data_3I7N
# 
_entry.id   3I7N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I7N         
RCSB  RCSB054066   
WWPDB D_1000054066 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7H 'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX'    unspecified 
PDB 3I7K 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX'    unspecified 
PDB 3I7L 'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2'   unspecified 
PDB 3I7O 'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1'  unspecified 
PDB 3I7P 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I89 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I8C 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' unspecified 
PDB 3I8E 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I7N 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I7N 
_cell.length_a           63.614 
_cell.length_b           133.877 
_cell.length_c           183.224 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I7N 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1'               127399.766 1 ? ? ?              ? 
2 polymer syn 'WD and tetratricopeptide repeats protein 1' 1658.945   1 ? ? 'Residue 5-17' ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no NITRDLIRRQIKE NITRDLIRRQIKE B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    ASN n 
2 2    ILE n 
2 3    THR n 
2 4    ARG n 
2 5    ASP n 
2 6    LEU n 
2 7    ILE n 
2 8    ARG n 
2 9    ARG n 
2 10   GLN n 
2 11   ILE n 
2 12   LYS n 
2 13   GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN  Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1 ? 
2 UNP WDTC1_HUMAN Q8N5D0 2 NITRDLIRRQIKE 5 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I7N A 4 ? 1143 ? Q16531 1 ? 1140 ? 1 1140 
2 2 3I7N B 1 ? 13   ? Q8N5D0 5 ? 17   ? 5 17   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I7N GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1 
1 3I7N SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2 
1 3I7N HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3 
1 3I7N TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4 
1 3I7N ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5 
1 3I7N VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I7N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.02 
_exptl_crystal.density_percent_sol   59.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005M DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I7N 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             48.68 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   36206 
_reflns.number_all                   39494 
_reflns.percent_possible_obs         91.7 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        28.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.87 
_reflns_shell.percent_possible_all   97.3 
_reflns_shell.Rmerge_I_obs           0.565 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2433 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3I7N 
_refine.ls_number_reflns_obs                     36206 
_refine.ls_number_reflns_all                     39494 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.68 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    91.7 
_refine.ls_R_factor_obs                          0.253 
_refine.ls_R_factor_all                          0.270 
_refine.ls_R_factor_R_work                       0.251 
_refine.ls_R_factor_R_free                       0.290 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1883 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.904 
_refine.correlation_coeff_Fo_to_Fc_free          0.874 
_refine.B_iso_mean                               71.580 
_refine.aniso_B[1][1]                            -1.32 
_refine.aniso_B[2][2]                            0.97 
_refine.aniso_B[3][3]                            0.35 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.692 
_refine.pdbx_overall_ESU_R_Free                  0.414 
_refine.overall_SU_ML                            0.340 
_refine.overall_SU_B                             17.332 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8842 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8842 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        48.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.016  0.022  ? 9001  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.736  1.966  ? 12188 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.270  5.000  ? 1122  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   39.940 24.707 ? 410   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   20.831 15.000 ? 1600  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   19.205 15.000 ? 51    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.107  0.200  ? 1405  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 6716  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.268  0.200  ? 4644  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.323  0.200  ? 6068  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.203  0.200  ? 340   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.192  0.200  ? 34    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.199  0.200  ? 2     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.number_reflns_R_work             2433 
_refine_ls_shell.R_factor_R_work                  0.458 
_refine_ls_shell.percent_reflns_obs               89.50 
_refine_ls_shell.R_factor_R_free                  0.452 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             125 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2433 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3I7N 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, WD and tetratricopeptide repeats protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I7N 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;DDB1, WDTC1, DCAF9, H-Box Motif, Cytoplasm, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, Alternative splicing, TPR repeat, WD repeat, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 253  ? LYS A 257  ? PRO A 250  LYS A 254  5 ? 5  
HELX_P HELX_P2  2  ALA A 384  ? GLU A 387  ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P3  3  GLU A 731  ? SER A 733  ? GLU A 728  SER A 730  5 ? 3  
HELX_P HELX_P4  4  SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P5  5  GLU A 1072 ? ARG A 1077 ? GLU A 1069 ARG A 1074 1 ? 6  
HELX_P HELX_P6  6  GLY A 1094 ? PHE A 1100 ? GLY A 1091 PHE A 1097 1 ? 7  
HELX_P HELX_P7  7  LEU A 1101 ? ILE A 1103 ? LEU A 1098 ILE A 1100 5 ? 3  
HELX_P HELX_P8  8  SER A 1104 ? VAL A 1111 ? SER A 1101 VAL A 1108 1 ? 8  
HELX_P HELX_P9  9  ASP A 1131 ? ARG A 1141 ? ASP A 1128 ARG A 1138 1 ? 11 
HELX_P HELX_P10 10 ASN B 1    ? ILE B 11   ? ASN B 5    ILE B 15   1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            21 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            316 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             18 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             313 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.054 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 2 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
N ? 4 ? 
O ? 4 ? 
P ? 4 ? 
Q ? 3 ? 
R ? 5 ? 
S ? 4 ? 
T ? 4 ? 
U ? 4 ? 
V ? 4 ? 
W ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? parallel      
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
W 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
A 2 THR A 1027 ? THR A 1035 ? THR A 1024 THR A 1032 
A 3 ILE A 1040 ? LEU A 1046 ? ILE A 1037 LEU A 1043 
A 4 ASN A 7    ? GLN A 13   ? ASN A 4    GLN A 10   
A 5 PHE A 1091 ? ASP A 1093 ? PHE A 1088 ASP A 1090 
B 1 GLY A 20   ? GLY A 24   ? GLY A 17   GLY A 21   
B 2 ASN A 33   ? ALA A 37   ? ASN A 30   ALA A 34   
B 3 ARG A 41   ? VAL A 47   ? ARG A 38   VAL A 44   
B 4 LEU A 52   ? GLY A 59   ? LEU A 49   GLY A 56   
C 1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C 2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C 3 ASN A 88   ? SER A 97   ? ASN A 85   SER A 94   
C 4 SER A 100  ? ASN A 110  ? SER A 97   ASN A 107  
D 1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D 2 MET A 133  ? ARG A 137  ? MET A 130  ARG A 134  
D 3 LEU A 142  ? PRO A 147  ? LEU A 139  PRO A 144  
D 4 PHE A 158  ? ARG A 161  ? PHE A 155  ARG A 158  
E 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
E 2 THR A 180  ? GLN A 186  ? THR A 177  GLN A 183  
E 3 ARG A 191  ? GLU A 197  ? ARG A 188  GLU A 194  
E 4 GLU A 213  ? VAL A 215  ? GLU A 210  VAL A 212  
F 1 MET A 221  ? ALA A 224  ? MET A 218  ALA A 221  
F 2 ALA A 232  ? ILE A 235  ? ALA A 229  ILE A 232  
F 3 ILE A 240  ? ASN A 244  ? ILE A 237  ASN A 241  
F 4 LYS A 247  ? ILE A 251  ? LYS A 244  ILE A 248  
G 1 ILE A 261  ? ARG A 266  ? ILE A 258  ARG A 263  
G 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
G 3 ARG A 282  ? GLU A 289  ? ARG A 279  GLU A 286  
G 4 ASP A 302  ? GLU A 310  ? ASP A 299  GLU A 307  
H 1 CYS A 316  ? TYR A 319  ? CYS A 313  TYR A 316  
H 2 VAL A 324  ? GLY A 328  ? VAL A 321  GLY A 325  
H 3 SER A 334  ? LEU A 339  ? SER A 331  LEU A 336  
H 4 VAL A 350  ? PHE A 356  ? VAL A 347  PHE A 353  
I 1 ILE A 362  ? VAL A 368  ? ILE A 359  VAL A 365  
I 2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
I 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
I 4 LEU A 713  ? PRO A 719  ? LEU A 710  PRO A 716  
J 1 LEU A 430  ? PHE A 432  ? LEU A 427  PHE A 429  
J 2 GLN A 435  ? ARG A 437  ? GLN A 432  ARG A 434  
K 1 GLN A 470  ? LEU A 471  ? GLN A 467  LEU A 468  
K 2 VAL A 482  ? SER A 483  ? VAL A 479  SER A 480  
L 1 GLN A 510  ? VAL A 511  ? GLN A 507  VAL A 508  
L 2 LEU A 522  ? HIS A 525  ? LEU A 519  HIS A 522  
L 3 GLU A 528  ? GLN A 531  ? GLU A 525  GLN A 528  
M 1 ALA A 518  ? LEU A 519  ? ALA A 515  LEU A 516  
M 2 THR A 535  ? GLU A 536  ? THR A 532  GLU A 533  
N 1 VAL A 541  ? ASP A 545  ? VAL A 538  ASP A 542  
N 2 CYS A 559  ? LEU A 563  ? CYS A 556  LEU A 560  
N 3 SER A 568  ? LEU A 572  ? SER A 565  LEU A 569  
N 4 LYS A 582  ? MET A 584  ? LYS A 579  MET A 581  
O 1 PRO A 591  ? THR A 598  ? PRO A 588  THR A 595  
O 2 HIS A 603  ? LEU A 609  ? HIS A 600  LEU A 606  
O 3 LEU A 614  ? LEU A 619  ? LEU A 611  LEU A 616  
O 4 LYS A 630  ? LYS A 631  ? LYS A 627  LYS A 628  
P 1 VAL A 640  ? PHE A 644  ? VAL A 637  PHE A 641  
P 2 ASN A 651  ? CYS A 655  ? ASN A 648  CYS A 652  
P 3 THR A 660  ? ILE A 662  ? THR A 657  ILE A 659  
P 4 SER A 672  ? ASN A 673  ? SER A 669  ASN A 670  
Q 1 TYR A 681  ? PRO A 684  ? TYR A 678  PRO A 681  
Q 2 LEU A 694  ? ALA A 697  ? LEU A 691  ALA A 694  
Q 3 ILE A 704  ? GLY A 705  ? ILE A 701  GLY A 702  
R 1 SER A 723  ? GLN A 730  ? SER A 720  GLN A 727  
R 2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
R 3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
R 4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
R 5 SER A 767  ? VAL A 768  ? SER A 764  VAL A 765  
S 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
S 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
S 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
S 4 LEU A 861  ? VAL A 869  ? LEU A 858  VAL A 866  
T 1 VAL A 877  ? GLU A 878  ? VAL A 874  GLU A 875  
T 2 LEU A 883  ? LEU A 884  ? LEU A 880  LEU A 881  
T 3 VAL A 891  ? TRP A 896  ? VAL A 888  TRP A 893  
T 4 VAL A 902  ? HIS A 908  ? VAL A 899  HIS A 905  
U 1 THR A 919  ? LYS A 920  ? THR A 916  LYS A 917  
U 2 ILE A 924  ? VAL A 926  ? ILE A 921  VAL A 923  
U 3 LEU A 934  ? LYS A 939  ? LEU A 931  LYS A 936  
U 4 ASN A 944  ? ARG A 950  ? ASN A 941  ARG A 947  
V 1 MET A 957  ? ILE A 962  ? MET A 954  ILE A 959  
V 2 ASN A 967  ? GLU A 972  ? ASN A 964  GLU A 969  
V 3 ASN A 976  ? LYS A 982  ? ASN A 973  LYS A 979  
V 4 LEU A 995  ? HIS A 1002 ? LEU A 992  HIS A 999  
W 1 PHE A 1079 ? THR A 1081 ? PHE A 1076 THR A 1078 
W 2 LYS A 1084 ? GLU A 1086 ? LYS A 1081 GLU A 1083 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 1011 ? N CYS A 1008 O LEU A 1032 ? O LEU A 1029 
A 2 3 N VAL A 1031 ? N VAL A 1028 O VAL A 1043 ? O VAL A 1040 
A 3 4 O ILE A 1040 ? O ILE A 1037 N ALA A 12   ? N ALA A 9    
A 4 5 N VAL A 9    ? N VAL A 6    O ILE A 1092 ? O ILE A 1089 
B 1 2 N GLY A 20   ? N GLY A 17   O ALA A 37   ? O ALA A 34   
B 2 3 N ILE A 36   ? N ILE A 33   O GLU A 43   ? O GLU A 40   
B 3 4 N VAL A 46   ? N VAL A 43   O ARG A 53   ? O ARG A 50   
C 1 2 N GLU A 68   ? N GLU A 65   O PHE A 81   ? O PHE A 78   
C 2 3 N THR A 84   ? N THR A 81   O ASN A 88   ? O ASN A 85   
C 3 4 N LYS A 95   ? N LYS A 92   O ASP A 102  ? O ASP A 99   
D 1 2 N ILE A 126  ? N ILE A 123  O GLY A 135  ? O GLY A 132  
D 2 3 N ILE A 134  ? N ILE A 131  O ILE A 146  ? O ILE A 143  
D 3 4 N VAL A 145  ? N VAL A 142  O PHE A 158  ? O PHE A 155  
E 1 2 N LYS A 171  ? N LYS A 168  O CYS A 182  ? O CYS A 179  
E 2 3 N TYR A 185  ? N TYR A 182  O HIS A 192  ? O HIS A 189  
E 3 4 N ARG A 191  ? N ARG A 188  O VAL A 215  ? O VAL A 212  
F 1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
F 2 3 N ALA A 232  ? N ALA A 229  O HIS A 243  ? O HIS A 240  
F 3 4 N ASN A 244  ? N ASN A 241  O LYS A 247  ? O LYS A 244  
G 1 2 N CYS A 263  ? N CYS A 260  O GLY A 277  ? O GLY A 274  
G 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
G 3 4 N GLU A 289  ? N GLU A 286  O ASP A 302  ? O ASP A 299  
H 1 2 N CYS A 316  ? N CYS A 313  O GLY A 328  ? O GLY A 325  
H 2 3 N VAL A 327  ? N VAL A 324  O GLN A 335  ? O GLN A 332  
H 3 4 N SER A 334  ? N SER A 331  O PHE A 356  ? O PHE A 353  
I 1 2 N VAL A 368  ? N VAL A 365  O GLN A 377  ? O GLN A 374  
I 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
I 3 4 N ARG A 394  ? N ARG A 391  O HIS A 714  ? O HIS A 711  
J 1 2 N LEU A 430  ? N LEU A 427  O ARG A 437  ? O ARG A 434  
K 1 2 N LEU A 471  ? N LEU A 468  O VAL A 482  ? O VAL A 479  
L 1 2 N VAL A 511  ? N VAL A 508  O LEU A 522  ? O LEU A 519  
L 2 3 N HIS A 525  ? N HIS A 522  O GLU A 528  ? O GLU A 525  
M 1 2 N LEU A 519  ? N LEU A 516  O THR A 535  ? O THR A 532  
N 1 2 N ALA A 542  ? N ALA A 539  O GLY A 562  ? O GLY A 559  
N 2 3 N CYS A 559  ? N CYS A 556  O LEU A 572  ? O LEU A 569  
N 3 4 N ALA A 569  ? N ALA A 566  O GLU A 583  ? O GLU A 580  
O 1 2 N LEU A 595  ? N LEU A 592  O LEU A 606  ? O LEU A 603  
O 2 3 N LEU A 605  ? N LEU A 602  O PHE A 617  ? O PHE A 614  
O 3 4 N TYR A 616  ? N TYR A 613  O LYS A 630  ? O LYS A 627  
P 1 2 N VAL A 640  ? N VAL A 637  O CYS A 655  ? O CYS A 652  
P 2 3 N ALA A 654  ? N ALA A 651  O THR A 660  ? O THR A 657  
P 3 4 N VAL A 661  ? N VAL A 658  O SER A 672  ? O SER A 669  
Q 1 2 N CYS A 683  ? N CYS A 680  O ALA A 695  ? O ALA A 692  
Q 2 3 N LEU A 694  ? N LEU A 691  O GLY A 705  ? O GLY A 702  
R 1 2 N ARG A 725  ? N ARG A 722  O LEU A 739  ? O LEU A 736  
R 2 3 N ARG A 742  ? N ARG A 739  O VAL A 791  ? O VAL A 788  
R 3 4 N LEU A 794  ? N LEU A 791  O HIS A 808  ? O HIS A 805  
R 4 5 O GLN A 809  ? O GLN A 806  N SER A 767  ? N SER A 764  
S 1 2 N CYS A 822  ? N CYS A 819  O TYR A 831  ? O TYR A 828  
S 2 3 N THR A 836  ? N THR A 833  O ARG A 850  ? O ARG A 847  
S 3 4 N VAL A 853  ? N VAL A 850  O ALA A 865  ? O ALA A 862  
T 1 2 N VAL A 877  ? N VAL A 874  O LEU A 884  ? O LEU A 881  
T 2 3 N LEU A 883  ? N LEU A 880  O TYR A 894  ? O TYR A 891  
T 3 4 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
U 1 2 N LYS A 920  ? N LYS A 917  O ILE A 924  ? O ILE A 921  
U 2 3 N LEU A 925  ? N LEU A 922  O LEU A 936  ? O LEU A 933  
U 3 4 N LYS A 939  ? N LYS A 936  O ASN A 944  ? O ASN A 941  
V 1 2 N GLU A 961  ? N GLU A 958  O LEU A 969  ? O LEU A 966  
V 2 3 N PHE A 968  ? N PHE A 965  O CYS A 980  ? O CYS A 977  
V 3 4 N LEU A 977  ? N LEU A 974  O PHE A 1001 ? O PHE A 998  
W 1 2 N THR A 1081 ? N THR A 1078 O LYS A 1084 ? O LYS A 1081 
# 
_database_PDB_matrix.entry_id          3I7N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I7N 
_atom_sites.fract_transf_matrix[1][1]   0.015720 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007470 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005458 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 4    ? 24.231  26.273 11.161  1.00 69.43  ? 1    MET A N   1 
ATOM 2    C CA  . MET A 1 4    ? 23.179  26.775 10.215  1.00 69.43  ? 1    MET A CA  1 
ATOM 3    C C   . MET A 1 4    ? 21.786  27.144 10.837  1.00 69.43  ? 1    MET A C   1 
ATOM 4    O O   . MET A 1 4    ? 20.743  26.577 10.458  1.00 69.43  ? 1    MET A O   1 
ATOM 5    C CB  . MET A 1 4    ? 23.035  25.831 8.995   1.00 119.77 ? 1    MET A CB  1 
ATOM 6    C CG  . MET A 1 4    ? 22.614  24.384 9.301   1.00 119.77 ? 1    MET A CG  1 
ATOM 7    S SD  . MET A 1 4    ? 22.181  23.445 7.810   1.00 119.77 ? 1    MET A SD  1 
ATOM 8    C CE  . MET A 1 4    ? 21.757  21.832 8.494   1.00 119.77 ? 1    MET A CE  1 
ATOM 9    N N   . SER A 1 5    ? 21.786  28.088 11.786  1.00 148.85 ? 2    SER A N   1 
ATOM 10   C CA  . SER A 1 5    ? 20.557  28.763 12.253  1.00 148.85 ? 2    SER A CA  1 
ATOM 11   C C   . SER A 1 5    ? 20.553  30.168 11.685  1.00 148.85 ? 2    SER A C   1 
ATOM 12   O O   . SER A 1 5    ? 21.606  30.796 11.597  1.00 148.85 ? 2    SER A O   1 
ATOM 13   C CB  . SER A 1 5    ? 20.493  28.826 13.783  1.00 107.72 ? 2    SER A CB  1 
ATOM 14   O OG  . SER A 1 5    ? 19.733  29.931 14.267  1.00 107.72 ? 2    SER A OG  1 
ATOM 15   N N   . TYR A 1 6    ? 19.381  30.665 11.299  1.00 58.90  ? 3    TYR A N   1 
ATOM 16   C CA  . TYR A 1 6    ? 19.312  31.982 10.638  1.00 58.90  ? 3    TYR A CA  1 
ATOM 17   C C   . TYR A 1 6    ? 18.164  32.869 11.119  1.00 58.90  ? 3    TYR A C   1 
ATOM 18   O O   . TYR A 1 6    ? 17.056  32.797 10.595  1.00 58.90  ? 3    TYR A O   1 
ATOM 19   C CB  . TYR A 1 6    ? 19.235  31.853 9.111   1.00 93.55  ? 3    TYR A CB  1 
ATOM 20   C CG  . TYR A 1 6    ? 20.243  30.937 8.448   1.00 93.55  ? 3    TYR A CG  1 
ATOM 21   C CD1 . TYR A 1 6    ? 21.621  31.175 8.529   1.00 93.55  ? 3    TYR A CD1 1 
ATOM 22   C CD2 . TYR A 1 6    ? 19.808  29.841 7.705   1.00 93.55  ? 3    TYR A CD2 1 
ATOM 23   C CE1 . TYR A 1 6    ? 22.539  30.325 7.895   1.00 93.55  ? 3    TYR A CE1 1 
ATOM 24   C CE2 . TYR A 1 6    ? 20.711  28.987 7.071   1.00 93.55  ? 3    TYR A CE2 1 
ATOM 25   C CZ  . TYR A 1 6    ? 22.070  29.233 7.159   1.00 93.55  ? 3    TYR A CZ  1 
ATOM 26   O OH  . TYR A 1 6    ? 22.930  28.370 6.511   1.00 93.55  ? 3    TYR A OH  1 
ATOM 27   N N   . ASN A 1 7    ? 18.440  33.722 12.099  1.00 50.26  ? 4    ASN A N   1 
ATOM 28   C CA  . ASN A 1 7    ? 17.394  34.553 12.651  1.00 50.26  ? 4    ASN A CA  1 
ATOM 29   C C   . ASN A 1 7    ? 17.682  36.004 12.530  1.00 50.26  ? 4    ASN A C   1 
ATOM 30   O O   . ASN A 1 7    ? 18.823  36.445 12.350  1.00 50.26  ? 4    ASN A O   1 
ATOM 31   C CB  . ASN A 1 7    ? 17.160  34.264 14.117  1.00 36.66  ? 4    ASN A CB  1 
ATOM 32   C CG  . ASN A 1 7    ? 16.779  32.841 14.365  1.00 36.66  ? 4    ASN A CG  1 
ATOM 33   O OD1 . ASN A 1 7    ? 15.656  32.423 14.057  1.00 36.66  ? 4    ASN A OD1 1 
ATOM 34   N ND2 . ASN A 1 7    ? 17.705  32.078 14.947  1.00 36.66  ? 4    ASN A ND2 1 
ATOM 35   N N   . TYR A 1 8    ? 16.602  36.737 12.697  1.00 41.97  ? 5    TYR A N   1 
ATOM 36   C CA  . TYR A 1 8    ? 16.557  38.140 12.490  1.00 41.97  ? 5    TYR A CA  1 
ATOM 37   C C   . TYR A 1 8    ? 15.874  38.670 13.747  1.00 41.97  ? 5    TYR A C   1 
ATOM 38   O O   . TYR A 1 8    ? 14.861  38.104 14.183  1.00 41.97  ? 5    TYR A O   1 
ATOM 39   C CB  . TYR A 1 8    ? 15.700  38.344 11.272  1.00 38.44  ? 5    TYR A CB  1 
ATOM 40   C CG  . TYR A 1 8    ? 15.521  39.755 10.874  1.00 38.44  ? 5    TYR A CG  1 
ATOM 41   C CD1 . TYR A 1 8    ? 16.390  40.348 9.989   1.00 38.44  ? 5    TYR A CD1 1 
ATOM 42   C CD2 . TYR A 1 8    ? 14.448  40.506 11.347  1.00 38.44  ? 5    TYR A CD2 1 
ATOM 43   C CE1 . TYR A 1 8    ? 16.224  41.664 9.606   1.00 38.44  ? 5    TYR A CE1 1 
ATOM 44   C CE2 . TYR A 1 8    ? 14.274  41.822 10.966  1.00 38.44  ? 5    TYR A CE2 1 
ATOM 45   C CZ  . TYR A 1 8    ? 15.165  42.393 10.101  1.00 38.44  ? 5    TYR A CZ  1 
ATOM 46   O OH  . TYR A 1 8    ? 15.022  43.704 9.713   1.00 38.44  ? 5    TYR A OH  1 
ATOM 47   N N   . VAL A 1 9    ? 16.439  39.699 14.373  1.00 35.80  ? 6    VAL A N   1 
ATOM 48   C CA  . VAL A 1 9    ? 15.792  40.340 15.507  1.00 35.80  ? 6    VAL A CA  1 
ATOM 49   C C   . VAL A 1 9    ? 15.652  41.849 15.300  1.00 35.80  ? 6    VAL A C   1 
ATOM 50   O O   . VAL A 1 9    ? 16.639  42.536 14.952  1.00 35.80  ? 6    VAL A O   1 
ATOM 51   C CB  . VAL A 1 9    ? 16.521  40.034 16.821  1.00 37.75  ? 6    VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 9    ? 16.704  38.567 16.931  1.00 37.75  ? 6    VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 9    ? 17.881  40.694 16.872  1.00 37.75  ? 6    VAL A CG2 1 
ATOM 54   N N   . VAL A 1 10   ? 14.428  42.365 15.490  1.00 25.15  ? 7    VAL A N   1 
ATOM 55   C CA  . VAL A 1 10   ? 14.185  43.824 15.445  1.00 25.15  ? 7    VAL A CA  1 
ATOM 56   C C   . VAL A 1 10   ? 13.505  44.335 16.681  1.00 25.15  ? 7    VAL A C   1 
ATOM 57   O O   . VAL A 1 10   ? 12.783  43.577 17.347  1.00 25.15  ? 7    VAL A O   1 
ATOM 58   C CB  . VAL A 1 10   ? 13.272  44.208 14.351  1.00 29.25  ? 7    VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 10   ? 13.876  45.371 13.582  1.00 29.25  ? 7    VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 10   ? 13.050  43.028 13.490  1.00 29.25  ? 7    VAL A CG2 1 
ATOM 61   N N   . THR A 1 11   ? 13.741  45.618 16.968  1.00 25.99  ? 8    THR A N   1 
ATOM 62   C CA  . THR A 1 11   ? 13.031  46.324 18.022  1.00 25.99  ? 8    THR A CA  1 
ATOM 63   C C   . THR A 1 11   ? 11.671  46.759 17.486  1.00 25.99  ? 8    THR A C   1 
ATOM 64   O O   . THR A 1 11   ? 11.585  47.357 16.403  1.00 25.99  ? 8    THR A O   1 
ATOM 65   C CB  . THR A 1 11   ? 13.828  47.572 18.502  1.00 42.48  ? 8    THR A CB  1 
ATOM 66   O OG1 . THR A 1 11   ? 14.976  47.162 19.279  1.00 42.48  ? 8    THR A OG1 1 
ATOM 67   C CG2 . THR A 1 11   ? 12.937  48.510 19.328  1.00 42.48  ? 8    THR A CG2 1 
ATOM 68   N N   . ALA A 1 12   ? 10.609  46.449 18.220  1.00 43.52  ? 9    ALA A N   1 
ATOM 69   C CA  . ALA A 1 12   ? 9.288   46.980 17.894  1.00 43.52  ? 9    ALA A CA  1 
ATOM 70   C C   . ALA A 1 12   ? 9.043   48.229 18.700  1.00 43.52  ? 9    ALA A C   1 
ATOM 71   O O   . ALA A 1 12   ? 8.400   49.151 18.212  1.00 43.52  ? 9    ALA A O   1 
ATOM 72   C CB  . ALA A 1 12   ? 8.210   45.968 18.180  1.00 9.34   ? 9    ALA A CB  1 
ATOM 73   N N   . GLN A 1 13   ? 9.538   48.248 19.940  1.00 30.49  ? 10   GLN A N   1 
ATOM 74   C CA  . GLN A 1 13   ? 9.387   49.402 20.817  1.00 30.49  ? 10   GLN A CA  1 
ATOM 75   C C   . GLN A 1 13   ? 10.688  49.604 21.544  1.00 30.49  ? 10   GLN A C   1 
ATOM 76   O O   . GLN A 1 13   ? 11.195  48.656 22.188  1.00 30.49  ? 10   GLN A O   1 
ATOM 77   C CB  . GLN A 1 13   ? 8.261   49.157 21.824  1.00 33.83  ? 10   GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13   ? 8.310   50.063 23.028  1.00 33.83  ? 10   GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13   ? 8.048   51.514 22.662  1.00 33.83  ? 10   GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13   ? 7.041   51.834 21.987  1.00 33.83  ? 10   GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13   ? 8.938   52.412 23.107  1.00 33.83  ? 10   GLN A NE2 1 
ATOM 82   N N   . LYS A 1 14   ? 11.249  50.814 21.436  1.00 31.44  ? 11   LYS A N   1 
ATOM 83   C CA  . LYS A 1 14   ? 12.530  51.099 22.099  1.00 31.44  ? 11   LYS A CA  1 
ATOM 84   C C   . LYS A 1 14   ? 12.381  50.976 23.641  1.00 31.44  ? 11   LYS A C   1 
ATOM 85   O O   . LYS A 1 14   ? 11.284  51.080 24.165  1.00 31.44  ? 11   LYS A O   1 
ATOM 86   C CB  . LYS A 1 14   ? 13.025  52.487 21.731  1.00 44.23  ? 11   LYS A CB  1 
ATOM 87   C CG  . LYS A 1 14   ? 13.414  52.720 20.295  1.00 44.23  ? 11   LYS A CG  1 
ATOM 88   C CD  . LYS A 1 14   ? 13.878  54.180 20.209  1.00 44.23  ? 11   LYS A CD  1 
ATOM 89   C CE  . LYS A 1 14   ? 14.219  54.688 18.792  1.00 44.23  ? 11   LYS A CE  1 
ATOM 90   N NZ  . LYS A 1 14   ? 14.414  56.227 18.746  1.00 44.23  ? 11   LYS A NZ  1 
ATOM 91   N N   . PRO A 1 15   ? 13.472  50.749 24.378  1.00 33.33  ? 12   PRO A N   1 
ATOM 92   C CA  . PRO A 1 15   ? 13.280  50.742 25.835  1.00 33.33  ? 12   PRO A CA  1 
ATOM 93   C C   . PRO A 1 15   ? 12.691  52.053 26.331  1.00 33.33  ? 12   PRO A C   1 
ATOM 94   O O   . PRO A 1 15   ? 13.050  53.123 25.861  1.00 33.33  ? 12   PRO A O   1 
ATOM 95   C CB  . PRO A 1 15   ? 14.699  50.569 26.387  1.00 33.09  ? 12   PRO A CB  1 
ATOM 96   C CG  . PRO A 1 15   ? 15.481  50.055 25.276  1.00 33.09  ? 12   PRO A CG  1 
ATOM 97   C CD  . PRO A 1 15   ? 14.865  50.493 24.001  1.00 33.09  ? 12   PRO A CD  1 
ATOM 98   N N   . THR A 1 16   ? 11.793  51.979 27.290  1.00 32.09  ? 13   THR A N   1 
ATOM 99   C CA  . THR A 1 16   ? 11.129  53.209 27.755  1.00 32.09  ? 13   THR A CA  1 
ATOM 100  C C   . THR A 1 16   ? 11.382  53.493 29.201  1.00 32.09  ? 13   THR A C   1 
ATOM 101  O O   . THR A 1 16   ? 10.932  54.504 29.696  1.00 32.09  ? 13   THR A O   1 
ATOM 102  C CB  . THR A 1 16   ? 9.628   53.124 27.620  1.00 26.90  ? 13   THR A CB  1 
ATOM 103  O OG1 . THR A 1 16   ? 9.184   52.033 28.431  1.00 26.90  ? 13   THR A OG1 1 
ATOM 104  C CG2 . THR A 1 16   ? 9.231   52.874 26.162  1.00 26.90  ? 13   THR A CG2 1 
ATOM 105  N N   . ALA A 1 17   ? 12.052  52.575 29.880  1.00 37.01  ? 14   ALA A N   1 
ATOM 106  C CA  . ALA A 1 17   ? 12.446  52.765 31.249  1.00 37.01  ? 14   ALA A CA  1 
ATOM 107  C C   . ALA A 1 17   ? 13.617  53.757 31.323  1.00 37.01  ? 14   ALA A C   1 
ATOM 108  O O   . ALA A 1 17   ? 14.314  53.988 30.350  1.00 37.01  ? 14   ALA A O   1 
ATOM 109  C CB  . ALA A 1 17   ? 12.834  51.472 31.791  1.00 17.38  ? 14   ALA A CB  1 
ATOM 110  N N   . VAL A 1 18   ? 13.840  54.362 32.469  1.00 21.91  ? 15   VAL A N   1 
ATOM 111  C CA  . VAL A 1 18   ? 14.816  55.436 32.534  1.00 21.91  ? 15   VAL A CA  1 
ATOM 112  C C   . VAL A 1 18   ? 15.821  55.061 33.578  1.00 21.91  ? 15   VAL A C   1 
ATOM 113  O O   . VAL A 1 18   ? 15.484  54.941 34.762  1.00 21.91  ? 15   VAL A O   1 
ATOM 114  C CB  . VAL A 1 18   ? 14.202  56.847 32.862  1.00 8.75   ? 15   VAL A CB  1 
ATOM 115  C CG1 . VAL A 1 18   ? 15.262  57.752 33.368  1.00 8.75   ? 15   VAL A CG1 1 
ATOM 116  C CG2 . VAL A 1 18   ? 13.635  57.494 31.610  1.00 8.75   ? 15   VAL A CG2 1 
ATOM 117  N N   . ASN A 1 19   ? 17.064  54.904 33.119  1.00 36.50  ? 16   ASN A N   1 
ATOM 118  C CA  . ASN A 1 19   ? 18.119  54.321 33.919  1.00 36.50  ? 16   ASN A CA  1 
ATOM 119  C C   . ASN A 1 19   ? 18.952  55.443 34.476  1.00 36.50  ? 16   ASN A C   1 
ATOM 120  O O   . ASN A 1 19   ? 19.476  55.377 35.585  1.00 36.50  ? 16   ASN A O   1 
ATOM 121  C CB  . ASN A 1 19   ? 18.918  53.323 33.065  1.00 33.74  ? 16   ASN A CB  1 
ATOM 122  C CG  . ASN A 1 19   ? 18.023  52.143 32.540  1.00 33.74  ? 16   ASN A CG  1 
ATOM 123  O OD1 . ASN A 1 19   ? 17.189  51.576 33.294  1.00 33.74  ? 16   ASN A OD1 1 
ATOM 124  N ND2 . ASN A 1 19   ? 18.177  51.791 31.250  1.00 33.74  ? 16   ASN A ND2 1 
ATOM 125  N N   . GLY A 1 20   ? 19.018  56.522 33.716  1.00 25.12  ? 17   GLY A N   1 
ATOM 126  C CA  . GLY A 1 20   ? 19.800  57.655 34.136  1.00 25.12  ? 17   GLY A CA  1 
ATOM 127  C C   . GLY A 1 20   ? 19.324  58.937 33.530  1.00 25.12  ? 17   GLY A C   1 
ATOM 128  O O   . GLY A 1 20   ? 18.773  58.933 32.423  1.00 25.12  ? 17   GLY A O   1 
ATOM 129  N N   . CYS A 1 21   ? 19.530  60.035 34.239  1.00 33.09  ? 18   CYS A N   1 
ATOM 130  C CA  . CYS A 1 21   ? 19.183  61.330 33.699  1.00 33.09  ? 18   CYS A CA  1 
ATOM 131  C C   . CYS A 1 21   ? 20.151  62.322 34.299  1.00 33.09  ? 18   CYS A C   1 
ATOM 132  O O   . CYS A 1 21   ? 20.489  62.230 35.481  1.00 33.09  ? 18   CYS A O   1 
ATOM 133  C CB  . CYS A 1 21   ? 17.729  61.713 33.989  1.00 45.09  ? 18   CYS A CB  1 
ATOM 134  S SG  . CYS A 1 21   ? 17.325  61.892 35.748  1.00 45.09  ? 18   CYS A SG  1 
ATOM 135  N N   . VAL A 1 22   ? 20.644  63.264 33.498  1.00 28.16  ? 19   VAL A N   1 
ATOM 136  C CA  . VAL A 1 22   ? 21.625  64.217 34.037  1.00 28.16  ? 19   VAL A CA  1 
ATOM 137  C C   . VAL A 1 22   ? 21.369  65.569 33.363  1.00 28.16  ? 19   VAL A C   1 
ATOM 138  O O   . VAL A 1 22   ? 20.986  65.626 32.187  1.00 28.16  ? 19   VAL A O   1 
ATOM 139  C CB  . VAL A 1 22   ? 23.086  63.660 33.875  1.00 29.35  ? 19   VAL A CB  1 
ATOM 140  C CG1 . VAL A 1 22   ? 23.619  63.855 32.443  1.00 29.35  ? 19   VAL A CG1 1 
ATOM 141  C CG2 . VAL A 1 22   ? 24.012  64.268 34.846  1.00 29.35  ? 19   VAL A CG2 1 
ATOM 142  N N   . THR A 1 23   ? 21.543  66.637 34.142  1.00 37.49  ? 20   THR A N   1 
ATOM 143  C CA  . THR A 1 23   ? 21.286  68.033 33.691  1.00 37.49  ? 20   THR A CA  1 
ATOM 144  C C   . THR A 1 23   ? 22.567  68.870 33.440  1.00 37.49  ? 20   THR A C   1 
ATOM 145  O O   . THR A 1 23   ? 23.594  68.691 34.116  1.00 37.49  ? 20   THR A O   1 
ATOM 146  C CB  . THR A 1 23   ? 20.373  68.789 34.692  1.00 51.84  ? 20   THR A CB  1 
ATOM 147  O OG1 . THR A 1 23   ? 20.124  70.088 34.192  1.00 51.84  ? 20   THR A OG1 1 
ATOM 148  C CG2 . THR A 1 23   ? 21.013  68.927 36.086  1.00 51.84  ? 20   THR A CG2 1 
ATOM 149  N N   . GLY A 1 24   ? 22.524  69.779 32.468  1.00 60.99  ? 21   GLY A N   1 
ATOM 150  C CA  . GLY A 1 24   ? 23.692  70.641 32.223  1.00 60.99  ? 21   GLY A CA  1 
ATOM 151  C C   . GLY A 1 24   ? 23.645  71.365 30.901  1.00 60.99  ? 21   GLY A C   1 
ATOM 152  O O   . GLY A 1 24   ? 22.604  71.371 30.244  1.00 60.99  ? 21   GLY A O   1 
ATOM 153  N N   . HIS A 1 25   ? 24.777  71.963 30.505  1.00 46.61  ? 22   HIS A N   1 
ATOM 154  C CA  . HIS A 1 25   ? 24.843  72.834 29.317  1.00 46.61  ? 22   HIS A CA  1 
ATOM 155  C C   . HIS A 1 25   ? 25.699  72.168 28.266  1.00 46.61  ? 22   HIS A C   1 
ATOM 156  O O   . HIS A 1 25   ? 26.894  72.425 28.179  1.00 46.61  ? 22   HIS A O   1 
ATOM 157  C CB  . HIS A 1 25   ? 25.408  74.190 29.694  1.00 52.13  ? 22   HIS A CB  1 
ATOM 158  C CG  . HIS A 1 25   ? 24.814  74.759 30.942  1.00 52.13  ? 22   HIS A CG  1 
ATOM 159  N ND1 . HIS A 1 25   ? 25.273  74.425 32.197  1.00 52.13  ? 22   HIS A ND1 1 
ATOM 160  C CD2 . HIS A 1 25   ? 23.794  75.628 31.131  1.00 52.13  ? 22   HIS A CD2 1 
ATOM 161  C CE1 . HIS A 1 25   ? 24.564  75.068 33.108  1.00 52.13  ? 22   HIS A CE1 1 
ATOM 162  N NE2 . HIS A 1 25   ? 23.663  75.808 32.487  1.00 52.13  ? 22   HIS A NE2 1 
ATOM 163  N N   . PHE A 1 26   ? 25.075  71.292 27.484  1.00 54.72  ? 23   PHE A N   1 
ATOM 164  C CA  . PHE A 1 26   ? 25.769  70.325 26.644  1.00 54.72  ? 23   PHE A CA  1 
ATOM 165  C C   . PHE A 1 26   ? 25.576  70.752 25.224  1.00 54.72  ? 23   PHE A C   1 
ATOM 166  O O   . PHE A 1 26   ? 26.329  70.403 24.313  1.00 54.72  ? 23   PHE A O   1 
ATOM 167  C CB  . PHE A 1 26   ? 25.149  68.927 26.859  1.00 23.57  ? 23   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 26   ? 25.702  67.866 25.941  1.00 23.57  ? 23   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 26   ? 27.057  67.486 26.013  1.00 23.57  ? 23   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 26   ? 24.897  67.276 24.993  1.00 23.57  ? 23   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 26   ? 27.587  66.559 25.153  1.00 23.57  ? 23   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 26   ? 25.419  66.331 24.133  1.00 23.57  ? 23   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 26   ? 26.784  65.973 24.214  1.00 23.57  ? 23   PHE A CZ  1 
ATOM 174  N N   . THR A 1 27   ? 24.530  71.530 25.058  1.00 56.71  ? 24   THR A N   1 
ATOM 175  C CA  . THR A 1 27   ? 24.148  72.024 23.766  1.00 56.71  ? 24   THR A CA  1 
ATOM 176  C C   . THR A 1 27   ? 24.798  73.408 23.505  1.00 56.71  ? 24   THR A C   1 
ATOM 177  O O   . THR A 1 27   ? 25.284  73.657 22.403  1.00 56.71  ? 24   THR A O   1 
ATOM 178  C CB  . THR A 1 27   ? 22.598  71.970 23.655  1.00 49.52  ? 24   THR A CB  1 
ATOM 179  O OG1 . THR A 1 27   ? 22.189  70.596 23.608  1.00 49.52  ? 24   THR A OG1 1 
ATOM 180  C CG2 . THR A 1 27   ? 22.083  72.665 22.404  1.00 49.52  ? 24   THR A CG2 1 
ATOM 181  N N   . SER A 1 28   ? 24.825  74.269 24.528  1.00 79.56  ? 25   SER A N   1 
ATOM 182  C CA  . SER A 1 28   ? 25.378  75.628 24.458  1.00 79.56  ? 25   SER A CA  1 
ATOM 183  C C   . SER A 1 28   ? 25.752  76.021 25.862  1.00 79.56  ? 25   SER A C   1 
ATOM 184  O O   . SER A 1 28   ? 25.204  75.469 26.811  1.00 79.56  ? 25   SER A O   1 
ATOM 185  C CB  . SER A 1 28   ? 24.332  76.647 23.996  1.00 83.18  ? 25   SER A CB  1 
ATOM 186  O OG  . SER A 1 28   ? 23.357  76.100 23.125  1.00 83.18  ? 25   SER A OG  1 
ATOM 187  N N   . ALA A 1 29   ? 26.642  77.002 26.015  1.00 60.39  ? 26   ALA A N   1 
ATOM 188  C CA  . ALA A 1 29   ? 27.037  77.438 27.362  1.00 60.39  ? 26   ALA A CA  1 
ATOM 189  C C   . ALA A 1 29   ? 25.810  77.990 28.056  1.00 60.39  ? 26   ALA A C   1 
ATOM 190  O O   . ALA A 1 29   ? 25.695  77.959 29.277  1.00 60.39  ? 26   ALA A O   1 
ATOM 191  C CB  . ALA A 1 29   ? 28.156  78.482 27.313  1.00 81.16  ? 26   ALA A CB  1 
ATOM 192  N N   . GLU A 1 30   ? 24.898  78.495 27.241  1.00 64.42  ? 27   GLU A N   1 
ATOM 193  C CA  . GLU A 1 30   ? 23.635  79.001 27.705  1.00 64.42  ? 27   GLU A CA  1 
ATOM 194  C C   . GLU A 1 30   ? 22.626  78.122 26.989  1.00 64.42  ? 27   GLU A C   1 
ATOM 195  O O   . GLU A 1 30   ? 22.254  78.346 25.828  1.00 64.42  ? 27   GLU A O   1 
ATOM 196  C CB  . GLU A 1 30   ? 23.439  80.489 27.358  1.00 95.52  ? 27   GLU A CB  1 
ATOM 197  C CG  . GLU A 1 30   ? 24.696  81.222 26.908  1.00 95.52  ? 27   GLU A CG  1 
ATOM 198  C CD  . GLU A 1 30   ? 25.162  80.727 25.557  1.00 95.52  ? 27   GLU A CD  1 
ATOM 199  O OE1 . GLU A 1 30   ? 26.385  80.572 25.369  1.00 95.52  ? 27   GLU A OE1 1 
ATOM 200  O OE2 . GLU A 1 30   ? 24.295  80.454 24.696  1.00 95.52  ? 27   GLU A OE2 1 
ATOM 201  N N   . ASP A 1 31   ? 22.250  77.075 27.709  1.00 58.20  ? 28   ASP A N   1 
ATOM 202  C CA  . ASP A 1 31   ? 21.238  76.117 27.345  1.00 58.20  ? 28   ASP A CA  1 
ATOM 203  C C   . ASP A 1 31   ? 21.209  75.278 28.570  1.00 58.20  ? 28   ASP A C   1 
ATOM 204  O O   . ASP A 1 31   ? 22.234  75.058 29.220  1.00 58.20  ? 28   ASP A O   1 
ATOM 205  C CB  . ASP A 1 31   ? 21.651  75.245 26.179  1.00 51.04  ? 28   ASP A CB  1 
ATOM 206  C CG  . ASP A 1 31   ? 20.909  75.583 24.909  1.00 51.04  ? 28   ASP A CG  1 
ATOM 207  O OD1 . ASP A 1 31   ? 20.090  76.530 24.924  1.00 51.04  ? 28   ASP A OD1 1 
ATOM 208  O OD2 . ASP A 1 31   ? 21.139  74.898 23.886  1.00 51.04  ? 28   ASP A OD2 1 
ATOM 209  N N   . LEU A 1 32   ? 20.007  74.864 28.921  1.00 52.82  ? 29   LEU A N   1 
ATOM 210  C CA  . LEU A 1 32   ? 19.809  73.893 29.957  1.00 52.82  ? 29   LEU A CA  1 
ATOM 211  C C   . LEU A 1 32   ? 19.289  72.688 29.209  1.00 52.82  ? 29   LEU A C   1 
ATOM 212  O O   . LEU A 1 32   ? 18.323  72.779 28.442  1.00 52.82  ? 29   LEU A O   1 
ATOM 213  C CB  . LEU A 1 32   ? 18.790  74.396 30.936  1.00 36.08  ? 29   LEU A CB  1 
ATOM 214  C CG  . LEU A 1 32   ? 18.817  73.784 32.310  1.00 36.08  ? 29   LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 32   ? 19.985  74.376 33.050  1.00 36.08  ? 29   LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 32   ? 17.519  74.076 33.047  1.00 36.08  ? 29   LEU A CD2 1 
ATOM 217  N N   . ASN A 1 33   ? 19.994  71.584 29.394  1.00 43.64  ? 30   ASN A N   1 
ATOM 218  C CA  . ASN A 1 33   ? 19.645  70.306 28.828  1.00 43.64  ? 30   ASN A CA  1 
ATOM 219  C C   . ASN A 1 33   ? 19.293  69.301 29.908  1.00 43.64  ? 30   ASN A C   1 
ATOM 220  O O   . ASN A 1 33   ? 19.827  69.310 31.040  1.00 43.64  ? 30   ASN A O   1 
ATOM 221  C CB  . ASN A 1 33   ? 20.833  69.752 28.062  1.00 45.06  ? 30   ASN A CB  1 
ATOM 222  C CG  . ASN A 1 33   ? 21.319  70.687 26.986  1.00 45.06  ? 30   ASN A CG  1 
ATOM 223  O OD1 . ASN A 1 33   ? 20.594  70.949 26.024  1.00 45.06  ? 30   ASN A OD1 1 
ATOM 224  N ND2 . ASN A 1 33   ? 22.555  71.171 27.113  1.00 45.06  ? 30   ASN A ND2 1 
ATOM 225  N N   . LEU A 1 34   ? 18.405  68.406 29.537  1.00 41.78  ? 31   LEU A N   1 
ATOM 226  C CA  . LEU A 1 34   ? 18.228  67.208 30.307  1.00 41.78  ? 31   LEU A CA  1 
ATOM 227  C C   . LEU A 1 34   ? 18.568  66.083 29.360  1.00 41.78  ? 31   LEU A C   1 
ATOM 228  O O   . LEU A 1 34   ? 17.951  65.932 28.284  1.00 41.78  ? 31   LEU A O   1 
ATOM 229  C CB  . LEU A 1 34   ? 16.806  67.127 30.836  1.00 44.81  ? 31   LEU A CB  1 
ATOM 230  C CG  . LEU A 1 34   ? 16.102  65.805 31.020  1.00 44.81  ? 31   LEU A CG  1 
ATOM 231  C CD1 . LEU A 1 34   ? 16.247  65.308 32.431  1.00 44.81  ? 31   LEU A CD1 1 
ATOM 232  C CD2 . LEU A 1 34   ? 14.656  66.079 30.708  1.00 44.81  ? 31   LEU A CD2 1 
ATOM 233  N N   . LEU A 1 35   ? 19.608  65.349 29.750  1.00 32.26  ? 32   LEU A N   1 
ATOM 234  C CA  . LEU A 1 35   ? 20.024  64.120 29.079  1.00 32.26  ? 32   LEU A CA  1 
ATOM 235  C C   . LEU A 1 35   ? 19.364  62.928 29.757  1.00 32.26  ? 32   LEU A C   1 
ATOM 236  O O   . LEU A 1 35   ? 19.542  62.716 30.979  1.00 32.26  ? 32   LEU A O   1 
ATOM 237  C CB  . LEU A 1 35   ? 21.534  63.977 29.151  1.00 53.74  ? 32   LEU A CB  1 
ATOM 238  C CG  . LEU A 1 35   ? 22.406  64.585 28.061  1.00 53.74  ? 32   LEU A CG  1 
ATOM 239  C CD1 . LEU A 1 35   ? 22.033  66.020 27.707  1.00 53.74  ? 32   LEU A CD1 1 
ATOM 240  C CD2 . LEU A 1 35   ? 23.783  64.554 28.620  1.00 53.74  ? 32   LEU A CD2 1 
ATOM 241  N N   . ILE A 1 36   ? 18.573  62.180 28.993  1.00 33.27  ? 33   ILE A N   1 
ATOM 242  C CA  . ILE A 1 36   ? 17.925  61.016 29.580  1.00 33.27  ? 33   ILE A CA  1 
ATOM 243  C C   . ILE A 1 36   ? 18.512  59.770 28.967  1.00 33.27  ? 33   ILE A C   1 
ATOM 244  O O   . ILE A 1 36   ? 18.539  59.619 27.734  1.00 33.27  ? 33   ILE A O   1 
ATOM 245  C CB  . ILE A 1 36   ? 16.382  61.007 29.412  1.00 23.12  ? 33   ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 36   ? 15.740  62.101 30.265  1.00 23.12  ? 33   ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 36   ? 15.799  59.625 29.826  1.00 23.12  ? 33   ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 36   ? 14.387  62.526 29.730  1.00 23.12  ? 33   ILE A CD1 1 
ATOM 249  N N   . ALA A 1 37   ? 18.984  58.887 29.845  1.00 46.13  ? 34   ALA A N   1 
ATOM 250  C CA  . ALA A 1 37   ? 19.531  57.593 29.458  1.00 46.13  ? 34   ALA A CA  1 
ATOM 251  C C   . ALA A 1 37   ? 18.495  56.465 29.628  1.00 46.13  ? 34   ALA A C   1 
ATOM 252  O O   . ALA A 1 37   ? 18.045  56.160 30.752  1.00 46.13  ? 34   ALA A O   1 
ATOM 253  C CB  . ALA A 1 37   ? 20.768  57.310 30.276  1.00 26.46  ? 34   ALA A CB  1 
ATOM 254  N N   . LYS A 1 38   ? 18.093  55.865 28.517  1.00 48.14  ? 35   LYS A N   1 
ATOM 255  C CA  . LYS A 1 38   ? 17.307  54.661 28.593  1.00 48.14  ? 35   LYS A CA  1 
ATOM 256  C C   . LYS A 1 38   ? 18.267  53.500 28.840  1.00 48.14  ? 35   LYS A C   1 
ATOM 257  O O   . LYS A 1 38   ? 18.902  53.411 29.874  1.00 48.14  ? 35   LYS A O   1 
ATOM 258  C CB  . LYS A 1 38   ? 16.503  54.445 27.317  1.00 29.93  ? 35   LYS A CB  1 
ATOM 259  C CG  . LYS A 1 38   ? 15.436  55.544 27.014  1.00 29.93  ? 35   LYS A CG  1 
ATOM 260  C CD  . LYS A 1 38   ? 14.794  56.115 28.244  1.00 29.93  ? 35   LYS A CD  1 
ATOM 261  C CE  . LYS A 1 38   ? 13.890  57.304 27.920  1.00 29.93  ? 35   LYS A CE  1 
ATOM 262  N NZ  . LYS A 1 38   ? 12.844  57.074 26.890  1.00 29.93  ? 35   LYS A NZ  1 
ATOM 263  N N   . ASN A 1 39   ? 18.407  52.600 27.899  1.00 34.79  ? 36   ASN A N   1 
ATOM 264  C CA  . ASN A 1 39   ? 19.379  51.554 28.088  1.00 34.79  ? 36   ASN A CA  1 
ATOM 265  C C   . ASN A 1 39   ? 20.468  51.891 27.065  1.00 34.79  ? 36   ASN A C   1 
ATOM 266  O O   . ASN A 1 39   ? 21.550  52.343 27.400  1.00 34.79  ? 36   ASN A O   1 
ATOM 267  C CB  . ASN A 1 39   ? 18.666  50.214 27.830  1.00 22.23  ? 36   ASN A CB  1 
ATOM 268  C CG  . ASN A 1 39   ? 19.564  49.025 27.941  1.00 22.23  ? 36   ASN A CG  1 
ATOM 269  O OD1 . ASN A 1 39   ? 20.470  48.965 28.778  1.00 22.23  ? 36   ASN A OD1 1 
ATOM 270  N ND2 . ASN A 1 39   ? 19.321  48.056 27.103  1.00 22.23  ? 36   ASN A ND2 1 
ATOM 271  N N   . THR A 1 40   ? 20.107  51.775 25.803  1.00 28.90  ? 37   THR A N   1 
ATOM 272  C CA  . THR A 1 40   ? 21.019  51.952 24.726  1.00 28.90  ? 37   THR A CA  1 
ATOM 273  C C   . THR A 1 40   ? 20.623  53.189 23.956  1.00 28.90  ? 37   THR A C   1 
ATOM 274  O O   . THR A 1 40   ? 20.912  53.302 22.764  1.00 28.90  ? 37   THR A O   1 
ATOM 275  C CB  . THR A 1 40   ? 20.887  50.748 23.733  1.00 34.73  ? 37   THR A CB  1 
ATOM 276  O OG1 . THR A 1 40   ? 19.545  50.695 23.172  1.00 34.73  ? 37   THR A OG1 1 
ATOM 277  C CG2 . THR A 1 40   ? 21.240  49.422 24.423  1.00 34.73  ? 37   THR A CG2 1 
ATOM 278  N N   . ARG A 1 41   ? 19.915  54.093 24.620  1.00 36.28  ? 38   ARG A N   1 
ATOM 279  C CA  . ARG A 1 41   ? 19.327  55.259 23.968  1.00 36.28  ? 38   ARG A CA  1 
ATOM 280  C C   . ARG A 1 41   ? 19.620  56.461 24.824  1.00 36.28  ? 38   ARG A C   1 
ATOM 281  O O   . ARG A 1 41   ? 19.324  56.458 26.036  1.00 36.28  ? 38   ARG A O   1 
ATOM 282  C CB  . ARG A 1 41   ? 17.834  55.079 23.799  1.00 60.78  ? 38   ARG A CB  1 
ATOM 283  C CG  . ARG A 1 41   ? 17.471  54.212 22.615  1.00 60.78  ? 38   ARG A CG  1 
ATOM 284  C CD  . ARG A 1 41   ? 17.692  55.003 21.373  1.00 60.78  ? 38   ARG A CD  1 
ATOM 285  N NE  . ARG A 1 41   ? 17.442  54.258 20.154  1.00 60.78  ? 38   ARG A NE  1 
ATOM 286  C CZ  . ARG A 1 41   ? 17.964  54.599 18.988  1.00 60.78  ? 38   ARG A CZ  1 
ATOM 287  N NH1 . ARG A 1 41   ? 18.748  55.646 18.923  1.00 60.78  ? 38   ARG A NH1 1 
ATOM 288  N NH2 . ARG A 1 41   ? 17.724  53.900 17.892  1.00 60.78  ? 38   ARG A NH2 1 
ATOM 289  N N   . LEU A 1 42   ? 20.264  57.463 24.223  1.00 33.30  ? 39   LEU A N   1 
ATOM 290  C CA  . LEU A 1 42   ? 20.520  58.705 24.926  1.00 33.30  ? 39   LEU A CA  1 
ATOM 291  C C   . LEU A 1 42   ? 19.563  59.761 24.384  1.00 33.30  ? 39   LEU A C   1 
ATOM 292  O O   . LEU A 1 42   ? 19.389  59.867 23.168  1.00 33.30  ? 39   LEU A O   1 
ATOM 293  C CB  . LEU A 1 42   ? 21.949  59.136 24.676  1.00 40.56  ? 39   LEU A CB  1 
ATOM 294  C CG  . LEU A 1 42   ? 22.490  60.348 25.440  1.00 40.56  ? 39   LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 42   ? 22.403  60.160 26.980  1.00 40.56  ? 39   LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 42   ? 23.899  60.547 25.030  1.00 40.56  ? 39   LEU A CD2 1 
ATOM 297  N N   . GLU A 1 43   ? 18.926  60.524 25.263  1.00 34.52  ? 40   GLU A N   1 
ATOM 298  C CA  . GLU A 1 43   ? 17.915  61.512 24.842  1.00 34.52  ? 40   GLU A CA  1 
ATOM 299  C C   . GLU A 1 43   ? 18.343  62.857 25.371  1.00 34.52  ? 40   GLU A C   1 
ATOM 300  O O   . GLU A 1 43   ? 18.565  63.033 26.597  1.00 34.52  ? 40   GLU A O   1 
ATOM 301  C CB  . GLU A 1 43   ? 16.506  61.171 25.380  1.00 30.90  ? 40   GLU A CB  1 
ATOM 302  C CG  . GLU A 1 43   ? 15.472  60.661 24.343  1.00 30.90  ? 40   GLU A CG  1 
ATOM 303  C CD  . GLU A 1 43   ? 14.434  59.677 24.951  1.00 30.90  ? 40   GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 43   ? 14.020  59.920 26.121  1.00 30.90  ? 40   GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 43   ? 14.030  58.680 24.258  1.00 30.90  ? 40   GLU A OE2 1 
ATOM 306  N N   . ILE A 1 44   ? 18.447  63.805 24.447  1.00 38.37  ? 41   ILE A N   1 
ATOM 307  C CA  . ILE A 1 44   ? 18.917  65.145 24.748  1.00 38.37  ? 41   ILE A CA  1 
ATOM 308  C C   . ILE A 1 44   ? 17.762  66.121 24.578  1.00 38.37  ? 41   ILE A C   1 
ATOM 309  O O   . ILE A 1 44   ? 17.097  66.133 23.539  1.00 38.37  ? 41   ILE A O   1 
ATOM 310  C CB  . ILE A 1 44   ? 20.102  65.500 23.810  1.00 33.31  ? 41   ILE A CB  1 
ATOM 311  C CG1 . ILE A 1 44   ? 21.226  64.492 24.021  1.00 33.31  ? 41   ILE A CG1 1 
ATOM 312  C CG2 . ILE A 1 44   ? 20.654  66.909 24.099  1.00 33.31  ? 41   ILE A CG2 1 
ATOM 313  C CD1 . ILE A 1 44   ? 22.275  64.474 22.928  1.00 33.31  ? 41   ILE A CD1 1 
ATOM 314  N N   . TYR A 1 45   ? 17.510  66.927 25.595  1.00 27.52  ? 42   TYR A N   1 
ATOM 315  C CA  . TYR A 1 45   ? 16.438  67.912 25.504  1.00 27.52  ? 42   TYR A CA  1 
ATOM 316  C C   . TYR A 1 45   ? 16.937  69.301 25.858  1.00 27.52  ? 42   TYR A C   1 
ATOM 317  O O   . TYR A 1 45   ? 18.016  69.460 26.453  1.00 27.52  ? 42   TYR A O   1 
ATOM 318  C CB  . TYR A 1 45   ? 15.301  67.553 26.467  1.00 35.08  ? 42   TYR A CB  1 
ATOM 319  C CG  . TYR A 1 45   ? 14.616  66.237 26.181  1.00 35.08  ? 42   TYR A CG  1 
ATOM 320  C CD1 . TYR A 1 45   ? 15.137  65.016 26.661  1.00 35.08  ? 42   TYR A CD1 1 
ATOM 321  C CD2 . TYR A 1 45   ? 13.443  66.203 25.446  1.00 35.08  ? 42   TYR A CD2 1 
ATOM 322  C CE1 . TYR A 1 45   ? 14.513  63.800 26.378  1.00 35.08  ? 42   TYR A CE1 1 
ATOM 323  C CE2 . TYR A 1 45   ? 12.802  64.983 25.171  1.00 35.08  ? 42   TYR A CE2 1 
ATOM 324  C CZ  . TYR A 1 45   ? 13.341  63.794 25.641  1.00 35.08  ? 42   TYR A CZ  1 
ATOM 325  O OH  . TYR A 1 45   ? 12.680  62.625 25.355  1.00 35.08  ? 42   TYR A OH  1 
ATOM 326  N N   . VAL A 1 46   ? 16.147  70.313 25.510  1.00 44.47  ? 43   VAL A N   1 
ATOM 327  C CA  . VAL A 1 46   ? 16.372  71.634 26.057  1.00 44.47  ? 43   VAL A CA  1 
ATOM 328  C C   . VAL A 1 46   ? 15.193  71.979 26.909  1.00 44.47  ? 43   VAL A C   1 
ATOM 329  O O   . VAL A 1 46   ? 14.066  71.914 26.445  1.00 44.47  ? 43   VAL A O   1 
ATOM 330  C CB  . VAL A 1 46   ? 16.563  72.732 24.987  1.00 61.73  ? 43   VAL A CB  1 
ATOM 331  C CG1 . VAL A 1 46   ? 16.747  74.080 25.673  1.00 61.73  ? 43   VAL A CG1 1 
ATOM 332  C CG2 . VAL A 1 46   ? 17.763  72.431 24.098  1.00 61.73  ? 43   VAL A CG2 1 
ATOM 333  N N   . VAL A 1 47   ? 15.470  72.317 28.161  1.00 46.76  ? 44   VAL A N   1 
ATOM 334  C CA  . VAL A 1 47   ? 14.472  72.795 29.110  1.00 46.76  ? 44   VAL A CA  1 
ATOM 335  C C   . VAL A 1 47   ? 13.960  74.168 28.686  1.00 46.76  ? 44   VAL A C   1 
ATOM 336  O O   . VAL A 1 47   ? 14.750  75.078 28.380  1.00 46.76  ? 44   VAL A O   1 
ATOM 337  C CB  . VAL A 1 47   ? 15.082  72.946 30.504  1.00 36.45  ? 44   VAL A CB  1 
ATOM 338  C CG1 . VAL A 1 47   ? 14.003  73.186 31.542  1.00 36.45  ? 44   VAL A CG1 1 
ATOM 339  C CG2 . VAL A 1 47   ? 15.892  71.696 30.840  1.00 36.45  ? 44   VAL A CG2 1 
ATOM 340  N N   . THR A 1 48   ? 12.640  74.314 28.699  1.00 77.55  ? 45   THR A N   1 
ATOM 341  C CA  . THR A 1 48   ? 11.969  75.508 28.216  1.00 77.55  ? 45   THR A CA  1 
ATOM 342  C C   . THR A 1 48   ? 10.856  75.848 29.188  1.00 77.55  ? 45   THR A C   1 
ATOM 343  O O   . THR A 1 48   ? 10.608  75.085 30.118  1.00 77.55  ? 45   THR A O   1 
ATOM 344  C CB  . THR A 1 48   ? 11.357  75.250 26.830  1.00 72.50  ? 45   THR A CB  1 
ATOM 345  O OG1 . THR A 1 48   ? 10.388  74.184 26.908  1.00 72.50  ? 45   THR A OG1 1 
ATOM 346  C CG2 . THR A 1 48   ? 12.453  74.904 25.819  1.00 72.50  ? 45   THR A CG2 1 
ATOM 347  N N   . ALA A 1 49   ? 10.184  76.979 28.972  1.00 87.51  ? 46   ALA A N   1 
ATOM 348  C CA  . ALA A 1 49   ? 9.003   77.355 29.764  1.00 87.51  ? 46   ALA A CA  1 
ATOM 349  C C   . ALA A 1 49   ? 7.943   76.255 29.733  1.00 87.51  ? 46   ALA A C   1 
ATOM 350  O O   . ALA A 1 49   ? 7.339   75.945 30.759  1.00 87.51  ? 46   ALA A O   1 
ATOM 351  C CB  . ALA A 1 49   ? 8.413   78.701 29.282  1.00 44.40  ? 46   ALA A CB  1 
ATOM 352  N N   . GLU A 1 50   ? 7.738   75.665 28.558  1.00 109.44 ? 47   GLU A N   1 
ATOM 353  C CA  . GLU A 1 50   ? 6.799   74.564 28.401  1.00 109.44 ? 47   GLU A CA  1 
ATOM 354  C C   . GLU A 1 50   ? 7.330   73.277 29.048  1.00 109.44 ? 47   GLU A C   1 
ATOM 355  O O   . GLU A 1 50   ? 6.557   72.376 29.383  1.00 109.44 ? 47   GLU A O   1 
ATOM 356  C CB  . GLU A 1 50   ? 6.497   74.342 26.914  1.00 133.53 ? 47   GLU A CB  1 
ATOM 357  C CG  . GLU A 1 50   ? 5.414   73.287 26.602  1.00 133.53 ? 47   GLU A CG  1 
ATOM 358  C CD  . GLU A 1 50   ? 5.970   71.872 26.400  1.00 133.53 ? 47   GLU A CD  1 
ATOM 359  O OE1 . GLU A 1 50   ? 7.151   71.742 25.918  1.00 133.53 ? 47   GLU A OE1 1 
ATOM 360  O OE2 . GLU A 1 50   ? 5.221   70.882 26.714  1.00 133.53 ? 47   GLU A OE2 1 
ATOM 361  N N   . GLY A 1 51   ? 8.645   73.208 29.241  1.00 60.94  ? 48   GLY A N   1 
ATOM 362  C CA  . GLY A 1 51   ? 9.310   71.982 29.682  1.00 60.94  ? 48   GLY A CA  1 
ATOM 363  C C   . GLY A 1 51   ? 10.367  71.536 28.673  1.00 60.94  ? 48   GLY A C   1 
ATOM 364  O O   . GLY A 1 51   ? 11.353  72.237 28.428  1.00 60.94  ? 48   GLY A O   1 
ATOM 365  N N   . LEU A 1 52   ? 10.154  70.384 28.056  1.00 44.11  ? 49   LEU A N   1 
ATOM 366  C CA  . LEU A 1 52   ? 11.215  69.753 27.282  1.00 44.11  ? 49   LEU A CA  1 
ATOM 367  C C   . LEU A 1 52   ? 11.145  69.967 25.770  1.00 44.11  ? 49   LEU A C   1 
ATOM 368  O O   . LEU A 1 52   ? 10.206  69.522 25.123  1.00 44.11  ? 49   LEU A O   1 
ATOM 369  C CB  . LEU A 1 52   ? 11.228  68.265 27.615  1.00 32.17  ? 49   LEU A CB  1 
ATOM 370  C CG  . LEU A 1 52   ? 11.958  67.820 28.891  1.00 32.17  ? 49   LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 52   ? 12.609  68.952 29.741  1.00 32.17  ? 49   LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 52   ? 11.046  66.909 29.700  1.00 32.17  ? 49   LEU A CD2 1 
ATOM 373  N N   . ARG A 1 53   ? 12.140  70.651 25.214  1.00 45.58  ? 50   ARG A N   1 
ATOM 374  C CA  . ARG A 1 53   ? 12.259  70.765 23.771  1.00 45.58  ? 50   ARG A CA  1 
ATOM 375  C C   . ARG A 1 53   ? 13.122  69.608 23.321  1.00 45.58  ? 50   ARG A C   1 
ATOM 376  O O   . ARG A 1 53   ? 14.315  69.598 23.619  1.00 45.58  ? 50   ARG A O   1 
ATOM 377  C CB  . ARG A 1 53   ? 12.916  72.093 23.377  1.00 125.87 ? 50   ARG A CB  1 
ATOM 378  C CG  . ARG A 1 53   ? 13.353  72.212 21.903  1.00 125.87 ? 50   ARG A CG  1 
ATOM 379  C CD  . ARG A 1 53   ? 13.457  73.668 21.475  1.00 125.87 ? 50   ARG A CD  1 
ATOM 380  N NE  . ARG A 1 53   ? 12.218  74.372 21.822  1.00 125.87 ? 50   ARG A NE  1 
ATOM 381  C CZ  . ARG A 1 53   ? 11.798  75.529 21.297  1.00 125.87 ? 50   ARG A CZ  1 
ATOM 382  N NH1 . ARG A 1 53   ? 12.513  76.167 20.366  1.00 125.87 ? 50   ARG A NH1 1 
ATOM 383  N NH2 . ARG A 1 53   ? 10.644  76.052 21.707  1.00 125.87 ? 50   ARG A NH2 1 
ATOM 384  N N   . PRO A 1 54   ? 12.538  68.606 22.643  1.00 42.07  ? 51   PRO A N   1 
ATOM 385  C CA  . PRO A 1 54   ? 13.387  67.546 22.096  1.00 42.07  ? 51   PRO A CA  1 
ATOM 386  C C   . PRO A 1 54   ? 14.424  68.084 21.110  1.00 42.07  ? 51   PRO A C   1 
ATOM 387  O O   . PRO A 1 54   ? 14.119  68.921 20.272  1.00 42.07  ? 51   PRO A O   1 
ATOM 388  C CB  . PRO A 1 54   ? 12.401  66.631 21.366  1.00 43.87  ? 51   PRO A CB  1 
ATOM 389  C CG  . PRO A 1 54   ? 11.113  66.885 21.993  1.00 43.87  ? 51   PRO A CG  1 
ATOM 390  C CD  . PRO A 1 54   ? 11.116  68.352 22.379  1.00 43.87  ? 51   PRO A CD  1 
ATOM 391  N N   . VAL A 1 55   ? 15.645  67.582 21.193  1.00 48.16  ? 52   VAL A N   1 
ATOM 392  C CA  . VAL A 1 55   ? 16.688  68.055 20.324  1.00 48.16  ? 52   VAL A CA  1 
ATOM 393  C C   . VAL A 1 55   ? 17.427  66.930 19.615  1.00 48.16  ? 52   VAL A C   1 
ATOM 394  O O   . VAL A 1 55   ? 17.656  67.012 18.404  1.00 48.16  ? 52   VAL A O   1 
ATOM 395  C CB  . VAL A 1 55   ? 17.647  68.925 21.109  1.00 30.88  ? 52   VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 55   ? 18.967  69.039 20.391  1.00 30.88  ? 52   VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 55   ? 17.002  70.278 21.328  1.00 30.88  ? 52   VAL A CG2 1 
ATOM 398  N N   . LYS A 1 56   ? 17.794  65.882 20.357  1.00 54.97  ? 53   LYS A N   1 
ATOM 399  C CA  . LYS A 1 56   ? 18.605  64.797 19.785  1.00 54.97  ? 53   LYS A CA  1 
ATOM 400  C C   . LYS A 1 56   ? 18.431  63.464 20.493  1.00 54.97  ? 53   LYS A C   1 
ATOM 401  O O   . LYS A 1 56   ? 18.527  63.376 21.735  1.00 54.97  ? 53   LYS A O   1 
ATOM 402  C CB  . LYS A 1 56   ? 20.075  65.187 19.790  1.00 55.10  ? 53   LYS A CB  1 
ATOM 403  C CG  . LYS A 1 56   ? 20.958  64.330 18.936  1.00 55.10  ? 53   LYS A CG  1 
ATOM 404  C CD  . LYS A 1 56   ? 20.647  64.465 17.487  1.00 55.10  ? 53   LYS A CD  1 
ATOM 405  C CE  . LYS A 1 56   ? 21.578  63.582 16.690  1.00 55.10  ? 53   LYS A CE  1 
ATOM 406  N NZ  . LYS A 1 56   ? 20.925  63.161 15.422  1.00 55.10  ? 53   LYS A NZ  1 
ATOM 407  N N   . GLU A 1 57   ? 18.187  62.435 19.685  1.00 43.34  ? 54   GLU A N   1 
ATOM 408  C CA  . GLU A 1 57   ? 18.026  61.090 20.195  1.00 43.34  ? 54   GLU A CA  1 
ATOM 409  C C   . GLU A 1 57   ? 18.918  60.176 19.408  1.00 43.34  ? 54   GLU A C   1 
ATOM 410  O O   . GLU A 1 57   ? 18.571  59.783 18.282  1.00 43.34  ? 54   GLU A O   1 
ATOM 411  C CB  . GLU A 1 57   ? 16.572  60.604 20.058  1.00 46.14  ? 54   GLU A CB  1 
ATOM 412  C CG  . GLU A 1 57   ? 16.160  59.513 21.043  1.00 46.14  ? 54   GLU A CG  1 
ATOM 413  C CD  . GLU A 1 57   ? 16.240  58.065 20.503  1.00 46.14  ? 54   GLU A CD  1 
ATOM 414  O OE1 . GLU A 1 57   ? 15.826  57.142 21.246  1.00 46.14  ? 54   GLU A OE1 1 
ATOM 415  O OE2 . GLU A 1 57   ? 16.689  57.824 19.362  1.00 46.14  ? 54   GLU A OE2 1 
ATOM 416  N N   . VAL A 1 58   ? 20.051  59.828 20.005  1.00 54.97  ? 55   VAL A N   1 
ATOM 417  C CA  . VAL A 1 58   ? 20.903  58.762 19.474  1.00 54.97  ? 55   VAL A CA  1 
ATOM 418  C C   . VAL A 1 58   ? 20.817  57.446 20.247  1.00 54.97  ? 55   VAL A C   1 
ATOM 419  O O   . VAL A 1 58   ? 20.393  57.387 21.425  1.00 54.97  ? 55   VAL A O   1 
ATOM 420  C CB  . VAL A 1 58   ? 22.383  59.173 19.417  1.00 49.01  ? 55   VAL A CB  1 
ATOM 421  C CG1 . VAL A 1 58   ? 22.586  60.196 18.327  1.00 49.01  ? 55   VAL A CG1 1 
ATOM 422  C CG2 . VAL A 1 58   ? 22.861  59.698 20.771  1.00 49.01  ? 55   VAL A CG2 1 
ATOM 423  N N   . GLY A 1 59   ? 21.239  56.393 19.559  1.00 42.12  ? 56   GLY A N   1 
ATOM 424  C CA  . GLY A 1 59   ? 21.380  55.081 20.144  1.00 42.12  ? 56   GLY A CA  1 
ATOM 425  C C   . GLY A 1 59   ? 22.860  54.769 20.220  1.00 42.12  ? 56   GLY A C   1 
ATOM 426  O O   . GLY A 1 59   ? 23.663  55.183 19.354  1.00 42.12  ? 56   GLY A O   1 
ATOM 427  N N   . MET A 1 60   ? 23.234  54.046 21.268  1.00 47.09  ? 57   MET A N   1 
ATOM 428  C CA  . MET A 1 60   ? 24.595  53.556 21.390  1.00 47.09  ? 57   MET A CA  1 
ATOM 429  C C   . MET A 1 60   ? 24.658  52.042 21.334  1.00 47.09  ? 57   MET A C   1 
ATOM 430  O O   . MET A 1 60   ? 23.622  51.338 21.462  1.00 47.09  ? 57   MET A O   1 
ATOM 431  C CB  . MET A 1 60   ? 25.223  54.089 22.653  1.00 44.92  ? 57   MET A CB  1 
ATOM 432  C CG  . MET A 1 60   ? 25.368  55.584 22.596  1.00 44.92  ? 57   MET A CG  1 
ATOM 433  S SD  . MET A 1 60   ? 26.423  56.064 23.935  1.00 44.92  ? 57   MET A SD  1 
ATOM 434  C CE  . MET A 1 60   ? 27.985  55.265 23.485  1.00 44.92  ? 57   MET A CE  1 
ATOM 435  N N   . TYR A 1 61   ? 25.880  51.558 21.119  1.00 37.82  ? 58   TYR A N   1 
ATOM 436  C CA  . TYR A 1 61   ? 26.114  50.139 20.959  1.00 37.82  ? 58   TYR A CA  1 
ATOM 437  C C   . TYR A 1 61   ? 26.463  49.496 22.296  1.00 37.82  ? 58   TYR A C   1 
ATOM 438  O O   . TYR A 1 61   ? 27.438  48.767 22.423  1.00 37.82  ? 58   TYR A O   1 
ATOM 439  C CB  . TYR A 1 61   ? 27.185  49.880 19.896  1.00 39.98  ? 58   TYR A CB  1 
ATOM 440  C CG  . TYR A 1 61   ? 26.727  50.033 18.455  1.00 39.98  ? 58   TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 61   ? 25.385  50.123 18.125  1.00 39.98  ? 58   TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 61   ? 27.662  50.050 17.413  1.00 39.98  ? 58   TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 61   ? 24.979  50.247 16.818  1.00 39.98  ? 58   TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 61   ? 27.270  50.181 16.096  1.00 39.98  ? 58   TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 61   ? 25.926  50.283 15.802  1.00 39.98  ? 58   TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 61   ? 25.537  50.401 14.476  1.00 39.98  ? 58   TYR A OH  1 
ATOM 447  N N   . GLY A 1 62   ? 25.629  49.751 23.290  1.00 30.56  ? 59   GLY A N   1 
ATOM 448  C CA  . GLY A 1 62   ? 25.875  49.252 24.632  1.00 30.56  ? 59   GLY A CA  1 
ATOM 449  C C   . GLY A 1 62   ? 24.874  49.813 25.606  1.00 30.56  ? 59   GLY A C   1 
ATOM 450  O O   . GLY A 1 62   ? 24.106  50.707 25.276  1.00 30.56  ? 59   GLY A O   1 
ATOM 451  N N   . LYS A 1 63   ? 24.884  49.278 26.810  1.00 30.53  ? 60   LYS A N   1 
ATOM 452  C CA  . LYS A 1 63   ? 23.942  49.660 27.823  1.00 30.53  ? 60   LYS A CA  1 
ATOM 453  C C   . LYS A 1 63   ? 24.664  50.738 28.591  1.00 30.53  ? 60   LYS A C   1 
ATOM 454  O O   . LYS A 1 63   ? 25.759  50.478 29.102  1.00 30.53  ? 60   LYS A O   1 
ATOM 455  C CB  . LYS A 1 63   ? 23.648  48.467 28.726  1.00 28.94  ? 60   LYS A CB  1 
ATOM 456  C CG  . LYS A 1 63   ? 23.185  47.202 27.977  1.00 28.94  ? 60   LYS A CG  1 
ATOM 457  C CD  . LYS A 1 63   ? 23.128  45.959 28.879  1.00 28.94  ? 60   LYS A CD  1 
ATOM 458  C CE  . LYS A 1 63   ? 22.008  46.043 29.940  1.00 28.94  ? 60   LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 63   ? 20.731  46.513 29.288  1.00 28.94  ? 60   LYS A NZ  1 
ATOM 460  N N   . ILE A 1 64   ? 24.097  51.946 28.655  1.00 26.71  ? 61   ILE A N   1 
ATOM 461  C CA  . ILE A 1 64   ? 24.712  53.040 29.410  1.00 26.71  ? 61   ILE A CA  1 
ATOM 462  C C   . ILE A 1 64   ? 24.735  52.757 30.918  1.00 26.71  ? 61   ILE A C   1 
ATOM 463  O O   . ILE A 1 64   ? 23.690  52.717 31.532  1.00 26.71  ? 61   ILE A O   1 
ATOM 464  C CB  . ILE A 1 64   ? 24.011  54.404 29.118  1.00 19.72  ? 61   ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 64   ? 24.263  54.796 27.668  1.00 19.72  ? 61   ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 64   ? 24.455  55.514 30.115  1.00 19.72  ? 61   ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 64   ? 23.182  55.582 26.994  1.00 19.72  ? 61   ILE A CD1 1 
ATOM 468  N N   . ALA A 1 65   ? 25.927  52.556 31.489  1.00 27.19  ? 62   ALA A N   1 
ATOM 469  C CA  . ALA A 1 65   ? 26.107  52.410 32.945  1.00 27.19  ? 62   ALA A CA  1 
ATOM 470  C C   . ALA A 1 65   ? 26.537  53.706 33.680  1.00 27.19  ? 62   ALA A C   1 
ATOM 471  O O   . ALA A 1 65   ? 26.300  53.864 34.859  1.00 27.19  ? 62   ALA A O   1 
ATOM 472  C CB  . ALA A 1 65   ? 27.100  51.259 33.257  1.00 8.28   ? 62   ALA A CB  1 
ATOM 473  N N   . VAL A 1 66   ? 27.218  54.613 33.003  1.00 34.56  ? 63   VAL A N   1 
ATOM 474  C CA  . VAL A 1 66   ? 27.649  55.862 33.630  1.00 34.56  ? 63   VAL A CA  1 
ATOM 475  C C   . VAL A 1 66   ? 27.329  56.985 32.670  1.00 34.56  ? 63   VAL A C   1 
ATOM 476  O O   . VAL A 1 66   ? 27.486  56.820 31.446  1.00 34.56  ? 63   VAL A O   1 
ATOM 477  C CB  . VAL A 1 66   ? 29.142  55.828 33.941  1.00 28.82  ? 63   VAL A CB  1 
ATOM 478  C CG1 . VAL A 1 66   ? 29.562  56.965 34.940  1.00 28.82  ? 63   VAL A CG1 1 
ATOM 479  C CG2 . VAL A 1 66   ? 29.506  54.445 34.501  1.00 28.82  ? 63   VAL A CG2 1 
ATOM 480  N N   . MET A 1 67   ? 26.810  58.090 33.193  1.00 37.25  ? 64   MET A N   1 
ATOM 481  C CA  . MET A 1 67   ? 26.508  59.234 32.331  1.00 37.25  ? 64   MET A CA  1 
ATOM 482  C C   . MET A 1 67   ? 26.759  60.529 33.103  1.00 37.25  ? 64   MET A C   1 
ATOM 483  O O   . MET A 1 67   ? 26.077  60.806 34.116  1.00 37.25  ? 64   MET A O   1 
ATOM 484  C CB  . MET A 1 67   ? 25.102  59.152 31.771  1.00 26.26  ? 64   MET A CB  1 
ATOM 485  C CG  . MET A 1 67   ? 24.715  60.341 30.929  1.00 26.26  ? 64   MET A CG  1 
ATOM 486  S SD  . MET A 1 67   ? 23.209  60.044 29.906  1.00 26.26  ? 64   MET A SD  1 
ATOM 487  C CE  . MET A 1 67   ? 21.988  60.192 31.258  1.00 26.26  ? 64   MET A CE  1 
ATOM 488  N N   . GLU A 1 68   ? 27.780  61.288 32.692  1.00 44.35  ? 65   GLU A N   1 
ATOM 489  C CA  . GLU A 1 68   ? 28.128  62.500 33.427  1.00 44.35  ? 65   GLU A CA  1 
ATOM 490  C C   . GLU A 1 68   ? 28.465  63.653 32.514  1.00 44.35  ? 65   GLU A C   1 
ATOM 491  O O   . GLU A 1 68   ? 29.070  63.448 31.468  1.00 44.35  ? 65   GLU A O   1 
ATOM 492  C CB  . GLU A 1 68   ? 29.286  62.243 34.369  1.00 54.95  ? 65   GLU A CB  1 
ATOM 493  C CG  . GLU A 1 68   ? 28.965  61.290 35.478  1.00 54.95  ? 65   GLU A CG  1 
ATOM 494  C CD  . GLU A 1 68   ? 27.911  61.819 36.439  1.00 54.95  ? 65   GLU A CD  1 
ATOM 495  O OE1 . GLU A 1 68   ? 27.374  61.004 37.236  1.00 54.95  ? 65   GLU A OE1 1 
ATOM 496  O OE2 . GLU A 1 68   ? 27.632  63.038 36.400  1.00 54.95  ? 65   GLU A OE2 1 
ATOM 497  N N   . LEU A 1 69   ? 28.060  64.864 32.888  1.00 61.72  ? 66   LEU A N   1 
ATOM 498  C CA  . LEU A 1 69   ? 28.528  66.039 32.165  1.00 61.72  ? 66   LEU A CA  1 
ATOM 499  C C   . LEU A 1 69   ? 29.610  66.688 32.988  1.00 61.72  ? 66   LEU A C   1 
ATOM 500  O O   . LEU A 1 69   ? 29.541  66.685 34.216  1.00 61.72  ? 66   LEU A O   1 
ATOM 501  C CB  . LEU A 1 69   ? 27.396  67.019 31.866  1.00 38.26  ? 66   LEU A CB  1 
ATOM 502  C CG  . LEU A 1 69   ? 26.502  66.638 30.691  1.00 38.26  ? 66   LEU A CG  1 
ATOM 503  C CD1 . LEU A 1 69   ? 25.217  67.382 30.783  1.00 38.26  ? 66   LEU A CD1 1 
ATOM 504  C CD2 . LEU A 1 69   ? 27.153  66.937 29.371  1.00 38.26  ? 66   LEU A CD2 1 
ATOM 505  N N   . PHE A 1 70   ? 30.626  67.205 32.307  1.00 44.34  ? 67   PHE A N   1 
ATOM 506  C CA  . PHE A 1 70   ? 31.748  67.867 32.963  1.00 44.34  ? 67   PHE A CA  1 
ATOM 507  C C   . PHE A 1 70   ? 32.271  68.871 31.994  1.00 44.34  ? 67   PHE A C   1 
ATOM 508  O O   . PHE A 1 70   ? 31.959  68.805 30.799  1.00 44.34  ? 67   PHE A O   1 
ATOM 509  C CB  . PHE A 1 70   ? 32.876  66.882 33.358  1.00 45.80  ? 67   PHE A CB  1 
ATOM 510  C CG  . PHE A 1 70   ? 33.541  66.179 32.182  1.00 45.80  ? 67   PHE A CG  1 
ATOM 511  C CD1 . PHE A 1 70   ? 34.819  66.536 31.777  1.00 45.80  ? 67   PHE A CD1 1 
ATOM 512  C CD2 . PHE A 1 70   ? 32.887  65.153 31.492  1.00 45.80  ? 67   PHE A CD2 1 
ATOM 513  C CE1 . PHE A 1 70   ? 35.431  65.882 30.688  1.00 45.80  ? 67   PHE A CE1 1 
ATOM 514  C CE2 . PHE A 1 70   ? 33.482  64.498 30.424  1.00 45.80  ? 67   PHE A CE2 1 
ATOM 515  C CZ  . PHE A 1 70   ? 34.745  64.857 30.012  1.00 45.80  ? 67   PHE A CZ  1 
ATOM 516  N N   . ARG A 1 71   ? 33.074  69.791 32.523  1.00 64.19  ? 68   ARG A N   1 
ATOM 517  C CA  . ARG A 1 71   ? 33.700  70.841 31.742  1.00 64.19  ? 68   ARG A CA  1 
ATOM 518  C C   . ARG A 1 71   ? 35.034  71.115 32.398  1.00 64.19  ? 68   ARG A C   1 
ATOM 519  O O   . ARG A 1 71   ? 35.081  71.632 33.510  1.00 64.19  ? 68   ARG A O   1 
ATOM 520  C CB  . ARG A 1 71   ? 32.820  72.099 31.728  1.00 85.82  ? 68   ARG A CB  1 
ATOM 521  C CG  . ARG A 1 71   ? 33.323  73.223 30.841  1.00 85.82  ? 68   ARG A CG  1 
ATOM 522  C CD  . ARG A 1 71   ? 32.205  73.886 30.048  1.00 85.82  ? 68   ARG A CD  1 
ATOM 523  N NE  . ARG A 1 71   ? 31.256  74.624 30.877  1.00 85.82  ? 68   ARG A NE  1 
ATOM 524  C CZ  . ARG A 1 71   ? 30.214  75.323 30.418  1.00 85.82  ? 68   ARG A CZ  1 
ATOM 525  N NH1 . ARG A 1 71   ? 29.959  75.399 29.119  1.00 85.82  ? 68   ARG A NH1 1 
ATOM 526  N NH2 . ARG A 1 71   ? 29.413  75.960 31.265  1.00 85.82  ? 68   ARG A NH2 1 
ATOM 527  N N   . PRO A 1 72   ? 36.129  70.729 31.729  1.00 99.58  ? 69   PRO A N   1 
ATOM 528  C CA  . PRO A 1 72   ? 37.479  71.075 32.189  1.00 99.58  ? 69   PRO A CA  1 
ATOM 529  C C   . PRO A 1 72   ? 37.763  72.565 32.010  1.00 99.58  ? 69   PRO A C   1 
ATOM 530  O O   . PRO A 1 72   ? 36.955  73.404 32.420  1.00 99.58  ? 69   PRO A O   1 
ATOM 531  C CB  . PRO A 1 72   ? 38.401  70.223 31.300  1.00 52.07  ? 69   PRO A CB  1 
ATOM 532  C CG  . PRO A 1 72   ? 37.473  69.227 30.591  1.00 52.07  ? 69   PRO A CG  1 
ATOM 533  C CD  . PRO A 1 72   ? 36.140  69.904 30.511  1.00 52.07  ? 69   PRO A CD  1 
ATOM 534  N N   . LYS A 1 73   ? 38.903  72.893 31.410  1.00 66.27  ? 70   LYS A N   1 
ATOM 535  C CA  . LYS A 1 73   ? 39.283  74.292 31.220  1.00 66.27  ? 70   LYS A CA  1 
ATOM 536  C C   . LYS A 1 73   ? 39.462  74.615 29.735  1.00 66.27  ? 70   LYS A C   1 
ATOM 537  O O   . LYS A 1 73   ? 39.925  73.780 28.951  1.00 66.27  ? 70   LYS A O   1 
ATOM 538  C CB  . LYS A 1 73   ? 40.552  74.622 32.022  1.00 159.01 ? 70   LYS A CB  1 
ATOM 539  C CG  . LYS A 1 73   ? 40.619  73.994 33.422  1.00 159.01 ? 70   LYS A CG  1 
ATOM 540  C CD  . LYS A 1 73   ? 39.558  74.552 34.370  1.00 159.01 ? 70   LYS A CD  1 
ATOM 541  C CE  . LYS A 1 73   ? 39.369  73.643 35.582  1.00 159.01 ? 70   LYS A CE  1 
ATOM 542  N NZ  . LYS A 1 73   ? 38.597  72.389 35.256  1.00 159.01 ? 70   LYS A NZ  1 
ATOM 543  N N   . GLY A 1 74   ? 39.085  75.834 29.354  1.00 133.10 ? 71   GLY A N   1 
ATOM 544  C CA  . GLY A 1 74   ? 39.191  76.278 27.962  1.00 133.10 ? 71   GLY A CA  1 
ATOM 545  C C   . GLY A 1 74   ? 38.012  75.792 27.142  1.00 133.10 ? 71   GLY A C   1 
ATOM 546  O O   . GLY A 1 74   ? 37.676  76.377 26.105  1.00 133.10 ? 71   GLY A O   1 
ATOM 547  N N   . GLU A 1 75   ? 37.395  74.714 27.627  1.00 68.03  ? 72   GLU A N   1 
ATOM 548  C CA  . GLU A 1 75   ? 36.178  74.125 27.060  1.00 68.03  ? 72   GLU A CA  1 
ATOM 549  C C   . GLU A 1 75   ? 34.965  75.059 27.153  1.00 68.03  ? 72   GLU A C   1 
ATOM 550  O O   . GLU A 1 75   ? 34.559  75.443 28.247  1.00 68.03  ? 72   GLU A O   1 
ATOM 551  C CB  . GLU A 1 75   ? 35.895  72.804 27.781  1.00 62.45  ? 72   GLU A CB  1 
ATOM 552  C CG  . GLU A 1 75   ? 36.799  71.662 27.337  1.00 62.45  ? 72   GLU A CG  1 
ATOM 553  C CD  . GLU A 1 75   ? 36.573  71.284 25.881  1.00 62.45  ? 72   GLU A CD  1 
ATOM 554  O OE1 . GLU A 1 75   ? 37.444  70.607 25.303  1.00 62.45  ? 72   GLU A OE1 1 
ATOM 555  O OE2 . GLU A 1 75   ? 35.527  71.662 25.309  1.00 62.45  ? 72   GLU A OE2 1 
ATOM 556  N N   . SER A 1 76   ? 34.397  75.422 26.006  1.00 74.09  ? 73   SER A N   1 
ATOM 557  C CA  . SER A 1 76   ? 33.328  76.429 25.950  1.00 74.09  ? 73   SER A CA  1 
ATOM 558  C C   . SER A 1 76   ? 32.008  75.973 26.558  1.00 74.09  ? 73   SER A C   1 
ATOM 559  O O   . SER A 1 76   ? 31.264  76.786 27.109  1.00 74.09  ? 73   SER A O   1 
ATOM 560  C CB  . SER A 1 76   ? 33.089  76.853 24.513  1.00 63.95  ? 73   SER A CB  1 
ATOM 561  O OG  . SER A 1 76   ? 32.731  75.736 23.741  1.00 63.95  ? 73   SER A OG  1 
ATOM 562  N N   . LYS A 1 77   ? 31.725  74.674 26.428  1.00 70.60  ? 74   LYS A N   1 
ATOM 563  C CA  . LYS A 1 77   ? 30.550  74.021 27.018  1.00 70.60  ? 74   LYS A CA  1 
ATOM 564  C C   . LYS A 1 77   ? 30.869  72.626 27.553  1.00 70.60  ? 74   LYS A C   1 
ATOM 565  O O   . LYS A 1 77   ? 31.941  72.093 27.300  1.00 70.60  ? 74   LYS A O   1 
ATOM 566  C CB  . LYS A 1 77   ? 29.412  73.953 26.016  1.00 42.51  ? 74   LYS A CB  1 
ATOM 567  C CG  . LYS A 1 77   ? 29.747  73.203 24.774  1.00 42.51  ? 74   LYS A CG  1 
ATOM 568  C CD  . LYS A 1 77   ? 28.705  73.466 23.701  1.00 42.51  ? 74   LYS A CD  1 
ATOM 569  C CE  . LYS A 1 77   ? 28.955  72.627 22.478  1.00 42.51  ? 74   LYS A CE  1 
ATOM 570  N NZ  . LYS A 1 77   ? 30.388  72.669 21.985  1.00 42.51  ? 74   LYS A NZ  1 
ATOM 571  N N   . ASP A 1 78   ? 29.927  72.056 28.304  1.00 49.93  ? 75   ASP A N   1 
ATOM 572  C CA  . ASP A 1 78   ? 30.048  70.708 28.896  1.00 49.93  ? 75   ASP A CA  1 
ATOM 573  C C   . ASP A 1 78   ? 30.237  69.589 27.868  1.00 49.93  ? 75   ASP A C   1 
ATOM 574  O O   . ASP A 1 78   ? 29.561  69.534 26.853  1.00 49.93  ? 75   ASP A O   1 
ATOM 575  C CB  . ASP A 1 78   ? 28.796  70.366 29.710  1.00 61.37  ? 75   ASP A CB  1 
ATOM 576  C CG  . ASP A 1 78   ? 28.721  71.076 31.052  1.00 61.37  ? 75   ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 78   ? 27.757  70.749 31.767  1.00 61.37  ? 75   ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 78   ? 29.578  71.916 31.423  1.00 61.37  ? 75   ASP A OD2 1 
ATOM 579  N N   . LEU A 1 79   ? 31.157  68.694 28.153  1.00 40.67  ? 76   LEU A N   1 
ATOM 580  C CA  . LEU A 1 79   ? 31.270  67.456 27.392  1.00 40.67  ? 76   LEU A CA  1 
ATOM 581  C C   . LEU A 1 79   ? 30.618  66.309 28.181  1.00 40.67  ? 76   LEU A C   1 
ATOM 582  O O   . LEU A 1 79   ? 30.335  66.427 29.411  1.00 40.67  ? 76   LEU A O   1 
ATOM 583  C CB  . LEU A 1 79   ? 32.741  67.103 27.142  1.00 38.84  ? 76   LEU A CB  1 
ATOM 584  C CG  . LEU A 1 79   ? 33.664  68.048 26.354  1.00 38.84  ? 76   LEU A CG  1 
ATOM 585  C CD1 . LEU A 1 79   ? 35.119  67.719 26.624  1.00 38.84  ? 76   LEU A CD1 1 
ATOM 586  C CD2 . LEU A 1 79   ? 33.345  68.000 24.866  1.00 38.84  ? 76   LEU A CD2 1 
ATOM 587  N N   . LEU A 1 80   ? 30.403  65.185 27.508  1.00 41.24  ? 77   LEU A N   1 
ATOM 588  C CA  . LEU A 1 80   ? 29.655  64.124 28.149  1.00 41.24  ? 77   LEU A CA  1 
ATOM 589  C C   . LEU A 1 80   ? 30.479  62.869 28.263  1.00 41.24  ? 77   LEU A C   1 
ATOM 590  O O   . LEU A 1 80   ? 31.063  62.419 27.279  1.00 41.24  ? 77   LEU A O   1 
ATOM 591  C CB  . LEU A 1 80   ? 28.373  63.869 27.363  1.00 41.16  ? 77   LEU A CB  1 
ATOM 592  C CG  . LEU A 1 80   ? 27.518  62.635 27.669  1.00 41.16  ? 77   LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 80   ? 27.136  62.546 29.140  1.00 41.16  ? 77   LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 80   ? 26.288  62.637 26.754  1.00 41.16  ? 77   LEU A CD2 1 
ATOM 595  N N   . PHE A 1 81   ? 30.529  62.309 29.462  1.00 44.31  ? 78   PHE A N   1 
ATOM 596  C CA  . PHE A 1 81   ? 31.219  61.055 29.676  1.00 44.31  ? 78   PHE A CA  1 
ATOM 597  C C   . PHE A 1 81   ? 30.251  59.889 29.748  1.00 44.31  ? 78   PHE A C   1 
ATOM 598  O O   . PHE A 1 81   ? 29.318  59.908 30.565  1.00 44.31  ? 78   PHE A O   1 
ATOM 599  C CB  . PHE A 1 81   ? 31.971  61.093 30.976  1.00 34.39  ? 78   PHE A CB  1 
ATOM 600  C CG  . PHE A 1 81   ? 32.582  59.775 31.340  1.00 34.39  ? 78   PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 81   ? 33.590  59.219 30.555  1.00 34.39  ? 78   PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 81   ? 32.158  59.076 32.487  1.00 34.39  ? 78   PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 81   ? 34.178  57.961 30.907  1.00 34.39  ? 78   PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 81   ? 32.737  57.825 32.849  1.00 34.39  ? 78   PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 81   ? 33.747  57.266 32.058  1.00 34.39  ? 78   PHE A CZ  1 
ATOM 606  N N   . ILE A 1 82   ? 30.481  58.865 28.931  1.00 48.82  ? 79   ILE A N   1 
ATOM 607  C CA  . ILE A 1 82   ? 29.628  57.693 28.974  1.00 48.82  ? 79   ILE A CA  1 
ATOM 608  C C   . ILE A 1 82   ? 30.387  56.376 29.054  1.00 48.82  ? 79   ILE A C   1 
ATOM 609  O O   . ILE A 1 82   ? 31.167  56.033 28.175  1.00 48.82  ? 79   ILE A O   1 
ATOM 610  C CB  . ILE A 1 82   ? 28.671  57.655 27.781  1.00 27.67  ? 79   ILE A CB  1 
ATOM 611  C CG1 . ILE A 1 82   ? 27.618  58.759 27.900  1.00 27.67  ? 79   ILE A CG1 1 
ATOM 612  C CG2 . ILE A 1 82   ? 27.948  56.273 27.670  1.00 27.67  ? 79   ILE A CG2 1 
ATOM 613  C CD1 . ILE A 1 82   ? 26.288  58.454 27.144  1.00 27.67  ? 79   ILE A CD1 1 
ATOM 614  N N   . LEU A 1 83   ? 30.129  55.631 30.111  1.00 28.99  ? 80   LEU A N   1 
ATOM 615  C CA  . LEU A 1 83   ? 30.620  54.282 30.228  1.00 28.99  ? 80   LEU A CA  1 
ATOM 616  C C   . LEU A 1 83   ? 29.549  53.215 29.959  1.00 28.99  ? 80   LEU A C   1 
ATOM 617  O O   . LEU A 1 83   ? 28.532  53.143 30.622  1.00 28.99  ? 80   LEU A O   1 
ATOM 618  C CB  . LEU A 1 83   ? 31.225  54.046 31.615  1.00 13.70  ? 80   LEU A CB  1 
ATOM 619  C CG  . LEU A 1 83   ? 31.835  52.628 31.780  1.00 13.70  ? 80   LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 83   ? 32.830  52.240 30.668  1.00 13.70  ? 80   LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 83   ? 32.469  52.502 33.141  1.00 13.70  ? 80   LEU A CD2 1 
ATOM 622  N N   . THR A 1 84   ? 29.824  52.355 29.004  1.00 29.82  ? 81   THR A N   1 
ATOM 623  C CA  . THR A 1 84   ? 29.001  51.219 28.685  1.00 29.82  ? 81   THR A CA  1 
ATOM 624  C C   . THR A 1 84   ? 29.222  50.020 29.639  1.00 29.82  ? 81   THR A C   1 
ATOM 625  O O   . THR A 1 84   ? 30.239  49.924 30.331  1.00 29.82  ? 81   THR A O   1 
ATOM 626  C CB  . THR A 1 84   ? 29.396  50.805 27.323  1.00 15.66  ? 81   THR A CB  1 
ATOM 627  O OG1 . THR A 1 84   ? 28.299  50.956 26.434  1.00 15.66  ? 81   THR A OG1 1 
ATOM 628  C CG2 . THR A 1 84   ? 29.898  49.431 27.312  1.00 15.66  ? 81   THR A CG2 1 
ATOM 629  N N   . ALA A 1 85   ? 28.259  49.105 29.685  1.00 26.64  ? 82   ALA A N   1 
ATOM 630  C CA  . ALA A 1 85   ? 28.382  47.942 30.564  1.00 26.64  ? 82   ALA A CA  1 
ATOM 631  C C   . ALA A 1 85   ? 29.412  46.903 30.067  1.00 26.64  ? 82   ALA A C   1 
ATOM 632  O O   . ALA A 1 85   ? 29.832  46.052 30.845  1.00 26.64  ? 82   ALA A O   1 
ATOM 633  C CB  . ALA A 1 85   ? 27.024  47.275 30.795  1.00 8.65   ? 82   ALA A CB  1 
ATOM 634  N N   . LYS A 1 86   ? 29.770  46.938 28.787  1.00 48.59  ? 83   LYS A N   1 
ATOM 635  C CA  . LYS A 1 86   ? 30.822  46.068 28.254  1.00 48.59  ? 83   LYS A CA  1 
ATOM 636  C C   . LYS A 1 86   ? 32.111  46.880 28.331  1.00 48.59  ? 83   LYS A C   1 
ATOM 637  O O   . LYS A 1 86   ? 33.088  46.652 27.615  1.00 48.59  ? 83   LYS A O   1 
ATOM 638  C CB  . LYS A 1 86   ? 30.511  45.565 26.820  1.00 18.13  ? 83   LYS A CB  1 
ATOM 639  C CG  . LYS A 1 86   ? 29.516  44.427 26.730  1.00 18.13  ? 83   LYS A CG  1 
ATOM 640  C CD  . LYS A 1 86   ? 29.254  44.140 25.284  1.00 18.13  ? 83   LYS A CD  1 
ATOM 641  C CE  . LYS A 1 86   ? 28.808  42.680 25.183  1.00 18.13  ? 83   LYS A CE  1 
ATOM 642  N NZ  . LYS A 1 86   ? 28.514  42.206 23.771  1.00 18.13  ? 83   LYS A NZ  1 
ATOM 643  N N   . TYR A 1 87   ? 32.055  47.855 29.225  1.00 29.67  ? 84   TYR A N   1 
ATOM 644  C CA  . TYR A 1 87   ? 33.198  48.628 29.666  1.00 29.67  ? 84   TYR A CA  1 
ATOM 645  C C   . TYR A 1 87   ? 33.724  49.553 28.563  1.00 29.67  ? 84   TYR A C   1 
ATOM 646  O O   . TYR A 1 87   ? 34.829  50.037 28.656  1.00 29.67  ? 84   TYR A O   1 
ATOM 647  C CB  . TYR A 1 87   ? 34.264  47.720 30.330  1.00 27.84  ? 84   TYR A CB  1 
ATOM 648  C CG  . TYR A 1 87   ? 33.762  46.876 31.514  1.00 27.84  ? 84   TYR A CG  1 
ATOM 649  C CD1 . TYR A 1 87   ? 33.147  45.631 31.308  1.00 27.84  ? 84   TYR A CD1 1 
ATOM 650  C CD2 . TYR A 1 87   ? 33.910  47.304 32.839  1.00 27.84  ? 84   TYR A CD2 1 
ATOM 651  C CE1 . TYR A 1 87   ? 32.667  44.862 32.379  1.00 27.84  ? 84   TYR A CE1 1 
ATOM 652  C CE2 . TYR A 1 87   ? 33.429  46.536 33.924  1.00 27.84  ? 84   TYR A CE2 1 
ATOM 653  C CZ  . TYR A 1 87   ? 32.815  45.328 33.663  1.00 27.84  ? 84   TYR A CZ  1 
ATOM 654  O OH  . TYR A 1 87   ? 32.321  44.562 34.688  1.00 27.84  ? 84   TYR A OH  1 
ATOM 655  N N   . ASN A 1 88   ? 32.911  49.815 27.537  1.00 35.57  ? 85   ASN A N   1 
ATOM 656  C CA  . ASN A 1 88   ? 33.171  50.894 26.547  1.00 35.57  ? 85   ASN A CA  1 
ATOM 657  C C   . ASN A 1 88   ? 33.089  52.286 27.205  1.00 35.57  ? 85   ASN A C   1 
ATOM 658  O O   . ASN A 1 88   ? 32.065  52.690 27.731  1.00 35.57  ? 85   ASN A O   1 
ATOM 659  C CB  . ASN A 1 88   ? 32.211  50.844 25.347  1.00 40.83  ? 85   ASN A CB  1 
ATOM 660  C CG  . ASN A 1 88   ? 32.195  49.466 24.613  1.00 40.83  ? 85   ASN A CG  1 
ATOM 661  O OD1 . ASN A 1 88   ? 31.232  48.705 24.709  1.00 40.83  ? 85   ASN A OD1 1 
ATOM 662  N ND2 . ASN A 1 88   ? 33.255  49.174 23.859  1.00 40.83  ? 85   ASN A ND2 1 
ATOM 663  N N   . ALA A 1 89   ? 34.197  53.009 27.213  1.00 30.26  ? 86   ALA A N   1 
ATOM 664  C CA  . ALA A 1 89   ? 34.234  54.304 27.822  1.00 30.26  ? 86   ALA A CA  1 
ATOM 665  C C   . ALA A 1 89   ? 34.371  55.241 26.671  1.00 30.26  ? 86   ALA A C   1 
ATOM 666  O O   . ALA A 1 89   ? 35.129  54.946 25.753  1.00 30.26  ? 86   ALA A O   1 
ATOM 667  C CB  . ALA A 1 89   ? 35.423  54.390 28.679  1.00 21.96  ? 86   ALA A CB  1 
ATOM 668  N N   . CYS A 1 90   ? 33.628  56.342 26.667  1.00 36.27  ? 87   CYS A N   1 
ATOM 669  C CA  . CYS A 1 90   ? 33.829  57.333 25.609  1.00 36.27  ? 87   CYS A CA  1 
ATOM 670  C C   . CYS A 1 90   ? 33.511  58.721 26.125  1.00 36.27  ? 87   CYS A C   1 
ATOM 671  O O   . CYS A 1 90   ? 32.984  58.861 27.237  1.00 36.27  ? 87   CYS A O   1 
ATOM 672  C CB  . CYS A 1 90   ? 32.997  57.018 24.375  1.00 37.60  ? 87   CYS A CB  1 
ATOM 673  S SG  . CYS A 1 90   ? 31.295  57.385 24.671  1.00 37.60  ? 87   CYS A SG  1 
ATOM 674  N N   . ILE A 1 91   ? 33.837  59.736 25.326  1.00 41.94  ? 88   ILE A N   1 
ATOM 675  C CA  . ILE A 1 91   ? 33.589  61.122 25.704  1.00 41.94  ? 88   ILE A CA  1 
ATOM 676  C C   . ILE A 1 91   ? 32.961  61.888 24.568  1.00 41.94  ? 88   ILE A C   1 
ATOM 677  O O   . ILE A 1 91   ? 33.421  61.807 23.446  1.00 41.94  ? 88   ILE A O   1 
ATOM 678  C CB  . ILE A 1 91   ? 34.853  61.847 26.003  1.00 30.72  ? 88   ILE A CB  1 
ATOM 679  C CG1 . ILE A 1 91   ? 35.493  61.272 27.267  1.00 30.72  ? 88   ILE A CG1 1 
ATOM 680  C CG2 . ILE A 1 91   ? 34.547  63.353 26.102  1.00 30.72  ? 88   ILE A CG2 1 
ATOM 681  C CD1 . ILE A 1 91   ? 36.580  62.195 27.882  1.00 30.72  ? 88   ILE A CD1 1 
ATOM 682  N N   . LEU A 1 92   ? 31.929  62.667 24.837  1.00 28.13  ? 89   LEU A N   1 
ATOM 683  C CA  . LEU A 1 92   ? 31.167  63.169 23.713  1.00 28.13  ? 89   LEU A CA  1 
ATOM 684  C C   . LEU A 1 92   ? 30.904  64.667 23.756  1.00 28.13  ? 89   LEU A C   1 
ATOM 685  O O   . LEU A 1 92   ? 30.900  65.323 24.855  1.00 28.13  ? 89   LEU A O   1 
ATOM 686  C CB  . LEU A 1 92   ? 29.882  62.352 23.557  1.00 22.86  ? 89   LEU A CB  1 
ATOM 687  C CG  . LEU A 1 92   ? 30.007  60.810 23.492  1.00 22.86  ? 89   LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 92   ? 28.624  60.101 23.562  1.00 22.86  ? 89   LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 92   ? 30.692  60.374 22.218  1.00 22.86  ? 89   LEU A CD2 1 
ATOM 690  N N   . GLU A 1 93   ? 30.714  65.199 22.548  1.00 50.81  ? 90   GLU A N   1 
ATOM 691  C CA  . GLU A 1 93   ? 30.565  66.619 22.313  1.00 50.81  ? 90   GLU A CA  1 
ATOM 692  C C   . GLU A 1 93   ? 29.412  66.835 21.366  1.00 50.81  ? 90   GLU A C   1 
ATOM 693  O O   . GLU A 1 93   ? 29.275  66.111 20.367  1.00 50.81  ? 90   GLU A O   1 
ATOM 694  C CB  . GLU A 1 93   ? 31.834  67.193 21.695  1.00 66.20  ? 90   GLU A CB  1 
ATOM 695  C CG  . GLU A 1 93   ? 31.950  68.687 21.872  1.00 66.20  ? 90   GLU A CG  1 
ATOM 696  C CD  . GLU A 1 93   ? 32.773  69.354 20.791  1.00 66.20  ? 90   GLU A CD  1 
ATOM 697  O OE1 . GLU A 1 93   ? 33.943  68.958 20.570  1.00 66.20  ? 90   GLU A OE1 1 
ATOM 698  O OE2 . GLU A 1 93   ? 32.245  70.301 20.174  1.00 66.20  ? 90   GLU A OE2 1 
ATOM 699  N N   . TYR A 1 94   ? 28.592  67.838 21.676  1.00 80.22  ? 91   TYR A N   1 
ATOM 700  C CA  . TYR A 1 94   ? 27.449  68.172 20.846  1.00 80.22  ? 91   TYR A CA  1 
ATOM 701  C C   . TYR A 1 94   ? 27.843  69.120 19.758  1.00 80.22  ? 91   TYR A C   1 
ATOM 702  O O   . TYR A 1 94   ? 28.252  70.249 20.028  1.00 80.22  ? 91   TYR A O   1 
ATOM 703  C CB  . TYR A 1 94   ? 26.327  68.799 21.662  1.00 72.08  ? 91   TYR A CB  1 
ATOM 704  C CG  . TYR A 1 94   ? 25.050  68.891 20.872  1.00 72.08  ? 91   TYR A CG  1 
ATOM 705  C CD1 . TYR A 1 94   ? 24.603  67.803 20.120  1.00 72.08  ? 91   TYR A CD1 1 
ATOM 706  C CD2 . TYR A 1 94   ? 24.289  70.046 20.870  1.00 72.08  ? 91   TYR A CD2 1 
ATOM 707  C CE1 . TYR A 1 94   ? 23.443  67.856 19.382  1.00 72.08  ? 91   TYR A CE1 1 
ATOM 708  C CE2 . TYR A 1 94   ? 23.115  70.111 20.136  1.00 72.08  ? 91   TYR A CE2 1 
ATOM 709  C CZ  . TYR A 1 94   ? 22.701  69.006 19.392  1.00 72.08  ? 91   TYR A CZ  1 
ATOM 710  O OH  . TYR A 1 94   ? 21.541  69.060 18.651  1.00 72.08  ? 91   TYR A OH  1 
ATOM 711  N N   . LYS A 1 95   ? 27.705  68.674 18.519  1.00 51.92  ? 92   LYS A N   1 
ATOM 712  C CA  . LYS A 1 95   ? 28.143  69.515 17.406  1.00 51.92  ? 92   LYS A CA  1 
ATOM 713  C C   . LYS A 1 95   ? 27.003  69.905 16.487  1.00 51.92  ? 92   LYS A C   1 
ATOM 714  O O   . LYS A 1 95   ? 26.436  69.059 15.797  1.00 51.92  ? 92   LYS A O   1 
ATOM 715  C CB  . LYS A 1 95   ? 29.272  68.828 16.628  1.00 67.28  ? 92   LYS A CB  1 
ATOM 716  C CG  . LYS A 1 95   ? 30.009  69.744 15.641  1.00 67.28  ? 92   LYS A CG  1 
ATOM 717  C CD  . LYS A 1 95   ? 31.529  69.580 15.793  1.00 67.28  ? 92   LYS A CD  1 
ATOM 718  C CE  . LYS A 1 95   ? 32.325  70.619 15.006  1.00 67.28  ? 92   LYS A CE  1 
ATOM 719  N NZ  . LYS A 1 95   ? 32.242  70.381 13.531  1.00 67.28  ? 92   LYS A NZ  1 
ATOM 720  N N   . GLN A 1 96   ? 26.659  71.182 16.470  1.00 63.64  ? 93   GLN A N   1 
ATOM 721  C CA  . GLN A 1 96   ? 25.606  71.604 15.552  1.00 63.64  ? 93   GLN A CA  1 
ATOM 722  C C   . GLN A 1 96   ? 26.162  72.266 14.290  1.00 63.64  ? 93   GLN A C   1 
ATOM 723  O O   . GLN A 1 96   ? 26.353  73.485 14.259  1.00 63.64  ? 93   GLN A O   1 
ATOM 724  C CB  . GLN A 1 96   ? 24.558  72.480 16.248  1.00 84.81  ? 93   GLN A CB  1 
ATOM 725  C CG  . GLN A 1 96   ? 23.632  73.166 15.263  1.00 84.81  ? 93   GLN A CG  1 
ATOM 726  C CD  . GLN A 1 96   ? 22.179  72.872 15.512  1.00 84.81  ? 93   GLN A CD  1 
ATOM 727  O OE1 . GLN A 1 96   ? 21.717  72.877 16.653  1.00 84.81  ? 93   GLN A OE1 1 
ATOM 728  N NE2 . GLN A 1 96   ? 21.438  72.616 14.437  1.00 84.81  ? 93   GLN A NE2 1 
ATOM 729  N N   . SER A 1 97   ? 26.436  71.476 13.255  1.00 139.32 ? 94   SER A N   1 
ATOM 730  C CA  . SER A 1 97   ? 26.891  72.042 11.980  1.00 139.32 ? 94   SER A CA  1 
ATOM 731  C C   . SER A 1 97   ? 25.801  72.943 11.385  1.00 139.32 ? 94   SER A C   1 
ATOM 732  O O   . SER A 1 97   ? 25.166  72.599 10.381  1.00 139.32 ? 94   SER A O   1 
ATOM 733  C CB  . SER A 1 97   ? 27.310  70.944 10.998  1.00 108.67 ? 94   SER A CB  1 
ATOM 734  O OG  . SER A 1 97   ? 28.345  70.146 11.543  1.00 108.67 ? 94   SER A OG  1 
ATOM 735  N N   . GLY A 1 98   ? 25.594  74.090 12.039  1.00 67.03  ? 95   GLY A N   1 
ATOM 736  C CA  . GLY A 1 98   ? 24.566  75.069 11.675  1.00 67.03  ? 95   GLY A CA  1 
ATOM 737  C C   . GLY A 1 98   ? 23.139  74.539 11.687  1.00 67.03  ? 95   GLY A C   1 
ATOM 738  O O   . GLY A 1 98   ? 22.316  74.979 12.494  1.00 67.03  ? 95   GLY A O   1 
ATOM 739  N N   . GLU A 1 99   ? 22.855  73.595 10.789  1.00 61.33  ? 96   GLU A N   1 
ATOM 740  C CA  . GLU A 1 99   ? 21.511  73.044 10.623  1.00 61.33  ? 96   GLU A CA  1 
ATOM 741  C C   . GLU A 1 99   ? 21.507  71.512 10.795  1.00 61.33  ? 96   GLU A C   1 
ATOM 742  O O   . GLU A 1 99   ? 20.435  70.888 10.908  1.00 61.33  ? 96   GLU A O   1 
ATOM 743  C CB  . GLU A 1 99   ? 20.955  73.421 9.241   1.00 126.95 ? 96   GLU A CB  1 
ATOM 744  C CG  . GLU A 1 99   ? 21.546  72.630 8.049   1.00 126.95 ? 96   GLU A CG  1 
ATOM 745  C CD  . GLU A 1 99   ? 23.073  72.644 7.997   1.00 126.95 ? 96   GLU A CD  1 
ATOM 746  O OE1 . GLU A 1 99   ? 23.661  73.704 7.703   1.00 126.95 ? 96   GLU A OE1 1 
