 39.038  56.924 44.993  1.00 64.18  ? 178  ILE A CD1 1 
ATOM 1401 N N   . CYS A 1 182  ? 35.603  59.427 48.172  1.00 58.34  ? 179  CYS A N   1 
ATOM 1402 C CA  . CYS A 1 182  ? 34.882  59.221 49.406  1.00 58.34  ? 179  CYS A CA  1 
ATOM 1403 C C   . CYS A 1 182  ? 33.883  58.109 49.184  1.00 58.34  ? 179  CYS A C   1 
ATOM 1404 O O   . CYS A 1 182  ? 33.081  58.155 48.249  1.00 58.34  ? 179  CYS A O   1 
ATOM 1405 C CB  . CYS A 1 182  ? 34.154  60.489 49.779  1.00 53.98  ? 179  CYS A CB  1 
ATOM 1406 S SG  . CYS A 1 182  ? 33.368  60.406 51.339  1.00 53.98  ? 179  CYS A SG  1 
ATOM 1407 N N   . PHE A 1 183  ? 33.913  57.108 50.045  1.00 40.86  ? 180  PHE A N   1 
ATOM 1408 C CA  . PHE A 1 183  ? 33.145  55.916 49.774  1.00 40.86  ? 180  PHE A CA  1 
ATOM 1409 C C   . PHE A 1 183  ? 32.803  55.153 51.025  1.00 40.86  ? 180  PHE A C   1 
ATOM 1410 O O   . PHE A 1 183  ? 33.579  55.132 51.996  1.00 40.86  ? 180  PHE A O   1 
ATOM 1411 C CB  . PHE A 1 183  ? 33.900  55.000 48.786  1.00 53.18  ? 180  PHE A CB  1 
ATOM 1412 C CG  . PHE A 1 183  ? 35.142  54.350 49.350  1.00 53.18  ? 180  PHE A CG  1 
ATOM 1413 C CD1 . PHE A 1 183  ? 35.091  53.057 49.870  1.00 53.18  ? 180  PHE A CD1 1 
ATOM 1414 C CD2 . PHE A 1 183  ? 36.359  55.022 49.345  1.00 53.18  ? 180  PHE A CD2 1 
ATOM 1415 C CE1 . PHE A 1 183  ? 36.236  52.455 50.381  1.00 53.18  ? 180  PHE A CE1 1 
ATOM 1416 C CE2 . PHE A 1 183  ? 37.517  54.435 49.856  1.00 53.18  ? 180  PHE A CE2 1 
ATOM 1417 C CZ  . PHE A 1 183  ? 37.466  53.158 50.370  1.00 53.18  ? 180  PHE A CZ  1 
ATOM 1418 N N   . VAL A 1 184  ? 31.654  54.499 50.991  1.00 48.74  ? 181  VAL A N   1 
ATOM 1419 C CA  . VAL A 1 184  ? 31.235  53.655 52.082  1.00 48.74  ? 181  VAL A CA  1 
ATOM 1420 C C   . VAL A 1 184  ? 31.564  52.248 51.649  1.00 48.74  ? 181  VAL A C   1 
ATOM 1421 O O   . VAL A 1 184  ? 31.370  51.909 50.476  1.00 48.74  ? 181  VAL A O   1 
ATOM 1422 C CB  . VAL A 1 184  ? 29.723  53.831 52.370  1.00 26.04  ? 181  VAL A CB  1 
ATOM 1423 C CG1 . VAL A 1 184  ? 29.192  52.768 53.318  1.00 26.04  ? 181  VAL A CG1 1 
ATOM 1424 C CG2 . VAL A 1 184  ? 29.427  55.257 52.945  1.00 26.04  ? 181  VAL A CG2 1 
ATOM 1425 N N   . TYR A 1 185  ? 32.084  51.438 52.572  1.00 79.38  ? 182  TYR A N   1 
ATOM 1426 C CA  . TYR A 1 185  ? 32.387  50.039 52.289  1.00 79.38  ? 182  TYR A CA  1 
ATOM 1427 C C   . TYR A 1 185  ? 31.958  49.118 53.408  1.00 79.38  ? 182  TYR A C   1 
ATOM 1428 O O   . TYR A 1 185  ? 31.761  49.553 54.536  1.00 79.38  ? 182  TYR A O   1 
ATOM 1429 C CB  . TYR A 1 185  ? 33.873  49.850 52.035  1.00 57.53  ? 182  TYR A CB  1 
ATOM 1430 C CG  . TYR A 1 185  ? 34.790  50.190 53.198  1.00 57.53  ? 182  TYR A CG  1 
ATOM 1431 C CD1 . TYR A 1 185  ? 35.313  49.190 54.033  1.00 57.53  ? 182  TYR A CD1 1 
ATOM 1432 C CD2 . TYR A 1 185  ? 35.170  51.503 53.430  1.00 57.53  ? 182  TYR A CD2 1 
ATOM 1433 C CE1 . TYR A 1 185  ? 36.188  49.508 55.084  1.00 57.53  ? 182  TYR A CE1 1 
ATOM 1434 C CE2 . TYR A 1 185  ? 36.016  51.838 54.458  1.00 57.53  ? 182  TYR A CE2 1 
ATOM 1435 C CZ  . TYR A 1 185  ? 36.535  50.855 55.283  1.00 57.53  ? 182  TYR A CZ  1 
ATOM 1436 O OH  . TYR A 1 185  ? 37.386  51.260 56.309  1.00 57.53  ? 182  TYR A OH  1 
ATOM 1437 N N   . GLN A 1 186  ? 31.838  47.836 53.093  1.00 86.61  ? 183  GLN A N   1 
ATOM 1438 C CA  . GLN A 1 186  ? 31.442  46.857 54.079  1.00 86.61  ? 183  GLN A CA  1 
ATOM 1439 C C   . GLN A 1 186  ? 32.531  45.800 54.244  1.00 86.61  ? 183  GLN A C   1 
ATOM 1440 O O   . GLN A 1 186  ? 33.138  45.359 53.265  1.00 86.61  ? 183  GLN A O   1 
ATOM 1441 C CB  . GLN A 1 186  ? 30.103  46.228 53.682  1.00 58.31  ? 183  GLN A CB  1 
ATOM 1442 C CG  . GLN A 1 186  ? 29.457  45.360 54.765  1.00 58.31  ? 183  GLN A CG  1 
ATOM 1443 C CD  . GLN A 1 186  ? 27.930  45.305 54.651  1.00 58.31  ? 183  GLN A CD  1 
ATOM 1444 O OE1 . GLN A 1 186  ? 27.375  44.806 53.649  1.00 58.31  ? 183  GLN A OE1 1 
ATOM 1445 N NE2 . GLN A 1 186  ? 27.232  45.820 55.692  1.00 58.31  ? 183  GLN A NE2 1 
ATOM 1446 N N   . ASP A 1 187  ? 32.792  45.443 55.501  1.00 68.93  ? 184  ASP A N   1 
ATOM 1447 C CA  . ASP A 1 187  ? 33.593  44.277 55.893  1.00 68.93  ? 184  ASP A CA  1 
ATOM 1448 C C   . ASP A 1 187  ? 32.801  43.667 57.042  1.00 68.93  ? 184  ASP A C   1 
ATOM 1449 O O   . ASP A 1 187  ? 31.646  44.057 57.250  1.00 68.93  ? 184  ASP A O   1 
ATOM 1450 C CB  . ASP A 1 187  ? 35.001  44.698 56.351  1.00 62.53  ? 184  ASP A CB  1 
ATOM 1451 C CG  . ASP A 1 187  ? 34.983  45.766 57.443  1.00 62.53  ? 184  ASP A CG  1 
ATOM 1452 O OD1 . ASP A 1 187  ? 33.909  46.092 57.984  1.00 62.53  ? 184  ASP A OD1 1 
ATOM 1453 O OD2 . ASP A 1 187  ? 36.057  46.296 57.772  1.00 62.53  ? 184  ASP A OD2 1 
ATOM 1454 N N   . PRO A 1 188  ? 33.430  42.786 57.814  1.00 114.63 ? 185  PRO A N   1 
ATOM 1455 C CA  . PRO A 1 188  ? 32.906  42.401 59.127  1.00 114.63 ? 185  PRO A CA  1 
ATOM 1456 C C   . PRO A 1 188  ? 33.196  43.558 60.076  1.00 114.63 ? 185  PRO A C   1 
ATOM 1457 O O   . PRO A 1 188  ? 34.174  44.269 59.847  1.00 114.63 ? 185  PRO A O   1 
ATOM 1458 C CB  . PRO A 1 188  ? 33.753  41.185 59.495  1.00 59.51  ? 185  PRO A CB  1 
ATOM 1459 C CG  . PRO A 1 188  ? 34.147  40.598 58.187  1.00 59.51  ? 185  PRO A CG  1 
ATOM 1460 C CD  . PRO A 1 188  ? 34.325  41.760 57.252  1.00 59.51  ? 185  PRO A CD  1 
ATOM 1461 N N   . GLN A 1 189  ? 32.377  43.769 61.103  1.00 124.56 ? 186  GLN A N   1 
ATOM 1462 C CA  . GLN A 1 189  ? 32.536  44.974 61.917  1.00 124.56 ? 186  GLN A CA  1 
ATOM 1463 C C   . GLN A 1 189  ? 31.539  46.059 61.476  1.00 124.56 ? 186  GLN A C   1 
ATOM 1464 O O   . GLN A 1 189  ? 31.314  47.031 62.198  1.00 124.56 ? 186  GLN A O   1 
ATOM 1465 C CB  . GLN A 1 189  ? 33.992  45.502 61.872  1.00 78.29  ? 186  GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 189  ? 35.081  44.534 62.449  1.00 78.29  ? 186  GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 189  ? 36.050  43.956 61.386  1.00 78.29  ? 186  GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 189  ? 36.839  44.688 60.759  1.00 78.29  ? 186  GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 189  ? 36.007  42.634 61.205  1.00 78.29  ? 186  GLN A NE2 1 
ATOM 1470 N N   . GLY A 1 190  ? 30.945  45.879 60.294  1.00 71.67  ? 187  GLY A N   1 
ATOM 1471 C CA  . GLY A 1 190  ? 29.893  46.762 59.778  1.00 71.67  ? 187  GLY A CA  1 
ATOM 1472 C C   . GLY A 1 190  ? 30.269  47.561 58.535  1.00 71.67  ? 187  GLY A C   1 
ATOM 1473 O O   . GLY A 1 190  ? 31.029  47.087 57.689  1.00 71.67  ? 187  GLY A O   1 
ATOM 1474 N N   . ARG A 1 191  ? 29.729  48.775 58.423  1.00 69.18  ? 188  ARG A N   1 
ATOM 1475 C CA  . ARG A 1 191  ? 30.064  49.668 57.316  1.00 69.18  ? 188  ARG A CA  1 
ATOM 1476 C C   . ARG A 1 191  ? 30.750  50.960 57.759  1.00 69.18  ? 188  ARG A C   1 
ATOM 1477 O O   . ARG A 1 191  ? 30.543  51.443 58.876  1.00 69.18  ? 188  ARG A O   1 
ATOM 1478 C CB  . ARG A 1 191  ? 28.824  49.993 56.496  1.00 60.49  ? 188  ARG A CB  1 
ATOM 1479 C CG  . ARG A 1 191  ? 28.378  48.857 55.621  1.00 60.49  ? 188  ARG A CG  1 
ATOM 1480 C CD  . ARG A 1 191  ? 27.170  49.219 54.768  1.00 60.49  ? 188  ARG A CD  1 
ATOM 1481 N NE  . ARG A 1 191  ? 26.742  48.065 53.985  1.00 60.49  ? 188  ARG A NE  1 
ATOM 1482 C CZ  . ARG A 1 191  ? 25.883  48.112 52.978  1.00 60.49  ? 188  ARG A CZ  1 
ATOM 1483 N NH1 . ARG A 1 191  ? 25.349  49.269 52.613  1.00 60.49  ? 188  ARG A NH1 1 
ATOM 1484 N NH2 . ARG A 1 191  ? 25.573  47.006 52.319  1.00 60.49  ? 188  ARG A NH2 1 
ATOM 1485 N N   . HIS A 1 192  ? 31.554  51.523 56.859  1.00 68.17  ? 189  HIS A N   1 
ATOM 1486 C CA  . HIS A 1 192  ? 32.412  52.656 57.173  1.00 68.17  ? 189  HIS A CA  1 
ATOM 1487 C C   . HIS A 1 192  ? 32.495  53.641 56.012  1.00 68.17  ? 189  HIS A C   1 
ATOM 1488 O O   . HIS A 1 192  ? 31.994  53.377 54.929  1.00 68.17  ? 189  HIS A O   1 
ATOM 1489 C CB  . HIS A 1 192  ? 33.826  52.155 57.478  1.00 79.67  ? 189  HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 192  ? 33.865  50.914 58.310  1.00 79.67  ? 189  HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 192  ? 33.905  50.945 59.687  1.00 79.67  ? 189  HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 192  ? 33.873  49.606 57.960  1.00 79.67  ? 189  HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 192  ? 33.943  49.708 60.150  1.00 79.67  ? 189  HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 192  ? 33.919  48.876 59.123  1.00 79.67  ? 189  HIS A NE2 1 
ATOM 1495 N N   . VAL A 1 193  ? 33.143  54.775 56.253  1.00 62.88  ? 190  VAL A N   1 
ATOM 1496 C CA  . VAL A 1 193  ? 33.581  55.663 55.197  1.00 62.88  ? 190  VAL A CA  1 
ATOM 1497 C C   . VAL A 1 193  ? 35.074  55.859 55.327  1.00 62.88  ? 190  VAL A C   1 
ATOM 1498 O O   . VAL A 1 193  ? 35.590  55.979 56.435  1.00 62.88  ? 190  VAL A O   1 
ATOM 1499 C CB  . VAL A 1 193  ? 32.934  57.055 55.269  1.00 69.26  ? 190  VAL A CB  1 
ATOM 1500 C CG1 . VAL A 1 193  ? 31.706  57.099 54.422  1.00 69.26  ? 190  VAL A CG1 1 
ATOM 1501 C CG2 . VAL A 1 193  ? 32.662  57.493 56.716  1.00 69.26  ? 190  VAL A CG2 1 
ATOM 1502 N N   . LYS A 1 194  ? 35.760  55.894 54.191  1.00 53.32  ? 191  LYS A N   1 
ATOM 1503 C CA  . LYS A 1 194  ? 37.179  56.101 54.168  1.00 53.32  ? 191  LYS A CA  1 
ATOM 1504 C C   . LYS A 1 194  ? 37.441  57.118 53.058  1.00 53.32  ? 191  LYS A C   1 
ATOM 1505 O O   . LYS A 1 194  ? 36.573  57.338 52.201  1.00 53.32  ? 191  LYS A O   1 
ATOM 1506 C CB  . LYS A 1 194  ? 37.905  54.775 53.915  1.00 64.47  ? 191  LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 194  ? 39.245  54.650 54.641  1.00 64.47  ? 191  LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 194  ? 40.066  53.380 54.270  1.00 64.47  ? 191  LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 194  ? 40.006  52.280 55.354  1.00 64.47  ? 191  LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 194  ? 40.436  52.715 56.745  1.00 64.47  ? 191  LYS A NZ  1 
ATOM 1511 N N   . THR A 1 195  ? 38.614  57.765 53.105  1.00 58.59  ? 192  THR A N   1 
ATOM 1512 C CA  . THR A 1 195  ? 39.027  58.683 52.049  1.00 58.59  ? 192  THR A CA  1 
ATOM 1513 C C   . THR A 1 195  ? 40.466  58.410 51.618  1.00 58.59  ? 192  THR A C   1 
ATOM 1514 O O   . THR A 1 195  ? 41.303  58.026 52.437  1.00 58.59  ? 192  THR A O   1 
ATOM 1515 C CB  . THR A 1 195  ? 38.873  60.153 52.461  1.00 51.31  ? 192  THR A CB  1 
ATOM 1516 O OG1 . THR A 1 195  ? 39.688  60.409 53.598  1.00 51.31  ? 192  THR A OG1 1 
ATOM 1517 C CG2 . THR A 1 195  ? 37.437  60.451 52.843  1.00 51.31  ? 192  THR A CG2 1 
ATOM 1518 N N   . TYR A 1 196  ? 40.722  58.568 50.322  1.00 52.99  ? 193  TYR A N   1 
ATOM 1519 C CA  . TYR A 1 196  ? 42.050  58.462 49.741  1.00 52.99  ? 193  TYR A CA  1 
ATOM 1520 C C   . TYR A 1 196  ? 42.171  59.627 48.817  1.00 52.99  ? 193  TYR A C   1 
ATOM 1521 O O   . TYR A 1 196  ? 41.171  60.042 48.227  1.00 52.99  ? 193  TYR A O   1 
ATOM 1522 C CB  . TYR A 1 196  ? 42.204  57.216 48.857  1.00 58.53  ? 193  TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 196  ? 42.155  55.900 49.567  1.00 58.53  ? 193  TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 196  ? 41.422  54.845 49.051  1.00 58.53  ? 193  TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 196  ? 42.846  55.706 50.761  1.00 58.53  ? 193  TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 196  ? 41.377  53.613 49.709  1.00 58.53  ? 193  TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 196  ? 42.794  54.497 51.430  1.00 58.53  ? 193  TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 196  ? 42.063  53.447 50.901  1.00 58.53  ? 193  TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 196  ? 42.006  52.251 51.597  1.00 58.53  ? 193  TYR A OH  1 
ATOM 1530 N N   . GLU A 1 197  ? 43.390  60.136 48.672  1.00 61.93  ? 194  GLU A N   1 
ATOM 1531 C CA  . GLU A 1 197  ? 43.687  61.106 47.640  1.00 61.93  ? 194  GLU A CA  1 
ATOM 1532 C C   . GLU A 1 197  ? 44.114  60.297 46.439  1.00 61.93  ? 194  GLU A C   1 
ATOM 1533 O O   . GLU A 1 197  ? 44.657  59.214 46.601  1.00 61.93  ? 194  GLU A O   1 
ATOM 1534 C CB  . GLU A 1 197  ? 44.833  62.021 48.058  1.00 87.06  ? 194  GLU A CB  1 
ATOM 1535 C CG  . GLU A 1 197  ? 44.685  62.642 49.423  1.00 87.06  ? 194  GLU A CG  1 
ATOM 1536 C CD  . GLU A 1 197  ? 45.479  63.921 49.560  1.00 87.06  ? 194  GLU A CD  1 
ATOM 1537 O OE1 . GLU A 1 197  ? 46.351  64.190 48.706  1.00 87.06  ? 194  GLU A OE1 1 
ATOM 1538 O OE2 . GLU A 1 197  ? 45.224  64.667 50.524  1.00 87.06  ? 194  GLU A OE2 1 
ATOM 1539 N N   . VAL A 1 198  ? 43.877  60.800 45.235  1.00 99.03  ? 195  VAL A N   1 
ATOM 1540 C CA  . VAL A 1 198  ? 44.377  60.108 44.051  1.00 99.03  ? 195  VAL A CA  1 
ATOM 1541 C C   . VAL A 1 198  ? 45.491  60.935 43.439  1.00 99.03  ? 195  VAL A C   1 
ATOM 1542 O O   . VAL A 1 198  ? 45.264  62.070 43.023  1.00 99.03  ? 195  VAL A O   1 
ATOM 1543 C CB  . VAL A 1 198  ? 43.271  59.799 43.005  1.00 58.72  ? 195  VAL A CB  1 
ATOM 1544 C CG1 . VAL A 1 198  ? 43.773  58.831 41.951  1.00 58.72  ? 195  VAL A CG1 1 
ATOM 1545 C CG2 . VAL A 1 198  ? 42.083  59.200 43.665  1.00 58.72  ? 195  VAL A CG2 1 
ATOM 1546 N N   . SER A 1 199  ? 46.695  60.361 43.432  1.00 73.21  ? 196  SER A N   1 
ATOM 1547 C CA  . SER A 1 199  ? 47.862  60.957 42.784  1.00 73.21  ? 196  SER A CA  1 
ATOM 1548 C C   . SER A 1 199  ? 48.162  60.197 41.499  1.00 73.21  ? 196  SER A C   1 
ATOM 1549 O O   . SER A 1 199  ? 48.378  58.978 41.527  1.00 73.21  ? 196  SER A O   1 
ATOM 1550 C CB  . SER A 1 199  ? 49.080  60.941 43.711  1.00 147.29 ? 196  SER A CB  1 
ATOM 1551 O OG  . SER A 1 199  ? 50.235  61.395 43.028  1.00 147.29 ? 196  SER A OG  1 
ATOM 1552 N N   . LEU A 1 200  ? 48.155  60.916 40.378  1.00 90.65  ? 197  LEU A N   1 
ATOM 1553 C CA  . LEU A 1 200  ? 48.310  60.288 39.062  1.00 90.65  ? 197  LEU A CA  1 
ATOM 1554 C C   . LEU A 1 200  ? 49.739  60.257 38.536  1.00 90.65  ? 197  LEU A C   1 
ATOM 1555 O O   . LEU A 1 200  ? 50.077  59.456 37.665  1.00 90.65  ? 197  LEU A O   1 
ATOM 1556 C CB  . LEU A 1 200  ? 47.325  60.848 38.025  1.00 72.75  ? 197  LEU A CB  1 
ATOM 1557 C CG  . LEU A 1 200  ? 46.918  62.300 37.804  1.00 72.75  ? 197  LEU A CG  1 
ATOM 1558 C CD1 . LEU A 1 200  ? 45.647  62.262 36.994  1.00 72.75  ? 197  LEU A CD1 1 
ATOM 1559 C CD2 . LEU A 1 200  ? 46.704  63.072 39.116  1.00 72.75  ? 197  LEU A CD2 1 
ATOM 1560 N N   . ARG A 1 201  ? 50.573  61.132 39.080  1.00 74.44  ? 198  ARG A N   1 
ATOM 1561 C CA  . ARG A 1 201  ? 52.007  61.012 38.898  1.00 74.44  ? 198  ARG A CA  1 
ATOM 1562 C C   . ARG A 1 201  ? 52.416  59.675 39.510  1.00 74.44  ? 198  ARG A C   1 
ATOM 1563 O O   . ARG A 1 201  ? 53.190  58.912 38.939  1.00 74.44  ? 198  ARG A O   1 
ATOM 1564 C CB  . ARG A 1 201  ? 52.727  62.154 39.623  1.00 131.91 ? 198  ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 201  ? 53.997  62.652 38.934  1.00 131.91 ? 198  ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 201  ? 53.813  64.040 38.303  1.00 131.91 ? 198  ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 201  ? 52.657  64.115 37.407  1.00 131.91 ? 198  ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 201  ? 52.334  65.176 36.668  1.00 131.91 ? 198  ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 201  ? 53.075  66.275 36.699  1.00 131.91 ? 198  ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 201  ? 51.260  65.138 35.892  1.00 131.91 ? 198  ARG A NH2 1 
ATOM 1571 N N   . GLU A 1 202  ? 51.847  59.396 40.669  1.00 56.07  ? 199  GLU A N   1 
ATOM 1572 C CA  . GLU A 1 202  ? 52.255  58.258 41.476  1.00 56.07  ? 199  GLU A CA  1 
ATOM 1573 C C   . GLU A 1 202  ? 51.539  56.936 41.153  1.00 56.07  ? 199  GLU A C   1 
ATOM 1574 O O   . GLU A 1 202  ? 52.117  55.857 41.310  1.00 56.07  ? 199  GLU A O   1 
ATOM 1575 C CB  . GLU A 1 202  ? 52.112  58.595 42.974  1.00 105.63 ? 199  GLU A CB  1 
ATOM 1576 C CG  . GLU A 1 202  ? 52.888  59.835 43.464  1.00 105.63 ? 199  GLU A CG  1 
ATOM 1577 C CD  . GLU A 1 202  ? 54.249  60.032 42.784  1.00 105.63 ? 199  GLU A CD  1 
ATOM 1578 O OE1 . GLU A 1 202  ? 54.588  61.196 42.455  1.00 105.63 ? 199  GLU A OE1 1 
ATOM 1579 O OE2 . GLU A 1 202  ? 54.973  59.028 42.570  1.00 105.63 ? 199  GLU A OE2 1 
ATOM 1580 N N   . LYS A 1 203  ? 50.290  57.017 40.705  1.00 57.86  ? 200  LYS A N   1 
ATOM 1581 C CA  . LYS A 1 203  ? 49.465  55.828 40.563  1.00 57.86  ? 200  LYS A CA  1 
ATOM 1582 C C   . LYS A 1 203  ? 49.292  55.111 41.907  1.00 57.86  ? 200  LYS A C   1 
ATOM 1583 O O   . LYS A 1 203  ? 49.087  53.900 41.963  1.00 57.86  ? 200  LYS A O   1 
ATOM 1584 C CB  . LYS A 1 203  ? 50.054  54.892 39.505  1.00 61.11  ? 200  LYS A CB  1 
ATOM 1585 C CG  . LYS A 1 203  ? 50.330  55.586 38.189  1.00 61.11  ? 200  LYS A CG  1 
ATOM 1586 C CD  . LYS A 1 203  ? 50.882  54.623 37.195  1.00 61.11  ? 200  LYS A CD  1 
ATOM 1587 C CE  . LYS A 1 203  ? 50.574  55.111 35.812  1.00 61.11  ? 200  LYS A CE  1 
ATOM 1588 N NZ  . LYS A 1 203  ? 51.059  54.152 34.798  1.00 61.11  ? 200  LYS A NZ  1 
ATOM 1589 N N   . GLU A 1 204  ? 49.371  55.878 42.991  1.00 68.80  ? 201  GLU A N   1 
ATOM 1590 C CA  . GLU A 1 204  ? 49.215  55.353 44.338  1.00 68.80  ? 201  GLU A CA  1 
ATOM 1591 C C   . GLU A 1 204  ? 47.947  55.947 44.889  1.00 68.80  ? 201  GLU A C   1 
ATOM 1592 O O   . GLU A 1 204  ? 47.324  56.769 44.237  1.00 68.80  ? 201  GLU A O   1 
ATOM 1593 C CB  . GLU A 1 204  ? 50.377  55.796 45.218  1.00 115.63 ? 201  GLU A CB  1 
ATOM 1594 C CG  . GLU A 1 204  ? 51.739  55.377 44.741  1.00 115.63 ? 201  GLU A CG  1 
ATOM 1595 C CD  . GLU A 1 204  ? 52.822  56.243 45.330  1.00 115.63 ? 201  GLU A CD  1 
ATOM 1596 O OE1 . GLU A 1 204  ? 52.841  56.428 46.568  1.00 115.63 ? 201  GLU A OE1 1 
ATOM 1597 O OE2 . GLU A 1 204  ? 53.655  56.748 44.551  1.00 115.63 ? 201  GLU A OE2 1 
ATOM 1598 N N   . PHE A 1 205  ? 47.545  55.445 46.053  1.00 135.71 ? 202  PHE A N   1 
ATOM 1599 C CA  . PHE A 1 205  ? 46.402  55.940 46.803  1.00 135.71 ? 202  PHE A CA  1 
ATOM 1600 C C   . PHE A 1 205  ? 46.986  56.393 48.125  1.00 135.71 ? 202  PHE A C   1 
ATOM 1601 O O   . PHE A 1 205  ? 47.595  55.604 48.847  1.00 135.71 ? 202  PHE A O   1 
ATOM 1602 C CB  . PHE A 1 205  ? 45.374  54.833 47.022  1.00 81.94  ? 202  PHE A CB  1 
ATOM 1603 C CG  . PHE A 1 205  ? 44.202  54.900 46.086  1.00 81.94  ? 202  PHE A CG  1 
ATOM 1604 C CD1 . PHE A 1 205  ? 43.786  53.775 45.394  1.00 81.94  ? 202  PHE A CD1 1 
ATOM 1605 C CD2 . PHE A 1 205  ? 43.515  56.087 45.899  1.00 81.94  ? 202  PHE A CD2 1 
ATOM 1606 C CE1 . PHE A 1 205  ? 42.708  53.833 44.532  1.00 81.94  ? 202  PHE A CE1 1 
ATOM 1607 C CE2 . PHE A 1 205  ? 42.435  56.152 45.039  1.00 81.94  ? 202  PHE A CE2 1 
ATOM 1608 C CZ  . PHE A 1 205  ? 42.031  55.023 44.354  1.00 81.94  ? 202  PHE A CZ  1 
ATOM 1609 N N   . ASN A 1 206  ? 46.825  57.672 48.429  1.00 62.01  ? 203  ASN A N   1 
ATOM 1610 C CA  . ASN A 1 206  ? 47.657  58.325 49.477  1.00 62.01  ? 203  ASN A CA  1 
ATOM 1611 C C   . ASN A 1 206  ? 46.518  58.508 50.489  1.00 62.01  ? 203  ASN A C   1 
ATOM 1612 O O   . ASN A 1 206  ? 45.343  58.587 50.124  1.00 62.01  ? 203  ASN A O   1 
ATOM 1613 C CB  . ASN A 1 206  ? 47.991  59.698 48.858  1.00 66.28  ? 203  ASN A CB  1 
ATOM 1614 C CG  . ASN A 1 206  ? 49.257  59.674 48.010  1.00 66.28  ? 203  ASN A CG  1 
ATOM 1615 O OD1 . ASN A 1 206  ? 50.031  58.709 48.051  1.00 66.28  ? 203  ASN A OD1 1 
ATOM 1616 N ND2 . ASN A 1 206  ? 49.462  60.722 47.222  1.00 66.28  ? 203  ASN A ND2 1 
ATOM 1617 N N   . LYS A 1 207  ? 46.908  58.591 51.759  1.00 57.35  ? 204  LYS A N   1 
ATOM 1618 C CA  . LYS A 1 207  ? 46.037  58.918 52.878  1.00 57.35  ? 204  LYS A CA  1 
ATOM 1619 C C   . LYS A 1 207  ? 45.142  60.108 52.571  1.00 57.35  ? 204  LYS A C   1 
ATOM 1620 O O   . LYS A 1 207  ? 45.607  61.128 52.039  1.00 57.35  ? 204  LYS A O   1 
ATOM 1621 C CB  . LYS A 1 207  ? 46.901  59.229 54.091  1.00 89.59  ? 204  LYS A CB  1 
ATOM 1622 C CG  . LYS A 1 207  ? 46.236  59.020 55.431  1.00 89.59  ? 204  LYS A CG  1 
ATOM 1623 C CD  . LYS A 1 207  ? 47.256  59.208 56.555  1.00 89.59  ? 204  LYS A CD  1 
ATOM 1624 C CE  . LYS A 1 207  ? 47.869  60.624 56.541  1.00 89.59  ? 204  LYS A CE  1 
ATOM 1625 N NZ  . LYS A 1 207  ? 49.176  60.759 57.264  1.00 89.59  ? 204  LYS A NZ  1 
ATOM 1626 N N   . GLY A 1 208  ? 43.857  59.962 52.894  1.00 72.76  ? 205  GLY A N   1 
ATOM 1627 C CA  . GLY A 1 208  ? 42.858  60.990 52.607  1.00 72.76  ? 205  GLY A CA  1 
ATOM 1628 C C   . GLY A 1 208  ? 42.865  62.115 53.633  1.00 72.76  ? 205  GLY A C   1 
ATOM 1629 O O   . GLY A 1 208  ? 43.659  62.091 54.570  1.00 72.76  ? 205  GLY A O   1 
ATOM 1630 N N   . PRO A 1 209  ? 41.965  63.103 53.482  1.00 63.73  ? 206  PRO A N   1 
ATOM 1631 C CA  . PRO A 1 209  ? 42.095  64.242 54.366  1.00 63.73  ? 206  PRO A CA  1 
ATOM 1632 C C   . PRO A 1 209  ? 41.446  64.026 55.715  1.00 63.73  ? 206  PRO A C   1 
ATOM 1633 O O   . PRO A 1 209  ? 41.685  64.815 56.608  1.00 63.73  ? 206  PRO A O   1 
ATOM 1634 C CB  . PRO A 1 209  ? 41.385  65.374 53.610  1.00 58.40  ? 206  PRO A CB  1 
ATOM 1635 C CG  . PRO A 1 209  ? 40.834  64.740 52.323  1.00 58.40  ? 206  PRO A CG  1 
ATOM 1636 C CD  . PRO A 1 209  ? 40.829  63.262 52.563  1.00 58.40  ? 206  PRO A CD  1 
ATOM 1637 N N   . TRP A 1 210  ? 40.644  62.980 55.889  1.00 59.67  ? 207  TRP A N   1 
ATOM 1638 C CA  . TRP A 1 210  ? 40.005  62.781 57.202  1.00 59.67  ? 207  TRP A CA  1 
ATOM 1639 C C   . TRP A 1 210  ? 39.718  61.346 57.653  1.00 59.67  ? 207  TRP A C   1 
ATOM 1640 O O   . TRP A 1 210  ? 39.310  60.490 56.865  1.00 59.67  ? 207  TRP A O   1 
ATOM 1641 C CB  . TRP A 1 210  ? 38.774  63.690 57.380  1.00 81.94  ? 207  TRP A CB  1 
ATOM 1642 C CG  . TRP A 1 210  ? 37.538  63.345 56.563  1.00 81.94  ? 207  TRP A CG  1 
ATOM 1643 C CD1 . TRP A 1 210  ? 36.714  62.258 56.721  1.00 81.94  ? 207  TRP A CD1 1 
ATOM 1644 C CD2 . TRP A 1 210  ? 36.958  64.128 55.507  1.00 81.94  ? 207  TRP A CD2 1 
ATOM 1645 N NE1 . TRP A 1 210  ? 35.675  62.302 55.809  1.00 81.94  ? 207  TRP A NE1 1 
ATOM 1646 C CE2 . TRP A 1 210  ? 35.800  63.437 55.055  1.00 81.94  ? 207  TRP A CE2 1 
ATOM 1647 C CE3 . TRP A 1 210  ? 37.312  65.335 54.888  1.00 81.94  ? 207  TRP A CE3 1 
ATOM 1648 C CZ2 . TRP A 1 210  ? 34.998  63.917 54.030  1.00 81.94  ? 207  TRP A CZ2 1 
ATOM 1649 C CZ3 . TRP A 1 210  ? 36.510  65.810 53.870  1.00 81.94  ? 207  TRP A CZ3 1 
ATOM 1650 C CH2 . TRP A 1 210  ? 35.364  65.101 53.453  1.00 81.94  ? 207  TRP A CH2 1 
ATOM 1651 N N   . LYS A 1 211  ? 39.937  61.121 58.946  1.00 77.48  ? 208  LYS A N   1 
ATOM 1652 C CA  . LYS A 1 211  ? 39.919  59.798 59.552  1.00 77.48  ? 208  LYS A CA  1 
ATOM 1653 C C   . LYS A 1 211  ? 38.618  59.050 59.274  1.00 77.48  ? 208  LYS A C   1 
ATOM 1654 O O   . LYS A 1 211  ? 37.542  59.628 59.199  1.00 77.48  ? 208  LYS A O   1 
ATOM 1655 C CB  . LYS A 1 211  ? 40.119  59.892 61.070  1.00 114.63 ? 208  LYS A CB  1 
ATOM 1656 C CG  . LYS A 1 211  ? 40.481  61.281 61.611  1.00 114.63 ? 208  LYS A CG  1 
ATOM 1657 C CD  . LYS A 1 211  ? 41.987  61.462 61.839  1.00 114.63 ? 208  LYS A CD  1 
ATOM 1658 C CE  . LYS A 1 211  ? 42.327  62.875 62.346  1.00 114.63 ? 208  LYS A CE  1 
ATOM 1659 N NZ  . LYS A 1 211  ? 41.706  63.224 63.664  1.00 114.63 ? 208  LYS A NZ  1 
ATOM 1660 N N   . GLN A 1 212  ? 38.737  57.741 59.150  1.00 57.44  ? 209  GLN A N   1 
ATOM 1661 C CA  . GLN A 1 212  ? 37.628  56.875 58.851  1.00 57.44  ? 209  GLN A CA  1 
ATOM 1662 C C   . GLN A 1 212  ? 36.639  56.767 60.018  1.00 57.44  ? 209  GLN A C   1 
ATOM 1663 O O   . GLN A 1 212  ? 37.013  56.427 61.153  1.00 57.44  ? 209  GLN A O   1 
ATOM 1664 C CB  . GLN A 1 212  ? 38.179  55.497 58.492  1.00 77.86  ? 209  GLN A CB  1 
ATOM 1665 C CG  . GLN A 1 212  ? 37.133  54.422 58.367  1.00 77.86  ? 209  GLN A CG  1 
ATOM 1666 C CD  . GLN A 1 212  ? 37.546  53.144 59.051  1.00 77.86  ? 209  GLN A CD  1 
ATOM 1667 O OE1 . GLN A 1 212  ? 38.686  52.676 58.897  1.00 77.86  ? 209  GLN A OE1 1 
ATOM 1668 N NE2 . GLN A 1 212  ? 36.619  52.563 59.822  1.00 77.86  ? 209  GLN A NE2 1 
ATOM 1669 N N   . GLU A 1 213  ? 35.368  57.032 59.726  1.00 83.29  ? 210  GLU A N   1 
ATOM 1670 C CA  . GLU A 1 213  ? 34.309  56.823 60.708  1.00 83.29  ? 210  GLU A CA  1 
ATOM 1671 C C   . GLU A 1 213  ? 33.468  55.616 60.314  1.00 83.29  ? 210  GLU A C   1 
ATOM 1672 O O   . GLU A 1 213  ? 33.537  55.154 59.177  1.00 83.29  ? 210  GLU A O   1 
ATOM 1673 C CB  . GLU A 1 213  ? 33.426  58.075 60.858  1.00 99.07  ? 210  GLU A CB  1 
ATOM 1674 C CG  . GLU A 1 213  ? 34.173  59.426 60.922  1.00 99.07  ? 210  GLU A CG  1 
ATOM 1675 C CD  . GLU A 1 213  ? 35.289  59.503 61.984  1.00 99.07  ? 210  GLU A CD  1 
ATOM 1676 O OE1 . GLU A 1 213  ? 35.306  58.699 62.949  1.00 99.07  ? 210  GLU A OE1 1 
ATOM 1677 O OE2 . GLU A 1 213  ? 36.155  60.395 61.845  1.00 99.07  ? 210  GLU A OE2 1 
ATOM 1678 N N   . ASN A 1 214  ? 32.696  55.101 61.267  1.00 106.91 ? 211  ASN A N   1 
ATOM 1679 C CA  . ASN A 1 214  ? 31.706  54.065 60.998  1.00 106.91 ? 211  ASN A CA  1 
ATOM 1680 C C   . ASN A 1 214  ? 30.398  54.724 60.617  1.00 106.91 ? 211  ASN A C   1 
ATOM 1681 O O   . ASN A 1 214  ? 30.064  55.792 61.134  1.00 106.91 ? 211  ASN A O   1 
ATOM 1682 C CB  . ASN A 1 214  ? 31.489  53.183 62.231  1.00 74.12  ? 211  ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 214  ? 32.684  52.289 62.541  1.00 74.12  ? 211  ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 214  ? 32.546  51.272 63.224  1.00 74.12  ? 211  ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 214  ? 33.861  52.662 62.042  1.00 74.12  ? 211  ASN A ND2 1 
ATOM 1686 N N   . VAL A 1 215  ? 29.661  54.101 59.702  1.00 37.55  ? 212  VAL A N   1 
ATOM 1687 C CA  . VAL A 1 215  ? 28.331  54.604 59.340  1.00 37.55  ? 212  VAL A CA  1 
ATOM 1688 C C   . VAL A 1 215  ? 27.322  53.454 59.446  1.00 37.55  ? 212  VAL A C   1 
ATOM 1689 O O   . VAL A 1 215  ? 27.683  52.327 59.785  1.00 37.55  ? 212  VAL A O   1 
ATOM 1690 C CB  . VAL A 1 215  ? 28.303  55.295 57.928  1.00 51.57  ? 212  VAL A CB  1 
ATOM 1691 C CG1 . VAL A 1 215  ? 29.436  56.329 57.776  1.00 51.57  ? 212  VAL A CG1 1 
ATOM 1692 C CG2 . VAL A 1 215  ? 28.367  54.247 56.790  1.00 51.57  ? 212  VAL A CG2 1 
ATOM 1693 N N   . GLU A 1 216  ? 26.064  53.747 59.152  1.00 50.60  ? 213  GLU A N   1 
ATOM 1694 C CA  . GLU A 1 216  ? 24.988  52.806 59.371  1.00 50.60  ? 213  GLU A CA  1 
ATOM 1695 C C   . GLU A 1 216  ? 25.094  51.519 58.534  1.00 50.60  ? 213  GLU A C   1 
ATOM 1696 O O   . GLU A 1 216  ? 25.513  51.533 57.350  1.00 50.60  ? 213  GLU A O   1 
ATOM 1697 C CB  . GLU A 1 216  ? 23.670  53.506 59.087  1.00 57.31  ? 213  GLU A CB  1 
ATOM 1698 C CG  . GLU A 1 216  ? 22.512  52.589 59.151  1.00 57.31  ? 213  GLU A CG  1 
ATOM 1699 C CD  . GLU A 1 216  ? 21.531  52.866 58.063  1.00 57.31  ? 213  GLU A CD  1 
ATOM 1700 O OE1 . GLU A 1 216  ? 21.593  53.991 57.537  1.00 57.31  ? 213  GLU A OE1 1 
ATOM 1701 O OE2 . GLU A 1 216  ? 20.701  51.974 57.746  1.00 57.31  ? 213  GLU A OE2 1 
ATOM 1702 N N   . ALA A 1 217  ? 24.682  50.411 59.145  1.00 72.62  ? 214  ALA A N   1 
ATOM 1703 C CA  . ALA A 1 217  ? 24.666  49.107 58.473  1.00 72.62  ? 214  ALA A CA  1 
ATOM 1704 C C   . ALA A 1 217  ? 24.079  49.142 57.062  1.00 72.62  ? 214  ALA A C   1 
ATOM 1705 O O   . ALA A 1 217  ? 24.436  48.314 56.228  1.00 72.62  ? 214  ALA A O   1 
ATOM 1706 C CB  . ALA A 1 217  ? 23.917  48.075 59.325  1.00 11.93  ? 214  ALA A CB  1 
ATOM 1707 N N   . GLU A 1 218  ? 23.181  50.093 56.803  1.00 48.22  ? 215  GLU A N   1 
ATOM 1708 C CA  . GLU A 1 218  ? 22.458  50.140 55.532  1.00 48.22  ? 215  GLU A CA  1 
ATOM 1709 C C   . GLU A 1 218  ? 22.770  51.373 54.713  1.00 48.22  ? 215  GLU A C   1 
ATOM 1710 O O   . GLU A 1 218  ? 22.098  51.626 53.720  1.00 48.22  ? 215  GLU A O   1 
ATOM 1711 C CB  . GLU A 1 218  ? 20.953  50.006 55.756  1.00 78.82  ? 215  GLU A CB  1 
ATOM 1712 C CG  . GLU A 1 218  ? 20.504  48.589 56.025  1.00 78.82  ? 215  GLU A CG  1 
ATOM 1713 C CD  . GLU A 1 218  ? 20.760  47.668 54.843  1.00 78.82  ? 215  GLU A CD  1 
ATOM 1714 O OE1 . GLU A 1 218  ? 20.166  47.917 53.772  1.00 78.82  ? 215  GLU A OE1 1 
ATOM 1715 O OE2 . GLU A 1 218  ? 21.546  46.701 54.983  1.00 78.82  ? 215  GLU A OE2 1 
ATOM 1716 N N   . ALA A 1 219  ? 23.782  52.136 55.138  1.00 40.75  ? 216  ALA A N   1 
ATOM 1717 C CA  . ALA A 1 219  ? 24.207  53.341 54.427  1.00 40.75  ? 216  ALA A CA  1 
ATOM 1718 C C   . ALA A 1 219  ? 24.527  52.966 52.984  1.00 40.75  ? 216  ALA A C   1 
ATOM 1719 O O   . ALA A 1 219  ? 25.261  51.996 52.747  1.00 40.75  ? 216  ALA A O   1 
ATOM 1720 C CB  . ALA A 1 219  ? 25.448  53.954 55.094  1.00 29.72  ? 216  ALA A CB  1 
ATOM 1721 N N   . SER A 1 220  ? 24.009  53.712 52.013  1.00 47.23  ? 217  SER A N   1 
ATOM 1722 C CA  . SER A 1 220  ? 24.197  53.246 50.674  1.00 47.23  ? 217  SER A CA  1 
ATOM 1723 C C   . SER A 1 220  ? 24.398  54.290 49.607  1.00 47.23  ? 217  SER A C   1 
ATOM 1724 O O   . SER A 1 220  ? 24.695  53.928 48.451  1.00 47.23  ? 217  SER A O   1 
ATOM 1725 C CB  . SER A 1 220  ? 23.052  52.333 50.293  1.00 49.26  ? 217  SER A CB  1 
ATOM 1726 O OG  . SER A 1 220  ? 21.927  53.118 50.045  1.00 49.26  ? 217  SER A OG  1 
ATOM 1727 N N   . MET A 1 221  ? 24.255  55.565 49.965  1.00 36.56  ? 218  MET A N   1 
ATOM 1728 C CA  . MET A 1 221  ? 24.306  56.658 48.985  1.00 36.56  ? 218  MET A CA  1 
ATOM 1729 C C   . MET A 1 221  ? 25.309  57.639 49.480  1.00 36.56  ? 218  MET A C   1 
ATOM 1730 O O   . MET A 1 221  ? 25.322  57.954 50.670  1.00 36.56  ? 218  MET A O   1 
ATOM 1731 C CB  . MET A 1 221  ? 22.962  57.365 48.945  1.00 98.07  ? 218  MET A CB  1 
ATOM 1732 C CG  . MET A 1 221  ? 22.604  57.999 47.636  1.00 98.07  ? 218  MET A CG  1 
ATOM 1733 S SD  . MET A 1 221  ? 21.427  56.939 46.799  1.00 98.07  ? 218  MET A SD  1 
ATOM 1734 C CE  . MET A 1 221  ? 22.495  55.671 46.081  1.00 98.07  ? 218  MET A CE  1 
ATOM 1735 N N   . VAL A 1 222  ? 26.166  58.143 48.615  1.00 39.97  ? 219  VAL A N   1 
ATOM 1736 C CA  . VAL A 1 222  ? 27.140  59.139 49.055  1.00 39.97  ? 219  VAL A CA  1 
ATOM 1737 C C   . VAL A 1 222  ? 26.938  60.334 48.159  1.00 39.97  ? 219  VAL A C   1 
ATOM 1738 O O   . VAL A 1 222  ? 27.085  60.204 46.955  1.00 39.97  ? 219  VAL A O   1 
ATOM 1739 C CB  . VAL A 1 222  ? 28.603  58.637 48.894  1.00 37.42  ? 219  VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 222  ? 29.627  59.783 49.125  1.00 37.42  ? 219  VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 222  ? 28.914  57.395 49.786  1.00 37.42  ? 219  VAL A CG2 1 
ATOM 1742 N N   . ILE A 1 223  ? 26.561  61.476 48.731  1.00 57.71  ? 220  ILE A N   1 
ATOM 1743 C CA  . ILE A 1 223  ? 26.467  62.727 47.959  1.00 57.71  ? 220  ILE A CA  1 
ATOM 1744 C C   . ILE A 1 223  ? 27.607  63.643 48.350  1.00 57.71  ? 220  ILE A C   1 
ATOM 1745 O O   . ILE A 1 223  ? 27.860  63.841 49.525  1.00 57.71  ? 220  ILE A O   1 
ATOM 1746 C CB  . ILE A 1 223  ? 25.137  63.503 48.181  1.00 42.23  ? 220  ILE A CB  1 
ATOM 1747 C CG1 . ILE A 1 223  ? 23.933  62.658 47.818  1.00 42.23  ? 220  ILE A CG1 1 
ATOM 1748 C CG2 . ILE A 1 223  ? 25.110  64.767 47.337  1.00 42.23  ? 220  ILE A CG2 1 
ATOM 1749 C CD1 . ILE A 1 223  ? 22.648  63.210 48.386  1.00 42.23  ? 220  ILE A CD1 1 
ATOM 1750 N N   . ALA A 1 224  ? 28.281  64.206 47.365  1.00 64.01  ? 221  ALA A N   1 
ATOM 1751 C CA  . ALA A 1 224  ? 29.410  65.064 47.637  1.00 64.01  ? 221  ALA A CA  1 
ATOM 1752 C C   . ALA A 1 224  ? 28.933  66.490 47.538  1.00 64.01  ? 221  ALA A C   1 
ATOM 1753 O O   . ALA A 1 224  ? 28.474  66.930 46.482  1.00 64.01  ? 221  ALA A O   1 
ATOM 1754 C CB  . ALA A 1 224  ? 30.554  64.796 46.657  1.00 56.88  ? 221  ALA A CB  1 
ATOM 1755 N N   . VAL A 1 225  ? 29.027  67.205 48.650  1.00 71.26  ? 222  VAL A N   1 
ATOM 1756 C CA  . VAL A 1 225  ? 28.494  68.552 48.731  1.00 71.26  ? 222  VAL A CA  1 
ATOM 1757 C C   . VAL A 1 225  ? 29.509  69.540 48.155  1.00 71.26  ? 222  VAL A C   1 
ATOM 1758 O O   . VAL A 1 225  ? 30.698  69.427 48.456  1.00 71.26  ? 222  VAL A O   1 
ATOM 1759 C CB  . VAL A 1 225  ? 28.136  68.887 50.181  1.00 77.42  ? 222  VAL A CB  1 
ATOM 1760 C CG1 . VAL A 1 225  ? 27.077  69.977 50.229  1.00 77.42  ? 222  VAL A CG1 1 
ATOM 1761 C CG2 . VAL A 1 225  ? 27.631  67.630 50.879  1.00 77.42  ? 222  VAL A CG2 1 
ATOM 1762 N N   . PRO A 1 226  ? 29.046  70.486 47.301  1.00 53.44  ? 223  PRO A N   1 
ATOM 1763 C CA  . PRO A 1 226  ? 29.852  71.495 46.579  1.00 53.44  ? 223  PRO A CA  1 
ATOM 1764 C C   . PRO A 1 226  ? 30.671  72.390 47.495  1.00 53.44  ? 223  PRO A C   1 
ATOM 1765 O O   . PRO A 1 226  ? 30.434  72.400 48.700  1.00 53.44  ? 223  PRO A O   1 
ATOM 1766 C CB  . PRO A 1 226  ? 28.798  72.332 45.860  1.00 68.74  ? 223  PRO A CB  1 
ATOM 1767 C CG  . PRO A 1 226  ? 27.656  71.453 45.723  1.00 68.74  ? 223  PRO A CG  1 
ATOM 1768 C CD  . PRO A 1 226  ? 27.623  70.609 46.953  1.00 68.74  ? 223  PRO A CD  1 
ATOM 1769 N N   . GLU A 1 227  ? 31.591  73.168 46.927  1.00 195.00 ? 224  GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227  ? 32.592  73.876 47.734  1.00 195.00 ? 224  GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227  ? 32.103  74.683 48.959  1.00 195.00 ? 224  GLU A C   1 
ATOM 1772 O O   . GLU A 1 227  ? 32.744  74.610 50.008  1.00 195.00 ? 224  GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227  ? 33.574  74.695 46.879  1.00 95.36  ? 224  GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227  ? 34.924  74.866 47.599  1.00 95.36  ? 224  GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227  ? 36.030  75.507 46.763  1.00 95.36  ? 224  GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227  ? 37.147  74.944 46.771  1.00 95.36  ? 224  GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227  ? 35.810  76.568 46.123  1.00 95.36  ? 224  GLU A OE2 1 
ATOM 1778 N N   . PRO A 1 228  ? 30.986  75.441 48.847  1.00 96.02  ? 225  PRO A N   1 
ATOM 1779 C CA  . PRO A 1 228  ? 30.535  76.216 50.034  1.00 96.02  ? 225  PRO A CA  1 
ATOM 1780 C C   . PRO A 1 228  ? 30.490  75.415 51.355  1.00 96.02  ? 225  PRO A C   1 
ATOM 1781 O O   . PRO A 1 228  ? 31.042  75.868 52.356  1.00 96.02  ? 225  PRO A O   1 
ATOM 1782 C CB  . PRO A 1 228  ? 29.131  76.685 49.644  1.00 91.90  ? 225  PRO A CB  1 
ATOM 1783 C CG  . PRO A 1 228  ? 29.145  76.708 48.154  1.00 91.90  ? 225  PRO A CG  1 
ATOM 1784 C CD  . PRO A 1 228  ? 30.097  75.643 47.686  1.00 91.90  ? 225  PRO A CD  1 
ATOM 1785 N N   . PHE A 1 229  ? 29.841  74.246 51.351  1.00 78.79  ? 226  PHE A N   1 
ATOM 1786 C CA  . PHE A 1 229  ? 29.837  73.341 52.504  1.00 78.79  ? 226  PHE A CA  1 
ATOM 1787 C C   . PHE A 1 229  ? 31.009  72.379 52.362  1.00 78.79  ? 226  PHE A C   1 
ATOM 1788 O O   . PHE A 1 229  ? 31.878  72.321 53.222  1.00 78.79  ? 226  PHE A O   1 
ATOM 1789 C CB  . PHE A 1 229  ? 28.574  72.476 52.554  1.00 89.05  ? 226  PHE A CB  1 
ATOM 1790 C CG  . PHE A 1 229  ? 27.277  73.231 52.688  1.00 89.05  ? 226  PHE A CG  1 
ATOM 1791 C CD1 . PHE A 1 229  ? 26.645  73.771 51.570  1.00 89.05  ? 226  PHE A CD1 1 
ATOM 1792 C CD2 . PHE A 1 229  ? 26.636  73.316 53.923  1.00 89.05  ? 226  PHE A CD2 1 
ATOM 1793 C CE1 . PHE A 1 229  ? 25.424  74.428 51.689  1.00 89.05  ? 226  PHE A CE1 1 
ATOM 1794 C CE2 . PHE A 1 229  ? 25.415  73.968 54.049  1.00 89.05  ? 226  PHE A CE2 1 
ATOM 1795 C CZ  . PHE A 1 229  ? 24.811  74.524 52.930  1.00 89.05  ? 226  PHE A CZ  1 
ATOM 1796 N N   . GLY A 1 230  ? 30.987  71.611 51.268  1.00 66.82  ? 227  GLY A N   1 
ATOM 1797 C CA  . GLY A 1 230  ? 32.004  70.638 50.928  1.00 66.82  ? 227  GLY A CA  1 
ATOM 1798 C C   . GLY A 1 230  ? 32.140  69.575 51.986  1.00 66.82  ? 227  GLY A C   1 
ATOM 1799 O O   . GLY A 1 230  ? 33.004  69.666 52.845  1.00 66.82  ? 227  GLY A O   1 
ATOM 1800 N N   . GLY A 1 231  ? 31.272  68.578 51.969  1.00 48.73  ? 228  GLY A N   1 
ATOM 1801 C CA  . GLY A 1 231  ? 31.519  67.359 52.741  1.00 48.73  ? 228  GLY A CA  1 
ATOM 1802 C C   . GLY A 1 231  ? 30.849  66.234 51.994  1.00 48.73  ? 228  GLY A C   1 
ATOM 1803 O O   . GLY A 1 231  ? 30.791  66.247 50.760  1.00 48.73  ? 228  GLY A O   1 
ATOM 1804 N N   . ALA A 1 232  ? 30.312  65.284 52.749  1.00 53.19  ? 229  ALA A N   1 
ATOM 1805 C CA  . ALA A 1 232  ? 29.676  64.112 52.175  1.00 53.19  ? 229  ALA A CA  1 
ATOM 1806 C C   . ALA A 1 232  ? 28.470  63.718 52.981  1.00 53.19  ? 229  ALA A C   1 
ATOM 1807 O O   . ALA A 1 232  ? 28.563  63.428 54.194  1.00 53.19  ? 229  ALA A O   1 
ATOM 1808 C CB  . ALA A 1 232  ? 30.655  62.933 52.096  1.00 43.04  ? 229  ALA A CB  1 
ATOM 1809 N N   . ILE A 1 233  ? 27.331  63.692 52.312  1.00 66.46  ? 230  ILE A N   1 
ATOM 1810 C CA  . ILE A 1 233  ? 26.147  63.211 52.966  1.00 66.46  ? 230  ILE A CA  1 
ATOM 1811 C C   . ILE A 1 233  ? 26.090  61.711 52.724  1.00 66.46  ? 230  ILE A C   1 
ATOM 1812 O O   . ILE A 1 233  ? 26.604  61.224 51.724  1.00 66.46  ? 230  ILE A O   1 
ATOM 1813 C CB  . ILE A 1 233  ? 24.917  64.009 52.517  1.00 70.35  ? 230  ILE A CB  1 
ATOM 1814 C CG1 . ILE A 1 233  ? 25.096  65.462 52.980  1.00 70.35  ? 230  ILE A CG1 1 
ATOM 1815 C CG2 . ILE A 1 233  ? 23.635  63.424 53.099  1.00 70.35  ? 230  ILE A CG2 1 
ATOM 1816 C CD1 . ILE A 1 233  ? 24.398  66.488 52.143  1.00 70.35  ? 230  ILE A CD1 1 
ATOM 1817 N N   . ILE A 1 234  ? 25.518  60.986 53.673  1.00 54.52  ? 231  ILE A N   1 
ATOM 1818 C CA  . ILE A 1 234  ? 25.454  59.535 53.630  1.00 54.52  ? 231  ILE A CA  1 
ATOM 1819 C C   . ILE A 1 234  ? 24.031  59.041 53.933  1.00 54.52  ? 231  ILE A C   1 
ATOM 1820 O O   . ILE A 1 234  ? 23.537  59.153 55.060  1.00 54.52  ? 231  ILE A O   1 
ATOM 1821 C CB  . ILE A 1 234  ? 26.495  58.963 54.594  1.00 51.54  ? 231  ILE A CB  1 
ATOM 1822 C CG1 . ILE A 1 234  ? 27.845  59.002 53.892  1.00 51.54  ? 231  ILE A CG1 1 
ATOM 1823 C CG2 . ILE A 1 234  ? 26.163  57.528 55.017  1.00 51.54  ? 231  ILE A CG2 1 
ATOM 1824 C CD1 . ILE A 1 234  ? 28.964  59.328 54.778  1.00 51.54  ? 231  ILE A CD1 1 
ATOM 1825 N N   . ILE A 1 235  ? 23.365  58.513 52.917  1.00 52.93  ? 232  ILE A N   1 
ATOM 1826 C CA  . ILE A 1 235  ? 21.974  58.111 53.073  1.00 52.93  ? 232  ILE A CA  1 
ATOM 1827 C C   . ILE A 1 235  ? 21.928  56.629 53.319  1.00 52.93  ? 232  ILE A C   1 
ATOM 1828 O O   . ILE A 1 235  ? 22.572  55.853 52.602  1.00 52.93  ? 232  ILE A O   1 
ATOM 1829 C CB  . ILE A 1 235  ? 21.129  58.440 51.814  1.00 56.09  ? 232  ILE A CB  1 
ATOM 1830 C CG1 . ILE A 1 235  ? 20.782  59.924 51.762  1.00 56.09  ? 232  ILE A CG1 1 
ATOM 1831 C CG2 . ILE A 1 235  ? 19.837  57.635 51.783  1.00 56.09  ? 232  ILE A CG2 1 
ATOM 1832 C CD1 . ILE A 1 235  ? 21.620  60.686 50.822  1.00 56.09  ? 232  ILE A CD1 1 
ATOM 1833 N N   . GLY A 1 236  ? 21.162  56.237 54.324  1.00 37.56  ? 233  GLY A N   1 
ATOM 1834 C CA  . GLY A 1 236  ? 20.974  54.824 54.648  1.00 37.56  ? 233  GLY A CA  1 
ATOM 1835 C C   . GLY A 1 236  ? 19.576  54.638 55.179  1.00 37.56  ? 233  GLY A C   1 
ATOM 1836 O O   . GLY A 1 236  ? 18.925  55.639 55.414  1.00 37.56  ? 233  GLY A O   1 
ATOM 1837 N N   . GLN A 1 237  ? 19.098  53.396 55.355  1.00 76.53  ? 234  GLN A N   1 
ATOM 1838 C CA  . GLN A 1 237  ? 17.785  53.157 55.990  1.00 76.53  ? 234  GLN A CA  1 
ATOM 1839 C C   . GLN A 1 237  ? 17.781  53.946 57.278  1.00 76.53  ? 234  GLN A C   1 
ATOM 1840 O O   . GLN A 1 237  ? 18.812  54.027 57.940  1.00 76.53  ? 234  GLN A O   1 
ATOM 1841 C CB  . GLN A 1 237  ? 17.585  51.691 56.370  1.00 75.91  ? 234  GLN A CB  1 
ATOM 1842 C CG  . GLN A 1 237  ? 17.299  50.728 55.249  1.00 75.91  ? 234  GLN A CG  1 
ATOM 1843 C CD  . GLN A 1 237  ? 15.944  50.956 54.613  1.00 75.91  ? 234  GLN A CD  1 
ATOM 1844 O OE1 . GLN A 1 237  ? 14.953  51.273 55.294  1.00 75.91  ? 234  GLN A OE1 1 
ATOM 1845 N NE2 . GLN A 1 237  ? 15.888  50.801 53.295  1.00 75.91  ? 234  GLN A NE2 1 
ATOM 1846 N N   . GLU A 1 238  ? 16.664  54.542 57.657  1.00 64.47  ? 235  GLU A N   1 
ATOM 1847 C CA  . GLU A 1 238  ? 16.594  55.122 59.017  1.00 64.47  ? 235  GLU A CA  1 
ATOM 1848 C C   . GLU A 1 238  ? 17.436  56.387 59.316  1.00 64.47  ? 235  GLU A C   1 
ATOM 1849 O O   . GLU A 1 238  ? 17.062  57.181 60.180  1.00 64.47  ? 235  GLU A O   1 
ATOM 1850 C CB  . GLU A 1 238  ? 16.837  54.018 60.074  1.00 92.31  ? 235  GLU A CB  1 
ATOM 1851 C CG  . GLU A 1 238  ? 17.972  54.267 61.060  1.00 92.31  ? 235  GLU A CG  1 
ATOM 1852 C CD  . GLU A 1 238  ? 18.255  53.081 61.973  1.00 92.31  ? 235  GLU A CD  1 
ATOM 1853 O OE1 . GLU A 1 238  ? 17.475  52.100 61.980  1.00 92.31  ? 235  GLU A OE1 1 
ATOM 1854 O OE2 . GLU A 1 238  ? 19.270  53.142 62.701  1.00 92.31  ? 235  GLU A OE2 1 
ATOM 1855 N N   . SER A 1 239  ? 18.517  56.602 58.574  1.00 67.27  ? 236  SER A N   1 
ATOM 1856 C CA  . SER A 1 239  ? 19.543  57.547 58.991  1.00 67.27  ? 236  SER A CA  1 
ATOM 1857 C C   . SER A 1 239  ? 20.055  58.428 57.851  1.00 67.27  ? 236  SER A C   1 
ATOM 1858 O O   . SER A 1 239  ? 20.165  57.962 56.718  1.00 67.27  ? 236  SER A O   1 
ATOM 1859 C CB  . SER A 1 239  ? 20.707  56.752 59.570  1.00 75.33  ? 236  SER A CB  1 
ATOM 1860 O OG  . SER A 1 239  ? 21.706  57.600 60.072  1.00 75.33  ? 236  SER A OG  1 
ATOM 1861 N N   . ILE A 1 240  ? 20.360  59.693 58.153  1.00 58.48  ? 237  ILE A N   1 
ATOM 1862 C CA  . ILE A 1 240  ? 21.025  60.592 57.213  1.00 58.48  ? 237  ILE A CA  1 
ATOM 1863 C C   . ILE A 1 240  ? 22.083  61.350 57.993  1.00 58.48  ? 237  ILE A C   1 
ATOM 1864 O O   . ILE A 1 240  ? 21.798  61.780 59.124  1.00 58.48  ? 237  ILE A O   1 
ATOM 1865 C CB  . ILE A 1 240  ? 20.054  61.612 56.574  1.00 42.00  ? 237  ILE A CB  1 
ATOM 1866 C CG1 . ILE A 1 240  ? 19.022  60.901 55.669  1.00 42.00  ? 237  ILE A CG1 1 
ATOM 1867 C CG2 . ILE A 1 240  ? 20.832  62.713 55.792  1.00 42.00  ? 237  ILE A CG2 1 
ATOM 1868 C CD1 . ILE A 1 240  ? 18.009  61.822 54.967  1.00 42.00  ? 237  ILE A CD1 1 
ATOM 1869 N N   . THR A 1 241  ? 23.290  61.507 57.417  1.00 67.63  ? 238  THR A N   1 
ATOM 1870 C CA  . THR A 1 241  ? 24.421  62.137 58.126  1.00 67.63  ? 238  THR A CA  1 
ATOM 1871 C C   . THR A 1 241  ? 25.429  62.879 57.250  1.00 67.63  ? 238  THR A C   1 
ATOM 1872 O O   . THR A 1 241  ? 25.850  62.373 56.197  1.00 67.63  ? 238  THR A O   1 
ATOM 1873 C CB  . THR A 1 241  ? 25.267  61.128 58.944  1.00 71.42  ? 238  THR A CB  1 
ATOM 1874 O OG1 . THR A 1 241  ? 26.228  60.507 58.085  1.00 71.42  ? 238  THR A OG1 1 
ATOM 1875 C CG2 . THR A 1 241  ? 24.414  60.072 59.628  1.00 71.42  ? 238  THR A CG2 1 
ATOM 1876 N N   . TYR A 1 242  ? 25.845  64.058 57.723  1.00 62.23  ? 239  TYR A N   1 
ATOM 1877 C CA  . TYR A 1 242  ? 26.919  64.824 57.096  1.00 62.23  ? 239  TYR A CA  1 
ATOM 1878 C C   . TYR A 1 242  ? 28.258  64.580 57.795  1.00 62.23  ? 239  TYR A C   1 
ATOM 1879 O O   . TYR A 1 242  ? 28.356  64.538 59.023  1.00 62.23  ? 239  TYR A O   1 
ATOM 1880 C CB  . TYR A 1 242  ? 26.598  66.305 57.122  1.00 59.74  ? 239  TYR A CB  1 
ATOM 1881 C CG  . TYR A 1 242  ? 27.613  67.222 56.457  1.00 59.74  ? 239  TYR A CG  1 
ATOM 1882 C CD1 . TYR A 1 242  ? 27.569  67.442 55.090  1.00 59.74  ? 239  TYR A CD1 1 
ATOM 1883 C CD2 . TYR A 1 242  ? 28.576  67.906 57.202  1.00 59.74  ? 239  TYR A CD2 1 
ATOM 1884 C CE1 . TYR A 1 242  ? 28.465  68.287 54.465  1.00 59.74  ? 239  TYR A CE1 1 
ATOM 1885 C CE2 . TYR A 1 242  ? 29.480  68.768 56.587  1.00 59.74  ? 239  TYR A CE2 1 
ATOM 1886 C CZ  . TYR A 1 242  ? 29.415  68.953 55.203  1.00 59.74  ? 239  TYR A CZ  1 
ATOM 1887 O OH  . TYR A 1 242  ? 30.276  69.806 54.525  1.00 59.74  ? 239  TYR A OH  1 
ATOM 1888 N N   . HIS A 1 243  ? 29.283  64.405 56.973  1.00 60.16  ? 240  HIS A N   1 
ATOM 1889 C CA  . HIS A 1 243  ? 30.622  64.160 57.429  1.00 60.16  ? 240  HIS A CA  1 
ATOM 1890 C C   . HIS A 1 243  ? 31.464  65.223 56.794  1.00 60.16  ? 240  HIS A C   1 
ATOM 1891 O O   . HIS A 1 243  ? 31.168  65.680 55.675  1.00 60.16  ? 240  HIS A O   1 
ATOM 1892 C CB  . HIS A 1 243  ? 31.114  62.804 56.941  1.00 46.72  ? 240  HIS A CB  1 
ATOM 1893 C CG  . HIS A 1 243  ? 30.496  61.646 57.648  1.00 46.72  ? 240  HIS A CG  1 
ATOM 1894 N ND1 . HIS A 1 243  ? 31.151  60.946 58.639  1.00 46.72  ? 240  HIS A ND1 1 
ATOM 1895 C CD2 . HIS A 1 243  ? 29.282  61.057 57.504  1.00 46.72  ? 240  HIS A CD2 1 
ATOM 1896 C CE1 . HIS A 1 243  ? 30.366  59.972 59.074  1.00 46.72  ? 240  HIS A CE1 1 
ATOM 1897 N NE2 . HIS A 1 243  ? 29.229  60.014 58.399  1.00 46.72  ? 240  HIS A NE2 1 
ATOM 1898 N N   . ASN A 1 244  ? 32.506  65.614 57.513  1.00 81.16  ? 241  ASN A N   1 
ATOM 1899 C CA  . ASN A 1 244  ? 33.540  66.476 56.980  1.00 81.16  ? 241  ASN A CA  1 
ATOM 1900 C C   . ASN A 1 244  ? 34.638  66.565 57.998  1.00 81.16  ? 241  ASN A C   1 
ATOM 1901 O O   . ASN A 1 244  ? 34.352  66.553 59.187  1.00 81.16  ? 241  ASN A O   1 
ATOM 1902 C CB  . ASN A 1 244  ? 33.003  67.874 56.698  1.00 70.23  ? 241  ASN A CB  1 
ATOM 1903 C CG  . ASN A 1 244  ? 33.988  68.724 55.956  1.00 70.23  ? 241  ASN A CG  1 
ATOM 1904 O OD1 . ASN A 1 244  ? 35.195  68.567 56.114  1.00 70.23  ? 241  ASN A OD1 1 
ATOM 1905 N ND2 . ASN A 1 244  ? 33.485  69.635 55.142  1.00 70.23  ? 241  ASN A ND2 1 
ATOM 1906 N N   . GLY A 1 245  ? 35.883  66.648 57.527  1.00 82.84  ? 242  GLY A N   1 
ATOM 1907 C CA  . GLY A 1 245  ? 37.050  66.803 58.389  1.00 82.84  ? 242  GLY A CA  1 
ATOM 1908 C C   . GLY A 1 245  ? 36.777  66.268 59.780  1.00 82.84  ? 242  GLY A C   1 
ATOM 1909 O O   . GLY A 1 245  ? 36.901  65.054 60.025  1.00 82.84  ? 242  GLY A O   1 
ATOM 1910 N N   . ASP A 1 246  ? 36.373  67.169 60.683  1.00 65.60  ? 243  ASP A N   1 
ATOM 1911 C CA  . ASP A 1 246  ? 35.967  66.760 62.042  1.00 65.60  ? 243  ASP A CA  1 
ATOM 1912 C C   . ASP A 1 246  ? 34.520  67.089 62.421  1.00 65.60  ? 243  ASP A C   1 
ATOM 1913 O O   . ASP A 1 246  ? 34.099  66.873 63.554  1.00 65.60  ? 243  ASP A O   1 
ATOM 1914 C CB  . ASP A 1 246  ? 36.978  67.211 63.107  1.00 141.60 ? 243  ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 246  ? 38.055  66.161 63.363  1.00 141.60 ? 243  ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 246  ? 39.246  66.463 63.138  1.00 141.60 ? 243  ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 246  ? 37.708  65.024 63.767  1.00 141.60 ? 243  ASP A OD2 1 
ATOM 1918 N N   . LYS A 1 247  ? 33.773  67.579 61.437  1.00 73.49  ? 244  LYS A N   1 
ATOM 1919 C CA  . LYS A 1 247  ? 32.328  67.742 61.541  1.00 73.49  ? 244  LYS A CA  1 
ATOM 1920 C C   . LYS A 1 247  ? 31.599  66.403 61.423  1.00 73.49  ? 244  LYS A C   1 
ATOM 1921 O O   . LYS A 1 247  ? 32.065  65.480 60.746  1.00 73.49  ? 244  LYS A O   1 
ATOM 1922 C CB  . LYS A 1 247  ? 31.820  68.702 60.468  1.00 85.72  ? 244  LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 247  ? 32.423  70.092 60.546  1.00 85.72  ? 244  LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 247  ? 31.335  71.134 60.411  1.00 85.72  ? 244  LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 247  ? 30.306  70.955 61.516  1.00 85.72  ? 244  LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 247  ? 28.927  71.183 61.035  1.00 85.72  ? 244  LYS A NZ  1 
ATOM 1927 N N   . TYR A 1 248  ? 30.460  66.320 62.106  1.00 63.07  ? 245  TYR A N   1 
ATOM 1928 C CA  . TYR A 1 248  ? 29.552  65.190 62.040  1.00 63.07  ? 245  TYR A CA  1 
ATOM 1929 C C   . TYR A 1 248  ? 28.166  65.718 62.371  1.00 63.07  ? 245  TYR A C   1 
ATOM 1930 O O   . TYR A 1 248  ? 27.996  66.441 63.354  1.00 63.07  ? 245  TYR A O   1 
ATOM 1931 C CB  . TYR A 1 248  ? 29.955  64.094 63.031  1.00 73.40  ? 245  TYR A CB  1 
ATOM 1932 C CG  . TYR A 1 248  ? 29.039  62.887 63.018  1.00 73.40  ? 245  TYR A CG  1 
ATOM 1933 C CD1 . TYR A 1 248  ? 29.166  61.882 62.039  1.00 73.40  ? 245  TYR A CD1 1 
ATOM 1934 C CD2 . TYR A 1 248  ? 28.034  62.749 63.975  1.00 73.40  ? 245  TYR A CD2 1 
ATOM 1935 C CE1 . TYR A 1 248  ? 28.300  60.762 62.021  1.00 73.40  ? 245  TYR A CE1 1 
ATOM 1936 C CE2 . TYR A 1 248  ? 27.171  61.641 63.981  1.00 73.40  ? 245  TYR A CE2 1 
ATOM 1937 C CZ  . TYR A 1 248  ? 27.300  60.653 63.005  1.00 73.40  ? 245  TYR A CZ  1 
ATOM 1938 O OH  . TYR A 1 248  ? 26.425  59.578 63.030  1.00 73.40  ? 245  TYR A OH  1 
ATOM 1939 N N   . LEU A 1 249  ? 27.181  65.382 61.541  1.00 61.93  ? 246  LEU A N   1 
ATOM 1940 C CA  . LEU A 1 249  ? 25.787  65.766 61.802  1.00 61.93  ? 246  LEU A CA  1 
ATOM 1941 C C   . LEU A 1 249  ? 24.848  64.641 61.479  1.00 61.93  ? 246  LEU A C   1 
ATOM 1942 O O   . LEU A 1 249  ? 25.100  63.910 60.537  1.00 61.93  ? 246  LEU A O   1 
ATOM 1943 C CB  . LEU A 1 249  ? 25.405  67.025 61.034  1.00 73.67  ? 246  LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 249  ? 25.313  68.194 62.022  1.00 73.67  ? 246  LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 249  ? 24.912  69.509 61.361  1.00 73.67  ? 246  LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 249  ? 24.334  67.838 63.138  1.00 73.67  ? 246  LEU A CD2 1 
ATOM 1947 N N   . ALA A 1 250  ? 23.776  64.482 62.251  1.00 47.36  ? 247  ALA A N   1 
ATOM 1948 C CA  . ALA A 1 250  ? 22.933  63.289 62.086  1.00 47.36  ? 247  ALA A CA  1 
ATOM 1949 C C   . ALA A 1 250  ? 21.458  63.399 62.500  1.00 47.36  ? 247  ALA A C   1 
ATOM 1950 O O   . ALA A 1 250  ? 21.123  63.383 63.688  1.00 47.36  ? 247  ALA A O   1 
ATOM 1951 C CB  . ALA A 1 250  ? 23.572  62.098 62.791  1.00 43.22  ? 247  ALA A CB  1 
ATOM 1952 N N   . ILE A 1 251  ? 20.579  63.450 61.512  1.00 50.02  ? 248  ILE A N   1 
ATOM 1953 C CA  . ILE A 1 251  ? 19.159  63.361 61.779  1.00 50.02  ? 248  ILE A CA  1 
ATOM 1954 C C   . ILE A 1 251  ? 18.705  61.947 61.473  1.00 50.02  ? 248  ILE A C   1 
ATOM 1955 O O   . ILE A 1 251  ? 19.330  61.243 60.650  1.00 50.02  ? 248  ILE A O   1 
ATOM 1956 C CB  . ILE A 1 251  ? 18.370  64.337 60.905  1.00 56.22  ? 248  ILE A CB  1 
ATOM 1957 C CG1 . ILE A 1 251  ? 18.546  63.990 59.413  1.00 56.22  ? 248  ILE A CG1 1 
ATOM 1958 C CG2 . ILE A 1 251  ? 18.835  65.760 61.189  1.00 56.22  ? 248  ILE A CG2 1 
ATOM 1959 C CD1 . ILE A 1 251  ? 17.549  64.629 58.496  1.00 56.22  ? 248  ILE A CD1 1 
ATOM 1960 N N   . ALA A 1 252  ? 17.621  61.528 62.119  1.00 59.08  ? 249  ALA A N   1 
ATOM 1961 C CA  . ALA A 1 252  ? 17.030  60.240 61.786  1.00 59.08  ? 249  ALA A CA  1 
ATOM 1962 C C   . ALA A 1 252  ? 15.492  60.309 61.787  1.00 59.08  ? 249  ALA A C   1 
ATOM 1963 O O   . ALA A 1 252  ? 14.825  59.654 62.593  1.00 59.08  ? 249  ALA A O   1 
ATOM 1964 C CB  . ALA A 1 252  ? 17.578  59.124 62.710  1.00 22.44  ? 249  ALA A CB  1 
ATOM 1965 N N   . PRO A 1 253  ? 14.920  61.071 60.843  1.00 55.81  ? 250  PRO A N   1 
ATOM 1966 C CA  . PRO A 1 253  ? 13.495  61.347 60.948  1.00 55.81  ? 250  PRO A CA  1 
ATOM 1967 C C   . PRO A 1 253  ? 12.683  60.064 60.688  1.00 55.81  ? 250  PRO A C   1 
ATOM 1968 O O   . PRO A 1 253  ? 12.970  59.309 59.726  1.00 55.81  ? 250  PRO A O   1 
ATOM 1969 C CB  . PRO A 1 253  ? 13.253  62.373 59.849  1.00 66.74  ? 250  PRO A CB  1 
ATOM 1970 C CG  . PRO A 1 253  ? 14.346  62.102 58.849  1.00 66.74  ? 250  PRO A CG  1 
ATOM 1971 C CD  . PRO A 1 253  ? 15.519  61.639 59.622  1.00 66.74  ? 250  PRO A CD  1 
ATOM 1972 N N   . PRO A 1 254  ? 11.635  59.834 61.493  1.00 80.40  ? 251  PRO A N   1 
ATOM 1973 C CA  . PRO A 1 254  ? 11.124  58.484 61.441  1.00 80.40  ? 251  PRO A CA  1 
ATOM 1974 C C   . PRO A 1 254  ? 10.284  58.286 60.175  1.00 80.40  ? 251  PRO A C   1 
ATOM 1975 O O   . PRO A 1 254  ? 9.865   57.165 59.884  1.00 80.40  ? 251  PRO A O   1 
ATOM 1976 C CB  . PRO A 1 254  ? 10.295  58.374 62.731  1.00 59.05  ? 251  PRO A CB  1 
ATOM 1977 C CG  . PRO A 1 254  ? 10.349  59.772 63.412  1.00 59.05  ? 251  PRO A CG  1 
ATOM 1978 C CD  . PRO A 1 254  ? 10.819  60.704 62.358  1.00 59.05  ? 251  PRO A CD  1 
ATOM 1979 N N   . ILE A 1 255  ? 10.087  59.371 59.419  1.00 80.01  ? 252  ILE A N   1 
ATOM 1980 C CA  . ILE A 1 255  ? 9.299   59.349 58.191  1.00 80.01  ? 252  ILE A CA  1 
ATOM 1981 C C   . ILE A 1 255  ? 10.026  58.528 57.127  1.00 80.01  ? 252  ILE A C   1 
ATOM 1982 O O   . ILE A 1 255  ? 9.401   57.722 56.429  1.00 80.01  ? 252  ILE A O   1 
ATOM 1983 C CB  . ILE A 1 255  ? 8.995   60.778 57.627  1.00 67.77  ? 252  ILE A CB  1 
ATOM 1984 C CG1 . ILE A 1 255  ? 8.628   61.774 58.734  1.00 67.77  ? 252  ILE A CG1 1 
ATOM 1985 C CG2 . ILE A 1 255  ? 7.858   60.729 56.612  1.00 67.77  ? 252  ILE A CG2 1 
ATOM 1986 C CD1 . ILE A 1 255  ? 8.418   63.230 58.260  1.00 67.77  ? 252  ILE A CD1 1 
ATOM 1987 N N   . ILE A 1 256  ? 11.345  58.718 57.022  1.00 59.69  ? 253  ILE A N   1 
ATOM 1988 C CA  . ILE A 1 256  ? 12.135  58.069 55.971  1.00 59.69  ? 253  ILE A CA  1 
ATOM 1989 C C   . ILE A 1 256  ? 12.578  56.642 56.315  1.00 59.69  ? 253  ILE A C   1 
ATOM 1990 O O   . ILE A 1 256  ? 13.455  56.089 55.660  1.00 59.69  ? 253  ILE A O   1 
ATOM 1991 C CB  . ILE A 1 256  ? 13.342  58.939 55.531  1.00 51.96  ? 253  ILE A CB  1 
ATOM 1992 C CG1 . ILE A 1 256  ? 14.410  59.066 56.631  1.00 51.96  ? 253  ILE A CG1 1 
ATOM 1993 C CG2 . ILE A 1 256  ? 12.864  60.308 55.074  1.00 51.96  ? 253  ILE A CG2 1 
ATOM 1994 C CD1 . ILE A 1 256  ? 15.528  57.985 56.607  1.00 51.96  ? 253  ILE A CD1 1 
ATOM 1995 N N   . LYS A 1 257  ? 11.963  56.034 57.328  1.00 53.76  ? 254  LYS A N   1 
ATOM 1996 C CA  . LYS A 1 257  ? 12.308  54.672 57.683  1.00 53.76  ? 254  LYS A CA  1 
ATOM 1997 C C   . LYS A 1 257  ? 11.406  53.696 56.931  1.00 53.76  ? 254  LYS A C   1 
ATOM 1998 O O   . LYS A 1 257  ? 11.823  52.599 56.583  1.00 53.76  ? 254  LYS A O   1 
ATOM 1999 C CB  . LYS A 1 257  ? 12.268  54.465 59.205  1.00 83.87  ? 254  LYS A CB  1 
ATOM 2000 C CG  . LYS A 1 257  ? 13.018  53.208 59.684  1.00 83.87  ? 254  LYS A CG  1 
ATOM 2001 C CD  . LYS A 1 257  ? 13.365  53.245 61.191  1.00 83.87  ? 254  LYS A CD  1 
ATOM 2002 C CE  . LYS A 1 257  ? 14.048  51.944 61.671  1.00 83.87  ? 254  LYS A CE  1 
ATOM 2003 N NZ  . LYS A 1 257  ? 15.239  51.513 60.833  1.00 83.87  ? 254  LYS A NZ  1 
ATOM 2004 N N   . GLN A 1 258  ? 10.176  54.105 56.665  1.00 65.45  ? 255  GLN A N   1 
ATOM 2005 C CA  . GLN A 1 258  ? 9.188   53.239 56.007  1.00 65.45  ? 255  GLN A CA  1 
ATOM 2006 C C   . GLN A 1 258  ? 9.654   52.611 54.681  1.00 65.45  ? 255  GLN A C   1 
ATOM 2007 O O   . GLN A 1 258  ? 9.127   51.576 54.260  1.00 65.45  ? 255  GLN A O   1 
ATOM 2008 C CB  . GLN A 1 258  ? 7.899   54.021 55.724  1.00 166.01 ? 255  GLN A CB  1 
ATOM 2009 C CG  . GLN A 1 258  ? 7.396   54.914 56.850  1.00 166.01 ? 255  GLN A CG  1 
ATOM 2010 C CD  . GLN A 1 258  ? 6.197   55.757 56.434  1.00 166.01 ? 255  GLN A CD  1 
ATOM 2011 O OE1 . GLN A 1 258  ? 5.572   55.512 55.399  1.00 166.01 ? 255  GLN A OE1 1 
ATOM 2012 N NE2 . GLN A 1 258  ? 5.870   56.755 57.244  1.00 166.01 ? 255  GLN A NE2 1 
ATOM 2013 N N   . SER A 1 259  ? 10.616  53.245 54.012  1.00 57.25  ? 256  SER A N   1 
ATOM 2014 C CA  . SER A 1 259  ? 10.932  52.892 52.639  1.00 57.25  ? 256  SER A CA  1 
ATOM 2015 C C   . SER A 1 259  ? 12.271  53.448 52.298  1.00 57.25  ? 256  SER A C   1 
ATOM 2016 O O   . SER A 1 259  ? 12.638  54.502 52.791  1.00 57.25  ? 256  SER A O   1 
ATOM 2017 C CB  . SER A 1 259  ? 9.901   53.498 51.697  1.00 47.59  ? 256  SER A CB  1 
ATOM 2018 O OG  . SER A 1 259  ? 10.113  53.120 50.358  1.00 47.59  ? 256  SER A OG  1 
ATOM 2019 N N   . THR A 1 260  ? 12.985  52.729 51.439  1.00 56.40  ? 257  THR A N   1 
ATOM 2020 C CA  . THR A 1 260  ? 14.391  52.981 51.141  1.00 56.40  ? 257  THR A CA  1 
ATOM 2021 C C   . THR A 1 260  ? 14.539  54.198 50.255  1.00 56.40  ? 257  THR A C   1 
ATOM 2022 O O   . THR A 1 260  ? 13.805  54.325 49.247  1.00 56.40  ? 257  THR A O   1 
ATOM 2023 C CB  . THR A 1 260  ? 14.996  51.788 50.360  1.00 41.05  ? 257  THR A CB  1 
ATOM 2024 O OG1 . THR A 1 260  ? 14.774  50.560 51.069  1.00 41.05  ? 257  THR A OG1 1 
ATOM 2025 C CG2 . THR A 1 260  ? 16.481  51.981 50.099  1.00 41.05  ? 257  THR A CG2 1 
ATOM 2026 N N   . ILE A 1 261  ? 15.477  55.084 50.595  1.00 33.38  ? 258  ILE A N   1 
ATOM 2027 C CA  . ILE A 1 261  ? 15.824  56.128 49.653  1.00 33.38  ? 258  ILE A CA  1 
ATOM 2028 C C   . ILE A 1 261  ? 16.712  55.491 48.564  1.00 33.38  ? 258  ILE A C   1 
ATOM 2029 O O   . ILE A 1 261  ? 17.661  54.777 48.903  1.00 33.38  ? 258  ILE A O   1 
ATOM 2030 C CB  . ILE A 1 261  ? 16.479  57.305 50.362  1.00 42.94  ? 258  ILE A CB  1 
ATOM 2031 C CG1 . ILE A 1 261  ? 15.483  57.828 51.411  1.00 42.94  ? 258  ILE A CG1 1 
ATOM 2032 C CG2 . ILE A 1 261  ? 16.827  58.409 49.366  1.00 42.94  ? 258  ILE A CG2 1 
ATOM 2033 C CD1 . ILE A 1 261  ? 15.925  59.068 52.244  1.00 42.94  ? 258  ILE A CD1 1 
ATOM 2034 N N   . VAL A 1 262  ? 16.399  55.688 47.279  1.00 45.55  ? 259  VAL A N   1 
ATOM 2035 C CA  . VAL A 1 262  ? 17.111  54.980 46.175  1.00 45.55  ? 259  VAL A CA  1 
ATOM 2036 C C   . VAL A 1 262  ? 17.827  55.889 45.190  1.00 45.55  ? 259  VAL A C   1 
ATOM 2037 O O   . VAL A 1 262  ? 18.714  55.420 44.481  1.00 45.55  ? 259  VAL A O   1 
ATOM 2038 C CB  . VAL A 1 262  ? 16.172  54.074 45.318  1.00 57.01  ? 259  VAL A CB  1 
ATOM 2039 C CG1 . VAL A 1 262  ? 15.588  52.929 46.131  1.00 57.01  ? 259  VAL A CG1 1 
ATOM 2040 C CG2 . VAL A 1 262  ? 15.053  54.890 44.690  1.00 57.01  ? 259  VAL A CG2 1 
ATOM 2041 N N   . CYS A 1 263  ? 17.399  57.158 45.116  1.00 46.89  ? 260  CYS A N   1 
ATOM 2042 C CA  . CYS A 1 263  ? 17.984  58.175 44.232  1.00 46.89  ? 260  CYS A CA  1 
ATOM 2043 C C   . CYS A 1 263  ? 17.939  59.598 44.824  1.00 46.89  ? 260  CYS A C   1 
ATOM 2044 O O   . CYS A 1 263  ? 16.972  59.973 45.456  1.00 46.89  ? 260  CYS A O   1 
ATOM 2045 C CB  . CYS A 1 263  ? 17.301  58.162 42.864  1.00 36.96  ? 260  CYS A CB  1 
ATOM 2046 S SG  . CYS A 1 263  ? 15.491  58.261 42.887  1.00 36.96  ? 260  CYS A SG  1 
ATOM 2047 N N   . HIS A 1 264  ? 18.997  60.378 44.601  1.00 46.26  ? 261  HIS A N   1 
ATOM 2048 C CA  . HIS A 1 264  ? 19.037  61.779 44.984  1.00 46.26  ? 261  HIS A CA  1 
ATOM 2049 C C   . HIS A 1 264  ? 19.279  62.661 43.770  1.00 46.26  ? 261  HIS A C   1 
ATOM 2050 O O   . HIS A 1 264  ? 19.606  62.178 42.682  1.00 46.26  ? 261  HIS A O   1 
ATOM 2051 C CB  . HIS A 1 264  ? 20.145  62.035 45.995  1.00 49.54  ? 261  HIS A CB  1 
ATOM 2052 C CG  . HIS A 1 264  ? 21.504  61.716 45.468  1.00 49.54  ? 261  HIS A CG  1 
ATOM 2053 N ND1 . HIS A 1 264  ? 22.263  62.627 44.750  1.00 49.54  ? 261  HIS A ND1 1 
ATOM 2054 C CD2 . HIS A 1 264  ? 22.230  60.575 45.522  1.00 49.54  ? 261  HIS A CD2 1 
ATOM 2055 C CE1 . HIS A 1 264  ? 23.399  62.059 44.395  1.00 49.54  ? 261  HIS A CE1 1 
ATOM 2056 N NE2 . HIS A 1 264  ? 23.401  60.814 44.846  1.00 49.54  ? 261  HIS A NE2 1 
ATOM 2057 N N   . ASN A 1 265  ? 19.124  63.966 43.975  1.00 52.12  ? 262  ASN A N   1 
ATOM 2058 C CA  . ASN A 1 265  ? 19.507  64.961 42.988  1.00 52.12  ? 262  ASN A CA  1 
ATOM 2059 C C   . ASN A 1 265  ? 19.728  66.323 43.655  1.00 52.12  ? 262  ASN A C   1 
ATOM 2060 O O   . ASN A 1 265  ? 19.015  66.663 44.594  1.00 52.12  ? 262  ASN A O   1 
ATOM 2061 C CB  . ASN A 1 265  ? 18.455  65.073 41.887  1.00 62.76  ? 262  ASN A CB  1 
ATOM 2062 C CG  . ASN A 1 265  ? 18.900  65.976 40.779  1.00 62.76  ? 262  ASN A CG  1 
ATOM 2063 O OD1 . ASN A 1 265  ? 19.989  65.788 40.220  1.00 62.76  ? 262  ASN A OD1 1 
ATOM 2064 N ND2 . ASN A 1 265  ? 18.104  66.991 40.477  1.00 62.76  ? 262  ASN A ND2 1 
ATOM 2065 N N   . ARG A 1 266  ? 20.714  67.085 43.178  1.00 42.16  ? 263  ARG A N   1 
ATOM 2066 C CA  . ARG A 1 266  ? 21.010  68.424 43.734  1.00 42.16  ? 263  ARG A CA  1 
ATOM 2067 C C   . ARG A 1 266  ? 20.138  69.534 43.132  1.00 42.16  ? 263  ARG A C   1 
ATOM 2068 O O   . ARG A 1 266  ? 20.015  69.621 41.920  1.00 42.16  ? 263  ARG A O   1 
ATOM 2069 C CB  . ARG A 1 266  ? 22.515  68.773 43.626  1.00 57.04  ? 263  ARG A CB  1 
ATOM 2070 C CG  . ARG A 1 266  ? 22.870  70.156 44.177  1.00 57.04  ? 263  ARG A CG  1 
ATOM 2071 C CD  . ARG A 1 266  ? 24.368  70.421 44.392  1.00 57.04  ? 263  ARG A CD  1 
ATOM 2072 N NE  . ARG A 1 266  ? 25.175  70.117 43.216  1.00 57.04  ? 263  ARG A NE  1 
ATOM 2073 C CZ  . ARG A 1 266  ? 24.948  70.588 41.993  1.00 57.04  ? 263  ARG A CZ  1 
ATOM 2074 N NH1 . ARG A 1 266  ? 23.914  71.401 41.763  1.00 57.04  ? 263  ARG A NH1 1 
ATOM 2075 N NH2 . ARG A 1 266  ? 25.744  70.227 40.995  1.00 57.04  ? 263  ARG A NH2 1 
ATOM 2076 N N   . VAL A 1 267  ? 19.558  70.377 43.987  1.00 61.32  ? 264  VAL A N   1 
ATOM 2077 C CA  . VAL A 1 267  ? 18.625  71.416 43.529  1.00 61.32  ? 264  VAL A CA  1 
ATOM 2078 C C   . VAL A 1 267  ? 19.280  72.775 43.313  1.00 61.32  ? 264  VAL A C   1 
ATOM 2079 O O   . VAL A 1 267  ? 19.244  73.318 42.212  1.00 61.32  ? 264  VAL A O   1 
ATOM 2080 C CB  . VAL A 1 267  ? 17.431  71.572 44.474  1.00 53.13  ? 264  VAL A CB  1 
ATOM 2081 C CG1 . VAL A 1 267  ? 16.549  72.762 44.045  1.00 53.13  ? 264  VAL A CG1 1 
ATOM 2082 C CG2 . VAL A 1 267  ? 16.612  70.272 44.524  1.00 53.13  ? 264  VAL A CG2 1 
ATOM 2083 N N   . ASP A 1 268  ? 19.856  73.331 44.367  1.00 54.97  ? 265  ASP A N   1 
ATOM 2084 C CA  . ASP A 1 268  ? 20.609  74.553 44.241  1.00 54.97  ? 265  ASP A CA  1 
ATOM 2085 C C   . ASP A 1 268  ? 22.069  74.138 44.245  1.00 54.97  ? 265  ASP A C   1 
ATOM 2086 O O   . ASP A 1 268  ? 22.494  73.415 45.146  1.00 54.97  ? 265  ASP A O   1 
ATOM 2087 C CB  . ASP A 1 268  ? 20.329  75.491 45.422  1.00 74.55  ? 265  ASP A CB  1 
ATOM 2088 C CG  . ASP A 1 268  ? 18.845  75.588 45.767  1.00 74.55  ? 265  ASP A CG  1 
ATOM 2089 O OD1 . ASP A 1 268  ? 18.050  75.992 44.886  1.00 74.55  ? 265  ASP A OD1 1 
ATOM 2090 O OD2 . ASP A 1 268  ? 18.477  75.275 46.924  1.00 74.55  ? 265  ASP A OD2 1 
ATOM 2091 N N   . PRO A 1 269  ? 22.838  74.587 43.240  1.00 72.35  ? 266  PRO A N   1 
ATOM 2092 C CA  . PRO A 1 269  ? 24.288  74.451 43.057  1.00 72.35  ? 266  PRO A CA  1 
ATOM 2093 C C   . PRO A 1 269  ? 25.172  74.543 44.289  1.00 72.35  ? 266  PRO A C   1 
ATOM 2094 O O   . PRO A 1 269  ? 26.247  73.957 44.295  1.00 72.35  ? 266  PRO A O   1 
ATOM 2095 C CB  . PRO A 1 269  ? 24.623  75.605 42.109  1.00 32.90  ? 266  PRO A CB  1 
ATOM 2096 C CG  . PRO A 1 269  ? 23.432  75.592 41.170  1.00 32.90  ? 266  PRO A CG  1 
ATOM 2097 C CD  . PRO A 1 269  ? 22.229  75.296 42.104  1.00 32.90  ? 266  PRO A CD  1 
ATOM 2098 N N   . ASN A 1 270  ? 24.759  75.281 45.308  1.00 57.43  ? 267  ASN A N   1 
ATOM 2099 C CA  . ASN A 1 270  ? 25.600  75.417 46.498  1.00 57.43  ? 267  ASN A CA  1 
ATOM 2100 C C   . ASN A 1 270  ? 25.419  74.266 47.422  1.00 57.43  ? 267  ASN A C   1 
ATOM 2101 O O   . ASN A 1 270  ? 26.218  74.092 48.322  1.00 57.43  ? 267  ASN A O   1 
ATOM 2102 C CB  . ASN A 1 270  ? 25.318  76.709 47.260  1.00 71.95  ? 267  ASN A CB  1 
ATOM 2103 C CG  . ASN A 1 270  ? 23.896  77.117 47.161  1.00 71.95  ? 267  ASN A CG  1 
ATOM 2104 O OD1 . ASN A 1 270  ? 23.568  78.038 46.416  1.00 71.95  ? 267  ASN A OD1 1 
ATOM 2105 N ND2 . ASN A 1 270  ? 23.020  76.402 47.865  1.00 71.95  ? 267  ASN A ND2 1 
ATOM 2106 N N   . GLY A 1 271  ? 24.348  73.507 47.219  1.00 65.02  ? 268  GLY A N   1 
ATOM 2107 C CA  . GLY A 1 271  ? 24.098  72.297 47.990  1.00 65.02  ? 268  GLY A CA  1 
ATOM 2108 C C   . GLY A 1 271  ? 23.152  72.477 49.158  1.00 65.02  ? 268  GLY A C   1 
ATOM 2109 O O   . GLY A 1 271  ? 23.116  71.649 50.075  1.00 65.02  ? 268  GLY A O   1 
ATOM 2110 N N   . SER A 1 272  ? 22.381  73.558 49.131  1.00 53.43  ? 269  SER A N   1 
ATOM 2111 C CA  . SER A 1 272  ? 21.476  73.877 50.235  1.00 53.43  ? 269  SER A CA  1 
ATOM 2112 C C   . SER A 1 272  ? 20.297  72.905 50.283  1.00 53.43  ? 269  SER A C   1 
ATOM 2113 O O   . SER A 1 272  ? 19.918  72.450 51.379  1.00 53.43  ? 269  SER A O   1 
ATOM 2114 C CB  . SER A 1 272  ? 20.976  75.317 50.117  1.00 92.77  ? 269  SER A CB  1 
ATOM 2115 O OG  . SER A 1 272  ? 20.287  75.505 48.889  1.00 92.77  ? 269  SER A OG  1 
ATOM 2116 N N   . ARG A 1 273  ? 19.727  72.605 49.098  1.00 52.04  ? 270  ARG A N   1 
ATOM 2117 C CA  . ARG A 1 273  ? 18.569  71.694 48.965  1.00 52.04  ? 270  ARG A CA  1 
ATOM 2118 C C   . ARG A 1 273  ? 18.768  70.545 47.978  1.00 52.04  ? 270  ARG A C   1 
ATOM 2119 O O   . ARG A 1 273  ? 19.263  70.745 46.853  1.00 52.04  ? 270  ARG A O   1 
ATOM 2120 C CB  . ARG A 1 273  ? 17.312  72.476 48.581  1.00 49.12  ? 270  ARG A CB  1 
ATOM 2121 C CG  . ARG A 1 273  ? 16.984  73.675 49.519  1.00 49.12  ? 270  ARG A CG  1 
ATOM 2122 C CD  . ARG A 1 273  ? 15.798  74.520 49.050  1.00 49.12  ? 270  ARG A CD  1 
ATOM 2123 N NE  . ARG A 1 273  ? 15.954  74.988 47.682  1.00 49.12  ? 270  ARG A NE  1 
ATOM 2124 C CZ  . ARG A 1 273  ? 14.941  75.174 46.839  1.00 49.12  ? 270  ARG A CZ  1 
ATOM 2125 N NH1 . ARG A 1 273  ? 13.671  74.953 47.208  1.00 49.12  ? 270  ARG A NH1 1 
ATOM 2126 N NH2 . ARG A 1 273  ? 15.197  75.579 45.599  1.00 49.12  ? 270  ARG A NH2 1 
ATOM 2127 N N   . TYR A 1 274  ? 18.369  69.341 48.399  1.00 54.75  ? 271  TYR A N   1 
ATOM 2128 C CA  . TYR A 1 274  ? 18.378  68.139 47.526  1.00 54.75  ? 271  TYR A CA  1 
ATOM 2129 C C   . TYR A 1 274  ? 17.004  67.443 47.369  1.00 54.75  ? 271  TYR A C   1 
ATOM 2130 O O   . TYR A 1 274  ? 16.100  67.605 48.213  1.00 54.75  ? 271  TYR A O   1 
ATOM 2131 C CB  . TYR A 1 274  ? 19.389  67.108 48.042  1.00 63.57  ? 271  TYR A CB  1 
ATOM 2132 C CG  . TYR A 1 274  ? 20.841  67.427 47.767  1.00 63.57  ? 271  TYR A CG  1 
ATOM 2133 C CD1 . TYR A 1 274  ? 21.631  68.045 48.723  1.00 63.57  ? 271  TYR A CD1 1 
ATOM 2134 C CD2 . TYR A 1 274  ? 21.428  67.093 46.560  1.00 63.57  ? 271  TYR A CD2 1 
ATOM 2135 C CE1 . TYR A 1 274  ? 22.968  68.331 48.476  1.00 63.57  ? 271  TYR A CE1 1 
ATOM 2136 C CE2 . TYR A 1 274  ? 22.754  67.383 46.303  1.00 63.57  ? 271  TYR A CE2 1 
ATOM 2137 C CZ  . TYR A 1 274  ? 23.520  67.999 47.266  1.00 63.57  ? 271  TYR A CZ  1 
ATOM 2138 O OH  . TYR A 1 274  ? 24.839  68.274 47.020  1.00 63.57  ? 271  TYR A OH  1 
ATOM 2139 N N   . LEU A 1 275  ? 16.855  66.658 46.297  1.00 42.35  ? 272  LEU A N   1 
ATOM 2140 C CA  . LEU A 1 275  ? 15.703  65.750 46.156  1.00 42.35  ? 272  LEU A CA  1 
ATOM 2141 C C   . LEU A 1 275  ? 16.104  64.329 46.509  1.00 42.35  ? 272  LEU A C   1 
ATOM 2142 O O   . LEU A 1 275  ? 17.252  63.922 46.325  1.00 42.35  ? 272  LEU A O   1 
ATOM 2143 C CB  . LEU A 1 275  ? 15.099  65.814 44.753  1.00 44.76  ? 272  LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 275  ? 14.617  67.187 44.267  1.00 44.76  ? 272  LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 275  ? 14.251  67.191 42.791  1.00 44.76  ? 272  LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 275  ? 13.444  67.690 45.068  1.00 44.76  ? 272  LEU A CD2 1 
ATOM 2147 N N   . LEU A 1 276  ? 15.149  63.576 47.038  1.00 48.09  ? 273  LEU A N   1 
ATOM 2148 C CA  . LEU A 1 276  ? 15.389  62.225 47.554  1.00 48.09  ? 273  LEU A CA  1 
ATOM 2149 C C   . LEU A 1 276  ? 14.238  61.335 47.107  1.00 48.09  ? 273  LEU A C   1 
ATOM 2150 O O   . LEU A 1 276  ? 13.071  61.585 47.435  1.00 48.09  ? 273  LEU A O   1 
ATOM 2151 C CB  . LEU A 1 276  ? 15.508  62.247 49.086  1.00 57.07  ? 273  LEU A CB  1 
ATOM 2152 C CG  . LEU A 1 276  ? 16.845  62.701 49.688  1.00 57.07  ? 273  LEU A CG  1 
ATOM 2153 C CD1 . LEU A 1 276  ? 17.209  64.090 49.280  1.00 57.07  ? 273  LEU A CD1 1 
ATOM 2154 C CD2 . LEU A 1 276  ? 16.845  62.631 51.198  1.00 57.07  ? 273  LEU A CD2 1 
ATOM 2155 N N   . GLY A 1 277  ? 14.593  60.317 46.323  1.00 50.30  ? 274  GLY A N   1 
ATOM 2156 C CA  . GLY A 1 277  ? 13.656  59.368 45.725  1.00 50.30  ? 274  GLY A CA  1 
ATOM 2157 C C   . GLY A 1 277  ? 13.590  58.091 46.536  1.00 50.30  ? 274  GLY A C   1 
ATOM 2158 O O   . GLY A 1 277  ? 14.611  57.469 46.834  1.00 50.30  ? 274  GLY A O   1 
ATOM 2159 N N   . ASP A 1 278  ? 12.360  57.710 46.857  1.00 54.95  ? 275  ASP A N   1 
ATOM 2160 C CA  . ASP A 1 278  ? 12.000  56.697 47.833  1.00 54.95  ? 275  ASP A CA  1 
ATOM 2161 C C   . ASP A 1 278  ? 11.385  55.504 47.069  1.00 54.95  ? 275  ASP A C   1 
ATOM 2162 O O   . ASP A 1 278  ? 10.803  55.697 46.003  1.00 54.95  ? 275  ASP A O   1 
ATOM 2163 C CB  . ASP A 1 278  ? 10.978  57.385 48.742  1.00 91.00  ? 275  ASP A CB  1 
ATOM 2164 C CG  . ASP A 1 278  ? 10.369  56.483 49.749  1.00 91.00  ? 275  ASP A CG  1 
ATOM 2165 O OD1 . ASP A 1 278  ? 10.645  56.658 50.957  1.00 91.00  ? 275  ASP A OD1 1 
ATOM 2166 O OD2 . ASP A 1 278  ? 9.578   55.629 49.337  1.00 91.00  ? 275  ASP A OD2 1 
ATOM 2167 N N   . MET A 1 279  ? 11.494  54.282 47.593  1.00 47.66  ? 276  MET A N   1 
ATOM 2168 C CA  . MET A 1 279  ? 10.978  53.107 46.875  1.00 47.66  ? 276  MET A CA  1 
ATOM 2169 C C   . MET A 1 279  ? 9.460   53.104 46.777  1.00 47.66  ? 276  MET A C   1 
ATOM 2170 O O   . MET A 1 279  ? 8.888   52.372 45.959  1.00 47.66  ? 276  MET A O   1 
ATOM 2171 C CB  . MET A 1 279  ? 11.490  51.811 47.505  1.00 59.57  ? 276  MET A CB  1 
ATOM 2172 C CG  . MET A 1 279  ? 12.239  50.890 46.549  1.00 59.57  ? 276  MET A CG  1 
ATOM 2173 S SD  . MET A 1 279  ? 13.761  50.136 47.266  1.00 59.57  ? 276  MET A SD  1 
ATOM 2174 C CE  . MET A 1 279  ? 13.121  48.877 48.383  1.00 59.57  ? 276  MET A CE  1 
ATOM 2175 N N   . GLU A 1 280  ? 8.811   53.925 47.601  1.00 61.29  ? 277  GLU A N   1 
ATOM 2176 C CA  . GLU A 1 280  ? 7.350   54.045 47.620  1.00 61.29  ? 277  GLU A CA  1 
ATOM 2177 C C   . GLU A 1 280  ? 6.823   55.111 46.620  1.00 61.29  ? 277  GLU A C   1 
ATOM 2178 O O   . GLU A 1 280  ? 5.613   55.167 46.309  1.00 61.29  ? 277  GLU A O   1 
ATOM 2179 C CB  . GLU A 1 280  ? 6.882   54.354 49.044  1.00 126.16 ? 277  GLU A CB  1 
ATOM 2180 C CG  . GLU A 1 280  ? 5.509   53.832 49.389  1.00 126.16 ? 277  GLU A CG  1 
ATOM 2181 C CD  . GLU A 1 280  ? 5.463   52.321 49.463  1.00 126.16 ? 277  GLU A CD  1 
ATOM 2182 O OE1 . GLU A 1 280  ? 6.372   51.718 50.075  1.00 126.16 ? 277  GLU A OE1 1 
ATOM 2183 O OE2 . GLU A 1 280  ? 4.507   51.739 48.910  1.00 126.16 ? 277  GLU A OE2 1 
ATOM 2184 N N   . GLY A 1 281  ? 7.742   55.937 46.116  1.00 51.53  ? 278  GLY A N   1 
ATOM 2185 C CA  . GLY A 1 281  ? 7.422   56.986 45.159  1.00 51.53  ? 278  GLY A CA  1 
ATOM 2186 C C   . GLY A 1 281  ? 7.278   58.349 45.816  1.00 51.53  ? 278  GLY A C   1 
ATOM 2187 O O   . GLY A 1 281  ? 6.929   59.338 45.156  1.00 51.53  ? 278  GLY A O   1 
ATOM 2188 N N   . ARG A 1 282  ? 7.540   58.397 47.121  1.00 27.89  ? 279  ARG A N   1 
ATOM 2189 C CA  . ARG A 1 282  ? 7.449   59.642 47.907  1.00 27.89  ? 279  ARG A CA  1 
ATOM 2190 C C   . ARG A 1 282  ? 8.639   60.496 47.594  1.00 27.89  ? 279  ARG A C   1 
ATOM 2191 O O   . ARG A 1 282  ? 9.710   59.974 47.393  1.00 27.89  ? 279  ARG A O   1 
ATOM 2192 C CB  . ARG A 1 282  ? 7.380   59.320 49.393  1.00 51.91  ? 279  ARG A CB  1 
ATOM 2193 C CG  . ARG A 1 282  ? 6.155   58.495 49.738  1.00 51.91  ? 279  ARG A CG  1 
ATOM 2194 C CD  . ARG A 1 282  ? 6.446   57.514 50.827  1.00 51.91  ? 279  ARG A CD  1 
ATOM 2195 N NE  . ARG A 1 282  ? 6.933   58.182 52.029  1.00 51.91  ? 279  ARG A NE  1 
ATOM 2196 C CZ  . ARG A 1 282  ? 7.357   57.550 53.119  1.00 51.91  ? 279  ARG A CZ  1 
ATOM 2197 N NH1 . ARG A 1 282  ? 7.372   56.230 53.136  1.00 51.91  ? 279  ARG A NH1 1 
ATOM 2198 N NH2 . ARG A 1 282  ? 7.773   58.232 54.183  1.00 51.91  ? 279  ARG A NH2 1 
ATOM 2199 N N   . LEU A 1 283  ? 8.451   61.803 47.471  1.00 43.82  ? 280  LEU A N   1 
ATOM 2200 C CA  . LEU A 1 283  ? 9.568   62.694 47.152  1.00 43.82  ? 280  LEU A CA  1 
ATOM 2201 C C   . LEU A 1 283  ? 9.900   63.530 48.366  1.00 43.82  ? 280  LEU A C   1 
ATOM 2202 O O   . LEU A 1 283  ? 9.012   64.066 49.008  1.00 43.82  ? 280  LEU A O   1 
ATOM 2203 C CB  . LEU A 1 283  ? 9.227   63.590 45.971  1.00 29.79  ? 280  LEU A CB  1 
ATOM 2204 C CG  . LEU A 1 283  ? 10.332  64.544 45.482  1.00 29.79  ? 280  LEU A CG  1 
ATOM 2205 C CD1 . LEU A 1 283  ? 11.615  63.792 45.386  1.00 29.79  ? 280  LEU A CD1 1 
ATOM 2206 C CD2 . LEU A 1 283  ? 10.057  65.225 44.144  1.00 29.79  ? 280  LEU A CD2 1 
ATOM 2207 N N   . PHE A 1 284  ? 11.173  63.632 48.706  1.00 56.05  ? 281  PHE A N   1 
ATOM 2208 C CA  . PHE A 1 284  ? 11.549  64.462 49.836  1.00 56.05  ? 281  PHE A CA  1 
ATOM 2209 C C   . PHE A 1 284  ? 12.382  65.637 49.403  1.00 56.05  ? 281  PHE A C   1 
ATOM 2210 O O   . PHE A 1 284  ? 12.884  65.675 48.279  1.00 56.05  ? 281  PHE A O   1 
ATOM 2211 C CB  . PHE A 1 284  ? 12.292  63.642 50.875  1.00 55.51  ? 281  PHE A CB  1 
ATOM 2212 C CG  . PHE A 1 284  ? 11.458  62.544 51.482  1.00 55.51  ? 281  PHE A CG  1 
ATOM 2213 C CD1 . PHE A 1 284  ? 11.452  61.270 50.928  1.00 55.51  ? 281  PHE A CD1 1 
ATOM 2214 C CD2 . PHE A 1 284  ? 10.677  62.789 52.607  1.00 55.51  ? 281  PHE A CD2 1 
ATOM 2215 C CE1 . PHE A 1 284  ? 10.692  60.263 51.490  1.00 55.51  ? 281  PHE A CE1 1 
ATOM 2216 C CE2 . PHE A 1 284  ? 9.910   61.785 53.174  1.00 55.51  ? 281  PHE A CE2 1 
ATOM 2217 C CZ  . PHE A 1 284  ? 9.908   60.524 52.621  1.00 55.51  ? 281  PHE A CZ  1 
ATOM 2218 N N   . MET A 1 285  ? 12.491  66.623 50.285  1.00 53.40  ? 282  MET A N   1 
ATOM 2219 C CA  . MET A 1 285  ? 13.481  67.675 50.120  1.00 53.40  ? 282  MET A CA  1 
ATOM 2220 C C   . MET A 1 285  ? 14.358  67.570 51.320  1.00 53.40  ? 282  MET A C   1 
ATOM 2221 O O   . MET A 1 285  ? 13.886  67.531 52.450  1.00 53.40  ? 282  MET A O   1 
ATOM 2222 C CB  . MET A 1 285  ? 12.860  69.050 50.070  1.00 52.71  ? 282  MET A CB  1 
ATOM 2223 C CG  . MET A 1 285  ? 13.848  70.118 49.741  1.00 52.71  ? 282  MET A CG  1 
ATOM 2224 S SD  . MET A 1 285  ? 14.192  70.228 47.978  1.00 52.71  ? 282  MET A SD  1 
ATOM 2225 C CE  . MET A 1 285  ? 12.726  71.067 47.364  1.00 52.71  ? 282  MET A CE  1 
ATOM 2226 N N   . LEU A 1 286  ? 15.647  67.464 51.055  1.00 45.49  ? 283  LEU A N   1 
ATOM 2227 C CA  . LEU A 1 286  ? 16.644  67.450 52.089  1.00 45.49  ? 283  LEU A CA  1 
ATOM 2228 C C   . LEU A 1 286  ? 17.212  68.859 52.089  1.00 45.49  ? 283  LEU A C   1 
ATOM 2229 O O   . LEU A 1 286  ? 17.606  69.399 51.043  1.00 45.49  ? 283  LEU A O   1 
ATOM 2230 C CB  . LEU A 1 286  ? 17.693  66.383 51.805  1.00 53.26  ? 283  LEU A CB  1 
ATOM 2231 C CG  . LEU A 1 286  ? 19.013  66.325 52.568  1.00 53.26  ? 283  LEU A CG  1 
ATOM 2232 C CD1 . LEU A 1 286  ? 18.850  65.927 54.055  1.00 53.26  ? 283  LEU A CD1 1 
ATOM 2233 C CD2 . LEU A 1 286  ? 19.917  65.356 51.857  1.00 53.26  ? 283  LEU A CD2 1 
ATOM 2234 N N   . LEU A 1 287  ? 17.191  69.460 53.269  1.00 63.91  ? 284  LEU A N   1 
ATOM 2235 C CA  . LEU A 1 287  ? 17.513  70.856 53.424  1.00 63.91  ? 284  LEU A CA  1 
ATOM 2236 C C   . LEU A 1 287  ? 18.728  71.019 54.328  1.00 63.91  ? 284  LEU A C   1 
ATOM 2237 O O   . LEU A 1 287  ? 18.761  70.522 55.462  1.00 63.91  ? 284  LEU A O   1 
ATOM 2238 C CB  . LEU A 1 287  ? 16.297  71.593 53.978  1.00 40.02  ? 284  LEU A CB  1 
ATOM 2239 C CG  . LEU A 1 287  ? 15.209  71.838 52.921  1.00 40.02  ? 284  LEU A CG  1 
ATOM 2240 C CD1 . LEU A 1 287  ? 13.843  71.358 53.360  1.00 40.02  ? 284  LEU A CD1 1 
ATOM 2241 C CD2 . LEU A 1 287  ? 15.148  73.290 52.513  1.00 40.02  ? 284  LEU A CD2 1 
ATOM 2242 N N   . LEU A 1 288  ? 19.738  71.695 53.793  1.00 62.47  ? 285  LEU A N   1 
ATOM 2243 C CA  . LEU A 1 288  ? 20.951  71.968 54.536  1.00 62.47  ? 285  LEU A CA  1 
ATOM 2244 C C   . LEU A 1 288  ? 20.866  73.356 55.165  1.00 62.47  ? 285  LEU A C   1 
ATOM 2245 O O   . LEU A 1 288  ? 20.978  74.380 54.463  1.00 62.47  ? 285  LEU A O   1 
ATOM 2246 C CB  . LEU A 1 288  ? 22.197  71.835 53.639  1.00 58.06  ? 285  LEU A CB  1 
ATOM 2247 C CG  . LEU A 1 288  ? 22.941  70.478 53.535  1.00 58.06  ? 285  LEU A CG  1 
ATOM 2248 C CD1 . LEU A 1 288  ? 22.043  69.282 53.188  1.00 58.06  ? 285  LEU A CD1 1 
ATOM 2249 C CD2 . LEU A 1 288  ? 24.082  70.571 52.534  1.00 58.06  ? 285  LEU A CD2 1 
ATOM 2250 N N   . GLU A 1 289  ? 20.664  73.382 56.487  1.00 48.83  ? 286  GLU A N   1 
ATOM 2251 C CA  . GLU A 1 289  ? 20.630  74.633 57.219  1.00 48.83  ? 286  GLU A CA  1 
ATOM 2252 C C   . GLU A 1 289  ? 22.031  75.218 57.248  1.00 48.83  ? 286  GLU A C   1 
ATOM 2253 O O   . GLU A 1 289  ? 22.890  74.731 57.980  1.00 48.83  ? 286  GLU A O   1 
ATOM 2254 C CB  . GLU A 1 289  ? 20.076  74.435 58.642  1.00 71.13  ? 286  GLU A CB  1 
ATOM 2255 C CG  . GLU A 1 289  ? 18.904  75.394 59.044  1.00 71.13  ? 286  GLU A CG  1 
ATOM 2256 C CD  . GLU A 1 289  ? 19.229  76.878 58.869  1.00 71.13  ? 286  GLU A CD  1 
ATOM 2257 O OE1 . GLU A 1 289  ? 19.560  77.289 57.729  1.00 71.13  ? 286  GLU A OE1 1 
ATOM 2258 O OE2 . GLU A 1 289  ? 19.142  77.639 59.868  1.00 71.13  ? 286  GLU A OE2 1 
ATOM 2259 N N   . LYS A 1 290  ? 22.242  76.244 56.425  1.00 85.56  ? 287  LYS A N   1 
ATOM 2260 C CA  . LYS A 1 290  ? 23.520  76.951 56.292  1.00 85.56  ? 287  LYS A CA  1 
ATOM 2261 C C   . LYS A 1 290  ? 23.592  78.127 57.284  1.00 85.56  ? 287  LYS A C   1 
ATOM 2262 O O   . LYS A 1 290  ? 22.567  78.726 57.613  1.00 85.56  ? 287  LYS A O   1 
ATOM 2263 C CB  . LYS A 1 290  ? 23.663  77.404 54.831  1.00 73.71  ? 287  LYS A CB  1 
ATOM 2264 C CG  . LYS A 1 290  ? 24.328  78.742 54.562  1.00 73.71  ? 287  LYS A CG  1 
ATOM 2265 C CD  . LYS A 1 290  ? 23.853  79.328 53.236  1.00 73.71  ? 287  LYS A CD  1 
ATOM 2266 C CE  . LYS A 1 290  ? 24.357  78.536 52.003  1.00 73.71  ? 287  LYS A CE  1 
ATOM 2267 N NZ  . LYS A 1 290  ? 23.513  78.746 50.755  1.00 73.71  ? 287  LYS A NZ  1 
ATOM 2268 N N   . GLU A 1 291  ? 24.786  78.455 57.772  1.00 166.51 ? 288  GLU A N   1 
ATOM 2269 C CA  . GLU A 1 291  ? 24.898  79.444 58.845  1.00 166.51 ? 288  GLU A CA  1 
ATOM 2270 C C   . GLU A 1 291  ? 26.136  80.343 58.760  1.00 166.51 ? 288  GLU A C   1 
ATOM 2271 O O   . GLU A 1 291  ? 27.268  79.862 58.720  1.00 166.51 ? 288  GLU A O   1 
ATOM 2272 C CB  . GLU A 1 291  ? 24.834  78.736 60.197  1.00 96.00  ? 288  GLU A CB  1 
ATOM 2273 C CG  . GLU A 1 291  ? 24.838  79.662 61.384  1.00 96.00  ? 288  GLU A CG  1 
ATOM 2274 C CD  . GLU A 1 291  ? 25.717  79.139 62.480  1.00 96.00  ? 288  GLU A CD  1 
ATOM 2275 O OE1 . GLU A 1 291  ? 25.193  78.837 63.571  1.00 96.00  ? 288  GLU A OE1 1 
ATOM 2276 O OE2 . GLU A 1 291  ? 26.931  79.012 62.235  1.00 96.00  ? 288  GLU A OE2 1 
ATOM 2277 N N   . GLU A 1 292  ? 25.896  81.653 58.764  1.00 176.52 ? 289  GLU A N   1 
ATOM 2278 C CA  . GLU A 1 292  ? 26.945  82.658 58.579  1.00 176.52 ? 289  GLU A CA  1 
ATOM 2279 C C   . GLU A 1 292  ? 27.724  82.962 59.863  1.00 176.52 ? 289  GLU A C   1 
ATOM 2280 O O   . GLU A 1 292  ? 27.153  82.988 60.959  1.00 176.52 ? 289  GLU A O   1 
ATOM 2281 C CB  . GLU A 1 292  ? 26.343  83.947 58.006  1.00 157.48 ? 289  GLU A CB  1 
ATOM 2282 C CG  . GLU A 1 292  ? 27.344  84.858 57.294  1.00 157.48 ? 289  GLU A CG  1 
ATOM 2283 C CD  . GLU A 1 292  ? 26.680  85.861 56.359  1.00 157.48 ? 289  GLU A CD  1 
ATOM 2284 O OE1 . GLU A 1 292  ? 25.463  85.736 56.097  1.00 157.48 ? 289  GLU A OE1 1 
ATOM 2285 O OE2 . GLU A 1 292  ? 27.381  86.777 55.878  1.00 157.48 ? 289  GLU A OE2 1 
ATOM 2286 N N   . GLN A 1 293  ? 29.030  83.191 59.706  1.00 197.37 ? 290  GLN A N   1 
ATOM 2287 C CA  . GLN A 1 293  ? 29.924  83.523 60.821  1.00 197.37 ? 290  GLN A CA  1 
ATOM 2288 C C   . GLN A 1 293  ? 29.976  84.900 60.161  1.00 197.37 ? 290  GLN A C   1 
ATOM 2289 O O   . GLN A 1 293  ? 28.930  85.397 59.727  1.00 197.37 ? 290  GLN A O   1 
ATOM 2290 C CB  . GLN A 1 293  ? 30.784  82.321 61.217  1.00 99.84  ? 290  GLN A CB  1 
ATOM 2291 C CG  . GLN A 1 293  ? 30.079  81.059 61.617  1.00 99.84  ? 290  GLN A CG  1 
ATOM 2292 C CD  . GLN A 1 293  ? 31.040  79.882 61.595  1.00 99.84  ? 290  GLN A CD  1 
ATOM 2293 O OE1 . GLN A 1 293  ? 31.815  79.728 60.648  1.00 99.84  ? 290  GLN A OE1 1 
ATOM 2294 N NE2 . GLN A 1 293  ? 31.006  79.052 62.644  1.00 99.84  ? 290  GLN A NE2 1 
ATOM 2295 N N   . MET A 1 294  ? 31.159  85.515 60.077  1.00 201.87 ? 291  MET A N   1 
ATOM 2296 C CA  . MET A 1 294  ? 31.298  86.856 59.482  1.00 201.87 ? 291  MET A CA  1 
ATOM 2297 C C   . MET A 1 294  ? 32.514  86.360 58.692  1.00 201.87 ? 291  MET A C   1 
ATOM 2298 O O   . MET A 1 294  ? 32.480  86.285 57.461  1.00 201.87 ? 291  MET A O   1 
ATOM 2299 C CB  . MET A 1 294  ? 31.772  87.643 60.715  1.00 201.87 ? 291  MET A CB  1 
ATOM 2300 C CG  . MET A 1 294  ? 31.047  88.951 60.997  1.00 201.87 ? 291  MET A CG  1 
ATOM 2301 S SD  . MET A 1 294  ? 31.730  89.793 62.451  1.00 201.87 ? 291  MET A SD  1 
ATOM 2302 C CE  . MET A 1 294  ? 33.434  90.086 61.956  1.00 201.87 ? 291  MET A CE  1 
ATOM 2303 N N   . ASP A 1 295  ? 33.579  86.023 59.424  1.00 186.13 ? 292  ASP A N   1 
ATOM 2304 C CA  . ASP A 1 295  ? 34.793  85.433 58.869  1.00 186.13 ? 292  ASP A CA  1 
ATOM 2305 C C   . ASP A 1 295  ? 35.054  84.077 59.518  1.00 186.13 ? 292  ASP A C   1 
ATOM 2306 O O   . ASP A 1 295  ? 35.224  83.982 60.739  1.00 186.13 ? 292  ASP A O   1 
ATOM 2307 C CB  . ASP A 1 295  ? 35.993  86.361 59.090  1.00 135.30 ? 292  ASP A CB  1 
ATOM 2308 C CG  . ASP A 1 295  ? 35.747  87.770 58.582  1.00 135.30 ? 292  ASP A CG  1 
ATOM 2309 O OD1 . ASP A 1 295  ? 35.212  87.918 57.461  1.00 135.30 ? 292  ASP A OD1 1 
ATOM 2310 O OD2 . ASP A 1 295  ? 36.092  88.728 59.311  1.00 135.30 ? 292  ASP A OD2 1 
ATOM 2311 N N   . GLY A 1 296  ? 35.144  83.073 58.650  1.00 189.02 ? 293  GLY A N   1 
ATOM 2312 C CA  . GLY A 1 296  ? 35.505  81.704 58.964  1.00 189.02 ? 293  GLY A CA  1 
ATOM 2313 C C   . GLY A 1 296  ? 35.330  80.992 57.636  1.00 189.02 ? 293  GLY A C   1 
ATOM 2314 O O   . GLY A 1 296  ? 36.172  81.090 56.743  1.00 189.02 ? 293  GLY A O   1 
ATOM 2315 N N   . THR A 1 297  ? 34.211  80.293 57.508  1.00 201.87 ? 294  THR A N   1 
ATOM 2316 C CA  . THR A 1 297  ? 33.622  79.914 56.204  1.00 201.87 ? 294  THR A CA  1 
ATOM 2317 C C   . THR A 1 297  ? 32.161  79.615 56.585  1.00 201.87 ? 294  THR A C   1 
ATOM 2318 O O   . THR A 1 297  ? 31.860  79.299 57.739  1.00 201.87 ? 294  THR A O   1 
ATOM 2319 C CB  . THR A 1 297  ? 34.465  78.611 55.943  1.00 130.74 ? 294  THR A CB  1 
ATOM 2320 O OG1 . THR A 1 297  ? 35.475  78.887 54.962  1.00 130.74 ? 294  THR A OG1 1 
ATOM 2321 C CG2 . THR A 1 297  ? 33.603  77.453 55.432  1.00 130.74 ? 294  THR A CG2 1 
ATOM 2322 N N   . VAL A 1 298  ? 31.263  79.732 55.603  1.00 137.72 ? 295  VAL A N   1 
ATOM 2323 C CA  . VAL A 1 298  ? 29.850  79.361 55.776  1.00 137.72 ? 295  VAL A CA  1 
ATOM 2324 C C   . VAL A 1 298  ? 29.742  77.880 56.167  1.00 137.72 ? 295  VAL A C   1 
ATOM 2325 O O   . VAL A 1 298  ? 30.389  77.023 55.560  1.00 137.72 ? 295  VAL A O   1 
ATOM 2326 C CB  . VAL A 1 298  ? 28.979  79.696 54.517  1.00 147.29 ? 295  VAL A CB  1 
ATOM 2327 C CG1 . VAL A 1 298  ? 28.894  81.207 54.299  1.00 147.29 ? 295  VAL A CG1 1 
ATOM 2328 C CG2 . VAL A 1 298  ? 29.515  79.010 53.254  1.00 147.29 ? 295  VAL A CG2 1 
ATOM 2329 N N   . THR A 1 299  ? 28.940  77.591 57.190  1.00 98.26  ? 296  THR A N   1 
ATOM 2330 C CA  . THR A 1 299  ? 28.968  76.278 57.851  1.00 98.26  ? 296  THR A CA  1 
ATOM 2331 C C   . THR A 1 299  ? 27.669  75.479 57.685  1.00 98.26  ? 296  THR A C   1 
ATOM 2332 O O   . THR A 1 299  ? 26.769  75.898 56.960  1.00 98.26  ? 296  THR A O   1 
ATOM 2333 C CB  . THR A 1 299  ? 29.317  76.427 59.357  1.00 143.50 ? 296  THR A CB  1 
ATOM 2334 O OG1 . THR A 1 299  ? 29.560  75.136 59.932  1.00 143.50 ? 296  THR A OG1 1 
ATOM 2335 C CG2 . THR A 1 299  ? 28.189  77.120 60.119  1.00 143.50 ? 296  THR A CG2 1 
ATOM 2336 N N   . LEU A 1 300  ? 27.589  74.322 58.341  1.00 94.87  ? 297  LEU A N   1 
ATOM 2337 C CA  . LEU A 1 300  ? 26.343  73.555 58.425  1.00 94.87  ? 297  LEU A CA  1 
ATOM 2338 C C   . LEU A 1 300  ? 25.757  73.593 59.848  1.00 94.87  ? 297  LEU A C   1 
ATOM 2339 O O   . LEU A 1 300  ? 26.371  73.119 60.819  1.00 94.87  ? 297  LEU A O   1 
ATOM 2340 C CB  . LEU A 1 300  ? 26.545  72.102 57.953  1.00 124.33 ? 297  LEU A CB  1 
ATOM 2341 C CG  . LEU A 1 300  ? 25.345  71.141 58.038  1.00 124.33 ? 297  LEU A CG  1 
ATOM 2342 C CD1 . LEU A 1 300  ? 24.455  71.201 56.803  1.00 124.33 ? 297  LEU A CD1 1 
ATOM 2343 C CD2 . LEU A 1 300  ? 25.807  69.727 58.263  1.00 124.33 ? 297  LEU A CD2 1 
ATOM 2344 N N   . LYS A 1 301  ? 24.562  74.151 59.972  1.00 55.69  ? 298  LYS A N   1 
ATOM 2345 C CA  . LYS A 1 301  ? 23.942  74.210 61.269  1.00 55.69  ? 298  LYS A CA  1 
ATOM 2346 C C   . LYS A 1 301  ? 23.237  72.907 61.535  1.00 55.69  ? 298  LYS A C   1 
ATOM 2347 O O   . LYS A 1 301  ? 23.532  72.230 62.523  1.00 55.69  ? 298  LYS A O   1 
ATOM 2348 C CB  . LYS A 1 301  ? 22.956  75.386 61.338  1.00 110.05 ? 298  LYS A CB  1 
ATOM 2349 C CG  . LYS A 1 301  ? 22.092  75.455 62.597  1.00 110.05 ? 298  LYS A CG  1 
ATOM 2350 C CD  . LYS A 1 301  ? 20.998  76.512 62.429  1.00 110.05 ? 298  LYS A CD  1 
ATOM 2351 C CE  . LYS A 1 301  ? 19.674  76.093 63.080  1.00 110.05 ? 298  LYS A CE  1 
ATOM 2352 N NZ  . LYS A 1 301  ? 19.043  74.896 62.435  1.00 110.05 ? 298  LYS A NZ  1 
ATOM 2353 N N   . ASP A 1 302  ? 22.298  72.562 60.656  1.00 72.05  ? 299  ASP A N   1 
ATOM 2354 C CA  . ASP A 1 302  ? 21.395  71.448 60.899  1.00 72.05  ? 299  ASP A CA  1 
ATOM 2355 C C   . ASP A 1 302  ? 20.972  70.795 59.555  1.00 72.05  ? 299  ASP A C   1 
ATOM 2356 O O   . ASP A 1 302  ? 21.168  71.388 58.467  1.00 72.05  ? 299  ASP A O   1 
ATOM 2357 C CB  . ASP A 1 302  ? 20.186  71.949 61.723  1.00 70.08  ? 299  ASP A CB  1 
ATOM 2358 C CG  . ASP A 1 302  ? 19.404  70.817 62.422  1.00 70.08  ? 299  ASP A CG  1 
ATOM 2359 O OD1 . ASP A 1 302  ? 18.172  70.980 62.629  1.00 70.08  ? 299  ASP A OD1 1 
ATOM 2360 O OD2 . ASP A 1 302  ? 19.991  69.769 62.764  1.00 70.08  ? 299  ASP A OD2 1 
ATOM 2361 N N   . LEU A 1 303  ? 20.439  69.566 59.647  1.00 63.75  ? 300  LEU A N   1 
ATOM 2362 C CA  . LEU A 1 303  ? 19.824  68.861 58.519  1.00 63.75  ? 300  LEU A CA  1 
ATOM 2363 C C   . LEU A 1 303  ? 18.335  68.650 58.716  1.00 63.75  ? 300  LEU A C   1 
ATOM 2364 O O   . LEU A 1 303  ? 17.885  68.362 59.827  1.00 63.75  ? 300  LEU A O   1 
ATOM 2365 C CB  . LEU A 1 303  ? 20.474  67.487 58.286  1.00 68.21  ? 300  LEU A CB  1 
ATOM 2366 C CG  . LEU A 1 303  ? 21.519  67.358 57.184  1.00 68.21  ? 300  LEU A CG  1 
ATOM 2367 C CD1 . LEU A 1 303  ? 21.491  68.597 56.299  1.00 68.21  ? 300  LEU A CD1 1 
ATOM 2368 C CD2 . LEU A 1 303  ? 22.879  67.185 57.796  1.00 68.21  ? 300  LEU A CD2 1 
ATOM 2369 N N   . ARG A 1 304  ? 17.588  68.765 57.616  1.00 62.75  ? 301  ARG A N   1 
ATOM 2370 C CA  . ARG A 1 304  ? 16.130  68.623 57.603  1.00 62.75  ? 301  ARG A CA  1 
ATOM 2371 C C   . ARG A 1 304  ? 15.581  67.999 56.287  1.00 62.75  ? 301  ARG A C   1 
ATOM 2372 O O   . ARG A 1 304  ? 16.189  68.101 55.214  1.00 62.75  ? 301  ARG A O   1 
ATOM 2373 C CB  . ARG A 1 304  ? 15.499  69.990 57.871  1.00 53.52  ? 301  ARG A CB  1 
ATOM 2374 C CG  . ARG A 1 304  ? 14.055  69.983 58.370  1.00 53.52  ? 301  ARG A CG  1 
ATOM 2375 C CD  . ARG A 1 304  ? 13.569  71.416 58.703  1.00 53.52  ? 301  ARG A CD  1 
ATOM 2376 N NE  . ARG A 1 304  ? 14.222  72.412 57.858  1.00 53.52  ? 301  ARG A NE  1 
ATOM 2377 C CZ  . ARG A 1 304  ? 13.649  73.046 56.844  1.00 53.52  ? 301  ARG A CZ  1 
ATOM 2378 N NH1 . ARG A 1 304  ? 12.373  72.842 56.549  1.00 53.52  ? 301  ARG A NH1 1 
ATOM 2379 N NH2 . ARG A 1 304  ? 14.359  73.909 56.127  1.00 53.52  ? 301  ARG A NH2 1 
ATOM 2380 N N   . VAL A 1 305  ? 14.414  67.367 56.416  1.00 57.34  ? 302  VAL A N   1 
ATOM 2381 C CA  . VAL A 1 305  ? 13.692  66.661 55.365  1.00 57.34  ? 302  VAL A CA  1 
ATOM 2382 C C   . VAL A 1 305  ? 12.239  67.154 55.333  1.00 57.34  ? 302  VAL A C   1 
ATOM 2383 O O   . VAL A 1 305  ? 11.570  67.170 56.350  1.00 57.34  ? 302  VAL A O   1 
ATOM 2384 C CB  . VAL A 1 305  ? 13.698  65.131 55.680  1.00 50.32  ? 302  VAL A CB  1 
ATOM 2385 C CG1 . VAL A 1 305  ? 12.585  64.398 54.964  1.00 50.32  ? 302  VAL A CG1 1 
ATOM 2386 C CG2 . VAL A 1 305  ? 15.058  64.493 55.367  1.00 50.32  ? 302  VAL A CG2 1 
ATOM 2387 N N   . GLU A 1 306  ? 11.761  67.576 54.167  1.00 53.98  ? 303  GLU A N   1 
ATOM 2388 C CA  . GLU A 1 306  ? 10.335  67.813 53.940  1.00 53.98  ? 303  GLU A CA  1 
ATOM 2389 C C   . GLU A 1 306  ? 9.765   66.777 52.970  1.00 53.98  ? 303  GLU A C   1 
ATOM 2390 O O   . GLU A 1 306  ? 10.227  66.671 51.818  1.00 53.98  ? 303  GLU A O   1 
ATOM 2391 C CB  . GLU A 1 306  ? 10.086  69.184 53.320  1.00 72.97  ? 303  GLU A CB  1 
ATOM 2392 C CG  . GLU A 1 306  ? 10.798  70.332 53.965  1.00 72.97  ? 303  GLU A CG  1 
ATOM 2393 C CD  . GLU A 1 306  ? 10.301  70.608 55.347  1.00 72.97  ? 303  GLU A CD  1 
ATOM 2394 O OE1 . GLU A 1 306  ? 10.491  71.741 55.825  1.00 72.97  ? 303  GLU A OE1 1 
ATOM 2395 O OE2 . GLU A 1 306  ? 9.707   69.699 55.952  1.00 72.97  ? 303  GLU A OE2 1 
ATOM 2396 N N   . LEU A 1 307  ? 8.751   66.034 53.425  1.00 55.35  ? 304  LEU A N   1 
ATOM 2397 C CA  . LEU A 1 307  ? 7.914   65.240 52.537  1.00 55.35  ? 304  LEU A CA  1 
ATOM 2398 C C   . LEU A 1 307  ? 7.193   66.152 51.520  1.00 55.35  ? 304  LEU A C   1 
ATOM 2399 O O   . LEU A 1 307  ? 6.194   66.795 51.829  1.00 55.35  ? 304  LEU A O   1 
ATOM 2400 C CB  . LEU A 1 307  ? 6.937   64.386 53.357  1.00 49.63  ? 304  LEU A CB  1 
ATOM 2401 C CG  . LEU A 1 307  ? 5.856   63.543 52.649  1.00 49.63  ? 304  LEU A CG  1 
ATOM 2402 C CD1 . LEU A 1 307  ? 6.331   62.898 51.308  1.00 49.63  ? 304  LEU A CD1 1 
ATOM 2403 C CD2 . LEU A 1 307  ? 5.257   62.488 53.559  1.00 49.63  ? 304  LEU A CD2 1 
ATOM 2404 N N   . LEU A 1 308  ? 7.732   66.219 50.310  1.00 57.70  ? 305  LEU A N   1 
ATOM 2405 C CA  . LEU A 1 308  ? 7.127   67.005 49.244  1.00 57.70  ? 305  LEU A CA  1 