ATOM 747  O OE2 . GLU A 1 99   ? 23.687  71.588 8.250   1.00 126.95 ? 96   GLU A OE2 1 
ATOM 748  N N   . SER A 1 100  ? 22.707  70.917 10.758  1.00 86.00  ? 97   SER A N   1 
ATOM 749  C CA  . SER A 1 100  ? 22.884  69.489 11.020  1.00 86.00  ? 97   SER A CA  1 
ATOM 750  C C   . SER A 1 100  ? 23.412  69.311 12.412  1.00 86.00  ? 97   SER A C   1 
ATOM 751  O O   . SER A 1 100  ? 24.018  70.216 12.981  1.00 86.00  ? 97   SER A O   1 
ATOM 752  C CB  . SER A 1 100  ? 23.854  68.847 10.039  1.00 73.46  ? 97   SER A CB  1 
ATOM 753  O OG  . SER A 1 100  ? 23.152  68.349 8.925   1.00 73.46  ? 97   SER A OG  1 
ATOM 754  N N   . ILE A 1 101  ? 23.175  68.133 12.960  1.00 62.40  ? 98   ILE A N   1 
ATOM 755  C CA  . ILE A 1 101  ? 23.610  67.841 14.317  1.00 62.40  ? 98   ILE A CA  1 
ATOM 756  C C   . ILE A 1 101  ? 24.360  66.528 14.363  1.00 62.40  ? 98   ILE A C   1 
ATOM 757  O O   . ILE A 1 101  ? 24.068  65.593 13.614  1.00 62.40  ? 98   ILE A O   1 
ATOM 758  C CB  . ILE A 1 101  ? 22.443  67.873 15.330  1.00 60.33  ? 98   ILE A CB  1 
ATOM 759  C CG1 . ILE A 1 101  ? 21.238  67.046 14.833  1.00 60.33  ? 98   ILE A CG1 1 
ATOM 760  C CG2 . ILE A 1 101  ? 22.038  69.331 15.635  1.00 60.33  ? 98   ILE A CG2 1 
ATOM 761  C CD1 . ILE A 1 101  ? 20.341  67.750 13.817  1.00 60.33  ? 98   ILE A CD1 1 
ATOM 762  N N   . ASP A 1 102  ? 25.356  66.499 15.236  1.00 60.17  ? 99   ASP A N   1 
ATOM 763  C CA  . ASP A 1 102  ? 26.268  65.381 15.366  1.00 60.17  ? 99   ASP A CA  1 
ATOM 764  C C   . ASP A 1 102  ? 26.744  65.284 16.790  1.00 60.17  ? 99   ASP A C   1 
ATOM 765  O O   . ASP A 1 102  ? 27.057  66.297 17.448  1.00 60.17  ? 99   ASP A O   1 
ATOM 766  C CB  . ASP A 1 102  ? 27.474  65.562 14.452  1.00 80.26  ? 99   ASP A CB  1 
ATOM 767  C CG  . ASP A 1 102  ? 27.232  65.008 13.081  1.00 80.26  ? 99   ASP A CG  1 
ATOM 768  O OD1 . ASP A 1 102  ? 27.249  63.766 12.932  1.00 80.26  ? 99   ASP A OD1 1 
ATOM 769  O OD2 . ASP A 1 102  ? 27.011  65.815 12.154  1.00 80.26  ? 99   ASP A OD2 1 
ATOM 770  N N   . ILE A 1 103  ? 26.793  64.056 17.279  1.00 61.35  ? 100  ILE A N   1 
ATOM 771  C CA  . ILE A 1 103  ? 27.443  63.811 18.540  1.00 61.35  ? 100  ILE A CA  1 
ATOM 772  C C   . ILE A 1 103  ? 28.773  63.162 18.235  1.00 61.35  ? 100  ILE A C   1 
ATOM 773  O O   . ILE A 1 103  ? 28.800  62.036 17.728  1.00 61.35  ? 100  ILE A O   1 
ATOM 774  C CB  . ILE A 1 103  ? 26.582  62.963 19.431  1.00 57.40  ? 100  ILE A CB  1 
ATOM 775  C CG1 . ILE A 1 103  ? 25.375  63.796 19.837  1.00 57.40  ? 100  ILE A CG1 1 
ATOM 776  C CG2 . ILE A 1 103  ? 27.360  62.551 20.675  1.00 57.40  ? 100  ILE A CG2 1 
ATOM 777  C CD1 . ILE A 1 103  ? 24.134  63.010 19.931  1.00 57.40  ? 100  ILE A CD1 1 
ATOM 778  N N   . ILE A 1 104  ? 29.863  63.889 18.520  1.00 49.04  ? 101  ILE A N   1 
ATOM 779  C CA  . ILE A 1 104  ? 31.211  63.484 18.105  1.00 49.04  ? 101  ILE A CA  1 
ATOM 780  C C   . ILE A 1 104  ? 31.991  62.868 19.265  1.00 49.04  ? 101  ILE A C   1 
ATOM 781  O O   . ILE A 1 104  ? 31.855  63.279 20.413  1.00 49.04  ? 101  ILE A O   1 
ATOM 782  C CB  . ILE A 1 104  ? 31.991  64.679 17.437  1.00 68.92  ? 101  ILE A CB  1 
ATOM 783  C CG1 . ILE A 1 104  ? 33.014  64.160 16.424  1.00 68.92  ? 101  ILE A CG1 1 
ATOM 784  C CG2 . ILE A 1 104  ? 32.667  65.590 18.469  1.00 68.92  ? 101  ILE A CG2 1 
ATOM 785  C CD1 . ILE A 1 104  ? 33.710  65.256 15.589  1.00 68.92  ? 101  ILE A CD1 1 
ATOM 786  N N   . THR A 1 105  ? 32.800  61.864 18.967  1.00 43.49  ? 102  THR A N   1 
ATOM 787  C CA  . THR A 1 105  ? 33.624  61.216 19.985  1.00 43.49  ? 102  THR A CA  1 
ATOM 788  C C   . THR A 1 105  ? 34.987  61.859 20.025  1.00 43.49  ? 102  THR A C   1 
ATOM 789  O O   . THR A 1 105  ? 35.773  61.734 19.076  1.00 43.49  ? 102  THR A O   1 
ATOM 790  C CB  . THR A 1 105  ? 33.776  59.743 19.669  1.00 40.45  ? 102  THR A CB  1 
ATOM 791  O OG1 . THR A 1 105  ? 32.474  59.191 19.521  1.00 40.45  ? 102  THR A OG1 1 
ATOM 792  C CG2 . THR A 1 105  ? 34.511  59.000 20.760  1.00 40.45  ? 102  THR A CG2 1 
ATOM 793  N N   . ARG A 1 106  ? 35.240  62.535 21.139  1.00 45.32  ? 103  ARG A N   1 
ATOM 794  C CA  . ARG A 1 106  ? 36.466  63.263 21.410  1.00 45.32  ? 103  ARG A CA  1 
ATOM 795  C C   . ARG A 1 106  ? 37.544  62.343 21.920  1.00 45.32  ? 103  ARG A C   1 
ATOM 796  O O   . ARG A 1 106  ? 38.743  62.596 21.724  1.00 45.32  ? 103  ARG A O   1 
ATOM 797  C CB  . ARG A 1 106  ? 36.197  64.382 22.409  1.00 37.18  ? 103  ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106  ? 35.373  65.507 21.767  1.00 37.18  ? 103  ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106  ? 36.268  66.565 21.049  1.00 37.18  ? 103  ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106  ? 36.489  67.738 21.917  1.00 37.18  ? 103  ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106  ? 37.205  67.725 23.040  1.00 37.18  ? 103  ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106  ? 37.797  66.606 23.422  1.00 37.18  ? 103  ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106  ? 37.306  68.810 23.792  1.00 37.18  ? 103  ARG A NH2 1 
ATOM 804  N N   . ALA A 1 107  ? 37.120  61.250 22.540  1.00 39.83  ? 104  ALA A N   1 
ATOM 805  C CA  . ALA A 1 107  ? 38.049  60.241 23.028  1.00 39.83  ? 104  ALA A CA  1 
ATOM 806  C C   . ALA A 1 107  ? 37.272  58.963 23.250  1.00 39.83  ? 104  ALA A C   1 
ATOM 807  O O   . ALA A 1 107  ? 36.044  59.012 23.360  1.00 39.83  ? 104  ALA A O   1 
ATOM 808  C CB  . ALA A 1 107  ? 38.677  60.694 24.327  1.00 7.81   ? 104  ALA A CB  1 
ATOM 809  N N   . HIS A 1 108  ? 37.991  57.837 23.322  1.00 38.57  ? 105  HIS A N   1 
ATOM 810  C CA  . HIS A 1 108  ? 37.382  56.556 23.627  1.00 38.57  ? 105  HIS A CA  1 
ATOM 811  C C   . HIS A 1 108  ? 38.353  55.421 23.822  1.00 38.57  ? 105  HIS A C   1 
ATOM 812  O O   . HIS A 1 108  ? 39.452  55.418 23.292  1.00 38.57  ? 105  HIS A O   1 
ATOM 813  C CB  . HIS A 1 108  ? 36.418  56.142 22.540  1.00 57.82  ? 105  HIS A CB  1 
ATOM 814  C CG  . HIS A 1 108  ? 37.082  55.541 21.350  1.00 57.82  ? 105  HIS A CG  1 
ATOM 815  N ND1 . HIS A 1 108  ? 37.732  56.300 20.406  1.00 57.82  ? 105  HIS A ND1 1 
ATOM 816  C CD2 . HIS A 1 108  ? 37.168  54.257 20.931  1.00 57.82  ? 105  HIS A CD2 1 
ATOM 817  C CE1 . HIS A 1 108  ? 38.186  55.507 19.452  1.00 57.82  ? 105  HIS A CE1 1 
ATOM 818  N NE2 . HIS A 1 108  ? 37.861  54.263 19.749  1.00 57.82  ? 105  HIS A NE2 1 
ATOM 819  N N   . GLY A 1 109  ? 37.902  54.414 24.555  1.00 36.69  ? 106  GLY A N   1 
ATOM 820  C CA  . GLY A 1 109  ? 38.647  53.189 24.684  1.00 36.69  ? 106  GLY A CA  1 
ATOM 821  C C   . GLY A 1 109  ? 37.995  52.287 25.692  1.00 36.69  ? 106  GLY A C   1 
ATOM 822  O O   . GLY A 1 109  ? 37.199  52.727 26.526  1.00 36.69  ? 106  GLY A O   1 
ATOM 823  N N   . ASN A 1 110  ? 38.344  51.012 25.623  1.00 36.35  ? 107  ASN A N   1 
ATOM 824  C CA  . ASN A 1 110  ? 37.744  50.056 26.493  1.00 36.35  ? 107  ASN A CA  1 
ATOM 825  C C   . ASN A 1 110  ? 38.548  49.860 27.763  1.00 36.35  ? 107  ASN A C   1 
ATOM 826  O O   . ASN A 1 110  ? 39.753  49.512 27.713  1.00 36.35  ? 107  ASN A O   1 
ATOM 827  C CB  . ASN A 1 110  ? 37.546  48.759 25.769  1.00 31.83  ? 107  ASN A CB  1 
ATOM 828  C CG  . ASN A 1 110  ? 36.706  47.814 26.550  1.00 31.83  ? 107  ASN A CG  1 
ATOM 829  O OD1 . ASN A 1 110  ? 37.074  47.411 27.660  1.00 31.83  ? 107  ASN A OD1 1 
ATOM 830  N ND2 . ASN A 1 110  ? 35.547  47.456 25.992  1.00 31.83  ? 107  ASN A ND2 1 
ATOM 831  N N   . VAL A 1 111  ? 37.861  50.053 28.892  1.00 34.60  ? 108  VAL A N   1 
ATOM 832  C CA  . VAL A 1 111  ? 38.492  50.021 30.206  1.00 34.60  ? 108  VAL A CA  1 
ATOM 833  C C   . VAL A 1 111  ? 38.222  48.745 31.021  1.00 34.60  ? 108  VAL A C   1 
ATOM 834  O O   . VAL A 1 111  ? 38.575  48.661 32.192  1.00 34.60  ? 108  VAL A O   1 
ATOM 835  C CB  . VAL A 1 111  ? 38.129  51.265 31.055  1.00 18.03  ? 108  VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 111  ? 38.488  52.517 30.368  1.00 18.03  ? 108  VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 111  ? 36.642  51.316 31.281  1.00 18.03  ? 108  VAL A CG2 1 
ATOM 838  N N   . GLN A 1 112  ? 37.630  47.728 30.432  1.00 41.61  ? 109  GLN A N   1 
ATOM 839  C CA  . GLN A 1 112  ? 37.555  46.472 31.173  1.00 41.61  ? 109  GLN A CA  1 
ATOM 840  C C   . GLN A 1 112  ? 38.961  45.952 31.480  1.00 41.61  ? 109  GLN A C   1 
ATOM 841  O O   . GLN A 1 112  ? 39.905  46.334 30.794  1.00 41.61  ? 109  GLN A O   1 
ATOM 842  C CB  . GLN A 1 112  ? 36.815  45.431 30.366  1.00 59.11  ? 109  GLN A CB  1 
ATOM 843  C CG  . GLN A 1 112  ? 37.424  45.232 29.013  1.00 59.11  ? 109  GLN A CG  1 
ATOM 844  C CD  . GLN A 1 112  ? 37.389  43.817 28.605  1.00 59.11  ? 109  GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 112  ? 37.615  43.506 27.439  1.00 59.11  ? 109  GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 112  ? 37.108  42.924 29.559  1.00 59.11  ? 109  GLN A NE2 1 
ATOM 847  N N   . ASP A 1 113  ? 39.100  45.090 32.490  1.00 56.66  ? 110  ASP A N   1 
ATOM 848  C CA  . ASP A 1 113  ? 40.376  44.455 32.820  1.00 56.66  ? 110  ASP A CA  1 
ATOM 849  C C   . ASP A 1 113  ? 40.164  42.973 32.946  1.00 56.66  ? 110  ASP A C   1 
ATOM 850  O O   . ASP A 1 113  ? 39.249  42.562 33.662  1.00 56.66  ? 110  ASP A O   1 
ATOM 851  C CB  . ASP A 1 113  ? 40.863  44.946 34.174  1.00 45.53  ? 110  ASP A CB  1 
ATOM 852  C CG  . ASP A 1 113  ? 41.188  46.396 34.178  1.00 45.53  ? 110  ASP A CG  1 
ATOM 853  O OD1 . ASP A 1 113  ? 41.088  47.032 33.128  1.00 45.53  ? 110  ASP A OD1 1 
ATOM 854  O OD2 . ASP A 1 113  ? 41.550  46.935 35.229  1.00 45.53  ? 110  ASP A OD2 1 
ATOM 855  N N   . ARG A 1 114  ? 41.013  42.157 32.311  1.00 63.75  ? 111  ARG A N   1 
ATOM 856  C CA  . ARG A 1 114  ? 40.946  40.683 32.470  1.00 63.75  ? 111  ARG A CA  1 
ATOM 857  C C   . ARG A 1 114  ? 40.857  40.285 33.960  1.00 63.75  ? 111  ARG A C   1 
ATOM 858  O O   . ARG A 1 114  ? 40.088  39.401 34.350  1.00 63.75  ? 111  ARG A O   1 
ATOM 859  C CB  . ARG A 1 114  ? 42.168  40.024 31.842  1.00 151.74 ? 111  ARG A CB  1 
ATOM 860  C CG  . ARG A 1 114  ? 41.843  38.782 31.047  1.00 151.74 ? 111  ARG A CG  1 
ATOM 861  C CD  . ARG A 1 114  ? 41.493  39.160 29.619  1.00 151.74 ? 111  ARG A CD  1 
ATOM 862  N NE  . ARG A 1 114  ? 42.650  39.737 28.930  1.00 151.74 ? 111  ARG A NE  1 
ATOM 863  C CZ  . ARG A 1 114  ? 42.580  40.593 27.911  1.00 151.74 ? 111  ARG A CZ  1 
ATOM 864  N NH1 . ARG A 1 114  ? 41.401  40.997 27.443  1.00 151.74 ? 111  ARG A NH1 1 
ATOM 865  N NH2 . ARG A 1 114  ? 43.702  41.052 27.363  1.00 151.74 ? 111  ARG A NH2 1 
ATOM 866  N N   . ILE A 1 115  ? 41.661  40.953 34.782  1.00 109.54 ? 112  ILE A N   1 
ATOM 867  C CA  . ILE A 1 115  ? 41.638  40.800 36.230  1.00 109.54 ? 112  ILE A CA  1 
ATOM 868  C C   . ILE A 1 115  ? 40.397  41.465 36.806  1.00 109.54 ? 112  ILE A C   1 
ATOM 869  O O   . ILE A 1 115  ? 39.999  42.551 36.372  1.00 109.54 ? 112  ILE A O   1 
ATOM 870  C CB  . ILE A 1 115  ? 42.932  41.413 36.836  1.00 55.08  ? 112  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 115  ? 44.023  40.361 36.880  1.00 55.08  ? 112  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 115  ? 42.719  42.012 38.214  1.00 55.08  ? 112  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 115  ? 44.513  39.945 35.500  1.00 55.08  ? 112  ILE A CD1 1 
ATOM 874  N N   . GLY A 1 116  ? 39.771  40.807 37.772  1.00 66.20  ? 113  GLY A N   1 
ATOM 875  C CA  . GLY A 1 116  ? 38.685  41.453 38.510  1.00 66.20  ? 113  GLY A CA  1 
ATOM 876  C C   . GLY A 1 116  ? 37.287  40.883 38.392  1.00 66.20  ? 113  GLY A C   1 
ATOM 877  O O   . GLY A 1 116  ? 36.822  40.537 37.286  1.00 66.20  ? 113  GLY A O   1 
ATOM 878  N N   . ARG A 1 117  ? 36.636  40.809 39.560  1.00 57.44  ? 114  ARG A N   1 
ATOM 879  C CA  . ARG A 1 117  ? 35.258  40.328 39.719  1.00 57.44  ? 114  ARG A CA  1 
ATOM 880  C C   . ARG A 1 117  ? 34.317  41.524 39.920  1.00 57.44  ? 114  ARG A C   1 
ATOM 881  O O   . ARG A 1 117  ? 34.513  42.286 40.885  1.00 57.44  ? 114  ARG A O   1 
ATOM 882  C CB  . ARG A 1 117  ? 35.187  39.375 40.907  1.00 98.10  ? 114  ARG A CB  1 
ATOM 883  C CG  . ARG A 1 117  ? 33.791  38.873 41.256  1.00 98.10  ? 114  ARG A CG  1 
ATOM 884  C CD  . ARG A 1 117  ? 33.745  38.311 42.680  1.00 98.10  ? 114  ARG A CD  1 
ATOM 885  N NE  . ARG A 1 117  ? 34.521  39.133 43.611  1.00 98.10  ? 114  ARG A NE  1 
ATOM 886  C CZ  . ARG A 1 117  ? 34.383  39.116 44.932  1.00 98.10  ? 114  ARG A CZ  1 
ATOM 887  N NH1 . ARG A 1 117  ? 33.484  38.323 45.500  1.00 98.10  ? 114  ARG A NH1 1 
ATOM 888  N NH2 . ARG A 1 117  ? 35.142  39.901 45.687  1.00 98.10  ? 114  ARG A NH2 1 
ATOM 889  N N   . PRO A 1 118  ? 33.290  41.683 39.024  1.00 55.09  ? 115  PRO A N   1 
ATOM 890  C CA  . PRO A 1 118  ? 32.492  42.930 38.918  1.00 55.09  ? 115  PRO A CA  1 
ATOM 891  C C   . PRO A 1 118  ? 31.819  43.194 40.247  1.00 55.09  ? 115  PRO A C   1 
ATOM 892  O O   . PRO A 1 118  ? 31.234  42.278 40.794  1.00 55.09  ? 115  PRO A O   1 
ATOM 893  C CB  . PRO A 1 118  ? 31.465  42.596 37.819  1.00 36.04  ? 115  PRO A CB  1 
ATOM 894  C CG  . PRO A 1 118  ? 32.095  41.499 37.017  1.00 36.04  ? 115  PRO A CG  1 
ATOM 895  C CD  . PRO A 1 118  ? 32.786  40.665 38.075  1.00 36.04  ? 115  PRO A CD  1 
ATOM 896  N N   . SER A 1 119  ? 31.917  44.405 40.782  1.00 46.15  ? 116  SER A N   1 
ATOM 897  C CA  . SER A 1 119  ? 31.812  44.550 42.259  1.00 46.15  ? 116  SER A CA  1 
ATOM 898  C C   . SER A 1 119  ? 30.421  44.578 42.933  1.00 46.15  ? 116  SER A C   1 
ATOM 899  O O   . SER A 1 119  ? 29.411  44.091 42.391  1.00 46.15  ? 116  SER A O   1 
ATOM 900  C CB  . SER A 1 119  ? 32.719  45.703 42.791  1.00 34.45  ? 116  SER A CB  1 
ATOM 901  O OG  . SER A 1 119  ? 32.109  46.977 42.711  1.00 34.45  ? 116  SER A OG  1 
ATOM 902  N N   . GLU A 1 120  ? 30.403  45.123 44.142  1.00 147.69 ? 117  GLU A N   1 
ATOM 903  C CA  . GLU A 1 120  ? 29.174  45.278 44.878  1.00 147.69 ? 117  GLU A CA  1 
ATOM 904  C C   . GLU A 1 120  ? 28.602  46.671 44.725  1.00 147.69 ? 117  GLU A C   1 
ATOM 905  O O   . GLU A 1 120  ? 29.210  47.649 45.162  1.00 147.69 ? 117  GLU A O   1 
ATOM 906  C CB  . GLU A 1 120  ? 29.373  44.958 46.352  1.00 105.00 ? 117  GLU A CB  1 
ATOM 907  C CG  . GLU A 1 120  ? 28.043  44.755 47.078  1.00 105.00 ? 117  GLU A CG  1 
ATOM 908  C CD  . GLU A 1 120  ? 27.053  43.898 46.285  1.00 105.00 ? 117  GLU A CD  1 
ATOM 909  O OE1 . GLU A 1 120  ? 26.825  44.183 45.073  1.00 105.00 ? 117  GLU A OE1 1 
ATOM 910  O OE2 . GLU A 1 120  ? 26.503  42.950 46.895  1.00 105.00 ? 117  GLU A OE2 1 
ATOM 911  N N   . THR A 1 121  ? 27.409  46.735 44.138  1.00 65.85  ? 118  THR A N   1 
ATOM 912  C CA  . THR A 1 121  ? 26.758  47.994 43.768  1.00 65.85  ? 118  THR A CA  1 
ATOM 913  C C   . THR A 1 121  ? 27.077  48.394 42.330  1.00 65.85  ? 118  THR A C   1 
ATOM 914  O O   . THR A 1 121  ? 26.726  49.507 41.902  1.00 65.85  ? 118  THR A O   1 
ATOM 915  C CB  . THR A 1 121  ? 27.064  49.174 44.735  1.00 93.67  ? 118  THR A CB  1 
ATOM 916  O OG1 . THR A 1 121  ? 27.041  48.711 46.088  1.00 93.67  ? 118  THR A OG1 1 
ATOM 917  C CG2 . THR A 1 121  ? 26.031  50.315 44.564  1.00 93.67  ? 118  THR A CG2 1 
ATOM 918  N N   . GLY A 1 122  ? 27.742  47.491 41.600  1.00 47.44  ? 119  GLY A N   1 
ATOM 919  C CA  . GLY A 1 122  ? 27.915  47.590 40.134  1.00 47.44  ? 119  GLY A CA  1 
ATOM 920  C C   . GLY A 1 122  ? 28.852  48.705 39.718  1.00 47.44  ? 119  GLY A C   1 
ATOM 921  O O   . GLY A 1 122  ? 29.498  49.334 40.577  1.00 47.44  ? 119  GLY A O   1 
ATOM 922  N N   . ILE A 1 123  ? 28.932  48.964 38.403  1.00 24.34  ? 120  ILE A N   1 
ATOM 923  C CA  . ILE A 1 123  ? 29.832  50.023 37.888  1.00 24.34  ? 120  ILE A CA  1 
ATOM 924  C C   . ILE A 1 123  ? 29.478  51.339 38.556  1.00 24.34  ? 120  ILE A C   1 
ATOM 925  O O   . ILE A 1 123  ? 28.332  51.565 38.840  1.00 24.34  ? 120  ILE A O   1 
ATOM 926  C CB  . ILE A 1 123  ? 29.700  50.196 36.381  1.00 20.70  ? 120  ILE A CB  1 
ATOM 927  C CG1 . ILE A 1 123  ? 30.398  49.039 35.665  1.00 20.70  ? 120  ILE A CG1 1 
ATOM 928  C CG2 . ILE A 1 123  ? 30.228  51.578 35.944  1.00 20.70  ? 120  ILE A CG2 1 
ATOM 929  C CD1 . ILE A 1 123  ? 29.766  48.590 34.410  1.00 20.70  ? 120  ILE A CD1 1 
ATOM 930  N N   . ILE A 1 124  ? 30.478  52.159 38.848  1.00 39.04  ? 121  ILE A N   1 
ATOM 931  C CA  . ILE A 1 124  ? 30.304  53.493 39.405  1.00 39.04  ? 121  ILE A CA  1 
ATOM 932  C C   . ILE A 1 124  ? 31.376  54.330 38.750  1.00 39.04  ? 121  ILE A C   1 
ATOM 933  O O   . ILE A 1 124  ? 32.539  53.950 38.770  1.00 39.04  ? 121  ILE A O   1 
ATOM 934  C CB  . ILE A 1 124  ? 30.568  53.539 40.918  1.00 38.10  ? 121  ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 124  ? 29.615  52.629 41.687  1.00 38.10  ? 121  ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 124  ? 30.483  54.970 41.430  1.00 38.10  ? 121  ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 124  ? 29.905  52.609 43.237  1.00 38.10  ? 121  ILE A CD1 1 
ATOM 938  N N   . GLY A 1 125  ? 31.006  55.471 38.181  1.00 36.93  ? 122  GLY A N   1 
ATOM 939  C CA  . GLY A 1 125  ? 31.968  56.295 37.412  1.00 36.93  ? 122  GLY A CA  1 
ATOM 940  C C   . GLY A 1 125  ? 31.914  57.702 37.949  1.00 36.93  ? 122  GLY A C   1 
ATOM 941  O O   . GLY A 1 125  ? 30.876  58.348 37.905  1.00 36.93  ? 122  GLY A O   1 
ATOM 942  N N   . ILE A 1 126  ? 32.995  58.210 38.498  1.00 30.64  ? 123  ILE A N   1 
ATOM 943  C CA  . ILE A 1 126  ? 32.837  59.527 39.116  1.00 30.64  ? 123  ILE A CA  1 
ATOM 944  C C   . ILE A 1 126  ? 33.842  60.449 38.500  1.00 30.64  ? 123  ILE A C   1 
ATOM 945  O O   . ILE A 1 126  ? 34.730  59.977 37.779  1.00 30.64  ? 123  ILE A O   1 
ATOM 946  C CB  . ILE A 1 126  ? 32.908  59.497 40.651  1.00 26.30  ? 123  ILE A CB  1 
ATOM 947  C CG1 . ILE A 1 126  ? 34.287  58.992 41.097  1.00 26.30  ? 123  ILE A CG1 1 
ATOM 948  C CG2 . ILE A 1 126  ? 31.721  58.701 41.221  1.00 26.30  ? 123  ILE A CG2 1 
ATOM 949  C CD1 . ILE A 1 126  ? 34.304  58.426 42.550  1.00 26.30  ? 123  ILE A CD1 1 
ATOM 950  N N   . ILE A 1 127  ? 33.655  61.746 38.720  1.00 40.65  ? 124  ILE A N   1 
ATOM 951  C CA  . ILE A 1 127  ? 34.508  62.741 38.124  1.00 40.65  ? 124  ILE A CA  1 
ATOM 952  C C   . ILE A 1 127  ? 34.754  63.873 39.093  1.00 40.65  ? 124  ILE A C   1 
ATOM 953  O O   . ILE A 1 127  ? 33.814  64.461 39.628  1.00 40.65  ? 124  ILE A O   1 
ATOM 954  C CB  . ILE A 1 127  ? 33.935  63.296 36.826  1.00 23.97  ? 124  ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127  ? 34.051  62.258 35.725  1.00 23.97  ? 124  ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127  ? 34.738  64.532 36.371  1.00 23.97  ? 124  ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127  ? 33.612  62.766 34.274  1.00 23.97  ? 124  ILE A CD1 1 
ATOM 958  N N   . ASP A 1 128  ? 36.039  64.169 39.282  1.00 52.31  ? 125  ASP A N   1 
ATOM 959  C CA  . ASP A 1 128  ? 36.552  65.227 40.148  1.00 52.31  ? 125  ASP A CA  1 
ATOM 960  C C   . ASP A 1 128  ? 36.000  66.585 39.729  1.00 52.31  ? 125  ASP A C   1 
ATOM 961  O O   . ASP A 1 128  ? 35.858  66.836 38.537  1.00 52.31  ? 125  ASP A O   1 
ATOM 962  C CB  . ASP A 1 128  ? 38.077  65.198 40.024  1.00 108.14 ? 125  ASP A CB  1 
ATOM 963  C CG  . ASP A 1 128  ? 38.743  66.382 40.657  1.00 108.14 ? 125  ASP A CG  1 
ATOM 964  O OD1 . ASP A 1 128  ? 38.867  66.411 41.901  1.00 108.14 ? 125  ASP A OD1 1 
ATOM 965  O OD2 . ASP A 1 128  ? 39.167  67.274 39.898  1.00 108.14 ? 125  ASP A OD2 1 
ATOM 966  N N   . PRO A 1 129  ? 35.638  67.440 40.706  1.00 48.43  ? 126  PRO A N   1 
ATOM 967  C CA  . PRO A 1 129  ? 35.280  68.852 40.500  1.00 48.43  ? 126  PRO A CA  1 
ATOM 968  C C   . PRO A 1 129  ? 36.249  69.646 39.599  1.00 48.43  ? 126  PRO A C   1 
ATOM 969  O O   . PRO A 1 129  ? 35.805  70.311 38.659  1.00 48.43  ? 126  PRO A O   1 
ATOM 970  C CB  . PRO A 1 129  ? 35.280  69.423 41.920  1.00 51.53  ? 126  PRO A CB  1 
ATOM 971  C CG  . PRO A 1 129  ? 34.936  68.305 42.775  1.00 51.53  ? 126  PRO A CG  1 
ATOM 972  C CD  . PRO A 1 129  ? 35.502  67.061 42.124  1.00 51.53  ? 126  PRO A CD  1 
ATOM 973  N N   . GLU A 1 130  ? 37.550  69.578 39.852  1.00 60.38  ? 127  GLU A N   1 
ATOM 974  C CA  . GLU A 1 130  ? 38.483  70.290 38.984  1.00 60.38  ? 127  GLU A CA  1 
ATOM 975  C C   . GLU A 1 130  ? 38.657  69.648 37.614  1.00 60.38  ? 127  GLU A C   1 
ATOM 976  O O   . GLU A 1 130  ? 39.278  70.237 36.731  1.00 60.38  ? 127  GLU A O   1 
ATOM 977  C CB  . GLU A 1 130  ? 39.835  70.460 39.655  1.00 101.27 ? 127  GLU A CB  1 
ATOM 978  C CG  . GLU A 1 130  ? 39.896  71.624 40.600  1.00 101.27 ? 127  GLU A CG  1 
ATOM 979  C CD  . GLU A 1 130  ? 41.009  71.468 41.605  1.00 101.27 ? 127  GLU A CD  1 
ATOM 980  O OE1 . GLU A 1 130  ? 40.896  72.056 42.699  1.00 101.27 ? 127  GLU A OE1 1 
ATOM 981  O OE2 . GLU A 1 130  ? 41.992  70.748 41.313  1.00 101.27 ? 127  GLU A OE2 1 
ATOM 982  N N   . CYS A 1 131  ? 38.106  68.451 37.439  1.00 41.82  ? 128  CYS A N   1 
ATOM 983  C CA  . CYS A 1 131  ? 38.166  67.731 36.170  1.00 41.82  ? 128  CYS A CA  1 
ATOM 984  C C   . CYS A 1 131  ? 39.554  67.184 35.877  1.00 41.82  ? 128  CYS A C   1 
ATOM 985  O O   . CYS A 1 131  ? 39.924  66.921 34.705  1.00 41.82  ? 128  CYS A O   1 
ATOM 986  C CB  . CYS A 1 131  ? 37.687  68.580 35.002  1.00 57.28  ? 128  CYS A CB  1 
ATOM 987  S SG  . CYS A 1 131  ? 35.989  68.343 34.649  1.00 57.28  ? 128  CYS A SG  1 
ATOM 988  N N   . ARG A 1 132  ? 40.316  66.989 36.942  1.00 110.03 ? 129  ARG A N   1 
ATOM 989  C CA  . ARG A 1 132  ? 41.652  66.466 36.809  1.00 110.03 ? 129  ARG A CA  1 
ATOM 990  C C   . ARG A 1 132  ? 41.617  65.012 36.338  1.00 110.03 ? 129  ARG A C   1 
ATOM 991  O O   . ARG A 1 132  ? 42.549  64.552 35.677  1.00 110.03 ? 129  ARG A O   1 
ATOM 992  C CB  . ARG A 1 132  ? 42.420  66.632 38.122  1.00 126.81 ? 129  ARG A CB  1 
ATOM 993  C CG  . ARG A 1 132  ? 42.850  68.077 38.427  1.00 126.81 ? 129  ARG A CG  1 
ATOM 994  C CD  . ARG A 1 132  ? 44.298  68.364 38.013  1.00 126.81 ? 129  ARG A CD  1 
ATOM 995  N NE  . ARG A 1 132  ? 45.247  67.489 38.707  1.00 126.81 ? 129  ARG A NE  1 
ATOM 996  C CZ  . ARG A 1 132  ? 45.786  67.735 39.903  1.00 126.81 ? 129  ARG A CZ  1 
ATOM 997  N NH1 . ARG A 1 132  ? 45.492  68.852 40.565  1.00 126.81 ? 129  ARG A NH1 1 
ATOM 998  N NH2 . ARG A 1 132  ? 46.625  66.857 40.443  1.00 126.81 ? 129  ARG A NH2 1 
ATOM 999  N N   . MET A 1 133  ? 40.530  64.303 36.639  1.00 89.00  ? 130  MET A N   1 
ATOM 1000 C CA  . MET A 1 133  ? 40.414  62.898 36.239  1.00 89.00  ? 130  MET A CA  1 
ATOM 1001 C C   . MET A 1 133  ? 38.994  62.349 36.247  1.00 89.00  ? 130  MET A C   1 
ATOM 1002 O O   . MET A 1 133  ? 38.027  63.048 36.575  1.00 89.00  ? 130  MET A O   1 
ATOM 1003 C CB  . MET A 1 133  ? 41.223  62.028 37.188  1.00 53.81  ? 130  MET A CB  1 
ATOM 1004 C CG  . MET A 1 133  ? 40.523  61.877 38.494  1.00 53.81  ? 130  MET A CG  1 
ATOM 1005 S SD  . MET A 1 133  ? 41.468  61.023 39.715  1.00 53.81  ? 130  MET A SD  1 
ATOM 1006 C CE  . MET A 1 133  ? 42.774  62.223 39.967  1.00 53.81  ? 130  MET A CE  1 
ATOM 1007 N N   . ILE A 1 134  ? 38.906  61.065 35.903  1.00 34.52  ? 131  ILE A N   1 
ATOM 1008 C CA  . ILE A 1 134  ? 37.688  60.268 36.054  1.00 34.52  ? 131  ILE A CA  1 
ATOM 1009 C C   . ILE A 1 134  ? 38.027  59.069 36.920  1.00 34.52  ? 131  ILE A C   1 
ATOM 1010 O O   . ILE A 1 134  ? 39.058  58.412 36.706  1.00 34.52  ? 131  ILE A O   1 
ATOM 1011 C CB  . ILE A 1 134  ? 37.157  59.719 34.722  1.00 43.09  ? 131  ILE A CB  1 
ATOM 1012 C CG1 . ILE A 1 134  ? 36.862  60.866 33.740  1.00 43.09  ? 131  ILE A CG1 1 
ATOM 1013 C CG2 . ILE A 1 134  ? 35.969  58.840 34.998  1.00 43.09  ? 131  ILE A CG2 1 
ATOM 1014 C CD1 . ILE A 1 134  ? 35.994  60.483 32.569  1.00 43.09  ? 131  ILE A CD1 1 
ATOM 1015 N N   . GLY A 1 135  ? 37.164  58.800 37.892  1.00 31.37  ? 132  GLY A N   1 
ATOM 1016 C CA  . GLY A 1 135  ? 37.337  57.678 38.787  1.00 31.37  ? 132  GLY A CA  1 
ATOM 1017 C C   . GLY A 1 135  ? 36.303  56.600 38.514  1.00 31.37  ? 132  GLY A C   1 
ATOM 1018 O O   . GLY A 1 135  ? 35.089  56.876 38.491  1.00 31.37  ? 132  GLY A O   1 
ATOM 1019 N N   . LEU A 1 136  ? 36.799  55.383 38.302  1.00 43.66  ? 133  LEU A N   1 
ATOM 1020 C CA  . LEU A 1 136  ? 35.987  54.214 38.060  1.00 43.66  ? 133  LEU A CA  1 
ATOM 1021 C C   . LEU A 1 136  ? 36.103  53.203 39.189  1.00 43.66  ? 133  LEU A C   1 
ATOM 1022 O O   . LEU A 1 136  ? 37.132  53.105 39.867  1.00 43.66  ? 133  LEU A O   1 
ATOM 1023 C CB  . LEU A 1 136  ? 36.434  53.532 36.782  1.00 35.43  ? 133  LEU A CB  1 
ATOM 1024 C CG  . LEU A 1 136  ? 35.676  53.803 35.491  1.00 35.43  ? 133  LEU A CG  1 
ATOM 1025 C CD1 . LEU A 1 136  ? 35.299  55.282 35.303  1.00 35.43  ? 133  LEU A CD1 1 
ATOM 1026 C CD2 . LEU A 1 136  ? 36.492  53.283 34.335  1.00 35.43  ? 133  LEU A CD2 1 
ATOM 1027 N N   . ARG A 1 137  ? 35.026  52.463 39.388  1.00 42.76  ? 134  ARG A N   1 
ATOM 1028 C CA  . ARG A 1 137  ? 35.029  51.350 40.259  1.00 42.76  ? 134  ARG A CA  1 
ATOM 1029 C C   . ARG A 1 137  ? 34.336  50.279 39.487  1.00 42.76  ? 134  ARG A C   1 
ATOM 1030 O O   . ARG A 1 137  ? 33.132  50.173 39.518  1.00 42.76  ? 134  ARG A O   1 
ATOM 1031 C CB  . ARG A 1 137  ? 34.262  51.653 41.518  1.00 38.23  ? 134  ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 137  ? 34.664  50.748 42.705  1.00 38.23  ? 134  ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 137  ? 34.159  49.348 42.539  1.00 38.23  ? 134  ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 137  ? 32.713  49.370 42.515  1.00 38.23  ? 134  ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 137  ? 31.935  49.183 43.571  1.00 38.23  ? 134  ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 137  ? 32.437  48.889 44.773  1.00 38.23  ? 134  ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 137  ? 30.642  49.259 43.395  1.00 38.23  ? 134  ARG A NH2 1 
ATOM 1038 N N   . LEU A 1 138  ? 35.100  49.505 38.745  1.00 42.56  ? 135  LEU A N   1 
ATOM 1039 C CA  . LEU A 1 138  ? 34.551  48.400 38.039  1.00 42.56  ? 135  LEU A CA  1 
ATOM 1040 C C   . LEU A 1 138  ? 34.658  47.125 38.879  1.00 42.56  ? 135  LEU A C   1 
ATOM 1041 O O   . LEU A 1 138  ? 33.775  46.260 38.827  1.00 42.56  ? 135  LEU A O   1 
ATOM 1042 C CB  . LEU A 1 138  ? 35.268  48.250 36.706  1.00 33.14  ? 135  LEU A CB  1 
ATOM 1043 C CG  . LEU A 1 138  ? 35.113  49.213 35.508  1.00 33.14  ? 135  LEU A CG  1 
ATOM 1044 C CD1 . LEU A 1 138  ? 33.696  49.708 35.177  1.00 33.14  ? 135  LEU A CD1 1 
ATOM 1045 C CD2 . LEU A 1 138  ? 35.986  50.410 35.692  1.00 33.14  ? 135  LEU A CD2 1 
ATOM 1046 N N   . TYR A 1 139  ? 35.722  46.996 39.668  1.00 49.22  ? 136  TYR A N   1 
ATOM 1047 C CA  . TYR A 1 139  ? 35.989  45.720 40.337  1.00 49.22  ? 136  TYR A CA  1 
ATOM 1048 C C   . TYR A 1 139  ? 36.276  45.890 41.797  1.00 49.22  ? 136  TYR A C   1 
ATOM 1049 O O   . TYR A 1 139  ? 36.630  46.969 42.235  1.00 49.22  ? 136  TYR A O   1 
ATOM 1050 C CB  . TYR A 1 139  ? 37.164  45.040 39.660  1.00 40.95  ? 136  TYR A CB  1 
ATOM 1051 C CG  . TYR A 1 139  ? 36.963  44.881 38.180  1.00 40.95  ? 136  TYR A CG  1 
ATOM 1052 C CD1 . TYR A 1 139  ? 37.717  45.598 37.268  1.00 40.95  ? 136  TYR A CD1 1 
ATOM 1053 C CD2 . TYR A 1 139  ? 35.968  44.026 37.691  1.00 40.95  ? 136  TYR A CD2 1 
ATOM 1054 C CE1 . TYR A 1 139  ? 37.501  45.444 35.882  1.00 40.95  ? 136  TYR A CE1 1 
ATOM 1055 C CE2 . TYR A 1 139  ? 35.754  43.871 36.334  1.00 40.95  ? 136  TYR A CE2 1 
ATOM 1056 C CZ  . TYR A 1 139  ? 36.520  44.573 35.445  1.00 40.95  ? 136  TYR A CZ  1 
ATOM 1057 O OH  . TYR A 1 139  ? 36.283  44.364 34.124  1.00 40.95  ? 136  TYR A OH  1 
ATOM 1058 N N   . ASP A 1 140  ? 36.111  44.823 42.561  1.00 33.12  ? 137  ASP A N   1 
ATOM 1059 C CA  . ASP A 1 140  ? 36.546  44.821 43.960  1.00 33.12  ? 137  ASP A CA  1 
ATOM 1060 C C   . ASP A 1 140  ? 38.062  44.897 44.027  1.00 33.12  ? 137  ASP A C   1 
ATOM 1061 O O   . ASP A 1 140  ? 38.736  44.223 43.275  1.00 33.12  ? 137  ASP A O   1 
ATOM 1062 C CB  . ASP A 1 140  ? 36.072  43.564 44.693  1.00 51.02  ? 137  ASP A CB  1 
ATOM 1063 C CG  . ASP A 1 140  ? 34.590  43.611 45.029  1.00 51.02  ? 137  ASP A CG  1 
ATOM 1064 O OD1 . ASP A 1 140  ? 34.085  44.716 45.362  1.00 51.02  ? 137  ASP A OD1 1 
ATOM 1065 O OD2 . ASP A 1 140  ? 33.929  42.556 44.955  1.00 51.02  ? 137  ASP A OD2 1 
ATOM 1066 N N   . GLY A 1 141  ? 38.604  45.732 44.905  1.00 49.87  ? 138  GLY A N   1 
ATOM 1067 C CA  . GLY A 1 141  ? 40.034  45.738 45.107  1.00 49.87  ? 138  GLY A CA  1 
ATOM 1068 C C   . GLY A 1 141  ? 40.722  46.694 44.174  1.00 49.87  ? 138  GLY A C   1 
ATOM 1069 O O   . GLY A 1 141  ? 41.778  47.222 44.497  1.00 49.87  ? 138  GLY A O   1 
ATOM 1070 N N   . LEU A 1 142  ? 40.146  46.922 43.008  1.00 35.83  ? 139  LEU A N   1 
ATOM 1071 C CA  . LEU A 1 142  ? 40.751  47.876 42.102  1.00 35.83  ? 139  LEU A CA  1 
ATOM 1072 C C   . LEU A 1 142  ? 40.033  49.178 42.180  1.00 35.83  ? 139  LEU A C   1 
ATOM 1073 O O   . LEU A 1 142  ? 38.904  49.246 42.660  1.00 35.83  ? 139  LEU A O   1 
ATOM 1074 C CB  . LEU A 1 142  ? 40.770  47.351 40.663  1.00 29.63  ? 139  LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 142  ? 41.493  45.991 40.528  1.00 29.63  ? 139  LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 142  ? 41.486  45.485 39.119  1.00 29.63  ? 139  LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 142  ? 42.932  46.135 41.032  1.00 29.63  ? 139  LEU A CD2 1 
ATOM 1078 N N   . PHE A 1 143  ? 40.711  50.224 41.744  1.00 42.39  ? 140  PHE A N   1 
ATOM 1079 C CA  . PHE A 1 143  ? 40.104  51.502 41.538  1.00 42.39  ? 140  PHE A CA  1 
ATOM 1080 C C   . PHE A 1 143  ? 40.826  52.016 40.320  1.00 42.39  ? 140  PHE A C   1 
ATOM 1081 O O   . PHE A 1 143  ? 42.017  52.257 40.384  1.00 42.39  ? 140  PHE A O   1 
ATOM 1082 C CB  . PHE A 1 143  ? 40.305  52.417 42.741  1.00 39.64  ? 140  PHE A CB  1 
ATOM 1083 C CG  . PHE A 1 143  ? 39.646  53.758 42.576  1.00 39.64  ? 140  PHE A CG  1 
ATOM 1084 C CD1 . PHE A 1 143  ? 38.275  53.909 42.789  1.00 39.64  ? 140  PHE A CD1 1 
ATOM 1085 C CD2 . PHE A 1 143  ? 40.381  54.877 42.147  1.00 39.64  ? 140  PHE A CD2 1 
ATOM 1086 C CE1 . PHE A 1 143  ? 37.659  55.162 42.590  1.00 39.64  ? 140  PHE A CE1 1 
ATOM 1087 C CE2 . PHE A 1 143  ? 39.781  56.118 41.944  1.00 39.64  ? 140  PHE A CE2 1 
ATOM 1088 C CZ  . PHE A 1 143  ? 38.425  56.267 42.165  1.00 39.64  ? 140  PHE A CZ  1 
ATOM 1089 N N   . LYS A 1 144  ? 40.128  52.149 39.196  1.00 33.57  ? 141  LYS A N   1 
ATOM 1090 C CA  . LYS A 1 144  ? 40.730  52.572 37.908  1.00 33.57  ? 141  LYS A CA  1 
ATOM 1091 C C   . LYS A 1 144  ? 40.667  54.128 37.744  1.00 33.57  ? 141  LYS A C   1 
ATOM 1092 O O   . LYS A 1 144  ? 39.676  54.760 38.071  1.00 33.57  ? 141  LYS A O   1 
ATOM 1093 C CB  . LYS A 1 144  ? 39.992  51.836 36.778  1.00 28.98  ? 141  LYS A CB  1 
ATOM 1094 C CG  . LYS A 1 144  ? 40.269  52.262 35.351  1.00 28.98  ? 141  LYS A CG  1 
ATOM 1095 C CD  . LYS A 1 144  ? 41.452  51.472 34.778  1.00 28.98  ? 141  LYS A CD  1 
ATOM 1096 C CE  . LYS A 1 144  ? 41.213  49.926 34.723  1.00 28.98  ? 141  LYS A CE  1 
ATOM 1097 N NZ  . LYS A 1 144  ? 40.684  49.542 33.398  1.00 28.98  ? 141  LYS A NZ  1 
ATOM 1098 N N   . VAL A 1 145  ? 41.733  54.753 37.283  1.00 44.77  ? 142  VAL A N   1 
ATOM 1099 C CA  . VAL A 1 145  ? 41.713  56.194 37.130  1.00 44.77  ? 142  VAL A CA  1 
ATOM 1100 C C   . VAL A 1 145  ? 42.024  56.538 35.701  1.00 44.77  ? 142  VAL A C   1 
ATOM 1101 O O   . VAL A 1 145  ? 43.050  56.100 35.154  1.00 44.77  ? 142  VAL A O   1 
ATOM 1102 C CB  . VAL A 1 145  ? 42.777  56.871 37.996  1.00 39.00  ? 142  VAL A CB  1 
ATOM 1103 C CG1 . VAL A 1 145  ? 42.931  58.321 37.610  1.00 39.00  ? 142  VAL A CG1 1 
ATOM 1104 C CG2 . VAL A 1 145  ? 42.427  56.767 39.446  1.00 39.00  ? 142  VAL A CG2 1 
ATOM 1105 N N   . ILE A 1 146  ? 41.165  57.342 35.086  1.00 31.56  ? 143  ILE A N   1 
ATOM 1106 C CA  . ILE A 1 146  ? 41.480  57.813 33.745  1.00 31.56  ? 143  ILE A CA  1 
ATOM 1107 C C   . ILE A 1 146  ? 41.806  59.277 33.776  1.00 31.56  ? 143  ILE A C   1 
ATOM 1108 O O   . ILE A 1 146  ? 40.899  60.082 33.906  1.00 31.56  ? 143  ILE A O   1 
ATOM 1109 C CB  . ILE A 1 146  ? 40.349  57.641 32.801  1.00 31.72  ? 143  ILE A CB  1 
ATOM 1110 C CG1 . ILE A 1 146  ? 39.986  56.160 32.694  1.00 31.72  ? 143  ILE A CG1 1 
ATOM 1111 C CG2 . ILE A 1 146  ? 40.754  58.236 31.478  1.00 31.72  ? 143  ILE A CG2 1 
ATOM 1112 C CD1 . ILE A 1 146  ? 38.647  55.925 32.015  1.00 31.72  ? 143  ILE A CD1 1 
ATOM 1113 N N   . PRO A 1 147  ? 43.104  59.622 33.637  1.00 49.34  ? 144  PRO A N   1 
ATOM 1114 C CA  . PRO A 1 147  ? 43.624  60.997 33.746  1.00 49.34  ? 144  PRO A CA  1 
ATOM 1115 C C   . PRO A 1 147  ? 43.167  61.824 32.571  1.00 49.34  ? 144  PRO A C   1 
ATOM 1116 O O   . PRO A 1 147  ? 43.398  61.448 31.416  1.00 49.34  ? 144  PRO A O   1 
ATOM 1117 C CB  . PRO A 1 147  ? 45.144  60.812 33.673  1.00 69.48  ? 144  PRO A CB  1 
ATOM 1118 C CG  . PRO A 1 147  ? 45.388  59.341 33.890  1.00 69.48  ? 144  PRO A CG  1 
ATOM 1119 C CD  . PRO A 1 147  ? 44.181  58.662 33.329  1.00 69.48  ? 144  PRO A CD  1 
ATOM 1120 N N   . LEU A 1 148  ? 42.494  62.925 32.873  1.00 62.04  ? 145  LEU A N   1 
ATOM 1121 C CA  . LEU A 1 148  ? 42.065  63.848 31.839  1.00 62.04  ? 145  LEU A CA  1 
ATOM 1122 C C   . LEU A 1 148  ? 43.218  64.774 31.443  1.00 62.04  ? 145  LEU A C   1 
ATOM 1123 O O   . LEU A 1 148  ? 43.844  65.448 32.289  1.00 62.04  ? 145  LEU A O   1 
ATOM 1124 C CB  . LEU A 1 148  ? 40.825  64.610 32.282  1.00 56.13  ? 145  LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 148  ? 39.671  63.621 32.498  1.00 56.13  ? 145  LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 148  ? 38.702  64.143 33.543  1.00 56.13  ? 145  LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 148  ? 38.933  63.245 31.170  1.00 56.13  ? 145  LEU A CD2 1 
ATOM 1128 N N   . ASP A 1 149  ? 43.505  64.738 30.145  1.00 100.42 ? 146  ASP A N   1 
ATOM 1129 C CA  . ASP A 1 149  ? 44.593  65.452 29.504  1.00 100.42 ? 146  ASP A CA  1 
ATOM 1130 C C   . ASP A 1 149  ? 44.087  65.761 28.125  1.00 100.42 ? 146  ASP A C   1 
ATOM 1131 O O   . ASP A 1 149  ? 43.064  65.218 27.701  1.00 100.42 ? 146  ASP A O   1 
ATOM 1132 C CB  . ASP A 1 149  ? 45.825  64.565 29.391  1.00 103.05 ? 146  ASP A CB  1 
ATOM 1133 C CG  . ASP A 1 149  ? 46.569  64.452 30.692  1.00 103.05 ? 146  ASP A CG  1 
ATOM 1134 O OD1 . ASP A 1 149  ? 46.157  63.656 31.558  1.00 103.05 ? 146  ASP A OD1 1 
ATOM 1135 O OD2 . ASP A 1 149  ? 47.575  65.169 30.854  1.00 103.05 ? 146  ASP A OD2 1 
ATOM 1136 N N   . ARG A 1 150  ? 44.800  66.621 27.411  1.00 72.26  ? 147  ARG A N   1 
ATOM 1137 C CA  . ARG A 1 150  ? 44.308  67.068 26.130  1.00 72.26  ? 147  ARG A CA  1 
ATOM 1138 C C   . ARG A 1 150  ? 44.385  65.887 25.190  1.00 72.26  ? 147  ARG A C   1 
ATOM 1139 O O   . ARG A 1 150  ? 43.530  65.701 24.331  1.00 72.26  ? 147  ARG A O   1 
ATOM 1140 C CB  . ARG A 1 150  ? 45.140  68.242 25.617  1.00 162.17 ? 147  ARG A CB  1 
ATOM 1141 C CG  . ARG A 1 150  ? 44.313  69.418 25.106  1.00 162.17 ? 147  ARG A CG  1 
ATOM 1142 C CD  . ARG A 1 150  ? 43.676  69.124 23.752  1.00 162.17 ? 147  ARG A CD  1 
ATOM 1143 N NE  . ARG A 1 150  ? 43.094  70.321 23.146  1.00 162.17 ? 147  ARG A NE  1 
ATOM 1144 C CZ  . ARG A 1 150  ? 43.757  71.167 22.358  1.00 162.17 ? 147  ARG A CZ  1 
ATOM 1145 N NH1 . ARG A 1 150  ? 45.040  70.962 22.070  1.00 162.17 ? 147  ARG A NH1 1 
ATOM 1146 N NH2 . ARG A 1 150  ? 43.134  72.224 21.855  1.00 162.17 ? 147  ARG A NH2 1 
ATOM 1147 N N   . ASP A 1 151  ? 45.418  65.080 25.385  1.00 168.78 ? 148  ASP A N   1 
ATOM 1148 C CA  . ASP A 1 151  ? 45.606  63.870 24.617  1.00 168.78 ? 148  ASP A CA  1 
ATOM 1149 C C   . ASP A 1 151  ? 44.694  62.814 25.206  1.00 168.78 ? 148  ASP A C   1 
ATOM 1150 O O   . ASP A 1 151  ? 43.472  62.981 25.229  1.00 168.78 ? 148  ASP A O   1 
ATOM 1151 C CB  . ASP A 1 151  ? 47.057  63.414 24.718  1.00 168.17 ? 148  ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 151  ? 47.921  64.415 25.457  1.00 168.17 ? 148  ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 151  ? 48.122  65.533 24.925  1.00 168.17 ? 148  ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 151  ? 48.381  64.087 26.579  1.00 168.17 ? 148  ASP A OD2 1 
ATOM 1155 N N   . ASN A 1 152  ? 45.299  61.738 25.702  1.00 82.48  ? 149  ASN A N   1 
ATOM 1156 C CA  . ASN A 1 152  ? 44.565  60.588 26.206  1.00 82.48  ? 149  ASN A CA  1 
ATOM 1157 C C   . ASN A 1 152  ? 43.296  60.300 25.410  1.00 82.48  ? 149  ASN A C   1 
ATOM 1158 O O   . ASN A 1 152  ? 42.270  59.900 25.957  1.00 82.48  ? 149  ASN A O   1 
ATOM 1159 C CB  . ASN A 1 152  ? 44.243  60.770 27.681  1.00 65.40  ? 149  ASN A CB  1 
ATOM 1160 C CG  . ASN A 1 152  ? 43.978  59.454 28.368  1.00 65.40  ? 149  ASN A CG  1 
ATOM 1161 O OD1 . ASN A 1 152  ? 44.017  58.397 27.735  1.00 65.40  ? 149  ASN A OD1 1 
ATOM 1162 N ND2 . ASN A 1 152  ? 43.713  59.504 29.669  1.00 65.40  ? 149  ASN A ND2 1 
ATOM 1163 N N   . LYS A 1 153  ? 43.388  60.513 24.104  1.00 42.87  ? 150  LYS A N   1 
ATOM 1164 C CA  . LYS A 1 153  ? 42.252  60.367 23.216  1.00 42.87  ? 150  LYS A CA  1 
ATOM 1165 C C   . LYS A 1 153  ? 41.749  58.924 23.170  1.00 42.87  ? 150  LYS A C   1 
ATOM 1166 O O   . LYS A 1 153  ? 40.642  58.663 22.678  1.00 42.87  ? 150  LYS A O   1 
ATOM 1167 C CB  . LYS A 1 153  ? 42.578  60.902 21.813  1.00 78.99  ? 150  LYS A CB  1 
ATOM 1168 C CG  . LYS A 1 153  ? 42.795  62.399 21.784  1.00 78.99  ? 150  LYS A CG  1 
ATOM 1169 C CD  . LYS A 1 153  ? 42.504  62.979 20.418  1.00 78.99  ? 150  LYS A CD  1 
ATOM 1170 C CE  . LYS A 1 153  ? 42.598  64.510 20.439  1.00 78.99  ? 150  LYS A CE  1 
ATOM 1171 N NZ  . LYS A 1 153  ? 43.997  65.044 20.603  1.00 78.99  ? 150  LYS A NZ  1 
ATOM 1172 N N   . GLU A 1 154  ? 42.585  58.023 23.703  1.00 47.58  ? 151  GLU A N   1 
ATOM 1173 C CA  . GLU A 1 154  ? 42.309  56.595 23.810  1.00 47.58  ? 151  GLU A CA  1 
ATOM 1174 C C   . GLU A 1 154  ? 41.969  56.197 25.260  1.00 47.58  ? 151  GLU A C   1 
ATOM 1175 O O   . GLU A 1 154  ? 41.798  55.007 25.566  1.00 47.58  ? 151  GLU A O   1 
ATOM 1176 C CB  . GLU A 1 154  ? 43.506  55.783 23.303  1.00 77.11  ? 151  GLU A CB  1 
ATOM 1177 C CG  . GLU A 1 154  ? 43.981  56.126 21.874  1.00 77.11  ? 151  GLU A CG  1 
ATOM 1178 C CD  . GLU A 1 154  ? 45.022  55.134 21.312  1.00 77.11  ? 151  GLU A CD  1 
ATOM 1179 O OE1 . GLU A 1 154  ? 44.827  54.656 20.170  1.00 77.11  ? 151  GLU A OE1 1 
ATOM 1180 O OE2 . GLU A 1 154  ? 46.027  54.834 21.999  1.00 77.11  ? 151  GLU A OE2 1 
ATOM 1181 N N   . LEU A 1 155  ? 41.878  57.193 26.147  1.00 49.40  ? 152  LEU A N   1 
ATOM 1182 C CA  . LEU A 1 155  ? 41.529  57.000 27.584  1.00 49.40  ? 152  LEU A CA  1 
ATOM 1183 C C   . LEU A 1 155  ? 42.309  55.878 28.238  1.00 49.40  ? 152  LEU A C   1 
ATOM 1184 O O   . LEU A 1 155  ? 41.762  54.867 28.680  1.00 49.40  ? 152  LEU A O   1 
ATOM 1185 C CB  . LEU A 1 155  ? 40.009  56.854 27.799  1.00 39.21  ? 152  LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 155  ? 39.204  58.078 27.334  1.00 39.21  ? 152  LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 155  ? 37.819  57.755 26.732  1.00 39.21  ? 152  LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 155  ? 39.098  59.042 28.477  1.00 39.21  ? 152  LEU A CD2 1 
ATOM 1189 N N   . LYS A 1 156  ? 43.615  56.057 28.284  1.00 44.39  ? 153  LYS A N   1 
ATOM 1190 C CA  . LYS A 1 156  ? 44.482  55.100 28.939  1.00 44.39  ? 153  LYS A CA  1 
ATOM 1191 C C   . LYS A 1 156  ? 44.283  55.326 30.417  1.00 44.39  ? 153  LYS A C   1 
ATOM 1192 O O   . LYS A 1 156  ? 43.931  56.425 30.831  1.00 44.39  ? 153  LYS A O   1 
ATOM 1193 C CB  . LYS A 1 156  ? 45.923  55.314 28.495  1.00 69.46  ? 153  LYS A CB  1 
ATOM 1194 C CG  . LYS A 1 156  ? 46.107  55.302 26.963  1.00 69.46  ? 153  LYS A CG  1 
ATOM 1195 C CD  . LYS A 1 156  ? 45.940  53.892 26.378  1.00 69.46  ? 153  LYS A CD  1 
ATOM 1196 C CE  . LYS A 1 156  ? 46.048  53.878 24.849  1.00 69.46  ? 153  LYS A CE  1 
ATOM 1197 N NZ  . LYS A 1 156  ? 46.468  52.544 24.284  1.00 69.46  ? 153  LYS A NZ  1 
ATOM 1198 N N   . ALA A 1 157  ? 44.444  54.290 31.220  1.00 56.18  ? 154  ALA A N   1 
ATOM 1199 C CA  . ALA A 1 157  ? 44.100  54.414 32.632  1.00 56.18  ? 154  ALA A CA  1 
ATOM 1200 C C   . ALA A 1 157  ? 44.951  53.510 33.475  1.00 56.18  ? 154  ALA A C   1 
ATOM 1201 O O   . ALA A 1 157  ? 45.404  52.483 33.002  1.00 56.18  ? 154  ALA A O   1 
ATOM 1202 C CB  . ALA A 1 157  ? 42.619  54.076 32.845  1.00 34.23  ? 154  ALA A CB  1 
ATOM 1203 N N   . PHE A 1 158  ? 45.150  53.877 34.731  1.00 56.20  ? 155  PHE A N   1 
ATOM 1204 C CA  . PHE A 1 158  ? 45.837  52.987 35.656  1.00 56.20  ? 155  PHE A CA  1 
ATOM 1205 C C   . PHE A 1 158  ? 44.913  52.526 36.763  1.00 56.20  ? 155  PHE A C   1 
ATOM 1206 O O   . PHE A 1 158  ? 43.949  53.208 37.107  1.00 56.20  ? 155  PHE A O   1 
ATOM 1207 C CB  . PHE A 1 158  ? 47.113  53.628 36.235  1.00 56.38  ? 155  PHE A CB  1 
ATOM 1208 C CG  . PHE A 1 158  ? 46.875  54.899 37.011  1.00 56.38  ? 155  PHE A CG  1 
ATOM 1209 C CD1 . PHE A 1 158  ? 46.811  54.878 38.409  1.00 56.38  ? 155  PHE A CD1 1 
ATOM 1210 C CD2 . PHE A 1 158  ? 46.729  56.112 36.352  1.00 56.38  ? 155  PHE A CD2 1 
ATOM 1211 C CE1 . PHE A 1 158  ? 46.599  56.036 39.130  1.00 56.38  ? 155  PHE A CE1 1 
ATOM 1212 C CE2 . PHE A 1 158  ? 46.505  57.275 37.060  1.00 56.38  ? 155  PHE A CE2 1 
ATOM 1213 C CZ  . PHE A 1 158  ? 46.449  57.237 38.453  1.00 56.38  ? 155  PHE A CZ  1 
ATOM 1214 N N   . ASN A 1 159  ? 45.226  51.360 37.308  1.00 42.96  ? 156  ASN A N   1 
ATOM 1215 C CA  . ASN A 1 159  ? 44.560  50.818 38.459  1.00 42.96  ? 156  ASN A CA  1 
ATOM 1216 C C   . ASN A 1 159  ? 45.375  51.074 39.734  1.00 42.96  ? 156  ASN A C   1 
ATOM 1217 O O   . ASN A 1 159  ? 46.585  50.955 39.711  1.00 42.96  ? 156  ASN A O   1 
ATOM 1218 C CB  . ASN A 1 159  ? 44.399  49.316 38.262  1.00 65.57  ? 156  ASN A CB  1 
ATOM 1219 C CG  . ASN A 1 159  ? 43.153  48.969 37.529  1.00 65.57  ? 156  ASN A CG  1 
ATOM 1220 O OD1 . ASN A 1 159  ? 42.059  49.267 37.987  1.00 65.57  ? 156  ASN A OD1 1 
ATOM 1221 N ND2 . ASN A 1 159  ? 43.297  48.330 36.386  1.00 65.57  ? 156  ASN A ND2 1 
ATOM 1222 N N   . ILE A 1 160  ? 44.718  51.375 40.848  1.00 61.57  ? 157  ILE A N   1 
ATOM 1223 C CA  . ILE A 1 160  ? 45.368  51.446 42.148  1.00 61.57  ? 157  ILE A CA  1 
ATOM 1224 C C   . ILE A 1 160  ? 44.784  50.369 43.045  1.00 61.57  ? 157  ILE A C   1 
ATOM 1225 O O   . ILE A 1 160  ? 43.618  50.068 42.943  1.00 61.57  ? 157  ILE A O   1 
ATOM 1226 C CB  . ILE A 1 160  ? 45.113  52.797 42.782  1.00 31.58  ? 157  ILE A CB  1 
ATOM 1227 C CG1 . ILE A 1 160  ? 45.609  53.902 41.828  1.00 31.58  ? 157  ILE A CG1 1 
ATOM 1228 C CG2 . ILE A 1 160  ? 45.679  52.846 44.204  1.00 31.58  ? 157  ILE A CG2 1 
ATOM 1229 C CD1 . ILE A 1 160  ? 45.228  55.333 42.209  1.00 31.58  ? 157  ILE A CD1 1 
ATOM 1230 N N   . ARG A 1 161  ? 45.588  49.776 43.922  1.00 67.70  ? 158  ARG A N   1 
ATOM 1231 C CA  . ARG A 1 161  ? 45.064  48.745 44.806  1.00 67.70  ? 158  ARG A CA  1 
ATOM 1232 C C   . ARG A 1 161  ? 44.165  49.369 45.866  1.00 67.70  ? 158  ARG A C   1 
ATOM 1233 O O   . ARG A 1 161  ? 44.498  50.387 46.480  1.00 67.70  ? 158  ARG A O   1 
ATOM 1234 C CB  . ARG A 1 161  ? 46.174  47.900 45.435  1.00 103.08 ? 158  ARG A CB  1 
ATOM 1235 C CG  . ARG A 1 161  ? 45.686  46.526 45.891  1.00 103.08 ? 158  ARG A CG  1 
ATOM 1236 C CD  . ARG A 1 161  ? 46.382  46.076 47.164  1.00 103.08 ? 158  ARG A CD  1 
ATOM 1237 N NE  . ARG A 1 161  ? 47.633  45.368 46.893  1.00 103.08 ? 158  ARG A NE  1 
ATOM 1238 C CZ  . ARG A 1 161  ? 48.686  45.344 47.710  1.00 103.08 ? 158  ARG A CZ  1 
ATOM 1239 N NH1 . ARG A 1 161  ? 48.661  46.004 48.864  1.00 103.08 ? 158  ARG A NH1 1 
ATOM 1240 N NH2 . ARG A 1 161  ? 49.774  44.664 47.368  1.00 103.08 ? 158  ARG A NH2 1 
ATOM 1241 N N   . LEU A 1 162  ? 43.001  48.754 46.042  1.00 40.97  ? 159  LEU A N   1 
ATOM 1242 C CA  . LEU A 1 162  ? 42.014  49.231 46.998  1.00 40.97  ? 159  LEU A CA  1 
ATOM 1243 C C   . LEU A 1 162  ? 41.895  48.262 48.138  1.00 40.97  ? 159  LEU A C   1 
ATOM 1244 O O   . LEU A 1 162  ? 41.354  47.171 47.975  1.00 40.97  ? 159  LEU A O   1 
ATOM 1245 C CB  . LEU A 1 162  ? 40.646  49.450 46.344  1.00 45.49  ? 159  LEU A CB  1 
ATOM 1246 C CG  . LEU A 1 162  ? 39.791  50.580 46.948  1.00 45.49  ? 159  LEU A CG  1 
ATOM 1247 C CD1 . LEU A 1 162  ? 38.683  50.950 45.956  1.00 45.49  ? 159  LEU A CD1 1 
ATOM 1248 C CD2 . LEU A 1 162  ? 39.195  50.252 48.326  1.00 45.49  ? 159  LEU A CD2 1 
ATOM 1249 N N   . GLU A 1 163  ? 42.418  48.689 49.288  1.00 44.74  ? 160  GLU A N   1 
ATOM 1250 C CA  . GLU A 1 163  ? 42.469  47.884 50.494  1.00 44.74  ? 160  GLU A CA  1 
ATOM 1251 C C   . GLU A 1 163  ? 41.087  47.344 50.850  1.00 44.74  ? 160  GLU A C   1 
ATOM 1252 O O   . GLU A 1 163  ? 40.945  46.180 51.249  1.00 44.74  ? 160  GLU A O   1 
ATOM 1253 C CB  . GLU A 1 163  ? 43.040  48.725 51.639  1.00 131.72 ? 160  GLU A CB  1 
ATOM 1254 C CG  . GLU A 1 163  ? 43.490  47.930 52.851  1.00 131.72 ? 160  GLU A CG  1 
ATOM 1255 C CD  . GLU A 1 163  ? 44.419  46.781 52.504  1.00 131.72 ? 160  GLU A CD  1 
ATOM 1256 O OE1 . GLU A 1 163  ? 44.554  45.869 53.347  1.00 131.72 ? 160  GLU A OE1 1 
ATOM 1257 O OE2 . GLU A 1 163  ? 45.009  46.782 51.398  1.00 131.72 ? 160  GLU A OE2 1 
ATOM 1258 N N   . GLU A 1 164  ? 40.067  48.188 50.677  1.00 46.14  ? 161  GLU A N   1 
ATOM 1259 C CA  . GLU A 1 164  ? 38.702  47.793 51.019  1.00 46.14  ? 161  GLU A CA  1 
ATOM 1260 C C   . GLU A 1 164  ? 37.994  47.060 49.880  1.00 46.14  ? 161  GLU A C   1 
ATOM 1261 O O   . GLU A 1 164  ? 37.675  47.640 48.845  1.00 46.14  ? 161  GLU A O   1 
ATOM 1262 C CB  . GLU A 1 164  ? 37.920  48.964 51.560  1.00 62.03  ? 161  GLU A CB  1 
ATOM 1263 C CG  . GLU A 1 164  ? 38.482  49.440 52.884  1.00 62.03  ? 161  GLU A CG  1 
ATOM 1264 C CD  . GLU A 1 164  ? 39.853  50.094 52.756  1.00 62.03  ? 161  GLU A CD  1 
ATOM 1265 O OE1 . GLU A 1 164  ? 40.156  50.630 51.669  1.00 62.03  ? 161  GLU A OE1 1 
ATOM 1266 O OE2 . GLU A 1 164  ? 40.622  50.067 53.750  1.00 62.03  ? 161  GLU A OE2 1 
ATOM 1267 N N   . LEU A 1 165  ? 37.814  45.755 50.100  1.00 60.28  ? 162  LEU A N   1 
ATOM 1268 C CA  . LEU A 1 165  ? 37.259  44.810 49.131  1.00 60.28  ? 162  LEU A CA  1 
ATOM 1269 C C   . LEU A 1 165  ? 35.745  44.915 48.906  1.00 60.28  ? 162  LEU A C   1 
ATOM 1270 O O   . LEU A 1 165  ? 35.194  44.152 48.105  1.00 60.28  ? 162  LEU A O   1 
ATOM 1271 C CB  . LEU A 1 165  ? 37.543  43.366 49.583  1.00 30.01  ? 162  LEU A CB  1 
ATOM 1272 C CG  . LEU A 1 165  ? 38.823  42.542 49.342  1.00 30.01  ? 162  LEU A CG  1 
ATOM 1273 C CD1 . LEU A 1 165  ? 38.402  41.069 49.066  1.00 30.01  ? 162  LEU A CD1 1 
ATOM 1274 C CD2 . LEU A 1 165  ? 39.830  43.070 48.220  1.00 30.01  ? 162  LEU A CD2 1 
ATOM 1275 N N   . HIS A 1 166  ? 35.072  45.813 49.625  1.00 53.83  ? 163  HIS A N   1 
ATOM 1276 C CA  . HIS A 1 166  ? 33.607  45.889 49.572  1.00 53.83  ? 163  HIS A CA  1 
ATOM 1277 C C   . HIS A 1 166  ? 33.055  47.312 49.742  1.00 53.83  ? 163  HIS A C   1 
ATOM 1278 O O   . HIS A 1 166  ? 32.516  47.690 50.787  1.00 53.83  ? 163  HIS A O   1 
ATOM 1279 C CB  . HIS A 1 166  ? 32.968  44.923 50.577  1.00 61.83  ? 163  HIS A CB  1 
ATOM 1280 C CG  . HIS A 1 166  ? 31.507  44.701 50.345  1.00 61.83  ? 163  HIS A CG  1 
ATOM 1281 N ND1 . HIS A 1 166  ? 30.580  45.721 50.403  1.00 61.83  ? 163  HIS A ND1 1 
ATOM 1282 C CD2 . HIS A 1 166  ? 30.807  43.577 50.050  1.00 61.83  ? 163  HIS A CD2 1 
ATOM 1283 C CE1 . HIS A 1 166  ? 29.374  45.237 50.156  1.00 61.83  ? 163  HIS A CE1 1 
ATOM 1284 N NE2 . HIS A 1 166  ? 29.482  43.938 49.940  1.00 61.83  ? 163  HIS A NE2 1 
ATOM 1285 N N   . VAL A 1 167  ? 33.184  48.091 48.687  1.00 35.81  ? 164  VAL A N   1 
ATOM 1286 C CA  . VAL A 1 167  ? 32.781  49.490 48.708  1.00 35.81  ? 164  VAL A CA  1 
ATOM 1287 C C   . VAL A 1 167  ? 31.335  49.710 48.223  1.00 35.81  ? 164  VAL A C   1 
ATOM 1288 O O   . VAL A 1 167  ? 30.986  49.306 47.108  1.00 35.81  ? 164  VAL A O   1 
ATOM 1289 C CB  . VAL A 1 167  ? 33.742  50.320 47.838  1.00 24.35  ? 164  VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 167  ? 33.219  51.789 47.649  1.00 24.35  ? 164  VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 167  ? 35.139  50.246 48.457  1.00 24.35  ? 164  VAL A CG2 1 
ATOM 1292 N N   . ILE A 1 168  ? 30.537  50.369 49.066  1.00 36.39  ? 165  ILE A N   1 
ATOM 1293 C CA  . ILE A 1 168  ? 29.131  50.662 48.765  1.00 36.39  ? 165  ILE A CA  1 
ATOM 1294 C C   . ILE A 1 168  ? 28.882  51.797 47.750  1.00 36.39  ? 165  ILE A C   1 
ATOM 1295 O O   . ILE A 1 168  ? 28.147  51.619 46.778  1.00 36.39  ? 165  ILE A O   1 
ATOM 1296 C CB  . ILE A 1 168  ? 28.295  50.890 50.049  1.00 26.42  ? 165  ILE A CB  1 
ATOM 1297 C CG1 . ILE A 1 168  ? 27.948  49.547 50.671  1.00 26.42  ? 165  ILE A CG1 1 
ATOM 1298 C CG2 . ILE A 1 168  ? 26.970  51.488 49.706  1.00 26.42  ? 165  ILE A CG2 1 
ATOM 1299 C CD1 . ILE A 1 168  ? 29.028  48.928 51.426  1.00 26.42  ? 165  ILE A CD1 1 
ATOM 1300 N N   . ASP A 1 169  ? 29.479  52.958 47.995  1.00 26.26  ? 166  ASP A N   1 
ATOM 1301 C CA  . ASP A 1 169  ? 29.300  54.117 47.112  1.00 26.26  ? 166  ASP A CA  1 
ATOM 1302 C C   . ASP A 1 169  ? 30.549  54.993 47.303  1.00 26.26  ? 166  ASP A C   1 
ATOM 1303 O O   . ASP A 1 169  ? 31.242  54.852 48.315  1.00 26.26  ? 166  ASP A O   1 
ATOM 1304 C CB  . ASP A 1 169  ? 28.007  54.863 47.462  1.00 40.24  ? 166  ASP A CB  1 
ATOM 1305 C CG  . ASP A 1 169  ? 27.696  55.980 46.513  1.00 40.24  ? 166  ASP A CG  1 
ATOM 1306 O OD1 . ASP A 1 169  ? 28.218  55.987 45.383  1.00 40.24  ? 166  ASP A OD1 1 
ATOM 1307 O OD2 . ASP A 1 169  ? 26.919  56.878 46.892  1.00 40.24  ? 166  ASP A OD2 1 
ATOM 1308 N N   . VAL A 1 170  ? 30.855  55.838 46.317  1.00 45.74  ? 167  VAL A N   1 
ATOM 1309 C CA  . VAL A 1 170  ? 32.012  56.719 46.349  1.00 45.74  ? 167  VAL A CA  1 
ATOM 1310 C C   . VAL A 1 170  ? 31.668  57.980 45.610  1.00 45.74  ? 167  VAL A C   1 
ATOM 1311 O O   . VAL A 1 170  ? 30.944  57.942 44.610  1.00 45.74  ? 167  VAL A O   1 
ATOM 1312 C CB  . VAL A 1 170  ? 33.268  56.176 45.556  1.00 35.30  ? 167  VAL A CB  1 
ATOM 1313 C CG1 . VAL A 1 170  ? 34.588  56.636 46.235  1.00 35.30  ? 167  VAL A CG1 1 
ATOM 1314 C CG2 . VAL A 1 170  ? 33.253  54.679 45.370  1.00 35.30  ? 167  VAL A CG2 1 
ATOM 1315 N N   . LYS A 1 171  ? 32.235  59.087 46.073  1.00 37.60  ? 168  LYS A N   1 
ATOM 1316 C CA  . LYS A 1 171  ? 32.217  60.339 45.337  1.00 37.60  ? 168  LYS A CA  1 
ATOM 1317 C C   . LYS A 1 171  ? 33.559  60.987 45.545  1.00 37.60  ? 168  LYS A C   1 
ATOM 1318 O O   . LYS A 1 171  ? 34.265  60.650 46.499  1.00 37.60  ? 168  LYS A O   1 
ATOM 1319 C CB  . LYS A 1 171  ? 31.181  61.293 45.928  1.00 25.27  ? 168  LYS A CB  1 
ATOM 1320 C CG  . LYS A 1 171  ? 29.735  60.895 45.783  1.00 25.27  ? 168  LYS A CG  1 
ATOM 1321 C CD  . LYS A 1 171  ? 29.210  61.270 44.416  1.00 25.27  ? 168  LYS A CD  1 
ATOM 1322 C CE  . LYS A 1 171  ? 28.126  60.339 43.988  1.00 25.27  ? 168  LYS A CE  1 
ATOM 1323 N NZ  . LYS A 1 171  ? 27.529  59.610 45.121  1.00 25.27  ? 168  LYS A NZ  1 
ATOM 1324 N N   . PHE A 1 172  ? 33.898  61.910 44.646  1.00 38.15  ? 169  PHE A N   1 
ATOM 1325 C CA  . PHE A 1 172  ? 34.955  62.897 44.860  1.00 38.15  ? 169  PHE A CA  1 
ATOM 1326 C C   . PHE A 1 172  ? 34.450  64.072 45.675  1.00 38.15  ? 169  PHE A C   1 
ATOM 1327 O O   . PHE A 1 172  ? 33.426  64.673 45.337  1.00 38.15  ? 169  PHE A O   1 
ATOM 1328 C CB  . PHE A 1 172  ? 35.432  63.455 43.536  1.00 50.48  ? 169  PHE A CB  1 
ATOM 1329 C CG  . PHE A 1 172  ? 36.458  62.620 42.866  1.00 50.48  ? 169  PHE A CG  1 
ATOM 1330 C CD1 . PHE A 1 172  ? 36.204  62.048 41.631  1.00 50.48  ? 169  PHE A CD1 1 
ATOM 1331 C CD2 . PHE A 1 172  ? 37.693  62.417 43.446  1.00 50.48  ? 169  PHE A CD2 1 
ATOM 1332 C CE1 . PHE A 1 172  ? 37.157  61.290 40.989  1.00 50.48  ? 169  PHE A CE1 1 
ATOM 1333 C CE2 . PHE A 1 172  ? 38.643  61.663 42.799  1.00 50.48  ? 169  PHE A CE2 1 
ATOM 1334 C CZ  . PHE A 1 172  ? 38.363  61.096 41.575  1.00 50.48  ? 169  PHE A CZ  1 
ATOM 1335 N N   . LEU A 1 173  ? 35.216  64.404 46.720  1.00 41.72  ? 170  LEU A N   1 
ATOM 1336 C CA  . LEU A 1 173  ? 34.969  65.534 47.618  1.00 41.72  ? 170  LEU A CA  1 
ATOM 1337 C C   . LEU A 1 173  ? 35.222  66.866 46.956  1.00 41.72  ? 170  LEU A C   1 
ATOM 1338 O O   . LEU A 1 173  ? 35.959  66.954 45.971  1.00 41.72  ? 170  LEU A O   1 
ATOM 1339 C CB  . LEU A 1 173  ? 35.853  65.430 48.838  1.00 43.21  ? 170  LEU A CB  1 
ATOM 1340 C CG  . LEU A 1 173  ? 35.338  64.490 49.906  1.00 43.21  ? 170  LEU A CG  1 
ATOM 1341 C CD1 . LEU A 1 173  ? 36.452  64.098 50.815  1.00 43.21  ? 170  LEU A CD1 1 
ATOM 1342 C CD2 . LEU A 1 173  ? 34.247  65.161 50.697  1.00 43.21  ? 170  LEU A CD2 1 
ATOM 1343 N N   . TYR A 1 174  ? 34.590  67.901 47.496  1.00 58.73  ? 171  TYR A N   1 
ATOM 1344 C CA  . TYR A 1 174  ? 34.776  69.251 46.997  1.00 58.73  ? 171  TYR A CA  1 
ATOM 1345 C C   . TYR A 1 174  ? 35.707  69.998 47.906  1.00 58.73  ? 171  TYR A C   1 
ATOM 1346 O O   . TYR A 1 174  ? 35.877  69.636 49.089  1.00 58.73  ? 171  TYR A O   1 
ATOM 1347 C CB  . TYR A 1 174  ? 33.470  70.011 46.983  1.00 44.20  ? 171  TYR A CB  1 
ATOM 1348 C CG  . TYR A 1 174  ? 32.603  69.757 45.804  1.00 44.20  ? 171  TYR A CG  1 
ATOM 1349 C CD1 . TYR A 1 174  ? 31.545  68.845 45.878  1.00 44.20  ? 171  TYR A CD1 1 
ATOM 1350 C CD2 . TYR A 1 174  ? 32.814  70.442 44.617  1.00 44.20  ? 171  TYR A CD2 1 
ATOM 1351 C CE1 . TYR A 1 174  ? 30.724  68.607 44.777  1.00 44.20  ? 171  TYR A CE1 1 
ATOM 1352 C CE2 . TYR A 1 174  ? 32.000  70.225 43.507  1.00 44.20  ? 171  TYR A CE2 1 
ATOM 1353 C CZ  . TYR A 1 174  ? 30.950  69.311 43.593  1.00 44.20  ? 171  TYR A CZ  1 
ATOM 1354 O OH  . TYR A 1 174  ? 30.144  69.104 42.496  1.00 44.20  ? 171  TYR A OH  1 
ATOM 1355 N N   . GLY A 1 175  ? 36.278  71.059 47.337  1.00 76.56  ? 172  GLY A N   1 
ATOM 1356 C CA  . GLY A 1 175  ? 37.209  71.936 48.028  1.00 76.56  ? 172  GLY A CA  1 
ATOM 1357 C C   . GLY A 1 175  ? 38.354  71.126 48.569  1.00 76.56  ? 172  GLY A C   1 
ATOM 1358 O O   . GLY A 1 175  ? 38.746  71.287 49.707  1.00 76.56  ? 172  GLY A O   1 
ATOM 1359 N N   . CYS A 1 176  ? 38.854  70.211 47.755  1.00 117.38 ? 173  CYS A N   1 
ATOM 1360 C CA  . CYS A 1 176  ? 39.991  69.411 48.141  1.00 117.38 ? 173  CYS A CA  1 
ATOM 1361 C C   . CYS A 1 176  ? 41.136  69.765 47.225  1.00 117.38 ? 173  CYS A C   1 
ATOM 1362 O O   . CYS A 1 176  ? 40.983  69.777 46.002  1.00 117.38 ? 173  CYS A O   1 
ATOM 1363 C CB  . CYS A 1 176  ? 39.660  67.920 48.070  1.00 61.25  ? 173  CYS A CB  1 
ATOM 1364 S SG  . CYS A 1 176  ? 38.956  67.258 49.594  1.00 61.25  ? 173  CYS A SG  1 
ATOM 1365 N N   . GLN A 1 177  ? 42.273  70.082 47.833  1.00 69.60  ? 174  GLN A N   1 
ATOM 1366 C CA  . GLN A 1 177  ? 43.473  70.448 47.095  1.00 69.60  ? 174  GLN A CA  1 
ATOM 1367 C C   . GLN A 1 177  ? 43.809  69.312 46.151  1.00 69.60  ? 174  GLN A C   1 
ATOM 1368 O O   . GLN A 1 177  ? 43.688  69.426 44.918  1.00 69.60  ? 174  GLN A O   1 
ATOM 1369 C CB  . GLN A 1 177  ? 44.630  70.711 48.064  1.00 125.86 ? 174  GLN A CB  1 
ATOM 1370 C CG  . GLN A 1 177  ? 44.277  71.635 49.243  1.00 125.86 ? 174  GLN A CG  1 
ATOM 1371 C CD  . GLN A 1 177  ? 43.906  73.070 48.827  1.00 125.86 ? 174  GLN A CD  1 
ATOM 1372 O OE1 . GLN A 1 177  ? 43.708  73.374 47.644  1.00 125.86 ? 174  GLN A OE1 1 
ATOM 1373 N NE2 . GLN A 1 177  ? 43.807  73.952 49.814  1.00 125.86 ? 174  GLN A NE2 1 
ATOM 1374 N N   . ALA A 1 178  ? 44.193  68.195 46.750  1.00 69.01  ? 175  ALA A N   1 
ATOM 1375 C CA  . ALA A 1 178  ? 44.391  66.970 46.006  1.00 69.01  ? 175  ALA A CA  1 
ATOM 1376 C C   . ALA A 1 178  ? 43.042  66.290 45.726  1.00 69.01  ? 175  ALA A C   1 
ATOM 1377 O O   . ALA A 1 178  ? 42.162  66.254 46.601  1.00 69.01  ? 175  ALA A O   1 
ATOM 1378 C CB  . ALA A 1 178  ? 45.321  66.046 46.774  1.00 52.20  ? 175  ALA A CB  1 
ATOM 1379 N N   . PRO A 1 179  ? 42.869  65.770 44.491  1.00 50.89  ? 176  PRO A N   1 
ATOM 1380 C CA  . PRO A 1 179  ? 41.767  64.889 44.171  1.00 50.89  ? 176  PRO A CA  1 
ATOM 1381 C C   . PRO A 1 179  ? 41.552  63.949 45.333  1.00 50.89  ? 176  PRO A C   1 
ATOM 1382 O O   . PRO A 1 179  ? 42.464  63.218 45.705  1.00 50.89  ? 176  PRO A O   1 
ATOM 1383 C CB  . PRO A 1 179  ? 42.294  64.129 42.968  1.00 66.03  ? 176  PRO A CB  1 
ATOM 1384 C CG  . PRO A 1 179  ? 43.098  65.136 42.244  1.00 66.03  ? 176  PRO A CG  1 
ATOM 1385 C CD  . PRO A 1 179  ? 43.716  66.008 43.305  1.00 66.03  ? 176  PRO A CD  1 
ATOM 1386 N N   . THR A 1 180  ? 40.370  64.009 45.928  1.00 53.45  ? 177  THR A N   1 
ATOM 1387 C CA  . THR A 1 180  ? 40.077  63.209 47.090  1.00 53.45  ? 177  THR A CA  1 
ATOM 1388 C C   . THR A 1 180  ? 38.755  62.516 46.899  1.00 53.45  ? 177  THR A C   1 
ATOM 1389 O O   . THR A 1 180  ? 37.821  63.113 46.373  1.00 53.45  ? 177  THR A O   1 
ATOM 1390 C CB  . THR A 1 180  ? 40.048  64.085 48.323  1.00 42.74  ? 177  THR A CB  1 
ATOM 1391 O OG1 . THR A 1 180  ? 41.370  64.582 48.522  1.00 42.74  ? 177  THR A OG1 1 
ATOM 1392 C CG2 . THR A 1 180  ? 39.596  63.301 49.565  1.00 42.74  ? 177  THR A CG2 1 
ATOM 1393 N N   . ILE A 1 181  ? 38.701  61.249 47.299  1.00 59.82  ? 178  ILE A N   1 
ATOM 1394 C CA  . ILE A 1 181  ? 37.489  60.452 47.205  1.00 59.82  ? 178  ILE A CA  1 
ATOM 1395 C C   . ILE A 1 181  ? 36.987  60.143 48.593  1.00 59.82  ? 178  ILE A C   1 
ATOM 1396 O O   . ILE A 1 181  ? 37.779  60.024 49.541  1.00 59.82  ? 178  ILE A O   1 
ATOM 1397 C CB  . ILE A 1 181  ? 37.687  59.105 46.452  1.00 60.79  ? 178  ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 181  ? 38.846  58.287 47.046  1.00 60.79  ? 178  ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 181  ? 37.874  59.323 44.969  1.00 60.79  ? 178  ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 181  ? 38.714  56.803 46.835  1.00 60.79  ? 178  ILE A CD1 1 
ATOM 1401 N N   . CYS A 1 182  ? 35.671  59.998 48.697  1.00 60.21  ? 179  CYS A N   1 
ATOM 1402 C CA  . CYS A 1 182  ? 35.031  59.692 49.946  1.00 60.21  ? 179  CYS A CA  1 
ATOM 1403 C C   . CYS A 1 182  ? 34.137  58.504 49.708  1.00 60.21  ? 179  CYS A C   1 
ATOM 1404 O O   . CYS A 1 182  ? 33.342  58.522 48.759  1.00 60.21  ? 179  CYS A O   1 
ATOM 1405 C CB  . CYS A 1 182  ? 34.207  60.878 50.411  1.00 43.76  ? 179  CYS A CB  1 
ATOM 1406 S SG  . CYS A 1 182  ? 33.417  60.531 51.985  1.00 43.76  ? 179  CYS A SG  1 
ATOM 1407 N N   . PHE A 1 183  ? 34.248  57.478 50.555  1.00 44.56  ? 180  PHE A N   1 
ATOM 1408 C CA  . PHE A 1 183  ? 33.498  56.258 50.298  1.00 44.56  ? 180  PHE A CA  1 
ATOM 1409 C C   . PHE A 1 183  ? 32.922  55.504 51.519  1.00 44.56  ? 180  PHE A C   1 
ATOM 1410 O O   . PHE A 1 183  ? 33.415  55.607 52.638  1.00 44.56  ? 180  PHE A O   1 
ATOM 1411 C CB  . PHE A 1 183  ? 34.274  55.342 49.335  1.00 43.35  ? 180  PHE A CB  1 
ATOM 1412 C CG  . PHE A 1 183  ? 35.480  54.661 49.944  1.00 43.35  ? 180  PHE A CG  1 
ATOM 1413 C CD1 . PHE A 1 183  ? 35.434  53.314 50.277  1.00 43.35  ? 180  PHE A CD1 1 
ATOM 1414 C CD2 . PHE A 1 183  ? 36.677  55.361 50.161  1.00 43.35  ? 180  PHE A CD2 1 
ATOM 1415 C CE1 . PHE A 1 183  ? 36.549  52.687 50.842  1.00 43.35  ? 180  PHE A CE1 1 
ATOM 1416 C CE2 . PHE A 1 183  ? 37.800  54.749 50.714  1.00 43.35  ? 180  PHE A CE2 1 
ATOM 1417 C CZ  . PHE A 1 183  ? 37.742  53.415 51.055  1.00 43.35  ? 180  PHE A CZ  1 
ATOM 1418 N N   . VAL A 1 184  ? 31.848  54.768 51.307  1.00 51.92  ? 181  VAL A N   1 
ATOM 1419 C CA  . VAL A 1 184  ? 31.276  53.956 52.363  1.00 51.92  ? 181  VAL A CA  1 
ATOM 1420 C C   . VAL A 1 184  ? 31.636  52.519 52.020  1.00 51.92  ? 181  VAL A C   1 
ATOM 1421 O O   . VAL A 1 184  ? 31.415  52.080 50.886  1.00 51.92  ? 181  VAL A O   1 
ATOM 1422 C CB  . VAL A 1 184  ? 29.707  54.180 52.494  1.00 14.15  ? 181  VAL A CB  1 
ATOM 1423 C CG1 . VAL A 1 184  ? 29.039  53.137 53.501  1.00 14.15  ? 181  VAL A CG1 1 
ATOM 1424 C CG2 . VAL A 1 184  ? 29.419  55.617 52.901  1.00 14.15  ? 181  VAL A CG2 1 
ATOM 1425 N N   . TYR A 1 185  ? 32.213  51.789 52.963  1.00 46.14  ? 182  TYR A N   1 
ATOM 1426 C CA  . TYR A 1 185  ? 32.620  50.417 52.654  1.00 46.14  ? 182  TYR A CA  1 
ATOM 1427 C C   . TYR A 1 185  ? 32.236  49.506 53.757  1.00 46.14  ? 182  TYR A C   1 
ATOM 1428 O O   . TYR A 1 185  ? 31.968  49.968 54.857  1.00 46.14  ? 182  TYR A O   1 
ATOM 1429 C CB  . TYR A 1 185  ? 34.123  50.308 52.395  1.00 58.36  ? 182  TYR A CB  1 
ATOM 1430 C CG  . TYR A 1 185  ? 34.973  50.523 53.613  1.00 58.36  ? 182  TYR A CG  1 
ATOM 1431 C CD1 . TYR A 1 185  ? 35.372  49.441 54.404  1.00 58.36  ? 182  TYR A CD1 1 
ATOM 1432 C CD2 . TYR A 1 185  ? 35.391  51.802 53.966  1.00 58.36  ? 182  TYR A CD2 1 
ATOM 1433 C CE1 . TYR A 1 185  ? 36.159  49.617 55.528  1.00 58.36  ? 182  TYR A CE1 1 
ATOM 1434 C CE2 . TYR A 1 185  ? 36.179  52.005 55.090  1.00 58.36  ? 182  TYR A CE2 1 
ATOM 1435 C CZ  . TYR A 1 185  ? 36.566  50.901 55.873  1.00 58.36  ? 182  TYR A CZ  1 
ATOM 1436 O OH  . TYR A 1 185  ? 37.356  51.104 56.995  1.00 58.36  ? 182  TYR A OH  1 
ATOM 1437 N N   . GLN A 1 186  ? 32.225  48.210 53.477  1.00 56.26  ? 183  GLN A N   1 
ATOM 1438 C CA  . GLN A 1 186  ? 31.750  47.237 54.448  1.00 56.26  ? 183  GLN A CA  1 
ATOM 1439 C C   . GLN A 1 186  ? 32.781  46.164 54.782  1.00 56.26  ? 183  GLN A C   1 
ATOM 1440 O O   . GLN A 1 186  ? 33.397  45.582 53.897  1.00 56.26  ? 183  GLN A O   1 
ATOM 1441 C CB  . GLN A 1 186  ? 30.488  46.589 53.926  1.00 57.75  ? 183  GLN A CB  1 
ATOM 1442 C CG  . GLN A 1 186  ? 29.656  45.969 54.996  1.00 57.75  ? 183  GLN A CG  1 
ATOM 1443 C CD  . GLN A 1 186  ? 28.708  44.928 54.437  1.00 57.75  ? 183  GLN A CD  1 
ATOM 1444 O OE1 . GLN A 1 186  ? 27.510  45.177 54.250  1.00 57.75  ? 183  GLN A OE1 1 
ATOM 1445 N NE2 . GLN A 1 186  ? 29.250  43.750 54.149  1.00 57.75  ? 183  GLN A NE2 1 
ATOM 1446 N N   . ASP A 1 187  ? 32.960  45.909 56.074  1.00 66.76  ? 184  ASP A N   1 
ATOM 1447 C CA  . ASP A 1 187  ? 33.914  44.906 56.532  1.00 66.76  ? 184  ASP A CA  1 
ATOM 1448 C C   . ASP A 1 187  ? 33.260  43.929 57.504  1.00 66.76  ? 184  ASP A C   1 
ATOM 1449 O O   . ASP A 1 187  ? 32.043  43.749 57.494  1.00 66.76  ? 184  ASP A O   1 
ATOM 1450 C CB  . ASP A 1 187  ? 35.121  45.575 57.191  1.00 53.20  ? 184  ASP A CB  1 
ATOM 1451 C CG  . ASP A 1 187  ? 34.736  46.784 58.022  1.00 53.20  ? 184  ASP A CG  1 
ATOM 1452 O OD1 . ASP A 1 187  ? 33.857  46.649 58.899  1.00 53.20  ? 184  ASP A OD1 1 
ATOM 1453 O OD2 . ASP A 1 187  ? 35.312  47.869 57.797  1.00 53.20  ? 184  ASP A OD2 1 
ATOM 1454 N N   . PRO A 1 188  ? 33.961  43.345 58.436  1.00 91.29  ? 185  PRO A N   1 
ATOM 1455 C CA  . PRO A 1 188  ? 33.179  42.692 59.463  1.00 91.29  ? 185  PRO A CA  1 
ATOM 1456 C C   . PRO A 1 188  ? 33.096  43.642 60.620  1.00 91.29  ? 185  PRO A C   1 
ATOM 1457 O O   . PRO A 1 188  ? 34.079  44.264 60.931  1.00 91.29  ? 185  PRO A O   1 
ATOM 1458 C CB  . PRO A 1 188  ? 33.998  41.470 59.758  1.00 47.10  ? 185  PRO A CB  1 
ATOM 1459 C CG  . PRO A 1 188  ? 34.483  41.094 58.475  1.00 47.10  ? 185  PRO A CG  1 
ATOM 1460 C CD  . PRO A 1 188  ? 34.725  42.346 57.690  1.00 47.10  ? 185  PRO A CD  1 
ATOM 1461 N N   . GLN A 1 189  ? 31.934  43.805 61.219  1.00 110.56 ? 186  GLN A N   1 
ATOM 1462 C CA  . GLN A 1 189  ? 31.840  44.743 62.310  1.00 110.56 ? 186  GLN A CA  1 
ATOM 1463 C C   . GLN A 1 189  ? 31.453  46.097 61.820  1.00 110.56 ? 186  GLN A C   1 
ATOM 1464 O O   . GLN A 1 189  ? 31.941  47.084 62.300  1.00 110.56 ? 186  GLN A O   1 
ATOM 1465 C CB  . GLN A 1 189  ? 33.190  44.881 62.958  1.00 84.69  ? 186  GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 189  ? 33.984  46.004 62.419  1.00 84.69  ? 186  GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 189  ? 35.443  45.689 62.438  1.00 84.69  ? 186  GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 189  ? 35.842  44.537 62.373  1.00 84.69  ? 186  GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 189  ? 36.256  46.715 62.549  1.00 84.69  ? 186  GLN A NE2 1 
ATOM 1470 N N   . GLY A 1 190  ? 30.564  46.111 60.855  1.00 89.71  ? 187  GLY A N   1 
ATOM 1471 C CA  . GLY A 1 190  ? 30.033  47.306 60.226  1.00 89.71  ? 187  GLY A CA  1 
ATOM 1472 C C   . GLY A 1 190  ? 30.484  48.084 59.006  1.00 89.71  ? 187  GLY A C   1 
ATOM 1473 O O   . GLY A 1 190  ? 31.345  47.631 58.252  1.00 89.71  ? 187  GLY A O   1 
ATOM 1474 N N   . ARG A 1 191  ? 29.900  49.262 58.812  1.00 47.85  ? 188  ARG A N   1 
ATOM 1475 C CA  . ARG A 1 191  ? 30.245  50.111 57.676  1.00 47.85  ? 188  ARG A CA  1 
ATOM 1476 C C   . ARG A 1 191  ? 30.977  51.354 58.138  1.00 47.85  ? 188  ARG A C   1 
ATOM 1477 O O   . ARG A 1 191  ? 30.854  51.781 59.298  1.00 47.85  ? 188  ARG A O   1 
ATOM 1478 C CB  . ARG A 1 191  ? 28.998  50.509 56.898  1.00 54.90  ? 188  ARG A CB  1 
ATOM 1479 C CG  . ARG A 1 191  ? 28.525  49.507 55.872  1.00 54.90  ? 188  ARG A CG  1 
ATOM 1480 C CD  . ARG A 1 191  ? 27.071  49.852 55.566  1.00 54.90  ? 188  ARG A CD  1 
ATOM 1481 N NE  . ARG A 1 191  ? 26.666  49.613 54.188  1.00 54.90  ? 188  ARG A NE  1 
ATOM 1482 C CZ  . ARG A 1 191  ? 26.205  48.460 53.728  1.00 54.90  ? 188  ARG A CZ  1 
ATOM 1483 N NH1 . ARG A 1 191  ? 26.096  47.404 54.518  1.00 54.90  ? 188  ARG A NH1 1 
ATOM 1484 N NH2 . ARG A 1 191  ? 25.865  48.360 52.462  1.00 54.90  ? 188  ARG A NH2 1 
ATOM 1485 N N   . HIS A 1 192  ? 31.734  51.930 57.215  1.00 59.90  ? 189  HIS A N   1 
ATOM 1486 C CA  . HIS A 1 192  ? 32.674  52.950 57.573  1.00 59.90  ? 189  HIS A CA  1 
ATOM 1487 C C   . HIS A 1 192  ? 32.809  53.905 56.415  1.00 59.90  ? 189  HIS A C   1 
ATOM 1488 O O   . HIS A 1 192  ? 32.610  53.510 55.263  1.00 59.90  ? 189  HIS A O   1 
ATOM 1489 C CB  . HIS A 1 192  ? 34.035  52.311 57.915  1.00 62.43  ? 189  HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 192  ? 33.938  51.122 58.827  1.00 62.43  ? 189  HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 192  ? 33.620  49.859 58.373  1.00 62.43  ? 189  HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 192  ? 34.092  51.013 60.167  1.00 62.43  ? 189  HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 192  ? 33.586  49.026 59.396  1.00 62.43  ? 189  HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 192  ? 33.869  49.700 60.496  1.00 62.43  ? 189  HIS A NE2 1 
ATOM 1495 N N   . VAL A 1 193  ? 33.130  55.160 56.744  1.00 51.40  ? 190  VAL A N   1 
ATOM 1496 C CA  . VAL A 1 193  ? 33.388  56.219 55.775  1.00 51.40  ? 190  VAL A CA  1 
ATOM 1497 C C   . VAL A 1 193  ? 34.898  56.501 55.863  1.00 51.40  ? 190  VAL A C   1 
ATOM 1498 O O   . VAL A 1 193  ? 35.450  56.579 56.957  1.00 51.40  ? 190  VAL A O   1 
ATOM 1499 C CB  . VAL A 1 193  ? 32.468  57.492 56.043  1.00 41.92  ? 190  VAL A CB  1 
ATOM 1500 C CG1 . VAL A 1 193  ? 32.502  57.936 57.488  1.00 41.92  ? 190  VAL A CG1 1 
ATOM 1501 C CG2 . VAL A 1 193  ? 32.804  58.684 55.129  1.00 41.92  ? 190  VAL A CG2 1 
ATOM 1502 N N   . LYS A 1 194  ? 35.566  56.613 54.720  1.00 41.75  ? 191  LYS A N   1 
ATOM 1503 C CA  . LYS A 1 194  ? 37.020  56.650 54.677  1.00 41.75  ? 191  LYS A CA  1 
ATOM 1504 C C   . LYS A 1 194  ? 37.466  57.454 53.456  1.00 41.75  ? 191  LYS A C   1 
ATOM 1505 O O   . LYS A 1 194  ? 36.707  57.538 52.475  1.00 41.75  ? 191  LYS A O   1 
ATOM 1506 C CB  . LYS A 1 194  ? 37.552  55.223 54.605  1.00 58.92  ? 191  LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 194  ? 39.045  55.145 54.420  1.00 58.92  ? 191  LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 194  ? 39.634  53.838 54.937  1.00 58.92  ? 191  LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 194  ? 41.152  53.837 54.730  1.00 58.92  ? 191  LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 194  ? 41.653  52.512 54.272  1.00 58.92  ? 191  LYS A NZ  1 
ATOM 1511 N N   . THR A 1 195  ? 38.670  58.044 53.495  1.00 40.86  ? 192  THR A N   1 
ATOM 1512 C CA  . THR A 1 195  ? 39.113  58.926 52.399  1.00 40.86  ? 192  THR A CA  1 
ATOM 1513 C C   . THR A 1 195  ? 40.529  58.663 51.919  1.00 40.86  ? 192  THR A C   1 
ATOM 1514 O O   . THR A 1 195  ? 41.372  58.222 52.683  1.00 40.86  ? 192  THR A O   1 
ATOM 1515 C CB  . THR A 1 195  ? 39.044  60.408 52.812  1.00 35.81  ? 192  THR A CB  1 
ATOM 1516 O OG1 . THR A 1 195  ? 39.622  60.565 54.120  1.00 35.81  ? 192  THR A OG1 1 
ATOM 1517 C CG2 . THR A 1 195  ? 37.583  60.883 52.824  1.00 35.81  ? 192  THR A CG2 1 
ATOM 1518 N N   . TYR A 1 196  ? 40.786  58.943 50.650  1.00 44.18  ? 193  TYR A N   1 
ATOM 1519 C CA  . TYR A 1 196  ? 42.141  58.977 50.121  1.00 44.18  ? 193  TYR A CA  1 
ATOM 1520 C C   . TYR A 1 196  ? 42.243  60.126 49.132  1.00 44.18  ? 193  TYR A C   1 
ATOM 1521 O O   . TYR A 1 196  ? 41.325  60.337 48.313  1.00 44.18  ? 193  TYR A O   1 
ATOM 1522 C CB  . TYR A 1 196  ? 42.519  57.704 49.348  1.00 47.87  ? 193  TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 196  ? 42.322  56.347 50.022  1.00 47.87  ? 193  TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 196  ? 41.472  55.378 49.444  1.00 47.87  ? 193  TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 196  ? 43.024  55.998 51.176  1.00 47.87  ? 193  TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 196  ? 41.301  54.102 50.025  1.00 47.87  ? 193  TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 196  ? 42.842  54.729 51.782  1.00 47.87  ? 193  TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 196  ? 41.986  53.791 51.198  1.00 47.87  ? 193  TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 196  ? 41.813  52.556 51.782  1.00 47.87  ? 193  TYR A OH  1 
ATOM 1530 N N   . GLU A 1 197  ? 43.358  60.863 49.199  1.00 45.42  ? 194  GLU A N   1 
ATOM 1531 C CA  . GLU A 1 197  ? 43.775  61.749 48.108  1.00 45.42  ? 194  GLU A CA  1 
ATOM 1532 C C   . GLU A 1 197  ? 44.133  60.841 46.937  1.00 45.42  ? 194  GLU A C   1 
ATOM 1533 O O   . GLU A 1 197  ? 44.441  59.647 47.143  1.00 45.42  ? 194  GLU A O   1 
ATOM 1534 C CB  . GLU A 1 197  ? 45.012  62.535 48.498  1.00 86.70  ? 194  GLU A CB  1 
ATOM 1535 C CG  . GLU A 1 197  ? 44.780  63.593 49.541  1.00 86.70  ? 194  GLU A CG  1 
ATOM 1536 C CD  . GLU A 1 197  ? 46.069  64.251 49.971  1.00 86.70  ? 194  GLU A CD  1 
ATOM 1537 O OE1 . GLU A 1 197  ? 46.991  64.376 49.132  1.00 86.70  ? 194  GLU A OE1 1 
ATOM 1538 O OE2 . GLU A 1 197  ? 46.157  64.637 51.155  1.00 86.70  ? 194  GLU A OE2 1 
ATOM 1539 N N   . VAL A 1 198  ? 44.081  61.371 45.721  1.00 85.12  ? 195  VAL A N   1 
ATOM 1540 C CA  . VAL A 1 198  ? 44.540  60.609 44.575  1.00 85.12  ? 195  VAL A CA  1 
ATOM 1541 C C   . VAL A 1 198  ? 45.637  61.387 43.858  1.00 85.12  ? 195  VAL A C   1 
ATOM 1542 O O   . VAL A 1 198  ? 45.384  62.437 43.241  1.00 85.12  ? 195  VAL A O   1 
ATOM 1543 C CB  . VAL A 1 198  ? 43.376  60.175 43.637  1.00 54.25  ? 195  VAL A CB  1 
ATOM 1544 C CG1 . VAL A 1 198  ? 43.882  59.412 42.416  1.00 54.25  ? 195  VAL A CG1 1 
ATOM 1545 C CG2 . VAL A 1 198  ? 42.410  59.285 44.393  1.00 54.25  ? 195  VAL A CG2 1 
ATOM 1546 N N   . SER A 1 199  ? 46.865  60.877 43.995  1.00 75.67  ? 196  SER A N   1 
ATOM 1547 C CA  . SER A 1 199  ? 48.013  61.410 43.288  1.00 75.67  ? 196  SER A CA  1 
ATOM 1548 C C   . SER A 1 199  ? 48.260  60.500 42.117  1.00 75.67  ? 196  SER A C   1 
ATOM 1549 O O   . SER A 1 199  ? 48.590  59.327 42.291  1.00 75.67  ? 196  SER A O   1 
ATOM 1550 C CB  . SER A 1 199  ? 49.245  61.463 44.183  1.00 119.06 ? 196  SER A CB  1 
ATOM 1551 O OG  . SER A 1 199  ? 50.330  62.026 43.469  1.00 119.06 ? 196  SER A OG  1 
ATOM 1552 N N   . LEU A 1 200  ? 48.073  61.053 40.927  1.00 102.01 ? 197  LEU A N   1 
ATOM 1553 C CA  . LEU A 1 200  ? 48.208  60.315 39.673  1.00 102.01 ? 197  LEU A CA  1 
ATOM 1554 C C   . LEU A 1 200  ? 49.636  60.327 39.162  1.00 102.01 ? 197  LEU A C   1 
ATOM 1555 O O   . LEU A 1 200  ? 50.001  59.554 38.269  1.00 102.01 ? 197  LEU A O   1 
ATOM 1556 C CB  . LEU A 1 200  ? 47.276  60.899 38.610  1.00 52.22  ? 197  LEU A CB  1 
ATOM 1557 C CG  . LEU A 1 200  ? 47.289  62.384 38.272  1.00 52.22  ? 197  LEU A CG  1 
ATOM 1558 C CD1 . LEU A 1 200  ? 46.184  62.670 37.235  1.00 52.22  ? 197  LEU A CD1 1 
ATOM 1559 C CD2 . LEU A 1 200  ? 47.109  63.219 39.549  1.00 52.22  ? 197  LEU A CD2 1 
ATOM 1560 N N   . ARG A 1 201  ? 50.451  61.209 39.730  1.00 145.47 ? 198  ARG A N   1 
ATOM 1561 C CA  . ARG A 1 201  ? 51.850  61.326 39.334  1.00 145.47 ? 198  ARG A CA  1 
ATOM 1562 C C   . ARG A 1 201  ? 52.695  60.224 39.965  1.00 145.47 ? 198  ARG A C   1 
ATOM 1563 O O   . ARG A 1 201  ? 53.875  60.076 39.649  1.00 145.47 ? 198  ARG A O   1 
ATOM 1564 C CB  . ARG A 1 201  ? 52.404  62.699 39.719  1.00 129.85 ? 198  ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 201  ? 53.867  62.901 39.360  1.00 129.85 ? 198  ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 201  ? 54.349  64.285 39.764  1.00 129.85 ? 198  ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 201  ? 53.603  65.343 39.089  1.00 129.85 ? 198  ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 201  ? 53.949  65.872 37.920  1.00 129.85 ? 198  ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 201  ? 55.034  65.442 37.290  1.00 129.85 ? 198  ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 201  ? 53.210  66.831 37.379  1.00 129.85 ? 198  ARG A NH2 1 
ATOM 1571 N N   . GLU A 1 202  ? 52.083  59.454 40.859  1.00 65.12  ? 199  GLU A N   1 
ATOM 1572 C CA  . GLU A 1 202  ? 52.777  58.365 41.536  1.00 65.12  ? 199  GLU A CA  1 
ATOM 1573 C C   . GLU A 1 202  ? 52.068  57.034 41.309  1.00 65.12  ? 199  GLU A C   1 
ATOM 1574 O O   . GLU A 1 202  ? 52.700  55.978 41.296  1.00 65.12  ? 199  GLU A O   1 
ATOM 1575 C CB  . GLU A 1 202  ? 52.891  58.652 43.034  1.00 140.77 ? 199  GLU A CB  1 
ATOM 1576 C CG  . GLU A 1 202  ? 53.653  59.925 43.367  1.00 140.77 ? 199  GLU A CG  1 
ATOM 1577 C CD  . GLU A 1 202  ? 55.079  59.901 42.853  1.00 140.77 ? 199  GLU A CD  1 
ATOM 1578 O OE1 . GLU A 1 202  ? 55.474  58.889 42.237  1.00 140.77 ? 199  GLU A OE1 1 
ATOM 1579 O OE2 . GLU A 1 202  ? 55.805  60.895 43.066  1.00 140.77 ? 199  GLU A OE2 1 
ATOM 1580 N N   . LYS A 1 203  ? 50.755  57.117 41.147  1.00 73.78  ? 200  LYS A N   1 
ATOM 1581 C CA  . LYS A 1 203  ? 49.878  55.991 40.920  1.00 73.78  ? 200  LYS A CA  1 
ATOM 1582 C C   . LYS A 1 203  ? 49.591  55.246 42.181  1.00 73.78  ? 200  LYS A C   1 
ATOM 1583 O O   . LYS A 1 203  ? 49.516  54.035 42.205  1.00 73.78  ? 200  LYS A O   1 
ATOM 1584 C CB  . LYS A 1 203  ? 50.471  55.076 39.896  1.00 82.54  ? 200  LYS A CB  1 
ATOM 1585 C CG  . LYS A 1 203  ? 50.506  55.723 38.574  1.00 82.54  ? 200  LYS A CG  1 
ATOM 1586 C CD  . LYS A 1 203  ? 50.809  54.753 37.499  1.00 82.54  ? 200  LYS A CD  1 
ATOM 1587 C CE  . LYS A 1 203  ? 50.432  55.390 36.204  1.00 82.54  ? 200  LYS A CE  1 
ATOM 1588 N NZ  . LYS A 1 203  ? 50.372  56.852 36.429  1.00 82.54  ? 200  LYS A NZ  1 
ATOM 1589 N N   . GLU A 1 204  ? 49.427  55.993 43.244  1.00 78.34  ? 201  GLU A N   1 
ATOM 1590 C CA  . GLU A 1 204  ? 49.152  55.405 44.503  1.00 78.34  ? 201  GLU A CA  1 
ATOM 1591 C C   . GLU A 1 204  ? 48.083  56.253 45.067  1.00 78.34  ? 201  GLU A C   1 
ATOM 1592 O O   . GLU A 1 204  ? 47.622  57.148 44.418  1.00 78.34  ? 201  GLU A O   1 
ATOM 1593 C CB  . GLU A 1 204  ? 50.384  55.471 45.377  1.00 106.63 ? 201  GLU A CB  1 
ATOM 1594 C CG  . GLU A 1 204  ? 51.228  56.722 45.249  1.00 106.63 ? 201  GLU A CG  1 
ATOM 1595 C CD  . GLU A 1 204  ? 52.351  56.743 46.263  1.00 106.63 ? 201  GLU A CD  1 
ATOM 1596 O OE1 . GLU A 1 204  ? 53.181  55.828 46.215  1.00 106.63 ? 201  GLU A OE1 1 
ATOM 1597 O OE2 . GLU A 1 204  ? 52.409  57.645 47.116  1.00 106.63 ? 201  GLU A OE2 1 
ATOM 1598 N N   . PHE A 1 205  ? 47.693  55.969 46.290  1.00 86.62  ? 202  PHE A N   1 
ATOM 1599 C CA  . PHE A 1 205  ? 46.658  56.734 46.927  1.00 86.62  ? 202  PHE A CA  1 
ATOM 1600 C C   . PHE A 1 205  ? 47.249  57.825 47.775  1.00 86.62  ? 202  PHE A C   1 
ATOM 1601 O O   . PHE A 1 205  ? 47.729  58.809 47.263  1.00 86.62  ? 202  PHE A O   1 
ATOM 1602 C CB  . PHE A 1 205  ? 45.757  55.835 47.758  1.00 55.83  ? 202  PHE A CB  1 
ATOM 1603 C CG  . PHE A 1 205  ? 44.532  55.372 47.032  1.00 55.83  ? 202  PHE A CG  1 
ATOM 1604 C CD1 . PHE A 1 205  ? 43.894  56.179 46.142  1.00 55.83  ? 202  PHE A CD1 1 
ATOM 1605 C CD2 . PHE A 1 205  ? 44.024  54.125 47.236  1.00 55.83  ? 202  PHE A CD2 1 
ATOM 1606 C CE1 . PHE A 1 205  ? 42.804  55.757 45.495  1.00 55.83  ? 202  PHE A CE1 1 
ATOM 1607 C CE2 . PHE A 1 205  ? 42.919  53.720 46.571  1.00 55.83  ? 202  PHE A CE2 1 
ATOM 1608 C CZ  . PHE A 1 205  ? 42.325  54.536 45.707  1.00 55.83  ? 202  PHE A CZ  1 
ATOM 1609 N N   . ASN A 1 206  ? 47.215  57.658 49.079  1.00 58.64  ? 203  ASN A N   1 
ATOM 1610 C CA  . ASN A 1 206  ? 47.748  58.668 49.960  1.00 58.64  ? 203  ASN A CA  1 
ATOM 1611 C C   . ASN A 1 206  ? 46.743  58.773 51.041  1.00 58.64  ? 203  ASN A C   1 
ATOM 1612 O O   . ASN A 1 206  ? 45.700  58.230 50.910  1.00 58.64  ? 203  ASN A O   1 
ATOM 1613 C CB  . ASN A 1 206  ? 47.841  59.983 49.235  1.00 56.20  ? 203  ASN A CB  1 
ATOM 1614 C CG  . ASN A 1 206  ? 49.240  60.337 48.869  1.00 56.20  ? 203  ASN A CG  1 
ATOM 1615 O OD1 . ASN A 1 206  ? 49.654  60.166 47.743  1.00 56.20  ? 203  ASN A OD1 1 
ATOM 1616 N ND2 . ASN A 1 206  ? 49.980  60.839 49.825  1.00 56.20  ? 203  ASN A ND2 1 
ATOM 1617 N N   . LYS A 1 207  ? 47.030  59.465 52.117  1.00 77.86  ? 204  LYS A N   1 
ATOM 1618 C CA  . LYS A 1 207  ? 46.048  59.554 53.184  1.00 77.86  ? 204  LYS A CA  1 
ATOM 1619 C C   . LYS A 1 207  ? 44.982  60.610 52.926  1.00 77.86  ? 204  LYS A C   1 
ATOM 1620 O O   . LYS A 1 207  ? 45.244  61.668 52.366  1.00 77.86  ? 204  LYS A O   1 
ATOM 1621 C CB  . LYS A 1 207  ? 46.736  59.791 54.532  1.00 164.11 ? 204  LYS A CB  1 
ATOM 1622 C CG  . LYS A 1 207  ? 46.315  58.841 55.646  1.00 164.11 ? 204  LYS A CG  1 
ATOM 1623 C CD  . LYS A 1 207  ? 45.922  59.579 56.927  1.00 164.11 ? 204  LYS A CD  1 
ATOM 1624 C CE  . LYS A 1 207  ? 44.602  59.053 57.527  1.00 164.11 ? 204  LYS A CE  1 
ATOM 1625 N NZ  . LYS A 1 207  ? 43.474  60.045 57.537  1.00 164.11 ? 204  LYS A NZ  1 
ATOM 1626 N N   . GLY A 1 208  ? 43.769  60.307 53.343  1.00 79.22  ? 205  GLY A N   1 
ATOM 1627 C CA  . GLY A 1 208  ? 42.682  61.229 53.153  1.00 79.22  ? 205  GLY A CA  1 
ATOM 1628 C C   . GLY A 1 208  ? 42.692  62.262 54.236  1.00 79.22  ? 205  GLY A C   1 
ATOM 1629 O O   . GLY A 1 208  ? 43.315  62.074 55.254  1.00 79.22  ? 205  GLY A O   1 
ATOM 1630 N N   . PRO A 1 209  ? 41.991  63.353 54.015  1.00 65.98  ? 206  PRO A N   1 
ATOM 1631 C CA  . PRO A 1 209  ? 41.946  64.423 54.986  1.00 65.98  ? 206  PRO A CA  1 
ATOM 1632 C C   . PRO A 1 209  ? 41.269  64.059 56.263  1.00 65.98  ? 206  PRO A C   1 
ATOM 1633 O O   . PRO A 1 209  ? 41.614  64.605 57.267  1.00 65.98  ? 206  PRO A O   1 
ATOM 1634 C CB  . PRO A 1 209  ? 41.170  65.488 54.257  1.00 81.93  ? 206  PRO A CB  1 
ATOM 1635 C CG  . PRO A 1 209  ? 41.488  65.263 52.883  1.00 81.93  ? 206  PRO A CG  1 
ATOM 1636 C CD  . PRO A 1 209  ? 41.469  63.799 52.727  1.00 81.93  ? 206  PRO A CD  1 
ATOM 1637 N N   . TRP A 1 210  ? 40.317  63.159 56.264  1.00 53.61  ? 207  TRP A N   1 
ATOM 1638 C CA  . TRP A 1 210  ? 39.726  62.850 57.537  1.00 53.61  ? 207  TRP A CA  1 
ATOM 1639 C C   . TRP A 1 210  ? 39.721  61.403 57.906  1.00 53.61  ? 207  TRP A C   1 
ATOM 1640 O O   . TRP A 1 210  ? 39.629  60.534 57.085  1.00 53.61  ? 207  TRP A O   1 
ATOM 1641 C CB  . TRP A 1 210  ? 38.404  63.550 57.804  1.00 73.53  ? 207  TRP A CB  1 
ATOM 1642 C CG  . TRP A 1 210  ? 37.309  63.434 56.832  1.00 73.53  ? 207  TRP A CG  1 
ATOM 1643 C CD1 . TRP A 1 210  ? 36.374  62.457 56.770  1.00 73.53  ? 207  TRP A CD1 1 
ATOM 1644 C CD2 . TRP A 1 210  ? 36.945  64.394 55.855  1.00 73.53  ? 207  TRP A CD2 1 
ATOM 1645 N NE1 . TRP A 1 210  ? 35.472  62.727 55.783  1.00 73.53  ? 207  TRP A NE1 1 
ATOM 1646 C CE2 . TRP A 1 210  ? 35.804  63.914 55.203  1.00 73.53  ? 207  TRP A CE2 1 
ATOM 1647 C CE3 . TRP A 1 210  ? 37.486  65.599 55.453  1.00 73.53  ? 207  TRP A CE3 1 
ATOM 1648 C CZ2 . TRP A 1 210  ? 35.206  64.589 54.181  1.00 73.53  ? 207  TRP A CZ2 1 
ATOM 1649 C CZ3 . TRP A 1 210  ? 36.894  66.265 54.448  1.00 73.53  ? 207  TRP A CZ3 1 
ATOM 1650 C CH2 . TRP A 1 210  ? 35.762  65.767 53.817  1.00 73.53  ? 207  TRP A CH2 1 
ATOM 1651 N N   . LYS A 1 211  ? 39.839  61.177 59.189  1.00 50.28  ? 208  LYS A N   1 
ATOM 1652 C CA  . LYS A 1 211  ? 39.908  59.851 59.744  1.00 50.28  ? 208  LYS A CA  1 
ATOM 1653 C C   . LYS A 1 211  ? 38.660  59.076 59.394  1.00 50.28  ? 208  LYS A C   1 
ATOM 1654 O O   . LYS A 1 211  ? 37.577  59.647 59.297  1.00 50.28  ? 208  LYS A O   1 
ATOM 1655 C CB  . LYS A 1 211  ? 40.101  59.940 61.257  1.00 87.33  ? 208  LYS A CB  1 
ATOM 1656 C CG  . LYS A 1 211  ? 41.556  60.157 61.650  1.00 87.33  ? 208  LYS A CG  1 
ATOM 1657 C CD  . LYS A 1 211  ? 41.724  61.369 62.570  1.00 87.33  ? 208  LYS A CD  1 
ATOM 1658 C CE  . LYS A 1 211  ? 43.195  61.624 62.957  1.00 87.33  ? 208  LYS A CE  1 
ATOM 1659 N NZ  . LYS A 1 211  ? 43.828  62.738 62.193  1.00 87.33  ? 208  LYS A NZ  1 
ATOM 1660 N N   . GLN A 1 212  ? 38.831  57.780 59.166  1.00 68.36  ? 209  GLN A N   1 
ATOM 1661 C CA  . GLN A 1 212  ? 37.727  56.864 58.981  1.00 68.36  ? 209  GLN A CA  1 
ATOM 1662 C C   . GLN A 1 212  ? 36.745  56.939 60.173  1.00 68.36  ? 209  GLN A C   1 
ATOM 1663 O O   . GLN A 1 212  ? 37.020  56.427 61.264  1.00 68.36  ? 209  GLN A O   1 
ATOM 1664 C CB  . GLN A 1 212  ? 38.279  55.448 58.785  1.00 128.20 ? 209  GLN A CB  1 
ATOM 1665 C CG  . GLN A 1 212  ? 37.252  54.339 58.773  1.00 128.20 ? 209  GLN A CG  1 
ATOM 1666 C CD  . GLN A 1 212  ? 37.774  53.070 59.412  1.00 128.20 ? 209  GLN A CD  1 
ATOM 1667 O OE1 . GLN A 1 212  ? 38.907  52.655 59.168  1.00 128.20 ? 209  GLN A OE1 1 
ATOM 1668 N NE2 . GLN A 1 212  ? 36.947  52.445 60.237  1.00 128.20 ? 209  GLN A NE2 1 
ATOM 1669 N N   . GLU A 1 213  ? 35.608  57.597 59.965  1.00 77.53  ? 210  GLU A N   1 
ATOM 1670 C CA  . GLU A 1 213  ? 34.518  57.537 60.939  1.00 77.53  ? 210  GLU A CA  1 
ATOM 1671 C C   . GLU A 1 213  ? 33.691  56.275 60.672  1.00 77.53  ? 210  GLU A C   1 
ATOM 1672 O O   . GLU A 1 213  ? 33.951  55.541 59.708  1.00 77.53  ? 210  GLU A O   1 
ATOM 1673 C CB  . GLU A 1 213  ? 33.618  58.786 60.876  1.00 114.94 ? 210  GLU A CB  1 
ATOM 1674 C CG  . GLU A 1 213  ? 34.312  60.123 60.560  1.00 114.94 ? 210  GLU A CG  1 
ATOM 1675 C CD  . GLU A 1 213  ? 35.333  60.565 61.611  1.00 114.94 ? 210  GLU A CD  1 
ATOM 1676 O OE1 . GLU A 1 213  ? 35.379  59.987 62.725  1.00 114.94 ? 210  GLU A OE1 1 
ATOM 1677 O OE2 . GLU A 1 213  ? 36.093  61.510 61.307  1.00 114.94 ? 210  GLU A OE2 1 
ATOM 1678 N N   . ASN A 1 214  ? 32.698  56.021 61.516  1.00 100.90 ? 211  ASN A N   1 
ATOM 1679 C CA  . ASN A 1 214  ? 31.748  54.952 61.243  1.00 100.90 ? 211  ASN A CA  1 
ATOM 1680 C C   . ASN A 1 214  ? 30.457  55.474 60.626  1.00 100.90 ? 211  ASN A C   1 
ATOM 1681 O O   . ASN A 1 214  ? 30.130  56.653 60.744  1.00 100.90 ? 211  ASN A O   1 
ATOM 1682 C CB  . ASN A 1 214  ? 31.408  54.191 62.518  1.00 61.91  ? 211  ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 214  ? 32.549  53.343 63.022  1.00 61.91  ? 211  ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 214  ? 33.007  52.436 62.337  1.00 61.91  ? 211  ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 214  ? 32.981  53.607 64.250  1.00 61.91  ? 211  ASN A ND2 1 
ATOM 1686 N N   . VAL A 1 215  ? 29.734  54.579 59.964  1.00 36.92  ? 212  VAL A N   1 
ATOM 1687 C CA  . VAL A 1 215  ? 28.415  54.866 59.428  1.00 36.92  ? 212  VAL A CA  1 
ATOM 1688 C C   . VAL A 1 215  ? 27.516  53.677 59.734  1.00 36.92  ? 212  VAL A C   1 
ATOM 1689 O O   . VAL A 1 215  ? 27.995  52.611 60.103  1.00 36.92  ? 212  VAL A O   1 
ATOM 1690 C CB  . VAL A 1 215  ? 28.436  55.194 57.922  1.00 67.25  ? 212  VAL A CB  1 
ATOM 1691 C CG1 . VAL A 1 215  ? 29.241  56.444 57.673  1.00 67.25  ? 212  VAL A CG1 1 
ATOM 1692 C CG2 . VAL A 1 215  ? 28.992  54.052 57.122  1.00 67.25  ? 212  VAL A CG2 1 
ATOM 1693 N N   . GLU A 1 216  ? 26.209  53.860 59.605  1.00 40.04  ? 213  GLU A N   1 
ATOM 1694 C CA  . GLU A 1 216  ? 25.252  52.824 59.985  1.00 40.04  ? 213  GLU A CA  1 
ATOM 1695 C C   . GLU A 1 216  ? 25.224  51.587 59.059  1.00 40.04  ? 213  GLU A C   1 
ATOM 1696 O O   . GLU A 1 216  ? 25.545  51.643 57.861  1.00 40.04  ? 213  GLU A O   1 
ATOM 1697 C CB  . GLU A 1 216  ? 23.861  53.428 60.056  1.00 40.04  ? 213  GLU A CB  1 
ATOM 1698 C CG  . GLU A 1 216  ? 23.282  53.611 58.708  1.00 40.04  ? 213  GLU A CG  1 
ATOM 1699 C CD  . GLU A 1 216  ? 21.854  54.046 58.733  1.00 40.04  ? 213  GLU A CD  1 
ATOM 1700 O OE1 . GLU A 1 216  ? 21.603  55.211 59.117  1.00 40.04  ? 213  GLU A OE1 1 
ATOM 1701 O OE2 . GLU A 1 216  ? 20.992  53.223 58.320  1.00 40.04  ? 213  GLU A OE2 1 
ATOM 1702 N N   . ALA A 1 217  ? 24.801  50.481 59.662  1.00 49.39  ? 214  ALA A N   1 
ATOM 1703 C CA  . ALA A 1 217  ? 24.693  49.178 59.037  1.00 49.39  ? 214  ALA A CA  1 
ATOM 1704 C C   . ALA A 1 217  ? 24.137  49.226 57.649  1.00 49.39  ? 214  ALA A C   1 
ATOM 1705 O O   . ALA A 1 217  ? 24.478  48.373 56.851  1.00 49.39  ? 214  ALA A O   1 
ATOM 1706 C CB  . ALA A 1 217  ? 23.836  48.257 59.887  1.00 28.73  ? 214  ALA A CB  1 
ATOM 1707 N N   . GLU A 1 218  ? 23.268  50.194 57.356  1.00 55.34  ? 215  GLU A N   1 
ATOM 1708 C CA  . GLU A 1 218  ? 22.615  50.233 56.038  1.00 55.34  ? 215  GLU A CA  1 
ATOM 1709 C C   . GLU A 1 218  ? 22.862  51.508 55.252  1.00 55.34  ? 215  GLU A C   1 
ATOM 1710 O O   . GLU A 1 218  ? 22.076  51.866 54.378  1.00 55.34  ? 215  GLU A O   1 
ATOM 1711 C CB  . GLU A 1 218  ? 21.120  49.911 56.137  1.00 76.30  ? 215  GLU A CB  1 
ATOM 1712 C CG  . GLU A 1 218  ? 20.813  48.410 56.287  1.00 76.30  ? 215  GLU A CG  1 
ATOM 1713 C CD  . GLU A 1 218  ? 21.255  47.546 55.088  1.00 76.30  ? 215  GLU A CD  1 
ATOM 1714 O OE1 . GLU A 1 218  ? 21.183  48.003 53.925  1.00 76.30  ? 215  GLU A OE1 1 
ATOM 1715 O OE2 . GLU A 1 218  ? 21.661  46.387 55.308  1.00 76.30  ? 215  GLU A OE2 1 
ATOM 1716 N N   . ALA A 1 219  ? 23.969  52.176 55.549  1.00 57.29  ? 216  ALA A N   1 
ATOM 1717 C CA  . ALA A 1 219  ? 24.388  53.338 54.796  1.00 57.29  ? 216  ALA A CA  1 
ATOM 1718 C C   . ALA A 1 219  ? 24.661  53.003 53.307  1.00 57.29  ? 216  ALA A C   1 
ATOM 1719 O O   . ALA A 1 219  ? 25.399  52.055 53.009  1.00 57.29  ? 216  ALA A O   1 
ATOM 1720 C CB  . ALA A 1 219  ? 25.620  53.938 55.456  1.00 32.51  ? 216  ALA A CB  1 
ATOM 1721 N N   . SER A 1 220  ? 24.079  53.776 52.380  1.00 32.84  ? 217  SER A N   1 
ATOM 1722 C CA  . SER A 1 220  ? 24.207  53.454 50.964  1.00 32.84  ? 217  SER A CA  1 
ATOM 1723 C C   . SER A 1 220  ? 24.525  54.578 49.986  1.00 32.84  ? 217  SER A C   1 
ATOM 1724 O O   . SER A 1 220  ? 24.970  54.314 48.882  1.00 32.84  ? 217  SER A O   1 
ATOM 1725 C CB  . SER A 1 220  ? 22.943  52.770 50.494  1.00 25.99  ? 217  SER A CB  1 
ATOM 1726 O OG  . SER A 1 220  ? 21.881  53.708 50.293  1.00 25.99  ? 217  SER A OG  1 
ATOM 1727 N N   . MET A 1 221  ? 24.251  55.823 50.335  1.00 29.27  ? 218  MET A N   1 
ATOM 1728 C CA  . MET A 1 221  ? 24.492  56.880 49.367  1.00 29.27  ? 218  MET A CA  1 
ATOM 1729 C C   . MET A 1 221  ? 25.518  57.821 49.934  1.00 29.27  ? 218  MET A C   1 
ATOM 1730 O O   . MET A 1 221  ? 25.556  58.060 51.145  1.00 29.27  ? 218  MET A O   1 
ATOM 1731 C CB  . MET A 1 221  ? 23.211  57.631 49.036  1.00 82.18  ? 218  MET A CB  1 
ATOM 1732 C CG  . MET A 1 221  ? 22.088  56.729 48.608  1.00 82.18  ? 218  MET A CG  1 
ATOM 1733 S SD  . MET A 1 221  ? 21.275  57.367 47.146  1.00 82.18  ? 218  MET A SD  1 
ATOM 1734 C CE  . MET A 1 221  ? 22.134  56.463 45.839  1.00 82.18  ? 218  MET A CE  1 
ATOM 1735 N N   . VAL A 1 222  ? 26.370  58.350 49.075  1.00 43.26  ? 219  VAL A N   1 
ATOM 1736 C CA  . VAL A 1 222  ? 27.323  59.328 49.523  1.00 43.26  ? 219  VAL A CA  1 
ATOM 1737 C C   . VAL A 1 222  ? 27.042  60.553 48.706  1.00 43.26  ? 219  VAL A C   1 
ATOM 1738 O O   . VAL A 1 222  ? 27.048  60.485 47.479  1.00 43.26  ? 219  VAL A O   1 
ATOM 1739 C CB  . VAL A 1 222  ? 28.774  58.869 49.264  1.00 29.56  ? 219  VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 222  ? 29.797  59.980 49.657  1.00 29.56  ? 219  VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 222  ? 29.083  57.570 50.006  1.00 29.56  ? 219  VAL A CG2 1 
ATOM 1742 N N   . ILE A 1 223  ? 26.769  61.671 49.367  1.00 52.48  ? 220  ILE A N   1 
ATOM 1743 C CA  . ILE A 1 223  ? 26.673  62.946 48.652  1.00 52.48  ? 220  ILE A CA  1 
ATOM 1744 C C   . ILE A 1 223  ? 27.827  63.848 49.020  1.00 52.48  ? 220  ILE A C   1 
ATOM 1745 O O   . ILE A 1 223  ? 28.127  64.053 50.185  1.00 52.48  ? 220  ILE A O   1 
ATOM 1746 C CB  . ILE A 1 223  ? 25.334  63.677 48.909  1.00 40.42  ? 220  ILE A CB  1 
ATOM 1747 C CG1 . ILE A 1 223  ? 24.164  62.784 48.461  1.00 40.42  ? 220  ILE A CG1 1 
ATOM 1748 C CG2 . ILE A 1 223  ? 25.347  65.076 48.238  1.00 40.42  ? 220  ILE A CG2 1 
ATOM 1749 C CD1 . ILE A 1 223  ? 22.797  63.177 49.053  1.00 40.42  ? 220  ILE A CD1 1 
ATOM 1750 N N   . ALA A 1 224  ? 28.468  64.390 48.007  1.00 50.03  ? 221  ALA A N   1 
ATOM 1751 C CA  . ALA A 1 224  ? 29.591  65.272 48.234  1.00 50.03  ? 221  ALA A CA  1 
ATOM 1752 C C   . ALA A 1 224  ? 29.111  66.704 48.063  1.00 50.03  ? 221  ALA A C   1 
ATOM 1753 O O   . ALA A 1 224  ? 28.858  67.161 46.943  1.00 50.03  ? 221  ALA A O   1 
ATOM 1754 C CB  . ALA A 1 224  ? 30.764  64.933 47.274  1.00 29.67  ? 221  ALA A CB  1 
ATOM 1755 N N   . VAL A 1 225  ? 28.975  67.400 49.187  1.00 60.88  ? 222  VAL A N   1 
ATOM 1756 C CA  . VAL A 1 225  ? 28.424  68.744 49.195  1.00 60.88  ? 222  VAL A CA  1 
ATOM 1757 C C   . VAL A 1 225  ? 29.328  69.762 48.483  1.00 60.88  ? 222  VAL A C   1 
ATOM 1758 O O   . VAL A 1 225  ? 30.556  69.764 48.681  1.00 60.88  ? 222  VAL A O   1 
ATOM 1759 C CB  . VAL A 1 225  ? 28.168  69.199 50.600  1.00 72.07  ? 222  VAL A CB  1 
ATOM 1760 C CG1 . VAL A 1 225  ? 26.999  70.143 50.606  1.00 72.07  ? 222  VAL A CG1 1 
ATOM 1761 C CG2 . VAL A 1 225  ? 27.855  68.005 51.459  1.00 72.07  ? 222  VAL A CG2 1 
ATOM 1762 N N   . PRO A 1 226  ? 28.720  70.644 47.663  1.00 39.68  ? 223  PRO A N   1 
ATOM 1763 C CA  . PRO A 1 226  ? 29.546  71.502 46.806  1.00 39.68  ? 223  PRO A CA  1 
ATOM 1764 C C   . PRO A 1 226  ? 30.450  72.497 47.563  1.00 39.68  ? 223  PRO A C   1 
ATOM 1765 O O   . PRO A 1 226  ? 30.251  72.761 48.768  1.00 39.68  ? 223  PRO A O   1 
ATOM 1766 C CB  . PRO A 1 226  ? 28.520  72.245 45.944  1.00 63.90  ? 223  PRO A CB  1 
ATOM 1767 C CG  . PRO A 1 226  ? 27.250  71.519 46.145  1.00 63.90  ? 223  PRO A CG  1 
ATOM 1768 C CD  . PRO A 1 226  ? 27.289  70.927 47.487  1.00 63.90  ? 223  PRO A CD  1 
ATOM 1769 N N   . GLU A 1 227  ? 31.422  73.026 46.815  1.00 201.00 ? 224  GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227  ? 32.453  73.950 47.299  1.00 201.00 ? 224  GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227  ? 32.057  74.842 48.476  1.00 201.00 ? 224  GLU A C   1 
ATOM 1772 O O   . GLU A 1 227  ? 32.781  74.889 49.468  1.00 201.00 ? 224  GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227  ? 33.001  74.810 46.147  1.00 106.32 ? 224  GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227  ? 34.484  74.567 45.786  1.00 106.32 ? 224  GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227  ? 35.480  75.345 46.670  1.00 106.32 ? 224  GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227  ? 35.601  75.037 47.878  1.00 106.32 ? 224  GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227  ? 36.164  76.254 46.147  1.00 106.32 ? 224  GLU A OE2 1 
ATOM 1778 N N   . PRO A 1 228  ? 30.919  75.554 48.375  1.00 88.59  ? 225  PRO A N   1 
ATOM 1779 C CA  . PRO A 1 228  ? 30.545  76.456 49.484  1.00 88.59  ? 225  PRO A CA  1 
ATOM 1780 C C   . PRO A 1 228  ? 30.553  75.799 50.875  1.00 88.59  ? 225  PRO A C   1 
ATOM 1781 O O   . PRO A 1 228  ? 31.172  76.326 51.798  1.00 88.59  ? 225  PRO A O   1 
ATOM 1782 C CB  . PRO A 1 228  ? 29.134  76.898 49.109  1.00 100.77 ? 225  PRO A CB  1 
ATOM 1783 C CG  . PRO A 1 228  ? 29.096  76.756 47.600  1.00 100.77 ? 225  PRO A CG  1 
ATOM 1784 C CD  . PRO A 1 228  ? 29.940  75.588 47.269  1.00 100.77 ? 225  PRO A CD  1 
ATOM 1785 N N   . PHE A 1 229  ? 29.887  74.653 51.006  1.00 91.70  ? 226  PHE A N   1 
ATOM 1786 C CA  . PHE A 1 229  ? 29.794  73.940 52.281  1.00 91.70  ? 226  PHE A CA  1 
ATOM 1787 C C   . PHE A 1 229  ? 30.924  72.930 52.432  1.00 91.70  ? 226  PHE A C   1 
ATOM 1788 O O   . PHE A 1 229  ? 31.535  72.854 53.489  1.00 91.70  ? 226  PHE A O   1 
ATOM 1789 C CB  . PHE A 1 229  ? 28.479  73.159 52.384  1.00 134.52 ? 226  PHE A CB  1 
ATOM 1790 C CG  . PHE A 1 229  ? 27.225  74.004 52.370  1.00 134.52 ? 226  PHE A CG  1 
ATOM 1791 C CD1 . PHE A 1 229  ? 26.943  74.869 51.310  1.00 134.52 ? 226  PHE A CD1 1 
ATOM 1792 C CD2 . PHE A 1 229  ? 26.284  73.872 53.391  1.00 134.52 ? 226  PHE A CD2 1 
ATOM 1793 C CE1 . PHE A 1 229  ? 25.768  75.622 51.293  1.00 134.52 ? 226  PHE A CE1 1 
ATOM 1794 C CE2 . PHE A 1 229  ? 25.110  74.613 53.381  1.00 134.52 ? 226  PHE A CE2 1 
ATOM 1795 C CZ  . PHE A 1 229  ? 24.852  75.491 52.327  1.00 134.52 ? 226  PHE A CZ  1 
ATOM 1796 N N   . GLY A 1 230  ? 31.151  72.132 51.378  1.00 50.04  ? 227  GLY A N   1 
ATOM 1797 C CA  . GLY A 1 230  ? 32.125  71.050 51.367  1.00 50.04  ? 227  GLY A CA  1 
ATOM 1798 C C   . GLY A 1 230  ? 31.665  69.962 52.299  1.00 50.04  ? 227  GLY A C   1 
ATOM 1799 O O   . GLY A 1 230  ? 30.755  70.177 53.088  1.00 50.04  ? 227  GLY A O   1 
ATOM 1800 N N   . GLY A 1 231  ? 32.296  68.796 52.231  1.00 40.61  ? 228  GLY A N   1 
ATOM 1801 C CA  . GLY A 1 231  ? 31.945  67.670 53.120  1.00 40.61  ? 228  GLY A CA  1 
ATOM 1802 C C   . GLY A 1 231  ? 31.159  66.571 52.430  1.00 40.61  ? 228  GLY A C   1 
ATOM 1803 O O   . GLY A 1 231  ? 31.101  66.504 51.189  1.00 40.61  ? 228  GLY A O   1 
ATOM 1804 N N   . ALA A 1 232  ? 30.547  65.712 53.230  1.00 52.95  ? 229  ALA A N   1 
ATOM 1805 C CA  . ALA A 1 232  ? 29.874  64.550 52.671  1.00 52.95  ? 229  ALA A CA  1 
ATOM 1806 C C   . ALA A 1 232  ? 28.612  64.183 53.419  1.00 52.95  ? 229  ALA A C   1 
ATOM 1807 O O   . ALA A 1 232  ? 28.614  64.068 54.648  1.00 52.95  ? 229  ALA A O   1 
ATOM 1808 C CB  . ALA A 1 232  ? 30.839  63.322 52.606  1.00 34.32  ? 229  ALA A CB  1 
ATOM 1809 N N   . ILE A 1 233  ? 27.534  63.971 52.680  1.00 41.13  ? 230  ILE A N   1 
ATOM 1810 C CA  . ILE A 1 233  ? 26.368  63.437 53.315  1.00 41.13  ? 230  ILE A CA  1 
ATOM 1811 C C   . ILE A 1 233  ? 26.301  61.936 53.114  1.00 41.13  ? 230  ILE A C   1 
ATOM 1812 O O   . ILE A 1 233  ? 26.580  61.448 52.033  1.00 41.13  ? 230  ILE A O   1 
ATOM 1813 C CB  . ILE A 1 233  ? 25.115  64.187 52.894  1.00 60.62  ? 230  ILE A CB  1 
ATOM 1814 C CG1 . ILE A 1 233  ? 25.137  65.564 53.553  1.00 60.62  ? 230  ILE A CG1 1 
ATOM 1815 C CG2 . ILE A 1 233  ? 23.879  63.483 53.386  1.00 60.62  ? 230  ILE A CG2 1 
ATOM 1816 C CD1 . ILE A 1 233  ? 24.304  66.617 52.836  1.00 60.62  ? 230  ILE A CD1 1 
ATOM 1817 N N   . ILE A 1 234  ? 25.961  61.213 54.170  1.00 37.77  ? 231  ILE A N   1 
ATOM 1818 C CA  . ILE A 1 234  ? 25.775  59.777 54.114  1.00 37.77  ? 231  ILE A CA  1 
ATOM 1819 C C   . ILE A 1 234  ? 24.321  59.365 54.411  1.00 37.77  ? 231  ILE A C   1 
ATOM 1820 O O   . ILE A 1 234  ? 23.782  59.634 55.488  1.00 37.77  ? 231  ILE A O   1 
ATOM 1821 C CB  . ILE A 1 234  ? 26.730  59.073 55.116  1.00 29.28  ? 231  ILE A CB  1 
ATOM 1822 C CG1 . ILE A 1 234  ? 28.139  58.891 54.502  1.00 29.28  ? 231  ILE A CG1 1 
ATOM 1823 C CG2 . ILE A 1 234  ? 26.186  57.674 55.505  1.00 29.28  ? 231  ILE A CG2 1 
ATOM 1824 C CD1 . ILE A 1 234  ? 29.052  60.054 54.634  1.00 29.28  ? 231  ILE A CD1 1 
ATOM 1825 N N   . ILE A 1 235  ? 23.669  58.686 53.489  1.00 46.69  ? 232  ILE A N   1 
ATOM 1826 C CA  . ILE A 1 235  ? 22.286  58.330 53.746  1.00 46.69  ? 232  ILE A CA  1 
ATOM 1827 C C   . ILE A 1 235  ? 22.118  56.867 54.044  1.00 46.69  ? 232  ILE A C   1 
ATOM 1828 O O   . ILE A 1 235  ? 22.442  56.016 53.228  1.00 46.69  ? 232  ILE A O   1 
ATOM 1829 C CB  . ILE A 1 235  ? 21.402  58.728 52.572  1.00 45.90  ? 232  ILE A CB  1 
ATOM 1830 C CG1 . ILE A 1 235  ? 21.176  60.239 52.598  1.00 45.90  ? 232  ILE A CG1 1 
ATOM 1831 C CG2 . ILE A 1 235  ? 20.060  57.951 52.599  1.00 45.90  ? 232  ILE A CG2 1 
ATOM 1832 C CD1 . ILE A 1 235  ? 20.986  60.824 51.240  1.00 45.90  ? 232  ILE A CD1 1 
ATOM 1833 N N   . GLY A 1 236  ? 21.611  56.590 55.231  1.00 36.64  ? 233  GLY A N   1 
ATOM 1834 C CA  . GLY A 1 236  ? 21.264  55.226 55.663  1.00 36.64  ? 233  GLY A CA  1 
ATOM 1835 C C   . GLY A 1 236  ? 19.755  54.975 55.637  1.00 36.64  ? 233  GLY A C   1 
ATOM 1836 O O   . GLY A 1 236  ? 19.041  55.715 54.956  1.00 36.64  ? 233  GLY A O   1 
ATOM 1837 N N   . GLN A 1 237  ? 19.290  53.915 56.312  1.00 52.77  ? 234  GLN A N   1 
ATOM 1838 C CA  . GLN A 1 237  ? 17.872  53.737 56.656  1.00 52.77  ? 234  GLN A CA  1 
ATOM 1839 C C   . GLN A 1 237  ? 17.508  54.511 57.933  1.00 52.77  ? 234  GLN A C   1 
ATOM 1840 O O   . GLN A 1 237  ? 18.306  54.573 58.857  1.00 52.77  ? 234  GLN A O   1 
ATOM 1841 C CB  . GLN A 1 237  ? 17.573  52.258 56.865  1.00 68.97  ? 234  GLN A CB  1 
ATOM 1842 C CG  . GLN A 1 237  ? 17.088  51.539 55.619  1.00 68.97  ? 234  GLN A CG  1 
ATOM 1843 C CD  . GLN A 1 237  ? 15.649  51.930 55.214  1.00 68.97  ? 234  GLN A CD  1 
ATOM 1844 O OE1 . GLN A 1 237  ? 15.211  53.095 55.347  1.00 68.97  ? 234  GLN A OE1 1 
ATOM 1845 N NE2 . GLN A 1 237  ? 14.915  50.951 54.712  1.00 68.97  ? 234  GLN A NE2 1 
ATOM 1846 N N   . GLU A 1 238  ? 16.338  55.124 58.018  1.00 119.27 ? 235  GLU A N   1 
ATOM 1847 C CA  . GLU A 1 238  ? 15.973  55.875 59.254  1.00 119.27 ? 235  GLU A CA  1 
ATOM 1848 C C   . GLU A 1 238  ? 16.970  56.924 59.779  1.00 119.27 ? 235  GLU A C   1 
ATOM 1849 O O   . GLU A 1 238  ? 16.765  57.475 60.862  1.00 119.27 ? 235  GLU A O   1 
ATOM 1850 C CB  . GLU A 1 238  ? 15.577  54.930 60.415  1.00 106.21 ? 235  GLU A CB  1 
ATOM 1851 C CG  . GLU A 1 238  ? 16.430  53.663 60.606  1.00 106.21 ? 235  GLU A CG  1 
ATOM 1852 C CD  . GLU A 1 238  ? 17.512  53.787 61.666  1.00 106.21 ? 235  GLU A CD  1 
ATOM 1853 O OE1 . GLU A 1 238  ? 18.266  54.784 61.650  1.00 106.21 ? 235  GLU A OE1 1 
ATOM 1854 O OE2 . GLU A 1 238  ? 17.616  52.862 62.503  1.00 106.21 ? 235  GLU A OE2 1 
ATOM 1855 N N   . SER A 1 239  ? 18.027  57.203 59.020  1.00 73.04  ? 236  SER A N   1 
ATOM 1856 C CA  . SER A 1 239  ? 19.078  58.120 59.468  1.00 73.04  ? 236  SER A CA  1 
ATOM 1857 C C   . SER A 1 239  ? 19.914  58.759 58.355  1.00 73.04  ? 236  SER A C   1 
ATOM 1858 O O   . SER A 1 239  ? 20.284  58.108 57.384  1.00 73.04  ? 236  SER A O   1 
ATOM 1859 C CB  . SER A 1 239  ? 19.982  57.401 60.466  1.00 33.66  ? 236  SER A CB  1 
ATOM 1860 O OG  . SER A 1 239  ? 21.358  57.647 60.234  1.00 33.66  ? 236  SER A OG  1 
ATOM 1861 N N   . ILE A 1 240  ? 20.204  60.044 58.524  1.00 52.70  ? 237  ILE A N   1 
ATOM 1862 C CA  . ILE A 1 240  ? 21.016  60.819 57.591  1.00 52.70  ? 237  ILE A CA  1 
ATOM 1863 C C   . ILE A 1 240  ? 22.113  61.502 58.377  1.00 52.70  ? 237  ILE A C   1 
ATOM 1864 O O   . ILE A 1 240  ? 21.860  61.968 59.501  1.00 52.70  ? 237  ILE A O   1 
ATOM 1865 C CB  . ILE A 1 240  ? 20.180  61.905 56.881  1.00 39.79  ? 237  ILE A CB  1 
ATOM 1866 C CG1 . ILE A 1 240  ? 19.031  61.241 56.090  1.00 39.79  ? 237  ILE A CG1 1 
ATOM 1867 C CG2 . ILE A 1 240  ? 21.071  62.775 55.976  1.00 39.79  ? 237  ILE A CG2 1 
ATOM 1868 C CD1 . ILE A 1 240  ? 18.376  62.122 55.063  1.00 39.79  ? 237  ILE A CD1 1 
ATOM 1869 N N   . THR A 1 241  ? 23.327  61.550 57.824  1.00 85.75  ? 238  THR A N   1 
ATOM 1870 C CA  . THR A 1 241  ? 24.459  62.153 58.551  1.00 85.75  ? 238  THR A CA  1 
ATOM 1871 C C   . THR A 1 241  ? 25.377  62.981 57.667  1.00 85.75  ? 238  THR A C   1 
ATOM 1872 O O   . THR A 1 241  ? 25.389  62.839 56.452  1.00 85.75  ? 238  THR A O   1 
ATOM 1873 C CB  . THR A 1 241  ? 25.325  61.116 59.333  1.00 66.33  ? 238  THR A CB  1 
ATOM 1874 O OG1 . THR A 1 241  ? 26.136  60.378 58.411  1.00 66.33  ? 238  THR A OG1 1 
ATOM 1875 C CG2 . THR A 1 241  ? 24.471  60.149 60.155  1.00 66.33  ? 238  THR A CG2 1 
ATOM 1876 N N   . TYR A 1 242  ? 26.120  63.874 58.312  1.00 73.37  ? 239  TYR A N   1 
ATOM 1877 C CA  . TYR A 1 242  ? 27.040  64.769 57.629  1.00 73.37  ? 239  TYR A CA  1 
ATOM 1878 C C   . TYR A 1 242  ? 28.425  64.663 58.251  1.00 73.37  ? 239  TYR A C   1 
ATOM 1879 O O   . TYR A 1 242  ? 28.577  64.689 59.473  1.00 73.37  ? 239  TYR A O   1 
ATOM 1880 C CB  . TYR A 1 242  ? 26.539  66.212 57.699  1.00 52.21  ? 239  TYR A CB  1 
ATOM 1881 C CG  . TYR A 1 242  ? 27.488  67.221 57.094  1.00 52.21  ? 239  TYR A CG  1 
ATOM 1882 C CD1 . TYR A 1 242  ? 27.589  67.370 55.717  1.00 52.21  ? 239  TYR A CD1 1 
ATOM 1883 C CD2 . TYR A 1 242  ? 28.285  68.024 57.899  1.00 52.21  ? 239  TYR A CD2 1 
ATOM 1884 C CE1 . TYR A 1 242  ? 28.455  68.290 55.159  1.00 52.21  ? 239  TYR A CE1 1 
ATOM 1885 C CE2 . TYR A 1 242  ? 29.154  68.948 57.350  1.00 52.21  ? 239  TYR A CE2 1 
ATOM 1886 C CZ  . TYR A 1 242  ? 29.236  69.076 55.980  1.00 52.21  ? 239  TYR A CZ  1 
ATOM 1887 O OH  . TYR A 1 242  ? 30.100  69.994 55.429  1.00 52.21  ? 239  TYR A OH  1 
ATOM 1888 N N   . HIS A 1 243  ? 29.431  64.540 57.396  1.00 44.97  ? 240  HIS A N   1 
ATOM 1889 C CA  . HIS A 1 243  ? 30.793  64.377 57.823  1.00 44.97  ? 240  HIS A CA  1 
ATOM 1890 C C   . HIS A 1 243  ? 31.618  65.404 57.105  1.00 44.97  ? 240  HIS A C   1 
ATOM 1891 O O   . HIS A 1 243  ? 31.369  65.726 55.929  1.00 44.97  ? 240  HIS A O   1 
ATOM 1892 C CB  . HIS A 1 243  ? 31.288  62.971 57.484  1.00 56.81  ? 240  HIS A CB  1 
ATOM 1893 C CG  . HIS A 1 243  ? 30.539  61.886 58.182  1.00 56.81  ? 240  HIS A CG  1 
ATOM 1894 N ND1 . HIS A 1 243  ? 30.939  61.373 59.395  1.00 56.81  ? 240  HIS A ND1 1 
ATOM 1895 C CD2 . HIS A 1 243  ? 29.405  61.227 57.845  1.00 56.81  ? 240  HIS A CD2 1 
ATOM 1896 C CE1 . HIS A 1 243  ? 30.080  60.442 59.774  1.00 56.81  ? 240  HIS A CE1 1 
ATOM 1897 N NE2 . HIS A 1 243  ? 29.141  60.334 58.851  1.00 56.81  ? 240  HIS A NE2 1 
ATOM 1898 N N   . ASN A 1 244  ? 32.598  65.915 57.838  1.00 87.02  ? 241  ASN A N   1 
ATOM 1899 C CA  . ASN A 1 244  ? 33.620  66.788 57.305  1.00 87.02  ? 241  ASN A CA  1 
ATOM 1900 C C   . ASN A 1 244  ? 34.636  67.004 58.399  1.00 87.02  ? 241  ASN A C   1 
ATOM 1901 O O   . ASN A 1 244  ? 34.294  67.513 59.461  1.00 87.02  ? 241  ASN A O   1 
ATOM 1902 C CB  . ASN A 1 244  ? 33.041  68.130 56.865  1.00 73.67  ? 241  ASN A CB  1 
ATOM 1903 C CG  . ASN A 1 244  ? 34.053  68.978 56.158  1.00 73.67  ? 241  ASN A CG  1 
ATOM 1904 O OD1 . ASN A 1 244  ? 35.254  68.796 56.342  1.00 73.67  ? 241  ASN A OD1 1 
ATOM 1905 N ND2 . ASN A 1 244  ? 33.585  69.913 55.337  1.00 73.67  ? 241  ASN A ND2 1 
ATOM 1906 N N   . GLY A 1 245  ? 35.882  66.614 58.146  1.00 106.86 ? 242  GLY A N   1 
ATOM 1907 C CA  . GLY A 1 245  ? 36.920  66.712 59.159  1.00 106.86 ? 242  GLY A CA  1 
ATOM 1908 C C   . GLY A 1 245  ? 36.395  66.181 60.477  1.00 106.86 ? 242  GLY A C   1 
ATOM 1909 O O   . GLY A 1 245  ? 35.957  65.027 60.554  1.00 106.86 ? 242  GLY A O   1 
ATOM 1910 N N   . ASP A 1 246  ? 36.404  67.043 61.493  1.00 87.88  ? 243  ASP A N   1 
ATOM 1911 C CA  . ASP A 1 246  ? 35.921  66.709 62.841  1.00 87.88  ? 243  ASP A CA  1 
ATOM 1912 C C   . ASP A 1 246  ? 34.470  67.149 63.023  1.00 87.88  ? 243  ASP A C   1 
ATOM 1913 O O   . ASP A 1 246  ? 33.870  66.916 64.073  1.00 87.88  ? 243  ASP A O   1 
ATOM 1914 C CB  . ASP A 1 246  ? 36.799  67.375 63.906  1.00 176.02 ? 243  ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 246  ? 38.253  67.473 63.487  1.00 176.02 ? 243  ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 246  ? 38.821  68.581 63.594  1.00 176.02 ? 243  ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 246  ? 38.823  66.452 63.038  1.00 176.02 ? 243  ASP A OD2 1 
ATOM 1918 N N   . LYS A 1 247  ? 33.924  67.794 61.991  1.00 49.61  ? 244  LYS A N   1 
ATOM 1919 C CA  . LYS A 1 247  ? 32.507  68.169 61.938  1.00 49.61  ? 244  LYS A CA  1 
ATOM 1920 C C   . LYS A 1 247  ? 31.592  66.936 61.722  1.00 49.61  ? 244  LYS A C   1 
ATOM 1921 O O   . LYS A 1 247  ? 31.834  66.118 60.810  1.00 49.61  ? 244  LYS A O   1 
ATOM 1922 C CB  . LYS A 1 247  ? 32.297  69.208 60.836  1.00 46.46  ? 244  LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 247  ? 30.988  69.954 60.923  1.00 46.46  ? 244  LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 247  ? 30.965  71.047 61.988  1.00 46.46  ? 244  LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 247  ? 29.513  71.493 62.276  1.00 46.46  ? 244  LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 247  ? 28.692  70.525 63.160  1.00 46.46  ? 244  LYS A NZ  1 
ATOM 1927 N N   . TYR A 1 248  ? 30.569  66.794 62.569  1.00 44.36  ? 245  TYR A N   1 
ATOM 1928 C CA  . TYR A 1 248  ? 29.706  65.626 62.504  1.00 44.36  ? 245  TYR A CA  1 
ATOM 1929 C C   . TYR A 1 248  ? 28.242  65.941 62.812  1.00 44.36  ? 245  TYR A C   1 
ATOM 1930 O O   . TYR A 1 248  ? 27.920  66.192 63.956  1.00 44.36  ? 245  TYR A O   1 
ATOM 1931 C CB  . TYR A 1 248  ? 30.204  64.542 63.467  1.00 67.13  ? 245  TYR A CB  1 
ATOM 1932 C CG  . TYR A 1 248  ? 29.278  63.358 63.479  1.00 67.13  ? 245  TYR A CG  1 
ATOM 1933 C CD1 . TYR A 1 248  ? 29.217  62.496 62.386  1.00 67.13  ? 245  TYR A CD1 1 
ATOM 1934 C CD2 . TYR A 1 248  ? 28.421  63.119 64.547  1.00 67.13  ? 245  TYR A CD2 1 
ATOM 1935 C CE1 . TYR A 1 248  ? 28.348  61.410 62.358  1.00 67.13  ? 245  TYR A CE1 1 
ATOM 1936 C CE2 . TYR A 1 248  ? 27.541  62.017 64.536  1.00 67.13  ? 245  TYR A CE2 1 
ATOM 1937 C CZ  . TYR A 1 248  ? 27.515  61.176 63.429  1.00 67.13  ? 245  TYR A CZ  1 
ATOM 1938 O OH  . TYR A 1 248  ? 26.662  60.100 63.366  1.00 67.13  ? 245  TYR A OH  1 
ATOM 1939 N N   . LEU A 1 249  ? 27.339  65.893 61.836  1.00 54.36  ? 246  LEU A N   1 
ATOM 1940 C CA  . LEU A 1 249  ? 25.921  66.194 62.130  1.00 54.36  ? 246  LEU A CA  1 
ATOM 1941 C C   . LEU A 1 249  ? 24.960  65.061 61.796  1.00 54.36  ? 246  LEU A C   1 
ATOM 1942 O O   . LEU A 1 249  ? 24.993  64.519 60.690  1.00 54.36  ? 246  LEU A O   1 
ATOM 1943 C CB  . LEU A 1 249  ? 25.478  67.452 61.392  1.00 74.22  ? 246  LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 249  ? 25.944  68.806 61.935  1.00 74.22  ? 246  LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 249  ? 26.062  69.826 60.796  1.00 74.22  ? 246  LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 249  ? 25.029  69.323 63.061  1.00 74.22  ? 246  LEU A CD2 1 
ATOM 1947 N N   . ALA A 1 250  ? 24.075  64.718 62.729  1.00 57.82  ? 247  ALA A N   1 
ATOM 1948 C CA  . ALA A 1 250  ? 23.166  63.588 62.484  1.00 57.82  ? 247  ALA A CA  1 
ATOM 1949 C C   . ALA A 1 250  ? 21.701  63.784 62.870  1.00 57.82  ? 247  ALA A C   1 
ATOM 1950 O O   . ALA A 1 250  ? 21.391  64.094 64.024  1.00 57.82  ? 247  ALA A O   1 
ATOM 1951 C CB  . ALA A 1 250  ? 23.703  62.346 63.143  1.00 18.92  ? 247  ALA A CB  1 
ATOM 1952 N N   . ILE A 1 251  ? 20.812  63.557 61.900  1.00 73.06  ? 248  ILE A N   1 
ATOM 1953 C CA  . ILE A 1 251  ? 19.358  63.504 62.137  1.00 73.06  ? 248  ILE A CA  1 
ATOM 1954 C C   . ILE A 1 251  ? 18.841  62.101 61.909  1.00 73.06  ? 248  ILE A C   1 
ATOM 1955 O O   . ILE A 1 251  ? 19.305  61.411 61.007  1.00 73.06  ? 248  ILE A O   1 
ATOM 1956 C CB  . ILE A 1 251  ? 18.544  64.451 61.207  1.00 53.16  ? 248  ILE A CB  1 
ATOM 1957 C CG1 . ILE A 1 251  ? 18.752  64.079 59.717  1.00 53.16  ? 248  ILE A CG1 1 
ATOM 1958 C CG2 . ILE A 1 251  ? 18.873  65.913 61.513  1.00 53.16  ? 248  ILE A CG2 1 
ATOM 1959 C CD1 . ILE A 1 251  ? 17.632  64.541 58.754  1.00 53.16  ? 248  ILE A CD1 1 
ATOM 1960 N N   . ALA A 1 252  ? 17.863  61.685 62.702  1.00 58.97  ? 249  ALA A N   1 
ATOM 1961 C CA  . ALA A 1 252  ? 17.246  60.381 62.483  1.00 58.97  ? 249  ALA A CA  1 
ATOM 1962 C C   . ALA A 1 252  ? 15.701  60.456 62.425  1.00 58.97  ? 249  ALA A C   1 
ATOM 1963 O O   . ALA A 1 252  ? 15.021  59.868 63.285  1.00 58.97  ? 249  ALA A O   1 
ATOM 1964 C CB  . ALA A 1 252  ? 17.725  59.401 63.546  1.00 33.18  ? 249  ALA A CB  1 
ATOM 1965 N N   . PRO A 1 253  ? 15.146  61.148 61.385  1.00 44.06  ? 250  PRO A N   1 
ATOM 1966 C CA  . PRO A 1 253  ? 13.744  61.529 61.365  1.00 44.06  ? 250  PRO A CA  1 
ATOM 1967 C C   . PRO A 1 253  ? 12.872  60.303 61.173  1.00 44.06  ? 250  PRO A C   1 
ATOM 1968 O O   . PRO A 1 253  ? 13.026  59.587 60.178  1.00 44.06  ? 250  PRO A O   1 
ATOM 1969 C CB  . PRO A 1 253  ? 13.655  62.451 60.155  1.00 55.08  ? 250  PRO A CB  1 
ATOM 1970 C CG  . PRO A 1 253  ? 14.697  62.002 59.272  1.00 55.08  ? 250  PRO A CG  1 
ATOM 1971 C CD  . PRO A 1 253  ? 15.814  61.542 60.132  1.00 55.08  ? 250  PRO A CD  1 
ATOM 1972 N N   . PRO A 1 254  ? 11.975  60.033 62.135  1.00 78.43  ? 251  PRO A N   1 
ATOM 1973 C CA  . PRO A 1 254  ? 11.093  58.880 62.043  1.00 78.43  ? 251  PRO A CA  1 
ATOM 1974 C C   . PRO A 1 254  ? 10.635  58.667 60.605  1.00 78.43  ? 251  PRO A C   1 
ATOM 1975 O O   . PRO A 1 254  ? 10.750  57.562 60.059  1.00 78.43  ? 251  PRO A O   1 
ATOM 1976 C CB  . PRO A 1 254  ? 9.909   59.299 62.920  1.00 57.01  ? 251  PRO A CB  1 
ATOM 1977 C CG  . PRO A 1 254  ? 10.523  60.140 63.998  1.00 57.01  ? 251  PRO A CG  1 
ATOM 1978 C CD  . PRO A 1 254  ? 11.743  60.803 63.373  1.00 57.01  ? 251  PRO A CD  1 
ATOM 1979 N N   . ILE A 1 255  ? 10.170  59.757 60.004  1.00 70.04  ? 252  ILE A N   1 
ATOM 1980 C CA  . ILE A 1 255  ? 9.530   59.766 58.704  1.00 70.04  ? 252  ILE A CA  1 
ATOM 1981 C C   . ILE A 1 255  ? 10.232  58.911 57.654  1.00 70.04  ? 252  ILE A C   1 
ATOM 1982 O O   . ILE A 1 255  ? 9.563   58.333 56.797  1.00 70.04  ? 252  ILE A O   1 
ATOM 1983 C CB  . ILE A 1 255  ? 9.363   61.224 58.208  1.00 33.81  ? 252  ILE A CB  1 
ATOM 1984 C CG1 . ILE A 1 255  ? 8.190   61.405 57.226  1.00 33.81  ? 252  ILE A CG1 1 
ATOM 1985 C CG2 . ILE A 1 255  ? 10.699  61.832 57.642  1.00 33.81  ? 252  ILE A CG2 1 
ATOM 1986 C CD1 . ILE A 1 255  ? 8.031   62.966 56.794  1.00 33.81  ? 252  ILE A CD1 1 
ATOM 1987 N N   . ILE A 1 256  ? 11.562  58.815 57.706  1.00 44.04  ? 253  ILE A N   1 
ATOM 1988 C CA  . ILE A 1 256  ? 12.266  58.136 56.619  1.00 44.04  ? 253  ILE A CA  1 
ATOM 1989 C C   . ILE A 1 256  ? 12.510  56.657 56.866  1.00 44.04  ? 253  ILE A C   1 
ATOM 1990 O O   . ILE A 1 256  ? 12.929  55.954 55.963  1.00 44.04  ? 253  ILE A O   1 
ATOM 1991 C CB  . ILE A 1 256  ? 13.566  58.834 56.218  1.00 35.66  ? 253  ILE A CB  1 
ATOM 1992 C CG1 . ILE A 1 256  ? 14.661  58.529 57.243  1.00 35.66  ? 253  ILE A CG1 1 
ATOM 1993 C CG2 . ILE A 1 256  ? 13.337  60.354 55.976  1.00 35.66  ? 253  ILE A CG2 1 
ATOM 1994 C CD1 . ILE A 1 256  ? 16.059  59.064 56.832  1.00 35.66  ? 253  ILE A CD1 1 
ATOM 1995 N N   . LYS A 1 257  ? 12.222  56.170 58.065  1.00 53.89  ? 254  LYS A N   1 
ATOM 1996 C CA  . LYS A 1 257  ? 12.317  54.735 58.320  1.00 53.89  ? 254  LYS A CA  1 
ATOM 1997 C C   . LYS A 1 257  ? 11.427  53.885 57.383  1.00 53.89  ? 254  LYS A C   1 
ATOM 1998 O O   . LYS A 1 257  ? 11.847  52.791 56.960  1.00 53.89  ? 254  LYS A O   1 
ATOM 1999 C CB  . LYS A 1 257  ? 12.018  54.425 59.787  1.00 82.74  ? 254  LYS A CB  1 
ATOM 2000 C CG  . LYS A 1 257  ? 12.529  53.053 60.245  1.00 82.74  ? 254  LYS A CG  1 
ATOM 2001 C CD  . LYS A 1 257  ? 12.981  53.068 61.710  1.00 82.74  ? 254  LYS A CD  1 
ATOM 2002 C CE  . LYS A 1 257  ? 13.712  51.785 62.084  1.00 82.74  ? 254  LYS A CE  1 
ATOM 2003 N NZ  . LYS A 1 257  ? 14.729  51.390 61.062  1.00 82.74  ? 254  LYS A NZ  1 
ATOM 2004 N N   . GLN A 1 258  ? 10.223  54.394 57.056  1.00 47.66  ? 255  GLN A N   1 
ATOM 2005 C CA  . GLN A 1 258  ? 9.213   53.683 56.215  1.00 47.66  ? 255  GLN A CA  1 
ATOM 2006 C C   . GLN A 1 258  ? 9.744   52.971 54.941  1.00 47.66  ? 255  GLN A C   1 
ATOM 2007 O O   . GLN A 1 258  ? 9.201   51.954 54.497  1.00 47.66  ? 255  GLN A O   1 
ATOM 2008 C CB  . GLN A 1 258  ? 8.089   54.637 55.773  1.00 106.59 ? 255  GLN A CB  1 
ATOM 2009 C CG  . GLN A 1 258  ? 6.925   54.805 56.737  1.00 106.59 ? 255  GLN A CG  1 
ATOM 2010 C CD  . GLN A 1 258  ? 7.070   56.034 57.615  1.00 106.59 ? 255  GLN A CD  1 
ATOM 2011 O OE1 . GLN A 1 258  ? 8.076   56.199 58.315  1.00 106.59 ? 255  GLN A OE1 1 
ATOM 2012 N NE2 . GLN A 1 258  ? 6.061   56.907 57.586  1.00 106.59 ? 255  GLN A NE2 1 
ATOM 2013 N N   . SER A 1 259  ? 10.798  53.523 54.361  1.00 50.30  ? 256  SER A N   1 
ATOM 2014 C CA  . SER A 1 259  ? 11.253  53.097 53.069  1.00 50.30  ? 256  SER A CA  1 
ATOM 2015 C C   . SER A 1 259  ? 12.630  53.634 52.850  1.00 50.30  ? 256  SER A C   1 
ATOM 2016 O O   . SER A 1 259  ? 13.031  54.629 53.463  1.00 50.30  ? 256  SER A O   1 
ATOM 2017 C CB  . SER A 1 259  ? 10.336  53.651 51.988  1.00 48.56  ? 256  SER A CB  1 
ATOM 2018 O OG  . SER A 1 259  ? 10.779  53.272 50.699  1.00 48.56  ? 256  SER A OG  1 
ATOM 2019 N N   . THR A 1 260  ? 13.344  52.979 51.940  1.00 55.10  ? 257  THR A N   1 
ATOM 2020 C CA  . THR A 1 260  ? 14.738  53.302 51.682  1.00 55.10  ? 257  THR A CA  1 
ATOM 2021 C C   . THR A 1 260  ? 14.796  54.459 50.753  1.00 55.10  ? 257  THR A C   1 
ATOM 2022 O O   . THR A 1 260  ? 13.971  54.573 49.850  1.00 55.10  ? 257  THR A O   1 
ATOM 2023 C CB  . THR A 1 260  ? 15.495  52.133 51.041  1.00 51.37  ? 257  THR A CB  1 
ATOM 2024 O OG1 . THR A 1 260  ? 15.343  50.960 51.853  1.00 51.37  ? 257  THR A OG1 1 
ATOM 2025 C CG2 . THR A 1 260  ? 16.980  52.482 50.877  1.00 51.37  ? 257  THR A CG2 1 
ATOM 2026 N N   . ILE A 1 261  ? 15.770  55.323 50.992  1.00 36.70  ? 258  ILE A N   1 
ATOM 2027 C CA  . ILE A 1 261  ? 16.084  56.381 50.032  1.00 36.70  ? 258  ILE A CA  1 
ATOM 2028 C C   . ILE A 1 261  ? 16.939  55.800 48.919  1.00 36.70  ? 258  ILE A C   1 
ATOM 2029 O O   . ILE A 1 261  ? 17.921  55.133 49.173  1.00 36.70  ? 258  ILE A O   1 
ATOM 2030 C CB  . ILE A 1 261  ? 16.730  57.571 50.705  1.00 29.06  ? 258  ILE A CB  1 
ATOM 2031 C CG1 . ILE A 1 261  ? 15.669  58.244 51.583  1.00 29.06  ? 258  ILE A CG1 1 
ATOM 2032 C CG2 . ILE A 1 261  ? 17.202  58.529 49.694  1.00 29.06  ? 258  ILE A CG2 1 
ATOM 2033 C CD1 . ILE A 1 261  ? 16.245  58.964 52.797  1.00 29.06  ? 258  ILE A CD1 1 
ATOM 2034 N N   . VAL A 1 262  ? 16.527  56.030 47.687  1.00 34.16  ? 259  VAL A N   1 
ATOM 2035 C CA  . VAL A 1 262  ? 17.097  55.367 46.528  1.00 34.16  ? 259  VAL A CA  1 
ATOM 2036 C C   . VAL A 1 262  ? 17.921  56.303 45.671  1.00 34.16  ? 259  VAL A C   1 
ATOM 2037 O O   . VAL A 1 262  ? 18.870  55.843 45.042  1.00 34.16  ? 259  VAL A O   1 
ATOM 2038 C CB  . VAL A 1 262  ? 15.969  54.821 45.643  1.00 23.94  ? 259  VAL A CB  1 
ATOM 2039 C CG1 . VAL A 1 262  ? 16.403  54.738 44.169  1.00 23.94  ? 259  VAL A CG1 1 
ATOM 2040 C CG2 . VAL A 1 262  ? 15.494  53.473 46.199  1.00 23.94  ? 259  VAL A CG2 1 
ATOM 2041 N N   . CYS A 1 263  ? 17.531  57.586 45.613  1.00 47.87  ? 260  CYS A N   1 
ATOM 2042 C CA  . CYS A 1 263  ? 18.177  58.566 44.730  1.00 47.87  ? 260  CYS A CA  1 
ATOM 2043 C C   . CYS A 1 263  ? 18.109  59.993 45.264  1.00 47.87  ? 260  CYS A C   1 
ATOM 2044 O O   . CYS A 1 263  ? 17.228  60.297 46.057  1.00 47.87  ? 260  CYS A O   1 
ATOM 2045 C CB  . CYS A 1 263  ? 17.569  58.514 43.341  1.00 33.21  ? 260  CYS A CB  1 
ATOM 2046 S SG  . CYS A 1 263  ? 15.771  58.730 43.338  1.00 33.21  ? 260  CYS A SG  1 
ATOM 2047 N N   . HIS A 1 264  ? 19.043  60.847 44.828  1.00 30.73  ? 261  HIS A N   1 
ATOM 2048 C CA  . HIS A 1 264  ? 19.104  62.254 45.219  1.00 30.73  ? 261  HIS A CA  1 
ATOM 2049 C C   . HIS A 1 264  ? 19.409  63.173 44.056  1.00 30.73  ? 261  HIS A C   1 
ATOM 2050 O O   . HIS A 1 264  ? 19.656  62.742 42.930  1.00 30.73  ? 261  HIS A O   1 
ATOM 2051 C CB  . HIS A 1 264  ? 20.183  62.488 46.280  1.00 42.32  ? 261  HIS A CB  1 
ATOM 2052 C CG  . HIS A 1 264  ? 21.512  61.911 45.913  1.00 42.32  ? 261  HIS A CG  1 
ATOM 2053 N ND1 . HIS A 1 264  ? 22.436  62.596 45.151  1.00 42.32  ? 261  HIS A ND1 1 
ATOM 2054 C CD2 . HIS A 1 264  ? 22.057  60.694 46.175  1.00 42.32  ? 261  HIS A CD2 1 
ATOM 2055 C CE1 . HIS A 1 264  ? 23.489  61.821 44.952  1.00 42.32  ? 261  HIS A CE1 1 
ATOM 2056 N NE2 . HIS A 1 264  ? 23.286  60.665 45.565  1.00 42.32  ? 261  HIS A NE2 1 
ATOM 2057 N N   . ASN A 1 265  ? 19.402  64.464 44.343  1.00 31.95  ? 262  ASN A N   1 
ATOM 2058 C CA  . ASN A 1 265  ? 19.724  65.467 43.356  1.00 31.95  ? 262  ASN A CA  1 
ATOM 2059 C C   . ASN A 1 265  ? 19.918  66.757 44.089  1.00 31.95  ? 262  ASN A C   1 
ATOM 2060 O O   . ASN A 1 265  ? 19.141  67.052 45.011  1.00 31.95  ? 262  ASN A O   1 
ATOM 2061 C CB  . ASN A 1 265  ? 18.585  65.622 42.366  1.00 47.17  ? 262  ASN A CB  1 
ATOM 2062 C CG  . ASN A 1 265  ? 18.732  66.834 41.514  1.00 47.17  ? 262  ASN A CG  1 
ATOM 2063 O OD1 . ASN A 1 265  ? 19.210  66.755 40.389  1.00 47.17  ? 262  ASN A OD1 1 
ATOM 2064 N ND2 . ASN A 1 265  ? 18.353  67.972 42.045  1.00 47.17  ? 262  ASN A ND2 1 
ATOM 2065 N N   . ARG A 1 266  ? 20.983  67.488 43.718  1.00 35.85  ? 263  ARG A N   1 
ATOM 2066 C CA  . ARG A 1 266  ? 21.252  68.841 44.212  1.00 35.85  ? 263  ARG A CA  1 
ATOM 2067 C C   . ARG A 1 266  ? 20.294  69.779 43.539  1.00 35.85  ? 263  ARG A C   1 
ATOM 2068 O O   . ARG A 1 266  ? 20.191  69.773 42.310  1.00 35.85  ? 263  ARG A O   1 
ATOM 2069 C CB  . ARG A 1 266  ? 22.695  69.237 43.892  1.00 44.08  ? 263  ARG A CB  1 
ATOM 2070 C CG  . ARG A 1 266  ? 22.971  70.758 43.759  1.00 44.08  ? 263  ARG A CG  1 
ATOM 2071 C CD  . ARG A 1 266  ? 24.305  71.159 44.396  1.00 44.08  ? 263  ARG A CD  1 
ATOM 2072 N NE  . ARG A 1 266  ? 25.397  70.332 43.918  1.00 44.08  ? 263  ARG A NE  1 
ATOM 2073 C CZ  . ARG A 1 266  ? 25.729  70.171 42.631  1.00 44.08  ? 263  ARG A CZ  1 
ATOM 2074 N NH1 . ARG A 1 266  ? 25.043  70.771 41.665  1.00 44.08  ? 263  ARG A NH1 1 
ATOM 2075 N NH2 . ARG A 1 266  ? 26.742  69.377 42.303  1.00 44.08  ? 263  ARG A NH2 1 
ATOM 2076 N N   . VAL A 1 267  ? 19.588  70.571 44.338  1.00 36.91  ? 264  VAL A N   1 
ATOM 2077 C CA  . VAL A 1 267  ? 18.655  71.583 43.805  1.00 36.91  ? 264  VAL A CA  1 
ATOM 2078 C C   . VAL A 1 267  ? 19.350  72.944 43.591  1.00 36.91  ? 264  VAL A C   1 
ATOM 2079 O O   . VAL A 1 267  ? 19.274  73.553 42.509  1.00 36.91  ? 264  VAL A O   1 
ATOM 2080 C CB  . VAL A 1 267  ? 17.434  71.752 44.733  1.00 55.31  ? 264  VAL A CB  1 
ATOM 2081 C CG1 . VAL A 1 267  ? 16.504  72.865 44.237  1.00 55.31  ? 264  VAL A CG1 1 
ATOM 2082 C CG2 . VAL A 1 267  ? 16.689  70.446 44.830  1.00 55.31  ? 264  VAL A CG2 1 
ATOM 2083 N N   . ASP A 1 268  ? 20.021  73.396 44.643  1.00 58.75  ? 265  ASP A N   1 
ATOM 2084 C CA  . ASP A 1 268  ? 20.700  74.655 44.653  1.00 58.75  ? 265  ASP A CA  1 
ATOM 2085 C C   . ASP A 1 268  ? 22.187  74.394 44.604  1.00 58.75  ? 265  ASP A C   1 
ATOM 2086 O O   . ASP A 1 268  ? 22.695  73.633 45.408  1.00 58.75  ? 265  ASP A O   1 
ATOM 2087 C CB  . ASP A 1 268  ? 20.351  75.404 45.933  1.00 54.62  ? 265  ASP A CB  1 
ATOM 2088 C CG  . ASP A 1 268  ? 18.912  75.877 45.952  1.00 54.62  ? 265  ASP A CG  1 
ATOM 2089 O OD1 . ASP A 1 268  ? 18.421  76.289 44.872  1.00 54.62  ? 265  ASP A OD1 1 
ATOM 2090 O OD2 . ASP A 1 268  ? 18.284  75.845 47.046  1.00 54.62  ? 265  ASP A OD2 1 
ATOM 2091 N N   . PRO A 1 269  ? 22.887  75.047 43.666  1.00 52.39  ? 266  PRO A N   1 
ATOM 2092 C CA  . PRO A 1 269  ? 24.317  74.935 43.430  1.00 52.39  ? 266  PRO A CA  1 
ATOM 2093 C C   . PRO A 1 269  ? 25.197  74.980 44.679  1.00 52.39  ? 266  PRO A C   1 
ATOM 2094 O O   . PRO A 1 269  ? 26.272  74.385 44.702  1.00 52.39  ? 266  PRO A O   1 
ATOM 2095 C CB  . PRO A 1 269  ? 24.597  76.144 42.548  1.00 33.06  ? 266  PRO A CB  1 
ATOM 2096 C CG  . PRO A 1 269  ? 23.345  76.257 41.720  1.00 33.06  ? 266  PRO A CG  1 
ATOM 2097 C CD  . PRO A 1 269  ? 22.258  75.987 42.714  1.00 33.06  ? 266  PRO A CD  1 
ATOM 2098 N N   . ASN A 1 270  ? 24.755  75.676 45.707  1.00 41.47  ? 267  ASN A N   1 
ATOM 2099 C CA  . ASN A 1 270  ? 25.548  75.778 46.908  1.00 41.47  ? 267  ASN A CA  1 
ATOM 2100 C C   . ASN A 1 270  ? 25.331  74.521 47.686  1.00 41.47  ? 267  ASN A C   1 
ATOM 2101 O O   . ASN A 1 270  ? 26.143  74.144 48.538  1.00 41.47  ? 267  ASN A O   1 
ATOM 2102 C CB  . ASN A 1 270  ? 25.078  76.948 47.724  1.00 63.48  ? 267  ASN A CB  1 
ATOM 2103 C CG  . ASN A 1 270  ? 23.602  77.072 47.687  1.00 63.48  ? 267  ASN A CG  1 
ATOM 2104 O OD1 . ASN A 1 270  ? 23.007  77.247 46.618  1.00 63.48  ? 267  ASN A OD1 1 
ATOM 2105 N ND2 . ASN A 1 270  ? 22.978  76.938 48.844  1.00 63.48  ? 267  ASN A ND2 1 
ATOM 2106 N N   . GLY A 1 271  ? 24.215  73.866 47.396  1.00 42.90  ? 268  GLY A N   1 
ATOM 2107 C CA  . GLY A 1 271  ? 23.842  72.649 48.115  1.00 42.90  ? 268  GLY A CA  1 
ATOM 2108 C C   . GLY A 1 271  ? 23.176  72.942 49.437  1.00 42.90  ? 268  GLY A C   1 
ATOM 2109 O O   . GLY A 1 271  ? 23.375  72.228 50.403  1.00 42.90  ? 268  GLY A O   1 
ATOM 2110 N N   . SER A 1 272  ? 22.394  74.014 49.474  1.00 67.07  ? 269  SER A N   1 
ATOM 2111 C CA  . SER A 1 272  ? 21.543  74.302 50.608  1.00 67.07  ? 269  SER A CA  1 
ATOM 2112 C C   . SER A 1 272  ? 20.488  73.210 50.666  1.00 67.07  ? 269  SER A C   1 
ATOM 2113 O O   . SER A 1 272  ? 20.032  72.829 51.746  1.00 67.07  ? 269  SER A O   1 
ATOM 2114 C CB  . SER A 1 272  ? 20.864  75.648 50.399  1.00 77.83  ? 269  SER A CB  1 
ATOM 2115 O OG  . SER A 1 272  ? 20.299  75.725 49.095  1.00 77.83  ? 269  SER A OG  1 
ATOM 2116 N N   . ARG A 1 273  ? 20.144  72.704 49.479  1.00 54.87  ? 270  ARG A N   1 
ATOM 2117 C CA  . ARG A 1 273  ? 18.961  71.898 49.250  1.00 54.87  ? 270  ARG A CA  1 
ATOM 2118 C C   . ARG A 1 273  ? 19.128  70.727 48.278  1.00 54.87  ? 270  ARG A C   1 
ATOM 2119 O O   . ARG A 1 273  ? 19.624  70.890 47.159  1.00 54.87  ? 270  ARG A O   1 
ATOM 2120 C CB  . ARG A 1 273  ? 17.866  72.795 48.688  1.00 47.36  ? 270  ARG A CB  1 
ATOM 2121 C CG  . ARG A 1 273  ? 17.171  73.667 49.715  1.00 47.36  ? 270  ARG A CG  1 
ATOM 2122 C CD  . ARG A 1 273  ? 15.899  74.242 49.157  1.00 47.36  ? 270  ARG A CD  1 
ATOM 2123 N NE  . ARG A 1 273  ? 16.099  74.891 47.866  1.00 47.36  ? 270  ARG A NE  1 
ATOM 2124 C CZ  . ARG A 1 273  ? 15.113  75.433 47.155  1.00 47.36  ? 270  ARG A CZ  1 
ATOM 2125 N NH1 . ARG A 1 273  ? 13.864  75.407 47.619  1.00 47.36  ? 270  ARG A NH1 1 
ATOM 2126 N NH2 . ARG A 1 273  ? 15.365  76.008 45.989  1.00 47.36  ? 270  ARG A NH2 1 
ATOM 2127 N N   . TYR A 1 274  ? 18.649  69.558 48.692  1.00 34.16  ? 271  TYR A N   1 
ATOM 2128 C CA  . TYR A 1 274  ? 18.616  68.372 47.825  1.00 34.16  ? 271  TYR A CA  1 
ATOM 2129 C C   . TYR A 1 274  ? 17.245  67.718 47.791  1.00 34.16  ? 271  TYR A C   1 
ATOM 2130 O O   . TYR A 1 274  ? 16.456  67.824 48.755  1.00 34.16  ? 271  TYR A O   1 
ATOM 2131 C CB  . TYR A 1 274  ? 19.590  67.322 48.337  1.00 50.87  ? 271  TYR A CB  1 
ATOM 2132 C CG  . TYR A 1 274  ? 21.042  67.658 48.117  1.00 50.87  ? 271  TYR A CG  1 
ATOM 2133 C CD1 . TYR A 1 274  ? 21.715  68.534 48.971  1.00 50.87  ? 271  TYR A CD1 1 
ATOM 2134 C CD2 . TYR A 1 274  ? 21.742  67.092 47.055  1.00 50.87  ? 271  TYR A CD2 1 
ATOM 2135 C CE1 . TYR A 1 274  ? 23.029  68.836 48.759  1.00 50.87  ? 271  TYR A CE1 1 
ATOM 2136 C CE2 . TYR A 1 274  ? 23.042  67.381 46.840  1.00 50.87  ? 271  TYR A CE2 1 
ATOM 2137 C CZ  . TYR A 1 274  ? 23.692  68.252 47.687  1.00 50.87  ? 271  TYR A CZ  1 
ATOM 2138 O OH  . TYR A 1 274  ? 25.015  68.535 47.458  1.00 50.87  ? 271  TYR A OH  1 
ATOM 2139 N N   . LEU A 1 275  ? 16.981  67.019 46.689  1.00 34.15  ? 272  LEU A N   1 
ATOM 2140 C CA  . LEU A 1 275  ? 15.827  66.137 46.572  1.00 34.15  ? 272  LEU A CA  1 
ATOM 2141 C C   . LEU A 1 275  ? 16.185  64.716 47.009  1.00 34.15  ? 272  LEU A C   1 
ATOM 2142 O O   . LEU A 1 275  ? 17.291  64.266 46.764  1.00 34.15  ? 272  LEU A O   1 
ATOM 2143 C CB  . LEU A 1 275  ? 15.338  66.132 45.127  1.00 34.81  ? 272  LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 275  ? 14.648  67.433 44.693  1.00 34.81  ? 272  LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 275  ? 14.176  67.415 43.218  1.00 34.81  ? 272  LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 275  ? 13.468  67.755 45.645  1.00 34.81  ? 272  LEU A CD2 1 
ATOM 2147 N N   . LEU A 1 276  ? 15.280  64.001 47.665  1.00 37.79  ? 273  LEU A N   1 
ATOM 2148 C CA  . LEU A 1 276  ? 15.508  62.577 47.930  1.00 37.79  ? 273  LEU A CA  1 
ATOM 2149 C C   . LEU A 1 276  ? 14.368  61.712 47.390  1.00 37.79  ? 273  LEU A C   1 
ATOM 2150 O O   . LEU A 1 276  ? 13.182  62.050 47.558  1.00 37.79  ? 273  LEU A O   1 
ATOM 2151 C CB  . LEU A 1 276  ? 15.689  62.346 49.426  1.00 50.42  ? 273  LEU A CB  1 
ATOM 2152 C CG  . LEU A 1 276  ? 16.764  63.182 50.135  1.00 50.42  ? 273  LEU A CG  1 
ATOM 2153 C CD1 . LEU A 1 276  ? 16.850  62.826 51.597  1.00 50.42  ? 273  LEU A CD1 1 
ATOM 2154 C CD2 . LEU A 1 276  ? 18.130  63.016 49.481  1.00 50.42  ? 273  LEU A CD2 1 
ATOM 2155 N N   . GLY A 1 277  ? 14.715  60.599 46.745  1.00 38.18  ? 274  GLY A N   1 
ATOM 2156 C CA  . GLY A 1 277  ? 13.720  59.662 46.208  1.00 38.18  ? 274  GLY A CA  1 
ATOM 2157 C C   . GLY A 1 277  ? 13.525  58.442 47.087  1.00 38.18  ? 274  GLY A C   1 
ATOM 2158 O O   . GLY A 1 277  ? 14.481  57.895 47.600  1.00 38.18  ? 274  GLY A O   1 
ATOM 2159 N N   . ASP A 1 278  ? 12.283  57.997 47.224  1.00 33.46  ? 275  ASP A N   1 
ATOM 2160 C CA  . ASP A 1 278  ? 11.909  56.828 48.072  1.00 33.46  ? 275  ASP A CA  1 
ATOM 2161 C C   . ASP A 1 278  ? 11.599  55.549 47.290  1.00 33.46  ? 275  ASP A C   1 
ATOM 2162 O O   . ASP A 1 278  ? 11.149  55.625 46.147  1.00 33.46  ? 275  ASP A O   1 
ATOM 2163 C CB  . ASP A 1 278  ? 10.617  57.177 48.802  1.00 74.45  ? 275  ASP A CB  1 
ATOM 2164 C CG  . ASP A 1 278  ? 10.626  56.762 50.219  1.00 74.45  ? 275  ASP A CG  1 
ATOM 2165 O OD1 . ASP A 1 278  ? 9.601   56.919 50.860  1.00 74.45  ? 275  ASP A OD1 1 
ATOM 2166 O OD2 . ASP A 1 278  ? 11.654  56.301 50.719  1.00 74.45  ? 275  ASP A OD2 1 
ATOM 2167 N N   . MET A 1 279  ? 11.754  54.379 47.925  1.00 28.81  ? 276  MET A N   1 
ATOM 2168 C CA  . MET A 1 279  ? 11.212  53.125 47.353  1.00 28.81  ? 276  MET A CA  1 
ATOM 2169 C C   . MET A 1 279  ? 9.704   53.283 47.152  1.00 28.81  ? 276  MET A C   1 
ATOM 2170 O O   . MET A 1 279  ? 9.150   52.721 46.235  1.00 28.81  ? 276  MET A O   1 
ATOM 2171 C CB  . MET A 1 279  ? 11.539  51.909 48.211  1.00 88.81  ? 276  MET A CB  1 
ATOM 2172 C CG  . MET A 1 279  ? 11.658  50.620 47.412  1.00 88.81  ? 276  MET A CG  1 
ATOM 2173 S SD  . MET A 1 279  ? 10.271  50.263 46.258  1.00 88.81  ? 276  MET A SD  1 
ATOM 2174 C CE  . MET A 1 279  ? 9.002   49.534 47.367  1.00 88.81  ? 276  MET A CE  1 
ATOM 2175 N N   . GLU A 1 280  ? 9.067   54.102 47.999  1.00 42.28  ? 277  GLU A N   1 
ATOM 2176 C CA  . GLU A 1 280  ? 7.629   54.382 47.967  1.00 42.28  ? 277  GLU A CA  1 
ATOM 2177 C C   . GLU A 1 280  ? 7.185   55.322 46.839  1.00 42.28  ? 277  GLU A C   1 
ATOM 2178 O O   . GLU A 1 280  ? 6.035   55.299 46.435  1.00 42.28  ? 277  GLU A O   1 
ATOM 2179 C CB  . GLU A 1 280  ? 7.200   55.028 49.275  1.00 114.13 ? 277  GLU A CB  1 
ATOM 2180 C CG  . GLU A 1 280  ? 7.558   54.265 50.501  1.00 114.13 ? 277  GLU A CG  1 
ATOM 2181 C CD  . GLU A 1 280  ? 6.552   53.225 50.826  1.00 114.13 ? 277  GLU A CD  1 
ATOM 2182 O OE1 . GLU A 1 280  ? 6.384   52.289 50.022  1.00 114.13 ? 277  GLU A OE1 1 
ATOM 2183 O OE2 . GLU A 1 280  ? 5.932   53.348 51.895  1.00 114.13 ? 277  GLU A OE2 1 
ATOM 2184 N N   . GLY A 1 281  ? 8.066   56.168 46.339  1.00 36.91  ? 278  GLY A N   1 
ATOM 2185 C CA  . GLY A 1 281  ? 7.622   57.235 45.448  1.00 36.91  ? 278  GLY A CA  1 
ATOM 2186 C C   . GLY A 1 281  ? 7.511   58.574 46.175  1.00 36.91  ? 278  GLY A C   1 
ATOM 2187 O O   . GLY A 1 281  ? 7.257   59.602 45.542  1.00 36.91  ? 278  GLY A O   1 
ATOM 2188 N N   . ARG A 1 282  ? 7.715   58.560 47.498  1.00 24.17  ? 279  ARG A N   1 
ATOM 2189 C CA  . ARG A 1 282  ? 7.747   59.791 48.329  1.00 24.17  ? 279  ARG A CA  1 
ATOM 2190 C C   . ARG A 1 282  ? 8.901   60.680 47.938  1.00 24.17  ? 279  ARG A C   1 
ATOM 2191 O O   . ARG A 1 282  ? 9.957   60.177 47.579  1.00 24.17  ? 279  ARG A O   1 
ATOM 2192 C CB  . ARG A 1 282  ? 7.777   59.486 49.827  1.00 54.85  ? 279  ARG A CB  1 
ATOM 2193 C CG  . ARG A 1 282  ? 6.541   58.749 50.313  1.00 54.85  ? 279  ARG A CG  1 
ATOM 2194 C CD  . ARG A 1 282  ? 6.529   58.544 51.824  1.00 54.85  ? 279  ARG A CD  1 
ATOM 2195 N NE  . ARG A 1 282  ? 7.702   57.818 52.292  1.00 54.85  ? 279  ARG A NE  1 
ATOM 2196 C CZ  . ARG A 1 282  ? 8.131   57.775 53.550  1.00 54.85  ? 279  ARG A CZ  1 
ATOM 2197 N NH1 . ARG A 1 282  ? 7.461   58.411 54.498  1.00 54.85  ? 279  ARG A NH1 1 
ATOM 2198 N NH2 . ARG A 1 282  ? 9.243   57.094 53.859  1.00 54.85  ? 279  ARG A NH2 1 
ATOM 2199 N N   . LEU A 1 283  ? 8.692   61.997 47.935  1.00 37.74  ? 280  LEU A N   1 
ATOM 2200 C CA  . LEU A 1 283  ? 9.775   62.933 47.595  1.00 37.74  ? 280  LEU A CA  1 
ATOM 2201 C C   . LEU A 1 283  ? 10.124  63.713 48.828  1.00 37.74  ? 280  LEU A C   1 
ATOM 2202 O O   . LEU A 1 283  ? 9.240   64.182 49.523  1.00 37.74  ? 280  LEU A O   1 
ATOM 2203 C CB  . LEU A 1 283  ? 9.345   63.890 46.503  1.00 29.64  ? 280  LEU A CB  1 
ATOM 2204 C CG  . LEU A 1 283  ? 10.444  64.656 45.738  1.00 29.64  ? 280  LEU A CG  1 
ATOM 2205 C CD1 . LEU A 1 283  ? 11.619  63.788 45.336  1.00 29.64  ? 280  LEU A CD1 1 
ATOM 2206 C CD2 . LEU A 1 283  ? 9.959   65.365 44.482  1.00 29.64  ? 280  LEU A CD2 1 
ATOM 2207 N N   . PHE A 1 284  ? 11.404  63.840 49.130  1.00 48.11  ? 281  PHE A N   1 
ATOM 2208 C CA  . PHE A 1 284  ? 11.791  64.665 50.277  1.00 48.11  ? 281  PHE A CA  1 
ATOM 2209 C C   . PHE A 1 284  ? 12.627  65.840 49.843  1.00 48.11  ? 281  PHE A C   1 
ATOM 2210 O O   . PHE A 1 284  ? 13.260  65.775 48.798  1.00 48.11  ? 281  PHE A O   1 
ATOM 2211 C CB  . PHE A 1 284  ? 12.548  63.849 51.325  1.00 45.75  ? 281  PHE A CB  1 
ATOM 2212 C CG  . PHE A 1 284  ? 11.729  62.740 51.945  1.00 45.75  ? 281  PHE A CG  1 
ATOM 2213 C CD1 . PHE A 1 284  ? 11.795  61.431 51.432  1.00 45.75  ? 281  PHE A CD1 1 
ATOM 2214 C CD2 . PHE A 1 284  ? 10.896  62.998 53.041  1.00 45.75  ? 281  PHE A CD2 1 
ATOM 2215 C CE1 . PHE A 1 284  ? 11.049  60.393 52.006  1.00 45.75  ? 281  PHE A CE1 1 
ATOM 2216 C CE2 . PHE A 1 284  ? 10.134  61.978 53.628  1.00 45.75  ? 281  PHE A CE2 1 
ATOM 2217 C CZ  . PHE A 1 284  ? 10.216  60.663 53.110  1.00 45.75  ? 281  PHE A CZ  1 
ATOM 2218 N N   . MET A 1 285  ? 12.581  66.922 50.628  1.00 32.15  ? 282  MET A N   1 
ATOM 2219 C CA  . MET A 1 285  ? 13.591  67.960 50.579  1.00 32.15  ? 282  MET A CA  1 
ATOM 2220 C C   . MET A 1 285  ? 14.531  67.791 51.747  1.00 32.15  ? 282  MET A C   1 
ATOM 2221 O O   . MET A 1 285  ? 14.103  67.748 52.919  1.00 32.15  ? 282  MET A O   1 
ATOM 2222 C CB  . MET A 1 285  ? 13.004  69.349 50.610  1.00 51.35  ? 282  MET A CB  1 
ATOM 2223 C CG  . MET A 1 285  ? 14.015  70.417 50.217  1.00 51.35  ? 282  MET A CG  1 
ATOM 2224 S SD  . MET A 1 285  ? 14.349  70.363 48.452  1.00 51.35  ? 282  MET A SD  1 
ATOM 2225 C CE  . MET A 1 285  ? 12.925  71.186 47.749  1.00 51.35  ? 282  MET A CE  1 
ATOM 2226 N N   . LEU A 1 286  ? 15.823  67.676 51.411  1.00 45.61  ? 283  LEU A N   1 
ATOM 2227 C CA  . LEU A 1 286  ? 16.911  67.722 52.393  1.00 45.61  ? 283  LEU A CA  1 
ATOM 2228 C C   . LEU A 1 286  ? 17.377  69.156 52.414  1.00 45.61  ? 283  LEU A C   1 
ATOM 2229 O O   . LEU A 1 286  ? 17.701  69.726 51.353  1.00 45.61  ? 283  LEU A O   1 
ATOM 2230 C CB  . LEU A 1 286  ? 18.072  66.833 51.978  1.00 40.54  ? 283  LEU A CB  1 
ATOM 2231 C CG  . LEU A 1 286  ? 18.886  66.038 53.013  1.00 40.54  ? 283  LEU A CG  1 
ATOM 2232 C CD1 . LEU A 1 286  ? 20.299  65.816 52.457  1.00 40.54  ? 283  LEU A CD1 1 
ATOM 2233 C CD2 . LEU A 1 286  ? 18.977  66.611 54.441  1.00 40.54  ? 283  LEU A CD2 1 
ATOM 2234 N N   . LEU A 1 287  ? 17.372  69.735 53.615  1.00 45.71  ? 284  LEU A N   1 
ATOM 2235 C CA  . LEU A 1 287  ? 17.776  71.131 53.809  1.00 45.71  ? 284  LEU A CA  1 
ATOM 2236 C C   . LEU A 1 287  ? 18.899  71.197 54.798  1.00 45.71  ? 284  LEU A C   1 
ATOM 2237 O O   . LEU A 1 287  ? 18.855  70.569 55.860  1.00 45.71  ? 284  LEU A O   1 
ATOM 2238 C CB  . LEU A 1 287  ? 16.620  72.004 54.296  1.00 52.74  ? 284  LEU A CB  1 
ATOM 2239 C CG  . LEU A 1 287  ? 15.467  72.070 53.301  1.00 52.74  ? 284  LEU A CG  1 
ATOM 2240 C CD1 . LEU A 1 287  ? 14.175  71.575 53.940  1.00 52.74  ? 284  LEU A CD1 1 
ATOM 2241 C CD2 . LEU A 1 287  ? 15.314  73.464 52.710  1.00 52.74  ? 284  LEU A CD2 1 
ATOM 2242 N N   . LEU A 1 288  ? 19.907  71.973 54.435  1.00 58.49  ? 285  LEU A N   1 
ATOM 2243 C CA  . LEU A 1 288  ? 21.038  72.172 55.292  1.00 58.49  ? 285  LEU A CA  1 
ATOM 2244 C C   . LEU A 1 288  ? 20.985  73.603 55.750  1.00 58.49  ? 285  LEU A C   1 
ATOM 2245 O O   . LEU A 1 288  ? 21.175  74.514 54.954  1.00 58.49  ? 285  LEU A O   1 
ATOM 2246 C CB  . LEU A 1 288  ? 22.324  71.905 54.511  1.00 59.89  ? 285  LEU A CB  1 
ATOM 2247 C CG  . LEU A 1 288  ? 22.447  70.607 53.702  1.00 59.89  ? 285  LEU A CG  1 
ATOM 2248 C CD1 . LEU A 1 288  ? 23.766  70.595 52.944  1.00 59.89  ? 285  LEU A CD1 1 
ATOM 2249 C CD2 . LEU A 1 288  ? 22.324  69.384 54.624  1.00 59.89  ? 285  LEU A CD2 1 
ATOM 2250 N N   . GLU A 1 289  ? 20.706  73.816 57.027  1.00 62.52  ? 286  GLU A N   1 
ATOM 2251 C CA  . GLU A 1 289  ? 20.717  75.168 57.557  1.00 62.52  ? 286  GLU A CA  1 
ATOM 2252 C C   . GLU A 1 289  ? 22.164  75.662 57.646  1.00 62.52  ? 286  GLU A C   1 
ATOM 2253 O O   . GLU A 1 289  ? 22.929  75.186 58.501  1.00 62.52  ? 286  GLU A O   1 
ATOM 2254 C CB  . GLU A 1 289  ? 20.025  75.216 58.919  1.00 82.74  ? 286  GLU A CB  1 
ATOM 2255 C CG  . GLU A 1 289  ? 19.160  76.458 59.131  1.00 82.74  ? 286  GLU A CG  1 
ATOM 2256 C CD  . GLU A 1 289  ? 18.967  76.794 60.611  1.00 82.74  ? 286  GLU A CD  1 
ATOM 2257 O OE1 . GLU A 1 289  ? 19.294  77.942 61.010  1.00 82.74  ? 286  GLU A OE1 1 
ATOM 2258 O OE2 . GLU A 1 289  ? 18.508  75.909 61.377  1.00 82.74  ? 286  GLU A OE2 1 
ATOM 2259 N N   . LYS A 1 290  ? 22.527  76.596 56.750  1.00 66.02  ? 287  LYS A N   1 
ATOM 2260 C CA  . LYS A 1 290  ? 23.845  77.296 56.758  1.00 66.02  ? 287  LYS A CA  1 
ATOM 2261 C C   . LYS A 1 290  ? 24.044  78.122 58.038  1.00 66.02  ? 287  LYS A C   1 
ATOM 2262 O O   . LYS A 1 290  ? 23.268  78.016 58.986  1.00 66.02  ? 287  LYS A O   1 
ATOM 2263 C CB  . LYS A 1 290  ? 24.040  78.241 55.539  1.00 74.19  ? 287  LYS A CB  1 
ATOM 2264 C CG  . LYS A 1 290  ? 23.227  77.955 54.269  1.00 74.19  ? 287  LYS A CG  1 
ATOM 2265 C CD  . LYS A 1 290  ? 23.592  78.919 53.112  1.00 74.19  ? 287  LYS A CD  1 
ATOM 2266 C CE  . LYS A 1 290  ? 22.505  78.933 51.989  1.00 74.19  ? 287  LYS A CE  1 
ATOM 2267 N NZ  . LYS A 1 290  ? 22.992  79.265 50.599  1.00 74.19  ? 287  LYS A NZ  1 
ATOM 2268 N N   . GLU A 1 291  ? 25.094  78.936 58.044  1.00 160.73 ? 288  GLU A N   1 
ATOM 2269 C CA  . GLU A 1 291  ? 25.418  79.783 59.185  1.00 160.73 ? 288  GLU A CA  1 
ATOM 2270 C C   . GLU A 1 291  ? 26.608  80.673 58.846  1.00 160.73 ? 288  GLU A C   1 
ATOM 2271 O O   . GLU A 1 291  ? 27.689  80.181 58.524  1.00 160.73 ? 288  GLU A O   1 
ATOM 2272 C CB  . GLU A 1 291  ? 25.728  78.931 60.417  1.00 103.03 ? 288  GLU A CB  1 
ATOM 2273 C CG  . GLU A 1 291  ? 26.066  79.738 61.660  1.00 103.03 ? 288  GLU A CG  1 
ATOM 2274 C CD  . GLU A 1 291  ? 26.357  78.861 62.862  1.00 103.03 ? 288  GLU A CD  1 
ATOM 2275 O OE1 . GLU A 1 291  ? 26.297  77.621 62.724  1.00 103.03 ? 288  GLU A OE1 1 
ATOM 2276 O OE2 . GLU A 1 291  ? 26.645  79.412 63.945  1.00 103.03 ? 288  GLU A OE2 1 
ATOM 2277 N N   . GLU A 1 292  ? 26.403  81.985 58.915  1.00 189.35 ? 289  GLU A N   1 
ATOM 2278 C CA  . GLU A 1 292  ? 27.460  82.937 58.596  1.00 189.35 ? 289  GLU A CA  1 
ATOM 2279 C C   . GLU A 1 292  ? 28.091  83.563 59.837  1.00 189.35 ? 289  GLU A C   1 
ATOM 2280 O O   . GLU A 1 292  ? 27.392  84.023 60.739  1.00 189.35 ? 289  GLU A O   1 
ATOM 2281 C CB  . GLU A 1 292  ? 26.927  84.035 57.672  1.00 187.47 ? 289  GLU A CB  1 
ATOM 2282 C CG  . GLU A 1 292  ? 27.965  85.074 57.279  1.00 187.47 ? 289  GLU A CG  1 
ATOM 2283 C CD  . GLU A 1 292  ? 27.403  86.140 56.359  1.00 187.47 ? 289  GLU A CD  1 
ATOM 2284 O OE1 . GLU A 1 292  ? 26.200  86.069 56.029  1.00 187.47 ? 289  GLU A OE1 1 
ATOM 2285 O OE2 . GLU A 1 292  ? 28.163  87.050 55.967  1.00 187.47 ? 289  GLU A OE2 1 
ATOM 2286 N N   . GLN A 1 293  ? 29.420  83.597 59.855  1.00 195.03 ? 290  GLN A N   1 
ATOM 2287 C CA  . GLN A 1 293  ? 30.168  84.226 60.937  1.00 195.03 ? 290  GLN A CA  1 
ATOM 2288 C C   . GLN A 1 293  ? 31.299  85.083 60.374  1.00 195.03 ? 290  GLN A C   1 
ATOM 2289 O O   . GLN A 1 293  ? 32.313  84.560 59.911  1.00 195.03 ? 290  GLN A O   1 
ATOM 2290 C CB  . GLN A 1 293  ? 30.730  83.167 61.888  1.00 94.30  ? 290  GLN A CB  1 
ATOM 2291 C CG  . GLN A 1 293  ? 31.669  82.173 61.224  1.00 94.30  ? 290  GLN A CG  1 
ATOM 2292 C CD  . GLN A 1 293  ? 32.199  81.135 62.194  1.00 94.30  ? 290  GLN A CD  1 
ATOM 2293 O OE1 . GLN A 1 293  ? 31.868  81.151 63.380  1.00 94.30  ? 290  GLN A OE1 1 
ATOM 2294 N NE2 . GLN A 1 293  ? 33.025  80.225 61.693  1.00 94.30  ? 290  GLN A NE2 1 
ATOM 2295 N N   . MET A 1 294  ? 31.116  86.399 60.413  1.00 201.00 ? 291  MET A N   1 
ATOM 2296 C CA  . MET A 1 294  ? 32.108  87.334 59.890  1.00 201.00 ? 291  MET A CA  1 
ATOM 2297 C C   . MET A 1 294  ? 33.521  86.764 59.970  1.00 201.00 ? 291  MET A C   1 
ATOM 2298 O O   . MET A 1 294  ? 33.837  85.989 60.873  1.00 201.00 ? 291  MET A O   1 
ATOM 2299 C CB  . MET A 1 294  ? 32.036  88.666 60.641  1.00 157.69 ? 291  MET A CB  1 
ATOM 2300 C CG  . MET A 1 294  ? 30.689  89.363 60.541  1.00 157.69 ? 291  MET A CG  1 
ATOM 2301 S SD  . MET A 1 294  ? 30.646  90.925 61.440  1.00 157.69 ? 291  MET A SD  1 
ATOM 2302 C CE  . MET A 1 294  ? 31.946  91.832 60.605  1.00 157.69 ? 291  MET A CE  1 
ATOM 2303 N N   . ASP A 1 295  ? 34.370  87.154 59.023  1.00 155.93 ? 292  ASP A N   1 
ATOM 2304 C CA  . ASP A 1 295  ? 35.741  86.661 58.984  1.00 155.93 ? 292  ASP A CA  1 
ATOM 2305 C C   . ASP A 1 295  ? 35.788  85.145 59.148  1.00 155.93 ? 292  ASP A C   1 
ATOM 2306 O O   . ASP A 1 295  ? 36.657  84.613 59.838  1.00 155.93 ? 292  ASP A O   1 
ATOM 2307 C CB  . ASP A 1 295  ? 36.583  87.334 60.070  1.00 201.00 ? 292  ASP A CB  1 
ATOM 2308 C CG  . ASP A 1 295  ? 36.638  88.841 59.914  1.00 201.00 ? 292  ASP A CG  1 
ATOM 2309 O OD1 . ASP A 1 295  ? 36.021  89.365 58.963  1.00 201.00 ? 292  ASP A OD1 1 
ATOM 2310 O OD2 . ASP A 1 295  ? 37.299  89.501 60.743  1.00 201.00 ? 292  ASP A OD2 1 
ATOM 2311 N N   . GLY A 1 296  ? 34.853  84.491 58.488  1.00 176.82 ? 293  GLY A N   1 
ATOM 2312 C CA  . GLY A 1 296  ? 34.744  83.059 58.528  1.00 176.82 ? 293  GLY A CA  1 
ATOM 2313 C C   . GLY A 1 296  ? 33.686  82.646 57.533  1.00 176.82 ? 293  GLY A C   1 
ATOM 2314 O O   . GLY A 1 296  ? 32.500  82.674 57.836  1.00 176.82 ? 293  GLY A O   1 
ATOM 2315 N N   . THR A 1 297  ? 34.137  82.270 56.344  1.00 201.00 ? 294  THR A N   1 
ATOM 2316 C CA  . THR A 1 297  ? 33.261  81.850 55.268  1.00 201.00 ? 294  THR A CA  1 
ATOM 2317 C C   . THR A 1 297  ? 31.875  81.490 55.796  1.00 201.00 ? 294  THR A C   1 
ATOM 2318 O O   . THR A 1 297  ? 31.076  82.374 56.063  1.00 201.00 ? 294  THR A O   1 
ATOM 2319 C CB  . THR A 1 297  ? 33.890  80.699 54.449  1.00 118.74 ? 294  THR A CB  1 
ATOM 2320 O OG1 . THR A 1 297  ? 35.234  81.041 54.081  1.00 118.74 ? 294  THR A OG1 1 
ATOM 2321 C CG2 . THR A 1 297  ? 33.089  80.450 53.189  1.00 118.74 ? 294  THR A CG2 1 
ATOM 2322 N N   . VAL A 1 298  ? 31.588  80.204 55.932  1.00 150.59 ? 295  VAL A N   1 
ATOM 2323 C CA  . VAL A 1 298  ? 30.316  79.725 56.460  1.00 150.59 ? 295  VAL A CA  1 
ATOM 2324 C C   . VAL A 1 298  ? 30.472  78.357 57.116  1.00 150.59 ? 295  VAL A C   1 
ATOM 2325 O O   . VAL A 1 298  ? 31.538  77.744 57.051  1.00 150.59 ? 295  VAL A O   1 
ATOM 2326 C CB  . VAL A 1 298  ? 29.245  79.635 55.357  1.00 130.88 ? 295  VAL A CB  1 
ATOM 2327 C CG1 . VAL A 1 298  ? 28.959  81.015 54.784  1.00 130.88 ? 295  VAL A CG1 1 
ATOM 2328 C CG2 . VAL A 1 298  ? 29.689  78.677 54.263  1.00 130.88 ? 295  VAL A CG2 1 
ATOM 2329 N N   . THR A 1 299  ? 29.402  77.884 57.748  1.00 100.86 ? 296  THR A N   1 
ATOM 2330 C CA  . THR A 1 299  ? 29.418  76.589 58.417  1.00 100.86 ? 296  THR A CA  1 
ATOM 2331 C C   . THR A 1 299  ? 28.141  75.806 58.131  1.00 100.86 ? 296  THR A C   1 
ATOM 2332 O O   . THR A 1 299  ? 27.487  76.018 57.109  1.00 100.86 ? 296  THR A O   1 
ATOM 2333 C CB  . THR A 1 299  ? 29.584  76.742 59.940  1.00 105.85 ? 296  THR A CB  1 
ATOM 2334 O OG1 . THR A 1 299  ? 29.605  75.447 60.554  1.00 105.85 ? 296  THR A OG1 1 
ATOM 2335 C CG2 . THR A 1 299  ? 28.439  77.556 60.522  1.00 105.85 ? 296  THR A CG2 1 
ATOM 2336 N N   . LEU A 1 300  ? 27.791  74.901 59.039  1.00 114.23 ? 297  LEU A N   1 
ATOM 2337 C CA  . LEU A 1 300  ? 26.589  74.084 58.885  1.00 114.23 ? 297  LEU A CA  1 
ATOM 2338 C C   . LEU A 1 300  ? 25.962  73.847 60.252  1.00 114.23 ? 297  LEU A C   1 
ATOM 2339 O O   . LEU A 1 300  ? 26.441  73.016 61.036  1.00 114.23 ? 297  LEU A O   1 
ATOM 2340 C CB  . LEU A 1 300  ? 26.914  72.736 58.238  1.00 201.00 ? 297  LEU A CB  1 
ATOM 2341 C CG  . LEU A 1 300  ? 27.145  72.660 56.731  1.00 201.00 ? 297  LEU A CG  1 
ATOM 2342 C CD1 . LEU A 1 300  ? 28.630  72.737 56.389  1.00 201.00 ? 297  LEU A CD1 1 
ATOM 2343 C CD2 . LEU A 1 300  ? 26.553  71.367 56.212  1.00 201.00 ? 297  LEU A CD2 1 
ATOM 2344 N N   . LYS A 1 301  ? 24.893  74.578 60.545  1.00 75.08  ? 298  LYS A N   1 
ATOM 2345 C CA  . LYS A 1 301  ? 24.304  74.488 61.862  1.00 75.08  ? 298  LYS A CA  1 
ATOM 2346 C C   . LYS A 1 301  ? 23.437  73.246 61.961  1.00 75.08  ? 298  LYS A C   1 
ATOM 2347 O O   . LYS A 1 301  ? 23.549  72.490 62.933  1.00 75.08  ? 298  LYS A O   1 
ATOM 2348 C CB  . LYS A 1 301  ? 23.536  75.772 62.218  1.00 127.99 ? 298  LYS A CB  1 
ATOM 2349 C CG  . LYS A 1 301  ? 22.880  75.814 63.621  1.00 127.99 ? 298  LYS A CG  1 
ATOM 2350 C CD  . LYS A 1 301  ? 23.750  75.232 64.757  1.00 127.99 ? 298  LYS A CD  1 
ATOM 2351 C CE  . LYS A 1 301  ? 24.854  76.168 65.232  1.00 127.99 ? 298  LYS A CE  1 
ATOM 2352 N NZ  . LYS A 1 301  ? 24.324  77.293 66.047  1.00 127.99 ? 298  LYS A NZ  1 
ATOM 2353 N N   . ASP A 1 302  ? 22.584  73.017 60.960  1.00 61.25  ? 299  ASP A N   1 
ATOM 2354 C CA  . ASP A 1 302  ? 21.656  71.891 61.039  1.00 61.25  ? 299  ASP A CA  1 
ATOM 2355 C C   . ASP A 1 302  ? 21.207  71.424 59.679  1.00 61.25  ? 299  ASP A C   1 
ATOM 2356 O O   . ASP A 1 302  ? 21.414  72.124 58.689  1.00 61.25  ? 299  ASP A O   1 
ATOM 2357 C CB  . ASP A 1 302  ? 20.440  72.263 61.882  1.00 66.29  ? 299  ASP A CB  1 
ATOM 2358 C CG  . ASP A 1 302  ? 19.810  71.056 62.551  1.00 66.29  ? 299  ASP A CG  1 
ATOM 2359 O OD1 . ASP A 1 302  ? 20.388  69.947 62.490  1.00 66.29  ? 299  ASP A OD1 1 
ATOM 2360 O OD2 . ASP A 1 302  ? 18.722  71.214 63.150  1.00 66.29  ? 299  ASP A OD2 1 
ATOM 2361 N N   . LEU A 1 303  ? 20.601  70.232 59.644  1.00 59.18  ? 300  LEU A N   1 
ATOM 2362 C CA  . LEU A 1 303  ? 19.920  69.706 58.439  1.00 59.18  ? 300  LEU A CA  1 
ATOM 2363 C C   . LEU A 1 303  ? 18.560  69.074 58.766  1.00 59.18  ? 300  LEU A C   1 
ATOM 2364 O O   . LEU A 1 303  ? 18.408  68.460 59.813  1.00 59.18  ? 300  LEU A O   1 
ATOM 2365 C CB  . LEU A 1 303  ? 20.822  68.719 57.674  1.00 71.89  ? 300  LEU A CB  1 
ATOM 2366 C CG  . LEU A 1 303  ? 21.300  67.388 58.273  1.00 71.89  ? 300  LEU A CG  1 
ATOM 2367 C CD1 . LEU A 1 303  ? 22.325  66.778 57.342  1.00 71.89  ? 300  LEU A CD1 1 
ATOM 2368 C CD2 . LEU A 1 303  ? 21.888  67.506 59.683  1.00 71.89  ? 300  LEU A CD2 1 
ATOM 2369 N N   . ARG A 1 304  ? 17.566  69.235 57.894  1.00 54.40  ? 301  ARG A N   1 
ATOM 2370 C CA  . ARG A 1 304  ? 16.266  68.570 58.113  1.00 54.40  ? 301  ARG A CA  1 
ATOM 2371 C C   . ARG A 1 304  ? 15.606  68.081 56.839  1.00 54.40  ? 301  ARG A C   1 
ATOM 2372 O O   . ARG A 1 304  ? 15.832  68.604 55.738  1.00 54.40  ? 301  ARG A O   1 
ATOM 2373 C CB  . ARG A 1 304  ? 15.276  69.458 58.911  1.00 51.39  ? 301  ARG A CB  1 
ATOM 2374 C CG  . ARG A 1 304  ? 14.494  70.478 58.083  1.00 51.39  ? 301  ARG A CG  1 
ATOM 2375 C CD  . ARG A 1 304  ? 14.360  71.799 58.818  1.00 51.39  ? 301  ARG A CD  1 
ATOM 2376 N NE  . ARG A 1 304  ? 14.500  72.885 57.853  1.00 51.39  ? 301  ARG A NE  1 
ATOM 2377 C CZ  . ARG A 1 304  ? 13.488  73.431 57.171  1.00 51.39  ? 301  ARG A CZ  1 
ATOM 2378 N NH1 . ARG A 1 304  ? 12.240  73.021 57.397  1.00 51.39  ? 301  ARG A NH1 1 
ATOM 2379 N NH2 . ARG A 1 304  ? 13.712  74.392 56.265  1.00 51.39  ? 301  ARG A NH2 1 
ATOM 2380 N N   . VAL A 1 305  ? 14.746  67.090 57.032  1.00 42.48  ? 302  VAL A N   1 
ATOM 2381 C CA  . VAL A 1 305  ? 13.981  66.470 55.958  1.00 42.48  ? 302  VAL A CA  1 
ATOM 2382 C C   . VAL A 1 305  ? 12.529  66.942 55.999  1.00 42.48  ? 302  VAL A C   1 
ATOM 2383 O O   . VAL A 1 305  ? 11.897  66.944 57.058  1.00 42.48  ? 302  VAL A O   1 
ATOM 2384 C CB  . VAL A 1 305  ? 14.059  64.933 56.147  1.00 31.72  ? 302  VAL A CB  1 
ATOM 2385 C CG1 . VAL A 1 305  ? 12.924  64.218 55.492  1.00 31.72  ? 302  VAL A CG1 1 
ATOM 2386 C CG2 . VAL A 1 305  ? 15.438  64.387 55.653  1.00 31.72  ? 302  VAL A CG2 1 
ATOM 2387 N N   . GLU A 1 306  ? 12.000  67.347 54.852  1.00 39.20  ? 303  GLU A N   1 
ATOM 2388 C CA  . GLU A 1 306  ? 10.581  67.645 54.726  1.00 39.20  ? 303  GLU A CA  1 
ATOM 2389 C C   . GLU A 1 306  ? 9.910   66.806 53.658  1.00 39.20  ? 303  GLU A C   1 
ATOM 2390 O O   . GLU A 1 306  ? 10.373  66.754 52.531  1.00 39.20  ? 303  GLU A O   1 
ATOM 2391 C CB  . GLU A 1 306  ? 10.388  69.110 54.396  1.00 69.83  ? 303  GLU A CB  1 
ATOM 2392 C CG  . GLU A 1 306  ? 10.466  69.987 55.601  1.00 69.83  ? 303  GLU A CG  1 
ATOM 2393 C CD  . GLU A 1 306  ? 10.415  71.450 55.262  1.00 69.83  ? 303  GLU A CD  1 
ATOM 2394 O OE1 . GLU A 1 306  ? 10.500  71.808 54.060  1.00 69.83  ? 303  GLU A OE1 1 
ATOM 2395 O OE2 . GLU A 1 306  ? 10.294  72.247 56.212  1.00 69.83  ? 303  GLU A OE2 1 
ATOM 2396 N N   . LEU A 1 307  ? 8.793   66.165 53.996  1.00 54.62  ? 304  LEU A N   1 
ATOM 2397 C CA  . LEU A 1 307  ? 8.019   65.451 52.991  1.00 54.62  ? 304  LEU A CA  1 
ATOM 2398 C C   . LEU A 1 307  ? 7.417   66.438 52.038  1.00 54.62  ? 304  LEU A C   1 
ATOM 2399 O O   . LEU A 1 307  ? 6.737   67.370 52.442  1.00 54.62  ? 304  LEU A O   1 
ATOM 2400 C CB  . LEU A 1 307  ? 6.922   64.621 53.620  1.00 38.44  ? 304  LEU A CB  1 
ATOM 2401 C CG  . LEU A 1 307  ? 6.023   63.715 52.752  1.00 38.44  ? 304  LEU A CG  1 
ATOM 2402 C CD1 . LEU A 1 307  ? 6.686   63.148 51.512  1.00 38.44  ? 304  LEU A CD1 1 
ATOM 2403 C CD2 . LEU A 1 307  ? 5.492   62.554 53.590  1.00 38.44  ? 304  LEU A CD2 1 
ATOM 2404 N N   . LEU A 1 308  ? 7.675   66.240 50.764  1.00 42.42  ? 305  LEU A N   1 
ATOM 2405 C CA  . LEU A 1 308  ? 7.138   67.124 49.784  1.00 42.42  ? 305  LEU A CA  1 
ATOM 2406 C C   . LEU A 1 308  ? 5.955   66.545 49.050  1.00 42.42  ? 305  LEU A C   1 
ATOM 2407 O O   . LEU A 1 308  ? 5.181   67.292 48.436  1.00 42.42  ? 305  LEU A O   1 
ATOM 2408 C CB  . LEU A 1 308  ? 8.182   67.423 48.745  1.00 32.62  ? 305  LEU A CB  1 
ATOM 2409 C CG  . LEU A 1 308  ? 9.326   68.371 49.001  1.00 32.62  ? 305  LEU A CG  1 
ATOM 2410 C CD1 . LEU A 1 308  ? 9.816   68.790 47.604  1.00 32.62  ? 305  LEU A CD1 1 
ATOM 2411 C CD2 . LEU A 1 308  ? 8.795   69.516 49.781  1.00 32.62  ? 305  LEU A CD2 1 
ATOM 2412 N N   . GLY A 1 309  ? 5.820   65.224 49.055  1.00 33.57  ? 306  GLY A N   1 
ATOM 2413 C CA  . GLY A 1 309  ? 4.787   64.611 48.204  1.00 33.57  ? 306  GLY A CA  1 
ATOM 2414 C C   . GLY A 1 309  ? 5.119   63.252 47.605  1.00 33.57  ? 306  GLY A C   1 
ATOM 2415 O O   . GLY A 1 309  ? 5.845   62.445 48.190  1.00 33.57  ? 306  GLY A O   1 
ATOM 2416 N N   . GLU A 1 310  ? 4.586   63.002 46.421  1.00 49.96  ? 307  GLU A N   1 
ATOM 2417 C CA  . GLU A 1 310  ? 4.643   61.675 45.888  1.00 49.96  ? 307  GLU A CA  1 
ATOM 2418 C C   . GLU A 1 310  ? 4.829   61.704 44.386  1.00 49.96  ? 307  GLU A C   1 
ATOM 2419 O O   . GLU A 1 310  ? 4.119   62.392 43.678  1.00 49.96  ? 307  GLU A O   1 
ATOM 2420 C CB  . GLU A 1 310  ? 3.371   60.951 46.285  1.00 49.94  ? 307  GLU A CB  1 
ATOM 2421 C CG  . GLU A 1 310  ? 2.910   59.903 45.338  1.00 49.94  ? 307  GLU A CG  1 
ATOM 2422 C CD  . GLU A 1 310  ? 2.202   58.772 46.054  1.00 49.94  ? 307  GLU A CD  1 
ATOM 2423 O OE1 . GLU A 1 310  ? 2.391   58.633 47.302  1.00 49.94  ? 307  GLU A OE1 1 
ATOM 2424 O OE2 . GLU A 1 310  ? 1.459   58.021 45.364  1.00 49.94  ? 307  GLU A OE2 1 
ATOM 2425 N N   . THR A 1 311  ? 5.805   60.948 43.908  1.00 30.13  ? 308  THR A N   1 
ATOM 2426 C CA  . THR A 1 311  ? 6.062   60.812 42.498  1.00 30.13  ? 308  THR A CA  1 
ATOM 2427 C C   . THR A 1 311  ? 5.914   59.337 42.114  1.00 30.13  ? 308  THR A C   1 
ATOM 2428 O O   . THR A 1 311  ? 5.561   58.502 42.956  1.00 30.13  ? 308  THR A O   1 
ATOM 2429 C CB  . THR A 1 311  ? 7.482   61.269 42.214  1.00 25.42  ? 308  THR A CB  1 
ATOM 2430 O OG1 . THR A 1 311  ? 8.412   60.376 42.872  1.00 25.42  ? 308  THR A OG1 1 
ATOM 2431 C CG2 . THR A 1 311  ? 7.707   62.727 42.728  1.00 25.42  ? 308  THR A CG2 1 
ATOM 2432 N N   . SER A 1 312  ? 6.184   59.022 40.844  1.00 33.95  ? 309  SER A N   1 
ATOM 2433 C CA  . SER A 1 312  ? 6.428   57.662 40.420  1.00 33.95  ? 309  SER A CA  1 
ATOM 2434 C C   . SER A 1 312  ? 7.601   57.194 41.213  1.00 33.95  ? 309  SER A C   1 
ATOM 2435 O O   . SER A 1 312  ? 8.409   58.030 41.640  1.00 33.95  ? 309  SER A O   1 
ATOM 2436 C CB  . SER A 1 312  ? 6.904   57.655 39.011  1.00 23.46  ? 309  SER A CB  1 
ATOM 2437 O OG  . SER A 1 312  ? 5.969   58.244 38.157  1.00 23.46  ? 309  SER A OG  1 
ATOM 2438 N N   . ILE A 1 313  ? 7.725   55.877 41.400  1.00 39.58  ? 310  ILE A N   1 
ATOM 2439 C CA  . ILE A 1 313  ? 8.972   55.339 41.925  1.00 39.58  ? 310  ILE A CA  1 
ATOM 2440 C C   . ILE A 1 313  ? 10.110  55.865 41.049  1.00 39.58  ? 310  ILE A C   1 
ATOM 2441 O O   . ILE A 1 313  ? 10.110  55.745 39.804  1.00 39.58  ? 310  ILE A O   1 
ATOM 2442 C CB  . ILE A 1 313  ? 8.998   53.812 42.014  1.00 34.66  ? 310  ILE A CB  1 
ATOM 2443 C CG1 . ILE A 1 313  ? 7.655   53.252 42.519  1.00 34.66  ? 310  ILE A CG1 1 
ATOM 2444 C CG2 . ILE A 1 313  ? 10.032  53.401 42.985  1.00 34.66  ? 310  ILE A CG2 1 
ATOM 2445 C CD1 . ILE A 1 313  ? 7.326   53.614 43.942  1.00 34.66  ? 310  ILE A CD1 1 
ATOM 2446 N N   . ALA A 1 314  ? 11.042  56.525 41.731  1.00 19.70  ? 311  ALA A N   1 
ATOM 2447 C CA  . ALA A 1 314  ? 12.112  57.266 41.075  1.00 19.70  ? 311  ALA A CA  1 
ATOM 2448 C C   . ALA A 1 314  ? 13.426  56.513 41.126  1.00 19.70  ? 311  ALA A C   1 
ATOM 2449 O O   . ALA A 1 314  ? 13.952  56.220 42.231  1.00 19.70  ? 311  ALA A O   1 
ATOM 2450 C CB  . ALA A 1 314  ? 12.298  58.691 41.757  1.00 2.00   ? 311  ALA A CB  1 
ATOM 2451 N N   . GLU A 1 315  ? 13.980  56.247 39.938  1.00 37.86  ? 312  GLU A N   1 
ATOM 2452 C CA  . GLU A 1 315  ? 15.387  55.868 39.843  1.00 37.86  ? 312  GLU A CA  1 
ATOM 2453 C C   . GLU A 1 315  ? 16.215  57.097 39.837  1.00 37.86  ? 312  GLU A C   1 
ATOM 2454 O O   . GLU A 1 315  ? 17.161  57.192 40.584  1.00 37.86  ? 312  GLU A O   1 
ATOM 2455 C CB  . GLU A 1 315  ? 15.662  55.043 38.622  1.00 45.37  ? 312  GLU A CB  1 
ATOM 2456 C CG  . GLU A 1 315  ? 15.767  53.622 39.025  1.00 45.37  ? 312  GLU A CG  1 
ATOM 2457 C CD  . GLU A 1 315  ? 17.187  53.147 39.065  1.00 45.37  ? 312  GLU A CD  1 
ATOM 2458 O OE1 . GLU A 1 315  ? 18.062  53.811 38.476  1.00 45.37  ? 312  GLU A OE1 1 
ATOM 2459 O OE2 . GLU A 1 315  ? 17.446  52.084 39.658  1.00 45.37  ? 312  GLU A OE2 1 
ATOM 2460 N N   . CYS A 1 316  ? 15.783  58.047 39.019  1.00 38.57  ? 313  CYS A N   1 
ATOM 2461 C CA  . CYS A 1 316  ? 16.495  59.243 38.622  1.00 38.57  ? 313  CYS A CA  1 
ATOM 2462 C C   . CYS A 1 316  ? 15.611  60.461 39.017  1.00 38.57  ? 313  CYS A C   1 
ATOM 2463 O O   . CYS A 1 316  ? 14.385  60.514 38.731  1.00 38.57  ? 313  CYS A O   1 
ATOM 2464 C CB  . CYS A 1 316  ? 16.650  59.222 37.108  1.00 172.88 ? 313  CYS A CB  1 
ATOM 2465 S SG  . CYS A 1 316  ? 18.039  60.123 36.509  1.00 172.88 ? 313  CYS A SG  1 
ATOM 2466 N N   . LEU A 1 317  ? 16.268  61.440 39.633  1.00 46.74  ? 314  LEU A N   1 
ATOM 2467 C CA  . LEU A 1 317  ? 15.714  62.746 39.966  1.00 46.74  ? 314  LEU A CA  1 
ATOM 2468 C C   . LEU A 1 317  ? 16.624  63.878 39.461  1.00 46.74  ? 314  LEU A C   1 
ATOM 2469 O O   . LEU A 1 317  ? 17.861  63.804 39.576  1.00 46.74  ? 314  LEU A O   1 
ATOM 2470 C CB  . LEU A 1 317  ? 15.635  62.855 41.476  1.00 27.96  ? 314  LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 317  ? 14.323  62.801 42.217  1.00 27.96  ? 314  LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 317  ? 13.295  62.018 41.485  1.00 27.96  ? 314  LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 317  ? 14.533  62.232 43.594  1.00 27.96  ? 314  LEU A CD2 1 
ATOM 2474 N N   . THR A 1 318  ? 16.009  64.938 38.943  1.00 33.48  ? 315  THR A N   1 
ATOM 2475 C CA  . THR A 1 318  ? 16.747  66.092 38.419  1.00 33.48  ? 315  THR A CA  1 
ATOM 2476 C C   . THR A 1 318  ? 15.943  67.381 38.443  1.00 33.48  ? 315  THR A C   1 
ATOM 2477 O O   . THR A 1 318  ? 15.007  67.557 37.653  1.00 33.48  ? 315  THR A O   1 
ATOM 2478 C CB  . THR A 1 318  ? 17.231  65.836 36.999  1.00 43.34  ? 315  THR A CB  1 
ATOM 2479 O OG1 . THR A 1 318  ? 18.341  64.940 37.062  1.00 43.34  ? 315  THR A OG1 1 
ATOM 2480 C CG2 . THR A 1 318  ? 17.706  67.085 36.362  1.00 43.34  ? 315  THR A CG2 1 
ATOM 2481 N N   . TYR A 1 319  ? 16.315  68.266 39.373  1.00 25.52  ? 316  TYR A N   1 
ATOM 2482 C CA  . TYR A 1 319  ? 15.765  69.601 39.426  1.00 25.52  ? 316  TYR A CA  1 
ATOM 2483 C C   . TYR A 1 319  ? 16.085  70.280 38.103  1.00 25.52  ? 316  TYR A C   1 
ATOM 2484 O O   . TYR A 1 319  ? 17.153  70.070 37.561  1.00 25.52  ? 316  TYR A O   1 
ATOM 2485 C CB  . TYR A 1 319  ? 16.387  70.376 40.553  1.00 51.18  ? 316  TYR A CB  1 
ATOM 2486 C CG  . TYR A 1 319  ? 15.737  71.712 40.731  1.00 51.18  ? 316  TYR A CG  1 
ATOM 2487 C CD1 . TYR A 1 319  ? 14.389  71.809 41.100  1.00 51.18  ? 316  TYR A CD1 1 
ATOM 2488 C CD2 . TYR A 1 319  ? 16.456  72.895 40.541  1.00 51.18  ? 316  TYR A CD2 1 
ATOM 2489 C CE1 . TYR A 1 319  ? 13.779  73.055 41.289  1.00 51.18  ? 316  TYR A CE1 1 
ATOM 2490 C CE2 . TYR A 1 319  ? 15.857  74.143 40.715  1.00 51.18  ? 316  TYR A CE2 1 
ATOM 2491 C CZ  . TYR A 1 319  ? 14.521  74.217 41.097  1.00 51.18  ? 316  TYR A CZ  1 
ATOM 2492 O OH  . TYR A 1 319  ? 13.914  75.441 41.271  1.00 51.18  ? 316  TYR A OH  1 
ATOM 2493 N N   . LEU A 1 320  ? 15.155  71.049 37.556  1.00 41.58  ? 317  LEU A N   1 
ATOM 2494 C CA  . LEU A 1 320  ? 15.428  71.741 36.310  1.00 41.58  ? 317  LEU A CA  1 
ATOM 2495 C C   . LEU A 1 320  ? 15.432  73.235 36.550  1.00 41.58  ? 317  LEU A C   1 
ATOM 2496 O O   . LEU A 1 320  ? 16.182  73.752 37.372  1.00 41.58  ? 317  LEU A O   1 
ATOM 2497 C CB  . LEU A 1 320  ? 14.370  71.399 35.277  1.00 43.31  ? 317  LEU A CB  1 
ATOM 2498 C CG  . LEU A 1 320  ? 14.241  69.960 34.820  1.00 43.31  ? 317  LEU A CG  1 
ATOM 2499 C CD1 . LEU A 1 320  ? 13.457  69.907 33.515  1.00 43.31  ? 317  LEU A CD1 1 
ATOM 2500 C CD2 . LEU A 1 320  ? 15.623  69.377 34.607  1.00 43.31  ? 317  LEU A CD2 1 
ATOM 2501 N N   . ASP A 1 321  ? 14.532  73.923 35.860  1.00 83.52  ? 318  ASP A N   1 
ATOM 2502 C CA  . ASP A 1 321  ? 14.335  75.332 36.086  1.00 83.52  ? 318  ASP A CA  1 
ATOM 2503 C C   . ASP A 1 321  ? 13.630  75.549 37.430  1.00 83.52  ? 318  ASP A C   1 
ATOM 2504 O O   . ASP A 1 321  ? 14.051  75.042 38.458  1.00 83.52  ? 318  ASP A O   1 
ATOM 2505 C CB  . ASP A 1 321  ? 13.566  75.960 34.914  1.00 142.55 ? 318  ASP A CB  1 
ATOM 2506 C CG  . ASP A 1 321  ? 14.331  77.109 34.256  1.00 142.55 ? 318  ASP A CG  1 
ATOM 2507 O OD1 . ASP A 1 321  ? 14.259  77.235 33.013  1.00 142.55 ? 318  ASP A OD1 1 
ATOM 2508 O OD2 . ASP A 1 321  ? 15.014  77.878 34.973  1.00 142.55 ? 318  ASP A OD2 1 
ATOM 2509 N N   . ASN A 1 322  ? 12.542  76.291 37.400  1.00 40.22  ? 319  ASN A N   1 
ATOM 2510 C CA  . ASN A 1 322  ? 11.939  76.830 38.590  1.00 40.22  ? 319  ASN A CA  1 
ATOM 2511 C C   . ASN A 1 322  ? 10.802  75.936 39.066  1.00 40.22  ? 319  ASN A C   1 
ATOM 2512 O O   . ASN A 1 322  ? 9.708   75.928 38.476  1.00 40.22  ? 319  ASN A O   1 
ATOM 2513 C CB  . ASN A 1 322  ? 11.457  78.252 38.309  1.00 85.51  ? 319  ASN A CB  1 
ATOM 2514 C CG  . ASN A 1 322  ? 12.478  79.064 37.538  1.00 85.51  ? 319  ASN A CG  1 
ATOM 2515 O OD1 . ASN A 1 322  ? 13.413  79.619 38.114  1.00 85.51  ? 319  ASN A OD1 1 
ATOM 2516 N ND2 . ASN A 1 322  ? 12.306  79.132 36.226  1.00 85.51  ? 319  ASN A ND2 1 
ATOM 2517 N N   . GLY A 1 323  ? 11.104  75.169 40.115  1.00 60.98  ? 320  GLY A N   1 
ATOM 2518 C CA  . GLY A 1 323  ? 10.183  74.220 40.714  1.00 60.98  ? 320  GLY A CA  1 
ATOM 2519 C C   . GLY A 1 323  ? 9.901   72.953 39.908  1.00 60.98  ? 320  GLY A C   1 
ATOM 2520 O O   . GLY A 1 323  ? 9.192   72.066 40.386  1.00 60.98  ? 320  GLY A O   1 
ATOM 2521 N N   . VAL A 1 324  ? 10.435  72.856 38.693  1.00 42.71  ? 321  VAL A N   1 
ATOM 2522 C CA  . VAL A 1 324  ? 10.230  71.669 37.861  1.00 42.71  ? 321  VAL A CA  1 
ATOM 2523 C C   . VAL A 1 324  ? 11.242  70.597 38.227  1.00 42.71  ? 321  VAL A C   1 
ATOM 2524 O O   . VAL A 1 324  ? 12.404  70.902 38.584  1.00 42.71  ? 321  VAL A O   1 
ATOM 2525 C CB  . VAL A 1 324  ? 10.419  71.935 36.367  1.00 54.27  ? 321  VAL A CB  1 
ATOM 2526 C CG1 . VAL A 1 324  ? 9.389   71.155 35.573  1.00 54.27  ? 321  VAL A CG1 1 
ATOM 2527 C CG2 . VAL A 1 324  ? 10.326  73.411 36.066  1.00 54.27  ? 321  VAL A CG2 1 
ATOM 2528 N N   . VAL A 1 325  ? 10.804  69.345 38.138  1.00 27.29  ? 322  VAL A N   1 
ATOM 2529 C CA  . VAL A 1 325  ? 11.666  68.225 38.443  1.00 27.29  ? 322  VAL A CA  1 
ATOM 2530 C C   . VAL A 1 325  ? 11.350  67.152 37.444  1.00 27.29  ? 322  VAL A C   1 
ATOM 2531 O O   . VAL A 1 325  ? 10.169  66.862 37.214  1.00 27.29  ? 322  VAL A O   1 
ATOM 2532 C CB  . VAL A 1 325  ? 11.405  67.727 39.856  1.00 30.03  ? 322  VAL A CB  1 
ATOM 2533 C CG1 . VAL A 1 325  ? 12.142  66.382 40.153  1.00 30.03  ? 322  VAL A CG1 1 
ATOM 2534 C CG2 . VAL A 1 325  ? 11.755  68.822 40.888  1.00 30.03  ? 322  VAL A CG2 1 
ATOM 2535 N N   . PHE A 1 326  ? 12.390  66.599 36.811  1.00 34.06  ? 323  PHE A N   1 
ATOM 2536 C CA  . PHE A 1 326  ? 12.194  65.435 35.972  1.00 34.06  ? 323  PHE A CA  1 
ATOM 2537 C C   . PHE A 1 326  ? 12.304  64.214 36.828  1.00 34.06  ? 323  PHE A C   1 
ATOM 2538 O O   . PHE A 1 326  ? 13.246  64.085 37.605  1.00 34.06  ? 323  PHE A O   1 
ATOM 2539 C CB  . PHE A 1 326  ? 13.183  65.308 34.848  1.00 29.79  ? 323  PHE A CB  1 
ATOM 2540 C CG  . PHE A 1 326  ? 12.976  64.064 34.050  1.00 29.79  ? 323  PHE A CG  1 
ATOM 2541 C CD1 . PHE A 1 326  ? 11.829  63.912 33.263  1.00 29.79  ? 323  PHE A CD1 1 
ATOM 2542 C CD2 . PHE A 1 326  ? 13.872  63.014 34.125  1.00 29.79  ? 323  PHE A CD2 1 
ATOM 2543 C CE1 . PHE A 1 326  ? 11.597  62.741 32.523  1.00 29.79  ? 323  PHE A CE1 1 
ATOM 2544 C CE2 . PHE A 1 326  ? 13.645  61.826 33.406  1.00 29.79  ? 323  PHE A CE2 1 
ATOM 2545 C CZ  . PHE A 1 326  ? 12.512  61.697 32.594  1.00 29.79  ? 323  PHE A CZ  1 
ATOM 2546 N N   . VAL A 1 327  ? 11.327  63.322 36.695  1.00 29.94  ? 324  VAL A N   1 
ATOM 2547 C CA  . VAL A 1 327  ? 11.321  62.090 37.469  1.00 29.94  ? 324  VAL A CA  1 
ATOM 2548 C C   . VAL A 1 327  ? 11.619  60.854 36.594  1.00 29.94  ? 324  VAL A C   1 
ATOM 2549 O O   . VAL A 1 327  ? 10.740  60.348 35.871  1.00 29.94  ? 324  VAL A O   1 
ATOM 2550 C CB  . VAL A 1 327  ? 10.032  61.945 38.263  1.00 28.86  ? 324  VAL A CB  1 
ATOM 2551 C CG1 . VAL A 1 327  ? 9.893   60.514 38.818  1.00 28.86  ? 324  VAL A CG1 1 
ATOM 2552 C CG2 . VAL A 1 327  ? 10.024  62.987 39.416  1.00 28.86  ? 324  VAL A CG2 1 
ATOM 2553 N N   . GLY A 1 328  ? 12.874  60.393 36.640  1.00 29.49  ? 325  GLY A N   1 
ATOM 2554 C CA  . GLY A 1 328  ? 13.231  59.197 35.911  1.00 29.49  ? 325  GLY A CA  1 
ATOM 2555 C C   . GLY A 1 328  ? 12.709  57.956 36.626  1.00 29.49  ? 325  GLY A C   1 
ATOM 2556 O O   . GLY A 1 328  ? 13.048  57.705 37.811  1.00 29.49  ? 325  GLY A O   1 
ATOM 2557 N N   . SER A 1 329  ? 11.886  57.187 35.926  1.00 27.38  ? 326  SER A N   1 
ATOM 2558 C CA  . SER A 1 329  ? 11.282  56.035 36.523  1.00 27.38  ? 326  SER A CA  1 
ATOM 2559 C C   . SER A 1 329  ? 11.567  54.751 35.751  1.00 27.38  ? 326  SER A C   1 
ATOM 2560 O O   . SER A 1 329  ? 11.603  54.689 34.531  1.00 27.38  ? 326  SER A O   1 
ATOM 2561 C CB  . SER A 1 329  ? 9.784   56.250 36.665  1.00 28.76  ? 326  SER A CB  1 
ATOM 2562 O OG  . SER A 1 329  ? 9.175   55.217 37.436  1.00 28.76  ? 326  SER A OG  1 
ATOM 2563 N N   . ARG A 1 330  ? 11.713  53.689 36.497  1.00 29.73  ? 327  ARG A N   1 
ATOM 2564 C CA  . ARG A 1 330  ? 12.095  52.429 35.919  1.00 29.73  ? 327  ARG A CA  1 
ATOM 2565 C C   . ARG A 1 330  ? 10.948  51.430 36.168  1.00 29.73  ? 327  ARG A C   1 
ATOM 2566 O O   . ARG A 1 330  ? 10.584  50.691 35.281  1.00 29.73  ? 327  ARG A O   1 
ATOM 2567 C CB  . ARG A 1 330  ? 13.402  52.068 36.605  1.00 39.99  ? 327  ARG A CB  1 
ATOM 2568 C CG  . ARG A 1 330  ? 13.855  50.701 36.525  1.00 39.99  ? 327  ARG A CG  1 
ATOM 2569 C CD  . ARG A 1 330  ? 15.233  50.614 37.135  1.00 39.99  ? 327  ARG A CD  1 
ATOM 2570 N NE  . ARG A 1 330  ? 15.246  50.511 38.597  1.00 39.99  ? 327  ARG A NE  1 
ATOM 2571 C CZ  . ARG A 1 330  ? 14.750  49.483 39.279  1.00 39.99  ? 327  ARG A CZ  1 
ATOM 2572 N NH1 . ARG A 1 330  ? 14.129  48.489 38.619  1.00 39.99  ? 327  ARG A NH1 1 
ATOM 2573 N NH2 . ARG A 1 330  ? 14.851  49.461 40.601  1.00 39.99  ? 327  ARG A NH2 1 
ATOM 2574 N N   . LEU A 1 331  ? 10.360  51.473 37.363  1.00 24.91  ? 328  LEU A N   1 
ATOM 2575 C CA  . LEU A 1 331  ? 9.223   50.651 37.732  1.00 24.91  ? 328  LEU A CA  1 
ATOM 2576 C C   . LEU A 1 331  ? 7.913   51.223 37.227  1.00 24.91  ? 328  LEU A C   1 
ATOM 2577 O O   . LEU A 1 331  ? 6.885   50.515 37.240  1.00 24.91  ? 328  LEU A O   1 
ATOM 2578 C CB  . LEU A 1 331  ? 9.136   50.513 39.272  1.00 20.14  ? 328  LEU A CB  1 
ATOM 2579 C CG  . LEU A 1 331  ? 10.304  49.727 39.907  1.00 20.14  ? 328  LEU A CG  1 
ATOM 2580 C CD1 . LEU A 1 331  ? 10.193  49.429 41.335  1.00 20.14  ? 328  LEU A CD1 1 
ATOM 2581 C CD2 . LEU A 1 331  ? 10.406  48.436 39.160  1.00 20.14  ? 328  LEU A CD2 1 
ATOM 2582 N N   . GLY A 1 332  ? 7.929   52.507 36.818  1.00 17.75  ? 329  GLY A N   1 
ATOM 2583 C CA  . GLY A 1 332  ? 6.687   53.230 36.463  1.00 17.75  ? 329  GLY A CA  1 
ATOM 2584 C C   . GLY A 1 332  ? 6.873   54.235 35.343  1.00 17.75  ? 329  GLY A C   1 
ATOM 2585 O O   . GLY A 1 332  ? 7.958   54.344 34.800  1.00 17.75  ? 329  GLY A O   1 
ATOM 2586 N N   . ASP A 1 333  ? 5.802   54.959 35.004  1.00 28.71  ? 330  ASP A N   1 
ATOM 2587 C CA  . ASP A 1 333  ? 5.849   56.024 34.013  1.00 28.71  ? 330  ASP A CA  1 
ATOM 2588 C C   . ASP A 1 333  ? 6.781   57.170 34.500  1.00 28.71  ? 330  ASP A C   1 
ATOM 2589 O O   . ASP A 1 333  ? 6.794   57.559 35.711  1.00 28.71  ? 330  ASP A O   1 
ATOM 2590 C CB  . ASP A 1 333  ? 4.468   56.584 33.812  1.00 16.31  ? 330  ASP A CB  1 
ATOM 2591 C CG  . ASP A 1 333  ? 3.560   55.742 32.837  1.00 16.31  ? 330  ASP A CG  1 
ATOM 2592 O OD1 . ASP A 1 333  ? 3.893   54.786 32.055  1.00 16.31  ? 330  ASP A OD1 1 
ATOM 2593 O OD2 . ASP A 1 333  ? 2.377   56.138 32.837  1.00 16.31  ? 330  ASP A OD2 1 
ATOM 2594 N N   . SER A 1 334  ? 7.578   57.714 33.582  1.00 32.96  ? 331  SER A N   1 
ATOM 2595 C CA  . SER A 1 334  ? 8.409   58.832 33.977  1.00 32.96  ? 331  SER A CA  1 
ATOM 2596 C C   . SER A 1 334  ? 7.544   60.074 33.966  1.00 32.96  ? 331  SER A C   1 
ATOM 2597 O O   . SER A 1 334  ? 6.414   60.084 33.390  1.00 32.96  ? 331  SER A O   1 
ATOM 2598 C CB  . SER A 1 334  ? 9.589   59.008 33.040  1.00 39.03  ? 331  SER A CB  1 
ATOM 2599 O OG  . SER A 1 334  ? 10.734  58.364 33.563  1.00 39.03  ? 331  SER A OG  1 
ATOM 2600 N N   . GLN A 1 335  ? 8.041   61.142 34.564  1.00 33.81  ? 332  GLN A N   1 
ATOM 2601 C CA  . GLN A 1 335  ? 7.186   62.295 34.625  1.00 33.81  ? 332  GLN A CA  1 
ATOM 2602 C C   . GLN A 1 335  ? 7.919   63.608 34.826  1.00 33.81  ? 332  GLN A C   1 
ATOM 2603 O O   . GLN A 1 335  ? 9.009   63.644 35.422  1.00 33.81  ? 332  GLN A O   1 
ATOM 2604 C CB  . GLN A 1 335  ? 6.085   62.070 35.687  1.00 26.57  ? 332  GLN A CB  1 