ATOM 2406 C C   . LEU A 1 308  ? 5.863   66.424 48.608  1.00 57.70  ? 305  LEU A C   1 
ATOM 2407 O O   . LEU A 1 308  ? 5.006   67.193 48.139  1.00 57.70  ? 305  LEU A O   1 
ATOM 2408 C CB  . LEU A 1 308  ? 8.133   67.275 48.137  1.00 41.55  ? 305  LEU A CB  1 
ATOM 2409 C CG  . LEU A 1 308  ? 9.303   68.239 48.412  1.00 41.55  ? 305  LEU A CG  1 
ATOM 2410 C CD1 . LEU A 1 308  ? 9.786   68.852 47.081  1.00 41.55  ? 305  LEU A CD1 1 
ATOM 2411 C CD2 . LEU A 1 308  ? 8.958   69.331 49.414  1.00 41.55  ? 305  LEU A CD2 1 
ATOM 2412 N N   . GLY A 1 309  ? 5.749   65.092 48.575  1.00 38.49  ? 306  GLY A N   1 
ATOM 2413 C CA  . GLY A 1 309  ? 4.605   64.442 47.938  1.00 38.49  ? 306  GLY A CA  1 
ATOM 2414 C C   . GLY A 1 309  ? 4.885   63.100 47.272  1.00 38.49  ? 306  GLY A C   1 
ATOM 2415 O O   . GLY A 1 309  ? 5.670   62.289 47.776  1.00 38.49  ? 306  GLY A O   1 
ATOM 2416 N N   . GLU A 1 310  ? 4.231   62.859 46.139  1.00 40.83  ? 307  GLU A N   1 
ATOM 2417 C CA  . GLU A 1 310  ? 4.288   61.557 45.473  1.00 40.83  ? 307  GLU A CA  1 
ATOM 2418 C C   . GLU A 1 310  ? 4.577   61.650 43.959  1.00 40.83  ? 307  GLU A C   1 
ATOM 2419 O O   . GLU A 1 310  ? 3.884   62.324 43.205  1.00 40.83  ? 307  GLU A O   1 
ATOM 2420 C CB  . GLU A 1 310  ? 2.998   60.787 45.754  1.00 56.62  ? 307  GLU A CB  1 
ATOM 2421 C CG  . GLU A 1 310  ? 2.581   59.820 44.670  1.00 56.62  ? 307  GLU A CG  1 
ATOM 2422 C CD  . GLU A 1 310  ? 1.829   58.617 45.214  1.00 56.62  ? 307  GLU A CD  1 
ATOM 2423 O OE1 . GLU A 1 310  ? 1.052   57.999 44.436  1.00 56.62  ? 307  GLU A OE1 1 
ATOM 2424 O OE2 . GLU A 1 310  ? 2.043   58.286 46.426  1.00 56.62  ? 307  GLU A OE2 1 
ATOM 2425 N N   . THR A 1 311  ? 5.635   60.983 43.527  1.00 40.90  ? 308  THR A N   1 
ATOM 2426 C CA  . THR A 1 311  ? 5.874   60.795 42.107  1.00 40.90  ? 308  THR A CA  1 
ATOM 2427 C C   . THR A 1 311  ? 5.714   59.326 41.744  1.00 40.90  ? 308  THR A C   1 
ATOM 2428 O O   . THR A 1 311  ? 5.415   58.484 42.602  1.00 40.90  ? 308  THR A O   1 
ATOM 2429 C CB  . THR A 1 311  ? 7.267   61.210 41.722  1.00 46.62  ? 308  THR A CB  1 
ATOM 2430 O OG1 . THR A 1 311  ? 8.190   60.318 42.352  1.00 46.62  ? 308  THR A OG1 1 
ATOM 2431 C CG2 . THR A 1 311  ? 7.526   62.658 42.127  1.00 46.62  ? 308  THR A CG2 1 
ATOM 2432 N N   . SER A 1 312  ? 5.885   59.018 40.470  1.00 31.10  ? 309  SER A N   1 
ATOM 2433 C CA  . SER A 1 312  ? 6.016   57.628 40.087  1.00 31.10  ? 309  SER A CA  1 
ATOM 2434 C C   . SER A 1 312  ? 7.372   57.171 40.612  1.00 31.10  ? 309  SER A C   1 
ATOM 2435 O O   . SER A 1 312  ? 8.283   57.999 40.783  1.00 31.10  ? 309  SER A O   1 
ATOM 2436 C CB  . SER A 1 312  ? 5.925   57.466 38.588  1.00 42.30  ? 309  SER A CB  1 
ATOM 2437 O OG  . SER A 1 312  ? 6.870   58.322 37.998  1.00 42.30  ? 309  SER A OG  1 
ATOM 2438 N N   . ILE A 1 313  ? 7.479   55.874 40.913  1.00 39.78  ? 310  ILE A N   1 
ATOM 2439 C CA  . ILE A 1 313  ? 8.693   55.292 41.493  1.00 39.78  ? 310  ILE A CA  1 
ATOM 2440 C C   . ILE A 1 313  ? 9.951   55.644 40.683  1.00 39.78  ? 310  ILE A C   1 
ATOM 2441 O O   . ILE A 1 313  ? 10.154  55.203 39.543  1.00 39.78  ? 310  ILE A O   1 
ATOM 2442 C CB  . ILE A 1 313  ? 8.598   53.785 41.674  1.00 25.50  ? 310  ILE A CB  1 
ATOM 2443 C CG1 . ILE A 1 313  ? 7.296   53.393 42.403  1.00 25.50  ? 310  ILE A CG1 1 
ATOM 2444 C CG2 . ILE A 1 313  ? 9.809   53.299 42.467  1.00 25.50  ? 310  ILE A CG2 1 
ATOM 2445 C CD1 . ILE A 1 313  ? 7.190   51.817 42.782  1.00 25.50  ? 310  ILE A CD1 1 
ATOM 2446 N N   . ALA A 1 314  ? 10.772  56.473 41.304  1.00 40.62  ? 311  ALA A N   1 
ATOM 2447 C CA  . ALA A 1 314  ? 11.888  57.091 40.634  1.00 40.62  ? 311  ALA A CA  1 
ATOM 2448 C C   . ALA A 1 314  ? 13.134  56.257 40.715  1.00 40.62  ? 311  ALA A C   1 
ATOM 2449 O O   . ALA A 1 314  ? 13.574  55.780 41.798  1.00 40.62  ? 311  ALA A O   1 
ATOM 2450 C CB  . ALA A 1 314  ? 12.180  58.424 41.237  1.00 16.35  ? 311  ALA A CB  1 
ATOM 2451 N N   . GLU A 1 315  ? 13.730  56.126 39.546  1.00 31.21  ? 312  GLU A N   1 
ATOM 2452 C CA  . GLU A 1 315  ? 15.009  55.511 39.446  1.00 31.21  ? 312  GLU A CA  1 
ATOM 2453 C C   . GLU A 1 315  ? 16.028  56.634 39.252  1.00 31.21  ? 312  GLU A C   1 
ATOM 2454 O O   . GLU A 1 315  ? 17.068  56.643 39.869  1.00 31.21  ? 312  GLU A O   1 
ATOM 2455 C CB  . GLU A 1 315  ? 14.937  54.531 38.308  1.00 41.46  ? 312  GLU A CB  1 
ATOM 2456 C CG  . GLU A 1 315  ? 15.449  53.208 38.741  1.00 41.46  ? 312  GLU A CG  1 
ATOM 2457 C CD  . GLU A 1 315  ? 16.880  53.153 38.383  1.00 41.46  ? 312  GLU A CD  1 
ATOM 2458 O OE1 . GLU A 1 315  ? 17.595  52.175 38.685  1.00 41.46  ? 312  GLU A OE1 1 
ATOM 2459 O OE2 . GLU A 1 315  ? 17.252  54.159 37.748  1.00 41.46  ? 312  GLU A OE2 1 
ATOM 2460 N N   . CYS A 1 316  ? 15.669  57.605 38.424  1.00 48.78  ? 313  CYS A N   1 
ATOM 2461 C CA  . CYS A 1 316  ? 16.491  58.753 38.053  1.00 48.78  ? 313  CYS A CA  1 
ATOM 2462 C C   . CYS A 1 316  ? 15.687  59.980 38.481  1.00 48.78  ? 313  CYS A C   1 
ATOM 2463 O O   . CYS A 1 316  ? 14.444  59.941 38.582  1.00 48.78  ? 313  CYS A O   1 
ATOM 2464 C CB  . CYS A 1 316  ? 16.652  58.789 36.537  1.00 144.12 ? 313  CYS A CB  1 
ATOM 2465 S SG  . CYS A 1 316  ? 17.992  59.819 35.991  1.00 144.12 ? 313  CYS A SG  1 
ATOM 2466 N N   . LEU A 1 317  ? 16.367  61.093 38.657  1.00 73.74  ? 314  LEU A N   1 
ATOM 2467 C CA  . LEU A 1 317  ? 15.669  62.284 39.059  1.00 73.74  ? 314  LEU A CA  1 
ATOM 2468 C C   . LEU A 1 317  ? 16.514  63.514 38.705  1.00 73.74  ? 314  LEU A C   1 
ATOM 2469 O O   . LEU A 1 317  ? 17.728  63.524 38.912  1.00 73.74  ? 314  LEU A O   1 
ATOM 2470 C CB  . LEU A 1 317  ? 15.449  62.168 40.549  1.00 32.95  ? 314  LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 317  ? 14.252  62.630 41.350  1.00 32.95  ? 314  LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 317  ? 12.901  62.261 40.688  1.00 32.95  ? 314  LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 317  ? 14.311  62.049 42.805  1.00 32.95  ? 314  LEU A CD2 1 
ATOM 2474 N N   . THR A 1 318  ? 15.897  64.546 38.146  1.00 46.91  ? 315  THR A N   1 
ATOM 2475 C CA  . THR A 1 318  ? 16.667  65.749 37.846  1.00 46.91  ? 315  THR A CA  1 
ATOM 2476 C C   . THR A 1 318  ? 15.827  67.034 37.847  1.00 46.91  ? 315  THR A C   1 
ATOM 2477 O O   . THR A 1 318  ? 14.795  67.138 37.151  1.00 46.91  ? 315  THR A O   1 
ATOM 2478 C CB  . THR A 1 318  ? 17.525  65.608 36.550  1.00 61.87  ? 315  THR A CB  1 
ATOM 2479 O OG1 . THR A 1 318  ? 18.335  66.774 36.390  1.00 61.87  ? 315  THR A OG1 1 
ATOM 2480 C CG2 . THR A 1 318  ? 16.654  65.457 35.331  1.00 61.87  ? 315  THR A CG2 1 
ATOM 2481 N N   . TYR A 1 319  ? 16.285  67.976 38.674  1.00 37.76  ? 316  TYR A N   1 
ATOM 2482 C CA  . TYR A 1 319  ? 15.700  69.285 38.794  1.00 37.76  ? 316  TYR A CA  1 
ATOM 2483 C C   . TYR A 1 319  ? 16.068  70.095 37.558  1.00 37.76  ? 316  TYR A C   1 
ATOM 2484 O O   . TYR A 1 319  ? 17.130  69.909 37.006  1.00 37.76  ? 316  TYR A O   1 
ATOM 2485 C CB  . TYR A 1 319  ? 16.198  69.966 40.068  1.00 69.89  ? 316  TYR A CB  1 
ATOM 2486 C CG  . TYR A 1 319  ? 15.579  71.326 40.304  1.00 69.89  ? 316  TYR A CG  1 
ATOM 2487 C CD1 . TYR A 1 319  ? 14.274  71.451 40.792  1.00 69.89  ? 316  TYR A CD1 1 
ATOM 2488 C CD2 . TYR A 1 319  ? 16.302  72.498 40.033  1.00 69.89  ? 316  TYR A CD2 1 
ATOM 2489 C CE1 . TYR A 1 319  ? 13.707  72.708 41.007  1.00 69.89  ? 316  TYR A CE1 1 
ATOM 2490 C CE2 . TYR A 1 319  ? 15.747  73.765 40.248  1.00 69.89  ? 316  TYR A CE2 1 
ATOM 2491 C CZ  . TYR A 1 319  ? 14.450  73.867 40.731  1.00 69.89  ? 316  TYR A CZ  1 
ATOM 2492 O OH  . TYR A 1 319  ? 13.903  75.121 40.929  1.00 69.89  ? 316  TYR A OH  1 
ATOM 2493 N N   . LEU A 1 320  ? 15.198  70.992 37.128  1.00 64.74  ? 317  LEU A N   1 
ATOM 2494 C CA  . LEU A 1 320  ? 15.435  71.723 35.900  1.00 64.74  ? 317  LEU A CA  1 
ATOM 2495 C C   . LEU A 1 320  ? 15.345  73.232 36.109  1.00 64.74  ? 317  LEU A C   1 
ATOM 2496 O O   . LEU A 1 320  ? 15.914  73.780 37.058  1.00 64.74  ? 317  LEU A O   1 
ATOM 2497 C CB  . LEU A 1 320  ? 14.445  71.259 34.835  1.00 45.50  ? 317  LEU A CB  1 
ATOM 2498 C CG  . LEU A 1 320  ? 14.737  69.863 34.282  1.00 45.50  ? 317  LEU A CG  1 
ATOM 2499 C CD1 . LEU A 1 320  ? 13.878  69.528 33.064  1.00 45.50  ? 317  LEU A CD1 1 
ATOM 2500 C CD2 . LEU A 1 320  ? 16.236  69.761 33.935  1.00 45.50  ? 317  LEU A CD2 1 
ATOM 2501 N N   . ASP A 1 321  ? 14.618  73.895 35.221  1.00 111.05 ? 318  ASP A N   1 
ATOM 2502 C CA  . ASP A 1 321  ? 14.285  75.290 35.386  1.00 111.05 ? 318  ASP A CA  1 
ATOM 2503 C C   . ASP A 1 321  ? 13.070  75.389 36.302  1.00 111.05 ? 318  ASP A C   1 
ATOM 2504 O O   . ASP A 1 321  ? 12.049  74.743 36.044  1.00 111.05 ? 318  ASP A O   1 
ATOM 2505 C CB  . ASP A 1 321  ? 13.941  75.883 34.014  1.00 152.82 ? 318  ASP A CB  1 
ATOM 2506 C CG  . ASP A 1 321  ? 14.351  77.341 33.870  1.00 152.82 ? 318  ASP A CG  1 
ATOM 2507 O OD1 . ASP A 1 321  ? 15.160  77.835 34.685  1.00 152.82 ? 318  ASP A OD1 1 
ATOM 2508 O OD2 . ASP A 1 321  ? 13.867  77.992 32.919  1.00 152.82 ? 318  ASP A OD2 1 
ATOM 2509 N N   . ASN A 1 322  ? 13.195  76.155 37.388  1.00 54.45  ? 319  ASN A N   1 
ATOM 2510 C CA  . ASN A 1 322  ? 12.012  76.786 38.019  1.00 54.45  ? 319  ASN A CA  1 
ATOM 2511 C C   . ASN A 1 322  ? 10.862  75.901 38.514  1.00 54.45  ? 319  ASN A C   1 
ATOM 2512 O O   . ASN A 1 322  ? 9.731   76.034 38.055  1.00 54.45  ? 319  ASN A O   1 
ATOM 2513 C CB  . ASN A 1 322  ? 11.443  77.851 37.075  1.00 96.35  ? 319  ASN A CB  1 
ATOM 2514 C CG  . ASN A 1 322  ? 12.478  78.876 36.678  1.00 96.35  ? 319  ASN A CG  1 
ATOM 2515 O OD1 . ASN A 1 322  ? 13.334  79.248 37.485  1.00 96.35  ? 319  ASN A OD1 1 
ATOM 2516 N ND2 . ASN A 1 322  ? 12.413  79.338 35.430  1.00 96.35  ? 319  ASN A ND2 1 
ATOM 2517 N N   . GLY A 1 323  ? 11.178  75.025 39.468  1.00 67.40  ? 320  GLY A N   1 
ATOM 2518 C CA  . GLY A 1 323  ? 10.206  74.128 40.090  1.00 67.40  ? 320  GLY A CA  1 
ATOM 2519 C C   . GLY A 1 323  ? 9.924   72.840 39.332  1.00 67.40  ? 320  GLY A C   1 
ATOM 2520 O O   . GLY A 1 323  ? 9.295   71.921 39.862  1.00 67.40  ? 320  GLY A O   1 
ATOM 2521 N N   . VAL A 1 324  ? 10.393  72.778 38.092  1.00 43.33  ? 321  VAL A N   1 
ATOM 2522 C CA  . VAL A 1 324  ? 10.149  71.642 37.240  1.00 43.33  ? 321  VAL A CA  1 
ATOM 2523 C C   . VAL A 1 324  ? 11.206  70.560 37.492  1.00 43.33  ? 321  VAL A C   1 
ATOM 2524 O O   . VAL A 1 324  ? 12.404  70.813 37.506  1.00 43.33  ? 321  VAL A O   1 
ATOM 2525 C CB  . VAL A 1 324  ? 10.058  72.075 35.760  1.00 60.43  ? 321  VAL A CB  1 
ATOM 2526 C CG1 . VAL A 1 324  ? 9.878   70.855 34.832  1.00 60.43  ? 321  VAL A CG1 1 
ATOM 2527 C CG2 . VAL A 1 324  ? 8.895   73.054 35.570  1.00 60.43  ? 321  VAL A CG2 1 
ATOM 2528 N N   . VAL A 1 325  ? 10.731  69.345 37.716  1.00 36.90  ? 322  VAL A N   1 
ATOM 2529 C CA  . VAL A 1 325  ? 11.577  68.197 38.010  1.00 36.90  ? 322  VAL A CA  1 
ATOM 2530 C C   . VAL A 1 325  ? 11.222  67.065 37.045  1.00 36.90  ? 322  VAL A C   1 
ATOM 2531 O O   . VAL A 1 325  ? 10.022  66.799 36.808  1.00 36.90  ? 322  VAL A O   1 
ATOM 2532 C CB  . VAL A 1 325  ? 11.323  67.776 39.425  1.00 40.27  ? 322  VAL A CB  1 
ATOM 2533 C CG1 . VAL A 1 325  ? 11.492  66.276 39.601  1.00 40.27  ? 322  VAL A CG1 1 
ATOM 2534 C CG2 . VAL A 1 325  ? 12.232  68.544 40.323  1.00 40.27  ? 322  VAL A CG2 1 
ATOM 2535 N N   . PHE A 1 326  ? 12.242  66.438 36.455  1.00 42.55  ? 323  PHE A N   1 
ATOM 2536 C CA  . PHE A 1 326  ? 12.010  65.269 35.608  1.00 42.55  ? 323  PHE A CA  1 
ATOM 2537 C C   . PHE A 1 326  ? 12.146  64.035 36.476  1.00 42.55  ? 323  PHE A C   1 
ATOM 2538 O O   . PHE A 1 326  ? 13.064  63.946 37.307  1.00 42.55  ? 323  PHE A O   1 
ATOM 2539 C CB  . PHE A 1 326  ? 12.975  65.212 34.421  1.00 35.85  ? 323  PHE A CB  1 
ATOM 2540 C CG  . PHE A 1 326  ? 12.788  64.007 33.544  1.00 35.85  ? 323  PHE A CG  1 
ATOM 2541 C CD1 . PHE A 1 326  ? 11.720  63.938 32.627  1.00 35.85  ? 323  PHE A CD1 1 
ATOM 2542 C CD2 . PHE A 1 326  ? 13.668  62.945 33.602  1.00 35.85  ? 323  PHE A CD2 1 
ATOM 2543 C CE1 . PHE A 1 326  ? 11.525  62.799 31.788  1.00 35.85  ? 323  PHE A CE1 1 
ATOM 2544 C CE2 . PHE A 1 326  ? 13.492  61.820 32.773  1.00 35.85  ? 323  PHE A CE2 1 
ATOM 2545 C CZ  . PHE A 1 326  ? 12.422  61.751 31.869  1.00 35.85  ? 323  PHE A CZ  1 
ATOM 2546 N N   . VAL A 1 327  ? 11.216  63.104 36.293  1.00 42.37  ? 324  VAL A N   1 
ATOM 2547 C CA  . VAL A 1 327  ? 11.160  61.862 37.051  1.00 42.37  ? 324  VAL A CA  1 
ATOM 2548 C C   . VAL A 1 327  ? 11.419  60.664 36.129  1.00 42.37  ? 324  VAL A C   1 
ATOM 2549 O O   . VAL A 1 327  ? 10.541  60.251 35.361  1.00 42.37  ? 324  VAL A O   1 
ATOM 2550 C CB  . VAL A 1 327  ? 9.789   61.719 37.758  1.00 44.94  ? 324  VAL A CB  1 
ATOM 2551 C CG1 . VAL A 1 327  ? 9.586   60.313 38.327  1.00 44.94  ? 324  VAL A CG1 1 
ATOM 2552 C CG2 . VAL A 1 327  ? 9.676   62.726 38.863  1.00 44.94  ? 324  VAL A CG2 1 
ATOM 2553 N N   . GLY A 1 328  ? 12.622  60.115 36.187  1.00 44.66  ? 325  GLY A N   1 
ATOM 2554 C CA  . GLY A 1 328  ? 12.921  58.949 35.383  1.00 44.66  ? 325  GLY A CA  1 
ATOM 2555 C C   . GLY A 1 328  ? 12.540  57.681 36.141  1.00 44.66  ? 325  GLY A C   1 
ATOM 2556 O O   . GLY A 1 328  ? 13.085  57.388 37.213  1.00 44.66  ? 325  GLY A O   1 
ATOM 2557 N N   . SER A 1 329  ? 11.604  56.929 35.579  1.00 40.81  ? 326  SER A N   1 
ATOM 2558 C CA  . SER A 1 329  ? 11.119  55.734 36.198  1.00 40.81  ? 326  SER A CA  1 
ATOM 2559 C C   . SER A 1 329  ? 11.555  54.486 35.412  1.00 40.81  ? 326  SER A C   1 
ATOM 2560 O O   . SER A 1 329  ? 11.653  54.528 34.196  1.00 40.81  ? 326  SER A O   1 
ATOM 2561 C CB  . SER A 1 329  ? 9.597   55.825 36.269  1.00 48.96  ? 326  SER A CB  1 
ATOM 2562 O OG  . SER A 1 329  ? 9.022   54.741 36.979  1.00 48.96  ? 326  SER A OG  1 
ATOM 2563 N N   . ARG A 1 330  ? 11.829  53.378 36.102  1.00 39.67  ? 327  ARG A N   1 
ATOM 2564 C CA  . ARG A 1 330  ? 11.981  52.077 35.437  1.00 39.67  ? 327  ARG A CA  1 
ATOM 2565 C C   . ARG A 1 330  ? 10.751  51.198 35.700  1.00 39.67  ? 327  ARG A C   1 
ATOM 2566 O O   . ARG A 1 330  ? 10.332  50.406 34.824  1.00 39.67  ? 327  ARG A O   1 
ATOM 2567 C CB  . ARG A 1 330  ? 13.217  51.343 35.911  1.00 58.81  ? 327  ARG A CB  1 
ATOM 2568 C CG  . ARG A 1 330  ? 14.541  51.926 35.506  1.00 58.81  ? 327  ARG A CG  1 
ATOM 2569 C CD  . ARG A 1 330  ? 15.629  50.972 35.920  1.00 58.81  ? 327  ARG A CD  1 
ATOM 2570 N NE  . ARG A 1 330  ? 15.110  50.108 36.977  1.00 58.81  ? 327  ARG A NE  1 
ATOM 2571 C CZ  . ARG A 1 330  ? 14.814  48.816 36.827  1.00 58.81  ? 327  ARG A CZ  1 
ATOM 2572 N NH1 . ARG A 1 330  ? 15.036  48.215 35.664  1.00 58.81  ? 327  ARG A NH1 1 
ATOM 2573 N NH2 . ARG A 1 330  ? 14.310  48.118 37.842  1.00 58.81  ? 327  ARG A NH2 1 
ATOM 2574 N N   . LEU A 1 331  ? 10.187  51.337 36.906  1.00 35.53  ? 328  LEU A N   1 
ATOM 2575 C CA  . LEU A 1 331  ? 8.995   50.565 37.297  1.00 35.53  ? 328  LEU A CA  1 
ATOM 2576 C C   . LEU A 1 331  ? 7.665   51.150 36.811  1.00 35.53  ? 328  LEU A C   1 
ATOM 2577 O O   . LEU A 1 331  ? 6.671   50.437 36.752  1.00 35.53  ? 328  LEU A O   1 
ATOM 2578 C CB  . LEU A 1 331  ? 8.950   50.374 38.802  1.00 30.68  ? 328  LEU A CB  1 
ATOM 2579 C CG  . LEU A 1 331  ? 9.707   49.193 39.368  1.00 30.68  ? 328  LEU A CG  1 
ATOM 2580 C CD1 . LEU A 1 331  ? 10.896  48.905 38.488  1.00 30.68  ? 328  LEU A CD1 1 
ATOM 2581 C CD2 . LEU A 1 331  ? 10.160  49.474 40.770  1.00 30.68  ? 328  LEU A CD2 1 
ATOM 2582 N N   . GLY A 1 332  ? 7.654   52.426 36.436  1.00 29.49  ? 329  GLY A N   1 
ATOM 2583 C CA  . GLY A 1 332  ? 6.427   53.054 35.957  1.00 29.49  ? 329  GLY A CA  1 
ATOM 2584 C C   . GLY A 1 332  ? 6.634   54.117 34.886  1.00 29.49  ? 329  GLY A C   1 
ATOM 2585 O O   . GLY A 1 332  ? 7.736   54.260 34.355  1.00 29.49  ? 329  GLY A O   1 
ATOM 2586 N N   . ASP A 1 333  ? 5.562   54.850 34.567  1.00 44.02  ? 330  ASP A N   1 
ATOM 2587 C CA  . ASP A 1 333  ? 5.603   55.909 33.563  1.00 44.02  ? 330  ASP A CA  1 
ATOM 2588 C C   . ASP A 1 333  ? 6.529   57.027 34.066  1.00 44.02  ? 330  ASP A C   1 
ATOM 2589 O O   . ASP A 1 333  ? 6.457   57.429 35.233  1.00 44.02  ? 330  ASP A O   1 
ATOM 2590 C CB  . ASP A 1 333  ? 4.205   56.481 33.314  1.00 42.47  ? 330  ASP A CB  1 
ATOM 2591 C CG  . ASP A 1 333  ? 3.369   55.670 32.291  1.00 42.47  ? 330  ASP A CG  1 
ATOM 2592 O OD1 . ASP A 1 333  ? 3.756   54.559 31.830  1.00 42.47  ? 330  ASP A OD1 1 
ATOM 2593 O OD2 . ASP A 1 333  ? 2.270   56.186 31.943  1.00 42.47  ? 330  ASP A OD2 1 
ATOM 2594 N N   . SER A 1 334  ? 7.413   57.505 33.197  1.00 39.55  ? 331  SER A N   1 
ATOM 2595 C CA  . SER A 1 334  ? 8.194   58.658 33.521  1.00 39.55  ? 331  SER A CA  1 
ATOM 2596 C C   . SER A 1 334  ? 7.350   59.934 33.431  1.00 39.55  ? 331  SER A C   1 
ATOM 2597 O O   . SER A 1 334  ? 6.293   59.996 32.727  1.00 39.55  ? 331  SER A O   1 
ATOM 2598 C CB  . SER A 1 334  ? 9.401   58.740 32.613  1.00 29.04  ? 331  SER A CB  1 
ATOM 2599 O OG  . SER A 1 334  ? 10.474  57.977 33.159  1.00 29.04  ? 331  SER A OG  1 
ATOM 2600 N N   . GLN A 1 335  ? 7.794   60.966 34.151  1.00 45.37  ? 332  GLN A N   1 
ATOM 2601 C CA  . GLN A 1 335  ? 6.973   62.170 34.184  1.00 45.37  ? 332  GLN A CA  1 
ATOM 2602 C C   . GLN A 1 335  ? 7.705   63.521 34.293  1.00 45.37  ? 332  GLN A C   1 
ATOM 2603 O O   . GLN A 1 335  ? 8.907   63.590 34.485  1.00 45.37  ? 332  GLN A O   1 
ATOM 2604 C CB  . GLN A 1 335  ? 5.863   62.004 35.232  1.00 48.15  ? 332  GLN A CB  1 
ATOM 2605 C CG  . GLN A 1 335  ? 6.361   61.877 36.605  1.00 48.15  ? 332  GLN A CG  1 
ATOM 2606 C CD  . GLN A 1 335  ? 5.354   61.262 37.547  1.00 48.15  ? 332  GLN A CD  1 
ATOM 2607 O OE1 . GLN A 1 335  ? 4.172   61.171 37.235  1.00 48.15  ? 332  GLN A OE1 1 
ATOM 2608 N NE2 . GLN A 1 335  ? 5.818   60.836 38.716  1.00 48.15  ? 332  GLN A NE2 1 
ATOM 2609 N N   . LEU A 1 336  ? 6.949   64.593 34.124  1.00 37.56  ? 333  LEU A N   1 
ATOM 2610 C CA  . LEU A 1 336  ? 7.434   65.942 34.406  1.00 37.56  ? 333  LEU A CA  1 
ATOM 2611 C C   . LEU A 1 336  ? 6.467   66.469 35.428  1.00 37.56  ? 333  LEU A C   1 
ATOM 2612 O O   . LEU A 1 336  ? 5.250   66.441 35.181  1.00 37.56  ? 333  LEU A O   1 
ATOM 2613 C CB  . LEU A 1 336  ? 7.332   66.800 33.141  1.00 55.04  ? 333  LEU A CB  1 
ATOM 2614 C CG  . LEU A 1 336  ? 8.395   67.853 32.929  1.00 55.04  ? 333  LEU A CG  1 
ATOM 2615 C CD1 . LEU A 1 336  ? 9.749   67.234 33.229  1.00 55.04  ? 333  LEU A CD1 1 
ATOM 2616 C CD2 . LEU A 1 336  ? 8.323   68.354 31.507  1.00 55.04  ? 333  LEU A CD2 1 
ATOM 2617 N N   . VAL A 1 337  ? 6.998   66.906 36.574  1.00 42.46  ? 334  VAL A N   1 
ATOM 2618 C CA  . VAL A 1 337  ? 6.174   67.383 37.703  1.00 42.46  ? 334  VAL A CA  1 
ATOM 2619 C C   . VAL A 1 337  ? 6.582   68.777 38.155  1.00 42.46  ? 334  VAL A C   1 
ATOM 2620 O O   . VAL A 1 337  ? 7.710   69.170 37.939  1.00 42.46  ? 334  VAL A O   1 
ATOM 2621 C CB  . VAL A 1 337  ? 6.191   66.380 38.939  1.00 25.82  ? 334  VAL A CB  1 
ATOM 2622 C CG1 . VAL A 1 337  ? 5.983   64.910 38.468  1.00 25.82  ? 334  VAL A CG1 1 
ATOM 2623 C CG2 . VAL A 1 337  ? 7.449   66.503 39.754  1.00 25.82  ? 334  VAL A CG2 1 
ATOM 2624 N N   . LYS A 1 338  ? 5.662   69.511 38.780  1.00 54.91  ? 335  LYS A N   1 
ATOM 2625 C CA  . LYS A 1 338  ? 5.920   70.852 39.307  1.00 54.91  ? 335  LYS A CA  1 
ATOM 2626 C C   . LYS A 1 338  ? 6.010   70.901 40.832  1.00 54.91  ? 335  LYS A C   1 
ATOM 2627 O O   . LYS A 1 338  ? 5.201   70.289 41.523  1.00 54.91  ? 335  LYS A O   1 
ATOM 2628 C CB  . LYS A 1 338  ? 4.846   71.818 38.816  1.00 50.80  ? 335  LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 338  ? 4.701   73.109 39.615  1.00 50.80  ? 335  LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 338  ? 5.896   74.059 39.468  1.00 50.80  ? 335  LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 338  ? 6.035   74.573 38.040  1.00 50.80  ? 335  LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 338  ? 5.164   75.760 37.808  1.00 50.80  ? 335  LYS A NZ  1 
ATOM 2633 N N   . LEU A 1 339  ? 7.000   71.631 41.345  1.00 58.49  ? 336  LEU A N   1 
ATOM 2634 C CA  . LEU A 1 339  ? 7.130   71.873 42.786  1.00 58.49  ? 336  LEU A CA  1 
ATOM 2635 C C   . LEU A 1 339  ? 6.685   73.271 43.195  1.00 58.49  ? 336  LEU A C   1 
ATOM 2636 O O   . LEU A 1 339  ? 7.189   74.285 42.688  1.00 58.49  ? 336  LEU A O   1 
ATOM 2637 C CB  . LEU A 1 339  ? 8.550   71.646 43.273  1.00 38.07  ? 336  LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 339  ? 9.252   70.331 42.986  1.00 38.07  ? 336  LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 339  ? 10.513  70.320 43.821  1.00 38.07  ? 336  LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 339  ? 8.374   69.173 43.360  1.00 38.07  ? 336  LEU A CD2 1 
ATOM 2641 N N   . ASN A 1 340  ? 5.745   73.286 44.137  1.00 67.29  ? 337  ASN A N   1 
ATOM 2642 C CA  . ASN A 1 340  ? 5.061   74.483 44.582  1.00 67.29  ? 337  ASN A CA  1 
ATOM 2643 C C   . ASN A 1 340  ? 5.444   74.781 45.996  1.00 67.29  ? 337  ASN A C   1 
ATOM 2644 O O   . ASN A 1 340  ? 5.774   73.879 46.767  1.00 67.29  ? 337  ASN A O   1 
ATOM 2645 C CB  . ASN A 1 340  ? 3.550   74.306 44.457  1.00 43.38  ? 337  ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 340  ? 3.128   74.247 43.036  1.00 43.38  ? 337  ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 340  ? 3.657   74.971 42.224  1.00 43.38  ? 337  ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 340  ? 2.220   73.365 42.704  1.00 43.38  ? 337  ASN A ND2 1 
ATOM 2649 N N   . VAL A 1 341  ? 5.418   76.059 46.331  1.00 75.95  ? 338  VAL A N   1 
ATOM 2650 C CA  . VAL A 1 341  ? 5.818   76.482 47.649  1.00 75.95  ? 338  VAL A CA  1 
ATOM 2651 C C   . VAL A 1 341  ? 4.714   76.185 48.669  1.00 75.95  ? 338  VAL A C   1 
ATOM 2652 O O   . VAL A 1 341  ? 4.994   75.945 49.850  1.00 75.95  ? 338  VAL A O   1 
ATOM 2653 C CB  . VAL A 1 341  ? 6.205   77.961 47.652  1.00 68.56  ? 338  VAL A CB  1 
ATOM 2654 C CG1 . VAL A 1 341  ? 6.687   78.370 49.046  1.00 68.56  ? 338  VAL A CG1 1 
ATOM 2655 C CG2 . VAL A 1 341  ? 7.284   78.234 46.577  1.00 68.56  ? 338  VAL A CG2 1 
ATOM 2656 N N   . ASP A 1 342  ? 3.470   76.177 48.191  1.00 52.51  ? 339  ASP A N   1 
ATOM 2657 C CA  . ASP A 1 342  ? 2.314   75.934 49.036  1.00 52.51  ? 339  ASP A CA  1 
ATOM 2658 C C   . ASP A 1 342  ? 1.692   74.637 48.615  1.00 52.51  ? 339  ASP A C   1 
ATOM 2659 O O   . ASP A 1 342  ? 1.545   74.392 47.436  1.00 52.51  ? 339  ASP A O   1 
ATOM 2660 C CB  . ASP A 1 342  ? 1.292   77.059 48.889  1.00 69.43  ? 339  ASP A CB  1 
ATOM 2661 C CG  . ASP A 1 342  ? 1.928   78.416 48.919  1.00 69.43  ? 339  ASP A CG  1 
ATOM 2662 O OD1 . ASP A 1 342  ? 2.175   78.926 50.028  1.00 69.43  ? 339  ASP A OD1 1 
ATOM 2663 O OD2 . ASP A 1 342  ? 2.202   78.966 47.827  1.00 69.43  ? 339  ASP A OD2 1 
ATOM 2664 N N   . SER A 1 343  ? 1.320   73.810 49.583  1.00 49.91  ? 340  SER A N   1 
ATOM 2665 C CA  . SER A 1 343  ? 0.677   72.533 49.304  1.00 49.91  ? 340  SER A CA  1 
ATOM 2666 C C   . SER A 1 343  ? -0.742  72.760 48.801  1.00 49.91  ? 340  SER A C   1 
ATOM 2667 O O   . SER A 1 343  ? -1.296  73.842 48.987  1.00 49.91  ? 340  SER A O   1 
ATOM 2668 C CB  . SER A 1 343  ? 0.663   71.675 50.558  1.00 47.47  ? 340  SER A CB  1 
ATOM 2669 O OG  . SER A 1 343  ? -0.136  72.256 51.564  1.00 47.47  ? 340  SER A OG  1 
ATOM 2670 N N   . ASN A 1 344  ? -1.305  71.773 48.112  1.00 69.64  ? 341  ASN A N   1 
ATOM 2671 C CA  . ASN A 1 344  ? -2.728  71.804 47.791  1.00 69.64  ? 341  ASN A CA  1 
ATOM 2672 C C   . ASN A 1 344  ? -3.465  71.003 48.857  1.00 69.64  ? 341  ASN A C   1 
ATOM 2673 O O   . ASN A 1 344  ? -3.002  70.949 49.994  1.00 69.64  ? 341  ASN A O   1 
ATOM 2674 C CB  . ASN A 1 344  ? -3.020  71.324 46.354  1.00 65.41  ? 341  ASN A CB  1 
ATOM 2675 C CG  . ASN A 1 344  ? -2.530  69.888 46.063  1.00 65.41  ? 341  ASN A CG  1 
ATOM 2676 O OD1 . ASN A 1 344  ? -2.176  69.101 46.959  1.00 65.41  ? 341  ASN A OD1 1 
ATOM 2677 N ND2 . ASN A 1 344  ? -2.527  69.547 44.785  1.00 65.41  ? 341  ASN A ND2 1 
ATOM 2678 N N   . GLU A 1 345  ? -4.586  70.378 48.501  1.00 94.08  ? 342  GLU A N   1 
ATOM 2679 C CA  . GLU A 1 345  ? -5.306  69.508 49.434  1.00 94.08  ? 342  GLU A CA  1 
ATOM 2680 C C   . GLU A 1 345  ? -4.618  68.146 49.547  1.00 94.08  ? 342  GLU A C   1 
ATOM 2681 O O   . GLU A 1 345  ? -4.238  67.555 48.539  1.00 94.08  ? 342  GLU A O   1 
ATOM 2682 C CB  . GLU A 1 345  ? -6.770  69.361 49.022  1.00 127.66 ? 342  GLU A CB  1 
ATOM 2683 C CG  . GLU A 1 345  ? -7.611  70.622 49.246  1.00 127.66 ? 342  GLU A CG  1 
ATOM 2684 C CD  . GLU A 1 345  ? -7.553  71.602 48.081  1.00 127.66 ? 342  GLU A CD  1 
ATOM 2685 O OE1 . GLU A 1 345  ? -8.630  72.013 47.596  1.00 127.66 ? 342  GLU A OE1 1 
ATOM 2686 O OE2 . GLU A 1 345  ? -6.437  71.962 47.645  1.00 127.66 ? 342  GLU A OE2 1 
ATOM 2687 N N   . GLN A 1 346  ? -4.466  67.669 50.783  1.00 106.99 ? 343  GLN A N   1 
ATOM 2688 C CA  . GLN A 1 346  ? -3.699  66.449 51.126  1.00 106.99 ? 343  GLN A CA  1 
ATOM 2689 C C   . GLN A 1 346  ? -2.200  66.704 51.385  1.00 106.99 ? 343  GLN A C   1 
ATOM 2690 O O   . GLN A 1 346  ? -1.440  65.761 51.658  1.00 106.99 ? 343  GLN A O   1 
ATOM 2691 C CB  . GLN A 1 346  ? -3.901  65.323 50.103  1.00 175.23 ? 343  GLN A CB  1 
ATOM 2692 C CG  . GLN A 1 346  ? -5.241  64.617 50.226  1.00 175.23 ? 343  GLN A CG  1 
ATOM 2693 C CD  . GLN A 1 346  ? -5.678  63.942 48.932  1.00 175.23 ? 343  GLN A CD  1 
ATOM 2694 O OE1 . GLN A 1 346  ? -6.119  62.788 48.938  1.00 175.23 ? 343  GLN A OE1 1 
ATOM 2695 N NE2 . GLN A 1 346  ? -5.562  64.662 47.815  1.00 175.23 ? 343  GLN A NE2 1 
ATOM 2696 N N   . GLY A 1 347  ? -1.785  67.973 51.310  1.00 57.27  ? 344  GLY A N   1 
ATOM 2697 C CA  . GLY A 1 347  ? -0.420  68.356 51.659  1.00 57.27  ? 344  GLY A CA  1 
ATOM 2698 C C   . GLY A 1 347  ? 0.576   68.125 50.539  1.00 57.27  ? 344  GLY A C   1 
ATOM 2699 O O   . GLY A 1 347  ? 1.770   68.010 50.788  1.00 57.27  ? 344  GLY A O   1 
ATOM 2700 N N   . SER A 1 348  ? 0.103   68.077 49.304  1.00 52.57  ? 345  SER A N   1 
ATOM 2701 C CA  . SER A 1 348  ? 1.003   67.795 48.213  1.00 52.57  ? 345  SER A CA  1 
ATOM 2702 C C   . SER A 1 348  ? 1.613   69.041 47.522  1.00 52.57  ? 345  SER A C   1 
ATOM 2703 O O   . SER A 1 348  ? 0.914   69.863 46.921  1.00 52.57  ? 345  SER A O   1 
ATOM 2704 C CB  . SER A 1 348  ? 0.333   66.886 47.191  1.00 56.63  ? 345  SER A CB  1 
ATOM 2705 O OG  . SER A 1 348  ? 1.277   66.518 46.209  1.00 56.63  ? 345  SER A OG  1 
ATOM 2706 N N   . TYR A 1 349  ? 2.935   69.147 47.604  1.00 36.74  ? 346  TYR A N   1 
ATOM 2707 C CA  . TYR A 1 349  ? 3.667   70.166 46.872  1.00 36.74  ? 346  TYR A CA  1 
ATOM 2708 C C   . TYR A 1 349  ? 3.906   69.812 45.399  1.00 36.74  ? 346  TYR A C   1 
ATOM 2709 O O   . TYR A 1 349  ? 4.355   70.654 44.605  1.00 36.74  ? 346  TYR A O   1 
ATOM 2710 C CB  . TYR A 1 349  ? 4.969   70.465 47.591  1.00 67.65  ? 346  TYR A CB  1 
ATOM 2711 C CG  . TYR A 1 349  ? 4.716   71.079 48.940  1.00 67.65  ? 346  TYR A CG  1 
ATOM 2712 C CD1 . TYR A 1 349  ? 4.494   70.277 50.054  1.00 67.65  ? 346  TYR A CD1 1 
ATOM 2713 C CD2 . TYR A 1 349  ? 4.663   72.466 49.100  1.00 67.65  ? 346  TYR A CD2 1 
ATOM 2714 C CE1 . TYR A 1 349  ? 4.247   70.842 51.297  1.00 67.65  ? 346  TYR A CE1 1 
ATOM 2715 C CE2 . TYR A 1 349  ? 4.416   73.034 50.330  1.00 67.65  ? 346  TYR A CE2 1 
ATOM 2716 C CZ  . TYR A 1 349  ? 4.213   72.217 51.416  1.00 67.65  ? 346  TYR A CZ  1 
ATOM 2717 O OH  . TYR A 1 349  ? 3.968   72.759 52.631  1.00 67.65  ? 346  TYR A OH  1 
ATOM 2718 N N   . VAL A 1 350  ? 3.573   68.580 45.025  1.00 66.69  ? 347  VAL A N   1 
ATOM 2719 C CA  . VAL A 1 350  ? 3.946   68.057 43.721  1.00 66.69  ? 347  VAL A CA  1 
ATOM 2720 C C   . VAL A 1 350  ? 2.739   68.059 42.795  1.00 66.69  ? 347  VAL A C   1 
ATOM 2721 O O   . VAL A 1 350  ? 1.674   67.596 43.179  1.00 66.69  ? 347  VAL A O   1 
ATOM 2722 C CB  . VAL A 1 350  ? 4.535   66.617 43.847  1.00 62.43  ? 347  VAL A CB  1 
ATOM 2723 C CG1 . VAL A 1 350  ? 5.362   66.264 42.626  1.00 62.43  ? 347  VAL A CG1 1 
ATOM 2724 C CG2 . VAL A 1 350  ? 5.423   66.508 45.050  1.00 62.43  ? 347  VAL A CG2 1 
ATOM 2725 N N   . VAL A 1 351  ? 2.890   68.594 41.585  1.00 51.90  ? 348  VAL A N   1 
ATOM 2726 C CA  . VAL A 1 351  ? 1.837   68.425 40.580  1.00 51.90  ? 348  VAL A CA  1 
ATOM 2727 C C   . VAL A 1 351  ? 2.335   67.987 39.200  1.00 51.90  ? 348  VAL A C   1 
ATOM 2728 O O   . VAL A 1 351  ? 3.169   68.657 38.590  1.00 51.90  ? 348  VAL A O   1 
ATOM 2729 C CB  . VAL A 1 351  ? 0.869   69.643 40.483  1.00 43.38  ? 348  VAL A CB  1 
ATOM 2730 C CG1 . VAL A 1 351  ? 0.209   69.728 39.086  1.00 43.38  ? 348  VAL A CG1 1 
ATOM 2731 C CG2 . VAL A 1 351  ? -0.211  69.559 41.586  1.00 43.38  ? 348  VAL A CG2 1 
ATOM 2732 N N   . ALA A 1 352  ? 1.793   66.875 38.713  1.00 42.22  ? 349  ALA A N   1 
ATOM 2733 C CA  . ALA A 1 352  ? 2.059   66.385 37.350  1.00 42.22  ? 349  ALA A CA  1 
ATOM 2734 C C   . ALA A 1 352  ? 1.800   67.431 36.237  1.00 42.22  ? 349  ALA A C   1 
ATOM 2735 O O   . ALA A 1 352  ? 0.885   68.222 36.342  1.00 42.22  ? 349  ALA A O   1 
ATOM 2736 C CB  . ALA A 1 352  ? 1.238   65.115 37.084  1.00 77.67  ? 349  ALA A CB  1 
ATOM 2737 N N   . MET A 1 353  ? 2.613   67.426 35.184  1.00 50.52  ? 350  MET A N   1 
ATOM 2738 C CA  . MET A 1 353  ? 2.435   68.324 34.053  1.00 50.52  ? 350  MET A CA  1 
ATOM 2739 C C   . MET A 1 353  ? 2.341   67.438 32.817  1.00 50.52  ? 350  MET A C   1 
ATOM 2740 O O   . MET A 1 353  ? 1.523   67.686 31.914  1.00 50.52  ? 350  MET A O   1 
ATOM 2741 C CB  . MET A 1 353  ? 3.611   69.285 33.945  1.00 47.08  ? 350  MET A CB  1 
ATOM 2742 C CG  . MET A 1 353  ? 3.878   70.116 35.237  1.00 47.08  ? 350  MET A CG  1 
ATOM 2743 S SD  . MET A 1 353  ? 5.553   70.893 35.444  1.00 47.08  ? 350  MET A SD  1 
ATOM 2744 C CE  . MET A 1 353  ? 5.857   71.516 33.764  1.00 47.08  ? 350  MET A CE  1 
ATOM 2745 N N   . GLU A 1 354  ? 3.153   66.377 32.810  1.00 59.70  ? 351  GLU A N   1 
ATOM 2746 C CA  . GLU A 1 354  ? 3.298   65.454 31.681  1.00 59.70  ? 351  GLU A CA  1 
ATOM 2747 C C   . GLU A 1 354  ? 3.651   64.077 32.206  1.00 59.70  ? 351  GLU A C   1 
ATOM 2748 O O   . GLU A 1 354  ? 4.356   63.945 33.196  1.00 59.70  ? 351  GLU A O   1 
ATOM 2749 C CB  . GLU A 1 354  ? 4.450   65.882 30.782  1.00 74.67  ? 351  GLU A CB  1 
ATOM 2750 C CG  . GLU A 1 354  ? 4.227   67.072 29.911  1.00 74.67  ? 351  GLU A CG  1 
ATOM 2751 C CD  . GLU A 1 354  ? 5.173   67.045 28.738  1.00 74.67  ? 351  GLU A CD  1 
ATOM 2752 O OE1 . GLU A 1 354  ? 5.926   68.024 28.553  1.00 74.67  ? 351  GLU A OE1 1 
ATOM 2753 O OE2 . GLU A 1 354  ? 5.185   66.027 28.005  1.00 74.67  ? 351  GLU A OE2 1 
ATOM 2754 N N   . THR A 1 355  ? 3.199   63.063 31.487  1.00 37.77  ? 352  THR A N   1 
ATOM 2755 C CA  . THR A 1 355  ? 3.381   61.671 31.829  1.00 37.77  ? 352  THR A CA  1 
ATOM 2756 C C   . THR A 1 355  ? 3.882   60.956 30.576  1.00 37.77  ? 352  THR A C   1 
ATOM 2757 O O   . THR A 1 355  ? 3.390   61.212 29.470  1.00 37.77  ? 352  THR A O   1 
ATOM 2758 C CB  . THR A 1 355  ? 2.046   61.120 32.363  1.00 34.02  ? 352  THR A CB  1 
ATOM 2759 O OG1 . THR A 1 355  ? 1.906   61.531 33.743  1.00 34.02  ? 352  THR A OG1 1 
ATOM 2760 C CG2 . THR A 1 355  ? 1.959   59.641 32.300  1.00 34.02  ? 352  THR A CG2 1 
ATOM 2761 N N   . PHE A 1 356  ? 4.907   60.112 30.726  1.00 35.59  ? 353  PHE A N   1 
ATOM 2762 C CA  . PHE A 1 356  ? 5.495   59.423 29.569  1.00 35.59  ? 353  PHE A CA  1 
ATOM 2763 C C   . PHE A 1 356  ? 5.434   57.896 29.673  1.00 35.59  ? 353  PHE A C   1 
ATOM 2764 O O   . PHE A 1 356  ? 6.079   57.256 30.517  1.00 35.59  ? 353  PHE A O   1 
ATOM 2765 C CB  . PHE A 1 356  ? 6.942   59.837 29.327  1.00 37.77  ? 353  PHE A CB  1 
ATOM 2766 C CG  . PHE A 1 356  ? 7.192   61.300 29.441  1.00 37.77  ? 353  PHE A CG  1 
ATOM 2767 C CD1 . PHE A 1 356  ? 7.944   61.802 30.505  1.00 37.77  ? 353  PHE A CD1 1 
ATOM 2768 C CD2 . PHE A 1 356  ? 6.683   62.195 28.483  1.00 37.77  ? 353  PHE A CD2 1 
ATOM 2769 C CE1 . PHE A 1 356  ? 8.200   63.183 30.632  1.00 37.77  ? 353  PHE A CE1 1 
ATOM 2770 C CE2 . PHE A 1 356  ? 6.923   63.609 28.604  1.00 37.77  ? 353  PHE A CE2 1 
ATOM 2771 C CZ  . PHE A 1 356  ? 7.685   64.095 29.686  1.00 37.77  ? 353  PHE A CZ  1 
ATOM 2772 N N   . THR A 1 357  ? 4.686   57.324 28.752  1.00 39.27  ? 354  THR A N   1 
ATOM 2773 C CA  . THR A 1 357  ? 4.559   55.895 28.609  1.00 39.27  ? 354  THR A CA  1 
ATOM 2774 C C   . THR A 1 357  ? 5.831   55.071 28.795  1.00 39.27  ? 354  THR A C   1 
ATOM 2775 O O   . THR A 1 357  ? 6.836   55.275 28.111  1.00 39.27  ? 354  THR A O   1 
ATOM 2776 C CB  . THR A 1 357  ? 3.888   55.613 27.301  1.00 45.03  ? 354  THR A CB  1 
ATOM 2777 O OG1 . THR A 1 357  ? 2.531   56.055 27.424  1.00 45.03  ? 354  THR A OG1 1 
ATOM 2778 C CG2 . THR A 1 357  ? 3.893   54.138 27.020  1.00 45.03  ? 354  THR A CG2 1 
ATOM 2779 N N   . ASN A 1 358  ? 5.784   54.164 29.762  1.00 33.98  ? 355  ASN A N   1 
ATOM 2780 C CA  . ASN A 1 358  ? 6.839   53.171 29.992  1.00 33.98  ? 355  ASN A CA  1 
ATOM 2781 C C   . ASN A 1 358  ? 6.182   51.813 29.953  1.00 33.98  ? 355  ASN A C   1 
ATOM 2782 O O   . ASN A 1 358  ? 5.250   51.536 30.702  1.00 33.98  ? 355  ASN A O   1 
ATOM 2783 C CB  . ASN A 1 358  ? 7.508   53.351 31.346  1.00 29.96  ? 355  ASN A CB  1 
ATOM 2784 C CG  . ASN A 1 358  ? 8.654   52.375 31.553  1.00 29.96  ? 355  ASN A CG  1 
ATOM 2785 O OD1 . ASN A 1 358  ? 9.142   51.795 30.584  1.00 29.96  ? 355  ASN A OD1 1 
ATOM 2786 N ND2 . ASN A 1 358  ? 9.087   52.180 32.813  1.00 29.96  ? 355  ASN A ND2 1 
ATOM 2787 N N   . LEU A 1 359  ? 6.617   50.944 29.057  1.00 29.79  ? 356  LEU A N   1 
ATOM 2788 C CA  . LEU A 1 359  ? 5.940   49.674 29.018  1.00 29.79  ? 356  LEU A CA  1 
ATOM 2789 C C   . LEU A 1 359  ? 6.611   48.800 30.062  1.00 29.79  ? 356  LEU A C   1 
ATOM 2790 O O   . LEU A 1 359  ? 6.264   47.621 30.204  1.00 29.79  ? 356  LEU A O   1 
ATOM 2791 C CB  . LEU A 1 359  ? 5.863   49.076 27.621  1.00 22.18  ? 356  LEU A CB  1 
ATOM 2792 C CG  . LEU A 1 359  ? 5.086   49.840 26.532  1.00 22.18  ? 356  LEU A CG  1 
ATOM 2793 C CD1 . LEU A 1 359  ? 5.128   48.937 25.303  1.00 22.18  ? 356  LEU A CD1 1 
ATOM 2794 C CD2 . LEU A 1 359  ? 3.656   50.152 26.803  1.00 22.18  ? 356  LEU A CD2 1 
ATOM 2795 N N   . GLY A 1 360  ? 7.516   49.445 30.811  1.00 70.67  ? 357  GLY A N   1 
ATOM 2796 C CA  . GLY A 1 360  ? 7.850   49.100 32.191  1.00 70.67  ? 357  GLY A CA  1 
ATOM 2797 C C   . GLY A 1 360  ? 8.578   47.805 32.149  1.00 70.67  ? 357  GLY A C   1 
ATOM 2798 O O   . GLY A 1 360  ? 9.062   47.422 31.082  1.00 70.67  ? 357  GLY A O   1 
ATOM 2799 N N   . PRO A 1 361  ? 8.692   47.123 33.296  1.00 36.72  ? 358  PRO A N   1 
ATOM 2800 C CA  . PRO A 1 361  ? 9.039   45.728 33.136  1.00 36.72  ? 358  PRO A CA  1 
ATOM 2801 C C   . PRO A 1 361  ? 7.819   45.059 32.549  1.00 36.72  ? 358  PRO A C   1 
ATOM 2802 O O   . PRO A 1 361  ? 6.713   45.250 33.018  1.00 36.72  ? 358  PRO A O   1 
ATOM 2803 C CB  . PRO A 1 361  ? 9.313   45.266 34.548  1.00 33.20  ? 358  PRO A CB  1 
ATOM 2804 C CG  . PRO A 1 361  ? 9.554   46.507 35.302  1.00 33.20  ? 358  PRO A CG  1 
ATOM 2805 C CD  . PRO A 1 361  ? 8.606   47.496 34.702  1.00 33.20  ? 358  PRO A CD  1 
ATOM 2806 N N   . ILE A 1 362  ? 8.008   44.375 31.442  1.00 34.22  ? 359  ILE A N   1 
ATOM 2807 C CA  . ILE A 1 362  ? 6.955   43.555 30.914  1.00 34.22  ? 359  ILE A CA  1 
ATOM 2808 C C   . ILE A 1 362  ? 7.149   42.165 31.473  1.00 34.22  ? 359  ILE A C   1 
ATOM 2809 O O   . ILE A 1 362  ? 8.051   41.438 31.027  1.00 34.22  ? 359  ILE A O   1 
ATOM 2810 C CB  . ILE A 1 362  ? 7.029   43.492 29.416  1.00 18.82  ? 359  ILE A CB  1 
ATOM 2811 C CG1 . ILE A 1 362  ? 6.731   44.876 28.877  1.00 18.82  ? 359  ILE A CG1 1 
ATOM 2812 C CG2 . ILE A 1 362  ? 6.088   42.376 28.890  1.00 18.82  ? 359  ILE A CG2 1 
ATOM 2813 C CD1 . ILE A 1 362  ? 7.056   44.997 27.442  1.00 18.82  ? 359  ILE A CD1 1 
ATOM 2814 N N   . VAL A 1 363  ? 6.324   41.804 32.458  1.00 26.12  ? 360  VAL A N   1 
ATOM 2815 C CA  . VAL A 1 363  ? 6.579   40.547 33.190  1.00 26.12  ? 360  VAL A CA  1 
ATOM 2816 C C   . VAL A 1 363  ? 5.977   39.380 32.448  1.00 26.12  ? 360  VAL A C   1 
ATOM 2817 O O   . VAL A 1 363  ? 6.398   38.278 32.642  1.00 26.12  ? 360  VAL A O   1 
ATOM 2818 C CB  . VAL A 1 363  ? 6.120   40.557 34.680  1.00 32.26  ? 360  VAL A CB  1 
ATOM 2819 C CG1 . VAL A 1 363  ? 6.528   41.859 35.380  1.00 32.26  ? 360  VAL A CG1 1 
ATOM 2820 C CG2 . VAL A 1 363  ? 4.645   40.333 34.790  1.00 32.26  ? 360  VAL A CG2 1 
ATOM 2821 N N   . ASP A 1 364  ? 5.017   39.638 31.568  1.00 26.61  ? 361  ASP A N   1 
ATOM 2822 C CA  . ASP A 1 364  ? 4.381   38.581 30.814  1.00 26.61  ? 361  ASP A CA  1 
ATOM 2823 C C   . ASP A 1 364  ? 3.482   39.224 29.749  1.00 26.61  ? 361  ASP A C   1 
ATOM 2824 O O   . ASP A 1 364  ? 3.175   40.439 29.823  1.00 26.61  ? 361  ASP A O   1 
ATOM 2825 C CB  . ASP A 1 364  ? 3.564   37.691 31.774  1.00 53.86  ? 361  ASP A CB  1 
ATOM 2826 C CG  . ASP A 1 364  ? 2.924   36.497 31.079  1.00 53.86  ? 361  ASP A CG  1 
ATOM 2827 O OD1 . ASP A 1 364  ? 3.496   36.023 30.062  1.00 53.86  ? 361  ASP A OD1 1 
ATOM 2828 O OD2 . ASP A 1 364  ? 1.846   36.046 31.539  1.00 53.86  ? 361  ASP A OD2 1 
ATOM 2829 N N   . MET A 1 365  ? 3.018   38.425 28.776  1.00 39.06  ? 362  MET A N   1 
ATOM 2830 C CA  . MET A 1 365  ? 2.118   38.973 27.750  1.00 39.06  ? 362  MET A CA  1 
ATOM 2831 C C   . MET A 1 365  ? 1.385   37.929 26.913  1.00 39.06  ? 362  MET A C   1 
ATOM 2832 O O   . MET A 1 365  ? 1.643   36.754 27.018  1.00 39.06  ? 362  MET A O   1 
ATOM 2833 C CB  . MET A 1 365  ? 2.889   39.936 26.820  1.00 38.98  ? 362  MET A CB  1 
ATOM 2834 C CG  . MET A 1 365  ? 4.098   39.284 26.187  1.00 38.98  ? 362  MET A CG  1 
ATOM 2835 S SD  . MET A 1 365  ? 4.912   40.158 24.848  1.00 38.98  ? 362  MET A SD  1 
ATOM 2836 C CE  . MET A 1 365  ? 5.463   41.609 25.691  1.00 38.98  ? 362  MET A CE  1 
ATOM 2837 N N   . CYS A 1 366  ? 0.472   38.383 26.061  1.00 29.39  ? 363  CYS A N   1 
ATOM 2838 C CA  . CYS A 1 366  ? -0.191  37.494 25.117  1.00 29.39  ? 363  CYS A CA  1 
ATOM 2839 C C   . CYS A 1 366  ? -0.778  38.311 23.977  1.00 29.39  ? 363  CYS A C   1 
ATOM 2840 O O   . CYS A 1 366  ? -0.958  39.521 24.116  1.00 29.39  ? 363  CYS A O   1 
ATOM 2841 C CB  . CYS A 1 366  ? -1.285  36.646 25.793  1.00 44.87  ? 363  CYS A CB  1 
ATOM 2842 S SG  . CYS A 1 366  ? -2.604  37.560 26.544  1.00 44.87  ? 363  CYS A SG  1 
ATOM 2843 N N   . VAL A 1 367  ? -1.075  37.638 22.869  1.00 38.03  ? 364  VAL A N   1 
ATOM 2844 C CA  . VAL A 1 367  ? -1.645  38.279 21.685  1.00 38.03  ? 364  VAL A CA  1 
ATOM 2845 C C   . VAL A 1 367  ? -3.091  37.842 21.461  1.00 38.03  ? 364  VAL A C   1 
ATOM 2846 O O   . VAL A 1 367  ? -3.422  36.635 21.466  1.00 38.03  ? 364  VAL A O   1 
ATOM 2847 C CB  . VAL A 1 367  ? -0.876  37.906 20.401  1.00 48.29  ? 364  VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 367  ? -1.434  38.673 19.248  1.00 48.29  ? 364  VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 367  ? 0.618   38.189 20.541  1.00 48.29  ? 364  VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 368  ? -3.949  38.822 21.219  1.00 72.33  ? 365  VAL A N   1 
ATOM 2851 C CA  . VAL A 1 368  ? -5.338  38.536 20.930  1.00 72.33  ? 365  VAL A CA  1 
ATOM 2852 C C   . VAL A 1 368  ? -5.842  39.290 19.708  1.00 72.33  ? 365  VAL A C   1 
ATOM 2853 O O   . VAL A 1 368  ? -5.248  40.266 19.278  1.00 72.33  ? 365  VAL A O   1 
ATOM 2854 C CB  . VAL A 1 368  ? -6.210  38.845 22.142  1.00 45.06  ? 365  VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 368  ? -6.167  37.686 23.116  1.00 45.06  ? 365  VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 368  ? -5.724  40.106 22.826  1.00 45.06  ? 365  VAL A CG2 1 
ATOM 2857 N N   . ASP A 1 369  ? -6.927  38.794 19.136  1.00 61.23  ? 366  ASP A N   1 
ATOM 2858 C CA  . ASP A 1 369  ? -7.696  39.539 18.170  1.00 61.23  ? 366  ASP A CA  1 
ATOM 2859 C C   . ASP A 1 369  ? -8.845  40.214 18.886  1.00 61.23  ? 366  ASP A C   1 
ATOM 2860 O O   . ASP A 1 369  ? -9.965  39.708 18.887  1.00 61.23  ? 366  ASP A O   1 
ATOM 2861 C CB  . ASP A 1 369  ? -8.213  38.625 17.062  1.00 85.62  ? 366  ASP A CB  1 
ATOM 2862 C CG  . ASP A 1 369  ? -7.196  38.413 15.978  1.00 85.62  ? 366  ASP A CG  1 
ATOM 2863 O OD1 . ASP A 1 369  ? -5.992  38.564 16.250  1.00 85.62  ? 366  ASP A OD1 1 
ATOM 2864 O OD2 . ASP A 1 369  ? -7.587  38.102 14.847  1.00 85.62  ? 366  ASP A OD2 1 
ATOM 2865 N N   . LEU A 1 370  ? -8.578  41.356 19.504  1.00 133.87 ? 367  LEU A N   1 
ATOM 2866 C CA  . LEU A 1 370  ? -9.639  42.022 20.234  1.00 133.87 ? 367  LEU A CA  1 
ATOM 2867 C C   . LEU A 1 370  ? -10.731 42.522 19.297  1.00 133.87 ? 367  LEU A C   1 
ATOM 2868 O O   . LEU A 1 370  ? -11.850 42.010 19.325  1.00 133.87 ? 367  LEU A O   1 
ATOM 2869 C CB  . LEU A 1 370  ? -9.101  43.120 21.151  1.00 95.25  ? 367  LEU A CB  1 
ATOM 2870 C CG  . LEU A 1 370  ? -8.528  42.603 22.476  1.00 95.25  ? 367  LEU A CG  1 
ATOM 2871 C CD1 . LEU A 1 370  ? -8.298  43.760 23.447  1.00 95.25  ? 367  LEU A CD1 1 
ATOM 2872 C CD2 . LEU A 1 370  ? -9.421  41.524 23.111  1.00 95.25  ? 367  LEU A CD2 1 
ATOM 2873 N N   . GLU A 1 371  ? -10.391 43.475 18.435  1.00 121.92 ? 368  GLU A N   1 
ATOM 2874 C CA  . GLU A 1 371  ? -11.366 44.071 17.519  1.00 121.92 ? 368  GLU A CA  1 
ATOM 2875 C C   . GLU A 1 371  ? -11.792 43.114 16.386  1.00 121.92 ? 368  GLU A C   1 
ATOM 2876 O O   . GLU A 1 371  ? -12.074 43.558 15.278  1.00 121.92 ? 368  GLU A O   1 
ATOM 2877 C CB  . GLU A 1 371  ? -10.827 45.384 16.931  1.00 174.79 ? 368  GLU A CB  1 
ATOM 2878 C CG  . GLU A 1 371  ? -9.823  46.149 17.803  1.00 174.79 ? 368  GLU A CG  1 
ATOM 2879 C CD  . GLU A 1 371  ? -10.463 47.208 18.686  1.00 174.79 ? 368  GLU A CD  1 
ATOM 2880 O OE1 . GLU A 1 371  ? -11.465 46.908 19.368  1.00 174.79 ? 368  GLU A OE1 1 
ATOM 2881 O OE2 . GLU A 1 371  ? -9.948  48.346 18.709  1.00 174.79 ? 368  GLU A OE2 1 
ATOM 2882 N N   . ARG A 1 372  ? -11.816 41.808 16.669  1.00 120.00 ? 369  ARG A N   1 
ATOM 2883 C CA  . ARG A 1 372  ? -12.348 40.757 15.762  1.00 120.00 ? 369  ARG A CA  1 
ATOM 2884 C C   . ARG A 1 372  ? -11.615 40.540 14.416  1.00 120.00 ? 369  ARG A C   1 
ATOM 2885 O O   . ARG A 1 372  ? -11.706 39.463 13.804  1.00 120.00 ? 369  ARG A O   1 
ATOM 2886 C CB  . ARG A 1 372  ? -13.867 40.932 15.543  1.00 120.55 ? 369  ARG A CB  1 
ATOM 2887 C CG  . ARG A 1 372  ? -14.658 39.623 15.432  1.00 120.55 ? 369  ARG A CG  1 
ATOM 2888 C CD  . ARG A 1 372  ? -14.535 38.791 16.714  1.00 120.55 ? 369  ARG A CD  1 
ATOM 2889 N NE  . ARG A 1 372  ? -14.903 37.385 16.532  1.00 120.55 ? 369  ARG A NE  1 
ATOM 2890 C CZ  . ARG A 1 372  ? -14.138 36.463 15.943  1.00 120.55 ? 369  ARG A CZ  1 
ATOM 2891 N NH1 . ARG A 1 372  ? -12.945 36.785 15.444  1.00 120.55 ? 369  ARG A NH1 1 
ATOM 2892 N NH2 . ARG A 1 372  ? -14.576 35.210 15.841  1.00 120.55 ? 369  ARG A NH2 1 
ATOM 2893 N N   . GLN A 1 373  ? -10.895 41.566 13.974  1.00 171.51 ? 370  GLN A N   1 
ATOM 2894 C CA  . GLN A 1 373  ? -10.179 41.547 12.706  1.00 171.51 ? 370  GLN A CA  1 
ATOM 2895 C C   . GLN A 1 373  ? -8.909  40.731 12.852  1.00 171.51 ? 370  GLN A C   1 
ATOM 2896 O O   . GLN A 1 373  ? -8.398  40.576 13.964  1.00 171.51 ? 370  GLN A O   1 
ATOM 2897 C CB  . GLN A 1 373  ? -9.778  42.967 12.312  1.00 100.52 ? 370  GLN A CB  1 
ATOM 2898 C CG  . GLN A 1 373  ? -10.406 44.073 13.139  1.00 100.52 ? 370  GLN A CG  1 
ATOM 2899 C CD  . GLN A 1 373  ? -9.430  45.199 13.435  1.00 100.52 ? 370  GLN A CD  1 
ATOM 2900 O OE1 . GLN A 1 373  ? -9.107  45.465 14.596  1.00 100.52 ? 370  GLN A OE1 1 
ATOM 2901 N NE2 . GLN A 1 373  ? -8.937  45.857 12.383  1.00 100.52 ? 370  GLN A NE2 1 
ATOM 2902 N N   . GLY A 1 374  ? -8.384  40.236 11.731  1.00 54.82  ? 371  GLY A N   1 
ATOM 2903 C CA  . GLY A 1 374  ? -7.119  39.526 11.734  1.00 54.82  ? 371  GLY A CA  1 
ATOM 2904 C C   . GLY A 1 374  ? -5.893  40.379 12.067  1.00 54.82  ? 371  GLY A C   1 
ATOM 2905 O O   . GLY A 1 374  ? -4.780  40.039 11.663  1.00 54.82  ? 371  GLY A O   1 
ATOM 2906 N N   . GLN A 1 375  ? -6.052  41.485 12.790  1.00 84.16  ? 372  GLN A N   1 
ATOM 2907 C CA  . GLN A 1 375  ? -4.861  42.161 13.318  1.00 84.16  ? 372  GLN A CA  1 
ATOM 2908 C C   . GLN A 1 375  ? -4.593  41.766 14.755  1.00 84.16  ? 372  GLN A C   1 
ATOM 2909 O O   . GLN A 1 375  ? -5.496  41.761 15.589  1.00 84.16  ? 372  GLN A O   1 
ATOM 2910 C CB  . GLN A 1 375  ? -4.877  43.692 13.135  1.00 131.32 ? 372  GLN A CB  1 
ATOM 2911 C CG  . GLN A 1 375  ? -6.183  44.383 13.470  1.00 131.32 ? 372  GLN A CG  1 
ATOM 2912 C CD  . GLN A 1 375  ? -6.298  44.812 14.928  1.00 131.32 ? 372  GLN A CD  1 
ATOM 2913 O OE1 . GLN A 1 375  ? -5.825  45.887 15.312  1.00 131.32 ? 372  GLN A OE1 1 
ATOM 2914 N NE2 . GLN A 1 375  ? -6.968  43.988 15.737  1.00 131.32 ? 372  GLN A NE2 1 
ATOM 2915 N N   . GLY A 1 376  ? -3.344  41.399 15.015  1.00 83.23  ? 373  GLY A N   1 
ATOM 2916 C CA  . GLY A 1 376  ? -2.897  41.065 16.349  1.00 83.23  ? 373  GLY A CA  1 
ATOM 2917 C C   . GLY A 1 376  ? -2.932  42.255 17.280  1.00 83.23  ? 373  GLY A C   1 
ATOM 2918 O O   . GLY A 1 376  ? -2.630  43.387 16.905  1.00 83.23  ? 373  GLY A O   1 
ATOM 2919 N N   . GLN A 1 377  ? -3.336  41.980 18.504  1.00 42.28  ? 374  GLN A N   1 
ATOM 2920 C CA  . GLN A 1 377  ? -3.294  42.962 19.578  1.00 42.28  ? 374  GLN A CA  1 
ATOM 2921 C C   . GLN A 1 377  ? -2.528  42.337 20.731  1.00 42.28  ? 374  GLN A C   1 
ATOM 2922 O O   . GLN A 1 377  ? -2.688  41.158 21.057  1.00 42.28  ? 374  GLN A O   1 
ATOM 2923 C CB  . GLN A 1 377  ? -4.703  43.385 19.998  1.00 64.44  ? 374  GLN A CB  1 
ATOM 2924 C CG  . GLN A 1 377  ? -4.854  44.918 20.008  1.00 64.44  ? 374  GLN A CG  1 
ATOM 2925 C CD  . GLN A 1 377  ? -6.271  45.446 19.691  1.00 64.44  ? 374  GLN A CD  1 
ATOM 2926 O OE1 . GLN A 1 377  ? -7.095  44.764 19.086  1.00 64.44  ? 374  GLN A OE1 1 
ATOM 2927 N NE2 . GLN A 1 377  ? -6.532  46.678 20.091  1.00 64.44  ? 374  GLN A NE2 1 
ATOM 2928 N N   . LEU A 1 378  ? -1.654  43.128 21.321  1.00 49.12  ? 375  LEU A N   1 
ATOM 2929 C CA  . LEU A 1 378  ? -0.763  42.637 22.357  1.00 49.12  ? 375  LEU A CA  1 
ATOM 2930 C C   . LEU A 1 378  ? -1.142  43.252 23.694  1.00 49.12  ? 375  LEU A C   1 
ATOM 2931 O O   . LEU A 1 378  ? -1.299  44.485 23.804  1.00 49.12  ? 375  LEU A O   1 
ATOM 2932 C CB  . LEU A 1 378  ? 0.665   43.011 21.993  1.00 33.91  ? 375  LEU A CB  1 
ATOM 2933 C CG  . LEU A 1 378  ? 1.820   42.420 22.795  1.00 33.91  ? 375  LEU A CG  1 
ATOM 2934 C CD1 . LEU A 1 378  ? 2.080   40.957 22.450  1.00 33.91  ? 375  LEU A CD1 1 
ATOM 2935 C CD2 . LEU A 1 378  ? 3.052   43.277 22.511  1.00 33.91  ? 375  LEU A CD2 1 
ATOM 2936 N N   . VAL A 1 379  ? -1.319  42.405 24.703  1.00 48.22  ? 376  VAL A N   1 
ATOM 2937 C CA  . VAL A 1 379  ? -1.578  42.929 26.035  1.00 48.22  ? 376  VAL A CA  1 
ATOM 2938 C C   . VAL A 1 379  ? -0.595  42.467 27.105  1.00 48.22  ? 376  VAL A C   1 
ATOM 2939 O O   . VAL A 1 379  ? -0.467  41.263 27.369  1.00 48.22  ? 376  VAL A O   1 
ATOM 2940 C CB  . VAL A 1 379  ? -3.074  42.846 26.464  1.00 36.16  ? 376  VAL A CB  1 
ATOM 2941 C CG1 . VAL A 1 379  ? -3.973  42.159 25.396  1.00 36.16  ? 376  VAL A CG1 1 
ATOM 2942 C CG2 . VAL A 1 379  ? -3.228  42.264 27.810  1.00 36.16  ? 376  VAL A CG2 1 
ATOM 2943 N N   . THR A 1 380  ? 0.100   43.431 27.698  1.00 39.78  ? 377  THR A N   1 
ATOM 2944 C CA  . THR A 1 380  ? 1.187   43.158 28.619  1.00 39.78  ? 377  THR A CA  1 
ATOM 2945 C C   . THR A 1 380  ? 0.826   43.271 30.097  1.00 39.78  ? 377  THR A C   1 
ATOM 2946 O O   . THR A 1 380  ? -0.008  44.094 30.472  1.00 39.78  ? 377  THR A O   1 
ATOM 2947 C CB  . THR A 1 380  ? 2.301   44.198 28.434  1.00 32.99  ? 377  THR A CB  1 
ATOM 2948 O OG1 . THR A 1 380  ? 1.775   45.505 28.753  1.00 32.99  ? 377  THR A OG1 1 
ATOM 2949 C CG2 . THR A 1 380  ? 2.847   44.165 27.005  1.00 32.99  ? 377  THR A CG2 1 
ATOM 2950 N N   . CYS A 1 381  ? 1.484   42.462 30.929  1.00 34.02  ? 378  CYS A N   1 
ATOM 2951 C CA  . CYS A 1 381  ? 1.600   42.739 32.350  1.00 34.02  ? 378  CYS A CA  1 
ATOM 2952 C C   . CYS A 1 381  ? 2.804   43.653 32.528  1.00 34.02  ? 378  CYS A C   1 
ATOM 2953 O O   . CYS A 1 381  ? 3.958   43.246 32.304  1.00 34.02  ? 378  CYS A O   1 
ATOM 2954 C CB  . CYS A 1 381  ? 1.758   41.462 33.152  1.00 44.33  ? 378  CYS A CB  1 
ATOM 2955 S SG  . CYS A 1 381  ? 0.303   40.403 33.095  1.00 44.33  ? 378  CYS A SG  1 
ATOM 2956 N N   . SER A 1 382  ? 2.533   44.891 32.935  1.00 44.99  ? 379  SER A N   1 
ATOM 2957 C CA  . SER A 1 382  ? 3.551   45.923 32.982  1.00 44.99  ? 379  SER A CA  1 
ATOM 2958 C C   . SER A 1 382  ? 3.671   46.582 34.335  1.00 44.99  ? 379  SER A C   1 
ATOM 2959 O O   . SER A 1 382  ? 2.705   46.711 35.056  1.00 44.99  ? 379  SER A O   1 
ATOM 2960 C CB  . SER A 1 382  ? 3.249   46.993 31.928  1.00 27.46  ? 379  SER A CB  1 
ATOM 2961 O OG  . SER A 1 382  ? 3.471   46.478 30.641  1.00 27.46  ? 379  SER A OG  1 
ATOM 2962 N N   . GLY A 1 383  ? 4.872   47.025 34.648  1.00 32.65  ? 380  GLY A N   1 
ATOM 2963 C CA  . GLY A 1 383  ? 5.120   47.813 35.823  1.00 32.65  ? 380  GLY A CA  1 
ATOM 2964 C C   . GLY A 1 383  ? 5.107   46.950 37.043  1.00 32.65  ? 380  GLY A C   1 
ATOM 2965 O O   . GLY A 1 383  ? 5.103   45.734 36.945  1.00 32.65  ? 380  GLY A O   1 
ATOM 2966 N N   . ALA A 1 384  ? 5.103   47.572 38.204  1.00 48.05  ? 381  ALA A N   1 
ATOM 2967 C CA  . ALA A 1 384  ? 5.044   46.814 39.419  1.00 48.05  ? 381  ALA A CA  1 
ATOM 2968 C C   . ALA A 1 384  ? 4.572   47.723 40.520  1.00 48.05  ? 381  ALA A C   1 
ATOM 2969 O O   . ALA A 1 384  ? 4.564   48.956 40.359  1.00 48.05  ? 381  ALA A O   1 
ATOM 2970 C CB  . ALA A 1 384  ? 6.365   46.259 39.732  1.00 31.74  ? 381  ALA A CB  1 
ATOM 2971 N N   . PHE A 1 385  ? 4.148   47.110 41.619  1.00 31.98  ? 382  PHE A N   1 
ATOM 2972 C CA  . PHE A 1 385  ? 3.574   47.826 42.750  1.00 31.98  ? 382  PHE A CA  1 
ATOM 2973 C C   . PHE A 1 385  ? 2.569   48.882 42.291  1.00 31.98  ? 382  PHE A C   1 
ATOM 2974 O O   . PHE A 1 385  ? 1.754   48.621 41.371  1.00 31.98  ? 382  PHE A O   1 
ATOM 2975 C CB  . PHE A 1 385  ? 4.678   48.409 43.607  1.00 24.55  ? 382  PHE A CB  1 
ATOM 2976 C CG  . PHE A 1 385  ? 5.882   47.506 43.738  1.00 24.55  ? 382  PHE A CG  1 
ATOM 2977 C CD1 . PHE A 1 385  ? 7.046   47.765 43.027  1.00 24.55  ? 382  PHE A CD1 1 
ATOM 2978 C CD2 . PHE A 1 385  ? 5.862   46.384 44.591  1.00 24.55  ? 382  PHE A CD2 1 
ATOM 2979 C CE1 . PHE A 1 385  ? 8.201   46.898 43.167  1.00 24.55  ? 382  PHE A CE1 1 
ATOM 2980 C CE2 . PHE A 1 385  ? 6.984   45.543 44.716  1.00 24.55  ? 382  PHE A CE2 1 
ATOM 2981 C CZ  . PHE A 1 385  ? 8.145   45.795 43.986  1.00 24.55  ? 382  PHE A CZ  1 
ATOM 2982 N N   . LYS A 1 386  ? 2.632   50.076 42.875  1.00 45.36  ? 383  LYS A N   1 
ATOM 2983 C CA  . LYS A 1 386  ? 1.650   51.106 42.543  1.00 45.36  ? 383  LYS A CA  1 
ATOM 2984 C C   . LYS A 1 386  ? 1.644   51.481 41.032  1.00 45.36  ? 383  LYS A C   1 
ATOM 2985 O O   . LYS A 1 386  ? 0.600   51.902 40.490  1.00 45.36  ? 383  LYS A O   1 
ATOM 2986 C CB  . LYS A 1 386  ? 1.760   52.318 43.494  1.00 33.17  ? 383  LYS A CB  1 
ATOM 2987 C CG  . LYS A 1 386  ? 2.758   53.346 43.108  1.00 33.17  ? 383  LYS A CG  1 
ATOM 2988 C CD  . LYS A 1 386  ? 2.626   54.625 43.920  1.00 33.17  ? 383  LYS A CD  1 
ATOM 2989 C CE  . LYS A 1 386  ? 3.805   55.616 43.695  1.00 33.17  ? 383  LYS A CE  1 
ATOM 2990 N NZ  . LYS A 1 386  ? 3.868   56.172 42.289  1.00 33.17  ? 383  LYS A NZ  1 
ATOM 2991 N N   . GLU A 1 387  ? 2.780   51.284 40.351  1.00 34.89  ? 384  GLU A N   1 
ATOM 2992 C CA  . GLU A 1 387  ? 2.842   51.515 38.910  1.00 34.89  ? 384  GLU A CA  1 
ATOM 2993 C C   . GLU A 1 387  ? 2.277   50.381 38.064  1.00 34.89  ? 384  GLU A C   1 
ATOM 2994 O O   . GLU A 1 387  ? 2.220   50.513 36.846  1.00 34.89  ? 384  GLU A O   1 
ATOM 2995 C CB  . GLU A 1 387  ? 4.265   51.782 38.466  1.00 44.72  ? 384  GLU A CB  1 
ATOM 2996 C CG  . GLU A 1 387  ? 5.108   52.626 39.425  1.00 44.72  ? 384  GLU A CG  1 
ATOM 2997 C CD  . GLU A 1 387  ? 4.488   53.966 39.727  1.00 44.72  ? 384  GLU A CD  1 
ATOM 2998 O OE1 . GLU A 1 387  ? 3.477   54.277 39.067  1.00 44.72  ? 384  GLU A OE1 1 
ATOM 2999 O OE2 . GLU A 1 387  ? 4.987   54.690 40.621  1.00 44.72  ? 384  GLU A OE2 1 
ATOM 3000 N N   . GLY A 1 388  ? 1.853   49.271 38.667  1.00 30.04  ? 385  GLY A N   1 
ATOM 3001 C CA  . GLY A 1 388  ? 1.470   48.112 37.856  1.00 30.04  ? 385  GLY A CA  1 
ATOM 3002 C C   . GLY A 1 388  ? 0.315   48.433 36.914  1.00 30.04  ? 385  GLY A C   1 
ATOM 3003 O O   . GLY A 1 388  ? -0.486  49.310 37.230  1.00 30.04  ? 385  GLY A O   1 
ATOM 3004 N N   . SER A 1 389  ? 0.204   47.718 35.791  1.00 39.65  ? 386  SER A N   1 
ATOM 3005 C CA  . SER A 1 389  ? -0.817  47.988 34.779  1.00 39.65  ? 386  SER A CA  1 
ATOM 3006 C C   . SER A 1 389  ? -0.933  46.882 33.711  1.00 39.65  ? 386  SER A C   1 
ATOM 3007 O O   . SER A 1 389  ? -0.001  46.076 33.551  1.00 39.65  ? 386  SER A O   1 
ATOM 3008 C CB  . SER A 1 389  ? -0.481  49.306 34.069  1.00 41.35  ? 386  SER A CB  1 
ATOM 3009 O OG  . SER A 1 389  ? 0.499   49.121 33.062  1.00 41.35  ? 386  SER A OG  1 
ATOM 3010 N N   . LEU A 1 390  ? -2.057  46.848 32.981  1.00 29.12  ? 387  LEU A N   1 
ATOM 3011 C CA  . LEU A 1 390  ? -2.066  46.226 31.638  1.00 29.12  ? 387  LEU A CA  1 
ATOM 3012 C C   . LEU A 1 390  ? -1.829  47.286 30.551  1.00 29.12  ? 387  LEU A C   1 
ATOM 3013 O O   . LEU A 1 390  ? -2.226  48.450 30.713  1.00 29.12  ? 387  LEU A O   1 
ATOM 3014 C CB  . LEU A 1 390  ? -3.375  45.520 31.311  1.00 13.27  ? 387  LEU A CB  1 
ATOM 3015 C CG  . LEU A 1 390  ? -3.927  44.715 32.471  1.00 13.27  ? 387  LEU A CG  1 
ATOM 3016 C CD1 . LEU A 1 390  ? -5.217  44.084 32.104  1.00 13.27  ? 387  LEU A CD1 1 
ATOM 3017 C CD2 . LEU A 1 390  ? -2.853  43.666 32.792  1.00 13.27  ? 387  LEU A CD2 1 
ATOM 3018 N N   . ARG A 1 391  ? -1.159  46.886 29.465  1.00 26.84  ? 388  ARG A N   1 
ATOM 3019 C CA  . ARG A 1 391  ? -1.089  47.760 28.295  1.00 26.84  ? 388  ARG A CA  1 
ATOM 3020 C C   . ARG A 1 391  ? -1.545  47.044 27.031  1.00 26.84  ? 388  ARG A C   1 
ATOM 3021 O O   . ARG A 1 391  ? -0.918  46.077 26.616  1.00 26.84  ? 388  ARG A O   1 
ATOM 3022 C CB  . ARG A 1 391  ? 0.323   48.295 28.080  1.00 32.73  ? 388  ARG A CB  1 
ATOM 3023 C CG  . ARG A 1 391  ? 0.982   48.805 29.316  1.00 32.73  ? 388  ARG A CG  1 
ATOM 3024 C CD  . ARG A 1 391  ? 0.558   50.159 29.639  1.00 32.73  ? 388  ARG A CD  1 
ATOM 3025 N NE  . ARG A 1 391  ? 1.389   50.683 30.708  1.00 32.73  ? 388  ARG A NE  1 
ATOM 3026 C CZ  . ARG A 1 391  ? 1.536   51.970 30.965  1.00 32.73  ? 388  ARG A CZ  1 
ATOM 3027 N NH1 . ARG A 1 391  ? 0.903   52.857 30.210  1.00 32.73  ? 388  ARG A NH1 1 
ATOM 3028 N NH2 . ARG A 1 391  ? 2.305   52.372 31.955  1.00 32.73  ? 388  ARG A NH2 1 
ATOM 3029 N N   . ILE A 1 392  ? -2.621  47.540 26.420  1.00 47.68  ? 389  ILE A N   1 
ATOM 3030 C CA  . ILE A 1 392  ? -3.055  47.028 25.128  1.00 47.68  ? 389  ILE A CA  1 
ATOM 3031 C C   . ILE A 1 392  ? -2.329  47.781 23.987  1.00 47.68  ? 389  ILE A C   1 
ATOM 3032 O O   . ILE A 1 392  ? -2.464  48.996 23.847  1.00 47.68  ? 389  ILE A O   1 
ATOM 3033 C CB  . ILE A 1 392  ? -4.600  47.069 25.002  1.00 38.76  ? 389  ILE A CB  1 
ATOM 3034 C CG1 . ILE A 1 392  ? -5.257  46.355 26.196  1.00 38.76  ? 389  ILE A CG1 1 
ATOM 3035 C CG2 . ILE A 1 392  ? -5.100  46.474 23.654  1.00 38.76  ? 389  ILE A CG2 1 
ATOM 3036 C CD1 . ILE A 1 392  ? -5.446  47.215 27.416  1.00 38.76  ? 389  ILE A CD1 1 
ATOM 3037 N N   . ILE A 1 393  ? -1.553  47.037 23.194  1.00 55.39  ? 390  ILE A N   1 
ATOM 3038 C CA  . ILE A 1 393  ? -0.722  47.595 22.124  1.00 55.39  ? 390  ILE A CA  1 
ATOM 3039 C C   . ILE A 1 393  ? -1.193  47.198 20.703  1.00 55.39  ? 390  ILE A C   1 
ATOM 3040 O O   . ILE A 1 393  ? -1.340  46.015 20.382  1.00 55.39  ? 390  ILE A O   1 
ATOM 3041 C CB  . ILE A 1 393  ? 0.740   47.177 22.330  1.00 43.82  ? 390  ILE A CB  1 
ATOM 3042 C CG1 . ILE A 1 393  ? 1.170   47.471 23.773  1.00 43.82  ? 390  ILE A CG1 1 
ATOM 3043 C CG2 . ILE A 1 393  ? 1.682   47.844 21.309  1.00 43.82  ? 390  ILE A CG2 1 
ATOM 3044 C CD1 . ILE A 1 393  ? 2.370   46.642 24.239  1.00 43.82  ? 390  ILE A CD1 1 
ATOM 3045 N N   . ARG A 1 394  ? -1.407  48.198 19.857  1.00 50.77  ? 391  ARG A N   1 
ATOM 3046 C CA  . ARG A 1 394  ? -1.983  47.998 18.529  1.00 50.77  ? 391  ARG A CA  1 
ATOM 3047 C C   . ARG A 1 394  ? -1.099  48.651 17.473  1.00 50.77  ? 391  ARG A C   1 
ATOM 3048 O O   . ARG A 1 394  ? -0.665  49.810 17.627  1.00 50.77  ? 391  ARG A O   1 
ATOM 3049 C CB  . ARG A 1 394  ? -3.373  48.654 18.479  1.00 71.58  ? 391  ARG A CB  1 
ATOM 3050 C CG  . ARG A 1 394  ? -4.337  48.107 17.430  1.00 71.58  ? 391  ARG A CG  1 
ATOM 3051 C CD  . ARG A 1 394  ? -5.131  49.211 16.682  1.00 71.58  ? 391  ARG A CD  1 
ATOM 3052 N NE  . ARG A 1 394  ? -5.462  50.411 17.467  1.00 71.58  ? 391  ARG A NE  1 
ATOM 3053 C CZ  . ARG A 1 394  ? -6.555  50.545 18.225  1.00 71.58  ? 391  ARG A CZ  1 
ATOM 3054 N NH1 . ARG A 1 394  ? -7.436  49.544 18.307  1.00 71.58  ? 391  ARG A NH1 1 
ATOM 3055 N NH2 . ARG A 1 394  ? -6.771  51.678 18.905  1.00 71.58  ? 391  ARG A NH2 1 
ATOM 3056 N N   . ASN A 1 395  ? -0.832  47.925 16.394  1.00 46.00  ? 392  ASN A N   1 
ATOM 3057 C CA  . ASN A 1 395  ? -0.191  48.547 15.229  1.00 46.00  ? 392  ASN A CA  1 
ATOM 3058 C C   . ASN A 1 395  ? -1.190  49.467 14.511  1.00 46.00  ? 392  ASN A C   1 
ATOM 3059 O O   . ASN A 1 395  ? -2.396  49.164 14.407  1.00 46.00  ? 392  ASN A O   1 
ATOM 3060 C CB  . ASN A 1 395  ? 0.349   47.477 14.286  1.00 78.66  ? 392  ASN A CB  1 
ATOM 3061 C CG  . ASN A 1 395  ? 1.833   47.628 14.023  1.00 78.66  ? 392  ASN A CG  1 
ATOM 3062 O OD1 . ASN A 1 395  ? 2.255   48.470 13.226  1.00 78.66  ? 392  ASN A OD1 1 
ATOM 3063 N ND2 . ASN A 1 395  ? 2.639   46.806 14.693  1.00 78.66  ? 392  ASN A ND2 1 
ATOM 3064 N N   . GLY A 1 396  ? -0.695  50.618 14.072  1.00 51.73  ? 393  GLY A N   1 
ATOM 3065 C CA  . GLY A 1 396  ? -1.447  51.487 13.176  1.00 51.73  ? 393  GLY A CA  1 
ATOM 3066 C C   . GLY A 1 396  ? -2.431  52.478 13.760  1.00 51.73  ? 393  GLY A C   1 
ATOM 3067 O O   . GLY A 1 396  ? -2.738  52.497 14.962  1.00 51.73  ? 393  GLY A O   1 
ATOM 3068 N N   . ILE A 1 397  ? -2.933  53.317 12.868  1.00 42.71  ? 394  ILE A N   1 
ATOM 3069 C CA  . ILE A 1 397  ? -3.875  54.360 13.216  1.00 42.71  ? 394  ILE A CA  1 
ATOM 3070 C C   . ILE A 1 397  ? -5.307  53.884 12.863  1.00 42.71  ? 394  ILE A C   1 
ATOM 3071 O O   . ILE A 1 397  ? -5.532  53.262 11.814  1.00 42.71  ? 394  ILE A O   1 
ATOM 3072 C CB  . ILE A 1 397  ? -3.448  55.648 12.490  1.00 32.16  ? 394  ILE A CB  1 
ATOM 3073 C CG1 . ILE A 1 397  ? -2.007  55.985 12.868  1.00 32.16  ? 394  ILE A CG1 1 
ATOM 3074 C CG2 . ILE A 1 397  ? -4.339  56.818 12.824  1.00 32.16  ? 394  ILE A CG2 1 
ATOM 3075 C CD1 . ILE A 1 397  ? -1.440  57.218 12.120  1.00 32.16  ? 394  ILE A CD1 1 
ATOM 3076 N N   . GLY A 1 398  ? -6.259  54.141 13.760  1.00 48.47  ? 395  GLY A N   1 
ATOM 3077 C CA  . GLY A 1 398  ? -7.632  53.675 13.600  1.00 48.47  ? 395  GLY A CA  1 
ATOM 3078 C C   . GLY A 1 398  ? -8.535  54.865 13.404  1.00 48.47  ? 395  GLY A C   1 
ATOM 3079 O O   . GLY A 1 398  ? -8.148  55.988 13.752  1.00 48.47  ? 395  GLY A O   1 
ATOM 3080 N N   . ILE A 1 399  ? -9.725  54.622 12.827  1.00 57.40  ? 396  ILE A N   1 
ATOM 3081 C CA  . ILE A 1 399  ? -10.790 55.636 12.689  1.00 57.40  ? 396  ILE A CA  1 
ATOM 3082 C C   . ILE A 1 399  ? -12.147 55.024 13.033  1.00 57.40  ? 396  ILE A C   1 
ATOM 3083 O O   . ILE A 1 399  ? -12.419 53.868 12.652  1.00 57.40  ? 396  ILE A O   1 
ATOM 3084 C CB  . ILE A 1 399  ? -10.857 56.295 11.234  1.00 67.66  ? 396  ILE A CB  1 
ATOM 3085 C CG1 . ILE A 1 399  ? -11.230 55.277 10.167  1.00 67.66  ? 396  ILE A CG1 1 
ATOM 3086 C CG2 . ILE A 1 399  ? -9.549  57.024 10.825  1.00 67.66  ? 396  ILE A CG2 1 
ATOM 3087 C CD1 . ILE A 1 399  ? -12.680 55.327 9.754   1.00 67.66  ? 396  ILE A CD1 1 
ATOM 3088 N N   . HIS A 1 400  ? -13.000 55.814 13.707  1.00 82.94  ? 397  HIS A N   1 
ATOM 3089 C CA  . HIS A 1 400  ? -14.322 55.377 14.228  1.00 82.94  ? 397  HIS A CA  1 
ATOM 3090 C C   . HIS A 1 400  ? -15.495 55.558 13.248  1.00 82.94  ? 397  HIS A C   1 
ATOM 3091 O O   . HIS A 1 400  ? -15.994 56.667 13.094  1.00 82.94  ? 397  HIS A O   1 
ATOM 3092 C CB  . HIS A 1 400  ? -14.668 56.121 15.530  1.00 172.65 ? 397  HIS A CB  1 
ATOM 3093 C CG  . HIS A 1 400  ? -13.607 56.055 16.587  1.00 172.65 ? 397  HIS A CG  1 
ATOM 3094 N ND1 . HIS A 1 400  ? -13.109 57.181 17.206  1.00 172.65 ? 397  HIS A ND1 1 
ATOM 3095 C CD2 . HIS A 1 400  ? -12.966 55.003 17.148  1.00 172.65 ? 397  HIS A CD2 1 
ATOM 3096 C CE1 . HIS A 1 400  ? -12.201 56.827 18.098  1.00 172.65 ? 397  HIS A CE1 1 
ATOM 3097 N NE2 . HIS A 1 400  ? -12.093 55.510 18.081  1.00 172.65 ? 397  HIS A NE2 1 
ATOM 3098 N N   . GLU A 1 401  ? -15.965 54.461 12.645  1.00 103.93 ? 398  GLU A N   1 
ATOM 3099 C CA  . GLU A 1 401  ? -17.026 54.484 11.603  1.00 103.93 ? 398  GLU A CA  1 
ATOM 3100 C C   . GLU A 1 401  ? -18.474 54.754 12.074  1.00 103.93 ? 398  GLU A C   1 
ATOM 3101 O O   . GLU A 1 401  ? -19.067 53.965 12.825  1.00 103.93 ? 398  GLU A O   1 
ATOM 3102 C CB  . GLU A 1 401  ? -16.988 53.205 10.746  1.00 131.71 ? 398  GLU A CB  1 
ATOM 3103 C CG  . GLU A 1 401  ? -15.826 53.146 9.746   1.00 131.71 ? 398  GLU A CG  1 
ATOM 3104 C CD  . GLU A 1 401  ? -15.732 51.825 8.980   1.00 131.71 ? 398  GLU A CD  1 
ATOM 3105 O OE1 . GLU A 1 401  ? -16.090 50.760 9.537   1.00 131.71 ? 398  GLU A OE1 1 
ATOM 3106 O OE2 . GLU A 1 401  ? -15.276 51.853 7.815   1.00 131.71 ? 398  GLU A OE2 1 
ATOM 3107 N N   . HIS A 1 402  ? -19.039 55.865 11.595  1.00 196.91 ? 399  HIS A N   1 
ATOM 3108 C CA  . HIS A 1 402  ? -20.434 56.235 11.874  1.00 196.91 ? 399  HIS A CA  1 
ATOM 3109 C C   . HIS A 1 402  ? -21.324 55.791 10.709  1.00 196.91 ? 399  HIS A C   1 
ATOM 3110 O O   . HIS A 1 402  ? -21.082 54.724 10.134  1.00 196.91 ? 399  HIS A O   1 
ATOM 3111 C CB  . HIS A 1 402  ? -20.559 57.741 12.158  1.00 87.36  ? 399  HIS A CB  1 
ATOM 3112 C CG  . HIS A 1 402  ? -19.542 58.260 13.131  1.00 87.36  ? 399  HIS A CG  1 
ATOM 3113 N ND1 . HIS A 1 402  ? -19.331 59.606 13.341  1.00 87.36  ? 399  HIS A ND1 1 
ATOM 3114 C CD2 . HIS A 1 402  ? -18.666 57.615 13.939  1.00 87.36  ? 399  HIS A CD2 1 
ATOM 3115 C CE1 . HIS A 1 402  ? -18.381 59.767 14.245  1.00 87.36  ? 399  HIS A CE1 1 
ATOM 3116 N NE2 . HIS A 1 402  ? -17.958 58.574 14.621  1.00 87.36  ? 399  HIS A NE2 1 
ATOM 3117 N N   . ALA A 1 403  ? -22.347 56.579 10.361  1.00 175.15 ? 400  ALA A N   1 
ATOM 3118 C CA  . ALA A 1 403  ? -23.186 56.239 9.205   1.00 175.15 ? 400  ALA A CA  1 
ATOM 3119 C C   . ALA A 1 403  ? -22.338 56.302 7.950   1.00 175.15 ? 400  ALA A C   1 
ATOM 3120 O O   . ALA A 1 403  ? -21.501 57.195 7.790   1.00 175.15 ? 400  ALA A O   1 
ATOM 3121 C CB  . ALA A 1 403  ? -24.419 57.137 9.084   1.00 47.91  ? 400  ALA A CB  1 
ATOM 3122 N N   . SER A 1 404  ? -22.552 55.324 7.081   1.00 130.38 ? 401  SER A N   1 
ATOM 3123 C CA  . SER A 1 404  ? -21.675 55.085 5.955   1.00 130.38 ? 401  SER A CA  1 
ATOM 3124 C C   . SER A 1 404  ? -22.501 54.719 4.731   1.00 130.38 ? 401  SER A C   1 
ATOM 3125 O O   . SER A 1 404  ? -22.961 53.580 4.574   1.00 130.38 ? 401  SER A O   1 
ATOM 3126 C CB  . SER A 1 404  ? -20.662 53.991 6.298   1.00 96.53  ? 401  SER A CB  1 
ATOM 3127 O OG  . SER A 1 404  ? -19.893 54.359 7.432   1.00 96.53  ? 401  SER A OG  1 
ATOM 3128 N N   . ILE A 1 405  ? -22.679 55.714 3.871   1.00 115.25 ? 402  ILE A N   1 
ATOM 3129 C CA  . ILE A 1 405  ? -23.552 55.624 2.714   1.00 115.25 ? 402  ILE A CA  1 
ATOM 3130 C C   . ILE A 1 405  ? -22.853 54.830 1.628   1.00 115.25 ? 402  ILE A C   1 
ATOM 3131 O O   . ILE A 1 405  ? -21.738 55.169 1.240   1.00 115.25 ? 402  ILE A O   1 
ATOM 3132 C CB  . ILE A 1 405  ? -23.922 57.043 2.195   1.00 93.27  ? 402  ILE A CB  1 
ATOM 3133 C CG1 . ILE A 1 405  ? -24.369 57.956 3.353   1.00 93.27  ? 402  ILE A CG1 1 
ATOM 3134 C CG2 . ILE A 1 405  ? -25.008 56.975 1.115   1.00 93.27  ? 402  ILE A CG2 1 
ATOM 3135 C CD1 . ILE A 1 405  ? -23.246 58.781 4.022   1.00 93.27  ? 402  ILE A CD1 1 
ATOM 3136 N N   . ASP A 1 406  ? -23.497 53.762 1.158   1.00 141.28 ? 403  ASP A N   1 
ATOM 3137 C CA  . ASP A 1 406  ? -22.928 52.933 0.091   1.00 141.28 ? 403  ASP A CA  1 
ATOM 3138 C C   . ASP A 1 406  ? -23.029 53.614 -1.268  1.00 141.28 ? 403  ASP A C   1 
ATOM 3139 O O   . ASP A 1 406  ? -23.824 53.226 -2.131  1.00 141.28 ? 403  ASP A O   1 
ATOM 3140 C CB  . ASP A 1 406  ? -23.543 51.538 0.076   1.00 128.18 ? 403  ASP A CB  1 
ATOM 3141 C CG  . ASP A 1 406  ? -22.814 50.585 0.992   1.00 128.18 ? 403  ASP A CG  1 
ATOM 3142 O OD1 . ASP A 1 406  ? -22.635 50.922 2.184   1.00 128.18 ? 403  ASP A OD1 1 
ATOM 3143 O OD2 . ASP A 1 406  ? -22.406 49.502 0.522   1.00 128.18 ? 403  ASP A OD2 1 
ATOM 3144 N N   . LEU A 1 407  ? -22.179 54.624 -1.430  1.00 149.93 ? 404  LEU A N   1 
ATOM 3145 C CA  . LEU A 1 407  ? -22.195 55.532 -2.561  1.00 149.93 ? 404  LEU A CA  1 
ATOM 3146 C C   . LEU A 1 407  ? -20.999 55.255 -3.473  1.00 149.93 ? 404  LEU A C   1 
ATOM 3147 O O   . LEU A 1 407  ? -19.856 55.502 -3.090  1.00 149.93 ? 404  LEU A O   1 
ATOM 3148 C CB  . LEU A 1 407  ? -22.178 56.971 -2.033  1.00 131.50 ? 404  LEU A CB  1 
ATOM 3149 C CG  . LEU A 1 407  ? -22.028 58.201 -2.928  1.00 131.50 ? 404  LEU A CG  1 
ATOM 3150 C CD1 . LEU A 1 407  ? -23.046 58.231 -4.060  1.00 131.50 ? 404  LEU A CD1 1 
ATOM 3151 C CD2 . LEU A 1 407  ? -22.158 59.437 -2.061  1.00 131.50 ? 404  LEU A CD2 1 
ATOM 3152 N N   . PRO A 1 408  ? -21.264 54.745 -4.690  1.00 122.00 ? 405  PRO A N   1 
ATOM 3153 C CA  . PRO A 1 408  ? -20.198 54.254 -5.569  1.00 122.00 ? 405  PRO A CA  1 
ATOM 3154 C C   . PRO A 1 408  ? -19.400 55.378 -6.218  1.00 122.00 ? 405  PRO A C   1 
ATOM 3155 O O   . PRO A 1 408  ? -19.565 56.546 -5.853  1.00 122.00 ? 405  PRO A O   1 
ATOM 3156 C CB  . PRO A 1 408  ? -20.952 53.446 -6.645  1.00 147.40 ? 405  PRO A CB  1 
ATOM 3157 C CG  . PRO A 1 408  ? -22.407 53.477 -6.261  1.00 147.40 ? 405  PRO A CG  1 
ATOM 3158 C CD  . PRO A 1 408  ? -22.589 54.624 -5.321  1.00 147.40 ? 405  PRO A CD  1 
ATOM 3159 N N   . GLY A 1 409  ? -18.539 55.007 -7.165  1.00 163.01 ? 406  GLY A N   1 
ATOM 3160 C CA  . GLY A 1 409  ? -17.741 55.957 -7.934  1.00 163.01 ? 406  GLY A CA  1 
ATOM 3161 C C   . GLY A 1 409  ? -17.875 57.396 -7.480  1.00 163.01 ? 406  GLY A C   1 
ATOM 3162 O O   . GLY A 1 409  ? -18.861 58.060 -7.797  1.00 163.01 ? 406  GLY A O   1 
ATOM 3163 N N   . ILE A 1 410  ? -16.860 57.866 -6.750  1.00 102.73 ? 407  ILE A N   1 
ATOM 3164 C CA  . ILE A 1 410  ? -16.801 59.206 -6.150  1.00 102.73 ? 407  ILE A CA  1 
ATOM 3165 C C   . ILE A 1 410  ? -15.420 59.534 -6.691  1.00 102.73 ? 407  ILE A C   1 
ATOM 3166 O O   . ILE A 1 410  ? -14.651 58.648 -7.040  1.00 102.73 ? 407  ILE A O   1 
ATOM 3167 C CB  . ILE A 1 410  ? -16.732 58.981 -4.627  1.00 77.68  ? 407  ILE A CB  1 
ATOM 3168 C CG1 . ILE A 1 410  ? -18.015 58.336 -4.112  1.00 77.68  ? 407  ILE A CG1 1 
ATOM 3169 C CG2 . ILE A 1 410  ? -16.511 60.314 -3.919  1.00 77.68  ? 407  ILE A CG2 1 
ATOM 3170 C CD1 . ILE A 1 410  ? -18.078 58.186 -2.595  1.00 77.68  ? 407  ILE A CD1 1 
ATOM 3171 N N   . LYS A 1 411  ? -15.109 60.822 -6.753  1.00 83.01  ? 408  LYS A N   1 
ATOM 3172 C CA  . LYS A 1 411  ? -13.907 61.262 -7.441  1.00 83.01  ? 408  LYS A CA  1 
ATOM 3173 C C   . LYS A 1 411  ? -13.153 62.390 -6.728  1.00 83.01  ? 408  LYS A C   1 
ATOM 3174 O O   . LYS A 1 411  ? -12.045 62.745 -7.154  1.00 83.01  ? 408  LYS A O   1 
ATOM 3175 C CB  . LYS A 1 411  ? -14.246 61.652 -8.887  1.00 59.59  ? 408  LYS A CB  1 
ATOM 3176 C CG  . LYS A 1 411  ? -14.869 60.538 -9.725  1.00 59.59  ? 408  LYS A CG  1 
ATOM 3177 C CD  . LYS A 1 411  ? -13.872 59.439 -9.920  1.00 59.59  ? 408  LYS A CD  1 
ATOM 3178 C CE  . LYS A 1 411  ? -14.499 58.224 -10.528 1.00 59.59  ? 408  LYS A CE  1 
ATOM 3179 N NZ  . LYS A 1 411  ? -13.437 57.370 -11.134 1.00 59.59  ? 408  LYS A NZ  1 
ATOM 3180 N N   . GLY A 1 412  ? -13.741 62.932 -5.650  1.00 59.80  ? 409  GLY A N   1 
ATOM 3181 C CA  . GLY A 1 412  ? -13.094 63.981 -4.838  1.00 59.80  ? 409  GLY A CA  1 
ATOM 3182 C C   . GLY A 1 412  ? -14.020 64.533 -3.765  1.00 59.80  ? 409  GLY A C   1 
ATOM 3183 O O   . GLY A 1 412  ? -15.232 64.266 -3.798  1.00 59.80  ? 409  GLY A O   1 
ATOM 3184 N N   . LEU A 1 413  ? -13.450 65.274 -2.800  1.00 57.04  ? 410  LEU A N   1 
ATOM 3185 C CA  . LEU A 1 413  ? -14.222 66.053 -1.804  1.00 57.04  ? 410  LEU A CA  1 
ATOM 3186 C C   . LEU A 1 413  ? -13.436 67.104 -0.977  1.00 57.04  ? 410  LEU A C   1 
ATOM 3187 O O   . LEU A 1 413  ? -12.208 67.012 -0.777  1.00 57.04  ? 410  LEU A O   1 
ATOM 3188 C CB  . LEU A 1 413  ? -15.064 65.158 -0.896  1.00 79.41  ? 410  LEU A CB  1 
ATOM 3189 C CG  . LEU A 1 413  ? -14.429 63.912 -0.311  1.00 79.41  ? 410  LEU A CG  1 
ATOM 3190 C CD1 . LEU A 1 413  ? -13.862 64.236 1.049   1.00 79.41  ? 410  LEU A CD1 1 
ATOM 3191 C CD2 . LEU A 1 413  ? -15.510 62.843 -0.231  1.00 79.41  ? 410  LEU A CD2 1 
ATOM 3192 N N   . TRP A 1 414  ? -14.186 68.106 -0.515  1.00 89.68  ? 411  TRP A N   1 
ATOM 3193 C CA  . TRP A 1 414  ? -13.654 69.333 0.061   1.00 89.68  ? 411  TRP A CA  1 
ATOM 3194 C C   . TRP A 1 414  ? -14.556 69.663 1.254   1.00 89.68  ? 411  TRP A C   1 
ATOM 3195 O O   . TRP A 1 414  ? -15.698 69.212 1.280   1.00 89.68  ? 411  TRP A O   1 
ATOM 3196 C CB  . TRP A 1 414  ? -13.682 70.455 -1.004  1.00 60.63  ? 411  TRP A CB  1 
ATOM 3197 C CG  . TRP A 1 414  ? -12.997 70.056 -2.322  1.00 60.63  ? 411  TRP A CG  1 
ATOM 3198 C CD1 . TRP A 1 414  ? -11.721 70.360 -2.703  1.00 60.63  ? 411  TRP A CD1 1 
ATOM 3199 C CD2 . TRP A 1 414  ? -13.552 69.252 -3.395  1.00 60.63  ? 411  TRP A CD2 1 
ATOM 3200 N NE1 . TRP A 1 414  ? -11.444 69.786 -3.930  1.00 60.63  ? 411  TRP A NE1 1 
ATOM 3201 C CE2 . TRP A 1 414  ? -12.547 69.104 -4.370  1.00 60.63  ? 411  TRP A CE2 1 
ATOM 3202 C CE3 . TRP A 1 414  ? -14.797 68.640 -3.612  1.00 60.63  ? 411  TRP A CE3 1 
ATOM 3203 C CZ2 . TRP A 1 414  ? -12.747 68.389 -5.549  1.00 60.63  ? 411  TRP A CZ2 1 
ATOM 3204 C CZ3 . TRP A 1 414  ? -14.994 67.922 -4.783  1.00 60.63  ? 411  TRP A CZ3 1 
ATOM 3205 C CH2 . TRP A 1 414  ? -13.971 67.810 -5.741  1.00 60.63  ? 411  TRP A CH2 1 
ATOM 3206 N N   . PRO A 1 415  ? -14.054 70.430 2.253   1.00 68.97  ? 412  PRO A N   1 
ATOM 3207 C CA  . PRO A 1 415  ? -14.922 70.799 3.386   1.00 68.97  ? 412  PRO A CA  1 
ATOM 3208 C C   . PRO A 1 415  ? -15.941 71.915 3.052   1.00 68.97  ? 412  PRO A C   1 
ATOM 3209 O O   . PRO A 1 415  ? -15.602 73.120 3.001   1.00 68.97  ? 412  PRO A O   1 
ATOM 3210 C CB  . PRO A 1 415  ? -13.932 71.216 4.492   1.00 101.98 ? 412  PRO A CB  1 
ATOM 3211 C CG  . PRO A 1 415  ? -12.671 71.566 3.798   1.00 101.98 ? 412  PRO A CG  1 
ATOM 3212 C CD  . PRO A 1 415  ? -12.691 70.985 2.399   1.00 101.98 ? 412  PRO A CD  1 
ATOM 3213 N N   . LEU A 1 416  ? -17.190 71.484 2.866   1.00 166.93 ? 413  LEU A N   1 
ATOM 3214 C CA  . LEU A 1 416  ? -18.265 72.337 2.364   1.00 166.93 ? 413  LEU A CA  1 
ATOM 3215 C C   . LEU A 1 416  ? -19.527 72.316 3.233   1.00 166.93 ? 413  LEU A C   1 
ATOM 3216 O O   . LEU A 1 416  ? -19.835 71.316 3.882   1.00 166.93 ? 413  LEU A O   1 
ATOM 3217 C CB  . LEU A 1 416  ? -18.606 71.953 0.919   1.00 201.87 ? 413  LEU A CB  1 
ATOM 3218 C CG  . LEU A 1 416  ? -19.392 72.957 0.068   1.00 201.87 ? 413  LEU A CG  1 
ATOM 3219 C CD1 . LEU A 1 416  ? -18.596 74.250 -0.167  1.00 201.87 ? 413  LEU A CD1 1 
ATOM 3220 C CD2 . LEU A 1 416  ? -19.809 72.314 -1.248  1.00 201.87 ? 413  LEU A CD2 1 
ATOM 3221 N N   . ARG A 1 417  ? -20.254 73.432 3.197   1.00 152.87 ? 414  ARG A N   1 
ATOM 3222 C CA  . ARG A 1 417  ? -21.360 73.719 4.098   1.00 152.87 ? 414  ARG A CA  1 
ATOM 3223 C C   . ARG A 1 417  ? -22.665 73.835 3.332   1.00 152.87 ? 414  ARG A C   1 
ATOM 3224 O O   . ARG A 1 417  ? -23.034 72.942 2.573   1.00 152.87 ? 414  ARG A O   1 
ATOM 3225 C CB  . ARG A 1 417  ? -21.076 75.048 4.806   1.00 104.07 ? 414  ARG A CB  1 
ATOM 3226 C CG  . ARG A 1 417  ? -21.697 75.222 6.190   1.00 104.07 ? 414  ARG A CG  1 
ATOM 3227 C CD  . ARG A 1 417  ? -21.173 76.496 6.843   1.00 104.07 ? 414  ARG A CD  1 
ATOM 3228 N NE  . ARG A 1 417  ? -19.707 76.534 6.947   1.00 104.07 ? 414  ARG A NE  1 
ATOM 3229 C CZ  . ARG A 1 417  ? -18.890 77.211 6.136   1.00 104.07 ? 414  ARG A CZ  1 
ATOM 3230 N NH1 . ARG A 1 417  ? -19.377 77.926 5.129   1.00 104.07 ? 414  ARG A NH1 1 
ATOM 3231 N NH2 . ARG A 1 417  ? -17.578 77.171 6.337   1.00 104.07 ? 414  ARG A NH2 1 
ATOM 3232 N N   . SER A 1 418  ? -23.349 74.954 3.564   1.00 172.81 ? 415  SER A N   1 
ATOM 3233 C CA  . SER A 1 418  ? -24.557 75.367 2.863   1.00 172.81 ? 415  SER A CA  1 
ATOM 3234 C C   . SER A 1 418  ? -24.975 76.723 3.446   1.00 172.81 ? 415  SER A C   1 
ATOM 3235 O O   . SER A 1 418  ? -26.033 77.262 3.105   1.00 172.81 ? 415  SER A O   1 
ATOM 3236 C CB  . SER A 1 418  ? -25.668 74.328 3.027   1.00 73.46  ? 415  SER A CB  1 
ATOM 3237 O OG  . SER A 1 418  ? -26.591 74.378 1.956   1.00 73.46  ? 415  SER A OG  1 
ATOM 3238 N N   . ASP A 1 419  ? -24.121 77.262 4.322   1.00 157.47 ? 416  ASP A N   1 
ATOM 3239 C CA  . ASP A 1 419  ? -24.335 78.554 4.990   1.00 157.47 ? 416  ASP A CA  1 
ATOM 3240 C C   . ASP A 1 419  ? -23.011 79.294 5.251   1.00 157.47 ? 416  ASP A C   1 
ATOM 3241 O O   . ASP A 1 419  ? -21.939 78.706 5.101   1.00 157.47 ? 416  ASP A O   1 
ATOM 3242 C CB  . ASP A 1 419  ? -25.106 78.354 6.303   1.00 174.71 ? 416  ASP A CB  1 
ATOM 3243 C CG  . ASP A 1 419  ? -26.605 78.557 6.142   1.00 174.71 ? 416  ASP A CG  1 
ATOM 3244 O OD1 . ASP A 1 419  ? -27.364 77.586 6.346   1.00 174.71 ? 416  ASP A OD1 1 
ATOM 3245 O OD2 . ASP A 1 419  ? -27.027 79.685 5.814   1.00 174.71 ? 416  ASP A OD2 1 
ATOM 3246 N N   . PRO A 1 420  ? -23.079 80.603 5.587   1.00 123.17 ? 417  PRO A N   1 
ATOM 3247 C CA  . PRO A 1 420  ? -21.918 81.330 6.101   1.00 123.17 ? 417  PRO A CA  1 
ATOM 3248 C C   . PRO A 1 420  ? -21.942 81.437 7.631   1.00 123.17 ? 417  PRO A C   1 
ATOM 3249 O O   . PRO A 1 420  ? -21.329 82.344 8.201   1.00 123.17 ? 417  PRO A O   1 
ATOM 3250 C CB  . PRO A 1 420  ? -22.086 82.717 5.473   1.00 179.12 ? 417  PRO A CB  1 
ATOM 3251 C CG  . PRO A 1 420  ? -23.588 82.849 5.195   1.00 179.12 ? 417  PRO A CG  1 
ATOM 3252 C CD  . PRO A 1 420  ? -24.235 81.505 5.433   1.00 179.12 ? 417  PRO A CD  1 
ATOM 3253 N N   . ASN A 1 421  ? -22.624 80.485 8.267   1.00 201.87 ? 418  ASN A N   1 
ATOM 3254 C CA  . ASN A 1 421  ? -22.991 80.543 9.684   1.00 201.87 ? 418  ASN A CA  1 
ATOM 3255 C C   . ASN A 1 421  ? -22.229 79.596 10.596  1.00 201.87 ? 418  ASN A C   1 
ATOM 3256 O O   . ASN A 1 421  ? -21.019 79.741 10.811  1.00 201.87 ? 418  ASN A O   1 
ATOM 3257 C CB  . ASN A 1 421  ? -24.480 80.221 9.821   1.00 81.62  ? 418  ASN A CB  1 
ATOM 3258 C CG  . ASN A 1 421  ? -25.330 81.431 9.710   1.00 81.62  ? 418  ASN A CG  1 
ATOM 3259 O OD1 . ASN A 1 421  ? -25.451 82.208 10.671  1.00 81.62  ? 418  ASN A OD1 1 
ATOM 3260 N ND2 . ASN A 1 421  ? -25.936 81.623 8.537   1.00 81.62  ? 418  ASN A ND2 1 
ATOM 3261 N N   . ARG A 1 422  ? -22.991 78.656 11.159  1.00 201.87 ? 419  ARG A N   1 
ATOM 3262 C CA  . ARG A 1 422  ? -22.490 77.504 11.893  1.00 201.87 ? 419  ARG A CA  1 
ATOM 3263 C C   . ARG A 1 422  ? -21.292 76.907 11.161  1.00 201.87 ? 419  ARG A C   1 
ATOM 3264 O O   . ARG A 1 422  ? -21.370 76.632 9.962   1.00 201.87 ? 419  ARG A O   1 
ATOM 3265 C CB  . ARG A 1 422  ? -23.613 76.457 12.057  1.00 169.23 ? 419  ARG A CB  1 
ATOM 3266 C CG  . ARG A 1 422  ? -24.532 76.267 10.819  1.00 169.23 ? 419  ARG A CG  1 
ATOM 3267 C CD  . ARG A 1 422  ? -25.459 75.027 10.924  1.00 169.23 ? 419  ARG A CD  1 
ATOM 3268 N NE  . ARG A 1 422  ? -26.799 75.320 11.452  1.00 169.23 ? 419  ARG A NE  1 
ATOM 3269 C CZ  . ARG A 1 422  ? -27.759 74.413 11.661  1.00 169.23 ? 419  ARG A CZ  1 
ATOM 3270 N NH1 . ARG A 1 422  ? -27.555 73.126 11.396  1.00 169.23 ? 419  ARG A NH1 1 
ATOM 3271 N NH2 . ARG A 1 422  ? -28.936 74.795 12.142  1.00 169.23 ? 419  ARG A NH2 1 
ATOM 3272 N N   . GLU A 1 423  ? -20.182 76.729 11.877  1.00 132.86 ? 420  GLU A N   1 
ATOM 3273 C CA  . GLU A 1 423  ? -18.951 76.202 11.272  1.00 132.86 ? 420  GLU A CA  1 
ATOM 3274 C C   . GLU A 1 423  ? -19.085 74.726 10.933  1.00 132.86 ? 420  GLU A C   1 
ATOM 3275 O O   . GLU A 1 423  ? -18.158 74.108 10.411  1.00 132.86 ? 420  GLU A O   1 
ATOM 3276 C CB  . GLU A 1 423  ? -17.743 76.470 12.163  1.00 91.22  ? 420  GLU A CB  1 
ATOM 3277 C CG  . GLU A 1 423  ? -17.488 77.950 12.346  1.00 91.22  ? 420  GLU A CG  1 
ATOM 3278 C CD  . GLU A 1 423  ? -16.120 78.227 12.890  1.00 91.22  ? 420  GLU A CD  1 
ATOM 3279 O OE1 . GLU A 1 423  ? -15.162 77.593 12.387  1.00 91.22  ? 420  GLU A OE1 1 
ATOM 3280 O OE2 . GLU A 1 423  ? -16.002 79.076 13.812  1.00 91.22  ? 420  GLU A OE2 1 
ATOM 3281 N N   . THR A 1 424  ? -20.267 74.192 11.237  1.00 201.87 ? 421  THR A N   1 
ATOM 3282 C CA  . THR A 1 424  ? -20.710 72.874 10.794  1.00 201.87 ? 421  THR A CA  1 
ATOM 3283 C C   . THR A 1 424  ? -21.282 72.964 9.368   1.00 201.87 ? 421  THR A C   1 
ATOM 3284 O O   . THR A 1 424  ? -21.621 74.048 8.893   1.00 201.87 ? 421  THR A O   1 
ATOM 3285 C CB  . THR A 1 424  ? -21.766 72.255 11.769  1.00 98.48  ? 421  THR A CB  1 
ATOM 3286 O OG1 . THR A 1 424  ? -23.063 72.824 11.533  1.00 98.48  ? 421  THR A OG1 1 
ATOM 3287 C CG2 . THR A 1 424  ? -21.358 72.431 13.259  1.00 98.48  ? 421  THR A CG2 1 
ATOM 3288 N N   . TYR A 1 425  ? -21.398 71.817 8.703   1.00 141.55 ? 422  TYR A N   1 
ATOM 3289 C CA  . TYR A 1 425  ? -21.740 71.752 7.284   1.00 141.55 ? 422  TYR A CA  1 
ATOM 3290 C C   . TYR A 1 425  ? -22.837 70.696 7.055   1.00 141.55 ? 422  TYR A C   1 
ATOM 3291 O O   . TYR A 1 425  ? -22.911 69.715 7.797   1.00 141.55 ? 422  TYR A O   1 
ATOM 3292 C CB  . TYR A 1 425  ? -20.484 71.396 6.476   1.00 170.20 ? 422  TYR A CB  1 
ATOM 3293 C CG  . TYR A 1 425  ? -19.173 72.067 6.913   1.00 170.20 ? 422  TYR A CG  1 
ATOM 3294 C CD1 . TYR A 1 425  ? -18.376 71.507 7.913   1.00 170.20 ? 422  TYR A CD1 1 
ATOM 3295 C CD2 . TYR A 1 425  ? -18.716 73.237 6.304   1.00 170.20 ? 422  TYR A CD2 1 
ATOM 3296 C CE1 . TYR A 1 425  ? -17.171 72.102 8.305   1.00 170.20 ? 422  TYR A CE1 1 
ATOM 3297 C CE2 . TYR A 1 425  ? -17.515 73.839 6.691   1.00 170.20 ? 422  TYR A CE2 1 
ATOM 3298 C CZ  . TYR A 1 425  ? -16.751 73.265 7.692   1.00 170.20 ? 422  TYR A CZ  1 
ATOM 3299 O OH  . TYR A 1 425  ? -15.568 73.848 8.081   1.00 170.20 ? 422  TYR A OH  1 
ATOM 3300 N N   . ASP A 1 426  ? -23.685 70.883 6.040   1.00 127.34 ? 423  ASP A N   1 
ATOM 3301 C CA  . ASP A 1 426  ? -24.810 69.944 5.811   1.00 127.34 ? 423  ASP A CA  1 
ATOM 3302 C C   . ASP A 1 426  ? -24.795 69.140 4.489   1.00 127.34 ? 423  ASP A C   1 
ATOM 3303 O O   . ASP A 1 426  ? -25.530 68.166 4.350   1.00 127.34 ? 423  ASP A O   1 
ATOM 3304 C CB  . ASP A 1 426  ? -26.178 70.623 6.055   1.00 141.74 ? 423  ASP A CB  1 
ATOM 3305 C CG  . ASP A 1 426  ? -26.708 71.378 4.834   1.00 141.74 ? 423  ASP A CG  1 
ATOM 3306 O OD1 . ASP A 1 426  ? -27.944 71.391 4.634   1.00 141.74 ? 423  ASP A OD1 1 
ATOM 3307 O OD2 . ASP A 1 426  ? -25.901 71.958 4.080   1.00 141.74 ? 423  ASP A OD2 1 
ATOM 3308 N N   . THR A 1 427  ? -23.960 69.565 3.547   1.00 79.43  ? 424  THR A N   1 
ATOM 3309 C CA  . THR A 1 427  ? -23.844 68.890 2.259   1.00 79.43  ? 424  THR A CA  1 
ATOM 3310 C C   . THR A 1 427  ? -22.419 68.988 1.726   1.00 79.43  ? 424  THR A C   1 
ATOM 3311 O O   . THR A 1 427  ? -21.916 70.082 1.470   1.00 79.43  ? 424  THR A O   1 
ATOM 3312 C CB  . THR A 1 427  ? -24.814 69.484 1.221   1.00 145.04 ? 424  THR A CB  1 
ATOM 3313 O OG1 . THR A 1 427  ? -26.161 69.142 1.571   1.00 145.04 ? 424  THR A OG1 1 
ATOM 3314 C CG2 . THR A 1 427  ? -24.503 68.945 -0.167  1.00 145.04 ? 424  THR A CG2 1 
ATOM 3315 N N   . LEU A 1 428  ? -21.774 67.838 1.561   1.00 131.12 ? 425  LEU A N   1 
ATOM 3316 C CA  . LEU A 1 428  ? -20.407 67.792 1.057   1.00 131.12 ? 425  LEU A CA  1 
ATOM 3317 C C   . LEU A 1 428  ? -20.370 67.339 -0.399  1.00 131.12 ? 425  LEU A C   1 
ATOM 3318 O O   . LEU A 1 428  ? -20.047 66.189 -0.693  1.00 131.12 ? 425  LEU A O   1 
ATOM 3319 C CB  . LEU A 1 428  ? -19.549 66.863 1.918   1.00 128.61 ? 425  LEU A CB  1 
ATOM 3320 C CG  . LEU A 1 428  ? -18.254 67.458 2.475   1.00 128.61 ? 425  LEU A CG  1 
ATOM 3321 C CD1 . LEU A 1 428  ? -18.513 68.173 3.792   1.00 128.61 ? 425  LEU A CD1 1 
ATOM 3322 C CD2 . LEU A 1 428  ? -17.196 66.379 2.645   1.00 128.61 ? 425  LEU A CD2 1 
ATOM 3323 N N   . VAL A 1 429  ? -20.705 68.252 -1.306  1.00 201.23 ? 426  VAL A N   1 
ATOM 3324 C CA  . VAL A 1 429  ? -20.711 67.948 -2.732  1.00 201.23 ? 426  VAL A CA  1 
ATOM 3325 C C   . VAL A 1 429  ? -19.361 67.405 -3.187  1.00 201.23 ? 426  VAL A C   1 
ATOM 3326 O O   . VAL A 1 429  ? -18.344 68.093 -3.103  1.00 201.23 ? 426  VAL A O   1 
ATOM 3327 C CB  . VAL A 1 429  ? -21.064 69.190 -3.572  1.00 123.14 ? 426  VAL A CB  1 
ATOM 3328 C CG1 . VAL A 1 429  ? -20.764 68.938 -5.041  1.00 123.14 ? 426  VAL A CG1 1 
ATOM 3329 C CG2 . VAL A 1 429  ? -22.524 69.566 -3.375  1.00 123.14 ? 426  VAL A CG2 1 
ATOM 3330 N N   . LEU A 1 430  ? -19.359 66.166 -3.668  1.00 117.08 ? 427  LEU A N   1 
ATOM 3331 C CA  . LEU A 1 430  ? -18.134 65.528 -4.137  1.00 117.08 ? 427  LEU A CA  1 
ATOM 3332 C C   . LEU A 1 430  ? -18.047 65.555 -5.659  1.00 117.08 ? 427  LEU A C   1 
ATOM 3333 O O   . LEU A 1 430  ? -18.158 66.613 -6.278  1.00 117.08 ? 427  LEU A O   1 
ATOM 3334 C CB  . LEU A 1 430  ? -18.053 64.087 -3.631  1.00 94.94  ? 427  LEU A CB  1 
ATOM 3335 C CG  . LEU A 1 430  ? -18.707 63.806 -2.276  1.00 94.94  ? 427  LEU A CG  1 
ATOM 3336 C CD1 . LEU A 1 430  ? -20.091 64.433 -2.206  1.00 94.94  ? 427  LEU A CD1 1 
ATOM 3337 C CD2 . LEU A 1 430  ? -18.778 62.309 -2.014  1.00 94.94  ? 427  LEU A CD2 1 
ATOM 3338 N N   . SER A 1 431  ? -17.847 64.385 -6.256  1.00 102.09 ? 428  SER A N   1 
ATOM 3339 C CA  . SER A 1 431  ? -17.744 64.271 -7.706  1.00 102.09 ? 428  SER A CA  1 
ATOM 3340 C C   . SER A 1 431  ? -17.820 62.815 -8.151  1.00 102.09 ? 428  SER A C   1 
ATOM 3341 O O   . SER A 1 431  ? -16.896 62.035 -7.917  1.00 102.09 ? 428  SER A O   1 
ATOM 3342 C CB  . SER A 1 431  ? -16.444 64.906 -8.202  1.00 80.25  ? 428  SER A CB  1 
ATOM 3343 O OG  . SER A 1 431  ? -15.893 65.771 -7.225  1.00 80.25  ? 428  SER A OG  1 
ATOM 3344 N N   . PHE A 1 432  ? -18.926 62.454 -8.793  1.00 153.60 ? 429  PHE A N   1 
ATOM 3345 C CA  . PHE A 1 432  ? -19.125 61.089 -9.270  1.00 153.60 ? 429  PHE A CA  1 
ATOM 3346 C C   . PHE A 1 432  ? -18.296 60.853 -10.544 1.00 153.60 ? 429  PHE A C   1 
ATOM 3347 O O   . PHE A 1 432  ? -17.632 61.776 -11.039 1.00 153.60 ? 429  PHE A O   1 
ATOM 3348 C CB  . PHE A 1 432  ? -20.616 60.832 -9.516  1.00 193.43 ? 429  PHE A CB  1 
ATOM 3349 C CG  . PHE A 1 432  ? -21.044 59.403 -9.288  1.00 193.43 ? 429  PHE A CG  1 
ATOM 3350 C CD1 . PHE A 1 432  ? -21.126 58.506 -10.353 1.00 193.43 ? 429  PHE A CD1 1 
ATOM 3351 C CD2 . PHE A 1 432  ? -21.387 58.961 -8.013  1.00 193.43 ? 429  PHE A CD2 1 
ATOM 3352 C CE1 . PHE A 1 432  ? -21.527 57.187 -10.150 1.00 193.43 ? 429  PHE A CE1 1 
ATOM 3353 C CE2 . PHE A 1 432  ? -21.793 57.645 -7.801  1.00 193.43 ? 429  PHE A CE2 1 
ATOM 3354 C CZ  . PHE A 1 432  ? -21.862 56.756 -8.871  1.00 193.43 ? 429  PHE A CZ  1 
ATOM 3355 N N   . VAL A 1 433  ? -18.330 59.616 -11.053 1.00 146.58 ? 430  VAL A N   1 
ATOM 3356 C CA  . VAL A 1 433  ? -17.675 59.220 -12.316 1.00 146.58 ? 430  VAL A CA  1 
ATOM 3357 C C   . VAL A 1 433  ? -18.036 60.166 -13.471 1.00 146.58 ? 430  VAL A C   1 
ATOM 3358 O O   . VAL A 1 433  ? -19.069 60.008 -14.126 1.00 146.58 ? 430  VAL A O   1 
ATOM 3359 C CB  . VAL A 1 433  ? -18.033 57.748 -12.725 1.00 141.77 ? 430  VAL A CB  1 
ATOM 3360 C CG1 . VAL A 1 433  ? -17.072 57.225 -13.794 1.00 141.77 ? 430  VAL A CG1 1 
ATOM 3361 C CG2 . VAL A 1 433  ? -18.038 56.816 -11.519 1.00 141.77 ? 430  VAL A CG2 1 
ATOM 3362 N N   . GLY A 1 434  ? -17.179 61.152 -13.706 1.00 77.86  ? 431  GLY A N   1 
ATOM 3363 C CA  . GLY A 1 434  ? -17.451 62.186 -14.700 1.00 77.86  ? 431  GLY A CA  1 
ATOM 3364 C C   . GLY A 1 434  ? -18.429 63.270 -14.251 1.00 77.86  ? 431  GLY A C   1 
ATOM 3365 O O   . GLY A 1 434  ? -18.670 64.247 -14.978 1.00 77.86  ? 431  GLY A O   1 
ATOM 3366 N N   . GLN A 1 435  ? -18.977 63.122 -13.046 1.00 190.27 ? 432  GLN A N   1 
ATOM 3367 C CA  . GLN A 1 435  ? -20.132 63.919 -12.625 1.00 190.27 ? 432  GLN A CA  1 
ATOM 3368 C C   . GLN A 1 435  ? -19.941 64.651 -11.288 1.00 190.27 ? 432  GLN A C   1 
ATOM 3369 O O   . GLN A 1 435  ? -18.949 64.436 -10.593 1.00 190.27 ? 432  GLN A O   1 
ATOM 3370 C CB  . GLN A 1 435  ? -21.390 63.033 -12.596 1.00 154.91 ? 432  GLN A CB  1 
ATOM 3371 C CG  . GLN A 1 435  ? -21.734 62.385 -13.956 1.00 154.91 ? 432  GLN A CG  1 
ATOM 3372 C CD  . GLN A 1 435  ? -22.733 61.230 -13.858 1.00 154.91 ? 432  GLN A CD  1 
ATOM 3373 O OE1 . GLN A 1 435  ? -23.774 61.337 -13.205 1.00 154.91 ? 432  GLN A OE1 1 
ATOM 3374 N NE2 . GLN A 1 435  ? -22.422 60.126 -14.531 1.00 154.91 ? 432  GLN A NE2 1 
ATOM 3375 N N   . THR A 1 436  ? -20.881 65.545 -10.974 1.00 176.85 ? 433  THR A N   1 
ATOM 3376 C CA  . THR A 1 436  ? -20.964 66.235 -9.677  1.00 176.85 ? 433  THR A CA  1 
ATOM 3377 C C   . THR A 1 436  ? -22.373 65.990 -9.108  1.00 176.85 ? 433  THR A C   1 
ATOM 3378 O O   . THR A 1 436  ? -23.367 66.157 -9.821  1.00 176.85 ? 433  THR A O   1 
ATOM 3379 C CB  . THR A 1 436  ? -20.641 67.771 -9.806  1.00 75.05  ? 433  THR A CB  1 
ATOM 3380 O OG1 . THR A 1 436  ? -19.242 67.960 -10.069 1.00 75.05  ? 433  THR A OG1 1 
ATOM 3381 C CG2 . THR A 1 436  ? -21.010 68.566 -8.540  1.00 75.05  ? 433  THR A CG2 1 
ATOM 3382 N N   . ARG A 1 437  ? -22.456 65.576 -7.840  1.00 160.31 ? 434  ARG A N   1 
ATOM 3383 C CA  . ARG A 1 437  ? -23.749 65.265 -7.198  1.00 160.31 ? 434  ARG A CA  1 
ATOM 3384 C C   . ARG A 1 437  ? -23.962 65.975 -5.853  1.00 160.31 ? 434  ARG A C   1 
ATOM 3385 O O   . ARG A 1 437  ? -23.079 66.683 -5.365  1.00 160.31 ? 434  ARG A O   1 
ATOM 3386 C CB  . ARG A 1 437  ? -23.943 63.745 -7.042  1.00 135.96 ? 434  ARG A CB  1 
ATOM 3387 C CG  . ARG A 1 437  ? -24.623 63.056 -8.229  1.00 135.96 ? 434  ARG A CG  1 
ATOM 3388 C CD  . ARG A 1 437  ? -24.964 61.596 -7.898  1.00 135.96 ? 434  ARG A CD  1 
ATOM 3389 N NE  . ARG A 1 437  ? -25.883 60.993 -8.873  1.00 135.96 ? 434  ARG A NE  1 
ATOM 3390 C CZ  . ARG A 1 437  ? -26.518 59.828 -8.713  1.00 135.96 ? 434  ARG A CZ  1 
ATOM 3391 N NH1 . ARG A 1 437  ? -26.347 59.106 -7.607  1.00 135.96 ? 434  ARG A NH1 1 
ATOM 3392 N NH2 . ARG A 1 437  ? -27.331 59.380 -9.665  1.00 135.96 ? 434  ARG A NH2 1 
ATOM 3393 N N   . VAL A 1 438  ? -25.144 65.774 -5.267  1.00 142.32 ? 435  VAL A N   1 
ATOM 3394 C CA  . VAL A 1 438  ? -25.542 66.453 -4.028  1.00 142.32 ? 435  VAL A CA  1 
ATOM 3395 C C   . VAL A 1 438  ? -25.964 65.481 -2.917  1.00 142.32 ? 435  VAL A C   1 
ATOM 3396 O O   . VAL A 1 438  ? -26.677 64.499 -3.162  1.00 142.32 ? 435  VAL A O   1 
ATOM 3397 C CB  . VAL A 1 438  ? -26.684 67.485 -4.278  1.00 153.15 ? 435  VAL A CB  1 
ATOM 3398 C CG1 . VAL A 1 438  ? -27.057 68.233 -2.991  1.00 153.15 ? 435  VAL A CG1 1 
ATOM 3399 C CG2 . VAL A 1 438  ? -26.282 68.474 -5.361  1.00 153.15 ? 435  VAL A CG2 1 
ATOM 3400 N N   . LEU A 1 439  ? -25.511 65.788 -1.700  1.00 201.87 ? 436  LEU A N   1 
ATOM 3401 C CA  . LEU A 1 439  ? -25.864 65.057 -0.484  1.00 201.87 ? 436  LEU A CA  1 
ATOM 3402 C C   . LEU A 1 439  ? -26.599 65.975 0.486   1.00 201.87 ? 436  LEU A C   1 
ATOM 3403 O O   . LEU A 1 439  ? -26.001 66.444 1.459   1.00 201.87 ? 436  LEU A O   1 
ATOM 3404 C CB  . LEU A 1 439  ? -24.606 64.595 0.248   1.00 151.32 ? 436  LEU A CB  1 
ATOM 3405 C CG  . LEU A 1 439  ? -23.312 64.184 -0.450  1.00 151.32 ? 436  LEU A CG  1 
ATOM 3406 C CD1 . LEU A 1 439  ? -22.181 64.378 0.543   1.00 151.32 ? 436  LEU A CD1 1 
ATOM 3407 C CD2 . LEU A 1 439  ? -23.403 62.736 -0.912  1.00 151.32 ? 436  LEU A CD2 1 
ATOM 3408 N N   . MET A 1 440  ? -27.881 66.232 0.250   1.00 116.96 ? 437  MET A N   1 
ATOM 3409 C CA  . MET A 1 440  ? -28.623 67.052 1.187   1.00 116.96 ? 437  MET A CA  1 
ATOM 3410 C C   . MET A 1 440  ? -28.753 66.256 2.492   1.00 116.96 ? 437  MET A C   1 
ATOM 3411 O O   . MET A 1 440  ? -29.561 65.329 2.596   1.00 116.96 ? 437  MET A O   1 
ATOM 3412 C CB  . MET A 1 440  ? -29.977 67.462 0.608   1.00 170.62 ? 437  MET A CB  1 
ATOM 3413 C CG  . MET A 1 440  ? -30.259 68.961 0.710   1.00 170.62 ? 437  MET A CG  1 
ATOM 3414 S SD  . MET A 1 440  ? -29.957 69.672 2.351   1.00 170.62 ? 437  MET A SD  1 
ATOM 3415 C CE  . MET A 1 440  ? -31.322 68.999 3.302   1.00 170.62 ? 437  MET A CE  1 
ATOM 3416 N N   . LEU A 1 441  ? -27.919 66.597 3.471   1.00 167.99 ? 438  LEU A N   1 