ATOM 2605 C CG  . GLN A 1 335  ? 6.591   62.172 37.117  1.00 26.57  ? 332  GLN A CG  1 
ATOM 2606 C CD  . GLN A 1 335  ? 5.704   61.467 38.146  1.00 26.57  ? 332  GLN A CD  1 
ATOM 2607 O OE1 . GLN A 1 335  ? 4.510   61.287 37.932  1.00 26.57  ? 332  GLN A OE1 1 
ATOM 2608 N NE2 . GLN A 1 335  ? 6.296   61.103 39.290  1.00 26.57  ? 332  GLN A NE2 1 
ATOM 2609 N N   . LEU A 1 336  ? 7.297   64.670 34.308  1.00 39.30  ? 333  LEU A N   1 
ATOM 2610 C CA  . LEU A 1 336  ? 7.713   66.040 34.576  1.00 39.30  ? 333  LEU A CA  1 
ATOM 2611 C C   . LEU A 1 336  ? 6.822   66.568 35.662  1.00 39.30  ? 333  LEU A C   1 
ATOM 2612 O O   . LEU A 1 336  ? 5.609   66.528 35.500  1.00 39.30  ? 333  LEU A O   1 
ATOM 2613 C CB  . LEU A 1 336  ? 7.513   66.892 33.335  1.00 50.06  ? 333  LEU A CB  1 
ATOM 2614 C CG  . LEU A 1 336  ? 8.533   67.991 33.113  1.00 50.06  ? 333  LEU A CG  1 
ATOM 2615 C CD1 . LEU A 1 336  ? 9.905   67.399 33.184  1.00 50.06  ? 333  LEU A CD1 1 
ATOM 2616 C CD2 . LEU A 1 336  ? 8.300   68.539 31.771  1.00 50.06  ? 333  LEU A CD2 1 
ATOM 2617 N N   . VAL A 1 337  ? 7.415   67.058 36.753  1.00 31.33  ? 334  VAL A N   1 
ATOM 2618 C CA  . VAL A 1 337  ? 6.678   67.380 37.991  1.00 31.33  ? 334  VAL A CA  1 
ATOM 2619 C C   . VAL A 1 337  ? 7.005   68.786 38.531  1.00 31.33  ? 334  VAL A C   1 
ATOM 2620 O O   . VAL A 1 337  ? 8.097   69.296 38.298  1.00 31.33  ? 334  VAL A O   1 
ATOM 2621 C CB  . VAL A 1 337  ? 6.998   66.336 39.075  1.00 28.99  ? 334  VAL A CB  1 
ATOM 2622 C CG1 . VAL A 1 337  ? 7.824   66.918 40.211  1.00 28.99  ? 334  VAL A CG1 1 
ATOM 2623 C CG2 . VAL A 1 337  ? 5.746   65.787 39.638  1.00 28.99  ? 334  VAL A CG2 1 
ATOM 2624 N N   . LYS A 1 338  ? 6.078   69.390 39.280  1.00 46.65  ? 335  LYS A N   1 
ATOM 2625 C CA  . LYS A 1 338  ? 6.203   70.783 39.733  1.00 46.65  ? 335  LYS A CA  1 
ATOM 2626 C C   . LYS A 1 338  ? 6.215   70.900 41.240  1.00 46.65  ? 335  LYS A C   1 
ATOM 2627 O O   . LYS A 1 338  ? 5.352   70.321 41.898  1.00 46.65  ? 335  LYS A O   1 
ATOM 2628 C CB  . LYS A 1 338  ? 5.038   71.619 39.203  1.00 44.02  ? 335  LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 338  ? 5.034   73.079 39.646  1.00 44.02  ? 335  LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 338  ? 5.794   73.959 38.647  1.00 44.02  ? 335  LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 338  ? 6.744   74.903 39.386  1.00 44.02  ? 335  LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 338  ? 6.242   76.291 39.459  1.00 44.02  ? 335  LYS A NZ  1 
ATOM 2633 N N   . LEU A 1 339  ? 7.165   71.671 41.775  1.00 46.48  ? 336  LEU A N   1 
ATOM 2634 C CA  . LEU A 1 339  ? 7.195   72.024 43.207  1.00 46.48  ? 336  LEU A CA  1 
ATOM 2635 C C   . LEU A 1 339  ? 6.724   73.460 43.491  1.00 46.48  ? 336  LEU A C   1 
ATOM 2636 O O   . LEU A 1 339  ? 7.154   74.425 42.850  1.00 46.48  ? 336  LEU A O   1 
ATOM 2637 C CB  . LEU A 1 339  ? 8.591   71.869 43.799  1.00 21.27  ? 336  LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 339  ? 9.434   70.588 43.636  1.00 21.27  ? 336  LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 339  ? 10.774  70.860 44.312  1.00 21.27  ? 336  LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 339  ? 8.795   69.356 44.248  1.00 21.27  ? 336  LEU A CD2 1 
ATOM 2641 N N   . ASN A 1 340  ? 5.845   73.583 44.474  1.00 32.52  ? 337  ASN A N   1 
ATOM 2642 C CA  . ASN A 1 340  ? 5.297   74.847 44.844  1.00 32.52  ? 337  ASN A CA  1 
ATOM 2643 C C   . ASN A 1 340  ? 5.559   75.103 46.292  1.00 32.52  ? 337  ASN A C   1 
ATOM 2644 O O   . ASN A 1 340  ? 5.767   74.173 47.073  1.00 32.52  ? 337  ASN A O   1 
ATOM 2645 C CB  . ASN A 1 340  ? 3.802   74.852 44.641  1.00 29.91  ? 337  ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 340  ? 3.420   74.557 43.253  1.00 29.91  ? 337  ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 340  ? 2.650   73.632 43.022  1.00 29.91  ? 337  ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 340  ? 3.961   75.318 42.299  1.00 29.91  ? 337  ASN A ND2 1 
ATOM 2649 N N   . VAL A 1 341  ? 5.529   76.389 46.636  1.00 54.36  ? 338  VAL A N   1 
ATOM 2650 C CA  . VAL A 1 341  ? 5.832   76.863 47.976  1.00 54.36  ? 338  VAL A CA  1 
ATOM 2651 C C   . VAL A 1 341  ? 4.665   76.516 48.886  1.00 54.36  ? 338  VAL A C   1 
ATOM 2652 O O   . VAL A 1 341  ? 4.840   76.311 50.089  1.00 54.36  ? 338  VAL A O   1 
ATOM 2653 C CB  . VAL A 1 341  ? 6.080   78.384 47.952  1.00 82.45  ? 338  VAL A CB  1 
ATOM 2654 C CG1 . VAL A 1 341  ? 6.785   78.846 49.216  1.00 82.45  ? 338  VAL A CG1 1 
ATOM 2655 C CG2 . VAL A 1 341  ? 6.888   78.755 46.710  1.00 82.45  ? 338  VAL A CG2 1 
ATOM 2656 N N   . ASP A 1 342  ? 3.475   76.442 48.290  1.00 50.19  ? 339  ASP A N   1 
ATOM 2657 C CA  . ASP A 1 342  ? 2.265   76.087 49.029  1.00 50.19  ? 339  ASP A CA  1 
ATOM 2658 C C   . ASP A 1 342  ? 1.740   74.708 48.658  1.00 50.19  ? 339  ASP A C   1 
ATOM 2659 O O   . ASP A 1 342  ? 1.640   74.367 47.485  1.00 50.19  ? 339  ASP A O   1 
ATOM 2660 C CB  . ASP A 1 342  ? 1.193   77.155 48.803  1.00 68.74  ? 339  ASP A CB  1 
ATOM 2661 C CG  . ASP A 1 342  ? 1.628   78.527 49.300  1.00 68.74  ? 339  ASP A CG  1 
ATOM 2662 O OD1 . ASP A 1 342  ? 1.847   78.681 50.524  1.00 68.74  ? 339  ASP A OD1 1 
ATOM 2663 O OD2 . ASP A 1 342  ? 1.762   79.443 48.460  1.00 68.74  ? 339  ASP A OD2 1 
ATOM 2664 N N   . SER A 1 343  ? 1.412   73.913 49.667  1.00 57.96  ? 340  SER A N   1 
ATOM 2665 C CA  . SER A 1 343  ? 0.774   72.615 49.438  1.00 57.96  ? 340  SER A CA  1 
ATOM 2666 C C   . SER A 1 343  ? -0.688  72.756 49.001  1.00 57.96  ? 340  SER A C   1 
ATOM 2667 O O   . SER A 1 343  ? -1.338  73.778 49.269  1.00 57.96  ? 340  SER A O   1 
ATOM 2668 C CB  . SER A 1 343  ? 0.837   71.773 50.703  1.00 60.42  ? 340  SER A CB  1 
ATOM 2669 O OG  . SER A 1 343  ? 0.262   72.462 51.780  1.00 60.42  ? 340  SER A OG  1 
ATOM 2670 N N   . ASN A 1 344  ? -1.203  71.735 48.324  1.00 68.17  ? 341  ASN A N   1 
ATOM 2671 C CA  . ASN A 1 344  ? -2.628  71.675 48.037  1.00 68.17  ? 341  ASN A CA  1 
ATOM 2672 C C   . ASN A 1 344  ? -3.371  71.007 49.179  1.00 68.17  ? 341  ASN A C   1 
ATOM 2673 O O   . ASN A 1 344  ? -2.850  70.921 50.286  1.00 68.17  ? 341  ASN A O   1 
ATOM 2674 C CB  . ASN A 1 344  ? -2.924  70.995 46.687  1.00 40.17  ? 341  ASN A CB  1 
ATOM 2675 C CG  . ASN A 1 344  ? -2.451  69.522 46.623  1.00 40.17  ? 341  ASN A CG  1 
ATOM 2676 O OD1 . ASN A 1 344  ? -2.297  68.798 47.652  1.00 40.17  ? 341  ASN A OD1 1 
ATOM 2677 N ND2 . ASN A 1 344  ? -2.218  69.075 45.387  1.00 40.17  ? 341  ASN A ND2 1 
ATOM 2678 N N   . GLU A 1 345  ? -4.580  70.529 48.900  1.00 86.81  ? 342  GLU A N   1 
ATOM 2679 C CA  . GLU A 1 345  ? -5.359  69.799 49.890  1.00 86.81  ? 342  GLU A CA  1 
ATOM 2680 C C   . GLU A 1 345  ? -5.392  68.712 50.956  1.00 86.81  ? 342  GLU A C   1 
ATOM 2681 O O   . GLU A 1 345  ? -6.247  68.729 51.842  1.00 86.81  ? 342  GLU A O   1 
ATOM 2682 C CB  . GLU A 1 345  ? -6.751  69.473 49.345  1.00 126.34 ? 342  GLU A CB  1 
ATOM 2683 C CG  . GLU A 1 345  ? -6.930  69.791 47.870  1.00 126.34 ? 342  GLU A CG  1 
ATOM 2684 C CD  . GLU A 1 345  ? -7.246  71.253 47.623  1.00 126.34 ? 342  GLU A CD  1 
ATOM 2685 O OE1 . GLU A 1 345  ? -6.316  72.084 47.696  1.00 126.34 ? 342  GLU A OE1 1 
ATOM 2686 O OE2 . GLU A 1 345  ? -8.424  71.571 47.357  1.00 126.34 ? 342  GLU A OE2 1 
ATOM 2687 N N   . GLN A 1 346  ? -4.463  67.766 50.870  1.00 72.49  ? 343  GLN A N   1 
ATOM 2688 C CA  . GLN A 1 346  ? -4.431  66.652 51.808  1.00 72.49  ? 343  GLN A CA  1 
ATOM 2689 C C   . GLN A 1 346  ? -3.007  66.974 52.245  1.00 72.49  ? 343  GLN A C   1 
ATOM 2690 O O   . GLN A 1 346  ? -2.551  66.521 53.295  1.00 72.49  ? 343  GLN A O   1 
ATOM 2691 C CB  . GLN A 1 346  ? -4.420  65.581 50.717  1.00 168.82 ? 343  GLN A CB  1 
ATOM 2692 C CG  . GLN A 1 346  ? -4.320  64.159 51.245  1.00 168.82 ? 343  GLN A CG  1 
ATOM 2693 C CD  . GLN A 1 346  ? -4.238  63.130 50.134  1.00 168.82 ? 343  GLN A CD  1 
ATOM 2694 O OE1 . GLN A 1 346  ? -3.220  62.459 49.967  1.00 168.82 ? 343  GLN A OE1 1 
ATOM 2695 N NE2 . GLN A 1 346  ? -5.315  63.000 49.368  1.00 168.82 ? 343  GLN A NE2 1 
ATOM 2696 N N   . GLY A 1 347  ? -2.312  67.765 51.433  1.00 43.72  ? 344  GLY A N   1 
ATOM 2697 C CA  . GLY A 1 347  ? -0.967  68.200 51.757  1.00 43.72  ? 344  GLY A CA  1 
ATOM 2698 C C   . GLY A 1 347  ? 0.103   67.676 50.819  1.00 43.72  ? 344  GLY A C   1 
ATOM 2699 O O   . GLY A 1 347  ? 0.813   66.725 51.147  1.00 43.72  ? 344  GLY A O   1 
ATOM 2700 N N   . SER A 1 348  ? 0.228   68.301 49.652  1.00 42.11  ? 345  SER A N   1 
ATOM 2701 C CA  . SER A 1 348  ? 1.262   67.951 48.732  1.00 42.11  ? 345  SER A CA  1 
ATOM 2702 C C   . SER A 1 348  ? 1.777   69.220 48.037  1.00 42.11  ? 345  SER A C   1 
ATOM 2703 O O   . SER A 1 348  ? 0.988   69.969 47.422  1.00 42.11  ? 345  SER A O   1 
ATOM 2704 C CB  . SER A 1 348  ? 0.746   66.950 47.714  1.00 34.65  ? 345  SER A CB  1 
ATOM 2705 O OG  . SER A 1 348  ? 1.687   66.772 46.665  1.00 34.65  ? 345  SER A OG  1 
ATOM 2706 N N   . TYR A 1 349  ? 3.099   69.445 48.146  1.00 44.08  ? 346  TYR A N   1 
ATOM 2707 C CA  . TYR A 1 349  ? 3.794   70.508 47.435  1.00 44.08  ? 346  TYR A CA  1 
ATOM 2708 C C   . TYR A 1 349  ? 4.175   70.071 46.026  1.00 44.08  ? 346  TYR A C   1 
ATOM 2709 O O   . TYR A 1 349  ? 4.717   70.866 45.258  1.00 44.08  ? 346  TYR A O   1 
ATOM 2710 C CB  . TYR A 1 349  ? 5.041   70.913 48.202  1.00 54.14  ? 346  TYR A CB  1 
ATOM 2711 C CG  . TYR A 1 349  ? 4.777   71.437 49.588  1.00 54.14  ? 346  TYR A CG  1 
ATOM 2712 C CD1 . TYR A 1 349  ? 4.663   70.574 50.665  1.00 54.14  ? 346  TYR A CD1 1 
ATOM 2713 C CD2 . TYR A 1 349  ? 4.656   72.799 49.821  1.00 54.14  ? 346  TYR A CD2 1 
ATOM 2714 C CE1 . TYR A 1 349  ? 4.411   71.058 51.935  1.00 54.14  ? 346  TYR A CE1 1 
ATOM 2715 C CE2 . TYR A 1 349  ? 4.414   73.287 51.074  1.00 54.14  ? 346  TYR A CE2 1 
ATOM 2716 C CZ  . TYR A 1 349  ? 4.294   72.413 52.118  1.00 54.14  ? 346  TYR A CZ  1 
ATOM 2717 O OH  . TYR A 1 349  ? 4.060   72.899 53.362  1.00 54.14  ? 346  TYR A OH  1 
ATOM 2718 N N   . VAL A 1 350  ? 3.878   68.818 45.677  1.00 52.79  ? 347  VAL A N   1 
ATOM 2719 C CA  . VAL A 1 350  ? 4.232   68.249 44.368  1.00 52.79  ? 347  VAL A CA  1 
ATOM 2720 C C   . VAL A 1 350  ? 3.002   68.177 43.498  1.00 52.79  ? 347  VAL A C   1 
ATOM 2721 O O   . VAL A 1 350  ? 1.975   67.669 43.934  1.00 52.79  ? 347  VAL A O   1 
ATOM 2722 C CB  . VAL A 1 350  ? 4.747   66.804 44.500  1.00 58.80  ? 347  VAL A CB  1 
ATOM 2723 C CG1 . VAL A 1 350  ? 4.973   66.173 43.133  1.00 58.80  ? 347  VAL A CG1 1 
ATOM 2724 C CG2 . VAL A 1 350  ? 6.008   66.744 45.346  1.00 58.80  ? 347  VAL A CG2 1 
ATOM 2725 N N   . VAL A 1 351  ? 3.086   68.687 42.276  1.00 41.60  ? 348  VAL A N   1 
ATOM 2726 C CA  . VAL A 1 351  ? 1.983   68.539 41.356  1.00 41.60  ? 348  VAL A CA  1 
ATOM 2727 C C   . VAL A 1 351  ? 2.494   68.044 40.011  1.00 41.60  ? 348  VAL A C   1 
ATOM 2728 O O   . VAL A 1 351  ? 3.277   68.742 39.375  1.00 41.60  ? 348  VAL A O   1 
ATOM 2729 C CB  . VAL A 1 351  ? 1.270   69.872 41.116  1.00 32.64  ? 348  VAL A CB  1 
ATOM 2730 C CG1 . VAL A 1 351  ? 0.265   69.733 39.949  1.00 32.64  ? 348  VAL A CG1 1 
ATOM 2731 C CG2 . VAL A 1 351  ? 0.585   70.388 42.393  1.00 32.64  ? 348  VAL A CG2 1 
ATOM 2732 N N   . ALA A 1 352  ? 2.056   66.867 39.556  1.00 23.36  ? 349  ALA A N   1 
ATOM 2733 C CA  . ALA A 1 352  ? 2.470   66.395 38.232  1.00 23.36  ? 349  ALA A CA  1 
ATOM 2734 C C   . ALA A 1 352  ? 2.068   67.358 37.110  1.00 23.36  ? 349  ALA A C   1 
ATOM 2735 O O   . ALA A 1 352  ? 0.944   67.876 37.142  1.00 23.36  ? 349  ALA A O   1 
ATOM 2736 C CB  . ALA A 1 352  ? 1.914   64.957 37.919  1.00 2.00   ? 349  ALA A CB  1 
ATOM 2737 N N   . MET A 1 353  ? 2.976   67.564 36.145  1.00 51.90  ? 350  MET A N   1 
ATOM 2738 C CA  . MET A 1 353  ? 2.698   68.299 34.923  1.00 51.90  ? 350  MET A CA  1 
ATOM 2739 C C   . MET A 1 353  ? 2.570   67.367 33.731  1.00 51.90  ? 350  MET A C   1 
ATOM 2740 O O   . MET A 1 353  ? 1.673   67.508 32.918  1.00 51.90  ? 350  MET A O   1 
ATOM 2741 C CB  . MET A 1 353  ? 3.799   69.312 34.642  1.00 47.83  ? 350  MET A CB  1 
ATOM 2742 C CG  . MET A 1 353  ? 3.881   70.459 35.647  1.00 47.83  ? 350  MET A CG  1 
ATOM 2743 S SD  . MET A 1 353  ? 5.564   71.152 35.929  1.00 47.83  ? 350  MET A SD  1 
ATOM 2744 C CE  . MET A 1 353  ? 6.069   71.630 34.239  1.00 47.83  ? 350  MET A CE  1 
ATOM 2745 N N   . GLU A 1 354  ? 3.479   66.418 33.597  1.00 52.52  ? 351  GLU A N   1 
ATOM 2746 C CA  . GLU A 1 354  ? 3.464   65.550 32.428  1.00 52.52  ? 351  GLU A CA  1 
ATOM 2747 C C   . GLU A 1 354  ? 3.926   64.174 32.816  1.00 52.52  ? 351  GLU A C   1 
ATOM 2748 O O   . GLU A 1 354  ? 4.780   64.005 33.671  1.00 52.52  ? 351  GLU A O   1 
ATOM 2749 C CB  . GLU A 1 354  ? 4.391   66.106 31.363  1.00 66.53  ? 351  GLU A CB  1 
ATOM 2750 C CG  . GLU A 1 354  ? 4.146   65.632 29.954  1.00 66.53  ? 351  GLU A CG  1 
ATOM 2751 C CD  . GLU A 1 354  ? 4.918   66.492 28.975  1.00 66.53  ? 351  GLU A CD  1 
ATOM 2752 O OE1 . GLU A 1 354  ? 5.351   67.589 29.383  1.00 66.53  ? 351  GLU A OE1 1 
ATOM 2753 O OE2 . GLU A 1 354  ? 5.105   66.087 27.810  1.00 66.53  ? 351  GLU A OE2 1 
ATOM 2754 N N   . THR A 1 355  ? 3.363   63.206 32.132  1.00 26.04  ? 352  THR A N   1 
ATOM 2755 C CA  . THR A 1 355  ? 3.572   61.812 32.357  1.00 26.04  ? 352  THR A CA  1 
ATOM 2756 C C   . THR A 1 355  ? 4.093   61.175 31.073  1.00 26.04  ? 352  THR A C   1 
ATOM 2757 O O   . THR A 1 355  ? 3.494   61.324 30.005  1.00 26.04  ? 352  THR A O   1 
ATOM 2758 C CB  . THR A 1 355  ? 2.232   61.179 32.750  1.00 28.78  ? 352  THR A CB  1 
ATOM 2759 O OG1 . THR A 1 355  ? 2.025   61.400 34.138  1.00 28.78  ? 352  THR A OG1 1 
ATOM 2760 C CG2 . THR A 1 355  ? 2.218   59.697 32.512  1.00 28.78  ? 352  THR A CG2 1 
ATOM 2761 N N   . PHE A 1 356  ? 5.204   60.460 31.157  1.00 36.81  ? 353  PHE A N   1 
ATOM 2762 C CA  . PHE A 1 356  ? 5.666   59.769 29.973  1.00 36.81  ? 353  PHE A CA  1 
ATOM 2763 C C   . PHE A 1 356  ? 5.559   58.289 30.205  1.00 36.81  ? 353  PHE A C   1 
ATOM 2764 O O   . PHE A 1 356  ? 5.974   57.800 31.276  1.00 36.81  ? 353  PHE A O   1 
ATOM 2765 C CB  . PHE A 1 356  ? 7.090   60.155 29.633  1.00 30.11  ? 353  PHE A CB  1 
ATOM 2766 C CG  . PHE A 1 356  ? 7.392   61.596 29.856  1.00 30.11  ? 353  PHE A CG  1 
ATOM 2767 C CD1 . PHE A 1 356  ? 7.992   62.009 31.046  1.00 30.11  ? 353  PHE A CD1 1 
ATOM 2768 C CD2 . PHE A 1 356  ? 7.071   62.540 28.880  1.00 30.11  ? 353  PHE A CD2 1 
ATOM 2769 C CE1 . PHE A 1 356  ? 8.278   63.347 31.266  1.00 30.11  ? 353  PHE A CE1 1 
ATOM 2770 C CE2 . PHE A 1 356  ? 7.331   63.873 29.087  1.00 30.11  ? 353  PHE A CE2 1 
ATOM 2771 C CZ  . PHE A 1 356  ? 7.941   64.290 30.282  1.00 30.11  ? 353  PHE A CZ  1 
ATOM 2772 N N   . THR A 1 357  ? 5.019   57.596 29.198  1.00 33.58  ? 354  THR A N   1 
ATOM 2773 C CA  . THR A 1 357  ? 4.614   56.200 29.284  1.00 33.58  ? 354  THR A CA  1 
ATOM 2774 C C   . THR A 1 357  ? 5.844   55.330 29.292  1.00 33.58  ? 354  THR A C   1 
ATOM 2775 O O   . THR A 1 357  ? 6.663   55.419 28.391  1.00 33.58  ? 354  THR A O   1 
ATOM 2776 C CB  . THR A 1 357  ? 3.699   55.795 28.082  1.00 37.70  ? 354  THR A CB  1 
ATOM 2777 O OG1 . THR A 1 357  ? 4.064   56.564 26.950  1.00 37.70  ? 354  THR A OG1 1 
ATOM 2778 C CG2 . THR A 1 357  ? 2.211   56.115 28.338  1.00 37.70  ? 354  THR A CG2 1 
ATOM 2779 N N   . ASN A 1 358  ? 5.984   54.540 30.351  1.00 22.52  ? 355  ASN A N   1 
ATOM 2780 C CA  . ASN A 1 358  ? 7.011   53.488 30.531  1.00 22.52  ? 355  ASN A CA  1 
ATOM 2781 C C   . ASN A 1 358  ? 6.293   52.147 30.454  1.00 22.52  ? 355  ASN A C   1 
ATOM 2782 O O   . ASN A 1 358  ? 5.549   51.807 31.390  1.00 22.52  ? 355  ASN A O   1 
ATOM 2783 C CB  . ASN A 1 358  ? 7.651   53.589 31.938  1.00 22.19  ? 355  ASN A CB  1 
ATOM 2784 C CG  . ASN A 1 358  ? 8.766   52.525 32.180  1.00 22.19  ? 355  ASN A CG  1 
ATOM 2785 O OD1 . ASN A 1 358  ? 9.257   51.920 31.228  1.00 22.19  ? 355  ASN A OD1 1 
ATOM 2786 N ND2 . ASN A 1 358  ? 9.144   52.293 33.447  1.00 22.19  ? 355  ASN A ND2 1 
ATOM 2787 N N   . LEU A 1 359  ? 6.456   51.397 29.360  1.00 24.39  ? 356  LEU A N   1 
ATOM 2788 C CA  . LEU A 1 359  ? 5.950   49.982 29.310  1.00 24.39  ? 356  LEU A CA  1 
ATOM 2789 C C   . LEU A 1 359  ? 6.657   49.147 30.369  1.00 24.39  ? 356  LEU A C   1 
ATOM 2790 O O   . LEU A 1 359  ? 6.346   47.977 30.527  1.00 24.39  ? 356  LEU A O   1 
ATOM 2791 C CB  . LEU A 1 359  ? 6.074   49.319 27.935  1.00 13.94  ? 356  LEU A CB  1 
ATOM 2792 C CG  . LEU A 1 359  ? 5.445   50.080 26.748  1.00 13.94  ? 356  LEU A CG  1 
ATOM 2793 C CD1 . LEU A 1 359  ? 5.454   49.240 25.437  1.00 13.94  ? 356  LEU A CD1 1 
ATOM 2794 C CD2 . LEU A 1 359  ? 3.989   50.476 27.056  1.00 13.94  ? 356  LEU A CD2 1 
ATOM 2795 N N   . GLY A 1 360  ? 7.591   49.805 31.074  1.00 65.38  ? 357  GLY A N   1 
ATOM 2796 C CA  . GLY A 1 360  ? 8.003   49.479 32.435  1.00 65.38  ? 357  GLY A CA  1 
ATOM 2797 C C   . GLY A 1 360  ? 8.654   48.160 32.369  1.00 65.38  ? 357  GLY A C   1 
ATOM 2798 O O   . GLY A 1 360  ? 9.043   47.742 31.293  1.00 65.38  ? 357  GLY A O   1 
ATOM 2799 N N   . PRO A 1 361  ? 8.790   47.484 33.508  1.00 30.38  ? 358  PRO A N   1 
ATOM 2800 C CA  . PRO A 1 361  ? 9.045   46.040 33.360  1.00 30.38  ? 358  PRO A CA  1 
ATOM 2801 C C   . PRO A 1 361  ? 7.812   45.352 32.774  1.00 30.38  ? 358  PRO A C   1 
ATOM 2802 O O   . PRO A 1 361  ? 6.764   45.342 33.401  1.00 30.38  ? 358  PRO A O   1 
ATOM 2803 C CB  . PRO A 1 361  ? 9.307   45.564 34.786  1.00 17.33  ? 358  PRO A CB  1 
ATOM 2804 C CG  . PRO A 1 361  ? 9.378   46.764 35.633  1.00 17.33  ? 358  PRO A CG  1 
ATOM 2805 C CD  . PRO A 1 361  ? 8.747   47.920 34.907  1.00 17.33  ? 358  PRO A CD  1 
ATOM 2806 N N   . ILE A 1 362  ? 7.907   44.891 31.537  1.00 19.93  ? 359  ILE A N   1 
ATOM 2807 C CA  . ILE A 1 362  ? 6.968   43.928 31.038  1.00 19.93  ? 359  ILE A CA  1 
ATOM 2808 C C   . ILE A 1 362  ? 7.273   42.585 31.731  1.00 19.93  ? 359  ILE A C   1 
ATOM 2809 O O   . ILE A 1 362  ? 8.265   41.914 31.412  1.00 19.93  ? 359  ILE A O   1 
ATOM 2810 C CB  . ILE A 1 362  ? 7.132   43.761 29.579  1.00 15.20  ? 359  ILE A CB  1 
ATOM 2811 C CG1 . ILE A 1 362  ? 6.831   45.079 28.906  1.00 15.20  ? 359  ILE A CG1 1 
ATOM 2812 C CG2 . ILE A 1 362  ? 6.253   42.610 29.090  1.00 15.20  ? 359  ILE A CG2 1 
ATOM 2813 C CD1 . ILE A 1 362  ? 7.084   45.048 27.420  1.00 15.20  ? 359  ILE A CD1 1 
ATOM 2814 N N   . VAL A 1 363  ? 6.441   42.209 32.694  1.00 29.95  ? 360  VAL A N   1 
ATOM 2815 C CA  . VAL A 1 363  ? 6.722   41.069 33.562  1.00 29.95  ? 360  VAL A CA  1 
ATOM 2816 C C   . VAL A 1 363  ? 6.215   39.798 32.912  1.00 29.95  ? 360  VAL A C   1 
ATOM 2817 O O   . VAL A 1 363  ? 6.781   38.748 33.115  1.00 29.95  ? 360  VAL A O   1 
ATOM 2818 C CB  . VAL A 1 363  ? 6.113   41.309 34.943  1.00 35.03  ? 360  VAL A CB  1 
ATOM 2819 C CG1 . VAL A 1 363  ? 5.850   40.047 35.678  1.00 35.03  ? 360  VAL A CG1 1 
ATOM 2820 C CG2 . VAL A 1 363  ? 7.032   42.168 35.714  1.00 35.03  ? 360  VAL A CG2 1 
ATOM 2821 N N   . ASP A 1 364  ? 5.168   39.947 32.106  1.00 21.15  ? 361  ASP A N   1 
ATOM 2822 C CA  . ASP A 1 364  ? 4.517   38.891 31.360  1.00 21.15  ? 361  ASP A CA  1 
ATOM 2823 C C   . ASP A 1 364  ? 3.641   39.576 30.283  1.00 21.15  ? 361  ASP A C   1 
ATOM 2824 O O   . ASP A 1 364  ? 3.333   40.762 30.413  1.00 21.15  ? 361  ASP A O   1 
ATOM 2825 C CB  . ASP A 1 364  ? 3.658   38.054 32.290  1.00 41.86  ? 361  ASP A CB  1 
ATOM 2826 C CG  . ASP A 1 364  ? 3.065   36.852 31.587  1.00 41.86  ? 361  ASP A CG  1 
ATOM 2827 O OD1 . ASP A 1 364  ? 2.106   36.287 32.145  1.00 41.86  ? 361  ASP A OD1 1 
ATOM 2828 O OD2 . ASP A 1 364  ? 3.539   36.477 30.478  1.00 41.86  ? 361  ASP A OD2 1 
ATOM 2829 N N   . MET A 1 365  ? 3.234   38.891 29.230  1.00 20.62  ? 362  MET A N   1 
ATOM 2830 C CA  . MET A 1 365  ? 2.405   39.572 28.265  1.00 20.62  ? 362  MET A CA  1 
ATOM 2831 C C   . MET A 1 365  ? 1.643   38.555 27.417  1.00 20.62  ? 362  MET A C   1 
ATOM 2832 O O   . MET A 1 365  ? 1.848   37.357 27.582  1.00 20.62  ? 362  MET A O   1 
ATOM 2833 C CB  . MET A 1 365  ? 3.260   40.534 27.452  1.00 32.57  ? 362  MET A CB  1 
ATOM 2834 C CG  . MET A 1 365  ? 4.039   39.890 26.290  1.00 32.57  ? 362  MET A CG  1 
ATOM 2835 S SD  . MET A 1 365  ? 5.384   40.900 25.625  1.00 32.57  ? 362  MET A SD  1 
ATOM 2836 C CE  . MET A 1 365  ? 5.615   40.010 24.093  1.00 32.57  ? 362  MET A CE  1 
ATOM 2837 N N   . CYS A 1 366  ? 0.727   38.991 26.558  1.00 33.00  ? 363  CYS A N   1 
ATOM 2838 C CA  . CYS A 1 366  ? 0.041   38.022 25.700  1.00 33.00  ? 363  CYS A CA  1 
ATOM 2839 C C   . CYS A 1 366  ? -0.614  38.718 24.541  1.00 33.00  ? 363  CYS A C   1 
ATOM 2840 O O   . CYS A 1 366  ? -0.945  39.889 24.675  1.00 33.00  ? 363  CYS A O   1 
ATOM 2841 C CB  . CYS A 1 366  ? -0.966  37.185 26.499  1.00 33.40  ? 363  CYS A CB  1 
ATOM 2842 S SG  . CYS A 1 366  ? -2.618  37.853 26.598  1.00 33.40  ? 363  CYS A SG  1 
ATOM 2843 N N   . VAL A 1 367  ? -0.802  38.020 23.422  1.00 41.67  ? 364  VAL A N   1 
ATOM 2844 C CA  . VAL A 1 367  ? -1.413  38.616 22.226  1.00 41.67  ? 364  VAL A CA  1 
ATOM 2845 C C   . VAL A 1 367  ? -2.883  38.236 22.076  1.00 41.67  ? 364  VAL A C   1 
ATOM 2846 O O   . VAL A 1 367  ? -3.272  37.094 22.315  1.00 41.67  ? 364  VAL A O   1 
ATOM 2847 C CB  . VAL A 1 367  ? -0.683  38.214 20.924  1.00 32.89  ? 364  VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 367  ? -1.179  39.051 19.776  1.00 32.89  ? 364  VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 367  ? 0.810   38.403 21.081  1.00 32.89  ? 364  VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 368  ? -3.681  39.199 21.634  1.00 65.10  ? 365  VAL A N   1 
ATOM 2851 C CA  . VAL A 1 368  ? -5.120  39.066 21.553  1.00 65.10  ? 365  VAL A CA  1 
ATOM 2852 C C   . VAL A 1 368  ? -5.602  40.056 20.509  1.00 65.10  ? 365  VAL A C   1 
ATOM 2853 O O   . VAL A 1 368  ? -5.149  41.203 20.508  1.00 65.10  ? 365  VAL A O   1 
ATOM 2854 C CB  . VAL A 1 368  ? -5.772  39.445 22.905  1.00 31.50  ? 365  VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 368  ? -7.259  39.662 22.732  1.00 31.50  ? 365  VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 368  ? -5.550  38.357 23.959  1.00 31.50  ? 365  VAL A CG2 1 
ATOM 2857 N N   . ASP A 1 369  ? -6.430  39.624 19.569  1.00 113.50 ? 366  ASP A N   1 
ATOM 2858 C CA  . ASP A 1 369  ? -7.139  40.571 18.725  1.00 113.50 ? 366  ASP A CA  1 
ATOM 2859 C C   . ASP A 1 369  ? -8.515  40.649 19.288  1.00 113.50 ? 366  ASP A C   1 
ATOM 2860 O O   . ASP A 1 369  ? -9.315  39.760 19.175  1.00 113.50 ? 366  ASP A O   1 
ATOM 2861 C CB  . ASP A 1 369  ? -7.152  40.233 17.239  1.00 66.84  ? 366  ASP A CB  1 
ATOM 2862 C CG  . ASP A 1 369  ? -7.064  38.809 16.984  1.00 66.84  ? 366  ASP A CG  1 
ATOM 2863 O OD1 . ASP A 1 369  ? -6.942  38.070 17.956  1.00 66.84  ? 366  ASP A OD1 1 
ATOM 2864 O OD2 . ASP A 1 369  ? -7.118  38.421 15.816  1.00 66.84  ? 366  ASP A OD2 1 
ATOM 2865 N N   . LEU A 1 370  ? -8.744  41.768 19.912  1.00 111.08 ? 367  LEU A N   1 
ATOM 2866 C CA  . LEU A 1 370  ? -9.689  41.980 20.994  1.00 111.08 ? 367  LEU A CA  1 
ATOM 2867 C C   . LEU A 1 370  ? -10.745 42.382 19.959  1.00 111.08 ? 367  LEU A C   1 
ATOM 2868 O O   . LEU A 1 370  ? -11.814 41.753 19.882  1.00 111.08 ? 367  LEU A O   1 
ATOM 2869 C CB  . LEU A 1 370  ? -9.036  43.199 21.678  1.00 76.39  ? 367  LEU A CB  1 
ATOM 2870 C CG  . LEU A 1 370  ? -8.220  42.986 22.969  1.00 76.39  ? 367  LEU A CG  1 
ATOM 2871 C CD1 . LEU A 1 370  ? -7.586  44.295 23.463  1.00 76.39  ? 367  LEU A CD1 1 
ATOM 2872 C CD2 . LEU A 1 370  ? -9.043  42.346 24.092  1.00 76.39  ? 367  LEU A CD2 1 
ATOM 2873 N N   . GLU A 1 371  ? -10.422 43.385 19.137  1.00 132.74 ? 368  GLU A N   1 
ATOM 2874 C CA  . GLU A 1 371  ? -11.279 43.814 18.021  1.00 132.74 ? 368  GLU A CA  1 
ATOM 2875 C C   . GLU A 1 371  ? -11.603 42.674 17.038  1.00 132.74 ? 368  GLU A C   1 
ATOM 2876 O O   . GLU A 1 371  ? -12.368 42.868 16.094  1.00 132.74 ? 368  GLU A O   1 
ATOM 2877 C CB  . GLU A 1 371  ? -10.647 44.983 17.253  1.00 133.86 ? 368  GLU A CB  1 
ATOM 2878 C CG  . GLU A 1 371  ? -9.463  45.665 17.928  1.00 133.86 ? 368  GLU A CG  1 
ATOM 2879 C CD  . GLU A 1 371  ? -9.867  46.745 18.906  1.00 133.86 ? 368  GLU A CD  1 
ATOM 2880 O OE1 . GLU A 1 371  ? -10.617 46.434 19.856  1.00 133.86 ? 368  GLU A OE1 1 
ATOM 2881 O OE2 . GLU A 1 371  ? -9.414  47.900 18.737  1.00 133.86 ? 368  GLU A OE2 1 
ATOM 2882 N N   . ARG A 1 372  ? -11.010 41.500 17.271  1.00 173.38 ? 369  ARG A N   1 
ATOM 2883 C CA  . ARG A 1 372  ? -11.266 40.279 16.493  1.00 173.38 ? 369  ARG A CA  1 
ATOM 2884 C C   . ARG A 1 372  ? -11.212 40.522 14.980  1.00 173.38 ? 369  ARG A C   1 
ATOM 2885 O O   . ARG A 1 372  ? -12.159 40.231 14.245  1.00 173.38 ? 369  ARG A O   1 
ATOM 2886 C CB  . ARG A 1 372  ? -12.591 39.628 16.914  1.00 118.20 ? 369  ARG A CB  1 
ATOM 2887 C CG  . ARG A 1 372  ? -12.713 38.150 16.547  1.00 118.20 ? 369  ARG A CG  1 
ATOM 2888 C CD  . ARG A 1 372  ? -14.110 37.831 16.022  1.00 118.20 ? 369  ARG A CD  1 
ATOM 2889 N NE  . ARG A 1 372  ? -15.141 37.920 17.062  1.00 118.20 ? 369  ARG A NE  1 
ATOM 2890 C CZ  . ARG A 1 372  ? -16.453 37.817 16.845  1.00 118.20 ? 369  ARG A CZ  1 
ATOM 2891 N NH1 . ARG A 1 372  ? -16.925 37.628 15.615  1.00 118.20 ? 369  ARG A NH1 1 
ATOM 2892 N NH2 . ARG A 1 372  ? -17.302 37.907 17.863  1.00 118.20 ? 369  ARG A NH2 1 
ATOM 2893 N N   . GLN A 1 373  ? -10.085 41.060 14.531  1.00 115.74 ? 370  GLN A N   1 
ATOM 2894 C CA  . GLN A 1 373  ? -9.893  41.397 13.132  1.00 115.74 ? 370  GLN A CA  1 
ATOM 2895 C C   . GLN A 1 373  ? -8.934  40.405 12.476  1.00 115.74 ? 370  GLN A C   1 
ATOM 2896 O O   . GLN A 1 373  ? -9.358  39.431 11.854  1.00 115.74 ? 370  GLN A O   1 
ATOM 2897 C CB  . GLN A 1 373  ? -9.339  42.815 13.019  1.00 91.12  ? 370  GLN A CB  1 
ATOM 2898 C CG  . GLN A 1 373  ? -9.907  43.805 14.028  1.00 91.12  ? 370  GLN A CG  1 
ATOM 2899 C CD  . GLN A 1 373  ? -9.315  45.198 13.868  1.00 91.12  ? 370  GLN A CD  1 
ATOM 2900 O OE1 . GLN A 1 373  ? -9.436  45.824 12.808  1.00 91.12  ? 370  GLN A OE1 1 
ATOM 2901 N NE2 . GLN A 1 373  ? -8.667  45.689 14.918  1.00 91.12  ? 370  GLN A NE2 1 
ATOM 2902 N N   . GLY A 1 374  ? -7.640  40.675 12.625  1.00 56.14  ? 371  GLY A N   1 
ATOM 2903 C CA  . GLY A 1 374  ? -6.566  39.797 12.186  1.00 56.14  ? 371  GLY A CA  1 
ATOM 2904 C C   . GLY A 1 374  ? -5.240  40.442 12.582  1.00 56.14  ? 371  GLY A C   1 
ATOM 2905 O O   . GLY A 1 374  ? -4.157  40.065 12.097  1.00 56.14  ? 371  GLY A O   1 
ATOM 2906 N N   . GLN A 1 375  ? -5.338  41.463 13.427  1.00 74.79  ? 372  GLN A N   1 
ATOM 2907 C CA  . GLN A 1 375  ? -4.171  42.030 14.054  1.00 74.79  ? 372  GLN A CA  1 
ATOM 2908 C C   . GLN A 1 375  ? -4.176  41.648 15.524  1.00 74.79  ? 372  GLN A C   1 
ATOM 2909 O O   . GLN A 1 375  ? -5.226  41.456 16.143  1.00 74.79  ? 372  GLN A O   1 
ATOM 2910 C CB  . GLN A 1 375  ? -4.100  43.549 13.863  1.00 105.92 ? 372  GLN A CB  1 
ATOM 2911 C CG  . GLN A 1 375  ? -5.421  44.270 13.978  1.00 105.92 ? 372  GLN A CG  1 
ATOM 2912 C CD  . GLN A 1 375  ? -6.002  44.209 15.374  1.00 105.92 ? 372  GLN A CD  1 
ATOM 2913 O OE1 . GLN A 1 375  ? -5.593  44.958 16.255  1.00 105.92 ? 372  GLN A OE1 1 
ATOM 2914 N NE2 . GLN A 1 375  ? -6.966  43.313 15.582  1.00 105.92 ? 372  GLN A NE2 1 
ATOM 2915 N N   . GLY A 1 376  ? -2.987  41.494 16.075  1.00 76.80  ? 373  GLY A N   1 
ATOM 2916 C CA  . GLY A 1 376  ? -2.863  41.330 17.497  1.00 76.80  ? 373  GLY A CA  1 
ATOM 2917 C C   . GLY A 1 376  ? -2.745  42.703 18.100  1.00 76.80  ? 373  GLY A C   1 
ATOM 2918 O O   . GLY A 1 376  ? -2.137  43.606 17.522  1.00 76.80  ? 373  GLY A O   1 
ATOM 2919 N N   . GLN A 1 377  ? -3.408  42.863 19.232  1.00 33.05  ? 374  GLN A N   1 
ATOM 2920 C CA  . GLN A 1 377  ? -3.065  43.868 20.207  1.00 33.05  ? 374  GLN A CA  1 
ATOM 2921 C C   . GLN A 1 377  ? -2.180  43.031 21.100  1.00 33.05  ? 374  GLN A C   1 
ATOM 2922 O O   . GLN A 1 377  ? -2.221  41.810 21.060  1.00 33.05  ? 374  GLN A O   1 
ATOM 2923 C CB  . GLN A 1 377  ? -4.265  44.293 21.056  1.00 77.52  ? 374  GLN A CB  1 
ATOM 2924 C CG  . GLN A 1 377  ? -5.550  44.653 20.329  1.00 77.52  ? 374  GLN A CG  1 
ATOM 2925 C CD  . GLN A 1 377  ? -5.758  46.152 20.156  1.00 77.52  ? 374  GLN A CD  1 
ATOM 2926 O OE1 . GLN A 1 377  ? -6.045  46.614 19.051  1.00 77.52  ? 374  GLN A OE1 1 
ATOM 2927 N NE2 . GLN A 1 377  ? -5.625  46.917 21.242  1.00 77.52  ? 374  GLN A NE2 1 
ATOM 2928 N N   . LEU A 1 378  ? -1.412  43.683 21.945  1.00 42.66  ? 375  LEU A N   1 
ATOM 2929 C CA  . LEU A 1 378  ? -0.577  42.988 22.887  1.00 42.66  ? 375  LEU A CA  1 
ATOM 2930 C C   . LEU A 1 378  ? -0.886  43.569 24.253  1.00 42.66  ? 375  LEU A C   1 
ATOM 2931 O O   . LEU A 1 378  ? -1.137  44.781 24.382  1.00 42.66  ? 375  LEU A O   1 
ATOM 2932 C CB  . LEU A 1 378  ? 0.864   43.280 22.513  1.00 29.65  ? 375  LEU A CB  1 
ATOM 2933 C CG  . LEU A 1 378  ? 1.980   42.480 23.114  1.00 29.65  ? 375  LEU A CG  1 
ATOM 2934 C CD1 . LEU A 1 378  ? 2.163   41.322 22.203  1.00 29.65  ? 375  LEU A CD1 1 
ATOM 2935 C CD2 . LEU A 1 378  ? 3.130   43.399 23.052  1.00 29.65  ? 375  LEU A CD2 1 
ATOM 2936 N N   . VAL A 1 379  ? -0.856  42.714 25.270  1.00 36.32  ? 376  VAL A N   1 
ATOM 2937 C CA  . VAL A 1 379  ? -1.367  43.079 26.587  1.00 36.32  ? 376  VAL A CA  1 
ATOM 2938 C C   . VAL A 1 379  ? -0.376  42.660 27.668  1.00 36.32  ? 376  VAL A C   1 
ATOM 2939 O O   . VAL A 1 379  ? -0.210  41.468 27.931  1.00 36.32  ? 376  VAL A O   1 
ATOM 2940 C CB  . VAL A 1 379  ? -2.768  42.448 26.808  1.00 21.13  ? 376  VAL A CB  1 
ATOM 2941 C CG1 . VAL A 1 379  ? -3.438  42.975 28.043  1.00 21.13  ? 376  VAL A CG1 1 
ATOM 2942 C CG2 . VAL A 1 379  ? -3.649  42.725 25.604  1.00 21.13  ? 376  VAL A CG2 1 
ATOM 2943 N N   . THR A 1 380  ? 0.270   43.645 28.291  1.00 31.40  ? 377  THR A N   1 
ATOM 2944 C CA  . THR A 1 380  ? 1.430   43.404 29.151  1.00 31.40  ? 377  THR A CA  1 
ATOM 2945 C C   . THR A 1 380  ? 1.102   43.565 30.610  1.00 31.40  ? 377  THR A C   1 
ATOM 2946 O O   . THR A 1 380  ? 0.409   44.472 30.981  1.00 31.40  ? 377  THR A O   1 
ATOM 2947 C CB  . THR A 1 380  ? 2.517   44.468 28.901  1.00 11.87  ? 377  THR A CB  1 
ATOM 2948 O OG1 . THR A 1 380  ? 1.920   45.775 29.052  1.00 11.87  ? 377  THR A OG1 1 
ATOM 2949 C CG2 . THR A 1 380  ? 3.136   44.341 27.497  1.00 11.87  ? 377  THR A CG2 1 
ATOM 2950 N N   . CYS A 1 381  ? 1.624   42.708 31.455  1.00 16.14  ? 378  CYS A N   1 
ATOM 2951 C CA  . CYS A 1 381  ? 1.647   43.028 32.864  1.00 16.14  ? 378  CYS A CA  1 
ATOM 2952 C C   . CYS A 1 381  ? 2.823   43.968 33.025  1.00 16.14  ? 378  CYS A C   1 
ATOM 2953 O O   . CYS A 1 381  ? 3.918   43.562 32.673  1.00 16.14  ? 378  CYS A O   1 
ATOM 2954 C CB  . CYS A 1 381  ? 1.867   41.776 33.719  1.00 26.04  ? 378  CYS A CB  1 
ATOM 2955 S SG  . CYS A 1 381  ? 0.587   40.548 33.481  1.00 26.04  ? 378  CYS A SG  1 
ATOM 2956 N N   . SER A 1 382  ? 2.604   45.179 33.554  1.00 25.35  ? 379  SER A N   1 
ATOM 2957 C CA  . SER A 1 382  ? 3.668   46.169 33.619  1.00 25.35  ? 379  SER A CA  1 
ATOM 2958 C C   . SER A 1 382  ? 3.822   46.859 34.946  1.00 25.35  ? 379  SER A C   1 
ATOM 2959 O O   . SER A 1 382  ? 2.853   46.973 35.733  1.00 25.35  ? 379  SER A O   1 
ATOM 2960 C CB  . SER A 1 382  ? 3.457   47.273 32.592  1.00 27.15  ? 379  SER A CB  1 
ATOM 2961 O OG  . SER A 1 382  ? 3.394   46.789 31.270  1.00 27.15  ? 379  SER A OG  1 
ATOM 2962 N N   . GLY A 1 383  ? 5.035   47.362 35.175  1.00 19.34  ? 380  GLY A N   1 
ATOM 2963 C CA  . GLY A 1 383  ? 5.300   48.207 36.295  1.00 19.34  ? 380  GLY A CA  1 
ATOM 2964 C C   . GLY A 1 383  ? 5.379   47.305 37.481  1.00 19.34  ? 380  GLY A C   1 
ATOM 2965 O O   . GLY A 1 383  ? 5.457   46.065 37.338  1.00 19.34  ? 380  GLY A O   1 
ATOM 2966 N N   . ALA A 1 384  ? 5.378   47.880 38.673  1.00 30.25  ? 381  ALA A N   1 
ATOM 2967 C CA  . ALA A 1 384  ? 5.442   47.066 39.879  1.00 30.25  ? 381  ALA A CA  1 
ATOM 2968 C C   . ALA A 1 384  ? 4.929   47.939 41.007  1.00 30.25  ? 381  ALA A C   1 
ATOM 2969 O O   . ALA A 1 384  ? 4.862   49.162 40.852  1.00 30.25  ? 381  ALA A O   1 
ATOM 2970 C CB  . ALA A 1 384  ? 6.853   46.627 40.124  1.00 31.44  ? 381  ALA A CB  1 
ATOM 2971 N N   . PHE A 1 385  ? 4.515   47.312 42.108  1.00 33.43  ? 382  PHE A N   1 
ATOM 2972 C CA  . PHE A 1 385  ? 3.755   48.011 43.144  1.00 33.43  ? 382  PHE A CA  1 
ATOM 2973 C C   . PHE A 1 385  ? 2.748   49.055 42.613  1.00 33.43  ? 382  PHE A C   1 
ATOM 2974 O O   . PHE A 1 385  ? 2.073   48.787 41.611  1.00 33.43  ? 382  PHE A O   1 
ATOM 2975 C CB  . PHE A 1 385  ? 4.725   48.616 44.123  1.00 11.71  ? 382  PHE A CB  1 
ATOM 2976 C CG  . PHE A 1 385  ? 5.993   47.810 44.264  1.00 11.71  ? 382  PHE A CG  1 
ATOM 2977 C CD1 . PHE A 1 385  ? 7.179   48.177 43.542  1.00 11.71  ? 382  PHE A CD1 1 
ATOM 2978 C CD2 . PHE A 1 385  ? 6.031   46.653 45.096  1.00 11.71  ? 382  PHE A CD2 1 
ATOM 2979 C CE1 . PHE A 1 385  ? 8.401   47.396 43.664  1.00 11.71  ? 382  PHE A CE1 1 
ATOM 2980 C CE2 . PHE A 1 385  ? 7.211   45.836 45.202  1.00 11.71  ? 382  PHE A CE2 1 
ATOM 2981 C CZ  . PHE A 1 385  ? 8.419   46.216 44.483  1.00 11.71  ? 382  PHE A CZ  1 
ATOM 2982 N N   . LYS A 1 386  ? 2.675   50.229 43.253  1.00 36.34  ? 383  LYS A N   1 
ATOM 2983 C CA  . LYS A 1 386  ? 1.689   51.252 42.861  1.00 36.34  ? 383  LYS A CA  1 
ATOM 2984 C C   . LYS A 1 386  ? 1.653   51.561 41.347  1.00 36.34  ? 383  LYS A C   1 
ATOM 2985 O O   . LYS A 1 386  ? 0.590   51.997 40.852  1.00 36.34  ? 383  LYS A O   1 
ATOM 2986 C CB  . LYS A 1 386  ? 1.770   52.516 43.745  1.00 17.74  ? 383  LYS A CB  1 
ATOM 2987 C CG  . LYS A 1 386  ? 2.822   53.554 43.388  1.00 17.74  ? 383  LYS A CG  1 
ATOM 2988 C CD  . LYS A 1 386  ? 3.023   54.542 44.553  1.00 17.74  ? 383  LYS A CD  1 
ATOM 2989 C CE  . LYS A 1 386  ? 4.063   55.643 44.261  1.00 17.74  ? 383  LYS A CE  1 
ATOM 2990 N NZ  . LYS A 1 386  ? 4.035   56.110 42.802  1.00 17.74  ? 383  LYS A NZ  1 
ATOM 2991 N N   . GLU A 1 387  ? 2.761   51.252 40.589  1.00 24.55  ? 384  GLU A N   1 
ATOM 2992 C CA  . GLU A 1 387  ? 2.798   51.541 39.184  1.00 24.55  ? 384  GLU A CA  1 
ATOM 2993 C C   . GLU A 1 387  ? 2.329   50.419 38.322  1.00 24.55  ? 384  GLU A C   1 
ATOM 2994 O O   . GLU A 1 387  ? 2.331   50.609 37.081  1.00 24.55  ? 384  GLU A O   1 
ATOM 2995 C CB  . GLU A 1 387  ? 4.229   51.947 38.761  1.00 28.30  ? 384  GLU A CB  1 
ATOM 2996 C CG  . GLU A 1 387  ? 5.020   52.800 39.778  1.00 28.30  ? 384  GLU A CG  1 
ATOM 2997 C CD  . GLU A 1 387  ? 4.516   54.318 39.935  1.00 28.30  ? 384  GLU A CD  1 
ATOM 2998 O OE1 . GLU A 1 387  ? 3.751   54.840 39.043  1.00 28.30  ? 384  GLU A OE1 1 
ATOM 2999 O OE2 . GLU A 1 387  ? 4.897   54.961 40.956  1.00 28.30  ? 384  GLU A OE2 1 
ATOM 3000 N N   . GLY A 1 388  ? 1.970   49.261 38.917  1.00 8.79   ? 385  GLY A N   1 
ATOM 3001 C CA  . GLY A 1 388  ? 1.454   48.071 38.119  1.00 8.79   ? 385  GLY A CA  1 
ATOM 3002 C C   . GLY A 1 388  ? 0.369   48.502 37.177  1.00 8.79   ? 385  GLY A C   1 
ATOM 3003 O O   . GLY A 1 388  ? -0.336  49.402 37.614  1.00 8.79   ? 385  GLY A O   1 
ATOM 3004 N N   . SER A 1 389  ? 0.271   47.929 35.975  1.00 21.78  ? 386  SER A N   1 
ATOM 3005 C CA  . SER A 1 389  ? -0.686  48.337 34.991  1.00 21.78  ? 386  SER A CA  1 
ATOM 3006 C C   . SER A 1 389  ? -0.753  47.198 33.977  1.00 21.78  ? 386  SER A C   1 
ATOM 3007 O O   . SER A 1 389  ? 0.079   46.229 34.071  1.00 21.78  ? 386  SER A O   1 
ATOM 3008 C CB  . SER A 1 389  ? -0.248  49.683 34.398  1.00 27.07  ? 386  SER A CB  1 
ATOM 3009 O OG  . SER A 1 389  ? 0.785   49.511 33.385  1.00 27.07  ? 386  SER A OG  1 
ATOM 3010 N N   . LEU A 1 390  ? -1.782  47.259 33.106  1.00 25.10  ? 387  LEU A N   1 
ATOM 3011 C CA  . LEU A 1 390  ? -1.797  46.454 31.958  1.00 25.10  ? 387  LEU A CA  1 
ATOM 3012 C C   . LEU A 1 390  ? -1.578  47.584 30.955  1.00 25.10  ? 387  LEU A C   1 
ATOM 3013 O O   . LEU A 1 390  ? -1.960  48.753 31.240  1.00 25.10  ? 387  LEU A O   1 
ATOM 3014 C CB  . LEU A 1 390  ? -3.139  45.734 31.825  1.00 11.46  ? 387  LEU A CB  1 
ATOM 3015 C CG  . LEU A 1 390  ? -3.527  44.651 32.858  1.00 11.46  ? 387  LEU A CG  1 
ATOM 3016 C CD1 . LEU A 1 390  ? -4.778  43.871 32.300  1.00 11.46  ? 387  LEU A CD1 1 
ATOM 3017 C CD2 . LEU A 1 390  ? -2.318  43.673 33.200  1.00 11.46  ? 387  LEU A CD2 1 
ATOM 3018 N N   . ARG A 1 391  ? -0.890  47.274 29.842  1.00 31.50  ? 388  ARG A N   1 
ATOM 3019 C CA  . ARG A 1 391  ? -0.793  48.190 28.749  1.00 31.50  ? 388  ARG A CA  1 
ATOM 3020 C C   . ARG A 1 391  ? -1.299  47.413 27.560  1.00 31.50  ? 388  ARG A C   1 
ATOM 3021 O O   . ARG A 1 391  ? -0.854  46.289 27.302  1.00 31.50  ? 388  ARG A O   1 
ATOM 3022 C CB  . ARG A 1 391  ? 0.658   48.664 28.509  1.00 23.00  ? 388  ARG A CB  1 
ATOM 3023 C CG  . ARG A 1 391  ? 1.354   49.402 29.673  1.00 23.00  ? 388  ARG A CG  1 
ATOM 3024 C CD  . ARG A 1 391  ? 0.639   50.619 30.110  1.00 23.00  ? 388  ARG A CD  1 
ATOM 3025 N NE  . ARG A 1 391  ? 1.183   51.106 31.366  1.00 23.00  ? 388  ARG A NE  1 
ATOM 3026 C CZ  . ARG A 1 391  ? 1.770   52.287 31.472  1.00 23.00  ? 388  ARG A CZ  1 
ATOM 3027 N NH1 . ARG A 1 391  ? 1.830   53.031 30.382  1.00 23.00  ? 388  ARG A NH1 1 
ATOM 3028 N NH2 . ARG A 1 391  ? 2.259   52.759 32.618  1.00 23.00  ? 388  ARG A NH2 1 
ATOM 3029 N N   . ILE A 1 392  ? -2.268  48.019 26.873  1.00 41.93  ? 389  ILE A N   1 
ATOM 3030 C CA  . ILE A 1 392  ? -2.811  47.428 25.669  1.00 41.93  ? 389  ILE A CA  1 
ATOM 3031 C C   . ILE A 1 392  ? -2.113  48.128 24.528  1.00 41.93  ? 389  ILE A C   1 
ATOM 3032 O O   . ILE A 1 392  ? -2.132  49.338 24.457  1.00 41.93  ? 389  ILE A O   1 
ATOM 3033 C CB  . ILE A 1 392  ? -4.365  47.505 25.576  1.00 28.09  ? 389  ILE A CB  1 
ATOM 3034 C CG1 . ILE A 1 392  ? -4.986  46.805 26.745  1.00 28.09  ? 389  ILE A CG1 1 
ATOM 3035 C CG2 . ILE A 1 392  ? -4.861  46.715 24.402  1.00 28.09  ? 389  ILE A CG2 1 
ATOM 3036 C CD1 . ILE A 1 392  ? -5.211  47.697 27.833  1.00 28.09  ? 389  ILE A CD1 1 
ATOM 3037 N N   . ILE A 1 393  ? -1.467  47.349 23.664  1.00 45.64  ? 390  ILE A N   1 
ATOM 3038 C CA  . ILE A 1 393  ? -0.591  47.903 22.646  1.00 45.64  ? 390  ILE A CA  1 
ATOM 3039 C C   . ILE A 1 393  ? -1.035  47.459 21.274  1.00 45.64  ? 390  ILE A C   1 
ATOM 3040 O O   . ILE A 1 393  ? -1.189  46.253 20.989  1.00 45.64  ? 390  ILE A O   1 
ATOM 3041 C CB  . ILE A 1 393  ? 0.872   47.496 22.866  1.00 33.43  ? 390  ILE A CB  1 
ATOM 3042 C CG1 . ILE A 1 393  ? 1.121   47.206 24.341  1.00 33.43  ? 390  ILE A CG1 1 
ATOM 3043 C CG2 . ILE A 1 393  ? 1.791   48.570 22.290  1.00 33.43  ? 390  ILE A CG2 1 
ATOM 3044 C CD1 . ILE A 1 393  ? 2.515   47.463 24.816  1.00 33.43  ? 390  ILE A CD1 1 
ATOM 3045 N N   . ARG A 1 394  ? -1.241  48.457 20.427  1.00 36.37  ? 391  ARG A N   1 
ATOM 3046 C CA  . ARG A 1 394  ? -1.901  48.236 19.142  1.00 36.37  ? 391  ARG A CA  1 
ATOM 3047 C C   . ARG A 1 394  ? -1.184  49.067 18.103  1.00 36.37  ? 391  ARG A C   1 
ATOM 3048 O O   . ARG A 1 394  ? -1.060  50.306 18.230  1.00 36.37  ? 391  ARG A O   1 
ATOM 3049 C CB  . ARG A 1 394  ? -3.367  48.666 19.243  1.00 71.13  ? 391  ARG A CB  1 
ATOM 3050 C CG  . ARG A 1 394  ? -4.255  48.254 18.087  1.00 71.13  ? 391  ARG A CG  1 
ATOM 3051 C CD  . ARG A 1 394  ? -4.606  49.380 17.089  1.00 71.13  ? 391  ARG A CD  1 
ATOM 3052 N NE  . ARG A 1 394  ? -4.864  50.720 17.642  1.00 71.13  ? 391  ARG A NE  1 
ATOM 3053 C CZ  . ARG A 1 394  ? -5.915  51.066 18.387  1.00 71.13  ? 391  ARG A CZ  1 
ATOM 3054 N NH1 . ARG A 1 394  ? -6.834  50.168 18.734  1.00 71.13  ? 391  ARG A NH1 1 
ATOM 3055 N NH2 . ARG A 1 394  ? -6.034  52.319 18.807  1.00 71.13  ? 391  ARG A NH2 1 
ATOM 3056 N N   . ASN A 1 395  ? -0.703  48.375 17.078  1.00 51.04  ? 392  ASN A N   1 
ATOM 3057 C CA  . ASN A 1 395  ? -0.088  49.044 15.945  1.00 51.04  ? 392  ASN A CA  1 
ATOM 3058 C C   . ASN A 1 395  ? -1.133  49.843 15.166  1.00 51.04  ? 392  ASN A C   1 
ATOM 3059 O O   . ASN A 1 395  ? -2.273  49.396 14.972  1.00 51.04  ? 392  ASN A O   1 
ATOM 3060 C CB  . ASN A 1 395  ? 0.574   48.018 15.034  1.00 140.34 ? 392  ASN A CB  1 
ATOM 3061 C CG  . ASN A 1 395  ? 1.869   48.519 14.447  1.00 140.34 ? 392  ASN A CG  1 
ATOM 3062 O OD1 . ASN A 1 395  ? 2.940   48.024 14.796  1.00 140.34 ? 392  ASN A OD1 1 
ATOM 3063 N ND2 . ASN A 1 395  ? 1.787   49.512 13.559  1.00 140.34 ? 392  ASN A ND2 1 
ATOM 3064 N N   . GLY A 1 396  ? -0.753  51.038 14.746  1.00 37.96  ? 393  GLY A N   1 
ATOM 3065 C CA  . GLY A 1 396  ? -1.506  51.709 13.717  1.00 37.96  ? 393  GLY A CA  1 
ATOM 3066 C C   . GLY A 1 396  ? -2.429  52.767 14.241  1.00 37.96  ? 393  GLY A C   1 
ATOM 3067 O O   . GLY A 1 396  ? -2.536  53.009 15.449  1.00 37.96  ? 393  GLY A O   1 
ATOM 3068 N N   . ILE A 1 397  ? -3.065  53.448 13.315  1.00 64.19  ? 394  ILE A N   1 
ATOM 3069 C CA  . ILE A 1 397  ? -3.986  54.472 13.693  1.00 64.19  ? 394  ILE A CA  1 
ATOM 3070 C C   . ILE A 1 397  ? -5.337  54.031 13.159  1.00 64.19  ? 394  ILE A C   1 
ATOM 3071 O O   . ILE A 1 397  ? -5.488  53.695 11.981  1.00 64.19  ? 394  ILE A O   1 
ATOM 3072 C CB  . ILE A 1 397  ? -3.534  55.856 13.147  1.00 33.48  ? 394  ILE A CB  1 
ATOM 3073 C CG1 . ILE A 1 397  ? -2.130  56.210 13.615  1.00 33.48  ? 394  ILE A CG1 1 
ATOM 3074 C CG2 . ILE A 1 397  ? -4.523  56.990 13.559  1.00 33.48  ? 394  ILE A CG2 1 
ATOM 3075 C CD1 . ILE A 1 397  ? -1.469  57.191 12.678  1.00 33.48  ? 394  ILE A CD1 1 
ATOM 3076 N N   . GLY A 1 398  ? -6.314  53.993 14.043  1.00 49.16  ? 395  GLY A N   1 
ATOM 3077 C CA  . GLY A 1 398  ? -7.642  53.560 13.645  1.00 49.16  ? 395  GLY A CA  1 
ATOM 3078 C C   . GLY A 1 398  ? -8.587  54.735 13.538  1.00 49.16  ? 395  GLY A C   1 
ATOM 3079 O O   . GLY A 1 398  ? -8.266  55.854 13.975  1.00 49.16  ? 395  GLY A O   1 
ATOM 3080 N N   . ILE A 1 399  ? -9.747  54.471 12.944  1.00 46.92  ? 396  ILE A N   1 
ATOM 3081 C CA  . ILE A 1 399  ? -10.848 55.425 12.869  1.00 46.92  ? 396  ILE A CA  1 
ATOM 3082 C C   . ILE A 1 399  ? -12.140 54.691 13.212  1.00 46.92  ? 396  ILE A C   1 
ATOM 3083 O O   . ILE A 1 399  ? -12.275 53.490 12.910  1.00 46.92  ? 396  ILE A O   1 
ATOM 3084 C CB  . ILE A 1 399  ? -10.943 56.076 11.451  1.00 64.14  ? 396  ILE A CB  1 
ATOM 3085 C CG1 . ILE A 1 399  ? -11.002 55.012 10.354  1.00 64.14  ? 396  ILE A CG1 1 
ATOM 3086 C CG2 . ILE A 1 399  ? -9.718  56.952 11.157  1.00 64.14  ? 396  ILE A CG2 1 
ATOM 3087 C CD1 . ILE A 1 399  ? -12.380 54.705 9.832   1.00 64.14  ? 396  ILE A CD1 1 
ATOM 3088 N N   . HIS A 1 400  ? -13.101 55.396 13.812  1.00 73.06  ? 397  HIS A N   1 
ATOM 3089 C CA  . HIS A 1 400  ? -14.416 54.800 14.140  1.00 73.06  ? 397  HIS A CA  1 
ATOM 3090 C C   . HIS A 1 400  ? -15.529 55.126 13.106  1.00 73.06  ? 397  HIS A C   1 
ATOM 3091 O O   . HIS A 1 400  ? -15.889 56.295 12.943  1.00 73.06  ? 397  HIS A O   1 
ATOM 3092 C CB  . HIS A 1 400  ? -14.820 55.214 15.555  1.00 123.99 ? 397  HIS A CB  1 
ATOM 3093 C CG  . HIS A 1 400  ? -13.651 55.461 16.461  1.00 123.99 ? 397  HIS A CG  1 
ATOM 3094 N ND1 . HIS A 1 400  ? -12.731 54.482 16.773  1.00 123.99 ? 397  HIS A ND1 1 
ATOM 3095 C CD2 . HIS A 1 400  ? -13.245 56.579 17.110  1.00 123.99 ? 397  HIS A CD2 1 
ATOM 3096 C CE1 . HIS A 1 400  ? -11.814 54.984 17.582  1.00 123.99 ? 397  HIS A CE1 1 
ATOM 3097 N NE2 . HIS A 1 400  ? -12.105 56.254 17.805  1.00 123.99 ? 397  HIS A NE2 1 
ATOM 3098 N N   . GLU A 1 401  ? -16.060 54.088 12.433  1.00 85.16  ? 398  GLU A N   1 
ATOM 3099 C CA  . GLU A 1 401  ? -17.042 54.235 11.306  1.00 85.16  ? 398  GLU A CA  1 
ATOM 3100 C C   . GLU A 1 401  ? -18.529 54.488 11.673  1.00 85.16  ? 398  GLU A C   1 
ATOM 3101 O O   . GLU A 1 401  ? -19.165 53.698 12.382  1.00 85.16  ? 398  GLU A O   1 
ATOM 3102 C CB  . GLU A 1 401  ? -16.923 53.094 10.271  1.00 100.12 ? 398  GLU A CB  1 
ATOM 3103 C CG  . GLU A 1 401  ? -17.384 51.716 10.744  1.00 100.12 ? 398  GLU A CG  1 
ATOM 3104 C CD  . GLU A 1 401  ? -17.790 50.788 9.593   1.00 100.12 ? 398  GLU A CD  1 
ATOM 3105 O OE1 . GLU A 1 401  ? -18.750 51.125 8.861   1.00 100.12 ? 398  GLU A OE1 1 
ATOM 3106 O OE2 . GLU A 1 401  ? -17.166 49.710 9.430   1.00 100.12 ? 398  GLU A OE2 1 
ATOM 3107 N N   . HIS A 1 402  ? -19.077 55.580 11.143  1.00 187.16 ? 399  HIS A N   1 
ATOM 3108 C CA  . HIS A 1 402  ? -20.392 56.079 11.560  1.00 187.16 ? 399  HIS A CA  1 
ATOM 3109 C C   . HIS A 1 402  ? -21.525 55.796 10.562  1.00 187.16 ? 399  HIS A C   1 
ATOM 3110 O O   . HIS A 1 402  ? -22.631 55.442 10.973  1.00 187.16 ? 399  HIS A O   1 
ATOM 3111 C CB  . HIS A 1 402  ? -20.298 57.569 11.925  1.00 86.50  ? 399  HIS A CB  1 
ATOM 3112 C CG  . HIS A 1 402  ? -19.393 57.849 13.095  1.00 86.50  ? 399  HIS A CG  1 
ATOM 3113 N ND1 . HIS A 1 402  ? -19.451 59.020 13.823  1.00 86.50  ? 399  HIS A ND1 1 
ATOM 3114 C CD2 . HIS A 1 402  ? -18.427 57.096 13.677  1.00 86.50  ? 399  HIS A CD2 1 
ATOM 3115 C CE1 . HIS A 1 402  ? -18.550 58.982 14.791  1.00 86.50  ? 399  HIS A CE1 1 
ATOM 3116 N NE2 . HIS A 1 402  ? -17.915 57.826 14.723  1.00 86.50  ? 399  HIS A NE2 1 
ATOM 3117 N N   . ALA A 1 403  ? -21.254 55.948 9.264   1.00 68.42  ? 400  ALA A N   1 
ATOM 3118 C CA  . ALA A 1 403  ? -22.194 55.526 8.219   1.00 68.42  ? 400  ALA A CA  1 
ATOM 3119 C C   . ALA A 1 403  ? -21.503 54.658 7.165   1.00 68.42  ? 400  ALA A C   1 
ATOM 3120 O O   . ALA A 1 403  ? -20.279 54.562 7.129   1.00 68.42  ? 400  ALA A O   1 
ATOM 3121 C CB  . ALA A 1 403  ? -22.885 56.731 7.569   1.00 30.88  ? 400  ALA A CB  1 
ATOM 3122 N N   . SER A 1 404  ? -22.294 54.013 6.319   1.00 98.61  ? 401  SER A N   1 
ATOM 3123 C CA  . SER A 1 404  ? -21.732 53.136 5.306   1.00 98.61  ? 401  SER A CA  1 
ATOM 3124 C C   . SER A 1 404  ? -22.553 53.172 4.005   1.00 98.61  ? 401  SER A C   1 
ATOM 3125 O O   . SER A 1 404  ? -23.366 52.288 3.728   1.00 98.61  ? 401  SER A O   1 
ATOM 3126 C CB  . SER A 1 404  ? -21.577 51.715 5.862   1.00 61.72  ? 401  SER A CB  1 
ATOM 3127 O OG  . SER A 1 404  ? -20.352 51.127 5.436   1.00 61.72  ? 401  SER A OG  1 
ATOM 3128 N N   . ILE A 1 405  ? -22.324 54.210 3.211   1.00 191.77 ? 402  ILE A N   1 
ATOM 3129 C CA  . ILE A 1 405  ? -23.080 54.402 1.981   1.00 191.77 ? 402  ILE A CA  1 
ATOM 3130 C C   . ILE A 1 405  ? -22.327 53.826 0.778   1.00 191.77 ? 402  ILE A C   1 
ATOM 3131 O O   . ILE A 1 405  ? -21.264 54.328 0.402   1.00 191.77 ? 402  ILE A O   1 
ATOM 3132 C CB  . ILE A 1 405  ? -23.444 55.895 1.771   1.00 63.70  ? 402  ILE A CB  1 
ATOM 3133 C CG1 . ILE A 1 405  ? -24.379 56.391 2.886   1.00 63.70  ? 402  ILE A CG1 1 
ATOM 3134 C CG2 . ILE A 1 405  ? -24.087 56.119 0.393   1.00 63.70  ? 402  ILE A CG2 1 
ATOM 3135 C CD1 . ILE A 1 405  ? -23.687 57.196 3.978   1.00 63.70  ? 402  ILE A CD1 1 
ATOM 3136 N N   . ASP A 1 406  ? -22.896 52.775 0.187   1.00 141.35 ? 403  ASP A N   1 
ATOM 3137 C CA  . ASP A 1 406  ? -22.301 52.075 -0.962  1.00 141.35 ? 403  ASP A CA  1 
ATOM 3138 C C   . ASP A 1 406  ? -22.271 52.923 -2.228  1.00 141.35 ? 403  ASP A C   1 
ATOM 3139 O O   . ASP A 1 406  ? -23.306 53.127 -2.871  1.00 141.35 ? 403  ASP A O   1 
ATOM 3140 C CB  . ASP A 1 406  ? -23.058 50.781 -1.259  1.00 129.80 ? 403  ASP A CB  1 
ATOM 3141 C CG  . ASP A 1 406  ? -23.237 49.920 -0.037  1.00 129.80 ? 403  ASP A CG  1 
ATOM 3142 O OD1 . ASP A 1 406  ? -22.947 48.708 -0.120  1.00 129.80 ? 403  ASP A OD1 1 
ATOM 3143 O OD2 . ASP A 1 406  ? -23.665 50.459 1.009   1.00 129.80 ? 403  ASP A OD2 1 
ATOM 3144 N N   . LEU A 1 407  ? -21.083 53.403 -2.588  1.00 187.05 ? 404  LEU A N   1 
ATOM 3145 C CA  . LEU A 1 407  ? -20.912 54.218 -3.793  1.00 187.05 ? 404  LEU A CA  1 
ATOM 3146 C C   . LEU A 1 407  ? -19.657 53.825 -4.591  1.00 187.05 ? 404  LEU A C   1 
ATOM 3147 O O   . LEU A 1 407  ? -18.621 54.489 -4.481  1.00 187.05 ? 404  LEU A O   1 
ATOM 3148 C CB  . LEU A 1 407  ? -20.912 55.714 -3.436  1.00 58.79  ? 404  LEU A CB  1 
ATOM 3149 C CG  . LEU A 1 407  ? -22.133 56.211 -2.644  1.00 58.79  ? 404  LEU A CG  1 
ATOM 3150 C CD1 . LEU A 1 407  ? -21.877 57.503 -1.861  1.00 58.79  ? 404  LEU A CD1 1 
ATOM 3151 C CD2 . LEU A 1 407  ? -23.318 56.376 -3.586  1.00 58.79  ? 404  LEU A CD2 1 
ATOM 3152 N N   . PRO A 1 408  ? -19.750 52.734 -5.392  1.00 167.68 ? 405  PRO A N   1 
ATOM 3153 C CA  . PRO A 1 408  ? -18.639 52.272 -6.237  1.00 167.68 ? 405  PRO A CA  1 
ATOM 3154 C C   . PRO A 1 408  ? -18.298 53.252 -7.364  1.00 167.68 ? 405  PRO A C   1 
ATOM 3155 O O   . PRO A 1 408  ? -18.538 52.971 -8.541  1.00 167.68 ? 405  PRO A O   1 
ATOM 3156 C CB  . PRO A 1 408  ? -19.147 50.930 -6.800  1.00 146.26 ? 405  PRO A CB  1 
ATOM 3157 C CG  . PRO A 1 408  ? -20.335 50.556 -5.960  1.00 146.26 ? 405  PRO A CG  1 
ATOM 3158 C CD  . PRO A 1 408  ? -20.928 51.856 -5.527  1.00 146.26 ? 405  PRO A CD  1 
ATOM 3159 N N   . GLY A 1 409  ? -17.730 54.393 -6.992  1.00 123.02 ? 406  GLY A N   1 
ATOM 3160 C CA  . GLY A 1 409  ? -17.367 55.414 -7.956  1.00 123.02 ? 406  GLY A CA  1 
ATOM 3161 C C   . GLY A 1 409  ? -16.569 56.558 -7.370  1.00 123.02 ? 406  GLY A C   1 
ATOM 3162 O O   . GLY A 1 409  ? -15.468 56.832 -7.831  1.00 123.02 ? 406  GLY A O   1 
ATOM 3163 N N   . ILE A 1 410  ? -17.121 57.210 -6.348  1.00 117.36 ? 407  ILE A N   1 
ATOM 3164 C CA  . ILE A 1 410  ? -16.579 58.465 -5.802  1.00 117.36 ? 407  ILE A CA  1 
ATOM 3165 C C   . ILE A 1 410  ? -15.110 58.735 -6.172  1.00 117.36 ? 407  ILE A C   1 
ATOM 3166 O O   . ILE A 1 410  ? -14.204 57.999 -5.768  1.00 117.36 ? 407  ILE A O   1 
ATOM 3167 C CB  . ILE A 1 410  ? -16.762 58.568 -4.262  1.00 61.09  ? 407  ILE A CB  1 
ATOM 3168 C CG1 . ILE A 1 410  ? -18.061 57.885 -3.796  1.00 61.09  ? 407  ILE A CG1 1 
ATOM 3169 C CG2 . ILE A 1 410  ? -16.696 60.033 -3.820  1.00 61.09  ? 407  ILE A CG2 1 
ATOM 3170 C CD1 . ILE A 1 410  ? -18.218 57.760 -2.263  1.00 61.09  ? 407  ILE A CD1 1 
ATOM 3171 N N   . LYS A 1 411  ? -14.898 59.803 -6.940  1.00 87.43  ? 408  LYS A N   1 
ATOM 3172 C CA  . LYS A 1 411  ? -13.590 60.127 -7.509  1.00 87.43  ? 408  LYS A CA  1 
ATOM 3173 C C   . LYS A 1 411  ? -13.052 61.426 -6.942  1.00 87.43  ? 408  LYS A C   1 
ATOM 3174 O O   . LYS A 1 411  ? -12.085 61.995 -7.448  1.00 87.43  ? 408  LYS A O   1 
ATOM 3175 C CB  . LYS A 1 411  ? -13.681 60.256 -9.023  1.00 51.84  ? 408  LYS A CB  1 
ATOM 3176 C CG  . LYS A 1 411  ? -14.149 59.017 -9.758  1.00 51.84  ? 408  LYS A CG  1 
ATOM 3177 C CD  . LYS A 1 411  ? -13.032 58.058 -10.155 1.00 51.84  ? 408  LYS A CD  1 
ATOM 3178 C CE  . LYS A 1 411  ? -13.662 56.775 -10.700 1.00 51.84  ? 408  LYS A CE  1 
ATOM 3179 N NZ  . LYS A 1 411  ? -12.714 55.711 -11.171 1.00 51.84  ? 408  LYS A NZ  1 
ATOM 3180 N N   . GLY A 1 412  ? -13.688 61.893 -5.882  1.00 54.84  ? 409  GLY A N   1 
ATOM 3181 C CA  . GLY A 1 412  ? -13.252 63.101 -5.191  1.00 54.84  ? 409  GLY A CA  1 
ATOM 3182 C C   . GLY A 1 412  ? -14.371 63.373 -4.214  1.00 54.84  ? 409  GLY A C   1 
ATOM 3183 O O   . GLY A 1 412  ? -15.403 62.675 -4.256  1.00 54.84  ? 409  GLY A O   1 
ATOM 3184 N N   . LEU A 1 413  ? -14.154 64.341 -3.318  1.00 56.41  ? 410  LEU A N   1 
ATOM 3185 C CA  . LEU A 1 413  ? -15.201 64.883 -2.451  1.00 56.41  ? 410  LEU A CA  1 
ATOM 3186 C C   . LEU A 1 413  ? -14.677 66.011 -1.589  1.00 56.41  ? 410  LEU A C   1 
ATOM 3187 O O   . LEU A 1 413  ? -13.555 65.940 -1.079  1.00 56.41  ? 410  LEU A O   1 
ATOM 3188 C CB  . LEU A 1 413  ? -15.882 63.805 -1.593  1.00 99.01  ? 410  LEU A CB  1 
ATOM 3189 C CG  . LEU A 1 413  ? -15.089 62.702 -0.898  1.00 99.01  ? 410  LEU A CG  1 
ATOM 3190 C CD1 . LEU A 1 413  ? -14.625 63.158 0.468   1.00 99.01  ? 410  LEU A CD1 1 
ATOM 3191 C CD2 . LEU A 1 413  ? -15.949 61.450 -0.786  1.00 99.01  ? 410  LEU A CD2 1 
ATOM 3192 N N   . TRP A 1 414  ? -15.495 67.061 -1.467  1.00 104.55 ? 411  TRP A N   1 
ATOM 3193 C CA  . TRP A 1 414  ? -15.169 68.257 -0.677  1.00 104.55 ? 411  TRP A CA  1 
ATOM 3194 C C   . TRP A 1 414  ? -16.326 68.552 0.279   1.00 104.55 ? 411  TRP A C   1 
ATOM 3195 O O   . TRP A 1 414  ? -17.487 68.241 -0.045  1.00 104.55 ? 411  TRP A O   1 
ATOM 3196 C CB  . TRP A 1 414  ? -14.875 69.494 -1.576  1.00 59.08  ? 411  TRP A CB  1 
ATOM 3197 C CG  . TRP A 1 414  ? -13.726 69.303 -2.546  1.00 59.08  ? 411  TRP A CG  1 
ATOM 3198 C CD1 . TRP A 1 414  ? -12.460 69.801 -2.427  1.00 59.08  ? 411  TRP A CD1 1 
ATOM 3199 C CD2 . TRP A 1 414  ? -13.745 68.539 -3.753  1.00 59.08  ? 411  TRP A CD2 1 
ATOM 3200 N NE1 . TRP A 1 414  ? -11.692 69.393 -3.486  1.00 59.08  ? 411  TRP A NE1 1 
ATOM 3201 C CE2 . TRP A 1 414  ? -12.452 68.614 -4.313  1.00 59.08  ? 411  TRP A CE2 1 
ATOM 3202 C CE3 . TRP A 1 414  ? -14.728 67.796 -4.415  1.00 59.08  ? 411  TRP A CE3 1 
ATOM 3203 C CZ2 . TRP A 1 414  ? -12.112 67.982 -5.517  1.00 59.08  ? 411  TRP A CZ2 1 
ATOM 3204 C CZ3 . TRP A 1 414  ? -14.392 67.153 -5.619  1.00 59.08  ? 411  TRP A CZ3 1 
ATOM 3205 C CH2 . TRP A 1 414  ? -13.091 67.258 -6.159  1.00 59.08  ? 411  TRP A CH2 1 
ATOM 3206 N N   . PRO A 1 415  ? -16.009 69.159 1.454   1.00 97.10  ? 412  PRO A N   1 
ATOM 3207 C CA  . PRO A 1 415  ? -16.963 69.608 2.496   1.00 97.10  ? 412  PRO A CA  1 
ATOM 3208 C C   . PRO A 1 415  ? -18.042 70.547 1.943   1.00 97.10  ? 412  PRO A C   1 
ATOM 3209 O O   . PRO A 1 415  ? -17.893 71.024 0.814   1.00 97.10  ? 412  PRO A O   1 
ATOM 3210 C CB  . PRO A 1 415  ? -16.066 70.384 3.485   1.00 89.57  ? 412  PRO A CB  1 
ATOM 3211 C CG  . PRO A 1 415  ? -14.766 70.613 2.789   1.00 89.57  ? 412  PRO A CG  1 
ATOM 3212 C CD  . PRO A 1 415  ? -14.616 69.462 1.838   1.00 89.57  ? 412  PRO A CD  1 
ATOM 3213 N N   . LEU A 1 416  ? -19.108 70.816 2.708   1.00 154.25 ? 413  LEU A N   1 
ATOM 3214 C CA  . LEU A 1 416  ? -20.061 71.876 2.307   1.00 154.25 ? 413  LEU A CA  1 
ATOM 3215 C C   . LEU A 1 416  ? -21.031 72.379 3.373   1.00 154.25 ? 413  LEU A C   1 
ATOM 3216 O O   . LEU A 1 416  ? -22.066 71.763 3.638   1.00 154.25 ? 413  LEU A O   1 
ATOM 3217 C CB  . LEU A 1 416  ? -20.827 71.499 1.028   1.00 147.14 ? 413  LEU A CB  1 
ATOM 3218 C CG  . LEU A 1 416  ? -21.286 72.635 0.105   1.00 147.14 ? 413  LEU A CG  1 
ATOM 3219 C CD1 . LEU A 1 416  ? -20.114 73.513 -0.339  1.00 147.14 ? 413  LEU A CD1 1 
ATOM 3220 C CD2 . LEU A 1 416  ? -22.020 72.081 -1.108  1.00 147.14 ? 413  LEU A CD2 1 
ATOM 3221 N N   . ARG A 1 417  ? -20.678 73.520 3.960   1.00 136.89 ? 414  ARG A N   1 
ATOM 3222 C CA  . ARG A 1 417  ? -21.546 74.253 4.875   1.00 136.89 ? 414  ARG A CA  1 
ATOM 3223 C C   . ARG A 1 417  ? -22.637 74.951 4.070   1.00 136.89 ? 414  ARG A C   1 
ATOM 3224 O O   . ARG A 1 417  ? -22.360 75.873 3.299   1.00 136.89 ? 414  ARG A O   1 
ATOM 3225 C CB  . ARG A 1 417  ? -20.740 75.267 5.712   1.00 60.19  ? 414  ARG A CB  1 
ATOM 3226 C CG  . ARG A 1 417  ? -19.685 76.058 4.909   1.00 60.19  ? 414  ARG A CG  1 
ATOM 3227 C CD  . ARG A 1 417  ? -19.357 77.486 5.449   1.00 60.19  ? 414  ARG A CD  1 
ATOM 3228 N NE  . ARG A 1 417  ? -18.440 77.494 6.597   1.00 60.19  ? 414  ARG A NE  1 
ATOM 3229 C CZ  . ARG A 1 417  ? -17.219 76.948 6.613   1.00 60.19  ? 414  ARG A CZ  1 
ATOM 3230 N NH1 . ARG A 1 417  ? -16.746 76.326 5.535   1.00 60.19  ? 414  ARG A NH1 1 
ATOM 3231 N NH2 . ARG A 1 417  ? -16.460 77.029 7.712   1.00 60.19  ? 414  ARG A NH2 1 
ATOM 3232 N N   . SER A 1 418  ? -23.875 74.498 4.235   1.00 117.08 ? 415  SER A N   1 
ATOM 3233 C CA  . SER A 1 418  ? -24.994 75.098 3.512   1.00 117.08 ? 415  SER A CA  1 
ATOM 3234 C C   . SER A 1 418  ? -25.510 76.387 4.179   1.00 117.08 ? 415  SER A C   1 
ATOM 3235 O O   . SER A 1 418  ? -26.294 77.135 3.587   1.00 117.08 ? 415  SER A O   1 
ATOM 3236 C CB  . SER A 1 418  ? -26.120 74.084 3.348   1.00 100.54 ? 415  SER A CB  1 
ATOM 3237 O OG  . SER A 1 418  ? -26.857 74.335 2.168   1.00 100.54 ? 415  SER A OG  1 
ATOM 3238 N N   . ASP A 1 419  ? -25.061 76.638 5.408   1.00 200.66 ? 416  ASP A N   1 
ATOM 3239 C CA  . ASP A 1 419  ? -25.387 77.871 6.120   1.00 200.66 ? 416  ASP A CA  1 
ATOM 3240 C C   . ASP A 1 419  ? -24.112 78.691 6.373   1.00 200.66 ? 416  ASP A C   1 
ATOM 3241 O O   . ASP A 1 419  ? -23.168 78.200 7.004   1.00 200.66 ? 416  ASP A O   1 
ATOM 3242 C CB  . ASP A 1 419  ? -26.129 77.557 7.426   1.00 169.00 ? 416  ASP A CB  1 
ATOM 3243 C CG  . ASP A 1 419  ? -26.805 78.779 8.035   1.00 169.00 ? 416  ASP A CG  1 
ATOM 3244 O OD1 . ASP A 1 419  ? -26.637 79.001 9.255   1.00 169.00 ? 416  ASP A OD1 1 
ATOM 3245 O OD2 . ASP A 1 419  ? -27.502 79.518 7.306   1.00 169.00 ? 416  ASP A OD2 1 
ATOM 3246 N N   . PRO A 1 420  ? -24.080 79.943 5.868   1.00 156.72 ? 417  PRO A N   1 
ATOM 3247 C CA  . PRO A 1 420  ? -22.904 80.834 5.900   1.00 156.72 ? 417  PRO A CA  1 
ATOM 3248 C C   . PRO A 1 420  ? -22.457 81.286 7.301   1.00 156.72 ? 417  PRO A C   1 
ATOM 3249 O O   . PRO A 1 420  ? -21.609 82.178 7.421   1.00 156.72 ? 417  PRO A O   1 
ATOM 3250 C CB  . PRO A 1 420  ? -23.360 82.046 5.070   1.00 127.01 ? 417  PRO A CB  1 
ATOM 3251 C CG  . PRO A 1 420  ? -24.574 81.578 4.306   1.00 127.01 ? 417  PRO A CG  1 
ATOM 3252 C CD  . PRO A 1 420  ? -25.226 80.581 5.195   1.00 127.01 ? 417  PRO A CD  1 
ATOM 3253 N N   . ASN A 1 421  ? -23.024 80.670 8.338   1.00 200.42 ? 418  ASN A N   1 
ATOM 3254 C CA  . ASN A 1 421  ? -22.689 80.973 9.730   1.00 200.42 ? 418  ASN A CA  1 
ATOM 3255 C C   . ASN A 1 421  ? -21.888 79.826 10.330  1.00 200.42 ? 418  ASN A C   1 
ATOM 3256 O O   . ASN A 1 421  ? -20.657 79.879 10.405  1.00 200.42 ? 418  ASN A O   1 
ATOM 3257 C CB  . ASN A 1 421  ? -23.957 81.190 10.575  1.00 116.00 ? 418  ASN A CB  1 
ATOM 3258 C CG  . ASN A 1 421  ? -25.023 81.984 9.850   1.00 116.00 ? 418  ASN A CG  1 
ATOM 3259 O OD1 . ASN A 1 421  ? -25.258 83.150 10.162  1.00 116.00 ? 418  ASN A OD1 1 
ATOM 3260 N ND2 . ASN A 1 421  ? -25.677 81.356 8.878   1.00 116.00 ? 418  ASN A ND2 1 
ATOM 3261 N N   . ARG A 1 422  ? -22.619 78.795 10.750  1.00 201.00 ? 419  ARG A N   1 
ATOM 3262 C CA  . ARG A 1 422  ? -22.074 77.588 11.364  1.00 201.00 ? 419  ARG A CA  1 
ATOM 3263 C C   . ARG A 1 422  ? -20.853 77.038 10.626  1.00 201.00 ? 419  ARG A C   1 
ATOM 3264 O O   . ARG A 1 422  ? -20.848 76.958 9.392   1.00 201.00 ? 419  ARG A O   1 
ATOM 3265 C CB  . ARG A 1 422  ? -23.171 76.514 11.458  1.00 126.92 ? 419  ARG A CB  1 
ATOM 3266 C CG  . ARG A 1 422  ? -24.185 76.544 10.303  1.00 126.92 ? 419  ARG A CG  1 
ATOM 3267 C CD  . ARG A 1 422  ? -25.141 75.336 10.272  1.00 126.92 ? 419  ARG A CD  1 
ATOM 3268 N NE  . ARG A 1 422  ? -25.833 75.084 11.545  1.00 126.92 ? 419  ARG A NE  1 
ATOM 3269 C CZ  . ARG A 1 422  ? -26.992 74.428 11.673  1.00 126.92 ? 419  ARG A CZ  1 
ATOM 3270 N NH1 . ARG A 1 422  ? -27.630 73.954 10.608  1.00 126.92 ? 419  ARG A NH1 1 
ATOM 3271 N NH2 . ARG A 1 422  ? -27.526 74.250 12.876  1.00 126.92 ? 419  ARG A NH2 1 
ATOM 3272 N N   . GLU A 1 423  ? -19.820 76.680 11.395  1.00 119.47 ? 420  GLU A N   1 
ATOM 3273 C CA  . GLU A 1 423  ? -18.633 75.994 10.861  1.00 119.47 ? 420  GLU A CA  1 
ATOM 3274 C C   . GLU A 1 423  ? -18.899 74.504 10.640  1.00 119.47 ? 420  GLU A C   1 
ATOM 3275 O O   . GLU A 1 423  ? -17.977 73.722 10.371  1.00 119.47 ? 420  GLU A O   1 
ATOM 3276 C CB  . GLU A 1 423  ? -17.418 76.222 11.759  1.00 117.82 ? 420  GLU A CB  1 
ATOM 3277 C CG  . GLU A 1 423  ? -16.614 77.439 11.340  1.00 117.82 ? 420  GLU A CG  1 
ATOM 3278 C CD  . GLU A 1 423  ? -16.122 78.238 12.534  1.00 117.82 ? 420  GLU A CD  1 
ATOM 3279 O OE1 . GLU A 1 423  ? -15.596 77.626 13.501  1.00 117.82 ? 420  GLU A OE1 1 
ATOM 3280 O OE2 . GLU A 1 423  ? -16.267 79.484 12.507  1.00 117.82 ? 420  GLU A OE2 1 
ATOM 3281 N N   . THR A 1 424  ? -20.176 74.139 10.761  1.00 140.25 ? 421  THR A N   1 
ATOM 3282 C CA  . THR A 1 424  ? -20.676 72.821 10.384  1.00 140.25 ? 421  THR A CA  1 
ATOM 3283 C C   . THR A 1 424  ? -21.212 72.846 8.942   1.00 140.25 ? 421  THR A C   1 
ATOM 3284 O O   . THR A 1 424  ? -21.761 73.849 8.479   1.00 140.25 ? 421  THR A O   1 
ATOM 3285 C CB  . THR A 1 424  ? -21.760 72.272 11.381  1.00 121.73 ? 421  THR A CB  1 
ATOM 3286 O OG1 . THR A 1 424  ? -23.030 72.888 11.131  1.00 121.73 ? 421  THR A OG1 1 
ATOM 3287 C CG2 . THR A 1 424  ? -21.351 72.490 12.852  1.00 121.73 ? 421  THR A CG2 1 
ATOM 3288 N N   . TYR A 1 425  ? -21.030 71.727 8.250   1.00 108.14 ? 422  TYR A N   1 
ATOM 3289 C CA  . TYR A 1 425  ? -21.388 71.562 6.845   1.00 108.14 ? 422  TYR A CA  1 
ATOM 3290 C C   . TYR A 1 425  ? -22.530 70.546 6.764   1.00 108.14 ? 422  TYR A C   1 
ATOM 3291 O O   . TYR A 1 425  ? -22.590 69.628 7.578   1.00 108.14 ? 422  TYR A O   1 
ATOM 3292 C CB  . TYR A 1 425  ? -20.175 71.022 6.059   1.00 139.93 ? 422  TYR A CB  1 
ATOM 3293 C CG  . TYR A 1 425  ? -18.837 71.676 6.379   1.00 139.93 ? 422  TYR A CG  1 
ATOM 3294 C CD1 . TYR A 1 425  ? -18.209 71.462 7.608   1.00 139.93 ? 422  TYR A CD1 1 
ATOM 3295 C CD2 . TYR A 1 425  ? -18.187 72.484 5.448   1.00 139.93 ? 422  TYR A CD2 1 
ATOM 3296 C CE1 . TYR A 1 425  ? -16.985 72.051 7.914   1.00 139.93 ? 422  TYR A CE1 1 
ATOM 3297 C CE2 . TYR A 1 425  ? -16.954 73.078 5.742   1.00 139.93 ? 422  TYR A CE2 1 
ATOM 3298 C CZ  . TYR A 1 425  ? -16.363 72.854 6.981   1.00 139.93 ? 422  TYR A CZ  1 
ATOM 3299 O OH  . TYR A 1 425  ? -15.148 73.422 7.301   1.00 139.93 ? 422  TYR A OH  1 
ATOM 3300 N N   . ASP A 1 426  ? -23.440 70.698 5.803   1.00 125.06 ? 423  ASP A N   1 
ATOM 3301 C CA  . ASP A 1 426  ? -24.502 69.690 5.639   1.00 125.06 ? 423  ASP A CA  1 
ATOM 3302 C C   . ASP A 1 426  ? -24.521 69.006 4.266   1.00 125.06 ? 423  ASP A C   1 
ATOM 3303 O O   . ASP A 1 426  ? -25.454 68.261 3.957   1.00 125.06 ? 423  ASP A O   1 
ATOM 3304 C CB  . ASP A 1 426  ? -25.894 70.231 6.046   1.00 108.86 ? 423  ASP A CB  1 
ATOM 3305 C CG  . ASP A 1 426  ? -26.589 71.028 4.937   1.00 108.86 ? 423  ASP A CG  1 
ATOM 3306 O OD1 . ASP A 1 426  ? -27.772 71.394 5.122   1.00 108.86 ? 423  ASP A OD1 1 
ATOM 3307 O OD2 . ASP A 1 426  ? -25.969 71.289 3.886   1.00 108.86 ? 423  ASP A OD2 1 
ATOM 3308 N N   . THR A 1 427  ? -23.483 69.252 3.464   1.00 86.09  ? 424  THR A N   1 
ATOM 3309 C CA  . THR A 1 427  ? -23.380 68.672 2.124   1.00 86.09  ? 424  THR A CA  1 
ATOM 3310 C C   . THR A 1 427  ? -21.989 68.104 1.795   1.00 86.09  ? 424  THR A C   1 
ATOM 3311 O O   . THR A 1 427  ? -20.952 68.631 2.229   1.00 86.09  ? 424  THR A O   1 
ATOM 3312 C CB  . THR A 1 427  ? -23.770 69.707 1.048   1.00 126.94 ? 424  THR A CB  1 
ATOM 3313 O OG1 . THR A 1 427  ? -24.938 70.422 1.468   1.00 126.94 ? 424  THR A OG1 1 
ATOM 3314 C CG2 . THR A 1 427  ? -24.032 69.041 -0.299  1.00 126.94 ? 424  THR A CG2 1 
ATOM 3315 N N   . LEU A 1 428  ? -21.967 67.032 1.013   1.00 161.63 ? 425  LEU A N   1 
ATOM 3316 C CA  . LEU A 1 428  ? -20.707 66.544 0.466   1.00 161.63 ? 425  LEU A CA  1 
ATOM 3317 C C   . LEU A 1 428  ? -20.796 66.278 -1.038  1.00 161.63 ? 425  LEU A C   1 
ATOM 3318 O O   . LEU A 1 428  ? -21.024 65.146 -1.479  1.00 161.63 ? 425  LEU A O   1 
ATOM 3319 C CB  . LEU A 1 428  ? -20.218 65.306 1.219   1.00 157.84 ? 425  LEU A CB  1 
ATOM 3320 C CG  . LEU A 1 428  ? -18.753 64.948 0.958   1.00 157.84 ? 425  LEU A CG  1 
ATOM 3321 C CD1 . LEU A 1 428  ? -17.838 65.659 1.945   1.00 157.84 ? 425  LEU A CD1 1 
ATOM 3322 C CD2 . LEU A 1 428  ? -18.564 63.448 1.034   1.00 157.84 ? 425  LEU A CD2 1 
ATOM 3323 N N   . VAL A 1 429  ? -20.617 67.337 -1.820  1.00 168.96 ? 426  VAL A N   1 
ATOM 3324 C CA  . VAL A 1 429  ? -20.600 67.209 -3.265  1.00 168.96 ? 426  VAL A CA  1 
ATOM 3325 C C   . VAL A 1 429  ? -19.330 66.454 -3.639  1.00 168.96 ? 426  VAL A C   1 
ATOM 3326 O O   . VAL A 1 429  ? -18.234 66.754 -3.156  1.00 168.96 ? 426  VAL A O   1 
ATOM 3327 C CB  . VAL A 1 429  ? -20.713 68.571 -3.976  1.00 174.74 ? 426  VAL A CB  1 
ATOM 3328 C CG1 . VAL A 1 429  ? -20.871 68.387 -5.473  1.00 174.74 ? 426  VAL A CG1 1 
ATOM 3329 C CG2 . VAL A 1 429  ? -21.898 69.353 -3.435  1.00 174.74 ? 426  VAL A CG2 1 
ATOM 3330 N N   . LEU A 1 430  ? -19.511 65.457 -4.492  1.00 95.30  ? 427  LEU A N   1 
ATOM 3331 C CA  . LEU A 1 430  ? -18.518 64.427 -4.721  1.00 95.30  ? 427  LEU A CA  1 
ATOM 3332 C C   . LEU A 1 430  ? -18.335 64.101 -6.203  1.00 95.30  ? 427  LEU A C   1 
ATOM 3333 O O   . LEU A 1 430  ? -19.291 63.726 -6.902  1.00 95.30  ? 427  LEU A O   1 
ATOM 3334 C CB  . LEU A 1 430  ? -18.928 63.160 -3.955  1.00 107.05 ? 427  LEU A CB  1 
ATOM 3335 C CG  . LEU A 1 430  ? -20.399 62.692 -3.974  1.00 107.05 ? 427  LEU A CG  1 
ATOM 3336 C CD1 . LEU A 1 430  ? -20.773 61.914 -5.239  1.00 107.05 ? 427  LEU A CD1 1 
ATOM 3337 C CD2 . LEU A 1 430  ? -20.701 61.854 -2.742  1.00 107.05 ? 427  LEU A CD2 1 
ATOM 3338 N N   . SER A 1 431  ? -17.104 64.230 -6.683  1.00 97.57  ? 428  SER A N   1 
ATOM 3339 C CA  . SER A 1 431  ? -16.788 63.759 -8.024  1.00 97.57  ? 428  SER A CA  1 
ATOM 3340 C C   . SER A 1 431  ? -17.220 62.298 -8.171  1.00 97.57  ? 428  SER A C   1 
ATOM 3341 O O   . SER A 1 431  ? -17.163 61.523 -7.212  1.00 97.57  ? 428  SER A O   1 
ATOM 3342 C CB  . SER A 1 431  ? -15.296 63.895 -8.303  1.00 146.30 ? 428  SER A CB  1 
ATOM 3343 O OG  . SER A 1 431  ? -15.027 63.709 -9.682  1.00 146.30 ? 428  SER A OG  1 
ATOM 3344 N N   . PHE A 1 432  ? -17.654 61.926 -9.370  1.00 87.75  ? 429  PHE A N   1 
ATOM 3345 C CA  . PHE A 1 432  ? -18.117 60.564 -9.622  1.00 87.75  ? 429  PHE A CA  1 
ATOM 3346 C C   . PHE A 1 432  ? -17.608 60.068 -10.991 1.00 87.75  ? 429  PHE A C   1 
ATOM 3347 O O   . PHE A 1 432  ? -16.883 60.780 -11.690 1.00 87.75  ? 429  PHE A O   1 
ATOM 3348 C CB  . PHE A 1 432  ? -19.648 60.558 -9.575  1.00 125.78 ? 429  PHE A CB  1 
ATOM 3349 C CG  . PHE A 1 432  ? -20.251 59.385 -8.845  1.00 125.78 ? 429  PHE A CG  1 
ATOM 3350 C CD1 . PHE A 1 432  ? -20.847 58.341 -9.551  1.00 125.78 ? 429  PHE A CD1 1 
ATOM 3351 C CD2 . PHE A 1 432  ? -20.268 59.346 -7.453  1.00 125.78 ? 429  PHE A CD2 1 
ATOM 3352 C CE1 . PHE A 1 432  ? -21.434 57.266 -8.882  1.00 125.78 ? 429  PHE A CE1 1 
ATOM 3353 C CE2 . PHE A 1 432  ? -20.847 58.273 -6.772  1.00 125.78 ? 429  PHE A CE2 1 
ATOM 3354 C CZ  . PHE A 1 432  ? -21.431 57.232 -7.489  1.00 125.78 ? 429  PHE A CZ  1 
ATOM 3355 N N   . VAL A 1 433  ? -18.004 58.853 -11.371 1.00 161.88 ? 430  VAL A N   1 
ATOM 3356 C CA  . VAL A 1 433  ? -17.610 58.244 -12.654 1.00 161.88 ? 430  VAL A CA  1 
ATOM 3357 C C   . VAL A 1 433  ? -18.141 59.051 -13.857 1.00 161.88 ? 430  VAL A C   1 
ATOM 3358 O O   . VAL A 1 433  ? -18.994 58.576 -14.613 1.00 161.88 ? 430  VAL A O   1 
ATOM 3359 C CB  . VAL A 1 433  ? -18.069 56.743 -12.748 1.00 134.15 ? 430  VAL A CB  1 
ATOM 3360 C CG1 . VAL A 1 433  ? -17.401 56.027 -13.927 1.00 134.15 ? 430  VAL A CG1 1 
ATOM 3361 C CG2 . VAL A 1 433  ? -17.780 55.993 -11.452 1.00 134.15 ? 430  VAL A CG2 1 
ATOM 3362 N N   . GLY A 1 434  ? -17.626 60.268 -14.028 1.00 84.46  ? 431  GLY A N   1 
ATOM 3363 C CA  . GLY A 1 434  ? -18.111 61.182 -15.064 1.00 84.46  ? 431  GLY A CA  1 
ATOM 3364 C C   . GLY A 1 434  ? -19.462 61.798 -14.722 1.00 84.46  ? 431  GLY A C   1 
ATOM 3365 O O   . GLY A 1 434  ? -20.318 61.983 -15.602 1.00 84.46  ? 431  GLY A O   1 
ATOM 3366 N N   . GLN A 1 435  ? -19.656 62.109 -13.440 1.00 107.87 ? 432  GLN A N   1 
ATOM 3367 C CA  . GLN A 1 435  ? -20.899 62.705 -12.929 1.00 107.87 ? 432  GLN A CA  1 
ATOM 3368 C C   . GLN A 1 435  ? -20.600 63.592 -11.727 1.00 107.87 ? 432  GLN A C   1 
ATOM 3369 O O   . GLN A 1 435  ? -19.436 63.858 -11.413 1.00 107.87 ? 432  GLN A O   1 
ATOM 3370 C CB  . GLN A 1 435  ? -21.891 61.614 -12.505 1.00 114.74 ? 432  GLN A CB  1 
ATOM 3371 C CG  . GLN A 1 435  ? -22.860 61.133 -13.586 1.00 114.74 ? 432  GLN A CG  1 
ATOM 3372 C CD  . GLN A 1 435  ? -23.816 60.046 -13.088 1.00 114.74 ? 432  GLN A CD  1 
ATOM 3373 O OE1 . GLN A 1 435  ? -23.642 58.868 -13.398 1.00 114.74 ? 432  GLN A OE1 1 
ATOM 3374 N NE2 . GLN A 1 435  ? -24.821 60.441 -12.308 1.00 114.74 ? 432  GLN A NE2 1 
ATOM 3375 N N   . THR A 1 436  ? -21.660 64.059 -11.073 1.00 196.91 ? 433  THR A N   1 
ATOM 3376 C CA  . THR A 1 436  ? -21.572 64.642 -9.741  1.00 196.91 ? 433  THR A CA  1 
ATOM 3377 C C   . THR A 1 436  ? -22.920 64.463 -9.049  1.00 196.91 ? 433  THR A C   1 
ATOM 3378 O O   . THR A 1 436  ? -23.963 64.839 -9.590  1.00 196.91 ? 433  THR A O   1 
ATOM 3379 C CB  . THR A 1 436  ? -21.187 66.149 -9.758  1.00 61.08  ? 433  THR A CB  1 
ATOM 3380 O OG1 . THR A 1 436  ? -19.977 66.348 -10.494 1.00 61.08  ? 433  THR A OG1 1 
ATOM 3381 C CG2 . THR A 1 436  ? -20.983 66.684 -8.342  1.00 61.08  ? 433  THR A CG2 1 
ATOM 3382 N N   . ARG A 1 437  ? -22.890 63.860 -7.866  1.00 106.61 ? 434  ARG A N   1 
ATOM 3383 C CA  . ARG A 1 437  ? -24.041 63.850 -6.965  1.00 106.61 ? 434  ARG A CA  1 
ATOM 3384 C C   . ARG A 1 437  ? -23.831 64.835 -5.803  1.00 106.61 ? 434  ARG A C   1 
ATOM 3385 O O   . ARG A 1 437  ? -22.713 65.013 -5.302  1.00 106.61 ? 434  ARG A O   1 
ATOM 3386 C CB  . ARG A 1 437  ? -24.319 62.435 -6.448  1.00 159.81 ? 434  ARG A CB  1 
ATOM 3387 C CG  . ARG A 1 437  ? -24.887 61.498 -7.505  1.00 159.81 ? 434  ARG A CG  1 
ATOM 3388 C CD  . ARG A 1 437  ? -26.363 61.200 -7.268  1.00 159.81 ? 434  ARG A CD  1 
ATOM 3389 N NE  . ARG A 1 437  ? -27.189 61.383 -8.465  1.00 159.81 ? 434  ARG A NE  1 
ATOM 3390 C CZ  . ARG A 1 437  ? -27.186 60.593 -9.537  1.00 159.81 ? 434  ARG A CZ  1 
ATOM 3391 N NH1 . ARG A 1 437  ? -26.383 59.538 -9.610  1.00 159.81 ? 434  ARG A NH1 1 
ATOM 3392 N NH2 . ARG A 1 437  ? -27.991 60.871 -10.550 1.00 159.81 ? 434  ARG A NH2 1 
ATOM 3393 N N   . VAL A 1 438  ? -24.914 65.495 -5.408  1.00 111.31 ? 435  VAL A N   1 
ATOM 3394 C CA  . VAL A 1 438  ? -24.910 66.400 -4.268  1.00 111.31 ? 435  VAL A CA  1 
ATOM 3395 C C   . VAL A 1 438  ? -25.412 65.574 -3.081  1.00 111.31 ? 435  VAL A C   1 
ATOM 3396 O O   . VAL A 1 438  ? -26.043 64.530 -3.279  1.00 111.31 ? 435  VAL A O   1 
ATOM 3397 C CB  . VAL A 1 438  ? -25.835 67.624 -4.520  1.00 117.02 ? 435  VAL A CB  1 
ATOM 3398 C CG1 . VAL A 1 438  ? -25.599 68.711 -3.483  1.00 117.02 ? 435  VAL A CG1 1 
ATOM 3399 C CG2 . VAL A 1 438  ? -25.634 68.186 -5.929  1.00 117.02 ? 435  VAL A CG2 1 
ATOM 3400 N N   . LEU A 1 439  ? -25.132 66.028 -1.859  1.00 201.00 ? 436  LEU A N   1 
ATOM 3401 C CA  . LEU A 1 439  ? -25.619 65.336 -0.667  1.00 201.00 ? 436  LEU A CA  1 
ATOM 3402 C C   . LEU A 1 439  ? -26.008 66.241 0.489   1.00 201.00 ? 436  LEU A C   1 
ATOM 3403 O O   . LEU A 1 439  ? -25.193 66.511 1.370   1.00 201.00 ? 436  LEU A O   1 
ATOM 3404 C CB  . LEU A 1 439  ? -24.604 64.298 -0.179  1.00 104.03 ? 436  LEU A CB  1 
ATOM 3405 C CG  . LEU A 1 439  ? -24.679 62.864 -0.724  1.00 104.03 ? 436  LEU A CG  1 
ATOM 3406 C CD1 . LEU A 1 439  ? -23.735 61.948 0.057   1.00 104.03 ? 436  LEU A CD1 1 
ATOM 3407 C CD2 . LEU A 1 439  ? -26.102 62.293 -0.708  1.00 104.03 ? 436  LEU A CD2 1 
ATOM 3408 N N   . MET A 1 440  ? -27.258 66.700 0.486   1.00 127.38 ? 437  MET A N   1 
ATOM 3409 C CA  . MET A 1 440  ? -27.807 67.435 1.626   1.00 127.38 ? 437  MET A CA  1 
ATOM 3410 C C   . MET A 1 440  ? -28.000 66.458 2.785   1.00 127.38 ? 437  MET A C   1 
ATOM 3411 O O   . MET A 1 440  ? -28.399 65.315 2.569   1.00 127.38 ? 437  MET A O   1 
ATOM 3412 C CB  . MET A 1 440  ? -29.140 68.097 1.261   1.00 178.58 ? 437  MET A CB  1 
ATOM 3413 C CG  . MET A 1 440  ? -29.026 69.298 0.290   1.00 178.58 ? 437  MET A CG  1 
ATOM 3414 S SD  . MET A 1 440  ? -28.483 70.873 1.066   1.00 178.58 ? 437  MET A SD  1 
ATOM 3415 C CE  . MET A 1 440  ? -29.777 71.165 2.306   1.00 178.58 ? 437  MET A CE  1 
ATOM 3416 N N   . LEU A 1 441  ? -27.689 66.896 4.001   1.00 200.61 ? 438  LEU A N   1 
ATOM 3417 C CA  . LEU A 1 441  ? -27.906 66.065 5.183   1.00 200.61 ? 438  LEU A CA  1 
ATOM 3418 C C   . LEU A 1 441  ? -28.882 66.714 6.148   1.00 200.61 ? 438  LEU A C   1 
ATOM 3419 O O   . LEU A 1 441  ? -28.831 67.923 6.388   1.00 200.61 ? 438  LEU A O   1 
ATOM 3420 C CB  . LEU A 1 441  ? -26.597 65.752 5.913   1.00 65.24  ? 438  LEU A CB  1 
ATOM 3421 C CG  . LEU A 1 441  ? -25.471 64.982 5.212   1.00 65.24  ? 438  LEU A CG  1 
ATOM 3422 C CD1 . LEU A 1 441  ? -24.081 65.392 5.744   1.00 65.24  ? 438  LEU A CD1 1 
ATOM 3423 C CD2 . LEU A 1 441  ? -25.673 63.468 5.322   1.00 65.24  ? 438  LEU A CD2 1 
ATOM 3424 N N   . ASN A 1 442  ? -29.762 65.889 6.704   1.00 190.44 ? 439  ASN A N   1 
ATOM 3425 C CA  . ASN A 1 442  ? -30.753 66.324 7.676   1.00 190.44 ? 439  ASN A CA  1 
ATOM 3426 C C   . ASN A 1 442  ? -30.142 66.314 9.086   1.00 190.44 ? 439  ASN A C   1 
ATOM 3427 O O   . ASN A 1 442  ? -30.832 66.073 10.079  1.00 190.44 ? 439  ASN A O   1 
ATOM 3428 C CB  . ASN A 1 442  ? -31.977 65.399 7.584   1.00 148.27 ? 439  ASN A CB  1 
ATOM 3429 C CG  . ASN A 1 442  ? -33.299 66.121 7.831   1.00 148.27 ? 439  ASN A CG  1 
ATOM 3430 O OD1 . ASN A 1 442  ? -34.372 65.530 7.676   1.00 148.27 ? 439  ASN A OD1 1 
ATOM 3431 N ND2 . ASN A 1 442  ? -33.231 67.394 8.216   1.00 148.27 ? 439  ASN A ND2 1 
ATOM 3432 N N   . GLY A 1 443  ? -28.841 66.599 9.160   1.00 93.27  ? 440  GLY A N   1 
ATOM 3433 C CA  . GLY A 1 443  ? -28.059 66.432 10.388  1.00 93.27  ? 440  GLY A CA  1 
ATOM 3434 C C   . GLY A 1 443  ? -27.190 65.176 10.348  1.00 93.27  ? 440  GLY A C   1 
ATOM 3435 O O   . GLY A 1 443  ? -25.990 65.250 10.058  1.00 93.27  ? 440  GLY A O   1 
ATOM 3436 N N   . GLU A 1 444  ? -27.810 64.027 10.639  1.00 82.71  ? 441  GLU A N   1 
ATOM 3437 C CA  . GLU A 1 444  ? -27.154 62.711 10.574  1.00 82.71  ? 441  GLU A CA  1 
ATOM 3438 C C   . GLU A 1 444  ? -27.621 61.895 9.359   1.00 82.71  ? 441  GLU A C   1 
ATOM 3439 O O   . GLU A 1 444  ? -26.904 61.008 8.886   1.00 82.71  ? 441  GLU A O   1 
ATOM 3440 C CB  . GLU A 1 444  ? -27.424 61.914 11.854  1.00 201.00 ? 441  GLU A CB  1 
ATOM 3441 C CG  . GLU A 1 444  ? -28.910 61.861 12.276  1.00 201.00 ? 441  GLU A CG  1 
ATOM 3442 C CD  . GLU A 1 444  ? -29.406 60.460 12.621  1.00 201.00 ? 441  GLU A CD  1 
ATOM 3443 O OE1 . GLU A 1 444  ? -29.960 60.307 13.753  1.00 201.00 ? 441  GLU A OE1 1 
ATOM 3444 O OE2 . GLU A 1 444  ? -29.238 59.508 11.770  1.00 201.00 ? 441  GLU A OE2 1 
ATOM 3445 N N   . GLU A 1 445  ? -28.830 62.199 8.880   1.00 150.95 ? 442  GLU A N   1 
ATOM 3446 C CA  . GLU A 1 445  ? -29.425 61.560 7.699   1.00 150.95 ? 442  GLU A CA  1 
ATOM 3447 C C   . GLU A 1 445  ? -28.762 61.958 6.383   1.00 150.95 ? 442  GLU A C   1 
ATOM 3448 O O   . GLU A 1 445  ? -28.078 62.978 6.314   1.00 150.95 ? 442  GLU A O   1 
ATOM 3449 C CB  . GLU A 1 445  ? -30.905 61.909 7.609   1.00 114.36 ? 442  GLU A CB  1 
ATOM 3450 C CG  . GLU A 1 445  ? -31.850 60.758 7.858   1.00 114.36 ? 442  GLU A CG  1 
ATOM 3451 C CD  . GLU A 1 445  ? -33.239 61.041 7.314   1.00 114.36 ? 442  GLU A CD  1 
ATOM 3452 O OE1 . GLU A 1 445  ? -33.338 61.508 6.155   1.00 114.36 ? 442  GLU A OE1 1 
ATOM 3453 O OE2 . GLU A 1 445  ? -34.231 60.797 8.040   1.00 114.36 ? 442  GLU A OE2 1 
ATOM 3454 N N   . VAL A 1 446  ? -29.005 61.157 5.340   1.00 180.84 ? 443  VAL A N   1 
ATOM 3455 C CA  . VAL A 1 446  ? -28.416 61.352 4.003   1.00 180.84 ? 443  VAL A CA  1 
ATOM 3456 C C   . VAL A 1 446  ? -29.467 61.545 2.908   1.00 180.84 ? 443  VAL A C   1 
ATOM 3457 O O   . VAL A 1 446  ? -30.486 60.848 2.876   1.00 180.84 ? 443  VAL A O   1 
ATOM 3458 C CB  . VAL A 1 446  ? -27.528 60.159 3.588   1.00 104.25 ? 443  VAL A CB  1 
ATOM 3459 C CG1 . VAL A 1 446  ? -26.885 60.421 2.240   1.00 104.25 ? 443  VAL A CG1 1 
ATOM 3460 C CG2 . VAL A 1 446  ? -26.463 59.888 4.635   1.00 104.25 ? 443  VAL A CG2 1 
ATOM 3461 N N   . GLU A 1 447  ? -29.190 62.476 1.995   1.00 199.84 ? 444  GLU A N   1 
ATOM 3462 C CA  . GLU A 1 447  ? -30.124 62.819 0.930   1.00 199.84 ? 444  GLU A CA  1 
ATOM 3463 C C   . GLU A 1 447  ? -29.430 63.412 -0.295  1.00 199.84 ? 444  GLU A C   1 
ATOM 3464 O O   . GLU A 1 447  ? -28.673 64.380 -0.186  1.00 199.84 ? 444  GLU A O   1 
ATOM 3465 C CB  . GLU A 1 447  ? -31.167 63.802 1.459   1.00 117.41 ? 444  GLU A CB  1 
ATOM 3466 C CG  . GLU A 1 447  ? -32.272 64.154 0.482   1.00 117.41 ? 444  GLU A CG  1 
ATOM 3467 C CD  . GLU A 1 447  ? -33.153 65.280 0.987   1.00 117.41 ? 444  GLU A CD  1 
ATOM 3468 O OE1 . GLU A 1 447  ? -32.673 66.104 1.800   1.00 117.41 ? 444  GLU A OE1 1 
ATOM 3469 O OE2 . GLU A 1 447  ? -34.327 65.339 0.563   1.00 117.41 ? 444  GLU A OE2 1 
ATOM 3470 N N   . GLU A 1 448  ? -29.707 62.823 -1.457  1.00 121.21 ? 445  GLU A N   1 
ATOM 3471 C CA  . GLU A 1 448  ? -29.212 63.335 -2.735  1.00 121.21 ? 445  GLU A CA  1 
ATOM 3472 C C   . GLU A 1 448  ? -30.275 64.162 -3.460  1.00 121.21 ? 445  GLU A C   1 
ATOM 3473 O O   . GLU A 1 448  ? -31.315 63.642 -3.888  1.00 121.21 ? 445  GLU A O   1 
ATOM 3474 C CB  . GLU A 1 448  ? -28.680 62.202 -3.625  1.00 190.38 ? 445  GLU A CB  1 
ATOM 3475 C CG  . GLU A 1 448  ? -29.609 61.001 -3.756  1.00 190.38 ? 445  GLU A CG  1 
ATOM 3476 C CD  . GLU A 1 448  ? -28.950 59.819 -4.431  1.00 190.38 ? 445  GLU A CD  1 
ATOM 3477 O OE1 . GLU A 1 448  ? -29.670 58.859 -4.772  1.00 190.38 ? 445  GLU A OE1 1 
ATOM 3478 O OE2 . GLU A 1 448  ? -27.716 59.844 -4.618  1.00 190.38 ? 445  GLU A OE2 1 
ATOM 3479 N N   . THR A 1 449  ? -30.008 65.459 -3.567  1.00 184.43 ? 446  THR A N   1 
ATOM 3480 C CA  . THR A 1 449  ? -30.896 66.387 -4.256  1.00 184.43 ? 446  THR A CA  1 
ATOM 3481 C C   . THR A 1 449  ? -30.107 67.223 -5.257  1.00 184.43 ? 446  THR A C   1 
ATOM 3482 O O   . THR A 1 449  ? -28.913 66.996 -5.467  1.00 184.43 ? 446  THR A O   1 
ATOM 3483 C CB  . THR A 1 449  ? -31.646 67.333 -3.267  1.00 80.09  ? 446  THR A CB  1 
ATOM 3484 O OG1 . THR A 1 449  ? -30.710 67.964 -2.385  1.00 80.09  ? 446  THR A OG1 1 
ATOM 3485 C CG2 . THR A 1 449  ? -32.668 66.574 -2.442  1.00 80.09  ? 446  THR A CG2 1 
ATOM 3486 N N   . GLU A 1 450  ? -30.791 68.184 -5.874  1.00 93.36  ? 447  GLU A N   1 
ATOM 3487 C CA  . GLU A 1 450  ? -30.175 69.157 -6.765  1.00 93.36  ? 447  GLU A CA  1 
ATOM 3488 C C   . GLU A 1 450  ? -29.381 70.174 -5.949  1.00 93.36  ? 447  GLU A C   1 
ATOM 3489 O O   . GLU A 1 450  ? -29.372 70.120 -4.715  1.00 93.36  ? 447  GLU A O   1 
ATOM 3490 C CB  . GLU A 1 450  ? -31.259 69.871 -7.584  1.00 160.82 ? 447  GLU A CB  1 
ATOM 3491 C CG  . GLU A 1 450  ? -32.219 70.720 -6.743  1.00 160.82 ? 447  GLU A CG  1 
ATOM 3492 C CD  . GLU A 1 450  ? -33.426 71.215 -7.518  1.00 160.82 ? 447  GLU A CD  1 
ATOM 3493 O OE1 . GLU A 1 450  ? -34.216 70.374 -8.003  1.00 160.82 ? 447  GLU A OE1 1 
ATOM 3494 O OE2 . GLU A 1 450  ? -33.597 72.450 -7.623  1.00 160.82 ? 447  GLU A OE2 1 
ATOM 3495 N N   . LEU A 1 451  ? -28.703 71.080 -6.650  1.00 195.69 ? 448  LEU A N   1 
ATOM 3496 C CA  . LEU A 1 451  ? -28.172 72.303 -6.055  1.00 195.69 ? 448  LEU A CA  1 
ATOM 3497 C C   . LEU A 1 451  ? -27.843 73.278 -7.176  1.00 195.69 ? 448  LEU A C   1 
ATOM 3498 O O   . LEU A 1 451  ? -27.279 72.895 -8.205  1.00 195.69 ? 448  LEU A O   1 
ATOM 3499 C CB  . LEU A 1 451  ? -26.948 72.036 -5.166  1.00 88.59  ? 448  LEU A CB  1 
ATOM 3500 C CG  . LEU A 1 451  ? -26.852 72.800 -3.835  1.00 88.59  ? 448  LEU A CG  1 
ATOM 3501 C CD1 . LEU A 1 451  ? -27.888 72.320 -2.785  1.00 88.59  ? 448  LEU A CD1 1 
ATOM 3502 C CD2 . LEU A 1 451  ? -25.443 72.687 -3.282  1.00 88.59  ? 448  LEU A CD2 1 
ATOM 3503 N N   . MET A 1 452  ? -28.220 74.534 -6.961  1.00 188.50 ? 449  MET A N   1 
ATOM 3504 C CA  . MET A 1 452  ? -28.128 75.585 -7.970  1.00 188.50 ? 449  MET A CA  1 
ATOM 3505 C C   . MET A 1 452  ? -26.721 75.754 -8.522  1.00 188.50 ? 449  MET A C   1 
ATOM 3506 O O   . MET A 1 452  ? -25.748 75.679 -7.776  1.00 188.50 ? 449  MET A O   1 
ATOM 3507 C CB  . MET A 1 452  ? -28.625 76.907 -7.386  1.00 149.54 ? 449  MET A CB  1 
ATOM 3508 C CG  . MET A 1 452  ? -30.062 76.871 -6.884  1.00 149.54 ? 449  MET A CG  1 
ATOM 3509 S SD  . MET A 1 452  ? -31.268 76.756 -8.219  1.00 149.54 ? 449  MET A SD  1 
ATOM 3510 C CE  . MET A 1 452  ? -31.543 74.988 -8.317  1.00 149.54 ? 449  MET A CE  1 
ATOM 3511 N N   . GLY A 1 453  ? -26.632 75.960 -9.835  1.00 191.08 ? 450  GLY A N   1 
ATOM 3512 C CA  . GLY A 1 453  ? -25.363 76.176 -10.533 1.00 191.08 ? 450  GLY A CA  1 
ATOM 3513 C C   . GLY A 1 453  ? -24.321 75.085 -10.345 1.00 191.08 ? 450  GLY A C   1 
ATOM 3514 O O   . GLY A 1 453  ? -23.121 75.336 -10.481 1.00 191.08 ? 450  GLY A O   1 
ATOM 3515 N N   . PHE A 1 454  ? -24.785 73.878 -10.025 1.00 145.94 ? 451  PHE A N   1 
ATOM 3516 C CA  . PHE A 1 454  ? -23.917 72.726 -9.802  1.00 145.94 ? 451  PHE A CA  1 
ATOM 3517 C C   . PHE A 1 454  ? -24.373 71.576 -10.688 1.00 145.94 ? 451  PHE A C   1 
ATOM 3518 O O   . PHE A 1 454  ? -25.346 70.897 -10.362 1.00 145.94 ? 451  PHE A O   1 
ATOM 3519 C CB  . PHE A 1 454  ? -23.971 72.295 -8.332  1.00 143.19 ? 451  PHE A CB  1 
ATOM 3520 C CG  . PHE A 1 454  ? -23.028 73.046 -7.428  1.00 143.19 ? 451  PHE A CG  1 
ATOM 3521 C CD1 . PHE A 1 454  ? -22.769 74.398 -7.612  1.00 143.19 ? 451  PHE A CD1 1 
ATOM 3522 C CD2 . PHE A 1 454  ? -22.424 72.398 -6.359  1.00 143.19 ? 451  PHE A CD2 1 
ATOM 3523 C CE1 . PHE A 1 454  ? -21.909 75.085 -6.766  1.00 143.19 ? 451  PHE A CE1 1 
ATOM 3524 C CE2 . PHE A 1 454  ? -21.562 73.083 -5.503  1.00 143.19 ? 451  PHE A CE2 1 
ATOM 3525 C CZ  . PHE A 1 454  ? -21.308 74.430 -5.710  1.00 143.19 ? 451  PHE A CZ  1 
ATOM 3526 N N   . VAL A 1 455  ? -23.675 71.361 -11.804 1.00 86.00  ? 452  VAL A N   1 
ATOM 3527 C CA  . VAL A 1 455  ? -24.089 70.343 -12.787 1.00 86.00  ? 452  VAL A CA  1 
ATOM 3528 C C   . VAL A 1 455  ? -24.033 68.915 -12.254 1.00 86.00  ? 452  VAL A C   1 
ATOM 3529 O O   . VAL A 1 455  ? -23.054 68.513 -11.628 1.00 86.00  ? 452  VAL A O   1 
ATOM 3530 C CB  . VAL A 1 455  ? -23.325 70.432 -14.133 1.00 91.44  ? 452  VAL A CB  1 
ATOM 3531 C CG1 . VAL A 1 455  ? -24.097 71.295 -15.132 1.00 91.44  ? 452  VAL A CG1 1 
ATOM 3532 C CG2 . VAL A 1 455  ? -21.903 70.935 -13.930 1.00 91.44  ? 452  VAL A CG2 1 
ATOM 3533 N N   . ASP A 1 456  ? -25.119 68.179 -12.494 1.00 81.14  ? 453  ASP A N   1 
ATOM 3534 C CA  . ASP A 1 456  ? -25.235 66.764 -12.141 1.00 81.14  ? 453  ASP A CA  1 
ATOM 3535 C C   . ASP A 1 456  ? -24.802 65.860 -13.307 1.00 81.14  ? 453  ASP A C   1 
ATOM 3536 O O   . ASP A 1 456  ? -24.427 64.701 -13.107 1.00 81.14  ? 453  ASP A O   1 
ATOM 3537 C CB  . ASP A 1 456  ? -26.665 66.431 -11.699 1.00 188.90 ? 453  ASP A CB  1 
ATOM 3538 C CG  . ASP A 1 456  ? -27.698 66.731 -12.772 1.00 188.90 ? 453  ASP A CG  1 
ATOM 3539 O OD1 . ASP A 1 456  ? -27.800 65.954 -13.743 1.00 188.90 ? 453  ASP A OD1 1 
ATOM 3540 O OD2 . ASP A 1 456  ? -28.416 67.741 -12.636 1.00 188.90 ? 453  ASP A OD2 1 
ATOM 3541 N N   . ASP A 1 457  ? -24.867 66.400 -14.524 1.00 183.87 ? 454  ASP A N   1 
ATOM 3542 C CA  . ASP A 1 457  ? -24.447 65.673 -15.720 1.00 183.87 ? 454  ASP A CA  1 
ATOM 3543 C C   . ASP A 1 457  ? -22.928 65.648 -15.839 1.00 183.87 ? 454  ASP A C   1 
ATOM 3544 O O   . ASP A 1 457  ? -22.360 64.719 -16.408 1.00 183.87 ? 454  ASP A O   1 
ATOM 3545 C CB  . ASP A 1 457  ? -25.064 66.294 -16.980 1.00 160.61 ? 454  ASP A CB  1 
ATOM 3546 C CG  . ASP A 1 457  ? -24.470 67.656 -17.323 1.00 160.61 ? 454  ASP A CG  1 
ATOM 3547 O OD1 . ASP A 1 457  ? -24.385 67.980 -18.525 1.00 160.61 ? 454  ASP A OD1 1 
ATOM 3548 O OD2 . ASP A 1 457  ? -24.086 68.404 -16.401 1.00 160.61 ? 454  ASP A OD2 1 
ATOM 3549 N N   . GLN A 1 458  ? -22.282 66.673 -15.293 1.00 177.61 ? 455  GLN A N   1 
ATOM 3550 C CA  . GLN A 1 458  ? -20.848 66.850 -15.452 1.00 177.61 ? 455  GLN A CA  1 
ATOM 3551 C C   . GLN A 1 458  ? -20.040 66.353 -14.258 1.00 177.61 ? 455  GLN A C   1 
ATOM 3552 O O   . GLN A 1 458  ? -20.579 66.176 -13.168 1.00 177.61 ? 455  GLN A O   1 
ATOM 3553 C CB  . GLN A 1 458  ? -20.536 68.314 -15.737 1.00 121.71 ? 455  GLN A CB  1 
ATOM 3554 C CG  . GLN A 1 458  ? -20.843 68.738 -17.149 1.00 121.71 ? 455  GLN A CG  1 
ATOM 3555 C CD  . GLN A 1 458  ? -19.850 68.193 -18.153 1.00 121.71 ? 455  GLN A CD  1 
ATOM 3556 O OE1 . GLN A 1 458  ? -19.842 68.611 -19.307 1.00 121.71 ? 455  GLN A OE1 1 
ATOM 3557 N NE2 . GLN A 1 458  ? -19.005 67.258 -17.723 1.00 121.71 ? 455  GLN A NE2 1 
ATOM 3558 N N   . GLN A 1 459  ? -18.743 66.143 -14.475 1.00 123.53 ? 456  GLN A N   1 
ATOM 3559 C CA  . GLN A 1 459  ? -17.869 65.565 -13.459 1.00 123.53 ? 456  GLN A CA  1 
ATOM 3560 C C   . GLN A 1 459  ? -17.066 66.596 -12.674 1.00 123.53 ? 456  GLN A C   1 
ATOM 3561 O O   . GLN A 1 459  ? -15.973 66.970 -13.080 1.00 123.53 ? 456  GLN A O   1 
ATOM 3562 C CB  . GLN A 1 459  ? -16.922 64.550 -14.092 1.00 114.63 ? 456  GLN A CB  1 
ATOM 3563 C CG  . GLN A 1 459  ? -16.138 63.751 -13.074 1.00 114.63 ? 456  GLN A CG  1 
ATOM 3564 C CD  . GLN A 1 459  ? -15.069 62.884 -13.693 1.00 114.63 ? 456  GLN A CD  1 
ATOM 3565 O OE1 . GLN A 1 459  ? -14.168 62.423 -13.000 1.00 114.63 ? 456  GLN A OE1 1 
ATOM 3566 N NE2 . GLN A 1 459  ? -15.157 62.655 -14.999 1.00 114.63 ? 456  GLN A NE2 1 
ATOM 3567 N N   . THR A 1 460  ? -17.616 67.035 -11.544 1.00 108.14 ? 457  THR A N   1 
ATOM 3568 C CA  . THR A 1 460  ? -16.947 67.958 -10.617 1.00 108.14 ? 457  THR A CA  1 
ATOM 3569 C C   . THR A 1 460  ? -15.515 67.517 -10.272 1.00 108.14 ? 457  THR A C   1 
ATOM 3570 O O   . THR A 1 460  ? -15.270 66.350 -9.981  1.00 108.14 ? 457  THR A O   1 
ATOM 3571 C CB  . THR A 1 460  ? -17.778 68.109 -9.316  1.00 82.15  ? 457  THR A CB  1 
ATOM 3572 O OG1 . THR A 1 460  ? -19.092 68.581 -9.637  1.00 82.15  ? 457  THR A OG1 1 
ATOM 3573 C CG2 . THR A 1 460  ? -17.133 69.063 -8.343  1.00 82.15  ? 457  THR A CG2 1 
ATOM 3574 N N   . PHE A 1 461  ? -14.584 68.469 -10.328 1.00 77.18  ? 458  PHE A N   1 
ATOM 3575 C CA  . PHE A 1 461  ? -13.159 68.257 -10.010 1.00 77.18  ? 458  PHE A CA  1 
ATOM 3576 C C   . PHE A 1 461  ? -12.736 69.139 -8.842  1.00 77.18  ? 458  PHE A C   1 
ATOM 3577 O O   . PHE A 1 461  ? -11.535 69.345 -8.599  1.00 77.18  ? 458  PHE A O   1 
ATOM 3578 C CB  . PHE A 1 461  ? -12.248 68.640 -11.196 1.00 160.44 ? 458  PHE A CB  1 
ATOM 3579 C CG  . PHE A 1 461  ? -12.359 67.744 -12.405 1.00 160.44 ? 458  PHE A CG  1 
ATOM 3580 C CD1 . PHE A 1 461  ? -12.829 66.435 -12.306 1.00 160.44 ? 458  PHE A CD1 1 
ATOM 3581 C CD2 . PHE A 1 461  ? -11.942 68.211 -13.648 1.00 160.44 ? 458  PHE A CD2 1 
ATOM 3582 C CE1 . PHE A 1 461  ? -12.915 65.621 -13.433 1.00 160.44 ? 458  PHE A CE1 1 
ATOM 3583 C CE2 . PHE A 1 461  ? -12.019 67.405 -14.777 1.00 160.44 ? 458  PHE A CE2 1 
ATOM 3584 C CZ  . PHE A 1 461  ? -12.507 66.108 -14.671 1.00 160.44 ? 458  PHE A CZ  1 
ATOM 3585 N N   . PHE A 1 462  ? -13.723 69.697 -8.152  1.00 53.04  ? 459  PHE A N   1 
ATOM 3586 C CA  . PHE A 1 462  ? -13.470 70.617 -7.054  1.00 53.04  ? 459  PHE A CA  1 
ATOM 3587 C C   . PHE A 1 462  ? -14.756 71.281 -6.580  1.00 53.04  ? 459  PHE A C   1 
ATOM 3588 O O   . PHE A 1 462  ? -15.771 71.268 -7.296  1.00 53.04  ? 459  PHE A O   1 
ATOM 3589 C CB  . PHE A 1 462  ? -12.418 71.672 -7.417  1.00 74.59  ? 459  PHE A CB  1 
ATOM 3590 C CG  . PHE A 1 462  ? -11.802 72.321 -6.226  1.00 74.59  ? 459  PHE A CG  1 
ATOM 3591 C CD1 . PHE A 1 462  ? -10.595 71.863 -5.724  1.00 74.59  ? 459  PHE A CD1 1 
ATOM 3592 C CD2 . PHE A 1 462  ? -12.436 73.381 -5.594  1.00 74.59  ? 459  PHE A CD2 1 
ATOM 3593 C CE1 . PHE A 1 462  ? -10.015 72.467 -4.606  1.00 74.59  ? 459  PHE A CE1 1 
ATOM 3594 C CE2 . PHE A 1 462  ? -11.881 73.978 -4.482  1.00 74.59  ? 459  PHE A CE2 1 
ATOM 3595 C CZ  . PHE A 1 462  ? -10.668 73.527 -3.980  1.00 74.59  ? 459  PHE A CZ  1 
ATOM 3596 N N   . CYS A 1 463  ? -14.688 71.884 -5.385  1.00 90.59  ? 460  CYS A N   1 
ATOM 3597 C CA  . CYS A 1 463  ? -15.881 72.203 -4.601  1.00 90.59  ? 460  CYS A CA  1 
ATOM 3598 C C   . CYS A 1 463  ? -15.582 72.994 -3.325  1.00 90.59  ? 460  CYS A C   1 
ATOM 3599 O O   . CYS A 1 463  ? -16.464 73.127 -2.488  1.00 90.59  ? 460  CYS A O   1 
ATOM 3600 C CB  . CYS A 1 463  ? -16.563 70.882 -4.217  1.00 113.76 ? 460  CYS A CB  1 
ATOM 3601 S SG  . CYS A 1 463  ? -18.343 70.823 -4.286  1.00 113.76 ? 460  CYS A SG  1 
ATOM 3602 N N   . GLY A 1 464  ? -14.352 73.506 -3.190  1.00 78.14  ? 461  GLY A N   1 
ATOM 3603 C CA  . GLY A 1 464  ? -13.855 74.222 -1.986  1.00 78.14  ? 461  GLY A CA  1 
ATOM 3604 C C   . GLY A 1 464  ? -14.809 75.175 -1.267  1.00 78.14  ? 461  GLY A C   1 
ATOM 3605 O O   . GLY A 1 464  ? -16.027 75.139 -1.492  1.00 78.14  ? 461  GLY A O   1 
ATOM 3606 N N   . ASN A 1 465  ? -14.275 76.023 -0.386  1.00 201.00 ? 462  ASN A N   1 
ATOM 3607 C CA  . ASN A 1 465  ? -15.108 76.992 0.351   1.00 201.00 ? 462  ASN A CA  1 
ATOM 3608 C C   . ASN A 1 465  ? -14.778 78.460 0.011   1.00 201.00 ? 462  ASN A C   1 
ATOM 3609 O O   . ASN A 1 465  ? -14.190 79.180 0.823   1.00 201.00 ? 462  ASN A O   1 
ATOM 3610 C CB  . ASN A 1 465  ? -15.067 76.726 1.875   1.00 193.13 ? 462  ASN A CB  1 
ATOM 3611 C CG  . ASN A 1 465  ? -16.030 75.604 2.318   1.00 193.13 ? 462  ASN A CG  1 
ATOM 3612 O OD1 . ASN A 1 465  ? -15.602 74.596 2.894   1.00 193.13 ? 462  ASN A OD1 1 
ATOM 3613 N ND2 . ASN A 1 465  ? -17.330 75.787 2.057   1.00 193.13 ? 462  ASN A ND2 1 
ATOM 3614 N N   . VAL A 1 466  ? -15.179 78.885 -1.191  1.00 105.94 ? 463  VAL A N   1 
ATOM 3615 C CA  . VAL A 1 466  ? -14.854 80.225 -1.735  1.00 105.94 ? 463  VAL A CA  1 
ATOM 3616 C C   . VAL A 1 466  ? -15.599 81.364 -1.041  1.00 105.94 ? 463  VAL A C   1 
ATOM 3617 O O   . VAL A 1 466  ? -16.833 81.384 -1.000  1.00 105.94 ? 463  VAL A O   1 
ATOM 3618 C CB  . VAL A 1 466  ? -15.065 80.314 -3.277  1.00 115.83 ? 463  VAL A CB  1 
ATOM 3619 C CG1 . VAL A 1 466  ? -13.973 79.567 -4.002  1.00 115.83 ? 463  VAL A CG1 1 
ATOM 3620 C CG2 . VAL A 1 466  ? -16.433 79.787 -3.686  1.00 115.83 ? 463  VAL A CG2 1 
ATOM 3621 N N   . ALA A 1 467  ? -14.834 82.311 -0.503  1.00 86.89  ? 464  ALA A N   1 
ATOM 3622 C CA  . ALA A 1 467  ? -15.394 83.410 0.285   1.00 86.89  ? 464  ALA A CA  1 
ATOM 3623 C C   . ALA A 1 467  ? -16.261 84.376 -0.547  1.00 86.89  ? 464  ALA A C   1 
ATOM 3624 O O   . ALA A 1 467  ? -16.368 84.234 -1.776  1.00 86.89  ? 464  ALA A O   1 
ATOM 3625 C CB  . ALA A 1 467  ? -14.277 84.159 1.031   1.00 110.52 ? 464  ALA A CB  1 
ATOM 3626 N N   . HIS A 1 468  ? -16.885 85.343 0.137   1.00 95.34  ? 465  HIS A N   1 
ATOM 3627 C CA  . HIS A 1 468  ? -17.781 86.341 -0.491  1.00 95.34  ? 465  HIS A CA  1 
ATOM 3628 C C   . HIS A 1 468  ? -19.208 85.795 -0.706  1.00 95.34  ? 465  HIS A C   1 
ATOM 3629 O O   . HIS A 1 468  ? -19.900 86.166 -1.666  1.00 95.34  ? 465  HIS A O   1 
ATOM 3630 C CB  . HIS A 1 468  ? -17.178 86.889 -1.802  1.00 127.81 ? 465  HIS A CB  1 
ATOM 3631 C CG  . HIS A 1 468  ? -15.811 87.492 -1.643  1.00 127.81 ? 465  HIS A CG  1 
ATOM 3632 N ND1 . HIS A 1 468  ? -14.895 87.043 -0.713  1.00 127.81 ? 465  HIS A ND1 1 
ATOM 3633 C CD2 . HIS A 1 468  ? -15.201 88.498 -2.313  1.00 127.81 ? 465  HIS A CD2 1 
ATOM 3634 C CE1 . HIS A 1 468  ? -13.787 87.755 -0.807  1.00 127.81 ? 465  HIS A CE1 1 
ATOM 3635 N NE2 . HIS A 1 468  ? -13.946 88.644 -1.771  1.00 127.81 ? 465  HIS A NE2 1 
ATOM 3636 N N   . GLN A 1 469  ? -19.631 84.932 0.225   1.00 83.79  ? 466  GLN A N   1 
ATOM 3637 C CA  . GLN A 1 469  ? -20.918 84.236 0.181   1.00 83.79  ? 466  GLN A CA  1 
ATOM 3638 C C   . GLN A 1 469  ? -21.126 83.482 -1.144  1.00 83.79  ? 466  GLN A C   1 
ATOM 3639 O O   . GLN A 1 469  ? -22.128 83.705 -1.828  1.00 83.79  ? 466  GLN A O   1 
ATOM 3640 C CB  . GLN A 1 469  ? -22.085 85.209 0.412   1.00 100.64 ? 466  GLN A CB  1 
ATOM 3641 C CG  . GLN A 1 469  ? -22.207 85.846 1.791   1.00 100.64 ? 466  GLN A CG  1 
ATOM 3642 C CD  . GLN A 1 469  ? -23.342 86.886 1.836   1.00 100.64 ? 466  GLN A CD  1 
ATOM 3643 O OE1 . GLN A 1 469  ? -24.264 86.778 2.677   1.00 100.64 ? 466  GLN A OE1 1 
ATOM 3644 N NE2 . GLN A 1 469  ? -23.284 87.884 0.915   1.00 100.64 ? 466  GLN A NE2 1 
ATOM 3645 N N   . GLN A 1 470  ? -20.187 82.604 -1.512  1.00 159.70 ? 467  GLN A N   1 
ATOM 3646 C CA  . GLN A 1 470  ? -20.299 81.816 -2.763  1.00 159.70 ? 467  GLN A CA  1 
ATOM 3647 C C   . GLN A 1 470  ? -19.895 80.327 -2.629  1.00 159.70 ? 467  GLN A C   1 
ATOM 3648 O O   . GLN A 1 470  ? -19.088 79.963 -1.763  1.00 159.70 ? 467  GLN A O   1 
ATOM 3649 C CB  . GLN A 1 470  ? -19.523 82.469 -3.930  1.00 106.30 ? 467  GLN A CB  1 
ATOM 3650 C CG  . GLN A 1 470  ? -19.231 83.966 -3.800  1.00 106.30 ? 467  GLN A CG  1 
ATOM 3651 C CD  . GLN A 1 470  ? -19.329 84.705 -5.121  1.00 106.30 ? 467  GLN A CD  1 
ATOM 3652 O OE1 . GLN A 1 470  ? -18.352 85.286 -5.601  1.00 106.30 ? 467  GLN A OE1 1 
ATOM 3653 N NE2 . GLN A 1 470  ? -20.519 84.696 -5.714  1.00 106.30 ? 467  GLN A NE2 1 
ATOM 3654 N N   . LEU A 1 471  ? -20.475 79.480 -3.489  1.00 163.29 ? 468  LEU A N   1 
ATOM 3655 C CA  . LEU A 1 471  ? -20.129 78.049 -3.584  1.00 163.29 ? 468  LEU A CA  1 
ATOM 3656 C C   . LEU A 1 471  ? -19.672 77.707 -5.010  1.00 163.29 ? 468  LEU A C   1 
ATOM 3657 O O   . LEU A 1 471  ? -20.442 77.868 -5.958  1.00 163.29 ? 468  LEU A O   1 
ATOM 3658 C CB  . LEU A 1 471  ? -21.326 77.135 -3.237  1.00 98.03  ? 468  LEU A CB  1 
ATOM 3659 C CG  . LEU A 1 471  ? -22.526 77.403 -2.304  1.00 98.03  ? 468  LEU A CG  1 
ATOM 3660 C CD1 . LEU A 1 471  ? -23.723 76.529 -2.710  1.00 98.03  ? 468  LEU A CD1 1 
ATOM 3661 C CD2 . LEU A 1 471  ? -22.200 77.191 -0.829  1.00 98.03  ? 468  LEU A CD2 1 
ATOM 3662 N N   . ILE A 1 472  ? -18.438 77.224 -5.159  1.00 117.79 ? 469  ILE A N   1 
ATOM 3663 C CA  . ILE A 1 472  ? -17.908 76.814 -6.474  1.00 117.79 ? 469  ILE A CA  1 
ATOM 3664 C C   . ILE A 1 472  ? -18.088 75.323 -6.771  1.00 117.79 ? 469  ILE A C   1 
ATOM 3665 O O   . ILE A 1 472  ? -18.157 74.509 -5.858  1.00 117.79 ? 469  ILE A O   1 
ATOM 3666 C CB  . ILE A 1 472  ? -16.404 77.173 -6.665  1.00 56.26  ? 469  ILE A CB  1 
ATOM 3667 C CG1 . ILE A 1 472  ? -15.907 76.567 -7.979  1.00 56.26  ? 469  ILE A CG1 1 
ATOM 3668 C CG2 . ILE A 1 472  ? -15.552 76.686 -5.470  1.00 56.26  ? 469  ILE A CG2 1 
ATOM 3669 C CD1 . ILE A 1 472  ? -14.532 76.875 -8.287  1.00 56.26  ? 469  ILE A CD1 1 
ATOM 3670 N N   . GLN A 1 473  ? -18.158 74.986 -8.056  1.00 84.58  ? 470  GLN A N   1 
ATOM 3671 C CA  . GLN A 1 473  ? -18.124 73.607 -8.527  1.00 84.58  ? 470  GLN A CA  1 
ATOM 3672 C C   . GLN A 1 473  ? -17.363 73.540 -9.864  1.00 84.58  ? 470  GLN A C   1 
ATOM 3673 O O   . GLN A 1 473  ? -17.992 73.548 -10.928 1.00 84.58  ? 470  GLN A O   1 
ATOM 3674 C CB  . GLN A 1 473  ? -19.550 73.065 -8.704  1.00 95.13  ? 470  GLN A CB  1 
ATOM 3675 C CG  . GLN A 1 473  ? -19.637 71.567 -9.036  1.00 95.13  ? 470  GLN A CG  1 
ATOM 3676 C CD  . GLN A 1 473  ? -20.727 71.221 -10.061 1.00 95.13  ? 470  GLN A CD  1 
ATOM 3677 O OE1 . GLN A 1 473  ? -21.055 72.021 -10.942 1.00 95.13  ? 470  GLN A OE1 1 
ATOM 3678 N NE2 . GLN A 1 473  ? -21.276 70.012 -9.955  1.00 95.13  ? 470  GLN A NE2 1 
ATOM 3679 N N   . ILE A 1 474  ? -16.025 73.483 -9.826  1.00 78.55  ? 471  ILE A N   1 
ATOM 3680 C CA  . ILE A 1 474  ? -15.238 73.299 -11.061 1.00 78.55  ? 471  ILE A CA  1 
ATOM 3681 C C   . ILE A 1 474  ? -15.483 71.920 -11.654 1.00 78.55  ? 471  ILE A C   1 
ATOM 3682 O O   . ILE A 1 474  ? -15.423 70.903 -10.955 1.00 78.55  ? 471  ILE A O   1 
ATOM 3683 C CB  . ILE A 1 474  ? -13.737 73.466 -10.864 1.00 48.85  ? 471  ILE A CB  1 
ATOM 3684 C CG1 . ILE A 1 474  ? -13.443 74.732 -10.044 1.00 48.85  ? 471  ILE A CG1 1 
ATOM 3685 C CG2 . ILE A 1 474  ? -13.044 73.433 -12.249 1.00 48.85  ? 471  ILE A CG2 1 
ATOM 3686 C CD1 . ILE A 1 474  ? -11.969 75.028 -9.752  1.00 48.85  ? 471  ILE A CD1 1 
ATOM 3687 N N   . THR A 1 475  ? -15.760 71.887 -12.948 1.00 72.88  ? 472  THR A N   1 
ATOM 3688 C CA  . THR A 1 475  ? -16.241 70.660 -13.565 1.00 72.88  ? 472  THR A CA  1 
ATOM 3689 C C   . THR A 1 475  ? -15.289 70.222 -14.714 1.00 72.88  ? 472  THR A C   1 
ATOM 3690 O O   . THR A 1 475  ? -14.222 70.849 -14.919 1.00 72.88  ? 472  THR A O   1 
ATOM 3691 C CB  . THR A 1 475  ? -17.791 70.799 -13.923 1.00 105.19 ? 472  THR A CB  1 
ATOM 3692 O OG1 . THR A 1 475  ? -18.455 69.535 -13.808 1.00 105.19 ? 472  THR A OG1 1 
ATOM 3693 C CG2 . THR A 1 475  ? -18.058 71.443 -15.300 1.00 105.19 ? 472  THR A CG2 1 
ATOM 3694 N N   . SER A 1 476  ? -15.649 69.141 -15.420 1.00 88.09  ? 473  SER A N   1 
ATOM 3695 C CA  . SER A 1 476  ? -14.904 68.686 -16.594 1.00 88.09  ? 473  SER A CA  1 
ATOM 3696 C C   . SER A 1 476  ? -14.628 69.929 -17.377 1.00 88.09  ? 473  SER A C   1 
ATOM 3697 O O   . SER A 1 476  ? -13.474 70.314 -17.565 1.00 88.09  ? 473  SER A O   1 
ATOM 3698 C CB  . SER A 1 476  ? -15.726 67.718 -17.458 1.00 104.09 ? 473  SER A CB  1 
ATOM 3699 O OG  . SER A 1 476  ? -15.675 66.381 -16.981 1.00 104.09 ? 473  SER A OG  1 
ATOM 3700 N N   . ALA A 1 477  ? -15.716 70.577 -17.787 1.00 117.84 ? 474  ALA A N   1 
ATOM 3701 C CA  . ALA A 1 477  ? -15.672 71.873 -18.441 1.00 117.84 ? 474  ALA A CA  1 
ATOM 3702 C C   . ALA A 1 477  ? -14.954 72.937 -17.601 1.00 117.84 ? 474  ALA A C   1 
ATOM 3703 O O   . ALA A 1 477  ? -13.718 72.957 -17.541 1.00 117.84 ? 474  ALA A O   1 
ATOM 3704 C CB  . ALA A 1 477  ? -17.077 72.317 -18.784 1.00 41.47  ? 474  ALA A CB  1 
ATOM 3705 N N   . SER A 1 478  ? -15.723 73.804 -16.939 1.00 83.74  ? 475  SER A N   1 
ATOM 3706 C CA  . SER A 1 478  ? -15.149 75.013 -16.372 1.00 83.74  ? 475  SER A CA  1 
ATOM 3707 C C   . SER A 1 478  ? -15.834 75.521 -15.119 1.00 83.74  ? 475  SER A C   1 
ATOM 3708 O O   . SER A 1 478  ? -17.021 75.246 -14.875 1.00 83.74  ? 475  SER A O   1 
ATOM 3709 C CB  . SER A 1 478  ? -15.143 76.115 -17.424 1.00 152.99 ? 475  SER A CB  1 
ATOM 3710 O OG  . SER A 1 478  ? -16.459 76.349 -17.889 1.00 152.99 ? 475  SER A OG  1 
ATOM 3711 N N   . VAL A 1 479  ? -15.053 76.295 -14.360 1.00 80.97  ? 476  VAL A N   1 
ATOM 3712 C CA  . VAL A 1 479  ? -15.413 76.807 -13.039 1.00 80.97  ? 476  VAL A CA  1 
ATOM 3713 C C   . VAL A 1 479  ? -16.769 77.539 -12.999 1.00 80.97  ? 476  VAL A C   1 
ATOM 3714 O O   . VAL A 1 479  ? -16.853 78.708 -13.381 1.00 80.97  ? 476  VAL A O   1 
ATOM 3715 C CB  . VAL A 1 479  ? -14.202 77.615 -12.395 1.00 87.86  ? 476  VAL A CB  1 
ATOM 3716 C CG1 . VAL A 1 479  ? -13.058 77.733 -13.366 1.00 87.86  ? 476  VAL A CG1 1 
ATOM 3717 C CG2 . VAL A 1 479  ? -14.604 78.996 -11.830 1.00 87.86  ? 476  VAL A CG2 1 
ATOM 3718 N N   . ARG A 1 480  ? -17.816 76.822 -12.559 1.00 85.86  ? 477  ARG A N   1 
ATOM 3719 C CA  . ARG A 1 480  ? -19.166 77.384 -12.344 1.00 85.86  ? 477  ARG A CA  1 
ATOM 3720 C C   . ARG A 1 480  ? -19.169 78.339 -11.149 1.00 85.86  ? 477  ARG A C   1 
ATOM 3721 O O   . ARG A 1 480  ? -18.140 78.512 -10.505 1.00 85.86  ? 477  ARG A O   1 
ATOM 3722 C CB  . ARG A 1 480  ? -20.216 76.278 -12.158 1.00 162.80 ? 477  ARG A CB  1 
ATOM 3723 C CG  . ARG A 1 480  ? -20.472 75.435 -13.401 1.00 162.80 ? 477  ARG A CG  1 
ATOM 3724 C CD  . ARG A 1 480  ? -21.775 74.643 -13.302 1.00 162.80 ? 477  ARG A CD  1 
ATOM 3725 N NE  . ARG A 1 480  ? -22.955 75.468 -13.573 1.00 162.80 ? 477  ARG A NE  1 
ATOM 3726 C CZ  . ARG A 1 480  ? -24.199 75.005 -13.710 1.00 162.80 ? 477  ARG A CZ  1 
ATOM 3727 N NH1 . ARG A 1 480  ? -24.458 73.711 -13.597 1.00 162.80 ? 477  ARG A NH1 1 
ATOM 3728 N NH2 . ARG A 1 480  ? -25.197 75.844 -13.955 1.00 162.80 ? 477  ARG A NH2 1 
ATOM 3729 N N   . LEU A 1 481  ? -20.306 78.984 -10.877 1.00 116.49 ? 478  LEU A N   1 
ATOM 3730 C CA  . LEU A 1 481  ? -20.440 79.879 -9.711  1.00 116.49 ? 478  LEU A CA  1 
ATOM 3731 C C   . LEU A 1 481  ? -21.872 79.942 -9.193  1.00 116.49 ? 478  LEU A C   1 
ATOM 3732 O O   . LEU A 1 481  ? -22.827 79.996 -9.975  1.00 116.49 ? 478  LEU A O   1 
ATOM 3733 C CB  . LEU A 1 481  ? -19.910 81.298 -10.002 1.00 76.74  ? 478  LEU A CB  1 
ATOM 3734 C CG  . LEU A 1 481  ? -19.763 82.352 -8.882  1.00 76.74  ? 478  LEU A CG  1 
ATOM 3735 C CD1 . LEU A 1 481  ? -18.682 81.999 -7.847  1.00 76.74  ? 478  LEU A CD1 1 
ATOM 3736 C CD2 . LEU A 1 481  ? -19.491 83.749 -9.447  1.00 76.74  ? 478  LEU A CD2 1 
ATOM 3737 N N   . VAL A 1 482  ? -21.988 79.934 -7.865  1.00 136.86 ? 479  VAL A N   1 
ATOM 3738 C CA  . VAL A 1 482  ? -23.258 79.910 -7.141  1.00 136.86 ? 479  VAL A CA  1 
ATOM 3739 C C   . VAL A 1 482  ? -23.098 80.779 -5.904  1.00 136.86 ? 479  VAL A C   1 
ATOM 3740 O O   . VAL A 1 482  ? -22.005 80.862 -5.344  1.00 136.86 ? 479  VAL A O   1 
ATOM 3741 C CB  . VAL A 1 482  ? -23.602 78.473 -6.697  1.00 94.41  ? 479  VAL A CB  1 
ATOM 3742 C CG1 . VAL A 1 482  ? -25.019 78.382 -6.057  1.00 94.41  ? 479  VAL A CG1 1 
ATOM 3743 C CG2 . VAL A 1 482  ? -23.468 77.531 -7.873  1.00 94.41  ? 479  VAL A CG2 1 
ATOM 3744 N N   . SER A 1 483  ? -24.179 81.423 -5.473  1.00 135.89 ? 480  SER A N   1 
ATOM 3745 C CA  . SER A 1 483  ? -24.110 82.291 -4.302  1.00 135.89 ? 480  SER A CA  1 
ATOM 3746 C C   . SER A 1 483  ? -24.802 81.728 -3.072  1.00 135.89 ? 480  SER A C   1 
ATOM 3747 O O   . SER A 1 483  ? -25.479 80.698 -3.128  1.00 135.89 ? 480  SER A O   1 
ATOM 3748 C CB  . SER A 1 483  ? -24.660 83.684 -4.614  1.00 82.32  ? 480  SER A CB  1 
ATOM 3749 O OG  . SER A 1 483  ? -23.658 84.546 -5.145  1.00 82.32  ? 480  SER A OG  1 
ATOM 3750 N N   . GLN A 1 484  ? -24.583 82.405 -1.953  1.00 201.00 ? 481  GLN A N   1 
ATOM 3751 C CA  . GLN A 1 484  ? -25.333 82.156 -0.740  1.00 201.00 ? 481  GLN A CA  1 
ATOM 3752 C C   . GLN A 1 484  ? -26.577 83.028 -0.812  1.00 201.00 ? 481  GLN A C   1 
ATOM 3753 O O   . GLN A 1 484  ? -27.690 82.561 -0.559  1.00 201.00 ? 481  GLN A O   1 
ATOM 3754 C CB  . GLN A 1 484  ? -24.498 82.498 0.498   1.00 104.81 ? 481  GLN A CB  1 
ATOM 3755 C CG  . GLN A 1 484  ? -23.165 81.766 0.601   1.00 104.81 ? 481  GLN A CG  1 
ATOM 3756 C CD  . GLN A 1 484  ? -23.297 80.302 0.961   1.00 104.81 ? 481  GLN A CD  1 
ATOM 3757 O OE1 . GLN A 1 484  ? -23.983 79.536 0.278   1.00 104.81 ? 481  GLN A OE1 1 
ATOM 3758 N NE2 . GLN A 1 484  ? -22.619 79.898 2.033   1.00 104.81 ? 481  GLN A NE2 1 
ATOM 3759 N N   . GLU A 1 485  ? -26.376 84.293 -1.179  1.00 176.20 ? 482  GLU A N   1 
ATOM 3760 C CA  . GLU A 1 485  ? -27.482 85.216 -1.405  1.00 176.20 ? 482  GLU A CA  1 
ATOM 3761 C C   . GLU A 1 485  ? -28.295 84.796 -2.649  1.00 176.20 ? 482  GLU A C   1 
ATOM 3762 O O   . GLU A 1 485  ? -29.368 84.209 -2.489  1.00 176.20 ? 482  GLU A O   1 
ATOM 3763 C CB  . GLU A 1 485  ? -26.993 86.673 -1.469  1.00 180.37 ? 482  GLU A CB  1 
ATOM 3764 C CG  . GLU A 1 485  ? -26.480 87.247 -0.127  1.00 180.37 ? 482  GLU A CG  1 
ATOM 3765 C CD  . GLU A 1 485  ? -27.611 87.717 0.811   1.00 180.37 ? 482  GLU A CD  1 
ATOM 3766 O OE1 . GLU A 1 485  ? -28.808 87.757 0.380   1.00 180.37 ? 482  GLU A OE1 1 
ATOM 3767 O OE2 . GLU A 1 485  ? -27.348 88.056 1.993   1.00 180.37 ? 482  GLU A OE2 1 
ATOM 3768 N N   . PRO A 1 486  ? -27.797 85.083 -3.881  1.00 201.00 ? 483  PRO A N   1 
ATOM 3769 C CA  . PRO A 1 486  ? -28.480 84.594 -5.092  1.00 201.00 ? 483  PRO A CA  1 
ATOM 3770 C C   . PRO A 1 486  ? -28.705 83.083 -5.152  1.00 201.00 ? 483  PRO A C   1 
ATOM 3771 O O   . PRO A 1 486  ? -29.826 82.660 -5.432  1.00 201.00 ? 483  PRO A O   1 
ATOM 3772 C CB  . PRO A 1 486  ? -27.554 85.041 -6.228  1.00 170.56 ? 483  PRO A CB  1 
ATOM 3773 C CG  . PRO A 1 486  ? -26.879 86.236 -5.690  1.00 170.56 ? 483  PRO A CG  1 
ATOM 3774 C CD  . PRO A 1 486  ? -26.636 85.920 -4.238  1.00 170.56 ? 483  PRO A CD  1 
ATOM 3775 N N   . LYS A 1 487  ? -27.668 82.284 -4.896  1.00 125.96 ? 484  LYS A N   1 
ATOM 3776 C CA  . LYS A 1 487  ? -27.795 80.827 -4.950  1.00 125.96 ? 484  LYS A CA  1 
ATOM 3777 C C   . LYS A 1 487  ? -28.395 80.399 -6.291  1.00 125.96 ? 484  LYS A C   1 
ATOM 3778 O O   . LYS A 1 487  ? -29.552 79.985 -6.370  1.00 125.96 ? 484  LYS A O   1 
ATOM 3779 C CB  . LYS A 1 487  ? -28.617 80.301 -3.748  1.00 98.48  ? 484  LYS A CB  1 
ATOM 3780 C CG  . LYS A 1 487  ? -29.133 78.840 -3.844  1.00 98.48  ? 484  LYS A CG  1 
ATOM 3781 C CD  . LYS A 1 487  ? -28.018 77.785 -3.858  1.00 98.48  ? 484  LYS A CD  1 
ATOM 3782 C CE  . LYS A 1 487  ? -27.656 77.322 -2.459  1.00 98.48  ? 484  LYS A CE  1 
ATOM 3783 N NZ  . LYS A 1 487  ? -26.936 76.024 -2.510  1.00 98.48  ? 484  LYS A NZ  1 
ATOM 3784 N N   . ALA A 1 488  ? -27.602 80.532 -7.349  1.00 193.86 ? 485  ALA A N   1 
ATOM 3785 C CA  . ALA A 1 488  ? -28.036 80.153 -8.687  1.00 193.86 ? 485  ALA A CA  1 
ATOM 3786 C C   . ALA A 1 488  ? -26.848 80.054 -9.643  1.00 193.86 ? 485  ALA A C   1 
ATOM 3787 O O   . ALA A 1 488  ? -25.893 79.320 -9.381  1.00 193.86 ? 485  ALA A O   1 
ATOM 3788 C CB  . ALA A 1 488  ? -29.087 81.134 -9.209  1.00 131.61 ? 485  ALA A CB  1 
ATOM 3789 N N   . LEU A 1 489  ? -26.922 80.796 -10.745 1.00 154.60 ? 486  LEU A N   1 
ATOM 3790 C CA  . LEU A 1 489  ? -25.881 80.840 -11.768 1.00 154.60 ? 486  LEU A CA  1 
ATOM 3791 C C   . LEU A 1 489  ? -25.271 82.249 -11.755 1.00 154.60 ? 486  LEU A C   1 
ATOM 3792 O O   . LEU A 1 489  ? -25.516 83.051 -12.660 1.00 154.60 ? 486  LEU A O   1 
ATOM 3793 C CB  . LEU A 1 489  ? -26.490 80.476 -13.143 1.00 106.03 ? 486  LEU A CB  1 
ATOM 3794 C CG  . LEU A 1 489  ? -25.701 80.186 -14.437 1.00 106.03 ? 486  LEU A CG  1 
ATOM 3795 C CD1 . LEU A 1 489  ? -24.581 79.151 -14.254 1.00 106.03 ? 486  LEU A CD1 1 
ATOM 3796 C CD2 . LEU A 1 489  ? -26.648 79.800 -15.604 1.00 106.03 ? 486  LEU A CD2 1 
ATOM 3797 N N   . VAL A 1 490  ? -24.491 82.537 -10.710 1.00 130.83 ? 487  VAL A N   1 
ATOM 3798 C CA  . VAL A 1 490  ? -23.920 83.877 -10.455 1.00 130.83 ? 487  VAL A CA  1 
ATOM 3799 C C   . VAL A 1 490  ? -22.906 84.298 -11.521 1.00 130.83 ? 487  VAL A C   1 
ATOM 3800 O O   . VAL A 1 490  ? -22.981 85.403 -12.066 1.00 130.83 ? 487  VAL A O   1 
ATOM 3801 C CB  . VAL A 1 490  ? -23.272 83.945 -9.051  1.00 67.25  ? 487  VAL A CB  1 
ATOM 3802 C CG1 . VAL A 1 490  ? -22.648 85.333 -8.776  1.00 67.25  ? 487  VAL A CG1 1 
ATOM 3803 C CG2 . VAL A 1 490  ? -24.304 83.572 -7.984  1.00 67.25  ? 487  VAL A CG2 1 
ATOM 3804 N N   . SER A 1 491  ? -21.952 83.411 -11.788 1.00 158.81 ? 488  SER A N   1 
ATOM 3805 C CA  . SER A 1 491  ? -21.062 83.518 -12.939 1.00 158.81 ? 488  SER A CA  1 
ATOM 3806 C C   . SER A 1 491  ? -20.740 82.095 -13.397 1.00 158.81 ? 488  SER A C   1 
ATOM 3807 O O   . SER A 1 491  ? -21.410 81.138 -12.982 1.00 158.81 ? 488  SER A O   1 
ATOM 3808 C CB  . SER A 1 491  ? -19.792 84.311 -12.592 1.00 166.45 ? 488  SER A CB  1 
ATOM 3809 O OG  . SER A 1 491  ? -18.993 84.562 -13.736 1.00 166.45 ? 488  SER A OG  1 
ATOM 3810 N N   . GLU A 1 492  ? -19.727 81.963 -14.250 1.00 110.42 ? 489  GLU A N   1 
ATOM 3811 C CA  . GLU A 1 492  ? -19.336 80.685 -14.826 1.00 110.42 ? 489  GLU A CA  1 
ATOM 3812 C C   . GLU A 1 492  ? -18.323 80.905 -15.939 1.00 110.42 ? 489  GLU A C   1 
ATOM 3813 O O   . GLU A 1 492  ? -18.668 81.408 -17.013 1.00 110.42 ? 489  GLU A O   1 
ATOM 3814 C CB  . GLU A 1 492  ? -20.552 79.946 -15.373 1.00 104.09 ? 489  GLU A CB  1 
ATOM 3815 C CG  . GLU A 1 492  ? -20.239 78.592 -15.924 1.00 104.09 ? 489  GLU A CG  1 
ATOM 3816 C CD  . GLU A 1 492  ? -21.425 77.970 -16.594 1.00 104.09 ? 489  GLU A CD  1 
ATOM 3817 O OE1 . GLU A 1 492  ? -22.426 78.691 -16.826 1.00 104.09 ? 489  GLU A OE1 1 
ATOM 3818 O OE2 . GLU A 1 492  ? -21.354 76.754 -16.887 1.00 104.09 ? 489  GLU A OE2 1 
ATOM 3819 N N   . TRP A 1 493  ? -17.080 80.517 -15.671 1.00 201.00 ? 490  TRP A N   1 
ATOM 3820 C CA  . TRP A 1 493  ? -15.984 80.608 -16.632 1.00 201.00 ? 490  TRP A CA  1 
ATOM 3821 C C   . TRP A 1 493  ? -16.158 79.553 -17.736 1.00 201.00 ? 490  TRP A C   1 
ATOM 3822 O O   . TRP A 1 493  ? -16.991 78.655 -17.607 1.00 201.00 ? 490  TRP A O   1 
ATOM 3823 C CB  . TRP A 1 493  ? -14.653 80.416 -15.895 1.00 100.59 ? 490  TRP A CB  1 
ATOM 3824 C CG  . TRP A 1 493  ? -13.443 80.966 -16.606 1.00 100.59 ? 490  TRP A CG  1 
ATOM 3825 C CD1 . TRP A 1 493  ? -13.011 82.254 -16.594 1.00 100.59 ? 490  TRP A CD1 1 
ATOM 3826 C CD2 . TRP A 1 493  ? -12.500 80.234 -17.407 1.00 100.59 ? 490  TRP A CD2 1 
ATOM 3827 N NE1 . TRP A 1 493  ? -11.868 82.379 -17.348 1.00 100.59 ? 490  TRP A NE1 1 
ATOM 3828 C CE2 . TRP A 1 493  ? -11.532 81.154 -17.856 1.00 100.59 ? 490  TRP A CE2 1 
ATOM 3829 C CE3 . TRP A 1 493  ? -12.383 78.890 -17.789 1.00 100.59 ? 490  TRP A CE3 1 
ATOM 3830 C CZ2 . TRP A 1 493  ? -10.462 80.780 -18.672 1.00 100.59 ? 490  TRP A CZ2 1 
ATOM 3831 C CZ3 . TRP A 1 493  ? -11.319 78.519 -18.601 1.00 100.59 ? 490  TRP A CZ3 1 
ATOM 3832 C CH2 . TRP A 1 493  ? -10.372 79.464 -19.035 1.00 100.59 ? 490  TRP A CH2 1 
ATOM 3833 N N   . LYS A 1 494  ? -15.390 79.689 -18.820 1.00 175.72 ? 491  LYS A N   1 
ATOM 3834 C CA  . LYS A 1 494  ? -15.353 78.721 -19.930 1.00 175.72 ? 491  LYS A CA  1 
ATOM 3835 C C   . LYS A 1 494  ? -14.128 78.964 -20.822 1.00 175.72 ? 491  LYS A C   1 
ATOM 3836 O O   . LYS A 1 494  ? -13.846 80.102 -21.206 1.00 175.72 ? 491  LYS A O   1 
ATOM 3837 C CB  . LYS A 1 494  ? -16.647 78.775 -20.751 1.00 93.67  ? 491  LYS A CB  1 
ATOM 3838 C CG  . LYS A 1 494  ? -16.675 77.889 -22.001 1.00 93.67  ? 491  LYS A CG  1 
ATOM 3839 C CD  . LYS A 1 494  ? -17.037 76.440 -21.673 1.00 93.67  ? 491  LYS A CD  1 
ATOM 3840 C CE  . LYS A 1 494  ? -17.124 75.589 -22.936 1.00 93.67  ? 491  LYS A CE  1 
ATOM 3841 N NZ  . LYS A 1 494  ? -17.277 74.142 -22.619 1.00 93.67  ? 491  LYS A NZ  1 
ATOM 3842 N N   . GLU A 1 495  ? -13.412 77.891 -21.151 1.00 99.70  ? 492  GLU A N   1 
ATOM 3843 C CA  . GLU A 1 495  ? -12.144 77.996 -21.873 1.00 99.70  ? 492  GLU A CA  1 
ATOM 3844 C C   . GLU A 1 495  ? -12.303 78.601 -23.267 1.00 99.70  ? 492  GLU A C   1 
ATOM 3845 O O   . GLU A 1 495  ? -13.106 78.096 -24.061 1.00 99.70  ? 492  GLU A O   1 
ATOM 3846 C CB  . GLU A 1 495  ? -11.446 76.638 -21.940 1.00 127.93 ? 492  GLU A CB  1 
ATOM 3847 C CG  . GLU A 1 495  ? -9.924  76.712 -22.026 1.00 127.93 ? 492  GLU A CG  1 
ATOM 3848 C CD  . GLU A 1 495  ? -9.397  76.787 -23.451 1.00 127.93 ? 492  GLU A CD  1 
ATOM 3849 O OE1 . GLU A 1 495  ? -10.060 76.262 -24.370 1.00 127.93 ? 492  GLU A OE1 1 
ATOM 3850 O OE2 . GLU A 1 495  ? -8.305  77.359 -23.646 1.00 127.93 ? 492  GLU A OE2 1 
ATOM 3851 N N   . PRO A 1 496  ? -11.525 79.677 -23.558 1.00 155.31 ? 493  PRO A N   1 
ATOM 3852 C CA  . PRO A 1 496  ? -11.601 80.476 -24.779 1.00 155.31 ? 493  PRO A CA  1 
ATOM 3853 C C   . PRO A 1 496  ? -11.537 79.667 -26.064 1.00 155.31 ? 493  PRO A C   1 
ATOM 3854 O O   . PRO A 1 496  ? -11.261 80.231 -27.123 1.00 155.31 ? 493  PRO A O   1 
ATOM 3855 C CB  . PRO A 1 496  ? -10.352 81.362 -24.695 1.00 71.16  ? 493  PRO A CB  1 
ATOM 3856 C CG  . PRO A 1 496  ? -10.077 81.504 -23.274 1.00 71.16  ? 493  PRO A CG  1 
ATOM 3857 C CD  . PRO A 1 496  ? -10.476 80.196 -22.655 1.00 71.16  ? 493  PRO A CD  1 
ATOM 3858 N N   . GLN A 1 497  ? -11.796 78.367 -25.980 1.00 71.15  ? 494  GLN A N   1 
ATOM 3859 C CA  . GLN A 1 497  ? -11.686 77.500 -27.145 1.00 71.15  ? 494  GLN A CA  1 
ATOM 3860 C C   . GLN A 1 497  ? -12.587 76.264 -27.122 1.00 71.15  ? 494  GLN A C   1 
ATOM 3861 O O   . GLN A 1 497  ? -12.597 75.485 -28.085 1.00 71.15  ? 494  GLN A O   1 
ATOM 3862 C CB  . GLN A 1 497  ? -10.226 77.076 -27.304 1.00 101.43 ? 494  GLN A CB  1 
ATOM 3863 C CG  . GLN A 1 497  ? -9.408  77.963 -28.215 1.00 101.43 ? 494  GLN A CG  1 
ATOM 3864 C CD  . GLN A 1 497  ? -9.275  77.373 -29.596 1.00 101.43 ? 494  GLN A CD  1 
ATOM 3865 O OE1 . GLN A 1 497  ? -10.268 77.063 -30.267 1.00 101.43 ? 494  GLN A OE1 1 
ATOM 3866 N NE2 . GLN A 1 497  ? -8.037  77.197 -30.027 1.00 101.43 ? 494  GLN A NE2 1 
ATOM 3867 N N   . ALA A 1 498  ? -13.332 76.088 -26.027 1.00 167.19 ? 495  ALA A N   1 
ATOM 3868 C CA  . ALA A 1 498  ? -14.101 74.862 -25.758 1.00 167.19 ? 495  ALA A CA  1 
ATOM 3869 C C   . ALA A 1 498  ? -13.196 73.639 -25.525 1.00 167.19 ? 495  ALA A C   1 
ATOM 3870 O O   . ALA A 1 498  ? -13.421 72.561 -26.081 1.00 167.19 ? 495  ALA A O   1 
ATOM 3871 C CB  . ALA A 1 498  ? -15.141 74.593 -26.859 1.00 61.20  ? 495  ALA A CB  1 
ATOM 3872 N N   . LYS A 1 499  ? -12.165 73.842 -24.706 1.00 91.74  ? 496  LYS A N   1 
ATOM 3873 C CA  . LYS A 1 499  ? -11.280 72.784 -24.211 1.00 91.74  ? 496  LYS A CA  1 
ATOM 3874 C C   . LYS A 1 499  ? -11.393 72.702 -22.681 1.00 91.74  ? 496  LYS A C   1 
ATOM 3875 O O   . LYS A 1 499  ? -11.560 73.724 -22.010 1.00 91.74  ? 496  LYS A O   1 
ATOM 3876 C CB  . LYS A 1 499  ? -9.825  73.074 -24.598 1.00 71.28  ? 496  LYS A CB  1 
ATOM 3877 C CG  . LYS A 1 499  ? -9.229  72.239 -25.750 1.00 71.28  ? 496  LYS A CG  1 
ATOM 3878 C CD  . LYS A 1 499  ? -7.811  72.742 -26.096 1.00 71.28  ? 496  LYS A CD  1 
ATOM 3879 C CE  . LYS A 1 499  ? -7.800  74.268 -26.373 1.00 71.28  ? 496  LYS A CE  1 
ATOM 3880 N NZ  . LYS A 1 499  ? -6.455  74.890 -26.214 1.00 71.28  ? 496  LYS A NZ  1 
ATOM 3881 N N   . ASN A 1 500  ? -11.274 71.492 -22.132 1.00 88.24  ? 497  ASN A N   1 
ATOM 3882 C CA  . ASN A 1 500  ? -11.537 71.254 -20.708 1.00 88.24  ? 497  ASN A CA  1 
ATOM 3883 C C   . ASN A 1 500  ? -10.521 71.852 -19.726 1.00 88.24  ? 497  ASN A C   1 
ATOM 3884 O O   . ASN A 1 500  ? -9.473  72.397 -20.112 1.00 88.24  ? 497  ASN A O   1 
ATOM 3885 C CB  . ASN A 1 500  ? -11.688 69.754 -20.444 1.00 94.53  ? 497  ASN A CB  1 
ATOM 3886 C CG  . ASN A 1 500  ? -12.976 69.175 -21.025 1.00 94.53  ? 497  ASN A CG  1 
ATOM 3887 O OD1 . ASN A 1 500  ? -14.084 69.572 -20.655 1.00 94.53  ? 497  ASN A OD1 1 
ATOM 3888 N ND2 . ASN A 1 500  ? -12.829 68.210 -21.922 1.00 94.53  ? 497  ASN A ND2 1 
ATOM 3889 N N   . ILE A 1 501  ? -10.859 71.777 -18.446 1.00 157.99 ? 498  ILE A N   1 
ATOM 3890 C CA  . ILE A 1 501  ? -9.862  71.930 -17.404 1.00 157.99 ? 498  ILE A CA  1 
ATOM 3891 C C   . ILE A 1 501  ? -9.390  70.523 -17.064 1.00 157.99 ? 498  ILE A C   1 
ATOM 3892 O O   . ILE A 1 501  ? -10.201 69.636 -16.774 1.00 157.99 ? 498  ILE A O   1 
ATOM 3893 C CB  . ILE A 1 501  ? -10.410 72.637 -16.150 1.00 114.21 ? 498  ILE A CB  1 
ATOM 3894 C CG1 . ILE A 1 501  ? -10.757 74.095 -16.466 1.00 114.21 ? 498  ILE A CG1 1 
ATOM 3895 C CG2 . ILE A 1 501  ? -9.394  72.566 -15.017 1.00 114.21 ? 498  ILE A CG2 1 
ATOM 3896 C CD1 . ILE A 1 501  ? -11.744 74.736 -15.500 1.00 114.21 ? 498  ILE A CD1 1 
ATOM 3897 N N   . SER A 1 502  ? -8.078  70.323 -17.135 1.00 65.70  ? 499  SER A N   1 
ATOM 3898 C CA  . SER A 1 502  ? -7.472  69.044 -16.796 1.00 65.70  ? 499  SER A CA  1 
ATOM 3899 C C   . SER A 1 502  ? -7.277  68.920 -15.273 1.00 65.70  ? 499  SER A C   1 
ATOM 3900 O O   . SER A 1 502  ? -7.767  67.969 -14.664 1.00 65.70  ? 499  SER A O   1 
ATOM 3901 C CB  . SER A 1 502  ? -6.168  68.829 -17.586 1.00 59.95  ? 499  SER A CB  1 
ATOM 3902 O OG  . SER A 1 502  ? -5.371  70.004 -17.645 1.00 59.95  ? 499  SER A OG  1 
ATOM 3903 N N   . VAL A 1 503  ? -6.615  69.906 -14.672 1.00 73.80  ? 500  VAL A N   1 
ATOM 3904 C CA  . VAL A 1 503  ? -6.225  69.856 -13.271 1.00 73.80  ? 500  VAL A CA  1 
ATOM 3905 C C   . VAL A 1 503  ? -6.785  71.077 -12.574 1.00 73.80  ? 500  VAL A C   1 
ATOM 3906 O O   . VAL A 1 503  ? -6.472  72.197 -12.960 1.00 73.80  ? 500  VAL A O   1 
ATOM 3907 C CB  . VAL A 1 503  ? -4.663  69.821 -13.115 1.00 48.35  ? 500  VAL A CB  1 
ATOM 3908 C CG1 . VAL A 1 503  ? -4.196  70.167 -11.686 1.00 48.35  ? 500  VAL A CG1 1 
ATOM 3909 C CG2 . VAL A 1 503  ? -4.120  68.484 -13.563 1.00 48.35  ? 500  VAL A CG2 1 
ATOM 3910 N N   . ALA A 1 504  ? -7.578  70.842 -11.527 1.00 119.91 ? 501  ALA A N   1 
ATOM 3911 C CA  . ALA A 1 504  ? -8.251  71.895 -10.753 1.00 119.91 ? 501  ALA A CA  1 
ATOM 3912 C C   . ALA A 1 504  ? -7.458  72.417 -9.535  1.00 119.91 ? 501  ALA A C   1 
ATOM 3913 O O   . ALA A 1 504  ? -6.574  71.734 -9.013  1.00 119.91 ? 501  ALA A O   1 
ATOM 3914 C CB  . ALA A 1 504  ? -9.642  71.404 -10.313 1.00 91.17  ? 501  ALA A CB  1 
ATOM 3915 N N   . SER A 1 505  ? -7.784  73.636 -9.100  1.00 157.29 ? 502  SER A N   1 
ATOM 3916 C CA  . SER A 1 505  ? -7.291  74.200 -7.832  1.00 157.29 ? 502  SER A CA  1 
ATOM 3917 C C   . SER A 1 505  ? -8.169  75.332 -7.285  1.00 157.29 ? 502  SER A C   1 
ATOM 3918 O O   . SER A 1 505  ? -9.029  75.862 -8.000  1.00 157.29 ? 502  SER A O   1 
ATOM 3919 C CB  . SER A 1 505  ? -5.843  74.668 -7.955  1.00 53.35  ? 502  SER A CB  1 
ATOM 3920 O OG  . SER A 1 505  ? -4.987  73.547 -8.036  1.00 53.35  ? 502  SER A OG  1 
ATOM 3921 N N   . CYS A 1 506  ? -7.937  75.683 -6.014  1.00 143.53 ? 503  CYS A N   1 
ATOM 3922 C CA  . CYS A 1 506  ? -8.682  76.722 -5.277  1.00 143.53 ? 503  CYS A CA  1 
ATOM 3923 C C   . CYS A 1 506  ? -8.497  76.544 -3.771  1.00 143.53 ? 503  CYS A C   1 
ATOM 3924 O O   . CYS A 1 506  ? -8.496  75.422 -3.265  1.00 143.53 ? 503  CYS A O   1 
ATOM 3925 C CB  . CYS A 1 506  ? -10.175 76.704 -5.642  1.00 125.88 ? 503  CYS A CB  1 
ATOM 3926 S SG  . CYS A 1 506  ? -11.275 77.496 -4.465  1.00 125.88 ? 503  CYS A SG  1 
ATOM 3927 N N   . ASN A 1 507  ? -8.345  77.646 -3.051  1.00 201.00 ? 504  ASN A N   1 
ATOM 3928 C CA  . ASN A 1 507  ? -8.209  77.553 -1.603  1.00 201.00 ? 504  ASN A CA  1 
ATOM 3929 C C   . ASN A 1 507  ? -9.473  77.996 -0.831  1.00 201.00 ? 504  ASN A C   1 
ATOM 3930 O O   . ASN A 1 507  ? -10.145 77.169 -0.207  1.00 201.00 ? 504  ASN A O   1 
ATOM 3931 C CB  . ASN A 1 507  ? -6.903  78.217 -1.122  1.00 76.42  ? 504  ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 507  ? -6.834  79.690 -1.443  1.00 76.42  ? 504  ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 507  ? -7.278  80.532 -0.658  1.00 76.42  ? 504  ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 507  ? -6.239  80.013 -2.580  1.00 76.42  ? 504  ASN A ND2 1 
ATOM 3935 N N   . SER A 1 508  ? -9.788  79.290 -0.898  1.00 161.36 ? 505  SER A N   1 
ATOM 3936 C CA  . SER A 1 508  ? -11.018 79.881 -0.351  1.00 161.36 ? 505  SER A CA  1 
ATOM 3937 C C   . SER A 1 508  ? -11.063 81.292 -0.943  1.00 161.36 ? 505  SER A C   1 
ATOM 3938 O O   . SER A 1 508  ? -11.877 82.134 -0.544  1.00 161.36 ? 505  SER A O   1 
ATOM 3939 C CB  . SER A 1 508  ? -10.993 79.916 1.193   1.00 106.46 ? 505  SER A CB  1 
ATOM 3940 O OG  . SER A 1 508  ? -12.166 79.343 1.764   1.00 106.46 ? 505  SER A OG  1 
ATOM 3941 N N   . SER A 1 509  ? -10.168 81.515 -1.914  1.00 137.05 ? 506  SER A N   1 
ATOM 3942 C CA  . SER A 1 509  ? -9.887  82.832 -2.506  1.00 137.05 ? 506  SER A CA  1 
ATOM 3943 C C   . SER A 1 509  ? -9.298  82.785 -3.944  1.00 137.05 ? 506  SER A C   1 
ATOM 3944 O O   . SER A 1 509  ? -9.671  83.606 -4.784  1.00 137.05 ? 506  SER A O   1 
ATOM 3945 C CB  . SER A 1 509  ? -8.963  83.645 -1.584  1.00 109.86 ? 506  SER A CB  1 
ATOM 3946 O OG  . SER A 1 509  ? -9.399  83.595 -0.231  1.00 109.86 ? 506  SER A OG  1 
ATOM 3947 N N   . GLN A 1 510  ? -8.377  81.850 -4.214  1.00 201.00 ? 507  GLN A N   1 
ATOM 3948 C CA  . GLN A 1 510  ? -7.788  81.672 -5.567  1.00 201.00 ? 507  GLN A CA  1 
ATOM 3949 C C   . GLN A 1 510  ? -8.432  80.550 -6.385  1.00 201.00 ? 507  GLN A C   1 
ATOM 3950 O O   . GLN A 1 510  ? -9.166  79.723 -5.846  1.00 201.00 ? 507  GLN A O   1 
ATOM 3951 C CB  . GLN A 1 510  ? -6.265  81.439 -5.508  1.00 85.46  ? 507  GLN A CB  1 
ATOM 3952 C CG  . GLN A 1 510  ? -5.427  82.682 -5.740  1.00 85.46  ? 507  GLN A CG  1 
ATOM 3953 C CD  . GLN A 1 510  ? -4.394  82.875 -4.659  1.00 85.46  ? 507  GLN A CD  1 
ATOM 3954 O OE1 . GLN A 1 510  ? -3.202  83.045 -4.931  1.00 85.46  ? 507  GLN A OE1 1 
ATOM 3955 N NE2 . GLN A 1 510  ? -4.848  82.836 -3.411  1.00 85.46  ? 507  GLN A NE2 1 
ATOM 3956 N N   . VAL A 1 511  ? -8.152  80.557 -7.691  1.00 201.00 ? 508  VAL A N   1 
ATOM 3957 C CA  . VAL A 1 511  ? -8.492  79.478 -8.635  1.00 201.00 ? 508  VAL A CA  1 
ATOM 3958 C C   . VAL A 1 511  ? -7.344  79.391 -9.661  1.00 201.00 ? 508  VAL A C   1 
ATOM 3959 O O   . VAL A 1 511  ? -7.049  80.371 -10.353 1.00 201.00 ? 508  VAL A O   1 
ATOM 3960 C CB  . VAL A 1 511  ? -9.875  79.713 -9.365  1.00 119.92 ? 508  VAL A CB  1 
ATOM 3961 C CG1 . VAL A 1 511  ? -10.074 78.742 -10.533 1.00 119.92 ? 508  VAL A CG1 1 
ATOM 3962 C CG2 . VAL A 1 511  ? -11.057 79.597 -8.402  1.00 119.92 ? 508  VAL A CG2 1 
ATOM 3963 N N   . VAL A 1 512  ? -6.687  78.230 -9.735  1.00 107.04 ? 509  VAL A N   1 
ATOM 3964 C CA  . VAL A 1 512  ? -5.600  77.983 -10.705 1.00 107.04 ? 509  VAL A CA  1 
ATOM 3965 C C   . VAL A 1 512  ? -5.727  76.630 -11.397 1.00 107.04 ? 509  VAL A C   1 
ATOM 3966 O O   . VAL A 1 512  ? -5.088  75.647 -10.997 1.00 107.04 ? 509  VAL A O   1 
ATOM 3967 C CB  . VAL A 1 512  ? -4.205  78.097 -10.064 1.00 45.17  ? 509  VAL A CB  1 
ATOM 3968 C CG1 . VAL A 1 512  ? -3.135  77.512 -10.976 1.00 45.17  ? 509  VAL A CG1 1 
ATOM 3969 C CG2 . VAL A 1 512  ? -3.904  79.566 -9.721  1.00 45.17  ? 509  VAL A CG2 1 
ATOM 3970 N N   . VAL A 1 513  ? -6.553  76.596 -12.441 1.00 78.58  ? 510  VAL A N   1 
ATOM 3971 C CA  . VAL A 1 513  ? -6.737  75.394 -13.249 1.00 78.58  ? 510  VAL A CA  1 
ATOM 3972 C C   . VAL A 1 513  ? -5.570  75.211 -14.231 1.00 78.58  ? 510  VAL A C   1 
ATOM 3973 O O   . VAL A 1 513  ? -4.576  75.967 -14.202 1.00 78.58  ? 510  VAL A O   1 
ATOM 3974 C CB  . VAL A 1 513  ? -8.126  75.364 -13.976 1.00 126.71 ? 510  VAL A CB  1 
ATOM 3975 C CG1 . VAL A 1 513  ? -9.257  75.365 -12.965 1.00 126.71 ? 510  VAL A CG1 1 
ATOM 3976 C CG2 . VAL A 1 513  ? -8.284  76.521 -14.950 1.00 126.71 ? 510  VAL A CG2 1 
ATOM 3977 N N   . ALA A 1 514  ? -5.680  74.182 -15.066 1.00 51.15  ? 511  ALA A N   1 
ATOM 3978 C CA  . ALA A 1 514  ? -4.744  73.986 -16.161 1.00 51.15  ? 511  ALA A CA  1 
ATOM 3979 C C   . ALA A 1 514  ? -5.523  73.372 -17.295 1.00 51.15  ? 511  ALA A C   1 
ATOM 3980 O O   . ALA A 1 514  ? -6.501  72.657 -17.035 1.00 51.15  ? 511  ALA A O   1 
ATOM 3981 C CB  . ALA A 1 514  ? -3.576  73.081 -15.740 1.00 58.18  ? 511  ALA A CB  1 
ATOM 3982 N N   . VAL A 1 515  ? -5.104  73.660 -18.534 1.00 75.50  ? 512  VAL A N   1 
ATOM 3983 C CA  . VAL A 1 515  ? -5.745  73.077 -19.714 1.00 75.50  ? 512  VAL A CA  1 
ATOM 3984 C C   . VAL A 1 515  ? -4.926  71.941 -20.322 1.00 75.50  ? 512  VAL A C   1 
ATOM 3985 O O   . VAL A 1 515  ? -5.465  71.081 -21.021 1.00 75.50  ? 512  VAL A O   1 
ATOM 3986 C CB  . VAL A 1 515  ? -6.097  74.143 -20.758 1.00 91.75  ? 512  VAL A CB  1 
ATOM 3987 C CG1 . VAL A 1 515  ? -6.644  73.514 -22.047 1.00 91.75  ? 512  VAL A CG1 1 
ATOM 3988 C CG2 . VAL A 1 515  ? -7.118  75.081 -20.171 1.00 91.75  ? 512  VAL A CG2 1 
ATOM 3989 N N   . GLY A 1 516  ? -3.638  71.975 -20.153 1.00 61.95  ? 513  GLY A N   1 
ATOM 3990 C CA  . GLY A 1 516  ? -2.856  70.962 -20.785 1.00 61.95  ? 513  GLY A CA  1 
ATOM 3991 C C   . GLY A 1 516  ? -1.496  71.367 -20.412 1.00 61.95  ? 513  GLY A C   1 
ATOM 3992 O O   . GLY A 1 516  ? -0.986  70.943 -19.417 1.00 61.95  ? 513  GLY A O   1 
ATOM 3993 N N   . ARG A 1 517  ? -0.905  72.222 -21.198 1.00 83.98  ? 514  ARG A N   1 
ATOM 3994 C CA  . ARG A 1 517  ? 0.391   72.670 -20.834 1.00 83.98  ? 514  ARG A CA  1 
ATOM 3995 C C   . ARG A 1 517  ? 0.116   74.012 -20.260 1.00 83.98  ? 514  ARG A C   1 
ATOM 3996 O O   . ARG A 1 517  ? 0.981   74.675 -19.746 1.00 83.98  ? 514  ARG A O   1 
ATOM 3997 C CB  . ARG A 1 517  ? 1.265   72.727 -22.070 1.00 75.42  ? 514  ARG A CB  1 
ATOM 3998 C CG  . ARG A 1 517  ? 1.089   71.509 -22.945 1.00 75.42  ? 514  ARG A CG  1 
ATOM 3999 C CD  . ARG A 1 517  ? 1.941   71.570 -24.157 1.00 75.42  ? 514  ARG A CD  1 
ATOM 4000 N NE  . ARG A 1 517  ? 1.740   72.812 -24.868 1.00 75.42  ? 514  ARG A NE  1 
ATOM 4001 C CZ  . ARG A 1 517  ? 0.987   72.922 -25.949 1.00 75.42  ? 514  ARG A CZ  1 
ATOM 4002 N NH1 . ARG A 1 517  ? 0.383   71.857 -26.437 1.00 75.42  ? 514  ARG A NH1 1 
ATOM 4003 N NH2 . ARG A 1 517  ? 0.837   74.090 -26.546 1.00 75.42  ? 514  ARG A NH2 1 
ATOM 4004 N N   . ALA A 1 518  ? -1.144  74.381 -20.335 1.00 71.53  ? 515  ALA A N   1 
ATOM 4005 C CA  . ALA A 1 518  ? -1.556  75.738 -20.081 1.00 71.53  ? 515  ALA A CA  1 
ATOM 4006 C C   . ALA A 1 518  ? -1.817  76.039 -18.639 1.00 71.53  ? 515  ALA A C   1 
ATOM 4007 O O   . ALA A 1 518  ? -2.192  75.184 -17.876 1.00 71.53  ? 515  ALA A O   1 
ATOM 4008 C CB  . ALA A 1 518  ? -2.769  76.068 -20.889 1.00 120.14 ? 515  ALA A CB  1 
ATOM 4009 N N   . LEU A 1 519  ? -1.645  77.293 -18.278 1.00 133.29 ? 516  LEU A N   1 
ATOM 4010 C CA  . LEU A 1 519  ? -1.843  77.684 -16.895 1.00 133.29 ? 516  LEU A CA  1 
ATOM 4011 C C   . LEU A 1 519  ? -2.503  79.048 -16.778 1.00 133.29 ? 516  LEU A C   1 
ATOM 4012 O O   . LEU A 1 519  ? -1.831  80.078 -16.789 1.00 133.29 ? 516  LEU A O   1 
ATOM 4013 C CB  . LEU A 1 519  ? -0.522  77.634 -16.121 1.00 72.84  ? 516  LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 519  ? 0.096   76.266 -15.829 1.00 72.84  ? 516  LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 519  ? 1.475   76.439 -15.213 1.00 72.84  ? 516  LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 519  ? -0.793  75.425 -14.910 1.00 72.84  ? 516  LEU A CD2 1 
ATOM 4017 N N   . TYR A 1 520  ? -3.828  79.040 -16.668 1.00 87.54  ? 517  TYR A N   1 
ATOM 4018 C CA  . TYR A 1 520  ? -4.607  80.254 -16.442 1.00 87.54  ? 517  TYR A CA  1 
ATOM 4019 C C   . TYR A 1 520  ? -4.512  80.777 -14.982 1.00 87.54  ? 517  TYR A C   1 
ATOM 4020 O O   . TYR A 1 520  ? -3.493  80.575 -14.293 1.00 87.54  ? 517  TYR A O   1 
ATOM 4021 C CB  . TYR A 1 520  ? -6.071  80.042 -16.862 1.00 121.60 ? 517  TYR A CB  1 
ATOM 4022 C CG  . TYR A 1 520  ? -6.278  79.811 -18.343 1.00 121.60 ? 517  TYR A CG  1 
ATOM 4023 C CD1 . TYR A 1 520  ? -6.849  78.619 -18.805 1.00 121.60 ? 517  TYR A CD1 1 
ATOM 4024 C CD2 . TYR A 1 520  ? -5.905  80.784 -19.286 1.00 121.60 ? 517  TYR A CD2 1 
ATOM 4025 C CE1 . TYR A 1 520  ? -7.050  78.401 -20.168 1.00 121.60 ? 517  TYR A CE1 1 
ATOM 4026 C CE2 . TYR A 1 520  ? -6.099  80.572 -20.654 1.00 121.60 ? 517  TYR A CE2 1 
ATOM 4027 C CZ  . TYR A 1 520  ? -6.674  79.377 -21.086 1.00 121.60 ? 517  TYR A CZ  1 
ATOM 4028 O OH  . TYR A 1 520  ? -6.875  79.151 -22.430 1.00 121.60 ? 517  TYR A OH  1 
ATOM 4029 N N   . TYR A 1 521  ? -5.568  81.475 -14.549 1.00 201.00 ? 518  TYR A N   1 
ATOM 4030 C CA  . TYR A 1 521  ? -5.722  82.040 -13.197 1.00 201.00 ? 518  TYR A CA  1 
ATOM 4031 C C   . TYR A 1 521  ? -7.032  82.816 -13.164 1.00 201.00 ? 518  TYR A C   1 
ATOM 4032 O O   . TYR A 1 521  ? -7.221  83.745 -13.951 1.00 201.00 ? 518  TYR A O   1 
ATOM 4033 C CB  . TYR A 1 521  ? -4.570  82.994 -12.841 1.00 94.94  ? 518  TYR A CB  1 
ATOM 4034 C CG  . TYR A 1 521  ? -4.636  83.620 -11.458 1.00 94.94  ? 518  TYR A CG  1 
ATOM 4035 C CD1 . TYR A 1 521  ? -3.471  83.872 -10.743 1.00 94.94  ? 518  TYR A CD1 1 
ATOM 4036 C CD2 . TYR A 1 521  ? -5.854  83.966 -10.868 1.00 94.94  ? 518  TYR A CD2 1 
ATOM 4037 C CE1 . TYR A 1 521  ? -3.519  84.459 -9.478  1.00 94.94  ? 518  TYR A CE1 1 
ATOM 4038 C CE2 . TYR A 1 521  ? -5.913  84.542 -9.607  1.00 94.94  ? 518  TYR A CE2 1 
ATOM 4039 C CZ  . TYR A 1 521  ? -4.742  84.784 -8.917  1.00 94.94  ? 518  TYR A CZ  1 
ATOM 4040 O OH  . TYR A 1 521  ? -4.781  85.363 -7.673  1.00 94.94  ? 518  TYR A OH  1 
ATOM 4041 N N   . LEU A 1 522  ? -7.929  82.442 -12.252 1.00 198.49 ? 519  LEU A N   1 
ATOM 4042 C CA  . LEU A 1 522  ? -9.216  83.133 -12.092 1.00 198.49 ? 519  LEU A CA  1 
ATOM 4043 C C   . LEU A 1 522  ? -9.487  83.503 -10.624 1.00 198.49 ? 519  LEU A C   1 
ATOM 4044 O O   . LEU A 1 522  ? -8.816  83.000 -9.724  1.00 198.49 ? 519  LEU A O   1 
ATOM 4045 C CB  . LEU A 1 522  ? -10.357 82.287 -12.674 1.00 127.11 ? 519  LEU A CB  1 
ATOM 4046 C CG  . LEU A 1 522  ? -10.111 81.524 -13.984 1.00 127.11 ? 519  LEU A CG  1 
ATOM 4047 C CD1 . LEU A 1 522  ? -11.267 80.609 -14.234 1.00 127.11 ? 519  LEU A CD1 1 
ATOM 4048 C CD2 . LEU A 1 522  ? -9.873  82.431 -15.182 1.00 127.11 ? 519  LEU A CD2 1 
ATOM 4049 N N   . GLN A 1 523  ? -10.458 84.389 -10.391 1.00 161.91 ? 520  GLN A N   1 
ATOM 4050 C CA  . GLN A 1 523  ? -10.758 84.893 -9.044  1.00 161.91 ? 520  GLN A CA  1 
ATOM 4051 C C   . GLN A 1 523  ? -12.259 84.870 -8.783  1.00 161.91 ? 520  GLN A C   1 
ATOM 4052 O O   . GLN A 1 523  ? -13.035 85.236 -9.664  1.00 161.91 ? 520  GLN A O   1 
ATOM 4053 C CB  . GLN A 1 523  ? -10.260 86.334 -8.886  1.00 115.36 ? 520  GLN A CB  1 
ATOM 4054 C CG  . GLN A 1 523  ? -8.840  86.602 -9.360  1.00 115.36 ? 520  GLN A CG  1 
ATOM 4055 C CD  . GLN A 1 523  ? -8.701  87.964 -10.004 1.00 115.36 ? 520  GLN A CD  1 
ATOM 4056 O OE1 . GLN A 1 523  ? -9.031  88.151 -11.177 1.00 115.36 ? 520  GLN A OE1 1 
ATOM 4057 N NE2 . GLN A 1 523  ? -8.195  88.925 -9.240  1.00 115.36 ? 520  GLN A NE2 1 
ATOM 4058 N N   . ILE A 1 524  ? -12.668 84.465 -7.579  1.00 166.86 ? 521  ILE A N   1 
ATOM 4059 C CA  . ILE A 1 524  ? -14.086 84.516 -7.184  1.00 166.86 ? 521  ILE A CA  1 
ATOM 4060 C C   . ILE A 1 524  ? -14.405 85.886 -6.551  1.00 166.86 ? 521  ILE A C   1 
ATOM 4061 O O   . ILE A 1 524  ? -14.896 85.972 -5.417  1.00 166.86 ? 521  ILE A O   1 
ATOM 4062 C CB  . ILE A 1 524  ? -14.507 83.341 -6.228  1.00 109.74 ? 521  ILE A CB  1 
ATOM 4063 C CG1 . ILE A 1 524  ? -13.837 82.008 -6.617  1.00 109.74 ? 521  ILE A CG1 1 
ATOM 4064 C CG2 . ILE A 1 524  ? -16.040 83.198 -6.177  1.00 109.74 ? 521  ILE A CG2 1 
ATOM 4065 C CD1 . ILE A 1 524  ? -14.704 81.038 -7.444  1.00 109.74 ? 521  ILE A CD1 1 
ATOM 4066 N N   . HIS A 1 525  ? -14.122 86.954 -7.298  1.00 176.91 ? 522  HIS A N   1 
ATOM 4067 C CA  . HIS A 1 525  ? -14.325 88.318 -6.816  1.00 176.91 ? 522  HIS A CA  1 
ATOM 4068 C C   . HIS A 1 525  ? -15.787 88.639 -6.591  1.00 176.91 ? 522  HIS A C   1 
ATOM 4069 O O   . HIS A 1 525  ? -16.650 87.959 -7.148  1.00 176.91 ? 522  HIS A O   1 
ATOM 4070 C CB  . HIS A 1 525  ? -13.659 89.331 -7.736  1.00 102.63 ? 522  HIS A CB  1 
ATOM 4071 C CG  . HIS A 1 525  ? -12.292 89.713 -7.276  1.00 102.63 ? 522  HIS A CG  1 
ATOM 4072 N ND1 . HIS A 1 525  ? -12.076 90.430 -6.116  1.00 102.63 ? 522  HIS A ND1 1 
ATOM 4073 C CD2 . HIS A 1 525  ? -11.068 89.441 -7.785  1.00 102.63 ? 522  HIS A CD2 1 
ATOM 4074 C CE1 . HIS A 1 525  ? -10.776 90.599 -5.943  1.00 102.63 ? 522  HIS A CE1 1 
ATOM 4075 N NE2 . HIS A 1 525  ? -10.142 90.008 -6.941  1.00 102.63 ? 522  HIS A NE2 1 
ATOM 4076 N N   . PRO A 1 526  ? -16.076 89.678 -5.778  1.00 163.69 ? 523  PRO A N   1 
ATOM 4077 C CA  . PRO A 1 526  ? -17.447 89.754 -5.254  1.00 163.69 ? 523  PRO A CA  1 
ATOM 4078 C C   . PRO A 1 526  ? -18.545 89.522 -6.317  1.00 163.69 ? 523  PRO A C   1 
ATOM 4079 O O   . PRO A 1 526  ? -18.936 90.446 -7.036  1.00 163.69 ? 523  PRO A O   1 
ATOM 4080 C CB  . PRO A 1 526  ? -17.507 91.150 -4.624  1.00 59.64  ? 523  PRO A CB  1 
ATOM 4081 C CG  . PRO A 1 526  ? -16.057 91.432 -4.217  1.00 59.64  ? 523  PRO A CG  1 
ATOM 4082 C CD  . PRO A 1 526  ? -15.237 90.815 -5.328  1.00 59.64  ? 523  PRO A CD  1 
ATOM 4083 N N   . GLN A 1 527  ? -18.982 88.261 -6.412  1.00 101.83 ? 524  GLN A N   1 
ATOM 4084 C CA  . GLN A 1 527  ? -20.093 87.804 -7.265  1.00 101.83 ? 524  GLN A CA  1 
ATOM 4085 C C   . GLN A 1 527  ? -19.779 87.516 -8.737  1.00 101.83 ? 524  GLN A C   1 
ATOM 4086 O O   . GLN A 1 527  ? -20.694 87.328 -9.544  1.00 101.83 ? 524  GLN A O   1 
ATOM 4087 C CB  . GLN A 1 527  ? -21.301 88.727 -7.153  1.00 109.03 ? 524  GLN A CB  1 
ATOM 4088 C CG  . GLN A 1 527  ? -22.127 88.490 -5.924  1.00 109.03 ? 524  GLN A CG  1 
ATOM 4089 C CD  . GLN A 1 527  ? -23.605 88.537 -6.239  1.00 109.03 ? 524  GLN A CD  1 
ATOM 4090 O OE1 . GLN A 1 527  ? -24.122 87.678 -6.964  1.00 109.03 ? 524  GLN A OE1 1 
ATOM 4091 N NE2 . GLN A 1 527  ? -24.299 89.544 -5.704  1.00 109.03 ? 524  GLN A NE2 1 
ATOM 4092 N N   . GLU A 1 528  ? -18.496 87.481 -9.085  1.00 87.29  ? 525  GLU A N   1 
ATOM 4093 C CA  . GLU A 1 528  ? -18.074 87.178 -10.463 1.00 87.29  ? 525  GLU A CA  1 
ATOM 4094 C C   . GLU A 1 528  ? -16.623 86.692 -10.551 1.00 87.29  ? 525  GLU A C   1 
ATOM 4095 O O   . GLU A 1 528  ? -15.745 87.195 -9.842  1.00 87.29  ? 525  GLU A O   1 
ATOM 4096 C CB  . GLU A 1 528  ? -18.299 88.387 -11.394 1.00 165.32 ? 525  GLU A CB  1 
ATOM 4097 C CG  . GLU A 1 528  ? -18.090 89.778 -10.759 1.00 165.32 ? 525  GLU A CG  1 
ATOM 4098 C CD  . GLU A 1 528  ? -16.629 90.141 -10.547 1.00 165.32 ? 525  GLU A CD  1 
ATOM 4099 O OE1 . GLU A 1 528  ? -16.310 90.701 -9.479  1.00 165.32 ? 525  GLU A OE1 1 
ATOM 4100 O OE2 . GLU A 1 528  ? -15.800 89.869 -11.440 1.00 165.32 ? 525  GLU A OE2 1 
ATOM 4101 N N   . LEU A 1 529  ? -16.377 85.730 -11.436 1.00 86.20  ? 526  LEU A N   1 
ATOM 4102 C CA  . LEU A 1 529  ? -15.021 85.199 -11.647 1.00 86.20  ? 526  LEU A CA  1 
ATOM 4103 C C   . LEU A 1 529  ? -14.222 85.979 -12.701 1.00 86.20  ? 526  LEU A C   1 
ATOM 4104 O O   . LEU A 1 529  ? -14.521 85.899 -13.897 1.00 86.20  ? 526  LEU A O   1 
ATOM 4105 C CB  . LEU A 1 529  ? -15.070 83.721 -12.041 1.00 78.49  ? 526  LEU A CB  1 
ATOM 4106 C CG  . LEU A 1 529  ? -16.302 82.922 -11.619 1.00 78.49  ? 526  LEU A CG  1 
ATOM 4107 C CD1 . LEU A 1 529  ? -16.701 82.005 -12.761 1.00 78.49  ? 526  LEU A CD1 1 
ATOM 4108 C CD2 . LEU A 1 529  ? -16.080 82.155 -10.314 1.00 78.49  ? 526  LEU A CD2 1 
ATOM 4109 N N   . ARG A 1 530  ? -13.205 86.722 -12.264 1.00 150.50 ? 527  ARG A N   1 
ATOM 4110 C CA  . ARG A 1 530  ? -12.400 87.540 -13.178 1.00 150.50 ? 527  ARG A CA  1 
ATOM 4111 C C   . ARG A 1 530  ? -11.072 86.859 -13.497 1.00 150.50 ? 527  ARG A C   1 
ATOM 4112 O O   . ARG A 1 530  ? -10.437 86.298 -12.604 1.00 150.50 ? 527  ARG A O   1 
ATOM 4113 C CB  . ARG A 1 530  ? -12.153 88.929 -12.581 1.00 96.98  ? 527  ARG A CB  1 
ATOM 4114 C CG  . ARG A 1 530  ? -11.935 90.033 -13.624 1.00 96.98  ? 527  ARG A CG  1 
ATOM 4115 C CD  . ARG A 1 530  ? -11.722 91.414 -12.986 1.00 96.98  ? 527  ARG A CD  1 
ATOM 4116 N NE  . ARG A 1 530  ? -12.884 91.893 -12.225 1.00 96.98  ? 527  ARG A NE  1 
ATOM 4117 C CZ  . ARG A 1 530  ? -13.006 91.817 -10.899 1.00 96.98  ? 527  ARG A CZ  1 
ATOM 4118 N NH1 . ARG A 1 530  ? -12.037 91.276 -10.170 1.00 96.98  ? 527  ARG A NH1 1 
ATOM 4119 N NH2 . ARG A 1 530  ? -14.098 92.279 -10.300 1.00 96.98  ? 527  ARG A NH2 1 
ATOM 4120 N N   . GLN A 1 531  ? -10.662 86.920 -14.767 1.00 128.31 ? 528  GLN A N   1 
ATOM 4121 C CA  . GLN A 1 531  ? -9.423  86.273 -15.261 1.00 128.31 ? 528  GLN A CA  1 
ATOM 4122 C C   . GLN A 1 531  ? -8.163  87.125 -15.025 1.00 128.31 ? 528  GLN A C   1 
ATOM 4123 O O   . GLN A 1 531  ? -8.263  88.343 -14.866 1.00 128.31 ? 528  GLN A O   1 
ATOM 4124 C CB  . GLN A 1 531  ? -9.571  85.918 -16.760 1.00 120.31 ? 528  GLN A CB  1 
ATOM 4125 C CG  . GLN A 1 531  ? -8.402  85.113 -17.391 1.00 120.31 ? 528  GLN A CG  1 
ATOM 4126 C CD  . GLN A 1 531  ? -8.758  84.460 -18.727 1.00 120.31 ? 528  GLN A CD  1 
ATOM 4127 O OE1 . GLN A 1 531  ? -9.727  83.707 -18.832 1.00 120.31 ? 528  GLN A OE1 1 
ATOM 4128 N NE2 . GLN A 1 531  ? -7.956  84.735 -19.747 1.00 120.31 ? 528  GLN A NE2 1 
ATOM 4129 N N   . ILE A 1 532  ? -6.991  86.481 -14.989 1.00 95.21  ? 529  ILE A N   1 
ATOM 4130 C CA  . ILE A 1 532  ? -5.700  87.185 -14.897 1.00 95.21  ? 529  ILE A CA  1 
ATOM 4131 C C   . ILE A 1 532  ? -4.620  86.680 -15.874 1.00 95.21  ? 529  ILE A C   1 
ATOM 4132 O O   . ILE A 1 532  ? -4.396  87.309 -16.912 1.00 95.21  ? 529  ILE A O   1 
ATOM 4133 C CB  . ILE A 1 532  ? -5.127  87.246 -13.445 1.00 39.69  ? 529  ILE A CB  1 
ATOM 4134 C CG1 . ILE A 1 532  ? -6.220  87.714 -12.431 1.00 39.69  ? 529  ILE A CG1 1 
ATOM 4135 C CG2 . ILE A 1 532  ? -3.784  88.039 -13.412 1.00 39.69  ? 529  ILE A CG2 1 
ATOM 4136 C CD1 . ILE A 1 532  ? -5.733  88.585 -11.230 1.00 39.69  ? 529  ILE A CD1 1 
ATOM 4137 N N   . SER A 1 533  ? -3.951  85.569 -15.552 1.00 91.29  ? 530  SER A N   1 
ATOM 4138 C CA  . SER A 1 533  ? -2.716  85.173 -16.275 1.00 91.29  ? 530  SER A CA  1 
ATOM 4139 C C   . SER A 1 533  ? -2.871  83.971 -17.240 1.00 91.29  ? 530  SER A C   1 
ATOM 4140 O O   . SER A 1 533  ? -3.951  83.398 -17.360 1.00 91.29  ? 530  SER A O   1 
ATOM 4141 C CB  . SER A 1 533  ? -1.536  84.948 -15.290 1.00 56.01  ? 530  SER A CB  1 
ATOM 4142 O OG  . SER A 1 533  ? -1.278  86.079 -14.466 1.00 56.01  ? 530  SER A OG  1 
ATOM 4143 N N   . HIS A 1 534  ? -1.784  83.630 -17.938 1.00 107.65 ? 531  HIS A N   1 
ATOM 4144 C CA  . HIS A 1 534  ? -1.707  82.449 -18.817 1.00 107.65 ? 531  HIS A CA  1 
ATOM 4145 C C   . HIS A 1 534  ? -0.252  82.140 -19.208 1.00 107.65 ? 531  HIS A C   1 
ATOM 4146 O O   . HIS A 1 534  ? 0.488   83.015 -19.668 1.00 107.65 ? 531  HIS A O   1 
ATOM 4147 C CB  . HIS A 1 534  ? -2.594  82.596 -20.067 1.00 137.33 ? 531  HIS A CB  1 
ATOM 4148 C CG  . HIS A 1 534  ? -2.453  81.471 -21.048 1.00 137.33 ? 531  HIS A CG  1 
ATOM 4149 N ND1 . HIS A 1 534  ? -2.658  80.152 -20.706 1.00 137.33 ? 531  HIS A ND1 1 
ATOM 4150 C CD2 . HIS A 1 534  ? -2.134  81.472 -22.364 1.00 137.33 ? 531  HIS A CD2 1 
ATOM 4151 C CE1 . HIS A 1 534  ? -2.462  79.388 -21.766 1.00 137.33 ? 531  HIS A CE1 1 
ATOM 4152 N NE2 . HIS A 1 534  ? -2.146  80.165 -22.786 1.00 137.33 ? 531  HIS A NE2 1 
ATOM 4153 N N   . THR A 1 535  ? 0.151   80.892 -19.002 1.00 115.27 ? 532  THR A N   1 
ATOM 4154 C CA  . THR A 1 535  ? 1.495   80.442 -19.345 1.00 115.27 ? 532  THR A CA  1 
ATOM 4155 C C   . THR A 1 535  ? 1.423   78.995 -19.769 1.00 115.27 ? 532  THR A C   1 
ATOM 4156 O O   . THR A 1 535  ? 0.507   78.262 -19.392 1.00 115.27 ? 532  THR A O   1 
ATOM 4157 C CB  . THR A 1 535  ? 2.500   80.657 -18.183 1.00 63.36  ? 532  THR A CB  1 
ATOM 4158 O OG1 . THR A 1 535  ? 2.609   82.063 -17.936 1.00 63.36  ? 532  THR A OG1 1 
ATOM 4159 C CG2 . THR A 1 535  ? 3.910   80.091 -18.494 1.00 63.36  ? 532  THR A CG2 1 
ATOM 4160 N N   . GLU A 1 536  ? 2.401   78.610 -20.574 1.00 63.26  ? 533  GLU A N   1 
ATOM 4161 C CA  . GLU A 1 536  ? 2.434   77.328 -21.237 1.00 63.26  ? 533  GLU A CA  1 
ATOM 4162 C C   . GLU A 1 536  ? 3.673   76.632 -20.688 1.00 63.26  ? 533  GLU A C   1 
ATOM 4163 O O   . GLU A 1 536  ? 4.676   77.300 -20.385 1.00 63.26  ? 533  GLU A O   1 
ATOM 4164 C CB  . GLU A 1 536  ? 2.573   77.547 -22.747 1.00 151.54 ? 533  GLU A CB  1 
ATOM 4165 C CG  . GLU A 1 536  ? 1.427   77.010 -23.594 1.00 151.54 ? 533  GLU A CG  1 
ATOM 4166 C CD  . GLU A 1 536  ? 1.696   77.118 -25.091 1.00 151.54 ? 533  GLU A CD  1 
ATOM 4167 O OE1 . GLU A 1 536  ? 0.890   76.540 -25.885 1.00 151.54 ? 533  GLU A OE1 1 
ATOM 4168 O OE2 . GLU A 1 536  ? 2.709   77.770 -25.478 1.00 151.54 ? 533  GLU A OE2 1 
ATOM 4169 N N   . MET A 1 537  ? 3.614   75.308 -20.539 1.00 53.35  ? 534  MET A N   1 
ATOM 4170 C CA  . MET A 1 537  ? 4.723   74.595 -19.911 1.00 53.35  ? 534  MET A CA  1 
ATOM 4171 C C   . MET A 1 537  ? 5.285   73.597 -20.879 1.00 53.35  ? 534  MET A C   1 
ATOM 4172 O O   . MET A 1 537  ? 4.571   73.110 -21.748 1.00 53.35  ? 534  MET A O   1 
ATOM 4173 C CB  . MET A 1 537  ? 4.267   73.874 -18.647 1.00 76.85  ? 534  MET A CB  1 
ATOM 4174 C CG  . MET A 1 537  ? 3.478   74.729 -17.673 1.00 76.85  ? 534  MET A CG  1 
ATOM 4175 S SD  . MET A 1 537  ? 4.476   75.676 -16.516 1.00 76.85  ? 534  MET A SD  1 
ATOM 4176 C CE  . MET A 1 537  ? 5.619   74.420 -15.910 1.00 76.85  ? 534  MET A CE  1 
ATOM 4177 N N   . GLU A 1 538  ? 6.568   73.303 -20.713 1.00 68.17  ? 535  GLU A N   1 
ATOM 4178 C CA  . GLU A 1 538  ? 7.254   72.300 -21.503 1.00 68.17  ? 535  GLU A CA  1 
ATOM 4179 C C   . GLU A 1 538  ? 6.283   71.165 -21.884 1.00 68.17  ? 535  GLU A C   1 
ATOM 4180 O O   . GLU A 1 538  ? 6.136   70.814 -23.071 1.00 68.17  ? 535  GLU A O   1 
ATOM 4181 C CB  . GLU A 1 538  ? 8.424   71.735 -20.688 1.00 120.29 ? 535  GLU A CB  1 
ATOM 4182 C CG  . GLU A 1 538  ? 9.653   72.617 -20.606 1.00 120.29 ? 535  GLU A CG  1 
ATOM 4183 C CD  . GLU A 1 538  ? 10.611  72.372 -21.752 1.00 120.29 ? 535  GLU A CD  1 
ATOM 4184 O OE1 . GLU A 1 538  ? 10.766  73.279 -22.598 1.00 120.29 ? 535  GLU A OE1 1 
ATOM 4185 O OE2 . GLU A 1 538  ? 11.199  71.268 -21.815 1.00 120.29 ? 535  GLU A OE2 1 
ATOM 4186 N N   . HIS A 1 539  ? 5.601   70.633 -20.859 1.00 58.60  ? 536  HIS A N   1 
ATOM 4187 C CA  . HIS A 1 539  ? 4.817   69.399 -20.958 1.00 58.60  ? 536  HIS A CA  1 
ATOM 4188 C C   . HIS A 1 539  ? 3.460   69.534 -20.293 1.00 58.60  ? 536  HIS A C   1 
ATOM 4189 O O   . HIS A 1 539  ? 3.122   70.599 -19.764 1.00 58.60  ? 536  HIS A O   1 
ATOM 4190 C CB  . HIS A 1 539  ? 5.598   68.246 -20.339 1.00 90.17  ? 536  HIS A CB  1 
ATOM 4191 C CG  . HIS A 1 539  ? 7.036   68.246 -20.725 1.00 90.17  ? 536  HIS A CG  1 
ATOM 4192 N ND1 . HIS A 1 539  ? 7.472   67.805 -21.955 1.00 90.17  ? 536  HIS A ND1 1 
ATOM 4193 C CD2 . HIS A 1 539  ? 8.135   68.680 -20.066 1.00 90.17  ? 536  HIS A CD2 1 
ATOM 4194 C CE1 . HIS A 1 539  ? 8.782   67.945 -22.028 1.00 90.17  ? 536  HIS A CE1 1 
ATOM 4195 N NE2 . HIS A 1 539  ? 9.209   68.477 -20.896 1.00 90.17  ? 536  HIS A NE2 1 
ATOM 4196 N N   . GLU A 1 540  ? 2.690   68.443 -20.343 1.00 57.57  ? 537  GLU A N   1 
ATOM 4197 C CA  . GLU A 1 540  ? 1.348   68.385 -19.764 1.00 57.57  ? 537  GLU A CA  1 
ATOM 4198 C C   . GLU A 1 540  ? 1.379   68.508 -18.251 1.00 57.57  ? 537  GLU A C   1 
ATOM 4199 O O   . GLU A 1 540  ? 2.072   67.746 -17.573 1.00 57.57  ? 537  GLU A O   1 
ATOM 4200 C CB  . GLU A 1 540  ? 0.692   67.066 -20.128 1.00 67.51  ? 537  GLU A CB  1 
ATOM 4201 C CG  . GLU A 1 540  ? -0.252  67.106 -21.303 1.00 67.51  ? 537  GLU A CG  1 
ATOM 4202 C CD  . GLU A 1 540  ? -1.116  65.845 -21.348 1.00 67.51  ? 537  GLU A CD  1 
ATOM 4203 O OE1 . GLU A 1 540  ? -0.611  64.749 -21.740 1.00 67.51  ? 537  GLU A OE1 1 
ATOM 4204 O OE2 . GLU A 1 540  ? -2.305  65.964 -20.965 1.00 67.51  ? 537  GLU A OE2 1 
ATOM 4205 N N   . VAL A 1 541  ? 0.625   69.458 -17.720 1.00 52.47  ? 538  VAL A N   1 
ATOM 4206 C CA  . VAL A 1 541  ? 0.518   69.612 -16.270 1.00 52.47  ? 538  VAL A CA  1 
ATOM 4207 C C   . VAL A 1 541  ? -0.059  68.314 -15.679 1.00 52.47  ? 538  VAL A C   1 
ATOM 4208 O O   . VAL A 1 541  ? -1.162  67.913 -16.059 1.00 52.47  ? 538  VAL A O   1 
ATOM 4209 C CB  . VAL A 1 541  ? -0.415  70.802 -15.889 1.00 69.42  ? 538  VAL A CB  1 
ATOM 4210 C CG1 . VAL A 1 541  ? -0.615  70.883 -14.374 1.00 69.42  ? 538  VAL A CG1 1 
ATOM 4211 C CG2 . VAL A 1 541  ? 0.111   72.118 -16.449 1.00 69.42  ? 538  VAL A CG2 1 
ATOM 4212 N N   . ALA A 1 542  ? 0.691   67.669 -14.776 1.00 52.98  ? 539  ALA A N   1 
ATOM 4213 C CA  . ALA A 1 542  ? 0.182   66.515 -13.990 1.00 52.98  ? 539  ALA A CA  1 
ATOM 4214 C C   . ALA A 1 542  ? -0.689  66.872 -12.776 1.00 52.98  ? 539  ALA A C   1 
ATOM 4215 O O   . ALA A 1 542  ? -1.767  66.306 -12.618 1.00 52.98  ? 539  ALA A O   1 
ATOM 4216 C CB  . ALA A 1 542  ? 1.326   65.547 -13.558 1.00 40.01  ? 539  ALA A CB  1 
ATOM 4217 N N   . CYS A 1 543  ? -0.217  67.776 -11.919 1.00 59.02  ? 540  CYS A N   1 
ATOM 4218 C CA  . CYS A 1 543  ? -0.915  68.097 -10.663 1.00 59.02  ? 540  CYS A CA  1 
ATOM 4219 C C   . CYS A 1 543  ? -0.531  69.466 -10.150 1.00 59.02  ? 540  CYS A C   1 
ATOM 4220 O O   . CYS A 1 543  ? 0.560   69.973 -10.451 1.00 59.02  ? 540  CYS A O   1 
ATOM 4221 C CB  . CYS A 1 543  ? -0.595  67.062 -9.576  1.00 46.98  ? 540  CYS A CB  1 
ATOM 4222 S SG  . CYS A 1 543  ? 1.133   66.519 -9.609  1.00 46.98  ? 540  CYS A SG  1 
ATOM 4223 N N   . LEU A 1 544  ? -1.410  70.048 -9.339  1.00 94.98  ? 541  LEU A N   1 
ATOM 4224 C CA  . LEU A 1 544  ? -1.234  71.427 -8.880  1.00 94.98  ? 541  LEU A CA  1 
ATOM 4225 C C   . LEU A 1 544  ? -1.581  71.641 -7.408  1.00 94.98  ? 541  LEU A C   1 
ATOM 4226 O O   . LEU A 1 544  ? -2.500  71.011 -6.887  1.00 94.98  ? 541  LEU A O   1 
ATOM 4227 C CB  . LEU A 1 544  ? -2.064  72.373 -9.760  1.00 46.69  ? 541  LEU A CB  1 
ATOM 4228 C CG  . LEU A 1 544  ? -1.375  72.748 -11.065 1.00 46.69  ? 541  LEU A CG  1 
ATOM 4229 C CD1 . LEU A 1 544  ? -2.406  73.276 -12.039 1.00 46.69  ? 541  LEU A CD1 1 
ATOM 4230 C CD2 . LEU A 1 544  ? -0.283  73.778 -10.772 1.00 46.69  ? 541  LEU A CD2 1 
ATOM 4231 N N   . ASP A 1 545  ? -0.846  72.532 -6.744  1.00 196.75 ? 542  ASP A N   1 
ATOM 4232 C CA  . ASP A 1 545  ? -1.174  72.890 -5.366  1.00 196.75 ? 542  ASP A CA  1 
ATOM 4233 C C   . ASP A 1 545  ? -1.003  74.357 -5.026  1.00 196.75 ? 542  ASP A C   1 
ATOM 4234 O O   . ASP A 1 545  ? 0.026   74.963 -5.331  1.00 196.75 ? 542  ASP A O   1 
ATOM 4235 C CB  . ASP A 1 545  ? -0.385  72.051 -4.361  1.00 145.53 ? 542  ASP A CB  1 
ATOM 4236 C CG  . ASP A 1 545  ? -0.715  72.408 -2.918  1.00 145.53 ? 542  ASP A CG  1 
ATOM 4237 O OD1 . ASP A 1 545  ? -1.841  72.874 -2.635  1.00 145.53 ? 542  ASP A OD1 1 
ATOM 4238 O OD2 . ASP A 1 545  ? 0.157   72.225 -2.059  1.00 145.53 ? 542  ASP A OD2 1 
ATOM 4239 N N   . ILE A 1 546  ? -2.031  74.896 -4.369  1.00 176.40 ? 543  ILE A N   1 
ATOM 4240 C CA  . ILE A 1 546  ? -2.025  76.244 -3.810  1.00 176.40 ? 543  ILE A CA  1 
ATOM 4241 C C   . ILE A 1 546  ? -2.873  76.366 -2.551  1.00 176.40 ? 543  ILE A C   1 
ATOM 4242 O O   . ILE A 1 546  ? -4.072  76.065 -2.556  1.00 176.40 ? 543  ILE A O   1 
ATOM 4243 C CB  . ILE A 1 546  ? -2.547  77.294 -4.798  1.00 82.73  ? 543  ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 546  ? -3.821  76.797 -5.497  1.00 82.73  ? 543  ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 546  ? -1.451  77.688 -5.778  1.00 82.73  ? 543  ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 546  ? -4.975  77.752 -5.390  1.00 82.73  ? 543  ILE A CD1 1 
ATOM 4247 N N   . THR A 1 547  ? -2.229  76.811 -1.477  1.00 132.97 ? 544  THR A N   1 
ATOM 4248 C CA  . THR A 1 547  ? -2.914  77.229 -0.259  1.00 132.97 ? 544  THR A CA  1 
ATOM 4249 C C   . THR A 1 547  ? -2.114  78.381 0.367   1.00 132.97 ? 544  THR A C   1 
ATOM 4250 O O   . THR A 1 547  ? -0.907  78.243 0.605   1.00 132.97 ? 544  THR A O   1 
ATOM 4251 C CB  . THR A 1 547  ? -3.104  76.069 0.767   1.00 107.42 ? 544  THR A CB  1 
ATOM 4252 O OG1 . THR A 1 547  ? -2.899  74.796 0.135   1.00 107.42 ? 544  THR A OG1 1 
ATOM 4253 C CG2 . THR A 1 547  ? -4.502  76.114 1.377   1.00 107.42 ? 544  THR A CG2 1 
ATOM 4254 N N   . PRO A 1 548  ? -2.776  79.532 0.598   1.00 201.00 ? 545  PRO A N   1 
ATOM 4255 C CA  . PRO A 1 548  ? -2.184  80.705 1.240   1.00 201.00 ? 545  PRO A CA  1 
ATOM 4256 C C   . PRO A 1 548  ? -1.635  80.308 2.601   1.00 201.00 ? 545  PRO A C   1 
ATOM 4257 O O   . PRO A 1 548  ? -2.392  80.162 3.566   1.00 201.00 ? 545  PRO A O   1 
ATOM 4258 C CB  . PRO A 1 548  ? -3.373  81.667 1.381   1.00 156.48 ? 545  PRO A CB  1 
ATOM 4259 C CG  . PRO A 1 548  ? -4.591  80.805 1.229   1.00 156.48 ? 545  PRO A CG  1 
ATOM 4260 C CD  . PRO A 1 548  ? -4.183  79.770 0.247   1.00 156.48 ? 545  PRO A CD  1 
ATOM 4261 N N   . LEU A 1 549  ? -0.320  80.129 2.661   1.00 121.85 ? 546  LEU A N   1 
ATOM 4262 C CA  . LEU A 1 549  ? 0.310   79.418 3.777   1.00 121.85 ? 546  LEU A CA  1 
ATOM 4263 C C   . LEU A 1 549  ? 0.188   80.059 5.186   1.00 121.85 ? 546  LEU A C   1 
ATOM 4264 O O   . LEU A 1 549  ? -0.606  79.596 6.011   1.00 121.85 ? 546  LEU A O   1 
ATOM 4265 C CB  . LEU A 1 549  ? 1.749   79.014 3.418   1.00 67.62  ? 546  LEU A CB  1 
ATOM 4266 C CG  . LEU A 1 549  ? 1.925   78.002 2.283   1.00 67.62  ? 546  LEU A CG  1 
ATOM 4267 C CD1 . LEU A 1 549  ? 2.216   78.725 0.988   1.00 67.62  ? 546  LEU A CD1 1 
ATOM 4268 C CD2 . LEU A 1 549  ? 3.057   77.050 2.602   1.00 67.62  ? 546  LEU A CD2 1 
ATOM 4269 N N   . GLY A 1 550  ? 0.940   81.122 5.458   1.00 151.52 ? 547  GLY A N   1 
ATOM 4270 C CA  . GLY A 1 550  ? 0.916   81.727 6.792   1.00 151.52 ? 547  GLY A CA  1 
ATOM 4271 C C   . GLY A 1 550  ? 0.677   83.222 6.799   1.00 151.52 ? 547  GLY A C   1 
ATOM 4272 O O   . GLY A 1 550  ? -0.318  83.701 7.347   1.00 151.52 ? 547  GLY A O   1 
ATOM 4273 N N   . ASP A 1 551  ? 1.601   83.953 6.185   1.00 194.48 ? 548  ASP A N   1 
ATOM 4274 C CA  . ASP A 1 551  ? 1.559   85.411 6.143   1.00 194.48 ? 548  ASP A CA  1 
ATOM 4275 C C   . ASP A 1 551  ? 0.732   85.922 4.962   1.00 194.48 ? 548  ASP A C   1 
ATOM 4276 O O   . ASP A 1 551  ? 1.085   86.924 4.333   1.00 194.48 ? 548  ASP A O   1 
ATOM 4277 C CB  . ASP A 1 551  ? 2.985   85.969 6.082   1.00 139.95 ? 548  ASP A CB  1 
ATOM 4278 C CG  . ASP A 1 551  ? 3.860   85.229 5.084   1.00 139.95 ? 548  ASP A CG  1 
ATOM 4279 O OD1 . ASP A 1 551  ? 4.944   84.757 5.494   1.00 139.95 ? 548  ASP A OD1 1 
ATOM 4280 O OD2 . ASP A 1 551  ? 3.461   85.105 3.901   1.00 139.95 ? 548  ASP A OD2 1 
ATOM 4281 N N   . SER A 1 552  ? -0.368  85.231 4.670   1.00 140.50 ? 549  SER A N   1 
ATOM 4282 C CA  . SER A 1 552  ? -1.233  85.575 3.540   1.00 140.50 ? 549  SER A CA  1 
ATOM 4283 C C   . SER A 1 552  ? -2.697  85.165 3.756   1.00 140.50 ? 549  SER A C   1 
ATOM 4284 O O   . SER A 1 552  ? -3.039  83.984 3.744   1.00 140.50 ? 549  SER A O   1 
ATOM 4285 C CB  . SER A 1 552  ? -0.664  85.011 2.223   1.00 134.47 ? 549  SER A CB  1 
ATOM 4286 O OG  . SER A 1 552  ? 0.220   83.920 2.444   1.00 134.47 ? 549  SER A OG  1 
ATOM 4287 N N   . ASN A 1 553  ? -3.551  86.158 3.973   1.00 129.87 ? 550  ASN A N   1 
ATOM 4288 C CA  . ASN A 1 553  ? -4.975  85.927 4.165   1.00 129.87 ? 550  ASN A CA  1 
ATOM 4289 C C   . ASN A 1 553  ? -5.672  85.614 2.849   1.00 129.87 ? 550  ASN A C   1 
ATOM 4290 O O   . ASN A 1 553  ? -6.091  86.528 2.134   1.00 129.87 ? 550  ASN A O   1 
ATOM 4291 C CB  . ASN A 1 553  ? -5.630  87.152 4.806   1.00 177.15 ? 550  ASN A CB  1 
ATOM 4292 C CG  . ASN A 1 553  ? -5.433  87.204 6.297   1.00 177.15 ? 550  ASN A CG  1 
ATOM 4293 O OD1 . ASN A 1 553  ? -5.960  86.371 7.033   1.00 177.15 ? 550  ASN A OD1 1 
ATOM 4294 N ND2 . ASN A 1 553  ? -4.684  88.195 6.758   1.00 177.15 ? 550  ASN A ND2 1 
ATOM 4295 N N   . GLY A 1 554  ? -5.780  84.327 2.523   1.00 158.44 ? 551  GLY A N   1 
ATOM 4296 C CA  . GLY A 1 554  ? -6.517  83.883 1.333   1.00 158.44 ? 551  GLY A CA  1 
ATOM 4297 C C   . GLY A 1 554  ? -5.756  83.942 0.017   1.00 158.44 ? 551  GLY A C   1 
ATOM 4298 O O   . GLY A 1 554  ? -5.779  82.986 -0.759  1.00 158.44 ? 551  GLY A O   1 
ATOM 4299 N N   . LEU A 1 555  ? -5.099  85.071 -0.245  1.00 123.82 ? 552  LEU A N   1 
ATOM 4300 C CA  . LEU A 1 555  ? -4.284  85.238 -1.444  1.00 123.82 ? 552  LEU A CA  1 
ATOM 4301 C C   . LEU A 1 555  ? -2.969  84.486 -1.238  1.00 123.82 ? 552  LEU A C   1 
ATOM 4302 O O   . LEU A 1 555  ? -2.366  84.574 -0.167  1.00 123.82 ? 552  LEU A O   1 
ATOM 4303 C CB  . LEU A 1 555  ? -4.044  86.729 -1.740  1.00 95.57  ? 552  LEU A CB  1 
ATOM 4304 C CG  . LEU A 1 555  ? -3.999  87.180 -3.211  1.00 95.57  ? 552  LEU A CG  1 
ATOM 4305 C CD1 . LEU A 1 555  ? -5.406  87.206 -3.818  1.00 95.57  ? 552  LEU A CD1 1 
ATOM 4306 C CD2 . LEU A 1 555  ? -3.294  88.540 -3.384  1.00 95.57  ? 552  LEU A CD2 1 
ATOM 4307 N N   . SER A 1 556  ? -2.530  83.750 -2.262  1.00 109.23 ? 553  SER A N   1 
ATOM 4308 C CA  . SER A 1 556  ? -1.433  82.783 -2.119  1.00 109.23 ? 553  SER A CA  1 
ATOM 4309 C C   . SER A 1 556  ? -0.123  83.139 -2.861  1.00 109.23 ? 553  SER A C   1 
ATOM 4310 O O   . SER A 1 556  ? -0.153  83.419 -4.061  1.00 109.23 ? 553  SER A O   1 
ATOM 4311 C CB  . SER A 1 556  ? -1.923  81.391 -2.533  1.00 96.26  ? 553  SER A CB  1 
ATOM 4312 O OG  . SER A 1 556  ? -1.246  80.377 -1.818  1.00 96.26  ? 553  SER A OG  1 
ATOM 4313 N N   . PRO A 1 557  ? 1.021   83.147 -2.125  1.00 174.68 ? 554  PRO A N   1 
ATOM 4314 C CA  . PRO A 1 557  ? 2.415   83.279 -2.618  1.00 174.68 ? 554  PRO A CA  1 
ATOM 4315 C C   . PRO A 1 557  ? 2.860   82.251 -3.686  1.00 174.68 ? 554  PRO A C   1 
ATOM 4316 O O   . PRO A 1 557  ? 2.094   81.967 -4.608  1.00 174.68 ? 554  PRO A O   1 
ATOM 4317 C CB  . PRO A 1 557  ? 3.253   83.146 -1.336  1.00 106.87 ? 554  PRO A CB  1 
ATOM 4318 C CG  . PRO A 1 557  ? 2.337   83.618 -0.250  1.00 106.87 ? 554  PRO A CG  1 
ATOM 4319 C CD  . PRO A 1 557  ? 0.986   83.090 -0.649  1.00 106.87 ? 554  PRO A CD  1 
ATOM 4320 N N   . LEU A 1 558  ? 4.080   81.713 -3.567  1.00 138.02 ? 555  LEU A N   1 
ATOM 4321 C CA  . LEU A 1 558  ? 4.704   80.887 -4.638  1.00 138.02 ? 555  LEU A CA  1 
ATOM 4322 C C   . LEU A 1 558  ? 4.019   79.550 -4.970  1.00 138.02 ? 555  LEU A C   1 
ATOM 4323 O O   . LEU A 1 558  ? 3.054   79.168 -4.309  1.00 138.02 ? 555  LEU A O   1 
ATOM 4324 C CB  . LEU A 1 558  ? 6.205   80.672 -4.383  1.00 104.98 ? 555  LEU A CB  1 
ATOM 4325 C CG  . LEU A 1 558  ? 6.683   79.953 -3.122  1.00 104.98 ? 555  LEU A CG  1 
ATOM 4326 C CD1 . LEU A 1 558  ? 7.986   79.172 -3.379  1.00 104.98 ? 555  LEU A CD1 1 
ATOM 4327 C CD2 . LEU A 1 558  ? 6.841   80.984 -1.988  1.00 104.98 ? 555  LEU A CD2 1 
ATOM 4328 N N   . CYS A 1 559  ? 4.529   78.847 -5.992  1.00 125.57 ? 556  CYS A N   1 
ATOM 4329 C CA  . CYS A 1 559  ? 3.894   77.606 -6.493  1.00 125.57 ? 556  CYS A CA  1 
ATOM 4330 C C   . CYS A 1 559  ? 4.788   76.427 -6.968  1.00 125.57 ? 556  CYS A C   1 
ATOM 4331 O O   . CYS A 1 559  ? 5.993   76.568 -7.189  1.00 125.57 ? 556  CYS A O   1 
ATOM 4332 C CB  . CYS A 1 559  ? 2.850   77.923 -7.568  1.00 145.88 ? 556  CYS A CB  1 
ATOM 4333 S SG  . CYS A 1 559  ? 1.640   76.602 -7.759  1.00 145.88 ? 556  CYS A SG  1 
ATOM 4334 N N   . ALA A 1 560  ? 4.138   75.270 -7.117  1.00 100.42 ? 557  ALA A N   1 
ATOM 4335 C CA  . ALA A 1 560  ? 4.767   73.997 -7.445  1.00 100.42 ? 557  ALA A CA  1 
ATOM 4336 C C   . ALA A 1 560  ? 3.817   73.114 -8.268  1.00 100.42 ? 557  ALA A C   1 
ATOM 4337 O O   . ALA A 1 560  ? 2.580   73.233 -8.175  1.00 100.42 ? 557  ALA A O   1 
ATOM 4338 C CB  . ALA A 1 560  ? 5.194   73.283 -6.178  1.00 197.19 ? 557  ALA A CB  1 
ATOM 4339 N N   . ILE A 1 561  ? 4.414   72.216 -9.053  1.00 58.14  ? 558  ILE A N   1 
ATOM 4340 C CA  . ILE A 1 561  ? 3.716   71.488 -10.107 1.00 58.14  ? 558  ILE A CA  1 
ATOM 4341 C C   . ILE A 1 561  ? 4.478   70.215 -10.505 1.00 58.14  ? 558  ILE A C   1 
ATOM 4342 O O   . ILE A 1 561  ? 5.722   70.164 -10.475 1.00 58.14  ? 558  ILE A O   1 
ATOM 4343 C CB  . ILE A 1 561  ? 3.540   72.419 -11.340 1.00 83.90  ? 558  ILE A CB  1 
ATOM 4344 C CG1 . ILE A 1 561  ? 2.580   71.832 -12.377 1.00 83.90  ? 558  ILE A CG1 1 
ATOM 4345 C CG2 . ILE A 1 561  ? 4.906   72.808 -11.953 1.00 83.90  ? 558  ILE A CG2 1 
ATOM 4346 C CD1 . ILE A 1 561  ? 2.151   72.850 -13.424 1.00 83.90  ? 558  ILE A CD1 1 
ATOM 4347 N N   . GLY A 1 562  ? 3.743   69.172 -10.864 1.00 44.39  ? 559  GLY A N   1 
ATOM 4348 C CA  . GLY A 1 562  ? 4.376   68.015 -11.509 1.00 44.39  ? 559  GLY A CA  1 
ATOM 4349 C C   . GLY A 1 562  ? 3.866   67.939 -12.940 1.00 44.39  ? 559  GLY A C   1 
ATOM 4350 O O   . GLY A 1 562  ? 2.677   68.189 -13.169 1.00 44.39  ? 559  GLY A O   1 
ATOM 4351 N N   . LEU A 1 563  ? 4.739   67.615 -13.898 1.00 61.55  ? 560  LEU A N   1 
ATOM 4352 C CA  . LEU A 1 563  ? 4.337   67.511 -15.313 1.00 61.55  ? 560  LEU A CA  1 
ATOM 4353 C C   . LEU A 1 563  ? 4.496   66.097 -15.826 1.00 61.55  ? 560  LEU A C   1 
ATOM 4354 O O   . LEU A 1 563  ? 5.095   65.269 -15.157 1.00 61.55  ? 560  LEU A O   1 
ATOM 4355 C CB  . LEU A 1 563  ? 5.173   68.424 -16.213 1.00 73.62  ? 560  LEU A CB  1 
ATOM 4356 C CG  . LEU A 1 563  ? 5.366   69.914 -15.961 1.00 73.62  ? 560  LEU A CG  1 
ATOM 4357 C CD1 . LEU A 1 563  ? 5.843   70.530 -17.268 1.00 73.62  ? 560  LEU A CD1 1 
ATOM 4358 C CD2 . LEU A 1 563  ? 4.105   70.604 -15.468 1.00 73.62  ? 560  LEU A CD2 1 
ATOM 4359 N N   . TRP A 1 564  ? 3.977   65.826 -17.022 1.00 68.94  ? 561  TRP A N   1 
ATOM 4360 C CA  . TRP A 1 564  ? 4.214   64.556 -17.716 1.00 68.94  ? 561  TRP A CA  1 
ATOM 4361 C C   . TRP A 1 564  ? 4.879   63.597 -18.723 1.00 68.94  ? 561  TRP A C   1 
ATOM 4362 O O   . TRP A 1 564  ? 4.378   62.499 -18.991 1.00 68.94  ? 561  TRP A O   1 
ATOM 4363 C CB  . TRP A 1 564  ? 3.134   64.338 -18.767 1.00 63.58  ? 561  TRP A CB  1 
ATOM 4364 C CG  . TRP A 1 564  ? 1.776   64.106 -18.265 1.00 63.58  ? 561  TRP A CG  1 
ATOM 4365 C CD1 . TRP A 1 564  ? 0.989   64.980 -17.585 1.00 63.58  ? 561  TRP A CD1 1 
ATOM 4366 C CD2 . TRP A 1 564  ? 1.005   62.923 -18.446 1.00 63.58  ? 561  TRP A CD2 1 
ATOM 4367 N NE1 . TRP A 1 564  ? -0.234  64.413 -17.319 1.00 63.58  ? 561  TRP A NE1 1 
ATOM 4368 C CE2 . TRP A 1 564  ? -0.248  63.145 -17.835 1.00 63.58  ? 561  TRP A CE2 1 
ATOM 4369 C CE3 . TRP A 1 564  ? 1.252   61.685 -19.064 1.00 63.58  ? 561  TRP A CE3 1 
ATOM 4370 C CZ2 . TRP A 1 564  ? -1.258  62.170 -17.818 1.00 63.58  ? 561  TRP A CZ2 1 
ATOM 4371 C CZ3 . TRP A 1 564  ? 0.251   60.709 -19.049 1.00 63.58  ? 561  TRP A CZ3 1 
ATOM 4372 C CH2 . TRP A 1 564  ? -0.990  60.961 -18.431 1.00 63.58  ? 561  TRP A CH2 1 
ATOM 4373 N N   . THR A 1 565  ? 6.025   64.032 -19.251 1.00 79.70  ? 562  THR A N   1 
ATOM 4374 C CA  . THR A 1 565  ? 6.951   63.198 -20.051 1.00 79.70  ? 562  THR A CA  1 
ATOM 4375 C C   . THR A 1 565  ? 8.336   63.261 -19.405 1.00 79.70  ? 562  THR A C   1 
ATOM 4376 O O   . THR A 1 565  ? 9.147   62.350 -19.564 1.00 79.70  ? 562  THR A O   1 
ATOM 4377 C CB  . THR A 1 565  ? 6.886   64.164 -21.292 1.00 70.44  ? 562  THR A CB  1 
ATOM 4378 O OG1 . THR A 1 565  ? 5.536   64.591 -21.517 1.00 70.44  ? 562  THR A OG1 1 
ATOM 4379 C CG2 . THR A 1 565  ? 7.419   63.471 -22.563 1.00 70.44  ? 562  THR A CG2 1 
ATOM 4380 N N   . ASP A 1 566  ? 8.588   64.422 -18.802 1.00 76.66  ? 563  ASP A N   1 
ATOM 4381 C CA  . ASP A 1 566  ? 9.719   64.700 -17.938 1.00 76.66  ? 563  ASP A CA  1 
ATOM 4382 C C   . ASP A 1 566  ? 9.055   64.819 -16.584 1.00 76.66  ? 563  ASP A C   1 
ATOM 4383 O O   . ASP A 1 566  ? 8.402   65.814 -16.271 1.00 76.66  ? 563  ASP A O   1 
ATOM 4384 C CB  . ASP A 1 566  ? 10.390  66.015 -18.324 1.00 69.98  ? 563  ASP A CB  1 
ATOM 4385 C CG  . ASP A 1 566  ? 9.458   67.204 -18.200 1.00 69.98  ? 563  ASP A CG  1 
ATOM 4386 O OD1 . ASP A 1 566  ? 8.267   66.997 -17.886 1.00 69.98  ? 563  ASP A OD1 1 
ATOM 4387 O OD2 . ASP A 1 566  ? 9.916   68.346 -18.416 1.00 69.98  ? 563  ASP A OD2 1 
ATOM 4388 N N   . ILE A 1 567  ? 9.218   63.770 -15.798 1.00 119.96 ? 564  ILE A N   1 
ATOM 4389 C CA  . ILE A 1 567  ? 8.280   63.376 -14.747 1.00 119.96 ? 564  ILE A CA  1 
ATOM 4390 C C   . ILE A 1 567  ? 9.055   64.298 -13.822 1.00 119.96 ? 564  ILE A C   1 
ATOM 4391 O O   . ILE A 1 567  ? 10.149  63.970 -13.347 1.00 119.96 ? 564  ILE A O   1 
ATOM 4392 C CB  . ILE A 1 567  ? 8.658   61.885 -14.517 1.00 56.51  ? 564  ILE A CB  1 
ATOM 4393 C CG1 . ILE A 1 567  ? 7.729   60.993 -15.322 1.00 56.51  ? 564  ILE A CG1 1 
ATOM 4394 C CG2 . ILE A 1 567  ? 8.606   61.502 -13.018 1.00 56.51  ? 564  ILE A CG2 1 
ATOM 4395 C CD1 . ILE A 1 567  ? 8.469   60.087 -16.236 1.00 56.51  ? 564  ILE A CD1 1 
ATOM 4396 N N   . SER A 1 568  ? 8.500   65.473 -13.589 1.00 46.73  ? 565  SER A N   1 
ATOM 4397 C CA  . SER A 1 568  ? 9.232   66.428 -12.809 1.00 46.73  ? 565  SER A CA  1 
ATOM 4398 C C   . SER A 1 568  ? 8.360   67.185 -11.845 1.00 46.73  ? 565  SER A C   1 
ATOM 4399 O O   . SER A 1 568  ? 7.143   67.285 -12.050 1.00 46.73  ? 565  SER A O   1 
ATOM 4400 C CB  . SER A 1 568  ? 9.913   67.428 -13.743 1.00 66.46  ? 565  SER A CB  1 
ATOM 4401 O OG  . SER A 1 568  ? 8.960   68.183 -14.475 1.00 66.46  ? 565  SER A OG  1 
ATOM 4402 N N   . ALA A 1 569  ? 8.992   67.736 -10.810 1.00 59.08  ? 566  ALA A N   1 
ATOM 4403 C CA  . ALA A 1 569  ? 8.359   68.728 -9.958  1.00 59.08  ? 566  ALA A CA  1 
ATOM 4404 C C   . ALA A 1 569  ? 9.236   69.986 -9.862  1.00 59.08  ? 566  ALA A C   1 
ATOM 4405 O O   . ALA A 1 569  ? 10.474  69.912 -9.732  1.00 59.08  ? 566  ALA A O   1 
ATOM 4406 C CB  . ALA A 1 569  ? 8.086   68.149 -8.600  1.00 93.03  ? 566  ALA A CB  1 
ATOM 4407 N N   . ARG A 1 570  ? 8.590   71.145 -9.923  1.00 72.14  ? 567  ARG A N   1 
ATOM 4408 C CA  . ARG A 1 570  ? 9.310   72.409 -10.063 1.00 72.14  ? 567  ARG A CA  1 
ATOM 4409 C C   . ARG A 1 570  ? 8.690   73.559 -9.265  1.00 72.14  ? 567  ARG A C   1 
ATOM 4410 O O   . ARG A 1 570  ? 7.481   73.561 -8.999  1.00 72.14  ? 567  ARG A O   1 
ATOM 4411 C CB  . ARG A 1 570  ? 9.436   72.802 -11.550 1.00 100.45 ? 567  ARG A CB  1 
ATOM 4412 C CG  . ARG A 1 570  ? 8.421   72.165 -12.512 1.00 100.45 ? 567  ARG A CG  1 
ATOM 4413 C CD  . ARG A 1 570  ? 9.099   71.227 -13.522 1.00 100.45 ? 567  ARG A CD  1 
ATOM 4414 N NE  . ARG A 1 570  ? 9.459   71.923 -14.766 1.00 100.45 ? 567  ARG A NE  1 
ATOM 4415 C CZ  . ARG A 1 570  ? 9.881   71.335 -15.887 1.00 100.45 ? 567  ARG A CZ  1 
ATOM 4416 N NH1 . ARG A 1 570  ? 10.013  70.022 -15.960 1.00 100.45 ? 567  ARG A NH1 1 
ATOM 4417 N NH2 . ARG A 1 570  ? 10.171  72.070 -16.950 1.00 100.45 ? 567  ARG A NH2 1 
ATOM 4418 N N   . ILE A 1 571  ? 9.523   74.549 -8.928  1.00 124.38 ? 568  ILE A N   1 
ATOM 4419 C CA  . ILE A 1 571  ? 9.141   75.673 -8.065  1.00 124.38 ? 568  ILE A CA  1 
ATOM 4420 C C   . ILE A 1 571  ? 8.857   76.949 -8.872  1.00 124.38 ? 568  ILE A C   1 
ATOM 4421 O O   . ILE A 1 571  ? 9.655   77.326 -9.717  1.00 124.38 ? 568  ILE A O   1 
ATOM 4422 C CB  . ILE A 1 571  ? 10.258  75.965 -7.028  1.00 187.54 ? 568  ILE A CB  1 
ATOM 4423 C CG1 . ILE A 1 571  ? 10.845  74.666 -6.439  1.00 187.54 ? 568  ILE A CG1 1 
ATOM 4424 C CG2 . ILE A 1 571  ? 9.771   76.949 -5.955  1.00 187.54 ? 568  ILE A CG2 1 
ATOM 4425 C CD1 . ILE A 1 571  ? 9.863   73.768 -5.691  1.00 187.54 ? 568  ILE A CD1 1 
ATOM 4426 N N   . LEU A 1 572  ? 7.731   77.612 -8.604  1.00 191.57 ? 569  LEU A N   1 
ATOM 4427 C CA  . LEU A 1 572  ? 7.273   78.749 -9.425  1.00 191.57 ? 569  LEU A CA  1 
ATOM 4428 C C   . LEU A 1 572  ? 6.609   79.870 -8.599  1.00 191.57 ? 569  LEU A C   1 
ATOM 4429 O O   . LEU A 1 572  ? 6.457   79.720 -7.390  1.00 191.57 ? 569  LEU A O   1 
ATOM 4430 C CB  . LEU A 1 572  ? 6.323   78.250 -10.526 1.00 155.47 ? 569  LEU A CB  1 
ATOM 4431 C CG  . LEU A 1 572  ? 6.891   77.485 -11.740 1.00 155.47 ? 569  LEU A CG  1 
ATOM 4432 C CD1 . LEU A 1 572  ? 7.111   75.992 -11.457 1.00 155.47 ? 569  LEU A CD1 1 
ATOM 4433 C CD2 . LEU A 1 572  ? 5.942   77.639 -12.922 1.00 155.47 ? 569  LEU A CD2 1 
ATOM 4434 N N   . LYS A 1 573  ? 6.239   80.987 -9.244  1.00 137.61 ? 570  LYS A N   1 
ATOM 4435 C CA  . LYS A 1 573  ? 5.503   82.095 -8.581  1.00 137.61 ? 570  LYS A CA  1 
ATOM 4436 C C   . LYS A 1 573  ? 4.014   82.129 -8.985  1.00 137.61 ? 570  LYS A C   1 
ATOM 4437 O O   . LYS A 1 573  ? 3.477   81.097 -9.380  1.00 137.61 ? 570  LYS A O   1 
ATOM 4438 C CB  . LYS A 1 573  ? 6.184   83.451 -8.817  1.00 65.76  ? 570  LYS A CB  1 
ATOM 4439 C CG  . LYS A 1 573  ? 5.693   84.589 -7.915  1.00 65.76  ? 570  LYS A CG  1 
ATOM 4440 C CD  . LYS A 1 573  ? 6.216   85.929 -8.401  1.00 65.76  ? 570  LYS A CD  1 
ATOM 4441 C CE  . LYS A 1 573  ? 5.087   86.984 -8.475  1.00 65.76  ? 570  LYS A CE  1 
ATOM 4442 N NZ  . LYS A 1 573  ? 4.280   86.921 -9.749  1.00 65.76  ? 570  LYS A NZ  1 
ATOM 4443 N N   . LEU A 1 574  ? 3.358   83.293 -8.891  1.00 201.00 ? 571  LEU A N   1 
ATOM 4444 C CA  . LEU A 1 574  ? 1.886   83.382 -9.041  1.00 201.00 ? 571  LEU A CA  1 
ATOM 4445 C C   . LEU A 1 574  ? 1.306   83.886 -10.391 1.00 201.00 ? 571  LEU A C   1 
ATOM 4446 O O   . LEU A 1 574  ? 0.955   83.059 -11.237 1.00 201.00 ? 571  LEU A O   1 
ATOM 4447 C CB  . LEU A 1 574  ? 1.234   84.103 -7.848  1.00 102.29 ? 571  LEU A CB  1 
ATOM 4448 C CG  . LEU A 1 574  ? -0.291  84.197 -7.937  1.00 102.29 ? 571  LEU A CG  1 
ATOM 4449 C CD1 . LEU A 1 574  ? -0.928  82.813 -7.760  1.00 102.29 ? 571  LEU A CD1 1 
ATOM 4450 C CD2 . LEU A 1 574  ? -0.831  85.233 -6.949  1.00 102.29 ? 571  LEU A CD2 1 
ATOM 4451 N N   . PRO A 1 575  ? 1.153   85.222 -10.588 1.00 190.00 ? 572  PRO A N   1 
ATOM 4452 C CA  . PRO A 1 575  ? 0.603   85.602 -11.894 1.00 190.00 ? 572  PRO A CA  1 
ATOM 4453 C C   . PRO A 1 575  ? 1.642   85.458 -13.010 1.00 190.00 ? 572  PRO A C   1 
ATOM 4454 O O   . PRO A 1 575  ? 1.287   85.175 -14.156 1.00 190.00 ? 572  PRO A O   1 
ATOM 4455 C CB  . PRO A 1 575  ? 0.203   87.077 -11.701 1.00 178.94 ? 572  PRO A CB  1 
ATOM 4456 C CG  . PRO A 1 575  ? 0.360   87.361 -10.228 1.00 178.94 ? 572  PRO A CG  1 
ATOM 4457 C CD  . PRO A 1 575  ? 1.404   86.412 -9.753  1.00 178.94 ? 572  PRO A CD  1 
ATOM 4458 N N   . SER A 1 576  ? 2.912   85.633 -12.649 1.00 140.52 ? 573  SER A N   1 
ATOM 4459 C CA  . SER A 1 576  ? 4.044   85.549 -13.574 1.00 140.52 ? 573  SER A CA  1 
ATOM 4460 C C   . SER A 1 576  ? 4.339   84.124 -14.053 1.00 140.52 ? 573  SER A C   1 
ATOM 4461 O O   . SER A 1 576  ? 4.635   83.913 -15.235 1.00 140.52 ? 573  SER A O   1 
ATOM 4462 C CB  . SER A 1 576  ? 5.298   86.138 -12.916 1.00 128.88 ? 573  SER A CB  1 
ATOM 4463 O OG  . SER A 1 576  ? 5.616   85.454 -11.712 1.00 128.88 ? 573  SER A OG  1 
ATOM 4464 N N   . PHE A 1 577  ? 4.256   83.166 -13.123 1.00 119.25 ? 574  PHE A N   1 
ATOM 4465 C CA  . PHE A 1 577  ? 4.622   81.752 -13.341 1.00 119.25 ? 574  PHE A CA  1 
ATOM 4466 C C   . PHE A 1 577  ? 6.136   81.559 -13.534 1.00 119.25 ? 574  PHE A C   1 
ATOM 4467 O O   . PHE A 1 577  ? 6.579   80.533 -14.051 1.00 119.25 ? 574  PHE A O   1 
ATOM 4468 C CB  . PHE A 1 577  ? 3.845   81.124 -14.514 1.00 97.57  ? 574  PHE A CB  1 
ATOM 4469 C CG  . PHE A 1 577  ? 2.356   80.988 -14.282 1.00 97.57  ? 574  PHE A CG  1 
ATOM 4470 C CD1 . PHE A 1 577  ? 1.475   82.008 -14.672 1.00 97.57  ? 574  PHE A CD1 1 
ATOM 4471 C CD2 . PHE A 1 577  ? 1.828   79.824 -13.714 1.00 97.57  ? 574  PHE A CD2 1 
ATOM 4472 C CE1 . PHE A 1 577  ? 0.087   81.879 -14.479 1.00 97.57  ? 574  PHE A CE1 1 
ATOM 4473 C CE2 . PHE A 1 577  ? 0.448   79.684 -13.519 1.00 97.57  ? 574  PHE A CE2 1 
ATOM 4474 C CZ  . PHE A 1 577  ? -0.424  80.713 -13.902 1.00 97.57  ? 574  PHE A CZ  1 
ATOM 4475 N N   . GLU A 1 578  ? 6.925   82.544 -13.115 1.00 134.47 ? 575  GLU A N   1 