ATOM 3417 C CA  . LEU A 1 441  ? -27.788 65.784 4.679   1.00 167.99 ? 438  LEU A CA  1 
ATOM 3418 C C   . LEU A 1 441  ? -27.910 66.607 5.963   1.00 167.99 ? 438  LEU A C   1 
ATOM 3419 O O   . LEU A 1 441  ? -27.029 67.407 6.290   1.00 167.99 ? 438  LEU A O   1 
ATOM 3420 C CB  . LEU A 1 441  ? -26.457 65.010 4.661   1.00 67.27  ? 438  LEU A CB  1 
ATOM 3421 C CG  . LEU A 1 441  ? -26.431 63.543 5.139   1.00 67.27  ? 438  LEU A CG  1 
ATOM 3422 C CD1 . LEU A 1 441  ? -25.013 62.957 5.217   1.00 67.27  ? 438  LEU A CD1 1 
ATOM 3423 C CD2 . LEU A 1 441  ? -27.120 63.366 6.473   1.00 67.27  ? 438  LEU A CD2 1 
ATOM 3424 N N   . ASN A 1 442  ? -29.001 66.381 6.697   1.00 173.41 ? 439  ASN A N   1 
ATOM 3425 C CA  . ASN A 1 442  ? -29.244 67.031 7.990   1.00 173.41 ? 439  ASN A CA  1 
ATOM 3426 C C   . ASN A 1 442  ? -28.286 66.502 9.053   1.00 173.41 ? 439  ASN A C   1 
ATOM 3427 O O   . ASN A 1 442  ? -28.488 66.725 10.250  1.00 173.41 ? 439  ASN A O   1 
ATOM 3428 C CB  . ASN A 1 442  ? -30.690 66.799 8.452   1.00 128.49 ? 439  ASN A CB  1 
ATOM 3429 C CG  . ASN A 1 442  ? -31.619 66.399 7.313   1.00 128.49 ? 439  ASN A CG  1 
ATOM 3430 O OD1 . ASN A 1 442  ? -32.120 65.272 7.277   1.00 128.49 ? 439  ASN A OD1 1 
ATOM 3431 N ND2 . ASN A 1 442  ? -31.839 67.314 6.371   1.00 128.49 ? 439  ASN A ND2 1 
ATOM 3432 N N   . GLY A 1 443  ? -27.243 65.803 8.602   1.00 83.98  ? 440  GLY A N   1 
ATOM 3433 C CA  . GLY A 1 443  ? -26.328 65.108 9.498   1.00 83.98  ? 440  GLY A CA  1 
ATOM 3434 C C   . GLY A 1 443  ? -26.893 63.803 10.046  1.00 83.98  ? 440  GLY A C   1 
ATOM 3435 O O   . GLY A 1 443  ? -26.390 63.273 11.046  1.00 83.98  ? 440  GLY A O   1 
ATOM 3436 N N   . GLU A 1 444  ? -27.939 63.298 9.386   1.00 118.91 ? 441  GLU A N   1 
ATOM 3437 C CA  . GLU A 1 444  ? -28.610 62.049 9.757   1.00 118.91 ? 441  GLU A CA  1 
ATOM 3438 C C   . GLU A 1 444  ? -28.839 61.116 8.563   1.00 118.91 ? 441  GLU A C   1 
ATOM 3439 O O   . GLU A 1 444  ? -28.252 60.035 8.501   1.00 118.91 ? 441  GLU A O   1 
ATOM 3440 C CB  . GLU A 1 444  ? -29.927 62.342 10.488  1.00 121.19 ? 441  GLU A CB  1 
ATOM 3441 C CG  . GLU A 1 444  ? -29.744 62.680 11.964  1.00 121.19 ? 441  GLU A CG  1 
ATOM 3442 C CD  . GLU A 1 444  ? -28.909 61.639 12.697  1.00 121.19 ? 441  GLU A CD  1 
ATOM 3443 O OE1 . GLU A 1 444  ? -27.916 62.026 13.349  1.00 121.19 ? 441  GLU A OE1 1 
ATOM 3444 O OE2 . GLU A 1 444  ? -29.239 60.434 12.606  1.00 121.19 ? 441  GLU A OE2 1 
ATOM 3445 N N   . GLU A 1 445  ? -29.692 61.532 7.627   1.00 195.92 ? 442  GLU A N   1 
ATOM 3446 C CA  . GLU A 1 445  ? -29.887 60.780 6.384   1.00 195.92 ? 442  GLU A CA  1 
ATOM 3447 C C   . GLU A 1 445  ? -29.754 61.619 5.117   1.00 195.92 ? 442  GLU A C   1 
ATOM 3448 O O   . GLU A 1 445  ? -30.093 62.806 5.103   1.00 195.92 ? 442  GLU A O   1 
ATOM 3449 C CB  . GLU A 1 445  ? -31.210 60.011 6.386   1.00 170.36 ? 442  GLU A CB  1 
ATOM 3450 C CG  . GLU A 1 445  ? -31.047 58.492 6.459   1.00 170.36 ? 442  GLU A CG  1 
ATOM 3451 C CD  . GLU A 1 445  ? -30.397 57.906 5.211   1.00 170.36 ? 442  GLU A CD  1 
ATOM 3452 O OE1 . GLU A 1 445  ? -29.149 57.828 5.157   1.00 170.36 ? 442  GLU A OE1 1 
ATOM 3453 O OE2 . GLU A 1 445  ? -31.140 57.517 4.286   1.00 170.36 ? 442  GLU A OE2 1 
ATOM 3454 N N   . VAL A 1 446  ? -29.267 60.971 4.059   1.00 130.76 ? 443  VAL A N   1 
ATOM 3455 C CA  . VAL A 1 446  ? -28.895 61.623 2.799   1.00 130.76 ? 443  VAL A CA  1 
ATOM 3456 C C   . VAL A 1 446  ? -30.064 61.735 1.813   1.00 130.76 ? 443  VAL A C   1 
ATOM 3457 O O   . VAL A 1 446  ? -31.126 61.137 2.014   1.00 130.76 ? 443  VAL A O   1 
ATOM 3458 C CB  . VAL A 1 446  ? -27.723 60.879 2.129   1.00 110.37 ? 443  VAL A CB  1 
ATOM 3459 C CG1 . VAL A 1 446  ? -26.942 61.810 1.208   1.00 110.37 ? 443  VAL A CG1 1 
ATOM 3460 C CG2 . VAL A 1 446  ? -26.810 60.297 3.189   1.00 110.37 ? 443  VAL A CG2 1 
ATOM 3461 N N   . GLU A 1 447  ? -29.850 62.508 0.749   1.00 172.70 ? 444  GLU A N   1 
ATOM 3462 C CA  . GLU A 1 447  ? -30.897 62.831 -0.215  1.00 172.70 ? 444  GLU A CA  1 
ATOM 3463 C C   . GLU A 1 447  ? -30.306 63.103 -1.602  1.00 172.70 ? 444  GLU A C   1 
ATOM 3464 O O   . GLU A 1 447  ? -29.181 63.599 -1.722  1.00 172.70 ? 444  GLU A O   1 
ATOM 3465 C CB  . GLU A 1 447  ? -31.683 64.051 0.279   1.00 140.59 ? 444  GLU A CB  1 
ATOM 3466 C CG  . GLU A 1 447  ? -33.142 64.098 -0.149  1.00 140.59 ? 444  GLU A CG  1 
ATOM 3467 C CD  . GLU A 1 447  ? -33.988 64.959 0.775   1.00 140.59 ? 444  GLU A CD  1 
ATOM 3468 O OE1 . GLU A 1 447  ? -33.475 66.018 1.259   1.00 140.59 ? 444  GLU A OE1 1 
ATOM 3469 O OE2 . GLU A 1 447  ? -35.168 64.576 1.017   1.00 140.59 ? 444  GLU A OE2 1 
ATOM 3470 N N   . GLU A 1 448  ? -31.071 62.775 -2.643  1.00 177.34 ? 445  GLU A N   1 
ATOM 3471 C CA  . GLU A 1 448  ? -30.629 62.967 -4.025  1.00 177.34 ? 445  GLU A CA  1 
ATOM 3472 C C   . GLU A 1 448  ? -31.413 64.067 -4.757  1.00 177.34 ? 445  GLU A C   1 
ATOM 3473 O O   . GLU A 1 448  ? -31.881 63.869 -5.884  1.00 177.34 ? 445  GLU A O   1 
ATOM 3474 C CB  . GLU A 1 448  ? -30.661 61.640 -4.793  1.00 153.58 ? 445  GLU A CB  1 
ATOM 3475 C CG  . GLU A 1 448  ? -29.456 60.740 -4.517  1.00 153.58 ? 445  GLU A CG  1 
ATOM 3476 C CD  . GLU A 1 448  ? -29.819 59.262 -4.377  1.00 153.58 ? 445  GLU A CD  1 
ATOM 3477 O OE1 . GLU A 1 448  ? -29.064 58.530 -3.693  1.00 153.58 ? 445  GLU A OE1 1 
ATOM 3478 O OE2 . GLU A 1 448  ? -30.851 58.826 -4.940  1.00 153.58 ? 445  GLU A OE2 1 
ATOM 3479 N N   . THR A 1 449  ? -31.556 65.217 -4.098  1.00 180.13 ? 446  THR A N   1 
ATOM 3480 C CA  . THR A 1 449  ? -32.040 66.437 -4.747  1.00 180.13 ? 446  THR A CA  1 
ATOM 3481 C C   . THR A 1 449  ? -30.833 67.248 -5.224  1.00 180.13 ? 446  THR A C   1 
ATOM 3482 O O   . THR A 1 449  ? -30.043 67.743 -4.417  1.00 180.13 ? 446  THR A O   1 
ATOM 3483 C CB  . THR A 1 449  ? -32.953 67.306 -3.826  1.00 121.71 ? 446  THR A CB  1 
ATOM 3484 O OG1 . THR A 1 449  ? -32.297 67.558 -2.579  1.00 121.71 ? 446  THR A OG1 1 
ATOM 3485 C CG2 . THR A 1 449  ? -34.291 66.621 -3.564  1.00 121.71 ? 446  THR A CG2 1 
ATOM 3486 N N   . GLU A 1 450  ? -30.697 67.361 -6.542  1.00 155.14 ? 447  GLU A N   1 
ATOM 3487 C CA  . GLU A 1 450  ? -29.547 68.017 -7.180  1.00 155.14 ? 447  GLU A CA  1 
ATOM 3488 C C   . GLU A 1 450  ? -29.644 69.564 -7.211  1.00 155.14 ? 447  GLU A C   1 
ATOM 3489 O O   . GLU A 1 450  ? -30.742 70.122 -7.143  1.00 155.14 ? 447  GLU A O   1 
ATOM 3490 C CB  . GLU A 1 450  ? -29.282 67.395 -8.567  1.00 201.87 ? 447  GLU A CB  1 
ATOM 3491 C CG  . GLU A 1 450  ? -30.443 66.531 -9.121  1.00 201.87 ? 447  GLU A CG  1 
ATOM 3492 C CD  . GLU A 1 450  ? -29.990 65.230 -9.795  1.00 201.87 ? 447  GLU A CD  1 
ATOM 3493 O OE1 . GLU A 1 450  ? -28.782 64.905 -9.759  1.00 201.87 ? 447  GLU A OE1 1 
ATOM 3494 O OE2 . GLU A 1 450  ? -30.856 64.522 -10.358 1.00 201.87 ? 447  GLU A OE2 1 
ATOM 3495 N N   . LEU A 1 451  ? -28.497 70.241 -7.314  1.00 201.87 ? 448  LEU A N   1 
ATOM 3496 C CA  . LEU A 1 451  ? -28.402 71.682 -7.010  1.00 201.87 ? 448  LEU A CA  1 
ATOM 3497 C C   . LEU A 1 451  ? -28.167 72.632 -8.197  1.00 201.87 ? 448  LEU A C   1 
ATOM 3498 O O   . LEU A 1 451  ? -27.784 72.213 -9.293  1.00 201.87 ? 448  LEU A O   1 
ATOM 3499 C CB  . LEU A 1 451  ? -27.327 71.919 -5.939  1.00 127.90 ? 448  LEU A CB  1 
ATOM 3500 C CG  . LEU A 1 451  ? -27.402 73.150 -5.023  1.00 127.90 ? 448  LEU A CG  1 
ATOM 3501 C CD1 . LEU A 1 451  ? -28.496 73.023 -3.948  1.00 127.90 ? 448  LEU A CD1 1 
ATOM 3502 C CD2 . LEU A 1 451  ? -26.042 73.386 -4.383  1.00 127.90 ? 448  LEU A CD2 1 
ATOM 3503 N N   . MET A 1 452  ? -28.397 73.918 -7.934  1.00 196.56 ? 449  MET A N   1 
ATOM 3504 C CA  . MET A 1 452  ? -28.262 75.001 -8.902  1.00 196.56 ? 449  MET A CA  1 
ATOM 3505 C C   . MET A 1 452  ? -26.830 75.205 -9.387  1.00 196.56 ? 449  MET A C   1 
ATOM 3506 O O   . MET A 1 452  ? -25.915 75.338 -8.576  1.00 196.56 ? 449  MET A O   1 
ATOM 3507 C CB  . MET A 1 452  ? -28.771 76.303 -8.276  1.00 133.15 ? 449  MET A CB  1 
ATOM 3508 C CG  . MET A 1 452  ? -30.270 76.525 -8.390  1.00 133.15 ? 449  MET A CG  1 
ATOM 3509 S SD  . MET A 1 452  ? -30.773 77.162 -10.010 1.00 133.15 ? 449  MET A SD  1 
ATOM 3510 C CE  . MET A 1 452  ? -30.956 75.671 -11.000 1.00 133.15 ? 449  MET A CE  1 
ATOM 3511 N N   . GLY A 1 453  ? -26.648 75.226 -10.709 1.00 171.08 ? 450  GLY A N   1 
ATOM 3512 C CA  . GLY A 1 453  ? -25.354 75.545 -11.331 1.00 171.08 ? 450  GLY A CA  1 
ATOM 3513 C C   . GLY A 1 453  ? -24.264 74.492 -11.186 1.00 171.08 ? 450  GLY A C   1 
ATOM 3514 O O   . GLY A 1 453  ? -23.295 74.475 -11.952 1.00 171.08 ? 450  GLY A O   1 
ATOM 3515 N N   . PHE A 1 454  ? -24.421 73.621 -10.191 1.00 125.71 ? 451  PHE A N   1 
ATOM 3516 C CA  . PHE A 1 454  ? -23.520 72.500 -9.971  1.00 125.71 ? 451  PHE A CA  1 
ATOM 3517 C C   . PHE A 1 454  ? -23.977 71.349 -10.847 1.00 125.71 ? 451  PHE A C   1 
ATOM 3518 O O   . PHE A 1 454  ? -24.255 70.258 -10.352 1.00 125.71 ? 451  PHE A O   1 
ATOM 3519 C CB  . PHE A 1 454  ? -23.536 72.080 -8.492  1.00 151.24 ? 451  PHE A CB  1 
ATOM 3520 C CG  . PHE A 1 454  ? -22.801 73.028 -7.561  1.00 151.24 ? 451  PHE A CG  1 
ATOM 3521 C CD1 . PHE A 1 454  ? -23.288 74.307 -7.297  1.00 151.24 ? 451  PHE A CD1 1 
ATOM 3522 C CD2 . PHE A 1 454  ? -21.638 72.618 -6.913  1.00 151.24 ? 451  PHE A CD2 1 
ATOM 3523 C CE1 . PHE A 1 454  ? -22.611 75.168 -6.428  1.00 151.24 ? 451  PHE A CE1 1 
ATOM 3524 C CE2 . PHE A 1 454  ? -20.956 73.481 -6.040  1.00 151.24 ? 451  PHE A CE2 1 
ATOM 3525 C CZ  . PHE A 1 454  ? -21.447 74.755 -5.802  1.00 151.24 ? 451  PHE A CZ  1 
ATOM 3526 N N   . VAL A 1 455  ? -24.054 71.604 -12.151 1.00 103.25 ? 452  VAL A N   1 
ATOM 3527 C CA  . VAL A 1 455  ? -24.640 70.650 -13.106 1.00 103.25 ? 452  VAL A CA  1 
ATOM 3528 C C   . VAL A 1 455  ? -24.296 69.210 -12.739 1.00 103.25 ? 452  VAL A C   1 
ATOM 3529 O O   . VAL A 1 455  ? -23.121 68.862 -12.589 1.00 103.25 ? 452  VAL A O   1 
ATOM 3530 C CB  . VAL A 1 455  ? -24.286 70.959 -14.619 1.00 68.89  ? 452  VAL A CB  1 
ATOM 3531 C CG1 . VAL A 1 455  ? -25.142 72.122 -15.157 1.00 68.89  ? 452  VAL A CG1 1 
ATOM 3532 C CG2 . VAL A 1 455  ? -22.812 71.267 -14.794 1.00 68.89  ? 452  VAL A CG2 1 
ATOM 3533 N N   . ASP A 1 456  ? -25.346 68.405 -12.562 1.00 86.08  ? 453  ASP A N   1 
ATOM 3534 C CA  . ASP A 1 456  ? -25.252 66.964 -12.302 1.00 86.08  ? 453  ASP A CA  1 
ATOM 3535 C C   . ASP A 1 456  ? -24.630 66.147 -13.465 1.00 86.08  ? 453  ASP A C   1 
ATOM 3536 O O   . ASP A 1 456  ? -24.658 64.906 -13.448 1.00 86.08  ? 453  ASP A O   1 
ATOM 3537 C CB  . ASP A 1 456  ? -26.630 66.402 -11.924 1.00 201.71 ? 453  ASP A CB  1 
ATOM 3538 C CG  . ASP A 1 456  ? -27.716 66.797 -12.915 1.00 201.71 ? 453  ASP A CG  1 
ATOM 3539 O OD1 . ASP A 1 456  ? -28.444 65.433 -13.350 1.00 201.71 ? 453  ASP A OD1 1 
ATOM 3540 O OD2 . ASP A 1 456  ? -27.836 68.321 -13.304 1.00 201.71 ? 453  ASP A OD2 1 
ATOM 3541 N N   . ASP A 1 457  ? -24.066 66.843 -14.457 1.00 153.67 ? 454  ASP A N   1 
ATOM 3542 C CA  . ASP A 1 457  ? -23.352 66.190 -15.560 1.00 153.67 ? 454  ASP A CA  1 
ATOM 3543 C C   . ASP A 1 457  ? -21.949 66.764 -15.838 1.00 153.67 ? 454  ASP A C   1 
ATOM 3544 O O   . ASP A 1 457  ? -21.388 66.538 -16.907 1.00 153.67 ? 454  ASP A O   1 
ATOM 3545 C CB  . ASP A 1 457  ? -24.213 66.156 -16.835 1.00 143.88 ? 454  ASP A CB  1 
ATOM 3546 C CG  . ASP A 1 457  ? -24.424 67.535 -17.457 1.00 143.88 ? 454  ASP A CG  1 
ATOM 3547 O OD1 . ASP A 1 457  ? -25.108 67.599 -18.501 1.00 143.88 ? 454  ASP A OD1 1 
ATOM 3548 O OD2 . ASP A 1 457  ? -23.920 68.550 -16.923 1.00 143.88 ? 454  ASP A OD2 1 
ATOM 3549 N N   . GLN A 1 458  ? -21.396 67.508 -14.880 1.00 155.79 ? 455  GLN A N   1 
ATOM 3550 C CA  . GLN A 1 458  ? -20.006 67.989 -14.956 1.00 155.79 ? 455  GLN A CA  1 
ATOM 3551 C C   . GLN A 1 458  ? -19.254 67.666 -13.658 1.00 155.79 ? 455  GLN A C   1 
ATOM 3552 O O   . GLN A 1 458  ? -19.730 66.854 -12.870 1.00 155.79 ? 455  GLN A O   1 
ATOM 3553 C CB  . GLN A 1 458  ? -19.945 69.484 -15.294 1.00 140.22 ? 455  GLN A CB  1 
ATOM 3554 C CG  . GLN A 1 458  ? -20.468 69.839 -16.694 1.00 140.22 ? 455  GLN A CG  1 
ATOM 3555 C CD  . GLN A 1 458  ? -19.514 69.457 -17.815 1.00 140.22 ? 455  GLN A CD  1 
ATOM 3556 O OE1 . GLN A 1 458  ? -19.815 68.581 -18.626 1.00 140.22 ? 455  GLN A OE1 1 
ATOM 3557 N NE2 . GLN A 1 458  ? -18.361 70.117 -17.868 1.00 140.22 ? 455  GLN A NE2 1 
ATOM 3558 N N   . GLN A 1 459  ? -18.098 68.294 -13.426 1.00 109.88 ? 456  GLN A N   1 
ATOM 3559 C CA  . GLN A 1 459  ? -17.209 67.855 -12.342 1.00 109.88 ? 456  GLN A CA  1 
ATOM 3560 C C   . GLN A 1 459  ? -16.407 68.948 -11.631 1.00 109.88 ? 456  GLN A C   1 
ATOM 3561 O O   . GLN A 1 459  ? -15.808 69.797 -12.283 1.00 109.88 ? 456  GLN A O   1 
ATOM 3562 C CB  . GLN A 1 459  ? -16.250 66.798 -12.880 1.00 91.30  ? 456  GLN A CB  1 
ATOM 3563 C CG  . GLN A 1 459  ? -15.622 65.960 -11.805 1.00 91.30  ? 456  GLN A CG  1 
ATOM 3564 C CD  . GLN A 1 459  ? -14.874 64.771 -12.349 1.00 91.30  ? 456  GLN A CD  1 
ATOM 3565 O OE1 . GLN A 1 459  ? -13.788 64.463 -11.879 1.00 91.30  ? 456  GLN A OE1 1 
ATOM 3566 N NE2 . GLN A 1 459  ? -15.448 64.092 -13.332 1.00 91.30  ? 456  GLN A NE2 1 
ATOM 3567 N N   . THR A 1 460  ? -16.380 68.898 -10.295 1.00 84.11  ? 457  THR A N   1 
ATOM 3568 C CA  . THR A 1 460  ? -15.581 69.836 -9.483  1.00 84.11  ? 457  THR A CA  1 
ATOM 3569 C C   . THR A 1 460  ? -14.156 69.332 -9.218  1.00 84.11  ? 457  THR A C   1 
ATOM 3570 O O   . THR A 1 460  ? -13.939 68.148 -8.953  1.00 84.11  ? 457  THR A O   1 
ATOM 3571 C CB  . THR A 1 460  ? -16.259 70.179 -8.122  1.00 77.83  ? 457  THR A CB  1 
ATOM 3572 O OG1 . THR A 1 460  ? -17.555 70.749 -8.353  1.00 77.83  ? 457  THR A OG1 1 
ATOM 3573 C CG2 . THR A 1 460  ? -15.413 71.166 -7.311  1.00 77.83  ? 457  THR A CG2 1 
ATOM 3574 N N   . PHE A 1 461  ? -13.199 70.258 -9.291  1.00 75.29  ? 458  PHE A N   1 
ATOM 3575 C CA  . PHE A 1 461  ? -11.795 69.967 -9.051  1.00 75.29  ? 458  PHE A CA  1 
ATOM 3576 C C   . PHE A 1 461  ? -11.344 70.521 -7.690  1.00 75.29  ? 458  PHE A C   1 
ATOM 3577 O O   . PHE A 1 461  ? -10.673 69.817 -6.934  1.00 75.29  ? 458  PHE A O   1 
ATOM 3578 C CB  . PHE A 1 461  ? -10.916 70.506 -10.191 1.00 91.68  ? 458  PHE A CB  1 
ATOM 3579 C CG  . PHE A 1 461  ? -11.059 69.762 -11.512 1.00 91.68  ? 458  PHE A CG  1 
ATOM 3580 C CD1 . PHE A 1 461  ? -11.729 68.535 -11.599 1.00 91.68  ? 458  PHE A CD1 1 
ATOM 3581 C CD2 . PHE A 1 461  ? -10.482 70.283 -12.672 1.00 91.68  ? 458  PHE A CD2 1 
ATOM 3582 C CE1 . PHE A 1 461  ? -11.845 67.856 -12.822 1.00 91.68  ? 458  PHE A CE1 1 
ATOM 3583 C CE2 . PHE A 1 461  ? -10.587 69.610 -13.890 1.00 91.68  ? 458  PHE A CE2 1 
ATOM 3584 C CZ  . PHE A 1 461  ? -11.271 68.397 -13.964 1.00 91.68  ? 458  PHE A CZ  1 
ATOM 3585 N N   . PHE A 1 462  ? -11.707 71.770 -7.386  1.00 86.65  ? 459  PHE A N   1 
ATOM 3586 C CA  . PHE A 1 462  ? -11.484 72.367 -6.057  1.00 86.65  ? 459  PHE A CA  1 
ATOM 3587 C C   . PHE A 1 462  ? -12.779 73.050 -5.667  1.00 86.65  ? 459  PHE A C   1 
ATOM 3588 O O   . PHE A 1 462  ? -13.574 73.370 -6.546  1.00 86.65  ? 459  PHE A O   1 
ATOM 3589 C CB  . PHE A 1 462  ? -10.303 73.349 -6.074  1.00 69.62  ? 459  PHE A CB  1 
ATOM 3590 C CG  . PHE A 1 462  ? -10.063 74.057 -4.765  1.00 69.62  ? 459  PHE A CG  1 
ATOM 3591 C CD1 . PHE A 1 462  ? -9.128  73.576 -3.860  1.00 69.62  ? 459  PHE A CD1 1 
ATOM 3592 C CD2 . PHE A 1 462  ? -10.754 75.223 -4.447  1.00 69.62  ? 459  PHE A CD2 1 
ATOM 3593 C CE1 . PHE A 1 462  ? -8.891  74.228 -2.635  1.00 69.62  ? 459  PHE A CE1 1 
ATOM 3594 C CE2 . PHE A 1 462  ? -10.522 75.884 -3.236  1.00 69.62  ? 459  PHE A CE2 1 
ATOM 3595 C CZ  . PHE A 1 462  ? -9.586  75.382 -2.326  1.00 69.62  ? 459  PHE A CZ  1 
ATOM 3596 N N   . CYS A 1 463  ? -12.999 73.265 -4.367  1.00 97.64  ? 460  CYS A N   1 
ATOM 3597 C CA  . CYS A 1 463  ? -14.312 73.694 -3.856  1.00 97.64  ? 460  CYS A CA  1 
ATOM 3598 C C   . CYS A 1 463  ? -14.229 74.263 -2.432  1.00 97.64  ? 460  CYS A C   1 
ATOM 3599 O O   . CYS A 1 463  ? -15.001 73.893 -1.546  1.00 97.64  ? 460  CYS A O   1 
ATOM 3600 C CB  . CYS A 1 463  ? -15.292 72.509 -3.937  1.00 125.90 ? 460  CYS A CB  1 
ATOM 3601 S SG  . CYS A 1 463  ? -16.813 72.604 -2.986  1.00 125.90 ? 460  CYS A SG  1 
ATOM 3602 N N   . GLY A 1 464  ? -13.299 75.186 -2.225  1.00 83.48  ? 461  GLY A N   1 
ATOM 3603 C CA  . GLY A 1 464  ? -13.011 75.734 -0.889  1.00 83.48  ? 461  GLY A CA  1 
ATOM 3604 C C   . GLY A 1 464  ? -13.864 76.889 -0.369  1.00 83.48  ? 461  GLY A C   1 
ATOM 3605 O O   . GLY A 1 464  ? -14.589 77.536 -1.128  1.00 83.48  ? 461  GLY A O   1 
ATOM 3606 N N   . ASN A 1 465  ? -13.770 77.146 0.938   1.00 187.48 ? 462  ASN A N   1 
ATOM 3607 C CA  . ASN A 1 465  ? -14.591 78.173 1.583   1.00 187.48 ? 462  ASN A CA  1 
ATOM 3608 C C   . ASN A 1 465  ? -14.204 79.581 1.133   1.00 187.48 ? 462  ASN A C   1 
ATOM 3609 O O   . ASN A 1 465  ? -13.521 80.311 1.854   1.00 187.48 ? 462  ASN A O   1 
ATOM 3610 C CB  . ASN A 1 465  ? -14.568 78.038 3.116   1.00 134.35 ? 462  ASN A CB  1 
ATOM 3611 C CG  . ASN A 1 465  ? -15.449 76.887 3.634   1.00 134.35 ? 462  ASN A CG  1 
ATOM 3612 O OD1 . ASN A 1 465  ? -15.600 76.712 4.843   1.00 134.35 ? 462  ASN A OD1 1 
ATOM 3613 N ND2 . ASN A 1 465  ? -16.029 76.107 2.721   1.00 134.35 ? 462  ASN A ND2 1 
ATOM 3614 N N   . VAL A 1 466  ? -14.643 79.931 -0.078  1.00 95.62  ? 463  VAL A N   1 
ATOM 3615 C CA  . VAL A 1 466  ? -14.424 81.260 -0.671  1.00 95.62  ? 463  VAL A CA  1 
ATOM 3616 C C   . VAL A 1 466  ? -15.445 82.265 -0.149  1.00 95.62  ? 463  VAL A C   1 
ATOM 3617 O O   . VAL A 1 466  ? -16.659 82.056 -0.262  1.00 95.62  ? 463  VAL A O   1 
ATOM 3618 C CB  . VAL A 1 466  ? -14.443 81.246 -2.244  1.00 100.49 ? 463  VAL A CB  1 
ATOM 3619 C CG1 . VAL A 1 466  ? -13.297 80.390 -2.814  1.00 100.49 ? 463  VAL A CG1 1 
ATOM 3620 C CG2 . VAL A 1 466  ? -15.825 80.817 -2.806  1.00 100.49 ? 463  VAL A CG2 1 
ATOM 3621 N N   . ALA A 1 467  ? -14.924 83.348 0.424   1.00 106.75 ? 464  ALA A N   1 
ATOM 3622 C CA  . ALA A 1 467  ? -15.742 84.424 0.977   1.00 106.75 ? 464  ALA A CA  1 
ATOM 3623 C C   . ALA A 1 467  ? -16.575 85.137 -0.101  1.00 106.75 ? 464  ALA A C   1 
ATOM 3624 O O   . ALA A 1 467  ? -16.632 84.693 -1.262  1.00 106.75 ? 464  ALA A O   1 
ATOM 3625 C CB  . ALA A 1 467  ? -14.855 85.431 1.737   1.00 120.54 ? 464  ALA A CB  1 
ATOM 3626 N N   . HIS A 1 468  ? -17.217 86.238 0.296   1.00 104.64 ? 465  HIS A N   1 
ATOM 3627 C CA  . HIS A 1 468  ? -17.968 87.099 -0.627  1.00 104.64 ? 465  HIS A CA  1 
ATOM 3628 C C   . HIS A 1 468  ? -19.290 86.454 -1.111  1.00 104.64 ? 465  HIS A C   1 
ATOM 3629 O O   . HIS A 1 468  ? -19.760 86.708 -2.232  1.00 104.64 ? 465  HIS A O   1 
ATOM 3630 C CB  . HIS A 1 468  ? -17.060 87.581 -1.784  1.00 134.48 ? 465  HIS A CB  1 
ATOM 3631 C CG  . HIS A 1 468  ? -15.698 88.033 -1.333  1.00 134.48 ? 465  HIS A CG  1 
ATOM 3632 N ND1 . HIS A 1 468  ? -14.609 87.187 -1.289  1.00 134.48 ? 465  HIS A ND1 1 
ATOM 3633 C CD2 . HIS A 1 468  ? -15.258 89.234 -0.884  1.00 134.48 ? 465  HIS A CD2 1 
ATOM 3634 C CE1 . HIS A 1 468  ? -13.556 87.848 -0.840  1.00 134.48 ? 465  HIS A CE1 1 
ATOM 3635 N NE2 . HIS A 1 468  ? -13.923 89.093 -0.589  1.00 134.48 ? 465  HIS A NE2 1 
ATOM 3636 N N   . GLN A 1 469  ? -19.882 85.639 -0.229  1.00 117.75 ? 466  GLN A N   1 
ATOM 3637 C CA  . GLN A 1 469  ? -21.182 84.972 -0.448  1.00 117.75 ? 466  GLN A CA  1 
ATOM 3638 C C   . GLN A 1 469  ? -21.278 84.118 -1.733  1.00 117.75 ? 466  GLN A C   1 
ATOM 3639 O O   . GLN A 1 469  ? -22.140 84.364 -2.586  1.00 117.75 ? 466  GLN A O   1 
ATOM 3640 C CB  . GLN A 1 469  ? -22.360 85.974 -0.357  1.00 99.85  ? 466  GLN A CB  1 
ATOM 3641 C CG  . GLN A 1 469  ? -22.944 86.198 1.058   1.00 99.85  ? 466  GLN A CG  1 
ATOM 3642 C CD  . GLN A 1 469  ? -24.241 87.027 1.054   1.00 99.85  ? 466  GLN A CD  1 
ATOM 3643 O OE1 . GLN A 1 469  ? -25.199 86.734 0.323   1.00 99.85  ? 466  GLN A OE1 1 
ATOM 3644 N NE2 . GLN A 1 469  ? -24.269 88.062 1.882   1.00 99.85  ? 466  GLN A NE2 1 
ATOM 3645 N N   . GLN A 1 470  ? -20.399 83.119 -1.856  1.00 201.87 ? 467  GLN A N   1 
ATOM 3646 C CA  . GLN A 1 470  ? -20.411 82.182 -2.997  1.00 201.87 ? 467  GLN A CA  1 
ATOM 3647 C C   . GLN A 1 470  ? -19.942 80.769 -2.619  1.00 201.87 ? 467  GLN A C   1 
ATOM 3648 O O   . GLN A 1 470  ? -19.074 80.598 -1.752  1.00 201.87 ? 467  GLN A O   1 
ATOM 3649 C CB  . GLN A 1 470  ? -19.537 82.688 -4.153  1.00 109.81 ? 467  GLN A CB  1 
ATOM 3650 C CG  . GLN A 1 470  ? -19.392 84.191 -4.245  1.00 109.81 ? 467  GLN A CG  1 
ATOM 3651 C CD  . GLN A 1 470  ? -18.000 84.646 -4.656  1.00 109.81 ? 467  GLN A CD  1 
ATOM 3652 O OE1 . GLN A 1 470  ? -17.596 85.767 -4.341  1.00 109.81 ? 467  GLN A OE1 1 
ATOM 3653 N NE2 . GLN A 1 470  ? -17.259 83.781 -5.355  1.00 109.81 ? 467  GLN A NE2 1 
ATOM 3654 N N   . LEU A 1 471  ? -20.520 79.770 -3.293  1.00 131.91 ? 468  LEU A N   1 
ATOM 3655 C CA  . LEU A 1 471  ? -20.125 78.366 -3.167  1.00 131.91 ? 468  LEU A CA  1 
ATOM 3656 C C   . LEU A 1 471  ? -19.356 77.935 -4.427  1.00 131.91 ? 468  LEU A C   1 
ATOM 3657 O O   . LEU A 1 471  ? -19.951 77.368 -5.347  1.00 131.91 ? 468  LEU A O   1 
ATOM 3658 C CB  . LEU A 1 471  ? -21.371 77.473 -2.982  1.00 82.73  ? 468  LEU A CB  1 
ATOM 3659 C CG  . LEU A 1 471  ? -22.119 77.211 -1.642  1.00 82.73  ? 468  LEU A CG  1 
ATOM 3660 C CD1 . LEU A 1 471  ? -23.148 78.290 -1.260  1.00 82.73  ? 468  LEU A CD1 1 
ATOM 3661 C CD2 . LEU A 1 471  ? -22.814 75.850 -1.664  1.00 82.73  ? 468  LEU A CD2 1 
ATOM 3662 N N   . ILE A 1 472  ? -18.043 78.201 -4.459  1.00 182.63 ? 469  ILE A N   1 
ATOM 3663 C CA  . ILE A 1 472  ? -17.186 77.972 -5.655  1.00 182.63 ? 469  ILE A CA  1 
ATOM 3664 C C   . ILE A 1 472  ? -17.246 76.547 -6.232  1.00 182.63 ? 469  ILE A C   1 
ATOM 3665 O O   . ILE A 1 472  ? -17.546 75.592 -5.516  1.00 182.63 ? 469  ILE A O   1 
ATOM 3666 C CB  . ILE A 1 472  ? -15.693 78.433 -5.427  1.00 80.30  ? 469  ILE A CB  1 
ATOM 3667 C CG1 . ILE A 1 472  ? -14.795 78.088 -6.625  1.00 80.30  ? 469  ILE A CG1 1 
ATOM 3668 C CG2 . ILE A 1 472  ? -15.114 77.803 -4.205  1.00 80.30  ? 469  ILE A CG2 1 
ATOM 3669 C CD1 . ILE A 1 472  ? -15.123 78.857 -7.920  1.00 80.30  ? 469  ILE A CD1 1 
ATOM 3670 N N   . GLN A 1 473  ? -16.953 76.422 -7.527  1.00 84.58  ? 470  GLN A N   1 
ATOM 3671 C CA  . GLN A 1 473  ? -17.105 75.161 -8.252  1.00 84.58  ? 470  GLN A CA  1 
ATOM 3672 C C   . GLN A 1 473  ? -16.187 75.017 -9.516  1.00 84.58  ? 470  GLN A C   1 
ATOM 3673 O O   . GLN A 1 473  ? -16.677 74.659 -10.608 1.00 84.58  ? 470  GLN A O   1 
ATOM 3674 C CB  . GLN A 1 473  ? -18.589 74.973 -8.616  1.00 121.79 ? 470  GLN A CB  1 
ATOM 3675 C CG  . GLN A 1 473  ? -18.984 73.593 -9.118  1.00 121.79 ? 470  GLN A CG  1 
ATOM 3676 C CD  . GLN A 1 473  ? -20.283 73.603 -9.936  1.00 121.79 ? 470  GLN A CD  1 
ATOM 3677 O OE1 . GLN A 1 473  ? -21.133 74.494 -9.783  1.00 121.79 ? 470  GLN A OE1 1 
ATOM 3678 N NE2 . GLN A 1 473  ? -20.442 72.603 -10.808 1.00 121.79 ? 470  GLN A NE2 1 
ATOM 3679 N N   . ILE A 1 474  ? -14.874 75.272 -9.372  1.00 89.70  ? 471  ILE A N   1 
ATOM 3680 C CA  . ILE A 1 474  ? -13.919 75.076 -10.490 1.00 89.70  ? 471  ILE A CA  1 
ATOM 3681 C C   . ILE A 1 474  ? -14.160 73.715 -11.157 1.00 89.70  ? 471  ILE A C   1 
ATOM 3682 O O   . ILE A 1 474  ? -13.774 72.675 -10.625 1.00 89.70  ? 471  ILE A O   1 
ATOM 3683 C CB  . ILE A 1 474  ? -12.413 75.161 -10.073 1.00 65.98  ? 471  ILE A CB  1 
ATOM 3684 C CG1 . ILE A 1 474  ? -12.126 76.348 -9.136  1.00 65.98  ? 471  ILE A CG1 1 
ATOM 3685 C CG2 . ILE A 1 474  ? -11.524 75.209 -11.315 1.00 65.98  ? 471  ILE A CG2 1 
ATOM 3686 C CD1 . ILE A 1 474  ? -10.660 76.413 -8.543  1.00 65.98  ? 471  ILE A CD1 1 
ATOM 3687 N N   . THR A 1 475  ? -14.796 73.737 -12.322 1.00 80.62  ? 472  THR A N   1 
ATOM 3688 C CA  . THR A 1 475  ? -15.280 72.513 -12.955 1.00 80.62  ? 472  THR A CA  1 
ATOM 3689 C C   . THR A 1 475  ? -14.408 72.038 -14.133 1.00 80.62  ? 472  THR A C   1 
ATOM 3690 O O   . THR A 1 475  ? -13.382 72.652 -14.447 1.00 80.62  ? 472  THR A O   1 
ATOM 3691 C CB  . THR A 1 475  ? -16.783 72.645 -13.372 1.00 146.08 ? 472  THR A CB  1 
ATOM 3692 O OG1 . THR A 1 475  ? -17.237 71.431 -13.987 1.00 146.08 ? 472  THR A OG1 1 
ATOM 3693 C CG2 . THR A 1 475  ? -16.991 73.803 -14.332 1.00 146.08 ? 472  THR A CG2 1 
ATOM 3694 N N   . SER A 1 476  ? -14.815 70.929 -14.754 1.00 114.63 ? 473  SER A N   1 
ATOM 3695 C CA  . SER A 1 476  ? -14.150 70.406 -15.945 1.00 114.63 ? 473  SER A CA  1 
ATOM 3696 C C   . SER A 1 476  ? -14.201 71.456 -17.034 1.00 114.63 ? 473  SER A C   1 
ATOM 3697 O O   . SER A 1 476  ? -13.160 71.963 -17.453 1.00 114.63 ? 473  SER A O   1 
ATOM 3698 C CB  . SER A 1 476  ? -14.796 69.099 -16.423 1.00 95.13  ? 473  SER A CB  1 
ATOM 3699 O OG  . SER A 1 476  ? -16.208 69.215 -16.476 1.00 95.13  ? 473  SER A OG  1 
ATOM 3700 N N   . ALA A 1 477  ? -15.420 71.796 -17.458 1.00 198.76 ? 474  ALA A N   1 
ATOM 3701 C CA  . ALA A 1 477  ? -15.648 72.853 -18.438 1.00 198.76 ? 474  ALA A CA  1 
ATOM 3702 C C   . ALA A 1 477  ? -14.775 74.065 -18.126 1.00 198.76 ? 474  ALA A C   1 
ATOM 3703 O O   . ALA A 1 477  ? -13.890 74.407 -18.911 1.00 198.76 ? 474  ALA A O   1 
ATOM 3704 C CB  . ALA A 1 477  ? -17.136 73.244 -18.488 1.00 100.97 ? 474  ALA A CB  1 
ATOM 3705 N N   . SER A 1 478  ? -15.010 74.683 -16.968 1.00 111.35 ? 475  SER A N   1 
ATOM 3706 C CA  . SER A 1 478  ? -14.283 75.880 -16.532 1.00 111.35 ? 475  SER A CA  1 
ATOM 3707 C C   . SER A 1 478  ? -15.040 76.541 -15.406 1.00 111.35 ? 475  SER A C   1 
ATOM 3708 O O   . SER A 1 478  ? -16.274 76.588 -15.431 1.00 111.35 ? 475  SER A O   1 
ATOM 3709 C CB  . SER A 1 478  ? -14.121 76.887 -17.671 1.00 201.44 ? 475  SER A CB  1 
ATOM 3710 O OG  . SER A 1 478  ? -15.376 77.169 -18.262 1.00 201.44 ? 475  SER A OG  1 
ATOM 3711 N N   . VAL A 1 479  ? -14.289 77.068 -14.438 1.00 70.71  ? 476  VAL A N   1 
ATOM 3712 C CA  . VAL A 1 479  ? -14.852 77.654 -13.215 1.00 70.71  ? 476  VAL A CA  1 
ATOM 3713 C C   . VAL A 1 479  ? -16.261 78.288 -13.407 1.00 70.71  ? 476  VAL A C   1 
ATOM 3714 O O   . VAL A 1 479  ? -16.492 79.110 -14.309 1.00 70.71  ? 476  VAL A O   1 
ATOM 3715 C CB  . VAL A 1 479  ? -13.811 78.571 -12.464 1.00 54.16  ? 476  VAL A CB  1 
ATOM 3716 C CG1 . VAL A 1 479  ? -12.772 79.106 -13.403 1.00 54.16  ? 476  VAL A CG1 1 
ATOM 3717 C CG2 . VAL A 1 479  ? -14.478 79.729 -11.691 1.00 54.16  ? 476  VAL A CG2 1 
ATOM 3718 N N   . ARG A 1 480  ? -17.197 77.824 -12.576 1.00 102.63 ? 477  ARG A N   1 
ATOM 3719 C CA  . ARG A 1 480  ? -18.582 78.300 -12.544 1.00 102.63 ? 477  ARG A CA  1 
ATOM 3720 C C   . ARG A 1 480  ? -18.827 79.054 -11.239 1.00 102.63 ? 477  ARG A C   1 
ATOM 3721 O O   . ARG A 1 480  ? -17.948 79.107 -10.374 1.00 102.63 ? 477  ARG A O   1 
ATOM 3722 C CB  . ARG A 1 480  ? -19.562 77.131 -12.685 1.00 152.59 ? 477  ARG A CB  1 
ATOM 3723 C CG  . ARG A 1 480  ? -19.588 76.498 -14.072 1.00 152.59 ? 477  ARG A CG  1 
ATOM 3724 C CD  . ARG A 1 480  ? -20.450 75.246 -14.083 1.00 152.59 ? 477  ARG A CD  1 
ATOM 3725 N NE  . ARG A 1 480  ? -20.955 74.929 -15.421 1.00 152.59 ? 477  ARG A NE  1 
ATOM 3726 C CZ  . ARG A 1 480  ? -20.616 73.853 -16.131 1.00 152.59 ? 477  ARG A CZ  1 
ATOM 3727 N NH1 . ARG A 1 480  ? -19.761 72.956 -15.644 1.00 152.59 ? 477  ARG A NH1 1 
ATOM 3728 N NH2 . ARG A 1 480  ? -21.149 73.670 -17.335 1.00 152.59 ? 477  ARG A NH2 1 
ATOM 3729 N N   . LEU A 1 481  ? -20.001 79.663 -11.107 1.00 141.80 ? 478  LEU A N   1 
ATOM 3730 C CA  . LEU A 1 481  ? -20.303 80.431 -9.902  1.00 141.80 ? 478  LEU A CA  1 
ATOM 3731 C C   . LEU A 1 481  ? -21.761 80.314 -9.487  1.00 141.80 ? 478  LEU A C   1 
ATOM 3732 O O   . LEU A 1 481  ? -22.671 80.593 -10.266 1.00 141.80 ? 478  LEU A O   1 
ATOM 3733 C CB  . LEU A 1 481  ? -19.883 81.903 -10.056 1.00 141.59 ? 478  LEU A CB  1 
ATOM 3734 C CG  . LEU A 1 481  ? -19.458 82.693 -8.807  1.00 141.59 ? 478  LEU A CG  1 
ATOM 3735 C CD1 . LEU A 1 481  ? -18.310 82.020 -8.057  1.00 141.59 ? 478  LEU A CD1 1 
ATOM 3736 C CD2 . LEU A 1 481  ? -19.069 84.106 -9.190  1.00 141.59 ? 478  LEU A CD2 1 
ATOM 3737 N N   . VAL A 1 482  ? -21.951 79.869 -8.250  1.00 120.79 ? 479  VAL A N   1 
ATOM 3738 C CA  . VAL A 1 482  ? -23.259 79.713 -7.642  1.00 120.79 ? 479  VAL A CA  1 
ATOM 3739 C C   . VAL A 1 482  ? -23.200 80.492 -6.336  1.00 120.79 ? 479  VAL A C   1 
ATOM 3740 O O   . VAL A 1 482  ? -22.353 80.213 -5.487  1.00 120.79 ? 479  VAL A O   1 
ATOM 3741 C CB  . VAL A 1 482  ? -23.578 78.220 -7.366  1.00 63.70  ? 479  VAL A CB  1 
ATOM 3742 C CG1 . VAL A 1 482  ? -24.974 78.068 -6.736  1.00 63.70  ? 479  VAL A CG1 1 
ATOM 3743 C CG2 . VAL A 1 482  ? -23.442 77.368 -8.654  1.00 63.70  ? 479  VAL A CG2 1 
ATOM 3744 N N   . SER A 1 483  ? -24.078 81.478 -6.178  1.00 167.79 ? 480  SER A N   1 
ATOM 3745 C CA  . SER A 1 483  ? -24.003 82.369 -5.021  1.00 167.79 ? 480  SER A CA  1 
ATOM 3746 C C   . SER A 1 483  ? -24.538 81.716 -3.743  1.00 167.79 ? 480  SER A C   1 
ATOM 3747 O O   . SER A 1 483  ? -25.372 80.813 -3.808  1.00 167.79 ? 480  SER A O   1 
ATOM 3748 C CB  . SER A 1 483  ? -24.724 83.686 -5.305  1.00 120.89 ? 480  SER A CB  1 
ATOM 3749 O OG  . SER A 1 483  ? -24.295 84.702 -4.409  1.00 120.89 ? 480  SER A OG  1 
ATOM 3750 N N   . GLN A 1 484  ? -24.031 82.164 -2.592  1.00 198.57 ? 481  GLN A N   1 
ATOM 3751 C CA  . GLN A 1 484  ? -24.479 81.666 -1.285  1.00 198.57 ? 481  GLN A CA  1 
ATOM 3752 C C   . GLN A 1 484  ? -25.976 81.867 -1.116  1.00 198.57 ? 481  GLN A C   1 
ATOM 3753 O O   . GLN A 1 484  ? -26.750 80.907 -1.162  1.00 198.57 ? 481  GLN A O   1 
ATOM 3754 C CB  . GLN A 1 484  ? -23.734 82.360 -0.136  1.00 159.30 ? 481  GLN A CB  1 
ATOM 3755 C CG  . GLN A 1 484  ? -22.558 81.582 0.444   1.00 159.30 ? 481  GLN A CG  1 
ATOM 3756 C CD  . GLN A 1 484  ? -22.918 80.770 1.681   1.00 159.30 ? 481  GLN A CD  1 
ATOM 3757 O OE1 . GLN A 1 484  ? -22.187 80.782 2.672   1.00 159.30 ? 481  GLN A OE1 1 
ATOM 3758 N NE2 . GLN A 1 484  ? -24.040 80.060 1.629   1.00 159.30 ? 481  GLN A NE2 1 
ATOM 3759 N N   . GLU A 1 485  ? -26.372 83.124 -0.932  1.00 192.34 ? 482  GLU A N   1 
ATOM 3760 C CA  . GLU A 1 485  ? -27.774 83.475 -0.763  1.00 192.34 ? 482  GLU A CA  1 
ATOM 3761 C C   . GLU A 1 485  ? -28.540 83.413 -2.104  1.00 192.34 ? 482  GLU A C   1 
ATOM 3762 O O   . GLU A 1 485  ? -29.475 82.615 -2.219  1.00 192.34 ? 482  GLU A O   1 
ATOM 3763 C CB  . GLU A 1 485  ? -27.920 84.831 -0.050  1.00 101.81 ? 482  GLU A CB  1 
ATOM 3764 C CG  . GLU A 1 485  ? -29.137 84.929 0.888   1.00 101.81 ? 482  GLU A CG  1 
ATOM 3765 C CD  . GLU A 1 485  ? -30.441 85.339 0.186   1.00 101.81 ? 482  GLU A CD  1 
ATOM 3766 O OE1 . GLU A 1 485  ? -30.569 85.153 -1.047  1.00 101.81 ? 482  GLU A OE1 1 
ATOM 3767 O OE2 . GLU A 1 485  ? -31.349 85.849 0.883   1.00 101.81 ? 482  GLU A OE2 1 
ATOM 3768 N N   . PRO A 1 486  ? -28.151 84.236 -3.116  1.00 201.87 ? 483  PRO A N   1 
ATOM 3769 C CA  . PRO A 1 486  ? -28.826 84.202 -4.431  1.00 201.87 ? 483  PRO A CA  1 
ATOM 3770 C C   . PRO A 1 486  ? -28.940 82.820 -5.104  1.00 201.87 ? 483  PRO A C   1 
ATOM 3771 O O   . PRO A 1 486  ? -29.950 82.547 -5.757  1.00 201.87 ? 483  PRO A O   1 
ATOM 3772 C CB  . PRO A 1 486  ? -27.976 85.149 -5.287  1.00 201.87 ? 483  PRO A CB  1 
ATOM 3773 C CG  . PRO A 1 486  ? -27.391 86.097 -4.311  1.00 201.87 ? 483  PRO A CG  1 
ATOM 3774 C CD  . PRO A 1 486  ? -27.099 85.272 -3.089  1.00 201.87 ? 483  PRO A CD  1 
ATOM 3775 N N   . LYS A 1 487  ? -27.917 81.976 -4.957  1.00 170.08 ? 484  LYS A N   1 
ATOM 3776 C CA  . LYS A 1 487  ? -27.930 80.595 -5.474  1.00 170.08 ? 484  LYS A CA  1 
ATOM 3777 C C   . LYS A 1 487  ? -28.033 80.498 -6.996  1.00 170.08 ? 484  LYS A C   1 
ATOM 3778 O O   . LYS A 1 487  ? -28.034 79.404 -7.565  1.00 170.08 ? 484  LYS A O   1 
ATOM 3779 C CB  . LYS A 1 487  ? -29.033 79.760 -4.800  1.00 106.12 ? 484  LYS A CB  1 
ATOM 3780 C CG  . LYS A 1 487  ? -28.675 78.276 -4.634  1.00 106.12 ? 484  LYS A CG  1 
ATOM 3781 C CD  . LYS A 1 487  ? -27.413 78.104 -3.786  1.00 106.12 ? 484  LYS A CD  1 
ATOM 3782 C CE  . LYS A 1 487  ? -26.848 76.706 -3.878  1.00 106.12 ? 484  LYS A CE  1 
ATOM 3783 N NZ  . LYS A 1 487  ? -25.471 76.663 -3.327  1.00 106.12 ? 484  LYS A NZ  1 
ATOM 3784 N N   . ALA A 1 488  ? -28.117 81.653 -7.645  1.00 171.79 ? 485  ALA A N   1 
ATOM 3785 C CA  . ALA A 1 488  ? -28.193 81.724 -9.092  1.00 171.79 ? 485  ALA A CA  1 
ATOM 3786 C C   . ALA A 1 488  ? -26.796 81.676 -9.685  1.00 171.79 ? 485  ALA A C   1 
ATOM 3787 O O   . ALA A 1 488  ? -25.822 82.064 -9.034  1.00 171.79 ? 485  ALA A O   1 
ATOM 3788 C CB  . ALA A 1 488  ? -28.915 82.994 -9.523  1.00 158.57 ? 485  ALA A CB  1 
ATOM 3789 N N   . LEU A 1 489  ? -26.709 81.186 -10.918 1.00 195.30 ? 486  LEU A N   1 
ATOM 3790 C CA  . LEU A 1 489  ? -25.463 81.157 -11.671 1.00 195.30 ? 486  LEU A CA  1 
ATOM 3791 C C   . LEU A 1 489  ? -24.959 82.588 -11.901 1.00 195.30 ? 486  LEU A C   1 
ATOM 3792 O O   . LEU A 1 489  ? -25.508 83.320 -12.729 1.00 195.30 ? 486  LEU A O   1 
ATOM 3793 C CB  . LEU A 1 489  ? -25.676 80.400 -12.993 1.00 140.53 ? 486  LEU A CB  1 
ATOM 3794 C CG  . LEU A 1 489  ? -24.565 80.097 -14.009 1.00 140.53 ? 486  LEU A CG  1 
ATOM 3795 C CD1 . LEU A 1 489  ? -23.242 79.680 -13.360 1.00 140.53 ? 486  LEU A CD1 1 
ATOM 3796 C CD2 . LEU A 1 489  ? -25.052 79.022 -14.982 1.00 140.53 ? 486  LEU A CD2 1 
ATOM 3797 N N   . VAL A 1 490  ? -23.933 82.979 -11.139 1.00 201.87 ? 487  VAL A N   1 
ATOM 3798 C CA  . VAL A 1 490  ? -23.367 84.339 -11.186 1.00 201.87 ? 487  VAL A CA  1 
ATOM 3799 C C   . VAL A 1 490  ? -22.586 84.554 -12.495 1.00 201.87 ? 487  VAL A C   1 
ATOM 3800 O O   . VAL A 1 490  ? -23.189 84.796 -13.547 1.00 201.87 ? 487  VAL A O   1 
ATOM 3801 C CB  . VAL A 1 490  ? -22.483 84.669 -9.926  1.00 67.60  ? 487  VAL A CB  1 
ATOM 3802 C CG1 . VAL A 1 490  ? -22.253 86.177 -9.795  1.00 67.60  ? 487  VAL A CG1 1 
ATOM 3803 C CG2 . VAL A 1 490  ? -23.114 84.123 -8.649  1.00 67.60  ? 487  VAL A CG2 1 
ATOM 3804 N N   . SER A 1 491  ? -21.256 84.462 -12.430 1.00 185.69 ? 488  SER A N   1 
ATOM 3805 C CA  . SER A 1 491  ? -20.408 84.582 -13.618 1.00 185.69 ? 488  SER A CA  1 
ATOM 3806 C C   . SER A 1 491  ? -19.855 83.211 -14.010 1.00 185.69 ? 488  SER A C   1 
ATOM 3807 O O   . SER A 1 491  ? -20.111 82.215 -13.327 1.00 185.69 ? 488  SER A O   1 
ATOM 3808 C CB  . SER A 1 491  ? -19.275 85.590 -13.383 1.00 192.86 ? 488  SER A CB  1 
ATOM 3809 O OG  . SER A 1 491  ? -18.392 85.143 -12.370 1.00 192.86 ? 488  SER A OG  1 
ATOM 3810 N N   . GLU A 1 492  ? -19.109 83.161 -15.111 1.00 179.45 ? 489  GLU A N   1 
ATOM 3811 C CA  . GLU A 1 492  ? -18.535 81.910 -15.601 1.00 179.45 ? 489  GLU A CA  1 
ATOM 3812 C C   . GLU A 1 492  ? -17.306 82.112 -16.465 1.00 179.45 ? 489  GLU A C   1 
ATOM 3813 O O   . GLU A 1 492  ? -16.977 83.232 -16.860 1.00 179.45 ? 489  GLU A O   1 
ATOM 3814 C CB  . GLU A 1 492  ? -19.566 81.117 -16.399 1.00 107.10 ? 489  GLU A CB  1 
ATOM 3815 C CG  . GLU A 1 492  ? -20.135 79.929 -15.667 1.00 107.10 ? 489  GLU A CG  1 
ATOM 3816 C CD  . GLU A 1 492  ? -21.290 79.310 -16.419 1.00 107.10 ? 489  GLU A CD  1 
ATOM 3817 O OE1 . GLU A 1 492  ? -22.281 80.027 -16.679 1.00 107.10 ? 489  GLU A OE1 1 
ATOM 3818 O OE2 . GLU A 1 492  ? -21.205 78.110 -16.751 1.00 107.10 ? 489  GLU A OE2 1 
ATOM 3819 N N   . TRP A 1 493  ? -16.644 80.998 -16.758 1.00 201.87 ? 490  TRP A N   1 
ATOM 3820 C CA  . TRP A 1 493  ? -15.490 80.976 -17.637 1.00 201.87 ? 490  TRP A CA  1 
ATOM 3821 C C   . TRP A 1 493  ? -15.728 79.996 -18.789 1.00 201.87 ? 490  TRP A C   1 
ATOM 3822 O O   . TRP A 1 493  ? -16.629 79.159 -18.716 1.00 201.87 ? 490  TRP A O   1 
ATOM 3823 C CB  . TRP A 1 493  ? -14.242 80.592 -16.844 1.00 113.44 ? 490  TRP A CB  1 
ATOM 3824 C CG  . TRP A 1 493  ? -13.044 81.322 -17.303 1.00 113.44 ? 490  TRP A CG  1 
ATOM 3825 C CD1 . TRP A 1 493  ? -12.641 82.551 -16.897 1.00 113.44 ? 490  TRP A CD1 1 
ATOM 3826 C CD2 . TRP A 1 493  ? -12.098 80.888 -18.284 1.00 113.44 ? 490  TRP A CD2 1 
ATOM 3827 N NE1 . TRP A 1 493  ? -11.498 82.915 -17.552 1.00 113.44 ? 490  TRP A NE1 1 
ATOM 3828 C CE2 . TRP A 1 493  ? -11.136 81.910 -18.410 1.00 113.44 ? 490  TRP A CE2 1 
ATOM 3829 C CE3 . TRP A 1 493  ? -11.960 79.729 -19.060 1.00 113.44 ? 490  TRP A CE3 1 
ATOM 3830 C CZ2 . TRP A 1 493  ? -10.045 81.814 -19.286 1.00 113.44 ? 490  TRP A CZ2 1 
ATOM 3831 C CZ3 . TRP A 1 493  ? -10.879 79.635 -19.935 1.00 113.44 ? 490  TRP A CZ3 1 
ATOM 3832 C CH2 . TRP A 1 493  ? -9.939  80.673 -20.044 1.00 113.44 ? 490  TRP A CH2 1 
ATOM 3833 N N   . LYS A 1 494  ? -14.927 80.121 -19.849 1.00 201.87 ? 491  LYS A N   1 
ATOM 3834 C CA  . LYS A 1 494  ? -14.971 79.237 -21.024 1.00 201.87 ? 491  LYS A CA  1 
ATOM 3835 C C   . LYS A 1 494  ? -13.711 79.514 -21.852 1.00 201.87 ? 491  LYS A C   1 
ATOM 3836 O O   . LYS A 1 494  ? -13.324 80.674 -22.019 1.00 201.87 ? 491  LYS A O   1 
ATOM 3837 C CB  . LYS A 1 494  ? -16.226 79.513 -21.864 1.00 140.93 ? 491  LYS A CB  1 
ATOM 3838 C CG  . LYS A 1 494  ? -17.010 78.276 -22.302 1.00 140.93 ? 491  LYS A CG  1 
ATOM 3839 C CD  . LYS A 1 494  ? -17.993 77.807 -21.220 1.00 140.93 ? 491  LYS A CD  1 
ATOM 3840 C CE  . LYS A 1 494  ? -19.103 76.946 -21.800 1.00 140.93 ? 491  LYS A CE  1 
ATOM 3841 N NZ  . LYS A 1 494  ? -18.574 75.780 -22.560 1.00 140.93 ? 491  LYS A NZ  1 
ATOM 3842 N N   . GLU A 1 495  ? -13.060 78.464 -22.355 1.00 114.09 ? 492  GLU A N   1 
ATOM 3843 C CA  . GLU A 1 495  ? -11.765 78.640 -23.033 1.00 114.09 ? 492  GLU A CA  1 
ATOM 3844 C C   . GLU A 1 495  ? -11.898 79.185 -24.435 1.00 114.09 ? 492  GLU A C   1 
ATOM 3845 O O   . GLU A 1 495  ? -12.554 78.564 -25.275 1.00 114.09 ? 492  GLU A O   1 
ATOM 3846 C CB  . GLU A 1 495  ? -10.906 77.369 -23.037 1.00 146.38 ? 492  GLU A CB  1 
ATOM 3847 C CG  . GLU A 1 495  ? -9.628  77.452 -22.189 1.00 146.38 ? 492  GLU A CG  1 
ATOM 3848 C CD  . GLU A 1 495  ? -8.545  78.332 -22.810 1.00 146.38 ? 492  GLU A CD  1 
ATOM 3849 O OE1 . GLU A 1 495  ? -8.082  78.023 -23.928 1.00 146.38 ? 492  GLU A OE1 1 
ATOM 3850 O OE2 . GLU A 1 495  ? -8.148  79.328 -22.170 1.00 146.38 ? 492  GLU A OE2 1 
ATOM 3851 N N   . PRO A 1 496  ? -11.258 80.345 -24.688 1.00 141.63 ? 493  PRO A N   1 
ATOM 3852 C CA  . PRO A 1 496  ? -11.298 81.034 -25.964 1.00 141.63 ? 493  PRO A CA  1 
ATOM 3853 C C   . PRO A 1 496  ? -11.412 80.100 -27.165 1.00 141.63 ? 493  PRO A C   1 
ATOM 3854 O O   . PRO A 1 496  ? -12.017 80.480 -28.165 1.00 141.63 ? 493  PRO A O   1 
ATOM 3855 C CB  . PRO A 1 496  ? -9.970  81.781 -25.979 1.00 70.07  ? 493  PRO A CB  1 
ATOM 3856 C CG  . PRO A 1 496  ? -9.748  82.155 -24.540 1.00 70.07  ? 493  PRO A CG  1 
ATOM 3857 C CD  . PRO A 1 496  ? -10.435 81.089 -23.708 1.00 70.07  ? 493  PRO A CD  1 
ATOM 3858 N N   . GLN A 1 497  ? -10.861 78.891 -27.064 1.00 111.39 ? 494  GLN A N   1 
ATOM 3859 C CA  . GLN A 1 497  ? -10.955 77.917 -28.154 1.00 111.39 ? 494  GLN A CA  1 
ATOM 3860 C C   . GLN A 1 497  ? -12.206 77.044 -28.080 1.00 111.39 ? 494  GLN A C   1 
ATOM 3861 O O   . GLN A 1 497  ? -13.234 77.351 -28.689 1.00 111.39 ? 494  GLN A O   1 
ATOM 3862 C CB  . GLN A 1 497  ? -9.693  77.049 -28.229 1.00 157.29 ? 494  GLN A CB  1 
ATOM 3863 C CG  . GLN A 1 497  ? -8.427  77.796 -28.658 1.00 157.29 ? 494  GLN A CG  1 
ATOM 3864 C CD  . GLN A 1 497  ? -8.600  78.587 -29.950 1.00 157.29 ? 494  GLN A CD  1 
ATOM 3865 O OE1 . GLN A 1 497  ? -8.271  79.775 -30.008 1.00 157.29 ? 494  GLN A OE1 1 
ATOM 3866 N NE2 . GLN A 1 497  ? -9.124  77.935 -30.988 1.00 157.29 ? 494  GLN A NE2 1 
ATOM 3867 N N   . ALA A 1 498  ? -12.085 75.944 -27.345 1.00 158.04 ? 495  ALA A N   1 
ATOM 3868 C CA  . ALA A 1 498  ? -13.138 74.956 -27.133 1.00 158.04 ? 495  ALA A CA  1 
ATOM 3869 C C   . ALA A 1 498  ? -12.551 74.007 -26.096 1.00 158.04 ? 495  ALA A C   1 
ATOM 3870 O O   . ALA A 1 498  ? -12.853 72.811 -26.074 1.00 158.04 ? 495  ALA A O   1 
ATOM 3871 C CB  . ALA A 1 498  ? -13.471 74.208 -28.439 1.00 64.33  ? 495  ALA A CB  1 
ATOM 3872 N N   . LYS A 1 499  ? -11.693 74.566 -25.244 1.00 131.58 ? 496  LYS A N   1 
ATOM 3873 C CA  . LYS A 1 499  ? -10.859 73.789 -24.335 1.00 131.58 ? 496  LYS A CA  1 
ATOM 3874 C C   . LYS A 1 499  ? -11.283 74.017 -22.886 1.00 131.58 ? 496  LYS A C   1 
ATOM 3875 O O   . LYS A 1 499  ? -12.036 74.942 -22.591 1.00 131.58 ? 496  LYS A O   1 
ATOM 3876 C CB  . LYS A 1 499  ? -9.373  74.125 -24.552 1.00 91.50  ? 496  LYS A CB  1 
ATOM 3877 C CG  . LYS A 1 499  ? -8.848  73.770 -25.960 1.00 91.50  ? 496  LYS A CG  1 
ATOM 3878 C CD  . LYS A 1 499  ? -7.376  74.126 -26.176 1.00 91.50  ? 496  LYS A CD  1 
ATOM 3879 C CE  . LYS A 1 499  ? -7.112  75.616 -25.979 1.00 91.50  ? 496  LYS A CE  1 
ATOM 3880 N NZ  . LYS A 1 499  ? -5.786  76.049 -26.512 1.00 91.50  ? 496  LYS A NZ  1 
ATOM 3881 N N   . ASN A 1 500  ? -10.792 73.167 -21.991 1.00 99.52  ? 497  ASN A N   1 
ATOM 3882 C CA  . ASN A 1 500  ? -11.258 73.117 -20.601 1.00 99.52  ? 497  ASN A CA  1 
ATOM 3883 C C   . ASN A 1 500  ? -10.143 72.988 -19.553 1.00 99.52  ? 497  ASN A C   1 
ATOM 3884 O O   . ASN A 1 500  ? -9.022  72.572 -19.872 1.00 99.52  ? 497  ASN A O   1 
ATOM 3885 C CB  . ASN A 1 500  ? -12.273 71.974 -20.437 1.00 96.07  ? 497  ASN A CB  1 
ATOM 3886 C CG  . ASN A 1 500  ? -11.943 70.768 -21.297 1.00 96.07  ? 497  ASN A CG  1 
ATOM 3887 O OD1 . ASN A 1 500  ? -11.992 70.832 -22.526 1.00 96.07  ? 497  ASN A OD1 1 
ATOM 3888 N ND2 . ASN A 1 500  ? -11.610 69.663 -20.654 1.00 96.07  ? 497  ASN A ND2 1 
ATOM 3889 N N   . ILE A 1 501  ? -10.451 73.346 -18.306 1.00 112.12 ? 498  ILE A N   1 
ATOM 3890 C CA  . ILE A 1 501  ? -9.481  73.163 -17.227 1.00 112.12 ? 498  ILE A CA  1 
ATOM 3891 C C   . ILE A 1 501  ? -9.227  71.674 -17.063 1.00 112.12 ? 498  ILE A C   1 
ATOM 3892 O O   . ILE A 1 501  ? -10.165 70.869 -17.098 1.00 112.12 ? 498  ILE A O   1 
ATOM 3893 C CB  . ILE A 1 501  ? -9.893  73.801 -15.859 1.00 44.90  ? 498  ILE A CB  1 
ATOM 3894 C CG1 . ILE A 1 501  ? -10.285 75.284 -16.052 1.00 44.90  ? 498  ILE A CG1 1 
ATOM 3895 C CG2 . ILE A 1 501  ? -8.730  73.734 -14.919 1.00 44.90  ? 498  ILE A CG2 1 
ATOM 3896 C CD1 . ILE A 1 501  ? -10.477 76.133 -14.774 1.00 44.90  ? 498  ILE A CD1 1 
ATOM 3897 N N   . SER A 1 502  ? -7.952  71.317 -16.931 1.00 60.08  ? 499  SER A N   1 
ATOM 3898 C CA  . SER A 1 502  ? -7.559  69.928 -16.720 1.00 60.08  ? 499  SER A CA  1 
ATOM 3899 C C   . SER A 1 502  ? -7.010  69.703 -15.326 1.00 60.08  ? 499  SER A C   1 
ATOM 3900 O O   . SER A 1 502  ? -7.144  68.596 -14.828 1.00 60.08  ? 499  SER A O   1 
ATOM 3901 C CB  . SER A 1 502  ? -6.571  69.434 -17.780 1.00 65.54  ? 499  SER A CB  1 
ATOM 3902 O OG  . SER A 1 502  ? -5.640  70.446 -18.126 1.00 65.54  ? 499  SER A OG  1 
ATOM 3903 N N   . VAL A 1 503  ? -6.422  70.733 -14.701 1.00 75.34  ? 500  VAL A N   1 
ATOM 3904 C CA  . VAL A 1 503  ? -5.832  70.614 -13.353 1.00 75.34  ? 500  VAL A CA  1 
ATOM 3905 C C   . VAL A 1 503  ? -6.041  71.838 -12.407 1.00 75.34  ? 500  VAL A C   1 
ATOM 3906 O O   . VAL A 1 503  ? -5.408  72.876 -12.581 1.00 75.34  ? 500  VAL A O   1 
ATOM 3907 C CB  . VAL A 1 503  ? -4.303  70.250 -13.430 1.00 48.97  ? 500  VAL A CB  1 
ATOM 3908 C CG1 . VAL A 1 503  ? -3.611  70.409 -12.045 1.00 48.97  ? 500  VAL A CG1 1 
ATOM 3909 C CG2 . VAL A 1 503  ? -4.086  68.868 -13.972 1.00 48.97  ? 500  VAL A CG2 1 
ATOM 3910 N N   . ALA A 1 504  ? -6.891  71.692 -11.388 1.00 90.90  ? 501  ALA A N   1 
ATOM 3911 C CA  . ALA A 1 504  ? -7.195  72.777 -10.422 1.00 90.90  ? 501  ALA A CA  1 
ATOM 3912 C C   . ALA A 1 504  ? -6.040  73.166 -9.473  1.00 90.90  ? 501  ALA A C   1 
ATOM 3913 O O   . ALA A 1 504  ? -4.950  72.609 -9.576  1.00 90.90  ? 501  ALA A O   1 
ATOM 3914 C CB  . ALA A 1 504  ? -8.434  72.419 -9.621  1.00 76.27  ? 501  ALA A CB  1 
ATOM 3915 N N   . SER A 1 505  ? -6.284  74.132 -8.577  1.00 137.18 ? 502  SER A N   1 
ATOM 3916 C CA  . SER A 1 505  ? -5.340  74.513 -7.501  1.00 137.18 ? 502  SER A CA  1 
ATOM 3917 C C   . SER A 1 505  ? -5.615  75.888 -6.883  1.00 137.18 ? 502  SER A C   1 
ATOM 3918 O O   . SER A 1 505  ? -5.543  76.901 -7.571  1.00 137.18 ? 502  SER A O   1 
ATOM 3919 C CB  . SER A 1 505  ? -3.900  74.471 -7.985  1.00 68.48  ? 502  SER A CB  1 
ATOM 3920 O OG  . SER A 1 505  ? -3.016  74.797 -6.937  1.00 68.48  ? 502  SER A OG  1 
ATOM 3921 N N   . CYS A 1 506  ? -5.869  75.916 -5.573  1.00 73.29  ? 503  CYS A N   1 
ATOM 3922 C CA  . CYS A 1 506  ? -6.459  77.085 -4.896  1.00 73.29  ? 503  CYS A CA  1 
ATOM 3923 C C   . CYS A 1 506  ? -6.332  77.095 -3.368  1.00 73.29  ? 503  CYS A C   1 
ATOM 3924 O O   . CYS A 1 506  ? -5.646  76.257 -2.783  1.00 73.29  ? 503  CYS A O   1 
ATOM 3925 C CB  . CYS A 1 506  ? -7.941  77.228 -5.284  1.00 118.43 ? 503  CYS A CB  1 
ATOM 3926 S SG  . CYS A 1 506  ? -8.846  78.538 -4.405  1.00 118.43 ? 503  CYS A SG  1 
ATOM 3927 N N   . ASN A 1 507  ? -6.998  78.078 -2.753  1.00 192.39 ? 504  ASN A N   1 
ATOM 3928 C CA  . ASN A 1 507  ? -7.089  78.249 -1.303  1.00 192.39 ? 504  ASN A CA  1 
ATOM 3929 C C   . ASN A 1 507  ? -8.484  78.731 -0.842  1.00 192.39 ? 504  ASN A C   1 
ATOM 3930 O O   . ASN A 1 507  ? -9.255  77.938 -0.290  1.00 192.39 ? 504  ASN A O   1 
ATOM 3931 C CB  . ASN A 1 507  ? -5.983  79.184 -0.799  1.00 116.65 ? 504  ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 507  ? -6.062  80.567 -1.410  1.00 116.65 ? 504  ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 507  ? -6.451  81.535 -0.746  1.00 116.65 ? 504  ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 507  ? -5.715  80.667 -2.686  1.00 116.65 ? 504  ASN A ND2 1 
ATOM 3935 N N   . SER A 1 508  ? -8.800  80.014 -1.075  1.00 123.24 ? 505  SER A N   1 
ATOM 3936 C CA  . SER A 1 508  ? -10.086 80.620 -0.658  1.00 123.24 ? 505  SER A CA  1 
ATOM 3937 C C   . SER A 1 508  ? -10.472 81.901 -1.406  1.00 123.24 ? 505  SER A C   1 
ATOM 3938 O O   . SER A 1 508  ? -11.464 82.550 -1.051  1.00 123.24 ? 505  SER A O   1 
ATOM 3939 C CB  . SER A 1 508  ? -10.108 80.895 0.853   1.00 83.94  ? 505  SER A CB  1 
ATOM 3940 O OG  . SER A 1 508  ? -11.423 81.196 1.283   1.00 83.94  ? 505  SER A OG  1 
ATOM 3941 N N   . SER A 1 509  ? -9.693  82.258 -2.429  1.00 201.87 ? 506  SER A N   1 
ATOM 3942 C CA  . SER A 1 509  ? -9.968  83.433 -3.271  1.00 201.87 ? 506  SER A CA  1 
ATOM 3943 C C   . SER A 1 509  ? -9.356  83.342 -4.680  1.00 201.87 ? 506  SER A C   1 
ATOM 3944 O O   . SER A 1 509  ? -9.350  84.334 -5.417  1.00 201.87 ? 506  SER A O   1 
ATOM 3945 C CB  . SER A 1 509  ? -9.487  84.716 -2.582  1.00 130.59 ? 506  SER A CB  1 
ATOM 3946 O OG  . SER A 1 509  ? -8.083  84.691 -2.417  1.00 130.59 ? 506  SER A OG  1 
ATOM 3947 N N   . GLN A 1 510  ? -8.857  82.157 -5.046  1.00 201.87 ? 507  GLN A N   1 
ATOM 3948 C CA  . GLN A 1 510  ? -8.156  81.942 -6.328  1.00 201.87 ? 507  GLN A CA  1 
ATOM 3949 C C   . GLN A 1 510  ? -8.788  80.862 -7.221  1.00 201.87 ? 507  GLN A C   1 
ATOM 3950 O O   . GLN A 1 510  ? -9.535  80.002 -6.750  1.00 201.87 ? 507  GLN A O   1 
ATOM 3951 C CB  . GLN A 1 510  ? -6.681  81.571 -6.091  1.00 85.17  ? 507  GLN A CB  1 
ATOM 3952 C CG  . GLN A 1 510  ? -5.838  82.608 -5.352  1.00 85.17  ? 507  GLN A CG  1 
ATOM 3953 C CD  . GLN A 1 510  ? -4.439  82.115 -5.131  1.00 85.17  ? 507  GLN A CD  1 
ATOM 3954 O OE1 . GLN A 1 510  ? -3.645  82.716 -4.416  1.00 85.17  ? 507  GLN A OE1 1 
ATOM 3955 N NE2 . GLN A 1 510  ? -4.132  80.993 -5.736  1.00 85.17  ? 507  GLN A NE2 1 
ATOM 3956 N N   . VAL A 1 511  ? -8.492  80.942 -8.520  1.00 201.87 ? 508  VAL A N   1 
ATOM 3957 C CA  . VAL A 1 511  ? -8.678  79.835 -9.469  1.00 201.87 ? 508  VAL A CA  1 
ATOM 3958 C C   . VAL A 1 511  ? -7.368  79.778 -10.269 1.00 201.87 ? 508  VAL A C   1 
ATOM 3959 O O   . VAL A 1 511  ? -7.261  80.329 -11.375 1.00 201.87 ? 508  VAL A O   1 
ATOM 3960 C CB  . VAL A 1 511  ? -9.930  80.004 -10.418 1.00 153.11 ? 508  VAL A CB  1 
ATOM 3961 C CG1 . VAL A 1 511  ? -10.053 78.826 -11.369 1.00 153.11 ? 508  VAL A CG1 1 
ATOM 3962 C CG2 . VAL A 1 511  ? -11.231 80.145 -9.630  1.00 153.11 ? 508  VAL A CG2 1 
ATOM 3963 N N   . VAL A 1 512  ? -6.368  79.129 -9.670  1.00 78.65  ? 509  VAL A N   1 
ATOM 3964 C CA  . VAL A 1 512  ? -4.991  79.044 -10.225 1.00 78.65  ? 509  VAL A CA  1 
ATOM 3965 C C   . VAL A 1 512  ? -4.660  77.713 -10.934 1.00 78.65  ? 509  VAL A C   1 
ATOM 3966 O O   . VAL A 1 512  ? -3.903  76.876 -10.429 1.00 78.65  ? 509  VAL A O   1 
ATOM 3967 C CB  . VAL A 1 512  ? -3.968  79.387 -9.125  1.00 53.20  ? 509  VAL A CB  1 
ATOM 3968 C CG1 . VAL A 1 512  ? -2.484  79.371 -9.660  1.00 53.20  ? 509  VAL A CG1 1 
ATOM 3969 C CG2 . VAL A 1 512  ? -4.393  80.715 -8.494  1.00 53.20  ? 509  VAL A CG2 1 
ATOM 3970 N N   . VAL A 1 513  ? -5.217  77.581 -12.135 1.00 88.99  ? 510  VAL A N   1 
ATOM 3971 C CA  . VAL A 1 513  ? -5.337  76.303 -12.828 1.00 88.99  ? 510  VAL A CA  1 
ATOM 3972 C C   . VAL A 1 513  ? -4.385  76.103 -13.990 1.00 88.99  ? 510  VAL A C   1 
ATOM 3973 O O   . VAL A 1 513  ? -3.436  76.861 -14.188 1.00 88.99  ? 510  VAL A O   1 
ATOM 3974 C CB  . VAL A 1 513  ? -6.760  76.105 -13.388 1.00 76.14  ? 510  VAL A CB  1 
ATOM 3975 C CG1 . VAL A 1 513  ? -7.770  76.067 -12.265 1.00 76.14  ? 510  VAL A CG1 1 
ATOM 3976 C CG2 . VAL A 1 513  ? -7.089  77.187 -14.385 1.00 76.14  ? 510  VAL A CG2 1 
ATOM 3977 N N   . ALA A 1 514  ? -4.683  75.067 -14.763 1.00 61.58  ? 511  ALA A N   1 
ATOM 3978 C CA  . ALA A 1 514  ? -3.891  74.679 -15.905 1.00 61.58  ? 511  ALA A CA  1 
ATOM 3979 C C   . ALA A 1 514  ? -4.818  74.113 -16.951 1.00 61.58  ? 511  ALA A C   1 
ATOM 3980 O O   . ALA A 1 514  ? -5.740  73.344 -16.632 1.00 61.58  ? 511  ALA A O   1 
ATOM 3981 C CB  . ALA A 1 514  ? -2.842  73.633 -15.495 1.00 60.60  ? 511  ALA A CB  1 
ATOM 3982 N N   . VAL A 1 515  ? -4.571  74.515 -18.198 1.00 53.77  ? 512  VAL A N   1 
ATOM 3983 C CA  . VAL A 1 515  ? -5.286  73.978 -19.375 1.00 53.77  ? 512  VAL A CA  1 
ATOM 3984 C C   . VAL A 1 515  ? -4.261  73.286 -20.255 1.00 53.77  ? 512  VAL A C   1 
ATOM 3985 O O   . VAL A 1 515  ? -3.488  73.957 -20.928 1.00 53.77  ? 512  VAL A O   1 
ATOM 3986 C CB  . VAL A 1 515  ? -5.975  75.101 -20.206 1.00 52.95  ? 512  VAL A CB  1 
ATOM 3987 C CG1 . VAL A 1 515  ? -6.669  74.522 -21.449 1.00 52.95  ? 512  VAL A CG1 1 
ATOM 3988 C CG2 . VAL A 1 515  ? -6.943  75.940 -19.350 1.00 52.95  ? 512  VAL A CG2 1 
ATOM 3989 N N   . GLY A 1 516  ? -4.253  71.951 -20.222 1.00 86.70  ? 513  GLY A N   1 
ATOM 3990 C CA  . GLY A 1 516  ? -3.194  71.124 -20.823 1.00 86.70  ? 513  GLY A CA  1 
ATOM 3991 C C   . GLY A 1 516  ? -1.944  71.764 -20.243 1.00 86.70  ? 513  GLY A C   1 
ATOM 3992 O O   . GLY A 1 516  ? -1.703  71.686 -19.032 1.00 86.70  ? 513  GLY A O   1 
ATOM 3993 N N   . ARG A 1 517  ? -1.149  72.394 -21.104 1.00 65.19  ? 514  ARG A N   1 
ATOM 3994 C CA  . ARG A 1 517  ? 0.158   73.008 -20.738 1.00 65.19  ? 514  ARG A CA  1 
ATOM 3995 C C   . ARG A 1 517  ? 0.071   74.475 -20.313 1.00 65.19  ? 514  ARG A C   1 
ATOM 3996 O O   . ARG A 1 517  ? 1.043   75.018 -19.768 1.00 65.19  ? 514  ARG A O   1 
ATOM 3997 C CB  . ARG A 1 517  ? 0.628   72.930 -22.202 1.00 78.90  ? 514  ARG A CB  1 
ATOM 3998 C CG  . ARG A 1 517  ? 1.290   71.629 -22.602 1.00 78.90  ? 514  ARG A CG  1 
ATOM 3999 C CD  . ARG A 1 517  ? 2.277   71.788 -23.772 1.00 78.90  ? 514  ARG A CD  1 
ATOM 4000 N NE  . ARG A 1 517  ? 1.699   72.317 -25.012 1.00 78.90  ? 514  ARG A NE  1 
ATOM 4001 C CZ  . ARG A 1 517  ? 0.635   71.812 -25.646 1.00 78.90  ? 514  ARG A CZ  1 
ATOM 4002 N NH1 . ARG A 1 517  ? -0.025  70.770 -25.150 1.00 78.90  ? 514  ARG A NH1 1 
ATOM 4003 N NH2 . ARG A 1 517  ? 0.208   72.374 -26.777 1.00 78.90  ? 514  ARG A NH2 1 
ATOM 4004 N N   . ALA A 1 518  ? -1.070  75.109 -20.578 1.00 68.82  ? 515  ALA A N   1 
ATOM 4005 C CA  . ALA A 1 518  ? -1.272  76.521 -20.234 1.00 68.82  ? 515  ALA A CA  1 
ATOM 4006 C C   . ALA A 1 518  ? -1.483  76.670 -18.743 1.00 68.82  ? 515  ALA A C   1 
ATOM 4007 O O   . ALA A 1 518  ? -2.043  75.780 -18.113 1.00 68.82  ? 515  ALA A O   1 
ATOM 4008 C CB  . ALA A 1 518  ? -2.470  77.097 -20.994 1.00 63.87  ? 515  ALA A CB  1 
ATOM 4009 N N   . LEU A 1 519  ? -1.054  77.794 -18.181 1.00 104.43 ? 516  LEU A N   1 
ATOM 4010 C CA  . LEU A 1 519  ? -1.282  78.075 -16.765 1.00 104.43 ? 516  LEU A CA  1 
ATOM 4011 C C   . LEU A 1 519  ? -1.756  79.521 -16.543 1.00 104.43 ? 516  LEU A C   1 
ATOM 4012 O O   . LEU A 1 519  ? -0.974  80.462 -16.720 1.00 104.43 ? 516  LEU A O   1 
ATOM 4013 C CB  . LEU A 1 519  ? -0.003  77.817 -15.955 1.00 82.23  ? 516  LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 519  ? 0.741   76.474 -15.928 1.00 82.23  ? 516  LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 519  ? 2.201   76.678 -15.546 1.00 82.23  ? 516  LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 519  ? 0.079   75.501 -14.966 1.00 82.23  ? 516  LEU A CD2 1 
ATOM 4017 N N   . TYR A 1 520  ? -3.021  79.689 -16.144 1.00 83.02  ? 517  TYR A N   1 
ATOM 4018 C CA  . TYR A 1 520  ? -3.611  81.026 -15.924 1.00 83.02  ? 517  TYR A CA  1 
ATOM 4019 C C   . TYR A 1 520  ? -3.663  81.510 -14.453 1.00 83.02  ? 517  TYR A C   1 
ATOM 4020 O O   . TYR A 1 520  ? -2.665  81.420 -13.722 1.00 83.02  ? 517  TYR A O   1 
ATOM 4021 C CB  . TYR A 1 520  ? -4.992  81.136 -16.596 1.00 101.72 ? 517  TYR A CB  1 
ATOM 4022 C CG  . TYR A 1 520  ? -4.966  80.895 -18.086 1.00 101.72 ? 517  TYR A CG  1 
ATOM 4023 C CD1 . TYR A 1 520  ? -5.647  79.819 -18.641 1.00 101.72 ? 517  TYR A CD1 1 
ATOM 4024 C CD2 . TYR A 1 520  ? -4.254  81.740 -18.942 1.00 101.72 ? 517  TYR A CD2 1 
ATOM 4025 C CE1 . TYR A 1 520  ? -5.625  79.583 -20.011 1.00 101.72 ? 517  TYR A CE1 1 
ATOM 4026 C CE2 . TYR A 1 520  ? -4.229  81.520 -20.321 1.00 101.72 ? 517  TYR A CE2 1 
ATOM 4027 C CZ  . TYR A 1 520  ? -4.911  80.434 -20.848 1.00 101.72 ? 517  TYR A CZ  1 
ATOM 4028 O OH  . TYR A 1 520  ? -4.895  80.187 -22.204 1.00 101.72 ? 517  TYR A OH  1 
ATOM 4029 N N   . TYR A 1 521  ? -4.817  82.067 -14.068 1.00 201.87 ? 518  TYR A N   1 
ATOM 4030 C CA  . TYR A 1 521  ? -5.141  82.552 -12.709 1.00 201.87 ? 518  TYR A CA  1 
ATOM 4031 C C   . TYR A 1 521  ? -6.351  83.491 -12.796 1.00 201.87 ? 518  TYR A C   1 
ATOM 4032 O O   . TYR A 1 521  ? -6.225  84.622 -13.267 1.00 201.87 ? 518  TYR A O   1 
ATOM 4033 C CB  . TYR A 1 521  ? -3.943  83.243 -12.019 1.00 106.41 ? 518  TYR A CB  1 
ATOM 4034 C CG  . TYR A 1 521  ? -4.280  84.081 -10.794 1.00 106.41 ? 518  TYR A CG  1 
ATOM 4035 C CD1 . TYR A 1 521  ? -3.387  85.050 -10.339 1.00 106.41 ? 518  TYR A CD1 1 
ATOM 4036 C CD2 . TYR A 1 521  ? -5.488  83.919 -10.094 1.00 106.41 ? 518  TYR A CD2 1 
ATOM 4037 C CE1 . TYR A 1 521  ? -3.679  85.836 -9.206  1.00 106.41 ? 518  TYR A CE1 1 
ATOM 4038 C CE2 . TYR A 1 521  ? -5.790  84.696 -8.976  1.00 106.41 ? 518  TYR A CE2 1 
ATOM 4039 C CZ  . TYR A 1 521  ? -4.882  85.655 -8.535  1.00 106.41 ? 518  TYR A CZ  1 
ATOM 4040 O OH  . TYR A 1 521  ? -5.150  86.444 -7.431  1.00 106.41 ? 518  TYR A OH  1 
ATOM 4041 N N   . LEU A 1 522  ? -7.512  83.022 -12.332 1.00 131.33 ? 519  LEU A N   1 
ATOM 4042 C CA  . LEU A 1 522  ? -8.778  83.747 -12.516 1.00 131.33 ? 519  LEU A CA  1 
ATOM 4043 C C   . LEU A 1 522  ? -9.488  84.070 -11.181 1.00 131.33 ? 519  LEU A C   1 
ATOM 4044 O O   . LEU A 1 522  ? -10.091 83.191 -10.564 1.00 131.33 ? 519  LEU A O   1 
ATOM 4045 C CB  . LEU A 1 522  ? -9.703  82.992 -13.513 1.00 90.32  ? 519  LEU A CB  1 
ATOM 4046 C CG  . LEU A 1 522  ? -9.171  82.741 -14.956 1.00 90.32  ? 519  LEU A CG  1 
ATOM 4047 C CD1 . LEU A 1 522  ? -9.639  81.409 -15.575 1.00 90.32  ? 519  LEU A CD1 1 
ATOM 4048 C CD2 . LEU A 1 522  ? -9.418  83.923 -15.910 1.00 90.32  ? 519  LEU A CD2 1 
ATOM 4049 N N   . GLN A 1 523  ? -9.417  85.342 -10.764 1.00 186.30 ? 520  GLN A N   1 
ATOM 4050 C CA  . GLN A 1 523  ? -9.922  85.815 -9.454  1.00 186.30 ? 520  GLN A CA  1 
ATOM 4051 C C   . GLN A 1 523  ? -11.436 86.017 -9.351  1.00 186.30 ? 520  GLN A C   1 
ATOM 4052 O O   . GLN A 1 523  ? -12.006 86.876 -10.022 1.00 186.30 ? 520  GLN A O   1 
ATOM 4053 C CB  . GLN A 1 523  ? -9.232  87.124 -9.046  1.00 164.46 ? 520  GLN A CB  1 
ATOM 4054 C CG  . GLN A 1 523  ? -8.232  87.013 -7.910  1.00 164.46 ? 520  GLN A CG  1 
ATOM 4055 C CD  . GLN A 1 523  ? -7.648  88.360 -7.503  1.00 164.46 ? 520  GLN A CD  1 
ATOM 4056 O OE1 . GLN A 1 523  ? -8.113  89.414 -7.940  1.00 164.46 ? 520  GLN A OE1 1 
ATOM 4057 N NE2 . GLN A 1 523  ? -6.623  88.327 -6.659  1.00 164.46 ? 520  GLN A NE2 1 
ATOM 4058 N N   . ILE A 1 524  ? -12.068 85.243 -8.472  1.00 201.69 ? 521  ILE A N   1 
ATOM 4059 C CA  . ILE A 1 524  ? -13.491 85.403 -8.159  1.00 201.69 ? 521  ILE A CA  1 
ATOM 4060 C C   . ILE A 1 524  ? -13.670 86.337 -6.943  1.00 201.69 ? 521  ILE A C   1 
ATOM 4061 O O   . ILE A 1 524  ? -13.880 85.869 -5.815  1.00 201.69 ? 521  ILE A O   1 
ATOM 4062 C CB  . ILE A 1 524  ? -14.193 84.021 -7.908  1.00 164.04 ? 521  ILE A CB  1 
ATOM 4063 C CG1 . ILE A 1 524  ? -13.957 83.041 -9.081  1.00 164.04 ? 521  ILE A CG1 1 
ATOM 4064 C CG2 . ILE A 1 524  ? -15.682 84.211 -7.600  1.00 164.04 ? 521  ILE A CG2 1 
ATOM 4065 C CD1 . ILE A 1 524  ? -15.137 82.831 -10.037 1.00 164.04 ? 521  ILE A CD1 1 
ATOM 4066 N N   . HIS A 1 525  ? -13.572 87.650 -7.179  1.00 201.43 ? 522  HIS A N   1 
ATOM 4067 C CA  . HIS A 1 525  ? -13.806 88.673 -6.144  1.00 201.43 ? 522  HIS A CA  1 
ATOM 4068 C C   . HIS A 1 525  ? -15.309 88.739 -5.811  1.00 201.43 ? 522  HIS A C   1 
ATOM 4069 O O   . HIS A 1 525  ? -15.988 87.718 -5.920  1.00 201.43 ? 522  HIS A O   1 
ATOM 4070 C CB  . HIS A 1 525  ? -13.261 90.026 -6.607  1.00 105.46 ? 522  HIS A CB  1 
ATOM 4071 C CG  . HIS A 1 525  ? -11.980 90.433 -5.942  1.00 105.46 ? 522  HIS A CG  1 
ATOM 4072 N ND1 . HIS A 1 525  ? -11.948 91.091 -4.728  1.00 105.46 ? 522  HIS A ND1 1 
ATOM 4073 C CD2 . HIS A 1 525  ? -10.689 90.302 -6.334  1.00 105.46 ? 522  HIS A CD2 1 
ATOM 4074 C CE1 . HIS A 1 525  ? -10.691 91.339 -4.399  1.00 105.46 ? 522  HIS A CE1 1 
ATOM 4075 N NE2 . HIS A 1 525  ? -9.908  90.870 -5.356  1.00 105.46 ? 522  HIS A NE2 1 
ATOM 4076 N N   . PRO A 1 526  ? -15.838 89.906 -5.365  1.00 179.02 ? 523  PRO A N   1 
ATOM 4077 C CA  . PRO A 1 526  ? -17.307 89.981 -5.281  1.00 179.02 ? 523  PRO A CA  1 
ATOM 4078 C C   . PRO A 1 526  ? -18.051 89.496 -6.551  1.00 179.02 ? 523  PRO A C   1 
ATOM 4079 O O   . PRO A 1 526  ? -18.454 90.293 -7.403  1.00 179.02 ? 523  PRO A O   1 
ATOM 4080 C CB  . PRO A 1 526  ? -17.563 91.464 -4.980  1.00 93.84  ? 523  PRO A CB  1 
ATOM 4081 C CG  . PRO A 1 526  ? -16.357 91.871 -4.182  1.00 93.84  ? 523  PRO A CG  1 
ATOM 4082 C CD  . PRO A 1 526  ? -15.208 91.144 -4.858  1.00 93.84  ? 523  PRO A CD  1 
ATOM 4083 N N   . GLN A 1 527  ? -18.195 88.174 -6.636  1.00 124.00 ? 524  GLN A N   1 
ATOM 4084 C CA  . GLN A 1 527  ? -18.928 87.441 -7.677  1.00 124.00 ? 524  GLN A CA  1 
ATOM 4085 C C   . GLN A 1 527  ? -18.645 87.718 -9.167  1.00 124.00 ? 524  GLN A C   1 
ATOM 4086 O O   . GLN A 1 527  ? -19.543 88.108 -9.915  1.00 124.00 ? 524  GLN A O   1 
ATOM 4087 C CB  . GLN A 1 527  ? -20.426 87.400 -7.358  1.00 177.98 ? 524  GLN A CB  1 
ATOM 4088 C CG  . GLN A 1 527  ? -20.780 86.185 -6.517  1.00 177.98 ? 524  GLN A CG  1 
ATOM 4089 C CD  . GLN A 1 527  ? -22.116 86.288 -5.823  1.00 177.98 ? 524  GLN A CD  1 
ATOM 4090 O OE1 . GLN A 1 527  ? -23.157 86.383 -6.467  1.00 177.98 ? 524  GLN A OE1 1 
ATOM 4091 N NE2 . GLN A 1 527  ? -22.096 86.249 -4.494  1.00 177.98 ? 524  GLN A NE2 1 
ATOM 4092 N N   . GLU A 1 528  ? -17.396 87.493 -9.585  1.00 112.76 ? 525  GLU A N   1 
ATOM 4093 C CA  . GLU A 1 528  ? -16.985 87.618 -10.998 1.00 112.76 ? 525  GLU A CA  1 
ATOM 4094 C C   . GLU A 1 528  ? -15.807 86.698 -11.362 1.00 112.76 ? 525  GLU A C   1 
ATOM 4095 O O   . GLU A 1 528  ? -15.809 85.532 -10.993 1.00 112.76 ? 525  GLU A O   1 
ATOM 4096 C CB  . GLU A 1 528  ? -16.710 89.083 -11.421 1.00 153.18 ? 525  GLU A CB  1 
ATOM 4097 C CG  . GLU A 1 528  ? -16.659 90.150 -10.311 1.00 153.18 ? 525  GLU A CG  1 
ATOM 4098 C CD  . GLU A 1 528  ? -15.563 89.939 -9.269  1.00 153.18 ? 525  GLU A CD  1 
ATOM 4099 O OE1 . GLU A 1 528  ? -14.650 89.106 -9.469  1.00 153.18 ? 525  GLU A OE1 1 
ATOM 4100 O OE2 . GLU A 1 528  ? -15.617 90.631 -8.236  1.00 153.18 ? 525  GLU A OE2 1 
ATOM 4101 N N   . LEU A 1 529  ? -14.836 87.232 -12.109 1.00 156.69 ? 526  LEU A N   1 
ATOM 4102 C CA  . LEU A 1 529  ? -13.618 86.518 -12.545 1.00 156.69 ? 526  LEU A CA  1 
ATOM 4103 C C   . LEU A 1 529  ? -12.518 87.536 -12.929 1.00 156.69 ? 526  LEU A C   1 
ATOM 4104 O O   . LEU A 1 529  ? -12.780 88.455 -13.708 1.00 156.69 ? 526  LEU A O   1 
ATOM 4105 C CB  . LEU A 1 529  ? -13.917 85.568 -13.725 1.00 80.80  ? 526  LEU A CB  1 
ATOM 4106 C CG  . LEU A 1 529  ? -14.419 84.135 -13.447 1.00 80.80  ? 526  LEU A CG  1 
ATOM 4107 C CD1 . LEU A 1 529  ? -15.927 83.944 -13.714 1.00 80.80  ? 526  LEU A CD1 1 
ATOM 4108 C CD2 . LEU A 1 529  ? -13.591 83.120 -14.239 1.00 80.80  ? 526  LEU A CD2 1 
ATOM 4109 N N   . ARG A 1 530  ? -11.301 87.381 -12.392 1.00 117.50 ? 527  ARG A N   1 
ATOM 4110 C CA  . ARG A 1 530  ? -10.256 88.422 -12.541 1.00 117.50 ? 527  ARG A CA  1 
ATOM 4111 C C   . ARG A 1 530  ? -8.809  87.935 -12.761 1.00 117.50 ? 527  ARG A C   1 
ATOM 4112 O O   . ARG A 1 530  ? -8.028  87.826 -11.811 1.00 117.50 ? 527  ARG A O   1 
ATOM 4113 C CB  . ARG A 1 530  ? -10.312 89.393 -11.352 1.00 126.51 ? 527  ARG A CB  1 
ATOM 4114 C CG  . ARG A 1 530  ? -9.643  90.751 -11.572 1.00 126.51 ? 527  ARG A CG  1 
ATOM 4115 C CD  . ARG A 1 530  ? -10.248 91.823 -10.656 1.00 126.51 ? 527  ARG A CD  1 
ATOM 4116 N NE  . ARG A 1 530  ? -11.609 92.192 -11.062 1.00 126.51 ? 527  ARG A NE  1 
ATOM 4117 C CZ  . ARG A 1 530  ? -12.729 91.740 -10.499 1.00 126.51 ? 527  ARG A CZ  1 
ATOM 4118 N NH1 . ARG A 1 530  ? -12.678 90.888 -9.481  1.00 126.51 ? 527  ARG A NH1 1 
ATOM 4119 N NH2 . ARG A 1 530  ? -13.907 92.147 -10.960 1.00 126.51 ? 527  ARG A NH2 1 
ATOM 4120 N N   . GLN A 1 531  ? -8.458  87.710 -14.027 1.00 179.63 ? 528  GLN A N   1 
ATOM 4121 C CA  . GLN A 1 531  ? -7.146  87.181 -14.446 1.00 179.63 ? 528  GLN A CA  1 
ATOM 4122 C C   . GLN A 1 531  ? -5.956  88.110 -14.160 1.00 179.63 ? 528  GLN A C   1 
ATOM 4123 O O   . GLN A 1 531  ? -6.133  89.322 -14.047 1.00 179.63 ? 528  GLN A O   1 
ATOM 4124 C CB  . GLN A 1 531  ? -7.195  86.853 -15.938 1.00 128.34 ? 528  GLN A CB  1 
ATOM 4125 C CG  . GLN A 1 531  ? -6.052  86.010 -16.462 1.00 128.34 ? 528  GLN A CG  1 
ATOM 4126 C CD  . GLN A 1 531  ? -6.094  85.871 -17.968 1.00 128.34 ? 528  GLN A CD  1 
ATOM 4127 O OE1 . GLN A 1 531  ? -7.116  85.496 -18.548 1.00 128.34 ? 528  GLN A OE1 1 
ATOM 4128 N NE2 . GLN A 1 531  ? -4.978  86.174 -18.612 1.00 128.34 ? 528  GLN A NE2 1 
ATOM 4129 N N   . ILE A 1 532  ? -4.753  87.535 -14.058 1.00 172.07 ? 529  ILE A N   1 
ATOM 4130 C CA  . ILE A 1 532  ? -3.528  88.295 -13.739 1.00 172.07 ? 529  ILE A CA  1 
ATOM 4131 C C   . ILE A 1 532  ? -2.281  87.914 -14.589 1.00 172.07 ? 529  ILE A C   1 
ATOM 4132 O O   . ILE A 1 532  ? -1.882  88.691 -15.461 1.00 172.07 ? 529  ILE A O   1 
ATOM 4133 C CB  . ILE A 1 532  ? -3.195  88.257 -12.207 1.00 121.39 ? 529  ILE A CB  1 
ATOM 4134 C CG1 . ILE A 1 532  ? -4.440  88.551 -11.325 1.00 121.39 ? 529  ILE A CG1 1 
ATOM 4135 C CG2 . ILE A 1 532  ? -1.973  89.133 -11.881 1.00 121.39 ? 529  ILE A CG2 1 
ATOM 4136 C CD1 . ILE A 1 532  ? -4.945  90.005 -11.274 1.00 121.39 ? 529  ILE A CD1 1 
ATOM 4137 N N   . SER A 1 533  ? -1.700  86.733 -14.340 1.00 99.53  ? 530  SER A N   1 
ATOM 4138 C CA  . SER A 1 533  ? -0.477  86.264 -15.003 1.00 99.53  ? 530  SER A CA  1 
ATOM 4139 C C   . SER A 1 533  ? -0.661  85.019 -15.896 1.00 99.53  ? 530  SER A C   1 
ATOM 4140 O O   . SER A 1 533  ? -1.650  84.343 -15.760 1.00 99.53  ? 530  SER A O   1 
ATOM 4141 C CB  . SER A 1 533  ? 0.582   86.010 -13.943 1.00 112.85 ? 530  SER A CB  1 
ATOM 4142 O OG  . SER A 1 533  ? 0.918   84.652 -13.878 1.00 112.85 ? 530  SER A OG  1 
ATOM 4143 N N   . HIS A 1 534  ? 0.269   84.731 -16.821 1.00 154.05 ? 531  HIS A N   1 
ATOM 4144 C CA  . HIS A 1 534  ? 0.124   83.601 -17.769 1.00 154.05 ? 531  HIS A CA  1 
ATOM 4145 C C   . HIS A 1 534  ? 1.433   83.143 -18.458 1.00 154.05 ? 531  HIS A C   1 
ATOM 4146 O O   . HIS A 1 534  ? 2.186   83.963 -18.990 1.00 154.05 ? 531  HIS A O   1 
ATOM 4147 C CB  . HIS A 1 534  ? -0.967  83.935 -18.810 1.00 168.11 ? 531  HIS A CB  1 
ATOM 4148 C CG  . HIS A 1 534  ? -1.010  83.012 -19.993 1.00 168.11 ? 531  HIS A CG  1 
ATOM 4149 N ND1 . HIS A 1 534  ? -1.088  81.640 -19.877 1.00 168.11 ? 531  HIS A ND1 1 
ATOM 4150 C CD2 . HIS A 1 534  ? -1.023  83.276 -21.322 1.00 168.11 ? 531  HIS A CD2 1 
ATOM 4151 C CE1 . HIS A 1 534  ? -1.126  81.098 -21.082 1.00 168.11 ? 531  HIS A CE1 1 
ATOM 4152 N NE2 . HIS A 1 534  ? -1.090  82.069 -21.976 1.00 168.11 ? 531  HIS A NE2 1 
ATOM 4153 N N   . THR A 1 535  ? 1.683   81.829 -18.432 1.00 67.16  ? 532  THR A N   1 
ATOM 4154 C CA  . THR A 1 535  ? 2.772   81.169 -19.168 1.00 67.16  ? 532  THR A CA  1 
ATOM 4155 C C   . THR A 1 535  ? 2.269   79.870 -19.831 1.00 67.16  ? 532  THR A C   1 
ATOM 4156 O O   . THR A 1 535  ? 1.057   79.598 -19.898 1.00 67.16  ? 532  THR A O   1 
ATOM 4157 C CB  . THR A 1 535  ? 3.991   80.863 -18.245 1.00 104.29 ? 532  THR A CB  1 
ATOM 4158 O OG1 . THR A 1 535  ? 4.298   82.020 -17.461 1.00 104.29 ? 532  THR A OG1 1 
ATOM 4159 C CG2 . THR A 1 535  ? 5.243   80.472 -19.047 1.00 104.29 ? 532  THR A CG2 1 
ATOM 4160 N N   . GLU A 1 536  ? 3.215   79.081 -20.336 1.00 77.70  ? 533  GLU A N   1 
ATOM 4161 C CA  . GLU A 1 536  ? 2.941   77.815 -21.010 1.00 77.70  ? 533  GLU A CA  1 
ATOM 4162 C C   . GLU A 1 536  ? 4.094   76.832 -20.722 1.00 77.70  ? 533  GLU A C   1 
ATOM 4163 O O   . GLU A 1 536  ? 5.272   77.226 -20.682 1.00 77.70  ? 533  GLU A O   1 
ATOM 4164 C CB  . GLU A 1 536  ? 2.767   78.053 -22.506 1.00 131.12 ? 533  GLU A CB  1 
ATOM 4165 C CG  . GLU A 1 536  ? 1.707   77.190 -23.138 1.00 131.12 ? 533  GLU A CG  1 
ATOM 4166 C CD  . GLU A 1 536  ? 0.891   77.936 -24.168 1.00 131.12 ? 533  GLU A CD  1 
ATOM 4167 O OE1 . GLU A 1 536  ? 0.694   77.390 -25.270 1.00 131.12 ? 533  GLU A OE1 1 
ATOM 4168 O OE2 . GLU A 1 536  ? 0.444   79.066 -23.880 1.00 131.12 ? 533  GLU A OE2 1 
ATOM 4169 N N   . MET A 1 537  ? 3.749   75.561 -20.494 1.00 64.58  ? 534  MET A N   1 
ATOM 4170 C CA  . MET A 1 537  ? 4.739   74.555 -20.082 1.00 64.58  ? 534  MET A CA  1 
ATOM 4171 C C   . MET A 1 537  ? 5.326   73.827 -21.257 1.00 64.58  ? 534  MET A C   1 
ATOM 4172 O O   . MET A 1 537  ? 4.652   73.642 -22.273 1.00 64.58  ? 534  MET A O   1 
ATOM 4173 C CB  . MET A 1 537  ? 4.119   73.551 -19.129 1.00 87.53  ? 534  MET A CB  1 
ATOM 4174 C CG  . MET A 1 537  ? 3.670   74.163 -17.840 1.00 87.53  ? 534  MET A CG  1 
ATOM 4175 S SD  . MET A 1 537  ? 4.905   75.255 -17.119 1.00 87.53  ? 534  MET A SD  1 
ATOM 4176 C CE  . MET A 1 537  ? 6.276   74.142 -16.768 1.00 87.53  ? 534  MET A CE  1 
ATOM 4177 N N   . GLU A 1 538  ? 6.583   73.408 -21.130 1.00 60.83  ? 535  GLU A N   1 
ATOM 4178 C CA  . GLU A 1 538  ? 7.195   72.692 -22.243 1.00 60.83  ? 535  GLU A CA  1 
ATOM 4179 C C   . GLU A 1 538  ? 6.467   71.362 -22.426 1.00 60.83  ? 535  GLU A C   1 
ATOM 4180 O O   . GLU A 1 538  ? 6.405   70.831 -23.536 1.00 60.83  ? 535  GLU A O   1 
ATOM 4181 C CB  . GLU A 1 538  ? 8.720   72.551 -22.107 1.00 77.40  ? 535  GLU A CB  1 
ATOM 4182 C CG  . GLU A 1 538  ? 9.225   71.809 -20.893 1.00 77.40  ? 535  GLU A CG  1 
ATOM 4183 C CD  . GLU A 1 538  ? 10.689  71.416 -21.036 1.00 77.40  ? 535  GLU A CD  1 
ATOM 4184 O OE1 . GLU A 1 538  ? 11.559  72.283 -20.822 1.00 77.40  ? 535  GLU A OE1 1 
ATOM 4185 O OE2 . GLU A 1 538  ? 10.980  70.242 -21.351 1.00 77.40  ? 535  GLU A OE2 1 
ATOM 4186 N N   . HIS A 1 539  ? 5.862   70.882 -21.336 1.00 77.33  ? 536  HIS A N   1 
ATOM 4187 C CA  . HIS A 1 539  ? 5.120   69.624 -21.311 1.00 77.33  ? 536  HIS A CA  1 
ATOM 4188 C C   . HIS A 1 539  ? 3.685   69.735 -20.784 1.00 77.33  ? 536  HIS A C   1 
ATOM 4189 O O   . HIS A 1 539  ? 3.245   70.810 -20.375 1.00 77.33  ? 536  HIS A O   1 
ATOM 4190 C CB  . HIS A 1 539  ? 5.903   68.610 -20.489 1.00 86.14  ? 536  HIS A CB  1 
ATOM 4191 C CG  . HIS A 1 539  ? 7.193   68.219 -21.123 1.00 86.14  ? 536  HIS A CG  1 
ATOM 4192 N ND1 . HIS A 1 539  ? 7.254   67.591 -22.347 1.00 86.14  ? 536  HIS A ND1 1 
ATOM 4193 C CD2 . HIS A 1 539  ? 8.469   68.385 -20.718 1.00 86.14  ? 536  HIS A CD2 1 
ATOM 4194 C CE1 . HIS A 1 539  ? 8.515   67.374 -22.662 1.00 86.14  ? 536  HIS A CE1 1 
ATOM 4195 N NE2 . HIS A 1 539  ? 9.273   67.847 -21.690 1.00 86.14  ? 536  HIS A NE2 1 
ATOM 4196 N N   . GLU A 1 540  ? 2.959   68.618 -20.802 1.00 72.17  ? 537  GLU A N   1 
ATOM 4197 C CA  . GLU A 1 540  ? 1.596   68.574 -20.271 1.00 72.17  ? 537  GLU A CA  1 
ATOM 4198 C C   . GLU A 1 540  ? 1.558   68.543 -18.744 1.00 72.17  ? 537  GLU A C   1 
ATOM 4199 O O   . GLU A 1 540  ? 2.173   67.669 -18.135 1.00 72.17  ? 537  GLU A O   1 
ATOM 4200 C CB  . GLU A 1 540  ? 0.848   67.376 -20.839 1.00 82.06  ? 537  GLU A CB  1 
ATOM 4201 C CG  . GLU A 1 540  ? -0.475  67.114 -20.149 1.00 82.06  ? 537  GLU A CG  1 
ATOM 4202 C CD  . GLU A 1 540  ? -1.611  66.944 -21.121 1.00 82.06  ? 537  GLU A CD  1 
ATOM 4203 O OE1 . GLU A 1 540  ? -1.714  67.759 -22.077 1.00 82.06  ? 537  GLU A OE1 1 
ATOM 4204 O OE2 . GLU A 1 540  ? -2.405  66.007 -20.919 1.00 82.06  ? 537  GLU A OE2 1 
ATOM 4205 N N   . VAL A 1 541  ? 0.826   69.487 -18.140 1.00 65.68  ? 538  VAL A N   1 
ATOM 4206 C CA  . VAL A 1 541  ? 0.743   69.624 -16.671 1.00 65.68  ? 538  VAL A CA  1 
ATOM 4207 C C   . VAL A 1 541  ? -0.076  68.509 -16.037 1.00 65.68  ? 538  VAL A C   1 
ATOM 4208 O O   . VAL A 1 541  ? -1.237  68.287 -16.408 1.00 65.68  ? 538  VAL A O   1 
ATOM 4209 C CB  . VAL A 1 541  ? 0.087   70.956 -16.238 1.00 55.44  ? 538  VAL A CB  1 
ATOM 4210 C CG1 . VAL A 1 541  ? 0.182   71.134 -14.715 1.00 55.44  ? 538  VAL A CG1 1 
ATOM 4211 C CG2 . VAL A 1 541  ? 0.687   72.145 -16.989 1.00 55.44  ? 538  VAL A CG2 1 
ATOM 4212 N N   . ALA A 1 542  ? 0.523   67.833 -15.060 1.00 53.54  ? 539  ALA A N   1 
ATOM 4213 C CA  . ALA A 1 542  ? -0.127  66.708 -14.370 1.00 53.54  ? 539  ALA A CA  1 
ATOM 4214 C C   . ALA A 1 542  ? -0.761  67.081 -13.030 1.00 53.54  ? 539  ALA A C   1 
ATOM 4215 O O   . ALA A 1 542  ? -1.824  66.560 -12.694 1.00 53.54  ? 539  ALA A O   1 
ATOM 4216 C CB  . ALA A 1 542  ? 0.836   65.532 -14.208 1.00 30.67  ? 539  ALA A CB  1 
ATOM 4217 N N   . CYS A 1 543  ? -0.127  67.983 -12.281 1.00 46.36  ? 540  CYS A N   1 
ATOM 4218 C CA  . CYS A 1 543  ? -0.619  68.372 -10.926 1.00 46.36  ? 540  CYS A CA  1 
ATOM 4219 C C   . CYS A 1 543  ? -0.026  69.713 -10.422 1.00 46.36  ? 540  CYS A C   1 
ATOM 4220 O O   . CYS A 1 543  ? 1.012   70.157 -10.928 1.00 46.36  ? 540  CYS A O   1 
ATOM 4221 C CB  . CYS A 1 543  ? -0.358  67.247 -9.895  1.00 57.05  ? 540  CYS A CB  1 
ATOM 4222 S SG  . CYS A 1 543  ? 1.386   66.711 -9.813  1.00 57.05  ? 540  CYS A SG  1 
ATOM 4223 N N   . LEU A 1 544  ? -0.676  70.318 -9.423  1.00 81.64  ? 541  LEU A N   1 
ATOM 4224 C CA  . LEU A 1 544  ? -0.345  71.666 -8.955  1.00 81.64  ? 541  LEU A CA  1 
ATOM 4225 C C   . LEU A 1 544  ? -0.503  71.838 -7.452  1.00 81.64  ? 541  LEU A C   1 
ATOM 4226 O O   . LEU A 1 544  ? -1.413  71.267 -6.843  1.00 81.64  ? 541  LEU A O   1 
ATOM 4227 C CB  . LEU A 1 544  ? -1.263  72.700 -9.616  1.00 57.07  ? 541  LEU A CB  1 
ATOM 4228 C CG  . LEU A 1 544  ? -1.118  73.094 -11.080 1.00 57.07  ? 541  LEU A CG  1 
ATOM 4229 C CD1 . LEU A 1 544  ? -2.447  73.568 -11.581 1.00 57.07  ? 541  LEU A CD1 1 
ATOM 4230 C CD2 . LEU A 1 544  ? -0.081  74.170 -11.268 1.00 57.07  ? 541  LEU A CD2 1 
ATOM 4231 N N   . ASP A 1 545  ? 0.360   72.662 -6.857  1.00 81.71  ? 542  ASP A N   1 
ATOM 4232 C CA  . ASP A 1 545  ? 0.145   73.099 -5.481  1.00 81.71  ? 542  ASP A CA  1 
ATOM 4233 C C   . ASP A 1 545  ? 0.445   74.575 -5.281  1.00 81.71  ? 542  ASP A C   1 
ATOM 4234 O O   . ASP A 1 545  ? 1.484   75.073 -5.710  1.00 81.71  ? 542  ASP A O   1 
ATOM 4235 C CB  . ASP A 1 545  ? 0.943   72.248 -4.477  1.00 86.53  ? 542  ASP A CB  1 
ATOM 4236 C CG  . ASP A 1 545  ? 0.351   72.292 -3.055  1.00 86.53  ? 542  ASP A CG  1 
ATOM 4237 O OD1 . ASP A 1 545  ? 1.101   72.044 -2.081  1.00 86.53  ? 542  ASP A OD1 1 
ATOM 4238 O OD2 . ASP A 1 545  ? -0.862  72.575 -2.913  1.00 86.53  ? 542  ASP A OD2 1 
ATOM 4239 N N   . ILE A 1 546  ? -0.505  75.256 -4.641  1.00 201.87 ? 543  ILE A N   1 
ATOM 4240 C CA  . ILE A 1 546  ? -0.344  76.603 -4.088  1.00 201.87 ? 543  ILE A CA  1 
ATOM 4241 C C   . ILE A 1 546  ? -1.287  76.718 -2.888  1.00 201.87 ? 543  ILE A C   1 
ATOM 4242 O O   . ILE A 1 546  ? -2.407  76.197 -2.926  1.00 201.87 ? 543  ILE A O   1 
ATOM 4243 C CB  . ILE A 1 546  ? -0.636  77.749 -5.125  1.00 68.84  ? 543  ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 546  ? -1.996  77.580 -5.840  1.00 68.84  ? 543  ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 546  ? 0.466   77.848 -6.175  1.00 68.84  ? 543  ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 546  ? -3.234  78.043 -5.057  1.00 68.84  ? 543  ILE A CD1 1 
ATOM 4247 N N   . THR A 1 547  ? -0.829  77.365 -1.817  1.00 201.87 ? 544  THR A N   1 
ATOM 4248 C CA  . THR A 1 547  ? -1.678  77.654 -0.647  1.00 201.87 ? 544  THR A CA  1 
ATOM 4249 C C   . THR A 1 547  ? -0.974  78.687 0.257   1.00 201.87 ? 544  THR A C   1 
ATOM 4250 O O   . THR A 1 547  ? 0.254   78.742 0.263   1.00 201.87 ? 544  THR A O   1 
ATOM 4251 C CB  . THR A 1 547  ? -2.051  76.363 0.174   1.00 129.72 ? 544  THR A CB  1 
ATOM 4252 O OG1 . THR A 1 547  ? -1.532  75.180 -0.460  1.00 129.72 ? 544  THR A OG1 1 
ATOM 4253 C CG2 . THR A 1 547  ? -3.573  76.233 0.324   1.00 129.72 ? 544  THR A CG2 1 
ATOM 4254 N N   . PRO A 1 548  ? -1.746  79.537 0.982   1.00 201.87 ? 545  PRO A N   1 
ATOM 4255 C CA  . PRO A 1 548  ? -1.226  80.492 1.976   1.00 201.87 ? 545  PRO A CA  1 
ATOM 4256 C C   . PRO A 1 548  ? 0.008   80.011 2.750   1.00 201.87 ? 545  PRO A C   1 
ATOM 4257 O O   . PRO A 1 548  ? -0.114  79.207 3.678   1.00 201.87 ? 545  PRO A O   1 
ATOM 4258 C CB  . PRO A 1 548  ? -2.413  80.667 2.930   1.00 162.90 ? 545  PRO A CB  1 
ATOM 4259 C CG  . PRO A 1 548  ? -3.614  80.487 2.065   1.00 162.90 ? 545  PRO A CG  1 
ATOM 4260 C CD  . PRO A 1 548  ? -3.209  79.677 0.847   1.00 162.90 ? 545  PRO A CD  1 
ATOM 4261 N N   . LEU A 1 549  ? 1.182   80.515 2.369   1.00 201.87 ? 546  LEU A N   1 
ATOM 4262 C CA  . LEU A 1 549  ? 2.451   80.068 2.952   1.00 201.87 ? 546  LEU A CA  1 
ATOM 4263 C C   . LEU A 1 549  ? 3.437   81.208 3.226   1.00 201.87 ? 546  LEU A C   1 
ATOM 4264 O O   . LEU A 1 549  ? 4.168   81.650 2.337   1.00 201.87 ? 546  LEU A O   1 
ATOM 4265 C CB  . LEU A 1 549  ? 3.080   78.989 2.068   1.00 96.03  ? 546  LEU A CB  1 
ATOM 4266 C CG  . LEU A 1 549  ? 2.409   77.624 2.214   1.00 96.03  ? 546  LEU A CG  1 
ATOM 4267 C CD1 . LEU A 1 549  ? 2.289   76.896 0.873   1.00 96.03  ? 546  LEU A CD1 1 
ATOM 4268 C CD2 . LEU A 1 549  ? 3.135   76.784 3.263   1.00 96.03  ? 546  LEU A CD2 1 
ATOM 4269 N N   . GLY A 1 550  ? 3.449   81.662 4.478   1.00 130.07 ? 547  GLY A N   1 
ATOM 4270 C CA  . GLY A 1 550  ? 4.251   82.804 4.903   1.00 130.07 ? 547  GLY A CA  1 
ATOM 4271 C C   . GLY A 1 550  ? 3.395   83.758 5.710   1.00 130.07 ? 547  GLY A C   1 
ATOM 4272 O O   . GLY A 1 550  ? 3.310   83.645 6.935   1.00 130.07 ? 547  GLY A O   1 
ATOM 4273 N N   . ASP A 1 551  ? 2.761   84.697 5.013   1.00 160.62 ? 548  ASP A N   1 
ATOM 4274 C CA  . ASP A 1 551  ? 1.771   85.585 5.617   1.00 160.62 ? 548  ASP A CA  1 
ATOM 4275 C C   . ASP A 1 551  ? 0.729   86.039 4.586   1.00 160.62 ? 548  ASP A C   1 
ATOM 4276 O O   . ASP A 1 551  ? 0.178   87.139 4.689   1.00 160.62 ? 548  ASP A O   1 
ATOM 4277 C CB  . ASP A 1 551  ? 2.445   86.784 6.316   1.00 164.86 ? 548  ASP A CB  1 
ATOM 4278 C CG  . ASP A 1 551  ? 2.861   87.884 5.348   1.00 164.86 ? 548  ASP A CG  1 
ATOM 4279 O OD1 . ASP A 1 551  ? 2.463   89.047 5.568   1.00 164.86 ? 548  ASP A OD1 1 
ATOM 4280 O OD2 . ASP A 1 551  ? 3.573   87.592 4.365   1.00 164.86 ? 548  ASP A OD2 1 
ATOM 4281 N N   . SER A 1 552  ? 0.461   85.187 3.598   1.00 151.60 ? 549  SER A N   1 
ATOM 4282 C CA  . SER A 1 552  ? -0.556  85.488 2.588   1.00 151.60 ? 549  SER A CA  1 
ATOM 4283 C C   . SER A 1 552  ? -1.914  84.861 2.931   1.00 151.60 ? 549  SER A C   1 
ATOM 4284 O O   . SER A 1 552  ? -1.978  83.850 3.636   1.00 151.60 ? 549  SER A O   1 
ATOM 4285 C CB  . SER A 1 552  ? -0.085  85.087 1.175   1.00 78.37  ? 549  SER A CB  1 
ATOM 4286 O OG  . SER A 1 552  ? -0.050  83.683 0.994   1.00 78.37  ? 549  SER A OG  1 
ATOM 4287 N N   . ASN A 1 553  ? -2.989  85.491 2.455   1.00 167.48 ? 550  ASN A N   1 
ATOM 4288 C CA  . ASN A 1 553  ? -4.352  84.972 2.602   1.00 167.48 ? 550  ASN A CA  1 
ATOM 4289 C C   . ASN A 1 553  ? -4.961  84.651 1.247   1.00 167.48 ? 550  ASN A C   1 
ATOM 4290 O O   . ASN A 1 553  ? -5.286  83.498 0.953   1.00 167.48 ? 550  ASN A O   1 
ATOM 4291 C CB  . ASN A 1 553  ? -5.259  85.988 3.305   1.00 128.36 ? 550  ASN A CB  1 
ATOM 4292 C CG  . ASN A 1 553  ? -4.943  86.146 4.773   1.00 128.36 ? 550  ASN A CG  1 
ATOM 4293 O OD1 . ASN A 1 553  ? -3.814  85.906 5.207   1.00 128.36 ? 550  ASN A OD1 1 
ATOM 4294 N ND2 . ASN A 1 553  ? -5.946  86.564 5.551   1.00 128.36 ? 550  ASN A ND2 1 
ATOM 4295 N N   . GLY A 1 554  ? -5.107  85.694 0.432   1.00 116.83 ? 551  GLY A N   1 
ATOM 4296 C CA  . GLY A 1 554  ? -5.834  85.620 -0.823  1.00 116.83 ? 551  GLY A CA  1 
ATOM 4297 C C   . GLY A 1 554  ? -4.982  85.090 -1.945  1.00 116.83 ? 551  GLY A C   1 
ATOM 4298 O O   . GLY A 1 554  ? -5.159  83.949 -2.380  1.00 116.83 ? 551  GLY A O   1 
ATOM 4299 N N   . LEU A 1 555  ? -4.071  85.932 -2.421  1.00 201.87 ? 552  LEU A N   1 
ATOM 4300 C CA  . LEU A 1 555  ? -3.092  85.539 -3.429  1.00 201.87 ? 552  LEU A CA  1 
ATOM 4301 C C   . LEU A 1 555  ? -1.990  84.727 -2.741  1.00 201.87 ? 552  LEU A C   1 
ATOM 4302 O O   . LEU A 1 555  ? -1.549  85.087 -1.646  1.00 201.87 ? 552  LEU A O   1 
ATOM 4303 C CB  . LEU A 1 555  ? -2.511  86.770 -4.145  1.00 148.50 ? 552  LEU A CB  1 
ATOM 4304 C CG  . LEU A 1 555  ? -3.448  87.782 -4.822  1.00 148.50 ? 552  LEU A CG  1 
ATOM 4305 C CD1 . LEU A 1 555  ? -3.868  88.878 -3.844  1.00 148.50 ? 552  LEU A CD1 1 
ATOM 4306 C CD2 . LEU A 1 555  ? -2.776  88.394 -6.040  1.00 148.50 ? 552  LEU A CD2 1 
ATOM 4307 N N   . SER A 1 556  ? -1.560  83.629 -3.368  1.00 89.37  ? 553  SER A N   1 
ATOM 4308 C CA  . SER A 1 556  ? -0.573  82.737 -2.746  1.00 89.37  ? 553  SER A CA  1 
ATOM 4309 C C   . SER A 1 556  ? 0.806   82.929 -3.377  1.00 89.37  ? 553  SER A C   1 
ATOM 4310 O O   . SER A 1 556  ? 0.876   83.323 -4.540  1.00 89.37  ? 553  SER A O   1 
ATOM 4311 C CB  . SER A 1 556  ? -1.038  81.278 -2.817  1.00 200.97 ? 553  SER A CB  1 
ATOM 4312 O OG  . SER A 1 556  ? -2.209  81.064 -1.994  1.00 200.97 ? 553  SER A OG  1 
ATOM 4313 N N   . PRO A 1 557  ? 1.901   82.692 -2.605  1.00 201.87 ? 554  PRO A N   1 
ATOM 4314 C CA  . PRO A 1 557  ? 3.305   82.942 -3.009  1.00 201.87 ? 554  PRO A CA  1 
ATOM 4315 C C   . PRO A 1 557  ? 3.964   81.963 -4.005  1.00 201.87 ? 554  PRO A C   1 
ATOM 4316 O O   . PRO A 1 557  ? 4.024   82.272 -5.196  1.00 201.87 ? 554  PRO A O   1 
ATOM 4317 C CB  . PRO A 1 557  ? 4.067   82.953 -1.669  1.00 162.85 ? 554  PRO A CB  1 
ATOM 4318 C CG  . PRO A 1 557  ? 3.001   82.935 -0.596  1.00 162.85 ? 554  PRO A CG  1 
ATOM 4319 C CD  . PRO A 1 557  ? 1.848   82.217 -1.214  1.00 162.85 ? 554  PRO A CD  1 
ATOM 4320 N N   . LEU A 1 558  ? 4.474   80.822 -3.533  1.00 108.41 ? 555  LEU A N   1 
ATOM 4321 C CA  . LEU A 1 558  ? 5.263   79.911 -4.392  1.00 108.41 ? 555  LEU A CA  1 
ATOM 4322 C C   . LEU A 1 558  ? 4.442   78.964 -5.289  1.00 108.41 ? 555  LEU A C   1 
ATOM 4323 O O   . LEU A 1 558  ? 3.211   79.044 -5.311  1.00 108.41 ? 555  LEU A O   1 
ATOM 4324 C CB  . LEU A 1 558  ? 6.278   79.134 -3.558  1.00 79.15  ? 555  LEU A CB  1 
ATOM 4325 C CG  . LEU A 1 558  ? 7.655   79.776 -3.373  1.00 79.15  ? 555  LEU A CG  1 
ATOM 4326 C CD1 . LEU A 1 558  ? 8.448   79.053 -2.297  1.00 79.15  ? 555  LEU A CD1 1 
ATOM 4327 C CD2 . LEU A 1 558  ? 8.443   79.794 -4.678  1.00 79.15  ? 555  LEU A CD2 1 
ATOM 4328 N N   . CYS A 1 559  ? 5.119   78.083 -6.038  1.00 78.09  ? 556  CYS A N   1 
ATOM 4329 C CA  . CYS A 1 559  ? 4.423   77.221 -7.024  1.00 78.09  ? 556  CYS A CA  1 
ATOM 4330 C C   . CYS A 1 559  ? 5.009   75.825 -7.357  1.00 78.09  ? 556  CYS A C   1 
ATOM 4331 O O   . CYS A 1 559  ? 6.060   75.703 -7.989  1.00 78.09  ? 556  CYS A O   1 
ATOM 4332 C CB  . CYS A 1 559  ? 4.160   77.979 -8.323  1.00 84.20  ? 556  CYS A CB  1 
ATOM 4333 S SG  . CYS A 1 559  ? 3.049   77.063 -9.378  1.00 84.20  ? 556  CYS A SG  1 
ATOM 4334 N N   . ALA A 1 560  ? 4.260   74.790 -6.969  1.00 91.83  ? 557  ALA A N   1 
ATOM 4335 C CA  . ALA A 1 560  ? 4.640   73.391 -7.173  1.00 91.83  ? 557  ALA A CA  1 
ATOM 4336 C C   . ALA A 1 560  ? 3.935   72.792 -8.389  1.00 91.83  ? 557  ALA A C   1 
ATOM 4337 O O   . ALA A 1 560  ? 2.713   72.885 -8.532  1.00 91.83  ? 557  ALA A O   1 
ATOM 4338 C CB  . ALA A 1 560  ? 4.346   72.577 -5.927  1.00 184.39 ? 557  ALA A CB  1 
ATOM 4339 N N   . ILE A 1 561  ? 4.726   72.161 -9.248  1.00 51.80  ? 558  ILE A N   1 
ATOM 4340 C CA  . ILE A 1 561  ? 4.273   71.701 -10.554 1.00 51.80  ? 558  ILE A CA  1 
ATOM 4341 C C   . ILE A 1 561  ? 4.800   70.294 -10.908 1.00 51.80  ? 558  ILE A C   1 
ATOM 4342 O O   . ILE A 1 561  ? 5.996   69.992 -10.778 1.00 51.80  ? 558  ILE A O   1 
ATOM 4343 C CB  . ILE A 1 561  ? 4.635   72.747 -11.678 1.00 63.83  ? 558  ILE A CB  1 
ATOM 4344 C CG1 . ILE A 1 561  ? 3.930   72.425 -12.998 1.00 63.83  ? 558  ILE A CG1 1 
ATOM 4345 C CG2 . ILE A 1 561  ? 6.144   72.848 -11.895 1.00 63.83  ? 558  ILE A CG2 1 
ATOM 4346 C CD1 . ILE A 1 561  ? 2.532   72.998 -13.105 1.00 63.83  ? 558  ILE A CD1 1 
ATOM 4347 N N   . GLY A 1 562  ? 3.882   69.442 -11.357 1.00 57.14  ? 559  GLY A N   1 
ATOM 4348 C CA  . GLY A 1 562  ? 4.219   68.097 -11.778 1.00 57.14  ? 559  GLY A CA  1 
ATOM 4349 C C   . GLY A 1 562  ? 3.768   67.911 -13.199 1.00 57.14  ? 559  GLY A C   1 
ATOM 4350 O O   . GLY A 1 562  ? 2.598   68.045 -13.490 1.00 57.14  ? 559  GLY A O   1 
ATOM 4351 N N   . LEU A 1 563  ? 4.743   67.629 -14.049 1.00 78.47  ? 560  LEU A N   1 
ATOM 4352 C CA  . LEU A 1 563  ? 4.625   67.612 -15.490 1.00 78.47  ? 560  LEU A CA  1 
ATOM 4353 C C   . LEU A 1 563  ? 4.641   66.229 -16.059 1.00 78.47  ? 560  LEU A C   1 
ATOM 4354 O O   . LEU A 1 563  ? 4.832   65.278 -15.366 1.00 78.47  ? 560  LEU A O   1 
ATOM 4355 C CB  . LEU A 1 563  ? 5.728   68.436 -16.122 1.00 71.38  ? 560  LEU A CB  1 
ATOM 4356 C CG  . LEU A 1 563  ? 5.350   69.871 -16.391 1.00 71.38  ? 560  LEU A CG  1 
ATOM 4357 C CD1 . LEU A 1 563  ? 6.509   70.548 -16.960 1.00 71.38  ? 560  LEU A CD1 1 
ATOM 4358 C CD2 . LEU A 1 563  ? 4.267   69.882 -17.377 1.00 71.38  ? 560  LEU A CD2 1 
ATOM 4359 N N   . TRP A 1 564  ? 4.448   66.141 -17.355 1.00 84.71  ? 561  TRP A N   1 
ATOM 4360 C CA  . TRP A 1 564  ? 3.908   64.966 -17.981 1.00 84.71  ? 561  TRP A CA  1 
ATOM 4361 C C   . TRP A 1 564  ? 4.769   64.160 -18.917 1.00 84.71  ? 561  TRP A C   1 
ATOM 4362 O O   . TRP A 1 564  ? 4.302   63.169 -19.396 1.00 84.71  ? 561  TRP A O   1 
ATOM 4363 C CB  . TRP A 1 564  ? 2.696   65.371 -18.777 1.00 63.04  ? 561  TRP A CB  1 
ATOM 4364 C CG  . TRP A 1 564  ? 1.478   64.824 -18.310 1.00 63.04  ? 561  TRP A CG  1 
ATOM 4365 C CD1 . TRP A 1 564  ? 0.758   65.257 -17.285 1.00 63.04  ? 561  TRP A CD1 1 
ATOM 4366 C CD2 . TRP A 1 564  ? 0.777   63.732 -18.869 1.00 63.04  ? 561  TRP A CD2 1 
ATOM 4367 N NE1 . TRP A 1 564  ? -0.365  64.506 -17.147 1.00 63.04  ? 561  TRP A NE1 1 
ATOM 4368 C CE2 . TRP A 1 564  ? -0.373  63.557 -18.121 1.00 63.04  ? 561  TRP A CE2 1 
ATOM 4369 C CE3 . TRP A 1 564  ? 1.012   62.883 -19.936 1.00 63.04  ? 561  TRP A CE3 1 
ATOM 4370 C CZ2 . TRP A 1 564  ? -1.282  62.568 -18.386 1.00 63.04  ? 561  TRP A CZ2 1 
ATOM 4371 C CZ3 . TRP A 1 564  ? 0.100   61.909 -20.204 1.00 63.04  ? 561  TRP A CZ3 1 
ATOM 4372 C CH2 . TRP A 1 564  ? -1.029  61.756 -19.433 1.00 63.04  ? 561  TRP A CH2 1 
ATOM 4373 N N   . THR A 1 565  ? 5.985   64.523 -19.239 1.00 59.07  ? 562  THR A N   1 
ATOM 4374 C CA  . THR A 1 565  ? 6.613   63.713 -20.263 1.00 59.07  ? 562  THR A CA  1 
ATOM 4375 C C   . THR A 1 565  ? 8.034   63.483 -19.950 1.00 59.07  ? 562  THR A C   1 
ATOM 4376 O O   . THR A 1 565  ? 8.642   62.476 -20.272 1.00 59.07  ? 562  THR A O   1 
ATOM 4377 C CB  . THR A 1 565  ? 6.525   64.412 -21.576 1.00 73.86  ? 562  THR A CB  1 
ATOM 4378 O OG1 . THR A 1 565  ? 5.165   64.429 -21.997 1.00 73.86  ? 562  THR A OG1 1 
ATOM 4379 C CG2 . THR A 1 565  ? 7.323   63.704 -22.579 1.00 73.86  ? 562  THR A CG2 1 
ATOM 4380 N N   . ASP A 1 566  ? 8.551   64.496 -19.315 1.00 112.65 ? 563  ASP A N   1 
ATOM 4381 C CA  . ASP A 1 566  ? 9.888   64.518 -18.730 1.00 112.65 ? 563  ASP A CA  1 
ATOM 4382 C C   . ASP A 1 566  ? 9.870   64.113 -17.255 1.00 112.65 ? 563  ASP A C   1 
ATOM 4383 O O   . ASP A 1 566  ? 10.919  64.046 -16.612 1.00 112.65 ? 563  ASP A O   1 
ATOM 4384 C CB  . ASP A 1 566  ? 10.533  65.888 -18.922 1.00 93.00  ? 563  ASP A CB  1 
ATOM 4385 C CG  . ASP A 1 566  ? 9.833   66.973 -18.143 1.00 93.00  ? 563  ASP A CG  1 
ATOM 4386 O OD1 . ASP A 1 566  ? 8.782   66.696 -17.526 1.00 93.00  ? 563  ASP A OD1 1 
ATOM 4387 O OD2 . ASP A 1 566  ? 10.340  68.113 -18.148 1.00 93.00  ? 563  ASP A OD2 1 
ATOM 4388 N N   . ILE A 1 567  ? 8.667   63.857 -16.738 1.00 99.62  ? 564  ILE A N   1 
ATOM 4389 C CA  . ILE A 1 567  ? 8.445   63.341 -15.377 1.00 99.62  ? 564  ILE A CA  1 
ATOM 4390 C C   . ILE A 1 567  ? 9.177   64.176 -14.339 1.00 99.62  ? 564  ILE A C   1 
ATOM 4391 O O   . ILE A 1 567  ? 10.191  63.753 -13.764 1.00 99.62  ? 564  ILE A O   1 
ATOM 4392 C CB  . ILE A 1 567  ? 8.820   61.837 -15.255 1.00 95.59  ? 564  ILE A CB  1 
ATOM 4393 C CG1 . ILE A 1 567  ? 8.042   61.013 -16.283 1.00 95.59  ? 564  ILE A CG1 1 
ATOM 4394 C CG2 . ILE A 1 567  ? 8.540   61.317 -13.846 1.00 95.59  ? 564  ILE A CG2 1 
ATOM 4395 C CD1 . ILE A 1 567  ? 8.819   59.897 -16.847 1.00 95.59  ? 564  ILE A CD1 1 
ATOM 4396 N N   . SER A 1 568  ? 8.656   65.375 -14.103 1.00 51.55  ? 565  SER A N   1 
ATOM 4397 C CA  . SER A 1 568  ? 9.363   66.316 -13.258 1.00 51.55  ? 565  SER A CA  1 
ATOM 4398 C C   . SER A 1 568  ? 8.459   67.134 -12.380 1.00 51.55  ? 565  SER A C   1 
ATOM 4399 O O   . SER A 1 568  ? 7.271   67.320 -12.660 1.00 51.55  ? 565  SER A O   1 
ATOM 4400 C CB  . SER A 1 568  ? 10.250  67.240 -14.100 1.00 59.62  ? 565  SER A CB  1 
ATOM 4401 O OG  . SER A 1 568  ? 9.508   67.842 -15.139 1.00 59.62  ? 565  SER A OG  1 
ATOM 4402 N N   . ALA A 1 569  ? 9.072   67.605 -11.302 1.00 67.41  ? 566  ALA A N   1 
ATOM 4403 C CA  . ALA A 1 569  ? 8.464   68.485 -10.340 1.00 67.41  ? 566  ALA A CA  1 
ATOM 4404 C C   . ALA A 1 569  ? 9.375   69.704 -10.164 1.00 67.41  ? 566  ALA A C   1 
ATOM 4405 O O   . ALA A 1 569  ? 10.594  69.567 -9.949  1.00 67.41  ? 566  ALA A O   1 
ATOM 4406 C CB  . ALA A 1 569  ? 8.279   67.757 -9.036  1.00 75.04  ? 566  ALA A CB  1 
ATOM 4407 N N   . ARG A 1 570  ? 8.776   70.892 -10.261 1.00 58.84  ? 567  ARG A N   1 
ATOM 4408 C CA  . ARG A 1 570  ? 9.541   72.125 -10.386 1.00 58.84  ? 567  ARG A CA  1 
ATOM 4409 C C   . ARG A 1 570  ? 8.959   73.154 -9.481  1.00 58.84  ? 567  ARG A C   1 
ATOM 4410 O O   . ARG A 1 570  ? 7.763   73.094 -9.195  1.00 58.84  ? 567  ARG A O   1 
ATOM 4411 C CB  . ARG A 1 570  ? 9.495   72.677 -11.821 1.00 72.66  ? 567  ARG A CB  1 
ATOM 4412 C CG  . ARG A 1 570  ? 10.178  71.843 -12.880 1.00 72.66  ? 567  ARG A CG  1 
ATOM 4413 C CD  . ARG A 1 570  ? 9.196   71.233 -13.846 1.00 72.66  ? 567  ARG A CD  1 
ATOM 4414 N NE  . ARG A 1 570  ? 9.875   70.536 -14.943 1.00 72.66  ? 567  ARG A NE  1 
ATOM 4415 C CZ  . ARG A 1 570  ? 10.068  71.033 -16.166 1.00 72.66  ? 567  ARG A CZ  1 
ATOM 4416 N NH1 . ARG A 1 570  ? 9.632   72.251 -16.485 1.00 72.66  ? 567  ARG A NH1 1 
ATOM 4417 N NH2 . ARG A 1 570  ? 10.695  70.298 -17.075 1.00 72.66  ? 567  ARG A NH2 1 
ATOM 4418 N N   . ILE A 1 571  ? 9.784   74.116 -9.113  1.00 71.75  ? 568  ILE A N   1 
ATOM 4419 C CA  . ILE A 1 571  ? 9.435   75.159 -8.181  1.00 71.75  ? 568  ILE A CA  1 
ATOM 4420 C C   . ILE A 1 571  ? 9.356   76.538 -8.814  1.00 71.75  ? 568  ILE A C   1 
ATOM 4421 O O   . ILE A 1 571  ? 10.357  77.099 -9.187  1.00 71.75  ? 568  ILE A O   1 
ATOM 4422 C CB  . ILE A 1 571  ? 10.490  75.238 -7.116  1.00 75.73  ? 568  ILE A CB  1 
ATOM 4423 C CG1 . ILE A 1 571  ? 10.075  74.419 -5.911  1.00 75.73  ? 568  ILE A CG1 1 
ATOM 4424 C CG2 . ILE A 1 571  ? 10.677  76.645 -6.709  1.00 75.73  ? 568  ILE A CG2 1 
ATOM 4425 C CD1 . ILE A 1 571  ? 8.650   74.595 -5.551  1.00 75.73  ? 568  ILE A CD1 1 
ATOM 4426 N N   . LEU A 1 572  ? 8.149   77.086 -8.915  1.00 142.12 ? 569  LEU A N   1 
ATOM 4427 C CA  . LEU A 1 572  ? 7.964   78.396 -9.534  1.00 142.12 ? 569  LEU A CA  1 
ATOM 4428 C C   . LEU A 1 572  ? 7.294   79.411 -8.606  1.00 142.12 ? 569  LEU A C   1 
ATOM 4429 O O   . LEU A 1 572  ? 7.411   79.323 -7.382  1.00 142.12 ? 569  LEU A O   1 