ATOM 4476 C CA  . GLU A 1 578  ? 8.375   82.478 -13.272 1.00 134.47 ? 575  GLU A CA  1 
ATOM 4477 C C   . GLU A 1 578  ? 8.963   81.250 -12.560 1.00 134.47 ? 575  GLU A C   1 
ATOM 4478 O O   . GLU A 1 578  ? 8.813   81.081 -11.349 1.00 134.47 ? 575  GLU A O   1 
ATOM 4479 C CB  . GLU A 1 578  ? 9.030   83.788 -12.811 1.00 137.07 ? 575  GLU A CB  1 
ATOM 4480 C CG  . GLU A 1 578  ? 8.598   84.258 -11.424 1.00 137.07 ? 575  GLU A CG  1 
ATOM 4481 C CD  . GLU A 1 578  ? 8.703   85.756 -11.233 1.00 137.07 ? 575  GLU A CD  1 
ATOM 4482 O OE1 . GLU A 1 578  ? 8.369   86.503 -12.174 1.00 137.07 ? 575  GLU A OE1 1 
ATOM 4483 O OE2 . GLU A 1 578  ? 9.103   86.187 -10.132 1.00 137.07 ? 575  GLU A OE2 1 
ATOM 4484 N N   . LEU A 1 579  ? 9.606   80.387 -13.341 1.00 84.07  ? 576  LEU A N   1 
ATOM 4485 C CA  . LEU A 1 579  ? 10.187  79.136 -12.846 1.00 84.07  ? 576  LEU A CA  1 
ATOM 4486 C C   . LEU A 1 579  ? 11.468  79.368 -12.043 1.00 84.07  ? 576  LEU A C   1 
ATOM 4487 O O   . LEU A 1 579  ? 12.351  80.110 -12.472 1.00 84.07  ? 576  LEU A O   1 
ATOM 4488 C CB  . LEU A 1 579  ? 10.448  78.180 -14.025 1.00 100.41 ? 576  LEU A CB  1 
ATOM 4489 C CG  . LEU A 1 579  ? 11.145  76.803 -13.942 1.00 100.41 ? 576  LEU A CG  1 
ATOM 4490 C CD1 . LEU A 1 579  ? 12.682  76.872 -14.056 1.00 100.41 ? 576  LEU A CD1 1 
ATOM 4491 C CD2 . LEU A 1 579  ? 10.716  75.969 -12.725 1.00 100.41 ? 576  LEU A CD2 1 
ATOM 4492 N N   . LEU A 1 580  ? 11.563  78.715 -10.886 1.00 194.90 ? 577  LEU A N   1 
ATOM 4493 C CA  . LEU A 1 580  ? 12.736  78.805 -10.016 1.00 194.90 ? 577  LEU A CA  1 
ATOM 4494 C C   . LEU A 1 580  ? 13.609  77.558 -10.151 1.00 194.90 ? 577  LEU A C   1 
ATOM 4495 O O   . LEU A 1 580  ? 13.997  77.170 -11.254 1.00 194.90 ? 577  LEU A O   1 
ATOM 4496 C CB  . LEU A 1 580  ? 12.306  78.985 -8.553  1.00 102.69 ? 577  LEU A CB  1 
ATOM 4497 C CG  . LEU A 1 580  ? 11.623  80.287 -8.124  1.00 102.69 ? 577  LEU A CG  1 
ATOM 4498 C CD1 . LEU A 1 580  ? 10.111  80.264 -8.346  1.00 102.69 ? 577  LEU A CD1 1 
ATOM 4499 C CD2 . LEU A 1 580  ? 11.936  80.563 -6.667  1.00 102.69 ? 577  LEU A CD2 1 
ATOM 4500 N N   . HIS A 1 581  ? 13.920  76.952 -9.007  1.00 97.60  ? 578  HIS A N   1 
ATOM 4501 C CA  . HIS A 1 581  ? 14.591  75.648 -8.926  1.00 97.60  ? 578  HIS A CA  1 
ATOM 4502 C C   . HIS A 1 581  ? 13.610  74.521 -9.299  1.00 97.60  ? 578  HIS A C   1 
ATOM 4503 O O   . HIS A 1 581  ? 12.394  74.743 -9.383  1.00 97.60  ? 578  HIS A O   1 
ATOM 4504 C CB  . HIS A 1 581  ? 15.170  75.464 -7.504  1.00 128.18 ? 578  HIS A CB  1 
ATOM 4505 C CG  . HIS A 1 581  ? 15.529  74.050 -7.147  1.00 128.18 ? 578  HIS A CG  1 
ATOM 4506 N ND1 . HIS A 1 581  ? 16.696  73.447 -7.565  1.00 128.18 ? 578  HIS A ND1 1 
ATOM 4507 C CD2 . HIS A 1 581  ? 14.885  73.132 -6.387  1.00 128.18 ? 578  HIS A CD2 1 
ATOM 4508 C CE1 . HIS A 1 581  ? 16.750  72.216 -7.089  1.00 128.18 ? 578  HIS A CE1 1 
ATOM 4509 N NE2 . HIS A 1 581  ? 15.661  71.999 -6.374  1.00 128.18 ? 578  HIS A NE2 1 
ATOM 4510 N N   . LYS A 1 582  ? 14.138  73.324 -9.533  1.00 99.53  ? 579  LYS A N   1 
ATOM 4511 C CA  . LYS A 1 582  ? 13.298  72.173 -9.829  1.00 99.53  ? 579  LYS A CA  1 
ATOM 4512 C C   . LYS A 1 582  ? 13.940  70.825 -9.452  1.00 99.53  ? 579  LYS A C   1 
ATOM 4513 O O   . LYS A 1 582  ? 14.972  70.773 -8.757  1.00 99.53  ? 579  LYS A O   1 
ATOM 4514 C CB  . LYS A 1 582  ? 12.906  72.182 -11.302 1.00 69.56  ? 579  LYS A CB  1 
ATOM 4515 C CG  . LYS A 1 582  ? 14.079  72.123 -12.281 1.00 69.56  ? 579  LYS A CG  1 
ATOM 4516 C CD  . LYS A 1 582  ? 13.699  71.382 -13.576 1.00 69.56  ? 579  LYS A CD  1 
ATOM 4517 C CE  . LYS A 1 582  ? 13.472  69.888 -13.306 1.00 69.56  ? 579  LYS A CE  1 
ATOM 4518 N NZ  . LYS A 1 582  ? 13.426  69.047 -14.551 1.00 69.56  ? 579  LYS A NZ  1 
ATOM 4519 N N   . GLU A 1 583  ? 13.322  69.737 -9.915  1.00 103.63 ? 580  GLU A N   1 
ATOM 4520 C CA  . GLU A 1 583  ? 13.819  68.395 -9.648  1.00 103.63 ? 580  GLU A CA  1 
ATOM 4521 C C   . GLU A 1 583  ? 13.364  67.448 -10.735 1.00 103.63 ? 580  GLU A C   1 
ATOM 4522 O O   . GLU A 1 583  ? 12.249  67.571 -11.234 1.00 103.63 ? 580  GLU A O   1 
ATOM 4523 C CB  . GLU A 1 583  ? 13.311  67.910 -8.289  1.00 118.43 ? 580  GLU A CB  1 
ATOM 4524 C CG  . GLU A 1 583  ? 13.827  66.540 -7.861  1.00 118.43 ? 580  GLU A CG  1 
ATOM 4525 C CD  . GLU A 1 583  ? 15.303  66.527 -7.515  1.00 118.43 ? 580  GLU A CD  1 
ATOM 4526 O OE1 . GLU A 1 583  ? 15.852  67.583 -7.106  1.00 118.43 ? 580  GLU A OE1 1 
ATOM 4527 O OE2 . GLU A 1 583  ? 15.908  65.441 -7.643  1.00 118.43 ? 580  GLU A OE2 1 
ATOM 4528 N N   . MET A 1 584  ? 14.224  66.498 -11.086 1.00 135.76 ? 581  MET A N   1 
ATOM 4529 C CA  . MET A 1 584  ? 13.909  65.509 -12.105 1.00 135.76 ? 581  MET A CA  1 
ATOM 4530 C C   . MET A 1 584  ? 13.756  64.126 -11.469 1.00 135.76 ? 581  MET A C   1 
ATOM 4531 O O   . MET A 1 584  ? 14.748  63.435 -11.237 1.00 135.76 ? 581  MET A O   1 
ATOM 4532 C CB  . MET A 1 584  ? 15.021  65.485 -13.162 1.00 89.38  ? 581  MET A CB  1 
ATOM 4533 C CG  . MET A 1 584  ? 14.575  65.106 -14.577 1.00 89.38  ? 581  MET A CG  1 
ATOM 4534 S SD  . MET A 1 584  ? 14.164  66.551 -15.604 1.00 89.38  ? 581  MET A SD  1 
ATOM 4535 C CE  . MET A 1 584  ? 15.781  67.008 -16.269 1.00 89.38  ? 581  MET A CE  1 
ATOM 4536 N N   . LEU A 1 585  ? 12.520  63.725 -11.174 1.00 66.09  ? 582  LEU A N   1 
ATOM 4537 C CA  . LEU A 1 585  ? 12.261  62.382 -10.593 1.00 66.09  ? 582  LEU A CA  1 
ATOM 4538 C C   . LEU A 1 585  ? 12.314  61.310 -11.680 1.00 66.09  ? 582  LEU A C   1 
ATOM 4539 O O   . LEU A 1 585  ? 12.085  61.607 -12.861 1.00 66.09  ? 582  LEU A O   1 
ATOM 4540 C CB  . LEU A 1 585  ? 10.902  62.338 -9.893  1.00 37.76  ? 582  LEU A CB  1 
ATOM 4541 C CG  . LEU A 1 585  ? 10.302  63.676 -9.438  1.00 37.76  ? 582  LEU A CG  1 
ATOM 4542 C CD1 . LEU A 1 585  ? 8.745   63.594 -9.224  1.00 37.76  ? 582  LEU A CD1 1 
ATOM 4543 C CD2 . LEU A 1 585  ? 11.009  64.204 -8.208  1.00 37.76  ? 582  LEU A CD2 1 
ATOM 4544 N N   . GLY A 1 586  ? 12.602  60.071 -11.298 1.00 69.20  ? 583  GLY A N   1 
ATOM 4545 C CA  . GLY A 1 586  ? 12.982  59.062 -12.292 1.00 69.20  ? 583  GLY A CA  1 
ATOM 4546 C C   . GLY A 1 586  ? 11.842  58.389 -13.031 1.00 69.20  ? 583  GLY A C   1 
ATOM 4547 O O   . GLY A 1 586  ? 10.767  58.957 -13.166 1.00 69.20  ? 583  GLY A O   1 
ATOM 4548 N N   . GLY A 1 587  ? 12.105  57.179 -13.527 1.00 88.97  ? 584  GLY A N   1 
ATOM 4549 C CA  . GLY A 1 587  ? 11.080  56.258 -14.044 1.00 88.97  ? 584  GLY A CA  1 
ATOM 4550 C C   . GLY A 1 587  ? 10.140  56.769 -15.123 1.00 88.97  ? 584  GLY A C   1 
ATOM 4551 O O   . GLY A 1 587  ? 10.357  57.836 -15.695 1.00 88.97  ? 584  GLY A O   1 
ATOM 4552 N N   . GLU A 1 588  ? 9.084   56.006 -15.393 1.00 153.29 ? 585  GLU A N   1 
ATOM 4553 C CA  . GLU A 1 588  ? 8.140   56.345 -16.462 1.00 153.29 ? 585  GLU A CA  1 
ATOM 4554 C C   . GLU A 1 588  ? 6.734   56.661 -15.934 1.00 153.29 ? 585  GLU A C   1 
ATOM 4555 O O   . GLU A 1 588  ? 5.760   56.634 -16.686 1.00 153.29 ? 585  GLU A O   1 
ATOM 4556 C CB  . GLU A 1 588  ? 8.099   55.229 -17.528 1.00 98.90  ? 585  GLU A CB  1 
ATOM 4557 C CG  . GLU A 1 588  ? 9.472   54.800 -18.092 1.00 98.90  ? 585  GLU A CG  1 
ATOM 4558 C CD  . GLU A 1 588  ? 10.135  55.844 -19.003 1.00 98.90  ? 585  GLU A CD  1 
ATOM 4559 O OE1 . GLU A 1 588  ? 10.295  57.016 -18.598 1.00 98.90  ? 585  GLU A OE1 1 
ATOM 4560 O OE2 . GLU A 1 588  ? 10.526  55.481 -20.131 1.00 98.90  ? 585  GLU A OE2 1 
ATOM 4561 N N   . ILE A 1 589  ? 6.644   56.985 -14.646 1.00 76.94  ? 586  ILE A N   1 
ATOM 4562 C CA  . ILE A 1 589  ? 5.347   57.181 -13.977 1.00 76.94  ? 586  ILE A CA  1 
ATOM 4563 C C   . ILE A 1 589  ? 5.156   58.611 -13.441 1.00 76.94  ? 586  ILE A C   1 
ATOM 4564 O O   . ILE A 1 589  ? 5.970   59.119 -12.656 1.00 76.94  ? 586  ILE A O   1 
ATOM 4565 C CB  . ILE A 1 589  ? 5.110   56.104 -12.879 1.00 75.42  ? 586  ILE A CB  1 
ATOM 4566 C CG1 . ILE A 1 589  ? 4.758   54.754 -13.520 1.00 75.42  ? 586  ILE A CG1 1 
ATOM 4567 C CG2 . ILE A 1 589  ? 4.007   56.532 -11.919 1.00 75.42  ? 586  ILE A CG2 1 
ATOM 4568 C CD1 . ILE A 1 589  ? 3.397   54.717 -14.273 1.00 75.42  ? 586  ILE A CD1 1 
ATOM 4569 N N   . ILE A 1 590  ? 4.070   59.248 -13.871 1.00 77.59  ? 587  ILE A N   1 
ATOM 4570 C CA  . ILE A 1 590  ? 3.919   60.691 -13.669 1.00 77.59  ? 587  ILE A CA  1 
ATOM 4571 C C   . ILE A 1 590  ? 3.484   61.040 -12.243 1.00 77.59  ? 587  ILE A C   1 
ATOM 4572 O O   . ILE A 1 590  ? 2.822   60.237 -11.592 1.00 77.59  ? 587  ILE A O   1 
ATOM 4573 C CB  . ILE A 1 590  ? 2.987   61.367 -14.750 1.00 50.60  ? 587  ILE A CB  1 
ATOM 4574 C CG1 . ILE A 1 590  ? 1.505   61.339 -14.349 1.00 50.60  ? 587  ILE A CG1 1 
ATOM 4575 C CG2 . ILE A 1 590  ? 3.226   60.775 -16.150 1.00 50.60  ? 587  ILE A CG2 1 
ATOM 4576 C CD1 . ILE A 1 590  ? 0.829   60.016 -14.544 1.00 50.60  ? 587  ILE A CD1 1 
ATOM 4577 N N   . PRO A 1 591  ? 3.862   62.234 -11.755 1.00 51.97  ? 588  PRO A N   1 
ATOM 4578 C CA  . PRO A 1 591  ? 3.426   62.613 -10.428 1.00 51.97  ? 588  PRO A CA  1 
ATOM 4579 C C   . PRO A 1 591  ? 1.891   62.712 -10.351 1.00 51.97  ? 588  PRO A C   1 
ATOM 4580 O O   . PRO A 1 591  ? 1.281   63.556 -11.013 1.00 51.97  ? 588  PRO A O   1 
ATOM 4581 C CB  . PRO A 1 591  ? 4.083   63.995 -10.204 1.00 51.13  ? 588  PRO A CB  1 
ATOM 4582 C CG  . PRO A 1 591  ? 5.054   64.169 -11.241 1.00 51.13  ? 588  PRO A CG  1 
ATOM 4583 C CD  . PRO A 1 591  ? 4.684   63.277 -12.386 1.00 51.13  ? 588  PRO A CD  1 
ATOM 4584 N N   . ARG A 1 592  ? 1.287   61.854 -9.540  1.00 60.28  ? 589  ARG A N   1 
ATOM 4585 C CA  . ARG A 1 592  ? -0.142  61.859 -9.317  1.00 60.28  ? 589  ARG A CA  1 
ATOM 4586 C C   . ARG A 1 592  ? -0.594  62.996 -8.374  1.00 60.28  ? 589  ARG A C   1 
ATOM 4587 O O   . ARG A 1 592  ? -1.742  63.442 -8.434  1.00 60.28  ? 589  ARG A O   1 
ATOM 4588 C CB  . ARG A 1 592  ? -0.552  60.507 -8.742  1.00 114.07 ? 589  ARG A CB  1 
ATOM 4589 C CG  . ARG A 1 592  ? -1.865  59.990 -9.266  1.00 114.07 ? 589  ARG A CG  1 
ATOM 4590 C CD  . ARG A 1 592  ? -3.009  60.308 -8.321  1.00 114.07 ? 589  ARG A CD  1 
ATOM 4591 N NE  . ARG A 1 592  ? -4.296  59.964 -8.924  1.00 114.07 ? 589  ARG A NE  1 
ATOM 4592 C CZ  . ARG A 1 592  ? -5.484  60.284 -8.414  1.00 114.07 ? 589  ARG A CZ  1 
ATOM 4593 N NH1 . ARG A 1 592  ? -5.572  60.966 -7.277  1.00 114.07 ? 589  ARG A NH1 1 
ATOM 4594 N NH2 . ARG A 1 592  ? -6.589  59.921 -9.048  1.00 114.07 ? 589  ARG A NH2 1 
ATOM 4595 N N   . SER A 1 593  ? 0.291   63.470 -7.502  1.00 47.65  ? 590  SER A N   1 
ATOM 4596 C CA  . SER A 1 593  ? -0.116  64.463 -6.497  1.00 47.65  ? 590  SER A CA  1 
ATOM 4597 C C   . SER A 1 593  ? 1.078   65.246 -5.921  1.00 47.65  ? 590  SER A C   1 
ATOM 4598 O O   . SER A 1 593  ? 2.167   64.683 -5.726  1.00 47.65  ? 590  SER A O   1 
ATOM 4599 C CB  . SER A 1 593  ? -0.903  63.786 -5.368  1.00 75.84  ? 590  SER A CB  1 
ATOM 4600 O OG  . SER A 1 593  ? -1.642  64.733 -4.623  1.00 75.84  ? 590  SER A OG  1 
ATOM 4601 N N   . ILE A 1 594  ? 0.855   66.539 -5.672  1.00 72.57  ? 591  ILE A N   1 
ATOM 4602 C CA  . ILE A 1 594  ? 1.883   67.469 -5.188  1.00 72.57  ? 591  ILE A CA  1 
ATOM 4603 C C   . ILE A 1 594  ? 1.287   68.197 -3.982  1.00 72.57  ? 591  ILE A C   1 
ATOM 4604 O O   . ILE A 1 594  ? 0.066   68.424 -3.958  1.00 72.57  ? 591  ILE A O   1 
ATOM 4605 C CB  . ILE A 1 594  ? 2.321   68.478 -6.335  1.00 79.98  ? 591  ILE A CB  1 
ATOM 4606 C CG1 . ILE A 1 594  ? 3.567   69.290 -5.970  1.00 79.98  ? 591  ILE A CG1 1 
ATOM 4607 C CG2 . ILE A 1 594  ? 1.184   69.407 -6.778  1.00 79.98  ? 591  ILE A CG2 1 
ATOM 4608 C CD1 . ILE A 1 594  ? 4.870   68.650 -6.414  1.00 79.98  ? 591  ILE A CD1 1 
ATOM 4609 N N   . LEU A 1 595  ? 2.097   68.540 -2.974  1.00 74.74  ? 592  LEU A N   1 
ATOM 4610 C CA  . LEU A 1 595  ? 1.547   69.288 -1.829  1.00 74.74  ? 592  LEU A CA  1 
ATOM 4611 C C   . LEU A 1 595  ? 2.471   70.301 -1.164  1.00 74.74  ? 592  LEU A C   1 
ATOM 4612 O O   . LEU A 1 595  ? 3.660   70.021 -0.958  1.00 74.74  ? 592  LEU A O   1 
ATOM 4613 C CB  . LEU A 1 595  ? 0.964   68.339 -0.765  1.00 134.22 ? 592  LEU A CB  1 
ATOM 4614 C CG  . LEU A 1 595  ? 0.045   68.904 0.341   1.00 134.22 ? 592  LEU A CG  1 
ATOM 4615 C CD1 . LEU A 1 595  ? -1.160  69.684 -0.200  1.00 134.22 ? 592  LEU A CD1 1 
ATOM 4616 C CD2 . LEU A 1 595  ? -0.435  67.800 1.276   1.00 134.22 ? 592  LEU A CD2 1 
ATOM 4617 N N   . MET A 1 596  ? 1.891   71.470 -0.840  1.00 123.05 ? 593  MET A N   1 
ATOM 4618 C CA  . MET A 1 596  ? 2.489   72.522 0.011   1.00 123.05 ? 593  MET A CA  1 
ATOM 4619 C C   . MET A 1 596  ? 1.750   72.621 1.356   1.00 123.05 ? 593  MET A C   1 
ATOM 4620 O O   . MET A 1 596  ? 0.527   72.791 1.388   1.00 123.05 ? 593  MET A O   1 
ATOM 4621 C CB  . MET A 1 596  ? 2.509   73.896 -0.703  1.00 105.12 ? 593  MET A CB  1 
ATOM 4622 C CG  . MET A 1 596  ? 1.183   74.715 -0.675  1.00 105.12 ? 593  MET A CG  1 
ATOM 4623 S SD  . MET A 1 596  ? 1.251   76.408 -1.358  1.00 105.12 ? 593  MET A SD  1 
ATOM 4624 C CE  . MET A 1 596  ? 1.744   76.084 -3.050  1.00 105.12 ? 593  MET A CE  1 
ATOM 4625 N N   . THR A 1 597  ? 2.498   72.520 2.456   1.00 172.18 ? 594  THR A N   1 
ATOM 4626 C CA  . THR A 1 597  ? 1.911   72.517 3.808   1.00 172.18 ? 594  THR A CA  1 
ATOM 4627 C C   . THR A 1 597  ? 2.636   73.376 4.845   1.00 172.18 ? 594  THR A C   1 
ATOM 4628 O O   . THR A 1 597  ? 3.531   74.153 4.510   1.00 172.18 ? 594  THR A O   1 
ATOM 4629 C CB  . THR A 1 597  ? 1.815   71.089 4.393   1.00 70.90  ? 594  THR A CB  1 
ATOM 4630 O OG1 . THR A 1 597  ? 2.961   70.306 3.981   1.00 70.90  ? 594  THR A OG1 1 
ATOM 4631 C CG2 . THR A 1 597  ? 0.489   70.421 3.984   1.00 70.90  ? 594  THR A CG2 1 
ATOM 4632 N N   . THR A 1 598  ? 2.219   73.220 6.106   1.00 87.95  ? 595  THR A N   1 
ATOM 4633 C CA  . THR A 1 598  ? 2.833   73.873 7.274   1.00 87.95  ? 595  THR A CA  1 
ATOM 4634 C C   . THR A 1 598  ? 2.389   73.140 8.547   1.00 87.95  ? 595  THR A C   1 
ATOM 4635 O O   . THR A 1 598  ? 1.319   72.536 8.579   1.00 87.95  ? 595  THR A O   1 
ATOM 4636 C CB  . THR A 1 598  ? 2.499   75.411 7.349   1.00 174.85 ? 595  THR A CB  1 
ATOM 4637 O OG1 . THR A 1 598  ? 3.317   76.130 6.418   1.00 174.85 ? 595  THR A OG1 1 
ATOM 4638 C CG2 . THR A 1 598  ? 2.745   75.992 8.741   1.00 174.85 ? 595  THR A CG2 1 
ATOM 4639 N N   . PHE A 1 599  ? 3.222   73.187 9.587   1.00 152.50 ? 596  PHE A N   1 
ATOM 4640 C CA  . PHE A 1 599  ? 2.893   72.553 10.866  1.00 152.50 ? 596  PHE A CA  1 
ATOM 4641 C C   . PHE A 1 599  ? 3.243   73.425 12.071  1.00 152.50 ? 596  PHE A C   1 
ATOM 4642 O O   . PHE A 1 599  ? 2.373   73.760 12.881  1.00 152.50 ? 596  PHE A O   1 
ATOM 4643 C CB  . PHE A 1 599  ? 3.555   71.175 10.957  1.00 107.50 ? 596  PHE A CB  1 
ATOM 4644 C CG  . PHE A 1 599  ? 2.970   70.171 10.009  1.00 107.50 ? 596  PHE A CG  1 
ATOM 4645 C CD1 . PHE A 1 599  ? 3.434   70.074 8.703   1.00 107.50 ? 596  PHE A CD1 1 
ATOM 4646 C CD2 . PHE A 1 599  ? 1.938   69.334 10.414  1.00 107.50 ? 596  PHE A CD2 1 
ATOM 4647 C CE1 . PHE A 1 599  ? 2.891   69.159 7.814   1.00 107.50 ? 596  PHE A CE1 1 
ATOM 4648 C CE2 . PHE A 1 599  ? 1.396   68.409 9.530   1.00 107.50 ? 596  PHE A CE2 1 
ATOM 4649 C CZ  . PHE A 1 599  ? 1.873   68.322 8.229   1.00 107.50 ? 596  PHE A CZ  1 
ATOM 4650 N N   . GLU A 1 600  ? 4.517   73.788 12.181  1.00 172.52 ? 597  GLU A N   1 
ATOM 4651 C CA  . GLU A 1 600  ? 4.969   74.707 13.217  1.00 172.52 ? 597  GLU A CA  1 
ATOM 4652 C C   . GLU A 1 600  ? 5.900   75.755 12.606  1.00 172.52 ? 597  GLU A C   1 
ATOM 4653 O O   . GLU A 1 600  ? 5.558   76.940 12.558  1.00 172.52 ? 597  GLU A O   1 
ATOM 4654 C CB  . GLU A 1 600  ? 5.669   73.965 14.368  1.00 144.63 ? 597  GLU A CB  1 
ATOM 4655 C CG  . GLU A 1 600  ? 4.948   72.721 14.899  1.00 144.63 ? 597  GLU A CG  1 
ATOM 4656 C CD  . GLU A 1 600  ? 5.335   71.439 14.155  1.00 144.63 ? 597  GLU A CD  1 
ATOM 4657 O OE1 . GLU A 1 600  ? 6.527   71.272 13.794  1.00 144.63 ? 597  GLU A OE1 1 
ATOM 4658 O OE2 . GLU A 1 600  ? 4.439   70.589 13.944  1.00 144.63 ? 597  GLU A OE2 1 
ATOM 4659 N N   . SER A 1 601  ? 7.060   75.302 12.120  1.00 181.45 ? 598  SER A N   1 
ATOM 4660 C CA  . SER A 1 601  ? 8.120   76.195 11.642  1.00 181.45 ? 598  SER A CA  1 
ATOM 4661 C C   . SER A 1 601  ? 8.830   75.720 10.367  1.00 181.45 ? 598  SER A C   1 
ATOM 4662 O O   . SER A 1 601  ? 10.059  75.787 10.275  1.00 181.45 ? 598  SER A O   1 
ATOM 4663 C CB  . SER A 1 601  ? 9.153   76.430 12.751  1.00 135.92 ? 598  SER A CB  1 
ATOM 4664 O OG  . SER A 1 601  ? 8.605   77.193 13.809  1.00 135.92 ? 598  SER A OG  1 
ATOM 4665 N N   . SER A 1 602  ? 8.057   75.231 9.399   1.00 199.83 ? 599  SER A N   1 
ATOM 4666 C CA  . SER A 1 602  ? 8.570   74.923 8.057   1.00 199.83 ? 599  SER A CA  1 
ATOM 4667 C C   . SER A 1 602  ? 7.416   74.765 7.074   1.00 199.83 ? 599  SER A C   1 
ATOM 4668 O O   . SER A 1 602  ? 6.347   74.254 7.425   1.00 199.83 ? 599  SER A O   1 
ATOM 4669 C CB  . SER A 1 602  ? 9.471   73.670 8.048   1.00 123.22 ? 599  SER A CB  1 
ATOM 4670 O OG  . SER A 1 602  ? 10.207  73.555 6.833   1.00 123.22 ? 599  SER A OG  1 
ATOM 4671 N N   . HIS A 1 603  ? 7.637   75.228 5.849   1.00 199.82 ? 600  HIS A N   1 
ATOM 4672 C CA  . HIS A 1 603  ? 6.675   75.053 4.771   1.00 199.82 ? 600  HIS A CA  1 
ATOM 4673 C C   . HIS A 1 603  ? 7.113   73.847 3.937   1.00 199.82 ? 600  HIS A C   1 
ATOM 4674 O O   . HIS A 1 603  ? 8.246   73.796 3.452   1.00 199.82 ? 600  HIS A O   1 
ATOM 4675 C CB  . HIS A 1 603  ? 6.541   76.343 3.947   1.00 85.80  ? 600  HIS A CB  1 
ATOM 4676 C CG  . HIS A 1 603  ? 6.114   77.526 4.764   1.00 85.80  ? 600  HIS A CG  1 
ATOM 4677 N ND1 . HIS A 1 603  ? 4.825   78.013 4.756   1.00 85.80  ? 600  HIS A ND1 1 
ATOM 4678 C CD2 . HIS A 1 603  ? 6.800   78.296 5.647   1.00 85.80  ? 600  HIS A CD2 1 
ATOM 4679 C CE1 . HIS A 1 603  ? 4.737   79.042 5.585   1.00 85.80  ? 600  HIS A CE1 1 
ATOM 4680 N NE2 . HIS A 1 603  ? 5.923   79.237 6.136   1.00 85.80  ? 600  HIS A NE2 1 
ATOM 4681 N N   . TYR A 1 604  ? 6.213   72.871 3.808   1.00 98.88  ? 601  TYR A N   1 
ATOM 4682 C CA  . TYR A 1 604  ? 6.540   71.551 3.255   1.00 98.88  ? 601  TYR A CA  1 
ATOM 4683 C C   . TYR A 1 604  ? 6.033   71.279 1.814   1.00 98.88  ? 601  TYR A C   1 
ATOM 4684 O O   . TYR A 1 604  ? 4.917   71.679 1.436   1.00 98.88  ? 601  TYR A O   1 
ATOM 4685 C CB  . TYR A 1 604  ? 5.997   70.452 4.174   1.00 117.74 ? 601  TYR A CB  1 
ATOM 4686 C CG  . TYR A 1 604  ? 6.467   70.437 5.623   1.00 117.74 ? 601  TYR A CG  1 
ATOM 4687 C CD1 . TYR A 1 604  ? 5.770   71.132 6.615   1.00 117.74 ? 601  TYR A CD1 1 
ATOM 4688 C CD2 . TYR A 1 604  ? 7.564   69.667 6.014   1.00 117.74 ? 601  TYR A CD2 1 
ATOM 4689 C CE1 . TYR A 1 604  ? 6.177   71.085 7.955   1.00 117.74 ? 601  TYR A CE1 1 
ATOM 4690 C CE2 . TYR A 1 604  ? 7.975   69.615 7.350   1.00 117.74 ? 601  TYR A CE2 1 
ATOM 4691 C CZ  . TYR A 1 604  ? 7.275   70.320 8.312   1.00 117.74 ? 601  TYR A CZ  1 
ATOM 4692 O OH  . TYR A 1 604  ? 7.681   70.264 9.626   1.00 117.74 ? 601  TYR A OH  1 
ATOM 4693 N N   . LEU A 1 605  ? 6.864   70.565 1.045   1.00 129.85 ? 602  LEU A N   1 
ATOM 4694 C CA  . LEU A 1 605  ? 6.523   70.084 -0.302  1.00 129.85 ? 602  LEU A CA  1 
ATOM 4695 C C   . LEU A 1 605  ? 6.737   68.572 -0.493  1.00 129.85 ? 602  LEU A C   1 
ATOM 4696 O O   . LEU A 1 605  ? 7.864   68.065 -0.409  1.00 129.85 ? 602  LEU A O   1 
ATOM 4697 C CB  . LEU A 1 605  ? 7.315   70.845 -1.368  1.00 108.57 ? 602  LEU A CB  1 
ATOM 4698 C CG  . LEU A 1 605  ? 7.579   70.094 -2.683  1.00 108.57 ? 602  LEU A CG  1 
ATOM 4699 C CD1 . LEU A 1 605  ? 6.584   70.498 -3.762  1.00 108.57 ? 602  LEU A CD1 1 
ATOM 4700 C CD2 . LEU A 1 605  ? 9.016   70.299 -3.150  1.00 108.57 ? 602  LEU A CD2 1 
ATOM 4701 N N   . LEU A 1 606  ? 5.653   67.859 -0.784  1.00 104.83 ? 603  LEU A N   1 
ATOM 4702 C CA  . LEU A 1 606  ? 5.742   66.428 -1.056  1.00 104.83 ? 603  LEU A CA  1 
ATOM 4703 C C   . LEU A 1 606  ? 5.119   66.120 -2.412  1.00 104.83 ? 603  LEU A C   1 
ATOM 4704 O O   . LEU A 1 606  ? 4.308   66.895 -2.939  1.00 104.83 ? 603  LEU A O   1 
ATOM 4705 C CB  . LEU A 1 606  ? 5.053   65.607 0.039   1.00 98.84  ? 603  LEU A CB  1 
ATOM 4706 C CG  . LEU A 1 606  ? 5.072   66.031 1.513   1.00 98.84  ? 603  LEU A CG  1 
ATOM 4707 C CD1 . LEU A 1 606  ? 4.004   67.069 1.841   1.00 98.84  ? 603  LEU A CD1 1 
ATOM 4708 C CD2 . LEU A 1 606  ? 4.862   64.812 2.366   1.00 98.84  ? 603  LEU A CD2 1 
ATOM 4709 N N   . CYS A 1 607  ? 5.498   64.979 -2.971  1.00 39.71  ? 604  CYS A N   1 
ATOM 4710 C CA  . CYS A 1 607  ? 5.034   64.611 -4.292  1.00 39.71  ? 604  CYS A CA  1 
ATOM 4711 C C   . CYS A 1 607  ? 4.811   63.095 -4.493  1.00 39.71  ? 604  CYS A C   1 
ATOM 4712 O O   . CYS A 1 607  ? 5.759   62.313 -4.562  1.00 39.71  ? 604  CYS A O   1 
ATOM 4713 C CB  . CYS A 1 607  ? 5.983   65.169 -5.352  1.00 69.83  ? 604  CYS A CB  1 
ATOM 4714 S SG  . CYS A 1 607  ? 5.539   64.691 -7.016  1.00 69.83  ? 604  CYS A SG  1 
ATOM 4715 N N   . ALA A 1 608  ? 3.545   62.697 -4.600  1.00 59.44  ? 605  ALA A N   1 
ATOM 4716 C CA  . ALA A 1 608  ? 3.184   61.291 -4.787  1.00 59.44  ? 605  ALA A CA  1 
ATOM 4717 C C   . ALA A 1 608  ? 3.222   60.890 -6.245  1.00 59.44  ? 605  ALA A C   1 
ATOM 4718 O O   . ALA A 1 608  ? 2.743   61.631 -7.112  1.00 59.44  ? 605  ALA A O   1 
ATOM 4719 C CB  . ALA A 1 608  ? 1.804   61.050 -4.243  1.00 48.54  ? 605  ALA A CB  1 
ATOM 4720 N N   . LEU A 1 609  ? 3.769   59.706 -6.500  1.00 55.69  ? 606  LEU A N   1 
ATOM 4721 C CA  . LEU A 1 609  ? 3.735   59.094 -7.834  1.00 55.69  ? 606  LEU A CA  1 
ATOM 4722 C C   . LEU A 1 609  ? 2.796   57.893 -7.932  1.00 55.69  ? 606  LEU A C   1 
ATOM 4723 O O   . LEU A 1 609  ? 2.328   57.340 -6.930  1.00 55.69  ? 606  LEU A O   1 
ATOM 4724 C CB  . LEU A 1 609  ? 5.131   58.657 -8.276  1.00 52.24  ? 606  LEU A CB  1 
ATOM 4725 C CG  . LEU A 1 609  ? 6.248   59.680 -8.144  1.00 52.24  ? 606  LEU A CG  1 
ATOM 4726 C CD1 . LEU A 1 609  ? 7.518   59.057 -8.643  1.00 52.24  ? 606  LEU A CD1 1 
ATOM 4727 C CD2 . LEU A 1 609  ? 5.917   60.941 -8.911  1.00 52.24  ? 606  LEU A CD2 1 
ATOM 4728 N N   . GLY A 1 610  ? 2.563   57.456 -9.153  1.00 43.11  ? 607  GLY A N   1 
ATOM 4729 C CA  . GLY A 1 610  ? 1.578   56.427 -9.401  1.00 43.11  ? 607  GLY A CA  1 
ATOM 4730 C C   . GLY A 1 610  ? 1.955   55.025 -8.975  1.00 43.11  ? 607  GLY A C   1 
ATOM 4731 O O   . GLY A 1 610  ? 1.116   54.122 -9.046  1.00 43.11  ? 607  GLY A O   1 
ATOM 4732 N N   . ASP A 1 611  ? 3.205   54.838 -8.554  1.00 91.64  ? 608  ASP A N   1 
ATOM 4733 C CA  . ASP A 1 611  ? 3.710   53.524 -8.137  1.00 91.64  ? 608  ASP A CA  1 
ATOM 4734 C C   . ASP A 1 611  ? 3.536   53.290 -6.632  1.00 91.64  ? 608  ASP A C   1 
ATOM 4735 O O   . ASP A 1 611  ? 3.879   52.232 -6.101  1.00 91.64  ? 608  ASP A O   1 
ATOM 4736 C CB  . ASP A 1 611  ? 5.181   53.393 -8.525  1.00 89.40  ? 608  ASP A CB  1 
ATOM 4737 C CG  . ASP A 1 611  ? 6.026   54.522 -7.980  1.00 89.40  ? 608  ASP A CG  1 
ATOM 4738 O OD1 . ASP A 1 611  ? 7.256   54.487 -8.163  1.00 89.40  ? 608  ASP A OD1 1 
ATOM 4739 O OD2 . ASP A 1 611  ? 5.468   55.451 -7.370  1.00 89.40  ? 608  ASP A OD2 1 
ATOM 4740 N N   . GLY A 1 612  ? 3.000   54.293 -5.951  1.00 78.82  ? 609  GLY A N   1 
ATOM 4741 C CA  . GLY A 1 612  ? 2.784   54.223 -4.514  1.00 78.82  ? 609  GLY A CA  1 
ATOM 4742 C C   . GLY A 1 612  ? 3.875   54.925 -3.734  1.00 78.82  ? 609  GLY A C   1 
ATOM 4743 O O   . GLY A 1 612  ? 3.726   55.225 -2.542  1.00 78.82  ? 609  GLY A O   1 
ATOM 4744 N N   . ALA A 1 613  ? 4.975   55.194 -4.416  1.00 53.19  ? 610  ALA A N   1 
ATOM 4745 C CA  . ALA A 1 613  ? 6.128   55.801 -3.782  1.00 53.19  ? 610  ALA A CA  1 
ATOM 4746 C C   . ALA A 1 613  ? 5.929   57.295 -3.646  1.00 53.19  ? 610  ALA A C   1 
ATOM 4747 O O   . ALA A 1 613  ? 5.116   57.878 -4.350  1.00 53.19  ? 610  ALA A O   1 
ATOM 4748 C CB  . ALA A 1 613  ? 7.392   55.486 -4.585  1.00 93.90  ? 610  ALA A CB  1 
ATOM 4749 N N   . LEU A 1 614  ? 6.676   57.902 -2.734  1.00 80.25  ? 611  LEU A N   1 
ATOM 4750 C CA  . LEU A 1 614  ? 6.604   59.335 -2.514  1.00 80.25  ? 611  LEU A CA  1 
ATOM 4751 C C   . LEU A 1 614  ? 7.982   59.911 -2.249  1.00 80.25  ? 611  LEU A C   1 
ATOM 4752 O O   . LEU A 1 614  ? 8.755   59.377 -1.436  1.00 80.25  ? 611  LEU A O   1 
ATOM 4753 C CB  . LEU A 1 614  ? 5.683   59.650 -1.335  1.00 52.55  ? 611  LEU A CB  1 
ATOM 4754 C CG  . LEU A 1 614  ? 5.416   61.124 -1.016  1.00 52.55  ? 611  LEU A CG  1 
ATOM 4755 C CD1 . LEU A 1 614  ? 4.096   61.286 -0.277  1.00 52.55  ? 611  LEU A CD1 1 
ATOM 4756 C CD2 . LEU A 1 614  ? 6.547   61.732 -0.201  1.00 52.55  ? 611  LEU A CD2 1 
ATOM 4757 N N   . PHE A 1 615  ? 8.269   61.010 -2.939  1.00 77.53  ? 612  PHE A N   1 
ATOM 4758 C CA  . PHE A 1 615  ? 9.466   61.803 -2.707  1.00 77.53  ? 612  PHE A CA  1 
ATOM 4759 C C   . PHE A 1 615  ? 9.067   62.952 -1.799  1.00 77.53  ? 612  PHE A C   1 
ATOM 4760 O O   . PHE A 1 615  ? 7.946   63.473 -1.907  1.00 77.53  ? 612  PHE A O   1 
ATOM 4761 C CB  . PHE A 1 615  ? 10.034  62.336 -4.028  1.00 75.03  ? 612  PHE A CB  1 
ATOM 4762 C CG  . PHE A 1 615  ? 10.552  61.263 -4.955  1.00 75.03  ? 612  PHE A CG  1 
ATOM 4763 C CD1 . PHE A 1 615  ? 9.680   60.517 -5.753  1.00 75.03  ? 612  PHE A CD1 1 
ATOM 4764 C CD2 . PHE A 1 615  ? 11.916  61.013 -5.054  1.00 75.03  ? 612  PHE A CD2 1 
ATOM 4765 C CE1 . PHE A 1 615  ? 10.163  59.509 -6.629  1.00 75.03  ? 612  PHE A CE1 1 
ATOM 4766 C CE2 . PHE A 1 615  ? 12.406  60.019 -5.928  1.00 75.03  ? 612  PHE A CE2 1 
ATOM 4767 C CZ  . PHE A 1 615  ? 11.520  59.260 -6.714  1.00 75.03  ? 612  PHE A CZ  1 
ATOM 4768 N N   . TYR A 1 616  ? 9.971   63.344 -0.903  1.00 137.07 ? 613  TYR A N   1 
ATOM 4769 C CA  . TYR A 1 616  ? 9.654   64.379 0.083   1.00 137.07 ? 613  TYR A CA  1 
ATOM 4770 C C   . TYR A 1 616  ? 10.702  65.463 0.247   1.00 137.07 ? 613  TYR A C   1 
ATOM 4771 O O   . TYR A 1 616  ? 11.893  65.176 0.305   1.00 137.07 ? 613  TYR A O   1 
ATOM 4772 C CB  . TYR A 1 616  ? 9.289   63.781 1.445   1.00 143.51 ? 613  TYR A CB  1 
ATOM 4773 C CG  . TYR A 1 616  ? 9.992   62.497 1.858   1.00 143.51 ? 613  TYR A CG  1 
ATOM 4774 C CD1 . TYR A 1 616  ? 9.781   61.299 1.165   1.00 143.51 ? 613  TYR A CD1 1 
ATOM 4775 C CD2 . TYR A 1 616  ? 10.808  62.466 2.992   1.00 143.51 ? 613  TYR A CD2 1 
ATOM 4776 C CE1 . TYR A 1 616  ? 10.393  60.121 1.564   1.00 143.51 ? 613  TYR A CE1 1 
ATOM 4777 C CE2 . TYR A 1 616  ? 11.423  61.292 3.403   1.00 143.51 ? 613  TYR A CE2 1 
ATOM 4778 C CZ  . TYR A 1 616  ? 11.209  60.125 2.685   1.00 143.51 ? 613  TYR A CZ  1 
ATOM 4779 O OH  . TYR A 1 616  ? 11.817  58.960 3.085   1.00 143.51 ? 613  TYR A OH  1 
ATOM 4780 N N   . PHE A 1 617  ? 10.221  66.704 0.333   1.00 94.98  ? 614  PHE A N   1 
ATOM 4781 C CA  . PHE A 1 617  ? 11.049  67.909 0.314   1.00 94.98  ? 614  PHE A CA  1 
ATOM 4782 C C   . PHE A 1 617  ? 10.384  69.047 1.126   1.00 94.98  ? 614  PHE A C   1 
ATOM 4783 O O   . PHE A 1 617  ? 9.208   68.974 1.486   1.00 94.98  ? 614  PHE A O   1 
ATOM 4784 C CB  . PHE A 1 617  ? 11.265  68.395 -1.140  1.00 91.31  ? 614  PHE A CB  1 
ATOM 4785 C CG  . PHE A 1 617  ? 12.064  67.440 -2.024  1.00 91.31  ? 614  PHE A CG  1 
ATOM 4786 C CD1 . PHE A 1 617  ? 11.415  66.532 -2.876  1.00 91.31  ? 614  PHE A CD1 1 
ATOM 4787 C CD2 . PHE A 1 617  ? 13.462  67.473 -2.035  1.00 91.31  ? 614  PHE A CD2 1 
ATOM 4788 C CE1 . PHE A 1 617  ? 12.148  65.647 -3.700  1.00 91.31  ? 614  PHE A CE1 1 
ATOM 4789 C CE2 . PHE A 1 617  ? 14.201  66.604 -2.864  1.00 91.31  ? 614  PHE A CE2 1 
ATOM 4790 C CZ  . PHE A 1 617  ? 13.543  65.689 -3.693  1.00 91.31  ? 614  PHE A CZ  1 
ATOM 4791 N N   . GLY A 1 618  ? 11.146  70.106 1.398   1.00 110.47 ? 615  GLY A N   1 
ATOM 4792 C CA  . GLY A 1 618  ? 10.636  71.319 2.045   1.00 110.47 ? 615  GLY A CA  1 
ATOM 4793 C C   . GLY A 1 618  ? 10.858  72.556 1.182   1.00 110.47 ? 615  GLY A C   1 
ATOM 4794 O O   . GLY A 1 618  ? 11.874  72.691 0.494   1.00 110.47 ? 615  GLY A O   1 
ATOM 4795 N N   . LEU A 1 619  ? 9.899   73.472 1.235   1.00 201.00 ? 616  LEU A N   1 
ATOM 4796 C CA  . LEU A 1 619  ? 9.932   74.683 0.424   1.00 201.00 ? 616  LEU A CA  1 
ATOM 4797 C C   . LEU A 1 619  ? 10.258  75.915 1.277   1.00 201.00 ? 616  LEU A C   1 
ATOM 4798 O O   . LEU A 1 619  ? 10.624  75.792 2.450   1.00 201.00 ? 616  LEU A O   1 
ATOM 4799 C CB  . LEU A 1 619  ? 8.592   74.845 -0.313  1.00 172.08 ? 616  LEU A CB  1 
ATOM 4800 C CG  . LEU A 1 619  ? 8.390   75.849 -1.458  1.00 172.08 ? 616  LEU A CG  1 
ATOM 4801 C CD1 . LEU A 1 619  ? 9.497   75.752 -2.497  1.00 172.08 ? 616  LEU A CD1 1 
ATOM 4802 C CD2 . LEU A 1 619  ? 7.013   75.660 -2.102  1.00 172.08 ? 616  LEU A CD2 1 
ATOM 4803 N N   . ASN A 1 620  ? 10.135  77.095 0.674   1.00 117.14 ? 617  ASN A N   1 
ATOM 4804 C CA  . ASN A 1 620  ? 10.455  78.353 1.324   1.00 117.14 ? 617  ASN A CA  1 
ATOM 4805 C C   . ASN A 1 620  ? 9.469   79.422 0.910   1.00 117.14 ? 617  ASN A C   1 
ATOM 4806 O O   . ASN A 1 620  ? 9.451   79.817 -0.258  1.00 117.14 ? 617  ASN A O   1 
ATOM 4807 C CB  . ASN A 1 620  ? 11.851  78.794 0.916   1.00 85.28  ? 617  ASN A CB  1 
ATOM 4808 C CG  . ASN A 1 620  ? 12.901  77.766 1.254   1.00 85.28  ? 617  ASN A CG  1 
ATOM 4809 O OD1 . ASN A 1 620  ? 13.423  77.767 2.367   1.00 85.28  ? 617  ASN A OD1 1 
ATOM 4810 N ND2 . ASN A 1 620  ? 13.215  76.872 0.302   1.00 85.28  ? 617  ASN A ND2 1 
ATOM 4811 N N   . ILE A 1 621  ? 8.648   79.886 1.856   1.00 196.78 ? 618  ILE A N   1 
ATOM 4812 C CA  . ILE A 1 621  ? 7.725   81.005 1.607   1.00 196.78 ? 618  ILE A CA  1 
ATOM 4813 C C   . ILE A 1 621  ? 8.470   82.237 1.102   1.00 196.78 ? 618  ILE A C   1 
ATOM 4814 O O   . ILE A 1 621  ? 7.944   83.003 0.294   1.00 196.78 ? 618  ILE A O   1 
ATOM 4815 C CB  . ILE A 1 621  ? 6.875   81.401 2.853   1.00 148.26 ? 618  ILE A CB  1 
ATOM 4816 C CG1 . ILE A 1 621  ? 7.686   81.262 4.155   1.00 148.26 ? 618  ILE A CG1 1 
ATOM 4817 C CG2 . ILE A 1 621  ? 5.569   80.614 2.873   1.00 148.26 ? 618  ILE A CG2 1 
ATOM 4818 C CD1 . ILE A 1 621  ? 7.201   82.144 5.308   1.00 148.26 ? 618  ILE A CD1 1 
ATOM 4819 N N   . GLU A 1 622  ? 9.696   82.420 1.582   1.00 180.91 ? 619  GLU A N   1 
ATOM 4820 C CA  . GLU A 1 622  ? 10.515  83.557 1.179   1.00 180.91 ? 619  GLU A CA  1 
ATOM 4821 C C   . GLU A 1 622  ? 11.231  83.276 -0.137  1.00 180.91 ? 619  GLU A C   1 
ATOM 4822 O O   . GLU A 1 622  ? 11.129  84.050 -1.089  1.00 180.91 ? 619  GLU A O   1 
ATOM 4823 C CB  . GLU A 1 622  ? 11.532  83.898 2.269   1.00 167.69 ? 619  GLU A CB  1 
ATOM 4824 C CG  . GLU A 1 622  ? 10.909  84.252 3.610   1.00 167.69 ? 619  GLU A CG  1 
ATOM 4825 C CD  . GLU A 1 622  ? 9.987   85.452 3.526   1.00 167.69 ? 619  GLU A CD  1 
ATOM 4826 O OE1 . GLU A 1 622  ? 9.834   86.010 2.419   1.00 167.69 ? 619  GLU A OE1 1 
ATOM 4827 O OE2 . GLU A 1 622  ? 9.415   85.838 4.567   1.00 167.69 ? 619  GLU A OE2 1 
ATOM 4828 N N   . THR A 1 623  ? 11.950  82.158 -0.184  1.00 187.44 ? 620  THR A N   1 
ATOM 4829 C CA  . THR A 1 623  ? 12.680  81.760 -1.382  1.00 187.44 ? 620  THR A CA  1 
ATOM 4830 C C   . THR A 1 623  ? 12.071  80.501 -1.992  1.00 187.44 ? 620  THR A C   1 
ATOM 4831 O O   . THR A 1 623  ? 11.388  80.562 -3.014  1.00 187.44 ? 620  THR A O   1 
ATOM 4832 C CB  . THR A 1 623  ? 14.168  81.507 -1.080  1.00 81.92  ? 620  THR A CB  1 
ATOM 4833 O OG1 . THR A 1 623  ? 14.290  80.453 -0.117  1.00 81.92  ? 620  THR A OG1 1 
ATOM 4834 C CG2 . THR A 1 623  ? 14.822  82.767 -0.532  1.00 81.92  ? 620  THR A CG2 1 
ATOM 4835 N N   . GLY A 1 624  ? 12.325  79.361 -1.358  1.00 198.92 ? 621  GLY A N   1 
ATOM 4836 C CA  . GLY A 1 624  ? 11.807  78.092 -1.834  1.00 198.92 ? 621  GLY A CA  1 
ATOM 4837 C C   . GLY A 1 624  ? 12.649  77.505 -2.949  1.00 198.92 ? 621  GLY A C   1 
ATOM 4838 O O   . GLY A 1 624  ? 12.704  78.051 -4.051  1.00 198.92 ? 621  GLY A O   1 
ATOM 4839 N N   . LEU A 1 625  ? 13.308  76.387 -2.662  1.00 155.39 ? 622  LEU A N   1 
ATOM 4840 C CA  . LEU A 1 625  ? 14.154  75.722 -3.646  1.00 155.39 ? 622  LEU A CA  1 
ATOM 4841 C C   . LEU A 1 625  ? 14.176  74.213 -3.426  1.00 155.39 ? 622  LEU A C   1 
ATOM 4842 O O   . LEU A 1 625  ? 13.131  73.562 -3.417  1.00 155.39 ? 622  LEU A O   1 
ATOM 4843 C CB  . LEU A 1 625  ? 15.577  76.282 -3.595  1.00 83.09  ? 622  LEU A CB  1 
ATOM 4844 C CG  . LEU A 1 625  ? 15.727  77.778 -3.879  1.00 83.09  ? 622  LEU A CG  1 
ATOM 4845 C CD1 . LEU A 1 625  ? 14.875  78.596 -2.921  1.00 83.09  ? 622  LEU A CD1 1 
ATOM 4846 C CD2 . LEU A 1 625  ? 17.187  78.197 -3.796  1.00 83.09  ? 622  LEU A CD2 1 
ATOM 4847 N N   . LEU A 1 626  ? 15.373  73.664 -3.250  1.00 112.49 ? 623  LEU A N   1 
ATOM 4848 C CA  . LEU A 1 626  ? 15.533  72.231 -3.032  1.00 112.49 ? 623  LEU A CA  1 
ATOM 4849 C C   . LEU A 1 626  ? 15.704  71.913 -1.550  1.00 112.49 ? 623  LEU A C   1 
ATOM 4850 O O   . LEU A 1 626  ? 16.078  72.778 -0.758  1.00 112.49 ? 623  LEU A O   1 
ATOM 4851 C CB  . LEU A 1 626  ? 16.729  71.699 -3.824  1.00 150.60 ? 623  LEU A CB  1 
ATOM 4852 C CG  . LEU A 1 626  ? 17.018  70.202 -3.691  1.00 150.60 ? 623  LEU A CG  1 
ATOM 4853 C CD1 . LEU A 1 626  ? 18.176  69.796 -4.590  1.00 150.60 ? 623  LEU A CD1 1 
ATOM 4854 C CD2 . LEU A 1 626  ? 17.305  69.837 -2.243  1.00 150.60 ? 623  LEU A CD2 1 
ATOM 4855 N N   . SER A 1 627  ? 15.427  70.666 -1.182  1.00 162.90 ? 624  SER A N   1 
ATOM 4856 C CA  . SER A 1 627  ? 15.549  70.230 0.204   1.00 162.90 ? 624  SER A CA  1 
ATOM 4857 C C   . SER A 1 627  ? 16.058  68.795 0.287   1.00 162.90 ? 624  SER A C   1 
ATOM 4858 O O   . SER A 1 627  ? 17.078  68.452 -0.311  1.00 162.90 ? 624  SER A O   1 
ATOM 4859 C CB  . SER A 1 627  ? 14.205  70.355 0.925   1.00 74.55  ? 624  SER A CB  1 
ATOM 4860 O OG  . SER A 1 627  ? 13.238  69.491 0.356   1.00 74.55  ? 624  SER A OG  1 
ATOM 4861 N N   . ASP A 1 628  ? 15.339  67.960 1.030   1.00 118.38 ? 625  ASP A N   1 
ATOM 4862 C CA  . ASP A 1 628  ? 15.716  66.561 1.192   1.00 118.38 ? 625  ASP A CA  1 
ATOM 4863 C C   . ASP A 1 628  ? 15.146  65.704 0.067   1.00 118.38 ? 625  ASP A C   1 
ATOM 4864 O O   . ASP A 1 628  ? 14.100  66.022 -0.500  1.00 118.38 ? 625  ASP A O   1 
ATOM 4865 C CB  . ASP A 1 628  ? 15.243  66.032 2.548   1.00 172.53 ? 625  ASP A CB  1 
ATOM 4866 C CG  . ASP A 1 628  ? 15.840  66.797 3.712   1.00 172.53 ? 625  ASP A CG  1 
ATOM 4867 O OD1 . ASP A 1 628  ? 16.619  67.743 3.467   1.00 172.53 ? 625  ASP A OD1 1 
ATOM 4868 O OD2 . ASP A 1 628  ? 15.531  66.454 4.872   1.00 172.53 ? 625  ASP A OD2 1 
ATOM 4869 N N   . ARG A 1 629  ? 15.839  64.615 -0.251  1.00 143.08 ? 626  ARG A N   1 
ATOM 4870 C CA  . ARG A 1 629  ? 15.402  63.712 -1.309  1.00 143.08 ? 626  ARG A CA  1 
ATOM 4871 C C   . ARG A 1 629  ? 15.394  62.247 -0.888  1.00 143.08 ? 626  ARG A C   1 
ATOM 4872 O O   . ARG A 1 629  ? 16.423  61.573 -0.934  1.00 143.08 ? 626  ARG A O   1 
ATOM 4873 C CB  . ARG A 1 629  ? 16.274  63.890 -2.554  1.00 125.13 ? 626  ARG A CB  1 
ATOM 4874 C CG  . ARG A 1 629  ? 16.097  65.230 -3.250  1.00 125.13 ? 626  ARG A CG  1 
ATOM 4875 C CD  . ARG A 1 629  ? 17.108  65.409 -4.370  1.00 125.13 ? 626  ARG A CD  1 
ATOM 4876 N NE  . ARG A 1 629  ? 18.479  65.450 -3.869  1.00 125.13 ? 626  ARG A NE  1 
ATOM 4877 C CZ  . ARG A 1 629  ? 19.552  65.599 -4.640  1.00 125.13 ? 626  ARG A CZ  1 
ATOM 4878 N NH1 . ARG A 1 629  ? 19.415  65.722 -5.953  1.00 125.13 ? 626  ARG A NH1 1 
ATOM 4879 N NH2 . ARG A 1 629  ? 20.761  65.624 -4.098  1.00 125.13 ? 626  ARG A NH2 1 
ATOM 4880 N N   . LYS A 1 630  ? 14.226  61.756 -0.484  1.00 70.42  ? 627  LYS A N   1 
ATOM 4881 C CA  . LYS A 1 630  ? 14.091  60.349 -0.088  1.00 70.42  ? 627  LYS A CA  1 
ATOM 4882 C C   . LYS A 1 630  ? 12.839  59.712 -0.736  1.00 70.42  ? 627  LYS A C   1 
ATOM 4883 O O   . LYS A 1 630  ? 12.042  60.416 -1.343  1.00 70.42  ? 627  LYS A O   1 
ATOM 4884 C CB  . LYS A 1 630  ? 14.133  60.176 1.446   1.00 82.73  ? 627  LYS A CB  1 
ATOM 4885 C CG  . LYS A 1 630  ? 15.275  60.911 2.191   1.00 82.73  ? 627  LYS A CG  1 
ATOM 4886 C CD  . LYS A 1 630  ? 15.614  60.273 3.539   1.00 82.73  ? 627  LYS A CD  1 
ATOM 4887 C CE  . LYS A 1 630  ? 16.428  58.976 3.369   1.00 82.73  ? 627  LYS A CE  1 
ATOM 4888 N NZ  . LYS A 1 630  ? 17.889  59.211 3.123   1.00 82.73  ? 627  LYS A NZ  1 
ATOM 4889 N N   . LYS A 1 631  ? 12.681  58.393 -0.625  1.00 68.89  ? 628  LYS A N   1 
ATOM 4890 C CA  . LYS A 1 631  ? 11.704  57.677 -1.456  1.00 68.89  ? 628  LYS A CA  1 
ATOM 4891 C C   . LYS A 1 631  ? 11.046  56.476 -0.753  1.00 68.89  ? 628  LYS A C   1 
ATOM 4892 O O   . LYS A 1 631  ? 11.716  55.505 -0.406  1.00 68.89  ? 628  LYS A O   1 
ATOM 4893 C CB  . LYS A 1 631  ? 12.348  57.250 -2.795  1.00 63.54  ? 628  LYS A CB  1 
ATOM 4894 C CG  . LYS A 1 631  ? 11.375  56.694 -3.853  1.00 63.54  ? 628  LYS A CG  1 
ATOM 4895 C CD  . LYS A 1 631  ? 12.116  55.935 -4.939  1.00 63.54  ? 628  LYS A CD  1 
ATOM 4896 C CE  . LYS A 1 631  ? 11.150  55.088 -5.771  1.00 63.54  ? 628  LYS A CE  1 
ATOM 4897 N NZ  . LYS A 1 631  ? 11.831  54.382 -6.902  1.00 63.54  ? 628  LYS A NZ  1 
ATOM 4898 N N   . VAL A 1 632  ? 9.726   56.540 -0.577  1.00 93.66  ? 629  VAL A N   1 
ATOM 4899 C CA  . VAL A 1 632  ? 9.014   55.515 0.196   1.00 93.66  ? 629  VAL A CA  1 
ATOM 4900 C C   . VAL A 1 632  ? 8.273   54.480 -0.659  1.00 93.66  ? 629  VAL A C   1 
ATOM 4901 O O   . VAL A 1 632  ? 8.688   54.171 -1.776  1.00 93.66  ? 629  VAL A O   1 
ATOM 4902 C CB  . VAL A 1 632  ? 8.086   56.146 1.235   1.00 59.90  ? 629  VAL A CB  1 
ATOM 4903 C CG1 . VAL A 1 632  ? 8.775   56.216 2.568   1.00 59.90  ? 629  VAL A CG1 1 
ATOM 4904 C CG2 . VAL A 1 632  ? 7.709   57.516 0.793   1.00 59.90  ? 629  VAL A CG2 1 
ATOM 4905 N N   . THR A 1 633  ? 7.201   53.911 -0.128  1.00 77.64  ? 630  THR A N   1 
ATOM 4906 C CA  . THR A 1 633  ? 6.492   52.889 -0.871  1.00 77.64  ? 630  THR A CA  1 
ATOM 4907 C C   . THR A 1 633  ? 5.014   52.742 -0.475  1.00 77.64  ? 630  THR A C   1 
ATOM 4908 O O   . THR A 1 633  ? 4.363   51.776 -0.894  1.00 77.64  ? 630  THR A O   1 
ATOM 4909 C CB  . THR A 1 633  ? 7.231   51.528 -0.769  1.00 81.73  ? 630  THR A CB  1 
ATOM 4910 O OG1 . THR A 1 633  ? 6.575   50.545 -1.589  1.00 81.73  ? 630  THR A OG1 1 
ATOM 4911 C CG2 . THR A 1 633  ? 7.300   51.040 0.703   1.00 81.73  ? 630  THR A CG2 1 
ATOM 4912 N N   . LEU A 1 634  ? 4.499   53.692 0.318   1.00 59.43  ? 631  LEU A N   1 
ATOM 4913 C CA  . LEU A 1 634  ? 3.099   53.708 0.786   1.00 59.43  ? 631  LEU A CA  1 
ATOM 4914 C C   . LEU A 1 634  ? 2.217   52.727 0.028   1.00 59.43  ? 631  LEU A C   1 
ATOM 4915 O O   . LEU A 1 634  ? 2.409   51.518 0.152   1.00 59.43  ? 631  LEU A O   1 
ATOM 4916 C CB  . LEU A 1 634  ? 2.516   55.115 0.745   1.00 52.78  ? 631  LEU A CB  1 
ATOM 4917 C CG  . LEU A 1 634  ? 3.402   56.261 1.229   1.00 52.78  ? 631  LEU A CG  1 
ATOM 4918 C CD1 . LEU A 1 634  ? 2.614   57.196 2.125   1.00 52.78  ? 631  LEU A CD1 1 
ATOM 4919 C CD2 . LEU A 1 634  ? 4.622   55.757 1.973   1.00 52.78  ? 631  LEU A CD2 1 
ATOM 4920 N N   . GLY A 1 635  ? 1.275   53.202 -0.775  1.00 67.84  ? 632  GLY A N   1 
ATOM 4921 C CA  . GLY A 1 635  ? 0.511   52.259 -1.598  1.00 67.84  ? 632  GLY A CA  1 
ATOM 4922 C C   . GLY A 1 635  ? 1.375   51.555 -2.635  1.00 67.84  ? 632  GLY A C   1 
ATOM 4923 O O   . GLY A 1 635  ? 2.587   51.773 -2.700  1.00 67.84  ? 632  GLY A O   1 
ATOM 4924 N N   . THR A 1 636  ? 0.770   50.686 -3.434  1.00 75.88  ? 633  THR A N   1 
ATOM 4925 C CA  . THR A 1 636  ? 1.358   50.375 -4.736  1.00 75.88  ? 633  THR A CA  1 
ATOM 4926 C C   . THR A 1 636  ? 0.568   51.185 -5.740  1.00 75.88  ? 633  THR A C   1 
ATOM 4927 O O   . THR A 1 636  ? 1.029   51.428 -6.858  1.00 75.88  ? 633  THR A O   1 
ATOM 4928 C CB  . THR A 1 636  ? 1.248   48.910 -5.108  1.00 94.24  ? 633  THR A CB  1 
ATOM 4929 O OG1 . THR A 1 636  ? -0.133  48.580 -5.310  1.00 94.24  ? 633  THR A OG1 1 
ATOM 4930 C CG2 . THR A 1 636  ? 1.858   48.030 -4.014  1.00 94.24  ? 633  THR A CG2 1 
ATOM 4931 N N   . GLN A 1 637  ? -0.634  51.579 -5.306  1.00 80.52  ? 634  GLN A N   1 
ATOM 4932 C CA  . GLN A 1 637  ? -1.508  52.508 -6.007  1.00 80.52  ? 634  GLN A CA  1 
ATOM 4933 C C   . GLN A 1 637  ? -1.062  53.952 -5.831  1.00 80.52  ? 634  GLN A C   1 
ATOM 4934 O O   . GLN A 1 637  ? -0.413  54.296 -4.831  1.00 80.52  ? 634  GLN A O   1 
ATOM 4935 C CB  . GLN A 1 637  ? -2.944  52.385 -5.493  1.00 87.82  ? 634  GLN A CB  1 
ATOM 4936 C CG  . GLN A 1 637  ? -3.605  51.075 -5.814  1.00 87.82  ? 634  GLN A CG  1 
ATOM 4937 C CD  . GLN A 1 637  ? -3.283  50.597 -7.215  1.00 87.82  ? 634  GLN A CD  1 
ATOM 4938 O OE1 . GLN A 1 637  ? -3.313  51.369 -8.178  1.00 87.82  ? 634  GLN A OE1 1 
ATOM 4939 N NE2 . GLN A 1 637  ? -2.964  49.313 -7.336  1.00 87.82  ? 634  GLN A NE2 1 
ATOM 4940 N N   . PRO A 1 638  ? -1.423  54.813 -6.801  1.00 75.33  ? 635  PRO A N   1 
ATOM 4941 C CA  . PRO A 1 638  ? -1.193  56.232 -6.686  1.00 75.33  ? 635  PRO A CA  1 
ATOM 4942 C C   . PRO A 1 638  ? -1.769  56.755 -5.405  1.00 75.33  ? 635  PRO A C   1 
ATOM 4943 O O   . PRO A 1 638  ? -2.752  56.250 -4.915  1.00 75.33  ? 635  PRO A O   1 
ATOM 4944 C CB  . PRO A 1 638  ? -1.956  56.813 -7.880  1.00 91.66  ? 635  PRO A CB  1 
ATOM 4945 C CG  . PRO A 1 638  ? -2.824  55.729 -8.374  1.00 91.66  ? 635  PRO A CG  1 
ATOM 4946 C CD  . PRO A 1 638  ? -2.067  54.492 -8.083  1.00 91.66  ? 635  PRO A CD  1 
ATOM 4947 N N   . THR A 1 639  ? -1.146  57.787 -4.890  1.00 52.84  ? 636  THR A N   1 
ATOM 4948 C CA  . THR A 1 639  ? -1.446  58.306 -3.595  1.00 52.84  ? 636  THR A CA  1 
ATOM 4949 C C   . THR A 1 639  ? -2.004  59.708 -3.724  1.00 52.84  ? 636  THR A C   1 
ATOM 4950 O O   . THR A 1 639  ? -1.418  60.567 -4.401  1.00 52.84  ? 636  THR A O   1 
ATOM 4951 C CB  . THR A 1 639  ? -0.165  58.353 -2.814  1.00 58.11  ? 636  THR A CB  1 
ATOM 4952 O OG1 . THR A 1 639  ? 0.472   57.063 -2.909  1.00 58.11  ? 636  THR A OG1 1 
ATOM 4953 C CG2 . THR A 1 639  ? -0.414  58.762 -1.362  1.00 58.11  ? 636  THR A CG2 1 
ATOM 4954 N N   . VAL A 1 640  ? -3.145  59.939 -3.083  1.00 42.77  ? 637  VAL A N   1 
ATOM 4955 C CA  . VAL A 1 640  ? -3.734  61.281 -3.003  1.00 42.77  ? 637  VAL A CA  1 
ATOM 4956 C C   . VAL A 1 640  ? -3.375  61.874 -1.657  1.00 42.77  ? 637  VAL A C   1 
ATOM 4957 O O   . VAL A 1 640  ? -3.673  61.273 -0.628  1.00 42.77  ? 637  VAL A O   1 
ATOM 4958 C CB  . VAL A 1 640  ? -5.271  61.233 -3.147  1.00 43.50  ? 637  VAL A CB  1 
ATOM 4959 C CG1 . VAL A 1 640  ? -5.776  62.501 -3.731  1.00 43.50  ? 637  VAL A CG1 1 
ATOM 4960 C CG2 . VAL A 1 640  ? -5.681  60.040 -4.014  1.00 43.50  ? 637  VAL A CG2 1 
ATOM 4961 N N   . LEU A 1 641  ? -2.704  63.020 -1.662  1.00 62.67  ? 638  LEU A N   1 
ATOM 4962 C CA  . LEU A 1 641  ? -2.366  63.712 -0.423  1.00 62.67  ? 638  LEU A CA  1 
ATOM 4963 C C   . LEU A 1 641  ? -3.430  64.742 -0.055  1.00 62.67  ? 638  LEU A C   1 
ATOM 4964 O O   . LEU A 1 641  ? -4.025  65.363 -0.945  1.00 62.67  ? 638  LEU A O   1 
ATOM 4965 C CB  . LEU A 1 641  ? -1.023  64.399 -0.563  1.00 54.15  ? 638  LEU A CB  1 
ATOM 4966 C CG  . LEU A 1 641  ? 0.178   63.469 -0.730  1.00 54.15  ? 638  LEU A CG  1 
ATOM 4967 C CD1 . LEU A 1 641  ? 1.280   64.184 -1.523  1.00 54.15  ? 638  LEU A CD1 1 
ATOM 4968 C CD2 . LEU A 1 641  ? 0.705   62.926 0.611   1.00 54.15  ? 638  LEU A CD2 1 
ATOM 4969 N N   . ARG A 1 642  ? -3.686  64.909 1.243   1.00 63.12  ? 639  ARG A N   1 
ATOM 4970 C CA  . ARG A 1 642  ? -4.697  65.865 1.753   1.00 63.12  ? 639  ARG A CA  1 
ATOM 4971 C C   . ARG A 1 642  ? -4.348  66.248 3.185   1.00 63.12  ? 639  ARG A C   1 
ATOM 4972 O O   . ARG A 1 642  ? -3.488  65.603 3.805   1.00 63.12  ? 639  ARG A O   1 
ATOM 4973 C CB  . ARG A 1 642  ? -6.123  65.293 1.663   1.00 168.27 ? 639  ARG A CB  1 
ATOM 4974 C CG  . ARG A 1 642  ? -7.244  66.266 2.075   1.00 168.27 ? 639  ARG A CG  1 
ATOM 4975 C CD  . ARG A 1 642  ? -7.586  67.295 0.992   1.00 168.27 ? 639  ARG A CD  1 
ATOM 4976 N NE  . ARG A 1 642  ? -8.764  66.922 0.201   1.00 168.27 ? 639  ARG A NE  1 
ATOM 4977 C CZ  . ARG A 1 642  ? -9.966  67.488 0.313   1.00 168.27 ? 639  ARG A CZ  1 
ATOM 4978 N NH1 . ARG A 1 642  ? -10.173 68.466 1.184   1.00 168.27 ? 639  ARG A NH1 1 
ATOM 4979 N NH2 . ARG A 1 642  ? -10.969 67.076 -0.453  1.00 168.27 ? 639  ARG A NH2 1 
ATOM 4980 N N   . THR A 1 643  ? -4.988  67.299 3.699   1.00 110.17 ? 640  THR A N   1 
ATOM 4981 C CA  . THR A 1 643  ? -4.732  67.768 5.066   1.00 110.17 ? 640  THR A CA  1 
ATOM 4982 C C   . THR A 1 643  ? -6.006  67.867 5.912   1.00 110.17 ? 640  THR A C   1 
ATOM 4983 O O   . THR A 1 643  ? -7.051  68.316 5.436   1.00 110.17 ? 640  THR A O   1 
ATOM 4984 C CB  . THR A 1 643  ? -3.894  69.074 5.079   1.00 62.02  ? 640  THR A CB  1 
ATOM 4985 O OG1 . THR A 1 643  ? -2.496  68.744 4.992   1.00 62.02  ? 640  THR A OG1 1 
ATOM 4986 C CG2 . THR A 1 643  ? -4.147  69.894 6.351   1.00 62.02  ? 640  THR A CG2 1 
ATOM 4987 N N   . PHE A 1 644  ? -5.889  67.441 7.169   1.00 130.28 ? 641  PHE A N   1 
ATOM 4988 C CA  . PHE A 1 644  ? -7.041  67.165 8.029   1.00 130.28 ? 641  PHE A CA  1 
ATOM 4989 C C   . PHE A 1 644  ? -7.047  67.972 9.341   1.00 130.28 ? 641  PHE A C   1 
ATOM 4990 O O   . PHE A 1 644  ? -5.987  68.367 9.842   1.00 130.28 ? 641  PHE A O   1 
ATOM 4991 C CB  . PHE A 1 644  ? -7.142  65.642 8.308   1.00 73.20  ? 641  PHE A CB  1 
ATOM 4992 C CG  . PHE A 1 644  ? -5.902  65.035 8.991   1.00 73.20  ? 641  PHE A CG  1 
ATOM 4993 C CD1 . PHE A 1 644  ? -5.812  64.965 10.390  1.00 73.20  ? 641  PHE A CD1 1 
ATOM 4994 C CD2 . PHE A 1 644  ? -4.842  64.524 8.231   1.00 73.20  ? 641  PHE A CD2 1 
ATOM 4995 C CE1 . PHE A 1 644  ? -4.684  64.421 11.023  1.00 73.20  ? 641  PHE A CE1 1 
ATOM 4996 C CE2 . PHE A 1 644  ? -3.719  63.969 8.853   1.00 73.20  ? 641  PHE A CE2 1 
ATOM 4997 C CZ  . PHE A 1 644  ? -3.640  63.916 10.255  1.00 73.20  ? 641  PHE A CZ  1 
ATOM 4998 N N   . ARG A 1 645  ? -8.248  68.204 9.882   1.00 184.49 ? 642  ARG A N   1 
ATOM 4999 C CA  . ARG A 1 645  ? -8.425  68.864 11.185  1.00 184.49 ? 642  ARG A CA  1 
ATOM 5000 C C   . ARG A 1 645  ? -8.272  67.867 12.347  1.00 184.49 ? 642  ARG A C   1 
ATOM 5001 O O   . ARG A 1 645  ? -8.896  66.799 12.354  1.00 184.49 ? 642  ARG A O   1 
ATOM 5002 C CB  . ARG A 1 645  ? -9.779  69.605 11.261  1.00 104.64 ? 642  ARG A CB  1 
ATOM 5003 C CG  . ARG A 1 645  ? -10.022 70.388 12.585  1.00 104.64 ? 642  ARG A CG  1 
ATOM 5004 C CD  . ARG A 1 645  ? -11.347 71.184 12.629  1.00 104.64 ? 642  ARG A CD  1 
ATOM 5005 N NE  . ARG A 1 645  ? -12.535 70.361 12.373  1.00 104.64 ? 642  ARG A NE  1 
ATOM 5006 C CZ  . ARG A 1 645  ? -13.790 70.730 12.612  1.00 104.64 ? 642  ARG A CZ  1 
ATOM 5007 N NH1 . ARG A 1 645  ? -14.062 71.913 13.140  1.00 104.64 ? 642  ARG A NH1 1 
ATOM 5008 N NH2 . ARG A 1 645  ? -14.772 69.897 12.327  1.00 104.64 ? 642  ARG A NH2 1 
ATOM 5009 N N   . SER A 1 646  ? -7.444  68.241 13.323  1.00 201.00 ? 643  SER A N   1 
ATOM 5010 C CA  . SER A 1 646  ? -7.107  67.387 14.466  1.00 201.00 ? 643  SER A CA  1 
ATOM 5011 C C   . SER A 1 646  ? -6.874  68.227 15.735  1.00 201.00 ? 643  SER A C   1 
ATOM 5012 O O   . SER A 1 646  ? -7.776  68.942 16.178  1.00 201.00 ? 643  SER A O   1 
ATOM 5013 C CB  . SER A 1 646  ? -5.872  66.553 14.129  1.00 90.56  ? 643  SER A CB  1 
ATOM 5014 O OG  . SER A 1 646  ? -4.854  67.388 13.603  1.00 90.56  ? 643  SER A OG  1 
ATOM 5015 N N   . LEU A 1 647  ? -5.675  68.134 16.315  1.00 144.17 ? 644  LEU A N   1 
ATOM 5016 C CA  . LEU A 1 647  ? -5.287  68.966 17.464  1.00 144.17 ? 644  LEU A CA  1 
ATOM 5017 C C   . LEU A 1 647  ? -4.688  70.306 16.986  1.00 144.17 ? 644  LEU A C   1 
ATOM 5018 O O   . LEU A 1 647  ? -5.063  70.807 15.920  1.00 144.17 ? 644  LEU A O   1 
ATOM 5019 C CB  . LEU A 1 647  ? -4.349  68.190 18.422  1.00 85.51  ? 644  LEU A CB  1 
ATOM 5020 C CG  . LEU A 1 647  ? -2.810  68.106 18.265  1.00 85.51  ? 644  LEU A CG  1 
ATOM 5021 C CD1 . LEU A 1 647  ? -2.142  67.386 19.460  1.00 85.51  ? 644  LEU A CD1 1 
ATOM 5022 C CD2 . LEU A 1 647  ? -2.356  67.485 16.921  1.00 85.51  ? 644  LEU A CD2 1 
ATOM 5023 N N   . SER A 1 648  ? -3.776  70.885 17.769  1.00 156.75 ? 645  SER A N   1 
ATOM 5024 C CA  . SER A 1 648  ? -3.106  72.145 17.412  1.00 156.75 ? 645  SER A CA  1 
ATOM 5025 C C   . SER A 1 648  ? -2.304  72.037 16.112  1.00 156.75 ? 645  SER A C   1 
ATOM 5026 O O   . SER A 1 648  ? -2.215  72.999 15.339  1.00 156.75 ? 645  SER A O   1 
ATOM 5027 C CB  . SER A 1 648  ? -2.192  72.619 18.550  1.00 152.32 ? 645  SER A CB  1 
ATOM 5028 O OG  . SER A 1 648  ? -1.049  71.787 18.682  1.00 152.32 ? 645  SER A OG  1 
ATOM 5029 N N   . THR A 1 649  ? -1.723  70.860 15.888  1.00 201.00 ? 646  THR A N   1 
ATOM 5030 C CA  . THR A 1 649  ? -0.929  70.603 14.697  1.00 201.00 ? 646  THR A CA  1 
ATOM 5031 C C   . THR A 1 649  ? -1.701  69.670 13.764  1.00 201.00 ? 646  THR A C   1 
ATOM 5032 O O   . THR A 1 649  ? -1.620  68.449 13.889  1.00 201.00 ? 646  THR A O   1 
ATOM 5033 C CB  . THR A 1 649  ? 0.468   70.023 15.058  1.00 89.88  ? 646  THR A CB  1 
ATOM 5034 O OG1 . THR A 1 649  ? 0.389   68.600 15.249  1.00 89.88  ? 646  THR A OG1 1 
ATOM 5035 C CG2 . THR A 1 649  ? 1.031   70.692 16.326  1.00 89.88  ? 646  THR A CG2 1 
ATOM 5036 N N   . THR A 1 650  ? -2.473  70.257 12.850  1.00 153.87 ? 647  THR A N   1 
ATOM 5037 C CA  . THR A 1 650  ? -3.267  69.496 11.874  1.00 153.87 ? 647  THR A CA  1 
ATOM 5038 C C   . THR A 1 650  ? -2.339  68.976 10.777  1.00 153.87 ? 647  THR A C   1 
ATOM 5039 O O   . THR A 1 650  ? -1.337  69.633 10.478  1.00 153.87 ? 647  THR A O   1 
ATOM 5040 C CB  . THR A 1 650  ? -4.362  70.370 11.272  1.00 80.87  ? 647  THR A CB  1 
ATOM 5041 O OG1 . THR A 1 650  ? -3.765  71.426 10.516  1.00 80.87  ? 647  THR A OG1 1 
ATOM 5042 C CG2 . THR A 1 650  ? -5.222  70.975 12.379  1.00 80.87  ? 647  THR A CG2 1 
ATOM 5043 N N   . ASN A 1 651  ? -2.653  67.816 10.184  1.00 131.94 ? 648  ASN A N   1 
ATOM 5044 C CA  . ASN A 1 651  ? -1.623  67.053 9.433   1.00 131.94 ? 648  ASN A CA  1 
ATOM 5045 C C   . ASN A 1 651  ? -1.945  66.580 8.005   1.00 131.94 ? 648  ASN A C   1 
ATOM 5046 O O   . ASN A 1 651  ? -2.977  66.953 7.451   1.00 131.94 ? 648  ASN A O   1 
ATOM 5047 C CB  . ASN A 1 651  ? -1.097  65.881 10.279  1.00 168.59 ? 648  ASN A CB  1 
ATOM 5048 C CG  . ASN A 1 651  ? -0.664  66.305 11.670  1.00 168.59 ? 648  ASN A CG  1 
ATOM 5049 O OD1 . ASN A 1 651  ? 0.495   66.657 11.900  1.00 168.59 ? 648  ASN A OD1 1 
ATOM 5050 N ND2 . ASN A 1 651  ? -1.599  66.258 12.614  1.00 168.59 ? 648  ASN A ND2 1 
ATOM 5051 N N   . VAL A 1 652  ? -1.048  65.758 7.435   1.00 85.92  ? 649  VAL A N   1 
ATOM 5052 C CA  . VAL A 1 652  ? -1.185  65.201 6.068   1.00 85.92  ? 649  VAL A CA  1 
ATOM 5053 C C   . VAL A 1 652  ? -1.652  63.736 5.986   1.00 85.92  ? 649  VAL A C   1 
ATOM 5054 O O   . VAL A 1 652  ? -0.959  62.815 6.452   1.00 85.92  ? 649  VAL A O   1 
ATOM 5055 C CB  . VAL A 1 652  ? 0.143   65.277 5.275   1.00 104.88 ? 649  VAL A CB  1 
ATOM 5056 C CG1 . VAL A 1 652  ? -0.093  64.930 3.806   1.00 104.88 ? 649  VAL A CG1 1 
ATOM 5057 C CG2 . VAL A 1 652  ? 0.777   66.648 5.401   1.00 104.88 ? 649  VAL A CG2 1 
ATOM 5058 N N   . PHE A 1 653  ? -2.800  63.529 5.342   1.00 49.19  ? 650  PHE A N   1 
ATOM 5059 C CA  . PHE A 1 653  ? -3.345  62.192 5.144   1.00 49.19  ? 650  PHE A CA  1 
ATOM 5060 C C   . PHE A 1 653  ? -3.085  61.677 3.720   1.00 49.19  ? 650  PHE A C   1 
ATOM 5061 O O   . PHE A 1 653  ? -3.445  62.329 2.730   1.00 49.19  ? 650  PHE A O   1 
ATOM 5062 C CB  . PHE A 1 653  ? -4.842  62.212 5.407   1.00 71.02  ? 650  PHE A CB  1 
ATOM 5063 C CG  . PHE A 1 653  ? -5.466  60.848 5.455   1.00 71.02  ? 650  PHE A CG  1 
ATOM 5064 C CD1 . PHE A 1 653  ? -6.063  60.387 6.623   1.00 71.02  ? 650  PHE A CD1 1 
ATOM 5065 C CD2 . PHE A 1 653  ? -5.463  60.019 4.338   1.00 71.02  ? 650  PHE A CD2 1 
ATOM 5066 C CE1 . PHE A 1 653  ? -6.642  59.136 6.678   1.00 71.02  ? 650  PHE A CE1 1 
ATOM 5067 C CE2 . PHE A 1 653  ? -6.042  58.765 4.392   1.00 71.02  ? 650  PHE A CE2 1 
ATOM 5068 C CZ  . PHE A 1 653  ? -6.632  58.326 5.566   1.00 71.02  ? 650  PHE A CZ  1 
ATOM 5069 N N   . ALA A 1 654  ? -2.486  60.497 3.607   1.00 43.89  ? 651  ALA A N   1 
ATOM 5070 C CA  . ALA A 1 654  ? -2.141  59.961 2.298   1.00 43.89  ? 651  ALA A CA  1 
ATOM 5071 C C   . ALA A 1 654  ? -3.098  58.834 1.938   1.00 43.89  ? 651  ALA A C   1 
ATOM 5072 O O   . ALA A 1 654  ? -3.196  57.863 2.690   1.00 43.89  ? 651  ALA A O   1 
ATOM 5073 C CB  . ALA A 1 654  ? -0.734  59.450 2.326   1.00 59.25  ? 651  ALA A CB  1 
ATOM 5074 N N   . CYS A 1 655  ? -3.784  58.951 0.796   1.00 50.26  ? 652  CYS A N   1 
ATOM 5075 C CA  . CYS A 1 655  ? -4.753  57.947 0.381   1.00 50.26  ? 652  CYS A CA  1 
ATOM 5076 C C   . CYS A 1 655  ? -4.085  56.967 -0.529  1.00 50.26  ? 652  CYS A C   1 
ATOM 5077 O O   . CYS A 1 655  ? -3.491  57.360 -1.503  1.00 50.26  ? 652  CYS A O   1 
ATOM 5078 C CB  . CYS A 1 655  ? -5.921  58.589 -0.347  1.00 63.70  ? 652  CYS A CB  1 
ATOM 5079 S SG  . CYS A 1 655  ? -6.975  59.667 0.694   1.00 63.70  ? 652  CYS A SG  1 
ATOM 5080 N N   . SER A 1 656  ? -4.172  55.685 -0.198  1.00 46.82  ? 653  SER A N   1 
ATOM 5081 C CA  . SER A 1 656  ? -3.544  54.597 -0.957  1.00 46.82  ? 653  SER A CA  1 
ATOM 5082 C C   . SER A 1 656  ? -4.258  53.302 -0.618  1.00 46.82  ? 653  SER A C   1 
ATOM 5083 O O   . SER A 1 656  ? -5.211  53.282 0.184   1.00 46.82  ? 653  SER A O   1 
ATOM 5084 C CB  . SER A 1 656  ? -2.090  54.413 -0.526  1.00 52.10  ? 653  SER A CB  1 
ATOM 5085 O OG  . SER A 1 656  ? -1.186  55.041 -1.408  1.00 52.10  ? 653  SER A OG  1 
ATOM 5086 N N   . ASP A 1 657  ? -3.769  52.214 -1.207  1.00 64.77  ? 654  ASP A N   1 
ATOM 5087 C CA  . ASP A 1 657  ? -4.153  50.873 -0.796  1.00 64.77  ? 654  ASP A CA  1 
ATOM 5088 C C   . ASP A 1 657  ? -3.570  50.642 0.585   1.00 64.77  ? 654  ASP A C   1 
ATOM 5089 O O   . ASP A 1 657  ? -4.024  49.769 1.311   1.00 64.77  ? 654  ASP A O   1 
ATOM 5090 C CB  . ASP A 1 657  ? -3.616  49.828 -1.775  1.00 97.63  ? 654  ASP A CB  1 
ATOM 5091 C CG  . ASP A 1 657  ? -2.223  50.155 -2.255  1.00 97.63  ? 654  ASP A CG  1 
ATOM 5092 O OD1 . ASP A 1 657  ? -2.066  51.210 -2.896  1.00 97.63  ? 654  ASP A OD1 1 
ATOM 5093 O OD2 . ASP A 1 657  ? -1.281  49.381 -1.987  1.00 97.63  ? 654  ASP A OD2 1 
ATOM 5094 N N   . ARG A 1 658  ? -2.544  51.415 0.940   1.00 48.00  ? 655  ARG A N   1 
ATOM 5095 C CA  . ARG A 1 658  ? -2.034  51.429 2.301   1.00 48.00  ? 655  ARG A CA  1 
ATOM 5096 C C   . ARG A 1 658  ? -2.232  52.849 2.885   1.00 48.00  ? 655  ARG A C   1 
ATOM 5097 O O   . ARG A 1 658  ? -1.302  53.653 2.898   1.00 48.00  ? 655  ARG A O   1 
ATOM 5098 C CB  . ARG A 1 658  ? -0.570  50.990 2.328   1.00 106.96 ? 655  ARG A CB  1 
ATOM 5099 C CG  . ARG A 1 658  ? -0.304  49.798 3.235   1.00 106.96 ? 655  ARG A CG  1 
ATOM 5100 C CD  . ARG A 1 658  ? 1.093   49.847 3.858   1.00 106.96 ? 655  ARG A CD  1 
ATOM 5101 N NE  . ARG A 1 658  ? 2.153   50.155 2.893   1.00 106.96 ? 655  ARG A NE  1 
ATOM 5102 C CZ  . ARG A 1 658  ? 2.772   49.249 2.137   1.00 106.96 ? 655  ARG A CZ  1 
ATOM 5103 N NH1 . ARG A 1 658  ? 2.437   47.968 2.222   1.00 106.96 ? 655  ARG A NH1 1 
ATOM 5104 N NH2 . ARG A 1 658  ? 3.723   49.623 1.287   1.00 106.96 ? 655  ARG A NH2 1 
ATOM 5105 N N   . PRO A 1 659  ? -3.464  53.169 3.345   1.00 38.88  ? 656  PRO A N   1 
ATOM 5106 C CA  . PRO A 1 659  ? -3.727  54.522 3.851   1.00 38.88  ? 656  PRO A CA  1 
ATOM 5107 C C   . PRO A 1 659  ? -2.697  54.863 4.898   1.00 38.88  ? 656  PRO A C   1 
ATOM 5108 O O   . PRO A 1 659  ? -2.355  54.003 5.725   1.00 38.88  ? 656  PRO A O   1 
ATOM 5109 C CB  . PRO A 1 659  ? -5.093  54.421 4.516   1.00 50.31  ? 656  PRO A CB  1 
ATOM 5110 C CG  . PRO A 1 659  ? -5.485  52.962 4.450   1.00 50.31  ? 656  PRO A CG  1 
ATOM 5111 C CD  . PRO A 1 659  ? -4.651  52.299 3.415   1.00 50.31  ? 656  PRO A CD  1 
ATOM 5112 N N   . THR A 1 660  ? -2.185  56.090 4.848   1.00 37.77  ? 657  THR A N   1 
ATOM 5113 C CA  . THR A 1 660  ? -1.138  56.494 5.754   1.00 37.77  ? 657  THR A CA  1 
ATOM 5114 C C   . THR A 1 660  ? -1.358  57.895 6.255   1.00 37.77  ? 657  THR A C   1 
ATOM 5115 O O   . THR A 1 660  ? -1.816  58.772 5.522   1.00 37.77  ? 657  THR A O   1 
ATOM 5116 C CB  . THR A 1 660  ? 0.241   56.427 5.073   1.00 44.20  ? 657  THR A CB  1 
ATOM 5117 O OG1 . THR A 1 660  ? 0.446   55.120 4.496   1.00 44.20  ? 657  THR A OG1 1 
ATOM 5118 C CG2 . THR A 1 660  ? 1.365   56.728 6.090   1.00 44.20  ? 657  THR A CG2 1 
ATOM 5119 N N   . VAL A 1 661  ? -1.037  58.108 7.519   1.00 45.18  ? 658  VAL A N   1 
ATOM 5120 C CA  . VAL A 1 661  ? -0.925  59.455 8.026   1.00 45.18  ? 658  VAL A CA  1 
ATOM 5121 C C   . VAL A 1 661  ? 0.511   59.893 8.074   1.00 45.18  ? 658  VAL A C   1 
ATOM 5122 O O   . VAL A 1 661  ? 1.414   59.097 8.405   1.00 45.18  ? 658  VAL A O   1 
ATOM 5123 C CB  . VAL A 1 661  ? -1.421  59.600 9.432   1.00 30.75  ? 658  VAL A CB  1 
ATOM 5124 C CG1 . VAL A 1 661  ? -0.861  60.862 9.991   1.00 30.75  ? 658  VAL A CG1 1 
ATOM 5125 C CG2 . VAL A 1 661  ? -2.924  59.673 9.439   1.00 30.75  ? 658  VAL A CG2 1 
ATOM 5126 N N   . ILE A 1 662  ? 0.689   61.169 7.734   1.00 122.23 ? 659  ILE A N   1 
ATOM 5127 C CA  . ILE A 1 662  ? 1.924   61.890 7.946   1.00 122.23 ? 659  ILE A CA  1 
ATOM 5128 C C   . ILE A 1 662  ? 1.699   63.046 8.940   1.00 122.23 ? 659  ILE A C   1 
ATOM 5129 O O   . ILE A 1 662  ? 1.168   64.105 8.575   1.00 122.23 ? 659  ILE A O   1 
ATOM 5130 C CB  . ILE A 1 662  ? 2.504   62.366 6.619   1.00 94.70  ? 659  ILE A CB  1 
ATOM 5131 C CG1 . ILE A 1 662  ? 2.705   61.163 5.687   1.00 94.70  ? 659  ILE A CG1 1 
ATOM 5132 C CG2 . ILE A 1 662  ? 3.824   63.071 6.856   1.00 94.70  ? 659  ILE A CG2 1 
ATOM 5133 C CD1 . ILE A 1 662  ? 2.942   61.498 4.225   1.00 94.70  ? 659  ILE A CD1 1 
ATOM 5134 N N   . TYR A 1 663  ? 2.088   62.795 10.199  1.00 145.77 ? 660  TYR A N   1 
ATOM 5135 C CA  . TYR A 1 663  ? 1.962   63.735 11.335  1.00 145.77 ? 660  TYR A CA  1 
ATOM 5136 C C   . TYR A 1 663  ? 3.247   64.564 11.471  1.00 145.77 ? 660  TYR A C   1 
ATOM 5137 O O   . TYR A 1 663  ? 3.688   65.181 10.507  1.00 145.77 ? 660  TYR A O   1 
ATOM 5138 C CB  . TYR A 1 663  ? 1.720   62.986 12.668  1.00 145.84 ? 660  TYR A CB  1 
ATOM 5139 C CG  . TYR A 1 663  ? 0.293   62.589 13.034  1.00 145.84 ? 660  TYR A CG  1 
ATOM 5140 C CD1 . TYR A 1 663  ? -0.128  61.256 12.953  1.00 145.84 ? 660  TYR A CD1 1 
ATOM 5141 C CD2 . TYR A 1 663  ? -0.614  63.527 13.524  1.00 145.84 ? 660  TYR A CD2 1 
ATOM 5142 C CE1 . TYR A 1 663  ? -1.434  60.878 13.306  1.00 145.84 ? 660  TYR A CE1 1 
ATOM 5143 C CE2 . TYR A 1 663  ? -1.926  63.157 13.879  1.00 145.84 ? 660  TYR A CE2 1 
ATOM 5144 C CZ  . TYR A 1 663  ? -2.322  61.832 13.767  1.00 145.84 ? 660  TYR A CZ  1 
ATOM 5145 O OH  . TYR A 1 663  ? -3.600  61.466 14.120  1.00 145.84 ? 660  TYR A OH  1 
ATOM 5146 N N   . SER A 1 664  ? 3.844   64.555 12.669  1.00 201.00 ? 661  SER A N   1 
ATOM 5147 C CA  . SER A 1 664  ? 5.092   65.285 12.963  1.00 201.00 ? 661  SER A CA  1 
ATOM 5148 C C   . SER A 1 664  ? 5.904   64.697 14.132  1.00 201.00 ? 661  SER A C   1 
ATOM 5149 O O   . SER A 1 664  ? 5.345   64.404 15.192  1.00 201.00 ? 661  SER A O   1 
ATOM 5150 C CB  . SER A 1 664  ? 4.800   66.768 13.232  1.00 95.66  ? 661  SER A CB  1 
ATOM 5151 O OG  . SER A 1 664  ? 4.444   67.451 12.039  1.00 95.66  ? 661  SER A OG  1 
ATOM 5152 N N   . SER A 1 665  ? 7.215   64.530 13.935  1.00 149.74 ? 662  SER A N   1 
ATOM 5153 C CA  . SER A 1 665  ? 8.121   64.102 15.017  1.00 149.74 ? 662  SER A CA  1 
ATOM 5154 C C   . SER A 1 665  ? 8.625   65.322 15.824  1.00 149.74 ? 662  SER A C   1 
ATOM 5155 O O   . SER A 1 665  ? 7.813   66.091 16.353  1.00 149.74 ? 662  SER A O   1 
ATOM 5156 C CB  . SER A 1 665  ? 9.275   63.224 14.476  1.00 69.15  ? 662  SER A CB  1 
ATOM 5157 O OG  . SER A 1 665  ? 9.907   62.455 15.497  1.00 69.15  ? 662  SER A OG  1 
ATOM 5158 N N   . ASN A 1 666  ? 9.946   65.491 15.920  1.00 181.92 ? 663  ASN A N   1 
ATOM 5159 C CA  . ASN A 1 666  ? 10.550  66.623 16.644  1.00 181.92 ? 663  ASN A CA  1 
ATOM 5160 C C   . ASN A 1 666  ? 10.107  67.972 16.076  1.00 181.92 ? 663  ASN A C   1 
ATOM 5161 O O   . ASN A 1 666  ? 9.528   68.800 16.776  1.00 181.92 ? 663  ASN A O   1 
ATOM 5162 C CB  . ASN A 1 666  ? 12.094  66.505 16.717  1.00 153.38 ? 663  ASN A CB  1 
ATOM 5163 C CG  . ASN A 1 666  ? 12.711  65.773 15.510  1.00 153.38 ? 663  ASN A CG  1 
ATOM 5164 O OD1 . ASN A 1 666  ? 12.753  66.302 14.396  1.00 153.38 ? 663  ASN A OD1 1 
ATOM 5165 N ND2 . ASN A 1 666  ? 13.221  64.563 15.747  1.00 153.38 ? 663  ASN A ND2 1 
ATOM 5166 N N   . HIS A 1 667  ? 10.400  68.158 14.796  1.00 80.77  ? 664  HIS A N   1 
ATOM 5167 C CA  . HIS A 1 667  ? 9.870   69.219 13.946  1.00 80.77  ? 664  HIS A CA  1 
ATOM 5168 C C   . HIS A 1 667  ? 9.735   68.511 12.597  1.00 80.77  ? 664  HIS A C   1 
ATOM 5169 O O   . HIS A 1 667  ? 9.365   69.119 11.582  1.00 80.77  ? 664  HIS A O   1 
ATOM 5170 C CB  . HIS A 1 667  ? 10.834  70.425 13.902  1.00 120.20 ? 664  HIS A CB  1 
ATOM 5171 C CG  . HIS A 1 667  ? 10.495  71.466 12.868  1.00 120.20 ? 664  HIS A CG  1 
ATOM 5172 N ND1 . HIS A 1 667  ? 11.419  71.936 11.956  1.00 120.20 ? 664  HIS A ND1 1 
ATOM 5173 C CD2 . HIS A 1 667  ? 9.344   72.132 12.609  1.00 120.20 ? 664  HIS A CD2 1 
ATOM 5174 C CE1 . HIS A 1 667  ? 10.853  72.840 11.179  1.00 120.20 ? 664  HIS A CE1 1 
ATOM 5175 N NE2 . HIS A 1 667  ? 9.594   72.977 11.553  1.00 120.20 ? 664  HIS A NE2 1 
ATOM 5176 N N   . LYS A 1 668  ? 10.029  67.203 12.633  1.00 201.00 ? 665  LYS A N   1 
ATOM 5177 C CA  . LYS A 1 668  ? 9.890   66.255 11.517  1.00 201.00 ? 665  LYS A CA  1 
ATOM 5178 C C   . LYS A 1 668  ? 8.420   65.900 11.225  1.00 201.00 ? 665  LYS A C   1 
ATOM 5179 O O   . LYS A 1 668  ? 7.544   66.752 11.365  1.00 201.00 ? 665  LYS A O   1 
ATOM 5180 C CB  . LYS A 1 668  ? 10.659  64.965 11.822  1.00 77.90  ? 665  LYS A CB  1 
ATOM 5181 C CG  . LYS A 1 668  ? 12.171  64.954 11.567  1.00 77.90  ? 665  LYS A CG  1 
ATOM 5182 C CD  . LYS A 1 668  ? 12.556  63.536 11.147  1.00 77.90  ? 665  LYS A CD  1 
ATOM 5183 C CE  . LYS A 1 668  ? 14.028  63.236 11.349  1.00 77.90  ? 665  LYS A CE  1 
ATOM 5184 N NZ  . LYS A 1 668  ? 14.304  61.770 11.158  1.00 77.90  ? 665  LYS A NZ  1 
ATOM 5185 N N   . LEU A 1 669  ? 8.155   64.646 10.832  1.00 80.03  ? 666  LEU A N   1 
ATOM 5186 C CA  . LEU A 1 669  ? 6.820   64.212 10.328  1.00 80.03  ? 666  LEU A CA  1 
ATOM 5187 C C   . LEU A 1 669  ? 6.601   62.696 10.418  1.00 80.03  ? 666  LEU A C   1 
ATOM 5188 O O   . LEU A 1 669  ? 7.429   61.944 9.907   1.00 80.03  ? 666  LEU A O   1 
ATOM 5189 C CB  . LEU A 1 669  ? 6.630   64.634 8.858   1.00 103.13 ? 666  LEU A CB  1 
ATOM 5190 C CG  . LEU A 1 669  ? 6.817   66.062 8.319   1.00 103.13 ? 666  LEU A CG  1 
ATOM 5191 C CD1 . LEU A 1 669  ? 7.002   66.045 6.817   1.00 103.13 ? 666  LEU A CD1 1 
ATOM 5192 C CD2 . LEU A 1 669  ? 5.657   66.965 8.684   1.00 103.13 ? 666  LEU A CD2 1 
ATOM 5193 N N   . VAL A 1 670  ? 5.492   62.246 11.020  1.00 132.94 ? 667  VAL A N   1 
ATOM 5194 C CA  . VAL A 1 670  ? 5.265   60.792 11.272  1.00 132.94 ? 667  VAL A CA  1 
ATOM 5195 C C   . VAL A 1 670  ? 4.774   60.035 10.027  1.00 132.94 ? 667  VAL A C   1 
ATOM 5196 O O   . VAL A 1 670  ? 4.203   60.636 9.123   1.00 132.94 ? 667  VAL A O   1 
ATOM 5197 C CB  . VAL A 1 670  ? 4.327   60.512 12.511  1.00 73.23  ? 667  VAL A CB  1 
ATOM 5198 C CG1 . VAL A 1 670  ? 4.387   59.041 12.957  1.00 73.23  ? 667  VAL A CG1 1 
ATOM 5199 C CG2 . VAL A 1 670  ? 4.715   61.388 13.683  1.00 73.23  ? 667  VAL A CG2 1 
ATOM 5200 N N   . PHE A 1 671  ? 5.011   58.720 10.000  1.00 139.13 ? 668  PHE A N   1 
ATOM 5201 C CA  . PHE A 1 671  ? 4.689   57.855 8.857   1.00 139.13 ? 668  PHE A CA  1 
ATOM 5202 C C   . PHE A 1 671  ? 4.016   56.526 9.227   1.00 139.13 ? 668  PHE A C   1 
ATOM 5203 O O   . PHE A 1 671  ? 4.494   55.456 8.844   1.00 139.13 ? 668  PHE A O   1 
ATOM 5204 C CB  . PHE A 1 671  ? 5.962   57.573 8.063   1.00 131.19 ? 668  PHE A CB  1 
ATOM 5205 C CG  . PHE A 1 671  ? 6.086   58.387 6.820   1.00 131.19 ? 668  PHE A CG  1 
ATOM 5206 C CD1 . PHE A 1 671  ? 6.059   59.777 6.873   1.00 131.19 ? 668  PHE A CD1 1 
ATOM 5207 C CD2 . PHE A 1 671  ? 6.235   57.765 5.590   1.00 131.19 ? 668  PHE A CD2 1 
ATOM 5208 C CE1 . PHE A 1 671  ? 6.171   60.538 5.718   1.00 131.19 ? 668  PHE A CE1 1 
ATOM 5209 C CE2 . PHE A 1 671  ? 6.353   58.515 4.426   1.00 131.19 ? 668  PHE A CE2 1 
ATOM 5210 C CZ  . PHE A 1 671  ? 6.318   59.907 4.490   1.00 131.19 ? 668  PHE A CZ  1 
ATOM 5211 N N   . SER A 1 672  ? 2.893   56.606 9.941   1.00 49.78  ? 669  SER A N   1 
ATOM 5212 C CA  . SER A 1 672  ? 2.232   55.430 10.520  1.00 49.78  ? 669  SER A CA  1 
ATOM 5213 C C   . SER A 1 672  ? 1.072   54.961 9.658   1.00 49.78  ? 669  SER A C   1 
ATOM 5214 O O   . SER A 1 672  ? 0.458   55.762 8.944   1.00 49.78  ? 669  SER A O   1 
ATOM 5215 C CB  . SER A 1 672  ? 1.722   55.736 11.929  1.00 182.22 ? 669  SER A CB  1 
ATOM 5216 O OG  . SER A 1 672  ? 2.758   56.220 12.762  1.00 182.22 ? 669  SER A OG  1 
ATOM 5217 N N   . ASN A 1 673  ? 0.770   53.663 9.711   1.00 37.34  ? 670  ASN A N   1 
ATOM 5218 C CA  . ASN A 1 673  ? -0.390  53.160 8.992   1.00 37.34  ? 670  ASN A CA  1 
ATOM 5219 C C   . ASN A 1 673  ? -1.713  53.630 9.596   1.00 37.34  ? 670  ASN A C   1 
ATOM 5220 O O   . ASN A 1 673  ? -1.832  53.953 10.813  1.00 37.34  ? 670  ASN A O   1 
ATOM 5221 C CB  . ASN A 1 673  ? -0.404  51.643 8.951   1.00 60.64  ? 670  ASN A CB  1 
ATOM 5222 C CG  . ASN A 1 673  ? 0.861   51.082 8.438   1.00 60.64  ? 670  ASN A CG  1 
ATOM 5223 O OD1 . ASN A 1 673  ? 1.103   51.061 7.239   1.00 60.64  ? 670  ASN A OD1 1 
ATOM 5224 N ND2 . ASN A 1 673  ? 1.697   50.615 9.346   1.00 60.64  ? 670  ASN A ND2 1 
ATOM 5225 N N   . VAL A 1 674  ? -2.714  53.656 8.730   1.00 47.33  ? 671  VAL A N   1 
ATOM 5226 C CA  . VAL A 1 674  ? -4.071  53.823 9.182   1.00 47.33  ? 671  VAL A CA  1 
ATOM 5227 C C   . VAL A 1 674  ? -4.762  52.482 9.015   1.00 47.33  ? 671  VAL A C   1 
ATOM 5228 O O   . VAL A 1 674  ? -4.685  51.878 7.941   1.00 47.33  ? 671  VAL A O   1 
ATOM 5229 C CB  . VAL A 1 674  ? -4.732  54.969 8.427   1.00 34.34  ? 671  VAL A CB  1 
ATOM 5230 C CG1 . VAL A 1 674  ? -6.226  55.003 8.674   1.00 34.34  ? 671  VAL A CG1 1 
ATOM 5231 C CG2 . VAL A 1 674  ? -4.084  56.267 8.863   1.00 34.34  ? 671  VAL A CG2 1 
ATOM 5232 N N   . ASN A 1 675  ? -5.376  52.004 10.095  1.00 56.75  ? 672  ASN A N   1 
ATOM 5233 C CA  . ASN A 1 675  ? -5.980  50.670 10.129  1.00 56.75  ? 672  ASN A CA  1 
ATOM 5234 C C   . ASN A 1 675  ? -7.251  50.623 9.293   1.00 56.75  ? 672  ASN A C   1 
ATOM 5235 O O   . ASN A 1 675  ? -8.362  50.633 9.828   1.00 56.75  ? 672  ASN A O   1 
ATOM 5236 C CB  . ASN A 1 675  ? -6.304  50.230 11.565  1.00 35.50  ? 672  ASN A CB  1 
ATOM 5237 C CG  . ASN A 1 675  ? -5.083  50.170 12.470  1.00 35.50  ? 672  ASN A CG  1 
ATOM 5238 O OD1 . ASN A 1 675  ? -3.982  49.899 12.029  1.00 35.50  ? 672  ASN A OD1 1 
ATOM 5239 N ND2 . ASN A 1 675  ? -5.292  50.401 13.762  1.00 35.50  ? 672  ASN A ND2 1 
ATOM 5240 N N   . LEU A 1 676  ? -7.081  50.578 7.979   1.00 53.44  ? 673  LEU A N   1 
ATOM 5241 C CA  . LEU A 1 676  ? -8.197  50.671 7.055   1.00 53.44  ? 673  LEU A CA  1 
ATOM 5242 C C   . LEU A 1 676  ? -7.896  49.969 5.764   1.00 53.44  ? 673  LEU A C   1 
ATOM 5243 O O   . LEU A 1 676  ? -6.788  50.060 5.243   1.00 53.44  ? 673  LEU A O   1 
ATOM 5244 C CB  . LEU A 1 676  ? -8.529  52.121 6.751   1.00 44.22  ? 673  LEU A CB  1 
ATOM 5245 C CG  . LEU A 1 676  ? -9.408  52.839 7.754   1.00 44.22  ? 673  LEU A CG  1 
ATOM 5246 C CD1 . LEU A 1 676  ? -9.703  54.255 7.249   1.00 44.22  ? 673  LEU A CD1 1 
ATOM 5247 C CD2 . LEU A 1 676  ? -10.690 52.000 7.924   1.00 44.22  ? 673  LEU A CD2 1 
ATOM 5248 N N   . LYS A 1 677  ? -8.917  49.274 5.276   1.00 78.23  ? 674  LYS A N   1 
ATOM 5249 C CA  . LYS A 1 677  ? -8.918  48.485 4.047   1.00 78.23  ? 674  LYS A CA  1 
ATOM 5250 C C   . LYS A 1 677  ? -8.139  49.208 2.912   1.00 78.23  ? 674  LYS A C   1 
ATOM 5251 O O   . LYS A 1 677  ? -7.065  48.757 2.498   1.00 78.23  ? 674  LYS A O   1 
ATOM 5252 C CB  . LYS A 1 677  ? -10.408 48.185 3.700   1.00 81.90  ? 674  LYS A CB  1 
ATOM 5253 C CG  . LYS A 1 677  ? -10.727 47.258 2.515   1.00 81.90  ? 674  LYS A CG  1 
ATOM 5254 C CD  . LYS A 1 677  ? -11.003 45.803 2.907   1.00 81.90  ? 674  LYS A CD  1 
ATOM 5255 C CE  . LYS A 1 677  ? -11.719 45.085 1.748   1.00 81.90  ? 674  LYS A CE  1 
ATOM 5256 N NZ  . LYS A 1 677  ? -11.779 43.600 1.880   1.00 81.90  ? 674  LYS A NZ  1 
ATOM 5257 N N   . GLU A 1 678  ? -8.679  50.339 2.455   1.00 62.39  ? 675  GLU A N   1 
ATOM 5258 C CA  . GLU A 1 678  ? -8.155  51.125 1.352   1.00 62.39  ? 675  GLU A CA  1 
ATOM 5259 C C   . GLU A 1 678  ? -8.915  52.435 1.411   1.00 62.39  ? 675  GLU A C   1 
ATOM 5260 O O   . GLU A 1 678  ? -10.117 52.428 1.580   1.00 62.39  ? 675  GLU A O   1 
ATOM 5261 C CB  . GLU A 1 678  ? -8.419  50.440 0.016   1.00 129.01 ? 675  GLU A CB  1 
ATOM 5262 C CG  . GLU A 1 678  ? -7.748  51.131 -1.150  1.00 129.01 ? 675  GLU A CG  1 
ATOM 5263 C CD  . GLU A 1 678  ? -8.142  50.556 -2.499  1.00 129.01 ? 675  GLU A CD  1 
ATOM 5264 O OE1 . GLU A 1 678  ? -9.331  50.195 -2.672  1.00 129.01 ? 675  GLU A OE1 1 
ATOM 5265 O OE2 . GLU A 1 678  ? -7.260  50.483 -3.390  1.00 129.01 ? 675  GLU A OE2 1 
ATOM 5266 N N   . VAL A 1 679  ? -8.222  53.561 1.322   1.00 64.02  ? 676  VAL A N   1 
ATOM 5267 C CA  . VAL A 1 679  ? -8.900  54.843 1.234   1.00 64.02  ? 676  VAL A CA  1 
ATOM 5268 C C   . VAL A 1 679  ? -8.529  55.496 -0.097  1.00 64.02  ? 676  VAL A C   1 
ATOM 5269 O O   . VAL A 1 679  ? -7.340  55.648 -0.412  1.00 64.02  ? 676  VAL A O   1 
ATOM 5270 C CB  . VAL A 1 679  ? -8.512  55.778 2.385   1.00 50.15  ? 676  VAL A CB  1 
ATOM 5271 C CG1 . VAL A 1 679  ? -9.273  57.087 2.280   1.00 50.15  ? 676  VAL A CG1 1 
ATOM 5272 C CG2 . VAL A 1 679  ? -8.719  55.114 3.752   1.00 50.15  ? 676  VAL A CG2 1 
ATOM 5273 N N   . ASN A 1 680  ? -9.549  55.867 -0.874  1.00 65.75  ? 677  ASN A N   1 
ATOM 5274 C CA  . ASN A 1 680  ? -9.367  56.425 -2.218  1.00 65.75  ? 677  ASN A CA  1 
ATOM 5275 C C   . ASN A 1 680  ? -9.237  57.938 -2.253  1.00 65.75  ? 677  ASN A C   1 
ATOM 5276 O O   . ASN A 1 680  ? -8.351  58.455 -2.928  1.00 65.75  ? 677  ASN A O   1 
ATOM 5277 C CB  . ASN A 1 680  ? -10.478 55.964 -3.153  1.00 100.42 ? 677  ASN A CB  1 
ATOM 5278 C CG  . ASN A 1 680  ? -10.185 54.620 -3.772  1.00 100.42 ? 677  ASN A CG  1 
ATOM 5279 O OD1 . ASN A 1 680  ? -9.025  54.247 -3.947  1.00 100.42 ? 677  ASN A OD1 1 
ATOM 5280 N ND2 . ASN A 1 680  ? -11.233 53.886 -4.118  1.00 100.42 ? 677  ASN A ND2 1 
ATOM 5281 N N   . TYR A 1 681  ? -10.139 58.628 -1.546  1.00 49.30  ? 678  TYR A N   1 
ATOM 5282 C CA  . TYR A 1 681  ? -10.083 60.093 -1.325  1.00 49.30  ? 678  TYR A CA  1 
ATOM 5283 C C   . TYR A 1 681  ? -10.574 60.354 0.087   1.00 49.30  ? 678  TYR A C   1 
ATOM 5284 O O   . TYR A 1 681  ? -11.264 59.505 0.659   1.00 49.30  ? 678  TYR A O   1 
ATOM 5285 C CB  . TYR A 1 681  ? -10.931 60.878 -2.347  1.00 63.07  ? 678  TYR A CB  1 
ATOM 5286 C CG  . TYR A 1 681  ? -10.659 60.463 -3.770  1.00 63.07  ? 678  TYR A CG  1 
ATOM 5287 C CD1 . TYR A 1 681  ? -11.383 59.426 -4.364  1.00 63.07  ? 678  TYR A CD1 1 
ATOM 5288 C CD2 . TYR A 1 681  ? -9.644  61.059 -4.509  1.00 63.07  ? 678  TYR A CD2 1 
ATOM 5289 C CE1 . TYR A 1 681  ? -11.116 59.016 -5.659  1.00 63.07  ? 678  TYR A CE1 1 
ATOM 5290 C CE2 . TYR A 1 681  ? -9.378  60.655 -5.807  1.00 63.07  ? 678  TYR A CE2 1 
ATOM 5291 C CZ  . TYR A 1 681  ? -10.121 59.644 -6.370  1.00 63.07  ? 678  TYR A CZ  1 
ATOM 5292 O OH  . TYR A 1 681  ? -9.863  59.245 -7.652  1.00 63.07  ? 678  TYR A OH  1 
ATOM 5293 N N   . MET A 1 682  ? -10.223 61.507 0.654   1.00 69.19  ? 679  MET A N   1 
ATOM 5294 C CA  . MET A 1 682  ? -10.446 61.761 2.076   1.00 69.19  ? 679  MET A CA  1 
ATOM 5295 C C   . MET A 1 682  ? -10.423 63.253 2.406   1.00 69.19  ? 679  MET A C   1 
ATOM 5296 O O   . MET A 1 682  ? -9.526  63.965 1.935   1.00 69.19  ? 679  MET A O   1 
ATOM 5297 C CB  . MET A 1 682  ? -9.384  61.029 2.897   1.00 82.70  ? 679  MET A CB  1 
ATOM 5298 C CG  . MET A 1 682  ? -9.226  61.530 4.314   1.00 82.70  ? 679  MET A CG  1 
ATOM 5299 S SD  . MET A 1 682  ? -8.380  63.113 4.346   1.00 82.70  ? 679  MET A SD  1 
ATOM 5300 C CE  . MET A 1 682  ? -8.965  63.804 5.880   1.00 82.70  ? 679  MET A CE  1 
ATOM 5301 N N   . CYS A 1 683  ? -11.388 63.709 3.223   1.00 123.79 ? 680  CYS A N   1 
ATOM 5302 C CA  . CYS A 1 683  ? -11.498 65.127 3.638   1.00 123.79 ? 680  CYS A CA  1 
ATOM 5303 C C   . CYS A 1 683  ? -12.078 65.326 5.039   1.00 123.79 ? 680  CYS A C   1 
ATOM 5304 O O   . CYS A 1 683  ? -12.870 64.498 5.496   1.00 123.79 ? 680  CYS A O   1 
ATOM 5305 C CB  . CYS A 1 683  ? -12.333 65.939 2.633   1.00 97.53  ? 680  CYS A CB  1 
ATOM 5306 S SG  . CYS A 1 683  ? -14.067 65.458 2.482   1.00 97.53  ? 680  CYS A SG  1 
ATOM 5307 N N   . PRO A 1 684  ? -11.669 66.419 5.727   1.00 107.76 ? 681  PRO A N   1 
ATOM 5308 C CA  . PRO A 1 684  ? -12.306 66.902 6.969   1.00 107.76 ? 681  PRO A CA  1 
ATOM 5309 C C   . PRO A 1 684  ? -13.799 67.209 6.798   1.00 107.76 ? 681  PRO A C   1 
ATOM 5310 O O   . PRO A 1 684  ? -14.256 67.444 5.670   1.00 107.76 ? 681  PRO A O   1 
ATOM 5311 C CB  . PRO A 1 684  ? -11.541 68.197 7.292   1.00 76.96  ? 681  PRO A CB  1 
ATOM 5312 C CG  . PRO A 1 684  ? -10.217 68.021 6.639   1.00 76.96  ? 681  PRO A CG  1 
ATOM 5313 C CD  . PRO A 1 684  ? -10.496 67.235 5.368   1.00 76.96  ? 681  PRO A CD  1 
ATOM 5314 N N   . LEU A 1 685  ? -14.531 67.198 7.921   1.00 200.33 ? 682  LEU A N   1 
ATOM 5315 C CA  . LEU A 1 685  ? -15.987 67.452 7.984   1.00 200.33 ? 682  LEU A CA  1 
ATOM 5316 C C   . LEU A 1 685  ? -16.392 67.931 9.395   1.00 200.33 ? 682  LEU A C   1 
ATOM 5317 O O   . LEU A 1 685  ? -15.514 68.110 10.247  1.00 200.33 ? 682  LEU A O   1 
ATOM 5318 C CB  . LEU A 1 685  ? -16.769 66.192 7.590   1.00 73.86  ? 682  LEU A CB  1 
ATOM 5319 C CG  . LEU A 1 685  ? -17.981 66.361 6.655   1.00 73.86  ? 682  LEU A CG  1 
ATOM 5320 C CD1 . LEU A 1 685  ? -17.576 66.867 5.259   1.00 73.86  ? 682  LEU A CD1 1 
ATOM 5321 C CD2 . LEU A 1 685  ? -18.791 65.059 6.532   1.00 73.86  ? 682  LEU A CD2 1 
ATOM 5322 N N   . ASN A 1 686  ? -17.697 68.133 9.647   1.00 147.63 ? 683  ASN A N   1 
ATOM 5323 C CA  . ASN A 1 686  ? -18.164 68.755 10.915  1.00 147.63 ? 683  ASN A CA  1 
ATOM 5324 C C   . ASN A 1 686  ? -19.688 68.849 11.187  1.00 147.63 ? 683  ASN A C   1 
ATOM 5325 O O   . ASN A 1 686  ? -20.091 69.453 12.186  1.00 147.63 ? 683  ASN A O   1 
ATOM 5326 C CB  . ASN A 1 686  ? -17.552 70.165 11.036  1.00 104.70 ? 683  ASN A CB  1 
ATOM 5327 C CG  . ASN A 1 686  ? -17.576 70.721 12.455  1.00 104.70 ? 683  ASN A CG  1 
ATOM 5328 O OD1 . ASN A 1 686  ? -18.018 70.069 13.404  1.00 104.70 ? 683  ASN A OD1 1 
ATOM 5329 N ND2 . ASN A 1 686  ? -17.090 71.951 12.598  1.00 104.70 ? 683  ASN A ND2 1 
ATOM 5330 N N   . SER A 1 687  ? -20.522 68.254 10.333  1.00 151.14 ? 684  SER A N   1 
ATOM 5331 C CA  . SER A 1 687  ? -21.997 68.435 10.386  1.00 151.14 ? 684  SER A CA  1 
ATOM 5332 C C   . SER A 1 687  ? -22.651 68.408 11.783  1.00 151.14 ? 684  SER A C   1 
ATOM 5333 O O   . SER A 1 687  ? -22.128 67.788 12.713  1.00 151.14 ? 684  SER A O   1 
ATOM 5334 C CB  . SER A 1 687  ? -22.701 67.417 9.473   1.00 118.48 ? 684  SER A CB  1 
ATOM 5335 O OG  . SER A 1 687  ? -23.976 67.893 9.056   1.00 118.48 ? 684  SER A OG  1 
ATOM 5336 N N   . ASP A 1 688  ? -23.795 69.083 11.922  1.00 167.52 ? 685  ASP A N   1 
ATOM 5337 C CA  . ASP A 1 688  ? -24.588 68.985 13.151  1.00 167.52 ? 685  ASP A CA  1 
ATOM 5338 C C   . ASP A 1 688  ? -25.294 67.629 13.188  1.00 167.52 ? 685  ASP A C   1 
ATOM 5339 O O   . ASP A 1 688  ? -26.494 67.501 12.943  1.00 167.52 ? 685  ASP A O   1 
ATOM 5340 C CB  . ASP A 1 688  ? -25.535 70.191 13.345  1.00 82.35  ? 685  ASP A CB  1 
ATOM 5341 C CG  . ASP A 1 688  ? -26.611 70.311 12.260  1.00 82.35  ? 685  ASP A CG  1 
ATOM 5342 O OD1 . ASP A 1 688  ? -26.805 69.381 11.443  1.00 82.35  ? 685  ASP A OD1 1 
ATOM 5343 O OD2 . ASP A 1 688  ? -27.294 71.361 12.252  1.00 82.35  ? 685  ASP A OD2 1 
ATOM 5344 N N   . GLY A 1 689  ? -24.501 66.614 13.504  1.00 73.21  ? 686  GLY A N   1 
ATOM 5345 C CA  . GLY A 1 689  ? -24.866 65.215 13.320  1.00 73.21  ? 686  GLY A CA  1 
ATOM 5346 C C   . GLY A 1 689  ? -23.635 64.356 13.007  1.00 73.21  ? 686  GLY A C   1 
ATOM 5347 O O   . GLY A 1 689  ? -23.750 63.126 12.909  1.00 73.21  ? 686  GLY A O   1 
ATOM 5348 N N   . TYR A 1 690  ? -22.463 65.009 12.855  1.00 65.74  ? 687  TYR A N   1 
ATOM 5349 C CA  . TYR A 1 690  ? -21.160 64.363 12.583  1.00 65.74  ? 687  TYR A CA  1 
ATOM 5350 C C   . TYR A 1 690  ? -19.863 65.172 12.931  1.00 65.74  ? 687  TYR A C   1 
ATOM 5351 O O   . TYR A 1 690  ? -18.901 65.094 12.179  1.00 65.74  ? 687  TYR A O   1 
ATOM 5352 C CB  . TYR A 1 690  ? -21.114 63.940 11.108  1.00 87.28  ? 687  TYR A CB  1 
ATOM 5353 C CG  . TYR A 1 690  ? -21.835 62.648 10.785  1.00 87.28  ? 687  TYR A CG  1 
ATOM 5354 C CD1 . TYR A 1 690  ? -21.561 61.473 11.496  1.00 87.28  ? 687  TYR A CD1 1 
ATOM 5355 C CD2 . TYR A 1 690  ? -22.761 62.585 9.747   1.00 87.28  ? 687  TYR A CD2 1 
ATOM 5356 C CE1 . TYR A 1 690  ? -22.210 60.261 11.193  1.00 87.28  ? 687  TYR A CE1 1 
ATOM 5357 C CE2 . TYR A 1 690  ? -23.417 61.378 9.424   1.00 87.28  ? 687  TYR A CE2 1 
ATOM 5358 C CZ  . TYR A 1 690  ? -23.138 60.213 10.154  1.00 87.28  ? 687  TYR A CZ  1 
ATOM 5359 O OH  . TYR A 1 690  ? -23.775 59.012 9.854   1.00 87.28  ? 687  TYR A OH  1 
ATOM 5360 N N   . PRO A 1 691  ? -19.805 65.906 14.073  1.00 107.69 ? 688  PRO A N   1 
ATOM 5361 C CA  . PRO A 1 691  ? -18.695 66.882 14.270  1.00 107.69 ? 688  PRO A CA  1 
ATOM 5362 C C   . PRO A 1 691  ? -17.285 66.278 14.365  1.00 107.69 ? 688  PRO A C   1 
ATOM 5363 O O   . PRO A 1 691  ? -17.158 65.062 14.483  1.00 107.69 ? 688  PRO A O   1 
ATOM 5364 C CB  . PRO A 1 691  ? -19.070 67.602 15.584  1.00 82.33  ? 688  PRO A CB  1 
ATOM 5365 C CG  . PRO A 1 691  ? -20.518 67.325 15.775  1.00 82.33  ? 688  PRO A CG  1 
ATOM 5366 C CD  . PRO A 1 691  ? -20.699 65.909 15.240  1.00 82.33  ? 688  PRO A CD  1 
ATOM 5367 N N   . ASP A 1 692  ? -16.252 67.133 14.326  1.00 97.19  ? 689  ASP A N   1 
ATOM 5368 C CA  . ASP A 1 692  ? -14.830 66.728 14.160  1.00 97.19  ? 689  ASP A CA  1 
ATOM 5369 C C   . ASP A 1 692  ? -14.615 65.379 13.404  1.00 97.19  ? 689  ASP A C   1 
ATOM 5370 O O   . ASP A 1 692  ? -13.696 64.602 13.691  1.00 97.19  ? 689  ASP A O   1 
ATOM 5371 C CB  . ASP A 1 692  ? -14.059 66.795 15.492  1.00 94.89  ? 689  ASP A CB  1 
ATOM 5372 C CG  . ASP A 1 692  ? -12.534 66.921 15.295  1.00 94.89  ? 689  ASP A CG  1 
ATOM 5373 O OD1 . ASP A 1 692  ? -11.965 67.938 15.752  1.00 94.89  ? 689  ASP A OD1 1 
ATOM 5374 O OD2 . ASP A 1 692  ? -11.899 66.014 14.697  1.00 94.89  ? 689  ASP A OD2 1 
ATOM 5375 N N   . SER A 1 693  ? -15.470 65.149 12.411  1.00 190.15 ? 690  SER A N   1 
ATOM 5376 C CA  . SER A 1 693  ? -15.479 63.921 11.623  1.00 190.15 ? 690  SER A CA  1 
ATOM 5377 C C   . SER A 1 693  ? -14.592 64.051 10.382  1.00 190.15 ? 690  SER A C   1 
ATOM 5378 O O   . SER A 1 693  ? -14.358 65.160 9.893   1.00 190.15 ? 690  SER A O   1 
ATOM 5379 C CB  . SER A 1 693  ? -16.924 63.582 11.234  1.00 83.99  ? 690  SER A CB  1 
ATOM 5380 O OG  . SER A 1 693  ? -17.007 62.633 10.186  1.00 83.99  ? 690  SER A OG  1 
ATOM 5381 N N   . LEU A 1 694  ? -14.086 62.915 9.897   1.00 51.55  ? 691  LEU A N   1 
ATOM 5382 C CA  . LEU A 1 694  ? -13.303 62.858 8.662   1.00 51.55  ? 691  LEU A CA  1 
ATOM 5383 C C   . LEU A 1 694  ? -14.072 61.964 7.709   1.00 51.55  ? 691  LEU A C   1 
ATOM 5384 O O   . LEU A 1 694  ? -14.713 60.997 8.137   1.00 51.55  ? 691  LEU A O   1 
ATOM 5385 C CB  . LEU A 1 694  ? -11.876 62.315 8.886   1.00 53.07  ? 691  LEU A CB  1 
ATOM 5386 C CG  . LEU A 1 694  ? -10.914 62.916 9.933   1.00 53.07  ? 691  LEU A CG  1 
ATOM 5387 C CD1 . LEU A 1 694  ? -9.422  62.730 9.519   1.00 53.07  ? 691  LEU A CD1 1 
ATOM 5388 C CD2 . LEU A 1 694  ? -11.203 64.409 10.315  1.00 53.07  ? 691  LEU A CD2 1 
ATOM 5389 N N   . ALA A 1 695  ? -14.042 62.314 6.426   1.00 87.43  ? 692  ALA A N   1 
ATOM 5390 C CA  . ALA A 1 695  ? -14.791 61.579 5.422   1.00 87.43  ? 692  ALA A CA  1 
ATOM 5391 C C   . ALA A 1 695  ? -13.786 60.876 4.555   1.00 87.43  ? 692  ALA A C   1 
ATOM 5392 O O   . ALA A 1 695  ? -12.685 61.391 4.362   1.00 87.43  ? 692  ALA A O   1 
ATOM 5393 C CB  . ALA A 1 695  ? -15.647 62.514 4.597   1.00 113.20 ? 692  ALA A CB  1 
ATOM 5394 N N   . LEU A 1 696  ? -14.163 59.706 4.040   1.00 66.37  ? 693  LEU A N   1 
ATOM 5395 C CA  . LEU A 1 696  ? -13.215 58.813 3.407   1.00 66.37  ? 693  LEU A CA  1 
ATOM 5396 C C   . LEU A 1 696  ? -13.930 57.759 2.564   1.00 66.37  ? 693  LEU A C   1 
ATOM 5397 O O   . LEU A 1 696  ? -14.600 56.859 3.099   1.00 66.37  ? 693  LEU A O   1 
ATOM 5398 C CB  . LEU A 1 696  ? -12.345 58.101 4.468   1.00 57.43  ? 693  LEU A CB  1 
ATOM 5399 C CG  . LEU A 1 696  ? -11.436 58.851 5.458   1.00 57.43  ? 693  LEU A CG  1 
ATOM 5400 C CD1 . LEU A 1 696  ? -12.097 59.087 6.809   1.00 57.43  ? 693  LEU A CD1 1 
ATOM 5401 C CD2 . LEU A 1 696  ? -10.183 58.061 5.664   1.00 57.43  ? 693  LEU A CD2 1 
ATOM 5402 N N   . ALA A 1 697  ? -13.769 57.839 1.247   1.00 60.40  ? 694  ALA A N   1 
ATOM 5403 C CA  . ALA A 1 697  ? -14.411 56.881 0.360   1.00 60.40  ? 694  ALA A CA  1 
ATOM 5404 C C   . ALA A 1 697  ? -13.378 55.926 -0.184  1.00 60.40  ? 694  ALA A C   1 
ATOM 5405 O O   . ALA A 1 697  ? -12.251 56.338 -0.477  1.00 60.40  ? 694  ALA A O   1 
ATOM 5406 C CB  . ALA A 1 697  ? -15.100 57.598 -0.777  1.00 153.62 ? 694  ALA A CB  1 
ATOM 5407 N N   . ASN A 1 698  ? -13.759 54.660 -0.325  1.00 90.65  ? 695  ASN A N   1 
ATOM 5408 C CA  . ASN A 1 698  ? -12.895 53.647 -0.916  1.00 90.65  ? 695  ASN A CA  1 
ATOM 5409 C C   . ASN A 1 698  ? -13.497 53.136 -2.213  1.00 90.65  ? 695  ASN A C   1 
ATOM 5410 O O   . ASN A 1 698  ? -14.364 53.796 -2.790  1.00 90.65  ? 695  ASN A O   1 
ATOM 5411 C CB  . ASN A 1 698  ? -12.690 52.489 0.056   1.00 126.03 ? 695  ASN A CB  1 
ATOM 5412 C CG  . ASN A 1 698  ? -13.968 51.730 0.339   1.00 126.03 ? 695  ASN A CG  1 