ATOM 4430 C CB  . LEU A 1 572  ? 7.160   78.265 -10.830 1.00 62.13  ? 569  LEU A CB  1 
ATOM 4431 C CG  . LEU A 1 572  ? 7.353   76.968 -11.619 1.00 62.13  ? 569  LEU A CG  1 
ATOM 4432 C CD1 . LEU A 1 572  ? 6.619   77.034 -12.950 1.00 62.13  ? 569  LEU A CD1 1 
ATOM 4433 C CD2 . LEU A 1 572  ? 8.832   76.683 -11.831 1.00 62.13  ? 569  LEU A CD2 1 
ATOM 4434 N N   . LYS A 1 573  ? 6.603   80.375 -9.211  1.00 195.84 ? 570  LYS A N   1 
ATOM 4435 C CA  . LYS A 1 573  ? 5.876   81.410 -8.480  1.00 195.84 ? 570  LYS A CA  1 
ATOM 4436 C C   . LYS A 1 573  ? 4.458   81.535 -9.034  1.00 195.84 ? 570  LYS A C   1 
ATOM 4437 O O   . LYS A 1 573  ? 4.168   81.040 -10.126 1.00 195.84 ? 570  LYS A O   1 
ATOM 4438 C CB  . LYS A 1 573  ? 6.603   82.751 -8.578  1.00 51.33  ? 570  LYS A CB  1 
ATOM 4439 C CG  . LYS A 1 573  ? 5.951   83.870 -7.783  1.00 51.33  ? 570  LYS A CG  1 
ATOM 4440 C CD  . LYS A 1 573  ? 6.750   85.159 -7.886  1.00 51.33  ? 570  LYS A CD  1 
ATOM 4441 C CE  . LYS A 1 573  ? 6.084   86.285 -7.111  1.00 51.33  ? 570  LYS A CE  1 
ATOM 4442 N NZ  . LYS A 1 573  ? 6.857   87.555 -7.202  1.00 51.33  ? 570  LYS A NZ  1 
ATOM 4443 N N   . LEU A 1 574  ? 3.572   82.192 -8.292  1.00 201.87 ? 571  LEU A N   1 
ATOM 4444 C CA  . LEU A 1 574  ? 2.171   82.226 -8.695  1.00 201.87 ? 571  LEU A CA  1 
ATOM 4445 C C   . LEU A 1 574  ? 1.401   83.291 -7.922  1.00 201.87 ? 571  LEU A C   1 
ATOM 4446 O O   . LEU A 1 574  ? 1.043   83.092 -6.761  1.00 201.87 ? 571  LEU A O   1 
ATOM 4447 C CB  . LEU A 1 574  ? 1.522   80.855 -8.490  1.00 194.58 ? 571  LEU A CB  1 
ATOM 4448 C CG  . LEU A 1 574  ? 0.045   80.741 -8.872  1.00 194.58 ? 571  LEU A CG  1 
ATOM 4449 C CD1 . LEU A 1 574  ? -0.448  79.313 -8.693  1.00 194.58 ? 571  LEU A CD1 1 
ATOM 4450 C CD2 . LEU A 1 574  ? -0.798  81.709 -8.056  1.00 194.58 ? 571  LEU A CD2 1 
ATOM 4451 N N   . PRO A 1 575  ? 1.186   84.412 -8.599  1.00 201.87 ? 572  PRO A N   1 
ATOM 4452 C CA  . PRO A 1 575  ? 1.536   84.578 -10.028 1.00 201.87 ? 572  PRO A CA  1 
ATOM 4453 C C   . PRO A 1 575  ? 2.611   83.681 -10.709 1.00 201.87 ? 572  PRO A C   1 
ATOM 4454 O O   . PRO A 1 575  ? 2.308   82.591 -11.196 1.00 201.87 ? 572  PRO A O   1 
ATOM 4455 C CB  . PRO A 1 575  ? 1.979   86.044 -10.100 1.00 127.54 ? 572  PRO A CB  1 
ATOM 4456 C CG  . PRO A 1 575  ? 2.475   86.351 -8.730  1.00 127.54 ? 572  PRO A CG  1 
ATOM 4457 C CD  . PRO A 1 575  ? 1.601   85.571 -7.790  1.00 127.54 ? 572  PRO A CD  1 
ATOM 4458 N N   . SER A 1 576  ? 3.849   84.177 -10.729 1.00 201.87 ? 573  SER A N   1 
ATOM 4459 C CA  . SER A 1 576  ? 4.903   83.942 -11.709 1.00 201.87 ? 573  SER A CA  1 
ATOM 4460 C C   . SER A 1 576  ? 5.007   82.785 -12.695 1.00 201.87 ? 573  SER A C   1 
ATOM 4461 O O   . SER A 1 576  ? 4.509   82.869 -13.818 1.00 201.87 ? 573  SER A O   1 
ATOM 4462 C CB  . SER A 1 576  ? 5.692   83.623 -10.437 1.00 82.05  ? 573  SER A CB  1 
ATOM 4463 O OG  . SER A 1 576  ? 7.013   83.215 -10.745 1.00 82.05  ? 573  SER A OG  1 
ATOM 4464 N N   . PHE A 1 577  ? 5.653   81.704 -12.271 1.00 147.57 ? 574  PHE A N   1 
ATOM 4465 C CA  . PHE A 1 577  ? 5.808   80.528 -13.119 1.00 147.57 ? 574  PHE A CA  1 
ATOM 4466 C C   . PHE A 1 577  ? 7.250   80.378 -13.594 1.00 147.57 ? 574  PHE A C   1 
ATOM 4467 O O   . PHE A 1 577  ? 7.599   79.396 -14.248 1.00 147.57 ? 574  PHE A O   1 
ATOM 4468 C CB  . PHE A 1 577  ? 4.864   80.606 -14.320 1.00 121.92 ? 574  PHE A CB  1 
ATOM 4469 C CG  . PHE A 1 577  ? 3.409   80.584 -13.950 1.00 121.92 ? 574  PHE A CG  1 
ATOM 4470 C CD1 . PHE A 1 577  ? 3.003   80.116 -12.711 1.00 121.92 ? 574  PHE A CD1 1 
ATOM 4471 C CD2 . PHE A 1 577  ? 2.447   81.032 -14.839 1.00 121.92 ? 574  PHE A CD2 1 
ATOM 4472 C CE1 . PHE A 1 577  ? 1.665   80.095 -12.366 1.00 121.92 ? 574  PHE A CE1 1 
ATOM 4473 C CE2 . PHE A 1 577  ? 1.107   81.013 -14.501 1.00 121.92 ? 574  PHE A CE2 1 
ATOM 4474 C CZ  . PHE A 1 577  ? 0.716   80.544 -13.263 1.00 121.92 ? 574  PHE A CZ  1 
ATOM 4475 N N   . GLU A 1 578  ? 8.082   81.358 -13.259 1.00 97.76  ? 575  GLU A N   1 
ATOM 4476 C CA  . GLU A 1 578  ? 9.487   81.338 -13.651 1.00 97.76  ? 575  GLU A CA  1 
ATOM 4477 C C   . GLU A 1 578  ? 10.175  80.063 -13.172 1.00 97.76  ? 575  GLU A C   1 
ATOM 4478 O O   . GLU A 1 578  ? 9.742   79.439 -12.204 1.00 97.76  ? 575  GLU A O   1 
ATOM 4479 C CB  . GLU A 1 578  ? 10.214  82.566 -13.100 1.00 127.59 ? 575  GLU A CB  1 
ATOM 4480 C CG  . GLU A 1 578  ? 10.186  82.677 -11.585 1.00 127.59 ? 575  GLU A CG  1 
ATOM 4481 C CD  . GLU A 1 578  ? 10.913  83.906 -11.076 1.00 127.59 ? 575  GLU A CD  1 
ATOM 4482 O OE1 . GLU A 1 578  ? 11.442  84.672 -11.909 1.00 127.59 ? 575  GLU A OE1 1 
ATOM 4483 O OE2 . GLU A 1 578  ? 10.955  84.106 -9.844  1.00 127.59 ? 575  GLU A OE2 1 
ATOM 4484 N N   . LEU A 1 579  ? 11.248  79.684 -13.858 1.00 91.48  ? 576  LEU A N   1 
ATOM 4485 C CA  . LEU A 1 579  ? 11.998  78.484 -13.505 1.00 91.48  ? 576  LEU A CA  1 
ATOM 4486 C C   . LEU A 1 579  ? 13.003  78.766 -12.393 1.00 91.48  ? 576  LEU A C   1 
ATOM 4487 O O   . LEU A 1 579  ? 13.697  79.782 -12.414 1.00 91.48  ? 576  LEU A O   1 
ATOM 4488 C CB  . LEU A 1 579  ? 12.717  77.921 -14.733 1.00 73.55  ? 576  LEU A CB  1 
ATOM 4489 C CG  . LEU A 1 579  ? 13.544  76.653 -14.512 1.00 73.55  ? 576  LEU A CG  1 
ATOM 4490 C CD1 . LEU A 1 579  ? 14.688  76.919 -13.545 1.00 73.55  ? 576  LEU A CD1 1 
ATOM 4491 C CD2 . LEU A 1 579  ? 12.665  75.519 -14.008 1.00 73.55  ? 576  LEU A CD2 1 
ATOM 4492 N N   . LEU A 1 580  ? 13.074  77.860 -11.424 1.00 99.89  ? 577  LEU A N   1 
ATOM 4493 C CA  . LEU A 1 580  ? 13.994  78.008 -10.302 1.00 99.89  ? 577  LEU A CA  1 
ATOM 4494 C C   . LEU A 1 580  ? 14.763  76.716 -10.049 1.00 99.89  ? 577  LEU A C   1 
ATOM 4495 O O   . LEU A 1 580  ? 15.981  76.732 -9.871  1.00 99.89  ? 577  LEU A O   1 
ATOM 4496 C CB  . LEU A 1 580  ? 13.237  78.426 -9.040  1.00 69.25  ? 577  LEU A CB  1 
ATOM 4497 C CG  . LEU A 1 580  ? 12.472  79.749 -9.114  1.00 69.25  ? 577  LEU A CG  1 
ATOM 4498 C CD1 . LEU A 1 580  ? 11.477  79.731 -10.264 1.00 69.25  ? 577  LEU A CD1 1 
ATOM 4499 C CD2 . LEU A 1 580  ? 11.770  80.039 -7.796  1.00 69.25  ? 577  LEU A CD2 1 
ATOM 4500 N N   . HIS A 1 581  ? 14.044  75.599 -10.034 1.00 75.87  ? 578  HIS A N   1 
ATOM 4501 C CA  . HIS A 1 581  ? 14.664  74.279 -9.801  1.00 75.87  ? 578  HIS A CA  1 
ATOM 4502 C C   . HIS A 1 581  ? 13.846  73.188 -10.496 1.00 75.87  ? 578  HIS A C   1 
ATOM 4503 O O   . HIS A 1 581  ? 12.711  72.939 -10.117 1.00 75.87  ? 578  HIS A O   1 
ATOM 4504 C CB  . HIS A 1 581  ? 14.761  73.968 -8.293  1.00 81.46  ? 578  HIS A CB  1 
ATOM 4505 C CG  . HIS A 1 581  ? 15.534  72.722 -7.971  1.00 81.46  ? 578  HIS A CG  1 
ATOM 4506 N ND1 . HIS A 1 581  ? 16.503  72.680 -6.991  1.00 81.46  ? 578  HIS A ND1 1 
ATOM 4507 C CD2 . HIS A 1 581  ? 15.479  71.472 -8.497  1.00 81.46  ? 578  HIS A CD2 1 
ATOM 4508 C CE1 . HIS A 1 581  ? 17.017  71.463 -6.931  1.00 81.46  ? 578  HIS A CE1 1 
ATOM 4509 N NE2 . HIS A 1 581  ? 16.413  70.711 -7.835  1.00 81.46  ? 578  HIS A NE2 1 
ATOM 4510 N N   . LYS A 1 582  ? 14.410  72.551 -11.517 1.00 126.56 ? 579  LYS A N   1 
ATOM 4511 C CA  . LYS A 1 582  ? 13.764  71.377 -12.113 1.00 126.56 ? 579  LYS A CA  1 
ATOM 4512 C C   . LYS A 1 582  ? 14.381  70.080 -11.599 1.00 126.56 ? 579  LYS A C   1 
ATOM 4513 O O   . LYS A 1 582  ? 15.592  69.860 -11.699 1.00 126.56 ? 579  LYS A O   1 
ATOM 4514 C CB  . LYS A 1 582  ? 13.716  71.419 -13.656 1.00 105.57 ? 579  LYS A CB  1 
ATOM 4515 C CG  . LYS A 1 582  ? 14.735  72.331 -14.344 1.00 105.57 ? 579  LYS A CG  1 
ATOM 4516 C CD  . LYS A 1 582  ? 14.651  72.215 -15.874 1.00 105.57 ? 579  LYS A CD  1 
ATOM 4517 C CE  . LYS A 1 582  ? 15.593  71.151 -16.427 1.00 105.57 ? 579  LYS A CE  1 
ATOM 4518 N NZ  . LYS A 1 582  ? 15.282  70.888 -17.844 1.00 105.57 ? 579  LYS A NZ  1 
ATOM 4519 N N   . GLU A 1 583  ? 13.533  69.235 -11.024 1.00 98.98  ? 580  GLU A N   1 
ATOM 4520 C CA  . GLU A 1 583  ? 13.970  67.958 -10.506 1.00 98.98  ? 580  GLU A CA  1 
ATOM 4521 C C   . GLU A 1 583  ? 13.433  66.868 -11.399 1.00 98.98  ? 580  GLU A C   1 
ATOM 4522 O O   . GLU A 1 583  ? 12.227  66.631 -11.449 1.00 98.98  ? 580  GLU A O   1 
ATOM 4523 C CB  . GLU A 1 583  ? 13.471  67.757 -9.075  1.00 85.27  ? 580  GLU A CB  1 
ATOM 4524 C CG  . GLU A 1 583  ? 13.958  66.463 -8.421  1.00 85.27  ? 580  GLU A CG  1 
ATOM 4525 C CD  . GLU A 1 583  ? 15.365  66.572 -7.884  1.00 85.27  ? 580  GLU A CD  1 
ATOM 4526 O OE1 . GLU A 1 583  ? 16.147  65.619 -8.078  1.00 85.27  ? 580  GLU A OE1 1 
ATOM 4527 O OE2 . GLU A 1 583  ? 15.685  67.615 -7.275  1.00 85.27  ? 580  GLU A OE2 1 
ATOM 4528 N N   . MET A 1 584  ? 14.340  66.216 -12.115 1.00 86.20  ? 581  MET A N   1 
ATOM 4529 C CA  . MET A 1 584  ? 13.989  65.050 -12.901 1.00 86.20  ? 581  MET A CA  1 
ATOM 4530 C C   . MET A 1 584  ? 13.680  63.890 -11.960 1.00 86.20  ? 581  MET A C   1 
ATOM 4531 O O   . MET A 1 584  ? 14.523  63.500 -11.152 1.00 86.20  ? 581  MET A O   1 
ATOM 4532 C CB  . MET A 1 584  ? 15.129  64.690 -13.839 1.00 92.58  ? 581  MET A CB  1 
ATOM 4533 C CG  . MET A 1 584  ? 14.673  64.524 -15.260 1.00 92.58  ? 581  MET A CG  1 
ATOM 4534 S SD  . MET A 1 584  ? 14.365  66.145 -16.003 1.00 92.58  ? 581  MET A SD  1 
ATOM 4535 C CE  . MET A 1 584  ? 15.928  66.433 -16.866 1.00 92.58  ? 581  MET A CE  1 
ATOM 4536 N N   . LEU A 1 585  ? 12.463  63.359 -12.031 1.00 67.55  ? 582  LEU A N   1 
ATOM 4537 C CA  . LEU A 1 585  ? 12.121  62.219 -11.172 1.00 67.55  ? 582  LEU A CA  1 
ATOM 4538 C C   . LEU A 1 585  ? 12.502  60.885 -11.809 1.00 67.55  ? 582  LEU A C   1 
ATOM 4539 O O   . LEU A 1 585  ? 12.562  59.866 -11.132 1.00 67.55  ? 582  LEU A O   1 
ATOM 4540 C CB  . LEU A 1 585  ? 10.649  62.242 -10.736 1.00 77.89  ? 582  LEU A CB  1 
ATOM 4541 C CG  . LEU A 1 585  ? 10.136  63.429 -9.899  1.00 77.89  ? 582  LEU A CG  1 
ATOM 4542 C CD1 . LEU A 1 585  ? 8.722   63.170 -9.394  1.00 77.89  ? 582  LEU A CD1 1 
ATOM 4543 C CD2 . LEU A 1 585  ? 11.061  63.818 -8.733  1.00 77.89  ? 582  LEU A CD2 1 
ATOM 4544 N N   . GLY A 1 586  ? 12.766  60.907 -13.110 1.00 76.65  ? 583  GLY A N   1 
ATOM 4545 C CA  . GLY A 1 586  ? 13.226  59.726 -13.828 1.00 76.65  ? 583  GLY A CA  1 
ATOM 4546 C C   . GLY A 1 586  ? 12.138  58.701 -14.013 1.00 76.65  ? 583  GLY A C   1 
ATOM 4547 O O   . GLY A 1 586  ? 10.983  58.963 -13.702 1.00 76.65  ? 583  GLY A O   1 
ATOM 4548 N N   . GLY A 1 587  ? 12.512  57.528 -14.513 1.00 90.13  ? 584  GLY A N   1 
ATOM 4549 C CA  . GLY A 1 587  ? 11.550  56.460 -14.778 1.00 90.13  ? 584  GLY A CA  1 
ATOM 4550 C C   . GLY A 1 587  ? 10.520  56.851 -15.830 1.00 90.13  ? 584  GLY A C   1 
ATOM 4551 O O   . GLY A 1 587  ? 10.831  57.608 -16.764 1.00 90.13  ? 584  GLY A O   1 
ATOM 4552 N N   . GLU A 1 588  ? 9.291   56.351 -15.663 1.00 96.69  ? 585  GLU A N   1 
ATOM 4553 C CA  . GLU A 1 588  ? 8.239   56.511 -16.678 1.00 96.69  ? 585  GLU A CA  1 
ATOM 4554 C C   . GLU A 1 588  ? 6.791   56.702 -16.185 1.00 96.69  ? 585  GLU A C   1 
ATOM 4555 O O   . GLU A 1 588  ? 5.869   56.685 -17.001 1.00 96.69  ? 585  GLU A O   1 
ATOM 4556 C CB  . GLU A 1 588  ? 8.329   55.394 -17.733 1.00 180.89 ? 585  GLU A CB  1 
ATOM 4557 C CG  . GLU A 1 588  ? 8.835   54.057 -17.204 1.00 180.89 ? 585  GLU A CG  1 
ATOM 4558 C CD  . GLU A 1 588  ? 10.004  53.522 -18.012 1.00 180.89 ? 585  GLU A CD  1 
ATOM 4559 O OE1 . GLU A 1 588  ? 9.884   53.433 -19.275 1.00 180.89 ? 585  GLU A OE1 1 
ATOM 4560 O OE2 . GLU A 1 588  ? 11.048  53.190 -17.382 1.00 180.89 ? 585  GLU A OE2 1 
ATOM 4561 N N   . ILE A 1 589  ? 6.590   56.901 -14.878 1.00 54.99  ? 586  ILE A N   1 
ATOM 4562 C CA  . ILE A 1 589  ? 5.234   57.162 -14.341 1.00 54.99  ? 586  ILE A CA  1 
ATOM 4563 C C   . ILE A 1 589  ? 5.031   58.663 -14.017 1.00 54.99  ? 586  ILE A C   1 
ATOM 4564 O O   . ILE A 1 589  ? 5.883   59.291 -13.375 1.00 54.99  ? 586  ILE A O   1 
ATOM 4565 C CB  . ILE A 1 589  ? 4.914   56.279 -13.076 1.00 61.88  ? 586  ILE A CB  1 
ATOM 4566 C CG1 . ILE A 1 589  ? 5.359   54.820 -13.272 1.00 61.88  ? 586  ILE A CG1 1 
ATOM 4567 C CG2 . ILE A 1 589  ? 3.421   56.343 -12.703 1.00 61.88  ? 586  ILE A CG2 1 
ATOM 4568 C CD1 . ILE A 1 589  ? 4.440   53.993 -14.172 1.00 61.88  ? 586  ILE A CD1 1 
ATOM 4569 N N   . ILE A 1 590  ? 3.925   59.256 -14.461 1.00 64.30  ? 587  ILE A N   1 
ATOM 4570 C CA  . ILE A 1 590  ? 3.777   60.685 -14.188 1.00 64.30  ? 587  ILE A CA  1 
ATOM 4571 C C   . ILE A 1 590  ? 3.404   60.947 -12.718 1.00 64.30  ? 587  ILE A C   1 
ATOM 4572 O O   . ILE A 1 590  ? 2.747   60.102 -12.084 1.00 64.30  ? 587  ILE A O   1 
ATOM 4573 C CB  . ILE A 1 590  ? 2.849   61.465 -15.209 1.00 75.88  ? 587  ILE A CB  1 
ATOM 4574 C CG1 . ILE A 1 590  ? 1.358   61.158 -15.027 1.00 75.88  ? 587  ILE A CG1 1 
ATOM 4575 C CG2 . ILE A 1 590  ? 3.340   61.291 -16.653 1.00 75.88  ? 587  ILE A CG2 1 
ATOM 4576 C CD1 . ILE A 1 590  ? 0.857   60.020 -15.844 1.00 75.88  ? 587  ILE A CD1 1 
ATOM 4577 N N   . PRO A 1 591  ? 3.864   62.090 -12.160 1.00 65.53  ? 588  PRO A N   1 
ATOM 4578 C CA  . PRO A 1 591  ? 3.430   62.581 -10.852 1.00 65.53  ? 588  PRO A CA  1 
ATOM 4579 C C   . PRO A 1 591  ? 1.898   62.654 -10.793 1.00 65.53  ? 588  PRO A C   1 
ATOM 4580 O O   . PRO A 1 591  ? 1.263   62.943 -11.806 1.00 65.53  ? 588  PRO A O   1 
ATOM 4581 C CB  . PRO A 1 591  ? 4.011   63.990 -10.806 1.00 45.73  ? 588  PRO A CB  1 
ATOM 4582 C CG  . PRO A 1 591  ? 5.217   63.915 -11.630 1.00 45.73  ? 588  PRO A CG  1 
ATOM 4583 C CD  . PRO A 1 591  ? 4.865   62.983 -12.767 1.00 45.73  ? 588  PRO A CD  1 
ATOM 4584 N N   . ARG A 1 592  ? 1.311   62.390 -9.630  1.00 59.69  ? 589  ARG A N   1 
ATOM 4585 C CA  . ARG A 1 592  ? -0.139  62.375 -9.511  1.00 59.69  ? 589  ARG A CA  1 
ATOM 4586 C C   . ARG A 1 592  ? -0.628  63.455 -8.539  1.00 59.69  ? 589  ARG A C   1 
ATOM 4587 O O   . ARG A 1 592  ? -1.697  64.044 -8.735  1.00 59.69  ? 589  ARG A O   1 
ATOM 4588 C CB  . ARG A 1 592  ? -0.606  60.989 -9.066  1.00 108.26 ? 589  ARG A CB  1 
ATOM 4589 C CG  . ARG A 1 592  ? -1.861  60.488 -9.753  1.00 108.26 ? 589  ARG A CG  1 
ATOM 4590 C CD  . ARG A 1 592  ? -3.128  60.873 -9.007  1.00 108.26 ? 589  ARG A CD  1 
ATOM 4591 N NE  . ARG A 1 592  ? -4.112  59.794 -9.086  1.00 108.26 ? 589  ARG A NE  1 
ATOM 4592 C CZ  . ARG A 1 592  ? -5.419  59.922 -8.869  1.00 108.26 ? 589  ARG A CZ  1 
ATOM 4593 N NH1 . ARG A 1 592  ? -5.945  61.104 -8.568  1.00 108.26 ? 589  ARG A NH1 1 
ATOM 4594 N NH2 . ARG A 1 592  ? -6.208  58.855 -8.968  1.00 108.26 ? 589  ARG A NH2 1 
ATOM 4595 N N   . SER A 1 593  ? 0.157   63.707 -7.491  1.00 55.40  ? 590  SER A N   1 
ATOM 4596 C CA  . SER A 1 593  ? -0.122  64.797 -6.570  1.00 55.40  ? 590  SER A CA  1 
ATOM 4597 C C   . SER A 1 593  ? 1.162   65.450 -6.126  1.00 55.40  ? 590  SER A C   1 
ATOM 4598 O O   . SER A 1 593  ? 2.200   64.790 -6.062  1.00 55.40  ? 590  SER A O   1 
ATOM 4599 C CB  . SER A 1 593  ? -0.877  64.296 -5.345  1.00 61.56  ? 590  SER A CB  1 
ATOM 4600 O OG  . SER A 1 593  ? -2.154  63.847 -5.724  1.00 61.56  ? 590  SER A OG  1 
ATOM 4601 N N   . ILE A 1 594  ? 1.080   66.740 -5.805  1.00 53.88  ? 591  ILE A N   1 
ATOM 4602 C CA  . ILE A 1 594  ? 2.245   67.490 -5.336  1.00 53.88  ? 591  ILE A CA  1 
ATOM 4603 C C   . ILE A 1 594  ? 1.945   68.369 -4.097  1.00 53.88  ? 591  ILE A C   1 
ATOM 4604 O O   . ILE A 1 594  ? 0.901   69.028 -4.018  1.00 53.88  ? 591  ILE A O   1 
ATOM 4605 C CB  . ILE A 1 594  ? 2.920   68.276 -6.511  1.00 84.80  ? 591  ILE A CB  1 
ATOM 4606 C CG1 . ILE A 1 594  ? 4.359   68.664 -6.155  1.00 84.80  ? 591  ILE A CG1 1 
ATOM 4607 C CG2 . ILE A 1 594  ? 2.066   69.463 -6.964  1.00 84.80  ? 591  ILE A CG2 1 
ATOM 4608 C CD1 . ILE A 1 594  ? 5.260   68.883 -7.356  1.00 84.80  ? 591  ILE A CD1 1 
ATOM 4609 N N   . LEU A 1 595  ? 2.856   68.358 -3.127  1.00 57.13  ? 592  LEU A N   1 
ATOM 4610 C CA  . LEU A 1 595  ? 2.601   69.059 -1.881  1.00 57.13  ? 592  LEU A CA  1 
ATOM 4611 C C   . LEU A 1 595  ? 3.846   69.593 -1.194  1.00 57.13  ? 592  LEU A C   1 
ATOM 4612 O O   . LEU A 1 595  ? 4.841   68.862 -1.035  1.00 57.13  ? 592  LEU A O   1 
ATOM 4613 C CB  . LEU A 1 595  ? 1.864   68.128 -0.919  1.00 92.18  ? 592  LEU A CB  1 
ATOM 4614 C CG  . LEU A 1 595  ? 1.048   68.733 0.220   1.00 92.18  ? 592  LEU A CG  1 
ATOM 4615 C CD1 . LEU A 1 595  ? 0.076   69.811 -0.279  1.00 92.18  ? 592  LEU A CD1 1 
ATOM 4616 C CD2 . LEU A 1 595  ? 0.298   67.624 0.952   1.00 92.18  ? 592  LEU A CD2 1 
ATOM 4617 N N   . MET A 1 596  ? 3.778   70.870 -0.794  1.00 83.74  ? 593  MET A N   1 
ATOM 4618 C CA  . MET A 1 596  ? 4.674   71.468 0.223   1.00 83.74  ? 593  MET A CA  1 
ATOM 4619 C C   . MET A 1 596  ? 3.849   71.827 1.472   1.00 83.74  ? 593  MET A C   1 
ATOM 4620 O O   . MET A 1 596  ? 2.689   72.244 1.343   1.00 83.74  ? 593  MET A O   1 
ATOM 4621 C CB  . MET A 1 596  ? 5.434   72.686 -0.323  1.00 151.57 ? 593  MET A CB  1 
ATOM 4622 C CG  . MET A 1 596  ? 4.899   73.313 -1.623  1.00 151.57 ? 593  MET A CG  1 
ATOM 4623 S SD  . MET A 1 596  ? 3.633   74.590 -1.417  1.00 151.57 ? 593  MET A SD  1 
ATOM 4624 C CE  . MET A 1 596  ? 3.697   75.412 -3.009  1.00 151.57 ? 593  MET A CE  1 
ATOM 4625 N N   . THR A 1 597  ? 4.408   71.657 2.672   1.00 165.67 ? 594  THR A N   1 
ATOM 4626 C CA  . THR A 1 597  ? 3.586   71.835 3.886   1.00 165.67 ? 594  THR A CA  1 
ATOM 4627 C C   . THR A 1 597  ? 4.232   72.375 5.155   1.00 165.67 ? 594  THR A C   1 
ATOM 4628 O O   . THR A 1 597  ? 5.412   72.129 5.437   1.00 165.67 ? 594  THR A O   1 
ATOM 4629 C CB  . THR A 1 597  ? 2.835   70.539 4.282   1.00 66.92  ? 594  THR A CB  1 
ATOM 4630 O OG1 . THR A 1 597  ? 3.588   69.395 3.850   1.00 66.92  ? 594  THR A OG1 1 
ATOM 4631 C CG2 . THR A 1 597  ? 1.394   70.550 3.685   1.00 66.92  ? 594  THR A CG2 1 
ATOM 4632 N N   . THR A 1 598  ? 3.410   73.105 5.917   1.00 119.98 ? 595  THR A N   1 
ATOM 4633 C CA  . THR A 1 598  ? 3.741   73.509 7.281   1.00 119.98 ? 595  THR A CA  1 
ATOM 4634 C C   . THR A 1 598  ? 3.657   72.270 8.157   1.00 119.98 ? 595  THR A C   1 
ATOM 4635 O O   . THR A 1 598  ? 2.564   71.766 8.422   1.00 119.98 ? 595  THR A O   1 
ATOM 4636 C CB  . THR A 1 598  ? 2.778   74.615 7.871   1.00 100.14 ? 595  THR A CB  1 
ATOM 4637 O OG1 . THR A 1 598  ? 1.482   74.054 8.146   1.00 100.14 ? 595  THR A OG1 1 
ATOM 4638 C CG2 . THR A 1 598  ? 2.668   75.863 6.949   1.00 100.14 ? 595  THR A CG2 1 
ATOM 4639 N N   . PHE A 1 599  ? 4.816   71.764 8.568   1.00 183.83 ? 596  PHE A N   1 
ATOM 4640 C CA  . PHE A 1 599  ? 4.862   70.780 9.635   1.00 183.83 ? 596  PHE A CA  1 
ATOM 4641 C C   . PHE A 1 599  ? 4.521   71.519 10.936  1.00 183.83 ? 596  PHE A C   1 
ATOM 4642 O O   . PHE A 1 599  ? 3.356   71.566 11.339  1.00 183.83 ? 596  PHE A O   1 
ATOM 4643 C CB  . PHE A 1 599  ? 6.233   70.088 9.692   1.00 83.54  ? 596  PHE A CB  1 
ATOM 4644 C CG  . PHE A 1 599  ? 6.294   68.775 8.949   1.00 83.54  ? 596  PHE A CG  1 
ATOM 4645 C CD1 . PHE A 1 599  ? 7.508   68.133 8.761   1.00 83.54  ? 596  PHE A CD1 1 
ATOM 4646 C CD2 . PHE A 1 599  ? 5.123   68.167 8.440   1.00 83.54  ? 596  PHE A CD2 1 
ATOM 4647 C CE1 . PHE A 1 599  ? 7.558   66.917 8.080   1.00 83.54  ? 596  PHE A CE1 1 
ATOM 4648 C CE2 . PHE A 1 599  ? 5.169   66.941 7.748   1.00 83.54  ? 596  PHE A CE2 1 
ATOM 4649 C CZ  . PHE A 1 599  ? 6.385   66.324 7.569   1.00 83.54  ? 596  PHE A CZ  1 
ATOM 4650 N N   . GLU A 1 600  ? 5.533   72.103 11.573  1.00 183.02 ? 597  GLU A N   1 
ATOM 4651 C CA  . GLU A 1 600  ? 5.344   73.057 12.664  1.00 183.02 ? 597  GLU A CA  1 
ATOM 4652 C C   . GLU A 1 600  ? 6.380   74.161 12.499  1.00 183.02 ? 597  GLU A C   1 
ATOM 4653 O O   . GLU A 1 600  ? 6.062   75.351 12.597  1.00 183.02 ? 597  GLU A O   1 
ATOM 4654 C CB  . GLU A 1 600  ? 5.503   72.393 14.036  1.00 188.86 ? 597  GLU A CB  1 
ATOM 4655 C CG  . GLU A 1 600  ? 4.436   71.368 14.390  1.00 188.86 ? 597  GLU A CG  1 
ATOM 4656 C CD  . GLU A 1 600  ? 4.812   69.954 13.973  1.00 188.86 ? 597  GLU A CD  1 
ATOM 4657 O OE1 . GLU A 1 600  ? 5.858   69.453 14.437  1.00 188.86 ? 597  GLU A OE1 1 
ATOM 4658 O OE2 . GLU A 1 600  ? 4.057   69.335 13.191  1.00 188.86 ? 597  GLU A OE2 1 
ATOM 4659 N N   . SER A 1 601  ? 7.620   73.740 12.246  1.00 164.42 ? 598  SER A N   1 
ATOM 4660 C CA  . SER A 1 601  ? 8.737   74.642 11.976  1.00 164.42 ? 598  SER A CA  1 
ATOM 4661 C C   . SER A 1 601  ? 9.782   73.957 11.074  1.00 164.42 ? 598  SER A C   1 
ATOM 4662 O O   . SER A 1 601  ? 10.733  73.338 11.564  1.00 164.42 ? 598  SER A O   1 
ATOM 4663 C CB  . SER A 1 601  ? 9.354   75.157 13.288  1.00 82.42  ? 598  SER A CB  1 
ATOM 4664 O OG  . SER A 1 601  ? 9.874   74.096 14.066  1.00 82.42  ? 598  SER A OG  1 
ATOM 4665 N N   . SER A 1 602  ? 9.562   74.072 9.759   1.00 201.87 ? 599  SER A N   1 
ATOM 4666 C CA  . SER A 1 602  ? 10.420  73.529 8.680   1.00 201.87 ? 599  SER A CA  1 
ATOM 4667 C C   . SER A 1 602  ? 9.574   73.070 7.482   1.00 201.87 ? 599  SER A C   1 
ATOM 4668 O O   . SER A 1 602  ? 8.423   72.656 7.653   1.00 201.87 ? 599  SER A O   1 
ATOM 4669 C CB  . SER A 1 602  ? 11.318  72.388 9.163   1.00 94.53  ? 599  SER A CB  1 
ATOM 4670 O OG  . SER A 1 602  ? 12.032  71.812 8.087   1.00 94.53  ? 599  SER A OG  1 
ATOM 4671 N N   . HIS A 1 603  ? 10.147  73.133 6.278   1.00 160.84 ? 600  HIS A N   1 
ATOM 4672 C CA  . HIS A 1 603  ? 9.385   72.852 5.055   1.00 160.84 ? 600  HIS A CA  1 
ATOM 4673 C C   . HIS A 1 603  ? 10.031  71.852 4.073   1.00 160.84 ? 600  HIS A C   1 
ATOM 4674 O O   . HIS A 1 603  ? 11.253  71.692 4.047   1.00 160.84 ? 600  HIS A O   1 
ATOM 4675 C CB  . HIS A 1 603  ? 8.992   74.159 4.361   1.00 152.47 ? 600  HIS A CB  1 
ATOM 4676 C CG  . HIS A 1 603  ? 7.833   74.856 5.007   1.00 152.47 ? 600  HIS A CG  1 
ATOM 4677 N ND1 . HIS A 1 603  ? 6.537   74.722 4.556   1.00 152.47 ? 600  HIS A ND1 1 
ATOM 4678 C CD2 . HIS A 1 603  ? 7.772   75.687 6.076   1.00 152.47 ? 600  HIS A CD2 1 
ATOM 4679 C CE1 . HIS A 1 603  ? 5.731   75.448 5.310   1.00 152.47 ? 600  HIS A CE1 1 
ATOM 4680 N NE2 . HIS A 1 603  ? 6.454   76.040 6.242   1.00 152.47 ? 600  HIS A NE2 1 
ATOM 4681 N N   . TYR A 1 604  ? 9.187   71.191 3.274   1.00 81.55  ? 601  TYR A N   1 
ATOM 4682 C CA  . TYR A 1 604  ? 9.578   70.053 2.426   1.00 81.55  ? 601  TYR A CA  1 
ATOM 4683 C C   . TYR A 1 604  ? 8.772   70.027 1.129   1.00 81.55  ? 601  TYR A C   1 
ATOM 4684 O O   . TYR A 1 604  ? 7.756   70.707 0.995   1.00 81.55  ? 601  TYR A O   1 
ATOM 4685 C CB  . TYR A 1 604  ? 9.293   68.717 3.142   1.00 101.41 ? 601  TYR A CB  1 
ATOM 4686 C CG  . TYR A 1 604  ? 10.131  68.379 4.363   1.00 101.41 ? 601  TYR A CG  1 
ATOM 4687 C CD1 . TYR A 1 604  ? 9.995   69.097 5.547   1.00 101.41 ? 601  TYR A CD1 1 
ATOM 4688 C CD2 . TYR A 1 604  ? 11.012  67.295 4.350   1.00 101.41 ? 601  TYR A CD2 1 
ATOM 4689 C CE1 . TYR A 1 604  ? 10.741  68.789 6.660   1.00 101.41 ? 601  TYR A CE1 1 
ATOM 4690 C CE2 . TYR A 1 604  ? 11.764  66.971 5.470   1.00 101.41 ? 601  TYR A CE2 1 
ATOM 4691 C CZ  . TYR A 1 604  ? 11.618  67.728 6.619   1.00 101.41 ? 601  TYR A CZ  1 
ATOM 4692 O OH  . TYR A 1 604  ? 12.340  67.443 7.743   1.00 101.41 ? 601  TYR A OH  1 
ATOM 4693 N N   . LEU A 1 605  ? 9.210   69.210 0.184   1.00 66.81  ? 602  LEU A N   1 
ATOM 4694 C CA  . LEU A 1 605  ? 8.356   68.879 -0.952  1.00 66.81  ? 602  LEU A CA  1 
ATOM 4695 C C   . LEU A 1 605  ? 8.124   67.370 -1.065  1.00 66.81  ? 602  LEU A C   1 
ATOM 4696 O O   . LEU A 1 605  ? 9.049   66.583 -0.863  1.00 66.81  ? 602  LEU A O   1 
ATOM 4697 C CB  . LEU A 1 605  ? 8.918   69.438 -2.272  1.00 89.27  ? 602  LEU A CB  1 
ATOM 4698 C CG  . LEU A 1 605  ? 8.029   69.267 -3.517  1.00 89.27  ? 602  LEU A CG  1 
ATOM 4699 C CD1 . LEU A 1 605  ? 6.846   70.233 -3.587  1.00 89.27  ? 602  LEU A CD1 1 
ATOM 4700 C CD2 . LEU A 1 605  ? 8.860   69.386 -4.752  1.00 89.27  ? 602  LEU A CD2 1 
ATOM 4701 N N   . LEU A 1 606  ? 6.879   67.003 -1.388  1.00 50.83  ? 603  LEU A N   1 
ATOM 4702 C CA  . LEU A 1 606  ? 6.405   65.631 -1.534  1.00 50.83  ? 603  LEU A CA  1 
ATOM 4703 C C   . LEU A 1 606  ? 5.642   65.459 -2.875  1.00 50.83  ? 603  LEU A C   1 
ATOM 4704 O O   . LEU A 1 606  ? 4.798   66.300 -3.294  1.00 50.83  ? 603  LEU A O   1 
ATOM 4705 C CB  . LEU A 1 606  ? 5.469   65.281 -0.377  1.00 49.87  ? 603  LEU A CB  1 
ATOM 4706 C CG  . LEU A 1 606  ? 5.762   65.277 1.150   1.00 49.87  ? 603  LEU A CG  1 
ATOM 4707 C CD1 . LEU A 1 606  ? 6.768   66.334 1.702   1.00 49.87  ? 603  LEU A CD1 1 
ATOM 4708 C CD2 . LEU A 1 606  ? 4.430   65.380 1.925   1.00 49.87  ? 603  LEU A CD2 1 
ATOM 4709 N N   . CYS A 1 607  ? 5.951   64.361 -3.550  1.00 52.82  ? 604  CYS A N   1 
ATOM 4710 C CA  . CYS A 1 607  ? 5.373   64.085 -4.834  1.00 52.82  ? 604  CYS A CA  1 
ATOM 4711 C C   . CYS A 1 607  ? 5.067   62.600 -4.918  1.00 52.82  ? 604  CYS A C   1 
ATOM 4712 O O   . CYS A 1 607  ? 5.945   61.755 -4.690  1.00 52.82  ? 604  CYS A O   1 
ATOM 4713 C CB  . CYS A 1 607  ? 6.353   64.495 -5.947  1.00 67.10  ? 604  CYS A CB  1 
ATOM 4714 S SG  . CYS A 1 607  ? 5.639   64.677 -7.631  1.00 67.10  ? 604  CYS A SG  1 
ATOM 4715 N N   . ALA A 1 608  ? 3.817   62.298 -5.259  1.00 57.47  ? 605  ALA A N   1 
ATOM 4716 C CA  . ALA A 1 608  ? 3.323   60.942 -5.376  1.00 57.47  ? 605  ALA A CA  1 
ATOM 4717 C C   . ALA A 1 608  ? 3.280   60.584 -6.839  1.00 57.47  ? 605  ALA A C   1 
ATOM 4718 O O   . ALA A 1 608  ? 2.560   61.216 -7.605  1.00 57.47  ? 605  ALA A O   1 
ATOM 4719 C CB  . ALA A 1 608  ? 1.936   60.878 -4.812  1.00 37.26  ? 605  ALA A CB  1 
ATOM 4720 N N   . LEU A 1 609  ? 4.056   59.584 -7.233  1.00 49.83  ? 606  LEU A N   1 
ATOM 4721 C CA  . LEU A 1 609  ? 3.965   59.057 -8.578  1.00 49.83  ? 606  LEU A CA  1 
ATOM 4722 C C   . LEU A 1 609  ? 2.756   58.162 -8.617  1.00 49.83  ? 606  LEU A C   1 
ATOM 4723 O O   . LEU A 1 609  ? 2.219   57.803 -7.580  1.00 49.83  ? 606  LEU A O   1 
ATOM 4724 C CB  . LEU A 1 609  ? 5.210   58.257 -8.939  1.00 59.26  ? 606  LEU A CB  1 
ATOM 4725 C CG  . LEU A 1 609  ? 6.563   58.948 -8.775  1.00 59.26  ? 606  LEU A CG  1 
ATOM 4726 C CD1 . LEU A 1 609  ? 7.703   58.032 -9.232  1.00 59.26  ? 606  LEU A CD1 1 
ATOM 4727 C CD2 . LEU A 1 609  ? 6.592   60.278 -9.530  1.00 59.26  ? 606  LEU A CD2 1 
ATOM 4728 N N   . GLY A 1 610  ? 2.330   57.776 -9.808  1.00 56.75  ? 607  GLY A N   1 
ATOM 4729 C CA  . GLY A 1 610  ? 1.205   56.844 -9.957  1.00 56.75  ? 607  GLY A CA  1 
ATOM 4730 C C   . GLY A 1 610  ? 1.519   55.363 -9.758  1.00 56.75  ? 607  GLY A C   1 
ATOM 4731 O O   . GLY A 1 610  ? 0.657   54.512 -9.993  1.00 56.75  ? 607  GLY A O   1 
ATOM 4732 N N   . ASP A 1 611  ? 2.738   55.037 -9.348  1.00 86.89  ? 608  ASP A N   1 
ATOM 4733 C CA  . ASP A 1 611  ? 3.078   53.634 -9.137  1.00 86.89  ? 608  ASP A CA  1 
ATOM 4734 C C   . ASP A 1 611  ? 2.785   53.223 -7.707  1.00 86.89  ? 608  ASP A C   1 
ATOM 4735 O O   . ASP A 1 611  ? 2.516   52.059 -7.427  1.00 86.89  ? 608  ASP A O   1 
ATOM 4736 C CB  . ASP A 1 611  ? 4.538   53.330 -9.514  1.00 64.20  ? 608  ASP A CB  1 
ATOM 4737 C CG  . ASP A 1 611  ? 5.548   54.254 -8.816  1.00 64.20  ? 608  ASP A CG  1 
ATOM 4738 O OD1 . ASP A 1 611  ? 6.744   54.197 -9.174  1.00 64.20  ? 608  ASP A OD1 1 
ATOM 4739 O OD2 . ASP A 1 611  ? 5.163   55.033 -7.915  1.00 64.20  ? 608  ASP A OD2 1 
ATOM 4740 N N   . GLY A 1 612  ? 2.825   54.198 -6.812  1.00 75.56  ? 609  GLY A N   1 
ATOM 4741 C CA  . GLY A 1 612  ? 2.664   53.934 -5.410  1.00 75.56  ? 609  GLY A CA  1 
ATOM 4742 C C   . GLY A 1 612  ? 3.757   54.602 -4.611  1.00 75.56  ? 609  GLY A C   1 
ATOM 4743 O O   . GLY A 1 612  ? 3.609   54.841 -3.406  1.00 75.56  ? 609  GLY A O   1 
ATOM 4744 N N   . ALA A 1 613  ? 4.860   54.912 -5.279  1.00 64.27  ? 610  ALA A N   1 
ATOM 4745 C CA  . ALA A 1 613  ? 5.987   55.544 -4.609  1.00 64.27  ? 610  ALA A CA  1 
ATOM 4746 C C   . ALA A 1 613  ? 5.714   57.013 -4.294  1.00 64.27  ? 610  ALA A C   1 
ATOM 4747 O O   . ALA A 1 613  ? 4.760   57.613 -4.791  1.00 64.27  ? 610  ALA A O   1 
ATOM 4748 C CB  . ALA A 1 613  ? 7.237   55.404 -5.447  1.00 98.99  ? 610  ALA A CB  1 
ATOM 4749 N N   . LEU A 1 614  ? 6.567   57.575 -3.457  1.00 76.48  ? 611  LEU A N   1 
ATOM 4750 C CA  . LEU A 1 614  ? 6.539   58.976 -3.153  1.00 76.48  ? 611  LEU A CA  1 
ATOM 4751 C C   . LEU A 1 614  ? 7.966   59.441 -2.930  1.00 76.48  ? 611  LEU A C   1 
ATOM 4752 O O   . LEU A 1 614  ? 8.769   58.729 -2.331  1.00 76.48  ? 611  LEU A O   1 
ATOM 4753 C CB  . LEU A 1 614  ? 5.695   59.235 -1.904  1.00 59.94  ? 611  LEU A CB  1 
ATOM 4754 C CG  . LEU A 1 614  ? 5.554   60.724 -1.544  1.00 59.94  ? 611  LEU A CG  1 
ATOM 4755 C CD1 . LEU A 1 614  ? 4.129   61.074 -1.093  1.00 59.94  ? 611  LEU A CD1 1 
ATOM 4756 C CD2 . LEU A 1 614  ? 6.589   61.170 -0.529  1.00 59.94  ? 611  LEU A CD2 1 
ATOM 4757 N N   . PHE A 1 615  ? 8.277   60.635 -3.419  1.00 99.80  ? 612  PHE A N   1 
ATOM 4758 C CA  . PHE A 1 615  ? 9.566   61.259 -3.159  1.00 99.80  ? 612  PHE A CA  1 
ATOM 4759 C C   . PHE A 1 615  ? 9.370   62.401 -2.185  1.00 99.80  ? 612  PHE A C   1 
ATOM 4760 O O   . PHE A 1 615  ? 8.270   62.936 -2.071  1.00 99.80  ? 612  PHE A O   1 
ATOM 4761 C CB  . PHE A 1 615  ? 10.184  61.797 -4.453  1.00 78.11  ? 612  PHE A CB  1 
ATOM 4762 C CG  . PHE A 1 615  ? 10.683  60.732 -5.382  1.00 78.11  ? 612  PHE A CG  1 
ATOM 4763 C CD1 . PHE A 1 615  ? 9.838   60.147 -6.305  1.00 78.11  ? 612  PHE A CD1 1 
ATOM 4764 C CD2 . PHE A 1 615  ? 12.013  60.327 -5.343  1.00 78.11  ? 612  PHE A CD2 1 
ATOM 4765 C CE1 . PHE A 1 615  ? 10.302  59.160 -7.178  1.00 78.11  ? 612  PHE A CE1 1 
ATOM 4766 C CE2 . PHE A 1 615  ? 12.488  59.339 -6.203  1.00 78.11  ? 612  PHE A CE2 1 
ATOM 4767 C CZ  . PHE A 1 615  ? 11.626  58.756 -7.127  1.00 78.11  ? 612  PHE A CZ  1 
ATOM 4768 N N   . TYR A 1 616  ? 10.434  62.772 -1.481  1.00 129.40 ? 613  TYR A N   1 
ATOM 4769 C CA  . TYR A 1 616  ? 10.401  63.971 -0.656  1.00 129.40 ? 613  TYR A CA  1 
ATOM 4770 C C   . TYR A 1 616  ? 11.746  64.684 -0.535  1.00 129.40 ? 613  TYR A C   1 
ATOM 4771 O O   . TYR A 1 616  ? 12.801  64.044 -0.482  1.00 129.40 ? 613  TYR A O   1 
ATOM 4772 C CB  . TYR A 1 616  ? 9.765   63.702 0.707   1.00 109.03 ? 613  TYR A CB  1 
ATOM 4773 C CG  . TYR A 1 616  ? 10.448  62.663 1.563   1.00 109.03 ? 613  TYR A CG  1 
ATOM 4774 C CD1 . TYR A 1 616  ? 10.226  61.299 1.360   1.00 109.03 ? 613  TYR A CD1 1 
ATOM 4775 C CD2 . TYR A 1 616  ? 11.286  63.047 2.612   1.00 109.03 ? 613  TYR A CD2 1 
ATOM 4776 C CE1 . TYR A 1 616  ? 10.835  60.348 2.171   1.00 109.03 ? 613  TYR A CE1 1 
ATOM 4777 C CE2 . TYR A 1 616  ? 11.900  62.104 3.431   1.00 109.03 ? 613  TYR A CE2 1 
ATOM 4778 C CZ  . TYR A 1 616  ? 11.667  60.759 3.212   1.00 109.03 ? 613  TYR A CZ  1 
ATOM 4779 O OH  . TYR A 1 616  ? 12.280  59.829 4.026   1.00 109.03 ? 613  TYR A OH  1 
ATOM 4780 N N   . PHE A 1 617  ? 11.680  66.018 -0.499  1.00 69.47  ? 614  PHE A N   1 
ATOM 4781 C CA  . PHE A 1 617  ? 12.862  66.886 -0.604  1.00 69.47  ? 614  PHE A CA  1 
ATOM 4782 C C   . PHE A 1 617  ? 12.945  67.945 0.505   1.00 69.47  ? 614  PHE A C   1 
ATOM 4783 O O   . PHE A 1 617  ? 12.006  68.102 1.279   1.00 69.47  ? 614  PHE A O   1 
ATOM 4784 C CB  . PHE A 1 617  ? 12.890  67.579 -1.985  1.00 61.06  ? 614  PHE A CB  1 
ATOM 4785 C CG  . PHE A 1 617  ? 12.869  66.618 -3.158  1.00 61.06  ? 614  PHE A CG  1 
ATOM 4786 C CD1 . PHE A 1 617  ? 11.653  66.140 -3.669  1.00 61.06  ? 614  PHE A CD1 1 
ATOM 4787 C CD2 . PHE A 1 617  ? 14.054  66.209 -3.759  1.00 61.06  ? 614  PHE A CD2 1 
ATOM 4788 C CE1 . PHE A 1 617  ? 11.624  65.269 -4.736  1.00 61.06  ? 614  PHE A CE1 1 
ATOM 4789 C CE2 . PHE A 1 617  ? 14.037  65.330 -4.840  1.00 61.06  ? 614  PHE A CE2 1 
ATOM 4790 C CZ  . PHE A 1 617  ? 12.825  64.859 -5.326  1.00 61.06  ? 614  PHE A CZ  1 
ATOM 4791 N N   . GLY A 1 618  ? 14.062  68.677 0.554   1.00 94.92  ? 615  GLY A N   1 
ATOM 4792 C CA  . GLY A 1 618  ? 14.222  69.826 1.450   1.00 94.92  ? 615  GLY A CA  1 
ATOM 4793 C C   . GLY A 1 618  ? 13.870  71.181 0.829   1.00 94.92  ? 615  GLY A C   1 
ATOM 4794 O O   . GLY A 1 618  ? 14.752  71.917 0.380   1.00 94.92  ? 615  GLY A O   1 
ATOM 4795 N N   . LEU A 1 619  ? 12.581  71.522 0.820   1.00 165.57 ? 616  LEU A N   1 
ATOM 4796 C CA  . LEU A 1 619  ? 12.142  72.815 0.296   1.00 165.57 ? 616  LEU A CA  1 
ATOM 4797 C C   . LEU A 1 619  ? 12.288  73.936 1.332   1.00 165.57 ? 616  LEU A C   1 
ATOM 4798 O O   . LEU A 1 619  ? 13.157  73.870 2.198   1.00 165.57 ? 616  LEU A O   1 
ATOM 4799 C CB  . LEU A 1 619  ? 10.710  72.745 -0.267  1.00 76.41  ? 616  LEU A CB  1 
ATOM 4800 C CG  . LEU A 1 619  ? 10.207  74.044 -0.935  1.00 76.41  ? 616  LEU A CG  1 
ATOM 4801 C CD1 . LEU A 1 619  ? 10.985  74.393 -2.200  1.00 76.41  ? 616  LEU A CD1 1 
ATOM 4802 C CD2 . LEU A 1 619  ? 8.735   74.054 -1.223  1.00 76.41  ? 616  LEU A CD2 1 
ATOM 4803 N N   . ASN A 1 620  ? 11.435  74.958 1.217   1.00 201.87 ? 617  ASN A N   1 
ATOM 4804 C CA  . ASN A 1 620  ? 11.505  76.217 1.973   1.00 201.87 ? 617  ASN A CA  1 
ATOM 4805 C C   . ASN A 1 620  ? 10.516  77.233 1.380   1.00 201.87 ? 617  ASN A C   1 
ATOM 4806 O O   . ASN A 1 620  ? 10.703  77.701 0.252   1.00 201.87 ? 617  ASN A O   1 
ATOM 4807 C CB  . ASN A 1 620  ? 12.920  76.792 1.913   1.00 82.19  ? 617  ASN A CB  1 
ATOM 4808 C CG  . ASN A 1 620  ? 13.445  76.873 0.497   1.00 82.19  ? 617  ASN A CG  1 
ATOM 4809 O OD1 . ASN A 1 620  ? 13.883  75.875 -0.090  1.00 82.19  ? 617  ASN A OD1 1 
ATOM 4810 N ND2 . ASN A 1 620  ? 13.380  78.060 -0.069  1.00 82.19  ? 617  ASN A ND2 1 
ATOM 4811 N N   . ILE A 1 621  ? 9.475   77.582 2.133   1.00 184.25 ? 618  ILE A N   1 
ATOM 4812 C CA  . ILE A 1 621  ? 8.359   78.370 1.572   1.00 184.25 ? 618  ILE A CA  1 
ATOM 4813 C C   . ILE A 1 621  ? 8.646   79.843 1.234   1.00 184.25 ? 618  ILE A C   1 
ATOM 4814 O O   . ILE A 1 621  ? 7.739   80.560 0.800   1.00 184.25 ? 618  ILE A O   1 
ATOM 4815 C CB  . ILE A 1 621  ? 7.023   78.243 2.403   1.00 150.05 ? 618  ILE A CB  1 
ATOM 4816 C CG1 . ILE A 1 621  ? 7.224   78.608 3.886   1.00 150.05 ? 618  ILE A CG1 1 
ATOM 4817 C CG2 . ILE A 1 621  ? 6.411   76.853 2.213   1.00 150.05 ? 618  ILE A CG2 1 
ATOM 4818 C CD1 . ILE A 1 621  ? 5.944   79.023 4.616   1.00 150.05 ? 618  ILE A CD1 1 
ATOM 4819 N N   . GLU A 1 622  ? 9.891   80.289 1.401   1.00 196.18 ? 619  GLU A N   1 
ATOM 4820 C CA  . GLU A 1 622  ? 10.216  81.708 1.175   1.00 196.18 ? 619  GLU A CA  1 
ATOM 4821 C C   . GLU A 1 622  ? 11.253  81.986 0.066   1.00 196.18 ? 619  GLU A C   1 
ATOM 4822 O O   . GLU A 1 622  ? 11.072  82.921 -0.718  1.00 196.18 ? 619  GLU A O   1 
ATOM 4823 C CB  . GLU A 1 622  ? 10.572  82.434 2.493   1.00 148.48 ? 619  GLU A CB  1 
ATOM 4824 C CG  . GLU A 1 622  ? 9.575   82.230 3.674   1.00 148.48 ? 619  GLU A CG  1 
ATOM 4825 C CD  . GLU A 1 622  ? 8.221   82.956 3.528   1.00 148.48 ? 619  GLU A CD  1 
ATOM 4826 O OE1 . GLU A 1 622  ? 7.553   82.830 2.476   1.00 148.48 ? 619  GLU A OE1 1 
ATOM 4827 O OE2 . GLU A 1 622  ? 7.808   83.633 4.496   1.00 148.48 ? 619  GLU A OE2 1 
ATOM 4828 N N   . THR A 1 623  ? 12.326  81.195 -0.008  1.00 146.94 ? 620  THR A N   1 
ATOM 4829 C CA  . THR A 1 623  ? 13.314  81.370 -1.081  1.00 146.94 ? 620  THR A CA  1 
ATOM 4830 C C   . THR A 1 623  ? 12.795  80.739 -2.361  1.00 146.94 ? 620  THR A C   1 
ATOM 4831 O O   . THR A 1 623  ? 12.347  81.448 -3.262  1.00 146.94 ? 620  THR A O   1 
ATOM 4832 C CB  . THR A 1 623  ? 14.697  80.750 -0.752  1.00 81.34  ? 620  THR A CB  1 
ATOM 4833 O OG1 . THR A 1 623  ? 15.144  81.200 0.531   1.00 81.34  ? 620  THR A OG1 1 
ATOM 4834 C CG2 . THR A 1 623  ? 15.730  81.103 -1.843  1.00 81.34  ? 620  THR A CG2 1 
ATOM 4835 N N   . GLY A 1 624  ? 12.864  79.406 -2.423  1.00 201.87 ? 621  GLY A N   1 
ATOM 4836 C CA  . GLY A 1 624  ? 12.444  78.618 -3.583  1.00 201.87 ? 621  GLY A CA  1 
ATOM 4837 C C   . GLY A 1 624  ? 13.575  77.808 -4.192  1.00 201.87 ? 621  GLY A C   1 
ATOM 4838 O O   . GLY A 1 624  ? 14.136  78.190 -5.218  1.00 201.87 ? 621  GLY A O   1 
ATOM 4839 N N   . LEU A 1 625  ? 13.914  76.690 -3.554  1.00 143.35 ? 622  LEU A N   1 
ATOM 4840 C CA  . LEU A 1 625  ? 15.015  75.825 -3.997  1.00 143.35 ? 622  LEU A CA  1 
ATOM 4841 C C   . LEU A 1 625  ? 15.007  74.484 -3.259  1.00 143.35 ? 622  LEU A C   1 
ATOM 4842 O O   . LEU A 1 625  ? 14.865  74.439 -2.036  1.00 143.35 ? 622  LEU A O   1 
ATOM 4843 C CB  . LEU A 1 625  ? 16.382  76.528 -3.856  1.00 133.61 ? 622  LEU A CB  1 
ATOM 4844 C CG  . LEU A 1 625  ? 16.610  77.743 -2.929  1.00 133.61 ? 622  LEU A CG  1 
ATOM 4845 C CD1 . LEU A 1 625  ? 16.517  77.414 -1.431  1.00 133.61 ? 622  LEU A CD1 1 
ATOM 4846 C CD2 . LEU A 1 625  ? 17.948  78.419 -3.233  1.00 133.61 ? 622  LEU A CD2 1 
ATOM 4847 N N   . LEU A 1 626  ? 15.159  73.396 -4.008  1.00 80.79  ? 623  LEU A N   1 
ATOM 4848 C CA  . LEU A 1 626  ? 15.051  72.047 -3.450  1.00 80.79  ? 623  LEU A CA  1 
ATOM 4849 C C   . LEU A 1 626  ? 16.405  71.552 -2.955  1.00 80.79  ? 623  LEU A C   1 
ATOM 4850 O O   . LEU A 1 626  ? 17.432  72.146 -3.306  1.00 80.79  ? 623  LEU A O   1 
ATOM 4851 C CB  . LEU A 1 626  ? 14.485  71.063 -4.489  1.00 94.29  ? 623  LEU A CB  1 
ATOM 4852 C CG  . LEU A 1 626  ? 13.054  71.148 -5.050  1.00 94.29  ? 623  LEU A CG  1 
ATOM 4853 C CD1 . LEU A 1 626  ? 12.743  69.884 -5.843  1.00 94.29  ? 623  LEU A CD1 1 
ATOM 4854 C CD2 . LEU A 1 626  ? 11.999  71.356 -3.974  1.00 94.29  ? 623  LEU A CD2 1 
ATOM 4855 N N   . SER A 1 627  ? 16.398  70.471 -2.158  1.00 149.44 ? 624  SER A N   1 
ATOM 4856 C CA  . SER A 1 627  ? 17.614  69.899 -1.525  1.00 149.44 ? 624  SER A CA  1 
ATOM 4857 C C   . SER A 1 627  ? 17.635  68.363 -1.432  1.00 149.44 ? 624  SER A C   1 
ATOM 4858 O O   . SER A 1 627  ? 17.889  67.679 -2.425  1.00 149.44 ? 624  SER A O   1 
ATOM 4859 C CB  . SER A 1 627  ? 17.831  70.468 -0.111  1.00 61.25  ? 624  SER A CB  1 
ATOM 4860 O OG  . SER A 1 627  ? 17.665  71.876 -0.066  1.00 61.25  ? 624  SER A OG  1 
ATOM 4861 N N   . ASP A 1 628  ? 17.382  67.847 -0.223  1.00 201.87 ? 625  ASP A N   1 
ATOM 4862 C CA  . ASP A 1 628  ? 17.488  66.416 0.112   1.00 201.87 ? 625  ASP A CA  1 
ATOM 4863 C C   . ASP A 1 628  ? 16.619  65.553 -0.788  1.00 201.87 ? 625  ASP A C   1 
ATOM 4864 O O   . ASP A 1 628  ? 15.594  66.012 -1.276  1.00 201.87 ? 625  ASP A O   1 
ATOM 4865 C CB  . ASP A 1 628  ? 17.072  66.163 1.571   1.00 198.12 ? 625  ASP A CB  1 
ATOM 4866 C CG  . ASP A 1 628  ? 17.649  67.184 2.541   1.00 198.12 ? 625  ASP A CG  1 
ATOM 4867 O OD1 . ASP A 1 628  ? 17.181  68.345 2.543   1.00 198.12 ? 625  ASP A OD1 1 
ATOM 4868 O OD2 . ASP A 1 628  ? 18.553  66.815 3.320   1.00 198.12 ? 625  ASP A OD2 1 
ATOM 4869 N N   . ARG A 1 629  ? 17.025  64.305 -1.003  1.00 107.50 ? 626  ARG A N   1 
ATOM 4870 C CA  . ARG A 1 629  ? 16.212  63.371 -1.784  1.00 107.50 ? 626  ARG A CA  1 
ATOM 4871 C C   . ARG A 1 629  ? 15.989  62.062 -1.050  1.00 107.50 ? 626  ARG A C   1 
ATOM 4872 O O   . ARG A 1 629  ? 16.893  61.548 -0.389  1.00 107.50 ? 626  ARG A O   1 
ATOM 4873 C CB  . ARG A 1 629  ? 16.823  63.091 -3.157  1.00 120.88 ? 626  ARG A CB  1 
ATOM 4874 C CG  . ARG A 1 629  ? 15.843  62.421 -4.121  1.00 120.88 ? 626  ARG A CG  1 
ATOM 4875 C CD  . ARG A 1 629  ? 16.531  61.932 -5.365  1.00 120.88 ? 626  ARG A CD  1 
ATOM 4876 N NE  . ARG A 1 629  ? 15.592  61.345 -6.311  1.00 120.88 ? 626  ARG A NE  1 
ATOM 4877 C CZ  . ARG A 1 629  ? 15.252  61.898 -7.472  1.00 120.88 ? 626  ARG A CZ  1 
ATOM 4878 N NH1 . ARG A 1 629  ? 15.769  63.060 -7.848  1.00 120.88 ? 626  ARG A NH1 1 
ATOM 4879 N NH2 . ARG A 1 629  ? 14.393  61.286 -8.268  1.00 120.88 ? 626  ARG A NH2 1 
ATOM 4880 N N   . LYS A 1 630  ? 14.776  61.527 -1.180  1.00 72.71  ? 627  LYS A N   1 
ATOM 4881 C CA  . LYS A 1 630  ? 14.411  60.262 -0.567  1.00 72.71  ? 627  LYS A CA  1 
ATOM 4882 C C   . LYS A 1 630  ? 13.218  59.673 -1.321  1.00 72.71  ? 627  LYS A C   1 
ATOM 4883 O O   . LYS A 1 630  ? 12.418  60.397 -1.922  1.00 72.71  ? 627  LYS A O   1 
ATOM 4884 C CB  . LYS A 1 630  ? 14.069  60.469 0.909   1.00 161.29 ? 627  LYS A CB  1 
ATOM 4885 C CG  . LYS A 1 630  ? 14.856  59.593 1.888   1.00 161.29 ? 627  LYS A CG  1 
ATOM 4886 C CD  . LYS A 1 630  ? 16.021  60.348 2.542   1.00 161.29 ? 627  LYS A CD  1 
ATOM 4887 C CE  . LYS A 1 630  ? 15.544  61.311 3.629   1.00 161.29 ? 627  LYS A CE  1 
ATOM 4888 N NZ  . LYS A 1 630  ? 16.652  62.122 4.201   1.00 161.29 ? 627  LYS A NZ  1 
ATOM 4889 N N   . LYS A 1 631  ? 13.119  58.352 -1.288  1.00 82.06  ? 628  LYS A N   1 
ATOM 4890 C CA  . LYS A 1 631  ? 12.063  57.648 -1.975  1.00 82.06  ? 628  LYS A CA  1 
ATOM 4891 C C   . LYS A 1 631  ? 11.448  56.662 -1.005  1.00 82.06  ? 628  LYS A C   1 
ATOM 4892 O O   . LYS A 1 631  ? 12.143  56.046 -0.212  1.00 82.06  ? 628  LYS A O   1 
ATOM 4893 C CB  . LYS A 1 631  ? 12.623  56.917 -3.198  1.00 70.25  ? 628  LYS A CB  1 
ATOM 4894 C CG  . LYS A 1 631  ? 11.566  56.249 -4.083  1.00 70.25  ? 628  LYS A CG  1 
ATOM 4895 C CD  . LYS A 1 631  ? 12.193  55.678 -5.354  1.00 70.25  ? 628  LYS A CD  1 
ATOM 4896 C CE  . LYS A 1 631  ? 11.141  55.271 -6.368  1.00 70.25  ? 628  LYS A CE  1 
ATOM 4897 N NZ  . LYS A 1 631  ? 11.679  54.234 -7.267  1.00 70.25  ? 628  LYS A NZ  1 
ATOM 4898 N N   . VAL A 1 632  ? 10.133  56.519 -1.072  1.00 79.65  ? 629  VAL A N   1 
ATOM 4899 C CA  . VAL A 1 632  ? 9.407   55.648 -0.172  1.00 79.65  ? 629  VAL A CA  1 
ATOM 4900 C C   . VAL A 1 632  ? 8.120   55.269 -0.855  1.00 79.65  ? 629  VAL A C   1 
ATOM 4901 O O   . VAL A 1 632  ? 7.383   56.141 -1.268  1.00 79.65  ? 629  VAL A O   1 
ATOM 4902 C CB  . VAL A 1 632  ? 9.133   56.338 1.199   1.00 57.10  ? 629  VAL A CB  1 
ATOM 4903 C CG1 . VAL A 1 632  ? 8.888   57.827 1.022   1.00 57.10  ? 629  VAL A CG1 1 
ATOM 4904 C CG2 . VAL A 1 632  ? 7.975   55.680 1.910   1.00 57.10  ? 629  VAL A CG2 1 
ATOM 4905 N N   . THR A 1 633  ? 7.866   53.975 -0.995  1.00 50.44  ? 630  THR A N   1 
ATOM 4906 C CA  . THR A 1 633  ? 6.617   53.488 -1.625  1.00 50.44  ? 630  THR A CA  1 
ATOM 4907 C C   . THR A 1 633  ? 5.479   53.234 -0.624  1.00 50.44  ? 630  THR A C   1 
ATOM 4908 O O   . THR A 1 633  ? 5.689   52.693 0.449   1.00 50.44  ? 630  THR A O   1 
ATOM 4909 C CB  . THR A 1 633  ? 6.800   52.159 -2.450  1.00 82.45  ? 630  THR A CB  1 
ATOM 4910 O OG1 . THR A 1 633  ? 6.804   51.023 -1.569  1.00 82.45  ? 630  THR A OG1 1 
ATOM 4911 C CG2 . THR A 1 633  ? 8.072   52.178 -3.315  1.00 82.45  ? 630  THR A CG2 1 
ATOM 4912 N N   . LEU A 1 634  ? 4.266   53.601 -0.992  1.00 52.93  ? 631  LEU A N   1 
ATOM 4913 C CA  . LEU A 1 634  ? 3.133   53.233 -0.181  1.00 52.93  ? 631  LEU A CA  1 
ATOM 4914 C C   . LEU A 1 634  ? 2.268   52.254 -0.956  1.00 52.93  ? 631  LEU A C   1 
ATOM 4915 O O   . LEU A 1 634  ? 2.553   51.031 -0.963  1.00 52.93  ? 631  LEU A O   1 
ATOM 4916 C CB  . LEU A 1 634  ? 2.335   54.462 0.221   1.00 45.51  ? 631  LEU A CB  1 
ATOM 4917 C CG  . LEU A 1 634  ? 3.186   55.608 0.730   1.00 45.51  ? 631  LEU A CG  1 
ATOM 4918 C CD1 . LEU A 1 634  ? 2.271   56.764 1.087   1.00 45.51  ? 631  LEU A CD1 1 
ATOM 4919 C CD2 . LEU A 1 634  ? 4.015   55.150 1.934   1.00 45.51  ? 631  LEU A CD2 1 
ATOM 4920 N N   . GLY A 1 635  ? 1.230   52.785 -1.609  1.00 99.27  ? 632  GLY A N   1 
ATOM 4921 C CA  . GLY A 1 635  ? 0.283   51.974 -2.361  1.00 99.27  ? 632  GLY A CA  1 
ATOM 4922 C C   . GLY A 1 635  ? 0.865   51.306 -3.595  1.00 99.27  ? 632  GLY A C   1 
ATOM 4923 O O   . GLY A 1 635  ? 2.048   51.457 -3.913  1.00 99.27  ? 632  GLY A O   1 
ATOM 4924 N N   . THR A 1 636  ? 0.026   50.537 -4.272  1.00 80.01  ? 633  THR A N   1 
ATOM 4925 C CA  . THR A 1 636  ? 0.354   49.986 -5.581  1.00 80.01  ? 633  THR A CA  1 
ATOM 4926 C C   . THR A 1 636  ? -0.421  50.794 -6.617  1.00 80.01  ? 633  THR A C   1 
ATOM 4927 O O   . THR A 1 636  ? -0.188  50.677 -7.825  1.00 80.01  ? 633  THR A O   1 
ATOM 4928 C CB  . THR A 1 636  ? -0.046  48.492 -5.699  1.00 59.36  ? 633  THR A CB  1 
ATOM 4929 O OG1 . THR A 1 636  ? -1.472  48.379 -5.858  1.00 59.36  ? 633  THR A OG1 1 
ATOM 4930 C CG2 . THR A 1 636  ? 0.418   47.677 -4.455  1.00 59.36  ? 633  THR A CG2 1 
ATOM 4931 N N   . GLN A 1 637  ? -1.360  51.601 -6.120  1.00 62.39  ? 634  GLN A N   1 
ATOM 4932 C CA  . GLN A 1 637  ? -2.130  52.510 -6.950  1.00 62.39  ? 634  GLN A CA  1 
ATOM 4933 C C   . GLN A 1 637  ? -1.623  53.970 -6.813  1.00 62.39  ? 634  GLN A C   1 
ATOM 4934 O O   . GLN A 1 637  ? -0.888  54.298 -5.859  1.00 62.39  ? 634  GLN A O   1 
ATOM 4935 C CB  . GLN A 1 637  ? -3.622  52.374 -6.630  1.00 85.71  ? 634  GLN A CB  1 
ATOM 4936 C CG  . GLN A 1 637  ? -4.204  50.960 -6.875  1.00 85.71  ? 634  GLN A CG  1 
ATOM 4937 C CD  . GLN A 1 637  ? -3.919  50.367 -8.277  1.00 85.71  ? 634  GLN A CD  1 
ATOM 4938 O OE1 . GLN A 1 637  ? -4.441  50.833 -9.296  1.00 85.71  ? 634  GLN A OE1 1 
ATOM 4939 N NE2 . GLN A 1 637  ? -3.110  49.315 -8.312  1.00 85.71  ? 634  GLN A NE2 1 
ATOM 4940 N N   . PRO A 1 638  ? -1.955  54.844 -7.793  1.00 73.86  ? 635  PRO A N   1 
ATOM 4941 C CA  . PRO A 1 638  ? -1.557  56.255 -7.652  1.00 73.86  ? 635  PRO A CA  1 
ATOM 4942 C C   . PRO A 1 638  ? -2.003  56.897 -6.329  1.00 73.86  ? 635  PRO A C   1 
ATOM 4943 O O   . PRO A 1 638  ? -3.190  56.977 -6.041  1.00 73.86  ? 635  PRO A O   1 
ATOM 4944 C CB  . PRO A 1 638  ? -2.231  56.942 -8.853  1.00 91.15  ? 635  PRO A CB  1 
ATOM 4945 C CG  . PRO A 1 638  ? -3.187  55.934 -9.438  1.00 91.15  ? 635  PRO A CG  1 
ATOM 4946 C CD  . PRO A 1 638  ? -2.644  54.594 -9.075  1.00 91.15  ? 635  PRO A CD  1 
ATOM 4947 N N   . THR A 1 639  ? -1.050  57.357 -5.539  1.00 88.93  ? 636  THR A N   1 
ATOM 4948 C CA  . THR A 1 639  ? -1.373  57.949 -4.251  1.00 88.93  ? 636  THR A CA  1 
ATOM 4949 C C   . THR A 1 639  ? -1.919  59.387 -4.326  1.00 88.93  ? 636  THR A C   1 
ATOM 4950 O O   . THR A 1 639  ? -1.405  60.199 -5.102  1.00 88.93  ? 636  THR A O   1 
ATOM 4951 C CB  . THR A 1 639  ? -0.157  57.887 -3.363  1.00 59.52  ? 636  THR A CB  1 
ATOM 4952 O OG1 . THR A 1 639  ? 0.177   56.505 -3.150  1.00 59.52  ? 636  THR A OG1 1 
ATOM 4953 C CG2 . THR A 1 639  ? -0.434  58.550 -2.033  1.00 59.52  ? 636  THR A CG2 1 
ATOM 4954 N N   . VAL A 1 640  ? -2.952  59.691 -3.525  1.00 73.46  ? 637  VAL A N   1 
ATOM 4955 C CA  . VAL A 1 640  ? -3.539  61.047 -3.442  1.00 73.46  ? 637  VAL A CA  1 
ATOM 4956 C C   . VAL A 1 640  ? -3.402  61.735 -2.066  1.00 73.46  ? 637  VAL A C   1 
ATOM 4957 O O   . VAL A 1 640  ? -3.864  61.205 -1.046  1.00 73.46  ? 637  VAL A O   1 
ATOM 4958 C CB  . VAL A 1 640  ? -5.018  61.079 -3.904  1.00 51.48  ? 637  VAL A CB  1 
ATOM 4959 C CG1 . VAL A 1 640  ? -5.678  62.421 -3.550  1.00 51.48  ? 637  VAL A CG1 1 
ATOM 4960 C CG2 . VAL A 1 640  ? -5.090  60.873 -5.383  1.00 51.48  ? 637  VAL A CG2 1 
ATOM 4961 N N   . LEU A 1 641  ? -2.806  62.933 -2.077  1.00 92.77  ? 638  LEU A N   1 
ATOM 4962 C CA  . LEU A 1 641  ? -2.401  63.662 -0.866  1.00 92.77  ? 638  LEU A CA  1 
ATOM 4963 C C   . LEU A 1 641  ? -3.403  64.697 -0.354  1.00 92.77  ? 638  LEU A C   1 
ATOM 4964 O O   . LEU A 1 641  ? -4.285  65.142 -1.084  1.00 92.77  ? 638  LEU A O   1 
ATOM 4965 C CB  . LEU A 1 641  ? -1.068  64.370 -1.103  1.00 54.60  ? 638  LEU A CB  1 
ATOM 4966 C CG  . LEU A 1 641  ? 0.155   63.554 -1.495  1.00 54.60  ? 638  LEU A CG  1 
ATOM 4967 C CD1 . LEU A 1 641  ? 1.321   64.451 -1.836  1.00 54.60  ? 638  LEU A CD1 1 
ATOM 4968 C CD2 . LEU A 1 641  ? 0.536   62.606 -0.380  1.00 54.60  ? 638  LEU A CD2 1 
ATOM 4969 N N   . ARG A 1 642  ? -3.242  65.080 0.909   1.00 77.37  ? 639  ARG A N   1 
ATOM 4970 C CA  . ARG A 1 642  ? -4.078  66.088 1.558   1.00 77.37  ? 639  ARG A CA  1 
ATOM 4971 C C   . ARG A 1 642  ? -3.514  66.348 2.946   1.00 77.37  ? 639  ARG A C   1 
ATOM 4972 O O   . ARG A 1 642  ? -2.960  65.438 3.564   1.00 77.37  ? 639  ARG A O   1 
ATOM 4973 C CB  . ARG A 1 642  ? -5.560  65.661 1.634   1.00 130.84 ? 639  ARG A CB  1 
ATOM 4974 C CG  . ARG A 1 642  ? -6.462  66.548 2.514   1.00 130.84 ? 639  ARG A CG  1 
ATOM 4975 C CD  . ARG A 1 642  ? -6.545  67.993 2.027   1.00 130.84 ? 639  ARG A CD  1 
ATOM 4976 N NE  . ARG A 1 642  ? -7.793  68.264 1.320   1.00 130.84 ? 639  ARG A NE  1 
ATOM 4977 C CZ  . ARG A 1 642  ? -8.730  69.111 1.744   1.00 130.84 ? 639  ARG A CZ  1 
ATOM 4978 N NH1 . ARG A 1 642  ? -8.560  69.794 2.872   1.00 130.84 ? 639  ARG A NH1 1 
ATOM 4979 N NH2 . ARG A 1 642  ? -9.836  69.285 1.028   1.00 130.84 ? 639  ARG A NH2 1 
ATOM 4980 N N   . THR A 1 643  ? -3.633  67.595 3.401   1.00 92.13  ? 640  THR A N   1 
ATOM 4981 C CA  . THR A 1 643  ? -3.193  68.020 4.722   1.00 92.13  ? 640  THR A CA  1 
ATOM 4982 C C   . THR A 1 643  ? -4.383  67.941 5.667   1.00 92.13  ? 640  THR A C   1 
ATOM 4983 O O   . THR A 1 643  ? -5.537  68.087 5.242   1.00 92.13  ? 640  THR A O   1 
ATOM 4984 C CB  . THR A 1 643  ? -2.667  69.482 4.705   1.00 101.34 ? 640  THR A CB  1 
ATOM 4985 O OG1 . THR A 1 643  ? -1.850  69.689 3.549   1.00 101.34 ? 640  THR A OG1 1 
ATOM 4986 C CG2 . THR A 1 643  ? -1.845  69.802 5.949   1.00 101.34 ? 640  THR A CG2 1 
ATOM 4987 N N   . PHE A 1 644  ? -4.094  67.693 6.943   1.00 84.92  ? 641  PHE A N   1 
ATOM 4988 C CA  . PHE A 1 644  ? -5.073  67.861 8.004   1.00 84.92  ? 641  PHE A CA  1 
ATOM 4989 C C   . PHE A 1 644  ? -4.383  68.308 9.294   1.00 84.92  ? 641  PHE A C   1 
ATOM 4990 O O   . PHE A 1 644  ? -3.216  67.977 9.534   1.00 84.92  ? 641  PHE A O   1 
ATOM 4991 C CB  . PHE A 1 644  ? -5.895  66.576 8.216   1.00 87.67  ? 641  PHE A CB  1 
ATOM 4992 C CG  . PHE A 1 644  ? -5.136  65.462 8.886   1.00 87.67  ? 641  PHE A CG  1 
ATOM 4993 C CD1 . PHE A 1 644  ? -5.375  65.153 10.217  1.00 87.67  ? 641  PHE A CD1 1 
ATOM 4994 C CD2 . PHE A 1 644  ? -4.190  64.726 8.187   1.00 87.67  ? 641  PHE A CD2 1 
ATOM 4995 C CE1 . PHE A 1 644  ? -4.684  64.143 10.849  1.00 87.67  ? 641  PHE A CE1 1 
ATOM 4996 C CE2 . PHE A 1 644  ? -3.492  63.708 8.808   1.00 87.67  ? 641  PHE A CE2 1 
ATOM 4997 C CZ  . PHE A 1 644  ? -3.740  63.416 10.148  1.00 87.67  ? 641  PHE A CZ  1 
ATOM 4998 N N   . ARG A 1 645  ? -5.115  69.079 10.102  1.00 136.00 ? 642  ARG A N   1 
ATOM 4999 C CA  . ARG A 1 645  ? -4.718  69.427 11.466  1.00 136.00 ? 642  ARG A CA  1 
ATOM 5000 C C   . ARG A 1 645  ? -5.690  68.745 12.434  1.00 136.00 ? 642  ARG A C   1 
ATOM 5001 O O   . ARG A 1 645  ? -6.901  68.983 12.377  1.00 136.00 ? 642  ARG A O   1 
ATOM 5002 C CB  . ARG A 1 645  ? -4.734  70.945 11.664  1.00 201.87 ? 642  ARG A CB  1 
ATOM 5003 C CG  . ARG A 1 645  ? -3.929  71.438 12.859  1.00 201.87 ? 642  ARG A CG  1 
ATOM 5004 C CD  . ARG A 1 645  ? -4.391  72.811 13.298  1.00 201.87 ? 642  ARG A CD  1 
ATOM 5005 N NE  . ARG A 1 645  ? -5.693  72.743 13.964  1.00 201.87 ? 642  ARG A NE  1 
ATOM 5006 C CZ  . ARG A 1 645  ? -6.541  73.762 14.079  1.00 201.87 ? 642  ARG A CZ  1 
ATOM 5007 N NH1 . ARG A 1 645  ? -6.258  74.966 13.575  1.00 201.87 ? 642  ARG A NH1 1 
ATOM 5008 N NH2 . ARG A 1 645  ? -7.783  73.551 14.716  1.00 201.87 ? 642  ARG A NH2 1 
ATOM 5009 N N   . SER A 1 646  ? -5.160  67.887 13.305  1.00 154.20 ? 643  SER A N   1 
ATOM 5010 C CA  . SER A 1 646  ? -5.987  67.149 14.263  1.00 154.20 ? 643  SER A CA  1 
ATOM 5011 C C   . SER A 1 646  ? -5.857  67.736 15.676  1.00 154.20 ? 643  SER A C   1 
ATOM 5012 O O   . SER A 1 646  ? -6.853  68.160 16.268  1.00 154.20 ? 643  SER A O   1 
ATOM 5013 C CB  . SER A 1 646  ? -5.646  65.655 14.237  1.00 95.13  ? 643  SER A CB  1 
ATOM 5014 O OG  . SER A 1 646  ? -4.259  65.459 14.458  1.00 95.13  ? 643  SER A OG  1 
ATOM 5015 N N   . LEU A 1 647  ? -4.637  67.759 16.212  1.00 105.07 ? 644  LEU A N   1 
ATOM 5016 C CA  . LEU A 1 647  ? -4.336  68.523 17.427  1.00 105.07 ? 644  LEU A CA  1 
ATOM 5017 C C   . LEU A 1 647  ? -3.902  69.952 17.017  1.00 105.07 ? 644  LEU A C   1 
ATOM 5018 O O   . LEU A 1 647  ? -4.586  70.607 16.222  1.00 105.07 ? 644  LEU A O   1 
ATOM 5019 C CB  . LEU A 1 647  ? -3.282  67.800 18.295  1.00 109.16 ? 644  LEU A CB  1 
ATOM 5020 C CG  . LEU A 1 647  ? -1.868  67.543 17.738  1.00 109.16 ? 644  LEU A CG  1 
ATOM 5021 C CD1 . LEU A 1 647  ? -0.850  67.323 18.860  1.00 109.16 ? 644  LEU A CD1 1 
ATOM 5022 C CD2 . LEU A 1 647  ? -1.842  66.382 16.730  1.00 109.16 ? 644  LEU A CD2 1 
ATOM 5023 N N   . SER A 1 648  ? -2.780  70.427 17.553  1.00 180.65 ? 645  SER A N   1 
ATOM 5024 C CA  . SER A 1 648  ? -2.209  71.704 17.136  1.00 180.65 ? 645  SER A CA  1 
ATOM 5025 C C   . SER A 1 648  ? -1.530  71.564 15.780  1.00 180.65 ? 645  SER A C   1 
ATOM 5026 O O   . SER A 1 648  ? -1.515  72.506 14.979  1.00 180.65 ? 645  SER A O   1 
ATOM 5027 C CB  . SER A 1 648  ? -1.180  72.186 18.159  1.00 136.91 ? 645  SER A CB  1 
ATOM 5028 O OG  . SER A 1 648  ? 0.041   71.477 18.024  1.00 136.91 ? 645  SER A OG  1 
ATOM 5029 N N   . THR A 1 649  ? -0.981  70.375 15.534  1.00 152.35 ? 646  THR A N   1 
ATOM 5030 C CA  . THR A 1 649  ? -0.063  70.149 14.419  1.00 152.35 ? 646  THR A CA  1 
ATOM 5031 C C   . THR A 1 649  ? -0.734  69.645 13.142  1.00 152.35 ? 646  THR A C   1 
ATOM 5032 O O   . THR A 1 649  ? -1.863  69.144 13.173  1.00 152.35 ? 646  THR A O   1 
ATOM 5033 C CB  . THR A 1 649  ? 1.053   69.174 14.817  1.00 89.35  ? 646  THR A CB  1 
ATOM 5034 O OG1 . THR A 1 649  ? 0.476   67.910 15.156  1.00 89.35  ? 646  THR A OG1 1 
ATOM 5035 C CG2 . THR A 1 649  ? 1.830   69.715 16.016  1.00 89.35  ? 646  THR A CG2 1 
ATOM 5036 N N   . THR A 1 650  ? -0.002  69.762 12.032  1.00 77.61  ? 647  THR A N   1 
ATOM 5037 C CA  . THR A 1 650  ? -0.515  69.461 10.686  1.00 77.61  ? 647  THR A CA  1 
ATOM 5038 C C   . THR A 1 650  ? 0.248   68.314 10.021  1.00 77.61  ? 647  THR A C   1 
ATOM 5039 O O   . THR A 1 650  ? 1.460   68.397 9.804   1.00 77.61  ? 647  THR A O   1 
ATOM 5040 C CB  . THR A 1 650  ? -0.471  70.711 9.748   1.00 96.99  ? 647  THR A CB  1 
ATOM 5041 O OG1 . THR A 1 650  ? 0.813   71.342 9.833   1.00 96.99  ? 647  THR A OG1 1 
ATOM 5042 C CG2 . THR A 1 650  ? -1.559  71.734 10.114  1.00 96.99  ? 647  THR A CG2 1 
ATOM 5043 N N   . ASN A 1 651  ? -0.470  67.239 9.705   1.00 98.46  ? 648  ASN A N   1 
ATOM 5044 C CA  . ASN A 1 651  ? 0.111   66.134 8.942   1.00 98.46  ? 648  ASN A CA  1 
ATOM 5045 C C   . ASN A 1 651  ? -0.522  65.952 7.571   1.00 98.46  ? 648  ASN A C   1 
ATOM 5046 O O   . ASN A 1 651  ? -1.420  66.685 7.158   1.00 98.46  ? 648  ASN A O   1 
ATOM 5047 C CB  . ASN A 1 651  ? 0.046   64.817 9.721   1.00 68.26  ? 648  ASN A CB  1 
ATOM 5048 C CG  . ASN A 1 651  ? 0.737   64.899 11.060  1.00 68.26  ? 648  ASN A CG  1 
ATOM 5049 O OD1 . ASN A 1 651  ? 1.967   64.988 11.147  1.00 68.26  ? 648  ASN A OD1 1 
ATOM 5050 N ND2 . ASN A 1 651  ? -0.052  64.869 12.119  1.00 68.26  ? 648  ASN A ND2 1 
ATOM 5051 N N   . VAL A 1 652  ? -0.038  64.947 6.872   1.00 65.75  ? 649  VAL A N   1 
ATOM 5052 C CA  . VAL A 1 652  ? -0.508  64.664 5.535   1.00 65.75  ? 649  VAL A CA  1 
ATOM 5053 C C   . VAL A 1 652  ? -1.190  63.282 5.543   1.00 65.75  ? 649  VAL A C   1 
ATOM 5054 O O   . VAL A 1 652  ? -0.584  62.267 5.965   1.00 65.75  ? 649  VAL A O   1 
ATOM 5055 C CB  . VAL A 1 652  ? 0.683   64.730 4.501   1.00 67.03  ? 649  VAL A CB  1 
ATOM 5056 C CG1 . VAL A 1 652  ? 0.273   64.235 3.109   1.00 67.03  ? 649  VAL A CG1 1 
ATOM 5057 C CG2 . VAL A 1 652  ? 1.273   66.140 4.418   1.00 67.03  ? 649  VAL A CG2 1 
ATOM 5058 N N   . PHE A 1 653  ? -2.459  63.263 5.127   1.00 57.22  ? 650  PHE A N   1 
ATOM 5059 C CA  . PHE A 1 653  ? -3.134  62.011 4.825   1.00 57.22  ? 650  PHE A CA  1 
ATOM 5060 C C   . PHE A 1 653  ? -2.832  61.635 3.380   1.00 57.22  ? 650  PHE A C   1 
ATOM 5061 O O   . PHE A 1 653  ? -3.073  62.418 2.455   1.00 57.22  ? 650  PHE A O   1 
ATOM 5062 C CB  . PHE A 1 653  ? -4.649  62.093 5.039   1.00 60.63  ? 650  PHE A CB  1 
ATOM 5063 C CG  . PHE A 1 653  ? -5.328  60.736 5.099   1.00 60.63  ? 650  PHE A CG  1 
ATOM 5064 C CD1 . PHE A 1 653  ? -5.825  60.241 6.311   1.00 60.63  ? 650  PHE A CD1 1 
ATOM 5065 C CD2 . PHE A 1 653  ? -5.455  59.937 3.951   1.00 60.63  ? 650  PHE A CD2 1 
ATOM 5066 C CE1 . PHE A 1 653  ? -6.447  58.978 6.391   1.00 60.63  ? 650  PHE A CE1 1 
ATOM 5067 C CE2 . PHE A 1 653  ? -6.070  58.679 4.030   1.00 60.63  ? 650  PHE A CE2 1 
ATOM 5068 C CZ  . PHE A 1 653  ? -6.572  58.208 5.266   1.00 60.63  ? 650  PHE A CZ  1 
ATOM 5069 N N   . ALA A 1 654  ? -2.291  60.436 3.203   1.00 51.97  ? 651  ALA A N   1 
ATOM 5070 C CA  . ALA A 1 654  ? -2.033  59.895 1.887   1.00 51.97  ? 651  ALA A CA  1 
ATOM 5071 C C   . ALA A 1 654  ? -3.093  58.837 1.518   1.00 51.97  ? 651  ALA A C   1 
ATOM 5072 O O   . ALA A 1 654  ? -3.262  57.832 2.224   1.00 51.97  ? 651  ALA A O   1 
ATOM 5073 C CB  . ALA A 1 654  ? -0.636  59.315 1.840   1.00 68.71  ? 651  ALA A CB  1 
ATOM 5074 N N   . CYS A 1 655  ? -3.806  59.055 0.418   1.00 51.49  ? 652  CYS A N   1 
ATOM 5075 C CA  . CYS A 1 655  ? -4.838  58.111 0.019   1.00 51.49  ? 652  CYS A CA  1 
ATOM 5076 C C   . CYS A 1 655  ? -4.296  57.126 -1.000  1.00 51.49  ? 652  CYS A C   1 
ATOM 5077 O O   . CYS A 1 655  ? -3.674  57.544 -1.952  1.00 51.49  ? 652  CYS A O   1 
ATOM 5078 C CB  . CYS A 1 655  ? -6.046  58.847 -0.548  1.00 76.61  ? 652  CYS A CB  1 
ATOM 5079 S SG  . CYS A 1 655  ? -7.226  59.377 0.690   1.00 76.61  ? 652  CYS A SG  1 
ATOM 5080 N N   . SER A 1 656  ? -4.510  55.827 -0.778  1.00 51.57  ? 653  SER A N   1 
ATOM 5081 C CA  . SER A 1 656  ? -4.056  54.730 -1.670  1.00 51.57  ? 653  SER A CA  1 
ATOM 5082 C C   . SER A 1 656  ? -4.591  53.411 -1.149  1.00 51.57  ? 653  SER A C   1 
ATOM 5083 O O   . SER A 1 656  ? -5.449  53.402 -0.270  1.00 51.57  ? 653  SER A O   1 
ATOM 5084 C CB  . SER A 1 656  ? -2.530  54.644 -1.791  1.00 56.52  ? 653  SER A CB  1 
ATOM 5085 O OG  . SER A 1 656  ? -1.905  54.875 -0.547  1.00 56.52  ? 653  SER A OG  1 
ATOM 5086 N N   . ASP A 1 657  ? -4.103  52.304 -1.702  1.00 91.09  ? 654  ASP A N   1 
ATOM 5087 C CA  . ASP A 1 657  ? -4.657  50.989 -1.371  1.00 91.09  ? 654  ASP A CA  1 
ATOM 5088 C C   . ASP A 1 657  ? -4.174  50.547 -0.005  1.00 91.09  ? 654  ASP A C   1 
ATOM 5089 O O   . ASP A 1 657  ? -4.679  49.594 0.582   1.00 91.09  ? 654  ASP A O   1 
ATOM 5090 C CB  . ASP A 1 657  ? -4.331  49.944 -2.450  1.00 75.32  ? 654  ASP A CB  1 
ATOM 5091 C CG  . ASP A 1 657  ? -2.853  49.799 -2.699  1.00 75.32  ? 654  ASP A CG  1 
ATOM 5092 O OD1 . ASP A 1 657  ? -2.213  50.768 -3.153  1.00 75.32  ? 654  ASP A OD1 1 
ATOM 5093 O OD2 . ASP A 1 657  ? -2.332  48.704 -2.451  1.00 75.32  ? 654  ASP A OD2 1 
ATOM 5094 N N   . ARG A 1 658  ? -3.193  51.285 0.485   1.00 49.59  ? 655  ARG A N   1 
ATOM 5095 C CA  . ARG A 1 658  ? -2.541  51.066 1.762   1.00 49.59  ? 655  ARG A CA  1 
ATOM 5096 C C   . ARG A 1 658  ? -2.464  52.484 2.379   1.00 49.59  ? 655  ARG A C   1 
ATOM 5097 O O   . ARG A 1 658  ? -1.412  53.102 2.366   1.00 49.59  ? 655  ARG A O   1 
ATOM 5098 C CB  . ARG A 1 658  ? -1.153  50.459 1.524   1.00 96.97  ? 655  ARG A CB  1 
ATOM 5099 C CG  . ARG A 1 658  ? -0.229  50.426 2.726   1.00 96.97  ? 655  ARG A CG  1 
ATOM 5100 C CD  . ARG A 1 658  ? 1.208   50.700 2.301   1.00 96.97  ? 655  ARG A CD  1 
ATOM 5101 N NE  . ARG A 1 658  ? 1.793   49.589 1.557   1.00 96.97  ? 655  ARG A NE  1 
ATOM 5102 C CZ  . ARG A 1 658  ? 2.424   48.558 2.119   1.00 96.97  ? 655  ARG A CZ  1 
ATOM 5103 N NH1 . ARG A 1 658  ? 2.558   48.482 3.444   1.00 96.97  ? 655  ARG A NH1 1 
ATOM 5104 N NH2 . ARG A 1 658  ? 2.921   47.593 1.356   1.00 96.97  ? 655  ARG A NH2 1 
ATOM 5105 N N   . PRO A 1 659  ? -3.597  52.992 2.907   1.00 44.25  ? 656  PRO A N   1 
ATOM 5106 C CA  . PRO A 1 659  ? -3.732  54.377 3.345   1.00 44.25  ? 656  PRO A CA  1 
ATOM 5107 C C   . PRO A 1 659  ? -2.792  54.717 4.511   1.00 44.25  ? 656  PRO A C   1 
ATOM 5108 O O   . PRO A 1 659  ? -2.731  53.970 5.517   1.00 44.25  ? 656  PRO A O   1 
ATOM 5109 C CB  . PRO A 1 659  ? -5.180  54.455 3.824   1.00 73.67  ? 656  PRO A CB  1 
ATOM 5110 C CG  . PRO A 1 659  ? -5.842  53.238 3.302   1.00 73.67  ? 656  PRO A CG  1 
ATOM 5111 C CD  . PRO A 1 659  ? -4.813  52.215 3.189   1.00 73.67  ? 656  PRO A CD  1 
ATOM 5112 N N   . THR A 1 660  ? -2.042  55.810 4.371   1.00 41.83  ? 657  THR A N   1 
ATOM 5113 C CA  . THR A 1 660  ? -1.046  56.140 5.380   1.00 41.83  ? 657  THR A CA  1 
ATOM 5114 C C   . THR A 1 660  ? -1.191  57.564 5.852   1.00 41.83  ? 657  THR A C   1 
ATOM 5115 O O   . THR A 1 660  ? -1.939  58.336 5.279   1.00 41.83  ? 657  THR A O   1 
ATOM 5116 C CB  . THR A 1 660  ? 0.381   56.019 4.852   1.00 47.21  ? 657  THR A CB  1 
ATOM 5117 O OG1 . THR A 1 660  ? 0.624   57.127 3.995   1.00 47.21  ? 657  THR A OG1 1 
ATOM 5118 C CG2 . THR A 1 660  ? 0.616   54.719 4.104   1.00 47.21  ? 657  THR A CG2 1 
ATOM 5119 N N   . VAL A 1 661  ? -0.461  57.890 6.902   1.00 52.38  ? 658  VAL A N   1 
ATOM 5120 C CA  . VAL A 1 661  ? -0.371  59.245 7.398   1.00 52.38  ? 658  VAL A CA  1 
ATOM 5121 C C   . VAL A 1 661  ? 1.108   59.590 7.493   1.00 52.38  ? 658  VAL A C   1 
ATOM 5122 O O   . VAL A 1 661  ? 1.918   58.783 8.014   1.00 52.38  ? 658  VAL A O   1 
ATOM 5123 C CB  . VAL A 1 661  ? -1.026  59.393 8.779   1.00 28.98  ? 658  VAL A CB  1 
ATOM 5124 C CG1 . VAL A 1 661  ? -0.477  60.573 9.467   1.00 28.98  ? 658  VAL A CG1 1 
ATOM 5125 C CG2 . VAL A 1 661  ? -2.449  59.597 8.617   1.00 28.98  ? 658  VAL A CG2 1 
ATOM 5126 N N   . ILE A 1 662  ? 1.454   60.780 6.997   1.00 106.82 ? 659  ILE A N   1 
ATOM 5127 C CA  . ILE A 1 662  ? 2.834   61.245 7.025   1.00 106.82 ? 659  ILE A CA  1 
ATOM 5128 C C   . ILE A 1 662  ? 3.072   62.076 8.283   1.00 106.82 ? 659  ILE A C   1 
ATOM 5129 O O   . ILE A 1 662  ? 2.337   63.028 8.552   1.00 106.82 ? 659  ILE A O   1 
ATOM 5130 C CB  . ILE A 1 662  ? 3.239   62.018 5.742   1.00 66.65  ? 659  ILE A CB  1 
ATOM 5131 C CG1 . ILE A 1 662  ? 2.510   61.460 4.516   1.00 66.65  ? 659  ILE A CG1 1 
ATOM 5132 C CG2 . ILE A 1 662  ? 4.747   61.971 5.559   1.00 66.65  ? 659  ILE A CG2 1 
ATOM 5133 C CD1 . ILE A 1 662  ? 3.258   61.571 3.191   1.00 66.65  ? 659  ILE A CD1 1 
ATOM 5134 N N   . TYR A 1 663  ? 4.092   61.671 9.046   1.00 98.91  ? 660  TYR A N   1 
ATOM 5135 C CA  . TYR A 1 663  ? 4.433   62.237 10.350  1.00 98.91  ? 660  TYR A CA  1 
ATOM 5136 C C   . TYR A 1 663  ? 5.864   62.739 10.402  1.00 98.91  ? 660  TYR A C   1 
ATOM 5137 O O   . TYR A 1 663  ? 6.541   62.884 9.382   1.00 98.91  ? 660  TYR A O   1 
ATOM 5138 C CB  . TYR A 1 663  ? 4.266   61.189 11.464  1.00 142.52 ? 660  TYR A CB  1 
ATOM 5139 C CG  . TYR A 1 663  ? 2.861   61.056 11.969  1.00 142.52 ? 660  TYR A CG  1 
ATOM 5140 C CD1 . TYR A 1 663  ? 2.229   59.822 12.001  1.00 142.52 ? 660  TYR A CD1 1 
ATOM 5141 C CD2 . TYR A 1 663  ? 2.149   62.173 12.405  1.00 142.52 ? 660  TYR A CD2 1 
ATOM 5142 C CE1 . TYR A 1 663  ? 0.908   59.703 12.459  1.00 142.52 ? 660  TYR A CE1 1 
ATOM 5143 C CE2 . TYR A 1 663  ? 0.833   62.065 12.857  1.00 142.52 ? 660  TYR A CE2 1 
ATOM 5144 C CZ  . TYR A 1 663  ? 0.214   60.831 12.881  1.00 142.52 ? 660  TYR A CZ  1 
ATOM 5145 O OH  . TYR A 1 663  ? -1.088  60.726 13.331  1.00 142.52 ? 660  TYR A OH  1 
ATOM 5146 N N   . SER A 1 664  ? 6.328   62.954 11.627  1.00 174.49 ? 661  SER A N   1 
ATOM 5147 C CA  . SER A 1 664  ? 7.635   63.511 11.866  1.00 174.49 ? 661  SER A CA  1 
ATOM 5148 C C   . SER A 1 664  ? 7.968   63.512 13.352  1.00 174.49 ? 661  SER A C   1 
ATOM 5149 O O   . SER A 1 664  ? 7.176   63.984 14.169  1.00 174.49 ? 661  SER A O   1 
ATOM 5150 C CB  . SER A 1 664  ? 7.648   64.924 11.330  1.00 42.54  ? 661  SER A CB  1 
ATOM 5151 O OG  . SER A 1 664  ? 8.911   65.526 11.500  1.00 42.54  ? 661  SER A OG  1 
ATOM 5152 N N   . SER A 1 665  ? 9.141   62.983 13.692  1.00 201.74 ? 662  SER A N   1 
ATOM 5153 C CA  . SER A 1 665  ? 9.594   62.903 15.080  1.00 201.74 ? 662  SER A CA  1 
ATOM 5154 C C   . SER A 1 665  ? 10.070  64.268 15.573  1.00 201.74 ? 662  SER A C   1 
ATOM 5155 O O   . SER A 1 665  ? 9.259   65.120 15.946  1.00 201.74 ? 662  SER A O   1 
ATOM 5156 C CB  . SER A 1 665  ? 10.709  61.866 15.212  1.00 63.29  ? 662  SER A CB  1 
ATOM 5157 O OG  . SER A 1 665  ? 11.921  62.288 14.556  1.00 63.29  ? 662  SER A OG  1 
ATOM 5158 N N   . ASN A 1 666  ? 11.390  64.453 15.593  1.00 173.62 ? 663  ASN A N   1 
ATOM 5159 C CA  . ASN A 1 666  ? 11.998  65.763 15.744  1.00 173.62 ? 663  ASN A CA  1 
ATOM 5160 C C   . ASN A 1 666  ? 11.508  66.600 14.563  1.00 173.62 ? 663  ASN A C   1 
ATOM 5161 O O   . ASN A 1 666  ? 10.525  67.338 14.677  1.00 173.62 ? 663  ASN A O   1 
ATOM 5162 C CB  . ASN A 1 666  ? 13.527  65.626 15.750  1.00 134.66 ? 663  ASN A CB  1 
ATOM 5163 C CG  . ASN A 1 666  ? 14.239  66.967 15.746  1.00 134.66 ? 663  ASN A CG  1 
ATOM 5164 O OD1 . ASN A 1 666  ? 14.286  67.667 16.763  1.00 134.66 ? 663  ASN A OD1 1 
ATOM 5165 N ND2 . ASN A 1 666  ? 14.805  67.329 14.598  1.00 134.66 ? 663  ASN A ND2 1 
ATOM 5166 N N   . HIS A 1 667  ? 12.191  66.457 13.432  1.00 201.87 ? 664  HIS A N   1 
ATOM 5167 C CA  . HIS A 1 667  ? 11.653  66.854 12.140  1.00 201.87 ? 664  HIS A CA  1 
ATOM 5168 C C   . HIS A 1 667  ? 12.049  65.850 11.054  1.00 201.87 ? 664  HIS A C   1 
ATOM 5169 O O   . HIS A 1 667  ? 11.928  66.141 9.863   1.00 201.87 ? 664  HIS A O   1 
ATOM 5170 C CB  . HIS A 1 667  ? 12.005  68.302 11.770  1.00 120.65 ? 664  HIS A CB  1 
ATOM 5171 C CG  . HIS A 1 667  ? 10.861  69.260 11.943  1.00 120.65 ? 664  HIS A CG  1 
ATOM 5172 N ND1 . HIS A 1 667  ? 10.074  69.680 10.891  1.00 120.65 ? 664  HIS A ND1 1 
ATOM 5173 C CD2 . HIS A 1 667  ? 10.362  69.865 13.048  1.00 120.65 ? 664  HIS A CD2 1 
ATOM 5174 C CE1 . HIS A 1 667  ? 9.151   70.512 11.339  1.00 120.65 ? 664  HIS A CE1 1 
ATOM 5175 N NE2 . HIS A 1 667  ? 9.302   70.639 12.644  1.00 120.65 ? 664  HIS A NE2 1 
ATOM 5176 N N   . LYS A 1 668  ? 12.506  64.668 11.472  1.00 98.49  ? 665  LYS A N   1 
ATOM 5177 C CA  . LYS A 1 668  ? 12.679  63.548 10.539  1.00 98.49  ? 665  LYS A CA  1 
ATOM 5178 C C   . LYS A 1 668  ? 11.348  62.852 10.260  1.00 98.49  ? 665  LYS A C   1 
ATOM 5179 O O   . LYS A 1 668  ? 10.485  62.792 11.132  1.00 98.49  ? 665  LYS A O   1 
ATOM 5180 C CB  . LYS A 1 668  ? 13.713  62.542 11.048  1.00 107.07 ? 665  LYS A CB  1 
ATOM 5181 C CG  . LYS A 1 668  ? 14.620  62.006 9.934   1.00 107.07 ? 665  LYS A CG  1 
ATOM 5182 C CD  . LYS A 1 668  ? 16.033  62.666 9.908   1.00 107.07 ? 665  LYS A CD  1 
ATOM 5183 C CE  . LYS A 1 668  ? 16.052  64.189 10.172  1.00 107.07 ? 665  LYS A CE  1 
ATOM 5184 N NZ  . LYS A 1 668  ? 15.388  64.993 9.106   1.00 107.07 ? 665  LYS A NZ  1 
ATOM 5185 N N   . LEU A 1 669  ? 11.208  62.316 9.047   1.00 74.56  ? 666  LEU A N   1 
ATOM 5186 C CA  . LEU A 1 669  ? 9.916   61.810 8.511   1.00 74.56  ? 666  LEU A CA  1 
ATOM 5187 C C   . LEU A 1 669  ? 9.470   60.408 8.952   1.00 74.56  ? 666  LEU A C   1 
ATOM 5188 O O   . LEU A 1 669  ? 10.240  59.456 8.850   1.00 74.56  ? 666  LEU A O   1 
ATOM 5189 C CB  . LEU A 1 669  ? 9.928   61.866 6.976   1.00 65.56  ? 666  LEU A CB  1 
ATOM 5190 C CG  . LEU A 1 669  ? 9.937   63.281 6.414   1.00 65.56  ? 666  LEU A CG  1 
ATOM 5191 C CD1 . LEU A 1 669  ? 9.304   63.336 5.026   1.00 65.56  ? 666  LEU A CD1 1 
ATOM 5192 C CD2 . LEU A 1 669  ? 9.184   64.194 7.362   1.00 65.56  ? 666  LEU A CD2 1 
ATOM 5193 N N   . VAL A 1 670  ? 8.217   60.291 9.407   1.00 81.18  ? 667  VAL A N   1 
ATOM 5194 C CA  . VAL A 1 670  ? 7.629   58.988 9.776   1.00 81.18  ? 667  VAL A CA  1 
ATOM 5195 C C   . VAL A 1 670  ? 6.388   58.639 8.930   1.00 81.18  ? 667  VAL A C   1 
ATOM 5196 O O   . VAL A 1 670  ? 5.574   59.501 8.614   1.00 81.18  ? 667  VAL A O   1 
ATOM 5197 C CB  . VAL A 1 670  ? 7.264   58.919 11.282  1.00 43.22  ? 667  VAL A CB  1 
ATOM 5198 C CG1 . VAL A 1 670  ? 6.845   57.481 11.699  1.00 43.22  ? 667  VAL A CG1 1 
ATOM 5199 C CG2 . VAL A 1 670  ? 8.412   59.428 12.156  1.00 43.22  ? 667  VAL A CG2 1 
ATOM 5200 N N   . PHE A 1 671  ? 6.262   57.361 8.579   1.00 81.88  ? 668  PHE A N   1 
ATOM 5201 C CA  . PHE A 1 671  ? 5.175   56.860 7.736   1.00 81.88  ? 668  PHE A CA  1 
ATOM 5202 C C   . PHE A 1 671  ? 4.402   55.717 8.407   1.00 81.88  ? 668  PHE A C   1 
ATOM 5203 O O   . PHE A 1 671  ? 4.872   54.576 8.443   1.00 81.88  ? 668  PHE A O   1 
ATOM 5204 C CB  . PHE A 1 671  ? 5.719   56.377 6.383   1.00 139.47 ? 668  PHE A CB  1 
ATOM 5205 C CG  . PHE A 1 671  ? 6.280   57.471 5.518   1.00 139.47 ? 668  PHE A CG  1 
ATOM 5206 C CD1 . PHE A 1 671  ? 7.628   57.802 5.578   1.00 139.47 ? 668  PHE A CD1 1 
ATOM 5207 C CD2 . PHE A 1 671  ? 5.466   58.154 4.624   1.00 139.47 ? 668  PHE A CD2 1 
ATOM 5208 C CE1 . PHE A 1 671  ? 8.151   58.809 4.772   1.00 139.47 ? 668  PHE A CE1 1 
ATOM 5209 C CE2 . PHE A 1 671  ? 5.983   59.159 3.813   1.00 139.47 ? 668  PHE A CE2 1 
ATOM 5210 C CZ  . PHE A 1 671  ? 7.325   59.487 3.889   1.00 139.47 ? 668  PHE A CZ  1 
ATOM 5211 N N   . SER A 1 672  ? 3.209   56.029 8.911   1.00 52.61  ? 669  SER A N   1 
ATOM 5212 C CA  . SER A 1 672  ? 2.376   55.063 9.650   1.00 52.61  ? 669  SER A CA  1 
ATOM 5213 C C   . SER A 1 672  ? 1.120   54.609 8.874   1.00 52.61  ? 669  SER A C   1 
ATOM 5214 O O   . SER A 1 672  ? 0.438   55.418 8.239   1.00 52.61  ? 669  SER A O   1 
ATOM 5215 C CB  . SER A 1 672  ? 1.977   55.640 11.013  1.00 111.42 ? 669  SER A CB  1 
ATOM 5216 O OG  . SER A 1 672  ? 3.088   56.255 11.646  1.00 111.42 ? 669  SER A OG  1 
ATOM 5217 N N   . ASN A 1 673  ? 0.817   53.316 8.942   1.00 48.66  ? 670  ASN A N   1 
ATOM 5218 C CA  . ASN A 1 673  ? -0.421  52.821 8.385   1.00 48.66  ? 670  ASN A CA  1 
ATOM 5219 C C   . ASN A 1 673  ? -1.684  53.420 9.013   1.00 48.66  ? 670  ASN A C   1 
ATOM 5220 O O   . ASN A 1 673  ? -1.695  53.907 10.175  1.00 48.66  ? 670  ASN A O   1 
ATOM 5221 C CB  . ASN A 1 673  ? -0.481  51.302 8.458   1.00 59.69  ? 670  ASN A CB  1 
ATOM 5222 C CG  . ASN A 1 673  ? 0.549   50.634 7.572   1.00 59.69  ? 670  ASN A CG  1 
ATOM 5223 O OD1 . ASN A 1 673  ? 0.813   51.076 6.452   1.00 59.69  ? 670  ASN A OD1 1 
ATOM 5224 N ND2 . ASN A 1 673  ? 1.133   49.555 8.067   1.00 59.69  ? 670  ASN A ND2 1 
ATOM 5225 N N   . VAL A 1 674  ? -2.747  53.396 8.223   1.00 54.22  ? 671  VAL A N   1 
ATOM 5226 C CA  . VAL A 1 674  ? -4.083  53.663 8.716   1.00 54.22  ? 671  VAL A CA  1 
ATOM 5227 C C   . VAL A 1 674  ? -4.871  52.361 8.586   1.00 54.22  ? 671  VAL A C   1 
ATOM 5228 O O   . VAL A 1 674  ? -4.782  51.668 7.569   1.00 54.22  ? 671  VAL A O   1 
ATOM 5229 C CB  . VAL A 1 674  ? -4.738  54.818 7.928   1.00 31.10  ? 671  VAL A CB  1 
ATOM 5230 C CG1 . VAL A 1 674  ? -6.243  54.862 8.177   1.00 31.10  ? 671  VAL A CG1 1 
ATOM 5231 C CG2 . VAL A 1 674  ? -4.054  56.150 8.297   1.00 31.10  ? 671  VAL A CG2 1 
ATOM 5232 N N   . ASN A 1 675  ? -5.616  52.012 9.622   1.00 47.96  ? 672  ASN A N   1 
ATOM 5233 C CA  . ASN A 1 675  ? -6.295  50.725 9.640   1.00 47.96  ? 672  ASN A CA  1 
ATOM 5234 C C   . ASN A 1 675  ? -7.608  50.739 8.885   1.00 47.96  ? 672  ASN A C   1 
ATOM 5235 O O   . ASN A 1 675  ? -8.678  50.566 9.484   1.00 47.96  ? 672  ASN A O   1 
ATOM 5236 C CB  . ASN A 1 675  ? -6.499  50.221 11.064  1.00 48.93  ? 672  ASN A CB  1 
ATOM 5237 C CG  . ASN A 1 675  ? -5.209  50.111 11.826  1.00 48.93  ? 672  ASN A CG  1 
ATOM 5238 O OD1 . ASN A 1 675  ? -4.184  49.714 11.276  1.00 48.93  ? 672  ASN A OD1 1 
ATOM 5239 N ND2 . ASN A 1 675  ? -5.247  50.458 13.098  1.00 48.93  ? 672  ASN A ND2 1 
ATOM 5240 N N   . LEU A 1 676  ? -7.511  50.961 7.569   1.00 60.20  ? 673  LEU A N   1 
ATOM 5241 C CA  . LEU A 1 676  ? -8.656  50.857 6.669   1.00 60.20  ? 673  LEU A CA  1 
ATOM 5242 C C   . LEU A 1 676  ? -8.344  50.065 5.414   1.00 60.20  ? 673  LEU A C   1 
ATOM 5243 O O   . LEU A 1 676  ? -7.189  49.961 4.993   1.00 60.20  ? 673  LEU A O   1 
ATOM 5244 C CB  . LEU A 1 676  ? -9.212  52.228 6.310   1.00 59.59  ? 673  LEU A CB  1 
ATOM 5245 C CG  . LEU A 1 676  ? -9.775  52.969 7.523   1.00 59.59  ? 673  LEU A CG  1 
ATOM 5246 C CD1 . LEU A 1 676  ? -9.928  54.445 7.209   1.00 59.59  ? 673  LEU A CD1 1 
ATOM 5247 C CD2 . LEU A 1 676  ? -11.081 52.354 8.001   1.00 59.59  ? 673  LEU A CD2 1 
ATOM 5248 N N   . LYS A 1 677  ? -9.412  49.511 4.842   1.00 92.31  ? 674  LYS A N   1 
ATOM 5249 C CA  . LYS A 1 677  ? -9.376  48.690 3.638   1.00 92.31  ? 674  LYS A CA  1 
ATOM 5250 C C   . LYS A 1 677  ? -8.641  49.430 2.512   1.00 92.31  ? 674  LYS A C   1 
ATOM 5251 O O   . LYS A 1 677  ? -7.489  49.111 2.205   1.00 92.31  ? 674  LYS A O   1 
ATOM 5252 C CB  . LYS A 1 677  ? -10.819 48.320 3.233   1.00 122.52 ? 674  LYS A CB  1 
ATOM 5253 C CG  . LYS A 1 677  ? -11.020 46.974 2.512   1.00 122.52 ? 674  LYS A CG  1 
ATOM 5254 C CD  . LYS A 1 677  ? -10.796 45.768 3.433   1.00 122.52 ? 674  LYS A CD  1 
ATOM 5255 C CE  . LYS A 1 677  ? -11.875 44.695 3.276   1.00 122.52 ? 674  LYS A CE  1 
ATOM 5256 N NZ  . LYS A 1 677  ? -11.933 44.078 1.929   1.00 122.52 ? 674  LYS A NZ  1 
ATOM 5257 N N   . GLU A 1 678  ? -9.312  50.417 1.919   1.00 94.38  ? 675  GLU A N   1 
ATOM 5258 C CA  . GLU A 1 678  ? -8.748  51.264 0.871   1.00 94.38  ? 675  GLU A CA  1 
ATOM 5259 C C   . GLU A 1 678  ? -9.349  52.648 1.042   1.00 94.38  ? 675  GLU A C   1 
ATOM 5260 O O   . GLU A 1 678  ? -10.423 52.797 1.639   1.00 94.38  ? 675  GLU A O   1 
ATOM 5261 C CB  . GLU A 1 678  ? -9.071  50.716 -0.523  1.00 102.09 ? 675  GLU A CB  1 
ATOM 5262 C CG  . GLU A 1 678  ? -8.148  51.256 -1.605  1.00 102.09 ? 675  GLU A CG  1 
ATOM 5263 C CD  . GLU A 1 678  ? -8.335  50.607 -2.977  1.00 102.09 ? 675  GLU A CD  1 
ATOM 5264 O OE1 . GLU A 1 678  ? -9.437  50.718 -3.567  1.00 102.09 ? 675  GLU A OE1 1 
ATOM 5265 O OE2 . GLU A 1 678  ? -7.357  50.013 -3.484  1.00 102.09 ? 675  GLU A OE2 1 
ATOM 5266 N N   . VAL A 1 679  ? -8.649  53.665 0.550   1.00 54.33  ? 676  VAL A N   1 
ATOM 5267 C CA  . VAL A 1 679  ? -9.127  55.046 0.649   1.00 54.33  ? 676  VAL A CA  1 
ATOM 5268 C C   . VAL A 1 679  ? -8.647  55.833 -0.561  1.00 54.33  ? 676  VAL A C   1 
ATOM 5269 O O   . VAL A 1 679  ? -7.441  55.971 -0.796  1.00 54.33  ? 676  VAL A O   1 
ATOM 5270 C CB  . VAL A 1 679  ? -8.639  55.780 1.911   1.00 45.51  ? 676  VAL A CB  1 
ATOM 5271 C CG1 . VAL A 1 679  ? -9.345  57.120 2.000   1.00 45.51  ? 676  VAL A CG1 1 
ATOM 5272 C CG2 . VAL A 1 679  ? -8.871  54.963 3.172   1.00 45.51  ? 676  VAL A CG2 1 
ATOM 5273 N N   . ASN A 1 680  ? -9.613  56.353 -1.312  1.00 64.05  ? 677  ASN A N   1 
ATOM 5274 C CA  . ASN A 1 680  ? -9.354  57.062 -2.558  1.00 64.05  ? 677  ASN A CA  1 
ATOM 5275 C C   . ASN A 1 680  ? -9.267  58.569 -2.383  1.00 64.05  ? 677  ASN A C   1 
ATOM 5276 O O   . ASN A 1 680  ? -8.282  59.153 -2.805  1.00 64.05  ? 677  ASN A O   1 
ATOM 5277 C CB  . ASN A 1 680  ? -10.397 56.668 -3.599  1.00 73.57  ? 677  ASN A CB  1 
ATOM 5278 C CG  . ASN A 1 680  ? -10.216 55.239 -4.074  1.00 73.57  ? 677  ASN A CG  1 
ATOM 5279 O OD1 . ASN A 1 680  ? -9.241  54.925 -4.762  1.00 73.57  ? 677  ASN A OD1 1 
ATOM 5280 N ND2 . ASN A 1 680  ? -11.144 54.365 -3.705  1.00 73.57  ? 677  ASN A ND2 1 
ATOM 5281 N N   . TYR A 1 681  ? -10.278 59.182 -1.757  1.00 72.51  ? 678  TYR A N   1 
ATOM 5282 C CA  . TYR A 1 681  ? -10.253 60.618 -1.439  1.00 72.51  ? 678  TYR A CA  1 
ATOM 5283 C C   . TYR A 1 681  ? -10.575 60.859 0.029   1.00 72.51  ? 678  TYR A C   1 
ATOM 5284 O O   . TYR A 1 681  ? -11.128 59.984 0.688   1.00 72.51  ? 678  TYR A O   1 
ATOM 5285 C CB  . TYR A 1 681  ? -11.186 61.403 -2.382  1.00 60.94  ? 678  TYR A CB  1 
ATOM 5286 C CG  . TYR A 1 681  ? -10.909 61.042 -3.820  1.00 60.94  ? 678  TYR A CG  1 
ATOM 5287 C CD1 . TYR A 1 681  ? -11.715 60.133 -4.491  1.00 60.94  ? 678  TYR A CD1 1 
ATOM 5288 C CD2 . TYR A 1 681  ? -9.773  61.531 -4.467  1.00 60.94  ? 678  TYR A CD2 1 
ATOM 5289 C CE1 . TYR A 1 681  ? -11.428 59.747 -5.782  1.00 60.94  ? 678  TYR A CE1 1 
ATOM 5290 C CE2 . TYR A 1 681  ? -9.473  61.154 -5.757  1.00 60.94  ? 678  TYR A CE2 1 
ATOM 5291 C CZ  . TYR A 1 681  ? -10.310 60.261 -6.417  1.00 60.94  ? 678  TYR A CZ  1 
ATOM 5292 O OH  . TYR A 1 681  ? -10.017 59.889 -7.717  1.00 60.94  ? 678  TYR A OH  1 
ATOM 5293 N N   . MET A 1 682  ? -10.202 62.029 0.547   1.00 59.56  ? 679  MET A N   1 
ATOM 5294 C CA  . MET A 1 682  ? -10.368 62.342 1.976   1.00 59.56  ? 679  MET A CA  1 
ATOM 5295 C C   . MET A 1 682  ? -10.172 63.822 2.229   1.00 59.56  ? 679  MET A C   1 
ATOM 5296 O O   . MET A 1 682  ? -9.344  64.448 1.579   1.00 59.56  ? 679  MET A O   1 
ATOM 5297 C CB  . MET A 1 682  ? -9.380  61.536 2.845   1.00 74.49  ? 679  MET A CB  1 
ATOM 5298 C CG  . MET A 1 682  ? -9.034  62.150 4.212   1.00 74.49  ? 679  MET A CG  1 
ATOM 5299 S SD  . MET A 1 682  ? -7.943  63.609 4.136   1.00 74.49  ? 679  MET A SD  1 
ATOM 5300 C CE  . MET A 1 682  ? -7.999  64.212 5.811   1.00 74.49  ? 679  MET A CE  1 
ATOM 5301 N N   . CYS A 1 683  ? -10.922 64.360 3.194   1.00 78.36  ? 680  CYS A N   1 
ATOM 5302 C CA  . CYS A 1 683  ? -10.782 65.738 3.657   1.00 78.36  ? 680  CYS A CA  1 
ATOM 5303 C C   . CYS A 1 683  ? -11.118 65.844 5.151   1.00 78.36  ? 680  CYS A C   1 
ATOM 5304 O O   . CYS A 1 683  ? -11.902 65.037 5.661   1.00 78.36  ? 680  CYS A O   1 
ATOM 5305 C CB  . CYS A 1 683  ? -11.698 66.656 2.854   1.00 93.13  ? 680  CYS A CB  1 
ATOM 5306 S SG  . CYS A 1 683  ? -13.403 66.671 3.405   1.00 93.13  ? 680  CYS A SG  1 
ATOM 5307 N N   . PRO A 1 684  ? -10.542 66.847 5.849   1.00 81.82  ? 681  PRO A N   1 
ATOM 5308 C CA  . PRO A 1 684  ? -10.822 67.142 7.248   1.00 81.82  ? 681  PRO A CA  1 
ATOM 5309 C C   . PRO A 1 684  ? -12.217 67.700 7.366   1.00 81.82  ? 681  PRO A C   1 
ATOM 5310 O O   . PRO A 1 684  ? -12.753 68.132 6.359   1.00 81.82  ? 681  PRO A O   1 
ATOM 5311 C CB  . PRO A 1 684  ? -9.817  68.250 7.574   1.00 71.69  ? 681  PRO A CB  1 
ATOM 5312 C CG  . PRO A 1 684  ? -8.793  68.205 6.498   1.00 71.69  ? 681  PRO A CG  1 
ATOM 5313 C CD  . PRO A 1 684  ? -9.556  67.789 5.299   1.00 71.69  ? 681  PRO A CD  1 
ATOM 5314 N N   . LEU A 1 685  ? -12.800 67.711 8.566   1.00 108.46 ? 682  LEU A N   1 
ATOM 5315 C CA  . LEU A 1 685  ? -14.197 68.158 8.743   1.00 108.46 ? 682  LEU A CA  1 
ATOM 5316 C C   . LEU A 1 685  ? -14.495 68.868 10.083  1.00 108.46 ? 682  LEU A C   1 
ATOM 5317 O O   . LEU A 1 685  ? -13.573 69.209 10.812  1.00 108.46 ? 682  LEU A O   1 
ATOM 5318 C CB  . LEU A 1 685  ? -15.149 66.981 8.505   1.00 59.92  ? 682  LEU A CB  1 
ATOM 5319 C CG  . LEU A 1 685  ? -16.615 67.271 8.120   1.00 59.92  ? 682  LEU A CG  1 
ATOM 5320 C CD1 . LEU A 1 685  ? -16.816 68.559 7.265   1.00 59.92  ? 682  LEU A CD1 1 
ATOM 5321 C CD2 . LEU A 1 685  ? -17.252 66.025 7.447   1.00 59.92  ? 682  LEU A CD2 1 
ATOM 5322 N N   . ASN A 1 686  ? -15.777 69.104 10.385  1.00 141.81 ? 683  ASN A N   1 
ATOM 5323 C CA  . ASN A 1 686  ? -16.219 69.785 11.619  1.00 141.81 ? 683  ASN A CA  1 
ATOM 5324 C C   . ASN A 1 686  ? -17.744 69.931 11.732  1.00 141.81 ? 683  ASN A C   1 
ATOM 5325 O O   . ASN A 1 686  ? -18.235 70.991 12.116  1.00 141.81 ? 683  ASN A O   1 
ATOM 5326 C CB  . ASN A 1 686  ? -15.568 71.169 11.727  1.00 74.26  ? 683  ASN A CB  1 
ATOM 5327 C CG  . ASN A 1 686  ? -14.612 71.286 12.913  1.00 74.26  ? 683  ASN A CG  1 
ATOM 5328 O OD1 . ASN A 1 686  ? -14.823 70.682 13.958  1.00 74.26  ? 683  ASN A OD1 1 
ATOM 5329 N ND2 . ASN A 1 686  ? -13.580 72.097 12.763  1.00 74.26  ? 683  ASN A ND2 1 
ATOM 5330 N N   . SER A 1 687  ? -18.479 68.853 11.460  1.00 134.87 ? 684  SER A N   1 
ATOM 5331 C CA  . SER A 1 687  ? -19.881 68.946 11.006  1.00 134.87 ? 684  SER A CA  1 
ATOM 5332 C C   . SER A 1 687  ? -21.047 69.014 12.030  1.00 134.87 ? 684  SER A C   1 
ATOM 5333 O O   . SER A 1 687  ? -20.847 69.267 13.229  1.00 134.87 ? 684  SER A O   1 
ATOM 5334 C CB  . SER A 1 687  ? -20.148 67.845 9.975   1.00 115.81 ? 684  SER A CB  1 
ATOM 5335 O OG  . SER A 1 687  ? -21.140 68.254 9.048   1.00 115.81 ? 684  SER A OG  1 
ATOM 5336 N N   . ASP A 1 688  ? -22.263 68.807 11.500  1.00 157.85 ? 685  ASP A N   1 
ATOM 5337 C CA  . ASP A 1 688  ? -23.554 68.911 12.210  1.00 157.85 ? 685  ASP A CA  1 
ATOM 5338 C C   . ASP A 1 688  ? -23.916 67.578 12.855  1.00 157.85 ? 685  ASP A C   1 
ATOM 5339 O O   . ASP A 1 688  ? -23.944 67.463 14.078  1.00 157.85 ? 685  ASP A O   1 
ATOM 5340 C CB  . ASP A 1 688  ? -24.659 69.391 11.228  1.00 125.05 ? 685  ASP A CB  1 
ATOM 5341 C CG  . ASP A 1 688  ? -26.086 69.243 11.779  1.00 125.05 ? 685  ASP A CG  1 
ATOM 5342 O OD1 . ASP A 1 688  ? -26.627 68.117 11.761  1.00 125.05 ? 685  ASP A OD1 1 
ATOM 5343 O OD2 . ASP A 1 688  ? -26.683 70.266 12.182  1.00 125.05 ? 685  ASP A OD2 1 
ATOM 5344 N N   . GLY A 1 689  ? -24.190 66.579 12.023  1.00 129.67 ? 686  GLY A N   1 
ATOM 5345 C CA  . GLY A 1 689  ? -24.438 65.230 12.502  1.00 129.67 ? 686  GLY A CA  1 
ATOM 5346 C C   . GLY A 1 689  ? -23.165 64.433 12.748  1.00 129.67 ? 686  GLY A C   1 
ATOM 5347 O O   . GLY A 1 689  ? -23.233 63.338 13.318  1.00 129.67 ? 686  GLY A O   1 
ATOM 5348 N N   . TYR A 1 690  ? -22.009 64.958 12.310  1.00 77.70  ? 687  TYR A N   1 
ATOM 5349 C CA  . TYR A 1 690  ? -20.723 64.277 12.498  1.00 77.70  ? 687  TYR A CA  1 
ATOM 5350 C C   . TYR A 1 690  ? -19.521 65.235 12.757  1.00 77.70  ? 687  TYR A C   1 
ATOM 5351 O O   . TYR A 1 690  ? -18.599 65.305 11.942  1.00 77.70  ? 687  TYR A O   1 
ATOM 5352 C CB  . TYR A 1 690  ? -20.456 63.339 11.309  1.00 103.35 ? 687  TYR A CB  1 
ATOM 5353 C CG  . TYR A 1 690  ? -21.641 62.468 10.904  1.00 103.35 ? 687  TYR A CG  1 
ATOM 5354 C CD1 . TYR A 1 690  ? -21.746 61.142 11.332  1.00 103.35 ? 687  TYR A CD1 1 
ATOM 5355 C CD2 . TYR A 1 690  ? -22.652 62.971 10.082  1.00 103.35 ? 687  TYR A CD2 1 
ATOM 5356 C CE1 . TYR A 1 690  ? -22.842 60.334 10.951  1.00 103.35 ? 687  TYR A CE1 1 
ATOM 5357 C CE2 . TYR A 1 690  ? -23.752 62.178 9.701   1.00 103.35 ? 687  TYR A CE2 1 
ATOM 5358 C CZ  . TYR A 1 690  ? -23.843 60.864 10.135  1.00 103.35 ? 687  TYR A CZ  1 
ATOM 5359 O OH  . TYR A 1 690  ? -24.931 60.100 9.751   1.00 103.35 ? 687  TYR A OH  1 
ATOM 5360 N N   . PRO A 1 691  ? -19.523 65.953 13.909  1.00 110.39 ? 688  PRO A N   1 
ATOM 5361 C CA  . PRO A 1 691  ? -18.524 66.995 14.272  1.00 110.39 ? 688  PRO A CA  1 
ATOM 5362 C C   . PRO A 1 691  ? -17.067 66.525 14.324  1.00 110.39 ? 688  PRO A C   1 
ATOM 5363 O O   . PRO A 1 691  ? -16.821 65.329 14.172  1.00 110.39 ? 688  PRO A O   1 
ATOM 5364 C CB  . PRO A 1 691  ? -18.991 67.465 15.657  1.00 112.74 ? 688  PRO A CB  1 
ATOM 5365 C CG  . PRO A 1 691  ? -20.445 67.145 15.679  1.00 112.74 ? 688  PRO A CG  1 
ATOM 5366 C CD  . PRO A 1 691  ? -20.538 65.819 14.968  1.00 112.74 ? 688  PRO A CD  1 
ATOM 5367 N N   . ASP A 1 692  ? -16.134 67.459 14.566  1.00 121.36 ? 689  ASP A N   1 
ATOM 5368 C CA  . ASP A 1 692  ? -14.677 67.288 14.293  1.00 121.36 ? 689  ASP A CA  1 
ATOM 5369 C C   . ASP A 1 692  ? -14.236 65.884 13.848  1.00 121.36 ? 689  ASP A C   1 
ATOM 5370 O O   . ASP A 1 692  ? -14.267 64.927 14.622  1.00 121.36 ? 689  ASP A O   1 
ATOM 5371 C CB  . ASP A 1 692  ? -13.803 67.818 15.438  1.00 70.18  ? 689  ASP A CB  1 
ATOM 5372 C CG  . ASP A 1 692  ? -12.298 67.522 15.234  1.00 70.18  ? 689  ASP A CG  1 
ATOM 5373 O OD1 . ASP A 1 692  ? -11.458 68.220 15.860  1.00 70.18  ? 689  ASP A OD1 1 
ATOM 5374 O OD2 . ASP A 1 692  ? -11.953 66.581 14.466  1.00 70.18  ? 689  ASP A OD2 1 
ATOM 5375 N N   . SER A 1 693  ? -13.772 65.798 12.605  1.00 92.31  ? 690  SER A N   1 
ATOM 5376 C CA  . SER A 1 693  ? -13.814 64.550 11.860  1.00 92.31  ? 690  SER A CA  1 
ATOM 5377 C C   . SER A 1 693  ? -12.904 64.588 10.623  1.00 92.31  ? 690  SER A C   1 
ATOM 5378 O O   . SER A 1 693  ? -12.024 65.438 10.504  1.00 92.31  ? 690  SER A O   1 
ATOM 5379 C CB  . SER A 1 693  ? -15.281 64.254 11.462  1.00 114.33 ? 690  SER A CB  1 
ATOM 5380 O OG  . SER A 1 693  ? -15.447 63.049 10.727  1.00 114.33 ? 690  SER A OG  1 
ATOM 5381 N N   . LEU A 1 694  ? -13.156 63.635 9.727   1.00 60.51  ? 691  LEU A N   1 
ATOM 5382 C CA  . LEU A 1 694  ? -12.440 63.368 8.498   1.00 60.51  ? 691  LEU A CA  1 
ATOM 5383 C C   . LEU A 1 694  ? -13.436 62.642 7.566   1.00 60.51  ? 691  LEU A C   1 
ATOM 5384 O O   . LEU A 1 694  ? -14.048 61.622 7.941   1.00 60.51  ? 691  LEU A O   1 
ATOM 5385 C CB  . LEU A 1 694  ? -11.241 62.442 8.742   1.00 98.32  ? 691  LEU A CB  1 
ATOM 5386 C CG  . LEU A 1 694  ? -10.091 62.718 9.716   1.00 98.32  ? 691  LEU A CG  1 
ATOM 5387 C CD1 . LEU A 1 694  ? -9.145  61.543 9.654   1.00 98.32  ? 691  LEU A CD1 1 
ATOM 5388 C CD2 . LEU A 1 694  ? -9.324  64.014 9.422   1.00 98.32  ? 691  LEU A CD2 1 
ATOM 5389 N N   . ALA A 1 695  ? -13.619 63.186 6.364   1.00 73.96  ? 692  ALA A N   1 
ATOM 5390 C CA  . ALA A 1 695  ? -14.476 62.552 5.380   1.00 73.96  ? 692  ALA A CA  1 
ATOM 5391 C C   . ALA A 1 695  ? -13.628 61.535 4.652   1.00 73.96  ? 692  ALA A C   1 
ATOM 5392 O O   . ALA A 1 695  ? -12.445 61.788 4.439   1.00 73.96  ? 692  ALA A O   1 
ATOM 5393 C CB  . ALA A 1 695  ? -15.010 63.574 4.420   1.00 95.72  ? 692  ALA A CB  1 
ATOM 5394 N N   . LEU A 1 696  ? -14.197 60.384 4.282   1.00 50.77  ? 693  LEU A N   1 
ATOM 5395 C CA  . LEU A 1 696  ? -13.401 59.420 3.525   1.00 50.77  ? 693  LEU A CA  1 
ATOM 5396 C C   . LEU A 1 696  ? -14.083 58.767 2.338   1.00 50.77  ? 693  LEU A C   1 
ATOM 5397 O O   . LEU A 1 696  ? -15.034 58.000 2.495   1.00 50.77  ? 693  LEU A O   1 
ATOM 5398 C CB  . LEU A 1 696  ? -12.754 58.377 4.440   1.00 65.89  ? 693  LEU A CB  1 
ATOM 5399 C CG  . LEU A 1 696  ? -11.516 58.900 5.174   1.00 65.89  ? 693  LEU A CG  1 
ATOM 5400 C CD1 . LEU A 1 696  ? -11.840 59.373 6.593   1.00 65.89  ? 693  LEU A CD1 1 
ATOM 5401 C CD2 . LEU A 1 696  ? -10.485 57.817 5.220   1.00 65.89  ? 693  LEU A CD2 1 
ATOM 5402 N N   . ALA A 1 697  ? -13.583 59.060 1.148   1.00 85.73  ? 694  ALA A N   1 
ATOM 5403 C CA  . ALA A 1 697  ? -14.082 58.421 -0.058  1.00 85.73  ? 694  ALA A CA  1 
ATOM 5404 C C   . ALA A 1 697  ? -13.308 57.146 -0.291  1.00 85.73  ? 694  ALA A C   1 
ATOM 5405 O O   . ALA A 1 697  ? -12.087 57.171 -0.466  1.00 85.73  ? 694  ALA A O   1 
ATOM 5406 C CB  . ALA A 1 697  ? -13.939 59.342 -1.251  1.00 115.01 ? 694  ALA A CB  1 
ATOM 5407 N N   . ASN A 1 698  ? -14.017 56.030 -0.298  1.00 79.13  ? 695  ASN A N   1 
ATOM 5408 C CA  . ASN A 1 698  ? -13.357 54.751 -0.507  1.00 79.13  ? 695  ASN A CA  1 
ATOM 5409 C C   . ASN A 1 698  ? -13.821 54.040 -1.764  1.00 79.13  ? 695  ASN A C   1 
ATOM 5410 O O   . ASN A 1 698  ? -14.614 54.597 -2.534  1.00 79.13  ? 695  ASN A O   1 
ATOM 5411 C CB  . ASN A 1 698  ? -13.476 53.859 0.738   1.00 148.73 ? 695  ASN A CB  1 
ATOM 5412 C CG  . ASN A 1 698  ? -14.896 53.734 1.241   1.00 148.73 ? 695  ASN A CG  1 
ATOM 5413 O OD1 . ASN A 1 698  ? -15.456 54.672 1.818   1.00 148.73 ? 695  ASN A OD1 1 
ATOM 5414 N ND2 . ASN A 1 698  ? -15.480 52.561 1.046   1.00 148.73 ? 695  ASN A ND2 1 
ATOM 5415 N N   . ASN A 1 699  ? -13.300 52.827 -1.964  1.00 106.04 ? 696  ASN A N   1 
ATOM 5416 C CA  . ASN A 1 699  ? -13.598 51.972 -3.120  1.00 106.04 ? 696  ASN A CA  1 
ATOM 5417 C C   . ASN A 1 699  ? -14.978 52.233 -3.739  1.00 106.04 ? 696  ASN A C   1 
ATOM 5418 O O   . ASN A 1 699  ? -15.074 52.826 -4.817  1.00 106.04 ? 696  ASN A O   1 
ATOM 5419 C CB  . ASN A 1 699  ? -13.439 50.493 -2.725  1.00 144.56 ? 696  ASN A CB  1 
ATOM 5420 C CG  . ASN A 1 699  ? -13.153 49.582 -3.914  1.00 144.56 ? 696  ASN A CG  1 
ATOM 5421 O OD1 . ASN A 1 699  ? -13.161 50.010 -5.068  1.00 144.56 ? 696  ASN A OD1 1 
ATOM 5422 N ND2 . ASN A 1 699  ? -12.896 48.312 -3.627  1.00 144.56 ? 696  ASN A ND2 1 
ATOM 5423 N N   . SER A 1 700  ? -16.029 51.796 -3.038  1.00 135.61 ? 697  SER A N   1 
ATOM 5424 C CA  . SER A 1 700  ? -17.421 52.062 -3.417  1.00 135.61 ? 697  SER A CA  1 
ATOM 5425 C C   . SER A 1 700  ? -18.320 52.168 -2.180  1.00 135.61 ? 697  SER A C   1 
ATOM 5426 O O   . SER A 1 700  ? -19.354 51.509 -2.084  1.00 135.61 ? 697  SER A O   1 
ATOM 5427 C CB  . SER A 1 700  ? -17.945 50.992 -4.379  1.00 156.36 ? 697  SER A CB  1 
ATOM 5428 O OG  . SER A 1 700  ? -18.252 49.796 -3.688  1.00 156.36 ? 697  SER A OG  1 
ATOM 5429 N N   . THR A 1 701  ? -17.889 52.991 -1.231  1.00 83.63  ? 698  THR A N   1 
ATOM 5430 C CA  . THR A 1 701  ? -18.674 53.375 -0.060  1.00 83.63  ? 698  THR A CA  1 
ATOM 5431 C C   . THR A 1 701  ? -18.253 54.805 0.262   1.00 83.63  ? 698  THR A C   1 
ATOM 5432 O O   . THR A 1 701  ? -17.428 55.371 -0.447  1.00 83.63  ? 698  THR A O   1 
ATOM 5433 C CB  . THR A 1 701  ? -18.357 52.468 1.148   1.00 101.24 ? 698  THR A CB  1 
ATOM 5434 O OG1 . THR A 1 701  ? -18.425 51.091 0.756   1.00 101.24 ? 698  THR A OG1 1 
ATOM 5435 C CG2 . THR A 1 701  ? -19.315 52.726 2.306   1.00 101.24 ? 698  THR A CG2 1 
ATOM 5436 N N   . LEU A 1 702  ? -18.817 55.398 1.306   1.00 94.88  ? 699  LEU A N   1 
ATOM 5437 C CA  . LEU A 1 702  ? -18.253 56.619 1.890   1.00 94.88  ? 699  LEU A CA  1 
ATOM 5438 C C   . LEU A 1 702  ? -18.347 56.522 3.409   1.00 94.88  ? 699  LEU A C   1 
ATOM 5439 O O   . LEU A 1 702  ? -19.063 55.659 3.943   1.00 94.88  ? 699  LEU A O   1 
ATOM 5440 C CB  . LEU A 1 702  ? -18.915 57.896 1.339   1.00 66.04  ? 699  LEU A CB  1 
ATOM 5441 C CG  . LEU A 1 702  ? -19.254 59.092 2.251   1.00 66.04  ? 699  LEU A CG  1 
ATOM 5442 C CD1 . LEU A 1 702  ? -18.116 60.082 2.490   1.00 66.04  ? 699  LEU A CD1 1 
ATOM 5443 C CD2 . LEU A 1 702  ? -20.432 59.814 1.668   1.00 66.04  ? 699  LEU A CD2 1 
ATOM 5444 N N   . THR A 1 703  ? -17.598 57.383 4.095   1.00 102.41 ? 700  THR A N   1 
ATOM 5445 C CA  . THR A 1 703  ? -17.422 57.257 5.525   1.00 102.41 ? 700  THR A CA  1 
ATOM 5446 C C   . THR A 1 703  ? -17.002 58.570 6.176   1.00 102.41 ? 700  THR A C   1 
ATOM 5447 O O   . THR A 1 703  ? -16.461 59.462 5.520   1.00 102.41 ? 700  THR A O   1 
ATOM 5448 C CB  . THR A 1 703  ? -16.390 56.157 5.855   1.00 99.16  ? 700  THR A CB  1 
ATOM 5449 O OG1 . THR A 1 703  ? -16.168 55.328 4.703   1.00 99.16  ? 700  THR A OG1 1 
ATOM 5450 C CG2 . THR A 1 703  ? -16.898 55.300 6.997   1.00 99.16  ? 700  THR A CG2 1 
ATOM 5451 N N   . ILE A 1 704  ? -17.289 58.676 7.472   1.00 88.14  ? 701  ILE A N   1 
ATOM 5452 C CA  . ILE A 1 704  ? -16.961 59.832 8.295   1.00 88.14  ? 701  ILE A CA  1 
ATOM 5453 C C   . ILE A 1 704  ? -16.788 59.358 9.729   1.00 88.14  ? 701  ILE A C   1 
ATOM 5454 O O   . ILE A 1 704  ? -17.589 58.549 10.209  1.00 88.14  ? 701  ILE A O   1 
ATOM 5455 C CB  . ILE A 1 704  ? -18.074 60.907 8.281   1.00 106.59 ? 701  ILE A CB  1 
ATOM 5456 C CG1 . ILE A 1 704  ? -19.454 60.288 7.964   1.00 106.59 ? 701  ILE A CG1 1 
ATOM 5457 C CG2 . ILE A 1 704  ? -17.692 62.067 7.364   1.00 106.59 ? 701  ILE A CG2 1 
ATOM 5458 C CD1 . ILE A 1 704  ? -19.822 60.165 6.473   1.00 106.59 ? 701  ILE A CD1 1 
ATOM 5459 N N   . GLY A 1 705  ? -15.752 59.873 10.398  1.00 57.41  ? 702  GLY A N   1 
ATOM 5460 C CA  . GLY A 1 705  ? -15.416 59.495 11.766  1.00 57.41  ? 702  GLY A CA  1 
ATOM 5461 C C   . GLY A 1 705  ? -14.197 60.251 12.271  1.00 57.41  ? 702  GLY A C   1 
ATOM 5462 O O   . GLY A 1 705  ? -13.585 61.010 11.517  1.00 57.41  ? 702  GLY A O   1 
ATOM 5463 N N   . THR A 1 706  ? -13.830 60.057 13.539  1.00 87.56  ? 703  THR A N   1 
ATOM 5464 C CA  . THR A 1 706  ? -12.658 60.760 14.072  1.00 87.56  ? 703  THR A CA  1 
ATOM 5465 C C   . THR A 1 706  ? -11.404 59.909 13.951  1.00 87.56  ? 703  THR A C   1 
ATOM 5466 O O   . THR A 1 706  ? -11.449 58.796 13.437  1.00 87.56  ? 703  THR A O   1 
ATOM 5467 C CB  . THR A 1 706  ? -12.849 61.205 15.520  1.00 55.58  ? 703  THR A CB  1 
ATOM 5468 O OG1 . THR A 1 706  ? -12.902 60.050 16.359  1.00 55.58  ? 703  THR A OG1 1 
ATOM 5469 C CG2 . THR A 1 706  ? -14.139 61.989 15.660  1.00 55.58  ? 703  THR A CG2 1 
ATOM 5470 N N   . ILE A 1 707  ? -10.280 60.422 14.434  1.00 66.08  ? 704  ILE A N   1 
ATOM 5471 C CA  . ILE A 1 707  ? -9.016  59.742 14.192  1.00 66.08  ? 704  ILE A CA  1 
ATOM 5472 C C   . ILE A 1 707  ? -8.103  59.582 15.428  1.00 66.08  ? 704  ILE A C   1 
ATOM 5473 O O   . ILE A 1 707  ? -8.066  60.433 16.303  1.00 66.08  ? 704  ILE A O   1 
ATOM 5474 C CB  . ILE A 1 707  ? -8.270  60.420 13.034  1.00 46.66  ? 704  ILE A CB  1 
ATOM 5475 C CG1 . ILE A 1 707  ? -7.125  59.537 12.533  1.00 46.66  ? 704  ILE A CG1 1 
ATOM 5476 C CG2 . ILE A 1 707  ? -7.794  61.808 13.453  1.00 46.66  ? 704  ILE A CG2 1 
ATOM 5477 C CD1 . ILE A 1 707  ? -5.760  60.236 12.582  1.00 46.66  ? 704  ILE A CD1 1 
ATOM 5478 N N   . ASP A 1 708  ? -7.346  58.490 15.424  1.00 53.12  ? 705  ASP A N   1 
ATOM 5479 C CA  . ASP A 1 708  ? -6.562  57.979 16.536  1.00 53.12  ? 705  ASP A CA  1 
ATOM 5480 C C   . ASP A 1 708  ? -5.365  58.867 16.849  1.00 53.12  ? 705  ASP A C   1 
ATOM 5481 O O   . ASP A 1 708  ? -5.120  59.826 16.147  1.00 53.12  ? 705  ASP A O   1 
ATOM 5482 C CB  . ASP A 1 708  ? -6.046  56.586 16.151  1.00 114.36 ? 705  ASP A CB  1 
ATOM 5483 C CG  . ASP A 1 708  ? -6.508  55.494 17.092  1.00 114.36 ? 705  ASP A CG  1 
ATOM 5484 O OD1 . ASP A 1 708  ? -7.523  55.693 17.795  1.00 114.36 ? 705  ASP A OD1 1 
ATOM 5485 O OD2 . ASP A 1 708  ? -5.860  54.422 17.104  1.00 114.36 ? 705  ASP A OD2 1 
ATOM 5486 N N   . GLU A 1 709  ? -4.595  58.482 17.863  1.00 106.70 ? 706  GLU A N   1 
ATOM 5487 C CA  . GLU A 1 709  ? -3.374  59.190 18.242  1.00 106.70 ? 706  GLU A CA  1 
ATOM 5488 C C   . GLU A 1 709  ? -2.518  59.621 17.047  1.00 106.70 ? 706  GLU A C   1 
ATOM 5489 O O   . GLU A 1 709  ? -2.935  60.460 16.250  1.00 106.70 ? 706  GLU A O   1 
ATOM 5490 C CB  . GLU A 1 709  ? -2.539  58.337 19.200  1.00 111.23 ? 706  GLU A CB  1 
ATOM 5491 C CG  . GLU A 1 709  ? -1.774  59.139 20.240  1.00 111.23 ? 706  GLU A CG  1 
ATOM 5492 C CD  . GLU A 1 709  ? -2.495  59.205 21.572  1.00 111.23 ? 706  GLU A CD  1 
ATOM 5493 O OE1 . GLU A 1 709  ? -2.954  58.148 22.054  1.00 111.23 ? 706  GLU A OE1 1 
ATOM 5494 O OE2 . GLU A 1 709  ? -2.603  60.314 22.137  1.00 111.23 ? 706  GLU A OE2 1 
ATOM 5495 N N   . ILE A 1 710  ? -1.318  59.052 16.935  1.00 68.66  ? 707  ILE A N   1 
ATOM 5496 C CA  . ILE A 1 710  ? -0.371  59.483 15.927  1.00 68.66  ? 707  ILE A CA  1 
ATOM 5497 C C   . ILE A 1 710  ? 0.560   58.315 15.664  1.00 68.66  ? 707  ILE A C   1 
ATOM 5498 O O   . ILE A 1 710  ? 0.510   57.698 14.601  1.00 68.66  ? 707  ILE A O   1 
ATOM 5499 C CB  . ILE A 1 710  ? 0.412   60.756 16.398  1.00 92.55  ? 707  ILE A CB  1 
ATOM 5500 C CG1 . ILE A 1 710  ? -0.329  62.052 16.007  1.00 92.55  ? 707  ILE A CG1 1 
ATOM 5501 C CG2 . ILE A 1 710  ? 1.853   60.791 15.859  1.00 92.55  ? 707  ILE A CG2 1 
ATOM 5502 C CD1 . ILE A 1 710  ? -1.116  62.740 17.129  1.00 92.55  ? 707  ILE A CD1 1 
ATOM 5503 N N   . GLN A 1 711  ? 1.360   57.985 16.676  1.00 54.94  ? 708  GLN A N   1 
ATOM 5504 C CA  . GLN A 1 711  ? 2.420   56.971 16.639  1.00 54.94  ? 708  GLN A CA  1 
ATOM 5505 C C   . GLN A 1 711  ? 2.223   55.786 15.691  1.00 54.94  ? 708  GLN A C   1 
ATOM 5506 O O   . GLN A 1 711  ? 1.128   55.513 15.221  1.00 54.94  ? 708  GLN A O   1 
ATOM 5507 C CB  . GLN A 1 711  ? 2.692   56.499 18.078  1.00 156.06 ? 708  GLN A CB  1 
ATOM 5508 C CG  . GLN A 1 711  ? 1.734   57.137 19.106  1.00 156.06 ? 708  GLN A CG  1 
ATOM 5509 C CD  . GLN A 1 711  ? 1.705   56.444 20.461  1.00 156.06 ? 708  GLN A CD  1 
ATOM 5510 O OE1 . GLN A 1 711  ? 0.706   56.515 21.176  1.00 156.06 ? 708  GLN A OE1 1 
ATOM 5511 N NE2 . GLN A 1 711  ? 2.794   55.772 20.819  1.00 156.06 ? 708  GLN A NE2 1 
ATOM 5512 N N   . LYS A 1 712  ? 3.309   55.090 15.403  1.00 60.50  ? 709  LYS A N   1 
ATOM 5513 C CA  . LYS A 1 712  ? 3.229   53.786 14.732  1.00 60.50  ? 709  LYS A CA  1 
ATOM 5514 C C   . LYS A 1 712  ? 2.412   52.821 15.611  1.00 60.50  ? 709  LYS A C   1 
ATOM 5515 O O   . LYS A 1 712  ? 1.541   52.109 15.110  1.00 60.50  ? 709  LYS A O   1 
ATOM 5516 C CB  . LYS A 1 712  ? 4.637   53.231 14.458  1.00 113.59 ? 709  LYS A CB  1 
ATOM 5517 C CG  . LYS A 1 712  ? 4.705   52.028 13.513  1.00 113.59 ? 709  LYS A CG  1 
ATOM 5518 C CD  . LYS A 1 712  ? 6.150   51.532 13.344  1.00 113.59 ? 709  LYS A CD  1 
ATOM 5519 C CE  . LYS A 1 712  ? 6.316   50.602 12.136  1.00 113.59 ? 709  LYS A CE  1 
ATOM 5520 N NZ  . LYS A 1 712  ? 5.860   49.204 12.398  1.00 113.59 ? 709  LYS A NZ  1 
ATOM 5521 N N   . LEU A 1 713  ? 2.687   52.835 16.920  1.00 44.08  ? 710  LEU A N   1 
ATOM 5522 C CA  . LEU A 1 713  ? 1.937   52.013 17.877  1.00 44.08  ? 710  LEU A CA  1 
ATOM 5523 C C   . LEU A 1 713  ? 0.897   52.774 18.690  1.00 44.08  ? 710  LEU A C   1 
ATOM 5524 O O   . LEU A 1 713  ? 1.158   53.838 19.214  1.00 44.08  ? 710  LEU A O   1 
ATOM 5525 C CB  . LEU A 1 713  ? 2.875   51.227 18.817  1.00 55.56  ? 710  LEU A CB  1 
ATOM 5526 C CG  . LEU A 1 713  ? 3.395   49.832 18.410  1.00 55.56  ? 710  LEU A CG  1 
ATOM 5527 C CD1 . LEU A 1 713  ? 3.091   49.404 16.954  1.00 55.56  ? 710  LEU A CD1 1 
ATOM 5528 C CD2 . LEU A 1 713  ? 4.903   49.728 18.699  1.00 55.56  ? 710  LEU A CD2 1 
ATOM 5529 N N   . HIS A 1 714  ? -0.282  52.184 18.791  1.00 60.02  ? 711  HIS A N   1 
ATOM 5530 C CA  . HIS A 1 714  ? -1.311  52.629 19.706  1.00 60.02  ? 711  HIS A CA  1 
ATOM 5531 C C   . HIS A 1 714  ? -1.165  51.882 21.046  1.00 60.02  ? 711  HIS A C   1 
ATOM 5532 O O   . HIS A 1 714  ? -0.983  50.658 21.041  1.00 60.02  ? 711  HIS A O   1 
ATOM 5533 C CB  . HIS A 1 714  ? -2.656  52.298 19.089  1.00 72.79  ? 711  HIS A CB  1 
ATOM 5534 C CG  . HIS A 1 714  ? -3.803  52.820 19.873  1.00 72.79  ? 711  HIS A CG  1 
ATOM 5535 N ND1 . HIS A 1 714  ? -4.162  54.149 19.854  1.00 72.79  ? 711  HIS A ND1 1 
ATOM 5536 C CD2 . HIS A 1 714  ? -4.648  52.209 20.733  1.00 72.79  ? 711  HIS A CD2 1 
ATOM 5537 C CE1 . HIS A 1 714  ? -5.195  54.331 20.657  1.00 72.79  ? 711  HIS A CE1 1 
ATOM 5538 N NE2 . HIS A 1 714  ? -5.513  53.169 21.197  1.00 72.79  ? 711  HIS A NE2 1 
ATOM 5539 N N   . ILE A 1 715  ? -1.253  52.605 22.174  1.00 43.26  ? 712  ILE A N   1 
ATOM 5540 C CA  . ILE A 1 715  ? -1.133  52.002 23.505  1.00 43.26  ? 712  ILE A CA  1 
ATOM 5541 C C   . ILE A 1 715  ? -2.243  52.368 24.561  1.00 43.26  ? 712  ILE A C   1 
ATOM 5542 O O   . ILE A 1 715  ? -2.376  53.539 24.959  1.00 43.26  ? 712  ILE A O   1 
ATOM 5543 C CB  . ILE A 1 715  ? 0.227   52.337 24.095  1.00 54.53  ? 712  ILE A CB  1 
ATOM 5544 C CG1 . ILE A 1 715  ? 1.350   51.991 23.116  1.00 54.53  ? 712  ILE A CG1 1 
ATOM 5545 C CG2 . ILE A 1 715  ? 0.412   51.607 25.431  1.00 54.53  ? 712  ILE A CG2 1 
ATOM 5546 C CD1 . ILE A 1 715  ? 2.688   52.592 23.511  1.00 54.53  ? 712  ILE A CD1 1 
ATOM 5547 N N   . ARG A 1 716  ? -2.962  51.365 25.084  1.00 62.84  ? 713  ARG A N   1 
ATOM 5548 C CA  . ARG A 1 716  ? -4.165  51.599 25.898  1.00 62.84  ? 713  ARG A CA  1 
ATOM 5549 C C   . ARG A 1 716  ? -3.989  51.998 27.382  1.00 62.84  ? 713  ARG A C   1 
ATOM 5550 O O   . ARG A 1 716  ? -4.429  53.070 27.791  1.00 62.84  ? 713  ARG A O   1 
ATOM 5551 C CB  . ARG A 1 716  ? -5.108  50.412 25.775  1.00 83.90  ? 713  ARG A CB  1 
ATOM 5552 C CG  . ARG A 1 716  ? -6.559  50.753 25.486  1.00 83.90  ? 713  ARG A CG  1 
ATOM 5553 C CD  . ARG A 1 716  ? -7.337  51.027 26.754  1.00 83.90  ? 713  ARG A CD  1 
ATOM 5554 N NE  . ARG A 1 716  ? -8.703  50.507 26.686  1.00 83.90  ? 713  ARG A NE  1 
ATOM 5555 C CZ  . ARG A 1 716  ? -9.594  50.632 27.667  1.00 83.90  ? 713  ARG A CZ  1 
ATOM 5556 N NH1 . ARG A 1 716  ? -9.261  51.271 28.790  1.00 83.90  ? 713  ARG A NH1 1 
ATOM 5557 N NH2 . ARG A 1 716  ? -10.813 50.123 27.534  1.00 83.90  ? 713  ARG A NH2 1 
ATOM 5558 N N   . THR A 1 717  ? -3.386  51.151 28.199  1.00 31.06  ? 714  THR A N   1 
ATOM 5559 C CA  . THR A 1 717  ? -3.147  51.442 29.660  1.00 31.06  ? 714  THR A CA  1 
ATOM 5560 C C   . THR A 1 717  ? -4.323  51.266 30.607  1.00 31.06  ? 714  THR A C   1 
ATOM 5561 O O   . THR A 1 717  ? -5.174  52.112 30.670  1.00 31.06  ? 714  THR A O   1 
ATOM 5562 C CB  . THR A 1 717  ? -2.587  52.850 29.957  1.00 32.09  ? 714  THR A CB  1 
ATOM 5563 O OG1 . THR A 1 717  ? -1.763  53.282 28.873  1.00 32.09  ? 714  THR A OG1 1 
ATOM 5564 C CG2 . THR A 1 717  ? -1.770  52.851 31.219  1.00 32.09  ? 714  THR A CG2 1 
ATOM 5565 N N   . VAL A 1 718  ? -4.328  50.178 31.370  1.00 47.88  ? 715  VAL A N   1 
ATOM 5566 C CA  . VAL A 1 718  ? -5.356  49.902 32.356  1.00 47.88  ? 715  VAL A CA  1 
ATOM 5567 C C   . VAL A 1 718  ? -4.584  49.878 33.657  1.00 47.88  ? 715  VAL A C   1 
ATOM 5568 O O   . VAL A 1 718  ? -3.955  48.880 33.962  1.00 47.88  ? 715  VAL A O   1 
ATOM 5569 C CB  . VAL A 1 718  ? -6.039  48.515 32.098  1.00 45.85  ? 715  VAL A CB  1 
ATOM 5570 C CG1 . VAL A 1 718  ? -7.087  48.168 33.153  1.00 45.85  ? 715  VAL A CG1 1 
ATOM 5571 C CG2 . VAL A 1 718  ? -6.654  48.462 30.710  1.00 45.85  ? 715  VAL A CG2 1 
ATOM 5572 N N   . PRO A 1 719  ? -4.592  50.992 34.409  1.00 44.93  ? 716  PRO A N   1 
ATOM 5573 C CA  . PRO A 1 719  ? -3.849  51.064 35.689  1.00 44.93  ? 716  PRO A CA  1 
ATOM 5574 C C   . PRO A 1 719  ? -4.332  50.008 36.691  1.00 44.93  ? 716  PRO A C   1 
ATOM 5575 O O   . PRO A 1 719  ? -5.507  49.707 36.712  1.00 44.93  ? 716  PRO A O   1 
ATOM 5576 C CB  . PRO A 1 719  ? -4.205  52.453 36.237  1.00 17.27  ? 716  PRO A CB  1 
ATOM 5577 C CG  . PRO A 1 719  ? -4.723  53.241 35.024  1.00 17.27  ? 716  PRO A CG  1 
ATOM 5578 C CD  . PRO A 1 719  ? -5.332  52.242 34.090  1.00 17.27  ? 716  PRO A CD  1 
ATOM 5579 N N   . LEU A 1 720  ? -3.444  49.473 37.527  1.00 44.22  ? 717  LEU A N   1 
ATOM 5580 C CA  . LEU A 1 720  ? -3.852  48.484 38.529  1.00 44.22  ? 717  LEU A CA  1 
ATOM 5581 C C   . LEU A 1 720  ? -3.484  48.797 39.979  1.00 44.22  ? 717  LEU A C   1 
ATOM 5582 O O   . LEU A 1 720  ? -4.083  48.270 40.885  1.00 44.22  ? 717  LEU A O   1 
ATOM 5583 C CB  . LEU A 1 720  ? -3.293  47.110 38.191  1.00 44.20  ? 717  LEU A CB  1 
ATOM 5584 C CG  . LEU A 1 720  ? -3.688  46.486 36.879  1.00 44.20  ? 717  LEU A CG  1 
ATOM 5585 C CD1 . LEU A 1 720  ? -2.722  45.357 36.551  1.00 44.20  ? 717  LEU A CD1 1 
ATOM 5586 C CD2 . LEU A 1 720  ? -5.078  45.987 37.014  1.00 44.20  ? 717  LEU A CD2 1 
ATOM 5587 N N   . TYR A 1 721  ? -2.503  49.641 40.195  1.00 37.17  ? 718  TYR A N   1 
ATOM 5588 C CA  . TYR A 1 721  ? -2.021  49.935 41.568  1.00 37.17  ? 718  TYR A CA  1 
ATOM 5589 C C   . TYR A 1 721  ? -1.495  48.743 42.356  1.00 37.17  ? 718  TYR A C   1 
ATOM 5590 O O   . TYR A 1 721  ? -1.372  48.842 43.574  1.00 37.17  ? 718  TYR A O   1 
ATOM 5591 C CB  . TYR A 1 721  ? -3.021  50.799 42.405  1.00 29.12  ? 718  TYR A CB  1 
ATOM 5592 C CG  . TYR A 1 721  ? -3.684  51.796 41.504  1.00 29.12  ? 718  TYR A CG  1 
ATOM 5593 C CD1 . TYR A 1 721  ? -4.973  51.591 41.053  1.00 29.12  ? 718  TYR A CD1 1 
ATOM 5594 C CD2 . TYR A 1 721  ? -2.957  52.866 40.971  1.00 29.12  ? 718  TYR A CD2 1 
ATOM 5595 C CE1 . TYR A 1 721  ? -5.515  52.456 40.155  1.00 29.12  ? 718  TYR A CE1 1 
ATOM 5596 C CE2 . TYR A 1 721  ? -3.502  53.706 40.095  1.00 29.12  ? 718  TYR A CE2 1 
ATOM 5597 C CZ  . TYR A 1 721  ? -4.753  53.484 39.695  1.00 29.12  ? 718  TYR A CZ  1 
ATOM 5598 O OH  . TYR A 1 721  ? -5.288  54.329 38.812  1.00 29.12  ? 718  TYR A OH  1 
ATOM 5599 N N   . GLU A 1 722  ? -1.178  47.639 41.668  1.00 48.87  ? 719  GLU A N   1 
ATOM 5600 C CA  . GLU A 1 722  ? -0.489  46.485 42.263  1.00 48.87  ? 719  GLU A CA  1 
ATOM 5601 C C   . GLU A 1 722  ? 0.232   45.747 41.143  1.00 48.87  ? 719  GLU A C   1 
ATOM 5602 O O   . GLU A 1 722  ? -0.032  46.013 39.969  1.00 48.87  ? 719  GLU A O   1 
ATOM 5603 C CB  . GLU A 1 722  ? -1.462  45.564 43.027  1.00 46.03  ? 719  GLU A CB  1 
ATOM 5604 C CG  . GLU A 1 722  ? -2.713  45.163 42.241  1.00 46.03  ? 719  GLU A CG  1 
ATOM 5605 C CD  . GLU A 1 722  ? -3.661  44.221 42.989  1.00 46.03  ? 719  GLU A CD  1 
ATOM 5606 O OE1 . GLU A 1 722  ? -3.444  43.003 42.944  1.00 46.03  ? 719  GLU A OE1 1 
ATOM 5607 O OE2 . GLU A 1 722  ? -4.651  44.684 43.596  1.00 46.03  ? 719  GLU A OE2 1 
ATOM 5608 N N   . SER A 1 723  ? 1.118   44.819 41.504  1.00 32.41  ? 720  SER A N   1 
ATOM 5609 C CA  . SER A 1 723  ? 1.973   44.070 40.572  1.00 32.41  ? 720  SER A CA  1 
ATOM 5610 C C   . SER A 1 723  ? 1.307   42.996 39.683  1.00 32.41  ? 720  SER A C   1 
ATOM 5611 O O   . SER A 1 723  ? 1.036   41.897 40.142  1.00 32.41  ? 720  SER A O   1 
ATOM 5612 C CB  . SER A 1 723  ? 3.047   43.393 41.391  1.00 45.92  ? 720  SER A CB  1 
ATOM 5613 O OG  . SER A 1 723  ? 3.845   44.357 42.046  1.00 45.92  ? 720  SER A OG  1 
ATOM 5614 N N   . PRO A 1 724  ? 1.094   43.259 38.387  1.00 24.48  ? 721  PRO A N   1 
ATOM 5615 C CA  . PRO A 1 724  ? 0.522   42.149 37.570  1.00 24.48  ? 721  PRO A CA  1 
ATOM 5616 C C   . PRO A 1 724  ? 1.633   41.170 37.201  1.00 24.48  ? 721  PRO A C   1 
ATOM 5617 O O   . PRO A 1 724  ? 2.733   41.582 36.809  1.00 24.48  ? 721  PRO A O   1 
ATOM 5618 C CB  . PRO A 1 724  ? 0.067   42.860 36.284  1.00 17.68  ? 721  PRO A CB  1 
ATOM 5619 C CG  . PRO A 1 724  ? 1.026   44.048 36.159  1.00 17.68  ? 721  PRO A CG  1 
ATOM 5620 C CD  . PRO A 1 724  ? 1.387   44.467 37.585  1.00 17.68  ? 721  PRO A CD  1 
ATOM 5621 N N   . ARG A 1 725  ? 1.373   39.875 37.287  1.00 29.35  ? 722  ARG A N   1 
ATOM 5622 C CA  . ARG A 1 725  ? 2.442   38.901 37.087  1.00 29.35  ? 722  ARG A CA  1 
ATOM 5623 C C   . ARG A 1 725  ? 2.226   37.876 35.964  1.00 29.35  ? 722  ARG A C   1 
ATOM 5624 O O   . ARG A 1 725  ? 3.179   37.452 35.346  1.00 29.35  ? 722  ARG A O   1 
ATOM 5625 C CB  . ARG A 1 725  ? 2.700   38.196 38.380  1.00 44.22  ? 722  ARG A CB  1 
ATOM 5626 C CG  . ARG A 1 725  ? 3.256   39.097 39.396  1.00 44.22  ? 722  ARG A CG  1 
ATOM 5627 C CD  . ARG A 1 725  ? 2.975   38.491 40.723  1.00 44.22  ? 722  ARG A CD  1 
ATOM 5628 N NE  . ARG A 1 725  ? 3.576   39.242 41.810  1.00 44.22  ? 722  ARG A NE  1 
ATOM 5629 C CZ  . ARG A 1 725  ? 4.772   38.968 42.287  1.00 44.22  ? 722  ARG A CZ  1 
ATOM 5630 N NH1 . ARG A 1 725  ? 5.454   37.965 41.756  1.00 44.22  ? 722  ARG A NH1 1 
ATOM 5631 N NH2 . ARG A 1 725  ? 5.263   39.661 43.300  1.00 44.22  ? 722  ARG A NH2 1 
ATOM 5632 N N   . LYS A 1 726  ? 1.004   37.454 35.691  1.00 41.26  ? 723  LYS A N   1 
ATOM 5633 C CA  . LYS A 1 726  ? 0.811   36.571 34.546  1.00 41.26  ? 723  LYS A CA  1 
ATOM 5634 C C   . LYS A 1 726  ? -0.503  36.883 33.880  1.00 41.26  ? 723  LYS A C   1 
ATOM 5635 O O   . LYS A 1 726  ? -1.378  37.477 34.511  1.00 41.26  ? 723  LYS A O   1 
ATOM 5636 C CB  . LYS A 1 726  ? 0.864   35.118 34.966  1.00 35.71  ? 723  LYS A CB  1 
ATOM 5637 C CG  . LYS A 1 726  ? 2.251   34.643 35.406  1.00 35.71  ? 723  LYS A CG  1 
ATOM 5638 C CD  . LYS A 1 726  ? 3.233   34.443 34.237  1.00 35.71  ? 723  LYS A CD  1 
ATOM 5639 C CE  . LYS A 1 726  ? 4.254   33.446 34.672  1.00 35.71  ? 723  LYS A CE  1 
ATOM 5640 N NZ  . LYS A 1 726  ? 5.463   33.387 33.851  1.00 35.71  ? 723  LYS A NZ  1 
ATOM 5641 N N   . ILE A 1 727  ? -0.664  36.510 32.617  1.00 33.70  ? 724  ILE A N   1 
ATOM 5642 C CA  . ILE A 1 727  ? -1.903  36.843 31.932  1.00 33.70  ? 724  ILE A CA  1 
ATOM 5643 C C   . ILE A 1 727  ? -2.287  35.775 30.915  1.00 33.70  ? 724  ILE A C   1 
ATOM 5644 O O   . ILE A 1 727  ? -1.433  35.283 30.161  1.00 33.70  ? 724  ILE A O   1 
ATOM 5645 C CB  . ILE A 1 727  ? -1.813  38.245 31.255  1.00 29.08  ? 724  ILE A CB  1 
ATOM 5646 C CG1 . ILE A 1 727  ? -3.036  38.538 30.361  1.00 29.08  ? 724  ILE A CG1 1 
ATOM 5647 C CG2 . ILE A 1 727  ? -0.580  38.337 30.373  1.00 29.08  ? 724  ILE A CG2 1 
ATOM 5648 C CD1 . ILE A 1 727  ? -3.498  40.009 30.348  1.00 29.08  ? 724  ILE A CD1 1 
ATOM 5649 N N   . CYS A 1 728  ? -3.577  35.437 30.899  1.00 39.06  ? 725  CYS A N   1 
ATOM 5650 C CA  . CYS A 1 728  ? -4.193  34.551 29.884  1.00 39.06  ? 725  CYS A CA  1 
ATOM 5651 C C   . CYS A 1 728  ? -5.536  35.100 29.428  1.00 39.06  ? 725  CYS A C   1 
ATOM 5652 O O   . CYS A 1 728  ? -6.339  35.626 30.253  1.00 39.06  ? 725  CYS A O   1 
ATOM 5653 C CB  . CYS A 1 728  ? -4.467  33.167 30.465  1.00 66.73  ? 725  CYS A CB  1 
ATOM 5654 S SG  . CYS A 1 728  ? -2.992  32.228 30.696  1.00 66.73  ? 725  CYS A SG  1 
ATOM 5655 N N   . TYR A 1 729  ? -5.784  34.937 28.128  1.00 43.09  ? 726  TYR A N   1 
ATOM 5656 C CA  . TYR A 1 729  ? -7.082  35.211 27.538  1.00 43.09  ? 726  TYR A CA  1 
ATOM 5657 C C   . TYR A 1 729  ? -7.964  33.964 27.478  1.00 43.09  ? 726  TYR A C   1 
ATOM 5658 O O   . TYR A 1 729  ? -7.520  32.918 26.989  1.00 43.09  ? 726  TYR A O   1 
ATOM 5659 C CB  . TYR A 1 729  ? -6.881  35.748 26.131  1.00 40.95  ? 726  TYR A CB  1 
ATOM 5660 C CG  . TYR A 1 729  ? -8.153  36.047 25.374  1.00 40.95  ? 726  TYR A CG  1 
ATOM 5661 C CD1 . TYR A 1 729  ? -9.121  36.911 25.895  1.00 40.95  ? 726  TYR A CD1 1 
ATOM 5662 C CD2 . TYR A 1 729  ? -8.376  35.490 24.113  1.00 40.95  ? 726  TYR A CD2 1 
ATOM 5663 C CE1 . TYR A 1 729  ? -10.300 37.197 25.178  1.00 40.95  ? 726  TYR A CE1 1 
ATOM 5664 C CE2 . TYR A 1 729  ? -9.539  35.782 23.382  1.00 40.95  ? 726  TYR A CE2 1 
ATOM 5665 C CZ  . TYR A 1 729  ? -10.500 36.630 23.923  1.00 40.95  ? 726  TYR A CZ  1 
ATOM 5666 O OH  . TYR A 1 729  ? -11.648 36.880 23.215  1.00 40.95  ? 726  TYR A OH  1 
ATOM 5667 N N   . GLN A 1 730  ? -9.207  34.072 27.977  1.00 44.76  ? 727  GLN A N   1 
ATOM 5668 C CA  . GLN A 1 730  ? -10.234 33.054 27.775  1.00 44.76  ? 727  GLN A CA  1 
ATOM 5669 C C   . GLN A 1 730  ? -11.361 33.626 26.878  1.00 44.76  ? 727  GLN A C   1 
ATOM 5670 O O   . GLN A 1 730  ? -12.191 34.426 27.331  1.00 44.76  ? 727  GLN A O   1 
ATOM 5671 C CB  . GLN A 1 730  ? -10.730 32.563 29.134  1.00 52.14  ? 727  GLN A CB  1 
ATOM 5672 C CG  . GLN A 1 730  ? -11.771 31.428 29.152  1.00 52.14  ? 727  GLN A CG  1 
ATOM 5673 C CD  . GLN A 1 730  ? -11.813 30.673 30.502  1.00 52.14  ? 727  GLN A CD  1 
ATOM 5674 O OE1 . GLN A 1 730  ? -10.965 29.801 30.766  1.00 52.14  ? 727  GLN A OE1 1 
ATOM 5675 N NE2 . GLN A 1 730  ? -12.797 30.999 31.349  1.00 52.14  ? 727  GLN A NE2 1 
ATOM 5676 N N   . GLU A 1 731  ? -11.378 33.218 25.604  1.00 56.17  ? 728  GLU A N   1 
ATOM 5677 C CA  . GLU A 1 731  ? -12.348 33.718 24.599  1.00 56.17  ? 728  GLU A CA  1 
ATOM 5678 C C   . GLU A 1 731  ? -13.808 33.416 24.937  1.00 56.17  ? 728  GLU A C   1 
ATOM 5679 O O   . GLU A 1 731  ? -14.683 34.276 24.745  1.00 56.17  ? 728  GLU A O   1 
ATOM 5680 C CB  . GLU A 1 731  ? -12.053 33.159 23.201  1.00 106.23 ? 728  GLU A CB  1 
ATOM 5681 C CG  . GLU A 1 731  ? -10.697 32.471 23.066  1.00 106.23 ? 728  GLU A CG  1 
ATOM 5682 C CD  . GLU A 1 731  ? -10.482 31.821 21.711  1.00 106.23 ? 728  GLU A CD  1 
ATOM 5683 O OE1 . GLU A 1 731  ? -11.197 32.190 20.752  1.00 106.23 ? 728  GLU A OE1 1 
ATOM 5684 O OE2 . GLU A 1 731  ? -9.593  30.940 21.613  1.00 106.23 ? 728  GLU A OE2 1 
ATOM 5685 N N   . VAL A 1 732  ? -14.073 32.192 25.410  1.00 52.32  ? 729  VAL A N   1 
ATOM 5686 C CA  . VAL A 1 732  ? -15.444 31.756 25.664  1.00 52.32  ? 729  VAL A CA  1 
ATOM 5687 C C   . VAL A 1 732  ? -15.992 32.596 26.778  1.00 52.32  ? 729  VAL A C   1 
ATOM 5688 O O   . VAL A 1 732  ? -17.185 32.873 26.836  1.00 52.32  ? 729  VAL A O   1 
ATOM 5689 C CB  . VAL A 1 732  ? -15.560 30.260 26.049  1.00 61.04  ? 729  VAL A CB  1 
ATOM 5690 C CG1 . VAL A 1 732  ? -15.756 29.389 24.813  1.00 61.04  ? 729  VAL A CG1 1 
ATOM 5691 C CG2 . VAL A 1 732  ? -14.346 29.795 26.843  1.00 61.04  ? 729  VAL A CG2 1 
ATOM 5692 N N   . SER A 1 733  ? -15.104 33.028 27.659  1.00 36.63  ? 730  SER A N   1 
ATOM 5693 C CA  . SER A 1 733  ? -15.515 33.862 28.766  1.00 36.63  ? 730  SER A CA  1 
ATOM 5694 C C   . SER A 1 733  ? -15.475 35.292 28.310  1.00 36.63  ? 730  SER A C   1 
ATOM 5695 O O   . SER A 1 733  ? -16.092 36.154 28.926  1.00 36.63  ? 730  SER A O   1 
ATOM 5696 C CB  . SER A 1 733  ? -14.590 33.663 29.947  1.00 57.75  ? 730  SER A CB  1 
ATOM 5697 O OG  . SER A 1 733  ? -14.547 32.295 30.262  1.00 57.75  ? 730  SER A OG  1 
ATOM 5698 N N   . GLN A 1 734  ? -14.761 35.539 27.216  1.00 41.71  ? 731  GLN A N   1 
ATOM 5699 C CA  . GLN A 1 734  ? -14.573 36.890 26.704  1.00 41.71  ? 731  GLN A CA  1 
ATOM 5700 C C   . GLN A 1 734  ? -14.009 37.718 27.823  1.00 41.71  ? 731  GLN A C   1 
ATOM 5701 O O   . GLN A 1 734  ? -14.528 38.775 28.101  1.00 41.71  ? 731  GLN A O   1 
ATOM 5702 C CB  . GLN A 1 734  ? -15.889 37.534 26.232  1.00 59.09  ? 731  GLN A CB  1 
ATOM 5703 C CG  . GLN A 1 734  ? -16.485 36.988 24.948  1.00 59.09  ? 731  GLN A CG  1 
ATOM 5704 C CD  . GLN A 1 734  ? -16.141 37.791 23.688  1.00 59.09  ? 731  GLN A CD  1 
ATOM 5705 O OE1 . GLN A 1 734  ? -16.590 37.461 22.603  1.00 59.09  ? 731  GLN A OE1 1 
ATOM 5706 N NE2 . GLN A 1 734  ? -15.353 38.835 23.833  1.00 59.09  ? 731  GLN A NE2 1 
ATOM 5707 N N   . CYS A 1 735  ? -12.959 37.234 28.478  1.00 44.69  ? 732  CYS A N   1 
ATOM 5708 C CA  . CYS A 1 735  ? -12.233 38.040 29.465  1.00 44.69  ? 732  CYS A CA  1 
ATOM 5709 C C   . CYS A 1 735  ? -10.794 37.564 29.664  1.00 44.69  ? 732  CYS A C   1 
ATOM 5710 O O   . CYS A 1 735  ? -10.407 36.517 29.143  1.00 44.69  ? 732  CYS A O   1 
ATOM 5711 C CB  . CYS A 1 735  ? -12.983 38.050 30.785  1.00 63.67  ? 732  CYS A CB  1 
ATOM 5712 S SG  . CYS A 1 735  ? -13.135 36.446 31.498  1.00 63.67  ? 732  CYS A SG  1 
ATOM 5713 N N   . PHE A 1 736  ? -9.994  38.335 30.394  1.00 54.83  ? 733  PHE A N   1 
ATOM 5714 C CA  . PHE A 1 736  ? -8.624  37.919 30.685  1.00 54.83  ? 733  PHE A CA  1 
ATOM 5715 C C   . PHE A 1 736  ? -8.485  37.468 32.133  1.00 54.83  ? 733  PHE A C   1 
ATOM 5716 O O   . PHE A 1 736  ? -9.054  38.100 33.037  1.00 54.83  ? 733  PHE A O   1 
ATOM 5717 C CB  . PHE A 1 736  ? -7.638  39.046 30.436  1.00 46.45  ? 733  PHE A CB  1 
ATOM 5718 C CG  . PHE A 1 736  ? -7.474  39.431 28.970  1.00 46.45  ? 733  PHE A CG  1 
ATOM 5719 C CD1 . PHE A 1 736  ? -8.288  40.418 28.384  1.00 46.45  ? 733  PHE A CD1 1 
ATOM 5720 C CD2 . PHE A 1 736  ? -6.485  38.864 28.192  1.00 46.45  ? 733  PHE A CD2 1 
ATOM 5721 C CE1 . PHE A 1 736  ? -8.124  40.792 27.050  1.00 46.45  ? 733  PHE A CE1 1 
ATOM 5722 C CE2 . PHE A 1 736  ? -6.333  39.248 26.861  1.00 46.45  ? 733  PHE A CE2 1 
ATOM 5723 C CZ  . PHE A 1 736  ? -7.149  40.217 26.303  1.00 46.45  ? 733  PHE A CZ  1 
ATOM 5724 N N   . GLY A 1 737  ? -7.749  36.374 32.355  1.00 31.37  ? 734  GLY A N   1 
ATOM 5725 C CA  . GLY A 1 737  ? -7.330  36.007 33.726  1.00 31.37  ? 734  GLY A CA  1 
ATOM 5726 C C   . GLY A 1 737  ? -5.978  36.633 34.011  1.00 31.37  ? 734  GLY A C   1 
ATOM 5727 O O   . GLY A 1 737  ? -5.065  36.536 33.161  1.00 31.37  ? 734  GLY A O   1 
ATOM 5728 N N   . VAL A 1 738  ? -5.842  37.333 35.137  1.00 47.62  ? 735  VAL A N   1 
ATOM 5729 C CA  . VAL A 1 738  ? -4.561  37.968 35.451  1.00 47.62  ? 735  VAL A CA  1 
ATOM 5730 C C   . VAL A 1 738  ? -4.138  37.812 36.876  1.00 47.62  ? 735  VAL A C   1 
ATOM 5731 O O   . VAL A 1 738  ? -4.901  38.118 37.788  1.00 47.62  ? 735  VAL A O   1 
ATOM 5732 C CB  . VAL A 1 738  ? -4.564  39.467 35.212  1.00 40.41  ? 735  VAL A CB  1 
ATOM 5733 C CG1 . VAL A 1 738  ? -3.438  40.139 36.045  1.00 40.41  ? 735  VAL A CG1 1 
ATOM 5734 C CG2 . VAL A 1 738  ? -4.380  39.755 33.760  1.00 40.41  ? 735  VAL A CG2 1 
ATOM 5735 N N   . LEU A 1 739  ? -2.889  37.400 37.058  1.00 27.18  ? 736  LEU A N   1 
ATOM 5736 C CA  . LEU A 1 739  ? -2.358  37.102 38.378  1.00 27.18  ? 736  LEU A CA  1 
ATOM 5737 C C   . LEU A 1 739  ? -1.735  38.316 38.972  1.00 27.18  ? 736  LEU A C   1 
ATOM 5738 O O   . LEU A 1 739  ? -0.846  38.861 38.375  1.00 27.18  ? 736  LEU A O   1 
ATOM 5739 C CB  . LEU A 1 739  ? -1.261  36.065 38.217  1.00 26.39  ? 736  LEU A CB  1 
ATOM 5740 C CG  . LEU A 1 739  ? -1.676  34.609 38.149  1.00 26.39  ? 736  LEU A CG  1 
ATOM 5741 C CD1 . LEU A 1 739  ? -0.344  33.773 38.258  1.00 26.39  ? 736  LEU A CD1 1 
ATOM 5742 C CD2 . LEU A 1 739  ? -2.745  34.320 39.277  1.00 26.39  ? 736  LEU A CD2 1 
ATOM 5743 N N   . SER A 1 740  ? -2.143  38.738 40.146  1.00 31.33  ? 737  SER A N   1 
ATOM 5744 C CA  . SER A 1 740  ? -1.566  39.958 40.675  1.00 31.33  ? 737  SER A CA  1 
ATOM 5745 C C   . SER A 1 740  ? -1.113  39.789 42.086  1.00 31.33  ? 737  SER A C   1 
ATOM 5746 O O   . SER A 1 740  ? -1.466  38.804 42.727  1.00 31.33  ? 737  SER A O   1 
ATOM 5747 C CB  . SER A 1 740  ? -2.562  41.128 40.587  1.00 41.87  ? 737  SER A CB  1 
ATOM 5748 O OG  . SER A 1 740  ? -3.786  40.912 41.308  1.00 41.87  ? 737  SER A OG  1 
ATOM 5749 N N   . SER A 1 741  ? -0.338  40.741 42.585  1.00 33.13  ? 738  SER A N   1 
ATOM 5750 C CA  . SER A 1 741  ? 0.151   40.686 43.951  1.00 33.13  ? 738  SER A CA  1 
ATOM 5751 C C   . SER A 1 741  ? 0.059   42.060 44.562  1.00 33.13  ? 738  SER A C   1 
ATOM 5752 O O   . SER A 1 741  ? 0.387   43.049 43.892  1.00 33.13  ? 738  SER A O   1 
ATOM 5753 C CB  . SER A 1 741  ? 1.613   40.304 43.955  1.00 25.96  ? 738  SER A CB  1 
ATOM 5754 O OG  . SER A 1 741  ? 2.295   41.079 44.944  1.00 25.96  ? 738  SER A OG  1 
ATOM 5755 N N   . ARG A 1 742  ? -0.352  42.144 45.821  1.00 40.34  ? 739  ARG A N   1 
ATOM 5756 C CA  . ARG A 1 742  ? -0.414  43.455 46.473  1.00 40.34  ? 739  ARG A CA  1 
ATOM 5757 C C   . ARG A 1 742  ? 0.381   43.384 47.758  1.00 40.34  ? 739  ARG A C   1 
ATOM 5758 O O   . ARG A 1 742  ? 0.516   42.300 48.334  1.00 40.34  ? 739  ARG A O   1 
ATOM 5759 C CB  . ARG A 1 742  ? -1.860  43.953 46.668  1.00 56.92  ? 739  ARG A CB  1 
ATOM 5760 C CG  . ARG A 1 742  ? -2.648  43.321 47.824  1.00 56.92  ? 739  ARG A CG  1 
ATOM 5761 C CD  . ARG A 1 742  ? -4.002  44.033 48.080  1.00 56.92  ? 739  ARG A CD  1 
ATOM 5762 N NE  . ARG A 1 742  ? -4.805  43.321 49.070  1.00 56.92  ? 739  ARG A NE  1 
ATOM 5763 C CZ  . ARG A 1 742  ? -5.506  42.212 48.811  1.00 56.92  ? 739  ARG A CZ  1 
ATOM 5764 N NH1 . ARG A 1 742  ? -5.525  41.705 47.583  1.00 56.92  ? 739  ARG A NH1 1 
ATOM 5765 N NH2 . ARG A 1 742  ? -6.196  41.598 49.771  1.00 56.92  ? 739  ARG A NH2 1 
ATOM 5766 N N   . ILE A 1 743  ? 0.963   44.507 48.164  1.00 45.82  ? 740  ILE A N   1 
ATOM 5767 C CA  . ILE A 1 743  ? 1.705   44.555 49.420  1.00 45.82  ? 740  ILE A CA  1 
ATOM 5768 C C   . ILE A 1 743  ? 0.812   45.028 50.566  1.00 45.82  ? 740  ILE A C   1 
ATOM 5769 O O   . ILE A 1 743  ? -0.058  45.894 50.376  1.00 45.82  ? 740  ILE A O   1 
ATOM 5770 C CB  . ILE A 1 743  ? 2.958   45.450 49.309  1.00 54.21  ? 740  ILE A CB  1 
ATOM 5771 C CG1 . ILE A 1 743  ? 4.111   44.644 48.696  1.00 54.21  ? 740  ILE A CG1 1 
ATOM 5772 C CG2 . ILE A 1 743  ? 3.356   46.035 50.672  1.00 54.21  ? 740  ILE A CG2 1 
ATOM 5773 C CD1 . ILE A 1 743  ? 5.415   45.428 48.588  1.00 54.21  ? 740  ILE A CD1 1 
ATOM 5774 N N   . GLU A 1 744  ? 1.001   44.414 51.736  1.00 85.25  ? 741  GLU A N   1 
ATOM 5775 C CA  . GLU A 1 744  ? 0.409   44.878 53.000  1.00 85.25  ? 741  GLU A CA  1 
ATOM 5776 C C   . GLU A 1 744  ? 1.459   44.837 54.092  1.00 85.25  ? 741  GLU A C   1 
ATOM 5777 O O   . GLU A 1 744  ? 2.339   43.985 54.096  1.00 85.25  ? 741  GLU A O   1 
ATOM 5778 C CB  . GLU A 1 744  ? -0.813  44.047 53.401  1.00 66.95  ? 741  GLU A CB  1 
ATOM 5779 C CG  . GLU A 1 744  ? -1.943  44.085 52.338  1.00 66.95  ? 741  GLU A CG  1 
ATOM 5780 C CD  . GLU A 1 744  ? -3.238  43.394 52.761  1.00 66.95  ? 741  GLU A CD  1 
ATOM 5781 O OE1 . GLU A 1 744  ? -3.249  42.736 53.821  1.00 66.95  ? 741  GLU A OE1 1 
ATOM 5782 O OE2 . GLU A 1 744  ? -4.245  43.519 52.036  1.00 66.95  ? 741  GLU A OE2 1 
ATOM 5783 N N   . VAL A 1 745  ? 1.371   45.787 55.006  1.00 47.89  ? 742  VAL A N   1 
ATOM 5784 C CA  . VAL A 1 745  ? 2.280   45.870 56.155  1.00 47.89  ? 742  VAL A CA  1 
ATOM 5785 C C   . VAL A 1 745  ? 1.692   45.269 57.441  1.00 47.89  ? 742  VAL A C   1 
ATOM 5786 O O   . VAL A 1 745  ? 0.529   44.837 57.475  1.00 47.89  ? 742  VAL A O   1 
ATOM 5787 C CB  . VAL A 1 745  ? 2.712   47.330 56.446  1.00 76.06  ? 742  VAL A CB  1 
ATOM 5788 C CG1 . VAL A 1 745  ? 3.449   47.925 55.240  1.00 76.06  ? 742  VAL A CG1 1 
ATOM 5789 C CG2 . VAL A 1 745  ? 1.497   48.191 56.872  1.00 76.06  ? 742  VAL A CG2 1 
ATOM 5790 N N   . GLN A 1 746  ? 2.538   45.233 58.477  1.00 134.52 ? 743  GLN A N   1 
ATOM 5791 C CA  . GLN A 1 746  ? 2.179   44.782 59.817  1.00 134.52 ? 743  GLN A CA  1 
ATOM 5792 C C   . GLN A 1 746  ? 1.092   45.695 60.358  1.00 134.52 ? 743  GLN A C   1 
ATOM 5793 O O   . GLN A 1 746  ? 1.120   46.906 60.138  1.00 134.52 ? 743  GLN A O   1 
ATOM 5794 C CB  . GLN A 1 746  ? 3.409   44.837 60.736  1.00 102.40 ? 743  GLN A CB  1 
ATOM 5795 C CG  . GLN A 1 746  ? 3.288   44.042 62.036  1.00 102.40 ? 743  GLN A CG  1 
ATOM 5796 C CD  . GLN A 1 746  ? 4.290   44.478 63.116  1.00 102.40 ? 743  GLN A CD  1 
ATOM 5797 O OE1 . GLN A 1 746  ? 5.416   43.983 63.185  1.00 102.40 ? 743  GLN A OE1 1 
ATOM 5798 N NE2 . GLN A 1 746  ? 3.861   45.392 63.977  1.00 102.40 ? 743  GLN A NE2 1 
ATOM 5799 N N   . ASP A 1 747  ? 0.122   45.104 61.042  1.00 141.64 ? 744  ASP A N   1 
ATOM 5800 C CA  . ASP A 1 747  ? -0.917  45.879 61.703  1.00 141.64 ? 744  ASP A CA  1 
ATOM 5801 C C   . ASP A 1 747  ? -0.489  46.142 63.143  1.00 141.64 ? 744  ASP A C   1 
ATOM 5802 O O   . ASP A 1 747  ? 0.484   45.551 63.628  1.00 141.64 ? 744  ASP A O   1 
ATOM 5803 C CB  . ASP A 1 747  ? -2.249  45.123 61.677  1.00 108.47 ? 744  ASP A CB  1 
ATOM 5804 C CG  . ASP A 1 747  ? -3.432  46.033 61.430  1.00 108.47 ? 744  ASP A CG  1 
ATOM 5805 O OD1 . ASP A 1 747  ? -3.718  46.319 60.249  1.00 108.47 ? 744  ASP A OD1 1 
ATOM 5806 O OD2 . ASP A 1 747  ? -4.084  46.455 62.411  1.00 108.47 ? 744  ASP A OD2 1 
ATOM 5807 N N   . THR A 1 748  ? -1.207  47.036 63.820  1.00 119.51 ? 745  THR A N   1 
ATOM 5808 C CA  . THR A 1 748  ? -1.044  47.214 65.257  1.00 119.51 ? 745  THR A CA  1 
ATOM 5809 C C   . THR A 1 748  ? -1.386  45.898 65.951  1.00 119.51 ? 745  THR A C   1 
ATOM 5810 O O   . THR A 1 748  ? -0.740  45.519 66.934  1.00 119.51 ? 745  THR A O   1 
ATOM 5811 C CB  . THR A 1 748  ? -1.950  48.330 65.821  1.00 139.65 ? 745  THR A CB  1 
ATOM 5812 O OG1 . THR A 1 748  ? -3.327  47.990 65.605  1.00 139.65 ? 745  THR A OG1 1 
ATOM 5813 C CG2 . THR A 1 748  ? -1.638  49.672 65.162  1.00 139.65 ? 745  THR A CG2 1 
ATOM 5814 N N   . SER A 1 749  ? -2.392  45.206 65.416  1.00 117.91 ? 746  SER A N   1 
ATOM 5815 C CA  . SER A 1 749  ? -2.823  43.919 65.939  1.00 117.91 ? 746  SER A CA  1 
ATOM 5816 C C   . SER A 1 749  ? -2.208  42.734 65.173  1.00 117.91 ? 746  SER A C   1 
ATOM 5817 O O   . SER A 1 749  ? -2.847  41.692 64.989  1.00 117.91 ? 746  SER A O   1 
ATOM 5818 C CB  . SER A 1 749  ? -4.348  43.845 65.925  1.00 127.82 ? 746  SER A CB  1 
ATOM 5819 O OG  . SER A 1 749  ? -4.801  42.748 66.698  1.00 127.82 ? 746  SER A OG  1 
ATOM 5820 N N   . GLY A 1 750  ? -0.964  42.901 64.730  1.00 164.06 ? 747  GLY A N   1 
ATOM 5821 C CA  . GLY A 1 750  ? -0.225  41.839 64.046  1.00 164.06 ? 747  GLY A CA  1 
ATOM 5822 C C   . GLY A 1 750  ? -0.764  41.451 62.680  1.00 164.06 ? 747  GLY A C   1 
ATOM 5823 O O   . GLY A 1 750  ? -0.104  40.721 61.935  1.00 164.06 ? 747  GLY A O   1 
ATOM 5824 N N   . GLY A 1 751  ? -1.961  41.939 62.350  1.00 133.03 ? 748  GLY A N   1 
ATOM 5825 C CA  . GLY A 1 751  ? -2.605  41.635 61.073  1.00 133.03 ? 748  GLY A CA  1 
ATOM 5826 C C   . GLY A 1 751  ? -1.932  42.311 59.895  1.00 133.03 ? 748  GLY A C   1 
ATOM 5827 O O   . GLY A 1 751  ? -0.836  42.867 60.024  1.00 133.03 ? 748  GLY A O   1 
ATOM 5828 N N   . THR A 1 752  ? -2.585  42.244 58.736  1.00 86.69  ? 749  THR A N   1 
ATOM 5829 C CA  . THR A 1 752  ? -2.126  42.949 57.522  1.00 86.69  ? 749  THR A CA  1 
ATOM 5830 C C   . THR A 1 752  ? -3.275  43.715 56.842  1.00 86.69  ? 749  THR A C   1 
ATOM 5831 O O   . THR A 1 752  ? -4.415  43.237 56.799  1.00 86.69  ? 749  THR A O   1 
ATOM 5832 C CB  . THR A 1 752  ? -1.400  41.997 56.516  1.00 61.84  ? 749  THR A CB  1 
ATOM 5833 O OG1 . THR A 1 752  ? -2.257  40.903 56.144  1.00 61.84  ? 749  THR A OG1 1 
ATOM 5834 C CG2 . THR A 1 752  ? -0.087  41.444 57.131  1.00 61.84  ? 749  THR A CG2 1 
ATOM 5835 N N   . THR A 1 753  ? -2.988  44.908 56.328  1.00 122.17 ? 750  THR A N   1 
ATOM 5836 C CA  . THR A 1 753  ? -4.060  45.724 55.753  1.00 122.17 ? 750  THR A CA  1 
ATOM 5837 C C   . THR A 1 753  ? -3.899  46.111 54.291  1.00 122.17 ? 750  THR A C   1 
ATOM 5838 O O   . THR A 1 753  ? -4.666  45.624 53.471  1.00 122.17 ? 750  THR A O   1 
ATOM 5839 C CB  . THR A 1 753  ? -4.380  46.965 56.591  1.00 78.17  ? 750  THR A CB  1 
ATOM 5840 O OG1 . THR A 1 753  ? -3.157  47.537 57.061  1.00 78.17  ? 750  THR A OG1 1 
ATOM 5841 C CG2 . THR A 1 753  ? -5.281  46.598 57.770  1.00 78.17  ? 750  THR A CG2 1 
ATOM 5842 N N   . ALA A 1 754  ? -2.934  46.980 53.964  1.00 63.73  ? 751  ALA A N   1 
ATOM 5843 C CA  . ALA A 1 754  ? -2.801  47.561 52.594  1.00 63.73  ? 751  ALA A CA  1 
ATOM 5844 C C   . ALA A 1 754  ? -2.577  49.066 52.563  1.00 63.73  ? 751  ALA A C   1 
ATOM 5845 O O   . ALA A 1 754  ? -3.341  49.825 53.160  1.00 63.73  ? 751  ALA A O   1 
ATOM 5846 C CB  . ALA A 1 754  ? -4.033  47.241 51.719  1.00 50.94  ? 751  ALA A CB  1 
ATOM 5847 N N   . LEU A 1 755  ? -1.576  49.503 51.811  1.00 72.73  ? 752  LEU A N   1 
ATOM 5848 C CA  . LEU A 1 755  ? -1.281  50.937 51.741  1.00 72.73  ? 752  LEU A CA  1 
ATOM 5849 C C   . LEU A 1 755  ? -2.212  51.792 50.870  1.00 72.73  ? 752  LEU A C   1 
ATOM 5850 O O   . LEU A 1 755  ? -2.203  53.018 50.993  1.00 72.73  ? 752  LEU A O   1 
ATOM 5851 C CB  . LEU A 1 755  ? 0.181   51.185 51.343  1.00 118.89 ? 752  LEU A CB  1 
ATOM 5852 C CG  . LEU A 1 755  ? 1.170   51.196 52.506  1.00 118.89 ? 752  LEU A CG  1 
ATOM 5853 C CD1 . LEU A 1 755  ? 1.887   49.860 52.568  1.00 118.89 ? 752  LEU A CD1 1 
ATOM 5854 C CD2 . LEU A 1 755  ? 2.159   52.340 52.336  1.00 118.89 ? 752  LEU A CD2 1 
ATOM 5855 N N   . ARG A 1 756  ? -3.007  51.149 50.012  1.00 41.53  ? 753  ARG A N   1 
ATOM 5856 C CA  . ARG A 1 756  ? -3.827  51.853 49.020  1.00 41.53  ? 753  ARG A CA  1 
ATOM 5857 C C   . ARG A 1 756  ? -4.822  50.891 48.366  1.00 41.53  ? 753  ARG A C   1 
ATOM 5858 O O   . ARG A 1 756  ? -4.663  49.677 48.440  1.00 41.53  ? 753  ARG A O   1 
ATOM 5859 C CB  . ARG A 1 756  ? -2.943  52.541 47.951  1.00 53.95  ? 753  ARG A CB  1 
ATOM 5860 C CG  . ARG A 1 756  ? -2.379  51.602 46.850  1.00 53.95  ? 753  ARG A CG  1 
ATOM 5861 C CD  . ARG A 1 756  ? -1.292  52.256 45.912  1.00 53.95  ? 753  ARG A CD  1 
ATOM 5862 N NE  . ARG A 1 756  ? -0.198  52.936 46.633  1.00 53.95  ? 753  ARG A NE  1 
ATOM 5863 C CZ  . ARG A 1 756  ? 0.759   52.306 47.328  1.00 53.95  ? 753  ARG A CZ  1 
ATOM 5864 N NH1 . ARG A 1 756  ? 0.770   50.972 47.380  1.00 53.95  ? 753  ARG A NH1 1 
ATOM 5865 N NH2 . ARG A 1 756  ? 1.720   52.997 47.962  1.00 53.95  ? 753  ARG A NH2 1 
ATOM 5866 N N   . PRO A 1 757  ? -5.838  51.445 47.693  1.00 40.82  ? 754  PRO A N   1 
ATOM 5867 C CA  . PRO A 1 757  ? -6.809  50.635 46.982  1.00 40.82  ? 754  PRO A CA  1 
ATOM 5868 C C   . PRO A 1 757  ? -6.175  50.039 45.736  1.00 40.82  ? 754  PRO A C   1 
ATOM 5869 O O   . PRO A 1 757  ? -5.611  50.741 44.919  1.00 40.82  ? 754  PRO A O   1 
ATOM 5870 C CB  . PRO A 1 757  ? -7.898  51.659 46.581  1.00 30.48  ? 754  PRO A CB  1 
ATOM 5871 C CG  . PRO A 1 757  ? -7.615  52.900 47.397  1.00 30.48  ? 754  PRO A CG  1 
ATOM 5872 C CD  . PRO A 1 757  ? -6.118  52.889 47.539  1.00 30.48  ? 754  PRO A CD  1 
ATOM 5873 N N   . SER A 1 758  ? -6.254  48.730 45.605  1.00 52.81  ? 755  SER A N   1 
ATOM 5874 C CA  . SER A 1 758  ? -5.639  48.064 44.477  1.00 52.81  ? 755  SER A CA  1 
ATOM 5875 C C   . SER A 1 758  ? -6.794  47.488 43.698  1.00 52.81  ? 755  SER A C   1 
ATOM 5876 O O   . SER A 1 758  ? -7.909  47.360 44.208  1.00 52.81  ? 755  SER A O   1 
ATOM 5877 C CB  . SER A 1 758  ? -4.710  46.915 44.925  1.00 52.18  ? 755  SER A CB  1 
ATOM 5878 O OG  . SER A 1 758  ? -4.138  47.087 46.223  1.00 52.18  ? 755  SER A OG  1 
ATOM 5879 N N   . ALA A 1 759  ? -6.512  47.139 42.461  1.00 50.93  ? 756  ALA A N   1 
ATOM 5880 C CA  . ALA A 1 759  ? -7.404  46.412 41.632  1.00 50.93  ? 756  ALA A CA  1 
ATOM 5881 C C   . ALA A 1 759  ? -8.022  45.168 42.296  1.00 50.93  ? 756  ALA A C   1 
ATOM 5882 O O   . ALA A 1 759  ? -9.139  44.778 41.968  1.00 50.93  ? 756  ALA A O   1 
ATOM 5883 C CB  . ALA A 1 759  ? -6.650  46.025 40.446  1.00 10.35  ? 756  ALA A CB  1 
ATOM 5884 N N   . SER A 1 760  ? -7.310  44.520 43.205  1.00 61.61  ? 757  SER A N   1 
ATOM 5885 C CA  . SER A 1 760  ? -7.848  43.315 43.843  1.00 61.61  ? 757  SER A CA  1 
ATOM 5886 C C   . SER A 1 760  ? -8.744  43.620 45.067  1.00 61.61  ? 757  SER A C   1 
ATOM 5887 O O   . SER A 1 760  ? -9.431  42.743 45.609  1.00 61.61  ? 757  SER A O   1 
ATOM 5888 C CB  . SER A 1 760  ? -6.712  42.353 44.206  1.00 36.74  ? 757  SER A CB  1 
ATOM 5889 O OG  . SER A 1 760  ? -5.833  42.897 45.194  1.00 36.74  ? 757  SER A OG  1 
ATOM 5890 N N   . THR A 1 761  ? -8.745  44.875 45.483  1.00 47.35  ? 758  THR A N   1 
ATOM 5891 C CA  . THR A 1 761  ? -9.533  45.302 46.603  1.00 47.35  ? 758  THR A CA  1 
ATOM 5892 C C   . THR A 1 761  ? -10.744 46.030 46.078  1.00 47.35  ? 758  THR A C   1 
ATOM 5893 O O   . THR A 1 761  ? -11.710 46.222 46.799  1.00 47.35  ? 758  THR A O   1 
ATOM 5894 C CB  . THR A 1 761  ? -8.759  46.293 47.498  1.00 44.98  ? 758  THR A CB  1 
ATOM 5895 O OG1 . THR A 1 761  ? -8.877  47.611 46.949  1.00 44.98  ? 758  THR A OG1 1 
ATOM 5896 C CG2 . THR A 1 761  ? -7.302  45.931 47.573  1.00 44.98  ? 758  THR A CG2 1 
ATOM 5897 N N   . GLN A 1 762  ? -10.679 46.491 44.839  1.00 51.29  ? 759  GLN A N   1 
ATOM 5898 C CA  . GLN A 1 762  ? -11.714 47.390 44.327  1.00 51.29  ? 759  GLN A CA  1 
ATOM 5899 C C   . GLN A 1 762  ? -12.478 46.664 43.256  1.00 51.29  ? 759  GLN A C   1 
ATOM 5900 O O   . GLN A 1 762  ? -13.231 47.268 42.476  1.00 51.29  ? 759  GLN A O   1 
ATOM 5901 C CB  . GLN A 1 762  ? -11.119 48.691 43.795  1.00 129.17 ? 759  GLN A CB  1 
ATOM 5902 C CG  . GLN A 1 762  ? -10.895 49.755 44.858  1.00 129.17 ? 759  GLN A CG  1 
ATOM 5903 C CD  . GLN A 1 762  ? -10.542 51.109 44.255  1.00 129.17 ? 759  GLN A CD  1 
ATOM 5904 O OE1 . GLN A 1 762  ? -10.821 52.154 44.855  1.00 129.17 ? 759  GLN A OE1 1 
ATOM 5905 N NE2 . GLN A 1 762  ? -9.927  51.098 43.062  1.00 129.17 ? 759  GLN A NE2 1 
ATOM 5906 N N   . ALA A 1 763  ? -12.274 45.348 43.244  1.00 54.93  ? 760  ALA A N   1 
ATOM 5907 C CA  . ALA A 1 763  ? -12.872 44.462 42.263  1.00 54.93  ? 760  ALA A CA  1 
ATOM 5908 C C   . ALA A 1 763  ? -14.367 44.331 42.497  1.00 54.93  ? 760  ALA A C   1 
ATOM 5909 O O   . ALA A 1 763  ? -14.825 44.309 43.647  1.00 54.93  ? 760  ALA A O   1 
ATOM 5910 C CB  . ALA A 1 763  ? -12.205 43.119 42.334  1.00 43.71  ? 760  ALA A CB  1 
ATOM 5911 N N   . LEU A 1 764  ? -15.116 44.219 41.408  1.00 63.06  ? 761  LEU A N   1 
ATOM 5912 C CA  . LEU A 1 764  ? -16.578 44.282 41.479  1.00 63.06  ? 761  LEU A CA  1 
ATOM 5913 C C   . LEU A 1 764  ? -17.205 43.152 42.324  1.00 63.06  ? 761  LEU A C   1 
ATOM 5914 O O   . LEU A 1 764  ? -18.010 43.410 43.224  1.00 63.06  ? 761  LEU A O   1 
ATOM 5915 C CB  . LEU A 1 764  ? -17.183 44.386 40.070  1.00 52.58  ? 761  LEU A CB  1 
ATOM 5916 C CG  . LEU A 1 764  ? -16.736 45.655 39.301  1.00 52.58  ? 761  LEU A CG  1 
ATOM 5917 C CD1 . LEU A 1 764  ? -17.165 45.635 37.844  1.00 52.58  ? 761  LEU A CD1 1 
ATOM 5918 C CD2 . LEU A 1 764  ? -17.202 46.943 39.960  1.00 52.58  ? 761  LEU A CD2 1 
ATOM 5919 N N   . SER A 1 765  ? -16.807 41.913 42.052  1.00 66.18  ? 762  SER A N   1 
ATOM 5920 C CA  . SER A 1 765  ? -17.161 40.776 42.901  1.00 66.18  ? 762  SER A CA  1 
ATOM 5921 C C   . SER A 1 765  ? -15.856 40.244 43.460  1.00 66.18  ? 762  SER A C   1 
ATOM 5922 O O   . SER A 1 765  ? -14.812 40.383 42.824  1.00 66.18  ? 762  SER A O   1 
ATOM 5923 C CB  . SER A 1 765  ? -17.830 39.689 42.072  1.00 81.19  ? 762  SER A CB  1 
ATOM 5924 O OG  . SER A 1 765  ? -18.393 40.228 40.887  1.00 81.19  ? 762  SER A OG  1 
ATOM 5925 N N   . SER A 1 766  ? -15.891 39.633 44.634  1.00 55.93  ? 763  SER A N   1 
ATOM 5926 C CA  . SER A 1 766  ? -14.663 39.105 45.209  1.00 55.93  ? 763  SER A CA  1 
ATOM 5927 C C   . SER A 1 766  ? -14.860 37.774 45.933  1.00 55.93  ? 763  SER A C   1 
ATOM 5928 O O   . SER A 1 766  ? -15.987 37.363 46.198  1.00 55.93  ? 763  SER A O   1 
ATOM 5929 C CB  . SER A 1 766  ? -14.039 40.137 46.145  1.00 44.86  ? 763  SER A CB  1 
ATOM 5930 O OG  . SER A 1 766  ? -14.515 39.986 47.460  1.00 44.86  ? 763  SER A OG  1 
ATOM 5931 N N   . SER A 1 767  ? -13.759 37.101 46.256  1.00 56.70  ? 764  SER A N   1 
ATOM 5932 C CA  . SER A 1 767  ? -13.814 35.775 46.874  1.00 56.70  ? 764  SER A CA  1 
ATOM 5933 C C   . SER A 1 767  ? -12.450 35.363 47.423  1.00 56.70  ? 764  SER A C   1 
ATOM 5934 O O   . SER A 1 767  ? -11.441 35.924 47.036  1.00 56.70  ? 764  SER A O   1 
ATOM 5935 C CB  . SER A 1 767  ? -14.328 34.738 45.866  1.00 33.71  ? 764  SER A CB  1 
ATOM 5936 O OG  . SER A 1 767  ? -13.277 34.361 45.025  1.00 33.71  ? 764  SER A OG  1 
ATOM 5937 N N   . VAL A 1 768  ? -12.440 34.375 48.315  1.00 67.17  ? 765  VAL A N   1 
ATOM 5938 C CA  . VAL A 1 768  ? -11.269 34.005 49.130  1.00 67.17  ? 765  VAL A CA  1 
ATOM 5939 C C   . VAL A 1 768  ? -11.109 32.484 49.144  1.00 67.17  ? 765  VAL A C   1 
ATOM 5940 O O   . VAL A 1 768  ? -12.029 31.765 48.753  1.00 67.17  ? 765  VAL A O   1 
ATOM 5941 C CB  . VAL A 1 768  ? -11.432 34.513 50.583  1.00 31.88  ? 765  VAL A CB  1 
ATOM 5942 C CG1 . VAL A 1 768  ? -10.186 34.157 51.472  1.00 31.88  ? 765  VAL A CG1 1 
ATOM 5943 C CG2 . VAL A 1 768  ? -11.719 36.042 50.589  1.00 31.88  ? 765  VAL A CG2 1 
ATOM 5944 N N   . SER A 1 769  ? -9.951  31.989 49.585  1.00 63.53  ? 766  SER A N   1 
ATOM 5945 C CA  . SER A 1 769  ? -9.655  30.570 49.445  1.00 63.53  ? 766  SER A CA  1 
ATOM 5946 C C   . SER A 1 769  ? -10.082 29.762 50.662  1.00 63.53  ? 766  SER A C   1 
ATOM 5947 O O   . SER A 1 769  ? -9.544  29.936 51.757  1.00 63.53  ? 766  SER A O   1 
ATOM 5948 C CB  . SER A 1 769  ? -8.184  30.337 49.076  1.00 79.08  ? 766  SER A CB  1 
ATOM 5949 O OG  . SER A 1 769  ? -8.016  30.294 47.665  1.00 79.08  ? 766  SER A OG  1 
ATOM 5950 N N   . SER A 1 770  ? -11.063 28.887 50.447  1.00 97.49  ? 767  SER A N   1 
ATOM 5951 C CA  . SER A 1 770  ? -11.646 28.066 51.503  1.00 97.49  ? 767  SER A CA  1 
ATOM 5952 C C   . SER A 1 770  ? -10.984 26.707 51.551  1.00 97.49  ? 767  SER A C   1 
ATOM 5953 O O   . SER A 1 770  ? -11.605 25.725 51.955  1.00 97.49  ? 767  SER A O   1 
ATOM 5954 C CB  . SER A 1 770  ? -13.148 27.883 51.282  1.00 132.30 ? 767  SER A CB  1 
ATOM 5955 O OG  . SER A 1 770  ? -13.837 29.112 51.413  1.00 132.30 ? 767  SER A OG  1 
ATOM 5956 N N   . SER A 1 771  ? -9.731  26.646 51.116  1.00 83.90  ? 768  SER A N   1 
ATOM 5957 C CA  . SER A 1 771  ? -8.968  25.421 51.234  1.00 83.90  ? 768  SER A CA  1 
ATOM 5958 C C   . SER A 1 771  ? -8.438  25.290 52.661  1.00 83.90  ? 768  SER A C   1 
ATOM 5959 O O   . SER A 1 771  ? -8.146  26.296 53.325  1.00 83.90  ? 768  SER A O   1 
ATOM 5960 C CB  . SER A 1 771  ? -7.847  25.354 50.202  1.00 56.69  ? 768  SER A CB  1 
ATOM 5961 O OG  . SER A 1 771  ? -6.944  24.301 50.525  1.00 56.69  ? 768  SER A OG  1 
ATOM 5962 N N   . LYS A 1 772  ? -8.344  24.042 53.117  1.00 96.95  ? 769  LYS A N   1 
ATOM 5963 C CA  . LYS A 1 772  ? -8.068  23.723 54.515  1.00 96.95  ? 769  LYS A CA  1 
ATOM 5964 C C   . LYS A 1 772  ? -6.932  22.707 54.646  1.00 96.95  ? 769  LYS A C   1 
ATOM 5965 O O   . LYS A 1 772  ? -6.815  22.010 55.662  1.00 96.95  ? 769  LYS A O   1 
ATOM 5966 C CB  . LYS A 1 772  ? -9.343  23.202 55.199  1.00 132.41 ? 769  LYS A CB  1 
ATOM 5967 C CG  . LYS A 1 772  ? -10.017 24.189 56.147  1.00 132.41 ? 769  LYS A CG  1 
ATOM 5968 C CD  . LYS A 1 772  ? -9.581  23.949 57.593  1.00 132.41 ? 769  LYS A CD  1 
ATOM 5969 C CE  . LYS A 1 772  ? -10.254 24.908 58.569  1.00 132.41 ? 769  LYS A CE  1 
ATOM 5970 N NZ  . LYS A 1 772  ? -9.522  26.197 58.682  1.00 132.41 ? 769  LYS A NZ  1 
ATOM 5971 N N   . LEU A 1 773  ? -6.100  22.626 53.609  1.00 96.56  ? 770  LEU A N   1 
ATOM 5972 C CA  . LEU A 1 773  ? -4.924  21.767 53.615  1.00 96.56  ? 770  LEU A CA  1 
ATOM 5973 C C   . LEU A 1 773  ? -3.836  22.329 54.524  1.00 96.56  ? 770  LEU A C   1 
ATOM 5974 O O   . LEU A 1 773  ? -3.783  22.015 55.711  1.00 96.56  ? 770  LEU A O   1 
ATOM 5975 C CB  . LEU A 1 773  ? -4.395  21.593 52.193  1.00 76.05  ? 770  LEU A CB  1 
ATOM 5976 C CG  . LEU A 1 773  ? -4.999  20.434 51.413  1.00 76.05  ? 770  LEU A CG  1 
ATOM 5977 C CD1 . LEU A 1 773  ? -4.835  20.613 49.907  1.00 76.05  ? 770  LEU A CD1 1 
ATOM 5978 C CD2 . LEU A 1 773  ? -4.364  19.130 51.908  1.00 76.05  ? 770  LEU A CD2 1 
ATOM 5979 N N   . PHE A 1 774  ? -2.987  23.179 53.965  1.00 140.46 ? 771  PHE A N   1 
ATOM 5980 C CA  . PHE A 1 774  ? -1.871  23.751 54.693  1.00 140.46 ? 771  PHE A CA  1 
ATOM 5981 C C   . PHE A 1 774  ? -2.350  24.493 55.941  1.00 140.46 ? 771  PHE A C   1 
ATOM 5982 O O   . PHE A 1 774  ? -2.598  25.701 55.908  1.00 140.46 ? 771  PHE A O   1 
ATOM 5983 C CB  . PHE A 1 774  ? -1.079  24.682 53.770  1.00 70.41  ? 771  PHE A CB  1 
ATOM 5984 C CG  . PHE A 1 774  ? -0.819  24.106 52.400  1.00 70.41  ? 771  PHE A CG  1 
ATOM 5985 C CD1 . PHE A 1 774  ? -1.492  24.592 51.290  1.00 70.41  ? 771  PHE A CD1 1 
ATOM 5986 C CD2 . PHE A 1 774  ? 0.091   23.071 52.223  1.00 70.41  ? 771  PHE A CD2 1 
ATOM 5987 C CE1 . PHE A 1 774  ? -1.261  24.058 50.030  1.00 70.41  ? 771  PHE A CE1 1 
ATOM 5988 C CE2 . PHE A 1 774  ? 0.323   22.541 50.974  1.00 70.41  ? 771  PHE A CE2 1 
ATOM 5989 C CZ  . PHE A 1 774  ? -0.351  23.033 49.878  1.00 70.41  ? 771  PHE A CZ  1 
ATOM 5990 N N   . SER A 1 775  ? -2.496  23.751 57.035  1.00 169.95 ? 772  SER A N   1 
ATOM 5991 C CA  . SER A 1 775  ? -2.965  24.309 58.305  1.00 169.95 ? 772  SER A CA  1 
ATOM 5992 C C   . SER A 1 775  ? -2.390  23.524 59.486  1.00 169.95 ? 772  SER A C   1 
ATOM 5993 O O   . SER A 1 775  ? -2.947  22.506 59.911  1.00 169.95 ? 772  SER A O   1 
ATOM 5994 C CB  . SER A 1 775  ? -4.503  24.375 58.356  1.00 73.55  ? 772  SER A CB  1 
ATOM 5995 O OG  . SER A 1 775  ? -5.093  23.269 57.695  1.00 73.55  ? 772  SER A OG  1 
ATOM 5996 N N   . SER A 1 776  ? -1.256  24.010 59.990  1.00 138.61 ? 773  SER A N   1 
ATOM 5997 C CA  . SER A 1 776  ? -0.529  23.376 61.087  1.00 138.61 ? 773  SER A CA  1 
ATOM 5998 C C   . SER A 1 776  ? 0.338   24.417 61.815  1.00 138.61 ? 773  SER A C   1 
ATOM 5999 O O   . SER A 1 776  ? 1.639   24.332 61.679  1.00 138.61 ? 773  SER A O   1 
ATOM 6000 C CB  . SER A 1 776  ? 0.319   22.204 60.566  1.00 111.91 ? 773  SER A CB  1 
ATOM 6001 O OG  . SER A 1 776  ? 1.207   22.627 59.543  1.00 111.91 ? 773  SER A OG  1 
ATOM 6002 N N   . GLY A 1 786  ? 5.997   47.116 61.471  1.00 151.67 ? 783  GLY A N   1 
ATOM 6003 C CA  . GLY A 1 786  ? 6.830   47.322 60.294  1.00 151.67 ? 783  GLY A CA  1 
ATOM 6004 C C   . GLY A 1 786  ? 7.261   46.002 59.692  1.00 151.67 ? 783  GLY A C   1 
ATOM 6005 O O   . GLY A 1 786  ? 8.411   45.586 59.845  1.00 151.67 ? 783  GLY A O   1 
ATOM 6006 N N   . GLU A 1 787  ? 6.327   45.346 59.008  1.00 77.54  ? 784  GLU A N   1 
ATOM 6007 C CA  . GLU A 1 787  ? 6.547   44.015 58.441  1.00 77.54  ? 784  GLU A CA  1 
ATOM 6008 C C   . GLU A 1 787  ? 5.801   43.905 57.108  1.00 77.54  ? 784  GLU A C   1 
ATOM 6009 O O   . GLU A 1 787  ? 4.602   44.190 57.046  1.00 77.54  ? 784  GLU A O   1 
ATOM 6010 C CB  . GLU A 1 787  ? 6.061   42.908 59.403  1.00 128.26 ? 784  GLU A CB  1 
ATOM 6011 C CG  . GLU A 1 787  ? 6.962   42.602 60.620  1.00 128.26 ? 784  GLU A CG  1 
ATOM 6012 C CD  . GLU A 1 787  ? 6.384   41.531 61.573  1.00 128.26 ? 784  GLU A CD  1 
ATOM 6013 O OE1 . GLU A 1 787  ? 5.145   41.357 61.632  1.00 128.26 ? 784  GLU A OE1 1 
ATOM 6014 O OE2 . GLU A 1 787  ? 7.175   40.866 62.281  1.00 128.26 ? 784  GLU A OE2 1 
ATOM 6015 N N   . GLU A 1 788  ? 6.503   43.484 56.051  1.00 80.46  ? 785  GLU A N   1 
ATOM 6016 C CA  . GLU A 1 788  ? 5.883   43.387 54.719  1.00 80.46  ? 785  GLU A CA  1 
ATOM 6017 C C   . GLU A 1 788  ? 5.419   41.998 54.302  1.00 80.46  ? 785  GLU A C   1 
ATOM 6018 O O   . GLU A 1 788  ? 6.055   40.997 54.612  1.00 80.46  ? 785  GLU A O   1 
ATOM 6019 C CB  . GLU A 1 788  ? 6.768   44.003 53.635  1.00 75.21  ? 785  GLU A CB  1 
ATOM 6020 C CG  . GLU A 1 788  ? 6.411   45.458 53.374  1.00 75.21  ? 785  GLU A CG  1 
ATOM 6021 C CD  . GLU A 1 788  ? 7.132   46.048 52.180  1.00 75.21  ? 785  GLU A CD  1 
ATOM 6022 O OE1 . GLU A 1 788  ? 7.580   45.274 51.302  1.00 75.21  ? 785  GLU A OE1 1 
ATOM 6023 O OE2 . GLU A 1 788  ? 7.243   47.293 52.119  1.00 75.21  ? 785  GLU A OE2 1 
ATOM 6024 N N   . VAL A 1 789  ? 4.293   41.966 53.596  1.00 44.58  ? 786  VAL A N   1 
ATOM 6025 C CA  . VAL A 1 789  ? 3.733   40.734 53.098  1.00 44.58  ? 786  VAL A CA  1 
ATOM 6026 C C   . VAL A 1 789  ? 3.012   40.900 51.719  1.00 44.58  ? 786  VAL A C   1 
ATOM 6027 O O   . VAL A 1 789  ? 2.356   41.929 51.460  1.00 44.58  ? 786  VAL A O   1 
ATOM 6028 C CB  . VAL A 1 789  ? 2.803   40.096 54.174  1.00 60.28  ? 786  VAL A CB  1 
ATOM 6029 C CG1 . VAL A 1 789  ? 1.318   40.245 53.793  1.00 60.28  ? 786  VAL A CG1 1 
ATOM 6030 C CG2 . VAL A 1 789  ? 3.178   38.611 54.409  1.00 60.28  ? 786  VAL A CG2 1 
ATOM 6031 N N   . GLU A 1 790  ? 3.137   39.884 50.851  1.00 35.28  ? 787  GLU A N   1 
ATOM 6032 C CA  . GLU A 1 790  ? 2.478   39.884 49.552  1.00 35.28  ? 787  GLU A CA  1 
ATOM 6033 C C   . GLU A 1 790  ? 1.142   39.137 49.587  1.00 35.28  ? 787  GLU A C   1 
ATOM 6034 O O   . GLU A 1 790  ? 1.091   37.960 49.820  1.00 35.28  ? 787  GLU A O   1 
ATOM 6035 C CB  . GLU A 1 790  ? 3.382   39.270 48.491  1.00 53.11  ? 787  GLU A CB  1 
ATOM 6036 C CG  . GLU A 1 790  ? 4.634   40.056 48.233  1.00 53.11  ? 787  GLU A CG  1 
ATOM 6037 C CD  . GLU A 1 790  ? 5.416   39.580 47.022  1.00 53.11  ? 787  GLU A CD  1 
ATOM 6038 O OE1 . GLU A 1 790  ? 4.929   38.701 46.259  1.00 53.11  ? 787  GLU A OE1 1 
ATOM 6039 O OE2 . GLU A 1 790  ? 6.531   40.110 46.835  1.00 53.11  ? 787  GLU A OE2 1 
ATOM 6040 N N   . VAL A 1 791  ? 0.042   39.805 49.341  1.00 49.59  ? 788  VAL A N   1 
ATOM 6041 C CA  . VAL A 1 791  ? -1.178  39.074 49.217  1.00 49.59  ? 788  VAL A CA  1 
ATOM 6042 C C   . VAL A 1 791  ? -1.273  38.822 47.699  1.00 49.59  ? 788  VAL A C   1 
ATOM 6043 O O   . VAL A 1 791  ? -1.057  39.743 46.911  1.00 49.59  ? 788  VAL A O   1 
ATOM 6044 C CB  . VAL A 1 791  ? -2.379  39.908 49.851  1.00 44.01  ? 788  VAL A CB  1 
ATOM 6045 C CG1 . VAL A 1 791  ? -3.726  39.206 49.678  1.00 44.01  ? 788  VAL A CG1 1 
ATOM 6046 C CG2 . VAL A 1 791  ? -2.162  40.185 51.339  1.00 44.01  ? 788  VAL A CG2 1 
ATOM 6047 N N   . HIS A 1 792  ? -1.560  37.595 47.276  1.00 32.85  ? 789  HIS A N   1 
ATOM 6048 C CA  . HIS A 1 792  ? -1.691  37.220 45.830  1.00 32.85  ? 789  HIS A CA  1 
ATOM 6049 C C   . HIS A 1 792  ? -3.116  36.881 45.389  1.00 32.85  ? 789  HIS A C   1 
ATOM 6050 O O   . HIS A 1 792  ? -3.839  36.214 46.144  1.00 32.85  ? 789  HIS A O   1 
ATOM 6051 C CB  . HIS A 1 792  ? -0.884  35.966 45.536  1.00 35.73  ? 789  HIS A CB  1 
ATOM 6052 C CG  . HIS A 1 792  ? 0.572   36.207 45.363  1.00 35.73  ? 789  HIS A CG  1 
ATOM 6053 N ND1 . HIS A 1 792  ? 1.268   35.749 44.266  1.00 35.73  ? 789  HIS A ND1 1 
ATOM 6054 C CD2 . HIS A 1 792  ? 1.469   36.851 46.147  1.00 35.73  ? 789  HIS A CD2 1 
ATOM 6055 C CE1 . HIS A 1 792  ? 2.535   36.115 44.376  1.00 35.73  ? 789  HIS A CE1 1 
ATOM 6056 N NE2 . HIS A 1 792  ? 2.683   36.792 45.504  1.00 35.73  ? 789  HIS A NE2 1 
ATOM 6057 N N   . ASN A 1 793  ? -3.495  37.287 44.165  1.00 48.81  ? 790  ASN A N   1 
ATOM 6058 C CA  . ASN A 1 793  ? -4.874  37.180 43.690  1.00 48.81  ? 790  ASN A CA  1 
ATOM 6059 C C   . ASN A 1 793  ? -4.943  36.665 42.269  1.00 48.81  ? 790  ASN A C   1 
ATOM 6060 O O   . ASN A 1 793  ? -3.957  36.730 41.557  1.00 48.81  ? 790  ASN A O   1 
ATOM 6061 C CB  . ASN A 1 793  ? -5.543  38.550 43.669  1.00 53.13  ? 790  ASN A CB  1 
ATOM 6062 C CG  . ASN A 1 793  ? -5.502  39.257 45.002  1.00 53.13  ? 790  ASN A CG  1 
ATOM 6063 O OD1 . ASN A 1 793  ? -6.324  38.998 45.876  1.00 53.13  ? 790  ASN A OD1 1 
ATOM 6064 N ND2 . ASN A 1 793  ? -4.567  40.192 45.151  1.00 53.13  ? 790  ASN A ND2 1 
ATOM 6065 N N   . LEU A 1 794  ? -6.110  36.185 41.845  1.00 35.90  ? 791  LEU A N   1 
ATOM 6066 C CA  . LEU A 1 794  ? -6.385  35.960 40.451  1.00 35.90  ? 791  LEU A CA  1 
ATOM 6067 C C   . LEU A 1 794  ? -7.543  36.845 39.993  1.00 35.90  ? 791  LEU A C   1 
ATOM 6068 O O   . LEU A 1 794  ? -8.693  36.577 40.349  1.00 35.90  ? 791  LEU A O   1 
ATOM 6069 C CB  . LEU A 1 794  ? -6.774  34.515 40.193  1.00 27.01  ? 791  LEU A CB  1 
ATOM 6070 C CG  . LEU A 1 794  ? -7.503  34.282 38.849  1.00 27.01  ? 791  LEU A CG  1 
ATOM 6071 C CD1 . LEU A 1 794  ? -6.623  34.672 37.668  1.00 27.01  ? 791  LEU A CD1 1 
ATOM 6072 C CD2 . LEU A 1 794  ? -7.994  32.836 38.703  1.00 27.01  ? 791  LEU A CD2 1 
ATOM 6073 N N   . LEU A 1 795  ? -7.231  37.845 39.162  1.00 33.79  ? 792  LEU A N   1 
ATOM 6074 C CA  . LEU A 1 795  ? -8.162  38.845 38.663  1.00 33.79  ? 792  LEU A CA  1 
ATOM 6075 C C   . LEU A 1 795  ? -8.934  38.385 37.411  1.00 33.79  ? 792  LEU A C   1 
ATOM 6076 O O   . LEU A 1 795  ? -8.373  37.692 36.526  1.00 33.79  ? 792  LEU A O   1 
ATOM 6077 C CB  . LEU A 1 795  ? -7.372  40.105 38.304  1.00 29.67  ? 792  LEU A CB  1 
ATOM 6078 C CG  . LEU A 1 795  ? -6.519  40.843 39.347  1.00 29.67  ? 792  LEU A CG  1 
ATOM 6079 C CD1 . LEU A 1 795  ? -6.054  42.193 38.808  1.00 29.67  ? 792  LEU A CD1 1 
ATOM 6080 C CD2 . LEU A 1 795  ? -7.230  41.045 40.689  1.00 29.67  ? 792  LEU A CD2 1 
ATOM 6081 N N   . ILE A 1 796  ? -10.210 38.779 37.309  1.00 44.01  ? 793  ILE A N   1 
ATOM 6082 C CA  . ILE A 1 796  ? -10.973 38.475 36.097  1.00 44.01  ? 793  ILE A CA  1 
ATOM 6083 C C   . ILE A 1 796  ? -11.292 39.765 35.403  1.00 44.01  ? 793  ILE A C   1 
ATOM 6084 O O   . ILE A 1 796  ? -12.198 40.471 35.835  1.00 44.01  ? 793  ILE A O   1 
ATOM 6085 C CB  . ILE A 1 796  ? -12.303 37.692 36.359  1.00 36.97  ? 793  ILE A CB  1 
ATOM 6086 C CG1 . ILE A 1 796  ? -12.042 36.465 37.210  1.00 36.97  ? 793  ILE A CG1 1 
ATOM 6087 C CG2 . ILE A 1 796  ? -12.964 37.259 34.995  1.00 36.97  ? 793  ILE A CG2 1 
ATOM 6088 C CD1 . ILE A 1 796  ? -11.139 35.388 36.448  1.00 36.97  ? 793  ILE A CD1 1 
ATOM 6089 N N   . ILE A 1 797  ? -10.566 40.071 34.329  1.00 30.31  ? 794  ILE A N   1 
ATOM 6090 C CA  . ILE A 1 797  ? -10.651 41.391 33.720  1.00 30.31  ? 794  ILE A CA  1 
ATOM 6091 C C   . ILE A 1 797  ? -11.559 41.236 32.523  1.00 30.31  ? 794  ILE A C   1 
ATOM 6092 O O   . ILE A 1 797  ? -11.414 40.286 31.755  1.00 30.31  ? 794  ILE A O   1 
ATOM 6093 C CB  . ILE A 1 797  ? -9.254  41.949 33.283  1.00 29.44  ? 794  ILE A CB  1 
ATOM 6094 C CG1 . ILE A 1 797  ? -8.488  42.568 34.449  1.00 29.44  ? 794  ILE A CG1 1 
ATOM 6095 C CG2 . ILE A 1 797  ? -9.392  43.054 32.229  1.00 29.44  ? 794  ILE A CG2 1 
ATOM 6096 C CD1 . ILE A 1 797  ? -8.446  41.741 35.660  1.00 29.44  ? 794  ILE A CD1 1 
ATOM 6097 N N   . ASP A 1 798  ? -12.507 42.158 32.377  1.00 41.12  ? 795  ASP A N   1 
ATOM 6098 C CA  . ASP A 1 798  ? -13.389 42.121 31.231  1.00 41.12  ? 795  ASP A CA  1 
ATOM 6099 C C   . ASP A 1 798  ? -12.640 42.478 29.960  1.00 41.12  ? 795  ASP A C   1 
ATOM 6100 O O   . ASP A 1 798  ? -11.665 43.240 29.962  1.00 41.12  ? 795  ASP A O   1 
ATOM 6101 C CB  . ASP A 1 798  ? -14.579 43.043 31.406  1.00 55.11  ? 795  ASP A CB  1 
ATOM 6102 C CG  . ASP A 1 798  ? -15.585 42.877 30.290  1.00 55.11  ? 795  ASP A CG  1 
ATOM 6103 O OD1 . ASP A 1 798  ? -15.362 43.440 29.188  1.00 55.11  ? 795  ASP A OD1 1 
ATOM 6104 O OD2 . ASP A 1 798  ? -16.596 42.172 30.506  1.00 55.11  ? 795  ASP A OD2 1 
ATOM 6105 N N   . GLN A 1 799  ? -13.143 41.950 28.864  1.00 56.86  ? 796  GLN A N   1 
ATOM 6106 C CA  . GLN A 1 799  ? -12.429 42.022 27.610  1.00 56.86  ? 796  GLN A CA  1 
ATOM 6107 C C   . GLN A 1 799  ? -12.532 43.361 26.899  1.00 56.86  ? 796  GLN A C   1 
ATOM 6108 O O   . GLN A 1 799  ? -11.575 43.789 26.282  1.00 56.86  ? 796  GLN A O   1 
ATOM 6109 C CB  . GLN A 1 799  ? -12.922 40.914 26.699  1.00 75.39  ? 796  GLN A CB  1 
ATOM 6110 C CG  . GLN A 1 799  ? -12.011 40.606 25.579  1.00 75.39  ? 796  GLN A CG  1 
ATOM 6111 C CD  . GLN A 1 799  ? -12.736 39.865 24.526  1.00 75.39  ? 796  GLN A CD  1 
ATOM 6112 O OE1 . GLN A 1 799  ? -12.991 40.390 23.452  1.00 75.39  ? 796  GLN A OE1 1 
ATOM 6113 N NE2 . GLN A 1 799  ? -13.120 38.638 24.832  1.00 75.39  ? 796  GLN A NE2 1 
ATOM 6114 N N   . HIS A 1 800  ? -13.698 43.993 26.963  1.00 44.19  ? 797  HIS A N   1 
ATOM 6115 C CA  . HIS A 1 800  ? -13.923 45.289 26.322  1.00 44.19  ? 797  HIS A CA  1 
ATOM 6116 C C   . HIS A 1 800  ? -13.755 46.511 27.272  1.00 44.19  ? 797  HIS A C   1 
ATOM 6117 O O   . HIS A 1 800  ? -13.171 47.545 26.888  1.00 44.19  ? 797  HIS A O   1 
ATOM 6118 C CB  . HIS A 1 800  ? -15.319 45.306 25.713  1.00 57.52  ? 797  HIS A CB  1 
ATOM 6119 C CG  . HIS A 1 800  ? -15.688 44.037 25.010  1.00 57.52  ? 797  HIS A CG  1 
ATOM 6120 N ND1 . HIS A 1 800  ? -15.196 43.702 23.766  1.00 57.52  ? 797  HIS A ND1 1 
ATOM 6121 C CD2 . HIS A 1 800  ? -16.510 43.024 25.375  1.00 57.52  ? 797  HIS A CD2 1 
ATOM 6122 C CE1 . HIS A 1 800  ? -15.698 42.538 23.395  1.00 57.52  ? 797  HIS A CE1 1 
ATOM 6123 N NE2 . HIS A 1 800  ? -16.500 42.107 24.353  1.00 57.52  ? 797  HIS A NE2 1 
ATOM 6124 N N   . THR A 1 801  ? -14.281 46.391 28.492  1.00 44.01  ? 798  THR A N   1 
ATOM 6125 C CA  . THR A 1 801  ? -14.338 47.508 29.421  1.00 44.01  ? 798  THR A CA  1 
ATOM 6126 C C   . THR A 1 801  ? -13.095 47.556 30.297  1.00 44.01  ? 798  THR A C   1 
ATOM 6127 O O   . THR A 1 801  ? -12.791 48.585 30.948  1.00 44.01  ? 798  THR A O   1 
ATOM 6128 C CB  . THR A 1 801  ? -15.568 47.377 30.333  1.00 38.61  ? 798  THR A CB  1 
ATOM 6129 O OG1 . THR A 1 801  ? -15.481 46.143 31.077  1.00 38.61  ? 798  THR A OG1 1 
ATOM 6130 C CG2 . THR A 1 801  ? -16.878 47.396 29.498  1.00 38.61  ? 798  THR A CG2 1 
ATOM 6131 N N   . PHE A 1 802  ? -12.397 46.416 30.322  1.00 52.07  ? 799  PHE A N   1 
ATOM 6132 C CA  . PHE A 1 802  ? -11.200 46.204 31.147  1.00 52.07  ? 799  PHE A CA  1 
ATOM 6133 C C   . PHE A 1 802  ? -11.445 46.558 32.615  1.00 52.07  ? 799  PHE A C   1 
ATOM 6134 O O   . PHE A 1 802  ? -10.532 47.041 33.313  1.00 52.07  ? 799  PHE A O   1 
ATOM 6135 C CB  . PHE A 1 802  ? -9.979  46.942 30.565  1.00 45.15  ? 799  PHE A CB  1 
ATOM 6136 C CG  . PHE A 1 802  ? -9.335  46.227 29.413  1.00 45.15  ? 799  PHE A CG  1 
ATOM 6137 C CD1 . PHE A 1 802  ? -9.715  46.504 28.093  1.00 45.15  ? 799  PHE A CD1 1 
ATOM 6138 C CD2 . PHE A 1 802  ? -8.356  45.270 29.632  1.00 45.15  ? 799  PHE A CD2 1 
ATOM 6139 C CE1 . PHE A 1 802  ? -9.129  45.835 27.012  1.00 45.15  ? 799  PHE A CE1 1 
ATOM 6140 C CE2 . PHE A 1 802  ? -7.766  44.588 28.555  1.00 45.15  ? 799  PHE A CE2 1 
ATOM 6141 C CZ  . PHE A 1 802  ? -8.160  44.872 27.243  1.00 45.15  ? 799  PHE A CZ  1 
ATOM 6142 N N   . GLU A 1 803  ? -12.678 46.334 33.080  1.00 49.82  ? 800  GLU A N   1 
ATOM 6143 C CA  . GLU A 1 803  ? -12.934 46.403 34.522  1.00 49.82  ? 800  GLU A CA  1 
ATOM 6144 C C   . GLU A 1 803  ? -12.698 45.080 35.242  1.00 49.82  ? 800  GLU A C   1 
ATOM 6145 O O   . GLU A 1 803  ? -12.790 43.966 34.669  1.00 49.82  ? 800  GLU A O   1 
ATOM 6146 C CB  . GLU A 1 803  ? -14.263 47.082 34.900  1.00 123.53 ? 800  GLU A CB  1 
ATOM 6147 C CG  . GLU A 1 803  ? -15.474 46.711 34.069  1.00 123.53 ? 800  GLU A CG  1 
ATOM 6148 C CD  . GLU A 1 803  ? -16.696 47.581 34.370  1.00 123.53 ? 800  GLU A CD  1 
ATOM 6149 O OE1 . GLU A 1 803  ? -17.776 47.288 33.808  1.00 123.53 ? 800  GLU A OE1 1 
ATOM 6150 O OE2 . GLU A 1 803  ? -16.581 48.548 35.161  1.00 123.53 ? 800  GLU A OE2 1 
ATOM 6151 N N   . VAL A 1 804  ? -12.335 45.195 36.502  1.00 36.81  ? 801  VAL A N   1 
ATOM 6152 C CA  . VAL A 1 804  ? -12.059 44.008 37.268  1.00 36.81  ? 801  VAL A CA  1 
ATOM 6153 C C   . VAL A 1 804  ? -13.364 43.336 37.747  1.00 36.81  ? 801  VAL A C   1 
ATOM 6154 O O   . VAL A 1 804  ? -13.930 43.711 38.771  1.00 36.81  ? 801  VAL A O   1 
ATOM 6155 C CB  . VAL A 1 804  ? -11.167 44.373 38.414  1.00 33.33  ? 801  VAL A CB  1 
ATOM 6156 C CG1 . VAL A 1 804  ? -10.452 43.136 38.953  1.00 33.33  ? 801  VAL A CG1 1 
ATOM 6157 C CG2 . VAL A 1 804  ? -10.189 45.421 37.918  1.00 33.33  ? 801  VAL A CG2 1 
ATOM 6158 N N   . LEU A 1 805  ? -13.839 42.356 36.988  1.00 38.50  ? 802  LEU A N   1 
ATOM 6159 C CA  . LEU A 1 805  ? -15.103 41.733 37.292  1.00 38.50  ? 802  LEU A CA  1 
ATOM 6160 C C   . LEU A 1 805  ? -15.029 40.934 38.596  1.00 38.50  ? 802  LEU A C   1 
ATOM 6161 O O   . LEU A 1 805  ? -15.964 41.013 39.403  1.00 38.50  ? 802  LEU A O   1 
ATOM 6162 C CB  . LEU A 1 805  ? -15.604 40.854 36.139  1.00 34.47  ? 802  LEU A CB  1 
ATOM 6163 C CG  . LEU A 1 805  ? -15.600 41.329 34.679  1.00 34.47  ? 802  LEU A CG  1 
ATOM 6164 C CD1 . LEU A 1 805  ? -16.000 40.197 33.792  1.00 34.47  ? 802  LEU A CD1 1 
ATOM 6165 C CD2 . LEU A 1 805  ? -16.499 42.531 34.400  1.00 34.47  ? 802  LEU A CD2 1 
ATOM 6166 N N   . HIS A 1 806  ? -13.930 40.211 38.834  1.00 45.77  ? 803  HIS A N   1 
ATOM 6167 C CA  . HIS A 1 806  ? -13.787 39.394 40.053  1.00 45.77  ? 803  HIS A CA  1 
ATOM 6168 C C   . HIS A 1 806  ? -12.339 39.280 40.577  1.00 45.77  ? 803  HIS A C   1 
ATOM 6169 O O   . HIS A 1 806  ? -11.360 39.308 39.806  1.00 45.77  ? 803  HIS A O   1 
ATOM 6170 C CB  . HIS A 1 806  ? -14.393 37.999 39.842  1.00 58.65  ? 803  HIS A CB  1 
ATOM 6171 C CG  . HIS A 1 806  ? -14.406 37.142 41.076  1.00 58.65  ? 803  HIS A CG  1 
ATOM 6172 N ND1 . HIS A 1 806  ? -15.293 37.340 42.113  1.00 58.65  ? 803  HIS A ND1 1 
ATOM 6173 C CD2 . HIS A 1 806  ? -13.646 36.081 41.433  1.00 58.65  ? 803  HIS A CD2 1 
ATOM 6174 C CE1 . HIS A 1 806  ? -15.070 36.450 43.061  1.00 58.65  ? 803  HIS A CE1 1 
ATOM 6175 N NE2 . HIS A 1 806  ? -14.078 35.673 42.672  1.00 58.65  ? 803  HIS A NE2 1 
ATOM 6176 N N   . ALA A 1 807  ? -12.209 39.146 41.894  1.00 55.83  ? 804  ALA A N   1 
ATOM 6177 C CA  . ALA A 1 807  ? -10.910 38.983 42.530  1.00 55.83  ? 804  ALA A CA  1 
ATOM 6178 C C   . ALA A 1 807  ? -10.923 37.853 43.556  1.00 55.83  ? 804  ALA A C   1 
ATOM 6179 O O   . ALA A 1 807  ? -11.616 37.920 44.576  1.00 55.83  ? 804  ALA A O   1 
ATOM 6180 C CB  . ALA A 1 807  ? -10.477 40.290 43.179  1.00 11.73  ? 804  ALA A CB  1 
ATOM 6181 N N   . HIS A 1 808  ? -10.159 36.804 43.280  1.00 39.90  ? 805  HIS A N   1 
ATOM 6182 C CA  . HIS A 1 808  ? -10.049 35.683 44.206  1.00 39.90  ? 805  HIS A CA  1 
ATOM 6183 C C   . HIS A 1 808  ? -8.763  35.789 44.988  1.00 39.90  ? 805  HIS A C   1 
ATOM 6184 O O   . HIS A 1 808  ? -7.703  35.925 44.411  1.00 39.90  ? 805  HIS A O   1 
ATOM 6185 C CB  . HIS A 1 808  ? -10.061 34.378 43.428  1.00 63.76  ? 805  HIS A CB  1 
ATOM 6186 C CG  . HIS A 1 808  ? -9.850  33.174 44.286  1.00 63.76  ? 805  HIS A CG  1 
ATOM 6187 N ND1 . HIS A 1 808  ? -10.814 32.701 45.148  1.00 63.76  ? 805  HIS A ND1 1 
ATOM 6188 C CD2 . HIS A 1 808  ? -8.781  32.358 44.431  1.00 63.76  ? 805  HIS A CD2 1 
ATOM 6189 C CE1 . HIS A 1 808  ? -10.355 31.635 45.775  1.00 63.76  ? 805  HIS A CE1 1 
ATOM 6190 N NE2 . HIS A 1 808  ? -9.122  31.408 45.362  1.00 63.76  ? 805  HIS A NE2 1 
ATOM 6191 N N   . GLN A 1 809  ? -8.824  35.733 46.300  1.00 65.65  ? 806  GLN A N   1 
ATOM 6192 C CA  . GLN A 1 809  ? -7.583  35.786 47.045  1.00 65.65  ? 806  GLN A CA  1 
ATOM 6193 C C   . GLN A 1 809  ? -7.071  34.397 47.364  1.00 65.65  ? 806  GLN A C   1 
ATOM 6194 O O   . GLN A 1 809  ? -7.841  33.436 47.465  1.00 65.65  ? 806  GLN A O   1 
ATOM 6195 C CB  . GLN A 1 809  ? -7.771  36.577 48.308  1.00 54.53  ? 806  GLN A CB  1 
ATOM 6196 C CG  . GLN A 1 809  ? -6.505  36.937 48.988  1.00 54.53  ? 806  GLN A CG  1 
ATOM 6197 C CD  . GLN A 1 809  ? -6.781  37.746 50.215  1.00 54.53  ? 806  GLN A CD  1 
ATOM 6198 O OE1 . GLN A 1 809  ? -6.291  37.445 51.292  1.00 54.53  ? 806  GLN A OE1 1 
ATOM 6199 N NE2 . GLN A 1 809  ? -7.587  38.771 50.066  1.00 54.53  ? 806  GLN A NE2 1 
ATOM 6200 N N   . PHE A 1 810  ? -5.761  34.284 47.505  1.00 45.39  ? 807  PHE A N   1 
ATOM 6201 C CA  . PHE A 1 810  ? -5.167  32.986 47.736  1.00 45.39  ? 807  PHE A CA  1 
ATOM 6202 C C   . PHE A 1 810  ? -4.859  32.864 49.216  1.00 45.39  ? 807  PHE A C   1 
ATOM 6203 O O   . PHE A 1 810  ? -5.073  33.842 49.947  1.00 45.39  ? 807  PHE A O   1 
ATOM 6204 C CB  . PHE A 1 810  ? -3.939  32.832 46.860  1.00 37.65  ? 807  PHE A CB  1 
ATOM 6205 C CG  . PHE A 1 810  ? -4.259  32.402 45.485  1.00 37.65  ? 807  PHE A CG  1 
ATOM 6206 C CD1 . PHE A 1 810  ? -4.064  33.261 44.411  1.00 37.65  ? 807  PHE A CD1 1 
ATOM 6207 C CD2 . PHE A 1 810  ? -4.817  31.141 45.248  1.00 37.65  ? 807  PHE A CD2 1 
ATOM 6208 C CE1 . PHE A 1 810  ? -4.392  32.862 43.117  1.00 37.65  ? 807  PHE A CE1 1 
ATOM 6209 C CE2 . PHE A 1 810  ? -5.163  30.737 43.943  1.00 37.65  ? 807  PHE A CE2 1 
ATOM 6210 C CZ  . PHE A 1 810  ? -4.929  31.591 42.881  1.00 37.65  ? 807  PHE A CZ  1 
ATOM 6211 N N   . LEU A 1 811  ? -4.392  31.693 49.665  1.00 54.54  ? 808  LEU A N   1 
ATOM 6212 C CA  . LEU A 1 811  ? -4.067  31.503 51.090  1.00 54.54  ? 808  LEU A CA  1 
ATOM 6213 C C   . LEU A 1 811  ? -2.999  32.496 51.494  1.00 54.54  ? 808  LEU A C   1 
ATOM 6214 O O   . LEU A 1 811  ? -2.251  32.989 50.653  1.00 54.54  ? 808  LEU A O   1 
ATOM 6215 C CB  . LEU A 1 811  ? -3.637  30.051 51.428  1.00 39.64  ? 808  LEU A CB  1 
ATOM 6216 C CG  . LEU A 1 811  ? -4.580  28.981 50.826  1.00 39.64  ? 808  LEU A CG  1 
ATOM 6217 C CD1 . LEU A 1 811  ? -3.992  27.541 50.654  1.00 39.64  ? 808  LEU A CD1 1 
ATOM 6218 C CD2 . LEU A 1 811  ? -5.951  28.979 51.508  1.00 39.64  ? 808  LEU A CD2 1 
ATOM 6219 N N   . GLN A 1 812  ? -2.956  32.814 52.779  1.00 48.51  ? 809  GLN A N   1 
ATOM 6220 C CA  . GLN A 1 812  ? -1.869  33.607 53.313  1.00 48.51  ? 809  GLN A CA  1 
ATOM 6221 C C   . GLN A 1 812  ? -0.553  32.903 52.951  1.00 48.51  ? 809  GLN A C   1 
ATOM 6222 O O   . GLN A 1 812  ? -0.417  31.689 53.160  1.00 48.51  ? 809  GLN A O   1 
ATOM 6223 C CB  . GLN A 1 812  ? -2.007  33.790 54.827  1.00 60.34  ? 809  GLN A CB  1 
ATOM 6224 C CG  . GLN A 1 812  ? -1.231  35.014 55.338  1.00 60.34  ? 809  GLN A CG  1 
ATOM 6225 C CD  . GLN A 1 812  ? -1.213  35.163 56.861  1.00 60.34  ? 809  GLN A CD  1 
ATOM 6226 O OE1 . GLN A 1 812  ? -0.678  36.146 57.397  1.00 60.34  ? 809  GLN A OE1 1 
ATOM 6227 N NE2 . GLN A 1 812  ? -1.802  34.193 57.563  1.00 60.34  ? 809  GLN A NE2 1 
ATOM 6228 N N   . ASN A 1 813  ? 0.382   33.662 52.382  1.00 52.81  ? 810  ASN A N   1 
ATOM 6229 C CA  . ASN A 1 813  ? 1.733   33.180 51.999  1.00 52.81  ? 810  ASN A CA  1 
ATOM 6230 C C   . ASN A 1 813  ? 1.788   32.269 50.780  1.00 52.81  ? 810  ASN A C   1 
ATOM 6231 O O   . ASN A 1 813  ? 2.773   31.592 50.510  1.00 52.81  ? 810  ASN A O   1 
ATOM 6232 C CB  . ASN A 1 813  ? 2.474   32.585 53.192  1.00 65.37  ? 810  ASN A CB  1 
ATOM 6233 C CG  . ASN A 1 813  ? 2.812   33.626 54.208  1.00 65.37  ? 810  ASN A CG  1 
ATOM 6234 O OD1 . ASN A 1 813  ? 3.526   34.586 53.914  1.00 65.37  ? 810  ASN A OD1 1 
ATOM 6235 N ND2 . ASN A 1 813  ? 2.280   33.473 55.407  1.00 65.37  ? 810  ASN A ND2 1 
ATOM 6236 N N   . GLU A 1 814  ? 0.711   32.279 50.035  1.00 42.72  ? 811  GLU A N   1 
ATOM 6237 C CA  . GLU A 1 814  ? 0.638   31.503 48.841  1.00 42.72  ? 811  GLU A CA  1 
ATOM 6238 C C   . GLU A 1 814  ? 0.919   32.397 47.645  1.00 42.72  ? 811  GLU A C   1 
ATOM 6239 O O   . GLU A 1 814  ? 0.153   33.292 47.370  1.00 42.72  ? 811  GLU A O   1 
ATOM 6240 C CB  . GLU A 1 814  ? -0.760  30.936 48.736  1.00 33.45  ? 811  GLU A CB  1 
ATOM 6241 C CG  . GLU A 1 814  ? -0.951  30.226 47.487  1.00 33.45  ? 811  GLU A CG  1 
ATOM 6242 C CD  . GLU A 1 814  ? -2.041  29.232 47.589  1.00 33.45  ? 811  GLU A CD  1 
ATOM 6243 O OE1 . GLU A 1 814  ? -3.122  29.627 48.104  1.00 33.45  ? 811  GLU A OE1 1 
ATOM 6244 O OE2 . GLU A 1 814  ? -1.815  28.082 47.129  1.00 33.45  ? 811  GLU A OE2 1 
ATOM 6245 N N   . TYR A 1 815  ? 2.026   32.164 46.950  1.00 65.81  ? 812  TYR A N   1 
ATOM 6246 C CA  . TYR A 1 815  ? 2.359   32.938 45.759  1.00 65.81  ? 812  TYR A CA  1 
ATOM 6247 C C   . TYR A 1 815  ? 1.824   32.250 44.495  1.00 65.81  ? 812  TYR A C   1 
ATOM 6248 O O   . TYR A 1 815  ? 1.961   31.032 44.331  1.00 65.81  ? 812  TYR A O   1 
ATOM 6249 C CB  . TYR A 1 815  ? 3.867   33.125 45.647  1.00 75.12  ? 812  TYR A CB  1 
ATOM 6250 C CG  . TYR A 1 815  ? 4.456   34.176 46.547  1.00 75.12  ? 812  TYR A CG  1 
ATOM 6251 C CD1 . TYR A 1 815  ? 5.527   34.959 46.108  1.00 75.12  ? 812  TYR A CD1 1 
ATOM 6252 C CD2 . TYR A 1 815  ? 3.964   34.395 47.843  1.00 75.12  ? 812  TYR A CD2 1 
ATOM 6253 C CE1 . TYR A 1 815  ? 6.103   35.941 46.939  1.00 75.12  ? 812  TYR A CE1 1 
ATOM 6254 C CE2 . TYR A 1 815  ? 4.534   35.375 48.686  1.00 75.12  ? 812  TYR A CE2 1 
ATOM 6255 C CZ  . TYR A 1 815  ? 5.603   36.141 48.218  1.00 75.12  ? 812  TYR A CZ  1 
ATOM 6256 O OH  . TYR A 1 815  ? 6.176   37.107 49.021  1.00 75.12  ? 812  TYR A OH  1 
ATOM 6257 N N   . ALA A 1 816  ? 1.220   33.023 43.601  1.00 54.07  ? 813  ALA A N   1 
ATOM 6258 C CA  . ALA A 1 816  ? 0.786   32.455 42.340  1.00 54.07  ? 813  ALA A CA  1 
ATOM 6259 C C   . ALA A 1 816  ? 1.873   32.646 41.261  1.00 54.07  ? 813  ALA A C   1 
ATOM 6260 O O   . ALA A 1 816  ? 2.287   33.766 40.973  1.00 54.07  ? 813  ALA A O   1 
ATOM 6261 C CB  . ALA A 1 816  ? -0.535  33.059 41.910  1.00 62.83  ? 813  ALA A CB  1 
ATOM 6262 N N   . LEU A 1 817  ? 2.339   31.547 40.680  1.00 38.13  ? 814  LEU A N   1 
ATOM 6263 C CA  . LEU A 1 817  ? 3.475   31.608 39.780  1.00 38.13  ? 814  LEU A CA  1 
ATOM 6264 C C   . LEU A 1 817  ? 3.049   31.375 38.338  1.00 38.13  ? 814  LEU A C   1 
ATOM 6265 O O   . LEU A 1 817  ? 3.548   32.037 37.435  1.00 38.13  ? 814  LEU A O   1 
ATOM 6266 C CB  . LEU A 1 817  ? 4.545   30.596 40.206  1.00 27.78  ? 814  LEU A CB  1 
ATOM 6267 C CG  . LEU A 1 817  ? 4.937   30.554 41.705  1.00 27.78  ? 814  LEU A CG  1 
ATOM 6268 C CD1 . LEU A 1 817  ? 5.963   29.459 41.981  1.00 27.78  ? 814  LEU A CD1 1 
ATOM 6269 C CD2 . LEU A 1 817  ? 5.406   31.952 42.217  1.00 27.78  ? 814  LEU A CD2 1 
ATOM 6270 N N   . SER A 1 818  ? 2.102   30.464 38.123  1.00 37.44  ? 815  SER A N   1 
ATOM 6271 C CA  . SER A 1 818  ? 1.716   30.058 36.769  1.00 37.44  ? 815  SER A CA  1 
ATOM 6272 C C   . SER A 1 818  ? 0.221   30.113 36.504  1.00 37.44  ? 815  SER A C   1 
ATOM 6273 O O   . SER A 1 818  ? -0.578  29.997 37.433  1.00 37.44  ? 815  SER A O   1 
ATOM 6274 C CB  . SER A 1 818  ? 2.247   28.665 36.462  1.00 45.49  ? 815  SER A CB  1 
ATOM 6275 O OG  . SER A 1 818  ? 2.226   27.878 37.620  1.00 45.49  ? 815  SER A OG  1 
ATOM 6276 N N   . LEU A 1 819  ? -0.151  30.292 35.232  1.00 32.24  ? 816  LEU A N   1 
ATOM 6277 C CA  . LEU A 1 819  ? -1.549  30.459 34.883  1.00 32.24  ? 816  LEU A CA  1 
ATOM 6278 C C   . LEU A 1 819  ? -1.859  29.925 33.507  1.00 32.24  ? 816  LEU A C   1 
ATOM 6279 O O   . LEU A 1 819  ? -1.230  30.325 32.554  1.00 32.24  ? 816  LEU A O   1 
ATOM 6280 C CB  . LEU A 1 819  ? -1.920  31.939 34.900  1.00 27.13  ? 816  LEU A CB  1 
ATOM 6281 C CG  . LEU A 1 819  ? -3.285  32.289 34.284  1.00 27.13  ? 816  LEU A CG  1 
ATOM 6282 C CD1 . LEU A 1 819  ? -4.448  31.863 35.233  1.00 27.13  ? 816  LEU A CD1 1 
ATOM 6283 C CD2 . LEU A 1 819  ? -3.402  33.765 33.872  1.00 27.13  ? 816  LEU A CD2 1 
ATOM 6284 N N   . VAL A 1 820  ? -2.858  29.060 33.379  1.00 40.72  ? 817  VAL A N   1 
ATOM 6285 C CA  . VAL A 1 820  ? -3.297  28.648 32.051  1.00 40.72  ? 817  VAL A CA  1 
ATOM 6286 C C   . VAL A 1 820  ? -4.821  28.742 31.914  1.00 40.72  ? 817  VAL A C   1 
ATOM 6287 O O   . VAL A 1 820  ? -5.530  28.807 32.922  1.00 40.72  ? 817  VAL A O   1 
ATOM 6288 C CB  . VAL A 1 820  ? -2.701  27.276 31.665  1.00 42.90  ? 817  VAL A CB  1 
ATOM 6289 C CG1 . VAL A 1 820  ? -3.195  26.190 32.583  1.00 42.90  ? 817  VAL A CG1 1 
ATOM 6290 C CG2 . VAL A 1 820  ? -3.008  26.935 30.234  1.00 42.90  ? 817  VAL A CG2 1 
ATOM 6291 N N   . SER A 1 821  ? -5.309  28.796 30.673  1.00 48.79  ? 818  SER A N   1 
ATOM 6292 C CA  . SER A 1 821  ? -6.742  28.735 30.382  1.00 48.79  ? 818  SER A CA  1 
ATOM 6293 C C   . SER A 1 821  ? -6.978  27.696 29.276  1.00 48.79  ? 818  SER A C   1 
ATOM 6294 O O   . SER A 1 821  ? -6.523  27.876 28.137  1.00 48.79  ? 818  SER A O   1 
ATOM 6295 C CB  . SER A 1 821  ? -7.223  30.110 29.944  1.00 58.58  ? 818  SER A CB  1 
ATOM 6296 O OG  . SER A 1 821  ? -8.572  30.099 29.538  1.00 58.58  ? 818  SER A OG  1 
ATOM 6297 N N   . CYS A 1 822  ? -7.689  26.614 29.606  1.00 51.25  ? 819  CYS A N   1 
ATOM 6298 C CA  . CYS A 1 822  ? -7.865  25.497 28.662  1.00 51.25  ? 819  CYS A CA  1 
ATOM 6299 C C   . CYS A 1 822  ? -9.020  24.525 28.963  1.00 51.25  ? 819  CYS A C   1 
ATOM 6300 O O   . CYS A 1 822  ? -9.579  24.511 30.064  1.00 51.25  ? 819  CYS A O   1 
ATOM 6301 C CB  . CYS A 1 822  ? -6.575  24.689 28.621  1.00 48.17  ? 819  CYS A CB  1 
ATOM 6302 S SG  . CYS A 1 822  ? -6.083  24.073 30.299  1.00 48.17  ? 819  CYS A SG  1 
ATOM 6303 N N   . LYS A 1 823  ? -9.346  23.696 27.973  1.00 77.20  ? 820  LYS A N   1 
ATOM 6304 C CA  . LYS A 1 823  ? -10.152 22.490 28.186  1.00 77.20  ? 820  LYS A CA  1 
ATOM 6305 C C   . LYS A 1 823  ? -9.231  21.324 28.576  1.00 77.20  ? 820  LYS A C   1 
ATOM 6306 O O   . LYS A 1 823  ? -8.049  21.307 28.220  1.00 77.20  ? 820  LYS A O   1 
ATOM 6307 C CB  . LYS A 1 823  ? -10.950 22.132 26.926  1.00 67.63  ? 820  LYS A CB  1 
ATOM 6308 C CG  . LYS A 1 823  ? -12.112 23.063 26.621  1.00 67.63  ? 820  LYS A CG  1 
ATOM 6309 C CD  . LYS A 1 823  ? -12.477 23.046 25.153  1.00 67.63  ? 820  LYS A CD  1 
ATOM 6310 C CE  . LYS A 1 823  ? -13.531 24.115 24.836  1.00 67.63  ? 820  LYS A CE  1 
ATOM 6311 N NZ  . LYS A 1 823  ? -13.936 24.196 23.372  1.00 67.63  ? 820  LYS A NZ  1 
ATOM 6312 N N   . LEU A 1 824  ? -9.771  20.350 29.299  1.00 92.56  ? 821  LEU A N   1 
ATOM 6313 C CA  . LEU A 1 824  ? -8.994  19.177 29.676  1.00 92.56  ? 821  LEU A CA  1 
ATOM 6314 C C   . LEU A 1 824  ? -9.745  17.888 29.409  1.00 92.56  ? 821  LEU A C   1 
ATOM 6315 O O   . LEU A 1 824  ? -10.893 17.726 29.854  1.00 92.56  ? 821  LEU A O   1 
ATOM 6316 C CB  . LEU A 1 824  ? -8.587  19.248 31.140  1.00 61.91  ? 821  LEU A CB  1 
ATOM 6317 C CG  . LEU A 1 824  ? -7.394  20.114 31.535  1.00 61.91  ? 821  LEU A CG  1 
ATOM 6318 C CD1 . LEU A 1 824  ? -6.923  19.693 32.910  1.00 61.91  ? 821  LEU A CD1 1 
ATOM 6319 C CD2 . LEU A 1 824  ? -6.244  20.004 30.553  1.00 61.91  ? 821  LEU A CD2 1 
ATOM 6320 N N   . GLY A 1 825  ? -9.077  16.983 28.683  1.00 74.80  ? 822  GLY A N   1 
ATOM 6321 C CA  . GLY A 1 825  ? -9.661  15.714 28.215  1.00 74.80  ? 822  GLY A CA  1 
ATOM 6322 C C   . GLY A 1 825  ? -11.097 15.855 27.736  1.00 74.80  ? 822  GLY A C   1 
ATOM 6323 O O   . GLY A 1 825  ? -11.430 16.807 27.020  1.00 74.80  ? 822  GLY A O   1 
ATOM 6324 N N   . LYS A 1 826  ? -11.947 14.957 28.191  1.00 88.54  ? 823  LYS A N   1 
ATOM 6325 C CA  . LYS A 1 826  ? -13.293 14.861 27.678  1.00 88.54  ? 823  LYS A CA  1 
ATOM 6326 C C   . LYS A 1 826  ? -14.291 15.908 28.176  1.00 88.54  ? 823  LYS A C   1 
ATOM 6327 O O   . LYS A 1 826  ? -15.424 15.923 27.703  1.00 88.54  ? 823  LYS A O   1 
ATOM 6328 C CB  . LYS A 1 826  ? -13.848 13.460 27.925  1.00 134.93 ? 823  LYS A CB  1 
ATOM 6329 C CG  . LYS A 1 826  ? -13.064 12.310 27.307  1.00 134.93 ? 823  LYS A CG  1 
ATOM 6330 C CD  . LYS A 1 826  ? -12.261 11.537 28.360  1.00 134.93 ? 823  LYS A CD  1 
ATOM 6331 C CE  . LYS A 1 826  ? -12.260 10.024 28.121  1.00 134.93 ? 823  LYS A CE  1 
ATOM 6332 N NZ  . LYS A 1 826  ? -11.508 9.547  26.911  1.00 134.93 ? 823  LYS A NZ  1 
ATOM 6333 N N   . ASP A 1 827  ? -13.890 16.728 29.136  1.00 61.82  ? 824  ASP A N   1 
ATOM 6334 C CA  . ASP A 1 827  ? -14.759 17.750 29.674  1.00 61.82  ? 824  ASP A CA  1 
ATOM 6335 C C   . ASP A 1 827  ? -14.794 18.945 28.752  1.00 61.82  ? 824  ASP A C   1 
ATOM 6336 O O   . ASP A 1 827  ? -13.766 19.406 28.319  1.00 61.82  ? 824  ASP A O   1 
ATOM 6337 C CB  . ASP A 1 827  ? -14.267 18.197 31.030  1.00 66.12  ? 824  ASP A CB  1 
ATOM 6338 C CG  . ASP A 1 827  ? -15.148 19.227 31.620  1.00 66.12  ? 824  ASP A CG  1 
ATOM 6339 O OD1 . ASP A 1 827  ? -16.302 18.866 31.897  1.00 66.12  ? 824  ASP A OD1 1 
ATOM 6340 O OD2 . ASP A 1 827  ? -14.714 20.371 31.809  1.00 66.12  ? 824  ASP A OD2 1 
ATOM 6341 N N   . PRO A 1 828  ? -15.972 19.461 28.441  1.00 108.93 ? 825  PRO A N   1 
ATOM 6342 C CA  . PRO A 1 828  ? -16.011 20.501 27.406  1.00 108.93 ? 825  PRO A CA  1 
ATOM 6343 C C   . PRO A 1 828  ? -15.988 21.935 27.956  1.00 108.93 ? 825  PRO A C   1 
ATOM 6344 O O   . PRO A 1 828  ? -16.150 22.883 27.186  1.00 108.93 ? 825  PRO A O   1 
ATOM 6345 C CB  . PRO A 1 828  ? -17.336 20.218 26.688  1.00 66.85  ? 825  PRO A CB  1 
ATOM 6346 C CG  . PRO A 1 828  ? -18.206 19.569 27.732  1.00 66.85  ? 825  PRO A CG  1 
ATOM 6347 C CD  . PRO A 1 828  ? -17.333 19.123 28.897  1.00 66.85  ? 825  PRO A CD  1 
ATOM 6348 N N   . ASN A 1 829  ? -15.804 22.074 29.271  1.00 70.96  ? 826  ASN A N   1 
ATOM 6349 C CA  . ASN A 1 829  ? -15.605 23.366 29.921  1.00 70.96  ? 826  ASN A CA  1 
ATOM 6350 C C   . ASN A 1 829  ? -14.157 23.822 29.797  1.00 70.96  ? 826  ASN A C   1 
ATOM 6351 O O   . ASN A 1 829  ? -13.268 22.986 29.591  1.00 70.96  ? 826  ASN A O   1 
ATOM 6352 C CB  . ASN A 1 829  ? -15.946 23.275 31.402  1.00 90.51  ? 826  ASN A CB  1 
ATOM 6353 C CG  . ASN A 1 829  ? -17.416 23.228 31.646  1.00 90.51  ? 826  ASN A CG  1 
ATOM 6354 O OD1 . ASN A 1 829  ? -18.029 22.186 31.521  1.00 90.51  ? 826  ASN A OD1 1 
ATOM 6355 N ND2 . ASN A 1 829  ? -18.000 24.365 31.997  1.00 90.51  ? 826  ASN A ND2 1 
ATOM 6356 N N   . THR A 1 830  ? -13.979 25.148 29.918  1.00 58.88  ? 827  THR A N   1 
ATOM 6357 C CA  . THR A 1 830  ? -12.716 25.896 30.000  1.00 58.88  ? 827  THR A CA  1 
ATOM 6358 C C   . THR A 1 830  ? -12.597 26.291 31.459  1.00 58.88  ? 827  THR A C   1 
ATOM 6359 O O   . THR A 1 830  ? -13.401 27.047 32.044  1.00 58.88  ? 827  THR A O   1 
ATOM 6360 C CB  . THR A 1 830  ? -12.733 27.106 29.137  1.00 49.20  ? 827  THR A CB  1 
ATOM 6361 O OG1 . THR A 1 830  ? -14.055 27.606 29.101  1.00 49.20  ? 827  THR A OG1 1 
ATOM 6362 C CG2 . THR A 1 830  ? -12.353 26.759 27.757  1.00 49.20  ? 827  THR A CG2 1 
ATOM 6363 N N   . TYR A 1 831  ? -11.546 25.743 32.011  1.00 68.31  ? 828  TYR A N   1 
ATOM 6364 C CA  . TYR A 1 831  ? -11.144 26.068 33.316  1.00 68.31  ? 828  TYR A CA  1 
ATOM 6365 C C   . TYR A 1 831  ? -9.990  26.954 33.112  1.00 68.31  ? 828  TYR A C   1 
ATOM 6366 O O   . TYR A 1 831  ? -9.331  26.932 32.114  1.00 68.31  ? 828  TYR A O   1 
ATOM 6367 C CB  . TYR A 1 831  ? -10.716 24.820 34.071  1.00 82.50  ? 828  TYR A CB  1 
ATOM 6368 C CG  . TYR A 1 831  ? -11.798 23.804 34.116  1.00 82.50  ? 828  TYR A CG  1 
ATOM 6369 C CD1 . TYR A 1 831  ? -11.886 22.841 33.165  1.00 82.50  ? 828  TYR A CD1 1 
ATOM 6370 C CD2 . TYR A 1 831  ? -12.756 23.843 35.075  1.00 82.50  ? 828  TYR A CD2 1 
ATOM 6371 C CE1 . TYR A 1 831  ? -12.872 21.940 33.178  1.00 82.50  ? 828  TYR A CE1 1 
ATOM 6372 C CE2 . TYR A 1 831  ? -13.759 22.932 35.096  1.00 82.50  ? 828  TYR A CE2 1 
ATOM 6373 C CZ  . TYR A 1 831  ? -13.813 21.977 34.148  1.00 82.50  ? 828  TYR A CZ  1 
ATOM 6374 O OH  . TYR A 1 831  ? -14.818 21.049 34.145  1.00 82.50  ? 828  TYR A OH  1 
ATOM 6375 N N   . PHE A 1 832  ? -9.775  27.764 34.090  1.00 42.79  ? 829  PHE A N   1 
ATOM 6376 C CA  . PHE A 1 832  ? -8.527  28.403 34.285  1.00 42.79  ? 829  PHE A CA  1 
ATOM 6377 C C   . PHE A 1 832  ? -7.851  27.798 35.426  1.00 42.79  ? 829  PHE A C   1 
ATOM 6378 O O   . PHE A 1 832  ? -8.471  27.554 36.423  1.00 42.79  ? 829  PHE A O   1 
ATOM 6379 C CB  . PHE A 1 832  ? -8.715  29.753 34.990  1.00 47.37  ? 829  PHE A CB  1 
ATOM 6380 C CG  . PHE A 1 832  ? -9.148  30.911 34.152  1.00 47.37  ? 829  PHE A CG  1 
ATOM 6381 C CD1 . PHE A 1 832  ? -8.442  31.342 33.076  1.00 47.37  ? 829  PHE A CD1 1 
ATOM 6382 C CD2 . PHE A 1 832  ? -10.229 31.651 34.546  1.00 47.37  ? 829  PHE A CD2 1 
ATOM 6383 C CE1 . PHE A 1 832  ? -8.862  32.434 32.361  1.00 47.37  ? 829  PHE A CE1 1 
ATOM 6384 C CE2 . PHE A 1 832  ? -10.644 32.724 33.832  1.00 47.37  ? 829  PHE A CE2 1 
ATOM 6385 C CZ  . PHE A 1 832  ? -9.963  33.114 32.744  1.00 47.37  ? 829  PHE A CZ  1 
ATOM 6386 N N   . ILE A 1 833  ? -6.543  27.742 35.342  1.00 60.61  ? 830  ILE A N   1 
ATOM 6387 C CA  . ILE A 1 833  ? -5.758  27.060 36.319  1.00 60.61  ? 830  ILE A CA  1 
ATOM 6388 C C   . ILE A 1 833  ? -4.554  27.698 36.806  1.00 60.61  ? 830  ILE A C   1 
ATOM 6389 O O   . ILE A 1 833  ? -3.782  28.205 36.081  1.00 60.61  ? 830  ILE A O   1 
ATOM 6390 C CB  . ILE A 1 833  ? -5.281  25.744 35.764  1.00 67.32  ? 830  ILE A CB  1 
ATOM 6391 C CG1 . ILE A 1 833  ? -6.450  24.857 35.449  1.00 67.32  ? 830  ILE A CG1 1 
ATOM 6392 C CG2 . ILE A 1 833  ? -4.451  25.067 36.753  1.00 67.32  ? 830  ILE A CG2 1 
ATOM 6393 C CD1 . ILE A 1 833  ? -6.211  24.008 34.306  1.00 67.32  ? 830  ILE A CD1 1 
ATOM 6394 N N   . VAL A 1 834  ? -4.361  27.585 38.082  1.00 47.76  ? 831  VAL A N   1 
ATOM 6395 C CA  . VAL A 1 834  ? -3.270  28.354 38.698  1.00 47.76  ? 831  VAL A CA  1 
ATOM 6396 C C   . VAL A 1 834  ? -2.341  27.465 39.506  1.00 47.76  ? 831  VAL A C   1 
ATOM 6397 O O   . VAL A 1 834  ? -2.789  26.502 40.108  1.00 47.76  ? 831  VAL A O   1 
ATOM 6398 C CB  . VAL A 1 834  ? -3.853  29.423 39.612  1.00 18.22  ? 831  VAL A CB  1 
ATOM 6399 C CG1 . VAL A 1 834  ? -2.753  30.192 40.404  1.00 18.22  ? 831  VAL A CG1 1 
ATOM 6400 C CG2 . VAL A 1 834  ? -4.726  30.348 38.794  1.00 18.22  ? 831  VAL A CG2 1 
ATOM 6401 N N   . GLY A 1 835  ? -1.055  27.797 39.527  1.00 37.17  ? 832  GLY A N   1 
ATOM 6402 C CA  . GLY A 1 835  ? -0.053  26.949 40.155  1.00 37.17  ? 832  GLY A CA  1 
ATOM 6403 C C   . GLY A 1 835  ? 0.629   27.849 41.140  1.00 37.17  ? 832  GLY A C   1 
ATOM 6404 O O   . GLY A 1 835  ? 1.059   28.974 40.766  1.00 37.17  ? 832  GLY A O   1 
ATOM 6405 N N   . THR A 1 836  ? 0.702   27.404 42.400  1.00 46.21  ? 833  THR A N   1 
ATOM 6406 C CA  . THR A 1 836  ? 1.064   28.306 43.497  1.00 46.21  ? 833  THR A CA  1 
ATOM 6407 C C   . THR A 1 836  ? 2.210   27.797 44.347  1.00 46.21  ? 833  THR A C   1 
ATOM 6408 O O   . THR A 1 836  ? 2.748   26.698 44.102  1.00 46.21  ? 833  THR A O   1 
ATOM 6409 C CB  . THR A 1 836  ? -0.102  28.511 44.433  1.00 49.96  ? 833  THR A CB  1 
ATOM 6410 O OG1 . THR A 1 836  ? -0.418  27.262 45.051  1.00 49.96  ? 833  THR A OG1 1 
ATOM 6411 C CG2 . THR A 1 836  ? -1.319  29.015 43.696  1.00 49.96  ? 833  THR A CG2 1 
ATOM 6412 N N   . ALA A 1 837  ? 2.579   28.572 45.364  1.00 41.71  ? 834  ALA A N   1 
ATOM 6413 C CA  . ALA A 1 837  ? 3.598   28.088 46.267  1.00 41.71  ? 834  ALA A CA  1 
ATOM 6414 C C   . ALA A 1 837  ? 3.634   28.744 47.655  1.00 41.71  ? 834  ALA A C   1 
ATOM 6415 O O   . ALA A 1 837  ? 3.332   29.919 47.816  1.00 41.71  ? 834  ALA A O   1 
ATOM 6416 C CB  . ALA A 1 837  ? 4.936   28.160 45.593  1.00 27.70  ? 834  ALA A CB  1 
ATOM 6417 N N   . MET A 1 838  ? 3.988   27.965 48.662  1.00 52.67  ? 835  MET A N   1 
ATOM 6418 C CA  . MET A 1 838  ? 4.019   28.472 50.019  1.00 52.67  ? 835  MET A CA  1 
ATOM 6419 C C   . MET A 1 838  ? 5.385   29.037 50.342  1.00 52.67  ? 835  MET A C   1 
ATOM 6420 O O   . MET A 1 838  ? 6.399   28.329 50.493  1.00 52.67  ? 835  MET A O   1 
ATOM 6421 C CB  . MET A 1 838  ? 3.552   27.413 51.031  1.00 50.76  ? 835  MET A CB  1 
ATOM 6422 C CG  . MET A 1 838  ? 2.196   27.739 51.743  1.00 50.76  ? 835  MET A CG  1 
ATOM 6423 S SD  . MET A 1 838  ? 0.729   28.036 50.696  1.00 50.76  ? 835  MET A SD  1 
ATOM 6424 C CE  . MET A 1 838  ? 0.939   26.635 49.606  1.00 50.76  ? 835  MET A CE  1 
ATOM 6425 N N   . VAL A 1 839  ? 5.397   30.352 50.423  1.00 56.55  ? 836  VAL A N   1 
ATOM 6426 C CA  . VAL A 1 839  ? 6.620   31.086 50.595  1.00 56.55  ? 836  VAL A CA  1 
ATOM 6427 C C   . VAL A 1 839  ? 6.693   31.623 52.004  1.00 56.55  ? 836  VAL A C   1 
ATOM 6428 O O   . VAL A 1 839  ? 5.791   32.326 52.439  1.00 56.55  ? 836  VAL A O   1 
ATOM 6429 C CB  . VAL A 1 839  ? 6.663   32.230 49.595  1.00 37.10  ? 836  VAL A CB  1 
ATOM 6430 C CG1 . VAL A 1 839  ? 7.741   33.285 49.980  1.00 37.10  ? 836  VAL A CG1 1 
ATOM 6431 C CG2 . VAL A 1 839  ? 6.896   31.678 48.183  1.00 37.10  ? 836  VAL A CG2 1 
ATOM 6432 N N   . TYR A 1 840  ? 7.754   31.272 52.718  1.00 81.81  ? 837  TYR A N   1 
ATOM 6433 C CA  . TYR A 1 840  ? 8.060   31.930 53.977  1.00 81.81  ? 837  TYR A CA  1 
ATOM 6434 C C   . TYR A 1 840  ? 9.436   32.550 53.840  1.00 81.81  ? 837  TYR A C   1 
ATOM 6435 O O   . TYR A 1 840  ? 10.358  31.902 53.337  1.00 81.81  ? 837  TYR A O   1 
ATOM 6436 C CB  . TYR A 1 840  ? 7.941   30.967 55.165  1.00 44.27  ? 837  TYR A CB  1 
ATOM 6437 C CG  . TYR A 1 840  ? 6.596   30.254 55.143  1.00 44.27  ? 837  TYR A CG  1 
ATOM 6438 C CD1 . TYR A 1 840  ? 6.464   28.997 54.529  1.00 44.27  ? 837  TYR A CD1 1 
ATOM 6439 C CD2 . TYR A 1 840  ? 5.432   30.856 55.669  1.00 44.27  ? 837  TYR A CD2 1 
ATOM 6440 C CE1 . TYR A 1 840  ? 5.231   28.343 54.473  1.00 44.27  ? 837  TYR A CE1 1 
ATOM 6441 C CE2 . TYR A 1 840  ? 4.182   30.193 55.620  1.00 44.27  ? 837  TYR A CE2 1 
ATOM 6442 C CZ  . TYR A 1 840  ? 4.094   28.940 55.018  1.00 44.27  ? 837  TYR A CZ  1 
ATOM 6443 O OH  . TYR A 1 840  ? 2.884   28.257 54.921  1.00 44.27  ? 837  TYR A OH  1 
ATOM 6444 N N   . PRO A 1 841  ? 9.571   33.825 54.255  1.00 127.44 ? 838  PRO A N   1 
ATOM 6445 C CA  . PRO A 1 841  ? 10.827  34.550 54.107  1.00 127.44 ? 838  PRO A CA  1 
ATOM 6446 C C   . PRO A 1 841  ? 12.005  33.668 54.491  1.00 127.44 ? 838  PRO A C   1 
ATOM 6447 O O   . PRO A 1 841  ? 12.973  33.582 53.733  1.00 127.44 ? 838  PRO A O   1 
ATOM 6448 C CB  . PRO A 1 841  ? 10.675  35.706 55.094  1.00 140.28 ? 838  PRO A CB  1 
ATOM 6449 C CG  . PRO A 1 841  ? 9.216   35.980 55.097  1.00 140.28 ? 838  PRO A CG  1 
ATOM 6450 C CD  . PRO A 1 841  ? 8.535   34.651 54.906  1.00 140.28 ? 838  PRO A CD  1 
ATOM 6451 N N   . GLU A 1 842  ? 11.892  32.996 55.640  1.00 85.00  ? 839  GLU A N   1 
ATOM 6452 C CA  . GLU A 1 842  ? 12.926  32.079 56.118  1.00 85.00  ? 839  GLU A CA  1 
ATOM 6453 C C   . GLU A 1 842  ? 13.291  30.940 55.134  1.00 85.00  ? 839  GLU A C   1 
ATOM 6454 O O   . GLU A 1 842  ? 14.454  30.821 54.747  1.00 85.00  ? 839  GLU A O   1 
ATOM 6455 C CB  . GLU A 1 842  ? 12.570  31.523 57.508  1.00 143.34 ? 839  GLU A CB  1 
ATOM 6456 C CG  . GLU A 1 842  ? 11.289  30.688 57.579  1.00 143.34 ? 839  GLU A CG  1 
ATOM 6457 C CD  . GLU A 1 842  ? 11.522  29.289 58.155  1.00 143.34 ? 839  GLU A CD  1 
ATOM 6458 O OE1 . GLU A 1 842  ? 10.559  28.493 58.198  1.00 143.34 ? 839  GLU A OE1 1 