ATOM 5413 O OD1 . ASN A 1 698  ? -14.917 52.273 0.911   1.00 126.03 ? 695  ASN A OD1 1 
ATOM 5414 N ND2 . ASN A 1 698  ? -13.997 50.464 -0.060  1.00 126.03 ? 695  ASN A ND2 1 
ATOM 5415 N N   . ASN A 1 699  ? -13.040 51.961 -2.653  1.00 95.55  ? 696  ASN A N   1 
ATOM 5416 C CA  . ASN A 1 699  ? -13.531 51.313 -3.867  1.00 95.55  ? 696  ASN A CA  1 
ATOM 5417 C C   . ASN A 1 699  ? -15.032 51.484 -3.993  1.00 95.55  ? 696  ASN A C   1 
ATOM 5418 O O   . ASN A 1 699  ? -15.533 51.742 -5.088  1.00 95.55  ? 696  ASN A O   1 
ATOM 5419 C CB  . ASN A 1 699  ? -13.156 49.825 -3.877  1.00 165.72 ? 696  ASN A CB  1 
ATOM 5420 C CG  . ASN A 1 699  ? -13.417 49.155 -5.225  1.00 165.72 ? 696  ASN A CG  1 
ATOM 5421 O OD1 . ASN A 1 699  ? -13.581 49.818 -6.251  1.00 165.72 ? 696  ASN A OD1 1 
ATOM 5422 N ND2 . ASN A 1 699  ? -13.447 47.827 -5.223  1.00 165.72 ? 696  ASN A ND2 1 
ATOM 5423 N N   . SER A 1 700  ? -15.730 51.364 -2.857  1.00 83.70  ? 697  SER A N   1 
ATOM 5424 C CA  . SER A 1 700  ? -17.183 51.582 -2.752  1.00 83.70  ? 697  SER A CA  1 
ATOM 5425 C C   . SER A 1 700  ? -17.642 51.731 -1.302  1.00 83.70  ? 697  SER A C   1 
ATOM 5426 O O   . SER A 1 700  ? -17.850 50.725 -0.632  1.00 83.70  ? 697  SER A O   1 
ATOM 5427 C CB  . SER A 1 700  ? -17.946 50.420 -3.396  1.00 131.36 ? 697  SER A CB  1 
ATOM 5428 O OG  . SER A 1 700  ? -17.623 49.187 -2.783  1.00 131.36 ? 697  SER A OG  1 
ATOM 5429 N N   . THR A 1 701  ? -17.791 52.971 -0.826  1.00 83.35  ? 698  THR A N   1 
ATOM 5430 C CA  . THR A 1 701  ? -18.393 53.275 0.492   1.00 83.35  ? 698  THR A CA  1 
ATOM 5431 C C   . THR A 1 701  ? -17.927 54.610 1.075   1.00 83.35  ? 698  THR A C   1 
ATOM 5432 O O   . THR A 1 701  ? -16.720 54.836 1.242   1.00 83.35  ? 698  THR A O   1 
ATOM 5433 C CB  . THR A 1 701  ? -18.146 52.142 1.551   1.00 140.75 ? 698  THR A CB  1 
ATOM 5434 O OG1 . THR A 1 701  ? -19.045 51.055 1.315   1.00 140.75 ? 698  THR A OG1 1 
ATOM 5435 C CG2 . THR A 1 701  ? -18.359 52.631 2.974   1.00 140.75 ? 698  THR A CG2 1 
ATOM 5436 N N   . LEU A 1 702  ? -18.867 55.493 1.402   1.00 83.60  ? 699  LEU A N   1 
ATOM 5437 C CA  . LEU A 1 702  ? -18.492 56.653 2.208   1.00 83.60  ? 699  LEU A CA  1 
ATOM 5438 C C   . LEU A 1 702  ? -18.397 56.228 3.677   1.00 83.60  ? 699  LEU A C   1 
ATOM 5439 O O   . LEU A 1 702  ? -19.045 55.263 4.098   1.00 83.60  ? 699  LEU A O   1 
ATOM 5440 C CB  . LEU A 1 702  ? -19.438 57.857 2.022   1.00 51.29  ? 699  LEU A CB  1 
ATOM 5441 C CG  . LEU A 1 702  ? -19.071 59.153 2.785   1.00 51.29  ? 699  LEU A CG  1 
ATOM 5442 C CD1 . LEU A 1 702  ? -17.847 59.891 2.212   1.00 51.29  ? 699  LEU A CD1 1 
ATOM 5443 C CD2 . LEU A 1 702  ? -20.238 60.095 2.838   1.00 51.29  ? 699  LEU A CD2 1 
ATOM 5444 N N   . THR A 1 703  ? -17.552 56.940 4.423   1.00 99.33  ? 700  THR A N   1 
ATOM 5445 C CA  . THR A 1 703  ? -17.297 56.707 5.842   1.00 99.33  ? 700  THR A CA  1 
ATOM 5446 C C   . THR A 1 703  ? -16.792 58.014 6.483   1.00 99.33  ? 700  THR A C   1 
ATOM 5447 O O   . THR A 1 703  ? -16.190 58.855 5.815   1.00 99.33  ? 700  THR A O   1 
ATOM 5448 C CB  . THR A 1 703  ? -16.301 55.509 6.104   1.00 88.43  ? 700  THR A CB  1 
ATOM 5449 O OG1 . THR A 1 703  ? -15.244 55.506 5.132   1.00 88.43  ? 700  THR A OG1 1 
ATOM 5450 C CG2 . THR A 1 703  ? -17.020 54.159 6.046   1.00 88.43  ? 700  THR A CG2 1 
ATOM 5451 N N   . ILE A 1 704  ? -17.056 58.169 7.778   1.00 78.33  ? 701  ILE A N   1 
ATOM 5452 C CA  . ILE A 1 704  ? -16.794 59.393 8.536   1.00 78.33  ? 701  ILE A CA  1 
ATOM 5453 C C   . ILE A 1 704  ? -16.490 59.023 9.999   1.00 78.33  ? 701  ILE A C   1 
ATOM 5454 O O   . ILE A 1 704  ? -17.116 58.100 10.528  1.00 78.33  ? 701  ILE A O   1 
ATOM 5455 C CB  . ILE A 1 704  ? -18.025 60.339 8.502   1.00 91.18  ? 701  ILE A CB  1 
ATOM 5456 C CG1 . ILE A 1 704  ? -19.318 59.620 8.952   1.00 91.18  ? 701  ILE A CG1 1 
ATOM 5457 C CG2 . ILE A 1 704  ? -18.187 60.998 7.137   1.00 91.18  ? 701  ILE A CG2 1 
ATOM 5458 C CD1 . ILE A 1 704  ? -19.751 58.391 8.134   1.00 91.18  ? 701  ILE A CD1 1 
ATOM 5459 N N   . GLY A 1 705  ? -15.554 59.722 10.654  1.00 46.87  ? 702  GLY A N   1 
ATOM 5460 C CA  . GLY A 1 705  ? -15.174 59.369 12.032  1.00 46.87  ? 702  GLY A CA  1 
ATOM 5461 C C   . GLY A 1 705  ? -13.930 60.055 12.601  1.00 46.87  ? 702  GLY A C   1 
ATOM 5462 O O   . GLY A 1 705  ? -13.181 60.710 11.855  1.00 46.87  ? 702  GLY A O   1 
ATOM 5463 N N   . THR A 1 706  ? -13.674 59.937 13.906  1.00 60.97  ? 703  THR A N   1 
ATOM 5464 C CA  . THR A 1 706  ? -12.479 60.617 14.425  1.00 60.97  ? 703  THR A CA  1 
ATOM 5465 C C   . THR A 1 706  ? -11.210 59.752 14.255  1.00 60.97  ? 703  THR A C   1 
ATOM 5466 O O   . THR A 1 706  ? -11.279 58.645 13.683  1.00 60.97  ? 703  THR A O   1 
ATOM 5467 C CB  . THR A 1 706  ? -12.634 61.142 15.883  1.00 103.14 ? 703  THR A CB  1 
ATOM 5468 O OG1 . THR A 1 706  ? -12.754 60.037 16.791  1.00 103.14 ? 703  THR A OG1 1 
ATOM 5469 C CG2 . THR A 1 706  ? -13.844 62.069 16.007  1.00 103.14 ? 703  THR A CG2 1 
ATOM 5470 N N   . ILE A 1 707  ? -10.079 60.251 14.743  1.00 69.25  ? 704  ILE A N   1 
ATOM 5471 C CA  . ILE A 1 707  ? -8.816  59.529 14.641  1.00 69.25  ? 704  ILE A CA  1 
ATOM 5472 C C   . ILE A 1 707  ? -8.274  59.169 16.021  1.00 69.25  ? 704  ILE A C   1 
ATOM 5473 O O   . ILE A 1 707  ? -8.693  59.735 17.030  1.00 69.25  ? 704  ILE A O   1 
ATOM 5474 C CB  . ILE A 1 707  ? -7.757  60.349 13.882  1.00 73.78  ? 704  ILE A CB  1 
ATOM 5475 C CG1 . ILE A 1 707  ? -8.336  60.884 12.571  1.00 73.78  ? 704  ILE A CG1 1 
ATOM 5476 C CG2 . ILE A 1 707  ? -6.519  59.505 13.618  1.00 73.78  ? 704  ILE A CG2 1 
ATOM 5477 C CD1 . ILE A 1 707  ? -8.764  59.801 11.605  1.00 73.78  ? 704  ILE A CD1 1 
ATOM 5478 N N   . ASP A 1 708  ? -7.341  58.224 16.055  1.00 46.49  ? 705  ASP A N   1 
ATOM 5479 C CA  . ASP A 1 708  ? -6.740  57.786 17.310  1.00 46.49  ? 705  ASP A CA  1 
ATOM 5480 C C   . ASP A 1 708  ? -5.651  58.750 17.767  1.00 46.49  ? 705  ASP A C   1 
ATOM 5481 O O   . ASP A 1 708  ? -5.861  59.962 17.812  1.00 46.49  ? 705  ASP A O   1 
ATOM 5482 C CB  . ASP A 1 708  ? -6.167  56.375 17.165  1.00 110.87 ? 705  ASP A CB  1 
ATOM 5483 C CG  . ASP A 1 708  ? -7.222  55.298 17.319  1.00 110.87 ? 705  ASP A CG  1 
ATOM 5484 O OD1 . ASP A 1 708  ? -8.425  55.634 17.292  1.00 110.87 ? 705  ASP A OD1 1 
ATOM 5485 O OD2 . ASP A 1 708  ? -6.850  54.115 17.466  1.00 110.87 ? 705  ASP A OD2 1 
ATOM 5486 N N   . GLU A 1 709  ? -4.488  58.204 18.104  1.00 115.16 ? 706  GLU A N   1 
ATOM 5487 C CA  . GLU A 1 709  ? -3.364  59.014 18.560  1.00 115.16 ? 706  GLU A CA  1 
ATOM 5488 C C   . GLU A 1 709  ? -2.530  59.513 17.384  1.00 115.16 ? 706  GLU A C   1 
ATOM 5489 O O   . GLU A 1 709  ? -2.971  60.369 16.617  1.00 115.16 ? 706  GLU A O   1 
ATOM 5490 C CB  . GLU A 1 709  ? -2.486  58.217 19.526  1.00 134.91 ? 706  GLU A CB  1 
ATOM 5491 C CG  . GLU A 1 709  ? -1.132  58.851 19.802  1.00 134.91 ? 706  GLU A CG  1 
ATOM 5492 C CD  . GLU A 1 709  ? -1.236  60.097 20.659  1.00 134.91 ? 706  GLU A CD  1 
ATOM 5493 O OE1 . GLU A 1 709  ? -2.372  60.517 20.965  1.00 134.91 ? 706  GLU A OE1 1 
ATOM 5494 O OE2 . GLU A 1 709  ? -0.182  60.657 21.027  1.00 134.91 ? 706  GLU A OE2 1 
ATOM 5495 N N   . ILE A 1 710  ? -1.366  58.931 17.205  1.00 45.54  ? 707  ILE A N   1 
ATOM 5496 C CA  . ILE A 1 710  ? -0.615  59.276 16.049  1.00 45.54  ? 707  ILE A CA  1 
ATOM 5497 C C   . ILE A 1 710  ? 0.467   58.292 15.836  1.00 45.54  ? 707  ILE A C   1 
ATOM 5498 O O   . ILE A 1 710  ? 0.694   57.837 14.760  1.00 45.54  ? 707  ILE A O   1 
ATOM 5499 C CB  . ILE A 1 710  ? 0.048   60.598 16.229  1.00 81.78  ? 707  ILE A CB  1 
ATOM 5500 C CG1 . ILE A 1 710  ? -0.923  61.724 15.922  1.00 81.78  ? 707  ILE A CG1 1 
ATOM 5501 C CG2 . ILE A 1 710  ? 1.256   60.686 15.349  1.00 81.78  ? 707  ILE A CG2 1 
ATOM 5502 C CD1 . ILE A 1 710  ? -0.882  62.820 16.949  1.00 81.78  ? 707  ILE A CD1 1 
ATOM 5503 N N   . GLN A 1 711  ? 1.171   57.981 16.876  1.00 43.52  ? 708  GLN A N   1 
ATOM 5504 C CA  . GLN A 1 711  ? 2.341   57.201 16.716  1.00 43.52  ? 708  GLN A CA  1 
ATOM 5505 C C   . GLN A 1 711  ? 2.069   55.974 15.938  1.00 43.52  ? 708  GLN A C   1 
ATOM 5506 O O   . GLN A 1 711  ? 0.975   55.705 15.545  1.00 43.52  ? 708  GLN A O   1 
ATOM 5507 C CB  . GLN A 1 711  ? 2.784   56.773 18.072  1.00 140.27 ? 708  GLN A CB  1 
ATOM 5508 C CG  . GLN A 1 711  ? 1.676   56.041 18.740  1.00 140.27 ? 708  GLN A CG  1 
ATOM 5509 C CD  . GLN A 1 711  ? 1.328   56.563 20.094  1.00 140.27 ? 708  GLN A CD  1 
ATOM 5510 O OE1 . GLN A 1 711  ? 0.604   57.538 20.218  1.00 140.27 ? 708  GLN A OE1 1 
ATOM 5511 N NE2 . GLN A 1 711  ? 1.836   55.918 21.124  1.00 140.27 ? 708  GLN A NE2 1 
ATOM 5512 N N   . LYS A 1 712  ? 3.111   55.199 15.757  1.00 65.76  ? 709  LYS A N   1 
ATOM 5513 C CA  . LYS A 1 712  ? 2.990   53.928 15.114  1.00 65.76  ? 709  LYS A CA  1 
ATOM 5514 C C   . LYS A 1 712  ? 2.335   52.962 16.059  1.00 65.76  ? 709  LYS A C   1 
ATOM 5515 O O   . LYS A 1 712  ? 1.641   52.072 15.632  1.00 65.76  ? 709  LYS A O   1 
ATOM 5516 C CB  . LYS A 1 712  ? 4.365   53.416 14.688  1.00 118.82 ? 709  LYS A CB  1 
ATOM 5517 C CG  . LYS A 1 712  ? 4.340   52.314 13.619  1.00 118.82 ? 709  LYS A CG  1 
ATOM 5518 C CD  . LYS A 1 712  ? 5.594   51.434 13.660  1.00 118.82 ? 709  LYS A CD  1 
ATOM 5519 C CE  . LYS A 1 712  ? 5.295   49.980 13.277  1.00 118.82 ? 709  LYS A CE  1 
ATOM 5520 N NZ  . LYS A 1 712  ? 6.015   49.505 12.044  1.00 118.82 ? 709  LYS A NZ  1 
ATOM 5521 N N   . LEU A 1 713  ? 2.557   53.142 17.350  1.00 47.89  ? 710  LEU A N   1 
ATOM 5522 C CA  . LEU A 1 713  ? 1.917   52.320 18.358  1.00 47.89  ? 710  LEU A CA  1 
ATOM 5523 C C   . LEU A 1 713  ? 1.016   53.097 19.264  1.00 47.89  ? 710  LEU A C   1 
ATOM 5524 O O   . LEU A 1 713  ? 1.387   54.063 19.847  1.00 47.89  ? 710  LEU A O   1 
ATOM 5525 C CB  . LEU A 1 713  ? 2.929   51.676 19.260  1.00 46.76  ? 710  LEU A CB  1 
ATOM 5526 C CG  . LEU A 1 713  ? 3.819   50.599 18.721  1.00 46.76  ? 710  LEU A CG  1 
ATOM 5527 C CD1 . LEU A 1 713  ? 4.534   50.020 19.852  1.00 46.76  ? 710  LEU A CD1 1 
ATOM 5528 C CD2 . LEU A 1 713  ? 3.055   49.579 18.030  1.00 46.76  ? 710  LEU A CD2 1 
ATOM 5529 N N   . HIS A 1 714  ? -0.170  52.592 19.455  1.00 64.12  ? 711  HIS A N   1 
ATOM 5530 C CA  . HIS A 1 714  ? -1.068  53.199 20.379  1.00 64.12  ? 711  HIS A CA  1 
ATOM 5531 C C   . HIS A 1 714  ? -1.064  52.320 21.633  1.00 64.12  ? 711  HIS A C   1 
ATOM 5532 O O   . HIS A 1 714  ? -1.111  51.076 21.547  1.00 64.12  ? 711  HIS A O   1 
ATOM 5533 C CB  . HIS A 1 714  ? -2.453  53.293 19.765  1.00 78.99  ? 711  HIS A CB  1 
ATOM 5534 C CG  . HIS A 1 714  ? -3.506  53.654 20.755  1.00 78.99  ? 711  HIS A CG  1 
ATOM 5535 N ND1 . HIS A 1 714  ? -3.638  54.930 21.263  1.00 78.99  ? 711  HIS A ND1 1 
ATOM 5536 C CD2 . HIS A 1 714  ? -4.440  52.898 21.378  1.00 78.99  ? 711  HIS A CD2 1 
ATOM 5537 C CE1 . HIS A 1 714  ? -4.628  54.950 22.137  1.00 78.99  ? 711  HIS A CE1 1 
ATOM 5538 N NE2 . HIS A 1 714  ? -5.131  53.731 22.224  1.00 78.99  ? 711  HIS A NE2 1 
ATOM 5539 N N   . ILE A 1 715  ? -0.990  52.976 22.787  1.00 50.97  ? 712  ILE A N   1 
ATOM 5540 C CA  . ILE A 1 715  ? -0.965  52.311 24.059  1.00 50.97  ? 712  ILE A CA  1 
ATOM 5541 C C   . ILE A 1 715  ? -2.093  52.815 24.920  1.00 50.97  ? 712  ILE A C   1 
ATOM 5542 O O   . ILE A 1 715  ? -2.154  54.007 25.212  1.00 50.97  ? 712  ILE A O   1 
ATOM 5543 C CB  . ILE A 1 715  ? 0.309   52.639 24.854  1.00 50.60  ? 712  ILE A CB  1 
ATOM 5544 C CG1 . ILE A 1 715  ? 1.563   52.446 24.017  1.00 50.60  ? 712  ILE A CG1 1 
ATOM 5545 C CG2 . ILE A 1 715  ? 0.393   51.777 26.102  1.00 50.60  ? 712  ILE A CG2 1 
ATOM 5546 C CD1 . ILE A 1 715  ? 2.761   53.195 24.600  1.00 50.60  ? 712  ILE A CD1 1 
ATOM 5547 N N   . ARG A 1 716  ? -2.885  51.875 25.444  1.00 60.41  ? 713  ARG A N   1 
ATOM 5548 C CA  . ARG A 1 716  ? -3.927  52.158 26.437  1.00 60.41  ? 713  ARG A CA  1 
ATOM 5549 C C   . ARG A 1 716  ? -3.731  51.447 27.798  1.00 60.41  ? 713  ARG A C   1 
ATOM 5550 O O   . ARG A 1 716  ? -4.056  50.270 27.956  1.00 60.41  ? 713  ARG A O   1 
ATOM 5551 C CB  . ARG A 1 716  ? -5.308  51.822 25.869  1.00 47.10  ? 713  ARG A CB  1 
ATOM 5552 C CG  . ARG A 1 716  ? -6.387  51.644 26.925  1.00 47.10  ? 713  ARG A CG  1 
ATOM 5553 C CD  . ARG A 1 716  ? -7.100  50.311 26.766  1.00 47.10  ? 713  ARG A CD  1 
ATOM 5554 N NE  . ARG A 1 716  ? -8.542  50.437 26.950  1.00 47.10  ? 713  ARG A NE  1 
ATOM 5555 C CZ  . ARG A 1 716  ? -9.113  51.079 27.964  1.00 47.10  ? 713  ARG A CZ  1 
ATOM 5556 N NH1 . ARG A 1 716  ? -8.363  51.658 28.891  1.00 47.10  ? 713  ARG A NH1 1 
ATOM 5557 N NH2 . ARG A 1 716  ? -10.435 51.143 28.051  1.00 47.10  ? 713  ARG A NH2 1 
ATOM 5558 N N   . THR A 1 717  ? -3.201  52.196 28.763  1.00 28.74  ? 714  THR A N   1 
ATOM 5559 C CA  . THR A 1 717  ? -3.041  51.813 30.205  1.00 28.74  ? 714  THR A CA  1 
ATOM 5560 C C   . THR A 1 717  ? -4.144  51.628 31.256  1.00 28.74  ? 714  THR A C   1 
ATOM 5561 O O   . THR A 1 717  ? -4.941  52.556 31.528  1.00 28.74  ? 714  THR A O   1 
ATOM 5562 C CB  . THR A 1 717  ? -2.285  53.066 30.637  1.00 19.78  ? 714  THR A CB  1 
ATOM 5563 O OG1 . THR A 1 717  ? -1.185  53.289 29.774  1.00 19.78  ? 714  THR A OG1 1 
ATOM 5564 C CG2 . THR A 1 717  ? -1.666  52.871 32.006  1.00 19.78  ? 714  THR A CG2 1 
ATOM 5565 N N   . VAL A 1 718  ? -4.125  50.464 31.899  1.00 29.04  ? 715  VAL A N   1 
ATOM 5566 C CA  . VAL A 1 718  ? -5.090  50.099 32.890  1.00 29.04  ? 715  VAL A CA  1 
ATOM 5567 C C   . VAL A 1 718  ? -4.341  50.124 34.204  1.00 29.04  ? 715  VAL A C   1 
ATOM 5568 O O   . VAL A 1 718  ? -3.675  49.169 34.552  1.00 29.04  ? 715  VAL A O   1 
ATOM 5569 C CB  . VAL A 1 718  ? -5.629  48.699 32.560  1.00 41.57  ? 715  VAL A CB  1 
ATOM 5570 C CG1 . VAL A 1 718  ? -6.579  48.166 33.623  1.00 41.57  ? 715  VAL A CG1 1 
ATOM 5571 C CG2 . VAL A 1 718  ? -6.287  48.748 31.199  1.00 41.57  ? 715  VAL A CG2 1 
ATOM 5572 N N   . PRO A 1 719  ? -4.383  51.244 34.909  1.00 19.66  ? 716  PRO A N   1 
ATOM 5573 C CA  . PRO A 1 719  ? -3.728  51.334 36.228  1.00 19.66  ? 716  PRO A CA  1 
ATOM 5574 C C   . PRO A 1 719  ? -4.211  50.274 37.205  1.00 19.66  ? 716  PRO A C   1 
ATOM 5575 O O   . PRO A 1 719  ? -5.366  50.287 37.592  1.00 19.66  ? 716  PRO A O   1 
ATOM 5576 C CB  . PRO A 1 719  ? -4.154  52.723 36.769  1.00 10.81  ? 716  PRO A CB  1 
ATOM 5577 C CG  . PRO A 1 719  ? -5.031  53.344 35.714  1.00 10.81  ? 716  PRO A CG  1 
ATOM 5578 C CD  . PRO A 1 719  ? -4.962  52.520 34.451  1.00 10.81  ? 716  PRO A CD  1 
ATOM 5579 N N   . LEU A 1 720  ? -3.354  49.369 37.646  1.00 28.25  ? 717  LEU A N   1 
ATOM 5580 C CA  . LEU A 1 720  ? -3.754  48.364 38.636  1.00 28.25  ? 717  LEU A CA  1 
ATOM 5581 C C   . LEU A 1 720  ? -3.404  48.763 40.061  1.00 28.25  ? 717  LEU A C   1 
ATOM 5582 O O   . LEU A 1 720  ? -3.953  48.222 41.020  1.00 28.25  ? 717  LEU A O   1 
ATOM 5583 C CB  . LEU A 1 720  ? -3.060  47.071 38.334  1.00 25.13  ? 717  LEU A CB  1 
ATOM 5584 C CG  . LEU A 1 720  ? -3.617  46.527 37.032  1.00 25.13  ? 717  LEU A CG  1 
ATOM 5585 C CD1 . LEU A 1 720  ? -2.572  45.595 36.370  1.00 25.13  ? 717  LEU A CD1 1 
ATOM 5586 C CD2 . LEU A 1 720  ? -4.944  45.781 37.355  1.00 25.13  ? 717  LEU A CD2 1 
ATOM 5587 N N   . TYR A 1 721  ? -2.490  49.724 40.226  1.00 29.14  ? 718  TYR A N   1 
ATOM 5588 C CA  . TYR A 1 721  ? -2.077  50.196 41.592  1.00 29.14  ? 718  TYR A CA  1 
ATOM 5589 C C   . TYR A 1 721  ? -1.386  49.052 42.398  1.00 29.14  ? 718  TYR A C   1 
ATOM 5590 O O   . TYR A 1 721  ? -0.973  49.245 43.505  1.00 29.14  ? 718  TYR A O   1 
ATOM 5591 C CB  . TYR A 1 721  ? -3.194  51.002 42.388  1.00 18.72  ? 718  TYR A CB  1 
ATOM 5592 C CG  . TYR A 1 721  ? -3.745  52.107 41.573  1.00 18.72  ? 718  TYR A CG  1 
ATOM 5593 C CD1 . TYR A 1 721  ? -4.929  51.918 40.894  1.00 18.72  ? 718  TYR A CD1 1 
ATOM 5594 C CD2 . TYR A 1 721  ? -3.003  53.293 41.396  1.00 18.72  ? 718  TYR A CD2 1 
ATOM 5595 C CE1 . TYR A 1 721  ? -5.364  52.867 40.088  1.00 18.72  ? 718  TYR A CE1 1 
ATOM 5596 C CE2 . TYR A 1 721  ? -3.453  54.257 40.578  1.00 18.72  ? 718  TYR A CE2 1 
ATOM 5597 C CZ  . TYR A 1 721  ? -4.647  54.051 39.944  1.00 18.72  ? 718  TYR A CZ  1 
ATOM 5598 O OH  . TYR A 1 721  ? -5.173  55.016 39.130  1.00 18.72  ? 718  TYR A OH  1 
ATOM 5599 N N   . GLU A 1 722  ? -1.198  47.864 41.842  1.00 70.15  ? 719  GLU A N   1 
ATOM 5600 C CA  . GLU A 1 722  ? -0.362  46.833 42.503  1.00 70.15  ? 719  GLU A CA  1 
ATOM 5601 C C   . GLU A 1 722  ? 0.422   46.099 41.404  1.00 70.15  ? 719  GLU A C   1 
ATOM 5602 O O   . GLU A 1 722  ? 0.288   46.444 40.221  1.00 70.15  ? 719  GLU A O   1 
ATOM 5603 C CB  . GLU A 1 722  ? -1.202  45.852 43.336  1.00 32.88  ? 719  GLU A CB  1 
ATOM 5604 C CG  . GLU A 1 722  ? -2.478  45.454 42.582  1.00 32.88  ? 719  GLU A CG  1 
ATOM 5605 C CD  . GLU A 1 722  ? -3.338  44.422 43.284  1.00 32.88  ? 719  GLU A CD  1 
ATOM 5606 O OE1 . GLU A 1 722  ? -3.339  43.295 42.756  1.00 32.88  ? 719  GLU A OE1 1 
ATOM 5607 O OE2 . GLU A 1 722  ? -4.039  44.738 44.300  1.00 32.88  ? 719  GLU A OE2 1 
ATOM 5608 N N   . SER A 1 723  ? 1.223   45.093 41.756  1.00 17.88  ? 720  SER A N   1 
ATOM 5609 C CA  . SER A 1 723  ? 2.117   44.527 40.755  1.00 17.88  ? 720  SER A CA  1 
ATOM 5610 C C   . SER A 1 723  ? 1.645   43.321 39.959  1.00 17.88  ? 720  SER A C   1 
ATOM 5611 O O   . SER A 1 723  ? 1.744   42.215 40.433  1.00 17.88  ? 720  SER A O   1 
ATOM 5612 C CB  . SER A 1 723  ? 3.469   44.221 41.372  1.00 28.90  ? 720  SER A CB  1 
ATOM 5613 O OG  . SER A 1 723  ? 3.299   43.670 42.651  1.00 28.90  ? 720  SER A OG  1 
ATOM 5614 N N   . PRO A 1 724  ? 1.234   43.512 38.701  1.00 12.31  ? 721  PRO A N   1 
ATOM 5615 C CA  . PRO A 1 724  ? 0.675   42.387 37.998  1.00 12.31  ? 721  PRO A CA  1 
ATOM 5616 C C   . PRO A 1 724  ? 1.771   41.333 37.774  1.00 12.31  ? 721  PRO A C   1 
ATOM 5617 O O   . PRO A 1 724  ? 2.960   41.678 37.576  1.00 12.31  ? 721  PRO A O   1 
ATOM 5618 C CB  . PRO A 1 724  ? 0.334   42.996 36.631  1.00 16.04  ? 721  PRO A CB  1 
ATOM 5619 C CG  . PRO A 1 724  ? 1.256   44.170 36.469  1.00 16.04  ? 721  PRO A CG  1 
ATOM 5620 C CD  . PRO A 1 724  ? 1.379   44.706 37.847  1.00 16.04  ? 721  PRO A CD  1 
ATOM 5621 N N   . ARG A 1 725  ? 1.429   40.051 37.746  1.00 36.44  ? 722  ARG A N   1 
ATOM 5622 C CA  . ARG A 1 725  ? 2.514   39.074 37.547  1.00 36.44  ? 722  ARG A CA  1 
ATOM 5623 C C   . ARG A 1 725  ? 2.426   38.188 36.323  1.00 36.44  ? 722  ARG A C   1 
ATOM 5624 O O   . ARG A 1 725  ? 3.419   37.993 35.624  1.00 36.44  ? 722  ARG A O   1 
ATOM 5625 C CB  . ARG A 1 725  ? 2.728   38.237 38.793  1.00 20.83  ? 722  ARG A CB  1 
ATOM 5626 C CG  . ARG A 1 725  ? 3.219   39.037 40.009  1.00 20.83  ? 722  ARG A CG  1 
ATOM 5627 C CD  . ARG A 1 725  ? 4.738   39.133 40.107  1.00 20.83  ? 722  ARG A CD  1 
ATOM 5628 N NE  . ARG A 1 725  ? 5.092   39.996 41.231  1.00 20.83  ? 722  ARG A NE  1 
ATOM 5629 C CZ  . ARG A 1 725  ? 5.184   39.599 42.499  1.00 20.83  ? 722  ARG A CZ  1 
ATOM 5630 N NH1 . ARG A 1 725  ? 5.003   38.319 42.814  1.00 20.83  ? 722  ARG A NH1 1 
ATOM 5631 N NH2 . ARG A 1 725  ? 5.465   40.469 43.452  1.00 20.83  ? 722  ARG A NH2 1 
ATOM 5632 N N   . LYS A 1 726  ? 1.249   37.641 36.061  1.00 20.00  ? 723  LYS A N   1 
ATOM 5633 C CA  . LYS A 1 726  ? 1.051   36.798 34.877  1.00 20.00  ? 723  LYS A CA  1 
ATOM 5634 C C   . LYS A 1 726  ? -0.271  37.185 34.261  1.00 20.00  ? 723  LYS A C   1 
ATOM 5635 O O   . LYS A 1 726  ? -1.142  37.773 34.955  1.00 20.00  ? 723  LYS A O   1 
ATOM 5636 C CB  . LYS A 1 726  ? 1.045   35.319 35.248  1.00 29.85  ? 723  LYS A CB  1 
ATOM 5637 C CG  . LYS A 1 726  ? 2.429   34.762 35.594  1.00 29.85  ? 723  LYS A CG  1 
ATOM 5638 C CD  . LYS A 1 726  ? 3.393   34.913 34.396  1.00 29.85  ? 723  LYS A CD  1 
ATOM 5639 C CE  . LYS A 1 726  ? 4.107   33.622 34.005  1.00 29.85  ? 723  LYS A CE  1 
ATOM 5640 N NZ  . LYS A 1 726  ? 4.990   33.218 35.150  1.00 29.85  ? 723  LYS A NZ  1 
ATOM 5641 N N   . ILE A 1 727  ? -0.457  36.851 32.986  1.00 18.68  ? 724  ILE A N   1 
ATOM 5642 C CA  . ILE A 1 727  ? -1.666  37.241 32.340  1.00 18.68  ? 724  ILE A CA  1 
ATOM 5643 C C   . ILE A 1 727  ? -2.118  36.235 31.285  1.00 18.68  ? 724  ILE A C   1 
ATOM 5644 O O   . ILE A 1 727  ? -1.309  35.850 30.435  1.00 18.68  ? 724  ILE A O   1 
ATOM 5645 C CB  . ILE A 1 727  ? -1.525  38.644 31.718  1.00 15.12  ? 724  ILE A CB  1 
ATOM 5646 C CG1 . ILE A 1 727  ? -2.871  39.080 31.136  1.00 15.12  ? 724  ILE A CG1 1 
ATOM 5647 C CG2 . ILE A 1 727  ? -0.541  38.639 30.567  1.00 15.12  ? 724  ILE A CG2 1 
ATOM 5648 C CD1 . ILE A 1 727  ? -3.229  40.483 31.424  1.00 15.12  ? 724  ILE A CD1 1 
ATOM 5649 N N   . CYS A 1 728  ? -3.412  35.857 31.335  1.00 33.03  ? 725  CYS A N   1 
ATOM 5650 C CA  . CYS A 1 728  ? -4.108  34.955 30.363  1.00 33.03  ? 725  CYS A CA  1 
ATOM 5651 C C   . CYS A 1 728  ? -5.427  35.473 29.746  1.00 33.03  ? 725  CYS A C   1 
ATOM 5652 O O   . CYS A 1 728  ? -6.259  36.112 30.442  1.00 33.03  ? 725  CYS A O   1 
ATOM 5653 C CB  . CYS A 1 728  ? -4.515  33.691 31.060  1.00 62.99  ? 725  CYS A CB  1 
ATOM 5654 S SG  . CYS A 1 728  ? -3.202  32.698 31.171  1.00 62.99  ? 725  CYS A SG  1 
ATOM 5655 N N   . TYR A 1 729  ? -5.656  35.080 28.494  1.00 50.34  ? 726  TYR A N   1 
ATOM 5656 C CA  . TYR A 1 729  ? -6.910  35.336 27.836  1.00 50.34  ? 726  TYR A CA  1 
ATOM 5657 C C   . TYR A 1 729  ? -7.871  34.112 27.656  1.00 50.34  ? 726  TYR A C   1 
ATOM 5658 O O   . TYR A 1 729  ? -7.659  33.236 26.817  1.00 50.34  ? 726  TYR A O   1 
ATOM 5659 C CB  . TYR A 1 729  ? -6.653  36.059 26.522  1.00 40.40  ? 726  TYR A CB  1 
ATOM 5660 C CG  . TYR A 1 729  ? -7.913  36.432 25.809  1.00 40.40  ? 726  TYR A CG  1 
ATOM 5661 C CD1 . TYR A 1 729  ? -8.870  37.251 26.417  1.00 40.40  ? 726  TYR A CD1 1 
ATOM 5662 C CD2 . TYR A 1 729  ? -8.172  35.952 24.535  1.00 40.40  ? 726  TYR A CD2 1 
ATOM 5663 C CE1 . TYR A 1 729  ? -10.044 37.604 25.752  1.00 40.40  ? 726  TYR A CE1 1 
ATOM 5664 C CE2 . TYR A 1 729  ? -9.332  36.295 23.859  1.00 40.40  ? 726  TYR A CE2 1 
ATOM 5665 C CZ  . TYR A 1 729  ? -10.278 37.117 24.463  1.00 40.40  ? 726  TYR A CZ  1 
ATOM 5666 O OH  . TYR A 1 729  ? -11.451 37.428 23.782  1.00 40.40  ? 726  TYR A OH  1 
ATOM 5667 N N   . GLN A 1 730  ? -8.946  34.094 28.446  1.00 28.63  ? 727  GLN A N   1 
ATOM 5668 C CA  . GLN A 1 730  ? -10.060 33.153 28.286  1.00 28.63  ? 727  GLN A CA  1 
ATOM 5669 C C   . GLN A 1 730  ? -11.153 33.718 27.347  1.00 28.63  ? 727  GLN A C   1 
ATOM 5670 O O   . GLN A 1 730  ? -12.131 34.385 27.777  1.00 28.63  ? 727  GLN A O   1 
ATOM 5671 C CB  . GLN A 1 730  ? -10.645 32.843 29.664  1.00 45.36  ? 727  GLN A CB  1 
ATOM 5672 C CG  . GLN A 1 730  ? -11.481 31.591 29.767  1.00 45.36  ? 727  GLN A CG  1 
ATOM 5673 C CD  . GLN A 1 730  ? -11.498 31.034 31.188  1.00 45.36  ? 727  GLN A CD  1 
ATOM 5674 O OE1 . GLN A 1 730  ? -10.499 30.466 31.649  1.00 45.36  ? 727  GLN A OE1 1 
ATOM 5675 N NE2 . GLN A 1 730  ? -12.631 31.195 31.891  1.00 45.36  ? 727  GLN A NE2 1 
ATOM 5676 N N   . GLU A 1 731  ? -11.000 33.444 26.056  1.00 54.47  ? 728  GLU A N   1 
ATOM 5677 C CA  . GLU A 1 731  ? -11.929 33.962 25.061  1.00 54.47  ? 728  GLU A CA  1 
ATOM 5678 C C   . GLU A 1 731  ? -13.405 33.640 25.337  1.00 54.47  ? 728  GLU A C   1 
ATOM 5679 O O   . GLU A 1 731  ? -14.233 34.558 25.375  1.00 54.47  ? 728  GLU A O   1 
ATOM 5680 C CB  . GLU A 1 731  ? -11.547 33.483 23.683  1.00 85.65  ? 728  GLU A CB  1 
ATOM 5681 C CG  . GLU A 1 731  ? -12.270 34.213 22.611  1.00 85.65  ? 728  GLU A CG  1 
ATOM 5682 C CD  . GLU A 1 731  ? -12.458 33.343 21.428  1.00 85.65  ? 728  GLU A CD  1 
ATOM 5683 O OE1 . GLU A 1 731  ? -12.296 33.847 20.301  1.00 85.65  ? 728  GLU A OE1 1 
ATOM 5684 O OE2 . GLU A 1 731  ? -12.746 32.147 21.637  1.00 85.65  ? 728  GLU A OE2 1 
ATOM 5685 N N   . VAL A 1 732  ? -13.755 32.364 25.539  1.00 51.89  ? 729  VAL A N   1 
ATOM 5686 C CA  . VAL A 1 732  ? -15.176 32.048 25.798  1.00 51.89  ? 729  VAL A CA  1 
ATOM 5687 C C   . VAL A 1 732  ? -15.793 33.007 26.797  1.00 51.89  ? 729  VAL A C   1 
ATOM 5688 O O   . VAL A 1 732  ? -16.947 33.417 26.641  1.00 51.89  ? 729  VAL A O   1 
ATOM 5689 C CB  . VAL A 1 732  ? -15.450 30.594 26.261  1.00 40.25  ? 729  VAL A CB  1 
ATOM 5690 C CG1 . VAL A 1 732  ? -15.179 29.637 25.105  1.00 40.25  ? 729  VAL A CG1 1 
ATOM 5691 C CG2 . VAL A 1 732  ? -14.674 30.240 27.516  1.00 40.25  ? 729  VAL A CG2 1 
ATOM 5692 N N   . SER A 1 733  ? -14.993 33.378 27.793  1.00 38.42  ? 730  SER A N   1 
ATOM 5693 C CA  . SER A 1 733  ? -15.448 34.205 28.898  1.00 38.42  ? 730  SER A CA  1 
ATOM 5694 C C   . SER A 1 733  ? -15.232 35.685 28.633  1.00 38.42  ? 730  SER A C   1 
ATOM 5695 O O   . SER A 1 733  ? -15.533 36.501 29.482  1.00 38.42  ? 730  SER A O   1 
ATOM 5696 C CB  . SER A 1 733  ? -14.724 33.800 30.172  1.00 49.50  ? 730  SER A CB  1 
ATOM 5697 O OG  . SER A 1 733  ? -14.503 32.403 30.178  1.00 49.50  ? 730  SER A OG  1 
ATOM 5698 N N   . GLN A 1 734  ? -14.703 36.016 27.456  1.00 51.98  ? 731  GLN A N   1 
ATOM 5699 C CA  . GLN A 1 734  ? -14.419 37.401 27.070  1.00 51.98  ? 731  GLN A CA  1 
ATOM 5700 C C   . GLN A 1 734  ? -13.683 38.226 28.144  1.00 51.98  ? 731  GLN A C   1 
ATOM 5701 O O   . GLN A 1 734  ? -13.924 39.424 28.301  1.00 51.98  ? 731  GLN A O   1 
ATOM 5702 C CB  . GLN A 1 734  ? -15.694 38.115 26.629  1.00 52.81  ? 731  GLN A CB  1 
ATOM 5703 C CG  . GLN A 1 734  ? -16.341 37.545 25.425  1.00 52.81  ? 731  GLN A CG  1 
ATOM 5704 C CD  . GLN A 1 734  ? -15.509 37.713 24.180  1.00 52.81  ? 731  GLN A CD  1 
ATOM 5705 O OE1 . GLN A 1 734  ? -15.418 38.812 23.603  1.00 52.81  ? 731  GLN A OE1 1 
ATOM 5706 N NE2 . GLN A 1 734  ? -14.907 36.608 23.729  1.00 52.81  ? 731  GLN A NE2 1 
ATOM 5707 N N   . CYS A 1 735  ? -12.773 37.583 28.862  1.00 35.72  ? 732  CYS A N   1 
ATOM 5708 C CA  . CYS A 1 735  ? -11.993 38.275 29.878  1.00 35.72  ? 732  CYS A CA  1 
ATOM 5709 C C   . CYS A 1 735  ? -10.514 37.793 30.050  1.00 35.72  ? 732  CYS A C   1 
ATOM 5710 O O   . CYS A 1 735  ? -10.062 36.788 29.456  1.00 35.72  ? 732  CYS A O   1 
ATOM 5711 C CB  . CYS A 1 735  ? -12.701 38.082 31.187  1.00 67.53  ? 732  CYS A CB  1 
ATOM 5712 S SG  . CYS A 1 735  ? -12.614 36.377 31.524  1.00 67.53  ? 732  CYS A SG  1 
ATOM 5713 N N   . PHE A 1 736  ? -9.784  38.499 30.906  1.00 40.08  ? 733  PHE A N   1 
ATOM 5714 C CA  . PHE A 1 736  ? -8.405  38.136 31.161  1.00 40.08  ? 733  PHE A CA  1 
ATOM 5715 C C   . PHE A 1 736  ? -8.261  37.649 32.595  1.00 40.08  ? 733  PHE A C   1 
ATOM 5716 O O   . PHE A 1 736  ? -8.972  38.151 33.473  1.00 40.08  ? 733  PHE A O   1 
ATOM 5717 C CB  . PHE A 1 736  ? -7.471  39.332 30.966  1.00 27.85  ? 733  PHE A CB  1 
ATOM 5718 C CG  . PHE A 1 736  ? -7.285  39.775 29.521  1.00 27.85  ? 733  PHE A CG  1 
ATOM 5719 C CD1 . PHE A 1 736  ? -7.844  40.988 29.064  1.00 27.85  ? 733  PHE A CD1 1 
ATOM 5720 C CD2 . PHE A 1 736  ? -6.542  39.034 28.642  1.00 27.85  ? 733  PHE A CD2 1 
ATOM 5721 C CE1 . PHE A 1 736  ? -7.649  41.427 27.724  1.00 27.85  ? 733  PHE A CE1 1 
ATOM 5722 C CE2 . PHE A 1 736  ? -6.353  39.459 27.316  1.00 27.85  ? 733  PHE A CE2 1 
ATOM 5723 C CZ  . PHE A 1 736  ? -6.892  40.654 26.860  1.00 27.85  ? 733  PHE A CZ  1 
ATOM 5724 N N   . GLY A 1 737  ? -7.371  36.670 32.836  1.00 25.89  ? 734  GLY A N   1 
ATOM 5725 C CA  . GLY A 1 737  ? -6.970  36.353 34.212  1.00 25.89  ? 734  GLY A CA  1 
ATOM 5726 C C   . GLY A 1 737  ? -5.623  37.004 34.475  1.00 25.89  ? 734  GLY A C   1 
ATOM 5727 O O   . GLY A 1 737  ? -4.776  37.028 33.594  1.00 25.89  ? 734  GLY A O   1 
ATOM 5728 N N   . VAL A 1 738  ? -5.411  37.556 35.660  1.00 20.52  ? 735  VAL A N   1 
ATOM 5729 C CA  . VAL A 1 738  ? -4.163  38.253 35.945  1.00 20.52  ? 735  VAL A CA  1 
ATOM 5730 C C   . VAL A 1 738  ? -3.779  37.953 37.377  1.00 20.52  ? 735  VAL A C   1 
ATOM 5731 O O   . VAL A 1 738  ? -4.603  38.137 38.299  1.00 20.52  ? 735  VAL A O   1 
ATOM 5732 C CB  . VAL A 1 738  ? -4.296  39.773 35.739  1.00 13.42  ? 735  VAL A CB  1 
ATOM 5733 C CG1 . VAL A 1 738  ? -3.317  40.541 36.568  1.00 13.42  ? 735  VAL A CG1 1 
ATOM 5734 C CG2 . VAL A 1 738  ? -4.108  40.111 34.284  1.00 13.42  ? 735  VAL A CG2 1 
ATOM 5735 N N   . LEU A 1 739  ? -2.554  37.444 37.570  1.00 23.65  ? 736  LEU A N   1 
ATOM 5736 C CA  . LEU A 1 739  ? -2.112  37.153 38.903  1.00 23.65  ? 736  LEU A CA  1 
ATOM 5737 C C   . LEU A 1 739  ? -1.537  38.456 39.368  1.00 23.65  ? 736  LEU A C   1 
ATOM 5738 O O   . LEU A 1 739  ? -0.876  39.117 38.585  1.00 23.65  ? 736  LEU A O   1 
ATOM 5739 C CB  . LEU A 1 739  ? -1.071  36.055 38.858  1.00 36.98  ? 736  LEU A CB  1 
ATOM 5740 C CG  . LEU A 1 739  ? -1.629  34.703 38.393  1.00 36.98  ? 736  LEU A CG  1 
ATOM 5741 C CD1 . LEU A 1 739  ? -0.619  33.583 38.739  1.00 36.98  ? 736  LEU A CD1 1 
ATOM 5742 C CD2 . LEU A 1 739  ? -2.974  34.466 39.088  1.00 36.98  ? 736  LEU A CD2 1 
ATOM 5743 N N   . SER A 1 740  ? -1.779  38.843 40.614  1.00 22.87  ? 737  SER A N   1 
ATOM 5744 C CA  . SER A 1 740  ? -1.405  40.158 41.075  1.00 22.87  ? 737  SER A CA  1 
ATOM 5745 C C   . SER A 1 740  ? -0.856  40.096 42.468  1.00 22.87  ? 737  SER A C   1 
ATOM 5746 O O   . SER A 1 740  ? -1.144  39.159 43.213  1.00 22.87  ? 737  SER A O   1 
ATOM 5747 C CB  . SER A 1 740  ? -2.616  41.090 41.024  1.00 58.48  ? 737  SER A CB  1 
ATOM 5748 O OG  . SER A 1 740  ? -3.508  40.862 42.101  1.00 58.48  ? 737  SER A OG  1 
ATOM 5749 N N   . SER A 1 741  ? -0.058  41.073 42.859  1.00 22.70  ? 738  SER A N   1 
ATOM 5750 C CA  . SER A 1 741  ? 0.496   40.984 44.194  1.00 22.70  ? 738  SER A CA  1 
ATOM 5751 C C   . SER A 1 741  ? 0.483   42.345 44.851  1.00 22.70  ? 738  SER A C   1 
ATOM 5752 O O   . SER A 1 741  ? 0.883   43.357 44.223  1.00 22.70  ? 738  SER A O   1 
ATOM 5753 C CB  . SER A 1 741  ? 1.915   40.432 44.178  1.00 34.86  ? 738  SER A CB  1 
ATOM 5754 O OG  . SER A 1 741  ? 2.551   40.789 45.397  1.00 34.86  ? 738  SER A OG  1 
ATOM 5755 N N   . ARG A 1 742  ? 0.002   42.389 46.091  1.00 17.37  ? 739  ARG A N   1 
ATOM 5756 C CA  . ARG A 1 742  ? -0.028  43.632 46.795  1.00 17.37  ? 739  ARG A CA  1 
ATOM 5757 C C   . ARG A 1 742  ? 0.781   43.457 48.062  1.00 17.37  ? 739  ARG A C   1 
ATOM 5758 O O   . ARG A 1 742  ? 0.915   42.325 48.554  1.00 17.37  ? 739  ARG A O   1 
ATOM 5759 C CB  . ARG A 1 742  ? -1.455  44.152 47.011  1.00 44.60  ? 739  ARG A CB  1 
ATOM 5760 C CG  . ARG A 1 742  ? -2.326  43.381 47.978  1.00 44.60  ? 739  ARG A CG  1 
ATOM 5761 C CD  . ARG A 1 742  ? -3.641  44.144 48.137  1.00 44.60  ? 739  ARG A CD  1 
ATOM 5762 N NE  . ARG A 1 742  ? -4.441  43.694 49.282  1.00 44.60  ? 739  ARG A NE  1 
ATOM 5763 C CZ  . ARG A 1 742  ? -5.282  42.664 49.261  1.00 44.60  ? 739  ARG A CZ  1 
ATOM 5764 N NH1 . ARG A 1 742  ? -5.445  41.958 48.150  1.00 44.60  ? 739  ARG A NH1 1 
ATOM 5765 N NH2 . ARG A 1 742  ? -5.960  42.337 50.345  1.00 44.60  ? 739  ARG A NH2 1 
ATOM 5766 N N   . ILE A 1 743  ? 1.376   44.553 48.526  1.00 38.30  ? 740  ILE A N   1 
ATOM 5767 C CA  . ILE A 1 743  ? 2.186   44.558 49.702  1.00 38.30  ? 740  ILE A CA  1 
ATOM 5768 C C   . ILE A 1 743  ? 1.311   45.008 50.840  1.00 38.30  ? 740  ILE A C   1 
ATOM 5769 O O   . ILE A 1 743  ? 0.340   45.720 50.631  1.00 38.30  ? 740  ILE A O   1 
ATOM 5770 C CB  . ILE A 1 743  ? 3.407   45.468 49.506  1.00 28.24  ? 740  ILE A CB  1 
ATOM 5771 C CG1 . ILE A 1 743  ? 4.599   44.621 49.055  1.00 28.24  ? 740  ILE A CG1 1 
ATOM 5772 C CG2 . ILE A 1 743  ? 3.820   46.170 50.791  1.00 28.24  ? 740  ILE A CG2 1 
ATOM 5773 C CD1 . ILE A 1 743  ? 5.332   45.225 47.919  1.00 28.24  ? 740  ILE A CD1 1 
ATOM 5774 N N   . GLU A 1 744  ? 1.635   44.554 52.051  1.00 49.17  ? 741  GLU A N   1 
ATOM 5775 C CA  . GLU A 1 744  ? 0.853   44.872 53.253  1.00 49.17  ? 741  GLU A CA  1 
ATOM 5776 C C   . GLU A 1 744  ? 1.768   44.913 54.437  1.00 49.17  ? 741  GLU A C   1 
ATOM 5777 O O   . GLU A 1 744  ? 2.836   44.324 54.386  1.00 49.17  ? 741  GLU A O   1 
ATOM 5778 C CB  . GLU A 1 744  ? -0.257  43.852 53.466  1.00 52.03  ? 741  GLU A CB  1 
ATOM 5779 C CG  . GLU A 1 744  ? -1.413  44.090 52.508  1.00 52.03  ? 741  GLU A CG  1 
ATOM 5780 C CD  . GLU A 1 744  ? -2.669  43.370 52.912  1.00 52.03  ? 741  GLU A CD  1 
ATOM 5781 O OE1 . GLU A 1 744  ? -2.691  42.771 54.020  1.00 52.03  ? 741  GLU A OE1 1 
ATOM 5782 O OE2 . GLU A 1 744  ? -3.630  43.402 52.102  1.00 52.03  ? 741  GLU A OE2 1 
ATOM 5783 N N   . VAL A 1 745  ? 1.374   45.614 55.494  1.00 52.89  ? 742  VAL A N   1 
ATOM 5784 C CA  . VAL A 1 745  ? 2.261   45.732 56.657  1.00 52.89  ? 742  VAL A CA  1 
ATOM 5785 C C   . VAL A 1 745  ? 1.678   45.108 57.919  1.00 52.89  ? 742  VAL A C   1 
ATOM 5786 O O   . VAL A 1 745  ? 0.450   45.021 58.075  1.00 52.89  ? 742  VAL A O   1 
ATOM 5787 C CB  . VAL A 1 745  ? 2.717   47.180 56.917  1.00 54.83  ? 742  VAL A CB  1 
ATOM 5788 C CG1 . VAL A 1 745  ? 3.460   47.751 55.677  1.00 54.83  ? 742  VAL A CG1 1 
ATOM 5789 C CG2 . VAL A 1 745  ? 1.519   48.031 57.293  1.00 54.83  ? 742  VAL A CG2 1 
ATOM 5790 N N   . GLN A 1 746  ? 2.579   44.637 58.787  1.00 89.99  ? 743  GLN A N   1 
ATOM 5791 C CA  . GLN A 1 746  ? 2.218   43.964 60.035  1.00 89.99  ? 743  GLN A CA  1 
ATOM 5792 C C   . GLN A 1 746  ? 1.347   44.882 60.879  1.00 89.99  ? 743  GLN A C   1 
ATOM 5793 O O   . GLN A 1 746  ? 1.698   46.039 61.128  1.00 89.99  ? 743  GLN A O   1 
ATOM 5794 C CB  . GLN A 1 746  ? 3.476   43.577 60.823  1.00 79.03  ? 743  GLN A CB  1 
ATOM 5795 C CG  . GLN A 1 746  ? 4.110   44.751 61.591  1.00 79.03  ? 743  GLN A CG  1 
ATOM 5796 C CD  . GLN A 1 746  ? 5.350   44.370 62.366  1.00 79.03  ? 743  GLN A CD  1 
ATOM 5797 O OE1 . GLN A 1 746  ? 6.300   45.144 62.456  1.00 79.03  ? 743  GLN A OE1 1 
ATOM 5798 N NE2 . GLN A 1 746  ? 5.347   43.176 62.936  1.00 79.03  ? 743  GLN A NE2 1 
ATOM 5799 N N   . ASP A 1 747  ? 0.207   44.364 61.309  1.00 134.74 ? 744  ASP A N   1 
ATOM 5800 C CA  . ASP A 1 747  ? -0.693  45.131 62.144  1.00 134.74 ? 744  ASP A CA  1 
ATOM 5801 C C   . ASP A 1 747  ? -0.251  45.003 63.584  1.00 134.74 ? 744  ASP A C   1 
ATOM 5802 O O   . ASP A 1 747  ? 0.620   44.181 63.898  1.00 134.74 ? 744  ASP A O   1 
ATOM 5803 C CB  . ASP A 1 747  ? -2.111  44.598 62.001  1.00 94.43  ? 744  ASP A CB  1 
ATOM 5804 C CG  . ASP A 1 747  ? -3.055  45.626 61.450  1.00 94.43  ? 744  ASP A CG  1 
ATOM 5805 O OD1 . ASP A 1 747  ? -2.601  46.751 61.168  1.00 94.43  ? 744  ASP A OD1 1 
ATOM 5806 O OD2 . ASP A 1 747  ? -4.245  45.307 61.283  1.00 94.43  ? 744  ASP A OD2 1 
ATOM 5807 N N   . THR A 1 748  ? -0.845  45.813 64.459  1.00 86.58  ? 745  THR A N   1 
ATOM 5808 C CA  . THR A 1 748  ? -0.625  45.651 65.906  1.00 86.58  ? 745  THR A CA  1 
ATOM 5809 C C   . THR A 1 748  ? -1.543  44.556 66.488  1.00 86.58  ? 745  THR A C   1 
ATOM 5810 O O   . THR A 1 748  ? -1.245  43.970 67.531  1.00 86.58  ? 745  THR A O   1 
ATOM 5811 C CB  . THR A 1 748  ? -0.783  46.965 66.665  1.00 74.61  ? 745  THR A CB  1 
ATOM 5812 O OG1 . THR A 1 748  ? -2.136  47.403 66.532  1.00 74.61  ? 745  THR A OG1 1 
ATOM 5813 C CG2 . THR A 1 748  ? 0.170   48.029 66.100  1.00 74.61  ? 745  THR A CG2 1 
ATOM 5814 N N   . SER A 1 749  ? -2.646  44.280 65.794  1.00 83.25  ? 746  SER A N   1 
ATOM 5815 C CA  . SER A 1 749  ? -3.370  43.014 65.952  1.00 83.25  ? 746  SER A CA  1 
ATOM 5816 C C   . SER A 1 749  ? -2.484  41.834 65.504  1.00 83.25  ? 746  SER A C   1 
ATOM 5817 O O   . SER A 1 749  ? -2.726  40.667 65.862  1.00 83.25  ? 746  SER A O   1 
ATOM 5818 C CB  . SER A 1 749  ? -4.632  43.036 65.097  1.00 124.13 ? 746  SER A CB  1 
ATOM 5819 O OG  . SER A 1 749  ? -4.294  42.954 63.722  1.00 124.13 ? 746  SER A OG  1 
ATOM 5820 N N   . GLY A 1 750  ? -1.471  42.165 64.701  1.00 80.71  ? 747  GLY A N   1 
ATOM 5821 C CA  . GLY A 1 750  ? -0.498  41.203 64.219  1.00 80.71  ? 747  GLY A CA  1 
ATOM 5822 C C   . GLY A 1 750  ? -0.800  40.888 62.777  1.00 80.71  ? 747  GLY A C   1 
ATOM 5823 O O   . GLY A 1 750  ? 0.070   40.409 62.043  1.00 80.71  ? 747  GLY A O   1 
ATOM 5824 N N   . GLY A 1 751  ? -2.038  41.171 62.372  1.00 113.45 ? 748  GLY A N   1 
ATOM 5825 C CA  . GLY A 1 751  ? -2.493  40.922 61.010  1.00 113.45 ? 748  GLY A CA  1 
ATOM 5826 C C   . GLY A 1 751  ? -1.804  41.809 59.995  1.00 113.45 ? 748  GLY A C   1 
ATOM 5827 O O   . GLY A 1 751  ? -0.816  42.482 60.299  1.00 113.45 ? 748  GLY A O   1 
ATOM 5828 N N   . THR A 1 752  ? -2.306  41.793 58.768  1.00 67.11  ? 749  THR A N   1 
ATOM 5829 C CA  . THR A 1 752  ? -1.804  42.723 57.751  1.00 67.11  ? 749  THR A CA  1 
ATOM 5830 C C   . THR A 1 752  ? -2.889  43.582 57.138  1.00 67.11  ? 749  THR A C   1 
ATOM 5831 O O   . THR A 1 752  ? -4.001  43.123 56.847  1.00 67.11  ? 749  THR A O   1 
ATOM 5832 C CB  . THR A 1 752  ? -0.898  42.079 56.656  1.00 37.03  ? 749  THR A CB  1 
ATOM 5833 O OG1 . THR A 1 752  ? -1.492  40.881 56.108  1.00 37.03  ? 749  THR A OG1 1 
ATOM 5834 C CG2 . THR A 1 752  ? 0.510   41.805 57.229  1.00 37.03  ? 749  THR A CG2 1 
ATOM 5835 N N   . THR A 1 753  ? -2.529  44.839 56.958  1.00 107.75 ? 750  THR A N   1 
ATOM 5836 C CA  . THR A 1 753  ? -3.458  45.858 56.565  1.00 107.75 ? 750  THR A CA  1 
ATOM 5837 C C   . THR A 1 753  ? -3.478  46.033 55.060  1.00 107.75 ? 750  THR A C   1 
ATOM 5838 O O   . THR A 1 753  ? -4.292  45.406 54.386  1.00 107.75 ? 750  THR A O   1 
ATOM 5839 C CB  . THR A 1 753  ? -3.086  47.165 57.229  1.00 100.53 ? 750  THR A CB  1 
ATOM 5840 O OG1 . THR A 1 753  ? -1.689  47.130 57.558  1.00 100.53 ? 750  THR A OG1 1 
ATOM 5841 C CG2 . THR A 1 753  ? -3.893  47.336 58.490  1.00 100.53 ? 750  THR A CG2 1 
ATOM 5842 N N   . ALA A 1 754  ? -2.566  46.864 54.549  1.00 80.29  ? 751  ALA A N   1 
ATOM 5843 C CA  . ALA A 1 754  ? -2.578  47.371 53.166  1.00 80.29  ? 751  ALA A CA  1 
ATOM 5844 C C   . ALA A 1 754  ? -2.209  48.843 53.195  1.00 80.29  ? 751  ALA A C   1 
ATOM 5845 O O   . ALA A 1 754  ? -2.557  49.556 54.136  1.00 80.29  ? 751  ALA A O   1 
ATOM 5846 C CB  . ALA A 1 754  ? -3.957  47.201 52.485  1.00 37.16  ? 751  ALA A CB  1 
ATOM 5847 N N   . LEU A 1 755  ? -1.545  49.309 52.144  1.00 42.58  ? 752  LEU A N   1 
ATOM 5848 C CA  . LEU A 1 755  ? -1.013  50.677 52.133  1.00 42.58  ? 752  LEU A CA  1 
ATOM 5849 C C   . LEU A 1 755  ? -1.836  51.659 51.298  1.00 42.58  ? 752  LEU A C   1 
ATOM 5850 O O   . LEU A 1 755  ? -1.711  52.879 51.463  1.00 42.58  ? 752  LEU A O   1 
ATOM 5851 C CB  . LEU A 1 755  ? 0.476   50.660 51.735  1.00 59.81  ? 752  LEU A CB  1 
ATOM 5852 C CG  . LEU A 1 755  ? 1.340   49.804 52.689  1.00 59.81  ? 752  LEU A CG  1 
ATOM 5853 C CD1 . LEU A 1 755  ? 2.777   49.517 52.161  1.00 59.81  ? 752  LEU A CD1 1 
ATOM 5854 C CD2 . LEU A 1 755  ? 1.352   50.380 54.136  1.00 59.81  ? 752  LEU A CD2 1 
ATOM 5855 N N   . ARG A 1 756  ? -2.698  51.095 50.444  1.00 29.30  ? 753  ARG A N   1 
ATOM 5856 C CA  . ARG A 1 756  ? -3.562  51.836 49.528  1.00 29.30  ? 753  ARG A CA  1 
ATOM 5857 C C   . ARG A 1 756  ? -4.572  50.887 48.833  1.00 29.30  ? 753  ARG A C   1 
ATOM 5858 O O   . ARG A 1 756  ? -4.340  49.676 48.733  1.00 29.30  ? 753  ARG A O   1 
ATOM 5859 C CB  . ARG A 1 756  ? -2.726  52.581 48.473  1.00 49.63  ? 753  ARG A CB  1 
ATOM 5860 C CG  . ARG A 1 756  ? -2.211  51.711 47.331  1.00 49.63  ? 753  ARG A CG  1 
ATOM 5861 C CD  . ARG A 1 756  ? -1.504  52.513 46.212  1.00 49.63  ? 753  ARG A CD  1 
ATOM 5862 N NE  . ARG A 1 756  ? -0.384  53.309 46.726  1.00 49.63  ? 753  ARG A NE  1 
ATOM 5863 C CZ  . ARG A 1 756  ? 0.727   52.797 47.262  1.00 49.63  ? 753  ARG A CZ  1 
ATOM 5864 N NH1 . ARG A 1 756  ? 0.878   51.475 47.363  1.00 49.63  ? 753  ARG A NH1 1 
ATOM 5865 N NH2 . ARG A 1 756  ? 1.683   53.614 47.708  1.00 49.63  ? 753  ARG A NH2 1 
ATOM 5866 N N   . PRO A 1 757  ? -5.680  51.447 48.310  1.00 41.55  ? 754  PRO A N   1 
ATOM 5867 C CA  . PRO A 1 757  ? -6.595  50.660 47.506  1.00 41.55  ? 754  PRO A CA  1 
ATOM 5868 C C   . PRO A 1 757  ? -5.905  50.209 46.224  1.00 41.55  ? 754  PRO A C   1 
ATOM 5869 O O   . PRO A 1 757  ? -5.277  51.017 45.551  1.00 41.55  ? 754  PRO A O   1 
ATOM 5870 C CB  . PRO A 1 757  ? -7.703  51.685 47.154  1.00 28.68  ? 754  PRO A CB  1 
ATOM 5871 C CG  . PRO A 1 757  ? -6.980  52.983 47.125  1.00 28.68  ? 754  PRO A CG  1 
ATOM 5872 C CD  . PRO A 1 757  ? -6.124  52.853 48.383  1.00 28.68  ? 754  PRO A CD  1 
ATOM 5873 N N   . SER A 1 758  ? -6.042  48.932 45.892  1.00 41.07  ? 755  SER A N   1 
ATOM 5874 C CA  . SER A 1 758  ? -5.434  48.345 44.694  1.00 41.07  ? 755  SER A CA  1 
ATOM 5875 C C   . SER A 1 758  ? -6.530  47.732 43.880  1.00 41.07  ? 755  SER A C   1 
ATOM 5876 O O   . SER A 1 758  ? -7.674  47.683 44.324  1.00 41.07  ? 755  SER A O   1 
ATOM 5877 C CB  . SER A 1 758  ? -4.527  47.206 45.111  1.00 29.92  ? 755  SER A CB  1 
ATOM 5878 O OG  . SER A 1 758  ? -4.236  47.302 46.491  1.00 29.92  ? 755  SER A OG  1 
ATOM 5879 N N   . ALA A 1 759  ? -6.178  47.210 42.719  1.00 35.00  ? 756  ALA A N   1 
ATOM 5880 C CA  . ALA A 1 759  ? -7.144  46.499 41.921  1.00 35.00  ? 756  ALA A CA  1 
ATOM 5881 C C   . ALA A 1 759  ? -7.769  45.296 42.590  1.00 35.00  ? 756  ALA A C   1 
ATOM 5882 O O   . ALA A 1 759  ? -8.847  44.877 42.181  1.00 35.00  ? 756  ALA A O   1 
ATOM 5883 C CB  . ALA A 1 759  ? -6.538  46.062 40.665  1.00 2.00   ? 756  ALA A CB  1 
ATOM 5884 N N   . SER A 1 760  ? -7.110  44.693 43.572  1.00 38.33  ? 757  SER A N   1 
ATOM 5885 C CA  . SER A 1 760  ? -7.716  43.520 44.216  1.00 38.33  ? 757  SER A CA  1 
ATOM 5886 C C   . SER A 1 760  ? -8.667  43.886 45.405  1.00 38.33  ? 757  SER A C   1 
ATOM 5887 O O   . SER A 1 760  ? -9.477  43.083 45.856  1.00 38.33  ? 757  SER A O   1 
ATOM 5888 C CB  . SER A 1 760  ? -6.611  42.559 44.646  1.00 29.83  ? 757  SER A CB  1 
ATOM 5889 O OG  . SER A 1 760  ? -5.804  43.122 45.681  1.00 29.83  ? 757  SER A OG  1 
ATOM 5890 N N   . THR A 1 761  ? -8.547  45.103 45.909  1.00 32.96  ? 758  THR A N   1 
ATOM 5891 C CA  . THR A 1 761  ? -9.368  45.552 47.019  1.00 32.96  ? 758  THR A CA  1 
ATOM 5892 C C   . THR A 1 761  ? -10.615 46.341 46.518  1.00 32.96  ? 758  THR A C   1 
ATOM 5893 O O   . THR A 1 761  ? -11.619 46.478 47.220  1.00 32.96  ? 758  THR A O   1 
ATOM 5894 C CB  . THR A 1 761  ? -8.560  46.467 47.951  1.00 32.04  ? 758  THR A CB  1 
ATOM 5895 O OG1 . THR A 1 761  ? -8.348  47.725 47.295  1.00 32.04  ? 758  THR A OG1 1 
ATOM 5896 C CG2 . THR A 1 761  ? -7.209  45.859 48.318  1.00 32.04  ? 758  THR A CG2 1 
ATOM 5897 N N   . GLN A 1 762  ? -10.520 46.892 45.320  1.00 33.40  ? 759  GLN A N   1 
ATOM 5898 C CA  . GLN A 1 762  ? -11.580 47.682 44.740  1.00 33.40  ? 759  GLN A CA  1 
ATOM 5899 C C   . GLN A 1 762  ? -12.278 46.773 43.746  1.00 33.40  ? 759  GLN A C   1 
ATOM 5900 O O   . GLN A 1 762  ? -13.059 47.248 42.905  1.00 33.40  ? 759  GLN A O   1 
ATOM 5901 C CB  . GLN A 1 762  ? -11.021 48.907 44.014  1.00 71.34  ? 759  GLN A CB  1 
ATOM 5902 C CG  . GLN A 1 762  ? -10.147 49.770 44.861  1.00 71.34  ? 759  GLN A CG  1 
ATOM 5903 C CD  . GLN A 1 762  ? -10.865 50.203 46.104  1.00 71.34  ? 759  GLN A CD  1 
ATOM 5904 O OE1 . GLN A 1 762  ? -10.536 49.773 47.220  1.00 71.34  ? 759  GLN A OE1 1 
ATOM 5905 N NE2 . GLN A 1 762  ? -11.880 51.045 45.925  1.00 71.34  ? 759  GLN A NE2 1 
ATOM 5906 N N   . ALA A 1 763  ? -11.967 45.472 43.822  1.00 36.22  ? 760  ALA A N   1 
ATOM 5907 C CA  . ALA A 1 763  ? -12.601 44.422 42.991  1.00 36.22  ? 760  ALA A CA  1 
ATOM 5908 C C   . ALA A 1 763  ? -14.163 44.493 42.987  1.00 36.22  ? 760  ALA A C   1 
ATOM 5909 O O   . ALA A 1 763  ? -14.752 44.781 44.040  1.00 36.22  ? 760  ALA A O   1 
ATOM 5910 C CB  . ALA A 1 763  ? -12.147 43.088 43.523  1.00 42.23  ? 760  ALA A CB  1 
ATOM 5911 N N   . LEU A 1 764  ? -14.833 44.239 41.854  1.00 64.65  ? 761  LEU A N   1 
ATOM 5912 C CA  . LEU A 1 764  ? -16.314 44.382 41.827  1.00 64.65  ? 761  LEU A CA  1 
ATOM 5913 C C   . LEU A 1 764  ? -17.014 43.393 42.736  1.00 64.65  ? 761  LEU A C   1 
ATOM 5914 O O   . LEU A 1 764  ? -17.945 43.752 43.455  1.00 64.65  ? 761  LEU A O   1 
ATOM 5915 C CB  . LEU A 1 764  ? -16.920 44.339 40.412  1.00 47.34  ? 761  LEU A CB  1 
ATOM 5916 C CG  . LEU A 1 764  ? -16.555 45.552 39.531  1.00 47.34  ? 761  LEU A CG  1 
ATOM 5917 C CD1 . LEU A 1 764  ? -17.194 45.509 38.149  1.00 47.34  ? 761  LEU A CD1 1 
ATOM 5918 C CD2 . LEU A 1 764  ? -16.833 46.888 40.247  1.00 47.34  ? 761  LEU A CD2 1 
ATOM 5919 N N   . SER A 1 765  ? -16.547 42.154 42.686  1.00 69.42  ? 762  SER A N   1 
ATOM 5920 C CA  . SER A 1 765  ? -16.908 41.109 43.633  1.00 69.42  ? 762  SER A CA  1 
ATOM 5921 C C   . SER A 1 765  ? -15.592 40.527 44.130  1.00 69.42  ? 762  SER A C   1 
ATOM 5922 O O   . SER A 1 765  ? -14.532 41.087 43.849  1.00 69.42  ? 762  SER A O   1 
ATOM 5923 C CB  . SER A 1 765  ? -17.707 40.032 42.930  1.00 51.52  ? 762  SER A CB  1 
ATOM 5924 O OG  . SER A 1 765  ? -16.995 39.582 41.795  1.00 51.52  ? 762  SER A OG  1 
ATOM 5925 N N   . SER A 1 766  ? -15.637 39.404 44.845  1.00 57.38  ? 763  SER A N   1 
ATOM 5926 C CA  . SER A 1 766  ? -14.426 38.907 45.478  1.00 57.38  ? 763  SER A CA  1 
ATOM 5927 C C   . SER A 1 766  ? -14.596 37.601 46.263  1.00 57.38  ? 763  SER A C   1 
ATOM 5928 O O   . SER A 1 766  ? -15.697 37.107 46.429  1.00 57.38  ? 763  SER A O   1 
ATOM 5929 C CB  . SER A 1 766  ? -13.844 40.006 46.358  1.00 30.42  ? 763  SER A CB  1 
ATOM 5930 O OG  . SER A 1 766  ? -14.445 39.997 47.626  1.00 30.42  ? 763  SER A OG  1 
ATOM 5931 N N   . SER A 1 767  ? -13.498 37.035 46.741  1.00 31.69  ? 764  SER A N   1 
ATOM 5932 C CA  . SER A 1 767  ? -13.536 35.731 47.406  1.00 31.69  ? 764  SER A CA  1 
ATOM 5933 C C   . SER A 1 767  ? -12.183 35.388 47.917  1.00 31.69  ? 764  SER A C   1 
ATOM 5934 O O   . SER A 1 767  ? -11.215 35.933 47.417  1.00 31.69  ? 764  SER A O   1 
ATOM 5935 C CB  . SER A 1 767  ? -13.977 34.616 46.447  1.00 30.08  ? 764  SER A CB  1 
ATOM 5936 O OG  . SER A 1 767  ? -13.334 34.700 45.225  1.00 30.08  ? 764  SER A OG  1 
ATOM 5937 N N   . VAL A 1 768  ? -12.108 34.500 48.904  1.00 45.36  ? 765  VAL A N   1 
ATOM 5938 C CA  . VAL A 1 768  ? -10.821 34.057 49.421  1.00 45.36  ? 765  VAL A CA  1 
ATOM 5939 C C   . VAL A 1 768  ? -10.710 32.534 49.391  1.00 45.36  ? 765  VAL A C   1 
ATOM 5940 O O   . VAL A 1 768  ? -11.706 31.840 49.198  1.00 45.36  ? 765  VAL A O   1 
ATOM 5941 C CB  . VAL A 1 768  ? -10.642 34.457 50.834  1.00 31.26  ? 765  VAL A CB  1 
ATOM 5942 C CG1 . VAL A 1 768  ? -11.355 33.424 51.706  1.00 31.26  ? 765  VAL A CG1 1 
ATOM 5943 C CG2 . VAL A 1 768  ? -9.152  34.470 51.173  1.00 31.26  ? 765  VAL A CG2 1 
ATOM 5944 N N   . SER A 1 769  ? -9.492  32.023 49.577  1.00 50.91  ? 766  SER A N   1 
ATOM 5945 C CA  . SER A 1 769  ? -9.285  30.579 49.604  1.00 50.91  ? 766  SER A CA  1 
ATOM 5946 C C   . SER A 1 769  ? -9.718  30.079 50.955  1.00 50.91  ? 766  SER A C   1 
ATOM 5947 O O   . SER A 1 769  ? -9.418  30.689 51.982  1.00 50.91  ? 766  SER A O   1 
ATOM 5948 C CB  . SER A 1 769  ? -7.830  30.172 49.257  1.00 44.06  ? 766  SER A CB  1 
ATOM 5949 O OG  . SER A 1 769  ? -7.710  29.734 47.884  1.00 44.06  ? 766  SER A OG  1 
ATOM 5950 N N   . SER A 1 770  ? -10.485 28.999 50.928  1.00 57.44  ? 767  SER A N   1 
ATOM 5951 C CA  . SER A 1 770  ? -10.876 28.319 52.152  1.00 57.44  ? 767  SER A CA  1 
ATOM 5952 C C   . SER A 1 770  ? -9.885  27.190 52.418  1.00 57.44  ? 767  SER A C   1 
ATOM 5953 O O   . SER A 1 770  ? -9.233  27.178 53.467  1.00 57.44  ? 767  SER A O   1 
ATOM 5954 C CB  . SER A 1 770  ? -12.303 27.798 52.040  1.00 44.90  ? 767  SER A CB  1 
ATOM 5955 O OG  . SER A 1 770  ? -12.475 27.238 50.762  1.00 44.90  ? 767  SER A OG  1 
ATOM 5956 N N   . SER A 1 771  ? -9.763  26.278 51.449  1.00 56.75  ? 768  SER A N   1 
ATOM 5957 C CA  . SER A 1 771  ? -8.737  25.207 51.440  1.00 56.75  ? 768  SER A CA  1 
ATOM 5958 C C   . SER A 1 771  ? -7.870  25.032 52.697  1.00 56.75  ? 768  SER A C   1 
ATOM 5959 O O   . SER A 1 771  ? -7.314  25.990 53.229  1.00 56.75  ? 768  SER A O   1 
ATOM 5960 C CB  . SER A 1 771  ? -7.824  25.339 50.218  1.00 51.25  ? 768  SER A CB  1 
ATOM 5961 O OG  . SER A 1 771  ? -6.609  24.620 50.423  1.00 51.25  ? 768  SER A OG  1 
ATOM 5962 N N   . LYS A 1 772  ? -7.739  23.789 53.144  1.00 73.47  ? 769  LYS A N   1 
ATOM 5963 C CA  . LYS A 1 772  ? -7.111  23.508 54.433  1.00 73.47  ? 769  LYS A CA  1 
ATOM 5964 C C   . LYS A 1 772  ? -5.847  22.652 54.316  1.00 73.47  ? 769  LYS A C   1 
ATOM 5965 O O   . LYS A 1 772  ? -5.346  22.153 55.329  1.00 73.47  ? 769  LYS A O   1 
ATOM 5966 C CB  . LYS A 1 772  ? -8.119  22.811 55.363  1.00 94.97  ? 769  LYS A CB  1 
ATOM 5967 C CG  . LYS A 1 772  ? -9.421  23.569 55.600  1.00 94.97  ? 769  LYS A CG  1 
ATOM 5968 C CD  . LYS A 1 772  ? -9.280  24.581 56.722  1.00 94.97  ? 769  LYS A CD  1 
ATOM 5969 C CE  . LYS A 1 772  ? -10.365 25.634 56.649  1.00 94.97  ? 769  LYS A CE  1 
ATOM 5970 N NZ  . LYS A 1 772  ? -10.024 26.800 57.520  1.00 94.97  ? 769  LYS A NZ  1 
ATOM 5971 N N   . LEU A 1 773  ? -5.333  22.485 53.099  1.00 76.49  ? 770  LEU A N   1 
ATOM 5972 C CA  . LEU A 1 773  ? -4.194  21.602 52.850  1.00 76.49  ? 770  LEU A CA  1 
ATOM 5973 C C   . LEU A 1 773  ? -3.009  21.737 53.805  1.00 76.49  ? 770  LEU A C   1 
ATOM 5974 O O   . LEU A 1 773  ? -2.249  20.777 53.970  1.00 76.49  ? 770  LEU A O   1 
ATOM 5975 C CB  . LEU A 1 773  ? -3.681  21.762 51.428  1.00 68.66  ? 770  LEU A CB  1 
ATOM 5976 C CG  . LEU A 1 773  ? -4.635  21.524 50.260  1.00 68.66  ? 770  LEU A CG  1 
ATOM 5977 C CD1 . LEU A 1 773  ? -3.812  21.338 48.999  1.00 68.66  ? 770  LEU A CD1 1 
ATOM 5978 C CD2 . LEU A 1 773  ? -5.558  20.337 50.470  1.00 68.66  ? 770  LEU A CD2 1 
ATOM 5979 N N   . PHE A 1 774  ? -2.845  22.910 54.422  1.00 80.24  ? 771  PHE A N   1 
ATOM 5980 C CA  . PHE A 1 774  ? -1.734  23.155 55.352  1.00 80.24  ? 771  PHE A CA  1 
ATOM 5981 C C   . PHE A 1 774  ? -2.200  23.446 56.799  1.00 80.24  ? 771  PHE A C   1 
ATOM 5982 O O   . PHE A 1 774  ? -3.393  23.334 57.103  1.00 80.24  ? 771  PHE A O   1 
ATOM 5983 C CB  . PHE A 1 774  ? -0.801  24.233 54.774  1.00 67.60  ? 771  PHE A CB  1 
ATOM 5984 C CG  . PHE A 1 774  ? -0.508  24.044 53.295  1.00 67.60  ? 771  PHE A CG  1 
ATOM 5985 C CD1 . PHE A 1 774  ? -1.056  24.890 52.346  1.00 67.60  ? 771  PHE A CD1 1 
ATOM 5986 C CD2 . PHE A 1 774  ? 0.291   22.991 52.850  1.00 67.60  ? 771  PHE A CD2 1 
ATOM 5987 C CE1 . PHE A 1 774  ? -0.808  24.688 50.970  1.00 67.60  ? 771  PHE A CE1 1 
ATOM 5988 C CE2 . PHE A 1 774  ? 0.538   22.788 51.489  1.00 67.60  ? 771  PHE A CE2 1 
ATOM 5989 C CZ  . PHE A 1 774  ? -0.015  23.636 50.551  1.00 67.60  ? 771  PHE A CZ  1 
ATOM 5990 N N   . SER A 1 775  ? -1.268  23.759 57.702  1.00 201.00 ? 772  SER A N   1 
ATOM 5991 C CA  . SER A 1 775  ? -1.609  24.001 59.119  1.00 201.00 ? 772  SER A CA  1 
ATOM 5992 C C   . SER A 1 775  ? -0.588  24.860 59.850  1.00 201.00 ? 772  SER A C   1 
ATOM 5993 O O   . SER A 1 775  ? -0.951  25.845 60.495  1.00 201.00 ? 772  SER A O   1 
ATOM 5994 C CB  . SER A 1 775  ? -1.826  22.684 59.882  1.00 63.75  ? 772  SER A CB  1 
ATOM 5995 O OG  . SER A 1 775  ? -2.979  22.021 59.373  1.00 63.75  ? 772  SER A OG  1 
ATOM 5996 N N   . SER A 1 776  ? 0.681   24.470 59.755  1.00 188.92 ? 773  SER A N   1 
ATOM 5997 C CA  . SER A 1 776  ? 1.787   25.215 60.355  1.00 188.92 ? 773  SER A CA  1 
ATOM 5998 C C   . SER A 1 776  ? 2.002   26.541 59.631  1.00 188.92 ? 773  SER A C   1 
ATOM 5999 O O   . SER A 1 776  ? 1.715   26.659 58.438  1.00 188.92 ? 773  SER A O   1 
ATOM 6000 C CB  . SER A 1 776  ? 3.063   24.387 60.276  1.00 82.49  ? 773  SER A CB  1 
ATOM 6001 O OG  . SER A 1 776  ? 3.240   23.893 58.955  1.00 82.49  ? 773  SER A OG  1 
ATOM 6002 N N   . GLY A 1 786  ? 4.731   47.209 59.889  1.00 111.74 ? 783  GLY A N   1 
ATOM 6003 C CA  . GLY A 1 786  ? 6.188   47.136 59.888  1.00 111.74 ? 783  GLY A CA  1 
ATOM 6004 C C   . GLY A 1 786  ? 6.707   46.046 58.967  1.00 111.74 ? 783  GLY A C   1 
ATOM 6005 O O   . GLY A 1 786  ? 7.146   46.320 57.855  1.00 111.74 ? 783  GLY A O   1 
ATOM 6006 N N   . GLU A 1 787  ? 6.671   44.808 59.441  1.00 70.82  ? 784  GLU A N   1 
ATOM 6007 C CA  . GLU A 1 787  ? 6.987   43.639 58.624  1.00 70.82  ? 784  GLU A CA  1 
ATOM 6008 C C   . GLU A 1 787  ? 6.113   43.635 57.343  1.00 70.82  ? 784  GLU A C   1 
ATOM 6009 O O   . GLU A 1 787  ? 4.877   43.783 57.402  1.00 70.82  ? 784  GLU A O   1 
ATOM 6010 C CB  . GLU A 1 787  ? 6.819   42.350 59.466  1.00 111.73 ? 784  GLU A CB  1 
ATOM 6011 C CG  . GLU A 1 787  ? 7.801   42.247 60.691  1.00 111.73 ? 784  GLU A CG  1 
ATOM 6012 C CD  . GLU A 1 787  ? 7.339   41.330 61.854  1.00 111.73 ? 784  GLU A CD  1 
ATOM 6013 O OE1 . GLU A 1 787  ? 8.135   41.138 62.799  1.00 111.73 ? 784  GLU A OE1 1 
ATOM 6014 O OE2 . GLU A 1 787  ? 6.196   40.815 61.845  1.00 111.73 ? 784  GLU A OE2 1 
ATOM 6015 N N   . GLU A 1 788  ? 6.769   43.507 56.191  1.00 65.63  ? 785  GLU A N   1 
ATOM 6016 C CA  . GLU A 1 788  ? 6.088   43.602 54.904  1.00 65.63  ? 785  GLU A CA  1 
ATOM 6017 C C   . GLU A 1 788  ? 5.783   42.226 54.351  1.00 65.63  ? 785  GLU A C   1 
ATOM 6018 O O   . GLU A 1 788  ? 6.502   41.297 54.633  1.00 65.63  ? 785  GLU A O   1 
ATOM 6019 C CB  . GLU A 1 788  ? 6.946   44.367 53.909  1.00 62.78  ? 785  GLU A CB  1 
ATOM 6020 C CG  . GLU A 1 788  ? 6.756   45.871 53.921  1.00 62.78  ? 785  GLU A CG  1 
ATOM 6021 C CD  . GLU A 1 788  ? 7.507   46.561 52.786  1.00 62.78  ? 785  GLU A CD  1 
ATOM 6022 O OE1 . GLU A 1 788  ? 8.096   45.872 51.925  1.00 62.78  ? 785  GLU A OE1 1 
ATOM 6023 O OE2 . GLU A 1 788  ? 7.509   47.803 52.745  1.00 62.78  ? 785  GLU A OE2 1 
ATOM 6024 N N   . VAL A 1 789  ? 4.725   42.102 53.557  1.00 42.74  ? 786  VAL A N   1 
ATOM 6025 C CA  . VAL A 1 789  ? 4.254   40.814 53.075  1.00 42.74  ? 786  VAL A CA  1 
ATOM 6026 C C   . VAL A 1 789  ? 3.430   41.004 51.791  1.00 42.74  ? 786  VAL A C   1 
ATOM 6027 O O   . VAL A 1 789  ? 2.922   42.094 51.521  1.00 42.74  ? 786  VAL A O   1 
ATOM 6028 C CB  . VAL A 1 789  ? 3.405   40.118 54.158  1.00 57.78  ? 786  VAL A CB  1 
ATOM 6029 C CG1 . VAL A 1 789  ? 1.953   40.607 54.101  1.00 57.78  ? 786  VAL A CG1 1 
ATOM 6030 C CG2 . VAL A 1 789  ? 3.485   38.588 54.033  1.00 57.78  ? 786  VAL A CG2 1 
ATOM 6031 N N   . GLU A 1 790  ? 3.319   39.950 50.996  1.00 26.35  ? 787  GLU A N   1 
ATOM 6032 C CA  . GLU A 1 790  ? 2.609   39.997 49.749  1.00 26.35  ? 787  GLU A CA  1 
ATOM 6033 C C   . GLU A 1 790  ? 1.282   39.294 49.897  1.00 26.35  ? 787  GLU A C   1 
ATOM 6034 O O   . GLU A 1 790  ? 1.195   38.231 50.557  1.00 26.35  ? 787  GLU A O   1 
ATOM 6035 C CB  . GLU A 1 790  ? 3.419   39.295 48.670  1.00 23.81  ? 787  GLU A CB  1 
ATOM 6036 C CG  . GLU A 1 790  ? 4.507   40.175 48.145  1.00 23.81  ? 787  GLU A CG  1 
ATOM 6037 C CD  . GLU A 1 790  ? 5.274   39.612 46.964  1.00 23.81  ? 787  GLU A CD  1 
ATOM 6038 O OE1 . GLU A 1 790  ? 6.502   39.872 47.057  1.00 23.81  ? 787  GLU A OE1 1 
ATOM 6039 O OE2 . GLU A 1 790  ? 4.729   38.940 45.990  1.00 23.81  ? 787  GLU A OE2 1 
ATOM 6040 N N   . VAL A 1 791  ? 0.243   39.858 49.290  1.00 39.57  ? 788  VAL A N   1 
ATOM 6041 C CA  . VAL A 1 791  ? -1.020  39.176 49.244  1.00 39.57  ? 788  VAL A CA  1 
ATOM 6042 C C   . VAL A 1 791  ? -1.287  38.956 47.773  1.00 39.57  ? 788  VAL A C   1 
ATOM 6043 O O   . VAL A 1 791  ? -1.210  39.897 46.988  1.00 39.57  ? 788  VAL A O   1 
ATOM 6044 C CB  . VAL A 1 791  ? -2.143  39.976 49.985  1.00 27.26  ? 788  VAL A CB  1 
ATOM 6045 C CG1 . VAL A 1 791  ? -3.515  39.338 49.778  1.00 27.26  ? 788  VAL A CG1 1 
ATOM 6046 C CG2 . VAL A 1 791  ? -1.881  40.031 51.482  1.00 27.26  ? 788  VAL A CG2 1 
ATOM 6047 N N   . HIS A 1 792  ? -1.593  37.724 47.387  1.00 42.65  ? 789  HIS A N   1 
ATOM 6048 C CA  . HIS A 1 792  ? -1.723  37.377 45.976  1.00 42.65  ? 789  HIS A CA  1 
ATOM 6049 C C   . HIS A 1 792  ? -3.150  37.152 45.550  1.00 42.65  ? 789  HIS A C   1 
ATOM 6050 O O   . HIS A 1 792  ? -3.962  36.726 46.354  1.00 42.65  ? 789  HIS A O   1 
ATOM 6051 C CB  . HIS A 1 792  ? -0.902  36.119 45.681  1.00 32.88  ? 789  HIS A CB  1 
ATOM 6052 C CG  . HIS A 1 792  ? 0.565   36.384 45.588  1.00 32.88  ? 789  HIS A CG  1 
ATOM 6053 N ND1 . HIS A 1 792  ? 1.271   36.215 44.422  1.00 32.88  ? 789  HIS A ND1 1 
ATOM 6054 C CD2 . HIS A 1 792  ? 1.445   36.861 46.505  1.00 32.88  ? 789  HIS A CD2 1 
ATOM 6055 C CE1 . HIS A 1 792  ? 2.526   36.579 44.628  1.00 32.88  ? 789  HIS A CE1 1 
ATOM 6056 N NE2 . HIS A 1 792  ? 2.657   36.975 45.881  1.00 32.88  ? 789  HIS A NE2 1 
ATOM 6057 N N   . ASN A 1 793  ? -3.442  37.381 44.271  1.00 33.08  ? 790  ASN A N   1 
ATOM 6058 C CA  . ASN A 1 793  ? -4.791  37.345 43.782  1.00 33.08  ? 790  ASN A CA  1 
ATOM 6059 C C   . ASN A 1 793  ? -4.855  36.872 42.359  1.00 33.08  ? 790  ASN A C   1 
ATOM 6060 O O   . ASN A 1 793  ? -3.983  37.203 41.579  1.00 33.08  ? 790  ASN A O   1 
ATOM 6061 C CB  . ASN A 1 793  ? -5.322  38.753 43.793  1.00 44.12  ? 790  ASN A CB  1 
ATOM 6062 C CG  . ASN A 1 793  ? -5.949  39.109 45.084  1.00 44.12  ? 790  ASN A CG  1 
ATOM 6063 O OD1 . ASN A 1 793  ? -7.036  38.640 45.404  1.00 44.12  ? 790  ASN A OD1 1 
ATOM 6064 N ND2 . ASN A 1 793  ? -5.291  39.962 45.844  1.00 44.12  ? 790  ASN A ND2 1 
ATOM 6065 N N   . LEU A 1 794  ? -5.877  36.091 42.005  1.00 36.27  ? 791  LEU A N   1 
ATOM 6066 C CA  . LEU A 1 794  ? -6.313  35.986 40.610  1.00 36.27  ? 791  LEU A CA  1 
ATOM 6067 C C   . LEU A 1 794  ? -7.367  37.069 40.387  1.00 36.27  ? 791  LEU A C   1 
ATOM 6068 O O   . LEU A 1 794  ? -8.284  37.176 41.174  1.00 36.27  ? 791  LEU A O   1 
ATOM 6069 C CB  . LEU A 1 794  ? -6.920  34.605 40.339  1.00 21.98  ? 791  LEU A CB  1 
ATOM 6070 C CG  . LEU A 1 794  ? -7.640  34.363 39.001  1.00 21.98  ? 791  LEU A CG  1 
ATOM 6071 C CD1 . LEU A 1 794  ? -6.718  34.695 37.836  1.00 21.98  ? 791  LEU A CD1 1 
ATOM 6072 C CD2 . LEU A 1 794  ? -8.169  32.911 38.854  1.00 21.98  ? 791  LEU A CD2 1 
ATOM 6073 N N   . LEU A 1 795  ? -7.245  37.871 39.335  1.00 27.51  ? 792  LEU A N   1 
ATOM 6074 C CA  . LEU A 1 795  ? -8.188  38.965 39.068  1.00 27.51  ? 792  LEU A CA  1 
ATOM 6075 C C   . LEU A 1 795  ? -8.888  38.609 37.809  1.00 27.51  ? 792  LEU A C   1 
ATOM 6076 O O   . LEU A 1 795  ? -8.255  38.000 36.939  1.00 27.51  ? 792  LEU A O   1 
ATOM 6077 C CB  . LEU A 1 795  ? -7.460  40.293 38.835  1.00 21.74  ? 792  LEU A CB  1 
ATOM 6078 C CG  . LEU A 1 795  ? -6.496  40.653 39.954  1.00 21.74  ? 792  LEU A CG  1 
ATOM 6079 C CD1 . LEU A 1 795  ? -5.821  41.961 39.742  1.00 21.74  ? 792  LEU A CD1 1 
ATOM 6080 C CD2 . LEU A 1 795  ? -7.259  40.641 41.210  1.00 21.74  ? 792  LEU A CD2 1 
ATOM 6081 N N   . ILE A 1 796  ? -10.171 38.978 37.682  1.00 26.94  ? 793  ILE A N   1 
ATOM 6082 C CA  . ILE A 1 796  ? -10.882 38.662 36.443  1.00 26.94  ? 793  ILE A CA  1 
ATOM 6083 C C   . ILE A 1 796  ? -11.221 39.936 35.698  1.00 26.94  ? 793  ILE A C   1 
ATOM 6084 O O   . ILE A 1 796  ? -12.078 40.682 36.141  1.00 26.94  ? 793  ILE A O   1 
ATOM 6085 C CB  . ILE A 1 796  ? -12.150 37.783 36.697  1.00 38.33  ? 793  ILE A CB  1 
ATOM 6086 C CG1 . ILE A 1 796  ? -11.751 36.438 37.288  1.00 38.33  ? 793  ILE A CG1 1 
ATOM 6087 C CG2 . ILE A 1 796  ? -12.968 37.558 35.405  1.00 38.33  ? 793  ILE A CG2 1 
ATOM 6088 C CD1 . ILE A 1 796  ? -10.848 35.629 36.371  1.00 38.33  ? 793  ILE A CD1 1 
ATOM 6089 N N   . ILE A 1 797  ? -10.582 40.190 34.569  1.00 29.26  ? 794  ILE A N   1 
ATOM 6090 C CA  . ILE A 1 797  ? -10.682 41.513 33.944  1.00 29.26  ? 794  ILE A CA  1 
ATOM 6091 C C   . ILE A 1 797  ? -11.521 41.520 32.672  1.00 29.26  ? 794  ILE A C   1 
ATOM 6092 O O   . ILE A 1 797  ? -11.254 40.751 31.713  1.00 29.26  ? 794  ILE A O   1 
ATOM 6093 C CB  . ILE A 1 797  ? -9.264  42.128 33.703  1.00 31.25  ? 794  ILE A CB  1 
ATOM 6094 C CG1 . ILE A 1 797  ? -8.747  42.707 35.011  1.00 31.25  ? 794  ILE A CG1 1 
ATOM 6095 C CG2 . ILE A 1 797  ? -9.280  43.199 32.643  1.00 31.25  ? 794  ILE A CG2 1 
ATOM 6096 C CD1 . ILE A 1 797  ? -7.405  42.238 35.348  1.00 31.25  ? 794  ILE A CD1 1 
ATOM 6097 N N   . ASP A 1 798  ? -12.540 42.375 32.649  1.00 25.91  ? 795  ASP A N   1 
ATOM 6098 C CA  . ASP A 1 798  ? -13.402 42.371 31.470  1.00 25.91  ? 795  ASP A CA  1 
ATOM 6099 C C   . ASP A 1 798  ? -12.567 42.800 30.262  1.00 25.91  ? 795  ASP A C   1 
ATOM 6100 O O   . ASP A 1 798  ? -11.752 43.728 30.358  1.00 25.91  ? 795  ASP A O   1 
ATOM 6101 C CB  . ASP A 1 798  ? -14.645 43.271 31.660  1.00 41.84  ? 795  ASP A CB  1 
ATOM 6102 C CG  . ASP A 1 798  ? -15.489 43.390 30.382  1.00 41.84  ? 795  ASP A CG  1 
ATOM 6103 O OD1 . ASP A 1 798  ? -15.267 44.327 29.565  1.00 41.84  ? 795  ASP A OD1 1 
ATOM 6104 O OD2 . ASP A 1 798  ? -16.384 42.543 30.206  1.00 41.84  ? 795  ASP A OD2 1 
ATOM 6105 N N   . GLN A 1 799  ? -12.765 42.157 29.128  1.00 39.57  ? 796  GLN A N   1 
ATOM 6106 C CA  . GLN A 1 799  ? -11.909 42.480 28.002  1.00 39.57  ? 796  GLN A CA  1 
ATOM 6107 C C   . GLN A 1 799  ? -12.241 43.763 27.295  1.00 39.57  ? 796  GLN A C   1 
ATOM 6108 O O   . GLN A 1 799  ? -11.419 44.263 26.533  1.00 39.57  ? 796  GLN A O   1 
ATOM 6109 C CB  . GLN A 1 799  ? -11.852 41.346 26.993  1.00 50.09  ? 796  GLN A CB  1 
ATOM 6110 C CG  . GLN A 1 799  ? -12.748 41.507 25.829  1.00 50.09  ? 796  GLN A CG  1 
ATOM 6111 C CD  . GLN A 1 799  ? -12.699 40.309 24.955  1.00 50.09  ? 796  GLN A CD  1 
ATOM 6112 O OE1 . GLN A 1 799  ? -12.623 40.434 23.744  1.00 50.09  ? 796  GLN A OE1 1 
ATOM 6113 N NE2 . GLN A 1 799  ? -12.716 39.133 25.554  1.00 50.09  ? 796  GLN A NE2 1 
ATOM 6114 N N   . HIS A 1 800  ? -13.443 44.281 27.514  1.00 41.53  ? 797  HIS A N   1 
ATOM 6115 C CA  . HIS A 1 800  ? -13.869 45.513 26.864  1.00 41.53  ? 797  HIS A CA  1 
ATOM 6116 C C   . HIS A 1 800  ? -13.634 46.682 27.791  1.00 41.53  ? 797  HIS A C   1 
ATOM 6117 O O   . HIS A 1 800  ? -13.076 47.701 27.371  1.00 41.53  ? 797  HIS A O   1 
ATOM 6118 C CB  . HIS A 1 800  ? -15.325 45.438 26.419  1.00 43.88  ? 797  HIS A CB  1 
ATOM 6119 C CG  . HIS A 1 800  ? -15.601 44.306 25.487  1.00 43.88  ? 797  HIS A CG  1 
ATOM 6120 N ND1 . HIS A 1 800  ? -15.506 44.431 24.118  1.00 43.88  ? 797  HIS A ND1 1 
ATOM 6121 C CD2 . HIS A 1 800  ? -15.947 43.014 25.724  1.00 43.88  ? 797  HIS A CD2 1 
ATOM 6122 C CE1 . HIS A 1 800  ? -15.783 43.268 23.549  1.00 43.88  ? 797  HIS A CE1 1 
ATOM 6123 N NE2 . HIS A 1 800  ? -16.062 42.391 24.501  1.00 43.88  ? 797  HIS A NE2 1 
ATOM 6124 N N   . THR A 1 801  ? -14.032 46.536 29.047  1.00 39.19  ? 798  THR A N   1 
ATOM 6125 C CA  . THR A 1 801  ? -13.993 47.656 29.968  1.00 39.19  ? 798  THR A CA  1 
ATOM 6126 C C   . THR A 1 801  ? -12.731 47.738 30.811  1.00 39.19  ? 798  THR A C   1 
ATOM 6127 O O   . THR A 1 801  ? -12.507 48.742 31.517  1.00 39.19  ? 798  THR A O   1 
ATOM 6128 C CB  . THR A 1 801  ? -15.186 47.605 30.950  1.00 37.28  ? 798  THR A CB  1 
ATOM 6129 O OG1 . THR A 1 801  ? -15.062 46.457 31.817  1.00 37.28  ? 798  THR A OG1 1 
ATOM 6130 C CG2 . THR A 1 801  ? -16.502 47.613 30.169  1.00 37.28  ? 798  THR A CG2 1 
ATOM 6131 N N   . PHE A 1 802  ? -11.950 46.656 30.770  1.00 40.18  ? 799  PHE A N   1 
ATOM 6132 C CA  . PHE A 1 802  ? -10.856 46.411 31.705  1.00 40.18  ? 799  PHE A CA  1 
ATOM 6133 C C   . PHE A 1 802  ? -11.173 46.700 33.180  1.00 40.18  ? 799  PHE A C   1 
ATOM 6134 O O   . PHE A 1 802  ? -10.342 47.246 33.911  1.00 40.18  ? 799  PHE A O   1 
ATOM 6135 C CB  . PHE A 1 802  ? -9.582  47.071 31.199  1.00 36.95  ? 799  PHE A CB  1 
ATOM 6136 C CG  . PHE A 1 802  ? -9.005  46.366 29.993  1.00 36.95  ? 799  PHE A CG  1 
ATOM 6137 C CD1 . PHE A 1 802  ? -9.436  46.705 28.676  1.00 36.95  ? 799  PHE A CD1 1 
ATOM 6138 C CD2 . PHE A 1 802  ? -8.072  45.344 30.151  1.00 36.95  ? 799  PHE A CD2 1 
ATOM 6139 C CE1 . PHE A 1 802  ? -8.942  46.042 27.550  1.00 36.95  ? 799  PHE A CE1 1 
ATOM 6140 C CE2 . PHE A 1 802  ? -7.576  44.674 29.038  1.00 36.95  ? 799  PHE A CE2 1 
ATOM 6141 C CZ  . PHE A 1 802  ? -8.014  45.015 27.725  1.00 36.95  ? 799  PHE A CZ  1 
ATOM 6142 N N   . GLU A 1 803  ? -12.392 46.333 33.605  1.00 47.71  ? 800  GLU A N   1 
ATOM 6143 C CA  . GLU A 1 803  ? -12.774 46.323 35.029  1.00 47.71  ? 800  GLU A CA  1 
ATOM 6144 C C   . GLU A 1 803  ? -12.372 44.991 35.684  1.00 47.71  ? 800  GLU A C   1 
ATOM 6145 O O   . GLU A 1 803  ? -12.470 43.893 35.069  1.00 47.71  ? 800  GLU A O   1 
ATOM 6146 C CB  . GLU A 1 803  ? -14.278 46.503 35.208  1.00 94.87  ? 800  GLU A CB  1 
ATOM 6147 C CG  . GLU A 1 803  ? -14.887 47.746 34.595  1.00 94.87  ? 800  GLU A CG  1 
ATOM 6148 C CD  . GLU A 1 803  ? -16.353 47.932 34.986  1.00 94.87  ? 800  GLU A CD  1 
ATOM 6149 O OE1 . GLU A 1 803  ? -16.640 48.933 35.665  1.00 94.87  ? 800  GLU A OE1 1 
ATOM 6150 O OE2 . GLU A 1 803  ? -17.210 47.085 34.634  1.00 94.87  ? 800  GLU A OE2 1 
ATOM 6151 N N   . VAL A 1 804  ? -11.920 45.097 36.932  1.00 32.60  ? 801  VAL A N   1 
ATOM 6152 C CA  . VAL A 1 804  ? -11.776 43.946 37.823  1.00 32.60  ? 801  VAL A CA  1 
ATOM 6153 C C   . VAL A 1 804  ? -13.167 43.380 38.187  1.00 32.60  ? 801  VAL A C   1 
ATOM 6154 O O   . VAL A 1 804  ? -13.785 43.784 39.189  1.00 32.60  ? 801  VAL A O   1 
ATOM 6155 C CB  . VAL A 1 804  ? -11.095 44.374 39.116  1.00 28.69  ? 801  VAL A CB  1 
ATOM 6156 C CG1 . VAL A 1 804  ? -10.670 43.143 39.955  1.00 28.69  ? 801  VAL A CG1 1 
ATOM 6157 C CG2 . VAL A 1 804  ? -9.932  45.314 38.803  1.00 28.69  ? 801  VAL A CG2 1 
ATOM 6158 N N   . LEU A 1 805  ? -13.661 42.453 37.381  1.00 40.22  ? 802  LEU A N   1 
ATOM 6159 C CA  . LEU A 1 805  ? -14.885 41.780 37.723  1.00 40.22  ? 802  LEU A CA  1 
ATOM 6160 C C   . LEU A 1 805  ? -14.738 41.042 39.057  1.00 40.22  ? 802  LEU A C   1 
ATOM 6161 O O   . LEU A 1 805  ? -15.457 41.329 40.020  1.00 40.22  ? 802  LEU A O   1 
ATOM 6162 C CB  . LEU A 1 805  ? -15.325 40.847 36.607  1.00 38.94  ? 802  LEU A CB  1 
ATOM 6163 C CG  . LEU A 1 805  ? -15.390 41.460 35.195  1.00 38.94  ? 802  LEU A CG  1 
ATOM 6164 C CD1 . LEU A 1 805  ? -15.504 40.361 34.081  1.00 38.94  ? 802  LEU A CD1 1 
ATOM 6165 C CD2 . LEU A 1 805  ? -16.442 42.612 35.023  1.00 38.94  ? 802  LEU A CD2 1 
ATOM 6166 N N   . HIS A 1 806  ? -13.789 40.126 39.162  1.00 50.58  ? 803  HIS A N   1 
ATOM 6167 C CA  . HIS A 1 806  ? -13.676 39.381 40.401  1.00 50.58  ? 803  HIS A CA  1 
ATOM 6168 C C   . HIS A 1 806  ? -12.241 39.424 40.947  1.00 50.58  ? 803  HIS A C   1 
ATOM 6169 O O   . HIS A 1 806  ? -11.277 39.620 40.177  1.00 50.58  ? 803  HIS A O   1 
ATOM 6170 C CB  . HIS A 1 806  ? -14.179 37.941 40.179  1.00 42.12  ? 803  HIS A CB  1 
ATOM 6171 C CG  . HIS A 1 806  ? -14.261 37.143 41.440  1.00 42.12  ? 803  HIS A CG  1 
ATOM 6172 N ND1 . HIS A 1 806  ? -15.143 37.451 42.457  1.00 42.12  ? 803  HIS A ND1 1 
ATOM 6173 C CD2 . HIS A 1 806  ? -13.520 36.100 41.884  1.00 42.12  ? 803  HIS A CD2 1 
ATOM 6174 C CE1 . HIS A 1 806  ? -14.950 36.618 43.463  1.00 42.12  ? 803  HIS A CE1 1 
ATOM 6175 N NE2 . HIS A 1 806  ? -13.972 35.789 43.140  1.00 42.12  ? 803  HIS A NE2 1 
ATOM 6176 N N   . ALA A 1 807  ? -12.097 39.257 42.257  1.00 53.78  ? 804  ALA A N   1 
ATOM 6177 C CA  . ALA A 1 807  ? -10.784 39.028 42.836  1.00 53.78  ? 804  ALA A CA  1 
ATOM 6178 C C   . ALA A 1 807  ? -10.752 37.828 43.779  1.00 53.78  ? 804  ALA A C   1 
ATOM 6179 O O   . ALA A 1 807  ? -11.446 37.825 44.805  1.00 53.78  ? 804  ALA A O   1 
ATOM 6180 C CB  . ALA A 1 807  ? -10.267 40.277 43.556  1.00 28.90  ? 804  ALA A CB  1 
ATOM 6181 N N   . HIS A 1 808  ? -9.936  36.816 43.456  1.00 34.15  ? 805  HIS A N   1 
ATOM 6182 C CA  . HIS A 1 808  ? -9.760  35.719 44.387  1.00 34.15  ? 805  HIS A CA  1 
ATOM 6183 C C   . HIS A 1 808  ? -8.436  35.782 45.118  1.00 34.15  ? 805  HIS A C   1 
ATOM 6184 O O   . HIS A 1 808  ? -7.383  35.575 44.522  1.00 34.15  ? 805  HIS A O   1 
ATOM 6185 C CB  . HIS A 1 808  ? -9.960  34.362 43.719  1.00 65.44  ? 805  HIS A CB  1 
ATOM 6186 C CG  . HIS A 1 808  ? -9.775  33.222 44.666  1.00 65.44  ? 805  HIS A CG  1 
ATOM 6187 N ND1 . HIS A 1 808  ? -10.621 33.003 45.729  1.00 65.44  ? 805  HIS A ND1 1 
ATOM 6188 C CD2 . HIS A 1 808  ? -8.799  32.287 44.758  1.00 65.44  ? 805  HIS A CD2 1 
ATOM 6189 C CE1 . HIS A 1 808  ? -10.194 31.960 46.416  1.00 65.44  ? 805  HIS A CE1 1 
ATOM 6190 N NE2 . HIS A 1 808  ? -9.092  31.504 45.848  1.00 65.44  ? 805  HIS A NE2 1 
ATOM 6191 N N   . GLN A 1 809  ? -8.484  36.061 46.409  1.00 48.35  ? 806  GLN A N   1 
ATOM 6192 C CA  . GLN A 1 809  ? -7.275  36.120 47.192  1.00 48.35  ? 806  GLN A CA  1 
ATOM 6193 C C   . GLN A 1 809  ? -6.799  34.742 47.683  1.00 48.35  ? 806  GLN A C   1 
ATOM 6194 O O   . GLN A 1 809  ? -7.588  33.943 48.232  1.00 48.35  ? 806  GLN A O   1 
ATOM 6195 C CB  . GLN A 1 809  ? -7.465  37.057 48.356  1.00 34.39  ? 806  GLN A CB  1 
ATOM 6196 C CG  . GLN A 1 809  ? -6.527  36.778 49.494  1.00 34.39  ? 806  GLN A CG  1 
ATOM 6197 C CD  . GLN A 1 809  ? -6.660  37.759 50.616  1.00 34.39  ? 806  GLN A CD  1 
ATOM 6198 O OE1 . GLN A 1 809  ? -6.914  38.930 50.403  1.00 34.39  ? 806  GLN A OE1 1 
ATOM 6199 N NE2 . GLN A 1 809  ? -6.444  37.293 51.823  1.00 34.39  ? 806  GLN A NE2 1 
ATOM 6200 N N   . PHE A 1 810  ? -5.507  34.467 47.502  1.00 35.66  ? 807  PHE A N   1 
ATOM 6201 C CA  . PHE A 1 810  ? -4.967  33.181 47.891  1.00 35.66  ? 807  PHE A CA  1 
ATOM 6202 C C   . PHE A 1 810  ? -4.665  33.175 49.385  1.00 35.66  ? 807  PHE A C   1 
ATOM 6203 O O   . PHE A 1 810  ? -5.021  34.137 50.060  1.00 35.66  ? 807  PHE A O   1 
ATOM 6204 C CB  . PHE A 1 810  ? -3.750  32.853 47.037  1.00 21.97  ? 807  PHE A CB  1 
ATOM 6205 C CG  . PHE A 1 810  ? -4.072  32.659 45.621  1.00 21.97  ? 807  PHE A CG  1 
ATOM 6206 C CD1 . PHE A 1 810  ? -3.942  33.693 44.737  1.00 21.97  ? 807  PHE A CD1 1 
ATOM 6207 C CD2 . PHE A 1 810  ? -4.526  31.444 45.180  1.00 21.97  ? 807  PHE A CD2 1 
ATOM 6208 C CE1 . PHE A 1 810  ? -4.260  33.519 43.389  1.00 21.97  ? 807  PHE A CE1 1 
ATOM 6209 C CE2 . PHE A 1 810  ? -4.854  31.232 43.856  1.00 21.97  ? 807  PHE A CE2 1 
ATOM 6210 C CZ  . PHE A 1 810  ? -4.726  32.267 42.939  1.00 21.97  ? 807  PHE A CZ  1 
ATOM 6211 N N   . LEU A 1 811  ? -4.027  32.109 49.894  1.00 29.08  ? 808  LEU A N   1 
ATOM 6212 C CA  . LEU A 1 811  ? -3.874  31.923 51.346  1.00 29.08  ? 808  LEU A CA  1 
ATOM 6213 C C   . LEU A 1 811  ? -2.838  32.871 51.910  1.00 29.08  ? 808  LEU A C   1 
ATOM 6214 O O   . LEU A 1 811  ? -2.114  33.509 51.145  1.00 29.08  ? 808  LEU A O   1 
ATOM 6215 C CB  . LEU A 1 811  ? -3.531  30.474 51.714  1.00 58.96  ? 808  LEU A CB  1 
ATOM 6216 C CG  . LEU A 1 811  ? -4.385  29.339 51.128  1.00 58.96  ? 808  LEU A CG  1 
ATOM 6217 C CD1 . LEU A 1 811  ? -3.726  27.993 51.368  1.00 58.96  ? 808  LEU A CD1 1 
ATOM 6218 C CD2 . LEU A 1 811  ? -5.834  29.326 51.623  1.00 58.96  ? 808  LEU A CD2 1 
ATOM 6219 N N   . GLN A 1 812  ? -2.769  32.975 53.229  1.00 54.04  ? 809  GLN A N   1 
ATOM 6220 C CA  . GLN A 1 812  ? -1.705  33.711 53.842  1.00 54.04  ? 809  GLN A CA  1 
ATOM 6221 C C   . GLN A 1 812  ? -0.383  33.104 53.399  1.00 54.04  ? 809  GLN A C   1 
ATOM 6222 O O   . GLN A 1 812  ? -0.128  31.937 53.645  1.00 54.04  ? 809  GLN A O   1 
ATOM 6223 C CB  . GLN A 1 812  ? -1.824  33.663 55.349  1.00 68.50  ? 809  GLN A CB  1 
ATOM 6224 C CG  . GLN A 1 812  ? -0.836  34.581 56.039  1.00 68.50  ? 809  GLN A CG  1 
ATOM 6225 C CD  . GLN A 1 812  ? -1.201  34.858 57.472  1.00 68.50  ? 809  GLN A CD  1 
ATOM 6226 O OE1 . GLN A 1 812  ? -0.403  35.405 58.233  1.00 68.50  ? 809  GLN A OE1 1 
ATOM 6227 N NE2 . GLN A 1 812  ? -2.416  34.479 57.855  1.00 68.50  ? 809  GLN A NE2 1 
ATOM 6228 N N   . ASN A 1 813  ? 0.426   33.911 52.711  1.00 48.16  ? 810  ASN A N   1 
ATOM 6229 C CA  . ASN A 1 813  ? 1.775   33.566 52.188  1.00 48.16  ? 810  ASN A CA  1 
ATOM 6230 C C   . ASN A 1 813  ? 1.785   32.645 51.008  1.00 48.16  ? 810  ASN A C   1 
ATOM 6231 O O   . ASN A 1 813  ? 2.747   31.957 50.742  1.00 48.16  ? 810  ASN A O   1 
ATOM 6232 C CB  . ASN A 1 813  ? 2.723   33.097 53.278  1.00 43.43  ? 810  ASN A CB  1 
ATOM 6233 C CG  . ASN A 1 813  ? 2.983   34.179 54.290  1.00 43.43  ? 810  ASN A CG  1 
ATOM 6234 O OD1 . ASN A 1 813  ? 3.609   35.212 54.000  1.00 43.43  ? 810  ASN A OD1 1 
ATOM 6235 N ND2 . ASN A 1 813  ? 2.466   33.971 55.492  1.00 43.43  ? 810  ASN A ND2 1 
ATOM 6236 N N   . GLU A 1 814  ? 0.697   32.651 50.284  1.00 46.66  ? 811  GLU A N   1 
ATOM 6237 C CA  . GLU A 1 814  ? 0.630   31.883 49.082  1.00 46.66  ? 811  GLU A CA  1 
ATOM 6238 C C   . GLU A 1 814  ? 0.865   32.788 47.845  1.00 46.66  ? 811  GLU A C   1 
ATOM 6239 O O   . GLU A 1 814  ? 0.030   33.616 47.499  1.00 46.66  ? 811  GLU A O   1 
ATOM 6240 C CB  . GLU A 1 814  ? -0.722  31.179 49.027  1.00 25.97  ? 811  GLU A CB  1 
ATOM 6241 C CG  . GLU A 1 814  ? -0.860  30.353 47.834  1.00 25.97  ? 811  GLU A CG  1 
ATOM 6242 C CD  . GLU A 1 814  ? -2.085  29.494 47.877  1.00 25.97  ? 811  GLU A CD  1 
ATOM 6243 O OE1 . GLU A 1 814  ? -3.082  29.926 48.532  1.00 25.97  ? 811  GLU A OE1 1 
ATOM 6244 O OE2 . GLU A 1 814  ? -2.051  28.401 47.230  1.00 25.97  ? 811  GLU A OE2 1 
ATOM 6245 N N   . TYR A 1 815  ? 2.010   32.643 47.204  1.00 47.93  ? 812  TYR A N   1 
ATOM 6246 C CA  . TYR A 1 815  ? 2.275   33.324 45.961  1.00 47.93  ? 812  TYR A CA  1 
ATOM 6247 C C   . TYR A 1 815  ? 1.692   32.515 44.829  1.00 47.93  ? 812  TYR A C   1 
ATOM 6248 O O   . TYR A 1 815  ? 1.834   31.303 44.781  1.00 47.93  ? 812  TYR A O   1 
ATOM 6249 C CB  . TYR A 1 815  ? 3.773   33.442 45.736  1.00 22.61  ? 812  TYR A CB  1 
ATOM 6250 C CG  . TYR A 1 815  ? 4.443   34.404 46.661  1.00 22.61  ? 812  TYR A CG  1 
ATOM 6251 C CD1 . TYR A 1 815  ? 5.577   35.093 46.264  1.00 22.61  ? 812  TYR A CD1 1 
ATOM 6252 C CD2 . TYR A 1 815  ? 3.936   34.663 47.925  1.00 22.61  ? 812  TYR A CD2 1 
ATOM 6253 C CE1 . TYR A 1 815  ? 6.198   36.037 47.114  1.00 22.61  ? 812  TYR A CE1 1 
ATOM 6254 C CE2 . TYR A 1 815  ? 4.555   35.560 48.763  1.00 22.61  ? 812  TYR A CE2 1 
ATOM 6255 C CZ  . TYR A 1 815  ? 5.676   36.256 48.351  1.00 22.61  ? 812  TYR A CZ  1 
ATOM 6256 O OH  . TYR A 1 815  ? 6.289   37.159 49.198  1.00 22.61  ? 812  TYR A OH  1 
ATOM 6257 N N   . ALA A 1 816  ? 1.050   33.198 43.896  1.00 29.05  ? 813  ALA A N   1 
ATOM 6258 C CA  . ALA A 1 816  ? 0.557   32.543 42.713  1.00 29.05  ? 813  ALA A CA  1 
ATOM 6259 C C   . ALA A 1 816  ? 1.517   32.934 41.587  1.00 29.05  ? 813  ALA A C   1 
ATOM 6260 O O   . ALA A 1 816  ? 1.645   34.101 41.250  1.00 29.05  ? 813  ALA A O   1 
ATOM 6261 C CB  . ALA A 1 816  ? -0.862  33.015 42.426  1.00 24.04  ? 813  ALA A CB  1 
ATOM 6262 N N   . LEU A 1 817  ? 2.198   31.946 41.019  1.00 29.75  ? 814  LEU A N   1 
ATOM 6263 C CA  . LEU A 1 817  ? 3.305   32.191 40.095  1.00 29.75  ? 814  LEU A CA  1 
ATOM 6264 C C   . LEU A 1 817  ? 3.016   31.813 38.643  1.00 29.75  ? 814  LEU A C   1 
ATOM 6265 O O   . LEU A 1 817  ? 3.668   32.335 37.744  1.00 29.75  ? 814  LEU A O   1 
ATOM 6266 C CB  . LEU A 1 817  ? 4.531   31.439 40.587  1.00 16.49  ? 814  LEU A CB  1 
ATOM 6267 C CG  . LEU A 1 817  ? 4.874   31.388 42.091  1.00 16.49  ? 814  LEU A CG  1 
ATOM 6268 C CD1 . LEU A 1 817  ? 5.571   30.056 42.349  1.00 16.49  ? 814  LEU A CD1 1 
ATOM 6269 C CD2 . LEU A 1 817  ? 5.695   32.548 42.598  1.00 16.49  ? 814  LEU A CD2 1 
ATOM 6270 N N   . SER A 1 818  ? 2.053   30.918 38.397  1.00 33.22  ? 815  SER A N   1 
ATOM 6271 C CA  . SER A 1 818  ? 1.726   30.504 37.006  1.00 33.22  ? 815  SER A CA  1 
ATOM 6272 C C   . SER A 1 818  ? 0.227   30.565 36.616  1.00 33.22  ? 815  SER A C   1 
ATOM 6273 O O   . SER A 1 818  ? -0.656  30.371 37.465  1.00 33.22  ? 815  SER A O   1 
ATOM 6274 C CB  . SER A 1 818  ? 2.305   29.107 36.687  1.00 23.46  ? 815  SER A CB  1 
ATOM 6275 O OG  . SER A 1 818  ? 2.565   28.375 37.858  1.00 23.46  ? 815  SER A OG  1 
ATOM 6276 N N   . LEU A 1 819  ? -0.065  30.789 35.337  1.00 18.83  ? 816  LEU A N   1 
ATOM 6277 C CA  . LEU A 1 819  ? -1.464  30.826 34.928  1.00 18.83  ? 816  LEU A CA  1 
ATOM 6278 C C   . LEU A 1 819  ? -1.775  30.268 33.535  1.00 18.83  ? 816  LEU A C   1 
ATOM 6279 O O   . LEU A 1 819  ? -1.079  30.546 32.549  1.00 18.83  ? 816  LEU A O   1 
ATOM 6280 C CB  . LEU A 1 819  ? -1.984  32.251 35.032  1.00 28.79  ? 816  LEU A CB  1 
ATOM 6281 C CG  . LEU A 1 819  ? -3.418  32.605 34.644  1.00 28.79  ? 816  LEU A CG  1 
ATOM 6282 C CD1 . LEU A 1 819  ? -4.359  32.174 35.742  1.00 28.79  ? 816  LEU A CD1 1 
ATOM 6283 C CD2 . LEU A 1 819  ? -3.518  34.096 34.459  1.00 28.79  ? 816  LEU A CD2 1 
ATOM 6284 N N   . VAL A 1 820  ? -2.834  29.474 33.430  1.00 40.41  ? 817  VAL A N   1 
ATOM 6285 C CA  . VAL A 1 820  ? -3.276  29.034 32.116  1.00 40.41  ? 817  VAL A CA  1 
ATOM 6286 C C   . VAL A 1 820  ? -4.752  29.158 32.015  1.00 40.41  ? 817  VAL A C   1 
ATOM 6287 O O   . VAL A 1 820  ? -5.465  29.069 33.015  1.00 40.41  ? 817  VAL A O   1 
ATOM 6288 C CB  . VAL A 1 820  ? -2.918  27.566 31.802  1.00 44.92  ? 817  VAL A CB  1 
ATOM 6289 C CG1 . VAL A 1 820  ? -1.512  27.455 31.344  1.00 44.92  ? 817  VAL A CG1 1 
ATOM 6290 C CG2 . VAL A 1 820  ? -3.170  26.662 32.996  1.00 44.92  ? 817  VAL A CG2 1 
ATOM 6291 N N   . SER A 1 821  ? -5.201  29.345 30.788  1.00 33.74  ? 818  SER A N   1 
ATOM 6292 C CA  . SER A 1 821  ? -6.596  29.257 30.474  1.00 33.74  ? 818  SER A CA  1 
ATOM 6293 C C   . SER A 1 821  ? -6.818  28.107 29.495  1.00 33.74  ? 818  SER A C   1 
ATOM 6294 O O   . SER A 1 821  ? -6.514  28.226 28.282  1.00 33.74  ? 818  SER A O   1 
ATOM 6295 C CB  . SER A 1 821  ? -7.040  30.542 29.834  1.00 29.66  ? 818  SER A CB  1 
ATOM 6296 O OG  . SER A 1 821  ? -8.442  30.574 29.854  1.00 29.66  ? 818  SER A OG  1 
ATOM 6297 N N   . CYS A 1 822  ? -7.362  27.002 29.989  1.00 55.04  ? 819  CYS A N   1 
ATOM 6298 C CA  . CYS A 1 822  ? -7.529  25.875 29.104  1.00 55.04  ? 819  CYS A CA  1 
ATOM 6299 C C   . CYS A 1 822  ? -8.673  24.931 29.443  1.00 55.04  ? 819  CYS A C   1 
ATOM 6300 O O   . CYS A 1 822  ? -9.138  24.861 30.599  1.00 55.04  ? 819  CYS A O   1 
ATOM 6301 C CB  . CYS A 1 822  ? -6.230  25.093 29.056  1.00 37.51  ? 819  CYS A CB  1 
ATOM 6302 S SG  . CYS A 1 822  ? -5.937  24.233 30.571  1.00 37.51  ? 819  CYS A SG  1 
ATOM 6303 N N   . LYS A 1 823  ? -9.109  24.201 28.415  1.00 52.44  ? 820  LYS A N   1 
ATOM 6304 C CA  . LYS A 1 823  ? -9.972  23.047 28.588  1.00 52.44  ? 820  LYS A CA  1 
ATOM 6305 C C   . LYS A 1 823  ? -9.079  21.864 28.877  1.00 52.44  ? 820  LYS A C   1 
ATOM 6306 O O   . LYS A 1 823  ? -7.974  21.792 28.352  1.00 52.44  ? 820  LYS A O   1 
ATOM 6307 C CB  . LYS A 1 823  ? -10.807 22.805 27.333  1.00 49.06  ? 820  LYS A CB  1 
ATOM 6308 C CG  . LYS A 1 823  ? -11.775 23.968 27.046  1.00 49.06  ? 820  LYS A CG  1 
ATOM 6309 C CD  . LYS A 1 823  ? -12.655 23.805 25.815  1.00 49.06  ? 820  LYS A CD  1 
ATOM 6310 C CE  . LYS A 1 823  ? -11.881 23.311 24.607  1.00 49.06  ? 820  LYS A CE  1 
ATOM 6311 N NZ  . LYS A 1 823  ? -12.718 23.383 23.371  1.00 49.06  ? 820  LYS A NZ  1 
ATOM 6312 N N   . LEU A 1 824  ? -9.540  20.946 29.716  1.00 63.97  ? 821  LEU A N   1 
ATOM 6313 C CA  . LEU A 1 824  ? -8.783  19.731 30.006  1.00 63.97  ? 821  LEU A CA  1 
ATOM 6314 C C   . LEU A 1 824  ? -9.609  18.445 29.865  1.00 63.97  ? 821  LEU A C   1 
ATOM 6315 O O   . LEU A 1 824  ? -10.804 18.441 30.176  1.00 63.97  ? 821  LEU A O   1 
ATOM 6316 C CB  . LEU A 1 824  ? -8.236  19.799 31.421  1.00 52.69  ? 821  LEU A CB  1 
ATOM 6317 C CG  . LEU A 1 824  ? -6.966  20.558 31.771  1.00 52.69  ? 821  LEU A CG  1 
ATOM 6318 C CD1 . LEU A 1 824  ? -6.499  20.000 33.104  1.00 52.69  ? 821  LEU A CD1 1 
ATOM 6319 C CD2 . LEU A 1 824  ? -5.863  20.426 30.718  1.00 52.69  ? 821  LEU A CD2 1 
ATOM 6320 N N   . GLY A 1 825  ? -8.962  17.358 29.424  1.00 62.42  ? 822  GLY A N   1 
ATOM 6321 C CA  . GLY A 1 825  ? -9.600  16.021 29.311  1.00 62.42  ? 822  GLY A CA  1 
ATOM 6322 C C   . GLY A 1 825  ? -10.794 16.005 28.368  1.00 62.42  ? 822  GLY A C   1 
ATOM 6323 O O   . GLY A 1 825  ? -10.828 16.788 27.415  1.00 62.42  ? 822  GLY A O   1 
ATOM 6324 N N   . LYS A 1 826  ? -11.778 15.142 28.631  1.00 70.35  ? 823  LYS A N   1 
ATOM 6325 C CA  . LYS A 1 826  ? -13.027 15.151 27.838  1.00 70.35  ? 823  LYS A CA  1 
ATOM 6326 C C   . LYS A 1 826  ? -13.936 16.316 28.240  1.00 70.35  ? 823  LYS A C   1 
ATOM 6327 O O   . LYS A 1 826  ? -14.758 16.792 27.442  1.00 70.35  ? 823  LYS A O   1 
ATOM 6328 C CB  . LYS A 1 826  ? -13.786 13.821 27.954  1.00 90.91  ? 823  LYS A CB  1 
ATOM 6329 C CG  . LYS A 1 826  ? -13.643 12.868 26.735  1.00 90.91  ? 823  LYS A CG  1 
ATOM 6330 C CD  . LYS A 1 826  ? -12.603 11.756 26.952  1.00 90.91  ? 823  LYS A CD  1 
ATOM 6331 C CE  . LYS A 1 826  ? -13.017 10.766 28.068  1.00 90.91  ? 823  LYS A CE  1 
ATOM 6332 N NZ  . LYS A 1 826  ? -11.948 9.762  28.422  1.00 90.91  ? 823  LYS A NZ  1 
ATOM 6333 N N   . ASP A 1 827  ? -13.763 16.738 29.493  1.00 54.11  ? 824  ASP A N   1 
ATOM 6334 C CA  . ASP A 1 827  ? -14.380 17.917 30.118  1.00 54.11  ? 824  ASP A CA  1 
ATOM 6335 C C   . ASP A 1 827  ? -14.468 19.182 29.217  1.00 54.11  ? 824  ASP A C   1 
ATOM 6336 O O   . ASP A 1 827  ? -13.434 19.737 28.812  1.00 54.11  ? 824  ASP A O   1 
ATOM 6337 C CB  . ASP A 1 827  ? -13.574 18.209 31.391  1.00 50.52  ? 824  ASP A CB  1 
ATOM 6338 C CG  . ASP A 1 827  ? -14.219 19.229 32.283  1.00 50.52  ? 824  ASP A CG  1 
ATOM 6339 O OD1 . ASP A 1 827  ? -15.028 20.076 31.800  1.00 50.52  ? 824  ASP A OD1 1 
ATOM 6340 O OD2 . ASP A 1 827  ? -13.895 19.175 33.490  1.00 50.52  ? 824  ASP A OD2 1 
ATOM 6341 N N   . PRO A 1 828  ? -15.703 19.656 28.926  1.00 69.89  ? 825  PRO A N   1 
ATOM 6342 C CA  . PRO A 1 828  ? -15.920 20.710 27.909  1.00 69.89  ? 825  PRO A CA  1 
ATOM 6343 C C   . PRO A 1 828  ? -15.750 22.157 28.413  1.00 69.89  ? 825  PRO A C   1 
ATOM 6344 O O   . PRO A 1 828  ? -15.947 23.108 27.654  1.00 69.89  ? 825  PRO A O   1 
ATOM 6345 C CB  . PRO A 1 828  ? -17.368 20.467 27.482  1.00 109.90 ? 825  PRO A CB  1 
ATOM 6346 C CG  . PRO A 1 828  ? -18.028 19.959 28.724  1.00 109.90 ? 825  PRO A CG  1 
ATOM 6347 C CD  . PRO A 1 828  ? -16.977 19.229 29.538  1.00 109.90 ? 825  PRO A CD  1 
ATOM 6348 N N   . ASN A 1 829  ? -15.392 22.302 29.682  1.00 87.18  ? 826  ASN A N   1 
ATOM 6349 C CA  . ASN A 1 829  ? -15.203 23.596 30.300  1.00 87.18  ? 826  ASN A CA  1 