ATOM 6459 O OE2 . GLU A 1 842  ? 12.666  28.976 58.552  1.00 143.34 ? 839  GLU A OE2 1 
ATOM 6460 N N   . GLU A 1 843  ? 12.304  30.133 54.725  1.00 73.72  ? 840  GLU A N   1 
ATOM 6461 C CA  . GLU A 1 843  ? 12.529  28.936 53.901  1.00 73.72  ? 840  GLU A CA  1 
ATOM 6462 C C   . GLU A 1 843  ? 13.184  29.194 52.536  1.00 73.72  ? 840  GLU A C   1 
ATOM 6463 O O   . GLU A 1 843  ? 12.604  29.857 51.687  1.00 73.72  ? 840  GLU A O   1 
ATOM 6464 C CB  . GLU A 1 843  ? 11.211  28.198 53.687  1.00 112.27 ? 840  GLU A CB  1 
ATOM 6465 C CG  . GLU A 1 843  ? 10.704  27.461 54.896  1.00 112.27 ? 840  GLU A CG  1 
ATOM 6466 C CD  . GLU A 1 843  ? 9.494   26.607 54.585  1.00 112.27 ? 840  GLU A CD  1 
ATOM 6467 O OE1 . GLU A 1 843  ? 9.452   25.973 53.508  1.00 112.27 ? 840  GLU A OE1 1 
ATOM 6468 O OE2 . GLU A 1 843  ? 8.580   26.563 55.428  1.00 112.27 ? 840  GLU A OE2 1 
ATOM 6469 N N   . ALA A 1 844  ? 14.374  28.636 52.324  1.00 67.93  ? 841  ALA A N   1 
ATOM 6470 C CA  . ALA A 1 844  ? 15.132  28.821 51.085  1.00 67.93  ? 841  ALA A CA  1 
ATOM 6471 C C   . ALA A 1 844  ? 14.429  28.285 49.845  1.00 67.93  ? 841  ALA A C   1 
ATOM 6472 O O   . ALA A 1 844  ? 14.581  28.850 48.764  1.00 67.93  ? 841  ALA A O   1 
ATOM 6473 C CB  . ALA A 1 844  ? 16.497  28.197 51.212  1.00 73.81  ? 841  ALA A CB  1 
ATOM 6474 N N   . GLU A 1 845  ? 13.660  27.203 50.006  1.00 48.55  ? 842  GLU A N   1 
ATOM 6475 C CA  . GLU A 1 845  ? 12.952  26.548 48.896  1.00 48.55  ? 842  GLU A CA  1 
ATOM 6476 C C   . GLU A 1 845  ? 11.508  26.194 49.272  1.00 48.55  ? 842  GLU A C   1 
ATOM 6477 O O   . GLU A 1 845  ? 11.278  25.568 50.297  1.00 48.55  ? 842  GLU A O   1 
ATOM 6478 C CB  . GLU A 1 845  ? 13.638  25.235 48.563  1.00 68.98  ? 842  GLU A CB  1 
ATOM 6479 C CG  . GLU A 1 845  ? 14.733  25.273 47.544  1.00 68.98  ? 842  GLU A CG  1 
ATOM 6480 C CD  . GLU A 1 845  ? 14.949  23.891 46.920  1.00 68.98  ? 842  GLU A CD  1 
ATOM 6481 O OE1 . GLU A 1 845  ? 14.975  22.885 47.672  1.00 68.98  ? 842  GLU A OE1 1 
ATOM 6482 O OE2 . GLU A 1 845  ? 15.079  23.812 45.680  1.00 68.98  ? 842  GLU A OE2 1 
ATOM 6483 N N   . PRO A 1 846  ? 10.527  26.557 48.437  1.00 85.83  ? 843  PRO A N   1 
ATOM 6484 C CA  . PRO A 1 846  ? 9.155   26.131 48.708  1.00 85.83  ? 843  PRO A CA  1 
ATOM 6485 C C   . PRO A 1 846  ? 9.001   24.609 48.823  1.00 85.83  ? 843  PRO A C   1 
ATOM 6486 O O   . PRO A 1 846  ? 9.334   23.874 47.888  1.00 85.83  ? 843  PRO A O   1 
ATOM 6487 C CB  . PRO A 1 846  ? 8.381   26.644 47.491  1.00 62.46  ? 843  PRO A CB  1 
ATOM 6488 C CG  . PRO A 1 846  ? 9.171   27.748 47.007  1.00 62.46  ? 843  PRO A CG  1 
ATOM 6489 C CD  . PRO A 1 846  ? 10.600  27.390 47.235  1.00 62.46  ? 843  PRO A CD  1 
ATOM 6490 N N   . LYS A 1 847  ? 8.490   24.164 49.969  1.00 85.68  ? 844  LYS A N   1 
ATOM 6491 C CA  . LYS A 1 847  ? 8.239   22.752 50.239  1.00 85.68  ? 844  LYS A CA  1 
ATOM 6492 C C   . LYS A 1 847  ? 6.820   22.365 49.824  1.00 85.68  ? 844  LYS A C   1 
ATOM 6493 O O   . LYS A 1 847  ? 6.545   21.218 49.467  1.00 85.68  ? 844  LYS A O   1 
ATOM 6494 C CB  . LYS A 1 847  ? 8.485   22.458 51.725  1.00 118.85 ? 844  LYS A CB  1 
ATOM 6495 C CG  . LYS A 1 847  ? 8.123   21.055 52.203  1.00 118.85 ? 844  LYS A CG  1 
ATOM 6496 C CD  . LYS A 1 847  ? 8.922   19.965 51.499  1.00 118.85 ? 844  LYS A CD  1 
ATOM 6497 C CE  . LYS A 1 847  ? 8.444   18.584 51.923  1.00 118.85 ? 844  LYS A CE  1 
ATOM 6498 N NZ  . LYS A 1 847  ? 9.083   17.501 51.134  1.00 118.85 ? 844  LYS A NZ  1 
ATOM 6499 N N   . GLN A 1 848  ? 5.916   23.330 49.868  1.00 59.90  ? 845  GLN A N   1 
ATOM 6500 C CA  . GLN A 1 848  ? 4.529   23.057 49.518  1.00 59.90  ? 845  GLN A CA  1 
ATOM 6501 C C   . GLN A 1 848  ? 4.023   23.967 48.407  1.00 59.90  ? 845  GLN A C   1 
ATOM 6502 O O   . GLN A 1 848  ? 4.654   24.960 48.054  1.00 59.90  ? 845  GLN A O   1 
ATOM 6503 C CB  . GLN A 1 848  ? 3.654   23.225 50.755  1.00 89.46  ? 845  GLN A CB  1 
ATOM 6504 C CG  . GLN A 1 848  ? 4.127   22.443 51.963  1.00 89.46  ? 845  GLN A CG  1 
ATOM 6505 C CD  . GLN A 1 848  ? 3.569   22.987 53.252  1.00 89.46  ? 845  GLN A CD  1 
ATOM 6506 O OE1 . GLN A 1 848  ? 3.896   24.101 53.661  1.00 89.46  ? 845  GLN A OE1 1 
ATOM 6507 N NE2 . GLN A 1 848  ? 2.728   22.197 53.912  1.00 89.46  ? 845  GLN A NE2 1 
ATOM 6508 N N   . GLY A 1 849  ? 2.867   23.619 47.863  1.00 59.83  ? 846  GLY A N   1 
ATOM 6509 C CA  . GLY A 1 849  ? 2.182   24.467 46.888  1.00 59.83  ? 846  GLY A CA  1 
ATOM 6510 C C   . GLY A 1 849  ? 1.053   23.694 46.246  1.00 59.83  ? 846  GLY A C   1 
ATOM 6511 O O   . GLY A 1 849  ? 0.939   22.475 46.450  1.00 59.83  ? 846  GLY A O   1 
ATOM 6512 N N   . ARG A 1 850  ? 0.229   24.383 45.459  1.00 56.54  ? 847  ARG A N   1 
ATOM 6513 C CA  . ARG A 1 850  ? -0.868  23.700 44.803  1.00 56.54  ? 847  ARG A CA  1 
ATOM 6514 C C   . ARG A 1 850  ? -1.213  24.182 43.400  1.00 56.54  ? 847  ARG A C   1 
ATOM 6515 O O   . ARG A 1 850  ? -0.827  25.267 42.975  1.00 56.54  ? 847  ARG A O   1 
ATOM 6516 C CB  . ARG A 1 850  ? -2.105  23.699 45.695  1.00 53.42  ? 847  ARG A CB  1 
ATOM 6517 C CG  . ARG A 1 850  ? -2.647  25.054 45.990  1.00 53.42  ? 847  ARG A CG  1 
ATOM 6518 C CD  . ARG A 1 850  ? -3.327  25.095 47.368  1.00 53.42  ? 847  ARG A CD  1 
ATOM 6519 N NE  . ARG A 1 850  ? -3.933  26.408 47.578  1.00 53.42  ? 847  ARG A NE  1 
ATOM 6520 C CZ  . ARG A 1 850  ? -5.187  26.726 47.267  1.00 53.42  ? 847  ARG A CZ  1 
ATOM 6521 N NH1 . ARG A 1 850  ? -6.025  25.827 46.776  1.00 53.42  ? 847  ARG A NH1 1 
ATOM 6522 N NH2 . ARG A 1 850  ? -5.603  27.961 47.478  1.00 53.42  ? 847  ARG A NH2 1 
ATOM 6523 N N   . ILE A 1 851  ? -1.928  23.322 42.696  1.00 41.50  ? 848  ILE A N   1 
ATOM 6524 C CA  . ILE A 1 851  ? -2.495  23.589 41.414  1.00 41.50  ? 848  ILE A CA  1 
ATOM 6525 C C   . ILE A 1 851  ? -3.981  23.648 41.667  1.00 41.50  ? 848  ILE A C   1 
ATOM 6526 O O   . ILE A 1 851  ? -4.552  22.710 42.245  1.00 41.50  ? 848  ILE A O   1 
ATOM 6527 C CB  . ILE A 1 851  ? -2.196  22.430 40.491  1.00 32.99  ? 848  ILE A CB  1 
ATOM 6528 C CG1 . ILE A 1 851  ? -0.669  22.375 40.251  1.00 32.99  ? 848  ILE A CG1 1 
ATOM 6529 C CG2 . ILE A 1 851  ? -3.034  22.491 39.215  1.00 32.99  ? 848  ILE A CG2 1 
ATOM 6530 C CD1 . ILE A 1 851  ? -0.220  21.216 39.361  1.00 32.99  ? 848  ILE A CD1 1 
ATOM 6531 N N   . VAL A 1 852  ? -4.616  24.754 41.270  1.00 47.73  ? 849  VAL A N   1 
ATOM 6532 C CA  . VAL A 1 852  ? -6.022  24.945 41.567  1.00 47.73  ? 849  VAL A CA  1 
ATOM 6533 C C   . VAL A 1 852  ? -6.808  25.073 40.286  1.00 47.73  ? 849  VAL A C   1 
ATOM 6534 O O   . VAL A 1 852  ? -6.403  25.795 39.389  1.00 47.73  ? 849  VAL A O   1 
ATOM 6535 C CB  . VAL A 1 852  ? -6.281  26.200 42.379  1.00 36.55  ? 849  VAL A CB  1 
ATOM 6536 C CG1 . VAL A 1 852  ? -7.724  26.169 42.862  1.00 36.55  ? 849  VAL A CG1 1 
ATOM 6537 C CG2 . VAL A 1 852  ? -5.302  26.366 43.562  1.00 36.55  ? 849  VAL A CG2 1 
ATOM 6538 N N   . VAL A 1 853  ? -7.946  24.400 40.200  1.00 44.58  ? 850  VAL A N   1 
ATOM 6539 C CA  . VAL A 1 853  ? -8.697  24.418 38.954  1.00 44.58  ? 850  VAL A CA  1 
ATOM 6540 C C   . VAL A 1 853  ? -10.027 25.226 39.012  1.00 44.58  ? 850  VAL A C   1 
ATOM 6541 O O   . VAL A 1 853  ? -11.051 24.723 39.504  1.00 44.58  ? 850  VAL A O   1 
ATOM 6542 C CB  . VAL A 1 853  ? -8.899  22.986 38.413  1.00 35.81  ? 850  VAL A CB  1 
ATOM 6543 C CG1 . VAL A 1 853  ? -9.788  22.990 37.179  1.00 35.81  ? 850  VAL A CG1 1 
ATOM 6544 C CG2 . VAL A 1 853  ? -7.557  22.346 38.110  1.00 35.81  ? 850  VAL A CG2 1 
ATOM 6545 N N   . PHE A 1 854  ? -10.011 26.449 38.482  1.00 53.00  ? 851  PHE A N   1 
ATOM 6546 C CA  . PHE A 1 854  ? -11.171 27.326 38.603  1.00 53.00  ? 851  PHE A CA  1 
ATOM 6547 C C   . PHE A 1 854  ? -12.175 27.261 37.450  1.00 53.00  ? 851  PHE A C   1 
ATOM 6548 O O   . PHE A 1 854  ? -11.861 26.795 36.367  1.00 53.00  ? 851  PHE A O   1 
ATOM 6549 C CB  . PHE A 1 854  ? -10.724 28.761 38.764  1.00 47.79  ? 851  PHE A CB  1 
ATOM 6550 C CG  . PHE A 1 854  ? -9.898  29.003 39.974  1.00 47.79  ? 851  PHE A CG  1 
ATOM 6551 C CD1 . PHE A 1 854  ? -8.527  28.839 39.925  1.00 47.79  ? 851  PHE A CD1 1 
ATOM 6552 C CD2 . PHE A 1 854  ? -10.489 29.416 41.151  1.00 47.79  ? 851  PHE A CD2 1 
ATOM 6553 C CE1 . PHE A 1 854  ? -7.765  29.066 41.030  1.00 47.79  ? 851  PHE A CE1 1 
ATOM 6554 C CE2 . PHE A 1 854  ? -9.738  29.643 42.252  1.00 47.79  ? 851  PHE A CE2 1 
ATOM 6555 C CZ  . PHE A 1 854  ? -8.368  29.469 42.196  1.00 47.79  ? 851  PHE A CZ  1 
ATOM 6556 N N   . GLN A 1 855  ? -13.398 27.711 37.700  1.00 60.54  ? 852  GLN A N   1 
ATOM 6557 C CA  . GLN A 1 855  ? -14.365 27.857 36.629  1.00 60.54  ? 852  GLN A CA  1 
ATOM 6558 C C   . GLN A 1 855  ? -15.079 29.189 36.787  1.00 60.54  ? 852  GLN A C   1 
ATOM 6559 O O   . GLN A 1 855  ? -15.552 29.559 37.894  1.00 60.54  ? 852  GLN A O   1 
ATOM 6560 C CB  . GLN A 1 855  ? -15.355 26.696 36.598  1.00 83.23  ? 852  GLN A CB  1 
ATOM 6561 C CG  . GLN A 1 855  ? -16.200 26.593 35.326  1.00 83.23  ? 852  GLN A CG  1 
ATOM 6562 C CD  . GLN A 1 855  ? -17.385 25.628 35.479  1.00 83.23  ? 852  GLN A CD  1 
ATOM 6563 O OE1 . GLN A 1 855  ? -17.781 25.272 36.600  1.00 83.23  ? 852  GLN A OE1 1 
ATOM 6564 N NE2 . GLN A 1 855  ? -17.965 25.221 34.347  1.00 83.23  ? 852  GLN A NE2 1 
ATOM 6565 N N   . TYR A 1 856  ? -15.102 29.913 35.672  1.00 46.35  ? 853  TYR A N   1 
ATOM 6566 C CA  . TYR A 1 856  ? -15.825 31.137 35.555  1.00 46.35  ? 853  TYR A CA  1 
ATOM 6567 C C   . TYR A 1 856  ? -16.885 30.954 34.466  1.00 46.35  ? 853  TYR A C   1 
ATOM 6568 O O   . TYR A 1 856  ? -16.778 31.535 33.367  1.00 46.35  ? 853  TYR A O   1 
ATOM 6569 C CB  . TYR A 1 856  ? -14.837 32.236 35.156  1.00 57.22  ? 853  TYR A CB  1 
ATOM 6570 C CG  . TYR A 1 856  ? -15.417 33.633 35.180  1.00 57.22  ? 853  TYR A CG  1 
ATOM 6571 C CD1 . TYR A 1 856  ? -15.757 34.258 36.398  1.00 57.22  ? 853  TYR A CD1 1 
ATOM 6572 C CD2 . TYR A 1 856  ? -15.627 34.329 33.999  1.00 57.22  ? 853  TYR A CD2 1 
ATOM 6573 C CE1 . TYR A 1 856  ? -16.296 35.546 36.424  1.00 57.22  ? 853  TYR A CE1 1 
ATOM 6574 C CE2 . TYR A 1 856  ? -16.154 35.612 34.014  1.00 57.22  ? 853  TYR A CE2 1 
ATOM 6575 C CZ  . TYR A 1 856  ? -16.488 36.215 35.225  1.00 57.22  ? 853  TYR A CZ  1 
ATOM 6576 O OH  . TYR A 1 856  ? -17.025 37.482 35.216  1.00 57.22  ? 853  TYR A OH  1 
ATOM 6577 N N   . SER A 1 857  ? -17.886 30.120 34.718  1.00 155.84 ? 854  SER A N   1 
ATOM 6578 C CA  . SER A 1 857  ? -18.968 29.955 33.744  1.00 155.84 ? 854  SER A CA  1 
ATOM 6579 C C   . SER A 1 857  ? -19.663 31.299 33.550  1.00 155.84 ? 854  SER A C   1 
ATOM 6580 O O   . SER A 1 857  ? -20.058 31.667 32.433  1.00 155.84 ? 854  SER A O   1 
ATOM 6581 C CB  . SER A 1 857  ? -19.963 28.892 34.210  1.00 94.40  ? 854  SER A CB  1 
ATOM 6582 O OG  . SER A 1 857  ? -20.097 28.917 35.622  1.00 94.40  ? 854  SER A OG  1 
ATOM 6583 N N   . ASP A 1 858  ? -19.768 32.030 34.659  1.00 169.16 ? 855  ASP A N   1 
ATOM 6584 C CA  . ASP A 1 858  ? -20.378 33.343 34.693  1.00 169.16 ? 855  ASP A CA  1 
ATOM 6585 C C   . ASP A 1 858  ? -20.436 33.874 36.124  1.00 169.16 ? 855  ASP A C   1 
ATOM 6586 O O   . ASP A 1 858  ? -20.646 33.111 37.073  1.00 169.16 ? 855  ASP A O   1 
ATOM 6587 C CB  . ASP A 1 858  ? -21.786 33.281 34.105  1.00 129.10 ? 855  ASP A CB  1 
ATOM 6588 C CG  . ASP A 1 858  ? -22.578 34.516 34.393  1.00 129.10 ? 855  ASP A CG  1 
ATOM 6589 O OD1 . ASP A 1 858  ? -22.085 35.622 34.085  1.00 129.10 ? 855  ASP A OD1 1 
ATOM 6590 O OD2 . ASP A 1 858  ? -23.685 34.379 34.944  1.00 129.10 ? 855  ASP A OD2 1 
ATOM 6591 N N   . GLY A 1 859  ? -20.238 35.185 36.264  1.00 76.63  ? 856  GLY A N   1 
ATOM 6592 C CA  . GLY A 1 859  ? -20.473 35.872 37.516  1.00 76.63  ? 856  GLY A CA  1 
ATOM 6593 C C   . GLY A 1 859  ? -19.407 35.607 38.551  1.00 76.63  ? 856  GLY A C   1 
ATOM 6594 O O   . GLY A 1 859  ? -18.758 36.549 39.046  1.00 76.63  ? 856  GLY A O   1 
ATOM 6595 N N   . LYS A 1 860  ? -19.217 34.330 38.895  1.00 64.97  ? 857  LYS A N   1 
ATOM 6596 C CA  . LYS A 1 860  ? -18.223 33.999 39.924  1.00 64.97  ? 857  LYS A CA  1 
ATOM 6597 C C   . LYS A 1 860  ? -17.216 32.912 39.559  1.00 64.97  ? 857  LYS A C   1 
ATOM 6598 O O   . LYS A 1 860  ? -17.369 32.189 38.573  1.00 64.97  ? 857  LYS A O   1 
ATOM 6599 C CB  . LYS A 1 860  ? -18.872 33.729 41.293  1.00 148.55 ? 857  LYS A CB  1 
ATOM 6600 C CG  . LYS A 1 860  ? -19.897 32.594 41.340  1.00 148.55 ? 857  LYS A CG  1 
ATOM 6601 C CD  . LYS A 1 860  ? -19.717 31.695 42.580  1.00 148.55 ? 857  LYS A CD  1 
ATOM 6602 C CE  . LYS A 1 860  ? -19.426 32.478 43.871  1.00 148.55 ? 857  LYS A CE  1 
ATOM 6603 N NZ  . LYS A 1 860  ? -20.582 33.291 44.344  1.00 148.55 ? 857  LYS A NZ  1 
ATOM 6604 N N   . LEU A 1 861  ? -16.163 32.857 40.368  1.00 61.82  ? 858  LEU A N   1 
ATOM 6605 C CA  . LEU A 1 861  ? -15.129 31.842 40.275  1.00 61.82  ? 858  LEU A CA  1 
ATOM 6606 C C   . LEU A 1 861  ? -15.425 30.651 41.175  1.00 61.82  ? 858  LEU A C   1 
ATOM 6607 O O   . LEU A 1 861  ? -15.443 30.768 42.397  1.00 61.82  ? 858  LEU A O   1 
ATOM 6608 C CB  . LEU A 1 861  ? -13.772 32.427 40.682  1.00 50.12  ? 858  LEU A CB  1 
ATOM 6609 C CG  . LEU A 1 861  ? -12.780 32.999 39.676  1.00 50.12  ? 858  LEU A CG  1 
ATOM 6610 C CD1 . LEU A 1 861  ? -11.444 32.774 40.307  1.00 50.12  ? 858  LEU A CD1 1 
ATOM 6611 C CD2 . LEU A 1 861  ? -12.837 32.338 38.288  1.00 50.12  ? 858  LEU A CD2 1 
ATOM 6612 N N   . GLN A 1 862  ? -15.627 29.489 40.589  1.00 59.35  ? 859  GLN A N   1 
ATOM 6613 C CA  . GLN A 1 862  ? -15.785 28.332 41.444  1.00 59.35  ? 859  GLN A CA  1 
ATOM 6614 C C   . GLN A 1 862  ? -14.519 27.504 41.419  1.00 59.35  ? 859  GLN A C   1 
ATOM 6615 O O   . GLN A 1 862  ? -13.942 27.273 40.341  1.00 59.35  ? 859  GLN A O   1 
ATOM 6616 C CB  . GLN A 1 862  ? -16.994 27.496 41.019  1.00 152.39 ? 859  GLN A CB  1 
ATOM 6617 C CG  . GLN A 1 862  ? -17.450 26.480 42.063  1.00 152.39 ? 859  GLN A CG  1 
ATOM 6618 C CD  . GLN A 1 862  ? -18.346 25.402 41.480  1.00 152.39 ? 859  GLN A CD  1 
ATOM 6619 O OE1 . GLN A 1 862  ? -18.369 25.182 40.265  1.00 152.39 ? 859  GLN A OE1 1 
ATOM 6620 N NE2 . GLN A 1 862  ? -19.089 24.721 42.346  1.00 152.39 ? 859  GLN A NE2 1 
ATOM 6621 N N   . THR A 1 863  ? -14.084 27.083 42.611  1.00 60.95  ? 860  THR A N   1 
ATOM 6622 C CA  . THR A 1 863  ? -12.982 26.127 42.768  1.00 60.95  ? 860  THR A CA  1 
ATOM 6623 C C   . THR A 1 863  ? -13.478 24.744 42.412  1.00 60.95  ? 860  THR A C   1 
ATOM 6624 O O   . THR A 1 863  ? -14.400 24.251 43.032  1.00 60.95  ? 860  THR A O   1 
ATOM 6625 C CB  . THR A 1 863  ? -12.494 26.126 44.189  1.00 48.09  ? 860  THR A CB  1 
ATOM 6626 O OG1 . THR A 1 863  ? -12.358 27.482 44.629  1.00 48.09  ? 860  THR A OG1 1 
ATOM 6627 C CG2 . THR A 1 863  ? -11.129 25.428 44.291  1.00 48.09  ? 860  THR A CG2 1 
ATOM 6628 N N   . VAL A 1 864  ? -12.892 24.129 41.401  1.00 57.66  ? 861  VAL A N   1 
ATOM 6629 C CA  . VAL A 1 864  ? -13.463 22.913 40.836  1.00 57.66  ? 861  VAL A CA  1 
ATOM 6630 C C   . VAL A 1 864  ? -12.654 21.664 41.220  1.00 57.66  ? 861  VAL A C   1 
ATOM 6631 O O   . VAL A 1 864  ? -13.160 20.546 41.226  1.00 57.66  ? 861  VAL A O   1 
ATOM 6632 C CB  . VAL A 1 864  ? -13.568 23.027 39.285  1.00 40.53  ? 861  VAL A CB  1 
ATOM 6633 C CG1 . VAL A 1 864  ? -14.364 21.845 38.661  1.00 40.53  ? 861  VAL A CG1 1 
ATOM 6634 C CG2 . VAL A 1 864  ? -14.188 24.386 38.886  1.00 40.53  ? 861  VAL A CG2 1 
ATOM 6635 N N   . ALA A 1 865  ? -11.392 21.866 41.547  1.00 49.23  ? 862  ALA A N   1 
ATOM 6636 C CA  . ALA A 1 865  ? -10.470 20.796 41.790  1.00 49.23  ? 862  ALA A CA  1 
ATOM 6637 C C   . ALA A 1 865  ? -9.295  21.485 42.420  1.00 49.23  ? 862  ALA A C   1 
ATOM 6638 O O   . ALA A 1 865  ? -8.918  22.573 41.983  1.00 49.23  ? 862  ALA A O   1 
ATOM 6639 C CB  . ALA A 1 865  ? -10.053 20.148 40.483  1.00 94.66  ? 862  ALA A CB  1 
ATOM 6640 N N   . GLU A 1 866  ? -8.732  20.855 43.444  1.00 91.81  ? 863  GLU A N   1 
ATOM 6641 C CA  . GLU A 1 866  ? -7.538  21.334 44.113  1.00 91.81  ? 863  GLU A CA  1 
ATOM 6642 C C   . GLU A 1 866  ? -6.591  20.166 44.329  1.00 91.81  ? 863  GLU A C   1 
ATOM 6643 O O   . GLU A 1 866  ? -7.028  19.066 44.671  1.00 91.81  ? 863  GLU A O   1 
ATOM 6644 C CB  . GLU A 1 866  ? -7.908  21.953 45.446  1.00 85.13  ? 863  GLU A CB  1 
ATOM 6645 C CG  . GLU A 1 866  ? -6.797  21.922 46.455  1.00 85.13  ? 863  GLU A CG  1 
ATOM 6646 C CD  . GLU A 1 866  ? -7.073  22.794 47.630  1.00 85.13  ? 863  GLU A CD  1 
ATOM 6647 O OE1 . GLU A 1 866  ? -6.114  23.110 48.359  1.00 85.13  ? 863  GLU A OE1 1 
ATOM 6648 O OE2 . GLU A 1 866  ? -8.244  23.175 47.822  1.00 85.13  ? 863  GLU A OE2 1 
ATOM 6649 N N   . LYS A 1 867  ? -5.295  20.413 44.153  1.00 56.74  ? 864  LYS A N   1 
ATOM 6650 C CA  . LYS A 1 867  ? -4.311  19.345 44.133  1.00 56.74  ? 864  LYS A CA  1 
ATOM 6651 C C   . LYS A 1 867  ? -3.035  19.765 44.823  1.00 56.74  ? 864  LYS A C   1 
ATOM 6652 O O   . LYS A 1 867  ? -2.338  20.626 44.319  1.00 56.74  ? 864  LYS A O   1 
ATOM 6653 C CB  . LYS A 1 867  ? -4.006  18.957 42.693  1.00 65.84  ? 864  LYS A CB  1 
ATOM 6654 C CG  . LYS A 1 867  ? -3.081  17.762 42.564  1.00 65.84  ? 864  LYS A CG  1 
ATOM 6655 C CD  . LYS A 1 867  ? -3.851  16.471 42.377  1.00 65.84  ? 864  LYS A CD  1 
ATOM 6656 C CE  . LYS A 1 867  ? -2.918  15.283 42.305  1.00 65.84  ? 864  LYS A CE  1 
ATOM 6657 N NZ  . LYS A 1 867  ? -3.718  14.026 42.281  1.00 65.84  ? 864  LYS A NZ  1 
ATOM 6658 N N   . GLU A 1 868  ? -2.726  19.136 45.958  1.00 55.44  ? 865  GLU A N   1 
ATOM 6659 C CA  . GLU A 1 868  ? -1.517  19.443 46.722  1.00 55.44  ? 865  GLU A CA  1 
ATOM 6660 C C   . GLU A 1 868  ? -0.256  19.006 45.985  1.00 55.44  ? 865  GLU A C   1 
ATOM 6661 O O   . GLU A 1 868  ? -0.243  17.962 45.349  1.00 55.44  ? 865  GLU A O   1 
ATOM 6662 C CB  . GLU A 1 868  ? -1.527  18.784 48.101  1.00 75.76  ? 865  GLU A CB  1 
ATOM 6663 C CG  . GLU A 1 868  ? -0.538  19.451 49.075  1.00 75.76  ? 865  GLU A CG  1 
ATOM 6664 C CD  . GLU A 1 868  ? -0.001  18.508 50.131  1.00 75.76  ? 865  GLU A CD  1 
ATOM 6665 O OE1 . GLU A 1 868  ? 1.018   17.865 49.860  1.00 75.76  ? 865  GLU A OE1 1 
ATOM 6666 O OE2 . GLU A 1 868  ? -0.571  18.434 51.240  1.00 75.76  ? 865  GLU A OE2 1 
ATOM 6667 N N   . VAL A 1 869  ? 0.792   19.818 46.046  1.00 50.82  ? 866  VAL A N   1 
ATOM 6668 C CA  . VAL A 1 869  ? 2.050   19.389 45.511  1.00 50.82  ? 866  VAL A CA  1 
ATOM 6669 C C   . VAL A 1 869  ? 3.184   19.720 46.470  1.00 50.82  ? 866  VAL A C   1 
ATOM 6670 O O   . VAL A 1 869  ? 2.978   20.377 47.506  1.00 50.82  ? 866  VAL A O   1 
ATOM 6671 C CB  . VAL A 1 869  ? 2.334   19.935 44.103  1.00 48.04  ? 866  VAL A CB  1 
ATOM 6672 C CG1 . VAL A 1 869  ? 1.102   19.827 43.224  1.00 48.04  ? 866  VAL A CG1 1 
ATOM 6673 C CG2 . VAL A 1 869  ? 2.872   21.368 44.161  1.00 48.04  ? 866  VAL A CG2 1 
ATOM 6674 N N   . LYS A 1 870  ? 4.376   19.265 46.101  1.00 55.58  ? 867  LYS A N   1 
ATOM 6675 C CA  . LYS A 1 870  ? 5.489   19.180 47.018  1.00 55.58  ? 867  LYS A CA  1 
ATOM 6676 C C   . LYS A 1 870  ? 6.561   20.237 46.768  1.00 55.58  ? 867  LYS A C   1 
ATOM 6677 O O   . LYS A 1 870  ? 7.700   20.119 47.241  1.00 55.58  ? 867  LYS A O   1 
ATOM 6678 C CB  . LYS A 1 870  ? 6.091   17.765 46.936  1.00 67.14  ? 867  LYS A CB  1 
ATOM 6679 C CG  . LYS A 1 870  ? 5.184   16.663 47.479  1.00 67.14  ? 867  LYS A CG  1 
ATOM 6680 C CD  . LYS A 1 870  ? 4.807   16.894 48.948  1.00 67.14  ? 867  LYS A CD  1 
ATOM 6681 C CE  . LYS A 1 870  ? 6.015   16.774 49.887  1.00 67.14  ? 867  LYS A CE  1 
ATOM 6682 N NZ  . LYS A 1 870  ? 6.533   15.367 50.013  1.00 67.14  ? 867  LYS A NZ  1 
ATOM 6683 N N   . GLY A 1 871  ? 6.197   21.270 46.021  1.00 55.61  ? 868  GLY A N   1 
ATOM 6684 C CA  . GLY A 1 871  ? 7.135   22.343 45.683  1.00 55.61  ? 868  GLY A CA  1 
ATOM 6685 C C   . GLY A 1 871  ? 6.449   23.419 44.887  1.00 55.61  ? 868  GLY A C   1 
ATOM 6686 O O   . GLY A 1 871  ? 5.252   23.356 44.656  1.00 55.61  ? 868  GLY A O   1 
ATOM 6687 N N   . ALA A 1 872  ? 7.238   24.392 44.458  1.00 50.28  ? 869  ALA A N   1 
ATOM 6688 C CA  . ALA A 1 872  ? 6.761   25.590 43.756  1.00 50.28  ? 869  ALA A CA  1 
ATOM 6689 C C   . ALA A 1 872  ? 6.422   25.291 42.317  1.00 50.28  ? 869  ALA A C   1 
ATOM 6690 O O   . ALA A 1 872  ? 7.324   25.059 41.529  1.00 50.28  ? 869  ALA A O   1 
ATOM 6691 C CB  . ALA A 1 872  ? 7.837   26.698 43.821  1.00 31.70  ? 869  ALA A CB  1 
ATOM 6692 N N   . VAL A 1 873  ? 5.137   25.309 41.967  1.00 47.16  ? 870  VAL A N   1 
ATOM 6693 C CA  . VAL A 1 873  ? 4.711   25.057 40.571  1.00 47.16  ? 870  VAL A CA  1 
ATOM 6694 C C   . VAL A 1 873  ? 5.081   26.223 39.668  1.00 47.16  ? 870  VAL A C   1 
ATOM 6695 O O   . VAL A 1 873  ? 4.254   27.144 39.457  1.00 47.16  ? 870  VAL A O   1 
ATOM 6696 C CB  . VAL A 1 873  ? 3.205   24.806 40.419  1.00 45.90  ? 870  VAL A CB  1 
ATOM 6697 C CG1 . VAL A 1 873  ? 2.970   23.968 39.185  1.00 45.90  ? 870  VAL A CG1 1 
ATOM 6698 C CG2 . VAL A 1 873  ? 2.644   24.086 41.615  1.00 45.90  ? 870  VAL A CG2 1 
ATOM 6699 N N   . TYR A 1 874  ? 6.321   26.175 39.153  1.00 49.40  ? 871  TYR A N   1 
ATOM 6700 C CA  . TYR A 1 874  ? 6.943   27.337 38.505  1.00 49.40  ? 871  TYR A CA  1 
ATOM 6701 C C   . TYR A 1 874  ? 6.331   27.650 37.160  1.00 49.40  ? 871  TYR A C   1 
ATOM 6702 O O   . TYR A 1 874  ? 6.467   28.769 36.672  1.00 49.40  ? 871  TYR A O   1 
ATOM 6703 C CB  . TYR A 1 874  ? 8.456   27.188 38.363  1.00 46.92  ? 871  TYR A CB  1 
ATOM 6704 C CG  . TYR A 1 874  ? 9.205   27.529 39.612  1.00 46.92  ? 871  TYR A CG  1 
ATOM 6705 C CD1 . TYR A 1 874  ? 9.954   26.550 40.287  1.00 46.92  ? 871  TYR A CD1 1 
ATOM 6706 C CD2 . TYR A 1 874  ? 9.155   28.819 40.152  1.00 46.92  ? 871  TYR A CD2 1 
ATOM 6707 C CE1 . TYR A 1 874  ? 10.652  26.859 41.476  1.00 46.92  ? 871  TYR A CE1 1 
ATOM 6708 C CE2 . TYR A 1 874  ? 9.837   29.134 41.343  1.00 46.92  ? 871  TYR A CE2 1 
ATOM 6709 C CZ  . TYR A 1 874  ? 10.572  28.147 41.998  1.00 46.92  ? 871  TYR A CZ  1 
ATOM 6710 O OH  . TYR A 1 874  ? 11.244  28.439 43.165  1.00 46.92  ? 871  TYR A OH  1 
ATOM 6711 N N   . SER A 1 875  ? 5.660   26.671 36.561  1.00 29.95  ? 872  SER A N   1 
ATOM 6712 C CA  . SER A 1 875  ? 5.033   26.889 35.276  1.00 29.95  ? 872  SER A CA  1 
ATOM 6713 C C   . SER A 1 875  ? 4.242   25.687 34.800  1.00 29.95  ? 872  SER A C   1 
ATOM 6714 O O   . SER A 1 875  ? 4.513   24.558 35.228  1.00 29.95  ? 872  SER A O   1 
ATOM 6715 C CB  . SER A 1 875  ? 6.083   27.293 34.202  1.00 62.17  ? 872  SER A CB  1 
ATOM 6716 O OG  . SER A 1 875  ? 6.658   26.174 33.551  1.00 62.17  ? 872  SER A OG  1 
ATOM 6717 N N   . MET A 1 876  ? 3.286   25.932 33.909  1.00 50.56  ? 873  MET A N   1 
ATOM 6718 C CA  . MET A 1 876  ? 2.525   24.841 33.333  1.00 50.56  ? 873  MET A CA  1 
ATOM 6719 C C   . MET A 1 876  ? 1.901   25.199 31.973  1.00 50.56  ? 873  MET A C   1 
ATOM 6720 O O   . MET A 1 876  ? 1.426   26.304 31.766  1.00 50.56  ? 873  MET A O   1 
ATOM 6721 C CB  . MET A 1 876  ? 1.481   24.327 34.339  1.00 45.57  ? 873  MET A CB  1 
ATOM 6722 C CG  . MET A 1 876  ? 0.380   25.278 34.668  1.00 45.57  ? 873  MET A CG  1 
ATOM 6723 S SD  . MET A 1 876  ? -0.570  24.723 36.086  1.00 45.57  ? 873  MET A SD  1 
ATOM 6724 C CE  . MET A 1 876  ? 0.681   24.777 37.342  1.00 45.57  ? 873  MET A CE  1 
ATOM 6725 N N   . VAL A 1 877  ? 1.931   24.268 31.034  1.00 34.94  ? 874  VAL A N   1 
ATOM 6726 C CA  . VAL A 1 877  ? 1.327   24.492 29.732  1.00 34.94  ? 874  VAL A CA  1 
ATOM 6727 C C   . VAL A 1 877  ? 0.279   23.404 29.415  1.00 34.94  ? 874  VAL A C   1 
ATOM 6728 O O   . VAL A 1 877  ? 0.375   22.279 29.901  1.00 34.94  ? 874  VAL A O   1 
ATOM 6729 C CB  . VAL A 1 877  ? 2.408   24.562 28.639  1.00 42.07  ? 874  VAL A CB  1 
ATOM 6730 C CG1 . VAL A 1 877  ? 3.282   23.329 28.686  1.00 42.07  ? 874  VAL A CG1 1 
ATOM 6731 C CG2 . VAL A 1 877  ? 1.788   24.733 27.259  1.00 42.07  ? 874  VAL A CG2 1 
ATOM 6732 N N   . GLU A 1 878  ? -0.726  23.716 28.618  1.00 54.62  ? 875  GLU A N   1 
ATOM 6733 C CA  . GLU A 1 878  ? -1.651  22.671 28.217  1.00 54.62  ? 875  GLU A CA  1 
ATOM 6734 C C   . GLU A 1 878  ? -0.892  21.739 27.256  1.00 54.62  ? 875  GLU A C   1 
ATOM 6735 O O   . GLU A 1 878  ? -0.056  22.213 26.490  1.00 54.62  ? 875  GLU A O   1 
ATOM 6736 C CB  . GLU A 1 878  ? -2.909  23.299 27.593  1.00 67.86  ? 875  GLU A CB  1 
ATOM 6737 C CG  . GLU A 1 878  ? -3.958  22.330 27.100  1.00 67.86  ? 875  GLU A CG  1 
ATOM 6738 C CD  . GLU A 1 878  ? -3.674  21.841 25.695  1.00 67.86  ? 875  GLU A CD  1 
ATOM 6739 O OE1 . GLU A 1 878  ? -2.799  22.407 25.009  1.00 67.86  ? 875  GLU A OE1 1 
ATOM 6740 O OE2 . GLU A 1 878  ? -4.332  20.878 25.268  1.00 67.86  ? 875  GLU A OE2 1 
ATOM 6741 N N   . PHE A 1 879  ? -1.147  20.433 27.304  1.00 89.12  ? 876  PHE A N   1 
ATOM 6742 C CA  . PHE A 1 879  ? -0.455  19.513 26.396  1.00 89.12  ? 876  PHE A CA  1 
ATOM 6743 C C   . PHE A 1 879  ? -1.353  19.047 25.253  1.00 89.12  ? 876  PHE A C   1 
ATOM 6744 O O   . PHE A 1 879  ? -1.567  19.775 24.267  1.00 89.12  ? 876  PHE A O   1 
ATOM 6745 C CB  . PHE A 1 879  ? 0.119   18.307 27.153  1.00 65.38  ? 876  PHE A CB  1 
ATOM 6746 C CG  . PHE A 1 879  ? 1.321   17.667 26.480  1.00 65.38  ? 876  PHE A CG  1 
ATOM 6747 C CD1 . PHE A 1 879  ? 2.265   18.438 25.813  1.00 65.38  ? 876  PHE A CD1 1 
ATOM 6748 C CD2 . PHE A 1 879  ? 1.528   16.292 26.554  1.00 65.38  ? 876  PHE A CD2 1 
ATOM 6749 C CE1 . PHE A 1 879  ? 3.375   17.839 25.200  1.00 65.38  ? 876  PHE A CE1 1 
ATOM 6750 C CE2 . PHE A 1 879  ? 2.640   15.692 25.957  1.00 65.38  ? 876  PHE A CE2 1 
ATOM 6751 C CZ  . PHE A 1 879  ? 3.560   16.465 25.286  1.00 65.38  ? 876  PHE A CZ  1 
ATOM 6752 N N   . ASN A 1 880  ? -1.862  17.824 25.401  1.00 60.54  ? 877  ASN A N   1 
ATOM 6753 C CA  . ASN A 1 880  ? -2.677  17.176 24.380  1.00 60.54  ? 877  ASN A CA  1 
ATOM 6754 C C   . ASN A 1 880  ? -4.006  16.838 25.046  1.00 60.54  ? 877  ASN A C   1 
ATOM 6755 O O   . ASN A 1 880  ? -4.462  15.688 25.057  1.00 60.54  ? 877  ASN A O   1 
ATOM 6756 C CB  . ASN A 1 880  ? -1.979  15.892 23.888  1.00 80.71  ? 877  ASN A CB  1 
ATOM 6757 C CG  . ASN A 1 880  ? -0.737  16.165 23.045  1.00 80.71  ? 877  ASN A CG  1 
ATOM 6758 O OD1 . ASN A 1 880  ? -0.828  16.308 21.829  1.00 80.71  ? 877  ASN A OD1 1 
ATOM 6759 N ND2 . ASN A 1 880  ? 0.429   16.204 23.684  1.00 80.71  ? 877  ASN A ND2 1 
ATOM 6760 N N   . GLY A 1 881  ? -4.611  17.858 25.633  1.00 53.17  ? 878  GLY A N   1 
ATOM 6761 C CA  . GLY A 1 881  ? -5.719  17.648 26.529  1.00 53.17  ? 878  GLY A CA  1 
ATOM 6762 C C   . GLY A 1 881  ? -5.304  17.072 27.875  1.00 53.17  ? 878  GLY A C   1 
ATOM 6763 O O   . GLY A 1 881  ? -6.127  16.472 28.555  1.00 53.17  ? 878  GLY A O   1 
ATOM 6764 N N   . LYS A 1 882  ? -4.034  17.247 28.246  1.00 53.12  ? 879  LYS A N   1 
ATOM 6765 C CA  . LYS A 1 882  ? -3.517  16.873 29.560  1.00 53.12  ? 879  LYS A CA  1 
ATOM 6766 C C   . LYS A 1 882  ? -2.982  18.116 30.277  1.00 53.12  ? 879  LYS A C   1 
ATOM 6767 O O   . LYS A 1 882  ? -2.975  19.214 29.717  1.00 53.12  ? 879  LYS A O   1 
ATOM 6768 C CB  . LYS A 1 882  ? -2.420  15.811 29.395  1.00 134.51 ? 879  LYS A CB  1 
ATOM 6769 C CG  . LYS A 1 882  ? -2.926  14.365 29.485  1.00 134.51 ? 879  LYS A CG  1 
ATOM 6770 C CD  . LYS A 1 882  ? -2.383  13.448 28.381  1.00 134.51 ? 879  LYS A CD  1 
ATOM 6771 C CE  . LYS A 1 882  ? -1.013  12.847 28.702  1.00 134.51 ? 879  LYS A CE  1 
ATOM 6772 N NZ  . LYS A 1 882  ? -0.932  11.931 29.887  1.00 134.51 ? 879  LYS A NZ  1 
ATOM 6773 N N   . LEU A 1 883  ? -2.520  17.976 31.511  1.00 76.50  ? 880  LEU A N   1 
ATOM 6774 C CA  . LEU A 1 883  ? -1.875  19.127 32.138  1.00 76.50  ? 880  LEU A CA  1 
ATOM 6775 C C   . LEU A 1 883  ? -0.400  18.922 32.399  1.00 76.50  ? 880  LEU A C   1 
ATOM 6776 O O   . LEU A 1 883  ? -0.021  18.268 33.373  1.00 76.50  ? 880  LEU A O   1 
ATOM 6777 C CB  . LEU A 1 883  ? -2.575  19.572 33.428  1.00 49.21  ? 880  LEU A CB  1 
ATOM 6778 C CG  . LEU A 1 883  ? -1.961  20.842 34.033  1.00 49.21  ? 880  LEU A CG  1 
ATOM 6779 C CD1 . LEU A 1 883  ? -2.048  22.058 33.062  1.00 49.21  ? 880  LEU A CD1 1 
ATOM 6780 C CD2 . LEU A 1 883  ? -2.584  21.148 35.376  1.00 49.21  ? 880  LEU A CD2 1 
ATOM 6781 N N   . LEU A 1 884  ? 0.423   19.511 31.535  1.00 54.23  ? 881  LEU A N   1 
ATOM 6782 C CA  . LEU A 1 884  ? 1.857   19.516 31.738  1.00 54.23  ? 881  LEU A CA  1 
ATOM 6783 C C   . LEU A 1 884  ? 2.220   20.597 32.746  1.00 54.23  ? 881  LEU A C   1 
ATOM 6784 O O   . LEU A 1 884  ? 1.692   21.706 32.665  1.00 54.23  ? 881  LEU A O   1 
ATOM 6785 C CB  . LEU A 1 884  ? 2.577   19.745 30.412  1.00 60.36  ? 881  LEU A CB  1 
ATOM 6786 C CG  . LEU A 1 884  ? 4.105   19.604 30.437  1.00 60.36  ? 881  LEU A CG  1 
ATOM 6787 C CD1 . LEU A 1 884  ? 4.489   18.226 30.926  1.00 60.36  ? 881  LEU A CD1 1 
ATOM 6788 C CD2 . LEU A 1 884  ? 4.710   19.893 29.053  1.00 60.36  ? 881  LEU A CD2 1 
ATOM 6789 N N   . ALA A 1 885  ? 3.119   20.281 33.683  1.00 46.75  ? 882  ALA A N   1 
ATOM 6790 C CA  . ALA A 1 885  ? 3.485   21.219 34.748  1.00 46.75  ? 882  ALA A CA  1 
ATOM 6791 C C   . ALA A 1 885  ? 4.811   20.885 35.401  1.00 46.75  ? 882  ALA A C   1 
ATOM 6792 O O   . ALA A 1 885  ? 5.206   19.710 35.472  1.00 46.75  ? 882  ALA A O   1 
ATOM 6793 C CB  . ALA A 1 885  ? 2.415   21.243 35.783  1.00 37.13  ? 882  ALA A CB  1 
ATOM 6794 N N   . SER A 1 886  ? 5.514   21.902 35.887  1.00 46.45  ? 883  SER A N   1 
ATOM 6795 C CA  . SER A 1 886  ? 6.757   21.626 36.583  1.00 46.45  ? 883  SER A CA  1 
ATOM 6796 C C   . SER A 1 886  ? 6.569   21.951 38.038  1.00 46.45  ? 883  SER A C   1 
ATOM 6797 O O   . SER A 1 886  ? 5.767   22.810 38.362  1.00 46.45  ? 883  SER A O   1 
ATOM 6798 C CB  . SER A 1 886  ? 7.919   22.421 36.007  1.00 51.94  ? 883  SER A CB  1 
ATOM 6799 O OG  . SER A 1 886  ? 7.579   23.780 35.803  1.00 51.94  ? 883  SER A OG  1 
ATOM 6800 N N   . ILE A 1 887  ? 7.290   21.255 38.910  1.00 50.92  ? 884  ILE A N   1 
ATOM 6801 C CA  . ILE A 1 887  ? 7.220   21.488 40.340  1.00 50.92  ? 884  ILE A CA  1 
ATOM 6802 C C   . ILE A 1 887  ? 8.641   21.386 40.858  1.00 50.92  ? 884  ILE A C   1 
ATOM 6803 O O   . ILE A 1 887  ? 9.210   20.297 40.812  1.00 50.92  ? 884  ILE A O   1 
ATOM 6804 C CB  . ILE A 1 887  ? 6.360   20.398 41.089  1.00 41.38  ? 884  ILE A CB  1 
ATOM 6805 C CG1 . ILE A 1 887  ? 4.926   20.294 40.536  1.00 41.38  ? 884  ILE A CG1 1 
ATOM 6806 C CG2 . ILE A 1 887  ? 6.307   20.699 42.614  1.00 41.38  ? 884  ILE A CG2 1 
ATOM 6807 C CD1 . ILE A 1 887  ? 4.703   19.162 39.591  1.00 41.38  ? 884  ILE A CD1 1 
ATOM 6808 N N   . ASN A 1 888  ? 9.215   22.495 41.334  1.00 60.34  ? 885  ASN A N   1 
ATOM 6809 C CA  . ASN A 1 888  ? 10.539  22.487 41.948  1.00 60.34  ? 885  ASN A CA  1 
ATOM 6810 C C   . ASN A 1 888  ? 11.409  21.351 41.389  1.00 60.34  ? 885  ASN A C   1 
ATOM 6811 O O   . ASN A 1 888  ? 11.507  20.269 42.002  1.00 60.34  ? 885  ASN A O   1 
ATOM 6812 C CB  . ASN A 1 888  ? 10.389  22.355 43.471  1.00 73.03  ? 885  ASN A CB  1 
ATOM 6813 C CG  . ASN A 1 888  ? 10.786  23.620 44.220  1.00 73.03  ? 885  ASN A CG  1 
ATOM 6814 O OD1 . ASN A 1 888  ? 11.885  24.132 44.049  1.00 73.03  ? 885  ASN A OD1 1 
ATOM 6815 N ND2 . ASN A 1 888  ? 9.911   24.105 45.078  1.00 73.03  ? 885  ASN A ND2 1 
ATOM 6816 N N   . SER A 1 889  ? 12.004  21.567 40.215  1.00 51.66  ? 886  SER A N   1 
ATOM 6817 C CA  . SER A 1 889  ? 12.757  20.496 39.514  1.00 51.66  ? 886  SER A CA  1 
ATOM 6818 C C   . SER A 1 889  ? 12.021  19.162 39.446  1.00 51.66  ? 886  SER A C   1 
ATOM 6819 O O   . SER A 1 889  ? 12.390  18.221 40.121  1.00 51.66  ? 886  SER A O   1 
ATOM 6820 C CB  . SER A 1 889  ? 14.176  20.288 40.105  1.00 34.84  ? 886  SER A CB  1 
ATOM 6821 O OG  . SER A 1 889  ? 14.198  19.492 41.279  1.00 34.84  ? 886  SER A OG  1 
ATOM 6822 N N   . THR A 1 890  ? 10.954  19.101 38.668  1.00 56.20  ? 887  THR A N   1 
ATOM 6823 C CA  . THR A 1 890  ? 10.241  17.866 38.384  1.00 56.20  ? 887  THR A CA  1 
ATOM 6824 C C   . THR A 1 890  ? 9.286   18.330 37.323  1.00 56.20  ? 887  THR A C   1 
ATOM 6825 O O   . THR A 1 890  ? 8.747   19.420 37.453  1.00 56.20  ? 887  THR A O   1 
ATOM 6826 C CB  . THR A 1 890  ? 9.363   17.379 39.555  1.00 65.47  ? 887  THR A CB  1 
ATOM 6827 O OG1 . THR A 1 890  ? 10.142  17.243 40.745  1.00 65.47  ? 887  THR A OG1 1 
ATOM 6828 C CG2 . THR A 1 890  ? 8.725   16.042 39.227  1.00 65.47  ? 887  THR A CG2 1 
ATOM 6829 N N   . VAL A 1 891  ? 9.073   17.526 36.286  1.00 62.64  ? 888  VAL A N   1 
ATOM 6830 C CA  . VAL A 1 891  ? 8.146   17.876 35.225  1.00 62.64  ? 888  VAL A CA  1 
ATOM 6831 C C   . VAL A 1 891  ? 7.054   16.769 35.172  1.00 62.64  ? 888  VAL A C   1 
ATOM 6832 O O   . VAL A 1 891  ? 7.272   15.689 34.620  1.00 62.64  ? 888  VAL A O   1 
ATOM 6833 C CB  . VAL A 1 891  ? 8.925   18.097 33.865  1.00 34.93  ? 888  VAL A CB  1 
ATOM 6834 C CG1 . VAL A 1 891  ? 7.999   18.444 32.688  1.00 34.93  ? 888  VAL A CG1 1 
ATOM 6835 C CG2 . VAL A 1 891  ? 9.975   19.200 34.001  1.00 34.93  ? 888  VAL A CG2 1 
ATOM 6836 N N   . ARG A 1 892  ? 5.896   17.023 35.788  1.00 41.22  ? 889  ARG A N   1 
ATOM 6837 C CA  . ARG A 1 892  ? 4.772   16.089 35.729  1.00 41.22  ? 889  ARG A CA  1 
ATOM 6838 C C   . ARG A 1 892  ? 3.794   16.356 34.585  1.00 41.22  ? 889  ARG A C   1 
ATOM 6839 O O   . ARG A 1 892  ? 3.741   17.464 34.046  1.00 41.22  ? 889  ARG A O   1 
ATOM 6840 C CB  . ARG A 1 892  ? 3.999   16.098 37.049  1.00 61.31  ? 889  ARG A CB  1 
ATOM 6841 C CG  . ARG A 1 892  ? 4.232   14.860 37.869  1.00 61.31  ? 889  ARG A CG  1 
ATOM 6842 C CD  . ARG A 1 892  ? 3.270   14.730 39.002  1.00 61.31  ? 889  ARG A CD  1 
ATOM 6843 N NE  . ARG A 1 892  ? 3.545   15.645 40.116  1.00 61.31  ? 889  ARG A NE  1 
ATOM 6844 C CZ  . ARG A 1 892  ? 4.571   15.545 40.956  1.00 61.31  ? 889  ARG A CZ  1 
ATOM 6845 N NH1 . ARG A 1 892  ? 5.483   14.586 40.820  1.00 61.31  ? 889  ARG A NH1 1 
ATOM 6846 N NH2 . ARG A 1 892  ? 4.688   16.423 41.928  1.00 61.31  ? 889  ARG A NH2 1 
ATOM 6847 N N   . LEU A 1 893  ? 3.010   15.330 34.244  1.00 55.81  ? 890  LEU A N   1 
ATOM 6848 C CA  . LEU A 1 893  ? 2.015   15.422 33.172  1.00 55.81  ? 890  LEU A CA  1 
ATOM 6849 C C   . LEU A 1 893  ? 0.691   14.808 33.605  1.00 55.81  ? 890  LEU A C   1 
ATOM 6850 O O   . LEU A 1 893  ? 0.437   13.623 33.361  1.00 55.81  ? 890  LEU A O   1 
ATOM 6851 C CB  . LEU A 1 893  ? 2.504   14.769 31.880  1.00 43.57  ? 890  LEU A CB  1 
ATOM 6852 C CG  . LEU A 1 893  ? 1.471   14.810 30.736  1.00 43.57  ? 890  LEU A CG  1 
ATOM 6853 C CD1 . LEU A 1 893  ? 1.120   16.239 30.293  1.00 43.57  ? 890  LEU A CD1 1 
ATOM 6854 C CD2 . LEU A 1 893  ? 1.894   13.929 29.527  1.00 43.57  ? 890  LEU A CD2 1 
ATOM 6855 N N   . TYR A 1 894  ? -0.144  15.636 34.238  1.00 56.62  ? 891  TYR A N   1 
ATOM 6856 C CA  . TYR A 1 894  ? -1.381  15.223 34.885  1.00 56.62  ? 891  TYR A CA  1 
ATOM 6857 C C   . TYR A 1 894  ? -2.471  14.867 33.870  1.00 56.62  ? 891  TYR A C   1 
ATOM 6858 O O   . TYR A 1 894  ? -2.544  15.432 32.771  1.00 56.62  ? 891  TYR A O   1 
ATOM 6859 C CB  . TYR A 1 894  ? -1.881  16.338 35.817  1.00 48.87  ? 891  TYR A CB  1 
ATOM 6860 C CG  . TYR A 1 894  ? -1.015  16.613 37.034  1.00 48.87  ? 891  TYR A CG  1 
ATOM 6861 C CD1 . TYR A 1 894  ? 0.138   17.375 36.941  1.00 48.87  ? 891  TYR A CD1 1 
ATOM 6862 C CD2 . TYR A 1 894  ? -1.377  16.142 38.298  1.00 48.87  ? 891  TYR A CD2 1 
ATOM 6863 C CE1 . TYR A 1 894  ? 0.935   17.655 38.097  1.00 48.87  ? 891  TYR A CE1 1 
ATOM 6864 C CE2 . TYR A 1 894  ? -0.596  16.410 39.451  1.00 48.87  ? 891  TYR A CE2 1 
ATOM 6865 C CZ  . TYR A 1 894  ? 0.558   17.162 39.353  1.00 48.87  ? 891  TYR A CZ  1 
ATOM 6866 O OH  . TYR A 1 894  ? 1.340   17.420 40.475  1.00 48.87  ? 891  TYR A OH  1 
ATOM 6867 N N   . GLU A 1 895  ? -3.312  13.912 34.259  1.00 69.03  ? 892  GLU A N   1 
ATOM 6868 C CA  . GLU A 1 895  ? -4.473  13.533 33.471  1.00 69.03  ? 892  GLU A CA  1 
ATOM 6869 C C   . GLU A 1 895  ? -5.719  14.039 34.194  1.00 69.03  ? 892  GLU A C   1 
ATOM 6870 O O   . GLU A 1 895  ? -5.687  14.302 35.399  1.00 69.03  ? 892  GLU A O   1 
ATOM 6871 C CB  . GLU A 1 895  ? -4.518  12.021 33.253  1.00 175.92 ? 892  GLU A CB  1 
ATOM 6872 C CG  . GLU A 1 895  ? -5.113  11.609 31.914  1.00 175.92 ? 892  GLU A CG  1 
ATOM 6873 C CD  . GLU A 1 895  ? -4.591  10.270 31.422  1.00 175.92 ? 892  GLU A CD  1 
ATOM 6874 O OE1 . GLU A 1 895  ? -3.385  10.174 31.117  1.00 175.92 ? 892  GLU A OE1 1 
ATOM 6875 O OE2 . GLU A 1 895  ? -5.390  9.314  31.326  1.00 175.92 ? 892  GLU A OE2 1 
ATOM 6876 N N   . TRP A 1 896  ? -6.809  14.196 33.454  1.00 52.79  ? 893  TRP A N   1 
ATOM 6877 C CA  . TRP A 1 896  ? -8.013  14.772 34.001  1.00 52.79  ? 893  TRP A CA  1 
ATOM 6878 C C   . TRP A 1 896  ? -9.144  13.760 33.950  1.00 52.79  ? 893  TRP A C   1 
ATOM 6879 O O   . TRP A 1 896  ? -9.782  13.567 32.907  1.00 52.79  ? 893  TRP A O   1 
ATOM 6880 C CB  . TRP A 1 896  ? -8.374  16.030 33.214  1.00 47.87  ? 893  TRP A CB  1 
ATOM 6881 C CG  . TRP A 1 896  ? -9.531  16.840 33.761  1.00 47.87  ? 893  TRP A CG  1 
ATOM 6882 C CD1 . TRP A 1 896  ? -10.677 17.146 33.104  1.00 47.87  ? 893  TRP A CD1 1 
ATOM 6883 C CD2 . TRP A 1 896  ? -9.620  17.472 35.051  1.00 47.87  ? 893  TRP A CD2 1 
ATOM 6884 N NE1 . TRP A 1 896  ? -11.484 17.942 33.899  1.00 47.87  ? 893  TRP A NE1 1 
ATOM 6885 C CE2 . TRP A 1 896  ? -10.860 18.143 35.103  1.00 47.87  ? 893  TRP A CE2 1 
ATOM 6886 C CE3 . TRP A 1 896  ? -8.767  17.541 36.163  1.00 47.87  ? 893  TRP A CE3 1 
ATOM 6887 C CZ2 . TRP A 1 896  ? -11.284 18.870 36.234  1.00 47.87  ? 893  TRP A CZ2 1 
ATOM 6888 C CZ3 . TRP A 1 896  ? -9.173  18.269 37.286  1.00 47.87  ? 893  TRP A CZ3 1 
ATOM 6889 C CH2 . TRP A 1 896  ? -10.433 18.923 37.314  1.00 47.87  ? 893  TRP A CH2 1 
ATOM 6890 N N   . THR A 1 897  ? -9.391  13.133 35.095  1.00 86.79  ? 894  THR A N   1 
ATOM 6891 C CA  . THR A 1 897  ? -10.465 12.151 35.239  1.00 86.79  ? 894  THR A CA  1 
ATOM 6892 C C   . THR A 1 897  ? -11.834 12.717 34.818  1.00 86.79  ? 894  THR A C   1 
ATOM 6893 O O   . THR A 1 897  ? -12.069 13.930 34.879  1.00 86.79  ? 894  THR A O   1 
ATOM 6894 C CB  . THR A 1 897  ? -10.497 11.511 36.690  1.00 64.88  ? 894  THR A CB  1 
ATOM 6895 O OG1 . THR A 1 897  ? -10.818 12.492 37.696  1.00 64.88  ? 894  THR A OG1 1 
ATOM 6896 C CG2 . THR A 1 897  ? -9.156  10.898 37.025  1.00 64.88  ? 894  THR A CG2 1 
ATOM 6897 N N   . THR A 1 898  ? -12.715 11.832 34.358  1.00 74.65  ? 895  THR A N   1 
ATOM 6898 C CA  . THR A 1 898  ? -14.123 12.169 34.145  1.00 74.65  ? 895  THR A CA  1 
ATOM 6899 C C   . THR A 1 898  ? -14.792 12.400 35.514  1.00 74.65  ? 895  THR A C   1 
ATOM 6900 O O   . THR A 1 898  ? -15.976 12.733 35.607  1.00 74.65  ? 895  THR A O   1 
ATOM 6901 C CB  . THR A 1 898  ? -14.857 11.046 33.348  1.00 65.47  ? 895  THR A CB  1 
ATOM 6902 O OG1 . THR A 1 898  ? -13.891 10.194 32.721  1.00 65.47  ? 895  THR A OG1 1 
ATOM 6903 C CG2 . THR A 1 898  ? -15.813 11.639 32.267  1.00 65.47  ? 895  THR A CG2 1 
ATOM 6904 N N   . GLU A 1 899  ? -14.001 12.224 36.570  1.00 70.60  ? 896  GLU A N   1 
ATOM 6905 C CA  . GLU A 1 899  ? -14.459 12.360 37.941  1.00 70.60  ? 896  GLU A CA  1 
ATOM 6906 C C   . GLU A 1 899  ? -13.907 13.655 38.568  1.00 70.60  ? 896  GLU A C   1 
ATOM 6907 O O   . GLU A 1 899  ? -13.866 13.780 39.810  1.00 70.60  ? 896  GLU A O   1 
ATOM 6908 C CB  . GLU A 1 899  ? -14.022 11.137 38.748  1.00 87.43  ? 896  GLU A CB  1 
ATOM 6909 C CG  . GLU A 1 899  ? -14.597 9.797  38.272  1.00 87.43  ? 896  GLU A CG  1 
ATOM 6910 C CD  . GLU A 1 899  ? -13.985 9.271  36.959  1.00 87.43  ? 896  GLU A CD  1 
ATOM 6911 O OE1 . GLU A 1 899  ? -13.044 8.439  36.984  1.00 87.43  ? 896  GLU A OE1 1 
ATOM 6912 O OE2 . GLU A 1 899  ? -14.459 9.666  35.881  1.00 87.43  ? 896  GLU A OE2 1 
ATOM 6913 N N   . LYS A 1 900  ? -13.489 14.597 37.693  1.00 66.16  ? 897  LYS A N   1 
ATOM 6914 C CA  . LYS A 1 900  ? -12.891 15.930 38.042  1.00 66.16  ? 897  LYS A CA  1 
ATOM 6915 C C   . LYS A 1 900  ? -11.686 15.967 39.012  1.00 66.16  ? 897  LYS A C   1 
ATOM 6916 O O   . LYS A 1 900  ? -11.765 16.572 40.096  1.00 66.16  ? 897  LYS A O   1 
ATOM 6917 C CB  . LYS A 1 900  ? -13.944 16.934 38.541  1.00 52.27  ? 897  LYS A CB  1 
ATOM 6918 C CG  . LYS A 1 900  ? -15.266 16.938 37.792  1.00 52.27  ? 897  LYS A CG  1 
ATOM 6919 C CD  . LYS A 1 900  ? -15.157 17.258 36.315  1.00 52.27  ? 897  LYS A CD  1 
ATOM 6920 C CE  . LYS A 1 900  ? -16.466 17.852 35.830  1.00 52.27  ? 897  LYS A CE  1 
ATOM 6921 N NZ  . LYS A 1 900  ? -16.789 19.029 36.692  1.00 52.27  ? 897  LYS A NZ  1 
ATOM 6922 N N   . ASP A 1 901  ? -10.573 15.345 38.626  1.00 48.04  ? 898  ASP A N   1 
ATOM 6923 C CA  . ASP A 1 901  ? -9.408  15.420 39.448  1.00 48.04  ? 898  ASP A CA  1 
ATOM 6924 C C   . ASP A 1 901  ? -8.185  15.276 38.572  1.00 48.04  ? 898  ASP A C   1 
ATOM 6925 O O   . ASP A 1 901  ? -8.252  14.660 37.487  1.00 48.04  ? 898  ASP A O   1 
ATOM 6926 C CB  . ASP A 1 901  ? -9.441  14.343 40.521  1.00 133.21 ? 898  ASP A CB  1 
ATOM 6927 C CG  . ASP A 1 901  ? -9.223  14.909 41.897  1.00 133.21 ? 898  ASP A CG  1 
ATOM 6928 O OD1 . ASP A 1 901  ? -8.315  15.757 42.060  1.00 133.21 ? 898  ASP A OD1 1 
ATOM 6929 O OD2 . ASP A 1 901  ? -9.972  14.517 42.815  1.00 133.21 ? 898  ASP A OD2 1 
ATOM 6930 N N   . VAL A 1 902  ? -7.077  15.869 39.016  1.00 54.90  ? 899  VAL A N   1 
ATOM 6931 C CA  . VAL A 1 902  ? -5.817  15.674 38.319  1.00 54.90  ? 899  VAL A CA  1 
ATOM 6932 C C   . VAL A 1 902  ? -5.055  14.530 38.972  1.00 54.90  ? 899  VAL A C   1 
ATOM 6933 O O   . VAL A 1 902  ? -4.647  14.621 40.132  1.00 54.90  ? 899  VAL A O   1 
ATOM 6934 C CB  . VAL A 1 902  ? -4.917  16.985 38.179  1.00 60.18  ? 899  VAL A CB  1 
ATOM 6935 C CG1 . VAL A 1 902  ? -5.414  17.906 37.065  1.00 60.18  ? 899  VAL A CG1 1 
ATOM 6936 C CG2 . VAL A 1 902  ? -4.821  17.742 39.464  1.00 60.18  ? 899  VAL A CG2 1 
ATOM 6937 N N   . ARG A 1 903  ? -4.891  13.441 38.227  1.00 67.87  ? 900  ARG A N   1 
ATOM 6938 C CA  . ARG A 1 903  ? -4.049  12.341 38.676  1.00 67.87  ? 900  ARG A CA  1 
ATOM 6939 C C   . ARG A 1 903  ? -2.741  12.325 37.898  1.00 67.87  ? 900  ARG A C   1 
ATOM 6940 O O   . ARG A 1 903  ? -2.713  12.656 36.710  1.00 67.87  ? 900  ARG A O   1 
ATOM 6941 C CB  . ARG A 1 903  ? -4.787  10.989 38.591  1.00 84.82  ? 900  ARG A CB  1 
ATOM 6942 C CG  . ARG A 1 903  ? -5.111  10.456 37.203  1.00 84.82  ? 900  ARG A CG  1 
ATOM 6943 C CD  . ARG A 1 903  ? -5.056  8.931  37.218  1.00 84.82  ? 900  ARG A CD  1 
ATOM 6944 N NE  . ARG A 1 903  ? -6.379  8.303  37.155  1.00 84.82  ? 900  ARG A NE  1 
ATOM 6945 C CZ  . ARG A 1 903  ? -7.252  8.200  38.170  1.00 84.82  ? 900  ARG A CZ  1 
ATOM 6946 N NH1 . ARG A 1 903  ? -6.979  8.703  39.379  1.00 84.82  ? 900  ARG A NH1 1 
ATOM 6947 N NH2 . ARG A 1 903  ? -8.428  7.600  37.968  1.00 84.82  ? 900  ARG A NH2 1 
ATOM 6948 N N   . THR A 1 904  ? -1.665  11.942 38.576  1.00 63.88  ? 901  THR A N   1 
ATOM 6949 C CA  . THR A 1 904  ? -0.328  11.963 38.001  1.00 63.88  ? 901  THR A CA  1 
ATOM 6950 C C   . THR A 1 904  ? -0.145  10.980 36.828  1.00 63.88  ? 901  THR A C   1 
ATOM 6951 O O   . THR A 1 904  ? -0.658  9.875  36.865  1.00 63.88  ? 901  THR A O   1 
ATOM 6952 C CB  . THR A 1 904  ? 0.717   11.652 39.089  1.00 57.40  ? 901  THR A CB  1 
ATOM 6953 O OG1 . THR A 1 904  ? 0.722   12.687 40.088  1.00 57.40  ? 901  THR A OG1 1 
ATOM 6954 C CG2 . THR A 1 904  ? 2.107   11.530 38.482  1.00 57.40  ? 901  THR A CG2 1 
ATOM 6955 N N   . GLU A 1 905  ? 0.563   11.390 35.783  1.00 201.87 ? 902  GLU A N   1 
ATOM 6956 C CA  . GLU A 1 905  ? 1.086   10.425 34.822  1.00 201.87 ? 902  GLU A CA  1 
ATOM 6957 C C   . GLU A 1 905  ? 2.458   9.839  34.994  1.00 201.87 ? 902  GLU A C   1 
ATOM 6958 O O   . GLU A 1 905  ? 2.591   8.717  35.484  1.00 201.87 ? 902  GLU A O   1 
ATOM 6959 C CB  . GLU A 1 905  ? 0.273   10.361 33.530  1.00 94.57  ? 902  GLU A CB  1 
ATOM 6960 C CG  . GLU A 1 905  ? -1.236  10.574 33.672  1.00 94.57  ? 902  GLU A CG  1 
ATOM 6961 C CD  . GLU A 1 905  ? -1.979  9.483  34.480  1.00 94.57  ? 902  GLU A CD  1 
ATOM 6962 O OE1 . GLU A 1 905  ? -1.543  8.302  34.490  1.00 94.57  ? 902  GLU A OE1 1 
ATOM 6963 O OE2 . GLU A 1 905  ? -3.016  9.813  35.105  1.00 94.57  ? 902  GLU A OE2 1 
ATOM 6964 N N   . CYS A 1 906  ? 3.469   10.606 34.586  1.00 100.70 ? 903  CYS A N   1 
ATOM 6965 C CA  . CYS A 1 906  ? 4.885   10.195 34.617  1.00 100.70 ? 903  CYS A CA  1 
ATOM 6966 C C   . CYS A 1 906  ? 5.426   11.536 35.097  1.00 100.70 ? 903  CYS A C   1 
ATOM 6967 O O   . CYS A 1 906  ? 4.749   12.570 35.044  1.00 100.70 ? 903  CYS A O   1 
ATOM 6968 C CB  . CYS A 1 906  ? 5.304   9.998  33.155  1.00 82.88  ? 903  CYS A CB  1 
ATOM 6969 S SG  . CYS A 1 906  ? 4.443   11.066 31.970  1.00 82.88  ? 903  CYS A SG  1 
ATOM 6970 N N   . ASN A 1 907  ? 6.669   11.504 35.566  1.00 63.75  ? 904  ASN A N   1 
ATOM 6971 C CA  . ASN A 1 907  ? 7.422   12.733 35.741  1.00 63.75  ? 904  ASN A CA  1 
ATOM 6972 C C   . ASN A 1 907  ? 8.895   12.600 35.436  1.00 63.75  ? 904  ASN A C   1 
ATOM 6973 O O   . ASN A 1 907  ? 9.546   11.717 35.940  1.00 63.75  ? 904  ASN A O   1 
ATOM 6974 C CB  . ASN A 1 907  ? 7.198   13.382 37.120  1.00 97.04  ? 904  ASN A CB  1 
ATOM 6975 C CG  . ASN A 1 907  ? 7.062   12.381 38.231  1.00 97.04  ? 904  ASN A CG  1 
ATOM 6976 O OD1 . ASN A 1 907  ? 8.044   11.987 38.859  1.00 97.04  ? 904  ASN A OD1 1 
ATOM 6977 N ND2 . ASN A 1 907  ? 5.832   11.984 38.504  1.00 97.04  ? 904  ASN A ND2 1 
ATOM 6978 N N   . HIS A 1 908  ? 9.408   13.478 34.589  1.00 67.00  ? 905  HIS A N   1 
ATOM 6979 C CA  . HIS A 1 908  ? 10.837  13.633 34.425  1.00 67.00  ? 905  HIS A CA  1 
ATOM 6980 C C   . HIS A 1 908  ? 11.358  14.352 35.656  1.00 67.00  ? 905  HIS A C   1 
ATOM 6981 O O   . HIS A 1 908  ? 10.652  15.184 36.212  1.00 67.00  ? 905  HIS A O   1 
ATOM 6982 C CB  . HIS A 1 908  ? 11.095  14.441 33.158  1.00 81.72  ? 905  HIS A CB  1 
ATOM 6983 C CG  . HIS A 1 908  ? 12.522  14.831 32.960  1.00 81.72  ? 905  HIS A CG  1 
ATOM 6984 N ND1 . HIS A 1 908  ? 12.888  16.087 32.537  1.00 81.72  ? 905  HIS A ND1 1 
ATOM 6985 C CD2 . HIS A 1 908  ? 13.671  14.139 33.129  1.00 81.72  ? 905  HIS A CD2 1 
ATOM 6986 C CE1 . HIS A 1 908  ? 14.203  16.151 32.450  1.00 81.72  ? 905  HIS A CE1 1 
ATOM 6987 N NE2 . HIS A 1 908  ? 14.703  14.984 32.808  1.00 81.72  ? 905  HIS A NE2 1 
ATOM 6988 N N   . TYR A 1 909  ? 12.566  14.016 36.114  1.00 45.61  ? 906  TYR A N   1 
ATOM 6989 C CA  . TYR A 1 909  ? 13.146  14.740 37.252  1.00 45.61  ? 906  TYR A CA  1 
ATOM 6990 C C   . TYR A 1 909  ? 14.663  15.038 37.218  1.00 45.61  ? 906  TYR A C   1 
ATOM 6991 O O   . TYR A 1 909  ? 15.232  15.583 38.179  1.00 45.61  ? 906  TYR A O   1 
ATOM 6992 C CB  . TYR A 1 909  ? 12.581  14.221 38.600  1.00 187.74 ? 906  TYR A CB  1 
ATOM 6993 C CG  . TYR A 1 909  ? 13.544  13.662 39.619  1.00 187.74 ? 906  TYR A CG  1 
ATOM 6994 C CD1 . TYR A 1 909  ? 13.884  14.401 40.754  1.00 187.74 ? 906  TYR A CD1 1 
ATOM 6995 C CD2 . TYR A 1 909  ? 14.077  12.383 39.482  1.00 187.74 ? 906  TYR A CD2 1 
ATOM 6996 C CE1 . TYR A 1 909  ? 14.756  13.891 41.712  1.00 187.74 ? 906  TYR A CE1 1 
ATOM 6997 C CE2 . TYR A 1 909  ? 14.956  11.862 40.437  1.00 187.74 ? 906  TYR A CE2 1 
ATOM 6998 C CZ  . TYR A 1 909  ? 15.288  12.622 41.546  1.00 187.74 ? 906  TYR A CZ  1 
ATOM 6999 O OH  . TYR A 1 909  ? 16.151  12.109 42.486  1.00 187.74 ? 906  TYR A OH  1 
ATOM 7000 N N   . ASN A 1 910  ? 15.281  14.766 36.066  1.00 71.00  ? 907  ASN A N   1 
ATOM 7001 C CA  . ASN A 1 910  ? 16.688  15.134 35.818  1.00 71.00  ? 907  ASN A CA  1 
ATOM 7002 C C   . ASN A 1 910  ? 16.870  16.603 35.402  1.00 71.00  ? 907  ASN A C   1 
ATOM 7003 O O   . ASN A 1 910  ? 17.133  16.912 34.235  1.00 71.00  ? 907  ASN A O   1 
ATOM 7004 C CB  . ASN A 1 910  ? 17.336  14.175 34.796  1.00 65.46  ? 907  ASN A CB  1 
ATOM 7005 C CG  . ASN A 1 910  ? 18.657  14.710 34.207  1.00 65.46  ? 907  ASN A CG  1 
ATOM 7006 O OD1 . ASN A 1 910  ? 19.577  15.104 34.926  1.00 65.46  ? 907  ASN A OD1 1 
ATOM 7007 N ND2 . ASN A 1 910  ? 18.741  14.717 32.890  1.00 65.46  ? 907  ASN A ND2 1 
ATOM 7008 N N   . ASN A 1 911  ? 16.723  17.511 36.357  1.00 57.55  ? 908  ASN A N   1 
ATOM 7009 C CA  . ASN A 1 911  ? 17.006  18.923 36.106  1.00 57.55  ? 908  ASN A CA  1 
ATOM 7010 C C   . ASN A 1 911  ? 17.035  19.717 37.382  1.00 57.55  ? 908  ASN A C   1 
ATOM 7011 O O   . ASN A 1 911  ? 16.350  19.368 38.315  1.00 57.55  ? 908  ASN A O   1 
ATOM 7012 C CB  . ASN A 1 911  ? 15.990  19.544 35.127  1.00 79.60  ? 908  ASN A CB  1 
ATOM 7013 C CG  . ASN A 1 911  ? 14.566  19.128 35.409  1.00 79.60  ? 908  ASN A CG  1 
ATOM 7014 O OD1 . ASN A 1 911  ? 13.864  18.719 34.510  1.00 79.60  ? 908  ASN A OD1 1 
ATOM 7015 N ND2 . ASN A 1 911  ? 14.140  19.225 36.657  1.00 79.60  ? 908  ASN A ND2 1 
ATOM 7016 N N   . ILE A 1 912  ? 17.826  20.778 37.409  1.00 101.25 ? 909  ILE A N   1 
ATOM 7017 C CA  . ILE A 1 912  ? 17.889  21.662 38.554  1.00 101.25 ? 909  ILE A CA  1 
ATOM 7018 C C   . ILE A 1 912  ? 16.950  22.810 38.266  1.00 101.25 ? 909  ILE A C   1 
ATOM 7019 O O   . ILE A 1 912  ? 17.193  23.574 37.331  1.00 101.25 ? 909  ILE A O   1 
ATOM 7020 C CB  . ILE A 1 912  ? 19.296  22.252 38.723  1.00 58.87  ? 909  ILE A CB  1 
ATOM 7021 C CG1 . ILE A 1 912  ? 20.387  21.163 38.549  1.00 58.87  ? 909  ILE A CG1 1 
ATOM 7022 C CG2 . ILE A 1 912  ? 19.373  23.038 40.019  1.00 58.87  ? 909  ILE A CG2 1 
ATOM 7023 C CD1 . ILE A 1 912  ? 21.808  21.634 38.807  1.00 58.87  ? 909  ILE A CD1 1 
ATOM 7024 N N   . MET A 1 913  ? 15.893  22.934 39.070  1.00 64.37  ? 910  MET A N   1 
ATOM 7025 C CA  . MET A 1 913  ? 14.822  23.947 38.886  1.00 64.37  ? 910  MET A CA  1 
ATOM 7026 C C   . MET A 1 913  ? 14.294  24.091 37.439  1.00 64.37  ? 910  MET A C   1 
ATOM 7027 O O   . MET A 1 913  ? 14.911  24.753 36.591  1.00 64.37  ? 910  MET A O   1 
ATOM 7028 C CB  . MET A 1 913  ? 15.250  25.299 39.454  1.00 71.68  ? 910  MET A CB  1 
ATOM 7029 C CG  . MET A 1 913  ? 14.237  25.912 40.383  1.00 71.68  ? 910  MET A CG  1 
ATOM 7030 S SD  . MET A 1 913  ? 14.990  27.062 41.552  1.00 71.68  ? 910  MET A SD  1 
ATOM 7031 C CE  . MET A 1 913  ? 15.118  28.541 40.579  1.00 71.68  ? 910  MET A CE  1 
ATOM 7032 N N   . ALA A 1 914  ? 13.150  23.465 37.166  1.00 52.57  ? 911  ALA A N   1 
ATOM 7033 C CA  . ALA A 1 914  ? 12.537  23.551 35.852  1.00 52.57  ? 911  ALA A CA  1 
ATOM 7034 C C   . ALA A 1 914  ? 11.622  24.787 35.747  1.00 52.57  ? 911  ALA A C   1 
ATOM 7035 O O   . ALA A 1 914  ? 10.441  24.738 36.122  1.00 52.57  ? 911  ALA A O   1 
ATOM 7036 C CB  . ALA A 1 914  ? 11.771  22.223 35.533  1.00 23.02  ? 911  ALA A CB  1 
ATOM 7037 N N   . LEU A 1 915  ? 12.145  25.903 35.246  1.00 48.33  ? 912  LEU A N   1 
ATOM 7038 C CA  . LEU A 1 915  ? 11.351  27.158 35.282  1.00 48.33  ? 912  LEU A CA  1 
ATOM 7039 C C   . LEU A 1 915  ? 10.384  27.397 34.125  1.00 48.33  ? 912  LEU A C   1 
ATOM 7040 O O   . LEU A 1 915  ? 9.408   28.113 34.283  1.00 48.33  ? 912  LEU A O   1 
ATOM 7041 C CB  . LEU A 1 915  ? 12.239  28.394 35.451  1.00 29.50  ? 912  LEU A CB  1 
ATOM 7042 C CG  . LEU A 1 915  ? 13.317  28.279 36.529  1.00 29.50  ? 912  LEU A CG  1 
ATOM 7043 C CD1 . LEU A 1 915  ? 14.081  29.599 36.682  1.00 29.50  ? 912  LEU A CD1 1 
ATOM 7044 C CD2 . LEU A 1 915  ? 12.699  27.848 37.841  1.00 29.50  ? 912  LEU A CD2 1 
ATOM 7045 N N   . TYR A 1 916  ? 10.650  26.796 32.977  1.00 29.96  ? 913  TYR A N   1 
ATOM 7046 C CA  . TYR A 1 916  ? 10.042  27.230 31.719  1.00 29.96  ? 913  TYR A CA  1 
ATOM 7047 C C   . TYR A 1 916  ? 9.657   26.055 30.822  1.00 29.96  ? 913  TYR A C   1 
ATOM 7048 O O   . TYR A 1 916  ? 10.463  25.123 30.624  1.00 29.96  ? 913  TYR A O   1 
ATOM 7049 C CB  . TYR A 1 916  ? 11.048  28.112 30.936  1.00 30.15  ? 913  TYR A CB  1 
ATOM 7050 C CG  . TYR A 1 916  ? 11.686  29.199 31.771  1.00 30.15  ? 913  TYR A CG  1 
ATOM 7051 C CD1 . TYR A 1 916  ? 13.065  29.209 32.009  1.00 30.15  ? 913  TYR A CD1 1 
ATOM 7052 C CD2 . TYR A 1 916  ? 10.888  30.226 32.335  1.00 30.15  ? 913  TYR A CD2 1 
ATOM 7053 C CE1 . TYR A 1 916  ? 13.643  30.244 32.771  1.00 30.15  ? 913  TYR A CE1 1 
ATOM 7054 C CE2 . TYR A 1 916  ? 11.415  31.208 33.088  1.00 30.15  ? 913  TYR A CE2 1 
ATOM 7055 C CZ  . TYR A 1 916  ? 12.778  31.233 33.311  1.00 30.15  ? 913  TYR A CZ  1 
ATOM 7056 O OH  . TYR A 1 916  ? 13.265  32.226 34.118  1.00 30.15  ? 913  TYR A OH  1 
ATOM 7057 N N   . LEU A 1 917  ? 8.469   26.141 30.238  1.00 34.91  ? 914  LEU A N   1 
ATOM 7058 C CA  . LEU A 1 917  ? 7.943   25.092 29.456  1.00 34.91  ? 914  LEU A CA  1 
ATOM 7059 C C   . LEU A 1 917  ? 7.316   25.622 28.168  1.00 34.91  ? 914  LEU A C   1 
ATOM 7060 O O   . LEU A 1 917  ? 6.609   26.630 28.169  1.00 34.91  ? 914  LEU A O   1 
ATOM 7061 C CB  . LEU A 1 917  ? 6.860   24.389 30.267  1.00 33.49  ? 914  LEU A CB  1 
ATOM 7062 C CG  . LEU A 1 917  ? 7.155   23.145 31.132  1.00 33.49  ? 914  LEU A CG  1 
ATOM 7063 C CD1 . LEU A 1 917  ? 8.612   23.082 31.721  1.00 33.49  ? 914  LEU A CD1 1 
ATOM 7064 C CD2 . LEU A 1 917  ? 6.038   22.904 32.246  1.00 33.49  ? 914  LEU A CD2 1 
ATOM 7065 N N   . LYS A 1 918  ? 7.513   24.898 27.072  1.00 46.20  ? 915  LYS A N   1 
ATOM 7066 C CA  . LYS A 1 918  ? 6.781   25.160 25.841  1.00 46.20  ? 915  LYS A CA  1 
ATOM 7067 C C   . LYS A 1 918  ? 6.553   23.826 25.117  1.00 46.20  ? 915  LYS A C   1 
ATOM 7068 O O   . LYS A 1 918  ? 7.246   22.831 25.399  1.00 46.20  ? 915  LYS A O   1 
ATOM 7069 C CB  . LYS A 1 918  ? 7.576   26.131 24.958  1.00 34.71  ? 915  LYS A CB  1 
ATOM 7070 C CG  . LYS A 1 918  ? 7.783   27.539 25.561  1.00 34.71  ? 915  LYS A CG  1 
ATOM 7071 C CD  . LYS A 1 918  ? 6.457   28.294 25.807  1.00 34.71  ? 915  LYS A CD  1 
ATOM 7072 C CE  . LYS A 1 918  ? 6.749   29.706 26.167  1.00 34.71  ? 915  LYS A CE  1 
ATOM 7073 N NZ  . LYS A 1 918  ? 7.408   30.506 25.087  1.00 34.71  ? 915  LYS A NZ  1 
ATOM 7074 N N   . THR A 1 919  ? 5.620   23.791 24.174  1.00 46.52  ? 916  THR A N   1 
ATOM 7075 C CA  . THR A 1 919  ? 5.196   22.510 23.662  1.00 46.52  ? 916  THR A CA  1 
ATOM 7076 C C   . THR A 1 919  ? 5.134   22.496 22.169  1.00 46.52  ? 916  THR A C   1 
ATOM 7077 O O   . THR A 1 919  ? 4.478   23.341 21.559  1.00 46.52  ? 916  THR A O   1 
ATOM 7078 C CB  . THR A 1 919  ? 3.833   22.120 24.257  1.00 49.70  ? 916  THR A CB  1 
ATOM 7079 O OG1 . THR A 1 919  ? 4.062   21.587 25.559  1.00 49.70  ? 916  THR A OG1 1 
ATOM 7080 C CG2 . THR A 1 919  ? 3.044   21.096 23.364  1.00 49.70  ? 916  THR A CG2 1 
ATOM 7081 N N   . LYS A 1 920  ? 5.813   21.517 21.581  1.00 63.10  ? 917  LYS A N   1 
ATOM 7082 C CA  . LYS A 1 920  ? 5.783   21.348 20.132  1.00 63.10  ? 917  LYS A CA  1 
ATOM 7083 C C   . LYS A 1 920  ? 4.459   20.675 19.844  1.00 63.10  ? 917  LYS A C   1 
ATOM 7084 O O   . LYS A 1 920  ? 4.547   19.458 19.770  1.00 63.10  ? 917  LYS A O   1 
ATOM 7085 C CB  . LYS A 1 920  ? 6.962   20.488 19.663  1.00 201.87 ? 917  LYS A CB  1 
ATOM 7086 C CG  . LYS A 1 920  ? 7.502   20.933 18.198  1.00 201.87 ? 917  LYS A CG  1 
ATOM 7087 C CD  . LYS A 1 920  ? 6.811   20.175 17.036  1.00 201.87 ? 917  LYS A CD  1 
ATOM 7088 C CE  . LYS A 1 920  ? 7.186   18.687 16.992  1.00 201.87 ? 917  LYS A CE  1 
ATOM 7089 N NZ  . LYS A 1 920  ? 8.667   18.509 16.679  1.00 201.87 ? 917  LYS A NZ  1 
ATOM 7090 N N   . GLY A 1 921  ? 3.419   21.520 19.778  1.00 183.12 ? 918  GLY A N   1 
ATOM 7091 C CA  . GLY A 1 921  ? 2.003   21.145 19.673  1.00 183.12 ? 918  GLY A CA  1 
ATOM 7092 C C   . GLY A 1 921  ? 1.765   19.697 20.015  1.00 183.12 ? 918  GLY A C   1 
ATOM 7093 O O   . GLY A 1 921  ? 1.056   19.374 20.976  1.00 183.12 ? 918  GLY A O   1 
ATOM 7094 N N   . ASP A 1 922  ? 2.372   18.851 19.184  1.00 109.65 ? 919  ASP A N   1 
ATOM 7095 C CA  . ASP A 1 922  ? 2.543   17.414 19.379  1.00 109.65 ? 919  ASP A CA  1 
ATOM 7096 C C   . ASP A 1 922  ? 3.104   17.035 20.765  1.00 109.65 ? 919  ASP A C   1 
ATOM 7097 O O   . ASP A 1 922  ? 2.560   17.425 21.804  1.00 109.65 ? 919  ASP A O   1 
ATOM 7098 C CB  . ASP A 1 922  ? 3.463   16.891 18.261  1.00 201.87 ? 919  ASP A CB  1 
ATOM 7099 C CG  . ASP A 1 922  ? 3.413   15.390 18.107  1.00 201.87 ? 919  ASP A CG  1 
ATOM 7100 O OD1 . ASP A 1 922  ? 2.383   14.877 17.625  1.00 201.87 ? 919  ASP A OD1 1 
ATOM 7101 O OD2 . ASP A 1 922  ? 4.413   14.728 18.457  1.00 201.87 ? 919  ASP A OD2 1 
ATOM 7102 N N   . PHE A 1 923  ? 4.199   16.286 20.782  1.00 55.30  ? 920  PHE A N   1 
ATOM 7103 C CA  . PHE A 1 923  ? 4.575   15.579 21.992  1.00 55.30  ? 920  PHE A CA  1 
ATOM 7104 C C   . PHE A 1 923  ? 5.944   15.930 22.534  1.00 55.30  ? 920  PHE A C   1 
ATOM 7105 O O   . PHE A 1 923  ? 6.327   15.448 23.592  1.00 55.30  ? 920  PHE A O   1 
ATOM 7106 C CB  . PHE A 1 923  ? 4.382   14.064 21.814  1.00 89.72  ? 920  PHE A CB  1 
ATOM 7107 C CG  . PHE A 1 923  ? 2.940   13.645 21.778  1.00 89.72  ? 920  PHE A CG  1 
ATOM 7108 C CD1 . PHE A 1 923  ? 2.281   13.468 20.569  1.00 89.72  ? 920  PHE A CD1 1 
ATOM 7109 C CD2 . PHE A 1 923  ? 2.225   13.453 22.960  1.00 89.72  ? 920  PHE A CD2 1 
ATOM 7110 C CE1 . PHE A 1 923  ? 0.920   13.095 20.524  1.00 89.72  ? 920  PHE A CE1 1 
ATOM 7111 C CE2 . PHE A 1 923  ? 0.864   13.074 22.940  1.00 89.72  ? 920  PHE A CE2 1 
ATOM 7112 C CZ  . PHE A 1 923  ? 0.212   12.896 21.716  1.00 89.72  ? 920  PHE A CZ  1 
ATOM 7113 N N   . ILE A 1 924  ? 6.657   16.809 21.840  1.00 55.79  ? 921  ILE A N   1 
ATOM 7114 C CA  . ILE A 1 924  ? 7.964   17.280 22.335  1.00 55.79  ? 921  ILE A CA  1 
ATOM 7115 C C   . ILE A 1 924  ? 7.877   18.573 23.228  1.00 55.79  ? 921  ILE A C   1 
ATOM 7116 O O   . ILE A 1 924  ? 6.889   19.306 23.136  1.00 55.79  ? 921  ILE A O   1 
ATOM 7117 C CB  . ILE A 1 924  ? 8.997   17.388 21.170  1.00 59.34  ? 921  ILE A CB  1 
ATOM 7118 C CG1 . ILE A 1 924  ? 8.368   16.971 19.823  1.00 59.34  ? 921  ILE A CG1 1 
ATOM 7119 C CG2 . ILE A 1 924  ? 10.226  16.528 21.484  1.00 59.34  ? 921  ILE A CG2 1 
ATOM 7120 C CD1 . ILE A 1 924  ? 9.226   15.991 18.915  1.00 59.34  ? 921  ILE A CD1 1 
ATOM 7121 N N   . LEU A 1 925  ? 8.877   18.830 24.090  1.00 59.23  ? 922  LEU A N   1 
ATOM 7122 C CA  . LEU A 1 925  ? 8.895   20.044 24.966  1.00 59.23  ? 922  LEU A CA  1 
ATOM 7123 C C   . LEU A 1 925  ? 10.269  20.479 25.595  1.00 59.23  ? 922  LEU A C   1 
ATOM 7124 O O   . LEU A 1 925  ? 11.177  19.656 25.693  1.00 59.23  ? 922  LEU A O   1 
ATOM 7125 C CB  . LEU A 1 925  ? 7.802   19.915 26.022  1.00 59.97  ? 922  LEU A CB  1 
ATOM 7126 C CG  . LEU A 1 925  ? 7.842   18.640 26.836  1.00 59.97  ? 922  LEU A CG  1 
ATOM 7127 C CD1 . LEU A 1 925  ? 8.624   18.935 28.130  1.00 59.97  ? 922  LEU A CD1 1 
ATOM 7128 C CD2 . LEU A 1 925  ? 6.455   18.069 27.136  1.00 59.97  ? 922  LEU A CD2 1 
ATOM 7129 N N   . VAL A 1 926  ? 10.377  21.742 25.995  1.00 51.95  ? 923  VAL A N   1 
ATOM 7130 C CA  . VAL A 1 926  ? 11.605  22.254 26.592  1.00 51.95  ? 923  VAL A CA  1 
ATOM 7131 C C   . VAL A 1 926  ? 11.436  22.491 28.089  1.00 51.95  ? 923  VAL A C   1 
ATOM 7132 O O   . VAL A 1 926  ? 10.342  22.334 28.632  1.00 51.95  ? 923  VAL A O   1 
ATOM 7133 C CB  . VAL A 1 926  ? 12.054  23.566 25.921  1.00 57.82  ? 923  VAL A CB  1 
ATOM 7134 C CG1 . VAL A 1 926  ? 13.296  24.114 26.607  1.00 57.82  ? 923  VAL A CG1 1 
ATOM 7135 C CG2 . VAL A 1 926  ? 12.309  23.343 24.438  1.00 57.82  ? 923  VAL A CG2 1 
ATOM 7136 N N   . GLY A 1 927  ? 12.525  22.871 28.749  1.00 65.19  ? 924  GLY A N   1 
ATOM 7137 C CA  . GLY A 1 927  ? 12.500  23.129 30.177  1.00 65.19  ? 924  GLY A CA  1 
ATOM 7138 C C   . GLY A 1 927  ? 13.806  22.766 30.854  1.00 65.19  ? 924  GLY A C   1 
ATOM 7139 O O   . GLY A 1 927  ? 14.448  21.777 30.498  1.00 65.19  ? 924  GLY A O   1 
ATOM 7140 N N   . ASP A 1 928  ? 14.201  23.569 31.837  1.00 120.35 ? 925  ASP A N   1 
ATOM 7141 C CA  . ASP A 1 928  ? 15.439  23.331 32.570  1.00 120.35 ? 925  ASP A CA  1 
ATOM 7142 C C   . ASP A 1 928  ? 16.134  24.643 32.919  1.00 120.35 ? 925  ASP A C   1 
ATOM 7143 O O   . ASP A 1 928  ? 16.440  25.448 32.039  1.00 120.35 ? 925  ASP A O   1 
ATOM 7144 C CB  . ASP A 1 928  ? 16.379  22.437 31.758  1.00 52.21  ? 925  ASP A CB  1 
ATOM 7145 C CG  . ASP A 1 928  ? 17.685  22.161 32.477  1.00 52.21  ? 925  ASP A CG  1 
ATOM 7146 O OD1 . ASP A 1 928  ? 17.861  22.664 33.607  1.00 52.21  ? 925  ASP A OD1 1 
ATOM 7147 O OD2 . ASP A 1 928  ? 18.535  21.441 31.912  1.00 52.21  ? 925  ASP A OD2 1 
ATOM 7148 N N   . LEU A 1 929  ? 16.381  24.851 34.208  1.00 42.55  ? 926  LEU A N   1 
ATOM 7149 C CA  . LEU A 1 929  ? 17.040  26.065 34.676  1.00 42.55  ? 926  LEU A CA  1 
ATOM 7150 C C   . LEU A 1 929  ? 18.516  25.814 34.967  1.00 42.55  ? 926  LEU A C   1 
ATOM 7151 O O   . LEU A 1 929  ? 18.935  24.672 35.158  1.00 42.55  ? 926  LEU A O   1 
ATOM 7152 C CB  . LEU A 1 929  ? 16.342  26.607 35.924  1.00 42.88  ? 926  LEU A CB  1 
ATOM 7153 C CG  . LEU A 1 929  ? 16.929  27.883 36.529  1.00 42.88  ? 926  LEU A CG  1 
ATOM 7154 C CD1 . LEU A 1 929  ? 16.962  29.001 35.498  1.00 42.88  ? 926  LEU A CD1 1 
ATOM 7155 C CD2 . LEU A 1 929  ? 16.142  28.307 37.759  1.00 42.88  ? 926  LEU A CD2 1 
ATOM 7156 N N   . MET A 1 930  ? 19.214  26.963 35.109  1.00 76.30  ? 927  MET A N   1 
ATOM 7157 C CA  . MET A 1 930  ? 20.654  27.113 35.402  1.00 76.30  ? 927  MET A CA  1 
ATOM 7158 C C   . MET A 1 930  ? 21.542  26.274 34.543  1.00 76.30  ? 927  MET A C   1 
ATOM 7159 O O   . MET A 1 930  ? 22.689  26.595 34.321  1.00 76.30  ? 927  MET A O   1 
ATOM 7160 C CB  . MET A 1 930  ? 20.995  26.723 36.814  1.00 81.68  ? 927  MET A CB  1 
ATOM 7161 C CG  . MET A 1 930  ? 22.440  26.267 36.917  1.00 81.68  ? 927  MET A CG  1 
ATOM 7162 S SD  . MET A 1 930  ? 22.916  25.223 38.293  1.00 81.68  ? 927  MET A SD  1 
ATOM 7163 C CE  . MET A 1 930  ? 22.900  26.383 39.605  1.00 81.68  ? 927  MET A CE  1 
ATOM 7164 N N   . ARG A 1 931  ? 20.955  25.175 34.123  1.00 99.50  ? 928  ARG A N   1 
ATOM 7165 C CA  . ARG A 1 931  ? 21.589  24.239 33.276  1.00 99.50  ? 928  ARG A CA  1 
ATOM 7166 C C   . ARG A 1 931  ? 21.463  25.102 32.104  1.00 99.50  ? 928  ARG A C   1 
ATOM 7167 O O   . ARG A 1 931  ? 22.184  26.063 31.980  1.00 99.50  ? 928  ARG A O   1 
ATOM 7168 C CB  . ARG A 1 931  ? 20.711  23.056 33.098  1.00 130.87 ? 928  ARG A CB  1 
ATOM 7169 C CG  . ARG A 1 931  ? 21.474  21.831 32.850  1.00 130.87 ? 928  ARG A CG  1 
ATOM 7170 C CD  . ARG A 1 931  ? 21.073  20.770 33.832  1.00 130.87 ? 928  ARG A CD  1 
ATOM 7171 N NE  . ARG A 1 931  ? 22.079  20.649 34.859  1.00 130.87 ? 928  ARG A NE  1 
ATOM 7172 C CZ  . ARG A 1 931  ? 22.240  19.558 35.587  1.00 130.87 ? 928  ARG A CZ  1 
ATOM 7173 N NH1 . ARG A 1 931  ? 21.438  18.524 35.394  1.00 130.87 ? 928  ARG A NH1 1 
ATOM 7174 N NH2 . ARG A 1 931  ? 23.195  19.506 36.504  1.00 130.87 ? 928  ARG A NH2 1 
ATOM 7175 N N   . SER A 1 932  ? 20.517  24.794 31.253  1.00 47.27  ? 929  SER A N   1 
ATOM 7176 C CA  . SER A 1 932  ? 20.327  25.580 30.089  1.00 47.27  ? 929  SER A CA  1 
ATOM 7177 C C   . SER A 1 932  ? 19.029  25.095 29.594  1.00 47.27  ? 929  SER A C   1 
ATOM 7178 O O   . SER A 1 932  ? 18.011  25.483 30.072  1.00 47.27  ? 929  SER A O   1 
ATOM 7179 C CB  . SER A 1 932  ? 21.377  25.199 29.101  1.00 76.86  ? 929  SER A CB  1 
ATOM 7180 O OG  . SER A 1 932  ? 21.154  25.876 27.911  1.00 76.86  ? 929  SER A OG  1 
ATOM 7181 N N   . VAL A 1 933  ? 19.066  24.206 28.632  1.00 43.23  ? 930  VAL A N   1 
ATOM 7182 C CA  . VAL A 1 933  ? 17.846  23.686 28.082  1.00 43.23  ? 930  VAL A CA  1 
ATOM 7183 C C   . VAL A 1 933  ? 17.811  22.195 27.903  1.00 43.23  ? 930  VAL A C   1 
ATOM 7184 O O   . VAL A 1 933  ? 18.793  21.526 28.028  1.00 43.23  ? 930  VAL A O   1 
ATOM 7185 C CB  . VAL A 1 933  ? 17.626  24.295 26.732  1.00 44.51  ? 930  VAL A CB  1 
ATOM 7186 C CG1 . VAL A 1 933  ? 17.344  23.249 25.753  1.00 44.51  ? 930  VAL A CG1 1 
ATOM 7187 C CG2 . VAL A 1 933  ? 16.562  25.328 26.766  1.00 44.51  ? 930  VAL A CG2 1 
ATOM 7188 N N   . LEU A 1 934  ? 16.643  21.678 27.605  1.00 33.80  ? 931  LEU A N   1 
ATOM 7189 C CA  . LEU A 1 934  ? 16.496  20.259 27.434  1.00 33.80  ? 931  LEU A CA  1 
ATOM 7190 C C   . LEU A 1 934  ? 15.276  19.982 26.607  1.00 33.80  ? 931  LEU A C   1 
ATOM 7191 O O   . LEU A 1 934  ? 14.285  20.636 26.665  1.00 33.80  ? 931  LEU A O   1 
ATOM 7192 C CB  . LEU A 1 934  ? 16.493  19.517 28.742  1.00 42.69  ? 931  LEU A CB  1 
ATOM 7193 C CG  . LEU A 1 934  ? 15.224  18.861 29.209  1.00 42.69  ? 931  LEU A CG  1 
ATOM 7194 C CD1 . LEU A 1 934  ? 14.709  17.958 28.176  1.00 42.69  ? 931  LEU A CD1 1 
ATOM 7195 C CD2 . LEU A 1 934  ? 15.582  18.104 30.393  1.00 42.69  ? 931  LEU A CD2 1 
ATOM 7196 N N   . LEU A 1 935  ? 15.402  18.964 25.813  1.00 78.38  ? 932  LEU A N   1 
ATOM 7197 C CA  . LEU A 1 935  ? 14.402  18.528 24.822  1.00 78.38  ? 932  LEU A CA  1 
ATOM 7198 C C   . LEU A 1 935  ? 13.830  17.254 25.453  1.00 78.38  ? 932  LEU A C   1 
ATOM 7199 O O   . LEU A 1 935  ? 14.571  16.500 26.115  1.00 78.38  ? 932  LEU A O   1 
ATOM 7200 C CB  . LEU A 1 935  ? 15.017  18.217 23.480  1.00 43.14  ? 932  LEU A CB  1 
ATOM 7201 C CG  . LEU A 1 935  ? 13.925  17.840 22.516  1.00 43.14  ? 932  LEU A CG  1 
ATOM 7202 C CD1 . LEU A 1 935  ? 12.851  18.761 22.769  1.00 43.14  ? 932  LEU A CD1 1 
ATOM 7203 C CD2 . LEU A 1 935  ? 14.348  17.981 21.135  1.00 43.14  ? 932  LEU A CD2 1 
ATOM 7204 N N   . LEU A 1 936  ? 12.537  17.006 25.244  1.00 70.03  ? 933  LEU A N   1 
ATOM 7205 C CA  . LEU A 1 936  ? 11.864  15.919 25.921  1.00 70.03  ? 933  LEU A CA  1 
ATOM 7206 C C   . LEU A 1 936  ? 10.589  15.570 25.161  1.00 70.03  ? 933  LEU A C   1 
ATOM 7207 O O   . LEU A 1 936  ? 9.829   16.458 24.805  1.00 70.03  ? 933  LEU A O   1 
ATOM 7208 C CB  . LEU A 1 936  ? 11.583  16.351 27.355  1.00 53.76  ? 933  LEU A CB  1 
ATOM 7209 C CG  . LEU A 1 936  ? 10.490  15.704 28.189  1.00 53.76  ? 933  LEU A CG  1 
ATOM 7210 C CD1 . LEU A 1 936  ? 10.501  14.180 28.063  1.00 53.76  ? 933  LEU A CD1 1 
ATOM 7211 C CD2 . LEU A 1 936  ? 10.629  16.136 29.653  1.00 53.76  ? 933  LEU A CD2 1 
ATOM 7212 N N   . ALA A 1 937  ? 10.379  14.283 24.885  1.00 52.76  ? 934  ALA A N   1 
ATOM 7213 C CA  . ALA A 1 937  ? 9.167   13.827 24.179  1.00 52.76  ? 934  ALA A CA  1 
ATOM 7214 C C   . ALA A 1 937  ? 8.227   13.004 25.060  1.00 52.76  ? 934  ALA A C   1 
ATOM 7215 O O   . ALA A 1 937  ? 8.639   12.358 26.023  1.00 52.76  ? 934  ALA A O   1 
ATOM 7216 C CB  . ALA A 1 937  ? 9.531   13.043 22.937  1.00 63.95  ? 934  ALA A CB  1 
ATOM 7217 N N   . TYR A 1 938  ? 6.949   13.030 24.731  1.00 86.34  ? 935  TYR A N   1 
ATOM 7218 C CA  . TYR A 1 938  ? 6.035   12.151 25.406  1.00 86.34  ? 935  TYR A CA  1 
ATOM 7219 C C   . TYR A 1 938  ? 5.703   10.996 24.486  1.00 86.34  ? 935  TYR A C   1 
ATOM 7220 O O   . TYR A 1 938  ? 5.143   11.198 23.412  1.00 86.34  ? 935  TYR A O   1 
ATOM 7221 C CB  . TYR A 1 938  ? 4.779   12.885 25.831  1.00 51.15  ? 935  TYR A CB  1 
ATOM 7222 C CG  . TYR A 1 938  ? 3.732   11.946 26.357  1.00 51.15  ? 935  TYR A CG  1 
ATOM 7223 C CD1 . TYR A 1 938  ? 3.775   11.491 27.677  1.00 51.15  ? 935  TYR A CD1 1 
ATOM 7224 C CD2 . TYR A 1 938  ? 2.708   11.495 25.535  1.00 51.15  ? 935  TYR A CD2 1 
ATOM 7225 C CE1 . TYR A 1 938  ? 2.821   10.625 28.160  1.00 51.15  ? 935  TYR A CE1 1 
ATOM 7226 C CE2 . TYR A 1 938  ? 1.760   10.630 26.004  1.00 51.15  ? 935  TYR A CE2 1 
ATOM 7227 C CZ  . TYR A 1 938  ? 1.819   10.198 27.313  1.00 51.15  ? 935  TYR A CZ  1 
ATOM 7228 O OH  . TYR A 1 938  ? 0.853   9.346  27.771  1.00 51.15  ? 935  TYR A OH  1 
ATOM 7229 N N   . LYS A 1 939  ? 6.068   9.791  24.918  1.00 81.63  ? 936  LYS A N   1 
ATOM 7230 C CA  . LYS A 1 939  ? 5.829   8.578  24.145  1.00 81.63  ? 936  LYS A CA  1 
ATOM 7231 C C   . LYS A 1 939  ? 4.436   8.037  24.437  1.00 81.63  ? 936  LYS A C   1 
ATOM 7232 O O   . LYS A 1 939  ? 4.194   7.504  25.526  1.00 81.63  ? 936  LYS A O   1 
ATOM 7233 C CB  . LYS A 1 939  ? 6.884   7.530  24.456  1.00 105.90 ? 936  LYS A CB  1 
ATOM 7234 C CG  . LYS A 1 939  ? 8.302   7.972  24.147  1.00 105.90 ? 936  LYS A CG  1 
ATOM 7235 C CD  . LYS A 1 939  ? 9.262   6.813  24.327  1.00 105.90 ? 936  LYS A CD  1 
ATOM 7236 C CE  . LYS A 1 939  ? 9.247   6.284  25.763  1.00 105.90 ? 936  LYS A CE  1 
ATOM 7237 N NZ  . LYS A 1 939  ? 9.844   4.920  25.900  1.00 105.90 ? 936  LYS A NZ  1 
ATOM 7238 N N   . PRO A 1 940  ? 3.522   8.157  23.454  1.00 92.51  ? 937  PRO A N   1 
ATOM 7239 C CA  . PRO A 1 940  ? 2.121   7.857  23.682  1.00 92.51  ? 937  PRO A CA  1 
ATOM 7240 C C   . PRO A 1 940  ? 1.974   6.466  24.270  1.00 92.51  ? 937  PRO A C   1 
ATOM 7241 O O   . PRO A 1 940  ? 1.489   6.337  25.398  1.00 92.51  ? 937  PRO A O   1 
ATOM 7242 C CB  . PRO A 1 940  ? 1.506   7.903  22.273  1.00 55.92  ? 937  PRO A CB  1 
ATOM 7243 C CG  . PRO A 1 940  ? 2.419   8.741  21.466  1.00 55.92  ? 937  PRO A CG  1 
ATOM 7244 C CD  . PRO A 1 940  ? 3.786   8.536  22.051  1.00 55.92  ? 937  PRO A CD  1 
ATOM 7245 N N   . MET A 1 941  ? 2.434   5.456  23.520  1.00 76.64  ? 938  MET A N   1 
ATOM 7246 C CA  . MET A 1 941  ? 2.226   4.043  23.837  1.00 76.64  ? 938  MET A CA  1 
ATOM 7247 C C   . MET A 1 941  ? 2.747   3.691  25.222  1.00 76.64  ? 938  MET A C   1 
ATOM 7248 O O   . MET A 1 941  ? 2.050   3.047  26.011  1.00 76.64  ? 938  MET A O   1 
ATOM 7249 C CB  . MET A 1 941  ? 2.876   3.151  22.776  1.00 122.99 ? 938  MET A CB  1 
ATOM 7250 C CG  . MET A 1 941  ? 2.283   3.290  21.366  1.00 122.99 ? 938  MET A CG  1 
ATOM 7251 S SD  . MET A 1 941  ? 0.492   3.015  21.237  1.00 122.99 ? 938  MET A SD  1 
ATOM 7252 C CE  . MET A 1 941  ? -0.157  4.685  21.154  1.00 122.99 ? 938  MET A CE  1 
ATOM 7253 N N   . GLU A 1 942  ? 3.964   4.144  25.510  1.00 66.34  ? 939  GLU A N   1 
ATOM 7254 C CA  . GLU A 1 942  ? 4.619   3.925  26.792  1.00 66.34  ? 939  GLU A CA  1 
ATOM 7255 C C   . GLU A 1 942  ? 3.920   4.675  27.915  1.00 66.34  ? 939  GLU A C   1 
ATOM 7256 O O   . GLU A 1 942  ? 4.076   4.349  29.101  1.00 66.34  ? 939  GLU A O   1 
ATOM 7257 C CB  . GLU A 1 942  ? 6.071   4.394  26.704  1.00 150.43 ? 939  GLU A CB  1 
ATOM 7258 C CG  . GLU A 1 942  ? 6.973   3.438  25.964  1.00 150.43 ? 939  GLU A CG  1 
ATOM 7259 C CD  . GLU A 1 942  ? 7.219   2.162  26.742  1.00 150.43 ? 939  GLU A CD  1 
ATOM 7260 O OE1 . GLU A 1 942  ? 7.634   2.251  27.918  1.00 150.43 ? 939  GLU A OE1 1 
ATOM 7261 O OE2 . GLU A 1 942  ? 6.998   1.070  26.177  1.00 150.43 ? 939  GLU A OE2 1 
ATOM 7262 N N   . GLY A 1 943  ? 3.149   5.689  27.540  1.00 56.78  ? 940  GLY A N   1 
ATOM 7263 C CA  . GLY A 1 943  ? 2.593   6.596  28.529  1.00 56.78  ? 940  GLY A CA  1 
ATOM 7264 C C   . GLY A 1 943  ? 3.726   7.249  29.293  1.00 56.78  ? 940  GLY A C   1 
ATOM 7265 O O   . GLY A 1 943  ? 3.688   7.317  30.537  1.00 56.78  ? 940  GLY A O   1 
ATOM 7266 N N   . ASN A 1 944  ? 4.736   7.724  28.552  1.00 67.93  ? 941  ASN A N   1 
ATOM 7267 C CA  . ASN A 1 944  ? 5.974   8.116  29.189  1.00 67.93  ? 941  ASN A CA  1 
ATOM 7268 C C   . ASN A 1 944  ? 6.780   9.254  28.584  1.00 67.93  ? 941  ASN A C   1 
ATOM 7269 O O   . ASN A 1 944  ? 6.580   9.647  27.431  1.00 67.93  ? 941  ASN A O   1 
ATOM 7270 C CB  . ASN A 1 944  ? 6.867   6.890  29.405  1.00 86.34  ? 941  ASN A CB  1 
ATOM 7271 C CG  . ASN A 1 944  ? 7.306   6.750  30.842  1.00 86.34  ? 941  ASN A CG  1 
ATOM 7272 O OD1 . ASN A 1 944  ? 7.979   5.791  31.211  1.00 86.34  ? 941  ASN A OD1 1 
ATOM 7273 N ND2 . ASN A 1 944  ? 6.913   7.704  31.671  1.00 86.34  ? 941  ASN A ND2 1 
ATOM 7274 N N   . PHE A 1 945  ? 7.677   9.768  29.432  1.00 60.62  ? 942  PHE A N   1 
ATOM 7275 C CA  . PHE A 1 945  ? 8.644   10.812 29.151  1.00 60.62  ? 942  PHE A CA  1 
ATOM 7276 C C   . PHE A 1 945  ? 9.954   10.146 28.742  1.00 60.62  ? 942  PHE A C   1 
ATOM 7277 O O   . PHE A 1 945  ? 10.444  9.226  29.405  1.00 60.62  ? 942  PHE A O   1 
ATOM 7278 C CB  . PHE A 1 945  ? 8.878   11.655 30.417  1.00 136.51 ? 942  PHE A CB  1 
ATOM 7279 C CG  . PHE A 1 945  ? 9.696   10.941 31.485  1.00 136.51 ? 942  PHE A CG  1 
ATOM 7280 C CD1 . PHE A 1 945  ? 11.065  11.200 31.631  1.00 136.51 ? 942  PHE A CD1 1 
ATOM 7281 C CD2 . PHE A 1 945  ? 9.108   9.990  32.322  1.00 136.51 ? 942  PHE A CD2 1 
ATOM 7282 C CE1 . PHE A 1 945  ? 11.826  10.535 32.603  1.00 136.51 ? 942  PHE A CE1 1 
ATOM 7283 C CE2 . PHE A 1 945  ? 9.865   9.319  33.295  1.00 136.51 ? 942  PHE A CE2 1 
ATOM 7284 C CZ  . PHE A 1 945  ? 11.223  9.595  33.436  1.00 136.51 ? 942  PHE A CZ  1 
ATOM 7285 N N   . GLU A 1 946  ? 10.520  10.619 27.642  1.00 77.43  ? 943  GLU A N   1 
ATOM 7286 C CA  . GLU A 1 946  ? 11.809  10.162 27.172  1.00 77.43  ? 943  GLU A CA  1 
ATOM 7287 C C   . GLU A 1 946  ? 12.656  11.395 26.997  1.00 77.43  ? 943  GLU A C   1 
ATOM 7288 O O   . GLU A 1 946  ? 12.292  12.276 26.223  1.00 77.43  ? 943  GLU A O   1 
ATOM 7289 C CB  . GLU A 1 946  ? 11.635  9.450  25.832  1.00 87.26  ? 943  GLU A CB  1 
ATOM 7290 C CG  . GLU A 1 946  ? 12.908  9.363  24.998  1.00 87.26  ? 943  GLU A CG  1 
ATOM 7291 C CD  . GLU A 1 946  ? 12.826  8.337  23.893  1.00 87.26  ? 943  GLU A CD  1 
ATOM 7292 O OE1 . GLU A 1 946  ? 11.796  8.291  23.178  1.00 87.26  ? 943  GLU A OE1 1 
ATOM 7293 O OE2 . GLU A 1 946  ? 13.805  7.581  23.741  1.00 87.26  ? 943  GLU A OE2 1 
ATOM 7294 N N   . GLU A 1 947  ? 13.767  11.485 27.718  1.00 55.44  ? 944  GLU A N   1 
ATOM 7295 C CA  . GLU A 1 947  ? 14.648  12.643 27.554  1.00 55.44  ? 944  GLU A CA  1 
ATOM 7296 C C   . GLU A 1 947  ? 15.420  12.562 26.239  1.00 55.44  ? 944  GLU A C   1 
ATOM 7297 O O   . GLU A 1 947  ? 16.327  11.731 26.105  1.00 55.44  ? 944  GLU A O   1 
ATOM 7298 C CB  . GLU A 1 947  ? 15.611  12.799 28.721  1.00 59.85  ? 944  GLU A CB  1 
ATOM 7299 C CG  . GLU A 1 947  ? 16.306  14.144 28.701  1.00 59.85  ? 944  GLU A CG  1 
ATOM 7300 C CD  . GLU A 1 947  ? 17.295  14.345 29.839  1.00 59.85  ? 944  GLU A CD  1 
ATOM 7301 O OE1 . GLU A 1 947  ? 17.010  13.944 30.990  1.00 59.85  ? 944  GLU A OE1 1 
ATOM 7302 O OE2 . GLU A 1 947  ? 18.366  14.929 29.572  1.00 59.85  ? 944  GLU A OE2 1 
ATOM 7303 N N   . ILE A 1 948  ? 15.088  13.417 25.273  1.00 61.92  ? 945  ILE A N   1 
ATOM 7304 C CA  . ILE A 1 948  ? 15.679  13.271 23.941  1.00 61.92  ? 945  ILE A CA  1 
ATOM 7305 C C   . ILE A 1 948  ? 17.081  13.827 23.764  1.00 61.92  ? 945  ILE A C   1 
ATOM 7306 O O   . ILE A 1 948  ? 17.992  13.105 23.344  1.00 61.92  ? 945  ILE A O   1 
ATOM 7307 C CB  . ILE A 1 948  ? 14.787  13.792 22.848  1.00 48.74  ? 945  ILE A CB  1 
ATOM 7308 C CG1 . ILE A 1 948  ? 13.692  12.772 22.610  1.00 48.74  ? 945  ILE A CG1 1 
ATOM 7309 C CG2 . ILE A 1 948  ? 15.610  14.049 21.588  1.00 48.74  ? 945  ILE A CG2 1 
ATOM 7310 C CD1 . ILE A 1 948  ? 13.330  12.589 21.187  1.00 48.74  ? 945  ILE A CD1 1 
ATOM 7311 N N   . ALA A 1 949  ? 17.251  15.112 24.052  1.00 48.60  ? 946  ALA A N   1 
ATOM 7312 C CA  . ALA A 1 949  ? 18.574  15.741 23.940  1.00 48.60  ? 946  ALA A CA  1 
ATOM 7313 C C   . ALA A 1 949  ? 18.766  16.770 25.032  1.00 48.60  ? 946  ALA A C   1 
ATOM 7314 O O   . ALA A 1 949  ? 17.873  16.973 25.840  1.00 48.60  ? 946  ALA A O   1 
ATOM 7315 C CB  . ALA A 1 949  ? 18.769  16.351 22.552  1.00 34.52  ? 946  ALA A CB  1 
ATOM 7316 N N   . ARG A 1 950  ? 19.925  17.410 25.065  1.00 53.70  ? 947  ARG A N   1 
ATOM 7317 C CA  . ARG A 1 950  ? 20.207  18.451 26.063  1.00 53.70  ? 947  ARG A CA  1 
ATOM 7318 C C   . ARG A 1 950  ? 21.308  19.398 25.577  1.00 53.70  ? 947  ARG A C   1 
ATOM 7319 O O   . ARG A 1 950  ? 22.209  18.999 24.841  1.00 53.70  ? 947  ARG A O   1 
ATOM 7320 C CB  . ARG A 1 950  ? 20.570  17.800 27.405  1.00 67.24  ? 947  ARG A CB  1 
ATOM 7321 C CG  . ARG A 1 950  ? 21.445  18.619 28.308  1.00 67.24  ? 947  ARG A CG  1 
ATOM 7322 C CD  . ARG A 1 950  ? 20.671  19.268 29.426  1.00 67.24  ? 947  ARG A CD  1 
ATOM 7323 N NE  . ARG A 1 950  ? 21.515  19.380 30.616  1.00 67.24  ? 947  ARG A NE  1 
ATOM 7324 C CZ  . ARG A 1 950  ? 21.918  18.344 31.358  1.00 67.24  ? 947  ARG A CZ  1 
ATOM 7325 N NH1 . ARG A 1 950  ? 21.560  17.097 31.036  1.00 67.24  ? 947  ARG A NH1 1 
ATOM 7326 N NH2 . ARG A 1 950  ? 22.692  18.558 32.423  1.00 67.24  ? 947  ARG A NH2 1 
ATOM 7327 N N   . ASP A 1 951  ? 21.222  20.662 25.963  1.00 45.51  ? 948  ASP A N   1 
ATOM 7328 C CA  . ASP A 1 951  ? 22.285  21.609 25.666  1.00 45.51  ? 948  ASP A CA  1 
ATOM 7329 C C   . ASP A 1 951  ? 23.122  21.669 26.918  1.00 45.51  ? 948  ASP A C   1 
ATOM 7330 O O   . ASP A 1 951  ? 22.587  21.743 28.014  1.00 45.51  ? 948  ASP A O   1 
ATOM 7331 C CB  . ASP A 1 951  ? 21.710  22.966 25.317  1.00 43.61  ? 948  ASP A CB  1 
ATOM 7332 C CG  . ASP A 1 951  ? 22.760  23.977 24.909  1.00 43.61  ? 948  ASP A CG  1 
ATOM 7333 O OD1 . ASP A 1 951  ? 23.972  23.654 24.908  1.00 43.61  ? 948  ASP A OD1 1 
ATOM 7334 O OD2 . ASP A 1 951  ? 22.379  25.134 24.596  1.00 43.61  ? 948  ASP A OD2 1 
ATOM 7335 N N   . PHE A 1 952  ? 24.432  21.609 26.766  1.00 68.46  ? 949  PHE A N   1 
ATOM 7336 C CA  . PHE A 1 952  ? 25.277  21.537 27.920  1.00 68.46  ? 949  PHE A CA  1 
ATOM 7337 C C   . PHE A 1 952  ? 26.036  22.828 28.053  1.00 68.46  ? 949  PHE A C   1 
ATOM 7338 O O   . PHE A 1 952  ? 27.249  22.836 27.887  1.00 68.46  ? 949  PHE A O   1 
ATOM 7339 C CB  . PHE A 1 952  ? 26.252  20.361 27.802  1.00 64.61  ? 949  PHE A CB  1 
ATOM 7340 C CG  . PHE A 1 952  ? 25.597  19.001 27.849  1.00 64.61  ? 949  PHE A CG  1 
ATOM 7341 C CD1 . PHE A 1 952  ? 25.156  18.386 26.691  1.00 64.61  ? 949  PHE A CD1 1 
ATOM 7342 C CD2 . PHE A 1 952  ? 25.440  18.332 29.058  1.00 64.61  ? 949  PHE A CD2 1 
ATOM 7343 C CE1 . PHE A 1 952  ? 24.554  17.133 26.731  1.00 64.61  ? 949  PHE A CE1 1 
ATOM 7344 C CE2 . PHE A 1 952  ? 24.835  17.067 29.112  1.00 64.61  ? 949  PHE A CE2 1 
ATOM 7345 C CZ  . PHE A 1 952  ? 24.400  16.464 27.941  1.00 64.61  ? 949  PHE A CZ  1 
ATOM 7346 N N   . ASN A 1 953  ? 25.344  23.929 28.335  1.00 56.10  ? 950  ASN A N   1 
ATOM 7347 C CA  . ASN A 1 953  ? 26.039  25.186 28.652  1.00 56.10  ? 950  ASN A CA  1 
ATOM 7348 C C   . ASN A 1 953  ? 25.493  25.843 29.920  1.00 56.10  ? 950  ASN A C   1 
ATOM 7349 O O   . ASN A 1 953  ? 24.330  25.642 30.281  1.00 56.10  ? 950  ASN A O   1 
ATOM 7350 C CB  . ASN A 1 953  ? 25.977  26.163 27.476  1.00 84.81  ? 950  ASN A CB  1 
ATOM 7351 C CG  . ASN A 1 953  ? 26.684  25.644 26.245  1.00 84.81  ? 950  ASN A CG  1 
ATOM 7352 O OD1 . ASN A 1 953  ? 26.281  24.647 25.653  1.00 84.81  ? 950  ASN A OD1 1 
ATOM 7353 N ND2 . ASN A 1 953  ? 27.729  26.337 25.840  1.00 84.81  ? 950  ASN A ND2 1 
ATOM 7354 N N   . PRO A 1 954  ? 26.324  26.632 30.612  1.00 88.14  ? 951  PRO A N   1 
ATOM 7355 C CA  . PRO A 1 954  ? 25.804  27.193 31.842  1.00 88.14  ? 951  PRO A CA  1 
ATOM 7356 C C   . PRO A 1 954  ? 25.008  28.477 31.595  1.00 88.14  ? 951  PRO A C   1 
ATOM 7357 O O   . PRO A 1 954  ? 25.365  29.532 32.116  1.00 88.14  ? 951  PRO A O   1 
ATOM 7358 C CB  . PRO A 1 954  ? 27.068  27.470 32.656  1.00 106.50 ? 951  PRO A CB  1 
ATOM 7359 C CG  . PRO A 1 954  ? 28.141  27.690 31.634  1.00 106.50 ? 951  PRO A CG  1 
ATOM 7360 C CD  . PRO A 1 954  ? 27.712  27.051 30.345  1.00 106.50 ? 951  PRO A CD  1 
ATOM 7361 N N   . ASN A 1 955  ? 23.937  28.382 30.810  1.00 48.26  ? 952  ASN A N   1 
ATOM 7362 C CA  . ASN A 1 955  ? 23.021  29.518 30.589  1.00 48.26  ? 952  ASN A CA  1 
ATOM 7363 C C   . ASN A 1 955  ? 21.962  29.614 31.674  1.00 48.26  ? 952  ASN A C   1 
ATOM 7364 O O   . ASN A 1 955  ? 21.208  28.676 31.875  1.00 48.26  ? 952  ASN A O   1 
ATOM 7365 C CB  . ASN A 1 955  ? 22.351  29.403 29.219  1.00 42.74  ? 952  ASN A CB  1 
ATOM 7366 C CG  . ASN A 1 955  ? 23.353  29.561 28.070  1.00 42.74  ? 952  ASN A CG  1 
ATOM 7367 O OD1 . ASN A 1 955  ? 24.294  30.373 28.173  1.00 42.74  ? 952  ASN A OD1 1 
ATOM 7368 N ND2 . ASN A 1 955  ? 23.158  28.794 26.969  1.00 42.74  ? 952  ASN A ND2 1 
ATOM 7369 N N   . TRP A 1 956  ? 21.925  30.726 32.403  1.00 47.66  ? 953  TRP A N   1 
ATOM 7370 C CA  . TRP A 1 956  ? 20.871  30.910 33.384  1.00 47.66  ? 953  TRP A CA  1 
ATOM 7371 C C   . TRP A 1 956  ? 19.690  31.454 32.599  1.00 47.66  ? 953  TRP A C   1 
ATOM 7372 O O   . TRP A 1 956  ? 19.698  32.594 32.140  1.00 47.66  ? 953  TRP A O   1 
ATOM 7373 C CB  . TRP A 1 956  ? 21.284  31.856 34.502  1.00 63.61  ? 953  TRP A CB  1 
ATOM 7374 C CG  . TRP A 1 956  ? 22.447  31.399 35.255  1.00 63.61  ? 953  TRP A CG  1 
ATOM 7375 C CD1 . TRP A 1 956  ? 23.714  31.299 34.793  1.00 63.61  ? 953  TRP A CD1 1 
ATOM 7376 C CD2 . TRP A 1 956  ? 22.485  30.995 36.631  1.00 63.61  ? 953  TRP A CD2 1 
ATOM 7377 N NE1 . TRP A 1 956  ? 24.543  30.843 35.780  1.00 63.61  ? 953  TRP A NE1 1 
ATOM 7378 C CE2 . TRP A 1 956  ? 23.819  30.655 36.925  1.00 63.61  ? 953  TRP A CE2 1 
ATOM 7379 C CE3 . TRP A 1 956  ? 21.525  30.894 37.645  1.00 63.61  ? 953  TRP A CE3 1 
ATOM 7380 C CZ2 . TRP A 1 956  ? 24.222  30.213 38.185  1.00 63.61  ? 953  TRP A CZ2 1 
ATOM 7381 C CZ3 . TRP A 1 956  ? 21.929  30.454 38.901  1.00 63.61  ? 953  TRP A CZ3 1 
ATOM 7382 C CH2 . TRP A 1 956  ? 23.265  30.120 39.157  1.00 63.61  ? 953  TRP A CH2 1 
ATOM 7383 N N   . MET A 1 957  ? 18.693  30.610 32.424  1.00 31.53  ? 954  MET A N   1 
ATOM 7384 C CA  . MET A 1 957  ? 17.603  30.897 31.544  1.00 31.53  ? 954  MET A CA  1 
ATOM 7385 C C   . MET A 1 957  ? 16.659  31.991 32.071  1.00 31.53  ? 954  MET A C   1 
ATOM 7386 O O   . MET A 1 957  ? 16.453  32.132 33.286  1.00 31.53  ? 954  MET A O   1 
ATOM 7387 C CB  . MET A 1 957  ? 16.823  29.611 31.318  1.00 42.83  ? 954  MET A CB  1 
ATOM 7388 C CG  . MET A 1 957  ? 17.653  28.513 30.727  1.00 42.83  ? 954  MET A CG  1 
ATOM 7389 S SD  . MET A 1 957  ? 18.720  29.089 29.401  1.00 42.83  ? 954  MET A SD  1 
ATOM 7390 C CE  . MET A 1 957  ? 17.653  29.143 27.982  1.00 42.83  ? 954  MET A CE  1 
ATOM 7391 N N   . SER A 1 958  ? 16.071  32.753 31.154  1.00 48.19  ? 955  SER A N   1 
ATOM 7392 C CA  . SER A 1 958  ? 14.968  33.621 31.506  1.00 48.19  ? 955  SER A CA  1 
ATOM 7393 C C   . SER A 1 958  ? 13.726  33.395 30.624  1.00 48.19  ? 955  SER A C   1 
ATOM 7394 O O   . SER A 1 958  ? 12.603  33.675 31.059  1.00 48.19  ? 955  SER A O   1 
ATOM 7395 C CB  . SER A 1 958  ? 15.427  35.063 31.422  1.00 45.29  ? 955  SER A CB  1 
ATOM 7396 O OG  . SER A 1 958  ? 15.220  35.563 30.106  1.00 45.29  ? 955  SER A OG  1 
ATOM 7397 N N   . ALA A 1 959  ? 13.921  32.910 29.395  1.00 44.27  ? 956  ALA A N   1 
ATOM 7398 C CA  . ALA A 1 959  ? 12.792  32.604 28.502  1.00 44.27  ? 956  ALA A CA  1 
ATOM 7399 C C   . ALA A 1 959  ? 13.090  31.551 27.436  1.00 44.27  ? 956  ALA A C   1 
ATOM 7400 O O   . ALA A 1 959  ? 14.236  31.295 27.107  1.00 44.27  ? 956  ALA A O   1 
ATOM 7401 C CB  . ALA A 1 959  ? 12.232  33.879 27.863  1.00 30.63  ? 956  ALA A CB  1 
ATOM 7402 N N   . VAL A 1 960  ? 12.055  30.937 26.884  1.00 34.89  ? 957  VAL A N   1 
ATOM 7403 C CA  . VAL A 1 960  ? 12.272  29.762 26.048  1.00 34.89  ? 957  VAL A CA  1 
ATOM 7404 C C   . VAL A 1 960  ? 11.164  29.647 25.020  1.00 34.89  ? 957  VAL A C   1 
ATOM 7405 O O   . VAL A 1 960  ? 10.010  29.965 25.330  1.00 34.89  ? 957  VAL A O   1 
ATOM 7406 C CB  . VAL A 1 960  ? 12.326  28.463 26.900  1.00 40.75  ? 957  VAL A CB  1 
ATOM 7407 C CG1 . VAL A 1 960  ? 12.001  27.290 26.071  1.00 40.75  ? 957  VAL A CG1 1 
ATOM 7408 C CG2 . VAL A 1 960  ? 13.703  28.253 27.497  1.00 40.75  ? 957  VAL A CG2 1 
ATOM 7409 N N   . GLU A 1 961  ? 11.486  29.191 23.810  1.00 46.68  ? 958  GLU A N   1 
ATOM 7410 C CA  . GLU A 1 961  ? 10.458  29.091 22.779  1.00 46.68  ? 958  GLU A CA  1 
ATOM 7411 C C   . GLU A 1 961  ? 10.816  28.065 21.706  1.00 46.68  ? 958  GLU A C   1 
ATOM 7412 O O   . GLU A 1 961  ? 11.971  27.937 21.304  1.00 46.68  ? 958  GLU A O   1 
ATOM 7413 C CB  . GLU A 1 961  ? 10.237  30.469 22.145  1.00 48.30  ? 958  GLU A CB  1 
ATOM 7414 C CG  . GLU A 1 961  ? 9.019   30.607 21.255  1.00 48.30  ? 958  GLU A CG  1 
ATOM 7415 C CD  . GLU A 1 961  ? 7.744   30.117 21.924  1.00 48.30  ? 958  GLU A CD  1 
ATOM 7416 O OE1 . GLU A 1 961  ? 7.570   28.875 21.978  1.00 48.30  ? 958  GLU A OE1 1 
ATOM 7417 O OE2 . GLU A 1 961  ? 6.933   30.976 22.392  1.00 48.30  ? 958  GLU A OE2 1 
ATOM 7418 N N   . ILE A 1 962  ? 9.823   27.330 21.242  1.00 35.98  ? 959  ILE A N   1 
ATOM 7419 C CA  . ILE A 1 962  ? 10.053  26.399 20.181  1.00 35.98  ? 959  ILE A CA  1 
ATOM 7420 C C   . ILE A 1 962  ? 9.749   27.114 18.895  1.00 35.98  ? 959  ILE A C   1 
ATOM 7421 O O   . ILE A 1 962  ? 8.588   27.477 18.633  1.00 35.98  ? 959  ILE A O   1 
ATOM 7422 C CB  . ILE A 1 962  ? 9.163   25.216 20.317  1.00 31.03  ? 959  ILE A CB  1 
ATOM 7423 C CG1 . ILE A 1 962  ? 9.755   24.252 21.364  1.00 31.03  ? 959  ILE A CG1 1 
ATOM 7424 C CG2 . ILE A 1 962  ? 8.980   24.523 18.941  1.00 31.03  ? 959  ILE A CG2 1 
ATOM 7425 C CD1 . ILE A 1 962  ? 8.750   23.221 21.891  1.00 31.03  ? 959  ILE A CD1 1 
ATOM 7426 N N   . LEU A 1 963  ? 10.795  27.371 18.116  1.00 43.25  ? 960  LEU A N   1 
ATOM 7427 C CA  . LEU A 1 963  ? 10.618  28.018 16.839  1.00 43.25  ? 960  LEU A CA  1 
ATOM 7428 C C   . LEU A 1 963  ? 10.004  26.995 15.929  1.00 43.25  ? 960  LEU A C   1 
ATOM 7429 O O   . LEU A 1 963  ? 9.054   27.303 15.218  1.00 43.25  ? 960  LEU A O   1 
ATOM 7430 C CB  . LEU A 1 963  ? 11.934  28.541 16.248  1.00 43.88  ? 960  LEU A CB  1 
ATOM 7431 C CG  . LEU A 1 963  ? 12.806  29.437 17.121  1.00 43.88  ? 960  LEU A CG  1 
ATOM 7432 C CD1 . LEU A 1 963  ? 14.067  29.719 16.439  1.00 43.88  ? 960  LEU A CD1 1 
ATOM 7433 C CD2 . LEU A 1 963  ? 12.102  30.725 17.396  1.00 43.88  ? 960  LEU A CD2 1 
ATOM 7434 N N   . ASP A 1 964  ? 10.521  25.774 15.961  1.00 82.51  ? 961  ASP A N   1 
ATOM 7435 C CA  . ASP A 1 964  ? 9.963   24.703 15.156  1.00 82.51  ? 961  ASP A CA  1 
ATOM 7436 C C   . ASP A 1 964  ? 10.410  23.357 15.700  1.00 82.51  ? 961  ASP A C   1 
ATOM 7437 O O   . ASP A 1 964  ? 10.981  23.268 16.795  1.00 82.51  ? 961  ASP A O   1 
ATOM 7438 C CB  . ASP A 1 964  ? 10.388  24.855 13.689  1.00 85.41  ? 961  ASP A CB  1 
ATOM 7439 C CG  . ASP A 1 964  ? 11.876  24.630 13.487  1.00 85.41  ? 961  ASP A CG  1 
ATOM 7440 O OD1 . ASP A 1 964  ? 12.593  25.625 13.251  1.00 85.41  ? 961  ASP A OD1 1 
ATOM 7441 O OD2 . ASP A 1 964  ? 12.325  23.465 13.576  1.00 85.41  ? 961  ASP A OD2 1 
ATOM 7442 N N   . ASP A 1 965  ? 10.169  22.318 14.909  1.00 67.80  ? 962  ASP A N   1 
ATOM 7443 C CA  . ASP A 1 965  ? 10.513  20.966 15.283  1.00 67.80  ? 962  ASP A CA  1 
ATOM 7444 C C   . ASP A 1 965  ? 11.964  20.827 15.739  1.00 67.80  ? 962  ASP A C   1 
ATOM 7445 O O   . ASP A 1 965  ? 12.229  20.214 16.770  1.00 67.80  ? 962  ASP A O   1 
ATOM 7446 C CB  . ASP A 1 965  ? 10.244  20.037 14.110  1.00 85.31  ? 962  ASP A CB  1 
ATOM 7447 C CG  . ASP A 1 965  ? 8.838   20.162 13.595  1.00 85.31  ? 962  ASP A CG  1 
ATOM 7448 O OD1 . ASP A 1 965  ? 7.935   19.620 14.270  1.00 85.31  ? 962  ASP A OD1 1 
ATOM 7449 O OD2 . ASP A 1 965  ? 8.645   20.806 12.531  1.00 85.31  ? 962  ASP A OD2 1 
ATOM 7450 N N   . ASP A 1 966  ? 12.891  21.409 14.986  1.00 84.35  ? 963  ASP A N   1 
ATOM 7451 C CA  . ASP A 1 966  ? 14.314  21.209 15.248  1.00 84.35  ? 963  ASP A CA  1 
ATOM 7452 C C   . ASP A 1 966  ? 15.024  22.478 15.736  1.00 84.35  ? 963  ASP A C   1 
ATOM 7453 O O   . ASP A 1 966  ? 16.240  22.463 15.970  1.00 84.35  ? 963  ASP A O   1 
ATOM 7454 C CB  . ASP A 1 966  ? 15.012  20.615 14.011  1.00 96.43  ? 963  ASP A CB  1 
ATOM 7455 C CG  . ASP A 1 966  ? 14.432  19.260 13.599  1.00 96.43  ? 963  ASP A CG  1 
ATOM 7456 O OD1 . ASP A 1 966  ? 14.747  18.251 14.270  1.00 96.43  ? 963  ASP A OD1 1 
ATOM 7457 O OD2 . ASP A 1 966  ? 13.674  19.203 12.599  1.00 96.43  ? 963  ASP A OD2 1 
ATOM 7458 N N   . ASN A 1 967  ? 14.262  23.563 15.897  1.00 60.30  ? 964  ASN A N   1 
ATOM 7459 C CA  . ASN A 1 967  ? 14.796  24.821 16.454  1.00 60.30  ? 964  ASN A CA  1 
ATOM 7460 C C   . ASN A 1 967  ? 14.203  25.283 17.776  1.00 60.30  ? 964  ASN A C   1 
ATOM 7461 O O   . ASN A 1 967  ? 13.008  25.501 17.884  1.00 60.30  ? 964  ASN A O   1 
ATOM 7462 C CB  . ASN A 1 967  ? 14.733  25.964 15.439  1.00 65.29  ? 964  ASN A CB  1 
ATOM 7463 C CG  . ASN A 1 967  ? 15.931  25.983 14.530  1.00 65.29  ? 964  ASN A CG  1 
ATOM 7464 O OD1 . ASN A 1 967  ? 16.367  27.030 14.070  1.00 65.29  ? 964  ASN A OD1 1 
ATOM 7465 N ND2 . ASN A 1 967  ? 16.478  24.823 14.282  1.00 65.29  ? 964  ASN A ND2 1 
ATOM 7466 N N   . PHE A 1 968  ? 15.072  25.432 18.766  1.00 34.29  ? 965  PHE A N   1 
ATOM 7467 C CA  . PHE A 1 968  ? 14.691  25.957 20.072  1.00 34.29  ? 965  PHE A CA  1 
ATOM 7468 C C   . PHE A 1 968  ? 15.468  27.218 20.451  1.00 34.29  ? 965  PHE A C   1 
ATOM 7469 O O   . PHE A 1 968  ? 16.720  27.269 20.452  1.00 34.29  ? 965  PHE A O   1 
ATOM 7470 C CB  . PHE A 1 968  ? 14.822  24.891 21.146  1.00 42.73  ? 965  PHE A CB  1 
ATOM 7471 C CG  . PHE A 1 968  ? 14.345  23.555 20.699  1.00 42.73  ? 965  PHE A CG  1 
ATOM 7472 C CD1 . PHE A 1 968  ? 15.266  22.526 20.413  1.00 42.73  ? 965  PHE A CD1 1 
ATOM 7473 C CD2 . PHE A 1 968  ? 12.981  23.322 20.510  1.00 42.73  ? 965  PHE A CD2 1 
ATOM 7474 C CE1 . PHE A 1 968  ? 14.828  21.268 19.989  1.00 42.73  ? 965  PHE A CE1 1 
ATOM 7475 C CE2 . PHE A 1 968  ? 12.523  22.082 20.095  1.00 42.73  ? 965  PHE A CE2 1 
ATOM 7476 C CZ  . PHE A 1 968  ? 13.445  21.047 19.825  1.00 42.73  ? 965  PHE A CZ  1 
ATOM 7477 N N   . LEU A 1 969  ? 14.678  28.239 20.754  1.00 34.19  ? 966  LEU A N   1 
ATOM 7478 C CA  . LEU A 1 969  ? 15.147  29.592 21.018  1.00 34.19  ? 966  LEU A CA  1 
ATOM 7479 C C   . LEU A 1 969  ? 15.058  29.895 22.527  1.00 34.19  ? 966  LEU A C   1 
ATOM 7480 O O   . LEU A 1 969  ? 14.105  29.475 23.209  1.00 34.19  ? 966  LEU A O   1 
ATOM 7481 C CB  . LEU A 1 969  ? 14.255  30.510 20.204  1.00 36.68  ? 966  LEU A CB  1 
ATOM 7482 C CG  . LEU A 1 969  ? 14.417  32.015 20.048  1.00 36.68  ? 966  LEU A CG  1 
ATOM 7483 C CD1 . LEU A 1 969  ? 13.365  32.620 20.927  1.00 36.68  ? 966  LEU A CD1 1 
ATOM 7484 C CD2 . LEU A 1 969  ? 15.840  32.591 20.269  1.00 36.68  ? 966  LEU A CD2 1 
ATOM 7485 N N   . GLY A 1 970  ? 16.052  30.606 23.035  1.00 40.14  ? 967  GLY A N   1 
ATOM 7486 C CA  . GLY A 1 970  ? 16.205  30.801 24.453  1.00 40.14  ? 967  GLY A CA  1 
ATOM 7487 C C   . GLY A 1 970  ? 16.971  32.086 24.736  1.00 40.14  ? 967  GLY A C   1 
ATOM 7488 O O   . GLY A 1 970  ? 17.891  32.473 23.982  1.00 40.14  ? 967  GLY A O   1 
ATOM 7489 N N   . ALA A 1 971  ? 16.562  32.718 25.843  1.00 42.28  ? 968  ALA A N   1 
ATOM 7490 C CA  . ALA A 1 971  ? 17.050  33.968 26.374  1.00 42.28  ? 968  ALA A CA  1 
ATOM 7491 C C   . ALA A 1 971  ? 17.570  33.730 27.776  1.00 42.28  ? 968  ALA A C   1 
ATOM 7492 O O   . ALA A 1 971  ? 16.969  33.016 28.588  1.00 42.28  ? 968  ALA A O   1 
ATOM 7493 C CB  . ALA A 1 971  ? 15.916  34.939 26.461  1.00 45.09  ? 968  ALA A CB  1 
ATOM 7494 N N   . GLU A 1 972  ? 18.659  34.411 28.095  1.00 33.88  ? 969  GLU A N   1 
ATOM 7495 C CA  . GLU A 1 972  ? 19.452  34.048 29.228  1.00 33.88  ? 969  GLU A CA  1 
ATOM 7496 C C   . GLU A 1 972  ? 19.826  35.296 30.023  1.00 33.88  ? 969  GLU A C   1 
ATOM 7497 O O   . GLU A 1 972  ? 19.871  36.364 29.473  1.00 33.88  ? 969  GLU A O   1 
ATOM 7498 C CB  . GLU A 1 972  ? 20.639  33.221 28.697  1.00 51.71  ? 969  GLU A CB  1 
ATOM 7499 C CG  . GLU A 1 972  ? 22.012  33.629 29.139  1.00 51.71  ? 969  GLU A CG  1 
ATOM 7500 C CD  . GLU A 1 972  ? 22.640  34.536 28.166  1.00 51.71  ? 969  GLU A CD  1 
ATOM 7501 O OE1 . GLU A 1 972  ? 23.768  34.250 27.762  1.00 51.71  ? 969  GLU A OE1 1 
ATOM 7502 O OE2 . GLU A 1 972  ? 22.006  35.532 27.781  1.00 51.71  ? 969  GLU A OE2 1 
ATOM 7503 N N   . ASN A 1 973  ? 20.071  35.152 31.317  1.00 36.01  ? 970  ASN A N   1 
ATOM 7504 C CA  . ASN A 1 973  ? 20.302  36.276 32.221  1.00 36.01  ? 970  ASN A CA  1 
ATOM 7505 C C   . ASN A 1 973  ? 21.421  37.241 31.858  1.00 36.01  ? 970  ASN A C   1 
ATOM 7506 O O   . ASN A 1 973  ? 21.764  38.142 32.640  1.00 36.01  ? 970  ASN A O   1 
ATOM 7507 C CB  . ASN A 1 973  ? 20.528  35.747 33.638  1.00 76.17  ? 970  ASN A CB  1 
ATOM 7508 C CG  . ASN A 1 973  ? 19.232  35.512 34.368  1.00 76.17  ? 970  ASN A CG  1 
ATOM 7509 O OD1 . ASN A 1 973  ? 18.435  34.653 33.982  1.00 76.17  ? 970  ASN A OD1 1 
ATOM 7510 N ND2 . ASN A 1 973  ? 18.991  36.299 35.419  1.00 76.17  ? 970  ASN A ND2 1 
ATOM 7511 N N   . ALA A 1 974  ? 22.014  37.069 30.688  1.00 39.30  ? 971  ALA A N   1 
ATOM 7512 C CA  . ALA A 1 974  ? 23.136  37.912 30.329  1.00 39.30  ? 971  ALA A CA  1 
ATOM 7513 C C   . ALA A 1 974  ? 22.915  38.640 28.995  1.00 39.30  ? 971  ALA A C   1 
ATOM 7514 O O   . ALA A 1 974  ? 23.846  38.982 28.279  1.00 39.30  ? 971  ALA A O   1 
ATOM 7515 C CB  . ALA A 1 974  ? 24.404  37.089 30.340  1.00 10.24  ? 971  ALA A CB  1 
ATOM 7516 N N   . PHE A 1 975  ? 21.643  38.859 28.688  1.00 51.30  ? 972  PHE A N   1 
ATOM 7517 C CA  . PHE A 1 975  ? 21.185  39.651 27.558  1.00 51.30  ? 972  PHE A CA  1 
ATOM 7518 C C   . PHE A 1 975  ? 21.618  39.035 26.221  1.00 51.30  ? 972  PHE A C   1 
ATOM 7519 O O   . PHE A 1 975  ? 21.757  39.734 25.213  1.00 51.30  ? 972  PHE A O   1 
ATOM 7520 C CB  . PHE A 1 975  ? 21.621  41.120 27.724  1.00 27.60  ? 972  PHE A CB  1 
ATOM 7521 C CG  . PHE A 1 975  ? 21.654  41.588 29.167  1.00 27.60  ? 972  PHE A CG  1 
ATOM 7522 C CD1 . PHE A 1 975  ? 22.833  42.069 29.731  1.00 27.60  ? 972  PHE A CD1 1 
ATOM 7523 C CD2 . PHE A 1 975  ? 20.505  41.524 29.983  1.00 27.60  ? 972  PHE A CD2 1 
ATOM 7524 C CE1 . PHE A 1 975  ? 22.879  42.506 31.066  1.00 27.60  ? 972  PHE A CE1 1 
ATOM 7525 C CE2 . PHE A 1 975  ? 20.554  41.944 31.334  1.00 27.60  ? 972  PHE A CE2 1 
ATOM 7526 C CZ  . PHE A 1 975  ? 21.742  42.438 31.860  1.00 27.60  ? 972  PHE A CZ  1 
ATOM 7527 N N   . ASN A 1 976  ? 21.799  37.714 26.215  1.00 45.26  ? 973  ASN A N   1 
ATOM 7528 C CA  . ASN A 1 976  ? 22.100  36.975 24.982  1.00 45.26  ? 973  ASN A CA  1 
ATOM 7529 C C   . ASN A 1 976  ? 20.917  36.108 24.502  1.00 45.26  ? 973  ASN A C   1 
ATOM 7530 O O   . ASN A 1 976  ? 20.121  35.603 25.296  1.00 45.26  ? 973  ASN A O   1 
ATOM 7531 C CB  . ASN A 1 976  ? 23.353  36.092 25.156  1.00 31.31  ? 973  ASN A CB  1 
ATOM 7532 C CG  . ASN A 1 976  ? 24.602  36.880 25.571  1.00 31.31  ? 973  ASN A CG  1 
ATOM 7533 O OD1 . ASN A 1 976  ? 25.067  37.810 24.870  1.00 31.31  ? 973  ASN A OD1 1 
ATOM 7534 N ND2 . ASN A 1 976  ? 25.164  36.503 26.707  1.00 31.31  ? 973  ASN A ND2 1 
ATOM 7535 N N   . LEU A 1 977  ? 20.809  35.939 23.196  1.00 37.99  ? 974  LEU A N   1 
ATOM 7536 C CA  . LEU A 1 977  ? 19.915  34.944 22.633  1.00 37.99  ? 974  LEU A CA  1 
ATOM 7537 C C   . LEU A 1 977  ? 20.731  33.783 22.049  1.00 37.99  ? 974  LEU A C   1 
ATOM 7538 O O   . LEU A 1 977  ? 21.918  33.953 21.756  1.00 37.99  ? 974  LEU A O   1 
ATOM 7539 C CB  . LEU A 1 977  ? 19.040  35.586 21.557  1.00 42.52  ? 974  LEU A CB  1 
ATOM 7540 C CG  . LEU A 1 977  ? 18.072  36.690 21.992  1.00 42.52  ? 974  LEU A CG  1 
ATOM 7541 C CD1 . LEU A 1 977  ? 17.357  37.240 20.785  1.00 42.52  ? 974  LEU A CD1 1 
ATOM 7542 C CD2 . LEU A 1 977  ? 17.037  36.174 23.035  1.00 42.52  ? 974  LEU A CD2 1 
ATOM 7543 N N   . PHE A 1 978  ? 20.122  32.606 21.894  1.00 56.68  ? 975  PHE A N   1 
ATOM 7544 C CA  . PHE A 1 978  ? 20.788  31.497 21.192  1.00 56.68  ? 975  PHE A CA  1 
ATOM 7545 C C   . PHE A 1 978  ? 19.790  30.508 20.628  1.00 56.68  ? 975  PHE A C   1 
ATOM 7546 O O   . PHE A 1 978  ? 18.636  30.478 21.021  1.00 56.68  ? 975  PHE A O   1 
ATOM 7547 C CB  . PHE A 1 978  ? 21.795  30.776 22.092  1.00 42.04  ? 975  PHE A CB  1 
ATOM 7548 C CG  . PHE A 1 978  ? 21.166  30.084 23.259  1.00 42.04  ? 975  PHE A CG  1 
ATOM 7549 C CD1 . PHE A 1 978  ? 20.693  28.774 23.135  1.00 42.04  ? 975  PHE A CD1 1 
ATOM 7550 C CD2 . PHE A 1 978  ? 21.009  30.748 24.476  1.00 42.04  ? 975  PHE A CD2 1 
ATOM 7551 C CE1 . PHE A 1 978  ? 20.087  28.127 24.201  1.00 42.04  ? 975  PHE A CE1 1 
ATOM 7552 C CE2 . PHE A 1 978  ? 20.395  30.115 25.566  1.00 42.04  ? 975  PHE A CE2 1 
ATOM 7553 C CZ  . PHE A 1 978  ? 19.946  28.796 25.434  1.00 42.04  ? 975  PHE A CZ  1 
ATOM 7554 N N   . VAL A 1 979  ? 20.237  29.694 19.693  1.00 40.33  ? 976  VAL A N   1 
ATOM 7555 C CA  . VAL A 1 979  ? 19.354  28.693 19.111  1.00 40.33  ? 976  VAL A CA  1 
ATOM 7556 C C   . VAL A 1 979  ? 20.012  27.338 19.143  1.00 40.33  ? 976  VAL A C   1 
ATOM 7557 O O   . VAL A 1 979  ? 21.179  27.213 18.779  1.00 40.33  ? 976  VAL A O   1 
ATOM 7558 C CB  . VAL A 1 979  ? 18.960  28.992 17.650  1.00 26.62  ? 976  VAL A CB  1 
ATOM 7559 C CG1 . VAL A 1 979  ? 17.809  28.039 17.218  1.00 26.62  ? 976  VAL A CG1 1 
ATOM 7560 C CG2 . VAL A 1 979  ? 18.569  30.473 17.477  1.00 26.62  ? 976  VAL A CG2 1 
ATOM 7561 N N   . CYS A 1 980  ? 19.249  26.335 19.566  1.00 46.90  ? 977  CYS A N   1 
ATOM 7562 C CA  . CYS A 1 980  ? 19.737  24.974 19.680  1.00 46.90  ? 977  CYS A CA  1 
ATOM 7563 C C   . CYS A 1 980  ? 19.069  24.120 18.648  1.00 46.90  ? 977  CYS A C   1 
ATOM 7564 O O   . CYS A 1 980  ? 17.907  24.345 18.280  1.00 46.90  ? 977  CYS A O   1 
ATOM 7565 C CB  . CYS A 1 980  ? 19.423  24.411 21.047  1.00 54.73  ? 977  CYS A CB  1 
ATOM 7566 S SG  . CYS A 1 980  ? 20.465  25.088 22.288  1.00 54.73  ? 977  CYS A SG  1 
ATOM 7567 N N   . GLN A 1 981  ? 19.799  23.113 18.195  1.00 66.09  ? 978  GLN A N   1 
ATOM 7568 C CA  . GLN A 1 981  ? 19.311  22.219 17.158  1.00 66.09  ? 978  GLN A CA  1 
ATOM 7569 C C   . GLN A 1 981  ? 19.808  20.846 17.539  1.00 66.09  ? 978  GLN A C   1 
ATOM 7570 O O   . GLN A 1 981  ? 20.887  20.733 18.108  1.00 66.09  ? 978  GLN A O   1 
ATOM 7571 C CB  . GLN A 1 981  ? 19.932  22.631 15.833  1.00 60.20  ? 978  GLN A CB  1 
ATOM 7572 C CG  . GLN A 1 981  ? 18.975  22.950 14.735  1.00 60.20  ? 978  GLN A CG  1 
ATOM 7573 C CD  . GLN A 1 981  ? 19.698  23.532 13.563  1.00 60.20  ? 978  GLN A CD  1 
ATOM 7574 O OE1 . GLN A 1 981  ? 20.866  23.220 13.344  1.00 60.20  ? 978  GLN A OE1 1 
ATOM 7575 N NE2 . GLN A 1 981  ? 19.031  24.388 12.803  1.00 60.20  ? 978  GLN A NE2 1 
ATOM 7576 N N   . LYS A 1 982  ? 19.028  19.809 17.256  1.00 73.20  ? 979  LYS A N   1 
ATOM 7577 C CA  . LYS A 1 982  ? 19.521  18.449 17.448  1.00 73.20  ? 979  LYS A CA  1 
ATOM 7578 C C   . LYS A 1 982  ? 20.411  18.108 16.277  1.00 73.20  ? 979  LYS A C   1 
ATOM 7579 O O   . LYS A 1 982  ? 20.120  18.510 15.145  1.00 73.20  ? 979  LYS A O   1 
ATOM 7580 C CB  . LYS A 1 982  ? 18.379  17.450 17.564  1.00 70.12  ? 979  LYS A CB  1 
ATOM 7581 C CG  . LYS A 1 982  ? 17.322  17.601 16.493  1.00 70.12  ? 979  LYS A CG  1 
ATOM 7582 C CD  . LYS A 1 982  ? 15.934  17.448 17.071  1.00 70.12  ? 979  LYS A CD  1 
ATOM 7583 C CE  . LYS A 1 982  ? 15.768  16.124 17.753  1.00 70.12  ? 979  LYS A CE  1 
ATOM 7584 N NZ  . LYS A 1 982  ? 14.356  15.972 18.190  1.00 70.12  ? 979  LYS A NZ  1 
ATOM 7585 N N   . ASP A 1 983  ? 21.497  17.384 16.555  1.00 111.62 ? 980  ASP A N   1 
ATOM 7586 C CA  . ASP A 1 983  ? 22.473  16.995 15.526  1.00 111.62 ? 980  ASP A CA  1 
ATOM 7587 C C   . ASP A 1 983  ? 21.865  16.120 14.418  1.00 111.62 ? 980  ASP A C   1 
ATOM 7588 O O   . ASP A 1 983  ? 20.948  15.337 14.653  1.00 111.62 ? 980  ASP A O   1 
ATOM 7589 C CB  . ASP A 1 983  ? 23.678  16.300 16.174  1.00 118.30 ? 980  ASP A CB  1 
ATOM 7590 C CG  . ASP A 1 983  ? 24.931  16.364 15.314  1.00 118.30 ? 980  ASP A CG  1 
ATOM 7591 O OD1 . ASP A 1 983  ? 25.212  17.435 14.721  1.00 118.30 ? 980  ASP A OD1 1 
ATOM 7592 O OD2 . ASP A 1 983  ? 25.645  15.338 15.251  1.00 118.30 ? 980  ASP A OD2 1 
ATOM 7593 N N   . SER A 1 984  ? 22.379  16.267 13.206  1.00 140.31 ? 981  SER A N   1 
ATOM 7594 C CA  . SER A 1 984  ? 21.846  15.525 12.076  1.00 140.31 ? 981  SER A CA  1 
ATOM 7595 C C   . SER A 1 984  ? 22.855  14.487 11.566  1.00 140.31 ? 981  SER A C   1 
ATOM 7596 O O   . SER A 1 984  ? 23.141  14.434 10.370  1.00 140.31 ? 981  SER A O   1 
ATOM 7597 C CB  . SER A 1 984  ? 21.433  16.502 10.973  1.00 112.55 ? 981  SER A CB  1 
ATOM 7598 O OG  . SER A 1 984  ? 20.825  15.823 9.899   1.00 112.55 ? 981  SER A OG  1 
ATOM 7599 N N   . ALA A 1 985  ? 23.380  13.663 12.480  1.00 106.59 ? 982  ALA A N   1 
ATOM 7600 C CA  . ALA A 1 985  ? 24.458  12.704 12.169  1.00 106.59 ? 982  ALA A CA  1 
ATOM 7601 C C   . ALA A 1 985  ? 24.387  11.391 12.970  1.00 106.59 ? 982  ALA A C   1 
ATOM 7602 O O   . ALA A 1 985  ? 23.660  11.296 13.961  1.00 106.59 ? 982  ALA A O   1 
ATOM 7603 C CB  . ALA A 1 985  ? 25.839  13.371 12.334  1.00 105.15 ? 982  ALA A CB  1 
ATOM 7604 N N   . ALA A 1 986  ? 25.165  10.397 12.531  1.00 156.59 ? 983  ALA A N   1 
ATOM 7605 C CA  . ALA A 1 986  ? 25.124  9.023  13.061  1.00 156.59 ? 983  ALA A CA  1 
ATOM 7606 C C   . ALA A 1 986  ? 25.507  8.891  14.543  1.00 156.59 ? 983  ALA A C   1 
ATOM 7607 O O   . ALA A 1 986  ? 25.890  9.873  15.184  1.00 156.59 ? 983  ALA A O   1 
ATOM 7608 C CB  . ALA A 1 986  ? 25.989  8.080  12.186  1.00 47.90  ? 983  ALA A CB  1 
ATOM 7609 N N   . THR A 1 987  ? 25.399  7.662  15.060  1.00 165.79 ? 984  THR A N   1 
ATOM 7610 C CA  . THR A 1 987  ? 25.696  7.307  16.464  1.00 165.79 ? 984  THR A CA  1 
ATOM 7611 C C   . THR A 1 987  ? 24.675  7.888  17.449  1.00 165.79 ? 984  THR A C   1 
ATOM 7612 O O   . THR A 1 987  ? 25.040  8.603  18.388  1.00 165.79 ? 984  THR A O   1 
ATOM 7613 C CB  . THR A 1 987  ? 27.155  7.671  16.903  1.00 149.68 ? 984  THR A CB  1 
ATOM 7614 O OG1 . THR A 1 987  ? 27.264  9.081  17.138  1.00 149.68 ? 984  THR A OG1 1 
ATOM 7615 C CG2 . THR A 1 987  ? 28.181  7.235  15.851  1.00 149.68 ? 984  THR A CG2 1 
ATOM 7616 N N   . THR A 1 988  ? 23.404  7.536  17.241  1.00 156.86 ? 985  THR A N   1 
ATOM 7617 C CA  . THR A 1 988  ? 22.257  8.186  17.912  1.00 156.86 ? 985  THR A CA  1 
ATOM 7618 C C   . THR A 1 988  ? 22.193  8.094  19.448  1.00 156.86 ? 985  THR A C   1 
ATOM 7619 O O   . THR A 1 988  ? 21.224  8.559  20.063  1.00 156.86 ? 985  THR A O   1 
ATOM 7620 C CB  . THR A 1 988  ? 20.890  7.755  17.295  1.00 121.01 ? 985  THR A CB  1 
ATOM 7621 O OG1 . THR A 1 988  ? 20.873  6.337  17.093  1.00 121.01 ? 985  THR A OG1 1 
ATOM 7622 C CG2 . THR A 1 988  ? 20.656  8.445  15.958  1.00 121.01 ? 985  THR A CG2 1 
ATOM 7623 N N   . ASP A 1 989  ? 23.223  7.504  20.055  1.00 122.98 ? 986  ASP A N   1 
ATOM 7624 C CA  . ASP A 1 989  ? 23.363  7.472  21.510  1.00 122.98 ? 986  ASP A CA  1 
ATOM 7625 C C   . ASP A 1 989  ? 24.132  8.688  22.028  1.00 122.98 ? 986  ASP A C   1 
ATOM 7626 O O   . ASP A 1 989  ? 23.921  9.128  23.159  1.00 122.98 ? 986  ASP A O   1 
ATOM 7627 C CB  . ASP A 1 989  ? 24.075  6.188  21.957  1.00 124.95 ? 986  ASP A CB  1 
ATOM 7628 C CG  . ASP A 1 989  ? 23.105  5.061  22.310  1.00 124.95 ? 986  ASP A CG  1 
ATOM 7629 O OD1 . ASP A 1 989  ? 21.906  5.162  21.955  1.00 124.95 ? 986  ASP A OD1 1 
ATOM 7630 O OD2 . ASP A 1 989  ? 23.553  4.069  22.954  1.00 124.95 ? 986  ASP A OD2 1 
ATOM 7631 N N   . GLU A 1 990  ? 25.024  9.222  21.200  1.00 127.02 ? 987  GLU A N   1 
ATOM 7632 C CA  . GLU A 1 990  ? 25.892  10.314 21.619  1.00 127.02 ? 987  GLU A CA  1 
ATOM 7633 C C   . GLU A 1 990  ? 25.534  11.650 20.957  1.00 127.02 ? 987  GLU A C   1 
ATOM 7634 O O   . GLU A 1 990  ? 25.026  12.556 21.611  1.00 127.02 ? 987  GLU A O   1 
ATOM 7635 C CB  . GLU A 1 990  ? 27.361  9.938  21.367  1.00 199.53 ? 987  GLU A CB  1 
ATOM 7636 C CG  . GLU A 1 990  ? 28.384  10.976 21.826  1.00 199.53 ? 987  GLU A CG  1 
ATOM 7637 C CD  . GLU A 1 990  ? 28.285  11.321 23.307  1.00 199.53 ? 987  GLU A CD  1 
ATOM 7638 O OE1 . GLU A 1 990  ? 27.822  10.477 24.105  1.00 199.53 ? 987  GLU A OE1 1 
ATOM 7639 O OE2 . GLU A 1 990  ? 28.680  12.447 23.674  1.00 199.53 ? 987  GLU A OE2 1 
ATOM 7640 N N   . GLU A 1 991  ? 25.801  11.755 19.660  1.00 107.03 ? 988  GLU A N   1 
ATOM 7641 C CA  . GLU A 1 991  ? 25.615  12.997 18.911  1.00 107.03 ? 988  GLU A CA  1 
ATOM 7642 C C   . GLU A 1 991  ? 24.147  13.417 18.775  1.00 107.03 ? 988  GLU A C   1 
ATOM 7643 O O   . GLU A 1 991  ? 23.848  14.612 18.730  1.00 107.03 ? 988  GLU A O   1 
ATOM 7644 C CB  . GLU A 1 991  ? 26.269  12.894 17.530  1.00 152.72 ? 988  GLU A CB  1 
ATOM 7645 C CG  . GLU A 1 991  ? 27.764  12.601 17.568  1.00 152.72 ? 988  GLU A CG  1 
ATOM 7646 C CD  . GLU A 1 991  ? 28.300  12.130 16.232  1.00 152.72 ? 988  GLU A CD  1 
ATOM 7647 O OE1 . GLU A 1 991  ? 28.260  12.915 15.261  1.00 152.72 ? 988  GLU A OE1 1 
ATOM 7648 O OE2 . GLU A 1 991  ? 28.766  10.973 16.157  1.00 152.72 ? 988  GLU A OE2 1 
ATOM 7649 N N   . ARG A 1 992  ? 23.242  12.440 18.702  1.00 83.31  ? 989  ARG A N   1 
ATOM 7650 C CA  . ARG A 1 992  ? 21.807  12.724 18.668  1.00 83.31  ? 989  ARG A CA  1 
ATOM 7651 C C   . ARG A 1 992  ? 21.295  13.003 20.085  1.00 83.31  ? 989  ARG A C   1 
ATOM 7652 O O   . ARG A 1 992  ? 20.123  13.328 20.280  1.00 83.31  ? 989  ARG A O   1 
ATOM 7653 C CB  . ARG A 1 992  ? 21.037  11.580 17.985  1.00 130.47 ? 989  ARG A CB  1 
ATOM 7654 C CG  . ARG A 1 992  ? 19.577  11.886 17.587  1.00 130.47 ? 989  ARG A CG  1 
ATOM 7655 C CD  . ARG A 1 992  ? 19.429  12.895 16.419  1.00 130.47 ? 989  ARG A CD  1 
ATOM 7656 N NE  . ARG A 1 992  ? 19.343  12.267 15.091  1.00 130.47 ? 989  ARG A NE  1 
ATOM 7657 C CZ  . ARG A 1 992  ? 18.944  12.884 13.972  1.00 130.47 ? 989  ARG A CZ  1 
ATOM 7658 N NH1 . ARG A 1 992  ? 18.578  14.163 13.988  1.00 130.47 ? 989  ARG A NH1 1 
ATOM 7659 N NH2 . ARG A 1 992  ? 18.908  12.216 12.823  1.00 130.47 ? 989  ARG A NH2 1 
ATOM 7660 N N   . GLN A 1 993  ? 22.200  12.908 21.060  1.00 85.53  ? 990  GLN A N   1 
ATOM 7661 C CA  . GLN A 1 993  ? 21.881  13.152 22.472  1.00 85.53  ? 990  GLN A CA  1 
ATOM 7662 C C   . GLN A 1 993  ? 22.235  14.576 22.938  1.00 85.53  ? 990  GLN A C   1 
ATOM 7663 O O   . GLN A 1 993  ? 21.612  15.098 23.873  1.00 85.53  ? 990  GLN A O   1 
ATOM 7664 C CB  . GLN A 1 993  ? 22.578  12.103 23.361  1.00 115.75 ? 990  GLN A CB  1 
ATOM 7665 C CG  . GLN A 1 993  ? 22.154  12.081 24.841  1.00 115.75 ? 990  GLN A CG  1 
ATOM 7666 C CD  . GLN A 1 993  ? 21.076  11.051 25.149  1.00 115.75 ? 990  GLN A CD  1 
ATOM 7667 O OE1 . GLN A 1 993  ? 21.223  9.870  24.835  1.00 115.75 ? 990  GLN A OE1 1 
ATOM 7668 N NE2 . GLN A 1 993  ? 19.997  11.495 25.789  1.00 115.75 ? 990  GLN A NE2 1 
ATOM 7669 N N   . HIS A 1 994  ? 23.246  15.180 22.305  1.00 70.54  ? 991  HIS A N   1 
ATOM 7670 C CA  . HIS A 1 994  ? 23.628  16.581 22.556  1.00 70.54  ? 991  HIS A CA  1 
ATOM 7671 C C   . HIS A 1 994  ? 22.979  17.487 21.503  1.00 70.54  ? 991  HIS A C   1 
ATOM 7672 O O   . HIS A 1 994  ? 22.685  17.049 20.385  1.00 70.54  ? 991  HIS A O   1 
ATOM 7673 C CB  . HIS A 1 994  ? 25.156  16.745 22.581  1.00 105.08 ? 991  HIS A CB  1 
ATOM 7674 C CG  . HIS A 1 994  ? 25.824  16.059 23.741  1.00 105.08 ? 991  HIS A CG  1 
ATOM 7675 N ND1 . HIS A 1 994  ? 26.802  16.664 24.505  1.00 105.08 ? 991  HIS A ND1 1 
ATOM 7676 C CD2 . HIS A 1 994  ? 25.649  14.823 24.273  1.00 105.08 ? 991  HIS A CD2 1 
ATOM 7677 C CE1 . HIS A 1 994  ? 27.201  15.831 25.451  1.00 105.08 ? 991  HIS A CE1 1 
ATOM 7678 N NE2 . HIS A 1 994  ? 26.516  14.708 25.333  1.00 105.08 ? 991  HIS A NE2 1 
ATOM 7679 N N   . LEU A 1 995  ? 22.692  18.734 21.862  1.00 64.67  ? 992  LEU A N   1 
ATOM 7680 C CA  . LEU A 1 995  ? 22.164  19.653 20.862  1.00 64.67  ? 992  LEU A CA  1 
ATOM 7681 C C   . LEU A 1 995  ? 23.002  20.899 20.680  1.00 64.67  ? 992  LEU A C   1 
ATOM 7682 O O   . LEU A 1 995  ? 23.383  21.559 21.638  1.00 64.67  ? 992  LEU A O   1 
ATOM 7683 C CB  . LEU A 1 995  ? 20.681  19.943 21.059  1.00 50.14  ? 992  LEU A CB  1 
ATOM 7684 C CG  . LEU A 1 995  ? 20.072  20.234 22.405  1.00 50.14  ? 992  LEU A CG  1 
ATOM 7685 C CD1 . LEU A 1 995  ? 20.490  21.605 22.790  1.00 50.14  ? 992  LEU A CD1 1 
ATOM 7686 C CD2 . LEU A 1 995  ? 18.582  20.175 22.256  1.00 50.14  ? 992  LEU A CD2 1 
ATOM 7687 N N   . GLN A 1 996  ? 23.320  21.194 19.428  1.00 75.96  ? 993  GLN A N   1 
ATOM 7688 C CA  . GLN A 1 996  ? 24.299  22.220 19.134  1.00 75.96  ? 993  GLN A CA  1 
ATOM 7689 C C   . GLN A 1 996  ? 23.689  23.597 19.109  1.00 75.96  ? 993  GLN A C   1 
ATOM 7690 O O   . GLN A 1 996  ? 22.684  23.835 18.445  1.00 75.96  ? 993  GLN A O   1 
ATOM 7691 C CB  . GLN A 1 996  ? 25.047  21.912 17.831  1.00 84.50  ? 993  GLN A CB  1 
ATOM 7692 C CG  . GLN A 1 996  ? 26.416  21.258 18.049  1.00 84.50  ? 993  GLN A CG  1 
ATOM 7693 C CD  . GLN A 1 996  ? 26.338  19.940 18.821  1.00 84.50  ? 993  GLN A CD  1 
ATOM 7694 O OE1 . GLN A 1 996  ? 26.074  18.876 18.247  1.00 84.50  ? 993  GLN A OE1 1 
ATOM 7695 N NE2 . GLN A 1 996  ? 26.574  20.010 20.132  1.00 84.50  ? 993  GLN A NE2 1 
ATOM 7696 N N   . GLU A 1 997  ? 24.300  24.496 19.861  1.00 76.81  ? 994  GLU A N   1 
ATOM 7697 C CA  . GLU A 1 997  ? 23.941  25.897 19.793  1.00 76.81  ? 994  GLU A CA  1 
ATOM 7698 C C   . GLU A 1 997  ? 24.323  26.452 18.440  1.00 76.81  ? 994  GLU A C   1 
ATOM 7699 O O   . GLU A 1 997  ? 25.446  26.915 18.254  1.00 76.81  ? 994  GLU A O   1 
ATOM 7700 C CB  . GLU A 1 997  ? 24.636  26.688 20.881  1.00 65.24  ? 994  GLU A CB  1 
ATOM 7701 C CG  . GLU A 1 997  ? 24.096  26.381 22.222  1.00 65.24  ? 994  GLU A CG  1 
ATOM 7702 C CD  . GLU A 1 997  ? 24.732  27.216 23.271  1.00 65.24  ? 994  GLU A CD  1 
ATOM 7703 O OE1 . GLU A 1 997  ? 25.661  27.982 22.919  1.00 65.24  ? 994  GLU A OE1 1 
ATOM 7704 O OE2 . GLU A 1 997  ? 24.298  27.110 24.446  1.00 65.24  ? 994  GLU A OE2 1 
ATOM 7705 N N   . VAL A 1 998  ? 23.367  26.409 17.512  1.00 54.81  ? 995  VAL A N   1 
ATOM 7706 C CA  . VAL A 1 998  ? 23.586  26.808 16.132  1.00 54.81  ? 995  VAL A CA  1 
ATOM 7707 C C   . VAL A 1 998  ? 23.390  28.303 15.890  1.00 54.81  ? 995  VAL A C   1 
ATOM 7708 O O   . VAL A 1 998  ? 23.615  28.780 14.774  1.00 54.81  ? 995  VAL A O   1 
ATOM 7709 C CB  . VAL A 1 998  ? 22.694  25.997 15.169  1.00 57.94  ? 995  VAL A CB  1 
ATOM 7710 C CG1 . VAL A 1 998  ? 23.132  24.537 15.144  1.00 57.94  ? 995  VAL A CG1 1 
ATOM 7711 C CG2 . VAL A 1 998  ? 21.265  26.087 15.575  1.00 57.94  ? 995  VAL A CG2 1 
ATOM 7712 N N   . GLY A 1 999  ? 22.966  29.036 16.921  1.00 62.67  ? 996  GLY A N   1 
ATOM 7713 C CA  . GLY A 1 999  ? 22.798  30.485 16.820  1.00 62.67  ? 996  GLY A CA  1 
ATOM 7714 C C   . GLY A 1 999  ? 23.195  31.234 18.077  1.00 62.67  ? 996  GLY A C   1 
ATOM 7715 O O   . GLY A 1 999  ? 22.865  30.828 19.171  1.00 62.67  ? 996  GLY A O   1 
ATOM 7716 N N   . LEU A 1 1000 ? 23.896  32.345 17.915  1.00 44.62  ? 997  LEU A N   1 
ATOM 7717 C CA  . LEU A 1 1000 ? 24.362  33.144 19.048  1.00 44.62  ? 997  LEU A CA  1 
ATOM 7718 C C   . LEU A 1 1000 ? 24.361  34.622 18.688  1.00 44.62  ? 997  LEU A C   1 
ATOM 7719 O O   . LEU A 1 1000 ? 24.853  34.996 17.638  1.00 44.62  ? 997  LEU A O   1 
ATOM 7720 C CB  . LEU A 1 1000 ? 25.783  32.740 19.470  1.00 35.39  ? 997  LEU A CB  1 
ATOM 7721 C CG  . LEU A 1 1000 ? 26.191  31.309 19.842  1.00 35.39  ? 997  LEU A CG  1 
ATOM 7722 C CD1 . LEU A 1 1000 ? 27.717  31.258 20.096  1.00 35.39  ? 997  LEU A CD1 1 
ATOM 7723 C CD2 . LEU A 1 1000 ? 25.474  30.862 21.065  1.00 35.39  ? 997  LEU A CD2 1 
ATOM 7724 N N   . PHE A 1 1001 ? 23.833  35.451 19.583  1.00 52.08  ? 998  PHE A N   1 
ATOM 7725 C CA  . PHE A 1 1001 ? 23.616  36.883 19.312  1.00 52.08  ? 998  PHE A CA  1 
ATOM 7726 C C   . PHE A 1 1001 ? 23.342  37.603 20.631  1.00 52.08  ? 998  PHE A C   1 
ATOM 7727 O O   . PHE A 1 1001 ? 22.641  37.087 21.495  1.00 52.08  ? 998  PHE A O   1 
ATOM 7728 C CB  . PHE A 1 1001 ? 22.462  37.027 18.303  1.00 44.31  ? 998  PHE A CB  1 
ATOM 7729 C CG  . PHE A 1 1001 ? 21.997  38.433 18.028  1.00 44.31  ? 998  PHE A CG  1 
ATOM 7730 C CD1 . PHE A 1 1001 ? 22.398  39.095 16.888  1.00 44.31  ? 998  PHE A CD1 1 
ATOM 7731 C CD2 . PHE A 1 1001 ? 21.059  39.046 18.841  1.00 44.31  ? 998  PHE A CD2 1 
ATOM 7732 C CE1 . PHE A 1 1001 ? 21.918  40.392 16.607  1.00 44.31  ? 998  PHE A CE1 1 
ATOM 7733 C CE2 . PHE A 1 1001 ? 20.575  40.316 18.555  1.00 44.31  ? 998  PHE A CE2 1 
ATOM 7734 C CZ  . PHE A 1 1001 ? 21.008  40.983 17.446  1.00 44.31  ? 998  PHE A CZ  1 
ATOM 7735 N N   . HIS A 1 1002 ? 23.935  38.774 20.797  1.00 45.92  ? 999  HIS A N   1 
ATOM 7736 C CA  . HIS A 1 1002 ? 23.760  39.515 22.017  1.00 45.92  ? 999  HIS A CA  1 
ATOM 7737 C C   . HIS A 1 1002 ? 22.719  40.639 21.881  1.00 45.92  ? 999  HIS A C   1 
ATOM 7738 O O   . HIS A 1 1002 ? 22.977  41.689 21.260  1.00 45.92  ? 999  HIS A O   1 
ATOM 7739 C CB  . HIS A 1 1002 ? 25.085  40.073 22.473  1.00 45.87  ? 999  HIS A CB  1 
ATOM 7740 C CG  . HIS A 1 1002 ? 24.994  40.863 23.737  1.00 45.87  ? 999  HIS A CG  1 
ATOM 7741 N ND1 . HIS A 1 1002 ? 25.330  40.338 24.966  1.00 45.87  ? 999  HIS A ND1 1 
ATOM 7742 C CD2 . HIS A 1 1002 ? 24.599  42.140 23.966  1.00 45.87  ? 999  HIS A CD2 1 
ATOM 7743 C CE1 . HIS A 1 1002 ? 25.160  41.261 25.895  1.00 45.87  ? 999  HIS A CE1 1 
ATOM 7744 N NE2 . HIS A 1 1002 ? 24.721  42.364 25.316  1.00 45.87  ? 999  HIS A NE2 1 
ATOM 7745 N N   . LEU A 1 1003 ? 21.558  40.422 22.503  1.00 44.21  ? 1000 LEU A N   1 
ATOM 7746 C CA  . LEU A 1 1003 ? 20.423  41.370 22.462  1.00 44.21  ? 1000 LEU A CA  1 
ATOM 7747 C C   . LEU A 1 1003 ? 20.630  42.691 23.201  1.00 44.21  ? 1000 LEU A C   1 
ATOM 7748 O O   . LEU A 1 1003 ? 20.315  43.743 22.698  1.00 44.21  ? 1000 LEU A O   1 
ATOM 7749 C CB  . LEU A 1 1003 ? 19.198  40.705 23.071  1.00 40.29  ? 1000 LEU A CB  1 
ATOM 7750 C CG  . LEU A 1 1003 ? 17.853  40.824 22.383  1.00 40.29  ? 1000 LEU A CG  1 
ATOM 7751 C CD1 . LEU A 1 1003 ? 16.838  40.767 23.470  1.00 40.29  ? 1000 LEU A CD1 1 
ATOM 7752 C CD2 . LEU A 1 1003 ? 17.725  42.102 21.603  1.00 40.29  ? 1000 LEU A CD2 1 
ATOM 7753 N N   . GLY A 1 1004 ? 21.129  42.620 24.420  1.00 40.97  ? 1001 GLY A N   1 
ATOM 7754 C CA  . GLY A 1 1004 ? 21.213  43.793 25.249  1.00 40.97  ? 1001 GLY A CA  1 
ATOM 7755 C C   . GLY A 1 1004 ? 19.887  44.093 25.910  1.00 40.97  ? 1001 GLY A C   1 
ATOM 7756 O O   . GLY A 1 1004 ? 19.682  45.204 26.377  1.00 40.97  ? 1001 GLY A O   1 
ATOM 7757 N N   . GLU A 1 1005 ? 18.959  43.143 25.910  1.00 35.61  ? 1002 GLU A N   1 
ATOM 7758 C CA  . GLU A 1 1005 ? 17.746  43.301 26.678  1.00 35.61  ? 1002 GLU A CA  1 
ATOM 7759 C C   . GLU A 1 1005 ? 17.482  42.031 27.470  1.00 35.61  ? 1002 GLU A C   1 
ATOM 7760 O O   . GLU A 1 1005 ? 17.899  40.942 27.027  1.00 35.61  ? 1002 GLU A O   1 
ATOM 7761 C CB  . GLU A 1 1005 ? 16.545  43.610 25.795  1.00 54.12  ? 1002 GLU A CB  1 
ATOM 7762 C CG  . GLU A 1 1005 ? 16.617  44.920 25.038  1.00 54.12  ? 1002 GLU A CG  1 
ATOM 7763 C CD  . GLU A 1 1005 ? 16.547  46.186 25.891  1.00 54.12  ? 1002 GLU A CD  1 
ATOM 7764 O OE1 . GLU A 1 1005 ? 16.639  46.127 27.130  1.00 54.12  ? 1002 GLU A OE1 1 
ATOM 7765 O OE2 . GLU A 1 1005 ? 16.418  47.269 25.290  1.00 54.12  ? 1002 GLU A OE2 1 
ATOM 7766 N N   . PHE A 1 1006 ? 16.819  42.152 28.628  1.00 41.03  ? 1003 PHE A N   1 
ATOM 7767 C CA  . PHE A 1 1006 ? 16.447  40.976 29.414  1.00 41.03  ? 1003 PHE A CA  1 
ATOM 7768 C C   . PHE A 1 1006 ? 15.086  40.497 28.954  1.00 41.03  ? 1003 PHE A C   1 
ATOM 7769 O O   . PHE A 1 1006 ? 14.146  41.270 28.950  1.00 41.03  ? 1003 PHE A O   1 
ATOM 7770 C CB  . PHE A 1 1006 ? 16.392  41.318 30.889  1.00 27.62  ? 1003 PHE A CB  1 
ATOM 7771 C CG  . PHE A 1 1006 ? 16.345  40.128 31.773  1.00 27.62  ? 1003 PHE A CG  1 
ATOM 7772 C CD1 . PHE A 1 1006 ? 17.519  39.570 32.269  1.00 27.62  ? 1003 PHE A CD1 1 
ATOM 7773 C CD2 . PHE A 1 1006 ? 15.125  39.543 32.126  1.00 27.62  ? 1003 PHE A CD2 1 
ATOM 7774 C CE1 . PHE A 1 1006 ? 17.485  38.439 33.108  1.00 27.62  ? 1003 PHE A CE1 1 
ATOM 7775 C CE2 . PHE A 1 1006 ? 15.099  38.412 32.980  1.00 27.62  ? 1003 PHE A CE2 1 
ATOM 7776 C CZ  . PHE A 1 1006 ? 16.282  37.863 33.457  1.00 27.62  ? 1003 PHE A CZ  1 
ATOM 7777 N N   . VAL A 1 1007 ? 14.951  39.244 28.549  1.00 32.57  ? 1004 VAL A N   1 
ATOM 7778 C CA  . VAL A 1 1007 ? 13.650  38.808 27.982  1.00 32.57  ? 1004 VAL A CA  1 
ATOM 7779 C C   . VAL A 1 1007 ? 12.760  38.012 28.962  1.00 32.57  ? 1004 VAL A C   1 
ATOM 7780 O O   . VAL A 1 1007 ? 13.175  36.941 29.442  1.00 32.57  ? 1004 VAL A O   1 
ATOM 7781 C CB  . VAL A 1 1007 ? 13.842  37.979 26.692  1.00 12.13  ? 1004 VAL A CB  1 
ATOM 7782 C CG1 . VAL A 1 1007 ? 12.462  37.566 26.153  1.00 12.13  ? 1004 VAL A CG1 1 
ATOM 7783 C CG2 . VAL A 1 1007 ? 14.583  38.791 25.654  1.00 12.13  ? 1004 VAL A CG2 1 
ATOM 7784 N N   . ASN A 1 1008 ? 11.556  38.501 29.266  1.00 30.87  ? 1005 ASN A N   1 
ATOM 7785 C CA  . ASN A 1 1008 ? 10.705  37.714 30.190  1.00 30.87  ? 1005 ASN A CA  1 
ATOM 7786 C C   . ASN A 1 1008 ? 9.739   36.745 29.549  1.00 30.87  ? 1005 ASN A C   1 
ATOM 7787 O O   . ASN A 1 1008 ? 9.460   35.707 30.123  1.00 30.87  ? 1005 ASN A O   1 
ATOM 7788 C CB  . ASN A 1 1008 ? 9.965   38.577 31.193  1.00 21.04  ? 1005 ASN A CB  1 
ATOM 7789 C CG  . ASN A 1 1008 ? 10.882  39.222 32.131  1.00 21.04  ? 1005 ASN A CG  1 
ATOM 7790 O OD1 . ASN A 1 1008 ? 10.745  40.409 32.452  1.00 21.04  ? 1005 ASN A OD1 1 
ATOM 7791 N ND2 . ASN A 1 1008 ? 11.865  38.470 32.580  1.00 21.04  ? 1005 ASN A ND2 1 
ATOM 7792 N N   . VAL A 1 1009 ? 9.259   37.077 28.362  1.00 26.61  ? 1006 VAL A N   1 
ATOM 7793 C CA  . VAL A 1 1009 ? 8.278   36.274 27.674  1.00 26.61  ? 1006 VAL A CA  1 
ATOM 7794 C C   . VAL A 1 1009 ? 8.485   36.279 26.158  1.00 26.61  ? 1006 VAL A C   1 
ATOM 7795 O O   . VAL A 1 1009 ? 8.609   37.348 25.526  1.00 26.61  ? 1006 VAL A O   1 
ATOM 7796 C CB  . VAL A 1 1009 ? 6.876   36.797 27.988  1.00 23.06  ? 1006 VAL A CB  1 
ATOM 7797 C CG1 . VAL A 1 1009 ? 6.849   38.325 27.916  1.00 23.06  ? 1006 VAL A CG1 1 
ATOM 7798 C CG2 . VAL A 1 1009 ? 5.816   36.132 27.069  1.00 23.06  ? 1006 VAL A CG2 1 
ATOM 7799 N N   . PHE A 1 1010 ? 8.542   35.087 25.591  1.00 37.32  ? 1007 PHE A N   1 
ATOM 7800 C CA  . PHE A 1 1010 ? 8.360   34.894 24.148  1.00 37.32  ? 1007 PHE A CA  1 
ATOM 7801 C C   . PHE A 1 1010 ? 6.930   34.397 23.936  1.00 37.32  ? 1007 PHE A C   1 
ATOM 7802 O O   . PHE A 1 1010 ? 6.414   33.606 24.745  1.00 37.32  ? 1007 PHE A O   1 
ATOM 7803 C CB  . PHE A 1 1010 ? 9.238   33.750 23.621  1.00 40.82  ? 1007 PHE A CB  1 
ATOM 7804 C CG  . PHE A 1 1010 ? 10.684  34.015 23.649  1.00 40.82  ? 1007 PHE A CG  1 
ATOM 7805 C CD1 . PHE A 1 1010 ? 11.494  33.337 24.525  1.00 40.82  ? 1007 PHE A CD1 1 
ATOM 7806 C CD2 . PHE A 1 1010 ? 11.258  34.887 22.748  1.00 40.82  ? 1007 PHE A CD2 1 
ATOM 7807 C CE1 . PHE A 1 1010 ? 12.875  33.566 24.529  1.00 40.82  ? 1007 PHE A CE1 1 
ATOM 7808 C CE2 . PHE A 1 1010 ? 12.613  35.130 22.744  1.00 40.82  ? 1007 PHE A CE2 1 
ATOM 7809 C CZ  . PHE A 1 1010 ? 13.422  34.475 23.628  1.00 40.82  ? 1007 PHE A CZ  1 
ATOM 7810 N N   . CYS A 1 1011 ? 6.284   34.811 22.857  1.00 52.92  ? 1008 CYS A N   1 
ATOM 7811 C CA  . CYS A 1 1011 ? 5.095   34.087 22.485  1.00 52.92  ? 1008 CYS A CA  1 
ATOM 7812 C C   . CYS A 1 1011 ? 4.756   34.317 21.056  1.00 52.92  ? 1008 CYS A C   1 
ATOM 7813 O O   . CYS A 1 1011 ? 4.985   35.403 20.559  1.00 52.92  ? 1008 CYS A O   1 
ATOM 7814 C CB  . CYS A 1 1011 ? 3.944   34.398 23.425  1.00 42.95  ? 1008 CYS A CB  1 
ATOM 7815 S SG  . CYS A 1 1011 ? 3.295   35.951 23.157  1.00 42.95  ? 1008 CYS A SG  1 
ATOM 7816 N N   . HIS A 1 1012 ? 4.264   33.267 20.393  1.00 51.08  ? 1009 HIS A N   1 
ATOM 7817 C CA  . HIS A 1 1012 ? 4.022   33.286 18.944  1.00 51.08  ? 1009 HIS A CA  1 
ATOM 7818 C C   . HIS A 1 1012 ? 2.869   34.226 18.611  1.00 51.08  ? 1009 HIS A C   1 
ATOM 7819 O O   . HIS A 1 1012 ? 1.799   34.119 19.194  1.00 51.08  ? 1009 HIS A O   1 
ATOM 7820 C CB  . HIS A 1 1012 ? 3.636   31.900 18.444  1.00 39.67  ? 1009 HIS A CB  1 
ATOM 7821 C CG  . HIS A 1 1012 ? 4.767   30.921 18.369  1.00 39.67  ? 1009 HIS A CG  1 
ATOM 7822 N ND1 . HIS A 1 1012 ? 5.621   30.846 17.287  1.00 39.67  ? 1009 HIS A ND1 1 
ATOM 7823 C CD2 . HIS A 1 1012 ? 5.146   29.931 19.209  1.00 39.67  ? 1009 HIS A CD2 1 
ATOM 7824 C CE1 . HIS A 1 1012 ? 6.492   29.870 17.477  1.00 39.67  ? 1009 HIS A CE1 1 
ATOM 7825 N NE2 . HIS A 1 1012 ? 6.233   29.308 18.643  1.00 39.67  ? 1009 HIS A NE2 1 
ATOM 7826 N N   . GLY A 1 1013 ? 3.086   35.160 17.691  1.00 32.93  ? 1010 GLY A N   1 
ATOM 7827 C CA  . GLY A 1 1013 ? 1.974   35.930 17.101  1.00 32.93  ? 1010 GLY A CA  1 
ATOM 7828 C C   . GLY A 1 1013 ? 2.529   37.117 16.368  1.00 32.93  ? 1010 GLY A C   1 
ATOM 7829 O O   . GLY A 1 1013 ? 3.734   37.249 16.292  1.00 32.93  ? 1010 GLY A O   1 
ATOM 7830 N N   . SER A 1 1014 ? 1.681   37.968 15.807  1.00 68.04  ? 1011 SER A N   1 
ATOM 7831 C CA  . SER A 1 1014 ? 2.186   39.153 15.113  1.00 68.04  ? 1011 SER A CA  1 
ATOM 7832 C C   . SER A 1 1014 ? 1.205   40.288 15.180  1.00 68.04  ? 1011 SER A C   1 
ATOM 7833 O O   . SER A 1 1014 ? -0.008  40.088 15.207  1.00 68.04  ? 1011 SER A O   1 
ATOM 7834 C CB  . SER A 1 1014 ? 2.512   38.878 13.641  1.00 55.61  ? 1011 SER A CB  1 
ATOM 7835 O OG  . SER A 1 1014 ? 3.416   39.851 13.121  1.00 55.61  ? 1011 SER A OG  1 
ATOM 7836 N N   . LEU A 1 1015 ? 1.758   41.487 15.191  1.00 44.96  ? 1012 LEU A N   1 
ATOM 7837 C CA  . LEU A 1 1015 ? 0.985   42.687 15.172  1.00 44.96  ? 1012 LEU A CA  1 
ATOM 7838 C C   . LEU A 1 1015 ? 0.672   43.175 13.760  1.00 44.96  ? 1012 LEU A C   1 
ATOM 7839 O O   . LEU A 1 1015 ? -0.113  44.079 13.607  1.00 44.96  ? 1012 LEU A O   1 
ATOM 7840 C CB  . LEU A 1 1015 ? 1.735   43.774 15.945  1.00 54.53  ? 1012 LEU A CB  1 
ATOM 7841 C CG  . LEU A 1 1015 ? 2.116   43.532 17.407  1.00 54.53  ? 1012 LEU A CG  1 
ATOM 7842 C CD1 . LEU A 1 1015 ? 3.087   44.604 17.881  1.00 54.53  ? 1012 LEU A CD1 1 
ATOM 7843 C CD2 . LEU A 1 1015 ? 0.865   43.491 18.295  1.00 54.53  ? 1012 LEU A CD2 1 
ATOM 7844 N N   . VAL A 1 1016 ? 1.272   42.624 12.720  1.00 66.35  ? 1013 VAL A N   1 
ATOM 7845 C CA  . VAL A 1 1016 ? 1.048   43.242 11.416  1.00 66.35  ? 1013 VAL A CA  1 
ATOM 7846 C C   . VAL A 1 1016 ? -0.263  42.846 10.763  1.00 66.35  ? 1013 VAL A C   1 
ATOM 7847 O O   . VAL A 1 1016 ? -1.113  43.705 10.467  1.00 66.35  ? 1013 VAL A O   1 
ATOM 7848 C CB  . VAL A 1 1016 ? 2.191   43.016 10.405  1.00 82.55  ? 1013 VAL A CB  1 
ATOM 7849 C CG1 . VAL A 1 1016 ? 3.114   44.205 10.391  1.00 82.55  ? 1013 VAL A CG1 1 
ATOM 7850 C CG2 . VAL A 1 1016 ? 2.934   41.727 10.689  1.00 82.55  ? 1013 VAL A CG2 1 
ATOM 7851 N N   . MET A 1 1017 ? -0.411  41.544 10.548  1.00 128.37 ? 1014 MET A N   1 
ATOM 7852 C CA  . MET A 1 1017 ? -1.439  41.004 9.682   1.00 128.37 ? 1014 MET A CA  1 
ATOM 7853 C C   . MET A 1 1017 ? -2.680  41.874 9.645   1.00 128.37 ? 1014 MET A C   1 
ATOM 7854 O O   . MET A 1 1017 ? -3.242  42.229 10.678  1.00 128.37 ? 1014 MET A O   1 
ATOM 7855 C CB  . MET A 1 1017 ? -1.789  39.566 10.088  1.00 153.37 ? 1014 MET A CB  1 
ATOM 7856 C CG  . MET A 1 1017 ? -2.834  38.885 9.209   1.00 153.37 ? 1014 MET A CG  1 
ATOM 7857 S SD  . MET A 1 1017 ? -2.655  39.261 7.459   1.00 153.37 ? 1014 MET A SD  1 
ATOM 7858 C CE  . MET A 1 1017 ? -1.099  38.455 7.079   1.00 153.37 ? 1014 MET A CE  1 
ATOM 7859 N N   . GLN A 1 1018 ? -3.068  42.249 8.436   1.00 54.07  ? 1015 GLN A N   1 
ATOM 7860 C CA  . GLN A 1 1018 ? -4.422  42.778 8.172   1.00 54.07  ? 1015 GLN A CA  1 
ATOM 7861 C C   . GLN A 1 1018 ? -5.533  41.792 8.622   1.00 54.07  ? 1015 GLN A C   1 
ATOM 7862 O O   . GLN A 1 1018 ? -6.352  42.095 9.499   1.00 54.07  ? 1015 GLN A O   1 
ATOM 7863 C CB  . GLN A 1 1018 ? -4.577  43.086 6.674   1.00 159.20 ? 1015 GLN A CB  1 
ATOM 7864 C CG  . GLN A 1 1018 ? -5.968  43.558 6.237   1.00 159.20 ? 1015 GLN A CG  1 
ATOM 7865 C CD  . GLN A 1 1018 ? -6.154  43.563 4.721   1.00 159.20 ? 1015 GLN A CD  1 
ATOM 7866 O OE1 . GLN A 1 1018 ? -5.184  43.628 3.960   1.00 159.20 ? 1015 GLN A OE1 1 
ATOM 7867 N NE2 . GLN A 1 1018 ? -7.411  43.498 4.279   1.00 159.20 ? 1015 GLN A NE2 1 
ATOM 7868 N N   . PRO A 1 1026 ? 9.008   36.947 2.448   1.00 96.56  ? 1023 PRO A N   1 
ATOM 7869 C CA  . PRO A 1 1026 ? 10.439  36.653 2.510   1.00 96.56  ? 1023 PRO A CA  1 
ATOM 7870 C C   . PRO A 1 1026 ? 10.855  35.883 3.775   1.00 96.56  ? 1023 PRO A C   1 
ATOM 7871 O O   . PRO A 1 1026 ? 11.891  35.217 3.777   1.00 96.56  ? 1023 PRO A O   1 
ATOM 7872 C CB  . PRO A 1 1026 ? 11.076  38.049 2.501   1.00 125.76 ? 1023 PRO A CB  1 
ATOM 7873 C CG  . PRO A 1 1026 ? 10.045  38.955 3.114   1.00 125.76 ? 1023 PRO A CG  1 
ATOM 7874 C CD  . PRO A 1 1026 ? 8.692   38.323 2.885   1.00 125.76 ? 1023 PRO A CD  1 
ATOM 7875 N N   . THR A 1 1027 ? 10.045  35.987 4.832   1.00 67.67  ? 1024 THR A N   1 
ATOM 7876 C CA  . THR A 1 1027 ? 10.347  35.402 6.152   1.00 67.67  ? 1024 THR A CA  1 
ATOM 7877 C C   . THR A 1 1027 ? 9.268   34.426 6.635   1.00 67.67  ? 1024 THR A C   1 
ATOM 7878 O O   . THR A 1 1027 ? 8.118   34.489 6.203   1.00 67.67  ? 1024 THR A O   1 
ATOM 7879 C CB  . THR A 1 1027 ? 10.555  36.492 7.252   1.00 60.36  ? 1024 THR A CB  1 
ATOM 7880 O OG1 . THR A 1 1027 ? 9.327   37.191 7.474   1.00 60.36  ? 1024 THR A OG1 1 
ATOM 7881 C CG2 . THR A 1 1027 ? 11.652  37.471 6.873   1.00 60.36  ? 1024 THR A CG2 1 
ATOM 7882 N N   . GLN A 1 1028 ? 9.666   33.544 7.547   1.00 79.81  ? 1025 GLN A N   1 
ATOM 7883 C CA  . GLN A 1 1028 ? 8.824   32.475 8.046   1.00 79.81  ? 1025 GLN A CA  1 
ATOM 7884 C C   . GLN A 1 1028 ? 8.727   32.540 9.585   1.00 79.81  ? 1025 GLN A C   1 
ATOM 7885 O O   . GLN A 1 1028 ? 9.742   32.631 10.282  1.00 79.81  ? 1025 GLN A O   1 
ATOM 7886 C CB  . GLN A 1 1028 ? 9.376   31.135 7.527   1.00 164.46 ? 1025 GLN A CB  1 
ATOM 7887 C CG  . GLN A 1 1028 ? 9.370   29.941 8.479   1.00 164.46 ? 1025 GLN A CG  1 
ATOM 7888 C CD  . GLN A 1 1028 ? 10.371  28.864 8.062   1.00 164.46 ? 1025 GLN A CD  1 
ATOM 7889 O OE1 . GLN A 1 1028 ? 10.376  28.413 6.917   1.00 164.46 ? 1025 GLN A OE1 1 
ATOM 7890 N NE2 . GLN A 1 1028 ? 11.223  28.453 8.994   1.00 164.46 ? 1025 GLN A NE2 1 
ATOM 7891 N N   . GLY A 1 1029 ? 7.499   32.527 10.103  1.00 61.56  ? 1026 GLY A N   1 
ATOM 7892 C CA  . GLY A 1 1029 ? 7.251   32.456 11.544  1.00 61.56  ? 1026 GLY A CA  1 
ATOM 7893 C C   . GLY A 1 1029 ? 7.263   33.825 12.186  1.00 61.56  ? 1026 GLY A C   1 
ATOM 7894 O O   . GLY A 1 1029 ? 7.853   34.748 11.640  1.00 61.56  ? 1026 GLY A O   1 
ATOM 7895 N N   . SER A 1 1030 ? 6.607   33.971 13.335  1.00 36.10  ? 1027 SER A N   1 
ATOM 7896 C CA  . SER A 1 1030 ? 6.584   35.275 14.044  1.00 36.10  ? 1027 SER A CA  1 
ATOM 7897 C C   . SER A 1 1030 ? 6.559   35.069 15.577  1.00 36.10  ? 1027 SER A C   1 
ATOM 7898 O O   . SER A 1 1030 ? 5.555   34.616 16.153  1.00 36.10  ? 1027 SER A O   1 
ATOM 7899 C CB  . SER A 1 1030 ? 5.400   36.158 13.563  1.00 44.40  ? 1027 SER A CB  1 
ATOM 7900 O OG  . SER A 1 1030 ? 5.404   37.482 14.106  1.00 44.40  ? 1027 SER A OG  1 
ATOM 7901 N N   . VAL A 1 1031 ? 7.685   35.368 16.219  1.00 40.68  ? 1028 VAL A N   1 
ATOM 7902 C CA  . VAL A 1 1031 ? 7.762   35.244 17.678  1.00 40.68  ? 1028 VAL A CA  1 
ATOM 7903 C C   . VAL A 1 1031 ? 8.047   36.559 18.373  1.00 40.68  ? 1028 VAL A C   1 
ATOM 7904 O O   . VAL A 1 1031 ? 9.135   37.163 18.217  1.00 40.68  ? 1028 VAL A O   1 
ATOM 7905 C CB  . VAL A 1 1031 ? 8.738   34.142 18.145  1.00 43.63  ? 1028 VAL A CB  1 
ATOM 7906 C CG1 . VAL A 1 1031 ? 9.126   34.349 19.616  1.00 43.63  ? 1028 VAL A CG1 1 
ATOM 7907 C CG2 . VAL A 1 1031 ? 8.111   32.760 17.931  1.00 43.63  ? 1028 VAL A CG2 1 
ATOM 7908 N N   . LEU A 1 1032 ? 7.056   37.009 19.131  1.00 26.78  ? 1029 LEU A N   1 
ATOM 7909 C CA  . LEU A 1 1032 ? 7.167   38.282 19.793  1.00 26.78  ? 1029 LEU A CA  1 
ATOM 7910 C C   . LEU A 1 1032 ? 7.817   38.107 21.168  1.00 26.78  ? 1029 LEU A C   1 
ATOM 7911 O O   . LEU A 1 1032 ? 7.750   37.025 21.770  1.00 26.78  ? 1029 LEU A O   1 
ATOM 7912 C CB  . LEU A 1 1032 ? 5.781   38.922 19.874  1.00 30.25  ? 1029 LEU A CB  1 
ATOM 7913 C CG  . LEU A 1 1032 ? 5.198   39.609 18.612  1.00 30.25  ? 1029 LEU A CG  1 
ATOM 7914 C CD1 . LEU A 1 1032 ? 3.698   39.400 18.553  1.00 30.25  ? 1029 LEU A CD1 1 
ATOM 7915 C CD2 . LEU A 1 1032 ? 5.539   41.121 18.598  1.00 30.25  ? 1029 LEU A CD2 1 
ATOM 7916 N N   . PHE A 1 1033 ? 8.484   39.145 21.660  1.00 32.56  ? 1030 PHE A N   1 
ATOM 7917 C CA  . PHE A 1 1033 ? 9.111   39.048 22.988  1.00 32.56  ? 1030 PHE A CA  1 
ATOM 7918 C C   . PHE A 1 1033 ? 9.137   40.360 23.744  1.00 32.56  ? 1030 PHE A C   1 
ATOM 7919 O O   . PHE A 1 1033 ? 9.353   41.409 23.123  1.00 32.56  ? 1030 PHE A O   1 
ATOM 7920 C CB  . PHE A 1 1033 ? 10.514  38.398 22.935  1.00 39.39  ? 1030 PHE A CB  1 
ATOM 7921 C CG  . PHE A 1 1033 ? 11.588  39.271 22.365  1.00 39.39  ? 1030 PHE A CG  1 
ATOM 7922 C CD1 . PHE A 1 1033 ? 12.290  40.154 23.174  1.00 39.39  ? 1030 PHE A CD1 1 
ATOM 7923 C CD2 . PHE A 1 1033 ? 11.937  39.181 21.008  1.00 39.39  ? 1030 PHE A CD2 1 
ATOM 7924 C CE1 . PHE A 1 1033 ? 13.314  40.978 22.630  1.00 39.39  ? 1030 PHE A CE1 1 
ATOM 7925 C CE2 . PHE A 1 1033 ? 12.955  39.998 20.464  1.00 39.39  ? 1030 PHE A CE2 1 
ATOM 7926 C CZ  . PHE A 1 1033 ? 13.653  40.895 21.282  1.00 39.39  ? 1030 PHE A CZ  1 
ATOM 7927 N N   . GLY A 1 1034 ? 8.921   40.302 25.069  1.00 31.66  ? 1031 GLY A N   1 
ATOM 7928 C CA  . GLY A 1 1034 ? 8.885   41.515 25.893  1.00 31.66  ? 1031 GLY A CA  1 
ATOM 7929 C C   . GLY A 1 1034 ? 9.969   41.523 26.943  1.00 31.66  ? 1031 GLY A C   1 
ATOM 7930 O O   . GLY A 1 1034 ? 10.374  40.468 27.442  1.00 31.66  ? 1031 GLY A O   1 
ATOM 7931 N N   . THR A 1 1035 ? 10.426  42.717 27.310  1.00 26.68  ? 1032 THR A N   1 
ATOM 7932 C CA  . THR A 1 1035 ? 11.663  42.847 28.063  1.00 26.68  ? 1032 THR A CA  1 
ATOM 7933 C C   . THR A 1 1035 ? 11.515  43.672 29.326  1.00 26.68  ? 1032 THR A C   1 
ATOM 7934 O O   . THR A 1 1035 ? 10.594  44.464 29.431  1.00 26.68  ? 1032 THR A O   1 
ATOM 7935 C CB  . THR A 1 1035 ? 12.708  43.527 27.204  1.00 23.29  ? 1032 THR A CB  1 
ATOM 7936 O OG1 . THR A 1 1035 ? 12.296  44.885 26.961  1.00 23.29  ? 1032 THR A OG1 1 
ATOM 7937 C CG2 . THR A 1 1035 ? 12.858  42.775 25.870  1.00 23.29  ? 1032 THR A CG2 1 
ATOM 7938 N N   . VAL A 1 1036 ? 12.432  43.491 30.279  1.00 31.55  ? 1033 VAL A N   1 
ATOM 7939 C CA  . VAL A 1 1036 ? 12.466  44.317 31.490  1.00 31.55  ? 1033 VAL A CA  1 
ATOM 7940 C C   . VAL A 1 1036 ? 12.384  45.804 31.176  1.00 31.55  ? 1033 VAL A C   1 
ATOM 7941 O O   . VAL A 1 1036 ? 11.776  46.546 31.933  1.00 31.55  ? 1033 VAL A O   1 
ATOM 7942 C CB  . VAL A 1 1036 ? 13.750  44.058 32.362  1.00 13.69  ? 1033 VAL A CB  1 
ATOM 7943 C CG1 . VAL A 1 1036 ? 13.986  45.167 33.490  1.00 13.69  ? 1033 VAL A CG1 1 
ATOM 7944 C CG2 . VAL A 1 1036 ? 13.724  42.629 32.941  1.00 13.69  ? 1033 VAL A CG2 1 
ATOM 7945 N N   . ASN A 1 1037 ? 12.987  46.227 30.063  1.00 30.18  ? 1034 ASN A N   1 
ATOM 7946 C CA  . ASN A 1 1037 ? 12.986  47.649 29.695  1.00 30.18  ? 1034 ASN A CA  1 
ATOM 7947 C C   . ASN A 1 1037 ? 11.775  48.078 28.921  1.00 30.18  ? 1034 ASN A C   1 
ATOM 7948 O O   . ASN A 1 1037 ? 11.671  49.246 28.567  1.00 30.18  ? 1034 ASN A O   1 
ATOM 7949 C CB  . ASN A 1 1037 ? 14.227  48.040 28.912  1.00 33.59  ? 1034 ASN A CB  1 
ATOM 7950 C CG  . ASN A 1 1037 ? 15.446  48.142 29.776  1.00 33.59  ? 1034 ASN A CG  1 
ATOM 7951 O OD1 . ASN A 1 1037 ? 16.571  47.879 29.315  1.00 33.59  ? 1034 ASN A OD1 1 
ATOM 7952 N ND2 . ASN A 1 1037 ? 15.257  48.560 31.030  1.00 33.59  ? 1034 ASN A ND2 1 
ATOM 7953 N N   . GLY A 1 1038 ? 10.854  47.211 28.629  1.00 54.52  ? 1035 GLY A N   1 
ATOM 7954 C CA  . GLY A 1 1038 ? 9.695   47.653 27.916  1.00 54.52  ? 1035 GLY A CA  1 
ATOM 7955 C C   . GLY A 1 1038 ? 9.906   47.711 26.443  1.00 54.52  ? 1035 GLY A C   1 
ATOM 7956 O O   . GLY A 1 1038 ? 9.269   48.477 25.748  1.00 54.52  ? 1035 GLY A O   1 
ATOM 7957 N N   . MET A 1 1039 ? 10.837  46.902 25.984  1.00 53.12  ? 1036 MET A N   1 
ATOM 7958 C CA  . MET A 1 1039 ? 11.165  46.817 24.610  1.00 53.12  ? 1036 MET A CA  1 
ATOM 7959 C C   . MET A 1 1039 ? 10.463  45.636 24.078  1.00 53.12  ? 1036 MET A C   1 
ATOM 7960 O O   . MET A 1 1039 ? 10.422  44.607 24.723  1.00 53.12  ? 1036 MET A O   1 
ATOM 7961 C CB  . MET A 1 1039 ? 12.665  46.608 24.477  1.00 40.39  ? 1036 MET A CB  1 
ATOM 7962 C CG  . MET A 1 1039 ? 13.175  46.410 23.058  1.00 40.39  ? 1036 MET A CG  1 
ATOM 7963 S SD  . MET A 1 1039 ? 13.619  44.752 22.683  1.00 40.39  ? 1036 MET A SD  1 
ATOM 7964 C CE  . MET A 1 1039 ? 13.939  44.768 20.979  1.00 40.39  ? 1036 MET A CE  1 
ATOM 7965 N N   . ILE A 1 1040 ? 9.922   45.768 22.889  1.00 42.44  ? 1037 ILE A N   1 
ATOM 7966 C CA  . ILE A 1 1040 ? 9.270   44.669 22.263  1.00 42.44  ? 1037 ILE A CA  1 
ATOM 7967 C C   . ILE A 1 1040 ? 10.055  44.292 21.083  1.00 42.44  ? 1037 ILE A C   1 
ATOM 7968 O O   . ILE A 1 1040 ? 10.537  45.112 20.373  1.00 42.44  ? 1037 ILE A O   1 
ATOM 7969 C CB  . ILE A 1 1040 ? 7.915   45.059 21.849  1.00 30.70  ? 1037 ILE A CB  1 
ATOM 7970 C CG1 . ILE A 1 1040 ? 7.233   45.687 23.039  1.00 30.70  ? 1037 ILE A CG1 1 
ATOM 7971 C CG2 . ILE A 1 1040 ? 7.158   43.882 21.390  1.00 30.70  ? 1037 ILE A CG2 1 
ATOM 7972 C CD1 . ILE A 1 1040 ? 5.802   45.710 22.935  1.00 30.70  ? 1037 ILE A CD1 1 
ATOM 7973 N N   . GLY A 1 1041 ? 10.214  43.012 20.890  1.00 47.60  ? 1038 GLY A N   1 
ATOM 7974 C CA  . GLY A 1 1041 ? 11.055  42.571 19.833  1.00 47.60  ? 1038 GLY A CA  1 
ATOM 7975 C C   . GLY A 1 1041 ? 10.404  41.519 19.018  1.00 47.60  ? 1038 GLY A C   1 
ATOM 7976 O O   . GLY A 1 1041 ? 9.380   41.006 19.312  1.00 47.60  ? 1038 GLY A O   1 
ATOM 7977 N N   . LEU A 1 1042 ? 11.029  41.187 17.938  1.00 31.15  ? 1039 LEU A N   1 
ATOM 7978 C CA  . LEU A 1 1042 ? 10.466  40.122 17.100  1.00 31.15  ? 1039 LEU A CA  1 
ATOM 7979 C C   . LEU A 1 1042 ? 11.528  39.232 16.458  1.00 31.15  ? 1039 LEU A C   1 
ATOM 7980 O O   . LEU A 1 1042 ? 12.529  39.723 15.942  1.00 31.15  ? 1039 LEU A O   1 
ATOM 7981 C CB  . LEU A 1 1042 ? 9.583   40.716 16.010  1.00 52.07  ? 1039 LEU A CB  1 
ATOM 7982 C CG  . LEU A 1 1042 ? 9.284   39.938 14.723  1.00 52.07  ? 1039 LEU A CG  1 
ATOM 7983 C CD1 . LEU A 1 1042 ? 8.492   38.651 14.914  1.00 52.07  ? 1039 LEU A CD1 1 
ATOM 7984 C CD2 . LEU A 1 1042 ? 8.502   40.868 13.875  1.00 52.07  ? 1039 LEU A CD2 1 
ATOM 7985 N N   . VAL A 1 1043 ? 11.275  37.922 16.479  1.00 42.15  ? 1040 VAL A N   1 
ATOM 7986 C CA  . VAL A 1 1043 ? 12.113  36.950 15.815  1.00 42.15  ? 1040 VAL A CA  1 
ATOM 7987 C C   . VAL A 1 1043 ? 11.345  36.173 14.718  1.00 42.15  ? 1040 VAL A C   1 
ATOM 7988 O O   . VAL A 1 1043 ? 10.226  35.716 14.946  1.00 42.15  ? 1040 VAL A O   1 
ATOM 7989 C CB  . VAL A 1 1043 ? 12.718  35.996 16.854  1.00 30.22  ? 1040 VAL A CB  1 
ATOM 7990 C CG1 . VAL A 1 1043 ? 13.595  34.868 16.182  1.00 30.22  ? 1040 VAL A CG1 1 
ATOM 7991 C CG2 . VAL A 1 1043 ? 13.520  36.810 17.928  1.00 30.22  ? 1040 VAL A CG2 1 
ATOM 7992 N N   . THR A 1 1044 ? 11.971  36.050 13.538  1.00 51.46  ? 1041 THR A N   1 
ATOM 7993 C CA  . THR A 1 1044 ? 11.509  35.232 12.389  1.00 51.46  ? 1041 THR A CA  1 
ATOM 7994 C C   . THR A 1 1044 ? 12.647  34.333 11.908  1.00 51.46  ? 1041 THR A C   1 
ATOM 7995 O O   . THR A 1 1044 ? 13.794  34.446 12.367  1.00 51.46  ? 1041 THR A O   1 
ATOM 7996 C CB  . THR A 1 1044 ? 11.205  36.125 11.173  1.00 79.37  ? 1041 THR A CB  1 
ATOM 7997 O OG1 . THR A 1 1044 ? 10.905  37.453 11.607  1.00 79.37  ? 1041 THR A OG1 1 
ATOM 7998 C CG2 . THR A 1 1044 ? 10.058  35.599 10.370  1.00 79.37  ? 1041 THR A CG2 1 
ATOM 7999 N N   . SER A 1 1045 ? 12.330  33.475 10.938  1.00 54.18  ? 1042 SER A N   1 
ATOM 8000 C CA  . SER A 1 1045 ? 13.301  32.586 10.286  1.00 54.18  ? 1042 SER A CA  1 
ATOM 8001 C C   . SER A 1 1045 ? 13.574  32.960 8.811   1.00 54.18  ? 1042 SER A C   1 
ATOM 8002 O O   . SER A 1 1045 ? 12.813  33.702 8.172   1.00 54.18  ? 1042 SER A O   1 
ATOM 8003 C CB  . SER A 1 1045 ? 12.838  31.148 10.423  1.00 83.19  ? 1042 SER A CB  1 
ATOM 8004 O OG  . SER A 1 1045 ? 12.659  30.843 11.796  1.00 83.19  ? 1042 SER A OG  1 
ATOM 8005 N N   . LEU A 1 1046 ? 14.677  32.453 8.277   1.00 67.58  ? 1043 LEU A N   1 
ATOM 8006 C CA  . LEU A 1 1046 ? 15.129  32.857 6.958   1.00 67.58  ? 1043 LEU A CA  1 
ATOM 8007 C C   . LEU A 1 1046 ? 15.659  31.678 6.164   1.00 67.58  ? 1043 LEU A C   1 
ATOM 8008 O O   . LEU A 1 1046 ? 16.062  30.672 6.744   1.00 67.58  ? 1043 LEU A O   1 
ATOM 8009 C CB  . LEU A 1 1046 ? 16.254  33.881 7.108   1.00 48.60  ? 1043 LEU A CB  1 
ATOM 8010 C CG  . LEU A 1 1046 ? 16.022  35.230 7.764   1.00 48.60  ? 1043 LEU A CG  1 
ATOM 8011 C CD1 . LEU A 1 1046 ? 17.295  35.991 7.757   1.00 48.60  ? 1043 LEU A CD1 1 
ATOM 8012 C CD2 . LEU A 1 1046 ? 14.957  36.002 7.012   1.00 48.60  ? 1043 LEU A CD2 1 
ATOM 8013 N N   . SER A 1 1047 ? 15.675  31.821 4.837   1.00 72.30  ? 1044 SER A N   1 
ATOM 8014 C CA  . SER A 1 1047 ? 16.378  30.884 3.944   1.00 72.30  ? 1044 SER A CA  1 
ATOM 8015 C C   . SER A 1 1047 ? 17.870  31.201 3.960   1.00 72.30  ? 1044 SER A C   1 
ATOM 8016 O O   . SER A 1 1047 ? 18.278  32.263 4.458   1.00 72.30  ? 1044 SER A O   1 
ATOM 8017 C CB  . SER A 1 1047 ? 15.859  31.018 2.517   1.00 77.18  ? 1044 SER A CB  1 
ATOM 8018 O OG  . SER A 1 1047 ? 16.158  32.309 2.008   1.00 77.18  ? 1044 SER A OG  1 
ATOM 8019 N N   . GLU A 1 1048 ? 18.684  30.296 3.409   1.00 60.91  ? 1045 GLU A N   1 
ATOM 8020 C CA  . GLU A 1 1048 ? 20.153  30.494 3.377   1.00 60.91  ? 1045 GLU A CA  1 
ATOM 8021 C C   . GLU A 1 1048 ? 20.530  31.710 2.516   1.00 60.91  ? 1045 GLU A C   1 
ATOM 8022 O O   . GLU A 1 1048 ? 21.456  32.455 2.823   1.00 60.91  ? 1045 GLU A O   1 
ATOM 8023 C CB  . GLU A 1 1048 ? 20.899  29.216 2.942   1.00 164.23 ? 1045 GLU A CB  1 
ATOM 8024 C CG  . GLU A 1 1048 ? 20.914  28.914 1.437   1.00 164.23 ? 1045 GLU A CG  1 
ATOM 8025 C CD  . GLU A 1 1048 ? 19.629  28.275 0.938   1.00 164.23 ? 1045 GLU A CD  1 
ATOM 8026 O OE1 . GLU A 1 1048 ? 19.436  27.061 1.166   1.00 164.23 ? 1045 GLU A OE1 1 
ATOM 8027 O OE2 . GLU A 1 1048 ? 18.818  28.982 0.302   1.00 164.23 ? 1045 GLU A OE2 1 
ATOM 8028 N N   . SER A 1 1049 ? 19.767  31.938 1.466   1.00 64.98  ? 1046 SER A N   1 
ATOM 8029 C CA  . SER A 1 1049 ? 20.127  32.976 0.519   1.00 64.98  ? 1046 SER A CA  1 
ATOM 8030 C C   . SER A 1 1049 ? 19.838  34.365 1.056   1.00 64.98  ? 1046 SER A C   1 
ATOM 8031 O O   . SER A 1 1049 ? 20.672  35.270 0.930   1.00 64.98  ? 1046 SER A O   1 
ATOM 8032 C CB  . SER A 1 1049 ? 19.471  32.740 -0.864  1.00 114.37 ? 1046 SER A CB  1 
ATOM 8033 O OG  . SER A 1 1049 ? 18.110  32.326 -0.771  1.00 114.37 ? 1046 SER A OG  1 
ATOM 8034 N N   . TRP A 1 1050 ? 18.654  34.521 1.636   1.00 60.70  ? 1047 TRP A N   1 
ATOM 8035 C CA  . TRP A 1 1050 ? 18.327  35.733 2.360   1.00 60.70  ? 1047 TRP A CA  1 
ATOM 8036 C C   . TRP A 1 1050 ? 19.339  36.012 3.469   1.00 60.70  ? 1047 TRP A C   1 
ATOM 8037 O O   . TRP A 1 1050 ? 19.987  37.065 3.485   1.00 60.70  ? 1047 TRP A O   1 
ATOM 8038 C CB  . TRP A 1 1050 ? 16.919  35.637 2.899   1.00 85.61  ? 1047 TRP A CB  1 
ATOM 8039 C CG  . TRP A 1 1050 ? 15.988  35.986 1.841   1.00 85.61  ? 1047 TRP A CG  1 
ATOM 8040 C CD1 . TRP A 1 1050 ? 15.322  35.132 1.017   1.00 85.61  ? 1047 TRP A CD1 1 
ATOM 8041 C CD2 . TRP A 1 1050 ? 15.647  37.303 1.424   1.00 85.61  ? 1047 TRP A CD2 1 
ATOM 8042 N NE1 . TRP A 1 1050 ? 14.555  35.840 0.126   1.00 85.61  ? 1047 TRP A NE1 1 
ATOM 8043 C CE2 . TRP A 1 1050 ? 14.741  37.178 0.352   1.00 85.61  ? 1047 TRP A CE2 1 
ATOM 8044 C CE3 . TRP A 1 1050 ? 16.008  38.578 1.860   1.00 85.61  ? 1047 TRP A CE3 1 
ATOM 8045 C CZ2 . TRP A 1 1050 ? 14.189  38.278 -0.286  1.00 85.61  ? 1047 TRP A CZ2 1 
ATOM 8046 C CZ3 . TRP A 1 1050 ? 15.461  39.664 1.231   1.00 85.61  ? 1047 TRP A CZ3 1 
ATOM 8047 C CH2 . TRP A 1 1050 ? 14.562  39.512 0.166   1.00 85.61  ? 1047 TRP A CH2 1 
ATOM 8048 N N   . TYR A 1 1051 ? 19.522  35.039 4.352   1.00 67.55  ? 1048 TYR A N   1 
ATOM 8049 C CA  . TYR A 1 1051 ? 20.514  35.170 5.388   1.00 67.55  ? 1048 TYR A CA  1 
ATOM 8050 C C   . TYR A 1 1051 ? 21.807  35.718 4.811   1.00 67.55  ? 1048 TYR A C   1 
ATOM 8051 O O   . TYR A 1 1051 ? 22.313  36.746 5.285   1.00 67.55  ? 1048 TYR A O   1 
ATOM 8052 C CB  . TYR A 1 1051 ? 20.759  33.836 6.052   1.00 62.41  ? 1048 TYR A CB  1 
ATOM 8053 C CG  . TYR A 1 1051 ? 21.775  33.895 7.162   1.00 62.41  ? 1048 TYR A CG  1 
ATOM 8054 C CD1 . TYR A 1 1051 ? 21.439  34.398 8.424   1.00 62.41  ? 1048 TYR A CD1 1 
ATOM 8055 C CD2 . TYR A 1 1051 ? 23.070  33.421 6.965   1.00 62.41  ? 1048 TYR A CD2 1 
ATOM 8056 C CE1 . TYR A 1 1051 ? 22.380  34.442 9.465   1.00 62.41  ? 1048 TYR A CE1 1 
ATOM 8057 C CE2 . TYR A 1 1051 ? 24.000  33.450 7.989   1.00 62.41  ? 1048 TYR A CE2 1 
ATOM 8058 C CZ  . TYR A 1 1051 ? 23.652  33.962 9.233   1.00 62.41  ? 1048 TYR A CZ  1 
ATOM 8059 O OH  . TYR A 1 1051 ? 24.598  33.979 10.227  1.00 62.41  ? 1048 TYR A OH  1 
ATOM 8060 N N   . ASN A 1 1052 ? 22.322  35.049 3.774   1.00 49.30  ? 1049 ASN A N   1 
ATOM 8061 C CA  . ASN A 1 1052 ? 23.605  35.438 3.165   1.00 49.30  ? 1049 ASN A CA  1 
ATOM 8062 C C   . ASN A 1 1052 ? 23.587  36.805 2.461   1.00 49.30  ? 1049 ASN A C   1 
ATOM 8063 O O   . ASN A 1 1052 ? 24.519  37.595 2.639   1.00 49.30  ? 1049 ASN A O   1 
ATOM 8064 C CB  . ASN A 1 1052 ? 24.134  34.339 2.247   1.00 74.92  ? 1049 ASN A CB  1 
ATOM 8065 C CG  . ASN A 1 1052 ? 24.484  33.071 3.001   1.00 74.92  ? 1049 ASN A CG  1 
ATOM 8066 O OD1 . ASN A 1 1052 ? 24.942  33.107 4.145   1.00 74.92  ? 1049 ASN A OD1 1 
ATOM 8067 N ND2 . ASN A 1 1052 ? 24.268  31.938 2.359   1.00 74.92  ? 1049 ASN A ND2 1 
ATOM 8068 N N   . LEU A 1 1053 ? 22.528  37.086 1.697   1.00 39.45  ? 1050 LEU A N   1 
ATOM 8069 C CA  . LEU A 1 1053 ? 22.342  38.423 1.159   1.00 39.45  ? 1050 LEU A CA  1 
ATOM 8070 C C   . LEU A 1 1053 ? 22.441  39.450 2.300   1.00 39.45  ? 1050 LEU A C   1 
ATOM 8071 O O   . LEU A 1 1053 ? 23.144  40.487 2.195   1.00 39.45  ? 1050 LEU A O   1 
ATOM 8072 C CB  . LEU A 1 1053 ? 20.972  38.573 0.484   1.00 43.27  ? 1050 LEU A CB  1 
ATOM 8073 C CG  . LEU A 1 1053 ? 20.752  39.748 -0.501  1.00 43.27  ? 1050 LEU A CG  1 
ATOM 8074 C CD1 . LEU A 1 1053 ? 19.293  40.082 -0.626  1.00 43.27  ? 1050 LEU A CD1 1 
ATOM 8075 C CD2 . LEU A 1 1053 ? 21.510  41.022 -0.177  1.00 43.27  ? 1050 LEU A CD2 1 
ATOM 8076 N N   . LEU A 1 1054 ? 21.726  39.140 3.385   1.00 44.75  ? 1051 LEU A N   1 
ATOM 8077 C CA  . LEU A 1 1054 ? 21.619  40.024 4.529   1.00 44.75  ? 1051 LEU A CA  1 
ATOM 8078 C C   . LEU A 1 1054 ? 22.925  40.063 5.353   1.00 44.75  ? 1051 LEU A C   1 
ATOM 8079 O O   . LEU A 1 1054 ? 23.373  41.130 5.802   1.00 44.75  ? 1051 LEU A O   1 
ATOM 8080 C CB  . LEU A 1 1054 ? 20.416  39.600 5.362   1.00 29.79  ? 1051 LEU A CB  1 
ATOM 8081 C CG  . LEU A 1 1054 ? 18.969  39.799 4.808   1.00 29.79  ? 1051 LEU A CG  1 
ATOM 8082 C CD1 . LEU A 1 1054 ? 17.876  39.190 5.704   1.00 29.79  ? 1051 LEU A CD1 1 
ATOM 8083 C CD2 . LEU A 1 1054 ? 18.662  41.279 4.510   1.00 29.79  ? 1051 LEU A CD2 1 
ATOM 8084 N N   . LEU A 1 1055 ? 23.561  38.909 5.507   1.00 43.05  ? 1052 LEU A N   1 
ATOM 8085 C CA  . LEU A 1 1055 ? 24.804  38.854 6.245   1.00 43.05  ? 1052 LEU A CA  1 
ATOM 8086 C C   . LEU A 1 1055 ? 25.787  39.795 5.568   1.00 43.05  ? 1052 LEU A C   1 
ATOM 8087 O O   . LEU A 1 1055 ? 26.476  40.605 6.229   1.00 43.05  ? 1052 LEU A O   1 
ATOM 8088 C CB  . LEU A 1 1055 ? 25.356  37.431 6.231   1.00 44.94  ? 1052 LEU A CB  1 
ATOM 8089 C CG  . LEU A 1 1055 ? 26.290  36.960 7.365   1.00 44.94  ? 1052 LEU A CG  1 
ATOM 8090 C CD1 . LEU A 1 1055 ? 27.072  35.720 6.876   1.00 44.94  ? 1052 LEU A CD1 1 
ATOM 8091 C CD2 . LEU A 1 1055 ? 27.241  38.035 7.934   1.00 44.94  ? 1052 LEU A CD2 1 
ATOM 8092 N N   . ASP A 1 1056 ? 25.800  39.673 4.230   1.00 57.78  ? 1053 ASP A N   1 
ATOM 8093 C CA  . ASP A 1 1056 ? 26.682  40.399 3.320   1.00 57.78  ? 1053 ASP A CA  1 
ATOM 8094 C C   . ASP A 1 1056 ? 26.478  41.878 3.519   1.00 57.78  ? 1053 ASP A C   1 
ATOM 8095 O O   . ASP A 1 1056 ? 27.423  42.623 3.861   1.00 57.78  ? 1053 ASP A O   1 
ATOM 8096 C CB  . ASP A 1 1056 ? 26.354  40.043 1.873   1.00 107.87 ? 1053 ASP A CB  1 
ATOM 8097 C CG  . ASP A 1 1056 ? 27.553  40.168 0.958   1.00 107.87 ? 1053 ASP A CG  1 
ATOM 8098 O OD1 . ASP A 1 1056 ? 28.434  39.285 1.049   1.00 107.87 ? 1053 ASP A OD1 1 
ATOM 8099 O OD2 . ASP A 1 1056 ? 27.617  41.128 0.149   1.00 107.87 ? 1053 ASP A OD2 1 
ATOM 8100 N N   . MET A 1 1057 ? 25.224  42.282 3.350   1.00 66.16  ? 1054 MET A N   1 
ATOM 8101 C CA  . MET A 1 1057 ? 24.829  43.677 3.442   1.00 66.16  ? 1054 MET A CA  1 
ATOM 8102 C C   . MET A 1 1057 ? 25.136  44.329 4.802   1.00 66.16  ? 1054 MET A C   1 
ATOM 8103 O O   . MET A 1 1057 ? 25.183  45.555 4.913   1.00 66.16  ? 1054 MET A O   1 
ATOM 8104 C CB  . MET A 1 1057 ? 23.349  43.791 3.135   1.00 103.54 ? 1054 MET A CB  1 
ATOM 8105 C CG  . MET A 1 1057 ? 22.986  45.103 2.513   1.00 103.54 ? 1054 MET A CG  1 
ATOM 8106 S SD  . MET A 1 1057 ? 21.213  45.327 2.506   1.00 103.54 ? 1054 MET A SD  1 
ATOM 8107 C CE  . MET A 1 1057 ? 20.910  45.840 4.187   1.00 103.54 ? 1054 MET A CE  1 
ATOM 8108 N N   . GLN A 1 1058 ? 25.346  43.497 5.822   1.00 53.59  ? 1055 GLN A N   1 
ATOM 8109 C CA  . GLN A 1 1058 ? 25.587  43.959 7.166   1.00 53.59  ? 1055 GLN A CA  1 
ATOM 8110 C C   . GLN A 1 1058 ? 27.017  44.381 7.351   1.00 53.59  ? 1055 GLN A C   1 
ATOM 8111 O O   . GLN A 1 1058 ? 27.304  45.365 8.012   1.00 53.59  ? 1055 GLN A O   1 
ATOM 8112 C CB  . GLN A 1 1058 ? 25.316  42.826 8.112   1.00 58.79  ? 1055 GLN A CB  1 
ATOM 8113 C CG  . GLN A 1 1058 ? 24.338  43.150 9.179   1.00 58.79  ? 1055 GLN A CG  1 
ATOM 8114 C CD  . GLN A 1 1058 ? 24.066  41.954 10.012  1.00 58.79  ? 1055 GLN A CD  1 
ATOM 8115 O OE1 . GLN A 1 1058 ? 24.976  41.425 10.635  1.00 58.79  ? 1055 GLN A OE1 1 
ATOM 8116 N NE2 . GLN A 1 1058 ? 22.820  41.496 10.023  1.00 58.79  ? 1055 GLN A NE2 1 
ATOM 8117 N N   . ASN A 1 1059 ? 27.932  43.613 6.788   1.00 59.41  ? 1056 ASN A N   1 
ATOM 8118 C CA  . ASN A 1 1059 ? 29.336  43.976 6.869   1.00 59.41  ? 1056 ASN A CA  1 
ATOM 8119 C C   . ASN A 1 1059 ? 29.573  45.196 6.013   1.00 59.41  ? 1056 ASN A C   1 
ATOM 8120 O O   . ASN A 1 1059 ? 30.250  46.145 6.423   1.00 59.41  ? 1056 ASN A O   1 
ATOM 8121 C CB  . ASN A 1 1059 ? 30.195  42.811 6.424   1.00 92.78  ? 1056 ASN A CB  1 
ATOM 8122 C CG  . ASN A 1 1059 ? 29.939  41.576 7.245   1.00 92.78  ? 1056 ASN A CG  1 
ATOM 8123 O OD1 . ASN A 1 1059 ? 29.380  40.601 6.752   1.00 92.78  ? 1056 ASN A OD1 1 
ATOM 8124 N ND2 . ASN A 1 1059 ? 30.316  41.623 8.521   1.00 92.78  ? 1056 ASN A ND2 1 
ATOM 8125 N N   . ARG A 1 1060 ? 28.960  45.189 4.837   1.00 40.13  ? 1057 ARG A N   1 
ATOM 8126 C CA  . ARG A 1 1060 ? 29.084  46.318 3.935   1.00 40.13  ? 1057 ARG A CA  1 
ATOM 8127 C C   . ARG A 1 1060 ? 28.637  47.574 4.652   1.00 40.13  ? 1057 ARG A C   1 
ATOM 8128 O O   . ARG A 1 1060 ? 29.380  48.537 4.697   1.00 40.13  ? 1057 ARG A O   1 
ATOM 8129 C CB  . ARG A 1 1060 ? 28.307  46.051 2.647   1.00 83.61  ? 1057 ARG A CB  1 
ATOM 8130 C CG  . ARG A 1 1060 ? 28.986  45.015 1.766   1.00 83.61  ? 1057 ARG A CG  1 
ATOM 8131 C CD  . ARG A 1 1060 ? 28.059  44.352 0.763   1.00 83.61  ? 1057 ARG A CD  1 
ATOM 8132 N NE  . ARG A 1 1060 ? 28.831  43.722 -0.312  1.00 83.61  ? 1057 ARG A NE  1 
ATOM 8133 C CZ  . ARG A 1 1060 ? 29.196  44.333 -1.444  1.00 83.61  ? 1057 ARG A CZ  1 
ATOM 8134 N NH1 . ARG A 1 1060 ? 28.850  45.598 -1.682  1.00 83.61  ? 1057 ARG A NH1 1 
ATOM 8135 N NH2 . ARG A 1 1060 ? 29.906  43.670 -2.347  1.00 83.61  ? 1057 ARG A NH2 1 
ATOM 8136 N N   . LEU A 1 1061 ? 27.452  47.534 5.261   1.00 48.53  ? 1058 LEU A N   1 
ATOM 8137 C CA  . LEU A 1 1061 ? 26.899  48.646 6.070   1.00 48.53  ? 1058 LEU A CA  1 
ATOM 8138 C C   . LEU A 1 1061 ? 27.773  49.082 7.221   1.00 48.53  ? 1058 LEU A C   1 
ATOM 8139 O O   . LEU A 1 1061 ? 27.844  50.283 7.505   1.00 48.53  ? 1058 LEU A O   1 
ATOM 8140 C CB  . LEU A 1 1061 ? 25.531  48.291 6.658   1.00 43.02  ? 1058 LEU A CB  1 
ATOM 8141 C CG  . LEU A 1 1061 ? 24.280  48.618 5.844   1.00 43.02  ? 1058 LEU A CG  1 
ATOM 8142 C CD1 . LEU A 1 1061 ? 23.137  47.761 6.290   1.00 43.02  ? 1058 LEU A CD1 1 
ATOM 8143 C CD2 . LEU A 1 1061 ? 23.906  50.084 5.975   1.00 43.02  ? 1058 LEU A CD2 1 
ATOM 8144 N N   . ASN A 1 1062 ? 28.421  48.133 7.908   1.00 46.52  ? 1059 ASN A N   1 
ATOM 8145 C CA  . ASN A 1 1062 ? 29.206  48.527 9.080   1.00 46.52  ? 1059 ASN A CA  1 
ATOM 8146 C C   . ASN A 1 1062 ? 30.244  49.540 8.697   1.00 46.52  ? 1059 ASN A C   1 
ATOM 8147 O O   . ASN A 1 1062 ? 30.414  50.546 9.389   1.00 46.52  ? 1059 ASN A O   1 
ATOM 8148 C CB  . ASN A 1 1062 ? 29.826  47.348 9.813   1.00 44.63  ? 1059 ASN A CB  1 
ATOM 8149 C CG  . ASN A 1 1062 ? 28.784  46.475 10.521  1.00 44.63  ? 1059 ASN A CG  1 
ATOM 8150 O OD1 . ASN A 1 1062 ? 27.763  46.953 11.042  1.00 44.63  ? 1059 ASN A OD1 1 
ATOM 8151 N ND2 . ASN A 1 1062 ? 29.039  45.182 10.523  1.00 44.63  ? 1059 ASN A ND2 1 
ATOM 8152 N N   . LYS A 1 1063 ? 30.866  49.284 7.545   1.00 58.50  ? 1060 LYS A N   1 
ATOM 8153 C CA  . LYS A 1 1063 ? 31.879  50.135 6.919   1.00 58.50  ? 1060 LYS A CA  1 
ATOM 8154 C C   . LYS A 1 1063 ? 31.299  51.485 6.593   1.00 58.50  ? 1060 LYS A C   1 
ATOM 8155 O O   . LYS A 1 1063 ? 31.950  52.510 6.771   1.00 58.50  ? 1060 LYS A O   1 
ATOM 8156 C CB  . LYS A 1 1063 ? 32.409  49.475 5.637   1.00 74.19  ? 1060 LYS A CB  1 
ATOM 8157 C CG  . LYS A 1 1063 ? 33.296  48.253 5.875   1.00 74.19  ? 1060 LYS A CG  1 
ATOM 8158 C CD  . LYS A 1 1063 ? 33.629  47.483 4.588   1.00 74.19  ? 1060 LYS A CD  1 
ATOM 8159 C CE  . LYS A 1 1063 ? 34.543  46.280 4.870   1.00 74.19  ? 1060 LYS A CE  1 
ATOM 8160 N NZ  . LYS A 1 1063 ? 35.812  46.686 5.582   1.00 74.19  ? 1060 LYS A NZ  1 
ATOM 8161 N N   . VAL A 1 1064 ? 30.062  51.491 6.125   1.00 55.33  ? 1061 VAL A N   1 
ATOM 8162 C CA  . VAL A 1 1064 ? 29.427  52.756 5.746   1.00 55.33  ? 1061 VAL A CA  1 
ATOM 8163 C C   . VAL A 1 1064 ? 28.981  53.614 6.949   1.00 55.33  ? 1061 VAL A C   1 
ATOM 8164 O O   . VAL A 1 1064 ? 29.340  54.771 7.019   1.00 55.33  ? 1061 VAL A O   1 
ATOM 8165 C CB  . VAL A 1 1064 ? 28.248  52.527 4.762   1.00 98.24  ? 1061 VAL A CB  1 
ATOM 8166 C CG1 . VAL A 1 1064 ? 27.826  53.821 4.139   1.00 98.24  ? 1061 VAL A CG1 1 
ATOM 8167 C CG2 . VAL A 1 1064 ? 28.645  51.543 3.673   1.00 98.24  ? 1061 VAL A CG2 1 
ATOM 8168 N N   . ILE A 1 1065 ? 28.231  53.027 7.890   1.00 80.65  ? 1062 ILE A N   1 
ATOM 8169 C CA  . ILE A 1 1065 ? 27.584  53.744 9.015   1.00 80.65  ? 1062 ILE A CA  1 
ATOM 8170 C C   . ILE A 1 1065 ? 28.545  54.243 10.111  1.00 80.65  ? 1062 ILE A C   1 
ATOM 8171 O O   . ILE A 1 1065 ? 29.262  53.447 10.737  1.00 80.65  ? 1062 ILE A O   1 
ATOM 8172 C CB  . ILE A 1 1065 ? 26.468  52.856 9.646   1.00 42.48  ? 1062 ILE A CB  1 
ATOM 8173 C CG1 . ILE A 1 1065 ? 25.186  52.905 8.787   1.00 42.48  ? 1062 ILE A CG1 1 
ATOM 8174 C CG2 . ILE A 1 1065 ? 26.119  53.308 11.045  1.00 42.48  ? 1062 ILE A CG2 1 
ATOM 8175 C CD1 . ILE A 1 1065 ? 24.421  51.544 8.669   1.00 42.48  ? 1062 ILE A CD1 1 
ATOM 8176 N N   . LYS A 1 1066 ? 28.553  55.561 10.326  1.00 90.16  ? 1063 LYS A N   1 
ATOM 8177 C CA  . LYS A 1 1066 ? 29.294  56.183 11.438  1.00 90.16  ? 1063 LYS A CA  1 
ATOM 8178 C C   . LYS A 1 1066 ? 28.614  55.808 12.754  1.00 90.16  ? 1063 LYS A C   1 
ATOM 8179 O O   . LYS A 1 1066 ? 27.384  55.878 12.861  1.00 90.16  ? 1063 LYS A O   1 
ATOM 8180 C CB  . LYS A 1 1066 ? 29.321  57.719 11.318  1.00 138.44 ? 1063 LYS A CB  1 
ATOM 8181 C CG  . LYS A 1 1066 ? 29.808  58.292 9.987   1.00 138.44 ? 1063 LYS A CG  1 
ATOM 8182 C CD  . LYS A 1 1066 ? 29.902  59.828 10.035  1.00 138.44 ? 1063 LYS A CD  1 
ATOM 8183 C CE  . LYS A 1 1066 ? 29.944  60.446 8.626   1.00 138.44 ? 1063 LYS A CE  1 
ATOM 8184 N NZ  . LYS A 1 1066 ? 30.438  61.864 8.562   1.00 138.44 ? 1063 LYS A NZ  1 
ATOM 8185 N N   . SER A 1 1067 ? 29.405  55.405 13.743  1.00 48.57  ? 1064 SER A N   1 
ATOM 8186 C CA  . SER A 1 1067 ? 28.858  54.980 15.026  1.00 48.57  ? 1064 SER A CA  1 
ATOM 8187 C C   . SER A 1 1067 ? 29.198  55.957 16.146  1.00 48.57  ? 1064 SER A C   1 
ATOM 8188 O O   . SER A 1 1067 ? 30.340  56.399 16.273  1.00 48.57  ? 1064 SER A O   1 
ATOM 8189 C CB  . SER A 1 1067 ? 29.360  53.579 15.384  1.00 24.95  ? 1064 SER A CB  1 
ATOM 8190 O OG  . SER A 1 1067 ? 30.398  53.639 16.347  1.00 24.95  ? 1064 SER A OG  1 
ATOM 8191 N N   . VAL A 1 1068 ? 28.198  56.289 16.957  1.00 151.01 ? 1065 VAL A N   1 
ATOM 8192 C CA  . VAL A 1 1068 ? 28.397  57.185 18.089  1.00 151.01 ? 1065 VAL A CA  1 
ATOM 8193 C C   . VAL A 1 1068 ? 29.457  56.621 19.028  1.00 151.01 ? 1065 VAL A C   1 
ATOM 8194 O O   . VAL A 1 1068 ? 29.308  55.518 19.554  1.00 151.01 ? 1065 VAL A O   1 
ATOM 8195 C CB  . VAL A 1 1068 ? 27.091  57.404 18.874  1.00 54.25  ? 1065 VAL A CB  1 
ATOM 8196 C CG1 . VAL A 1 1068 ? 26.177  58.362 18.124  1.00 54.25  ? 1065 VAL A CG1 1 
ATOM 8197 C CG2 . VAL A 1 1068 ? 26.394  56.076 19.124  1.00 54.25  ? 1065 VAL A CG2 1 
ATOM 8198 N N   . GLY A 1 1069 ? 30.527  57.380 19.230  1.00 41.78  ? 1066 GLY A N   1 
ATOM 8199 C CA  . GLY A 1 1069 ? 31.629  56.933 20.061  1.00 41.78  ? 1066 GLY A CA  1 
ATOM 8200 C C   . GLY A 1 1069 ? 32.603  56.089 19.263  1.00 41.78  ? 1066 GLY A C   1 
ATOM 8201 O O   . GLY A 1 1069 ? 33.799  56.058 19.553  1.00 41.78  ? 1066 GLY A O   1 
ATOM 8202 N N   . LYS A 1 1070 ? 32.084  55.402 18.250  1.00 52.84  ? 1067 LYS A N   1 
ATOM 8203 C CA  . LYS A 1 1070 ? 32.921  54.565 17.365  1.00 52.84  ? 1067 LYS A CA  1 
ATOM 8204 C C   . LYS A 1 1070 ? 33.082  53.189 17.954  1.00 52.84  ? 1067 LYS A C   1 
ATOM 8205 O O   . LYS A 1 1070 ? 34.212  52.726 18.177  1.00 52.84  ? 1067 LYS A O   1 
ATOM 8206 C CB  . LYS A 1 1070 ? 34.310  55.192 17.094  1.00 49.20  ? 1067 LYS A CB  1 
ATOM 8207 C CG  . LYS A 1 1070 ? 34.319  56.671 16.691  1.00 49.20  ? 1067 LYS A CG  1 
ATOM 8208 C CD  . LYS A 1 1070 ? 35.481  56.990 15.761  1.00 49.20  ? 1067 LYS A CD  1 
ATOM 8209 C CE  . LYS A 1 1070 ? 35.362  58.401 15.153  1.00 49.20  ? 1067 LYS A CE  1 
ATOM 8210 N NZ  . LYS A 1 1070 ? 36.703  59.108 15.184  1.00 49.20  ? 1067 LYS A NZ  1 
ATOM 8211 N N   . ILE A 1 1071 ? 31.946  52.561 18.255  1.00 35.59  ? 1068 ILE A N   1 
ATOM 8212 C CA  . ILE A 1 1071 ? 31.945  51.232 18.845  1.00 35.59  ? 1068 ILE A CA  1 
ATOM 8213 C C   . ILE A 1 1071 ? 31.647  50.312 17.681  1.00 35.59  ? 1068 ILE A C   1 
ATOM 8214 O O   . ILE A 1 1071 ? 30.854  50.644 16.836  1.00 35.59  ? 1068 ILE A O   1 
ATOM 8215 C CB  . ILE A 1 1071 ? 30.848  51.100 19.953  1.00 30.44  ? 1068 ILE A CB  1 
ATOM 8216 C CG1 . ILE A 1 1071 ? 31.191  51.966 21.164  1.00 30.44  ? 1068 ILE A CG1 1 
ATOM 8217 C CG2 . ILE A 1 1071 ? 30.615  49.610 20.372  1.00 30.44  ? 1068 ILE A CG2 1 
ATOM 8218 C CD1 . ILE A 1 1071 ? 30.032  52.140 22.108  1.00 30.44  ? 1068 ILE A CD1 1 
ATOM 8219 N N   . GLU A 1 1072 ? 32.270  49.152 17.655  1.00 37.00  ? 1069 GLU A N   1 
ATOM 8220 C CA  . GLU A 1 1072 ? 32.147  48.260 16.524  1.00 37.00  ? 1069 GLU A CA  1 
ATOM 8221 C C   . GLU A 1 1072 ? 30.900  47.407 16.637  1.00 37.00  ? 1069 GLU A C   1 
ATOM 8222 O O   . GLU A 1 1072 ? 30.665  46.714 17.642  1.00 37.00  ? 1069 GLU A O   1 
ATOM 8223 C CB  . GLU A 1 1072 ? 33.356  47.337 16.442  1.00 81.22  ? 1069 GLU A CB  1 
ATOM 8224 C CG  . GLU A 1 1072 ? 33.878  47.215 15.057  1.00 81.22  ? 1069 GLU A CG  1 
ATOM 8225 C CD  . GLU A 1 1072 ? 34.784  48.356 14.727  1.00 81.22  ? 1069 GLU A CD  1 
ATOM 8226 O OE1 . GLU A 1 1072 ? 34.370  49.256 13.977  1.00 81.22  ? 1069 GLU A OE1 1 
ATOM 8227 O OE2 . GLU A 1 1072 ? 35.909  48.370 15.252  1.00 81.22  ? 1069 GLU A OE2 1 
ATOM 8228 N N   . HIS A 1 1073 ? 30.101  47.447 15.583  1.00 41.98  ? 1070 HIS A N   1 
ATOM 8229 C CA  . HIS A 1 1073 ? 28.913  46.672 15.578  1.00 41.98  ? 1070 HIS A CA  1 
ATOM 8230 C C   . HIS A 1 1073 ? 29.159  45.171 15.845  1.00 41.98  ? 1070 HIS A C   1 
ATOM 8231 O O   . HIS A 1 1073 ? 28.334  44.515 16.492  1.00 41.98  ? 1070 HIS A O   1 
ATOM 8232 C CB  . HIS A 1 1073 ? 28.185  46.862 14.280  1.00 45.82  ? 1070 HIS A CB  1 
ATOM 8233 C CG  . HIS A 1 1073 ? 27.024  45.939 14.133  1.00 45.82  ? 1070 HIS A CG  1 
ATOM 8234 N ND1 . HIS A 1 1073 ? 25.741  46.307 14.474  1.00 45.82  ? 1070 HIS A ND1 1 
ATOM 8235 C CD2 . HIS A 1 1073 ? 26.962  44.641 13.747  1.00 45.82  ? 1070 HIS A CD2 1 
ATOM 8236 C CE1 . HIS A 1 1073 ? 24.934  45.279 14.282  1.00 45.82  ? 1070 HIS A CE1 1 
ATOM 8237 N NE2 . HIS A 1 1073 ? 25.646  44.258 13.838  1.00 45.82  ? 1070 HIS A NE2 1 
ATOM 8238 N N   . SER A 1 1074 ? 30.263  44.610 15.355  1.00 47.25  ? 1071 SER A N   1 
ATOM 8239 C CA  . SER A 1 1074 ? 30.522  43.181 15.595  1.00 47.25  ? 1071 SER A CA  1 
ATOM 8240 C C   . SER A 1 1074 ? 30.731  42.959 17.053  1.00 47.25  ? 1071 SER A C   1 
ATOM 8241 O O   . SER A 1 1074 ? 30.351  41.927 17.558  1.00 47.25  ? 1071 SER A O   1 
ATOM 8242 C CB  . SER A 1 1074 ? 31.747  42.667 14.862  1.00 58.99  ? 1071 SER A CB  1 
ATOM 8243 O OG  . SER A 1 1074 ? 31.816  43.236 13.587  1.00 58.99  ? 1071 SER A OG  1 
ATOM 8244 N N   . PHE A 1 1075 ? 31.340  43.930 17.724  1.00 50.13  ? 1072 PHE A N   1 
ATOM 8245 C CA  . PHE A 1 1075 ? 31.583  43.829 19.144  1.00 50.13  ? 1072 PHE A CA  1 
ATOM 8246 C C   . PHE A 1 1075 ? 30.286  43.981 19.943  1.00 50.13  ? 1072 PHE A C   1 
ATOM 8247 O O   . PHE A 1 1075 ? 30.046  43.264 20.914  1.00 50.13  ? 1072 PHE A O   1 
ATOM 8248 C CB  . PHE A 1 1075 ? 32.581  44.874 19.555  1.00 31.92  ? 1072 PHE A CB  1 
ATOM 8249 C CG  . PHE A 1 1075 ? 32.914  44.856 21.002  1.00 31.92  ? 1072 PHE A CG  1 
ATOM 8250 C CD1 . PHE A 1 1075 ? 33.900  43.997 21.493  1.00 31.92  ? 1072 PHE A CD1 1 
ATOM 8251 C CD2 . PHE A 1 1075 ? 32.259  45.712 21.892  1.00 31.92  ? 1072 PHE A CD2 1 
ATOM 8252 C CE1 . PHE A 1 1075 ? 34.243  43.997 22.876  1.00 31.92  ? 1072 PHE A CE1 1 
ATOM 8253 C CE2 . PHE A 1 1075 ? 32.564  45.722 23.286  1.00 31.92  ? 1072 PHE A CE2 1 
ATOM 8254 C CZ  . PHE A 1 1075 ? 33.551  44.865 23.786  1.00 31.92  ? 1072 PHE A CZ  1 
ATOM 8255 N N   . TRP A 1 1076 ? 29.443  44.904 19.525  1.00 39.65  ? 1073 TRP A N   1 
ATOM 8256 C CA  . TRP A 1 1076 ? 28.117  44.968 20.066  1.00 39.65  ? 1073 TRP A CA  1 
ATOM 8257 C C   . TRP A 1 1076 ? 27.511  43.566 20.061  1.00 39.65  ? 1073 TRP A C   1 
ATOM 8258 O O   . TRP A 1 1076 ? 27.348  42.958 21.139  1.00 39.65  ? 1073 TRP A O   1 
ATOM 8259 C CB  . TRP A 1 1076 ? 27.284  45.985 19.274  1.00 54.43  ? 1073 TRP A CB  1 
ATOM 8260 C CG  . TRP A 1 1076 ? 25.845  46.235 19.724  1.00 54.43  ? 1073 TRP A CG  1 
ATOM 8261 C CD1 . TRP A 1 1076 ? 24.820  46.604 18.914  1.00 54.43  ? 1073 TRP A CD1 1 
ATOM 8262 C CD2 . TRP A 1 1076 ? 25.279  46.130 21.049  1.00 54.43  ? 1073 TRP A CD2 1 
ATOM 8263 N NE1 . TRP A 1 1076 ? 23.666  46.733 19.629  1.00 54.43  ? 1073 TRP A NE1 1 
ATOM 8264 C CE2 . TRP A 1 1076 ? 23.914  46.450 20.942  1.00 54.43  ? 1073 TRP A CE2 1 
ATOM 8265 C CE3 . TRP A 1 1076 ? 25.787  45.788 22.304  1.00 54.43  ? 1073 TRP A CE3 1 
ATOM 8266 C CZ2 . TRP A 1 1076 ? 23.053  46.446 22.032  1.00 54.43  ? 1073 TRP A CZ2 1 
ATOM 8267 C CZ3 . TRP A 1 1076 ? 24.919  45.794 23.392  1.00 54.43  ? 1073 TRP A CZ3 1 
ATOM 8268 C CH2 . TRP A 1 1076 ? 23.579  46.133 23.245  1.00 54.43  ? 1073 TRP A CH2 1 
ATOM 8269 N N   . ARG A 1 1077 ? 27.249  43.018 18.870  1.00 36.29  ? 1074 ARG A N   1 
ATOM 8270 C CA  . ARG A 1 1077 ? 26.359  41.858 18.771  1.00 36.29  ? 1074 ARG A CA  1 
ATOM 8271 C C   . ARG A 1 1077 ? 26.933  40.540 19.215  1.00 36.29  ? 1074 ARG A C   1 
ATOM 8272 O O   . ARG A 1 1077 ? 26.216  39.528 19.167  1.00 36.29  ? 1074 ARG A O   1 
ATOM 8273 C CB  . ARG A 1 1077 ? 25.742  41.700 17.385  1.00 39.28  ? 1074 ARG A CB  1 
ATOM 8274 C CG  . ARG A 1 1077 ? 24.726  42.757 17.019  1.00 39.28  ? 1074 ARG A CG  1 
ATOM 8275 C CD  . ARG A 1 1077 ? 23.735  42.949 18.129  1.00 39.28  ? 1074 ARG A CD  1 
ATOM 8276 N NE  . ARG A 1 1077 ? 22.668  43.857 17.721  1.00 39.28  ? 1074 ARG A NE  1 
ATOM 8277 C CZ  . ARG A 1 1077 ? 21.650  44.228 18.497  1.00 39.28  ? 1074 ARG A CZ  1 
ATOM 8278 N NH1 . ARG A 1 1077 ? 21.535  43.786 19.740  1.00 39.28  ? 1074 ARG A NH1 1 
ATOM 8279 N NH2 . ARG A 1 1077 ? 20.736  45.036 18.007  1.00 39.28  ? 1074 ARG A NH2 1 
ATOM 8280 N N   . SER A 1 1078 ? 28.196  40.542 19.656  1.00 46.05  ? 1075 SER A N   1 
ATOM 8281 C CA  . SER A 1 1078 ? 28.854  39.311 20.146  1.00 46.05  ? 1075 SER A CA  1 
ATOM 8282 C C   . SER A 1 1078 ? 28.216  38.721 21.398  1.00 46.05  ? 1075 SER A C   1 
ATOM 8283 O O   . SER A 1 1078 ? 27.798  39.440 22.302  1.00 46.05  ? 1075 SER A O   1 
ATOM 8284 C CB  . SER A 1 1078 ? 30.342  39.561 20.433  1.00 34.88  ? 1075 SER A CB  1 
ATOM 8285 O OG  . SER A 1 1078 ? 31.099  39.515 19.249  1.00 34.88  ? 1075 SER A OG  1 
ATOM 8286 N N   . PHE A 1 1079 ? 28.179  37.401 21.441  1.00 47.02  ? 1076 PHE A N   1 
ATOM 8287 C CA  . PHE A 1 1079 ? 27.759  36.656 22.615  1.00 47.02  ? 1076 PHE A CA  1 
ATOM 8288 C C   . PHE A 1 1079 ? 28.753  36.945 23.701  1.00 47.02  ? 1076 PHE A C   1 
ATOM 8289 O O   . PHE A 1 1079 ? 29.945  36.873 23.450  1.00 47.02  ? 1076 PHE A O   1 
ATOM 8290 C CB  . PHE A 1 1079 ? 27.806  35.181 22.301  1.00 59.89  ? 1076 PHE A CB  1 
ATOM 8291 C CG  . PHE A 1 1079 ? 26.994  34.338 23.223  1.00 59.89  ? 1076 PHE A CG  1 
ATOM 8292 C CD1 . PHE A 1 1079 ? 25.643  34.119 22.973  1.00 59.89  ? 1076 PHE A CD1 1 
ATOM 8293 C CD2 . PHE A 1 1079 ? 27.581  33.726 24.324  1.00 59.89  ? 1076 PHE A CD2 1 
ATOM 8294 C CE1 . PHE A 1 1079 ? 24.892  33.323 23.820  1.00 59.89  ? 1076 PHE A CE1 1 
ATOM 8295 C CE2 . PHE A 1 1079 ? 26.834  32.933 25.168  1.00 59.89  ? 1076 PHE A CE2 1 
ATOM 8296 C CZ  . PHE A 1 1079 ? 25.483  32.733 24.914  1.00 59.89  ? 1076 PHE A CZ  1 
ATOM 8297 N N   . HIS A 1 1080 ? 28.271  37.290 24.892  1.00 48.44  ? 1077 HIS A N   1 
ATOM 8298 C CA  . HIS A 1 1080 ? 29.137  37.624 26.025  1.00 48.44  ? 1077 HIS A CA  1 
ATOM 8299 C C   . HIS A 1 1080 ? 28.550  37.191 27.371  1.00 48.44  ? 1077 HIS A C   1 
ATOM 8300 O O   . HIS A 1 1080 ? 27.464  37.614 27.757  1.00 48.44  ? 1077 HIS A O   1 
ATOM 8301 C CB  . HIS A 1 1080 ? 29.471  39.122 26.032  1.00 54.57  ? 1077 HIS A CB  1 
ATOM 8302 C CG  . HIS A 1 1080 ? 30.321  39.569 27.191  1.00 54.57  ? 1077 HIS A CG  1 
ATOM 8303 N ND1 . HIS A 1 1080 ? 30.001  39.304 28.507  1.00 54.57  ? 1077 HIS A ND1 1 
ATOM 8304 C CD2 . HIS A 1 1080 ? 31.452  40.313 27.231  1.00 54.57  ? 1077 HIS A CD2 1 
ATOM 8305 C CE1 . HIS A 1 1080 ? 30.900  39.852 29.306  1.00 54.57  ? 1077 HIS A CE1 1 
ATOM 8306 N NE2 . HIS A 1 1080 ? 31.788  40.475 28.557  1.00 54.57  ? 1077 HIS A NE2 1 
ATOM 8307 N N   . THR A 1 1081 ? 29.282  36.331 28.071  1.00 63.82  ? 1078 THR A N   1 
ATOM 8308 C CA  . THR A 1 1081 ? 28.966  35.957 29.440  1.00 63.82  ? 1078 THR A CA  1 
ATOM 8309 C C   . THR A 1 1081 ? 30.231  36.205 30.189  1.00 63.82  ? 1078 THR A C   1 
ATOM 8310 O O   . THR A 1 1081 ? 31.156  36.814 29.655  1.00 63.82  ? 1078 THR A O   1 
ATOM 8311 C CB  . THR A 1 1081 ? 28.674  34.446 29.614  1.00 76.78  ? 1078 THR A CB  1 
ATOM 8312 O OG1 . THR A 1 1081 ? 29.897  33.708 29.503  1.00 76.78  ? 1078 THR A OG1 1 
ATOM 8313 C CG2 . THR A 1 1081 ? 27.610  33.917 28.612  1.00 76.78  ? 1078 THR A CG2 1 
ATOM 8314 N N   . GLU A 1 1082 ? 30.288  35.686 31.411  1.00 71.77  ? 1079 GLU A N   1 
ATOM 8315 C CA  . GLU A 1 1082 ? 31.506  35.675 32.215  1.00 71.77  ? 1079 GLU A CA  1 
ATOM 8316 C C   . GLU A 1 1082 ? 32.488  34.683 31.612  1.00 71.77  ? 1079 GLU A C   1 
ATOM 8317 O O   . GLU A 1 1082 ? 33.679  34.960 31.506  1.00 71.77  ? 1079 GLU A O   1 
ATOM 8318 C CB  . GLU A 1 1082 ? 31.176  35.270 33.653  1.00 156.87 ? 1079 GLU A CB  1 
ATOM 8319 C CG  . GLU A 1 1082 ? 32.247  35.633 34.659  1.00 156.87 ? 1079 GLU A CG  1 
ATOM 8320 C CD  . GLU A 1 1082 ? 32.381  37.128 34.828  1.00 156.87 ? 1079 GLU A CD  1 
ATOM 8321 O OE1 . GLU A 1 1082 ? 31.483  37.735 35.456  1.00 156.87 ? 1079 GLU A OE1 1 
ATOM 8322 O OE2 . GLU A 1 1082 ? 33.380  37.695 34.327  1.00 156.87 ? 1079 GLU A OE2 1 
ATOM 8323 N N   . ARG A 1 1083 ? 31.961  33.534 31.201  1.00 90.60  ? 1080 ARG A N   1 
ATOM 8324 C CA  . ARG A 1 1083 ? 32.769  32.420 30.726  1.00 90.60  ? 1080 ARG A CA  1 
ATOM 8325 C C   . ARG A 1 1083 ? 33.392  32.647 29.346  1.00 90.60  ? 1080 ARG A C   1 
ATOM 8326 O O   . ARG A 1 1083 ? 34.529  32.237 29.115  1.00 90.60  ? 1080 ARG A O   1 
ATOM 8327 C CB  . ARG A 1 1083 ? 31.951  31.120 30.747  1.00 182.80 ? 1080 ARG A CB  1 
ATOM 8328 C CG  . ARG A 1 1083 ? 32.729  29.869 30.335  1.00 182.80 ? 1080 ARG A CG  1 
ATOM 8329 C CD  . ARG A 1 1083 ? 32.384  28.662 31.200  1.00 182.80 ? 1080 ARG A CD  1 
ATOM 8330 N NE  . ARG A 1 1083 ? 32.788  28.852 32.595  1.00 182.80 ? 1080 ARG A NE  1 
ATOM 8331 C CZ  . ARG A 1 1083 ? 34.020  28.662 33.066  1.00 182.80 ? 1080 ARG A CZ  1 
ATOM 8332 N NH1 . ARG A 1 1083 ? 35.001  28.269 32.260  1.00 182.80 ? 1080 ARG A NH1 1 
ATOM 8333 N NH2 . ARG A 1 1083 ? 34.272  28.867 34.352  1.00 182.80 ? 1080 ARG A NH2 1 
ATOM 8334 N N   . LYS A 1 1084 ? 32.671  33.299 28.433  1.00 70.30  ? 1081 LYS A N   1 
ATOM 8335 C CA  . LYS A 1 1084 ? 33.091  33.311 27.030  1.00 70.30  ? 1081 LYS A CA  1 
ATOM 8336 C C   . LYS A 1 1084 ? 32.606  34.509 26.227  1.00 70.30  ? 1081 LYS A C   1 
ATOM 8337 O O   . LYS A 1 1084 ? 31.636  35.150 26.595  1.00 70.30  ? 1081 LYS A O   1 
ATOM 8338 C CB  . LYS A 1 1084 ? 32.646  32.010 26.354  1.00 49.39  ? 1081 LYS A CB  1 
ATOM 8339 C CG  . LYS A 1 1084 ? 31.165  31.946 25.976  1.00 49.39  ? 1081 LYS A CG  1 
ATOM 8340 C CD  . LYS A 1 1084 ? 30.780  30.502 25.686  1.00 49.39  ? 1081 LYS A CD  1 
ATOM 8341 C CE  . LYS A 1 1084 ? 29.693  30.411 24.641  1.00 49.39  ? 1081 LYS A CE  1 
ATOM 8342 N NZ  . LYS A 1 1084 ? 29.791  29.146 23.887  1.00 49.39  ? 1081 LYS A NZ  1 
ATOM 8343 N N   . THR A 1 1085 ? 33.304  34.790 25.128  1.00 60.84  ? 1082 THR A N   1 
ATOM 8344 C CA  . THR A 1 1085 ? 32.891  35.810 24.166  1.00 60.84  ? 1082 THR A CA  1 
ATOM 8345 C C   . THR A 1 1085 ? 33.042  35.314 22.718  1.00 60.84  ? 1082 THR A C   1 
ATOM 8346 O O   . THR A 1 1085 ? 34.123  34.917 22.303  1.00 60.84  ? 1082 THR A O   1 
ATOM 8347 C CB  . THR A 1 1085 ? 33.672  37.111 24.380  1.00 42.42  ? 1082 THR A CB  1 
ATOM 8348 O OG1 . THR A 1 1085 ? 33.451  37.579 25.709  1.00 42.42  ? 1082 THR A OG1 1 
ATOM 8349 C CG2 . THR A 1 1085 ? 33.201  38.186 23.434  1.00 42.42  ? 1082 THR A CG2 1 
ATOM 8350 N N   . GLU A 1 1086 ? 31.949  35.335 21.964  1.00 57.10  ? 1083 GLU A N   1 
ATOM 8351 C CA  . GLU A 1 1086 ? 31.920  34.832 20.581  1.00 57.10  ? 1083 GLU A CA  1 
ATOM 8352 C C   . GLU A 1 1086 ? 31.269  35.847 19.657  1.00 57.10  ? 1083 GLU A C   1 
ATOM 8353 O O   . GLU A 1 1086 ? 30.402  36.594 20.101  1.00 57.10  ? 1083 GLU A O   1 
ATOM 8354 C CB  . GLU A 1 1086 ? 31.096  33.537 20.473  1.00 91.85  ? 1083 GLU A CB  1 
ATOM 8355 C CG  . GLU A 1 1086 ? 31.492  32.416 21.391  1.00 91.85  ? 1083 GLU A CG  1 
ATOM 8356 C CD  . GLU A 1 1086 ? 32.874  31.922 21.120  1.00 91.85  ? 1083 GLU A CD  1 
ATOM 8357 O OE1 . GLU A 1 1086 ? 33.608  31.675 22.103  1.00 91.85  ? 1083 GLU A OE1 1 
ATOM 8358 O OE2 . GLU A 1 1086 ? 33.230  31.793 19.928  1.00 91.85  ? 1083 GLU A OE2 1 
ATOM 8359 N N   . PRO A 1 1087 ? 31.663  35.855 18.365  1.00 60.15  ? 1084 PRO A N   1 
ATOM 8360 C CA  . PRO A 1 1087 ? 30.956  36.621 17.346  1.00 60.15  ? 1084 PRO A CA  1 
ATOM 8361 C C   . PRO A 1 1087 ? 29.562  36.060 17.185  1.00 60.15  ? 1084 PRO A C   1 
ATOM 8362 O O   . PRO A 1 1087 ? 29.331  34.891 17.430  1.00 60.15  ? 1084 PRO A O   1 
ATOM 8363 C CB  . PRO A 1 1087 ? 31.758  36.330 16.065  1.00 42.57  ? 1084 PRO A CB  1 
ATOM 8364 C CG  . PRO A 1 1087 ? 33.087  35.937 16.509  1.00 42.57  ? 1084 PRO A CG  1 
ATOM 8365 C CD  . PRO A 1 1087 ? 32.804  35.137 17.774  1.00 42.57  ? 1084 PRO A CD  1 
ATOM 8366 N N   . ALA A 1 1088 ? 28.633  36.897 16.773  1.00 49.86  ? 1085 ALA A N   1 
ATOM 8367 C CA  . ALA A 1 1088 ? 27.277  36.438 16.581  1.00 49.86  ? 1085 ALA A CA  1 
ATOM 8368 C C   . ALA A 1 1088 ? 27.200  35.428 15.416  1.00 49.86  ? 1085 ALA A C   1 
ATOM 8369 O O   . ALA A 1 1088 ? 27.907  35.572 14.447  1.00 49.86  ? 1085 ALA A O   1 
ATOM 8370 C CB  . ALA A 1 1088 ? 26.367  37.638 16.348  1.00 28.55  ? 1085 ALA A CB  1 
ATOM 8371 N N   . THR A 1 1089 ? 26.354  34.410 15.526  1.00 45.94  ? 1086 THR A N   1 
ATOM 8372 C CA  . THR A 1 1089 ? 26.176  33.427 14.464  1.00 45.94  ? 1086 THR A CA  1 
ATOM 8373 C C   . THR A 1 1089 ? 24.685  33.213 14.180  1.00 45.94  ? 1086 THR A C   1 
ATOM 8374 O O   . THR A 1 1089 ? 23.846  33.348 15.075  1.00 45.94  ? 1086 THR A O   1 
ATOM 8375 C CB  . THR A 1 1089 ? 26.771  32.050 14.857  1.00 76.64  ? 1086 THR A CB  1 
ATOM 8376 O OG1 . THR A 1 1089 ? 27.993  32.231 15.586  1.00 76.64  ? 1086 THR A OG1 1 
ATOM 8377 C CG2 . THR A 1 1089 ? 27.009  31.167 13.608  1.00 76.64  ? 1086 THR A CG2 1 
ATOM 8378 N N   . GLY A 1 1090 ? 24.361  32.860 12.938  1.00 35.82  ? 1087 GLY A N   1 
ATOM 8379 C CA  . GLY A 1 1090 ? 22.984  32.606 12.549  1.00 35.82  ? 1087 GLY A CA  1 
ATOM 8380 C C   . GLY A 1 1090 ? 21.971  33.691 12.875  1.00 35.82  ? 1087 GLY A C   1 
ATOM 8381 O O   . GLY A 1 1090 ? 20.769  33.406 12.914  1.00 35.82  ? 1087 GLY A O   1 
ATOM 8382 N N   . PHE A 1 1091 ? 22.419  34.931 13.086  1.00 52.94  ? 1088 PHE A N   1 
ATOM 8383 C CA  . PHE A 1 1091 ? 21.507  36.011 13.458  1.00 52.94  ? 1088 PHE A CA  1 
ATOM 8384 C C   . PHE A 1 1091 ? 21.669  37.319 12.697  1.00 52.94  ? 1088 PHE A C   1 
ATOM 8385 O O   . PHE A 1 1091 ? 22.788  37.841 12.568  1.00 52.94  ? 1088 PHE A O   1 
ATOM 8386 C CB  . PHE A 1 1091 ? 21.608  36.297 14.960  1.00 44.58  ? 1088 PHE A CB  1 
ATOM 8387 C CG  . PHE A 1 1091 ? 20.661  35.502 15.783  1.00 44.58  ? 1088 PHE A CG  1 
ATOM 8388 C CD1 . PHE A 1 1091 ? 21.007  34.246 16.239  1.00 44.58  ? 1088 PHE A CD1 1 
ATOM 8389 C CD2 . PHE A 1 1091 ? 19.404  36.000 16.090  1.00 44.58  ? 1088 PHE A CD2 1 
ATOM 8390 C CE1 . PHE A 1 1091 ? 20.115  33.509 17.007  1.00 44.58  ? 1088 PHE A CE1 1 
ATOM 8391 C CE2 . PHE A 1 1091 ? 18.513  35.268 16.852  1.00 44.58  ? 1088 PHE A CE2 1 
ATOM 8392 C CZ  . PHE A 1 1091 ? 18.867  34.030 17.314  1.00 44.58  ? 1088 PHE A CZ  1 
ATOM 8393 N N   . ILE A 1 1092 ? 20.529  37.853 12.247  1.00 44.66  ? 1089 ILE A N   1 
ATOM 8394 C CA  . ILE A 1 1092 ? 20.454  39.186 11.648  1.00 44.66  ? 1089 ILE A CA  1 
ATOM 8395 C C   . ILE A 1 1092 ? 19.904  40.305 12.569  1.00 44.66  ? 1089 ILE A C   1 
ATOM 8396 O O   . ILE A 1 1092 ? 18.833  40.191 13.197  1.00 44.66  ? 1089 ILE A O   1 
ATOM 8397 C CB  . ILE A 1 1092 ? 19.739  39.133 10.302  1.00 70.64  ? 1089 ILE A CB  1 
ATOM 8398 C CG1 . ILE A 1 1092 ? 20.597  38.291 9.366   1.00 70.64  ? 1089 ILE A CG1 1 
ATOM 8399 C CG2 . ILE A 1 1092 ? 19.541  40.536 9.720   1.00 70.64  ? 1089 ILE A CG2 1 
ATOM 8400 C CD1 . ILE A 1 1092 ? 19.936  37.911 8.118   1.00 70.64  ? 1089 ILE A CD1 1 
ATOM 8401 N N   . ASP A 1 1093 ? 20.655  41.396 12.636  1.00 40.13  ? 1090 ASP A N   1 
ATOM 8402 C CA  . ASP A 1 1093 ? 20.291  42.534 13.437  1.00 40.13  ? 1090 ASP A CA  1 
ATOM 8403 C C   . ASP A 1 1093 ? 19.388  43.360 12.525  1.00 40.13  ? 1090 ASP A C   1 
ATOM 8404 O O   . ASP A 1 1093 ? 19.833  44.294 11.871  1.00 40.13  ? 1090 ASP A O   1 
ATOM 8405 C CB  . ASP A 1 1093 ? 21.587  43.282 13.826  1.00 35.88  ? 1090 ASP A CB  1 
ATOM 8406 C CG  . ASP A 1 1093 ? 21.364  44.482 14.730  1.00 35.88  ? 1090 ASP A CG  1 
ATOM 8407 O OD1 . ASP A 1 1093 ? 20.197  44.850 15.013  1.00 35.88  ? 1090 ASP A OD1 1 
ATOM 8408 O OD2 . ASP A 1 1093 ? 22.372  45.064 15.165  1.00 35.88  ? 1090 ASP A OD2 1 
ATOM 8409 N N   . GLY A 1 1094 ? 18.110  43.006 12.465  1.00 37.64  ? 1091 GLY A N   1 
ATOM 8410 C CA  . GLY A 1 1094 ? 17.169  43.702 11.578  1.00 37.64  ? 1091 GLY A CA  1 
ATOM 8411 C C   . GLY A 1 1094 ? 17.178  45.228 11.727  1.00 37.64  ? 1091 GLY A C   1 
ATOM 8412 O O   . GLY A 1 1094 ? 16.864  45.944 10.779  1.00 37.64  ? 1091 GLY A O   1 
ATOM 8413 N N   . ASP A 1 1095 ? 17.528  45.722 12.917  1.00 42.32  ? 1092 ASP A N   1 
ATOM 8414 C CA  . ASP A 1 1095 ? 17.537  47.147 13.180  1.00 42.32  ? 1092 ASP A CA  1 
ATOM 8415 C C   . ASP A 1 1095 ? 18.608  47.720 12.297  1.00 42.32  ? 1092 ASP A C   1 
ATOM 8416 O O   . ASP A 1 1095 ? 18.409  48.752 11.661  1.00 42.32  ? 1092 ASP A O   1 
ATOM 8417 C CB  . ASP A 1 1095 ? 17.854  47.447 14.648  1.00 39.05  ? 1092 ASP A CB  1 
ATOM 8418 C CG  . ASP A 1 1095 ? 16.651  47.252 15.568  1.00 39.05  ? 1092 ASP A CG  1 
ATOM 8419 O OD1 . ASP A 1 1095 ? 15.537  46.908 15.102  1.00 39.05  ? 1092 ASP A OD1 1 
ATOM 8420 O OD2 . ASP A 1 1095 ? 16.829  47.438 16.793  1.00 39.05  ? 1092 ASP A OD2 1 
ATOM 8421 N N   . LEU A 1 1096 ? 19.739  47.028 12.261  1.00 47.28  ? 1093 LEU A N   1 
ATOM 8422 C CA  . LEU A 1 1096 ? 20.857  47.425 11.437  1.00 47.28  ? 1093 LEU A CA  1 
ATOM 8423 C C   . LEU A 1 1096 ? 20.479  47.387 9.971   1.00 47.28  ? 1093 LEU A C   1 
ATOM 8424 O O   . LEU A 1 1096 ? 20.639  48.396 9.272   1.00 47.28  ? 1093 LEU A O   1 
ATOM 8425 C CB  . LEU A 1 1096 ? 22.069  46.519 11.687  1.00 42.70  ? 1093 LEU A CB  1 
ATOM 8426 C CG  . LEU A 1 1096 ? 23.421  47.077 11.242  1.00 42.70  ? 1093 LEU A CG  1 
ATOM 8427 C CD1 . LEU A 1 1096 ? 23.966  46.406 10.014  1.00 42.70  ? 1093 LEU A CD1 1 
ATOM 8428 C CD2 . LEU A 1 1096 ? 23.356  48.600 11.075  1.00 42.70  ? 1093 LEU A CD2 1 
ATOM 8429 N N   . ILE A 1 1097 ? 19.987  46.233 9.510   1.00 49.76  ? 1094 ILE A N   1 
ATOM 8430 C CA  . ILE A 1 1097 ? 19.539  46.115 8.117   1.00 49.76  ? 1094 ILE A CA  1 
ATOM 8431 C C   . ILE A 1 1097 ? 18.599  47.290 7.781   1.00 49.76  ? 1094 ILE A C   1 
ATOM 8432 O O   . ILE A 1 1097 ? 18.851  48.019 6.832   1.00 49.76  ? 1094 ILE A O   1 
ATOM 8433 C CB  . ILE A 1 1097 ? 18.909  44.718 7.747   1.00 32.00  ? 1094 ILE A CB  1 
ATOM 8434 C CG1 . ILE A 1 1097 ? 19.915  43.753 7.112   1.00 32.00  ? 1094 ILE A CG1 1 
ATOM 8435 C CG2 . ILE A 1 1097 ? 17.919  44.887 6.649   1.00 32.00  ? 1094 ILE A CG2 1 
ATOM 8436 C CD1 . ILE A 1 1097 ? 21.395  44.015 7.378   1.00 32.00  ? 1094 ILE A CD1 1 
ATOM 8437 N N   . GLU A 1 1098 ? 17.569  47.512 8.597   1.00 51.14  ? 1095 GLU A N   1 
ATOM 8438 C CA  . GLU A 1 1098 ? 16.611  48.577 8.329   1.00 51.14  ? 1095 GLU A CA  1 
ATOM 8439 C C   . GLU A 1 1098 ? 17.271  49.936 8.165   1.00 51.14  ? 1095 GLU A C   1 
ATOM 8440 O O   . GLU A 1 1098 ? 16.846  50.711 7.317   1.00 51.14  ? 1095 GLU A O   1 
ATOM 8441 C CB  . GLU A 1 1098 ? 15.477  48.613 9.363   1.00 37.27  ? 1095 GLU A CB  1 
ATOM 8442 C CG  . GLU A 1 1098 ? 14.432  47.474 9.201   1.00 37.27  ? 1095 GLU A CG  1 
ATOM 8443 C CD  . GLU A 1 1098 ? 13.137  47.611 10.098  1.00 37.27  ? 1095 GLU A CD  1 
ATOM 8444 O OE1 . GLU A 1 1098 ? 12.924  48.702 10.722  1.00 37.27  ? 1095 GLU A OE1 1 
ATOM 8445 O OE2 . GLU A 1 1098 ? 12.321  46.621 10.154  1.00 37.27  ? 1095 GLU A OE2 1 
ATOM 8446 N N   . SER A 1 1099 ? 18.327  50.219 8.925   1.00 55.60  ? 1096 SER A N   1 
ATOM 8447 C CA  . SER A 1 1099 ? 18.900  51.574 8.918   1.00 55.60  ? 1096 SER A CA  1 
ATOM 8448 C C   . SER A 1 1099 ? 19.615  51.912 7.605   1.00 55.60  ? 1096 SER A C   1 
ATOM 8449 O O   . SER A 1 1099 ? 20.220  52.981 7.458   1.00 55.60  ? 1096 SER A O   1 
ATOM 8450 C CB  . SER A 1 1099 ? 19.801  51.831 10.134  1.00 44.85  ? 1096 SER A CB  1 
ATOM 8451 O OG  . SER A 1 1099 ? 21.031  51.155 10.004  1.00 44.85  ? 1096 SER A OG  1 
ATOM 8452 N N   . PHE A 1 1100 ? 19.523  50.985 6.657   1.00 72.47  ? 1097 PHE A N   1 
ATOM 8453 C CA  . PHE A 1 1100 ? 20.029  51.180 5.308   1.00 72.47  ? 1097 PHE A CA  1 
ATOM 8454 C C   . PHE A 1 1100 ? 19.274  52.263 4.554   1.00 72.47  ? 1097 PHE A C   1 
ATOM 8455 O O   . PHE A 1 1100 ? 19.799  52.794 3.567   1.00 72.47  ? 1097 PHE A O   1 
ATOM 8456 C CB  . PHE A 1 1100 ? 19.939  49.875 4.532   1.00 67.26  ? 1097 PHE A CB  1 
ATOM 8457 C CG  . PHE A 1 1100 ? 20.027  50.040 3.037   1.00 67.26  ? 1097 PHE A CG  1 
ATOM 8458 C CD1 . PHE A 1 1100 ? 21.262  50.151 2.405   1.00 67.26  ? 1097 PHE A CD1 1 
ATOM 8459 C CD2 . PHE A 1 1100 ? 18.863  50.053 2.249   1.00 67.26  ? 1097 PHE A CD2 1 
ATOM 8460 C CE1 . PHE A 1 1100 ? 21.335  50.283 1.027   1.00 67.26  ? 1097 PHE A CE1 1 
ATOM 8461 C CE2 . PHE A 1 1100 ? 18.937  50.191 0.855   1.00 67.26  ? 1097 PHE A CE2 1 
ATOM 8462 C CZ  . PHE A 1 1100 ? 20.168  50.306 0.251   1.00 67.26  ? 1097 PHE A CZ  1 
ATOM 8463 N N   . LEU A 1 1101 ? 18.055  52.581 5.011   1.00 38.14  ? 1098 LEU A N   1 
ATOM 8464 C CA  . LEU A 1 1101 ? 17.164  53.480 4.269   1.00 38.14  ? 1098 LEU A CA  1 
ATOM 8465 C C   . LEU A 1 1101 ? 17.428  54.884 4.685   1.00 38.14  ? 1098 LEU A C   1 
ATOM 8466 O O   . LEU A 1 1101 ? 16.900  55.803 4.055   1.00 38.14  ? 1098 LEU A O   1 
ATOM 8467 C CB  . LEU A 1 1101 ? 15.684  53.203 4.503   1.00 38.29  ? 1098 LEU A CB  1 
ATOM 8468 C CG  . LEU A 1 1101 ? 15.038  51.833 4.280   1.00 38.29  ? 1098 LEU A CG  1 
ATOM 8469 C CD1 . LEU A 1 1101 ? 13.666  51.837 4.957   1.00 38.29  ? 1098 LEU A CD1 1 
ATOM 8470 C CD2 . LEU A 1 1101 ? 14.940  51.374 2.791   1.00 38.29  ? 1098 LEU A CD2 1 
ATOM 8471 N N   . ASP A 1 1102 ? 18.203  55.065 5.745   1.00 66.91  ? 1099 ASP A N   1 
ATOM 8472 C CA  . ASP A 1 1102 ? 18.426  56.389 6.290   1.00 66.91  ? 1099 ASP A CA  1 
ATOM 8473 C C   . ASP A 1 1102 ? 19.655  57.035 5.698   1.00 66.91  ? 1099 ASP A C   1 
ATOM 8474 O O   . ASP A 1 1102 ? 19.801  58.256 5.752   1.00 66.91  ? 1099 ASP A O   1 
ATOM 8475 C CB  . ASP A 1 1102 ? 18.581  56.309 7.801   1.00 90.78  ? 1099 ASP A CB  1 
ATOM 8476 C CG  . ASP A 1 1102 ? 17.279  56.455 8.512   1.00 90.78  ? 1099 ASP A CG  1 
ATOM 8477 O OD1 . ASP A 1 1102 ? 17.299  56.521 9.763   1.00 90.78  ? 1099 ASP A OD1 1 
ATOM 8478 O OD2 . ASP A 1 1102 ? 16.239  56.522 7.815   1.00 90.78  ? 1099 ASP A OD2 1 
ATOM 8479 N N   . ILE A 1 1103 ? 20.539  56.211 5.146   1.00 79.93  ? 1100 ILE A N   1 
ATOM 8480 C CA  . ILE A 1 1103 ? 21.814  56.695 4.623   1.00 79.93  ? 1100 ILE A CA  1 
ATOM 8481 C C   . ILE A 1 1103 ? 21.662  57.381 3.258   1.00 79.93  ? 1100 ILE A C   1 
ATOM 8482 O O   . ILE A 1 1103 ? 20.633  57.226 2.599   1.00 79.93  ? 1100 ILE A O   1 
ATOM 8483 C CB  . ILE A 1 1103 ? 22.892  55.577 4.620   1.00 42.31  ? 1100 ILE A CB  1 
ATOM 8484 C CG1 . ILE A 1 1103 ? 22.594  54.503 3.565   1.00 42.31  ? 1100 ILE A CG1 1 
ATOM 8485 C CG2 . ILE A 1 1103 ? 23.013  54.986 6.021   1.00 42.31  ? 1100 ILE A CG2 1 
ATOM 8486 C CD1 . ILE A 1 1103 ? 23.609  53.354 3.550   1.00 42.31  ? 1100 ILE A CD1 1 
ATOM 8487 N N   . SER A 1 1104 ? 22.669  58.155 2.856   1.00 123.95 ? 1101 SER A N   1 
ATOM 8488 C CA  . SER A 1 1104 ? 22.578  58.969 1.641   1.00 123.95 ? 1101 SER A CA  1 
ATOM 8489 C C   . SER A 1 1104 ? 22.802  58.139 0.379   1.00 123.95 ? 1101 SER A C   1 
ATOM 8490 O O   . SER A 1 1104 ? 23.438  57.087 0.434   1.00 123.95 ? 1101 SER A O   1 
ATOM 8491 C CB  . SER A 1 1104 ? 23.567  60.133 1.703   1.00 86.24  ? 1101 SER A CB  1 
ATOM 8492 O OG  . SER A 1 1104 ? 24.900  59.653 1.734   1.00 86.24  ? 1101 SER A OG  1 
ATOM 8493 N N   . ARG A 1 1105 ? 22.273  58.624 -0.748  1.00 115.68 ? 1102 ARG A N   1 
ATOM 8494 C CA  . ARG A 1 1105 ? 22.394  57.938 -2.050  1.00 115.68 ? 1102 ARG A CA  1 
ATOM 8495 C C   . ARG A 1 1105 ? 23.835  57.533 -2.413  1.00 115.68 ? 1102 ARG A C   1 
ATOM 8496 O O   . ARG A 1 1105 ? 24.056  56.404 -2.867  1.00 115.68 ? 1102 ARG A O   1 
ATOM 8497 C CB  . ARG A 1 1105 ? 21.747  58.747 -3.191  1.00 109.00 ? 1102 ARG A CB  1 
ATOM 8498 C CG  . ARG A 1 1105 ? 20.242  58.492 -3.404  1.00 109.00 ? 1102 ARG A CG  1 
ATOM 8499 C CD  . ARG A 1 1105 ? 19.824  58.638 -4.877  1.00 109.00 ? 1102 ARG A CD  1 
ATOM 8500 N NE  . ARG A 1 1105 ? 20.420  57.615 -5.749  1.00 109.00 ? 1102 ARG A NE  1 
ATOM 8501 C CZ  . ARG A 1 1105 ? 19.834  56.473 -6.111  1.00 109.00 ? 1102 ARG A CZ  1 
ATOM 8502 N NH1 . ARG A 1 1105 ? 18.611  56.169 -5.690  1.00 109.00 ? 1102 ARG A NH1 1 
ATOM 8503 N NH2 . ARG A 1 1105 ? 20.479  55.626 -6.901  1.00 109.00 ? 1102 ARG A NH2 1 
ATOM 8504 N N   . PRO A 1 1106 ? 24.812  58.453 -2.226  1.00 65.27  ? 1103 PRO A N   1 
ATOM 8505 C CA  . PRO A 1 1106 ? 26.226  58.058 -2.329  1.00 65.27  ? 1103 PRO A CA  1 
ATOM 8506 C C   . PRO A 1 1106 ? 26.570  56.841 -1.471  1.00 65.27  ? 1103 PRO A C   1 
ATOM 8507 O O   . PRO A 1 1106 ? 27.131  55.864 -1.993  1.00 65.27  ? 1103 PRO A O   1 
ATOM 8508 C CB  . PRO A 1 1106 ? 26.993  59.295 -1.829  1.00 85.99  ? 1103 PRO A CB  1 
ATOM 8509 C CG  . PRO A 1 1106 ? 25.952  60.232 -1.267  1.00 85.99  ? 1103 PRO A CG  1 
ATOM 8510 C CD  . PRO A 1 1106 ? 24.669  59.894 -1.947  1.00 85.99  ? 1103 PRO A CD  1 
ATOM 8511 N N   . LYS A 1 1107 ? 26.216  56.887 -0.180  1.00 63.45  ? 1104 LYS A N   1 
ATOM 8512 C CA  . LYS A 1 1107 ? 26.558  55.798 0.752   1.00 63.45  ? 1104 LYS A CA  1 
ATOM 8513 C C   . LYS A 1 1107 ? 25.812  54.472 0.477   1.00 63.45  ? 1104 LYS A C   1 
ATOM 8514 O O   . LYS A 1 1107 ? 26.359  53.392 0.704   1.00 63.45  ? 1104 LYS A O   1 
ATOM 8515 C CB  . LYS A 1 1107 ? 26.429  56.266 2.203   1.00 98.38  ? 1104 LYS A CB  1 
ATOM 8516 C CG  . LYS A 1 1107 ? 27.560  57.206 2.620   1.00 98.38  ? 1104 LYS A CG  1 
ATOM 8517 C CD  . LYS A 1 1107 ? 27.713  57.304 4.133   1.00 98.38  ? 1104 LYS A CD  1 
ATOM 8518 C CE  . LYS A 1 1107 ? 28.973  58.091 4.532   1.00 98.38  ? 1104 LYS A CE  1 
ATOM 8519 N NZ  . LYS A 1 1107 ? 28.931  58.662 5.930   1.00 98.38  ? 1104 LYS A NZ  1 
ATOM 8520 N N   . MET A 1 1108 ? 24.584  54.557 -0.037  1.00 66.68  ? 1105 MET A N   1 
ATOM 8521 C CA  . MET A 1 1108 ? 23.870  53.393 -0.556  1.00 66.68  ? 1105 MET A CA  1 
ATOM 8522 C C   . MET A 1 1108 ? 24.679  52.665 -1.646  1.00 66.68  ? 1105 MET A C   1 
ATOM 8523 O O   . MET A 1 1108 ? 25.003  51.484 -1.498  1.00 66.68  ? 1105 MET A O   1 
ATOM 8524 C CB  . MET A 1 1108 ? 22.515  53.807 -1.128  1.00 67.62  ? 1105 MET A CB  1 
ATOM 8525 C CG  . MET A 1 1108 ? 21.515  54.343 -0.135  1.00 67.62  ? 1105 MET A CG  1 
ATOM 8526 S SD  . MET A 1 1108 ? 19.830  53.851 -0.630  1.00 67.62  ? 1105 MET A SD  1 
ATOM 8527 C CE  . MET A 1 1108 ? 19.088  55.465 -0.971  1.00 67.62  ? 1105 MET A CE  1 
ATOM 8528 N N   . GLN A 1 1109 ? 25.011  53.379 -2.728  1.00 80.96  ? 1106 GLN A N   1 
ATOM 8529 C CA  . GLN A 1 1109 ? 25.789  52.815 -3.852  1.00 80.96  ? 1106 GLN A CA  1 
ATOM 8530 C C   . GLN A 1 1109 ? 27.067  52.125 -3.375  1.00 80.96  ? 1106 GLN A C   1 
ATOM 8531 O O   . GLN A 1 1109 ? 27.419  51.048 -3.876  1.00 80.96  ? 1106 GLN A O   1 
ATOM 8532 C CB  . GLN A 1 1109 ? 26.153  53.896 -4.889  1.00 92.72  ? 1106 GLN A CB  1 
ATOM 8533 C CG  . GLN A 1 1109 ? 24.982  54.665 -5.525  1.00 92.72  ? 1106 GLN A CG  1 
ATOM 8534 C CD  . GLN A 1 1109 ? 24.084  53.826 -6.446  1.00 92.72  ? 1106 GLN A CD  1 
ATOM 8535 O OE1 . GLN A 1 1109 ? 22.955  54.226 -6.760  1.00 92.72  ? 1106 GLN A OE1 1 
ATOM 8536 N NE2 . GLN A 1 1109 ? 24.580  52.668 -6.881  1.00 92.72  ? 1106 GLN A NE2 1 
ATOM 8537 N N   . GLU A 1 1110 ? 27.736  52.766 -2.405  1.00 87.76  ? 1107 GLU A N   1 
ATOM 8538 C CA  . GLU A 1 1110 ? 28.961  52.274 -1.756  1.00 87.76  ? 1107 GLU A CA  1 
ATOM 8539 C C   . GLU A 1 1110 ? 28.885  50.798 -1.395  1.00 87.76  ? 1107 GLU A C   1 
ATOM 8540 O O   . GLU A 1 1110 ? 29.867  50.053 -1.512  1.00 87.76  ? 1107 GLU A O   1 
ATOM 8541 C CB  . GLU A 1 1110 ? 29.232  53.055 -0.472  1.00 84.15  ? 1107 GLU A CB  1 
ATOM 8542 C CG  . GLU A 1 1110 ? 30.016  54.341 -0.620  1.00 84.15  ? 1107 GLU A CG  1 
ATOM 8543 C CD  . GLU A 1 1110 ? 30.916  54.601 0.586   1.00 84.15  ? 1107 GLU A CD  1 
ATOM 8544 O OE1 . GLU A 1 1110 ? 31.671  53.680 0.987   1.00 84.15  ? 1107 GLU A OE1 1 
ATOM 8545 O OE2 . GLU A 1 1110 ? 30.874  55.726 1.128   1.00 84.15  ? 1107 GLU A OE2 1 
ATOM 8546 N N   . VAL A 1 1111 ? 27.684  50.350 -1.037  1.00 162.75 ? 1108 VAL A N   1 
ATOM 8547 C CA  . VAL A 1 1111 ? 27.463  48.944 -0.704  1.00 162.75 ? 1108 VAL A CA  1 
ATOM 8548 C C   . VAL A 1 1111 ? 26.370  48.247 -1.528  1.00 162.75 ? 1108 VAL A C   1 
ATOM 8549 O O   . VAL A 1 1111 ? 25.359  47.811 -0.976  1.00 162.75 ? 1108 VAL A O   1 
ATOM 8550 C CB  . VAL A 1 1111 ? 27.139  48.770 0.794   1.00 89.09  ? 1108 VAL A CB  1 
ATOM 8551 C CG1 . VAL A 1 1111 ? 26.853  47.309 1.108   1.00 89.09  ? 1108 VAL A CG1 1 
ATOM 8552 C CG2 . VAL A 1 1111 ? 28.285  49.291 1.648   1.00 89.09  ? 1108 VAL A CG2 1 
ATOM 8553 N N   . VAL A 1 1112 ? 26.579  48.129 -2.838  1.00 92.80  ? 1109 VAL A N   1 
ATOM 8554 C CA  . VAL A 1 1112 ? 25.700  47.305 -3.697  1.00 92.80  ? 1109 VAL A CA  1 
ATOM 8555 C C   . VAL A 1 1112 ? 26.818  46.720 -4.591  1.00 92.80  ? 1109 VAL A C   1 
ATOM 8556 O O   . VAL A 1 1112 ? 26.749  45.552 -4.961  1.00 92.80  ? 1109 VAL A O   1 
ATOM 8557 C CB  . VAL A 1 1112 ? 24.945  48.421 -4.461  1.00 91.61  ? 1109 VAL A CB  1 
ATOM 8558 C CG1 . VAL A 1 1112 ? 24.765  48.057 -5.932  1.00 91.61  ? 1109 VAL A CG1 1 
ATOM 8559 C CG2 . VAL A 1 1112 ? 23.608  48.671 -3.813  1.00 91.61  ? 1109 VAL A CG2 1 
ATOM 8560 N N   . ALA A 1 1113 ? 27.813  47.541 -4.945  1.00 118.37 ? 1110 ALA A N   1 
ATOM 8561 C CA  . ALA A 1 1113 ? 28.926  47.143 -5.821  1.00 118.37 ? 1110 ALA A CA  1 
ATOM 8562 C C   . ALA A 1 1113 ? 28.727  45.796 -6.522  1.00 118.37 ? 1110 ALA A C   1 
ATOM 8563 O O   . ALA A 1 1113 ? 28.568  45.749 -7.744  1.00 118.37 ? 1110 ALA A O   1 
ATOM 8564 C CB  . ALA A 1 1113 ? 30.257  47.177 -5.056  1.00 66.48  ? 1110 ALA A CB  1 
ATOM 8565 N N   . ASN A 1 1114 ? 28.729  44.715 -5.735  1.00 88.22  ? 1111 ASN A N   1 
ATOM 8566 C CA  . ASN A 1 1114 ? 28.556  43.330 -6.233  1.00 88.22  ? 1111 ASN A CA  1 
ATOM 8567 C C   . ASN A 1 1114 ? 27.816  42.379 -5.276  1.00 88.22  ? 1111 ASN A C   1 
ATOM 8568 O O   . ASN A 1 1114 ? 26.973  41.578 -5.696  1.00 88.22  ? 1111 ASN A O   1 
ATOM 8569 C CB  . ASN A 1 1114 ? 29.905  42.719 -6.665  1.00 87.72  ? 1111 ASN A CB  1 
ATOM 8570 C CG  . ASN A 1 1114 ? 31.114  43.503 -6.143  1.00 87.72  ? 1111 ASN A CG  1 
ATOM 8571 O OD1 . ASN A 1 1114 ? 31.716  43.133 -5.129  1.00 87.72  ? 1111 ASN A OD1 1 
ATOM 8572 N ND2 . ASN A 1 1114 ? 31.473  44.587 -6.840  1.00 87.72  ? 1111 ASN A ND2 1 
ATOM 8573 N N   . ARG A 1 1125 ? 21.580  36.802 -11.331 1.00 177.83 ? 1122 ARG A N   1 
ATOM 8574 C CA  . ARG A 1 1125 ? 21.688  37.787 -10.259 1.00 177.83 ? 1122 ARG A CA  1 
ATOM 8575 C C   . ARG A 1 1125 ? 22.263  39.127 -10.736 1.00 177.83 ? 1122 ARG A C   1 
ATOM 8576 O O   . ARG A 1 1125 ? 22.955  39.194 -11.756 1.00 177.83 ? 1122 ARG A O   1 
ATOM 8577 C CB  . ARG A 1 1125 ? 22.490  37.228 -9.072  1.00 134.18 ? 1122 ARG A CB  1 
ATOM 8578 C CG  . ARG A 1 1125 ? 23.726  36.415 -9.438  1.00 134.18 ? 1122 ARG A CG  1 
ATOM 8579 C CD  . ARG A 1 1125 ? 24.720  36.412 -8.280  1.00 134.18 ? 1122 ARG A CD  1 
ATOM 8580 N NE  . ARG A 1 1125 ? 25.960  35.690 -8.592  1.00 134.18 ? 1122 ARG A NE  1 
ATOM 8581 C CZ  . ARG A 1 1125 ? 27.188  36.094 -8.247  1.00 134.18 ? 1122 ARG A CZ  1 
ATOM 8582 N NH1 . ARG A 1 1125 ? 27.379  37.238 -7.588  1.00 134.18 ? 1122 ARG A NH1 1 
ATOM 8583 N NH2 . ARG A 1 1125 ? 28.241  35.359 -8.579  1.00 134.18 ? 1122 ARG A NH2 1 
ATOM 8584 N N   . GLU A 1 1126 ? 21.952  40.188 -9.991  1.00 115.41 ? 1123 GLU A N   1 
ATOM 8585 C CA  . GLU A 1 1126 ? 22.380  41.549 -10.316 1.00 115.41 ? 1123 GLU A CA  1 
ATOM 8586 C C   . GLU A 1 1126 ? 22.920  42.201 -9.045  1.00 115.41 ? 1123 GLU A C   1 
ATOM 8587 O O   . GLU A 1 1126 ? 23.338  41.503 -8.120  1.00 115.41 ? 1123 GLU A O   1 
ATOM 8588 C CB  . GLU A 1 1126 ? 21.192  42.355 -10.860 1.00 103.63 ? 1123 GLU A CB  1 
ATOM 8589 C CG  . GLU A 1 1126 ? 20.330  41.615 -11.889 1.00 103.63 ? 1123 GLU A CG  1 
ATOM 8590 C CD  . GLU A 1 1126 ? 18.834  41.799 -11.660 1.00 103.63 ? 1123 GLU A CD  1 
ATOM 8591 O OE1 . GLU A 1 1126 ? 18.407  41.914 -10.488 1.00 103.63 ? 1123 GLU A OE1 1 
ATOM 8592 O OE2 . GLU A 1 1126 ? 18.079  41.809 -12.657 1.00 103.63 ? 1123 GLU A OE2 1 
ATOM 8593 N N   . ALA A 1 1127 ? 22.895  43.533 -9.001  1.00 154.74 ? 1124 ALA A N   1 
ATOM 8594 C CA  . ALA A 1 1127 ? 23.278  44.291 -7.807  1.00 154.74 ? 1124 ALA A CA  1 
ATOM 8595 C C   . ALA A 1 1127 ? 22.958  45.801 -7.945  1.00 154.74 ? 1124 ALA A C   1 
ATOM 8596 O O   . ALA A 1 1127 ? 23.631  46.511 -8.700  1.00 154.74 ? 1124 ALA A O   1 
ATOM 8597 C CB  . ALA A 1 1127 ? 24.777  44.048 -7.475  1.00 44.16  ? 1124 ALA A CB  1 
ATOM 8598 N N   . THR A 1 1128 ? 21.939  46.278 -7.214  1.00 113.41 ? 1125 THR A N   1 
ATOM 8599 C CA  . THR A 1 1128 ? 21.434  47.671 -7.331  1.00 113.41 ? 1125 THR A CA  1 
ATOM 8600 C C   . THR A 1 1128 ? 20.864  48.237 -6.014  1.00 113.41 ? 1125 THR A C   1 
ATOM 8601 O O   . THR A 1 1128 ? 20.330  47.480 -5.207  1.00 113.41 ? 1125 THR A O   1 
ATOM 8602 C CB  . THR A 1 1128 ? 20.295  47.747 -8.344  1.00 105.05 ? 1125 THR A CB  1 
ATOM 8603 O OG1 . THR A 1 1128 ? 19.987  46.430 -8.831  1.00 105.05 ? 1125 THR A OG1 1 
ATOM 8604 C CG2 . THR A 1 1128 ? 20.651  48.692 -9.476  1.00 105.05 ? 1125 THR A CG2 1 
ATOM 8605 N N   . ALA A 1 1129 ? 20.940  49.556 -5.803  1.00 96.26  ? 1126 ALA A N   1 
ATOM 8606 C CA  . ALA A 1 1129 ? 20.428  50.156 -4.553  1.00 96.26  ? 1126 ALA A CA  1 
ATOM 8607 C C   . ALA A 1 1129 ? 18.910  50.216 -4.527  1.00 96.26  ? 1126 ALA A C   1 
ATOM 8608 O O   . ALA A 1 1129 ? 18.285  49.681 -3.613  1.00 96.26  ? 1126 ALA A O   1 
ATOM 8609 C CB  . ALA A 1 1129 ? 21.031  51.539 -4.278  1.00 26.65  ? 1126 ALA A CB  1 
ATOM 8610 N N   . ASP A 1 1130 ? 18.329  50.876 -5.527  1.00 79.97  ? 1127 ASP A N   1 
ATOM 8611 C CA  . ASP A 1 1130 ? 16.880  50.850 -5.776  1.00 79.97  ? 1127 ASP A CA  1 
ATOM 8612 C C   . ASP A 1 1130 ? 16.322  49.442 -5.526  1.00 79.97  ? 1127 ASP A C   1 
ATOM 8613 O O   . ASP A 1 1130 ? 15.220  49.280 -5.008  1.00 79.97  ? 1127 ASP A O   1 
ATOM 8614 C CB  . ASP A 1 1130 ? 16.581  51.267 -7.224  1.00 139.09 ? 1127 ASP A CB  1 
ATOM 8615 C CG  . ASP A 1 1130 ? 17.651  52.186 -7.819  1.00 139.09 ? 1127 ASP A CG  1 
ATOM 8616 O OD1 . ASP A 1 1130 ? 17.266  53.182 -8.468  1.00 139.09 ? 1127 ASP A OD1 1 
ATOM 8617 O OD2 . ASP A 1 1130 ? 18.868  51.915 -7.654  1.00 139.09 ? 1127 ASP A OD2 1 
ATOM 8618 N N   . ASP A 1 1131 ? 17.111  48.436 -5.901  1.00 134.63 ? 1128 ASP A N   1 
ATOM 8619 C CA  . ASP A 1 1131 ? 16.776  47.028 -5.721  1.00 134.63 ? 1128 ASP A CA  1 
ATOM 8620 C C   . ASP A 1 1131 ? 16.798  46.642 -4.242  1.00 134.63 ? 1128 ASP A C   1 
ATOM 8621 O O   . ASP A 1 1131 ? 15.927  45.900 -3.785  1.00 134.63 ? 1128 ASP A O   1 
ATOM 8622 C CB  . ASP A 1 1131 ? 17.783  46.171 -6.495  1.00 145.04 ? 1128 ASP A CB  1 
ATOM 8623 C CG  . ASP A 1 1131 ? 17.188  44.888 -7.048  1.00 145.04 ? 1128 ASP A CG  1 
ATOM 8624 O OD1 . ASP A 1 1131 ? 17.626  44.484 -8.146  1.00 145.04 ? 1128 ASP A OD1 1 
ATOM 8625 O OD2 . ASP A 1 1131 ? 16.311  44.277 -6.399  1.00 145.04 ? 1128 ASP A OD2 1 
ATOM 8626 N N   . LEU A 1 1132 ? 17.793  47.144 -3.506  1.00 55.21  ? 1129 LEU A N   1 
ATOM 8627 C CA  . LEU A 1 1132 ? 17.965  46.828 -2.064  1.00 55.21  ? 1129 LEU A CA  1 
ATOM 8628 C C   . LEU A 1 1132 ? 16.908  47.432 -1.180  1.00 55.21  ? 1129 LEU A C   1 
ATOM 8629 O O   . LEU A 1 1132 ? 16.414  46.781 -0.262  1.00 55.21  ? 1129 LEU A O   1 
ATOM 8630 C CB  . LEU A 1 1132 ? 19.297  47.324 -1.536  1.00 67.36  ? 1129 LEU A CB  1 
ATOM 8631 C CG  . LEU A 1 1132 ? 20.457  46.348 -1.429  1.00 67.36  ? 1129 LEU A CG  1 
ATOM 8632 C CD1 . LEU A 1 1132 ? 21.552  47.017 -0.576  1.00 67.36  ? 1129 LEU A CD1 1 
ATOM 8633 C CD2 . LEU A 1 1132 ? 20.022  44.997 -0.855  1.00 67.36  ? 1129 LEU A CD2 1 
ATOM 8634 N N   . ILE A 1 1133 ? 16.591  48.693 -1.445  1.00 63.46  ? 1130 ILE A N   1 
ATOM 8635 C CA  . ILE A 1 1133 ? 15.502  49.378 -0.758  1.00 63.46  ? 1130 ILE A CA  1 
ATOM 8636 C C   . ILE A 1 1133 ? 14.123  48.705 -1.000  1.00 63.46  ? 1130 ILE A C   1 
ATOM 8637 O O   . ILE A 1 1133 ? 13.204  48.885 -0.219  1.00 63.46  ? 1130 ILE A O   1 
ATOM 8638 C CB  . ILE A 1 1133 ? 15.564  50.945 -0.989  1.00 79.61  ? 1130 ILE A CB  1 
ATOM 8639 C CG1 . ILE A 1 1133 ? 14.350  51.686 -0.415  1.00 79.61  ? 1130 ILE A CG1 1 
ATOM 8640 C CG2 . ILE A 1 1133 ? 15.797  51.297 -2.435  1.00 79.61  ? 1130 ILE A CG2 1 
ATOM 8641 C CD1 . ILE A 1 1133 ? 14.588  53.195 -0.129  1.00 79.61  ? 1130 ILE A CD1 1 
ATOM 8642 N N   . LYS A 1 1134 ? 13.997  47.884 -2.042  1.00 90.83  ? 1131 LYS A N   1 
ATOM 8643 C CA  . LYS A 1 1134 ? 12.782  47.074 -2.224  1.00 90.83  ? 1131 LYS A CA  1 
ATOM 8644 C C   . LYS A 1 1134 ? 12.743  46.005 -1.146  1.00 90.83  ? 1131 LYS A C   1 
ATOM 8645 O O   . LYS A 1 1134 ? 11.753  45.849 -0.429  1.00 90.83  ? 1131 LYS A O   1 
ATOM 8646 C CB  . LYS A 1 1134 ? 12.744  46.423 -3.616  1.00 130.13 ? 1131 LYS A CB  1 
ATOM 8647 C CG  . LYS A 1 1134 ? 11.849  45.176 -3.712  1.00 130.13 ? 1131 LYS A CG  1 
ATOM 8648 C CD  . LYS A 1 1134 ? 12.210  44.288 -4.909  1.00 130.13 ? 1131 LYS A CD  1 
ATOM 8649 C CE  . LYS A 1 1134 ? 11.324  44.612 -6.120  1.00 130.13 ? 1131 LYS A CE  1 
ATOM 8650 N NZ  . LYS A 1 1134 ? 11.343  43.533 -7.151  1.00 130.13 ? 1131 LYS A NZ  1 
ATOM 8651 N N   . VAL A 1 1135 ? 13.850  45.282 -1.050  1.00 85.80  ? 1132 VAL A N   1 
ATOM 8652 C CA  . VAL A 1 1135 ? 14.019  44.212 -0.087  1.00 85.80  ? 1132 VAL A CA  1 
ATOM 8653 C C   . VAL A 1 1135 ? 13.907  44.679 1.373   1.00 85.80  ? 1132 VAL A C   1 
ATOM 8654 O O   . VAL A 1 1135 ? 13.322  43.981 2.198   1.00 85.80  ? 1132 VAL A O   1 
ATOM 8655 C CB  . VAL A 1 1135 ? 15.353  43.490 -0.340  1.00 87.17  ? 1132 VAL A CB  1 
ATOM 8656 C CG1 . VAL A 1 1135 ? 15.843  42.775 0.900   1.00 87.17  ? 1132 VAL A CG1 1 
ATOM 8657 C CG2 . VAL A 1 1135 ? 15.201  42.522 -1.500  1.00 87.17  ? 1132 VAL A CG2 1 
ATOM 8658 N N   . VAL A 1 1136 ? 14.459  45.854 1.683   1.00 61.16  ? 1133 VAL A N   1 
ATOM 8659 C CA  . VAL A 1 1136 ? 14.374  46.396 3.033   1.00 61.16  ? 1133 VAL A CA  1 
ATOM 8660 C C   . VAL A 1 1136 ? 12.962  46.935 3.358   1.00 61.16  ? 1133 VAL A C   1 
ATOM 8661 O O   . VAL A 1 1136 ? 12.422  46.665 4.436   1.00 61.16  ? 1133 VAL A O   1 
ATOM 8662 C CB  . VAL A 1 1136 ? 15.512  47.403 3.333   1.00 40.88  ? 1133 VAL A CB  1 
ATOM 8663 C CG1 . VAL A 1 1136 ? 15.313  48.070 4.671   1.00 40.88  ? 1133 VAL A CG1 1 
ATOM 8664 C CG2 . VAL A 1 1136 ? 16.884  46.681 3.350   1.00 40.88  ? 1133 VAL A CG2 1 
ATOM 8665 N N   . GLU A 1 1137 ? 12.349  47.652 2.419   1.00 69.72  ? 1134 GLU A N   1 
ATOM 8666 C CA  . GLU A 1 1137 ? 10.961  48.116 2.579   1.00 69.72  ? 1134 GLU A CA  1 
ATOM 8667 C C   . GLU A 1 1137 ? 10.046  46.935 2.828   1.00 69.72  ? 1134 GLU A C   1 
ATOM 8668 O O   . GLU A 1 1137 ? 9.068   47.041 3.556   1.00 69.72  ? 1134 GLU A O   1 
ATOM 8669 C CB  . GLU A 1 1137 ? 10.480  48.848 1.328   1.00 102.81 ? 1134 GLU A CB  1 
ATOM 8670 C CG  . GLU A 1 1137 ? 10.946  50.294 1.186   1.00 102.81 ? 1134 GLU A CG  1 
ATOM 8671 C CD  . GLU A 1 1137 ? 10.347  50.988 -0.038  1.00 102.81 ? 1134 GLU A CD  1 
ATOM 8672 O OE1 . GLU A 1 1137 ? 9.553   50.348 -0.761  1.00 102.81 ? 1134 GLU A OE1 1 
ATOM 8673 O OE2 . GLU A 1 1137 ? 10.663  52.174 -0.273  1.00 102.81 ? 1134 GLU A OE2 1 
ATOM 8674 N N   . GLU A 1 1138 ? 10.374  45.812 2.201   1.00 85.81  ? 1135 GLU A N   1 
ATOM 8675 C CA  . GLU A 1 1138 ? 9.611   44.585 2.356   1.00 85.81  ? 1135 GLU A CA  1 
ATOM 8676 C C   . GLU A 1 1138 ? 9.830   43.921 3.715   1.00 85.81  ? 1135 GLU A C   1 
ATOM 8677 O O   . GLU A 1 1138 ? 8.934   43.247 4.238   1.00 85.81  ? 1135 GLU A O   1 
ATOM 8678 C CB  . GLU A 1 1138 ? 9.951   43.619 1.223   1.00 91.63  ? 1135 GLU A CB  1 
ATOM 8679 C CG  . GLU A 1 1138 ? 8.766   43.223 0.369   1.00 91.63  ? 1135 GLU A CG  1 
ATOM 8680 C CD  . GLU A 1 1138 ? 8.386   41.772 0.565   1.00 91.63  ? 1135 GLU A CD  1 
ATOM 8681 O OE1 . GLU A 1 1138 ? 7.283   41.509 1.097   1.00 91.63  ? 1135 GLU A OE1 1 
ATOM 8682 O OE2 . GLU A 1 1138 ? 9.206   40.901 0.188   1.00 91.63  ? 1135 GLU A OE2 1 
ATOM 8683 N N   . LEU A 1 1139 ? 11.031  44.111 4.262   1.00 63.83  ? 1136 LEU A N   1 
ATOM 8684 C CA  . LEU A 1 1139 ? 11.398  43.602 5.581   1.00 63.83  ? 1136 LEU A CA  1 
ATOM 8685 C C   . LEU A 1 1139 ? 10.785  44.444 6.706   1.00 63.83  ? 1136 LEU A C   1 
ATOM 8686 O O   . LEU A 1 1139 ? 10.428  43.928 7.760   1.00 63.83  ? 1136 LEU A O   1 
ATOM 8687 C CB  . LEU A 1 1139 ? 12.916  43.575 5.723   1.00 43.53  ? 1136 LEU A CB  1 
ATOM 8688 C CG  . LEU A 1 1139 ? 13.713  42.342 5.236   1.00 43.53  ? 1136 LEU A CG  1 
ATOM 8689 C CD1 . LEU A 1 1139 ? 15.210  42.580 5.455   1.00 43.53  ? 1136 LEU A CD1 1 
ATOM 8690 C CD2 . LEU A 1 1139 ? 13.300  40.964 5.836   1.00 43.53  ? 1136 LEU A CD2 1 
ATOM 8691 N N   . THR A 1 1140 ? 10.653  45.742 6.468   1.00 46.59  ? 1137 THR A N   1 
ATOM 8692 C CA  . THR A 1 1140 ? 10.133  46.654 7.478   1.00 46.59  ? 1137 THR A CA  1 
ATOM 8693 C C   . THR A 1 1140 ? 8.709   46.347 7.934   1.00 46.59  ? 1137 THR A C   1 
ATOM 8694 O O   . THR A 1 1140 ? 8.296   46.770 9.016   1.00 46.59  ? 1137 THR A O   1 
ATOM 8695 C CB  . THR A 1 1140 ? 10.137  48.113 6.973   1.00 53.44  ? 1137 THR A CB  1 
ATOM 8696 O OG1 . THR A 1 1140 ? 9.435   48.177 5.727   1.00 53.44  ? 1137 THR A OG1 1 
ATOM 8697 C CG2 . THR A 1 1140 ? 11.591  48.659 6.834   1.00 53.44  ? 1137 THR A CG2 1 
ATOM 8698 N N   . ARG A 1 1141 ? 7.965   45.635 7.096   1.00 57.15  ? 1138 ARG A N   1 
ATOM 8699 C CA  . ARG A 1 1141 ? 6.526   45.444 7.304   1.00 57.15  ? 1138 ARG A CA  1 
ATOM 8700 C C   . ARG A 1 1141 ? 6.272   44.080 7.939   1.00 57.15  ? 1138 ARG A C   1 
ATOM 8701 O O   . ARG A 1 1141 ? 5.154   43.554 7.908   1.00 57.15  ? 1138 ARG A O   1 
ATOM 8702 C CB  . ARG A 1 1141 ? 5.764   45.585 5.976   1.00 86.98  ? 1138 ARG A CB  1 
ATOM 8703 C CG  . ARG A 1 1141 ? 6.000   46.897 5.241   1.00 86.98  ? 1138 ARG A CG  1 
ATOM 8704 C CD  . ARG A 1 1141 ? 5.249   46.943 3.908   1.00 86.98  ? 1138 ARG A CD  1 
ATOM 8705 N NE  . ARG A 1 1141 ? 5.968   47.746 2.912   1.00 86.98  ? 1138 ARG A NE  1 
ATOM 8706 C CZ  . ARG A 1 1141 ? 6.395   47.307 1.724   1.00 86.98  ? 1138 ARG A CZ  1 
ATOM 8707 N NH1 . ARG A 1 1141 ? 6.164   46.060 1.320   1.00 86.98  ? 1138 ARG A NH1 1 
ATOM 8708 N NH2 . ARG A 1 1141 ? 7.052   48.132 0.918   1.00 86.98  ? 1138 ARG A NH2 1 
ATOM 8709 N N   . ILE A 1 1142 ? 7.341   43.509 8.483   1.00 46.49  ? 1139 ILE A N   1 
ATOM 8710 C CA  . ILE A 1 1142 ? 7.288   42.301 9.303   1.00 46.49  ? 1139 ILE A CA  1 
ATOM 8711 C C   . ILE A 1 1142 ? 6.715   42.689 10.687  1.00 46.49  ? 1139 ILE A C   1 
ATOM 8712 O O   . ILE A 1 1142 ? 6.082   41.879 11.380  1.00 46.49  ? 1139 ILE A O   1 
ATOM 8713 C CB  . ILE A 1 1142 ? 8.709   41.701 9.401   1.00 66.43  ? 1139 ILE A CB  1 
ATOM 8714 C CG1 . ILE A 1 1142 ? 8.960   40.746 8.250   1.00 66.43  ? 1139 ILE A CG1 1 
ATOM 8715 C CG2 . ILE A 1 1142 ? 8.941   40.940 10.646  1.00 66.43  ? 1139 ILE A CG2 1 
ATOM 8716 C CD1 . ILE A 1 1142 ? 10.445  40.441 8.093   1.00 66.43  ? 1139 ILE A CD1 1 
ATOM 8717 N N   . HIS A 1 1143 ? 6.927   43.947 11.059  1.00 66.43  ? 1140 HIS A N   1 
ATOM 8718 C CA  . HIS A 1 1143 ? 6.449   44.495 12.304  1.00 66.43  ? 1140 HIS A CA  1 
ATOM 8719 C C   . HIS A 1 1143 ? 5.900   45.879 11.991  1.00 66.43  ? 1140 HIS A C   1 
ATOM 8720 O O   . HIS A 1 1143 ? 4.720   46.153 12.148  1.00 66.43  ? 1140 HIS A O   1 
ATOM 8721 C CB  . HIS A 1 1143 ? 7.629   44.632 13.249  1.00 51.34  ? 1140 HIS A CB  1 
ATOM 8722 C CG  . HIS A 1 1143 ? 8.601   45.691 12.831  1.00 51.34  ? 1140 HIS A CG  1 
ATOM 8723 N ND1 . HIS A 1 1143 ? 9.495   45.514 11.797  1.00 51.34  ? 1140 HIS A ND1 1 
ATOM 8724 C CD2 . HIS A 1 1143 ? 8.787   46.957 13.273  1.00 51.34  ? 1140 HIS A CD2 1 
ATOM 8725 C CE1 . HIS A 1 1143 ? 10.200  46.616 11.629  1.00 51.34  ? 1140 HIS A CE1 1 
ATOM 8726 N NE2 . HIS A 1 1143 ? 9.798   47.504 12.521  1.00 51.34  ? 1140 HIS A NE2 1 
ATOM 8727 N N   . SER B 2 1    ? 13.831  31.860 50.276  1.00 67.34  ? 68   SER B N   1 
ATOM 8728 C CA  . SER B 2 1    ? 12.836  32.110 49.249  1.00 67.34  ? 68   SER B CA  1 
ATOM 8729 C C   . SER B 2 1    ? 13.556  32.465 47.956  1.00 67.34  ? 68   SER B C   1 
ATOM 8730 O O   . SER B 2 1    ? 13.816  33.642 47.669  1.00 67.34  ? 68   SER B O   1 
ATOM 8731 C CB  . SER B 2 1    ? 11.948  33.252 49.686  1.00 127.77 ? 68   SER B CB  1 
ATOM 8732 O OG  . SER B 2 1    ? 12.767  34.306 50.150  1.00 69.53  ? 68   SER B OG  1 
ATOM 8733 N N   . ILE B 2 2    ? 13.910  31.426 47.200  1.00 70.24  ? 69   ILE B N   1 
ATOM 8734 C CA  . ILE B 2 2    ? 14.404  31.588 45.838  1.00 70.24  ? 69   ILE B CA  1 
ATOM 8735 C C   . ILE B 2 2    ? 13.305  32.213 44.953  1.00 70.24  ? 69   ILE B C   1 
ATOM 8736 O O   . ILE B 2 2    ? 13.567  33.157 44.198  1.00 70.24  ? 69   ILE B O   1 
ATOM 8737 C CB  . ILE B 2 2    ? 14.970  30.256 45.254  1.00 50.57  ? 69   ILE B CB  1 
ATOM 8738 C CG1 . ILE B 2 2    ? 15.780  30.513 43.990  1.00 37.52  ? 69   ILE B CG1 1 
ATOM 8739 C CG2 . ILE B 2 2    ? 13.881  29.250 44.967  1.00 37.52  ? 69   ILE B CG2 1 
ATOM 8740 C CD1 . ILE B 2 2    ? 16.831  31.585 44.185  1.00 50.57  ? 69   ILE B CD1 1 
ATOM 8741 N N   . VAL B 2 3    ? 12.079  31.713 45.089  1.00 53.72  ? 70   VAL B N   1 
ATOM 8742 C CA  . VAL B 2 3    ? 10.919  32.316 44.453  1.00 53.72  ? 70   VAL B CA  1 
ATOM 8743 C C   . VAL B 2 3    ? 11.003  33.835 44.376  1.00 53.72  ? 70   VAL B C   1 
ATOM 8744 O O   . VAL B 2 3    ? 10.755  34.398 43.299  1.00 53.72  ? 70   VAL B O   1 
ATOM 8745 C CB  . VAL B 2 3    ? 9.594   31.907 45.134  1.00 36.20  ? 70   VAL B CB  1 
ATOM 8746 C CG1 . VAL B 2 3    ? 8.421   32.585 44.498  1.00 36.20  ? 70   VAL B CG1 1 
ATOM 8747 C CG2 . VAL B 2 3    ? 9.389   30.417 45.007  1.00 36.20  ? 70   VAL B CG2 1 
ATOM 8748 N N   . ARG B 2 4    ? 11.344  34.486 45.497  1.00 51.95  ? 71   ARG B N   1 
ATOM 8749 C CA  . ARG B 2 4    ? 11.451  35.945 45.555  1.00 51.95  ? 71   ARG B CA  1 
ATOM 8750 C C   . ARG B 2 4    ? 12.565  36.414 44.659  1.00 51.95  ? 71   ARG B C   1 
ATOM 8751 O O   . ARG B 2 4    ? 12.323  36.970 43.589  1.00 51.95  ? 71   ARG B O   1 
ATOM 8752 C CB  . ARG B 2 4    ? 11.748  36.415 46.970  1.00 86.62  ? 71   ARG B CB  1 
ATOM 8753 C CG  . ARG B 2 4    ? 10.639  36.198 47.931  1.00 51.58  ? 71   ARG B CG  1 
ATOM 8754 C CD  . ARG B 2 4    ? 9.796   37.423 48.087  1.00 51.58  ? 71   ARG B CD  1 
ATOM 8755 N NE  . ARG B 2 4    ? 9.242   37.460 49.439  1.00 51.58  ? 71   ARG B NE  1 
ATOM 8756 C CZ  . ARG B 2 4    ? 9.878   37.955 50.508  1.00 51.58  ? 71   ARG B CZ  1 
ATOM 8757 N NH1 . ARG B 2 4    ? 11.101  38.482 50.379  1.00 51.58  ? 71   ARG B NH1 1 
ATOM 8758 N NH2 . ARG B 2 4    ? 9.289   37.923 51.708  1.00 51.58  ? 71   ARG B NH2 1 
ATOM 8759 N N   . THR B 2 5    ? 13.791  36.173 45.121  1.00 44.40  ? 72   THR B N   1 
ATOM 8760 C CA  . THR B 2 5    ? 15.022  36.432 44.369  1.00 44.40  ? 72   THR B CA  1 
ATOM 8761 C C   . THR B 2 5    ? 14.814  36.207 42.880  1.00 44.40  ? 72   THR B C   1 
ATOM 8762 O O   . THR B 2 5    ? 15.294  36.983 42.051  1.00 44.40  ? 72   THR B O   1 
ATOM 8763 C CB  . THR B 2 5    ? 16.166  35.484 44.842  1.00 59.70  ? 72   THR B CB  1 
ATOM 8764 O OG1 . THR B 2 5    ? 16.256  35.517 46.275  1.00 48.61  ? 72   THR B OG1 1 
ATOM 8765 C CG2 . THR B 2 5    ? 17.521  35.889 44.224  1.00 48.61  ? 72   THR B CG2 1 
ATOM 8766 N N   . LEU B 2 6    ? 14.116  35.120 42.566  1.00 45.21  ? 73   LEU B N   1 
ATOM 8767 C CA  . LEU B 2 6    ? 13.795  34.800 41.201  1.00 45.21  ? 73   LEU B CA  1 
ATOM 8768 C C   . LEU B 2 6    ? 12.973  35.929 40.643  1.00 45.21  ? 73   LEU B C   1 
ATOM 8769 O O   . LEU B 2 6    ? 13.500  36.740 39.915  1.00 45.21  ? 73   LEU B O   1 
ATOM 8770 C CB  . LEU B 2 6    ? 13.070  33.458 41.073  1.00 60.56  ? 73   LEU B CB  1 
ATOM 8771 C CG  . LEU B 2 6    ? 14.017  32.258 40.973  1.00 60.56  ? 73   LEU B CG  1 
ATOM 8772 C CD1 . LEU B 2 6    ? 13.197  30.998 40.821  1.00 42.82  ? 73   LEU B CD1 1 
ATOM 8773 C CD2 . LEU B 2 6    ? 14.989  32.390 39.807  1.00 60.56  ? 73   LEU B CD2 1 
ATOM 8774 N N   . HIS B 2 7    ? 11.696  36.008 40.988  1.00 60.77  ? 74   HIS B N   1 
ATOM 8775 C CA  . HIS B 2 7    ? 10.863  37.064 40.448  1.00 60.77  ? 74   HIS B CA  1 
ATOM 8776 C C   . HIS B 2 7    ? 11.562  38.445 40.327  1.00 60.77  ? 74   HIS B C   1 
ATOM 8777 O O   . HIS B 2 7    ? 11.285  39.220 39.399  1.00 60.77  ? 74   HIS B O   1 
ATOM 8778 C CB  . HIS B 2 7    ? 9.605   37.196 41.273  1.00 70.71  ? 74   HIS B CB  1 
ATOM 8779 C CG  . HIS B 2 7    ? 8.650   38.184 40.710  1.00 43.17  ? 74   HIS B CG  1 
ATOM 8780 N ND1 . HIS B 2 7    ? 7.835   37.894 39.633  1.00 43.17  ? 74   HIS B ND1 1 
ATOM 8781 C CD2 . HIS B 2 7    ? 8.413   39.478 41.029  1.00 43.17  ? 74   HIS B CD2 1 
ATOM 8782 C CE1 . HIS B 2 7    ? 7.109   38.957 39.334  1.00 43.17  ? 74   HIS B CE1 1 
ATOM 8783 N NE2 . HIS B 2 7    ? 7.432   39.929 40.173  1.00 43.17  ? 74   HIS B NE2 1 
ATOM 8784 N N   . GLN B 2 8    ? 12.473  38.756 41.248  1.00 43.92  ? 75   GLN B N   1 
ATOM 8785 C CA  . GLN B 2 8    ? 13.076  40.074 41.262  1.00 43.92  ? 75   GLN B CA  1 
ATOM 8786 C C   . GLN B 2 8    ? 13.786  40.370 39.961  1.00 43.92  ? 75   GLN B C   1 
ATOM 8787 O O   . GLN B 2 8    ? 13.664  41.467 39.386  1.00 43.92  ? 75   GLN B O   1 
ATOM 8788 C CB  . GLN B 2 8    ? 14.026  40.219 42.416  1.00 85.45  ? 75   GLN B CB  1 
ATOM 8789 C CG  . GLN B 2 8    ? 13.505  41.130 43.460  1.00 85.45  ? 75   GLN B CG  1 
ATOM 8790 C CD  . GLN B 2 8    ? 14.447  41.161 44.606  1.00 60.15  ? 75   GLN B CD  1 
ATOM 8791 O OE1 . GLN B 2 8    ? 15.524  41.778 44.532  1.00 60.15  ? 75   GLN B OE1 1 
ATOM 8792 N NE2 . GLN B 2 8    ? 14.082  40.444 45.689  1.00 60.15  ? 75   GLN B NE2 1 
ATOM 8793 N N   . HIS B 2 9    ? 14.540  39.372 39.519  1.00 49.41  ? 76   HIS B N   1 
ATOM 8794 C CA  . HIS B 2 9    ? 15.127  39.334 38.197  1.00 49.41  ? 76   HIS B CA  1 
ATOM 8795 C C   . HIS B 2 9    ? 14.158  39.757 37.090  1.00 49.41  ? 76   HIS B C   1 
ATOM 8796 O O   . HIS B 2 9    ? 14.571  40.495 36.175  1.00 49.41  ? 76   HIS B O   1 
ATOM 8797 C CB  . HIS B 2 9    ? 15.700  37.948 37.929  1.00 82.15  ? 76   HIS B CB  1 
ATOM 8798 C CG  . HIS B 2 9    ? 16.926  37.651 38.729  1.00 82.15  ? 76   HIS B CG  1 
ATOM 8799 N ND1 . HIS B 2 9    ? 17.977  38.537 38.835  1.00 69.97  ? 76   HIS B ND1 1 
ATOM 8800 C CD2 . HIS B 2 9    ? 17.279  36.565 39.453  1.00 69.97  ? 76   HIS B CD2 1 
ATOM 8801 C CE1 . HIS B 2 9    ? 18.926  38.012 39.587  1.00 69.97  ? 76   HIS B CE1 1 
ATOM 8802 N NE2 . HIS B 2 9    ? 18.528  36.814 39.975  1.00 69.97  ? 76   HIS B NE2 1 
ATOM 8803 N N   . LYS B 2 10   ? 12.892  39.318 37.188  1.00 36.72  ? 77   LYS B N   1 
ATOM 8804 C CA  . LYS B 2 10   ? 11.898  39.563 36.123  1.00 36.72  ? 77   LYS B CA  1 
ATOM 8805 C C   . LYS B 2 10   ? 11.667  41.049 36.063  1.00 36.72  ? 77   LYS B C   1 
ATOM 8806 O O   . LYS B 2 10   ? 11.467  41.598 34.970  1.00 36.72  ? 77   LYS B O   1 
ATOM 8807 C CB  . LYS B 2 10   ? 10.568  38.842 36.345  1.00 55.50  ? 77   LYS B CB  1 
ATOM 8808 C CG  . LYS B 2 10   ? 10.640  37.336 36.354  1.00 55.50  ? 77   LYS B CG  1 
ATOM 8809 C CD  . LYS B 2 10   ? 9.285   36.721 36.045  1.00 55.50  ? 77   LYS B CD  1 
ATOM 8810 C CE  . LYS B 2 10   ? 9.021   35.480 36.930  1.00 42.10  ? 77   LYS B CE  1 
ATOM 8811 N NZ  . LYS B 2 10   ? 10.219  34.533 37.085  1.00 42.10  ? 77   LYS B NZ  1 
ATOM 8812 N N   . LEU B 2 11   ? 11.726  41.684 37.247  1.00 36.47  ? 78   LEU B N   1 
ATOM 8813 C CA  . LEU B 2 11   ? 11.670  43.151 37.421  1.00 36.47  ? 78   LEU B CA  1 
ATOM 8814 C C   . LEU B 2 11   ? 13.044  43.809 37.234  1.00 36.47  ? 78   LEU B C   1 
ATOM 8815 O O   . LEU B 2 11   ? 13.190  45.034 37.370  1.00 36.47  ? 78   LEU B O   1 
ATOM 8816 C CB  . LEU B 2 11   ? 11.152  43.479 38.823  1.00 34.84  ? 78   LEU B CB  1 
ATOM 8817 C CG  . LEU B 2 11   ? 9.707   43.044 39.109  1.00 34.84  ? 78   LEU B CG  1 
ATOM 8818 C CD1 . LEU B 2 11   ? 9.223   43.385 40.503  1.00 34.84  ? 78   LEU B CD1 1 
ATOM 8819 C CD2 . LEU B 2 11   ? 8.800   43.650 38.028  1.00 34.84  ? 78   LEU B CD2 1 
ATOM 8820 N N   . GLY B 2 12   ? 14.057  42.996 36.943  1.00 44.20  ? 79   GLY B N   1 
ATOM 8821 C CA  . GLY B 2 12   ? 15.394  43.518 36.701  1.00 44.20  ? 79   GLY B CA  1 
ATOM 8822 C C   . GLY B 2 12   ? 16.061  43.988 37.971  1.00 44.20  ? 79   GLY B C   1 
ATOM 8823 O O   . GLY B 2 12   ? 16.404  45.151 38.075  1.00 44.20  ? 79   GLY B O   1 
ATOM 8824 N N   . ARG B 2 13   ? 16.226  43.076 38.933  1.00 93.94  ? 80   ARG B N   1 
ATOM 8825 C CA  . ARG B 2 13   ? 16.850  43.372 40.234  1.00 93.94  ? 80   ARG B CA  1 
ATOM 8826 C C   . ARG B 2 13   ? 17.797  42.285 40.754  1.00 93.94  ? 80   ARG B C   1 
ATOM 8827 O O   . ARG B 2 13   ? 17.889  41.199 40.175  1.00 93.94  ? 80   ARG B O   1 
ATOM 8828 C CB  . ARG B 2 13   ? 15.785  43.665 41.269  1.00 101.77 ? 80   ARG B CB  1 
ATOM 8829 C CG  . ARG B 2 13   ? 15.326  45.068 41.195  1.00 101.77 ? 80   ARG B CG  1 
ATOM 8830 C CD  . ARG B 2 13   ? 14.029  45.287 41.925  1.00 57.04  ? 80   ARG B CD  1 
ATOM 8831 N NE  . ARG B 2 13   ? 13.515  46.581 41.519  1.00 57.04  ? 80   ARG B NE  1 
ATOM 8832 C CZ  . ARG B 2 13   ? 12.765  47.398 42.256  1.00 57.04  ? 80   ARG B CZ  1 
ATOM 8833 N NH1 . ARG B 2 13   ? 12.390  47.066 43.496  1.00 57.04  ? 80   ARG B NH1 1 
ATOM 8834 N NH2 . ARG B 2 13   ? 12.385  48.568 41.731  1.00 57.04  ? 80   ARG B NH2 1 
ATOM 8835 N N   . ALA B 2 14   ? 18.481  42.591 41.860  1.00 122.31 ? 81   ALA B N   1 
ATOM 8836 C CA  . ALA B 2 14   ? 19.582  41.767 42.405  1.00 122.31 ? 81   ALA B CA  1 
ATOM 8837 C C   . ALA B 2 14   ? 19.288  40.258 42.540  1.00 122.31 ? 81   ALA B C   1 
ATOM 8838 O O   . ALA B 2 14   ? 20.179  39.429 42.345  1.00 122.31 ? 81   ALA B O   1 
ATOM 8839 C CB  . ALA B 2 14   ? 20.109  42.366 43.755  1.00 66.01  ? 81   ALA B CB  1 
ATOM 8840 O OXT . ALA B 2 14   ? 18.174  39.812 42.833  1.00 96.89  ? 81   ALA B OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    GLY 1    -2   ?    ?   ?   A . n 
A 1 2    SER 2    -1   ?    ?   ?   A . n 
A 1 3    HIS 3    0    ?    ?   ?   A . n 
A 1 4    MET 4    1    1    MET MET A . n 
A 1 5    SER 5    2    2    SER SER A . n 
A 1 6    TYR 6    3    3    TYR TYR A . n 
A 1 7    ASN 7    4    4    ASN ASN A . n 
A 1 8    TYR 8    5    5    TYR TYR A . n 
A 1 9    VAL 9    6    6    VAL VAL A . n 
A 1 10   VAL 10   7    7    VAL VAL A . n 
A 1 11   THR 11   8    8    THR THR A . n 
A 1 12   ALA 12   9    9    ALA ALA A . n 
A 1 13   GLN 13   10   10   GLN GLN A . n 
A 1 14   LYS 14   11   11   LYS LYS A . n 
A 1 15   PRO 15   12   12   PRO PRO A . n 
A 1 16   THR 16   13   13   THR THR A . n 
A 1 17   ALA 17   14   14   ALA ALA A . n 
A 1 18   VAL 18   15   15   VAL VAL A . n 
A 1 19   ASN 19   16   16   ASN ASN A . n 
A 1 20   GLY 20   17   17   GLY GLY A . n 
A 1 21   CYS 21   18   18   CYS CYS A . n 
A 1 22   VAL 22   19   19   VAL VAL A . n 
A 1 23   THR 23   20   20   THR THR A . n 
A 1 24   GLY 24   21   21   GLY GLY A . n 
A 1 25   HIS 25   22   22   HIS HIS A . n 
A 1 26   PHE 26   23   23   PHE PHE A . n 
A 1 27   THR 27   24   24   THR THR A . n 
A 1 28   SER 28   25   25   SER SER A . n 
A 1 29   ALA 29   26   26   ALA ALA A . n 
A 1 30   GLU 30   27   27   GLU GLU A . n 
A 1 31   ASP 31   28   28   ASP ASP A . n 
A 1 32   LEU 32   29   29   LEU LEU A . n 
A 1 33   ASN 33   30   30   ASN ASN A . n 
A 1 34   LEU 34   31   31   LEU LEU A . n 
A 1 35   LEU 35   32   32   LEU LEU A . n 
A 1 36   ILE 36   33   33   ILE ILE A . n 
A 1 37   ALA 37   34   34   ALA ALA A . n 
A 1 38   LYS 38   35   35   LYS LYS A . n 
A 1 39   ASN 39   36   36   ASN ASN A . n 
A 1 40   THR 40   37   37   THR THR A . n 
A 1 41   ARG 41   38   38   ARG ARG A . n 
A 1 42   LEU 42   39   39   LEU LEU A . n 
A 1 43   GLU 43   40   40   GLU GLU A . n 
A 1 44   ILE 44   41   41   ILE ILE A . n 
A 1 45   TYR 45   42   42   TYR TYR A . n 
A 1 46   VAL 46   43   43   VAL VAL A . n 
A 1 47   VAL 47   44   44   VAL VAL A . n 
A 1 48   THR 48   45   45   THR THR A . n 
A 1 49   ALA 49   46   46   ALA ALA A . n 
A 1 50   GLU 50   47   47   GLU GLU A . n 
A 1 51   GLY 51   48   48   GLY GLY A . n 
A 1 52   LEU 52   49   49   LEU LEU A . n 
A 1 53   ARG 53   50   50   ARG ARG A . n 
A 1 54   PRO 54   51   51   PRO PRO A . n 
A 1 55   VAL 55   52   52   VAL VAL A . n 
A 1 56   LYS 56   53   53   LYS LYS A . n 
A 1 57   GLU 57   54   54   GLU GLU A . n 
A 1 58   VAL 58   55   55   VAL VAL A . n 
A 1 59   GLY 59   56   56   GLY GLY A . n 
A 1 60   MET 60   57   57   MET MET A . n 
A 1 61   TYR 61   58   58   TYR TYR A . n 
A 1 62   GLY 62   59   59   GLY GLY A . n 
A 1 63   LYS 63   60   60   LYS LYS A . n 
A 1 64   ILE 64   61   61   ILE ILE A . n 
A 1 65   ALA 65   62   62   ALA ALA A . n 
A 1 66   VAL 66   63   63   VAL VAL A . n 
A 1 67   MET 67   64   64   MET MET A . n 
A 1 68   GLU 68   65   65   GLU GLU A . n 
A 1 69   LEU 69   66   66   LEU LEU A . n 
A 1 70   PHE 70   67   67   PHE PHE A . n 
A 1 71   ARG 71   68   68   ARG ARG A . n 
A 1 72   PRO 72   69   69   PRO PRO A . n 
A 1 73   LYS 73   70   70   LYS LYS A . n 
A 1 74   GLY 74   71   71   GLY GLY A . n 
A 1 75   GLU 75   72   72   GLU GLU A . n 
A 1 76   SER 76   73   73   SER SER A . n 
A 1 77   LYS 77   74   74   LYS LYS A . n 
A 1 78   ASP 78   75   75   ASP ASP A . n 
A 1 79   LEU 79   76   76   LEU LEU A . n 
A 1 80   LEU 80   77   77   LEU LEU A . n 
A 1 81   PHE 81   78   78   PHE PHE A . n 
A 1 82   ILE 82   79   79   ILE ILE A . n 
A 1 83   LEU 83   80   80   LEU LEU A . n 
A 1 84   THR 84   81   81   THR THR A . n 
A 1 85   ALA 85   82   82   ALA ALA A . n 
A 1 86   LYS 86   83   83   LYS LYS A . n 
A 1 87   TYR 87   84   84   TYR TYR A . n 
A 1 88   ASN 88   85   85   ASN ASN A . n 
A 1 89   ALA 89   86   86   ALA ALA A . n 
A 1 90   CYS 90   87   87   CYS CYS A . n 
A 1 91   ILE 91   88   88   ILE ILE A . n 
A 1 92   LEU 92   89   89   LEU LEU A . n 
A 1 93   GLU 93   90   90   GLU GLU A . n 
A 1 94   TYR 94   91   91   TYR TYR A . n 
A 1 95   LYS 95   92   92   LYS LYS A . n 
A 1 96   GLN 96   93   93   GLN GLN A . n 
A 1 97   SER 97   94   94   SER SER A . n 
A 1 98   GLY 98   95   95   GLY GLY A . n 
A 1 99   GLU 99   96   96   GLU GLU A . n 
A 1 100  SER 100  97   97   SER SER A . n 
A 1 101  ILE 101  98   98   ILE ILE A . n 
A 1 102  ASP 102  99   99   ASP ASP A . n 
A 1 103  ILE 103  100  100  ILE ILE A . n 
A 1 104  ILE 104  101  101  ILE ILE A . n 
A 1 105  THR 105  102  102  THR THR A . n 
A 1 106  ARG 106  103  103  ARG ARG A . n 
A 1 107  ALA 107  104  104  ALA ALA A . n 
A 1 108  HIS 108  105  105  HIS HIS A . n 
A 1 109  GLY 109  106  106  GLY GLY A . n 
A 1 110  ASN 110  107  107  ASN ASN A . n 
A 1 111  VAL 111  108  108  VAL VAL A . n 
A 1 112  GLN 112  109  109  GLN GLN A . n 
A 1 113  ASP 113  110  110  ASP ASP A . n 
A 1 114  ARG 114  111  111  ARG ARG A . n 
A 1 115  ILE 115  112  112  ILE ILE A . n 
A 1 116  GLY 116  113  113  GLY GLY A . n 
A 1 117  ARG 117  114  114  ARG ARG A . n 
A 1 118  PRO 118  115  115  PRO PRO A . n 
A 1 119  SER 119  116  116  SER SER A . n 
A 1 120  GLU 120  117  117  GLU GLU A . n 
A 1 121  THR 121  118  118  THR THR A . n 
A 1 122  GLY 122  119  119  GLY GLY A . n 
A 1 123  ILE 123  120  120  ILE ILE A . n 
A 1 124  ILE 124  121  121  ILE ILE A . n 
A 1 125  GLY 125  122  122  GLY GLY A . n 
A 1 126  ILE 126  123  123  ILE ILE A . n 
A 1 127  ILE 127  124  124  ILE ILE A . n 
A 1 128  ASP 128  125  125  ASP ASP A . n 
A 1 129  PRO 129  126  126  PRO PRO A . n 
A 1 130  GLU 130  127  127  GLU GLU A . n 
A 1 131  CYS 131  128  128  CYS CYS A . n 
A 1 132  ARG 132  129  129  ARG ARG A . n 
A 1 133  MET 133  130  130  MET MET A . n 
A 1 134  ILE 134  131  131  ILE ILE A . n 
A 1 135  GLY 135  132  132  GLY GLY A . n 
A 1 136  LEU 136  133  133  LEU LEU A . n 
A 1 137  ARG 137  134  134  ARG ARG A . n 
A 1 138  LEU 138  135  135  LEU LEU A . n 
A 1 139  TYR 139  136  136  TYR TYR A . n 
A 1 140  ASP 140  137  137  ASP ASP A . n 
A 1 141  GLY 141  138  138  GLY GLY A . n 
A 1 142  LEU 142  139  139  LEU LEU A . n 
A 1 143  PHE 143  140  140  PHE PHE A . n 
A 1 144  LYS 144  141  141  LYS LYS A . n 
A 1 145  VAL 145  142  142  VAL VAL A . n 
A 1 146  ILE 146  143  143  ILE ILE A . n 
A 1 147  PRO 147  144  144  PRO PRO A . n 
A 1 148  LEU 148  145  145  LEU LEU A . n 
A 1 149  ASP 149  146  146  ASP ASP A . n 
A 1 150  ARG 150  147  147  ARG ARG A . n 
A 1 151  ASP 151  148  148  ASP ASP A . n 
A 1 152  ASN 152  149  149  ASN ASN A . n 
A 1 153  LYS 153  150  150  LYS LYS A . n 
A 1 154  GLU 154  151  151  GLU GLU A . n 
A 1 155  LEU 155  152  152  LEU LEU A . n 
A 1 156  LYS 156  153  153  LYS LYS A . n 
A 1 157  ALA 157  154  154  ALA ALA A . n 
A 1 158  PHE 158  155  155  PHE PHE A . n 
A 1 159  ASN 159  156  156  ASN ASN A . n 
A 1 160  ILE 160  157  157  ILE ILE A . n 
A 1 161  ARG 161  158  158  ARG ARG A . n 
A 1 162  LEU 162  159  159  LEU LEU A . n 
A 1 163  GLU 163  160  160  GLU GLU A . n 
A 1 164  GLU 164  161  161  GLU GLU A . n 
A 1 165  LEU 165  162  162  LEU LEU A . n 
A 1 166  HIS 166  163  163  HIS HIS A . n 
A 1 167  VAL 167  164  164  VAL VAL A . n 
A 1 168  ILE 168  165  165  ILE ILE A . n 
A 1 169  ASP 169  166  166  ASP ASP A . n 
A 1 170  VAL 170  167  167  VAL VAL A . n 
A 1 171  LYS 171  168  168  LYS LYS A . n 
A 1 172  PHE 172  169  169  PHE PHE A . n 
A 1 173  LEU 173  170  170  LEU LEU A . n 
A 1 174  TYR 174  171  171  TYR TYR A . n 
A 1 175  GLY 175  172  172  GLY GLY A . n 
A 1 176  CYS 176  173  173  CYS CYS A . n 
A 1 177  GLN 177  174  174  GLN GLN A . n 
A 1 178  ALA 178  175  175  ALA ALA A . n 
A 1 179  PRO 179  176  176  PRO PRO A . n 
A 1 180  THR 180  177  177  THR THR A . n 
A 1 181  ILE 181  178  178  ILE ILE A . n 
A 1 182  CYS 182  179  179  CYS CYS A . n 
A 1 183  PHE 183  180  180  PHE PHE A . n 
A 1 184  VAL 184  181  181  VAL VAL A . n 
A 1 185  TYR 185  182  182  TYR TYR A . n 
A 1 186  GLN 186  183  183  GLN GLN A . n 
A 1 187  ASP 187  184  184  ASP ASP A . n 
A 1 188  PRO 188  185  185  PRO PRO A . n 
A 1 189  GLN 189  186  186  GLN GLN A . n 
A 1 190  GLY 190  187  187  GLY GLY A . n 
A 1 191  ARG 191  188  188  ARG ARG A . n 
A 1 192  HIS 192  189  189  HIS HIS A . n 
A 1 193  VAL 193  190  190  VAL VAL A . n 
A 1 194  LYS 194  191  191  LYS LYS A . n 
A 1 195  THR 195  192  192  THR THR A . n 
A 1 196  TYR 196  193  193  TYR TYR A . n 
A 1 197  GLU 197  194  194  GLU GLU A . n 
A 1 198  VAL 198  195  195  VAL VAL A . n 
A 1 199  SER 199  196  196  SER SER A . n 
A 1 200  LEU 200  197  197  LEU LEU A . n 
A 1 201  ARG 201  198  198  ARG ARG A . n 
A 1 202  GLU 202  199  199  GLU GLU A . n 
A 1 203  LYS 203  200  200  LYS LYS A . n 
A 1 204  GLU 204  201  201  GLU GLU A . n 
A 1 205  PHE 205  202  202  PHE PHE A . n 
A 1 206  ASN 206  203  203  ASN ASN A . n 
A 1 207  LYS 207  204  204  LYS LYS A . n 
A 1 208  GLY 208  205  205  GLY GLY A . n 
A 1 209  PRO 209  206  206  PRO PRO A . n 
A 1 210  TRP 210  207  207  TRP TRP A . n 
A 1 211  LYS 211  208  208  LYS LYS A . n 
A 1 212  GLN 212  209  209  GLN GLN A . n 
A 1 213  GLU 213  210  210  GLU GLU A . n 
A 1 214  ASN 214  211  211  ASN ASN A . n 
A 1 215  VAL 215  212  212  VAL VAL A . n 
A 1 216  GLU 216  213  213  GLU GLU A . n 
A 1 217  ALA 217  214  214  ALA ALA A . n 
A 1 218  GLU 218  215  215  GLU GLU A . n 
A 1 219  ALA 219  216  216  ALA ALA A . n 
A 1 220  SER 220  217  217  SER SER A . n 
A 1 221  MET 221  218  218  MET MET A . n 
A 1 222  VAL 222  219  219  VAL VAL A . n 
A 1 223  ILE 223  220  220  ILE ILE A . n 
A 1 224  ALA 224  221  221  ALA ALA A . n 
A 1 225  VAL 225  222  222  VAL VAL A . n 
A 1 226  PRO 226  223  223  PRO PRO A . n 
A 1 227  GLU 227  224  224  GLU GLU A . n 
A 1 228  PRO 228  225  225  PRO PRO A . n 
A 1 229  PHE 229  226  226  PHE PHE A . n 
A 1 230  GLY 230  227  227  GLY GLY A . n 
A 1 231  GLY 231  228  228  GLY GLY A . n 
A 1 232  ALA 232  229  229  ALA ALA A . n 
A 1 233  ILE 233  230  230  ILE ILE A . n 
A 1 234  ILE 234  231  231  ILE ILE A . n 
A 1 235  ILE 235  232  232  ILE ILE A . n 
A 1 236  GLY 236  233  233  GLY GLY A . n 
A 1 237  GLN 237  234  234  GLN GLN A . n 
A 1 238  GLU 238  235  235  GLU GLU A . n 
A 1 239  SER 239  236  236  SER SER A . n 
A 1 240  ILE 240  237  237  ILE ILE A . n 
A 1 241  THR 241  238  238  THR THR A . n 
A 1 242  TYR 242  239  239  TYR TYR A . n 
A 1 243  HIS 243  240  240  HIS HIS A . n 
A 1 244  ASN 244  241  241  ASN ASN A . n 
A 1 245  GLY 245  242  242  GLY GLY A . n 
A 1 246  ASP 246  243  243  ASP ASP A . n 
A 1 247  LYS 247  244  244  LYS LYS A . n 
A 1 248  TYR 248  245  245  TYR TYR A . n 
A 1 249  LEU 249  246  246  LEU LEU A . n 
A 1 250  ALA 250  247  247  ALA ALA A . n 
A 1 251  ILE 251  248  248  ILE ILE A . n 
A 1 252  ALA 252  249  249  ALA ALA A . n 
A 1 253  PRO 253  250  250  PRO PRO A . n 
A 1 254  PRO 254  251  251  PRO PRO A . n 
A 1 255  ILE 255  252  252  ILE ILE A . n 
A 1 256  ILE 256  253  253  ILE ILE A . n 
A 1 257  LYS 257  254  254  LYS LYS A . n 
A 1 258  GLN 258  255  255  GLN GLN A . n 
A 1 259  SER 259  256  256  SER SER A . n 
A 1 260  THR 260  257  257  THR THR A . n 
A 1 261  ILE 261  258  258  ILE ILE A . n 
A 1 262  VAL 262  259  259  VAL VAL A . n 
A 1 263  CYS 263  260  260  CYS CYS A . n 
A 1 264  HIS 264  261  261  HIS HIS A . n 
A 1 265  ASN 265  262  262  ASN ASN A . n 
A 1 266  ARG 266  263  263  ARG ARG A . n 
A 1 267  VAL 267  264  264  VAL VAL A . n 
A 1 268  ASP 268  265  265  ASP ASP A . n 
A 1 269  PRO 269  266  266  PRO PRO A . n 
A 1 270  ASN 270  267  267  ASN ASN A . n 
A 1 271  GLY 271  268  268  GLY GLY A . n 
A 1 272  SER 272  269  269  SER SER A . n 
A 1 273  ARG 273  270  270  ARG ARG A . n 
A 1 274  TYR 274  271  271  TYR TYR A . n 
A 1 275  LEU 275  272  272  LEU LEU A . n 
A 1 276  LEU 276  273  273  LEU LEU A . n 
A 1 277  GLY 277  274  274  GLY GLY A . n 
A 1 278  ASP 278  275  275  ASP ASP A . n 
A 1 279  MET 279  276  276  MET MET A . n 
A 1 280  GLU 280  277  277  GLU GLU A . n 
A 1 281  GLY 281  278  278  GLY GLY A . n 
A 1 282  ARG 282  279  279  ARG ARG A . n 
A 1 283  LEU 283  280  280  LEU LEU A . n 
A 1 284  PHE 284  281  281  PHE PHE A . n 
A 1 285  MET 285  282  282  MET MET A . n 
A 1 286  LEU 286  283  283  LEU LEU A . n 
A 1 287  LEU 287  284  284  LEU LEU A . n 
A 1 288  LEU 288  285  285  LEU LEU A . n 
A 1 289  GLU 289  286  286  GLU GLU A . n 
A 1 290  LYS 290  287  287  LYS LYS A . n 
A 1 291  GLU 291  288  288  GLU GLU A . n 
A 1 292  GLU 292  289  289  GLU GLU A . n 
A 1 293  GLN 293  290  290  GLN GLN A . n 
A 1 294  MET 294  291  291  MET MET A . n 
A 1 295  ASP 295  292  292  ASP ASP A . n 
A 1 296  GLY 296  293  293  GLY GLY A . n 
A 1 297  THR 297  294  294  THR THR A . n 
A 1 298  VAL 298  295  295  VAL VAL A . n 
A 1 299  THR 299  296  296  THR THR A . n 
A 1 300  LEU 300  297  297  LEU LEU A . n 
A 1 301  LYS 301  298  298  LYS LYS A . n 
A 1 302  ASP 302  299  299  ASP ASP A . n 
A 1 303  LEU 303  300  300  LEU LEU A . n 
A 1 304  ARG 304  301  301  ARG ARG A . n 
A 1 305  VAL 305  302  302  VAL VAL A . n 
A 1 306  GLU 306  303  303  GLU GLU A . n 
A 1 307  LEU 307  304  304  LEU LEU A . n 
A 1 308  LEU 308  305  305  LEU LEU A . n 
A 1 309  GLY 309  306  306  GLY GLY A . n 
A 1 310  GLU 310  307  307  GLU GLU A . n 
A 1 311  THR 311  308  308  THR THR A . n 
A 1 312  SER 312  309  309  SER SER A . n 
A 1 313  ILE 313  310  310  ILE ILE A . n 
A 1 314  ALA 314  311  311  ALA ALA A . n 
A 1 315  GLU 315  312  312  GLU GLU A . n 
A 1 316  CYS 316  313  313  CYS CYS A . n 
A 1 317  LEU 317  314  314  LEU LEU A . n 
A 1 318  THR 318  315  315  THR THR A . n 
A 1 319  TYR 319  316  316  TYR TYR A . n 
A 1 320  LEU 320  317  317  LEU LEU A . n 
A 1 321  ASP 321  318  318  ASP ASP A . n 
A 1 322  ASN 322  319  319  ASN ASN A . n 
A 1 323  GLY 323  320  320  GLY GLY A . n 
A 1 324  VAL 324  321  321  VAL VAL A . n 
A 1 325  VAL 325  322  322  VAL VAL A . n 
A 1 326  PHE 326  323  323  PHE PHE A . n 
A 1 327  VAL 327  324  324  VAL VAL A . n 
A 1 328  GLY 328  325  325  GLY GLY A . n 
A 1 329  SER 329  326  326  SER SER A . n 
A 1 330  ARG 330  327  327  ARG ARG A . n 
A 1 331  LEU 331  328  328  LEU LEU A . n 
A 1 332  GLY 332  329  329  GLY GLY A . n 
A 1 333  ASP 333  330  330  ASP ASP A . n 
A 1 334  SER 334  331  331  SER SER A . n 
A 1 335  GLN 335  332  332  GLN GLN A . n 
A 1 336  LEU 336  333  333  LEU LEU A . n 
A 1 337  VAL 337  334  334  VAL VAL A . n 
A 1 338  LYS 338  335  335  LYS LYS A . n 
A 1 339  LEU 339  336  336  LEU LEU A . n 
A 1 340  ASN 340  337  337  ASN ASN A . n 
A 1 341  VAL 341  338  338  VAL VAL A . n 
A 1 342  ASP 342  339  339  ASP ASP A . n 
A 1 343  SER 343  340  340  SER SER A . n 
A 1 344  ASN 344  341  341  ASN ASN A . n 
A 1 345  GLU 345  342  342  GLU GLU A . n 
A 1 346  GLN 346  343  343  GLN GLN A . n 
A 1 347  GLY 347  344  344  GLY GLY A . n 
A 1 348  SER 348  345  345  SER SER A . n 
A 1 349  TYR 349  346  346  TYR TYR A . n 
A 1 350  VAL 350  347  347  VAL VAL A . n 
A 1 351  VAL 351  348  348  VAL VAL A . n 
A 1 352  ALA 352  349  349  ALA ALA A . n 
A 1 353  MET 353  350  350  MET MET A . n 
A 1 354  GLU 354  351  351  GLU GLU A . n 
A 1 355  THR 355  352  352  THR THR A . n 
A 1 356  PHE 356  353  353  PHE PHE A . n 
A 1 357  THR 357  354  354  THR THR A . n 
A 1 358  ASN 358  355  355  ASN ASN A . n 
A 1 359  LEU 359  356  356  LEU LEU A . n 
A 1 360  GLY 360  357  357  GLY GLY A . n 
A 1 361  PRO 361  358  358  PRO PRO A . n 
A 1 362  ILE 362  359  359  ILE ILE A . n 
A 1 363  VAL 363  360  360  VAL VAL A . n 
A 1 364  ASP 364  361  361  ASP ASP A . n 
A 1 365  MET 365  362  362  MET MET A . n 
A 1 366  CYS 366  363  363  CYS CYS A . n 
A 1 367  VAL 367  364  364  VAL VAL A . n 
A 1 368  VAL 368  365  365  VAL VAL A . n 
A 1 369  ASP 369  366  366  ASP ASP A . n 
A 1 370  LEU 370  367  367  LEU LEU A . n 
A 1 371  GLU 371  368  368  GLU GLU A . n 
A 1 372  ARG 372  369  369  ARG ARG A . n 
A 1 373  GLN 373  370  370  GLN GLN A . n 
A 1 374  GLY 374  371  371  GLY GLY A . n 
A 1 375  GLN 375  372  372  GLN GLN A . n 
A 1 376  GLY 376  373  373  GLY GLY A . n 
A 1 377  GLN 377  374  374  GLN GLN A . n 
A 1 378  LEU 378  375  375  LEU LEU A . n 
A 1 379  VAL 379  376  376  VAL VAL A . n 
A 1 380  THR 380  377  377  THR THR A . n 
A 1 381  CYS 381  378  378  CYS CYS A . n 
A 1 382  SER 382  379  379  SER SER A . n 
A 1 383  GLY 383  380  380  GLY GLY A . n 
A 1 384  ALA 384  381  381  ALA ALA A . n 
A 1 385  PHE 385  382  382  PHE PHE A . n 
A 1 386  LYS 386  383  383  LYS LYS A . n 
A 1 387  GLU 387  384  384  GLU GLU A . n 
A 1 388  GLY 388  385  385  GLY GLY A . n 
A 1 389  SER 389  386  386  SER SER A . n 
A 1 390  LEU 390  387  387  LEU LEU A . n 
A 1 391  ARG 391  388  388  ARG ARG A . n 
A 1 392  ILE 392  389  389  ILE ILE A . n 
A 1 393  ILE 393  390  390  ILE ILE A . n 
A 1 394  ARG 394  391  391  ARG ARG A . n 
A 1 395  ASN 395  392  392  ASN ASN A . n 
A 1 396  GLY 396  393  393  GLY GLY A . n 
A 1 397  ILE 397  394  394  ILE ILE A . n 
A 1 398  GLY 398  395  395  GLY GLY A . n 
A 1 399  ILE 399  396  396  ILE ILE A . n 
A 1 400  HIS 400  397  397  HIS HIS A . n 
A 1 401  GLU 401  398  398  GLU GLU A . n 
A 1 402  HIS 402  399  399  HIS HIS A . n 
A 1 403  ALA 403  400  400  ALA ALA A . n 
A 1 404  SER 404  401  401  SER SER A . n 
A 1 405  ILE 405  402  402  ILE ILE A . n 
A 1 406  ASP 406  403  403  ASP ASP A . n 
A 1 407  LEU 407  404  404  LEU LEU A . n 
A 1 408  PRO 408  405  405  PRO PRO A . n 
A 1 409  GLY 409  406  406  GLY GLY A . n 
A 1 410  ILE 410  407  407  ILE ILE A . n 
A 1 411  LYS 411  408  408  LYS LYS A . n 
A 1 412  GLY 412  409  409  GLY GLY A . n 
A 1 413  LEU 413  410  410  LEU LEU A . n 
A 1 414  TRP 414  411  411  TRP TRP A . n 
A 1 415  PRO 415  412  412  PRO PRO A . n 
A 1 416  LEU 416  413  413  LEU LEU A . n 
A 1 417  ARG 417  414  414  ARG ARG A . n 
A 1 418  SER 418  415  415  SER SER A . n 
A 1 419  ASP 419  416  416  ASP ASP A . n 
A 1 420  PRO 420  417  417  PRO PRO A . n 
A 1 421  ASN 421  418  418  ASN ASN A . n 
A 1 422  ARG 422  419  419  ARG ARG A . n 
A 1 423  GLU 423  420  420  GLU GLU A . n 
A 1 424  THR 424  421  421  THR THR A . n 
A 1 425  TYR 425  422  422  TYR TYR A . n 
A 1 426  ASP 426  423  423  ASP ASP A . n 
A 1 427  THR 427  424  424  THR THR A . n 
A 1 428  LEU 428  425  425  LEU LEU A . n 
A 1 429  VAL 429  426  426  VAL VAL A . n 
A 1 430  LEU 430  427  427  LEU LEU A . n 
A 1 431  SER 431  428  428  SER SER A . n 
A 1 432  PHE 432  429  429  PHE PHE A . n 
A 1 433  VAL 433  430  430  VAL VAL A . n 
A 1 434  GLY 434  431  431  GLY GLY A . n 
A 1 435  GLN 435  432  432  GLN GLN A . n 
A 1 436  THR 436  433  433  THR THR A . n 
A 1 437  ARG 437  434  434  ARG ARG A . n 
A 1 438  VAL 438  435  435  VAL VAL A . n 
A 1 439  LEU 439  436  436  LEU LEU A . n 
A 1 440  MET 440  437  437  MET MET A . n 
A 1 441  LEU 441  438  438  LEU LEU A . n 
A 1 442  ASN 442  439  439  ASN ASN A . n 
A 1 443  GLY 443  440  440  GLY GLY A . n 
A 1 444  GLU 444  441  441  GLU GLU A . n 
A 1 445  GLU 445  442  442  GLU GLU A . n 
A 1 446  VAL 446  443  443  VAL VAL A . n 
A 1 447  GLU 447  444  444  GLU GLU A . n 
A 1 448  GLU 448  445  445  GLU GLU A . n 
A 1 449  THR 449  446  446  THR THR A . n 
A 1 450  GLU 450  447  447  GLU GLU A . n 
A 1 451  LEU 451  448  448  LEU LEU A . n 
A 1 452  MET 452  449  449  MET MET A . n 
A 1 453  GLY 453  450  450  GLY GLY A . n 
A 1 454  PHE 454  451  451  PHE PHE A . n 
A 1 455  VAL 455  452  452  VAL VAL A . n 
A 1 456  ASP 456  453  453  ASP ASP A . n 
A 1 457  ASP 457  454  454  ASP ASP A . n 
A 1 458  GLN 458  455  455  GLN GLN A . n 
A 1 459  GLN 459  456  456  GLN GLN A . n 
A 1 460  THR 460  457  457  THR THR A . n 
A 1 461  PHE 461  458  458  PHE PHE A . n 
A 1 462  PHE 462  459  459  PHE PHE A . n 
A 1 463  CYS 463  460  460  CYS CYS A . n 
A 1 464  GLY 464  461  461  GLY GLY A . n 
A 1 465  ASN 465  462  462  ASN ASN A . n 
A 1 466  VAL 466  463  463  VAL VAL A . n 
A 1 467  ALA 467  464  464  ALA ALA A . n 
A 1 468  HIS 468  465  465  HIS HIS A . n 
A 1 469  GLN 469  466  466  GLN GLN A . n 
A 1 470  GLN 470  467  467  GLN GLN A . n 
A 1 471  LEU 471  468  468  LEU LEU A . n 
A 1 472  ILE 472  469  469  ILE ILE A . n 
A 1 473  GLN 473  470  470  GLN GLN A . n 
A 1 474  ILE 474  471  471  ILE ILE A . n 
A 1 475  THR 475  472  472  THR THR A . n 
A 1 476  SER 476  473  473  SER SER A . n 
A 1 477  ALA 477  474  474  ALA ALA A . n 
A 1 478  SER 478  475  475  SER SER A . n 
A 1 479  VAL 479  476  476  VAL VAL A . n 
A 1 480  ARG 480  477  477  ARG ARG A . n 
A 1 481  LEU 481  478  478  LEU LEU A . n 
A 1 482  VAL 482  479  479  VAL VAL A . n 
A 1 483  SER 483  480  480  SER SER A . n 
A 1 484  GLN 484  481  481  GLN GLN A . n 
A 1 485  GLU 485  482  482  GLU GLU A . n 
A 1 486  PRO 486  483  483  PRO PRO A . n 
A 1 487  LYS 487  484  484  LYS LYS A . n 
A 1 488  ALA 488  485  485  ALA ALA A . n 
A 1 489  LEU 489  486  486  LEU LEU A . n 
A 1 490  VAL 490  487  487  VAL VAL A . n 
A 1 491  SER 491  488  488  SER SER A . n 
A 1 492  GLU 492  489  489  GLU GLU A . n 
A 1 493  TRP 493  490  490  TRP TRP A . n 
A 1 494  LYS 494  491  491  LYS LYS A . n 
A 1 495  GLU 495  492  492  GLU GLU A . n 
A 1 496  PRO 496  493  493  PRO PRO A . n 
A 1 497  GLN 497  494  494  GLN GLN A . n 
A 1 498  ALA 498  495  495  ALA ALA A . n 
A 1 499  LYS 499  496  496  LYS LYS A . n 
A 1 500  ASN 500  497  497  ASN ASN A . n 
A 1 501  ILE 501  498  498  ILE ILE A . n 
A 1 502  SER 502  499  499  SER SER A . n 
A 1 503  VAL 503  500  500  VAL VAL A . n 
A 1 504  ALA 504  501  501  ALA ALA A . n 
A 1 505  SER 505  502  502  SER SER A . n 
A 1 506  CYS 506  503  503  CYS CYS A . n 
A 1 507  ASN 507  504  504  ASN ASN A . n 
A 1 508  SER 508  505  505  SER SER A . n 
A 1 509  SER 509  506  506  SER SER A . n 
A 1 510  GLN 510  507  507  GLN GLN A . n 
A 1 511  VAL 511  508  508  VAL VAL A . n 
A 1 512  VAL 512  509  509  VAL VAL A . n 
A 1 513  VAL 513  510  510  VAL VAL A . n 
A 1 514  ALA 514  511  511  ALA ALA A . n 
A 1 515  VAL 515  512  512  VAL VAL A . n 
A 1 516  GLY 516  513  513  GLY GLY A . n 
A 1 517  ARG 517  514  514  ARG ARG A . n 
A 1 518  ALA 518  515  515  ALA ALA A . n 
A 1 519  LEU 519  516  516  LEU LEU A . n 
A 1 520  TYR 520  517  517  TYR TYR A . n 
A 1 521  TYR 521  518  518  TYR TYR A . n 
A 1 522  LEU 522  519  519  LEU LEU A . n 
A 1 523  GLN 523  520  520  GLN GLN A . n 
A 1 524  ILE 524  521  521  ILE ILE A . n 
A 1 525  HIS 525  522  522  HIS HIS A . n 
A 1 526  PRO 526  523  523  PRO PRO A . n 
A 1 527  GLN 527  524  524  GLN GLN A . n 
A 1 528  GLU 528  525  525  GLU GLU A . n 
A 1 529  LEU 529  526  526  LEU LEU A . n 
A 1 530  ARG 530  527  527  ARG ARG A . n 
A 1 531  GLN 531  528  528  GLN GLN A . n 
A 1 532  ILE 532  529  529  ILE ILE A . n 
A 1 533  SER 533  530  530  SER SER A . n 
A 1 534  HIS 534  531  531  HIS HIS A . n 
A 1 535  THR 535  532  532  THR THR A . n 
A 1 536  GLU 536  533  533  GLU GLU A . n 
A 1 537  MET 537  534  534  MET MET A . n 
A 1 538  GLU 538  535  535  GLU GLU A . n 
A 1 539  HIS 539  536  536  HIS HIS A . n 
A 1 540  GLU 540  537  537  GLU GLU A . n 
A 1 541  VAL 541  538  538  VAL VAL A . n 
A 1 542  ALA 542  539  539  ALA ALA A . n 
A 1 543  CYS 543  540  540  CYS CYS A . n 
A 1 544  LEU 544  541  541  LEU LEU A . n 
A 1 545  ASP 545  542  542  ASP ASP A . n 
A 1 546  ILE 546  543  543  ILE ILE A . n 
A 1 547  THR 547  544  544  THR THR A . n 
A 1 548  PRO 548  545  545  PRO PRO A . n 
A 1 549  LEU 549  546  546  LEU LEU A . n 
A 1 550  GLY 550  547  547  GLY GLY A . n 
A 1 551  ASP 551  548  548  ASP ASP A . n 
A 1 552  SER 552  549  549  SER SER A . n 
A 1 553  ASN 553  550  550  ASN ASN A . n 
A 1 554  GLY 554  551  551  GLY GLY A . n 
A 1 555  LEU 555  552  552  LEU LEU A . n 
A 1 556  SER 556  553  553  SER SER A . n 
A 1 557  PRO 557  554  554  PRO PRO A . n 
A 1 558  LEU 558  555  555  LEU LEU A . n 
A 1 559  CYS 559  556  556  CYS CYS A . n 
A 1 560  ALA 560  557  557  ALA ALA A . n 
A 1 561  ILE 561  558  558  ILE ILE A . n 
A 1 562  GLY 562  559  559  GLY GLY A . n 
A 1 563  LEU 563  560  560  LEU LEU A . n 
A 1 564  TRP 564  561  561  TRP TRP A . n 
A 1 565  THR 565  562  562  THR THR A . n 
A 1 566  ASP 566  563  563  ASP ASP A . n 
A 1 567  ILE 567  564  564  ILE ILE A . n 
A 1 568  SER 568  565  565  SER SER A . n 
A 1 569  ALA 569  566  566  ALA ALA A . n 
A 1 570  ARG 570  567  567  ARG ARG A . n 
A 1 571  ILE 571  568  568  ILE ILE A . n 
A 1 572  LEU 572  569  569  LEU LEU A . n 
A 1 573  LYS 573  570  570  LYS LYS A . n 
A 1 574  LEU 574  571  571  LEU LEU A . n 
A 1 575  PRO 575  572  572  PRO PRO A . n 
A 1 576  SER 576  573  573  SER SER A . n 
A 1 577  PHE 577  574  574  PHE PHE A . n 
A 1 578  GLU 578  575  575  GLU GLU A . n 
A 1 579  LEU 579  576  576  LEU LEU A . n 
A 1 580  LEU 580  577  577  LEU LEU A . n 
A 1 581  HIS 581  578  578  HIS HIS A . n 
A 1 582  LYS 582  579  579  LYS LYS A . n 
A 1 583  GLU 583  580  580  GLU GLU A . n 
A 1 584  MET 584  581  581  MET MET A . n 
A 1 585  LEU 585  582  582  LEU LEU A . n 
A 1 586  GLY 586  583  583  GLY GLY A . n 
A 1 587  GLY 587  584  584  GLY GLY A . n 
A 1 588  GLU 588  585  585  GLU GLU A . n 
A 1 589  ILE 589  586  586  ILE ILE A . n 
A 1 590  ILE 590  587  587  ILE ILE A . n 
A 1 591  PRO 591  588  588  PRO PRO A . n 
A 1 592  ARG 592  589  589  ARG ARG A . n 
A 1 593  SER 593  590  590  SER SER A . n 
A 1 594  ILE 594  591  591  ILE ILE A . n 
A 1 595  LEU 595  592  592  LEU LEU A . n 
A 1 596  MET 596  593  593  MET MET A . n 
A 1 597  THR 597  594  594  THR THR A . n 
A 1 598  THR 598  595  595  THR THR A . n 
A 1 599  PHE 599  596  596  PHE PHE A . n 
A 1 600  GLU 600  597  597  GLU GLU A . n 
A 1 601  SER 601  598  598  SER SER A . n 
A 1 602  SER 602  599  599  SER SER A . n 
A 1 603  HIS 603  600  600  HIS HIS A . n 
A 1 604  TYR 604  601  601  TYR TYR A . n 
A 1 605  LEU 605  602  602  LEU LEU A . n 
A 1 606  LEU 606  603  603  LEU LEU A . n 
A 1 607  CYS 607  604  604  CYS CYS A . n 
A 1 608  ALA 608  605  605  ALA ALA A . n 
A 1 609  LEU 609  606  606  LEU LEU A . n 
A 1 610  GLY 610  607  607  GLY GLY A . n 
A 1 611  ASP 611  608  608  ASP ASP A . n 
A 1 612  GLY 612  609  609  GLY GLY A . n 
A 1 613  ALA 613  610  610  ALA ALA A . n 
A 1 614  LEU 614  611  611  LEU LEU A . n 
A 1 615  PHE 615  612  612  PHE PHE A . n 
A 1 616  TYR 616  613  613  TYR TYR A . n 
A 1 617  PHE 617  614  614  PHE PHE A . n 
A 1 618  GLY 618  615  615  GLY GLY A . n 
A 1 619  LEU 619  616  616  LEU LEU A . n 
A 1 620  ASN 620  617  617  ASN ASN A . n 
A 1 621  ILE 621  618  618  ILE ILE A . n 
A 1 622  GLU 622  619  619  GLU GLU A . n 
A 1 623  THR 623  620  620  THR THR A . n 
A 1 624  GLY 624  621  621  GLY GLY A . n 
A 1 625  LEU 625  622  622  LEU LEU A . n 
A 1 626  LEU 626  623  623  LEU LEU A . n 
A 1 627  SER 627  624  624  SER SER A . n 
A 1 628  ASP 628  625  625  ASP ASP A . n 
A 1 629  ARG 629  626  626  ARG ARG A . n 
A 1 630  LYS 630  627  627  LYS LYS A . n 
A 1 631  LYS 631  628  628  LYS LYS A . n 
A 1 632  VAL 632  629  629  VAL VAL A . n 
A 1 633  THR 633  630  630  THR THR A . n 
A 1 634  LEU 634  631  631  LEU LEU A . n 
A 1 635  GLY 635  632  632  GLY GLY A . n 
A 1 636  THR 636  633  633  THR THR A . n 
A 1 637  GLN 637  634  634  GLN GLN A . n 
A 1 638  PRO 638  635  635  PRO PRO A . n 
A 1 639  THR 639  636  636  THR THR A . n 
A 1 640  VAL 640  637  637  VAL VAL A . n 
A 1 641  LEU 641  638  638  LEU LEU A . n 
A 1 642  ARG 642  639  639  ARG ARG A . n 
A 1 643  THR 643  640  640  THR THR A . n 
A 1 644  PHE 644  641  641  PHE PHE A . n 
A 1 645  ARG 645  642  642  ARG ARG A . n 
A 1 646  SER 646  643  643  SER SER A . n 
A 1 647  LEU 647  644  644  LEU LEU A . n 
A 1 648  SER 648  645  645  SER SER A . n 
A 1 649  THR 649  646  646  THR THR A . n 
A 1 650  THR 650  647  647  THR THR A . n 
A 1 651  ASN 651  648  648  ASN ASN A . n 
A 1 652  VAL 652  649  649  VAL VAL A . n 
A 1 653  PHE 653  650  650  PHE PHE A . n 
A 1 654  ALA 654  651  651  ALA ALA A . n 
A 1 655  CYS 655  652  652  CYS CYS A . n 
A 1 656  SER 656  653  653  SER SER A . n 
A 1 657  ASP 657  654  654  ASP ASP A . n 
A 1 658  ARG 658  655  655  ARG ARG A . n 
A 1 659  PRO 659  656  656  PRO PRO A . n 
A 1 660  THR 660  657  657  THR THR A . n 
A 1 661  VAL 661  658  658  VAL VAL A . n 
A 1 662  ILE 662  659  659  ILE ILE A . n 
A 1 663  TYR 663  660  660  TYR TYR A . n 
A 1 664  SER 664  661  661  SER SER A . n 
A 1 665  SER 665  662  662  SER SER A . n 
A 1 666  ASN 666  663  663  ASN ASN A . n 
A 1 667  HIS 667  664  664  HIS HIS A . n 
A 1 668  LYS 668  665  665  LYS LYS A . n 
A 1 669  LEU 669  666  666  LEU LEU A . n 
A 1 670  VAL 670  667  667  VAL VAL A . n 
A 1 671  PHE 671  668  668  PHE PHE A . n 
A 1 672  SER 672  669  669  SER SER A . n 
A 1 673  ASN 673  670  670  ASN ASN A . n 
A 1 674  VAL 674  671  671  VAL VAL A . n 
A 1 675  ASN 675  672  672  ASN ASN A . n 
A 1 676  LEU 676  673  673  LEU LEU A . n 
A 1 677  LYS 677  674  674  LYS LYS A . n 
A 1 678  GLU 678  675  675  GLU GLU A . n 
A 1 679  VAL 679  676  676  VAL VAL A . n 
A 1 680  ASN 680  677  677  ASN ASN A . n 
A 1 681  TYR 681  678  678  TYR TYR A . n 
A 1 682  MET 682  679  679  MET MET A . n 
A 1 683  CYS 683  680  680  CYS CYS A . n 
A 1 684  PRO 684  681  681  PRO PRO A . n 
A 1 685  LEU 685  682  682  LEU LEU A . n 
A 1 686  ASN 686  683  683  ASN ASN A . n 
A 1 687  SER 687  684  684  SER SER A . n 
A 1 688  ASP 688  685  685  ASP ASP A . n 
A 1 689  GLY 689  686  686  GLY GLY A . n 
A 1 690  TYR 690  687  687  TYR TYR A . n 
A 1 691  PRO 691  688  688  PRO PRO A . n 
A 1 692  ASP 692  689  689  ASP ASP A . n 
A 1 693  SER 693  690  690  SER SER A . n 
A 1 694  LEU 694  691  691  LEU LEU A . n 
A 1 695  ALA 695  692  692  ALA ALA A . n 
A 1 696  LEU 696  693  693  LEU LEU A . n 
A 1 697  ALA 697  694  694  ALA ALA A . n 
A 1 698  ASN 698  695  695  ASN ASN A . n 
A 1 699  ASN 699  696  696  ASN ASN A . n 
A 1 700  SER 700  697  697  SER SER A . n 
A 1 701  THR 701  698  698  THR THR A . n 
A 1 702  LEU 702  699  699  LEU LEU A . n 
A 1 703  THR 703  700  700  THR THR A . n 
A 1 704  ILE 704  701  701  ILE ILE A . n 
A 1 705  GLY 705  702  702  GLY GLY A . n 
A 1 706  THR 706  703  703  THR THR A . n 
A 1 707  ILE 707  704  704  ILE ILE A . n 
A 1 708  ASP 708  705  705  ASP ASP A . n 
A 1 709  GLU 709  706  706  GLU GLU A . n 
A 1 710  ILE 710  707  707  ILE ILE A . n 
A 1 711  GLN 711  708  708  GLN GLN A . n 
A 1 712  LYS 712  709  709  LYS LYS A . n 
A 1 713  LEU 713  710  710  LEU LEU A . n 
A 1 714  HIS 714  711  711  HIS HIS A . n 
A 1 715  ILE 715  712  712  ILE ILE A . n 
A 1 716  ARG 716  713  713  ARG ARG A . n 
A 1 717  THR 717  714  714  THR THR A . n 
A 1 718  VAL 718  715  715  VAL VAL A . n 
A 1 719  PRO 719  716  716  PRO PRO A . n 
A 1 720  LEU 720  717  717  LEU LEU A . n 
A 1 721  TYR 721  718  718  TYR TYR A . n 
A 1 722  GLU 722  719  719  GLU GLU A . n 
A 1 723  SER 723  720  720  SER SER A . n 
A 1 724  PRO 724  721  721  PRO PRO A . n 
A 1 725  ARG 725  722  722  ARG ARG A . n 
A 1 726  LYS 726  723  723  LYS LYS A . n 
A 1 727  ILE 727  724  724  ILE ILE A . n 
A 1 728  CYS 728  725  725  CYS CYS A . n 
A 1 729  TYR 729  726  726  TYR TYR A . n 
A 1 730  GLN 730  727  727  GLN GLN A . n 
A 1 731  GLU 731  728  728  GLU GLU A . n 
A 1 732  VAL 732  729  729  VAL VAL A . n 
A 1 733  SER 733  730  730  SER SER A . n 
A 1 734  GLN 734  731  731  GLN GLN A . n 
A 1 735  CYS 735  732  732  CYS CYS A . n 
A 1 736  PHE 736  733  733  PHE PHE A . n 
A 1 737  GLY 737  734  734  GLY GLY A . n 
A 1 738  VAL 738  735  735  VAL VAL A . n 
A 1 739  LEU 739  736  736  LEU LEU A . n 
A 1 740  SER 740  737  737  SER SER A . n 
A 1 741  SER 741  738  738  SER SER A . n 
A 1 742  ARG 742  739  739  ARG ARG A . n 
A 1 743  ILE 743  740  740  ILE ILE A . n 
A 1 744  GLU 744  741  741  GLU GLU A . n 
A 1 745  VAL 745  742  742  VAL VAL A . n 
A 1 746  GLN 746  743  743  GLN GLN A . n 
A 1 747  ASP 747  744  744  ASP ASP A . n 
A 1 748  THR 748  745  745  THR THR A . n 
A 1 749  SER 749  746  746  SER SER A . n 
A 1 750  GLY 750  747  747  GLY GLY A . n 
A 1 751  GLY 751  748  748  GLY GLY A . n 
A 1 752  THR 752  749  749  THR THR A . n 
A 1 753  THR 753  750  750  THR THR A . n 
A 1 754  ALA 754  751  751  ALA ALA A . n 
A 1 755  LEU 755  752  752  LEU LEU A . n 
A 1 756  ARG 756  753  753  ARG ARG A . n 
A 1 757  PRO 757  754  754  PRO PRO A . n 
A 1 758  SER 758  755  755  SER SER A . n 
A 1 759  ALA 759  756  756  ALA ALA A . n 
A 1 760  SER 760  757  757  SER SER A . n 
A 1 761  THR 761  758  758  THR THR A . n 
A 1 762  GLN 762  759  759  GLN GLN A . n 
A 1 763  ALA 763  760  760  ALA ALA A . n 
A 1 764  LEU 764  761  761  LEU LEU A . n 
A 1 765  SER 765  762  762  SER SER A . n 
A 1 766  SER 766  763  763  SER SER A . n 
A 1 767  SER 767  764  764  SER SER A . n 
A 1 768  VAL 768  765  765  VAL VAL A . n 
A 1 769  SER 769  766  766  SER SER A . n 
A 1 770  SER 770  767  767  SER SER A . n 
A 1 771  SER 771  768  768  SER SER A . n 
A 1 772  LYS 772  769  769  LYS LYS A . n 
A 1 773  LEU 773  770  770  LEU LEU A . n 
A 1 774  PHE 774  771  771  PHE PHE A . n 
A 1 775  SER 775  772  772  SER SER A . n 
A 1 776  SER 776  773  773  SER SER A . n 
A 1 777  SER 777  774  ?    ?   ?   A . n 
A 1 778  THR 778  775  ?    ?   ?   A . n 
A 1 779  ALA 779  776  ?    ?   ?   A . n 
A 1 780  PRO 780  777  ?    ?   ?   A . n 
A 1 781  HIS 781  778  ?    ?   ?   A . n 
A 1 782  GLU 782  779  ?    ?   ?   A . n 
A 1 783  THR 783  780  ?    ?   ?   A . n 
A 1 784  SER 784  781  ?    ?   ?   A . n 
A 1 785  PHE 785  782  ?    ?   ?   A . n 
A 1 786  GLY 786  783  783  GLY GLY A . n 
A 1 787  GLU 787  784  784  GLU GLU A . n 
A 1 788  GLU 788  785  785  GLU GLU A . n 
A 1 789  VAL 789  786  786  VAL VAL A . n 
A 1 790  GLU 790  787  787  GLU GLU A . n 
A 1 791  VAL 791  788  788  VAL VAL A . n 
A 1 792  HIS 792  789  789  HIS HIS A . n 
A 1 793  ASN 793  790  790  ASN ASN A . n 
A 1 794  LEU 794  791  791  LEU LEU A . n 
A 1 795  LEU 795  792  792  LEU LEU A . n 
A 1 796  ILE 796  793  793  ILE ILE A . n 
A 1 797  ILE 797  794  794  ILE ILE A . n 
A 1 798  ASP 798  795  795  ASP ASP A . n 
A 1 799  GLN 799  796  796  GLN GLN A . n 
A 1 800  HIS 800  797  797  HIS HIS A . n 
A 1 801  THR 801  798  798  THR THR A . n 
A 1 802  PHE 802  799  799  PHE PHE A . n 
A 1 803  GLU 803  800  800  GLU GLU A . n 
A 1 804  VAL 804  801  801  VAL VAL A . n 
A 1 805  LEU 805  802  802  LEU LEU A . n 
A 1 806  HIS 806  803  803  HIS HIS A . n 
A 1 807  ALA 807  804  804  ALA ALA A . n 
A 1 808  HIS 808  805  805  HIS HIS A . n 
A 1 809  GLN 809  806  806  GLN GLN A . n 
A 1 810  PHE 810  807  807  PHE PHE A . n 
A 1 811  LEU 811  808  808  LEU LEU A . n 
A 1 812  GLN 812  809  809  GLN GLN A . n 
A 1 813  ASN 813  810  810  ASN ASN A . n 
A 1 814  GLU 814  811  811  GLU GLU A . n 
A 1 815  TYR 815  812  812  TYR TYR A . n 
A 1 816  ALA 816  813  813  ALA ALA A . n 
A 1 817  LEU 817  814  814  LEU LEU A . n 
A 1 818  SER 818  815  815  SER SER A . n 
A 1 819  LEU 819  816  816  LEU LEU A . n 
A 1 820  VAL 820  817  817  VAL VAL A . n 
A 1 821  SER 821  818  818  SER SER A . n 
A 1 822  CYS 822  819  819  CYS CYS A . n 
A 1 823  LYS 823  820  820  LYS LYS A . n 
A 1 824  LEU 824  821  821  LEU LEU A . n 
A 1 825  GLY 825  822  822  GLY GLY A . n 
A 1 826  LYS 826  823  823  LYS LYS A . n 
A 1 827  ASP 827  824  824  ASP ASP A . n 
A 1 828  PRO 828  825  825  PRO PRO A . n 
A 1 829  ASN 829  826  826  ASN ASN A . n 
A 1 830  THR 830  827  827  THR THR A . n 
A 1 831  TYR 831  828  828  TYR TYR A . n 
A 1 832  PHE 832  829  829  PHE PHE A . n 
A 1 833  ILE 833  830  830  ILE ILE A . n 
A 1 834  VAL 834  831  831  VAL VAL A . n 
A 1 835  GLY 835  832  832  GLY GLY A . n 
A 1 836  THR 836  833  833  THR THR A . n 
A 1 837  ALA 837  834  834  ALA ALA A . n 
A 1 838  MET 838  835  835  MET MET A . n 
A 1 839  VAL 839  836  836  VAL VAL A . n 
A 1 840  TYR 840  837  837  TYR TYR A . n 
A 1 841  PRO 841  838  838  PRO PRO A . n 
A 1 842  GLU 842  839  839  GLU GLU A . n 
A 1 843  GLU 843  840  840  GLU GLU A . n 
A 1 844  ALA 844  841  841  ALA ALA A . n 
A 1 845  GLU 845  842  842  GLU GLU A . n 
A 1 846  PRO 846  843  843  PRO PRO A . n 
A 1 847  LYS 847  844  844  LYS LYS A . n 
A 1 848  GLN 848  845  845  GLN GLN A . n 
A 1 849  GLY 849  846  846  GLY GLY A . n 
A 1 850  ARG 850  847  847  ARG ARG A . n 
A 1 851  ILE 851  848  848  ILE ILE A . n 
A 1 852  VAL 852  849  849  VAL VAL A . n 
A 1 853  VAL 853  850  850  VAL VAL A . n 
A 1 854  PHE 854  851  851  PHE PHE A . n 
A 1 855  GLN 855  852  852  GLN GLN A . n 
A 1 856  TYR 856  853  853  TYR TYR A . n 
A 1 857  SER 857  854  854  SER SER A . n 
A 1 858  ASP 858  855  855  ASP ASP A . n 
A 1 859  GLY 859  856  856  GLY GLY A . n 
A 1 860  LYS 860  857  857  LYS LYS A . n 
A 1 861  LEU 861  858  858  LEU LEU A . n 
A 1 862  GLN 862  859  859  GLN GLN A . n 
A 1 863  THR 863  860  860  THR THR A . n 
A 1 864  VAL 864  861  861  VAL VAL A . n 
A 1 865  ALA 865  862  862  ALA ALA A . n 
A 1 866  GLU 866  863  863  GLU GLU A . n 
A 1 867  LYS 867  864  864  LYS LYS A . n 
A 1 868  GLU 868  865  865  GLU GLU A . n 
A 1 869  VAL 869  866  866  VAL VAL A . n 
A 1 870  LYS 870  867  867  LYS LYS A . n 
A 1 871  GLY 871  868  868  GLY GLY A . n 
A 1 872  ALA 872  869  869  ALA ALA A . n 
A 1 873  VAL 873  870  870  VAL VAL A . n 
A 1 874  TYR 874  871  871  TYR TYR A . n 
A 1 875  SER 875  872  872  SER SER A . n 
A 1 876  MET 876  873  873  MET MET A . n 
A 1 877  VAL 877  874  874  VAL VAL A . n 
A 1 878  GLU 878  875  875  GLU GLU A . n 
A 1 879  PHE 879  876  876  PHE PHE A . n 
A 1 880  ASN 880  877  877  ASN ASN A . n 
A 1 881  GLY 881  878  878  GLY GLY A . n 
A 1 882  LYS 882  879  879  LYS LYS A . n 
A 1 883  LEU 883  880  880  LEU LEU A . n 
A 1 884  LEU 884  881  881  LEU LEU A . n 
A 1 885  ALA 885  882  882  ALA ALA A . n 
A 1 886  SER 886  883  883  SER SER A . n 
A 1 887  ILE 887  884  884  ILE ILE A . n 
A 1 888  ASN 888  885  885  ASN ASN A . n 
A 1 889  SER 889  886  886  SER SER A . n 
A 1 890  THR 890  887  887  THR THR A . n 
A 1 891  VAL 891  888  888  VAL VAL A . n 
A 1 892  ARG 892  889  889  ARG ARG A . n 
A 1 893  LEU 893  890  890  LEU LEU A . n 
A 1 894  TYR 894  891  891  TYR TYR A . n 
A 1 895  GLU 895  892  892  GLU GLU A . n 
A 1 896  TRP 896  893  893  TRP TRP A . n 
A 1 897  THR 897  894  894  THR THR A . n 
A 1 898  THR 898  895  895  THR THR A . n 
A 1 899  GLU 899  896  896  GLU GLU A . n 
A 1 900  LYS 900  897  897  LYS LYS A . n 
A 1 901  ASP 901  898  898  ASP ASP A . n 
A 1 902  VAL 902  899  899  VAL VAL A . n 
A 1 903  ARG 903  900  900  ARG ARG A . n 
A 1 904  THR 904  901  901  THR THR A . n 
A 1 905  GLU 905  902  902  GLU GLU A . n 
A 1 906  CYS 906  903  903  CYS CYS A . n 
A 1 907  ASN 907  904  904  ASN ASN A . n 
A 1 908  HIS 908  905  905  HIS HIS A . n 
A 1 909  TYR 909  906  906  TYR TYR A . n 
A 1 910  ASN 910  907  907  ASN ASN A . n 
A 1 911  ASN 911  908  908  ASN ASN A . n 
A 1 912  ILE 912  909  909  ILE ILE A . n 
A 1 913  MET 913  910  910  MET MET A . n 
A 1 914  ALA 914  911  911  ALA ALA A . n 
A 1 915  LEU 915  912  912  LEU LEU A . n 
A 1 916  TYR 916  913  913  TYR TYR A . n 
A 1 917  LEU 917  914  914  LEU LEU A . n 
A 1 918  LYS 918  915  915  LYS LYS A . n 
A 1 919  THR 919  916  916  THR THR A . n 
A 1 920  LYS 920  917  917  LYS LYS A . n 
A 1 921  GLY 921  918  918  GLY GLY A . n 
A 1 922  ASP 922  919  919  ASP ASP A . n 
A 1 923  PHE 923  920  920  PHE PHE A . n 
A 1 924  ILE 924  921  921  ILE ILE A . n 
A 1 925  LEU 925  922  922  LEU LEU A . n 
A 1 926  VAL 926  923  923  VAL VAL A . n 
A 1 927  GLY 927  924  924  GLY GLY A . n 
A 1 928  ASP 928  925  925  ASP ASP A . n 
A 1 929  LEU 929  926  926  LEU LEU A . n 
A 1 930  MET 930  927  927  MET MET A . n 
A 1 931  ARG 931  928  928  ARG ARG A . n 
A 1 932  SER 932  929  929  SER SER A . n 
A 1 933  VAL 933  930  930  VAL VAL A . n 
A 1 934  LEU 934  931  931  LEU LEU A . n 
A 1 935  LEU 935  932  932  LEU LEU A . n 
A 1 936  LEU 936  933  933  LEU LEU A . n 
A 1 937  ALA 937  934  934  ALA ALA A . n 
A 1 938  TYR 938  935  935  TYR TYR A . n 
A 1 939  LYS 939  936  936  LYS LYS A . n 
A 1 940  PRO 940  937  937  PRO PRO A . n 
A 1 941  MET 941  938  938  MET MET A . n 
A 1 942  GLU 942  939  939  GLU GLU A . n 
A 1 943  GLY 943  940  940  GLY GLY A . n 
A 1 944  ASN 944  941  941  ASN ASN A . n 
A 1 945  PHE 945  942  942  PHE PHE A . n 
A 1 946  GLU 946  943  943  GLU GLU A . n 
A 1 947  GLU 947  944  944  GLU GLU A . n 
A 1 948  ILE 948  945  945  ILE ILE A . n 
A 1 949  ALA 949  946  946  ALA ALA A . n 
A 1 950  ARG 950  947  947  ARG ARG A . n 
A 1 951  ASP 951  948  948  ASP ASP A . n 
A 1 952  PHE 952  949  949  PHE PHE A . n 
A 1 953  ASN 953  950  950  ASN ASN A . n 
A 1 954  PRO 954  951  951  PRO PRO A . n 
A 1 955  ASN 955  952  952  ASN ASN A . n 
A 1 956  TRP 956  953  953  TRP TRP A . n 
A 1 957  MET 957  954  954  MET MET A . n 
A 1 958  SER 958  955  955  SER SER A . n 
A 1 959  ALA 959  956  956  ALA ALA A . n 
A 1 960  VAL 960  957  957  VAL VAL A . n 
A 1 961  GLU 961  958  958  GLU GLU A . n 
A 1 962  ILE 962  959  959  ILE ILE A . n 
A 1 963  LEU 963  960  960  LEU LEU A . n 
A 1 964  ASP 964  961  961  ASP ASP A . n 
A 1 965  ASP 965  962  962  ASP ASP A . n 
A 1 966  ASP 966  963  963  ASP ASP A . n 
A 1 967  ASN 967  964  964  ASN ASN A . n 
A 1 968  PHE 968  965  965  PHE PHE A . n 
A 1 969  LEU 969  966  966  LEU LEU A . n 
A 1 970  GLY 970  967  967  GLY GLY A . n 
A 1 971  ALA 971  968  968  ALA ALA A . n 
A 1 972  GLU 972  969  969  GLU GLU A . n 
A 1 973  ASN 973  970  970  ASN ASN A . n 
A 1 974  ALA 974  971  971  ALA ALA A . n 
A 1 975  PHE 975  972  972  PHE PHE A . n 
A 1 976  ASN 976  973  973  ASN ASN A . n 
A 1 977  LEU 977  974  974  LEU LEU A . n 
A 1 978  PHE 978  975  975  PHE PHE A . n 
A 1 979  VAL 979  976  976  VAL VAL A . n 
A 1 980  CYS 980  977  977  CYS CYS A . n 
A 1 981  GLN 981  978  978  GLN GLN A . n 
A 1 982  LYS 982  979  979  LYS LYS A . n 
A 1 983  ASP 983  980  980  ASP ASP A . n 
A 1 984  SER 984  981  981  SER SER A . n 
A 1 985  ALA 985  982  982  ALA ALA A . n 
A 1 986  ALA 986  983  983  ALA ALA A . n 
A 1 987  THR 987  984  984  THR THR A . n 
A 1 988  THR 988  985  985  THR THR A . n 
A 1 989  ASP 989  986  986  ASP ASP A . n 
A 1 990  GLU 990  987  987  GLU GLU A . n 
A 1 991  GLU 991  988  988  GLU GLU A . n 
A 1 992  ARG 992  989  989  ARG ARG A . n 
A 1 993  GLN 993  990  990  GLN GLN A . n 
A 1 994  HIS 994  991  991  HIS HIS A . n 
A 1 995  LEU 995  992  992  LEU LEU A . n 
A 1 996  GLN 996  993  993  GLN GLN A . n 
A 1 997  GLU 997  994  994  GLU GLU A . n 
A 1 998  VAL 998  995  995  VAL VAL A . n 
A 1 999  GLY 999  996  996  GLY GLY A . n 
A 1 1000 LEU 1000 997  997  LEU LEU A . n 
A 1 1001 PHE 1001 998  998  PHE PHE A . n 
A 1 1002 HIS 1002 999  999  HIS HIS A . n 
A 1 1003 LEU 1003 1000 1000 LEU LEU A . n 
A 1 1004 GLY 1004 1001 1001 GLY GLY A . n 
A 1 1005 GLU 1005 1002 1002 GLU GLU A . n 
A 1 1006 PHE 1006 1003 1003 PHE PHE A . n 
A 1 1007 VAL 1007 1004 1004 VAL VAL A . n 
A 1 1008 ASN 1008 1005 1005 ASN ASN A . n 
A 1 1009 VAL 1009 1006 1006 VAL VAL A . n 
A 1 1010 PHE 1010 1007 1007 PHE PHE A . n 
A 1 1011 CYS 1011 1008 1008 CYS CYS A . n 
A 1 1012 HIS 1012 1009 1009 HIS HIS A . n 
A 1 1013 GLY 1013 1010 1010 GLY GLY A . n 
A 1 1014 SER 1014 1011 1011 SER SER A . n 
A 1 1015 LEU 1015 1012 1012 LEU LEU A . n 
A 1 1016 VAL 1016 1013 1013 VAL VAL A . n 
A 1 1017 MET 1017 1014 1014 MET MET A . n 
A 1 1018 GLN 1018 1015 1015 GLN GLN A . n 
A 1 1019 ASN 1019 1016 ?    ?   ?   A . n 
A 1 1020 LEU 1020 1017 ?    ?   ?   A . n 
A 1 1021 GLY 1021 1018 ?    ?   ?   A . n 
A 1 1022 GLU 1022 1019 ?    ?   ?   A . n 
A 1 1023 THR 1023 1020 ?    ?   ?   A . n 
A 1 1024 SER 1024 1021 ?    ?   ?   A . n 
A 1 1025 THR 1025 1022 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1023 1023 PRO PRO A . n 
A 1 1027 THR 1027 1024 1024 THR THR A . n 
A 1 1028 GLN 1028 1025 1025 GLN GLN A . n 
A 1 1029 GLY 1029 1026 1026 GLY GLY A . n 
A 1 1030 SER 1030 1027 1027 SER SER A . n 
A 1 1031 VAL 1031 1028 1028 VAL VAL A . n 
A 1 1032 LEU 1032 1029 1029 LEU LEU A . n 
A 1 1033 PHE 1033 1030 1030 PHE PHE A . n 
A 1 1034 GLY 1034 1031 1031 GLY GLY A . n 
A 1 1035 THR 1035 1032 1032 THR THR A . n 
A 1 1036 VAL 1036 1033 1033 VAL VAL A . n 
A 1 1037 ASN 1037 1034 1034 ASN ASN A . n 
A 1 1038 GLY 1038 1035 1035 GLY GLY A . n 
A 1 1039 MET 1039 1036 1036 MET MET A . n 
A 1 1040 ILE 1040 1037 1037 ILE ILE A . n 
A 1 1041 GLY 1041 1038 1038 GLY GLY A . n 
A 1 1042 LEU 1042 1039 1039 LEU LEU A . n 
A 1 1043 VAL 1043 1040 1040 VAL VAL A . n 
A 1 1044 THR 1044 1041 1041 THR THR A . n 
A 1 1045 SER 1045 1042 1042 SER SER A . n 
A 1 1046 LEU 1046 1043 1043 LEU LEU A . n 
A 1 1047 SER 1047 1044 1044 SER SER A . n 
A 1 1048 GLU 1048 1045 1045 GLU GLU A . n 
A 1 1049 SER 1049 1046 1046 SER SER A . n 
A 1 1050 TRP 1050 1047 1047 TRP TRP A . n 
A 1 1051 TYR 1051 1048 1048 TYR TYR A . n 
A 1 1052 ASN 1052 1049 1049 ASN ASN A . n 
A 1 1053 LEU 1053 1050 1050 LEU LEU A . n 
A 1 1054 LEU 1054 1051 1051 LEU LEU A . n 
A 1 1055 LEU 1055 1052 1052 LEU LEU A . n 
A 1 1056 ASP 1056 1053 1053 ASP ASP A . n 
A 1 1057 MET 1057 1054 1054 MET MET A . n 
A 1 1058 GLN 1058 1055 1055 GLN GLN A . n 
A 1 1059 ASN 1059 1056 1056 ASN ASN A . n 
A 1 1060 ARG 1060 1057 1057 ARG ARG A . n 
A 1 1061 LEU 1061 1058 1058 LEU LEU A . n 
A 1 1062 ASN 1062 1059 1059 ASN ASN A . n 
A 1 1063 LYS 1063 1060 1060 LYS LYS A . n 
A 1 1064 VAL 1064 1061 1061 VAL VAL A . n 
A 1 1065 ILE 1065 1062 1062 ILE ILE A . n 
A 1 1066 LYS 1066 1063 1063 LYS LYS A . n 
A 1 1067 SER 1067 1064 1064 SER SER A . n 
A 1 1068 VAL 1068 1065 1065 VAL VAL A . n 
A 1 1069 GLY 1069 1066 1066 GLY GLY A . n 
A 1 1070 LYS 1070 1067 1067 LYS LYS A . n 
A 1 1071 ILE 1071 1068 1068 ILE ILE A . n 
A 1 1072 GLU 1072 1069 1069 GLU GLU A . n 
A 1 1073 HIS 1073 1070 1070 HIS HIS A . n 
A 1 1074 SER 1074 1071 1071 SER SER A . n 
A 1 1075 PHE 1075 1072 1072 PHE PHE A . n 
A 1 1076 TRP 1076 1073 1073 TRP TRP A . n 
A 1 1077 ARG 1077 1074 1074 ARG ARG A . n 
A 1 1078 SER 1078 1075 1075 SER SER A . n 
A 1 1079 PHE 1079 1076 1076 PHE PHE A . n 
A 1 1080 HIS 1080 1077 1077 HIS HIS A . n 
A 1 1081 THR 1081 1078 1078 THR THR A . n 
A 1 1082 GLU 1082 1079 1079 GLU GLU A . n 
A 1 1083 ARG 1083 1080 1080 ARG ARG A . n 
A 1 1084 LYS 1084 1081 1081 LYS LYS A . n 
A 1 1085 THR 1085 1082 1082 THR THR A . n 
A 1 1086 GLU 1086 1083 1083 GLU GLU A . n 
A 1 1087 PRO 1087 1084 1084 PRO PRO A . n 
A 1 1088 ALA 1088 1085 1085 ALA ALA A . n 
A 1 1089 THR 1089 1086 1086 THR THR A . n 
A 1 1090 GLY 1090 1087 1087 GLY GLY A . n 
A 1 1091 PHE 1091 1088 1088 PHE PHE A . n 
A 1 1092 ILE 1092 1089 1089 ILE ILE A . n 
A 1 1093 ASP 1093 1090 1090 ASP ASP A . n 
A 1 1094 GLY 1094 1091 1091 GLY GLY A . n 
A 1 1095 ASP 1095 1092 1092 ASP ASP A . n 
A 1 1096 LEU 1096 1093 1093 LEU LEU A . n 
A 1 1097 ILE 1097 1094 1094 ILE ILE A . n 
A 1 1098 GLU 1098 1095 1095 GLU GLU A . n 
A 1 1099 SER 1099 1096 1096 SER SER A . n 
A 1 1100 PHE 1100 1097 1097 PHE PHE A . n 
A 1 1101 LEU 1101 1098 1098 LEU LEU A . n 
A 1 1102 ASP 1102 1099 1099 ASP ASP A . n 
A 1 1103 ILE 1103 1100 1100 ILE ILE A . n 
A 1 1104 SER 1104 1101 1101 SER SER A . n 
A 1 1105 ARG 1105 1102 1102 ARG ARG A . n 
A 1 1106 PRO 1106 1103 1103 PRO PRO A . n 
A 1 1107 LYS 1107 1104 1104 LYS LYS A . n 
A 1 1108 MET 1108 1105 1105 MET MET A . n 
A 1 1109 GLN 1109 1106 1106 GLN GLN A . n 
A 1 1110 GLU 1110 1107 1107 GLU GLU A . n 
A 1 1111 VAL 1111 1108 1108 VAL VAL A . n 
A 1 1112 VAL 1112 1109 1109 VAL VAL A . n 
A 1 1113 ALA 1113 1110 1110 ALA ALA A . n 
A 1 1114 ASN 1114 1111 1111 ASN ASN A . n 
A 1 1115 LEU 1115 1112 ?    ?   ?   A . n 
A 1 1116 GLN 1116 1113 ?    ?   ?   A . n 
A 1 1117 TYR 1117 1114 ?    ?   ?   A . n 
A 1 1118 ASP 1118 1115 ?    ?   ?   A . n 
A 1 1119 ASP 1119 1116 ?    ?   ?   A . n 
A 1 1120 GLY 1120 1117 ?    ?   ?   A . n 
A 1 1121 SER 1121 1118 ?    ?   ?   A . n 
A 1 1122 GLY 1122 1119 ?    ?   ?   A . n 
A 1 1123 MET 1123 1120 ?    ?   ?   A . n 
A 1 1124 LYS 1124 1121 ?    ?   ?   A . n 
A 1 1125 ARG 1125 1122 1122 ARG ARG A . n 
A 1 1126 GLU 1126 1123 1123 GLU GLU A . n 
A 1 1127 ALA 1127 1124 1124 ALA ALA A . n 
A 1 1128 THR 1128 1125 1125 THR THR A . n 
A 1 1129 ALA 1129 1126 1126 ALA ALA A . n 
A 1 1130 ASP 1130 1127 1127 ASP ASP A . n 
A 1 1131 ASP 1131 1128 1128 ASP ASP A . n 
A 1 1132 LEU 1132 1129 1129 LEU LEU A . n 
A 1 1133 ILE 1133 1130 1130 ILE ILE A . n 
A 1 1134 LYS 1134 1131 1131 LYS LYS A . n 
A 1 1135 VAL 1135 1132 1132 VAL VAL A . n 
A 1 1136 VAL 1136 1133 1133 VAL VAL A . n 
A 1 1137 GLU 1137 1134 1134 GLU GLU A . n 
A 1 1138 GLU 1138 1135 1135 GLU GLU A . n 
A 1 1139 LEU 1139 1136 1136 LEU LEU A . n 
A 1 1140 THR 1140 1137 1137 THR THR A . n 
A 1 1141 ARG 1141 1138 1138 ARG ARG A . n 
A 1 1142 ILE 1142 1139 1139 ILE ILE A . n 
A 1 1143 HIS 1143 1140 1140 HIS HIS A . n 
B 2 1    SER 1    68   68   SER SER B . n 
B 2 2    ILE 2    69   69   ILE ILE B . n 
B 2 3    VAL 3    70   70   VAL VAL B . n 
B 2 4    ARG 4    71   71   ARG ARG B . n 
B 2 5    THR 5    72   72   THR THR B . n 
B 2 6    LEU 6    73   73   LEU LEU B . n 
B 2 7    HIS 7    74   74   HIS HIS B . n 
B 2 8    GLN 8    75   75   GLN GLN B . n 
B 2 9    HIS 9    76   76   HIS HIS B . n 
B 2 10   LYS 10   77   77   LYS LYS B . n 
B 2 11   LEU 11   78   78   LEU LEU B . n 
B 2 12   GLY 12   79   79   GLY GLY B . n 
B 2 13   ARG 13   80   80   ARG ARG B . n 
B 2 14   ALA 14   81   81   ALA ALA B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1520  ? 
1 MORE         -7    ? 
1 'SSA (A^2)'  48370 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3I7L 
_pdbx_entry_details.sequence_details     'MUTATIONS OCCURRED DURING THE CLONING OF DDB1' 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A ASP 453  ? ? OD1 A ASP 453  ? ? 1.606 1.249 0.357  0.023 N 
2 1 CG A ASP 453  ? ? OD2 A ASP 453  ? ? 1.577 1.249 0.328  0.023 N 
3 1 CZ A ARG 642  ? ? NH2 A ARG 642  ? ? 1.412 1.326 0.086  0.013 N 
4 1 CB A CYS 1008 ? ? SG  A CYS 1008 ? ? 1.704 1.812 -0.108 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C   A ASP 265 ? ? N  A PRO 266 ? ? CA  A PRO 266 ? ? 128.91 119.30 9.61   1.50 Y 
2  1 CB  A GLN 290 ? ? CA A GLN 290 ? ? C   A GLN 290 ? ? 143.19 110.40 32.79  2.00 N 
3  1 N   A GLN 290 ? ? CA A GLN 290 ? ? C   A GLN 290 ? ? 84.05  111.00 -26.95 2.70 N 
4  1 N   A MET 291 ? ? CA A MET 291 ? ? C   A MET 291 ? ? 89.34  111.00 -21.66 2.70 N 
5  1 N   A THR 294 ? ? CA A THR 294 ? ? CB  A THR 294 ? ? 98.33  110.30 -11.97 1.90 N 
6  1 OD1 A ASP 453 ? ? CG A ASP 453 ? ? OD2 A ASP 453 ? ? 135.99 123.30 12.69  1.90 N 
7  1 CB  A ASP 453 ? ? CG A ASP 453 ? ? OD1 A ASP 453 ? ? 106.22 118.30 -12.08 0.90 N 
8  1 N   A ARG 514 ? ? CA A ARG 514 ? ? CB  A ARG 514 ? ? 90.76  110.60 -19.84 1.80 N 
9  1 N   A SER 573 ? ? CA A SER 573 ? ? CB  A SER 573 ? ? 81.24  110.50 -29.26 1.50 N 
10 1 N   A SER 573 ? ? CA A SER 573 ? ? C   A SER 573 ? ? 127.34 111.00 16.34  2.70 N 
11 1 CB  A PHE 829 ? ? CA A PHE 829 ? ? C   A PHE 829 ? ? 93.57  110.40 -16.83 2.00 N 
12 1 CB  A GLU 902 ? ? CA A GLU 902 ? ? C   A GLU 902 ? ? 124.52 110.40 14.12  2.00 N 
13 1 N   A ARG 928 ? ? CA A ARG 928 ? ? C   A ARG 928 ? ? 92.92  111.00 -18.08 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASP A 28   ? ? 156.19  135.01  
2   1 LYS A 35   ? ? -99.39  -95.98  
3   1 ASN A 36   ? ? -127.24 -76.43  
4   1 TYR A 58   ? ? -99.14  58.27   
5   1 LYS A 70   ? ? -37.60  125.05  
6   1 TYR A 84   ? ? 81.02   28.77   
7   1 SER A 94   ? ? 1.89    108.59  
8   1 VAL A 108  ? ? -105.02 41.89   
9   1 PRO A 115  ? ? -47.12  105.69  
10  1 LEU A 145  ? ? -97.88  41.51   
11  1 ARG A 147  ? ? -45.80  -17.51  
12  1 ASP A 148  ? ? -74.88  -136.88 
13  1 ARG A 158  ? ? -35.09  119.14  
14  1 PRO A 176  ? ? -35.93  116.73  
15  1 GLN A 186  ? ? 98.22   -14.98  
16  1 SER A 217  ? ? -144.76 -6.44   
17  1 PHE A 226  ? ? -90.68  -60.47  
18  1 GLU A 235  ? ? 70.18   -24.73  
19  1 ASN A 241  ? ? -172.76 144.87  
20  1 VAL A 264  ? ? -95.57  -60.11  
21  1 PRO A 266  ? ? -37.23  -29.14  
22  1 GLN A 290  ? ? -110.74 -137.35 
23  1 MET A 291  ? ? -134.20 -65.73  
24  1 LEU A 304  ? ? -61.15  99.71   
25  1 LEU A 317  ? ? -126.53 -132.86 
26  1 ASN A 341  ? ? -95.32  -149.67 
27  1 GLN A 343  ? ? 88.22   1.86    
28  1 GLU A 368  ? ? -71.75  31.85   
29  1 ARG A 369  ? ? 64.29   -22.42  
30  1 PHE A 382  ? ? 44.76   -136.06 
31  1 HIS A 399  ? ? -96.98  -143.40 
32  1 ARG A 414  ? ? -116.64 -127.36 
33  1 SER A 415  ? ? -179.04 6.04    
34  1 ASN A 418  ? ? -108.21 -114.99 
35  1 LEU A 425  ? ? -104.39 77.45   
36  1 LEU A 427  ? ? -101.27 -126.41 
37  1 SER A 428  ? ? -167.67 109.79  
38  1 VAL A 430  ? ? -50.57  95.13   
39  1 LEU A 436  ? ? -117.75 77.96   
40  1 GLU A 441  ? ? -132.31 -66.51  
41  1 VAL A 452  ? ? -37.32  123.32  
42  1 ASP A 453  ? ? -64.07  10.25   
43  1 GLN A 455  ? ? -129.79 -164.56 
44  1 CYS A 460  ? ? -163.38 49.75   
45  1 ASN A 462  ? ? -68.39  76.87   
46  1 ALA A 464  ? ? -63.82  -171.81 
47  1 HIS A 465  ? ? 72.18   31.64   
48  1 GLN A 470  ? ? -155.15 50.28   
49  1 ILE A 471  ? ? -46.86  103.66  
50  1 SER A 475  ? ? 163.87  142.41  
51  1 VAL A 476  ? ? -30.33  125.24  
52  1 GLN A 481  ? ? -57.43  -72.02  
53  1 LYS A 484  ? ? 63.15   -0.98   
54  1 VAL A 487  ? ? -71.70  -100.92 
55  1 PRO A 493  ? ? -32.30  -30.67  
56  1 GLN A 494  ? ? -88.33  -87.54  
57  1 ALA A 495  ? ? -173.21 30.43   
58  1 ALA A 501  ? ? -69.02  -179.26 
59  1 SER A 502  ? ? 162.06  120.46  
60  1 ASN A 504  ? ? -141.76 -74.14  
61  1 SER A 505  ? ? -159.77 6.46    
62  1 SER A 506  ? ? -155.54 10.71   
63  1 VAL A 509  ? ? -100.79 74.80   
64  1 VAL A 510  ? ? -105.89 -167.28 
65  1 TYR A 517  ? ? -99.09  -135.13 
66  1 TYR A 518  ? ? 162.49  107.18  
67  1 HIS A 522  ? ? -71.45  -151.98 
68  1 PRO A 523  ? ? -48.36  81.74   
69  1 GLU A 525  ? ? -151.46 -136.40 
70  1 ILE A 529  ? ? -136.86 -72.04  
71  1 PRO A 545  ? ? -33.73  102.47  
72  1 ASP A 548  ? ? -151.31 30.24   
73  1 PRO A 554  ? ? -75.03  -82.27  
74  1 THR A 562  ? ? -140.13 -32.13  
75  1 ILE A 564  ? ? 51.39   72.72   
76  1 LEU A 569  ? ? -122.40 -152.83 
77  1 LEU A 571  ? ? -166.06 101.34  
78  1 PRO A 572  ? ? -22.11  -93.72  
79  1 SER A 573  ? ? -19.88  -89.88  
80  1 PHE A 574  ? ? 108.45  -4.80   
81  1 LEU A 577  ? ? -132.55 -46.45  
82  1 PHE A 596  ? ? -71.31  -86.56  
83  1 GLU A 597  ? ? -140.67 -46.21  
84  1 SER A 598  ? ? -151.71 87.23   
85  1 SER A 599  ? ? 145.23  150.69  
86  1 LEU A 616  ? ? -82.42  -151.79 
87  1 ASN A 617  ? ? 169.57  112.75  
88  1 THR A 620  ? ? -79.08  -76.57  
89  1 SER A 624  ? ? -143.39 -103.80 
90  1 LEU A 631  ? ? -113.34 -96.24  
91  1 ARG A 639  ? ? -174.86 146.42  
92  1 LEU A 644  ? ? -89.78  -130.44 
93  1 SER A 653  ? ? -175.04 -169.41 
94  1 TYR A 660  ? ? -123.81 -164.20 
95  1 SER A 661  ? ? -173.95 129.21  
96  1 SER A 662  ? ? -76.19  -100.87 
97  1 ASN A 663  ? ? -59.94  -83.92  
98  1 HIS A 664  ? ? -141.40 15.54   
99  1 LYS A 674  ? ? -52.80  -75.18  
100 1 ASN A 683  ? ? -179.85 46.43   
101 1 PRO A 688  ? ? -58.63  175.94  
102 1 ASP A 689  ? ? -6.80   114.07  
103 1 SER A 690  ? ? -164.73 -163.44 
104 1 ASN A 696  ? ? -26.90  -73.09  
105 1 SER A 697  ? ? -148.41 50.58   
106 1 GLU A 706  ? ? -42.33  -114.83 
107 1 ILE A 707  ? ? -155.61 -67.19  
108 1 GLN A 708  ? ? -29.89  162.56  
109 1 THR A 714  ? ? 78.81   103.80  
110 1 TYR A 718  ? ? 59.65   17.23   
111 1 SER A 746  ? ? -96.72  35.10   
112 1 THR A 750  ? ? -121.22 -69.19  
113 1 ALA A 751  ? ? 133.62  130.58  
114 1 LEU A 770  ? ? -72.63  -88.47  
115 1 PHE A 771  ? ? -57.28  86.71   
116 1 TYR A 853  ? ? -118.13 68.13   
117 1 ASP A 855  ? ? 175.85  143.57  
118 1 PHE A 876  ? ? -104.12 -101.51 
119 1 ASN A 885  ? ? 27.92   80.86   
120 1 THR A 887  ? ? -171.88 139.14  
121 1 GLU A 902  ? ? -91.44  -80.48  
122 1 MET A 910  ? ? 45.78   99.67   
123 1 ASP A 919  ? ? -49.30  -125.29 
124 1 ASP A 925  ? ? 143.09  123.38  
125 1 MET A 927  ? ? 48.37   -28.13  
126 1 ARG A 928  ? ? -74.29  -102.83 
127 1 SER A 929  ? ? -167.99 -98.45  
128 1 PHE A 949  ? ? -110.70 66.77   
129 1 ASP A 961  ? ? -161.33 -168.11 
130 1 ASN A 970  ? ? -55.85  6.50    
131 1 SER A 981  ? ? -111.88 51.14   
132 1 THR A 985  ? ? -61.57  3.97    
133 1 GLU A 987  ? ? -109.24 -70.56  
134 1 GLU A 994  ? ? -66.96  92.38   
135 1 MET A 1014 ? ? -29.85  125.53  
136 1 LYS A 1067 ? ? 86.47   54.04   
137 1 THR A 1078 ? ? -127.10 -166.80 
138 1 VAL A 1109 ? ? -140.80 -39.24  
139 1 ALA A 1110 ? ? 11.25   -67.52  
140 1 GLU A 1123 ? ? -133.80 -156.03 
141 1 ALA A 1124 ? ? -171.36 108.21  
142 1 ASP A 1127 ? ? -39.12  -37.40  
143 1 ARG B 71   ? ? -64.55  -73.53  
144 1 LEU B 73   ? ? -60.46  -76.81  
145 1 HIS B 74   ? ? -39.08  -33.27  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    GLU 
_pdbx_validate_chiral.auth_seq_id     902 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2   ? A GLY 1    
2  1 Y 1 A SER -1   ? A SER 2    
3  1 Y 1 A HIS 0    ? A HIS 3    
4  1 Y 1 A SER 774  ? A SER 777  
5  1 Y 1 A THR 775  ? A THR 778  
6  1 Y 1 A ALA 776  ? A ALA 779  
7  1 Y 1 A PRO 777  ? A PRO 780  
8  1 Y 1 A HIS 778  ? A HIS 781  
9  1 Y 1 A GLU 779  ? A GLU 782  
10 1 Y 1 A THR 780  ? A THR 783  
11 1 Y 1 A SER 781  ? A SER 784  
12 1 Y 1 A PHE 782  ? A PHE 785  
13 1 Y 1 A ASN 1016 ? A ASN 1019 
14 1 Y 1 A LEU 1017 ? A LEU 1020 
15 1 Y 1 A GLY 1018 ? A GLY 1021 
16 1 Y 1 A GLU 1019 ? A GLU 1022 
17 1 Y 1 A THR 1020 ? A THR 1023 
18 1 Y 1 A SER 1021 ? A SER 1024 
19 1 Y 1 A THR 1022 ? A THR 1025 
20 1 Y 1 A LEU 1112 ? A LEU 1115 
21 1 Y 1 A GLN 1113 ? A GLN 1116 
22 1 Y 1 A TYR 1114 ? A TYR 1117 
23 1 Y 1 A ASP 1115 ? A ASP 1118 
24 1 Y 1 A ASP 1116 ? A ASP 1119 
25 1 Y 1 A GLY 1117 ? A GLY 1120 
26 1 Y 1 A SER 1118 ? A SER 1121 
27 1 Y 1 A GLY 1119 ? A GLY 1122 
28 1 Y 1 A MET 1120 ? A MET 1123 
29 1 Y 1 A LYS 1121 ? A LYS 1124 
#