ATOM 6350 C C   . ASN A 1 829  ? -13.822 24.145 30.097  1.00 87.18  ? 826  ASN A C   1 
ATOM 6351 O O   . ASN A 1 829  ? -12.858 23.381 30.197  1.00 87.18  ? 826  ASN A O   1 
ATOM 6352 C CB  . ASN A 1 829  ? -15.363 23.432 31.787  1.00 53.11  ? 826  ASN A CB  1 
ATOM 6353 C CG  . ASN A 1 829  ? -16.790 23.367 32.195  1.00 53.11  ? 826  ASN A CG  1 
ATOM 6354 O OD1 . ASN A 1 829  ? -17.695 23.571 31.378  1.00 53.11  ? 826  ASN A OD1 1 
ATOM 6355 N ND2 . ASN A 1 829  ? -17.017 23.111 33.478  1.00 53.11  ? 826  ASN A ND2 1 
ATOM 6356 N N   . THR A 1 830  ? -13.719 25.459 29.852  1.00 55.36  ? 827  THR A N   1 
ATOM 6357 C CA  . THR A 1 830  ? -12.428 26.166 29.924  1.00 55.36  ? 827  THR A CA  1 
ATOM 6358 C C   . THR A 1 830  ? -12.173 26.633 31.357  1.00 55.36  ? 827  THR A C   1 
ATOM 6359 O O   . THR A 1 830  ? -12.884 27.495 31.870  1.00 55.36  ? 827  THR A O   1 
ATOM 6360 C CB  . THR A 1 830  ? -12.343 27.394 28.969  1.00 52.95  ? 827  THR A CB  1 
ATOM 6361 O OG1 . THR A 1 830  ? -12.555 27.006 27.601  1.00 52.95  ? 827  THR A OG1 1 
ATOM 6362 C CG2 . THR A 1 830  ? -10.970 28.057 29.086  1.00 52.95  ? 827  THR A CG2 1 
ATOM 6363 N N   . TYR A 1 831  ? -11.163 26.065 32.003  1.00 34.92  ? 828  TYR A N   1 
ATOM 6364 C CA  . TYR A 1 831  ? -10.803 26.507 33.360  1.00 34.92  ? 828  TYR A CA  1 
ATOM 6365 C C   . TYR A 1 831  ? -9.675  27.558 33.365  1.00 34.92  ? 828  TYR A C   1 
ATOM 6366 O O   . TYR A 1 831  ? -8.996  27.772 32.341  1.00 34.92  ? 828  TYR A O   1 
ATOM 6367 C CB  . TYR A 1 831  ? -10.419 25.307 34.257  1.00 62.96  ? 828  TYR A CB  1 
ATOM 6368 C CG  . TYR A 1 831  ? -11.503 24.268 34.381  1.00 62.96  ? 828  TYR A CG  1 
ATOM 6369 C CD1 . TYR A 1 831  ? -11.530 23.171 33.525  1.00 62.96  ? 828  TYR A CD1 1 
ATOM 6370 C CD2 . TYR A 1 831  ? -12.524 24.399 35.328  1.00 62.96  ? 828  TYR A CD2 1 
ATOM 6371 C CE1 . TYR A 1 831  ? -12.543 22.211 33.596  1.00 62.96  ? 828  TYR A CE1 1 
ATOM 6372 C CE2 . TYR A 1 831  ? -13.550 23.446 35.426  1.00 62.96  ? 828  TYR A CE2 1 
ATOM 6373 C CZ  . TYR A 1 831  ? -13.556 22.344 34.550  1.00 62.96  ? 828  TYR A CZ  1 
ATOM 6374 O OH  . TYR A 1 831  ? -14.561 21.389 34.607  1.00 62.96  ? 828  TYR A OH  1 
ATOM 6375 N N   . PHE A 1 832  ? -9.511  28.219 34.511  1.00 32.07  ? 829  PHE A N   1 
ATOM 6376 C CA  . PHE A 1 832  ? -8.359  29.064 34.794  1.00 32.07  ? 829  PHE A CA  1 
ATOM 6377 C C   . PHE A 1 832  ? -7.545  28.335 35.818  1.00 32.07  ? 829  PHE A C   1 
ATOM 6378 O O   . PHE A 1 832  ? -7.867  28.400 37.023  1.00 32.07  ? 829  PHE A O   1 
ATOM 6379 C CB  . PHE A 1 832  ? -8.752  30.357 35.507  1.00 33.79  ? 829  PHE A CB  1 
ATOM 6380 C CG  . PHE A 1 832  ? -9.108  31.486 34.607  1.00 33.79  ? 829  PHE A CG  1 
ATOM 6381 C CD1 . PHE A 1 832  ? -8.275  31.856 33.564  1.00 33.79  ? 829  PHE A CD1 1 
ATOM 6382 C CD2 . PHE A 1 832  ? -10.278 32.231 34.856  1.00 33.79  ? 829  PHE A CD2 1 
ATOM 6383 C CE1 . PHE A 1 832  ? -8.626  32.932 32.728  1.00 33.79  ? 829  PHE A CE1 1 
ATOM 6384 C CE2 . PHE A 1 832  ? -10.644 33.287 34.039  1.00 33.79  ? 829  PHE A CE2 1 
ATOM 6385 C CZ  . PHE A 1 832  ? -9.816  33.649 32.973  1.00 33.79  ? 829  PHE A CZ  1 
ATOM 6386 N N   . ILE A 1 833  ? -6.467  27.685 35.401  1.00 50.64  ? 830  ILE A N   1 
ATOM 6387 C CA  . ILE A 1 833  ? -5.626  27.029 36.401  1.00 50.64  ? 830  ILE A CA  1 
ATOM 6388 C C   . ILE A 1 833  ? -4.453  27.891 36.850  1.00 50.64  ? 830  ILE A C   1 
ATOM 6389 O O   . ILE A 1 833  ? -3.765  28.511 36.036  1.00 50.64  ? 830  ILE A O   1 
ATOM 6390 C CB  . ILE A 1 833  ? -5.137  25.668 35.942  1.00 31.03  ? 830  ILE A CB  1 
ATOM 6391 C CG1 . ILE A 1 833  ? -6.319  24.816 35.496  1.00 31.03  ? 830  ILE A CG1 1 
ATOM 6392 C CG2 . ILE A 1 833  ? -4.473  24.978 37.088  1.00 31.03  ? 830  ILE A CG2 1 
ATOM 6393 C CD1 . ILE A 1 833  ? -6.038  23.968 34.289  1.00 31.03  ? 830  ILE A CD1 1 
ATOM 6394 N N   . VAL A 1 834  ? -4.244  27.908 38.160  1.00 35.15  ? 831  VAL A N   1 
ATOM 6395 C CA  . VAL A 1 834  ? -3.207  28.703 38.787  1.00 35.15  ? 831  VAL A CA  1 
ATOM 6396 C C   . VAL A 1 834  ? -2.255  27.861 39.635  1.00 35.15  ? 831  VAL A C   1 
ATOM 6397 O O   . VAL A 1 834  ? -2.685  27.178 40.557  1.00 35.15  ? 831  VAL A O   1 
ATOM 6398 C CB  . VAL A 1 834  ? -3.881  29.765 39.660  1.00 23.06  ? 831  VAL A CB  1 
ATOM 6399 C CG1 . VAL A 1 834  ? -2.872  30.512 40.589  1.00 23.06  ? 831  VAL A CG1 1 
ATOM 6400 C CG2 . VAL A 1 834  ? -4.640  30.722 38.743  1.00 23.06  ? 831  VAL A CG2 1 
ATOM 6401 N N   . GLY A 1 835  ? -0.960  27.918 39.345  1.00 52.71  ? 832  GLY A N   1 
ATOM 6402 C CA  . GLY A 1 835  ? 0.014   27.211 40.177  1.00 52.71  ? 832  GLY A CA  1 
ATOM 6403 C C   . GLY A 1 835  ? 0.536   28.157 41.216  1.00 52.71  ? 832  GLY A C   1 
ATOM 6404 O O   . GLY A 1 835  ? 0.844   29.293 40.894  1.00 52.71  ? 832  GLY A O   1 
ATOM 6405 N N   . THR A 1 836  ? 0.635   27.706 42.459  1.00 33.66  ? 833  THR A N   1 
ATOM 6406 C CA  . THR A 1 836  ? 1.009   28.605 43.555  1.00 33.66  ? 833  THR A CA  1 
ATOM 6407 C C   . THR A 1 836  ? 2.174   28.100 44.391  1.00 33.66  ? 833  THR A C   1 
ATOM 6408 O O   . THR A 1 836  ? 2.868   27.178 43.993  1.00 33.66  ? 833  THR A O   1 
ATOM 6409 C CB  . THR A 1 836  ? -0.168  28.846 44.531  1.00 39.31  ? 833  THR A CB  1 
ATOM 6410 O OG1 . THR A 1 836  ? -0.405  27.674 45.346  1.00 39.31  ? 833  THR A OG1 1 
ATOM 6411 C CG2 . THR A 1 836  ? -1.432  29.285 43.760  1.00 39.31  ? 833  THR A CG2 1 
ATOM 6412 N N   . ALA A 1 837  ? 2.393   28.675 45.563  1.00 34.23  ? 834  ALA A N   1 
ATOM 6413 C CA  . ALA A 1 837  ? 3.516   28.231 46.326  1.00 34.23  ? 834  ALA A CA  1 
ATOM 6414 C C   . ALA A 1 837  ? 3.656   28.955 47.682  1.00 34.23  ? 834  ALA A C   1 
ATOM 6415 O O   . ALA A 1 837  ? 3.428   30.160 47.790  1.00 34.23  ? 834  ALA A O   1 
ATOM 6416 C CB  . ALA A 1 837  ? 4.741   28.374 45.488  1.00 18.75  ? 834  ALA A CB  1 
ATOM 6417 N N   . MET A 1 838  ? 4.016   28.217 48.722  1.00 33.91  ? 835  MET A N   1 
ATOM 6418 C CA  . MET A 1 838  ? 4.047   28.810 50.028  1.00 33.91  ? 835  MET A CA  1 
ATOM 6419 C C   . MET A 1 838  ? 5.448   29.321 50.343  1.00 33.91  ? 835  MET A C   1 
ATOM 6420 O O   . MET A 1 838  ? 6.383   28.534 50.572  1.00 33.91  ? 835  MET A O   1 
ATOM 6421 C CB  . MET A 1 838  ? 3.598   27.792 51.066  1.00 31.58  ? 835  MET A CB  1 
ATOM 6422 C CG  . MET A 1 838  ? 2.324   27.039 50.696  1.00 31.58  ? 835  MET A CG  1 
ATOM 6423 S SD  . MET A 1 838  ? 0.857   28.086 50.744  1.00 31.58  ? 835  MET A SD  1 
ATOM 6424 C CE  . MET A 1 838  ? 1.025   28.932 52.344  1.00 31.58  ? 835  MET A CE  1 
ATOM 6425 N N   . VAL A 1 839  ? 5.583   30.639 50.378  1.00 39.84  ? 836  VAL A N   1 
ATOM 6426 C CA  . VAL A 1 839  ? 6.873   31.300 50.477  1.00 39.84  ? 836  VAL A CA  1 
ATOM 6427 C C   . VAL A 1 839  ? 7.063   31.788 51.893  1.00 39.84  ? 836  VAL A C   1 
ATOM 6428 O O   . VAL A 1 839  ? 6.256   32.574 52.363  1.00 39.84  ? 836  VAL A O   1 
ATOM 6429 C CB  . VAL A 1 839  ? 6.927   32.565 49.525  1.00 25.91  ? 836  VAL A CB  1 
ATOM 6430 C CG1 . VAL A 1 839  ? 8.211   33.372 49.725  1.00 25.91  ? 836  VAL A CG1 1 
ATOM 6431 C CG2 . VAL A 1 839  ? 6.733   32.173 48.049  1.00 25.91  ? 836  VAL A CG2 1 
ATOM 6432 N N   . TYR A 1 840  ? 8.129   31.357 52.563  1.00 56.88  ? 837  TYR A N   1 
ATOM 6433 C CA  . TYR A 1 840  ? 8.478   31.923 53.869  1.00 56.88  ? 837  TYR A CA  1 
ATOM 6434 C C   . TYR A 1 840  ? 9.916   32.402 53.813  1.00 56.88  ? 837  TYR A C   1 
ATOM 6435 O O   . TYR A 1 840  ? 10.796  31.623 53.453  1.00 56.88  ? 837  TYR A O   1 
ATOM 6436 C CB  . TYR A 1 840  ? 8.253   30.907 55.013  1.00 24.71  ? 837  TYR A CB  1 
ATOM 6437 C CG  . TYR A 1 840  ? 6.826   30.376 55.070  1.00 24.71  ? 837  TYR A CG  1 
ATOM 6438 C CD1 . TYR A 1 840  ? 6.473   29.221 54.348  1.00 24.71  ? 837  TYR A CD1 1 
ATOM 6439 C CD2 . TYR A 1 840  ? 5.828   31.049 55.805  1.00 24.71  ? 837  TYR A CD2 1 
ATOM 6440 C CE1 . TYR A 1 840  ? 5.192   28.741 54.351  1.00 24.71  ? 837  TYR A CE1 1 
ATOM 6441 C CE2 . TYR A 1 840  ? 4.531   30.575 55.845  1.00 24.71  ? 837  TYR A CE2 1 
ATOM 6442 C CZ  . TYR A 1 840  ? 4.210   29.409 55.107  1.00 24.71  ? 837  TYR A CZ  1 
ATOM 6443 O OH  . TYR A 1 840  ? 2.899   28.888 55.097  1.00 24.71  ? 837  TYR A OH  1 
ATOM 6444 N N   . PRO A 1 841  ? 10.160  33.693 54.149  1.00 78.07  ? 838  PRO A N   1 
ATOM 6445 C CA  . PRO A 1 841  ? 11.453  34.397 53.933  1.00 78.07  ? 838  PRO A CA  1 
ATOM 6446 C C   . PRO A 1 841  ? 12.699  33.679 54.450  1.00 78.07  ? 838  PRO A C   1 
ATOM 6447 O O   . PRO A 1 841  ? 13.750  33.757 53.816  1.00 78.07  ? 838  PRO A O   1 
ATOM 6448 C CB  . PRO A 1 841  ? 11.261  35.727 54.670  1.00 72.51  ? 838  PRO A CB  1 
ATOM 6449 C CG  . PRO A 1 841  ? 9.815   35.960 54.615  1.00 72.51  ? 838  PRO A CG  1 
ATOM 6450 C CD  . PRO A 1 841  ? 9.167   34.595 54.762  1.00 72.51  ? 838  PRO A CD  1 
ATOM 6451 N N   . GLU A 1 842  ? 12.571  33.004 55.589  1.00 72.10  ? 839  GLU A N   1 
ATOM 6452 C CA  . GLU A 1 842  ? 13.662  32.252 56.182  1.00 72.10  ? 839  GLU A CA  1 
ATOM 6453 C C   . GLU A 1 842  ? 14.089  31.129 55.247  1.00 72.10  ? 839  GLU A C   1 
ATOM 6454 O O   . GLU A 1 842  ? 15.291  30.953 54.988  1.00 72.10  ? 839  GLU A O   1 
ATOM 6455 C CB  . GLU A 1 842  ? 13.254  31.681 57.549  1.00 88.29  ? 839  GLU A CB  1 
ATOM 6456 C CG  . GLU A 1 842  ? 11.955  30.861 57.566  1.00 88.29  ? 839  GLU A CG  1 
ATOM 6457 C CD  . GLU A 1 842  ? 10.710  31.718 57.794  1.00 88.29  ? 839  GLU A CD  1 
ATOM 6458 O OE1 . GLU A 1 842  ? 9.940   31.404 58.728  1.00 88.29  ? 839  GLU A OE1 1 
ATOM 6459 O OE2 . GLU A 1 842  ? 10.494  32.705 57.052  1.00 88.29  ? 839  GLU A OE2 1 
ATOM 6460 N N   . GLU A 1 843  ? 13.102  30.395 54.727  1.00 63.32  ? 840  GLU A N   1 
ATOM 6461 C CA  . GLU A 1 843  ? 13.344  29.252 53.849  1.00 63.32  ? 840  GLU A CA  1 
ATOM 6462 C C   . GLU A 1 843  ? 14.136  29.613 52.599  1.00 63.32  ? 840  GLU A C   1 
ATOM 6463 O O   . GLU A 1 843  ? 14.105  30.753 52.130  1.00 63.32  ? 840  GLU A O   1 
ATOM 6464 C CB  . GLU A 1 843  ? 12.027  28.583 53.472  1.00 62.48  ? 840  GLU A CB  1 
ATOM 6465 C CG  . GLU A 1 843  ? 11.170  28.221 54.682  1.00 62.48  ? 840  GLU A CG  1 
ATOM 6466 C CD  . GLU A 1 843  ? 10.038  27.275 54.344  1.00 62.48  ? 840  GLU A CD  1 
ATOM 6467 O OE1 . GLU A 1 843  ? 9.461   26.658 55.276  1.00 62.48  ? 840  GLU A OE1 1 
ATOM 6468 O OE2 . GLU A 1 843  ? 9.725   27.146 53.143  1.00 62.48  ? 840  GLU A OE2 1 
ATOM 6469 N N   . ALA A 1 844  ? 14.869  28.639 52.076  1.00 60.38  ? 841  ALA A N   1 
ATOM 6470 C CA  . ALA A 1 844  ? 15.708  28.861 50.900  1.00 60.38  ? 841  ALA A CA  1 
ATOM 6471 C C   . ALA A 1 844  ? 14.839  28.763 49.673  1.00 60.38  ? 841  ALA A C   1 
ATOM 6472 O O   . ALA A 1 844  ? 15.103  29.366 48.634  1.00 60.38  ? 841  ALA A O   1 
ATOM 6473 C CB  . ALA A 1 844  ? 16.829  27.809 50.825  1.00 45.90  ? 841  ALA A CB  1 
ATOM 6474 N N   . GLU A 1 845  ? 13.788  27.986 49.820  1.00 47.50  ? 842  GLU A N   1 
ATOM 6475 C CA  . GLU A 1 845  ? 13.064  27.490 48.698  1.00 47.50  ? 842  GLU A CA  1 
ATOM 6476 C C   . GLU A 1 845  ? 11.791  26.878 49.270  1.00 47.50  ? 842  GLU A C   1 
ATOM 6477 O O   . GLU A 1 845  ? 11.839  26.202 50.299  1.00 47.50  ? 842  GLU A O   1 
ATOM 6478 C CB  . GLU A 1 845  ? 13.913  26.448 48.022  1.00 48.18  ? 842  GLU A CB  1 
ATOM 6479 C CG  . GLU A 1 845  ? 13.245  25.693 46.942  1.00 48.18  ? 842  GLU A CG  1 
ATOM 6480 C CD  . GLU A 1 845  ? 14.178  24.695 46.329  1.00 48.18  ? 842  GLU A CD  1 
ATOM 6481 O OE1 . GLU A 1 845  ? 14.993  24.108 47.096  1.00 48.18  ? 842  GLU A OE1 1 
ATOM 6482 O OE2 . GLU A 1 845  ? 14.086  24.516 45.083  1.00 48.18  ? 842  GLU A OE2 1 
ATOM 6483 N N   . PRO A 1 846  ? 10.637  27.190 48.659  1.00 70.28  ? 843  PRO A N   1 
ATOM 6484 C CA  . PRO A 1 846  ? 9.401   26.617 49.163  1.00 70.28  ? 843  PRO A CA  1 
ATOM 6485 C C   . PRO A 1 846  ? 9.321   25.122 48.868  1.00 70.28  ? 843  PRO A C   1 
ATOM 6486 O O   . PRO A 1 846  ? 9.758   24.662 47.799  1.00 70.28  ? 843  PRO A O   1 
ATOM 6487 C CB  . PRO A 1 846  ? 8.302   27.400 48.425  1.00 28.60  ? 843  PRO A CB  1 
ATOM 6488 C CG  . PRO A 1 846  ? 8.958   27.896 47.157  1.00 28.60  ? 843  PRO A CG  1 
ATOM 6489 C CD  . PRO A 1 846  ? 10.426  28.109 47.523  1.00 28.60  ? 843  PRO A CD  1 
ATOM 6490 N N   . LYS A 1 847  ? 8.776   24.399 49.852  1.00 63.32  ? 844  LYS A N   1 
ATOM 6491 C CA  . LYS A 1 847  ? 8.547   22.953 49.824  1.00 63.32  ? 844  LYS A CA  1 
ATOM 6492 C C   . LYS A 1 847  ? 7.061   22.639 49.609  1.00 63.32  ? 844  LYS A C   1 
ATOM 6493 O O   . LYS A 1 847  ? 6.714   21.516 49.282  1.00 63.32  ? 844  LYS A O   1 
ATOM 6494 C CB  . LYS A 1 847  ? 9.049   22.315 51.130  1.00 170.13 ? 844  LYS A CB  1 
ATOM 6495 C CG  . LYS A 1 847  ? 8.316   22.783 52.401  1.00 170.13 ? 844  LYS A CG  1 
ATOM 6496 C CD  . LYS A 1 847  ? 8.565   24.266 52.704  1.00 170.13 ? 844  LYS A CD  1 
ATOM 6497 C CE  . LYS A 1 847  ? 7.281   24.995 53.081  1.00 170.13 ? 844  LYS A CE  1 
ATOM 6498 N NZ  . LYS A 1 847  ? 7.226   26.368 52.504  1.00 170.13 ? 844  LYS A NZ  1 
ATOM 6499 N N   . GLN A 1 848  ? 6.197   23.640 49.795  1.00 57.00  ? 845  GLN A N   1 
ATOM 6500 C CA  . GLN A 1 848  ? 4.743   23.481 49.667  1.00 57.00  ? 845  GLN A CA  1 
ATOM 6501 C C   . GLN A 1 848  ? 4.155   24.423 48.632  1.00 57.00  ? 845  GLN A C   1 
ATOM 6502 O O   . GLN A 1 848  ? 4.538   25.597 48.555  1.00 57.00  ? 845  GLN A O   1 
ATOM 6503 C CB  . GLN A 1 848  ? 4.058   23.829 50.966  1.00 67.03  ? 845  GLN A CB  1 
ATOM 6504 C CG  . GLN A 1 848  ? 4.445   23.046 52.134  1.00 67.03  ? 845  GLN A CG  1 
ATOM 6505 C CD  . GLN A 1 848  ? 3.857   23.647 53.372  1.00 67.03  ? 845  GLN A CD  1 
ATOM 6506 O OE1 . GLN A 1 848  ? 3.891   24.867 53.570  1.00 67.03  ? 845  GLN A OE1 1 
ATOM 6507 N NE2 . GLN A 1 848  ? 3.292   22.803 54.219  1.00 67.03  ? 845  GLN A NE2 1 
ATOM 6508 N N   . GLY A 1 849  ? 3.187   23.930 47.871  1.00 35.41  ? 846  GLY A N   1 
ATOM 6509 C CA  . GLY A 1 849  ? 2.466   24.759 46.913  1.00 35.41  ? 846  GLY A CA  1 
ATOM 6510 C C   . GLY A 1 849  ? 1.249   24.002 46.419  1.00 35.41  ? 846  GLY A C   1 
ATOM 6511 O O   . GLY A 1 849  ? 1.034   22.830 46.783  1.00 35.41  ? 846  GLY A O   1 
ATOM 6512 N N   . ARG A 1 850  ? 0.430   24.637 45.593  1.00 43.41  ? 847  ARG A N   1 
ATOM 6513 C CA  . ARG A 1 850  ? -0.687  23.901 45.039  1.00 43.41  ? 847  ARG A CA  1 
ATOM 6514 C C   . ARG A 1 850  ? -1.052  24.308 43.637  1.00 43.41  ? 847  ARG A C   1 
ATOM 6515 O O   . ARG A 1 850  ? -0.695  25.380 43.152  1.00 43.41  ? 847  ARG A O   1 
ATOM 6516 C CB  . ARG A 1 850  ? -1.923  23.936 45.973  1.00 57.89  ? 847  ARG A CB  1 
ATOM 6517 C CG  . ARG A 1 850  ? -2.125  25.216 46.748  1.00 57.89  ? 847  ARG A CG  1 
ATOM 6518 C CD  . ARG A 1 850  ? -3.301  25.132 47.724  1.00 57.89  ? 847  ARG A CD  1 
ATOM 6519 N NE  . ARG A 1 850  ? -3.816  26.477 48.048  1.00 57.89  ? 847  ARG A NE  1 
ATOM 6520 C CZ  . ARG A 1 850  ? -4.979  26.982 47.626  1.00 57.89  ? 847  ARG A CZ  1 
ATOM 6521 N NH1 . ARG A 1 850  ? -5.802  26.256 46.876  1.00 57.89  ? 847  ARG A NH1 1 
ATOM 6522 N NH2 . ARG A 1 850  ? -5.319  28.220 47.966  1.00 57.89  ? 847  ARG A NH2 1 
ATOM 6523 N N   . ILE A 1 851  ? -1.759  23.413 42.978  1.00 40.22  ? 848  ILE A N   1 
ATOM 6524 C CA  . ILE A 1 851  ? -2.414  23.738 41.744  1.00 40.22  ? 848  ILE A CA  1 
ATOM 6525 C C   . ILE A 1 851  ? -3.916  23.867 41.974  1.00 40.22  ? 848  ILE A C   1 
ATOM 6526 O O   . ILE A 1 851  ? -4.507  23.039 42.674  1.00 40.22  ? 848  ILE A O   1 
ATOM 6527 C CB  . ILE A 1 851  ? -2.088  22.704 40.744  1.00 22.71  ? 848  ILE A CB  1 
ATOM 6528 C CG1 . ILE A 1 851  ? -0.554  22.659 40.665  1.00 22.71  ? 848  ILE A CG1 1 
ATOM 6529 C CG2 . ILE A 1 851  ? -2.807  23.021 39.368  1.00 22.71  ? 848  ILE A CG2 1 
ATOM 6530 C CD1 . ILE A 1 851  ? -0.033  21.631 39.739  1.00 22.71  ? 848  ILE A CD1 1 
ATOM 6531 N N   . VAL A 1 852  ? -4.523  24.920 41.421  1.00 41.21  ? 849  VAL A N   1 
ATOM 6532 C CA  . VAL A 1 852  ? -5.912  25.197 41.712  1.00 41.21  ? 849  VAL A CA  1 
ATOM 6533 C C   . VAL A 1 852  ? -6.637  25.366 40.419  1.00 41.21  ? 849  VAL A C   1 
ATOM 6534 O O   . VAL A 1 852  ? -6.164  26.078 39.537  1.00 41.21  ? 849  VAL A O   1 
ATOM 6535 C CB  . VAL A 1 852  ? -6.137  26.481 42.520  1.00 24.70  ? 849  VAL A CB  1 
ATOM 6536 C CG1 . VAL A 1 852  ? -7.580  26.467 43.049  1.00 24.70  ? 849  VAL A CG1 1 
ATOM 6537 C CG2 . VAL A 1 852  ? -5.154  26.631 43.719  1.00 24.70  ? 849  VAL A CG2 1 
ATOM 6538 N N   . VAL A 1 853  ? -7.791  24.722 40.298  1.00 62.18  ? 850  VAL A N   1 
ATOM 6539 C CA  . VAL A 1 853  ? -8.527  24.779 39.053  1.00 62.18  ? 850  VAL A CA  1 
ATOM 6540 C C   . VAL A 1 853  ? -9.830  25.510 39.266  1.00 62.18  ? 850  VAL A C   1 
ATOM 6541 O O   . VAL A 1 853  ? -10.611 25.124 40.122  1.00 62.18  ? 850  VAL A O   1 
ATOM 6542 C CB  . VAL A 1 853  ? -8.792  23.384 38.513  1.00 25.81  ? 850  VAL A CB  1 
ATOM 6543 C CG1 . VAL A 1 853  ? -9.621  23.451 37.219  1.00 25.81  ? 850  VAL A CG1 1 
ATOM 6544 C CG2 . VAL A 1 853  ? -7.488  22.668 38.255  1.00 25.81  ? 850  VAL A CG2 1 
ATOM 6545 N N   . PHE A 1 854  ? -10.051 26.565 38.487  1.00 44.82  ? 851  PHE A N   1 
ATOM 6546 C CA  . PHE A 1 854  ? -11.171 27.457 38.715  1.00 44.82  ? 851  PHE A CA  1 
ATOM 6547 C C   . PHE A 1 854  ? -12.019 27.563 37.465  1.00 44.82  ? 851  PHE A C   1 
ATOM 6548 O O   . PHE A 1 854  ? -11.514 27.475 36.325  1.00 44.82  ? 851  PHE A O   1 
ATOM 6549 C CB  . PHE A 1 854  ? -10.727 28.890 38.966  1.00 40.58  ? 851  PHE A CB  1 
ATOM 6550 C CG  . PHE A 1 854  ? -9.870  29.121 40.185  1.00 40.58  ? 851  PHE A CG  1 
ATOM 6551 C CD1 . PHE A 1 854  ? -8.489  29.090 40.092  1.00 40.58  ? 851  PHE A CD1 1 
ATOM 6552 C CD2 . PHE A 1 854  ? -10.446 29.542 41.378  1.00 40.58  ? 851  PHE A CD2 1 
ATOM 6553 C CE1 . PHE A 1 854  ? -7.698  29.385 41.185  1.00 40.58  ? 851  PHE A CE1 1 
ATOM 6554 C CE2 . PHE A 1 854  ? -9.669  29.834 42.473  1.00 40.58  ? 851  PHE A CE2 1 
ATOM 6555 C CZ  . PHE A 1 854  ? -8.286  29.753 42.376  1.00 40.58  ? 851  PHE A CZ  1 
ATOM 6556 N N   . GLN A 1 855  ? -13.310 27.804 37.693  1.00 66.77  ? 852  GLN A N   1 
ATOM 6557 C CA  . GLN A 1 855  ? -14.178 28.246 36.626  1.00 66.77  ? 852  GLN A CA  1 
ATOM 6558 C C   . GLN A 1 855  ? -14.812 29.580 36.952  1.00 66.77  ? 852  GLN A C   1 
ATOM 6559 O O   . GLN A 1 855  ? -15.230 29.839 38.090  1.00 66.77  ? 852  GLN A O   1 
ATOM 6560 C CB  . GLN A 1 855  ? -15.251 27.228 36.295  1.00 51.23  ? 852  GLN A CB  1 
ATOM 6561 C CG  . GLN A 1 855  ? -15.833 27.436 34.890  1.00 51.23  ? 852  GLN A CG  1 
ATOM 6562 C CD  . GLN A 1 855  ? -16.930 26.451 34.558  1.00 51.23  ? 852  GLN A CD  1 
ATOM 6563 O OE1 . GLN A 1 855  ? -17.447 25.772 35.446  1.00 51.23  ? 852  GLN A OE1 1 
ATOM 6564 N NE2 . GLN A 1 855  ? -17.297 26.369 33.280  1.00 51.23  ? 852  GLN A NE2 1 
ATOM 6565 N N   . TYR A 1 856  ? -14.827 30.426 35.926  1.00 41.05  ? 853  TYR A N   1 
ATOM 6566 C CA  . TYR A 1 856  ? -15.553 31.680 35.921  1.00 41.05  ? 853  TYR A CA  1 
ATOM 6567 C C   . TYR A 1 856  ? -16.789 31.505 35.023  1.00 41.05  ? 853  TYR A C   1 
ATOM 6568 O O   . TYR A 1 856  ? -16.660 31.282 33.801  1.00 41.05  ? 853  TYR A O   1 
ATOM 6569 C CB  . TYR A 1 856  ? -14.647 32.828 35.426  1.00 46.06  ? 853  TYR A CB  1 
ATOM 6570 C CG  . TYR A 1 856  ? -15.255 34.208 35.592  1.00 46.06  ? 853  TYR A CG  1 
ATOM 6571 C CD1 . TYR A 1 856  ? -15.393 34.788 36.863  1.00 46.06  ? 853  TYR A CD1 1 
ATOM 6572 C CD2 . TYR A 1 856  ? -15.706 34.932 34.478  1.00 46.06  ? 853  TYR A CD2 1 
ATOM 6573 C CE1 . TYR A 1 856  ? -15.965 36.045 37.022  1.00 46.06  ? 853  TYR A CE1 1 
ATOM 6574 C CE2 . TYR A 1 856  ? -16.293 36.203 34.625  1.00 46.06  ? 853  TYR A CE2 1 
ATOM 6575 C CZ  . TYR A 1 856  ? -16.407 36.752 35.904  1.00 46.06  ? 853  TYR A CZ  1 
ATOM 6576 O OH  . TYR A 1 856  ? -16.966 37.996 36.064  1.00 46.06  ? 853  TYR A OH  1 
ATOM 6577 N N   . SER A 1 857  ? -17.966 31.643 35.636  1.00 125.09 ? 854  SER A N   1 
ATOM 6578 C CA  . SER A 1 857  ? -19.247 31.215 35.058  1.00 125.09 ? 854  SER A CA  1 
ATOM 6579 C C   . SER A 1 857  ? -20.020 32.317 34.314  1.00 125.09 ? 854  SER A C   1 
ATOM 6580 O O   . SER A 1 857  ? -19.544 32.860 33.310  1.00 125.09 ? 854  SER A O   1 
ATOM 6581 C CB  . SER A 1 857  ? -20.124 30.622 36.169  1.00 72.23  ? 854  SER A CB  1 
ATOM 6582 O OG  . SER A 1 857  ? -19.344 29.939 37.141  1.00 72.23  ? 854  SER A OG  1 
ATOM 6583 N N   . ASP A 1 858  ? -21.228 32.608 34.798  1.00 127.11 ? 855  ASP A N   1 
ATOM 6584 C CA  . ASP A 1 858  ? -22.037 33.730 34.317  1.00 127.11 ? 855  ASP A CA  1 
ATOM 6585 C C   . ASP A 1 858  ? -21.384 35.029 34.784  1.00 127.11 ? 855  ASP A C   1 
ATOM 6586 O O   . ASP A 1 858  ? -21.301 36.012 34.044  1.00 127.11 ? 855  ASP A O   1 
ATOM 6587 C CB  . ASP A 1 858  ? -23.474 33.642 34.864  1.00 111.98 ? 855  ASP A CB  1 
ATOM 6588 C CG  . ASP A 1 858  ? -24.455 32.964 33.893  1.00 111.98 ? 855  ASP A CG  1 
ATOM 6589 O OD1 . ASP A 1 858  ? -24.185 31.841 33.413  1.00 111.98 ? 855  ASP A OD1 1 
ATOM 6590 O OD2 . ASP A 1 858  ? -25.527 33.553 33.626  1.00 111.98 ? 855  ASP A OD2 1 
ATOM 6591 N N   . GLY A 1 859  ? -20.923 35.004 36.030  1.00 69.32  ? 856  GLY A N   1 
ATOM 6592 C CA  . GLY A 1 859  ? -20.189 36.095 36.640  1.00 69.32  ? 856  GLY A CA  1 
ATOM 6593 C C   . GLY A 1 859  ? -19.590 35.563 37.922  1.00 69.32  ? 856  GLY A C   1 
ATOM 6594 O O   . GLY A 1 859  ? -19.314 36.330 38.857  1.00 69.32  ? 856  GLY A O   1 
ATOM 6595 N N   . LYS A 1 860  ? -19.376 34.244 37.954  1.00 51.28  ? 857  LYS A N   1 
ATOM 6596 C CA  . LYS A 1 860  ? -18.970 33.540 39.175  1.00 51.28  ? 857  LYS A CA  1 
ATOM 6597 C C   . LYS A 1 860  ? -17.542 32.967 39.081  1.00 51.28  ? 857  LYS A C   1 
ATOM 6598 O O   . LYS A 1 860  ? -17.021 32.770 37.983  1.00 51.28  ? 857  LYS A O   1 
ATOM 6599 C CB  . LYS A 1 860  ? -19.981 32.427 39.473  1.00 144.72 ? 857  LYS A CB  1 
ATOM 6600 C CG  . LYS A 1 860  ? -21.231 32.503 38.609  1.00 144.72 ? 857  LYS A CG  1 
ATOM 6601 C CD  . LYS A 1 860  ? -22.491 32.537 39.422  1.00 144.72 ? 857  LYS A CD  1 
ATOM 6602 C CE  . LYS A 1 860  ? -23.589 33.165 38.604  1.00 144.72 ? 857  LYS A CE  1 
ATOM 6603 N NZ  . LYS A 1 860  ? -24.576 33.809 39.489  1.00 144.72 ? 857  LYS A NZ  1 
ATOM 6604 N N   . LEU A 1 861  ? -16.913 32.693 40.221  1.00 60.18  ? 858  LEU A N   1 
ATOM 6605 C CA  . LEU A 1 861  ? -15.568 32.104 40.213  1.00 60.18  ? 858  LEU A CA  1 
ATOM 6606 C C   . LEU A 1 861  ? -15.492 30.914 41.170  1.00 60.18  ? 858  LEU A C   1 
ATOM 6607 O O   . LEU A 1 861  ? -15.223 31.072 42.357  1.00 60.18  ? 858  LEU A O   1 
ATOM 6608 C CB  . LEU A 1 861  ? -14.492 33.174 40.543  1.00 35.10  ? 858  LEU A CB  1 
ATOM 6609 C CG  . LEU A 1 861  ? -13.016 33.118 40.050  1.00 35.10  ? 858  LEU A CG  1 
ATOM 6610 C CD1 . LEU A 1 861  ? -12.072 32.708 41.180  1.00 35.10  ? 858  LEU A CD1 1 
ATOM 6611 C CD2 . LEU A 1 861  ? -12.763 32.279 38.776  1.00 35.10  ? 858  LEU A CD2 1 
ATOM 6612 N N   . GLN A 1 862  ? -15.720 29.715 40.656  1.00 39.05  ? 859  GLN A N   1 
ATOM 6613 C CA  . GLN A 1 862  ? -15.731 28.542 41.526  1.00 39.05  ? 859  GLN A CA  1 
ATOM 6614 C C   . GLN A 1 862  ? -14.357 27.848 41.629  1.00 39.05  ? 859  GLN A C   1 
ATOM 6615 O O   . GLN A 1 862  ? -13.727 27.535 40.573  1.00 39.05  ? 859  GLN A O   1 
ATOM 6616 C CB  . GLN A 1 862  ? -16.792 27.561 41.025  1.00 104.62 ? 859  GLN A CB  1 
ATOM 6617 C CG  . GLN A 1 862  ? -17.094 26.396 41.960  1.00 104.62 ? 859  GLN A CG  1 
ATOM 6618 C CD  . GLN A 1 862  ? -18.013 25.366 41.318  1.00 104.62 ? 859  GLN A CD  1 
ATOM 6619 O OE1 . GLN A 1 862  ? -18.248 25.395 40.110  1.00 104.62 ? 859  GLN A OE1 1 
ATOM 6620 N NE2 . GLN A 1 862  ? -18.536 24.453 42.126  1.00 104.62 ? 859  GLN A NE2 1 
ATOM 6621 N N   . THR A 1 863  ? -13.906 27.627 42.880  1.00 50.33  ? 860  THR A N   1 
ATOM 6622 C CA  . THR A 1 863  ? -12.786 26.719 43.176  1.00 50.33  ? 860  THR A CA  1 
ATOM 6623 C C   . THR A 1 863  ? -13.210 25.271 42.843  1.00 50.33  ? 860  THR A C   1 
ATOM 6624 O O   . THR A 1 863  ? -13.802 24.587 43.699  1.00 50.33  ? 860  THR A O   1 
ATOM 6625 C CB  . THR A 1 863  ? -12.331 26.761 44.672  1.00 42.21  ? 860  THR A CB  1 
ATOM 6626 O OG1 . THR A 1 863  ? -11.974 28.089 45.066  1.00 42.21  ? 860  THR A OG1 1 
ATOM 6627 C CG2 . THR A 1 863  ? -11.107 25.867 44.896  1.00 42.21  ? 860  THR A CG2 1 
ATOM 6628 N N   . VAL A 1 864  ? -12.915 24.826 41.608  1.00 43.68  ? 861  VAL A N   1 
ATOM 6629 C CA  . VAL A 1 864  ? -13.351 23.531 41.055  1.00 43.68  ? 861  VAL A CA  1 
ATOM 6630 C C   . VAL A 1 864  ? -12.518 22.357 41.540  1.00 43.68  ? 861  VAL A C   1 
ATOM 6631 O O   . VAL A 1 864  ? -12.933 21.219 41.385  1.00 43.68  ? 861  VAL A O   1 
ATOM 6632 C CB  . VAL A 1 864  ? -13.284 23.509 39.491  1.00 37.92  ? 861  VAL A CB  1 
ATOM 6633 C CG1 . VAL A 1 864  ? -13.769 22.158 38.885  1.00 37.92  ? 861  VAL A CG1 1 
ATOM 6634 C CG2 . VAL A 1 864  ? -14.053 24.679 38.873  1.00 37.92  ? 861  VAL A CG2 1 
ATOM 6635 N N   . ALA A 1 865  ? -11.334 22.606 42.094  1.00 49.04  ? 862  ALA A N   1 
ATOM 6636 C CA  . ALA A 1 865  ? -10.401 21.526 42.455  1.00 49.04  ? 862  ALA A CA  1 
ATOM 6637 C C   . ALA A 1 865  ? -9.105  22.119 42.924  1.00 49.04  ? 862  ALA A C   1 
ATOM 6638 O O   . ALA A 1 865  ? -8.671  23.164 42.410  1.00 49.04  ? 862  ALA A O   1 
ATOM 6639 C CB  . ALA A 1 865  ? -10.124 20.642 41.264  1.00 38.44  ? 862  ALA A CB  1 
ATOM 6640 N N   . GLU A 1 866  ? -8.474  21.449 43.882  1.00 68.17  ? 863  GLU A N   1 
ATOM 6641 C CA  . GLU A 1 866  ? -7.127  21.799 44.310  1.00 68.17  ? 863  GLU A CA  1 
ATOM 6642 C C   . GLU A 1 866  ? -6.224  20.572 44.295  1.00 68.17  ? 863  GLU A C   1 
ATOM 6643 O O   . GLU A 1 866  ? -6.717  19.453 44.142  1.00 68.17  ? 863  GLU A O   1 
ATOM 6644 C CB  . GLU A 1 866  ? -7.127  22.503 45.669  1.00 60.49  ? 863  GLU A CB  1 
ATOM 6645 C CG  . GLU A 1 866  ? -7.834  21.818 46.808  1.00 60.49  ? 863  GLU A CG  1 
ATOM 6646 C CD  . GLU A 1 866  ? -7.505  22.466 48.146  1.00 60.49  ? 863  GLU A CD  1 
ATOM 6647 O OE1 . GLU A 1 866  ? -6.514  23.221 48.197  1.00 60.49  ? 863  GLU A OE1 1 
ATOM 6648 O OE2 . GLU A 1 866  ? -8.221  22.237 49.153  1.00 60.49  ? 863  GLU A OE2 1 
ATOM 6649 N N   . LYS A 1 867  ? -4.911  20.784 44.426  1.00 44.57  ? 864  LYS A N   1 
ATOM 6650 C CA  . LYS A 1 867  ? -3.931  19.701 44.306  1.00 44.57  ? 864  LYS A CA  1 
ATOM 6651 C C   . LYS A 1 867  ? -2.636  19.983 45.042  1.00 44.57  ? 864  LYS A C   1 
ATOM 6652 O O   . LYS A 1 867  ? -1.809  20.681 44.526  1.00 44.57  ? 864  LYS A O   1 
ATOM 6653 C CB  . LYS A 1 867  ? -3.627  19.423 42.836  1.00 70.23  ? 864  LYS A CB  1 
ATOM 6654 C CG  . LYS A 1 867  ? -2.835  18.146 42.621  1.00 70.23  ? 864  LYS A CG  1 
ATOM 6655 C CD  . LYS A 1 867  ? -3.682  16.892 42.869  1.00 70.23  ? 864  LYS A CD  1 
ATOM 6656 C CE  . LYS A 1 867  ? -2.866  15.607 42.679  1.00 70.23  ? 864  LYS A CE  1 
ATOM 6657 N NZ  . LYS A 1 867  ? -3.733  14.447 42.295  1.00 70.23  ? 864  LYS A NZ  1 
ATOM 6658 N N   . GLU A 1 868  ? -2.434  19.415 46.223  1.00 47.70  ? 865  GLU A N   1 
ATOM 6659 C CA  . GLU A 1 868  ? -1.191  19.615 46.944  1.00 47.70  ? 865  GLU A CA  1 
ATOM 6660 C C   . GLU A 1 868  ? 0.006   19.326 46.046  1.00 47.70  ? 865  GLU A C   1 
ATOM 6661 O O   . GLU A 1 868  ? -0.025  18.383 45.227  1.00 47.70  ? 865  GLU A O   1 
ATOM 6662 C CB  . GLU A 1 868  ? -1.142  18.741 48.188  1.00 56.06  ? 865  GLU A CB  1 
ATOM 6663 C CG  . GLU A 1 868  ? 0.068   19.017 49.110  1.00 56.06  ? 865  GLU A CG  1 
ATOM 6664 C CD  . GLU A 1 868  ? -0.249  18.869 50.610  1.00 56.06  ? 865  GLU A CD  1 
ATOM 6665 O OE1 . GLU A 1 868  ? 0.649   19.101 51.450  1.00 56.06  ? 865  GLU A OE1 1 
ATOM 6666 O OE2 . GLU A 1 868  ? -1.400  18.534 50.960  1.00 56.06  ? 865  GLU A OE2 1 
ATOM 6667 N N   . VAL A 1 869  ? 1.032   20.178 46.154  1.00 42.66  ? 866  VAL A N   1 
ATOM 6668 C CA  . VAL A 1 869  ? 2.381   19.836 45.643  1.00 42.66  ? 866  VAL A CA  1 
ATOM 6669 C C   . VAL A 1 869  ? 3.456   20.065 46.706  1.00 42.66  ? 866  VAL A C   1 
ATOM 6670 O O   . VAL A 1 869  ? 3.208   20.724 47.737  1.00 42.66  ? 866  VAL A O   1 
ATOM 6671 C CB  . VAL A 1 869  ? 2.781   20.519 44.283  1.00 53.90  ? 866  VAL A CB  1 
ATOM 6672 C CG1 . VAL A 1 869  ? 1.819   20.140 43.163  1.00 53.90  ? 866  VAL A CG1 1 
ATOM 6673 C CG2 . VAL A 1 869  ? 2.947   22.052 44.419  1.00 53.90  ? 866  VAL A CG2 1 
ATOM 6674 N N   . LYS A 1 870  ? 4.632   19.488 46.448  1.00 61.84  ? 867  LYS A N   1 
ATOM 6675 C CA  . LYS A 1 870  ? 5.780   19.571 47.363  1.00 61.84  ? 867  LYS A CA  1 
ATOM 6676 C C   . LYS A 1 870  ? 6.858   20.510 46.793  1.00 61.84  ? 867  LYS A C   1 
ATOM 6677 O O   . LYS A 1 870  ? 8.065   20.228 46.822  1.00 61.84  ? 867  LYS A O   1 
ATOM 6678 C CB  . LYS A 1 870  ? 6.332   18.173 47.678  1.00 63.11  ? 867  LYS A CB  1 
ATOM 6679 C CG  . LYS A 1 870  ? 5.407   17.276 48.509  1.00 63.11  ? 867  LYS A CG  1 
ATOM 6680 C CD  . LYS A 1 870  ? 5.757   15.783 48.352  1.00 63.11  ? 867  LYS A CD  1 
ATOM 6681 C CE  . LYS A 1 870  ? 5.488   15.281 46.902  1.00 63.11  ? 867  LYS A CE  1 
ATOM 6682 N NZ  . LYS A 1 870  ? 5.744   13.810 46.607  1.00 63.11  ? 867  LYS A NZ  1 
ATOM 6683 N N   . GLY A 1 871  ? 6.395   21.646 46.285  1.00 63.88  ? 868  GLY A N   1 
ATOM 6684 C CA  . GLY A 1 871  ? 7.275   22.622 45.683  1.00 63.88  ? 868  GLY A CA  1 
ATOM 6685 C C   . GLY A 1 871  ? 6.553   23.883 45.290  1.00 63.88  ? 868  GLY A C   1 
ATOM 6686 O O   . GLY A 1 871  ? 5.424   24.121 45.721  1.00 63.88  ? 868  GLY A O   1 
ATOM 6687 N N   . ALA A 1 872  ? 7.239   24.682 44.474  1.00 35.90  ? 869  ALA A N   1 
ATOM 6688 C CA  . ALA A 1 872  ? 6.754   25.956 43.939  1.00 35.90  ? 869  ALA A CA  1 
ATOM 6689 C C   . ALA A 1 872  ? 6.482   25.807 42.474  1.00 35.90  ? 869  ALA A C   1 
ATOM 6690 O O   . ALA A 1 872  ? 7.406   25.616 41.704  1.00 35.90  ? 869  ALA A O   1 
ATOM 6691 C CB  . ALA A 1 872  ? 7.813   27.087 44.148  1.00 26.09  ? 869  ALA A CB  1 
ATOM 6692 N N   . VAL A 1 873  ? 5.231   25.916 42.071  1.00 44.59  ? 870  VAL A N   1 
ATOM 6693 C CA  . VAL A 1 873  ? 4.926   25.707 40.665  1.00 44.59  ? 870  VAL A CA  1 
ATOM 6694 C C   . VAL A 1 873  ? 5.384   26.871 39.776  1.00 44.59  ? 870  VAL A C   1 
ATOM 6695 O O   . VAL A 1 873  ? 4.767   27.953 39.798  1.00 44.59  ? 870  VAL A O   1 
ATOM 6696 C CB  . VAL A 1 873  ? 3.458   25.397 40.442  1.00 34.86  ? 870  VAL A CB  1 
ATOM 6697 C CG1 . VAL A 1 873  ? 3.260   25.134 38.998  1.00 34.86  ? 870  VAL A CG1 1 
ATOM 6698 C CG2 . VAL A 1 873  ? 3.054   24.174 41.236  1.00 34.86  ? 870  VAL A CG2 1 
ATOM 6699 N N   . TYR A 1 874  ? 6.468   26.656 39.026  1.00 45.53  ? 871  TYR A N   1 
ATOM 6700 C CA  . TYR A 1 874  ? 7.095   27.754 38.283  1.00 45.53  ? 871  TYR A CA  1 
ATOM 6701 C C   . TYR A 1 874  ? 6.431   28.071 36.965  1.00 45.53  ? 871  TYR A C   1 
ATOM 6702 O O   . TYR A 1 874  ? 6.201   29.238 36.663  1.00 45.53  ? 871  TYR A O   1 
ATOM 6703 C CB  . TYR A 1 874  ? 8.606   27.590 38.120  1.00 34.45  ? 871  TYR A CB  1 
ATOM 6704 C CG  . TYR A 1 874  ? 9.287   27.881 39.399  1.00 34.45  ? 871  TYR A CG  1 
ATOM 6705 C CD1 . TYR A 1 874  ? 9.810   26.852 40.192  1.00 34.45  ? 871  TYR A CD1 1 
ATOM 6706 C CD2 . TYR A 1 874  ? 9.350   29.179 39.872  1.00 34.45  ? 871  TYR A CD2 1 
ATOM 6707 C CE1 . TYR A 1 874  ? 10.400  27.129 41.415  1.00 34.45  ? 871  TYR A CE1 1 
ATOM 6708 C CE2 . TYR A 1 874  ? 9.938   29.473 41.074  1.00 34.45  ? 871  TYR A CE2 1 
ATOM 6709 C CZ  . TYR A 1 874  ? 10.453  28.456 41.846  1.00 34.45  ? 871  TYR A CZ  1 
ATOM 6710 O OH  . TYR A 1 874  ? 11.010  28.787 43.055  1.00 34.45  ? 871  TYR A OH  1 
ATOM 6711 N N   . SER A 1 875  ? 6.109   27.057 36.182  1.00 40.95  ? 872  SER A N   1 
ATOM 6712 C CA  . SER A 1 875  ? 5.336   27.321 35.017  1.00 40.95  ? 872  SER A CA  1 
ATOM 6713 C C   . SER A 1 875  ? 4.301   26.212 34.751  1.00 40.95  ? 872  SER A C   1 
ATOM 6714 O O   . SER A 1 875  ? 4.265   25.222 35.494  1.00 40.95  ? 872  SER A O   1 
ATOM 6715 C CB  . SER A 1 875  ? 6.266   27.565 33.841  1.00 28.08  ? 872  SER A CB  1 
ATOM 6716 O OG  . SER A 1 875  ? 6.575   26.323 33.235  1.00 28.08  ? 872  SER A OG  1 
ATOM 6717 N N   . MET A 1 876  ? 3.438   26.392 33.740  1.00 34.82  ? 873  MET A N   1 
ATOM 6718 C CA  . MET A 1 876  ? 2.558   25.300 33.297  1.00 34.82  ? 873  MET A CA  1 
ATOM 6719 C C   . MET A 1 876  ? 1.875   25.511 31.941  1.00 34.82  ? 873  MET A C   1 
ATOM 6720 O O   . MET A 1 876  ? 1.055   26.372 31.804  1.00 34.82  ? 873  MET A O   1 
ATOM 6721 C CB  . MET A 1 876  ? 1.519   24.887 34.378  1.00 37.90  ? 873  MET A CB  1 
ATOM 6722 C CG  . MET A 1 876  ? 0.588   25.920 34.932  1.00 37.90  ? 873  MET A CG  1 
ATOM 6723 S SD  . MET A 1 876  ? -0.385  25.383 36.405  1.00 37.90  ? 873  MET A SD  1 
ATOM 6724 C CE  . MET A 1 876  ? 0.852   24.905 37.582  1.00 37.90  ? 873  MET A CE  1 
ATOM 6725 N N   . VAL A 1 877  ? 2.197   24.745 30.918  1.00 44.86  ? 874  VAL A N   1 
ATOM 6726 C CA  . VAL A 1 877  ? 1.424   24.894 29.699  1.00 44.86  ? 874  VAL A CA  1 
ATOM 6727 C C   . VAL A 1 877  ? 0.362   23.806 29.636  1.00 44.86  ? 874  VAL A C   1 
ATOM 6728 O O   . VAL A 1 877  ? 0.391   22.863 30.422  1.00 44.86  ? 874  VAL A O   1 
ATOM 6729 C CB  . VAL A 1 877  ? 2.305   24.834 28.452  1.00 37.38  ? 874  VAL A CB  1 
ATOM 6730 C CG1 . VAL A 1 877  ? 3.109   23.542 28.417  1.00 37.38  ? 874  VAL A CG1 1 
ATOM 6731 C CG2 . VAL A 1 877  ? 1.429   24.994 27.147  1.00 37.38  ? 874  VAL A CG2 1 
ATOM 6732 N N   . GLU A 1 878  ? -0.573  23.931 28.702  1.00 58.66  ? 875  GLU A N   1 
ATOM 6733 C CA  . GLU A 1 878  ? -1.550  22.878 28.450  1.00 58.66  ? 875  GLU A CA  1 
ATOM 6734 C C   . GLU A 1 878  ? -0.962  22.007 27.362  1.00 58.66  ? 875  GLU A C   1 
ATOM 6735 O O   . GLU A 1 878  ? -0.730  22.471 26.236  1.00 58.66  ? 875  GLU A O   1 
ATOM 6736 C CB  . GLU A 1 878  ? -2.914  23.475 28.044  1.00 70.53  ? 875  GLU A CB  1 
ATOM 6737 C CG  . GLU A 1 878  ? -3.933  22.494 27.461  1.00 70.53  ? 875  GLU A CG  1 
ATOM 6738 C CD  . GLU A 1 878  ? -3.819  22.341 25.940  1.00 70.53  ? 875  GLU A CD  1 
ATOM 6739 O OE1 . GLU A 1 878  ? -3.542  23.338 25.237  1.00 70.53  ? 875  GLU A OE1 1 
ATOM 6740 O OE2 . GLU A 1 878  ? -4.012  21.220 25.441  1.00 70.53  ? 875  GLU A OE2 1 
ATOM 6741 N N   . PHE A 1 879  ? -0.715  20.747 27.696  1.00 89.48  ? 876  PHE A N   1 
ATOM 6742 C CA  . PHE A 1 879  ? -0.045  19.860 26.763  1.00 89.48  ? 876  PHE A CA  1 
ATOM 6743 C C   . PHE A 1 879  ? -1.018  19.387 25.695  1.00 89.48  ? 876  PHE A C   1 
ATOM 6744 O O   . PHE A 1 879  ? -1.213  20.089 24.698  1.00 89.48  ? 876  PHE A O   1 
ATOM 6745 C CB  . PHE A 1 879  ? 0.685   18.721 27.492  1.00 53.89  ? 876  PHE A CB  1 
ATOM 6746 C CG  . PHE A 1 879  ? 1.752   18.042 26.659  1.00 53.89  ? 876  PHE A CG  1 
ATOM 6747 C CD1 . PHE A 1 879  ? 2.540   18.774 25.766  1.00 53.89  ? 876  PHE A CD1 1 
ATOM 6748 C CD2 . PHE A 1 879  ? 1.966   16.664 26.777  1.00 53.89  ? 876  PHE A CD2 1 
ATOM 6749 C CE1 . PHE A 1 879  ? 3.502   18.148 24.999  1.00 53.89  ? 876  PHE A CE1 1 
ATOM 6750 C CE2 . PHE A 1 879  ? 2.923   16.035 26.028  1.00 53.89  ? 876  PHE A CE2 1 
ATOM 6751 C CZ  . PHE A 1 879  ? 3.701   16.775 25.140  1.00 53.89  ? 876  PHE A CZ  1 
ATOM 6752 N N   . ASN A 1 880  ? -1.635  18.225 25.894  1.00 55.94  ? 877  ASN A N   1 
ATOM 6753 C CA  . ASN A 1 880  ? -2.567  17.707 24.892  1.00 55.94  ? 877  ASN A CA  1 
ATOM 6754 C C   . ASN A 1 880  ? -3.830  17.260 25.582  1.00 55.94  ? 877  ASN A C   1 
ATOM 6755 O O   . ASN A 1 880  ? -4.186  16.090 25.580  1.00 55.94  ? 877  ASN A O   1 
ATOM 6756 C CB  . ASN A 1 880  ? -1.954  16.560 24.103  1.00 47.63  ? 877  ASN A CB  1 
ATOM 6757 C CG  . ASN A 1 880  ? -0.915  17.025 23.128  1.00 47.63  ? 877  ASN A CG  1 
ATOM 6758 O OD1 . ASN A 1 880  ? -1.232  17.662 22.124  1.00 47.63  ? 877  ASN A OD1 1 
ATOM 6759 N ND2 . ASN A 1 880  ? 0.352   16.698 23.406  1.00 47.63  ? 877  ASN A ND2 1 
ATOM 6760 N N   . GLY A 1 881  ? -4.505  18.206 26.201  1.00 50.13  ? 878  GLY A N   1 
ATOM 6761 C CA  . GLY A 1 881  ? -5.667  17.870 26.965  1.00 50.13  ? 878  GLY A CA  1 
ATOM 6762 C C   . GLY A 1 881  ? -5.219  17.494 28.346  1.00 50.13  ? 878  GLY A C   1 
ATOM 6763 O O   . GLY A 1 881  ? -6.064  17.168 29.199  1.00 50.13  ? 878  GLY A O   1 
ATOM 6764 N N   . LYS A 1 882  ? -3.895  17.540 28.571  1.00 41.10  ? 879  LYS A N   1 
ATOM 6765 C CA  . LYS A 1 882  ? -3.339  17.337 29.918  1.00 41.10  ? 879  LYS A CA  1 
ATOM 6766 C C   . LYS A 1 882  ? -2.686  18.627 30.397  1.00 41.10  ? 879  LYS A C   1 
ATOM 6767 O O   . LYS A 1 882  ? -2.340  19.503 29.598  1.00 41.10  ? 879  LYS A O   1 
ATOM 6768 C CB  . LYS A 1 882  ? -2.343  16.169 29.961  1.00 62.73  ? 879  LYS A CB  1 
ATOM 6769 C CG  . LYS A 1 882  ? -2.559  15.072 28.914  1.00 62.73  ? 879  LYS A CG  1 
ATOM 6770 C CD  . LYS A 1 882  ? -1.934  13.755 29.353  1.00 62.73  ? 879  LYS A CD  1 
ATOM 6771 C CE  . LYS A 1 882  ? -2.296  12.585 28.442  1.00 62.73  ? 879  LYS A CE  1 
ATOM 6772 N NZ  . LYS A 1 882  ? -1.585  12.581 27.129  1.00 62.73  ? 879  LYS A NZ  1 
ATOM 6773 N N   . LEU A 1 883  ? -2.528  18.743 31.708  1.00 47.40  ? 880  LEU A N   1 
ATOM 6774 C CA  . LEU A 1 883  ? -1.810  19.860 32.319  1.00 47.40  ? 880  LEU A CA  1 
ATOM 6775 C C   . LEU A 1 883  ? -0.397  19.458 32.682  1.00 47.40  ? 880  LEU A C   1 
ATOM 6776 O O   . LEU A 1 883  ? -0.177  18.782 33.694  1.00 47.40  ? 880  LEU A O   1 
ATOM 6777 C CB  . LEU A 1 883  ? -2.529  20.364 33.585  1.00 33.04  ? 880  LEU A CB  1 
ATOM 6778 C CG  . LEU A 1 883  ? -1.961  21.568 34.344  1.00 33.04  ? 880  LEU A CG  1 
ATOM 6779 C CD1 . LEU A 1 883  ? -2.002  22.812 33.487  1.00 33.04  ? 880  LEU A CD1 1 
ATOM 6780 C CD2 . LEU A 1 883  ? -2.759  21.791 35.599  1.00 33.04  ? 880  LEU A CD2 1 
ATOM 6781 N N   . LEU A 1 884  ? 0.549   20.001 31.930  1.00 36.71  ? 881  LEU A N   1 
ATOM 6782 C CA  . LEU A 1 884  ? 1.954   19.831 32.166  1.00 36.71  ? 881  LEU A CA  1 
ATOM 6783 C C   . LEU A 1 884  ? 2.324   20.975 33.063  1.00 36.71  ? 881  LEU A C   1 
ATOM 6784 O O   . LEU A 1 884  ? 2.100   22.092 32.733  1.00 36.71  ? 881  LEU A O   1 
ATOM 6785 C CB  . LEU A 1 884  ? 2.739   19.963 30.888  1.00 55.20  ? 881  LEU A CB  1 
ATOM 6786 C CG  . LEU A 1 884  ? 2.350   18.820 29.972  1.00 55.20  ? 881  LEU A CG  1 
ATOM 6787 C CD1 . LEU A 1 884  ? 3.029   19.062 28.668  1.00 55.20  ? 881  LEU A CD1 1 
ATOM 6788 C CD2 . LEU A 1 884  ? 2.714   17.507 30.533  1.00 55.20  ? 881  LEU A CD2 1 
ATOM 6789 N N   . ALA A 1 885  ? 2.885   20.673 34.209  1.00 38.55  ? 882  ALA A N   1 
ATOM 6790 C CA  . ALA A 1 885  ? 3.243   21.675 35.164  1.00 38.55  ? 882  ALA A CA  1 
ATOM 6791 C C   . ALA A 1 885  ? 4.713   21.874 35.393  1.00 38.55  ? 882  ALA A C   1 
ATOM 6792 O O   . ALA A 1 885  ? 5.437   22.148 34.498  1.00 38.55  ? 882  ALA A O   1 
ATOM 6793 C CB  . ALA A 1 885  ? 2.591   21.395 36.417  1.00 27.93  ? 882  ALA A CB  1 
ATOM 6794 N N   . SER A 1 886  ? 5.176   21.770 36.601  1.00 39.71  ? 883  SER A N   1 
ATOM 6795 C CA  . SER A 1 886  ? 6.574   21.984 36.797  1.00 39.71  ? 883  SER A CA  1 
ATOM 6796 C C   . SER A 1 886  ? 6.666   22.511 38.173  1.00 39.71  ? 883  SER A C   1 
ATOM 6797 O O   . SER A 1 886  ? 6.169   23.549 38.442  1.00 39.71  ? 883  SER A O   1 
ATOM 6798 C CB  . SER A 1 886  ? 7.051   23.041 35.871  1.00 85.13  ? 883  SER A CB  1 
ATOM 6799 O OG  . SER A 1 886  ? 7.491   24.102 36.646  1.00 85.13  ? 883  SER A OG  1 
ATOM 6800 N N   . ILE A 1 887  ? 7.303   21.766 39.049  1.00 44.56  ? 884  ILE A N   1 
ATOM 6801 C CA  . ILE A 1 887  ? 7.402   22.128 40.425  1.00 44.56  ? 884  ILE A CA  1 
ATOM 6802 C C   . ILE A 1 887  ? 8.798   22.181 41.030  1.00 44.56  ? 884  ILE A C   1 
ATOM 6803 O O   . ILE A 1 887  ? 9.403   21.186 41.250  1.00 44.56  ? 884  ILE A O   1 
ATOM 6804 C CB  . ILE A 1 887  ? 6.589   21.087 41.222  1.00 37.65  ? 884  ILE A CB  1 
ATOM 6805 C CG1 . ILE A 1 887  ? 5.257   20.797 40.548  1.00 37.65  ? 884  ILE A CG1 1 
ATOM 6806 C CG2 . ILE A 1 887  ? 6.317   21.539 42.587  1.00 37.65  ? 884  ILE A CG2 1 
ATOM 6807 C CD1 . ILE A 1 887  ? 5.258   19.664 39.606  1.00 37.65  ? 884  ILE A CD1 1 
ATOM 6808 N N   . ASN A 1 888  ? 9.312   23.354 41.316  1.00 51.78  ? 885  ASN A N   1 
ATOM 6809 C CA  . ASN A 1 888  ? 10.599  23.416 41.960  1.00 51.78  ? 885  ASN A CA  1 
ATOM 6810 C C   . ASN A 1 888  ? 11.694  22.706 41.277  1.00 51.78  ? 885  ASN A C   1 
ATOM 6811 O O   . ASN A 1 888  ? 12.836  22.944 41.526  1.00 51.78  ? 885  ASN A O   1 
ATOM 6812 C CB  . ASN A 1 888  ? 10.476  22.738 43.294  1.00 50.72  ? 885  ASN A CB  1 
ATOM 6813 C CG  . ASN A 1 888  ? 10.637  23.658 44.398  1.00 50.72  ? 885  ASN A CG  1 
ATOM 6814 O OD1 . ASN A 1 888  ? 10.730  24.843 44.203  1.00 50.72  ? 885  ASN A OD1 1 
ATOM 6815 N ND2 . ASN A 1 888  ? 10.697  23.133 45.585  1.00 50.72  ? 885  ASN A ND2 1 
ATOM 6816 N N   . SER A 1 889  ? 11.411  21.762 40.413  1.00 38.53  ? 886  SER A N   1 
ATOM 6817 C CA  . SER A 1 889  ? 12.546  21.057 39.822  1.00 38.53  ? 886  SER A CA  1 
ATOM 6818 C C   . SER A 1 889  ? 12.188  19.729 39.256  1.00 38.53  ? 886  SER A C   1 
ATOM 6819 O O   . SER A 1 889  ? 13.002  18.979 38.751  1.00 38.53  ? 886  SER A O   1 
ATOM 6820 C CB  . SER A 1 889  ? 13.527  20.758 40.916  1.00 38.65  ? 886  SER A CB  1 
ATOM 6821 O OG  . SER A 1 889  ? 14.116  19.518 40.685  1.00 38.65  ? 886  SER A OG  1 
ATOM 6822 N N   . THR A 1 890  ? 10.919  19.460 39.369  1.00 58.43  ? 887  THR A N   1 
ATOM 6823 C CA  . THR A 1 890  ? 10.337  18.275 38.885  1.00 58.43  ? 887  THR A CA  1 
ATOM 6824 C C   . THR A 1 890  ? 9.384   18.830 37.857  1.00 58.43  ? 887  THR A C   1 
ATOM 6825 O O   . THR A 1 890  ? 8.836   19.931 37.994  1.00 58.43  ? 887  THR A O   1 
ATOM 6826 C CB  . THR A 1 890  ? 9.511   17.647 39.945  1.00 38.89  ? 887  THR A CB  1 
ATOM 6827 O OG1 . THR A 1 890  ? 10.325  17.369 41.074  1.00 38.89  ? 887  THR A OG1 1 
ATOM 6828 C CG2 . THR A 1 890  ? 8.934   16.411 39.437  1.00 38.89  ? 887  THR A CG2 1 
ATOM 6829 N N   . VAL A 1 891  ? 9.186   18.058 36.819  1.00 52.96  ? 888  VAL A N   1 
ATOM 6830 C CA  . VAL A 1 891  ? 8.304   18.421 35.755  1.00 52.96  ? 888  VAL A CA  1 
ATOM 6831 C C   . VAL A 1 891  ? 7.285   17.327 35.688  1.00 52.96  ? 888  VAL A C   1 
ATOM 6832 O O   . VAL A 1 891  ? 7.661   16.190 35.659  1.00 52.96  ? 888  VAL A O   1 
ATOM 6833 C CB  . VAL A 1 891  ? 9.064   18.451 34.464  1.00 27.24  ? 888  VAL A CB  1 
ATOM 6834 C CG1 . VAL A 1 891  ? 8.176   18.563 33.346  1.00 27.24  ? 888  VAL A CG1 1 
ATOM 6835 C CG2 . VAL A 1 891  ? 9.958   19.571 34.459  1.00 27.24  ? 888  VAL A CG2 1 
ATOM 6836 N N   . ARG A 1 892  ? 6.007   17.672 35.679  1.00 38.24  ? 889  ARG A N   1 
ATOM 6837 C CA  . ARG A 1 892  ? 4.955   16.687 35.660  1.00 38.24  ? 889  ARG A CA  1 
ATOM 6838 C C   . ARG A 1 892  ? 3.913   16.787 34.621  1.00 38.24  ? 889  ARG A C   1 
ATOM 6839 O O   . ARG A 1 892  ? 3.765   17.759 33.950  1.00 38.24  ? 889  ARG A O   1 
ATOM 6840 C CB  . ARG A 1 892  ? 4.225   16.739 36.975  1.00 38.65  ? 889  ARG A CB  1 
ATOM 6841 C CG  . ARG A 1 892  ? 4.600   15.701 37.949  1.00 38.65  ? 889  ARG A CG  1 
ATOM 6842 C CD  . ARG A 1 892  ? 3.598   15.574 39.014  1.00 38.65  ? 889  ARG A CD  1 
ATOM 6843 N NE  . ARG A 1 892  ? 3.964   16.287 40.213  1.00 38.65  ? 889  ARG A NE  1 
ATOM 6844 C CZ  . ARG A 1 892  ? 4.850   15.863 41.081  1.00 38.65  ? 889  ARG A CZ  1 
ATOM 6845 N NH1 . ARG A 1 892  ? 5.480   14.745 40.862  1.00 38.65  ? 889  ARG A NH1 1 
ATOM 6846 N NH2 . ARG A 1 892  ? 5.113   16.561 42.159  1.00 38.65  ? 889  ARG A NH2 1 
ATOM 6847 N N   . LEU A 1 893  ? 3.156   15.733 34.498  1.00 53.57  ? 890  LEU A N   1 
ATOM 6848 C CA  . LEU A 1 893  ? 2.103   15.742 33.516  1.00 53.57  ? 890  LEU A CA  1 
ATOM 6849 C C   . LEU A 1 893  ? 0.878   15.289 34.227  1.00 53.57  ? 890  LEU A C   1 
ATOM 6850 O O   . LEU A 1 893  ? 0.805   14.182 34.636  1.00 53.57  ? 890  LEU A O   1 
ATOM 6851 C CB  . LEU A 1 893  ? 2.412   14.788 32.400  1.00 51.80  ? 890  LEU A CB  1 
ATOM 6852 C CG  . LEU A 1 893  ? 1.382   14.803 31.303  1.00 51.80  ? 890  LEU A CG  1 
ATOM 6853 C CD1 . LEU A 1 893  ? 1.008   16.157 30.915  1.00 51.80  ? 890  LEU A CD1 1 
ATOM 6854 C CD2 . LEU A 1 893  ? 1.878   14.092 30.139  1.00 51.80  ? 890  LEU A CD2 1 
ATOM 6855 N N   . TYR A 1 894  ? -0.087  16.164 34.391  1.00 50.71  ? 891  TYR A N   1 
ATOM 6856 C CA  . TYR A 1 894  ? -1.300  15.812 35.111  1.00 50.71  ? 891  TYR A CA  1 
ATOM 6857 C C   . TYR A 1 894  ? -2.397  15.414 34.162  1.00 50.71  ? 891  TYR A C   1 
ATOM 6858 O O   . TYR A 1 894  ? -2.587  16.023 33.102  1.00 50.71  ? 891  TYR A O   1 
ATOM 6859 C CB  . TYR A 1 894  ? -1.782  16.962 35.998  1.00 44.13  ? 891  TYR A CB  1 
ATOM 6860 C CG  . TYR A 1 894  ? -0.983  17.153 37.271  1.00 44.13  ? 891  TYR A CG  1 
ATOM 6861 C CD1 . TYR A 1 894  ? 0.117   18.051 37.331  1.00 44.13  ? 891  TYR A CD1 1 
ATOM 6862 C CD2 . TYR A 1 894  ? -1.319  16.453 38.430  1.00 44.13  ? 891  TYR A CD2 1 
ATOM 6863 C CE1 . TYR A 1 894  ? 0.853   18.233 38.516  1.00 44.13  ? 891  TYR A CE1 1 
ATOM 6864 C CE2 . TYR A 1 894  ? -0.584  16.639 39.629  1.00 44.13  ? 891  TYR A CE2 1 
ATOM 6865 C CZ  . TYR A 1 894  ? 0.494   17.532 39.658  1.00 44.13  ? 891  TYR A CZ  1 
ATOM 6866 O OH  . TYR A 1 894  ? 1.184   17.675 40.843  1.00 44.13  ? 891  TYR A OH  1 
ATOM 6867 N N   . GLU A 1 895  ? -3.123  14.378 34.562  1.00 63.19  ? 892  GLU A N   1 
ATOM 6868 C CA  . GLU A 1 895  ? -4.352  14.017 33.881  1.00 63.19  ? 892  GLU A CA  1 
ATOM 6869 C C   . GLU A 1 895  ? -5.587  14.415 34.652  1.00 63.19  ? 892  GLU A C   1 
ATOM 6870 O O   . GLU A 1 895  ? -5.629  14.318 35.881  1.00 63.19  ? 892  GLU A O   1 
ATOM 6871 C CB  . GLU A 1 895  ? -4.388  12.536 33.559  1.00 56.67  ? 892  GLU A CB  1 
ATOM 6872 C CG  . GLU A 1 895  ? -3.906  12.225 32.164  1.00 56.67  ? 892  GLU A CG  1 
ATOM 6873 C CD  . GLU A 1 895  ? -3.780  10.748 31.928  1.00 56.67  ? 892  GLU A CD  1 
ATOM 6874 O OE1 . GLU A 1 895  ? -3.575  10.010 32.931  1.00 56.67  ? 892  GLU A OE1 1 
ATOM 6875 O OE2 . GLU A 1 895  ? -3.880  10.338 30.745  1.00 56.67  ? 892  GLU A OE2 1 
ATOM 6876 N N   . TRP A 1 896  ? -6.583  14.865 33.895  1.00 41.39  ? 893  TRP A N   1 
ATOM 6877 C CA  . TRP A 1 896  ? -7.865  15.262 34.443  1.00 41.39  ? 893  TRP A CA  1 
ATOM 6878 C C   . TRP A 1 896  ? -8.849  14.068 34.463  1.00 41.39  ? 893  TRP A C   1 
ATOM 6879 O O   . TRP A 1 896  ? -9.459  13.705 33.429  1.00 41.39  ? 893  TRP A O   1 
ATOM 6880 C CB  . TRP A 1 896  ? -8.405  16.406 33.594  1.00 39.19  ? 893  TRP A CB  1 
ATOM 6881 C CG  . TRP A 1 896  ? -9.510  17.258 34.167  1.00 39.19  ? 893  TRP A CG  1 
ATOM 6882 C CD1 . TRP A 1 896  ? -10.635 17.628 33.516  1.00 39.19  ? 893  TRP A CD1 1 
ATOM 6883 C CD2 . TRP A 1 896  ? -9.561  17.905 35.458  1.00 39.19  ? 893  TRP A CD2 1 
ATOM 6884 N NE1 . TRP A 1 896  ? -11.398 18.455 34.316  1.00 39.19  ? 893  TRP A NE1 1 
ATOM 6885 C CE2 . TRP A 1 896  ? -10.764 18.630 35.515  1.00 39.19  ? 893  TRP A CE2 1 
ATOM 6886 C CE3 . TRP A 1 896  ? -8.707  17.945 36.562  1.00 39.19  ? 893  TRP A CE3 1 
ATOM 6887 C CZ2 . TRP A 1 896  ? -11.147 19.372 36.633  1.00 39.19  ? 893  TRP A CZ2 1 
ATOM 6888 C CZ3 . TRP A 1 896  ? -9.082  18.702 37.683  1.00 39.19  ? 893  TRP A CZ3 1 
ATOM 6889 C CH2 . TRP A 1 896  ? -10.294 19.398 37.705  1.00 39.19  ? 893  TRP A CH2 1 
ATOM 6890 N N   . THR A 1 897  ? -9.008  13.464 35.639  1.00 85.16  ? 894  THR A N   1 
ATOM 6891 C CA  . THR A 1 897  ? -10.021 12.431 35.822  1.00 85.16  ? 894  THR A CA  1 
ATOM 6892 C C   . THR A 1 897  ? -11.375 12.953 35.314  1.00 85.16  ? 894  THR A C   1 
ATOM 6893 O O   . THR A 1 897  ? -11.653 14.157 35.393  1.00 85.16  ? 894  THR A O   1 
ATOM 6894 C CB  . THR A 1 897  ? -10.161 11.968 37.314  1.00 50.73  ? 894  THR A CB  1 
ATOM 6895 O OG1 . THR A 1 897  ? -10.775 12.989 38.099  1.00 50.73  ? 894  THR A OG1 1 
ATOM 6896 C CG2 . THR A 1 897  ? -8.825  11.612 37.943  1.00 50.73  ? 894  THR A CG2 1 
ATOM 6897 N N   . THR A 1 898  ? -12.192 12.051 34.766  1.00 101.63 ? 895  THR A N   1 
ATOM 6898 C CA  . THR A 1 898  ? -13.592 12.343 34.444  1.00 101.63 ? 895  THR A CA  1 
ATOM 6899 C C   . THR A 1 898  ? -14.320 12.664 35.734  1.00 101.63 ? 895  THR A C   1 
ATOM 6900 O O   . THR A 1 898  ? -15.292 13.425 35.743  1.00 101.63 ? 895  THR A O   1 
ATOM 6901 C CB  . THR A 1 898  ? -14.300 11.124 33.886  1.00 86.61  ? 895  THR A CB  1 
ATOM 6902 O OG1 . THR A 1 898  ? -14.139 10.046 34.818  1.00 86.61  ? 895  THR A OG1 1 
ATOM 6903 C CG2 . THR A 1 898  ? -13.753 10.737 32.512  1.00 86.61  ? 895  THR A CG2 1 
ATOM 6904 N N   . GLU A 1 899  ? -13.847 12.050 36.816  1.00 70.40  ? 896  GLU A N   1 
ATOM 6905 C CA  . GLU A 1 899  ? -14.269 12.386 38.167  1.00 70.40  ? 896  GLU A CA  1 
ATOM 6906 C C   . GLU A 1 899  ? -13.906 13.833 38.534  1.00 70.40  ? 896  GLU A C   1 
ATOM 6907 O O   . GLU A 1 899  ? -14.093 14.232 39.692  1.00 70.40  ? 896  GLU A O   1 
ATOM 6908 C CB  . GLU A 1 899  ? -13.610 11.430 39.168  1.00 81.87  ? 896  GLU A CB  1 
ATOM 6909 C CG  . GLU A 1 899  ? -13.427 9.995  38.641  1.00 81.87  ? 896  GLU A CG  1 
ATOM 6910 C CD  . GLU A 1 899  ? -11.988 9.455  38.864  1.00 81.87  ? 896  GLU A CD  1 
ATOM 6911 O OE1 . GLU A 1 899  ? -11.199 10.100 39.605  1.00 81.87  ? 896  GLU A OE1 1 
ATOM 6912 O OE2 . GLU A 1 899  ? -11.642 8.395  38.284  1.00 81.87  ? 896  GLU A OE2 1 
ATOM 6913 N N   . LYS A 1 900  ? -13.382 14.595 37.553  1.00 58.88  ? 897  LYS A N   1 
ATOM 6914 C CA  . LYS A 1 900  ? -12.932 16.014 37.681  1.00 58.88  ? 897  LYS A CA  1 
ATOM 6915 C C   . LYS A 1 900  ? -11.828 16.278 38.701  1.00 58.88  ? 897  LYS A C   1 
ATOM 6916 O O   . LYS A 1 900  ? -12.003 17.107 39.596  1.00 58.88  ? 897  LYS A O   1 
ATOM 6917 C CB  . LYS A 1 900  ? -14.100 16.976 37.954  1.00 53.82  ? 897  LYS A CB  1 
ATOM 6918 C CG  . LYS A 1 900  ? -14.817 17.502 36.688  1.00 53.82  ? 897  LYS A CG  1 
ATOM 6919 C CD  . LYS A 1 900  ? -15.801 18.634 37.048  1.00 53.82  ? 897  LYS A CD  1 
ATOM 6920 C CE  . LYS A 1 900  ? -17.121 18.502 36.315  1.00 53.82  ? 897  LYS A CE  1 
ATOM 6921 N NZ  . LYS A 1 900  ? -16.923 18.253 34.854  1.00 53.82  ? 897  LYS A NZ  1 
ATOM 6922 N N   . ASP A 1 901  ? -10.693 15.589 38.562  1.00 43.52  ? 898  ASP A N   1 
ATOM 6923 C CA  . ASP A 1 901  ? -9.534  15.809 39.462  1.00 43.52  ? 898  ASP A CA  1 
ATOM 6924 C C   . ASP A 1 901  ? -8.176  15.714 38.732  1.00 43.52  ? 898  ASP A C   1 
ATOM 6925 O O   . ASP A 1 901  ? -8.071  14.994 37.723  1.00 43.52  ? 898  ASP A O   1 
ATOM 6926 C CB  . ASP A 1 901  ? -9.593  14.847 40.649  1.00 88.80  ? 898  ASP A CB  1 
ATOM 6927 C CG  . ASP A 1 901  ? -9.292  15.532 41.959  1.00 88.80  ? 898  ASP A CG  1 
ATOM 6928 O OD1 . ASP A 1 901  ? -9.654  14.964 43.007  1.00 88.80  ? 898  ASP A OD1 1 
ATOM 6929 O OD2 . ASP A 1 901  ? -8.699  16.639 41.946  1.00 88.80  ? 898  ASP A OD2 1 
ATOM 6930 N N   . VAL A 1 902  ? -7.162  16.464 39.188  1.00 50.11  ? 899  VAL A N   1 
ATOM 6931 C CA  . VAL A 1 902  ? -5.804  16.345 38.561  1.00 50.11  ? 899  VAL A CA  1 
ATOM 6932 C C   . VAL A 1 902  ? -4.940  15.248 39.226  1.00 50.11  ? 899  VAL A C   1 
ATOM 6933 O O   . VAL A 1 902  ? -4.490  15.412 40.364  1.00 50.11  ? 899  VAL A O   1 
ATOM 6934 C CB  . VAL A 1 902  ? -4.981  17.743 38.253  1.00 36.33  ? 899  VAL A CB  1 
ATOM 6935 C CG1 . VAL A 1 902  ? -5.562  18.540 37.097  1.00 36.33  ? 899  VAL A CG1 1 
ATOM 6936 C CG2 . VAL A 1 902  ? -4.823  18.649 39.450  1.00 36.33  ? 899  VAL A CG2 1 
ATOM 6937 N N   . ARG A 1 903  ? -4.766  14.127 38.505  1.00 45.02  ? 900  ARG A N   1 
ATOM 6938 C CA  . ARG A 1 903  ? -3.883  13.021 38.926  1.00 45.02  ? 900  ARG A CA  1 
ATOM 6939 C C   . ARG A 1 903  ? -2.663  12.761 38.009  1.00 45.02  ? 900  ARG A C   1 
ATOM 6940 O O   . ARG A 1 903  ? -2.761  12.768 36.773  1.00 45.02  ? 900  ARG A O   1 
ATOM 6941 C CB  . ARG A 1 903  ? -4.673  11.720 39.161  1.00 59.60  ? 900  ARG A CB  1 
ATOM 6942 C CG  . ARG A 1 903  ? -5.183  10.979 37.913  1.00 59.60  ? 900  ARG A CG  1 
ATOM 6943 C CD  . ARG A 1 903  ? -4.276  9.841  37.444  1.00 59.60  ? 900  ARG A CD  1 
ATOM 6944 N NE  . ARG A 1 903  ? -4.652  9.484  36.078  1.00 59.60  ? 900  ARG A NE  1 
ATOM 6945 C CZ  . ARG A 1 903  ? -5.655  8.657  35.761  1.00 59.60  ? 900  ARG A CZ  1 
ATOM 6946 N NH1 . ARG A 1 903  ? -6.363  8.064  36.717  1.00 59.60  ? 900  ARG A NH1 1 
ATOM 6947 N NH2 . ARG A 1 903  ? -5.953  8.416  34.488  1.00 59.60  ? 900  ARG A NH2 1 
ATOM 6948 N N   . THR A 1 904  ? -1.521  12.527 38.649  1.00 53.91  ? 901  THR A N   1 
ATOM 6949 C CA  . THR A 1 904  ? -0.227  12.373 37.993  1.00 53.91  ? 901  THR A CA  1 
ATOM 6950 C C   . THR A 1 904  ? -0.247  11.299 36.923  1.00 53.91  ? 901  THR A C   1 
ATOM 6951 O O   . THR A 1 904  ? -0.907  10.272 37.088  1.00 53.91  ? 901  THR A O   1 
ATOM 6952 C CB  . THR A 1 904  ? 0.822   11.979 39.033  1.00 66.62  ? 901  THR A CB  1 
ATOM 6953 O OG1 . THR A 1 904  ? 0.784   12.917 40.111  1.00 66.62  ? 901  THR A OG1 1 
ATOM 6954 C CG2 . THR A 1 904  ? 2.227   11.941 38.426  1.00 66.62  ? 901  THR A CG2 1 
ATOM 6955 N N   . GLU A 1 905  ? 0.511   11.493 35.848  1.00 197.00 ? 902  GLU A N   1 
ATOM 6956 C CA  . GLU A 1 905  ? 0.731   10.463 34.839  1.00 197.00 ? 902  GLU A CA  1 
ATOM 6957 C C   . GLU A 1 905  ? 2.191   10.110 34.767  1.00 197.00 ? 902  GLU A C   1 
ATOM 6958 O O   . GLU A 1 905  ? 2.544   8.954  34.662  1.00 197.00 ? 902  GLU A O   1 
ATOM 6959 C CB  . GLU A 1 905  ? 0.288   10.889 33.443  1.00 128.07 ? 902  GLU A CB  1 
ATOM 6960 C CG  . GLU A 1 905  ? 0.456   9.775  32.408  1.00 128.07 ? 902  GLU A CG  1 
ATOM 6961 C CD  . GLU A 1 905  ? -0.422  8.580  32.651  1.00 128.07 ? 902  GLU A CD  1 
ATOM 6962 O OE1 . GLU A 1 905  ? -1.323  8.694  33.458  1.00 128.07 ? 902  GLU A OE1 1 
ATOM 6963 O OE2 . GLU A 1 905  ? -0.242  7.523  32.032  1.00 128.07 ? 902  GLU A OE2 1 
ATOM 6964 N N   . CYS A 1 906  ? 3.044   11.114 34.805  1.00 168.47 ? 903  CYS A N   1 
ATOM 6965 C CA  . CYS A 1 906  ? 4.484   10.912 34.803  1.00 168.47 ? 903  CYS A CA  1 
ATOM 6966 C C   . CYS A 1 906  ? 5.230   12.169 35.203  1.00 168.47 ? 903  CYS A C   1 
ATOM 6967 O O   . CYS A 1 906  ? 4.662   13.260 35.220  1.00 168.47 ? 903  CYS A O   1 
ATOM 6968 C CB  . CYS A 1 906  ? 4.957   10.474 33.418  1.00 59.97  ? 903  CYS A CB  1 
ATOM 6969 S SG  . CYS A 1 906  ? 4.515   11.578 32.067  1.00 59.97  ? 903  CYS A SG  1 
ATOM 6970 N N   . ASN A 1 907  ? 6.508   11.998 35.529  1.00 56.74  ? 904  ASN A N   1 
ATOM 6971 C CA  . ASN A 1 907  ? 7.426   13.125 35.727  1.00 56.74  ? 904  ASN A CA  1 
ATOM 6972 C C   . ASN A 1 907  ? 8.907   12.914 35.385  1.00 56.74  ? 904  ASN A C   1 
ATOM 6973 O O   . ASN A 1 907  ? 9.457   11.848 35.609  1.00 56.74  ? 904  ASN A O   1 
ATOM 6974 C CB  . ASN A 1 907  ? 7.291   13.728 37.129  1.00 78.43  ? 904  ASN A CB  1 
ATOM 6975 C CG  . ASN A 1 907  ? 6.952   12.715 38.162  1.00 78.43  ? 904  ASN A CG  1 
ATOM 6976 O OD1 . ASN A 1 907  ? 7.836   12.117 38.754  1.00 78.43  ? 904  ASN A OD1 1 
ATOM 6977 N ND2 . ASN A 1 907  ? 5.659   12.522 38.405  1.00 78.43  ? 904  ASN A ND2 1 
ATOM 6978 N N   . HIS A 1 908  ? 9.525   13.965 34.845  1.00 56.46  ? 905  HIS A N   1 
ATOM 6979 C CA  . HIS A 1 908  ? 10.963  14.043 34.581  1.00 56.46  ? 905  HIS A CA  1 
ATOM 6980 C C   . HIS A 1 908  ? 11.623  14.637 35.792  1.00 56.46  ? 905  HIS A C   1 
ATOM 6981 O O   . HIS A 1 908  ? 11.092  15.575 36.349  1.00 56.46  ? 905  HIS A O   1 
ATOM 6982 C CB  . HIS A 1 908  ? 11.188  14.973 33.401  1.00 54.63  ? 905  HIS A CB  1 
ATOM 6983 C CG  . HIS A 1 908  ? 12.616  15.350 33.185  1.00 54.63  ? 905  HIS A CG  1 
ATOM 6984 N ND1 . HIS A 1 908  ? 13.361  14.863 32.133  1.00 54.63  ? 905  HIS A ND1 1 
ATOM 6985 C CD2 . HIS A 1 908  ? 13.430  16.186 33.866  1.00 54.63  ? 905  HIS A CD2 1 
ATOM 6986 C CE1 . HIS A 1 908  ? 14.577  15.373 32.183  1.00 54.63  ? 905  HIS A CE1 1 
ATOM 6987 N NE2 . HIS A 1 908  ? 14.646  16.173 33.230  1.00 54.63  ? 905  HIS A NE2 1 
ATOM 6988 N N   . TYR A 1 909  ? 12.782  14.124 36.199  1.00 47.36  ? 906  TYR A N   1 
ATOM 6989 C CA  . TYR A 1 909  ? 13.390  14.591 37.446  1.00 47.36  ? 906  TYR A CA  1 
ATOM 6990 C C   . TYR A 1 909  ? 14.727  15.312 37.312  1.00 47.36  ? 906  TYR A C   1 
ATOM 6991 O O   . TYR A 1 909  ? 15.235  15.891 38.289  1.00 47.36  ? 906  TYR A O   1 
ATOM 6992 C CB  . TYR A 1 909  ? 13.544  13.437 38.426  1.00 76.61  ? 906  TYR A CB  1 
ATOM 6993 C CG  . TYR A 1 909  ? 12.291  13.099 39.195  1.00 76.61  ? 906  TYR A CG  1 
ATOM 6994 C CD1 . TYR A 1 909  ? 11.690  11.844 39.067  1.00 76.61  ? 906  TYR A CD1 1 
ATOM 6995 C CD2 . TYR A 1 909  ? 11.708  14.027 40.062  1.00 76.61  ? 906  TYR A CD2 1 
ATOM 6996 C CE1 . TYR A 1 909  ? 10.554  11.522 39.774  1.00 76.61  ? 906  TYR A CE1 1 
ATOM 6997 C CE2 . TYR A 1 909  ? 10.563  13.712 40.773  1.00 76.61  ? 906  TYR A CE2 1 
ATOM 6998 C CZ  . TYR A 1 909  ? 9.993   12.458 40.622  1.00 76.61  ? 906  TYR A CZ  1 
ATOM 6999 O OH  . TYR A 1 909  ? 8.844   12.141 41.319  1.00 76.61  ? 906  TYR A OH  1 
ATOM 7000 N N   . ASN A 1 910  ? 15.298  15.272 36.120  1.00 61.01  ? 907  ASN A N   1 
ATOM 7001 C CA  . ASN A 1 910  ? 16.667  15.704 35.939  1.00 61.01  ? 907  ASN A CA  1 
ATOM 7002 C C   . ASN A 1 910  ? 16.783  17.214 35.657  1.00 61.01  ? 907  ASN A C   1 
ATOM 7003 O O   . ASN A 1 910  ? 17.136  17.633 34.550  1.00 61.01  ? 907  ASN A O   1 
ATOM 7004 C CB  . ASN A 1 910  ? 17.322  14.841 34.842  1.00 70.17  ? 907  ASN A CB  1 
ATOM 7005 C CG  . ASN A 1 910  ? 18.809  15.126 34.665  1.00 70.17  ? 907  ASN A CG  1 
ATOM 7006 O OD1 . ASN A 1 910  ? 19.326  15.092 33.544  1.00 70.17  ? 907  ASN A OD1 1 
ATOM 7007 N ND2 . ASN A 1 910  ? 19.499  15.418 35.765  1.00 70.17  ? 907  ASN A ND2 1 
ATOM 7008 N N   . ASN A 1 911  ? 16.463  18.025 36.660  1.00 68.78  ? 908  ASN A N   1 
ATOM 7009 C CA  . ASN A 1 911  ? 16.469  19.478 36.527  1.00 68.78  ? 908  ASN A CA  1 
ATOM 7010 C C   . ASN A 1 911  ? 17.072  20.060 37.754  1.00 68.78  ? 908  ASN A C   1 
ATOM 7011 O O   . ASN A 1 911  ? 16.857  19.571 38.846  1.00 68.78  ? 908  ASN A O   1 
ATOM 7012 C CB  . ASN A 1 911  ? 15.057  20.063 36.425  1.00 46.29  ? 908  ASN A CB  1 
ATOM 7013 C CG  . ASN A 1 911  ? 14.254  19.466 35.315  1.00 46.29  ? 908  ASN A CG  1 
ATOM 7014 O OD1 . ASN A 1 911  ? 14.482  19.743 34.145  1.00 46.29  ? 908  ASN A OD1 1 
ATOM 7015 N ND2 . ASN A 1 911  ? 13.296  18.641 35.674  1.00 46.29  ? 908  ASN A ND2 1 
ATOM 7016 N N   . ILE A 1 912  ? 17.815  21.134 37.579  1.00 71.13  ? 909  ILE A N   1 
ATOM 7017 C CA  . ILE A 1 912  ? 18.315  21.890 38.697  1.00 71.13  ? 909  ILE A CA  1 
ATOM 7018 C C   . ILE A 1 912  ? 17.145  22.704 39.245  1.00 71.13  ? 909  ILE A C   1 
ATOM 7019 O O   . ILE A 1 912  ? 16.951  22.776 40.461  1.00 71.13  ? 909  ILE A O   1 
ATOM 7020 C CB  . ILE A 1 912  ? 19.482  22.772 38.232  1.00 65.37  ? 909  ILE A CB  1 
ATOM 7021 C CG1 . ILE A 1 912  ? 20.528  22.937 39.332  1.00 65.37  ? 909  ILE A CG1 1 
ATOM 7022 C CG2 . ILE A 1 912  ? 18.995  24.095 37.606  1.00 65.37  ? 909  ILE A CG2 1 
ATOM 7023 C CD1 . ILE A 1 912  ? 21.660  21.935 39.194  1.00 65.37  ? 909  ILE A CD1 1 
ATOM 7024 N N   . MET A 1 913  ? 16.353  23.268 38.315  1.00 62.80  ? 910  MET A N   1 
ATOM 7025 C CA  . MET A 1 913  ? 15.131  24.046 38.584  1.00 62.80  ? 910  MET A CA  1 
ATOM 7026 C C   . MET A 1 913  ? 14.388  24.370 37.291  1.00 62.80  ? 910  MET A C   1 
ATOM 7027 O O   . MET A 1 913  ? 14.739  25.292 36.566  1.00 62.80  ? 910  MET A O   1 
ATOM 7028 C CB  . MET A 1 913  ? 15.468  25.340 39.308  1.00 53.15  ? 910  MET A CB  1 
ATOM 7029 C CG  . MET A 1 913  ? 14.399  25.819 40.246  1.00 53.15  ? 910  MET A CG  1 
ATOM 7030 S SD  . MET A 1 913  ? 15.167  27.002 41.356  1.00 53.15  ? 910  MET A SD  1 
ATOM 7031 C CE  . MET A 1 913  ? 13.844  28.156 41.653  1.00 53.15  ? 910  MET A CE  1 
ATOM 7032 N N   . ALA A 1 914  ? 13.342  23.594 37.018  1.00 40.56  ? 911  ALA A N   1 
ATOM 7033 C CA  . ALA A 1 914  ? 12.483  23.791 35.829  1.00 40.56  ? 911  ALA A CA  1 
ATOM 7034 C C   . ALA A 1 914  ? 11.637  25.068 35.962  1.00 40.56  ? 911  ALA A C   1 
ATOM 7035 O O   . ALA A 1 914  ? 10.642  25.123 36.683  1.00 40.56  ? 911  ALA A O   1 
ATOM 7036 C CB  . ALA A 1 914  ? 11.599  22.548 35.584  1.00 35.48  ? 911  ALA A CB  1 
ATOM 7037 N N   . LEU A 1 915  ? 12.073  26.124 35.269  1.00 42.92  ? 912  LEU A N   1 
ATOM 7038 C CA  . LEU A 1 915  ? 11.332  27.439 35.328  1.00 42.92  ? 912  LEU A CA  1 
ATOM 7039 C C   . LEU A 1 915  ? 10.426  27.755 34.287  1.00 42.92  ? 912  LEU A C   1 
ATOM 7040 O O   . LEU A 1 915  ? 9.598   28.626 34.494  1.00 42.92  ? 912  LEU A O   1 
ATOM 7041 C CB  . LEU A 1 915  ? 12.366  28.549 35.307  1.00 18.63  ? 912  LEU A CB  1 
ATOM 7042 C CG  . LEU A 1 915  ? 13.361  28.609 36.493  1.00 18.63  ? 912  LEU A CG  1 
ATOM 7043 C CD1 . LEU A 1 915  ? 14.075  29.933 36.521  1.00 18.63  ? 912  LEU A CD1 1 
ATOM 7044 C CD2 . LEU A 1 915  ? 12.755  28.360 37.831  1.00 18.63  ? 912  LEU A CD2 1 
ATOM 7045 N N   . TYR A 1 916  ? 10.596  27.182 33.109  1.00 26.40  ? 913  TYR A N   1 
ATOM 7046 C CA  . TYR A 1 916  ? 9.800   27.505 31.840  1.00 26.40  ? 913  TYR A CA  1 
ATOM 7047 C C   . TYR A 1 916  ? 9.479   26.289 31.048  1.00 26.40  ? 913  TYR A C   1 
ATOM 7048 O O   . TYR A 1 916  ? 10.285  25.382 31.085  1.00 26.40  ? 913  TYR A O   1 
ATOM 7049 C CB  . TYR A 1 916  ? 10.559  28.414 30.975  1.00 14.62  ? 913  TYR A CB  1 
ATOM 7050 C CG  . TYR A 1 916  ? 11.292  29.470 31.762  1.00 14.62  ? 913  TYR A CG  1 
ATOM 7051 C CD1 . TYR A 1 916  ? 12.690  29.445 31.893  1.00 14.62  ? 913  TYR A CD1 1 
ATOM 7052 C CD2 . TYR A 1 916  ? 10.569  30.421 32.492  1.00 14.62  ? 913  TYR A CD2 1 
ATOM 7053 C CE1 . TYR A 1 916  ? 13.341  30.381 32.709  1.00 14.62  ? 913  TYR A CE1 1 
ATOM 7054 C CE2 . TYR A 1 916  ? 11.111  31.322 33.293  1.00 14.62  ? 913  TYR A CE2 1 
ATOM 7055 C CZ  . TYR A 1 916  ? 12.491  31.371 33.423  1.00 14.62  ? 913  TYR A CZ  1 
ATOM 7056 O OH  . TYR A 1 916  ? 13.020  32.353 34.265  1.00 14.62  ? 913  TYR A OH  1 
ATOM 7057 N N   . LEU A 1 917  ? 8.300   26.304 30.403  1.00 23.95  ? 914  LEU A N   1 
ATOM 7058 C CA  . LEU A 1 917  ? 8.063   25.202 29.416  1.00 23.95  ? 914  LEU A CA  1 
ATOM 7059 C C   . LEU A 1 917  ? 7.326   25.697 28.182  1.00 23.95  ? 914  LEU A C   1 
ATOM 7060 O O   . LEU A 1 917  ? 6.703   26.824 28.366  1.00 23.95  ? 914  LEU A O   1 
ATOM 7061 C CB  . LEU A 1 917  ? 7.233   24.102 30.138  1.00 19.83  ? 914  LEU A CB  1 
ATOM 7062 C CG  . LEU A 1 917  ? 7.732   23.845 31.656  1.00 19.83  ? 914  LEU A CG  1 
ATOM 7063 C CD1 . LEU A 1 917  ? 6.550   23.144 32.450  1.00 19.83  ? 914  LEU A CD1 1 
ATOM 7064 C CD2 . LEU A 1 917  ? 8.965   22.924 31.579  1.00 19.83  ? 914  LEU A CD2 1 
ATOM 7065 N N   . LYS A 1 918  ? 7.416   25.023 27.077  1.00 39.44  ? 915  LYS A N   1 
ATOM 7066 C CA  . LYS A 1 918  ? 6.666   25.369 25.889  1.00 39.44  ? 915  LYS A CA  1 
ATOM 7067 C C   . LYS A 1 918  ? 6.468   24.001 25.298  1.00 39.44  ? 915  LYS A C   1 
ATOM 7068 O O   . LYS A 1 918  ? 7.075   23.022 25.780  1.00 39.44  ? 915  LYS A O   1 
ATOM 7069 C CB  . LYS A 1 918  ? 7.512   26.316 25.031  1.00 24.79  ? 915  LYS A CB  1 
ATOM 7070 C CG  . LYS A 1 918  ? 7.821   27.696 25.672  1.00 24.79  ? 915  LYS A CG  1 
ATOM 7071 C CD  . LYS A 1 918  ? 6.602   28.606 25.594  1.00 24.79  ? 915  LYS A CD  1 
ATOM 7072 C CE  . LYS A 1 918  ? 6.814   29.839 26.396  1.00 24.79  ? 915  LYS A CE  1 
ATOM 7073 N NZ  . LYS A 1 918  ? 7.272   30.851 25.428  1.00 24.79  ? 915  LYS A NZ  1 
ATOM 7074 N N   . THR A 1 919  ? 5.616   23.918 24.280  1.00 34.57  ? 916  THR A N   1 
ATOM 7075 C CA  . THR A 1 919  ? 5.171   22.640 23.824  1.00 34.57  ? 916  THR A CA  1 
ATOM 7076 C C   . THR A 1 919  ? 5.108   22.832 22.369  1.00 34.57  ? 916  THR A C   1 
ATOM 7077 O O   . THR A 1 919  ? 4.549   23.826 21.902  1.00 34.57  ? 916  THR A O   1 
ATOM 7078 C CB  . THR A 1 919  ? 3.825   22.335 24.491  1.00 48.16  ? 916  THR A CB  1 
ATOM 7079 O OG1 . THR A 1 919  ? 4.087   21.832 25.834  1.00 48.16  ? 916  THR A OG1 1 
ATOM 7080 C CG2 . THR A 1 919  ? 2.913   21.370 23.606  1.00 48.16  ? 916  THR A CG2 1 
ATOM 7081 N N   . LYS A 1 920  ? 5.783   21.952 21.640  1.00 72.05  ? 917  LYS A N   1 
ATOM 7082 C CA  . LYS A 1 920  ? 5.691   22.018 20.196  1.00 72.05  ? 917  LYS A CA  1 
ATOM 7083 C C   . LYS A 1 920  ? 4.651   21.003 19.836  1.00 72.05  ? 917  LYS A C   1 
ATOM 7084 O O   . LYS A 1 920  ? 4.830   19.799 20.097  1.00 72.05  ? 917  LYS A O   1 
ATOM 7085 C CB  . LYS A 1 920  ? 7.024   21.757 19.492  1.00 194.95 ? 917  LYS A CB  1 
ATOM 7086 C CG  . LYS A 1 920  ? 7.351   22.810 18.396  1.00 194.95 ? 917  LYS A CG  1 
ATOM 7087 C CD  . LYS A 1 920  ? 6.254   22.948 17.295  1.00 194.95 ? 917  LYS A CD  1 
ATOM 7088 C CE  . LYS A 1 920  ? 6.480   21.968 16.109  1.00 194.95 ? 917  LYS A CE  1 
ATOM 7089 N NZ  . LYS A 1 920  ? 6.511   20.496 16.500  1.00 194.95 ? 917  LYS A NZ  1 
ATOM 7090 N N   . GLY A 1 921  ? 3.556   21.544 19.289  1.00 170.92 ? 918  GLY A N   1 
ATOM 7091 C CA  . GLY A 1 921  ? 2.312   20.845 18.961  1.00 170.92 ? 918  GLY A CA  1 
ATOM 7092 C C   . GLY A 1 921  ? 2.304   19.422 19.443  1.00 170.92 ? 918  GLY A C   1 
ATOM 7093 O O   . GLY A 1 921  ? 1.531   19.052 20.327  1.00 170.92 ? 918  GLY A O   1 
ATOM 7094 N N   . ASP A 1 922  ? 3.201   18.643 18.850  1.00 89.21  ? 919  ASP A N   1 
ATOM 7095 C CA  . ASP A 1 922  ? 3.458   17.264 19.222  1.00 89.21  ? 919  ASP A CA  1 
ATOM 7096 C C   . ASP A 1 922  ? 3.834   17.112 20.704  1.00 89.21  ? 919  ASP A C   1 
ATOM 7097 O O   . ASP A 1 922  ? 3.696   18.029 21.516  1.00 89.21  ? 919  ASP A O   1 
ATOM 7098 C CB  . ASP A 1 922  ? 4.575   16.703 18.322  1.00 201.00 ? 919  ASP A CB  1 
ATOM 7099 C CG  . ASP A 1 922  ? 4.700   15.186 18.399  1.00 201.00 ? 919  ASP A CG  1 
ATOM 7100 O OD1 . ASP A 1 922  ? 3.704   14.511 18.733  1.00 201.00 ? 919  ASP A OD1 1 
ATOM 7101 O OD2 . ASP A 1 922  ? 5.803   14.670 18.122  1.00 201.00 ? 919  ASP A OD2 1 
ATOM 7102 N N   . PHE A 1 923  ? 4.327   15.934 21.039  1.00 74.14  ? 920  PHE A N   1 
ATOM 7103 C CA  . PHE A 1 923  ? 4.562   15.598 22.406  1.00 74.14  ? 920  PHE A CA  1 
ATOM 7104 C C   . PHE A 1 923  ? 5.931   16.098 22.860  1.00 74.14  ? 920  PHE A C   1 
ATOM 7105 O O   . PHE A 1 923  ? 6.546   15.512 23.736  1.00 74.14  ? 920  PHE A O   1 
ATOM 7106 C CB  . PHE A 1 923  ? 4.392   14.087 22.597  1.00 115.11 ? 920  PHE A CB  1 
ATOM 7107 C CG  . PHE A 1 923  ? 3.064   13.551 22.116  1.00 115.11 ? 920  PHE A CG  1 
ATOM 7108 C CD1 . PHE A 1 923  ? 1.870   13.973 22.699  1.00 115.11 ? 920  PHE A CD1 1 
ATOM 7109 C CD2 . PHE A 1 923  ? 3.010   12.605 21.095  1.00 115.11 ? 920  PHE A CD2 1 
ATOM 7110 C CE1 . PHE A 1 923  ? 0.629   13.469 22.262  1.00 115.11 ? 920  PHE A CE1 1 
ATOM 7111 C CE2 . PHE A 1 923  ? 1.780   12.094 20.644  1.00 115.11 ? 920  PHE A CE2 1 
ATOM 7112 C CZ  . PHE A 1 923  ? 0.587   12.527 21.229  1.00 115.11 ? 920  PHE A CZ  1 
ATOM 7113 N N   . ILE A 1 924  ? 6.374   17.209 22.276  1.00 40.21  ? 921  ILE A N   1 
ATOM 7114 C CA  . ILE A 1 924  ? 7.677   17.827 22.594  1.00 40.21  ? 921  ILE A CA  1 
ATOM 7115 C C   . ILE A 1 924  ? 7.569   19.041 23.576  1.00 40.21  ? 921  ILE A C   1 
ATOM 7116 O O   . ILE A 1 924  ? 6.670   19.881 23.416  1.00 40.21  ? 921  ILE A O   1 
ATOM 7117 C CB  . ILE A 1 924  ? 8.404   18.195 21.281  1.00 39.66  ? 921  ILE A CB  1 
ATOM 7118 C CG1 . ILE A 1 924  ? 9.095   16.961 20.651  1.00 39.66  ? 921  ILE A CG1 1 
ATOM 7119 C CG2 . ILE A 1 924  ? 9.432   19.266 21.540  1.00 39.66  ? 921  ILE A CG2 1 
ATOM 7120 C CD1 . ILE A 1 924  ? 9.169   16.955 19.108  1.00 39.66  ? 921  ILE A CD1 1 
ATOM 7121 N N   . LEU A 1 925  ? 8.462   19.091 24.582  1.00 39.96  ? 922  LEU A N   1 
ATOM 7122 C CA  . LEU A 1 925  ? 8.573   20.150 25.649  1.00 39.96  ? 922  LEU A CA  1 
ATOM 7123 C C   . LEU A 1 925  ? 10.042  20.649 25.812  1.00 39.96  ? 922  LEU A C   1 
ATOM 7124 O O   . LEU A 1 925  ? 10.939  20.019 25.265  1.00 39.96  ? 922  LEU A O   1 
ATOM 7125 C CB  . LEU A 1 925  ? 8.124   19.602 27.009  1.00 42.90  ? 922  LEU A CB  1 
ATOM 7126 C CG  . LEU A 1 925  ? 6.911   18.654 27.188  1.00 42.90  ? 922  LEU A CG  1 
ATOM 7127 C CD1 . LEU A 1 925  ? 6.791   17.604 26.142  1.00 42.90  ? 922  LEU A CD1 1 
ATOM 7128 C CD2 . LEU A 1 925  ? 6.880   17.934 28.566  1.00 42.90  ? 922  LEU A CD2 1 
ATOM 7129 N N   . VAL A 1 926  ? 10.308  21.715 26.603  1.00 43.40  ? 923  VAL A N   1 
ATOM 7130 C CA  . VAL A 1 926  ? 11.679  22.340 26.766  1.00 43.40  ? 923  VAL A CA  1 
ATOM 7131 C C   . VAL A 1 926  ? 11.879  23.158 28.067  1.00 43.40  ? 923  VAL A C   1 
ATOM 7132 O O   . VAL A 1 926  ? 10.924  23.878 28.369  1.00 43.40  ? 923  VAL A O   1 
ATOM 7133 C CB  . VAL A 1 926  ? 11.908  23.270 25.515  1.00 36.68  ? 923  VAL A CB  1 
ATOM 7134 C CG1 . VAL A 1 926  ? 10.591  23.695 24.970  1.00 36.68  ? 923  VAL A CG1 1 
ATOM 7135 C CG2 . VAL A 1 926  ? 12.777  24.498 25.767  1.00 36.68  ? 923  VAL A CG2 1 
ATOM 7136 N N   . GLY A 1 927  ? 13.024  23.089 28.820  1.00 67.37  ? 924  GLY A N   1 
ATOM 7137 C CA  . GLY A 1 927  ? 13.446  24.179 29.824  1.00 67.37  ? 924  GLY A CA  1 
ATOM 7138 C C   . GLY A 1 927  ? 14.324  23.973 31.106  1.00 67.37  ? 924  GLY A C   1 
ATOM 7139 O O   . GLY A 1 927  ? 14.429  22.805 31.544  1.00 67.37  ? 924  GLY A O   1 
ATOM 7140 N N   . ASP A 1 928  ? 14.937  25.067 31.705  1.00 87.83  ? 925  ASP A N   1 
ATOM 7141 C CA  . ASP A 1 928  ? 15.757  25.118 33.056  1.00 87.83  ? 925  ASP A CA  1 
ATOM 7142 C C   . ASP A 1 928  ? 16.453  26.438 33.557  1.00 87.83  ? 925  ASP A C   1 
ATOM 7143 O O   . ASP A 1 928  ? 16.758  27.284 32.769  1.00 87.83  ? 925  ASP A O   1 
ATOM 7144 C CB  . ASP A 1 928  ? 16.835  24.005 33.175  1.00 65.04  ? 925  ASP A CB  1 
ATOM 7145 C CG  . ASP A 1 928  ? 17.450  23.865 34.647  1.00 65.04  ? 925  ASP A CG  1 
ATOM 7146 O OD1 . ASP A 1 928  ? 16.993  22.985 35.395  1.00 65.04  ? 925  ASP A OD1 1 
ATOM 7147 O OD2 . ASP A 1 928  ? 18.391  24.593 35.064  1.00 65.04  ? 925  ASP A OD2 1 
ATOM 7148 N N   . LEU A 1 929  ? 16.780  26.538 34.858  1.00 52.26  ? 926  LEU A N   1 
ATOM 7149 C CA  . LEU A 1 929  ? 17.318  27.731 35.562  1.00 52.26  ? 926  LEU A CA  1 
ATOM 7150 C C   . LEU A 1 929  ? 18.798  28.108 35.440  1.00 52.26  ? 926  LEU A C   1 
ATOM 7151 O O   . LEU A 1 929  ? 19.134  29.220 35.046  1.00 52.26  ? 926  LEU A O   1 
ATOM 7152 C CB  . LEU A 1 929  ? 17.075  27.628 37.068  1.00 42.38  ? 926  LEU A CB  1 
ATOM 7153 C CG  . LEU A 1 929  ? 18.041  28.454 37.965  1.00 42.38  ? 926  LEU A CG  1 
ATOM 7154 C CD1 . LEU A 1 929  ? 17.774  29.981 37.924  1.00 42.38  ? 926  LEU A CD1 1 
ATOM 7155 C CD2 . LEU A 1 929  ? 18.097  28.042 39.441  1.00 42.38  ? 926  LEU A CD2 1 
ATOM 7156 N N   . MET A 1 930  ? 19.697  27.244 35.892  1.00 47.54  ? 927  MET A N   1 
ATOM 7157 C CA  . MET A 1 930  ? 21.114  27.504 35.660  1.00 47.54  ? 927  MET A CA  1 
ATOM 7158 C C   . MET A 1 930  ? 21.764  26.693 34.525  1.00 47.54  ? 927  MET A C   1 
ATOM 7159 O O   . MET A 1 930  ? 22.931  26.897 34.219  1.00 47.54  ? 927  MET A O   1 
ATOM 7160 C CB  . MET A 1 930  ? 21.923  27.361 36.941  1.00 56.76  ? 927  MET A CB  1 
ATOM 7161 C CG  . MET A 1 930  ? 21.886  25.989 37.578  1.00 56.76  ? 927  MET A CG  1 
ATOM 7162 S SD  . MET A 1 930  ? 22.844  25.947 39.111  1.00 56.76  ? 927  MET A SD  1 
ATOM 7163 C CE  . MET A 1 930  ? 21.938  27.019 40.233  1.00 56.76  ? 927  MET A CE  1 
ATOM 7164 N N   . ARG A 1 931  ? 21.023  25.795 33.890  1.00 36.32  ? 928  ARG A N   1 
ATOM 7165 C CA  . ARG A 1 931  ? 21.657  24.810 32.997  1.00 36.32  ? 928  ARG A CA  1 
ATOM 7166 C C   . ARG A 1 931  ? 20.999  24.811 31.626  1.00 36.32  ? 928  ARG A C   1 
ATOM 7167 O O   . ARG A 1 931  ? 20.634  23.767 31.115  1.00 36.32  ? 928  ARG A O   1 
ATOM 7168 C CB  . ARG A 1 931  ? 21.633  23.394 33.614  1.00 63.33  ? 928  ARG A CB  1 
ATOM 7169 C CG  . ARG A 1 931  ? 21.963  23.332 35.108  1.00 63.33  ? 928  ARG A CG  1 
ATOM 7170 C CD  . ARG A 1 931  ? 22.146  21.923 35.636  1.00 63.33  ? 928  ARG A CD  1 
ATOM 7171 N NE  . ARG A 1 931  ? 21.138  20.961 35.168  1.00 63.33  ? 928  ARG A NE  1 
ATOM 7172 C CZ  . ARG A 1 931  ? 21.302  19.629 35.131  1.00 63.33  ? 928  ARG A CZ  1 
ATOM 7173 N NH1 . ARG A 1 931  ? 22.441  19.076 35.529  1.00 63.33  ? 928  ARG A NH1 1 
ATOM 7174 N NH2 . ARG A 1 931  ? 20.334  18.840 34.673  1.00 63.33  ? 928  ARG A NH2 1 
ATOM 7175 N N   . SER A 1 932  ? 20.877  25.998 31.038  1.00 43.34  ? 929  SER A N   1 
ATOM 7176 C CA  . SER A 1 932  ? 20.221  26.215 29.751  1.00 43.34  ? 929  SER A CA  1 
ATOM 7177 C C   . SER A 1 932  ? 18.983  25.367 29.498  1.00 43.34  ? 929  SER A C   1 
ATOM 7178 O O   . SER A 1 932  ? 18.058  25.425 30.276  1.00 43.34  ? 929  SER A O   1 
ATOM 7179 C CB  . SER A 1 932  ? 21.206  26.140 28.592  1.00 50.52  ? 929  SER A CB  1 
ATOM 7180 O OG  . SER A 1 932  ? 21.943  24.954 28.686  1.00 50.52  ? 929  SER A OG  1 
ATOM 7181 N N   . VAL A 1 933  ? 18.942  24.577 28.431  1.00 28.35  ? 930  VAL A N   1 
ATOM 7182 C CA  . VAL A 1 933  ? 17.652  24.021 28.016  1.00 28.35  ? 930  VAL A CA  1 
ATOM 7183 C C   . VAL A 1 933  ? 17.639  22.483 27.750  1.00 28.35  ? 930  VAL A C   1 
ATOM 7184 O O   . VAL A 1 933  ? 18.611  21.939 27.264  1.00 28.35  ? 930  VAL A O   1 
ATOM 7185 C CB  . VAL A 1 933  ? 17.012  24.850 26.798  1.00 33.05  ? 930  VAL A CB  1 
ATOM 7186 C CG1 . VAL A 1 933  ? 16.855  26.334 27.145  1.00 33.05  ? 930  VAL A CG1 1 
ATOM 7187 C CG2 . VAL A 1 933  ? 17.798  24.668 25.458  1.00 33.05  ? 930  VAL A CG2 1 
ATOM 7188 N N   . LEU A 1 934  ? 16.534  21.807 28.087  1.00 51.62  ? 931  LEU A N   1 
ATOM 7189 C CA  . LEU A 1 934  ? 16.323  20.388 27.772  1.00 51.62  ? 931  LEU A CA  1 
ATOM 7190 C C   . LEU A 1 934  ? 15.223  20.281 26.717  1.00 51.62  ? 931  LEU A C   1 
ATOM 7191 O O   . LEU A 1 934  ? 14.425  21.199 26.532  1.00 51.62  ? 931  LEU A O   1 
ATOM 7192 C CB  . LEU A 1 934  ? 15.906  19.598 29.011  1.00 54.45  ? 931  LEU A CB  1 
ATOM 7193 C CG  . LEU A 1 934  ? 16.902  19.219 30.118  1.00 54.45  ? 931  LEU A CG  1 
ATOM 7194 C CD1 . LEU A 1 934  ? 17.800  20.394 30.698  1.00 54.45  ? 931  LEU A CD1 1 
ATOM 7195 C CD2 . LEU A 1 934  ? 16.161  18.535 31.242  1.00 54.45  ? 931  LEU A CD2 1 
ATOM 7196 N N   . LEU A 1 935  ? 15.211  19.166 26.000  1.00 54.69  ? 932  LEU A N   1 
ATOM 7197 C CA  . LEU A 1 935  ? 14.150  18.840 25.083  1.00 54.69  ? 932  LEU A CA  1 
ATOM 7198 C C   . LEU A 1 935  ? 13.576  17.532 25.584  1.00 54.69  ? 932  LEU A C   1 
ATOM 7199 O O   . LEU A 1 935  ? 14.328  16.602 25.873  1.00 54.69  ? 932  LEU A O   1 
ATOM 7200 C CB  . LEU A 1 935  ? 14.744  18.646 23.719  1.00 37.21  ? 932  LEU A CB  1 
ATOM 7201 C CG  . LEU A 1 935  ? 13.887  18.314 22.499  1.00 37.21  ? 932  LEU A CG  1 
ATOM 7202 C CD1 . LEU A 1 935  ? 12.681  19.201 22.416  1.00 37.21  ? 932  LEU A CD1 1 
ATOM 7203 C CD2 . LEU A 1 935  ? 14.717  18.421 21.191  1.00 37.21  ? 932  LEU A CD2 1 
ATOM 7204 N N   . LEU A 1 936  ? 12.255  17.470 25.734  1.00 70.75  ? 933  LEU A N   1 
ATOM 7205 C CA  . LEU A 1 936  ? 11.582  16.249 26.176  1.00 70.75  ? 933  LEU A CA  1 
ATOM 7206 C C   . LEU A 1 936  ? 10.492  15.825 25.214  1.00 70.75  ? 933  LEU A C   1 
ATOM 7207 O O   . LEU A 1 936  ? 9.947   16.652 24.485  1.00 70.75  ? 933  LEU A O   1 
ATOM 7208 C CB  . LEU A 1 936  ? 10.974  16.452 27.557  1.00 53.14  ? 933  LEU A CB  1 
ATOM 7209 C CG  . LEU A 1 936  ? 11.768  16.013 28.789  1.00 53.14  ? 933  LEU A CG  1 
ATOM 7210 C CD1 . LEU A 1 936  ? 13.169  16.680 28.855  1.00 53.14  ? 933  LEU A CD1 1 
ATOM 7211 C CD2 . LEU A 1 936  ? 10.966  16.303 30.057  1.00 53.14  ? 933  LEU A CD2 1 
ATOM 7212 N N   . ALA A 1 937  ? 10.183  14.532 25.207  1.00 58.32  ? 934  ALA A N   1 
ATOM 7213 C CA  . ALA A 1 937  ? 8.982   14.036 24.520  1.00 58.32  ? 934  ALA A CA  1 
ATOM 7214 C C   . ALA A 1 937  ? 8.037   13.281 25.423  1.00 58.32  ? 934  ALA A C   1 
ATOM 7215 O O   . ALA A 1 937  ? 8.410   12.775 26.484  1.00 58.32  ? 934  ALA A O   1 
ATOM 7216 C CB  . ALA A 1 937  ? 9.320   13.188 23.317  1.00 20.13  ? 934  ALA A CB  1 
ATOM 7217 N N   . TYR A 1 938  ? 6.807   13.193 24.972  1.00 80.77  ? 935  TYR A N   1 
ATOM 7218 C CA  . TYR A 1 938  ? 5.846   12.370 25.621  1.00 80.77  ? 935  TYR A CA  1 
ATOM 7219 C C   . TYR A 1 938  ? 5.744   11.141 24.790  1.00 80.77  ? 935  TYR A C   1 
ATOM 7220 O O   . TYR A 1 938  ? 5.621   11.195 23.588  1.00 80.77  ? 935  TYR A O   1 
ATOM 7221 C CB  . TYR A 1 938  ? 4.485   13.018 25.682  1.00 52.72  ? 935  TYR A CB  1 
ATOM 7222 C CG  . TYR A 1 938  ? 3.512   12.149 26.411  1.00 52.72  ? 935  TYR A CG  1 
ATOM 7223 C CD1 . TYR A 1 938  ? 3.668   11.902 27.733  1.00 52.72  ? 935  TYR A CD1 1 
ATOM 7224 C CD2 . TYR A 1 938  ? 2.471   11.548 25.767  1.00 52.72  ? 935  TYR A CD2 1 
ATOM 7225 C CE1 . TYR A 1 938  ? 2.819   11.122 28.395  1.00 52.72  ? 935  TYR A CE1 1 
ATOM 7226 C CE2 . TYR A 1 938  ? 1.613   10.756 26.430  1.00 52.72  ? 935  TYR A CE2 1 
ATOM 7227 C CZ  . TYR A 1 938  ? 1.792   10.544 27.748  1.00 52.72  ? 935  TYR A CZ  1 
ATOM 7228 O OH  . TYR A 1 938  ? 0.942   9.755  28.464  1.00 52.72  ? 935  TYR A OH  1 
ATOM 7229 N N   . LYS A 1 939  ? 5.792   10.017 25.456  1.00 72.87  ? 936  LYS A N   1 
ATOM 7230 C CA  . LYS A 1 939  ? 5.716   8.751  24.786  1.00 72.87  ? 936  LYS A CA  1 
ATOM 7231 C C   . LYS A 1 939  ? 4.379   8.098  25.120  1.00 72.87  ? 936  LYS A C   1 
ATOM 7232 O O   . LYS A 1 939  ? 4.192   7.567  26.220  1.00 72.87  ? 936  LYS A O   1 
ATOM 7233 C CB  . LYS A 1 939  ? 6.883   7.860  25.215  1.00 52.63  ? 936  LYS A CB  1 
ATOM 7234 C CG  . LYS A 1 939  ? 8.288   8.466  25.098  1.00 52.63  ? 936  LYS A CG  1 
ATOM 7235 C CD  . LYS A 1 939  ? 8.518   9.198  23.776  1.00 52.63  ? 936  LYS A CD  1 
ATOM 7236 C CE  . LYS A 1 939  ? 8.500   8.284  22.565  1.00 52.63  ? 936  LYS A CE  1 
ATOM 7237 N NZ  . LYS A 1 939  ? 9.796   7.568  22.526  1.00 52.63  ? 936  LYS A NZ  1 
ATOM 7238 N N   . PRO A 1 940  ? 3.422   8.164  24.184  1.00 60.42  ? 937  PRO A N   1 
ATOM 7239 C CA  . PRO A 1 940  ? 2.234   7.328  24.327  1.00 60.42  ? 937  PRO A CA  1 
ATOM 7240 C C   . PRO A 1 940  ? 2.678   5.849  24.303  1.00 60.42  ? 937  PRO A C   1 
ATOM 7241 O O   . PRO A 1 940  ? 2.286   5.046  23.445  1.00 60.42  ? 937  PRO A O   1 
ATOM 7242 C CB  . PRO A 1 940  ? 1.385   7.704  23.096  1.00 54.02  ? 937  PRO A CB  1 
ATOM 7243 C CG  . PRO A 1 940  ? 1.921   9.010  22.622  1.00 54.02  ? 937  PRO A CG  1 
ATOM 7244 C CD  . PRO A 1 940  ? 3.376   8.995  22.966  1.00 54.02  ? 937  PRO A CD  1 
ATOM 7245 N N   . MET A 1 941  ? 3.542   5.519  25.239  1.00 98.06  ? 938  MET A N   1 
ATOM 7246 C CA  . MET A 1 941  ? 4.090   4.205  25.336  1.00 98.06  ? 938  MET A CA  1 
ATOM 7247 C C   . MET A 1 941  ? 3.424   3.757  26.600  1.00 98.06  ? 938  MET A C   1 
ATOM 7248 O O   . MET A 1 941  ? 2.248   3.395  26.592  1.00 98.06  ? 938  MET A O   1 
ATOM 7249 C CB  . MET A 1 941  ? 5.612   4.333  25.469  1.00 129.78 ? 938  MET A CB  1 
ATOM 7250 C CG  . MET A 1 941  ? 6.347   3.230  26.222  1.00 129.78 ? 938  MET A CG  1 
ATOM 7251 S SD  . MET A 1 941  ? 8.091   3.639  26.471  1.00 129.78 ? 938  MET A SD  1 
ATOM 7252 C CE  . MET A 1 941  ? 8.021   5.208  27.322  1.00 129.78 ? 938  MET A CE  1 
ATOM 7253 N N   . GLU A 1 942  ? 4.164   3.840  27.697  1.00 141.99 ? 939  GLU A N   1 
ATOM 7254 C CA  . GLU A 1 942  ? 3.610   3.656  29.018  1.00 141.99 ? 939  GLU A CA  1 
ATOM 7255 C C   . GLU A 1 942  ? 3.176   5.030  29.512  1.00 141.99 ? 939  GLU A C   1 
ATOM 7256 O O   . GLU A 1 942  ? 2.884   5.221  30.697  1.00 141.99 ? 939  GLU A O   1 
ATOM 7257 C CB  . GLU A 1 942  ? 4.647   3.026  29.955  1.00 157.66 ? 939  GLU A CB  1 
ATOM 7258 C CG  . GLU A 1 942  ? 5.958   3.796  30.058  1.00 157.66 ? 939  GLU A CG  1 
ATOM 7259 C CD  . GLU A 1 942  ? 6.763   3.427  31.286  1.00 157.66 ? 939  GLU A CD  1 
ATOM 7260 O OE1 . GLU A 1 942  ? 7.190   4.354  32.012  1.00 157.66 ? 939  GLU A OE1 1 
ATOM 7261 O OE2 . GLU A 1 942  ? 6.963   2.215  31.526  1.00 157.66 ? 939  GLU A OE2 1 
ATOM 7262 N N   . GLY A 1 943  ? 3.125   5.982  28.585  1.00 140.82 ? 940  GLY A N   1 
ATOM 7263 C CA  . GLY A 1 943  ? 2.808   7.351  28.928  1.00 140.82 ? 940  GLY A CA  1 
ATOM 7264 C C   . GLY A 1 943  ? 3.928   7.858  29.795  1.00 140.82 ? 940  GLY A C   1 
ATOM 7265 O O   . GLY A 1 943  ? 3.762   8.045  30.999  1.00 140.82 ? 940  GLY A O   1 
ATOM 7266 N N   . ASN A 1 944  ? 5.085   8.042  29.176  1.00 70.42  ? 941  ASN A N   1 
ATOM 7267 C CA  . ASN A 1 944  ? 6.262   8.471  29.905  1.00 70.42  ? 941  ASN A CA  1 
ATOM 7268 C C   . ASN A 1 944  ? 7.013   9.627  29.230  1.00 70.42  ? 941  ASN A C   1 
ATOM 7269 O O   . ASN A 1 944  ? 6.754   9.956  28.056  1.00 70.42  ? 941  ASN A O   1 
ATOM 7270 C CB  . ASN A 1 944  ? 7.196   7.280  30.134  1.00 159.62 ? 941  ASN A CB  1 
ATOM 7271 C CG  . ASN A 1 944  ? 8.034   7.426  31.388  1.00 159.62 ? 941  ASN A CG  1 
ATOM 7272 O OD1 . ASN A 1 944  ? 9.075   6.783  31.528  1.00 159.62 ? 941  ASN A OD1 1 
ATOM 7273 N ND2 . ASN A 1 944  ? 7.586   8.275  32.310  1.00 159.62 ? 941  ASN A ND2 1 
ATOM 7274 N N   . PHE A 1 945  ? 7.916   10.255 29.993  1.00 37.71  ? 942  PHE A N   1 
ATOM 7275 C CA  . PHE A 1 945  ? 8.856   11.208 29.414  1.00 37.71  ? 942  PHE A CA  1 
ATOM 7276 C C   . PHE A 1 945  ? 10.139  10.517 28.976  1.00 37.71  ? 942  PHE A C   1 
ATOM 7277 O O   . PHE A 1 945  ? 10.775  9.782  29.775  1.00 37.71  ? 942  PHE A O   1 
ATOM 7278 C CB  . PHE A 1 945  ? 9.241   12.321 30.402  1.00 35.98  ? 942  PHE A CB  1 
ATOM 7279 C CG  . PHE A 1 945  ? 8.143   13.272 30.689  1.00 35.98  ? 942  PHE A CG  1 
ATOM 7280 C CD1 . PHE A 1 945  ? 7.902   13.692 31.997  1.00 35.98  ? 942  PHE A CD1 1 
ATOM 7281 C CD2 . PHE A 1 945  ? 7.345   13.760 29.654  1.00 35.98  ? 942  PHE A CD2 1 
ATOM 7282 C CE1 . PHE A 1 945  ? 6.886   14.577 32.273  1.00 35.98  ? 942  PHE A CE1 1 
ATOM 7283 C CE2 . PHE A 1 945  ? 6.332   14.627 29.922  1.00 35.98  ? 942  PHE A CE2 1 
ATOM 7284 C CZ  . PHE A 1 945  ? 6.094   15.038 31.243  1.00 35.98  ? 942  PHE A CZ  1 
ATOM 7285 N N   . GLU A 1 946  ? 10.526  10.800 27.733  1.00 84.93  ? 943  GLU A N   1 
ATOM 7286 C CA  . GLU A 1 946  ? 11.862  10.528 27.253  1.00 84.93  ? 943  GLU A CA  1 
ATOM 7287 C C   . GLU A 1 946  ? 12.629  11.833 27.094  1.00 84.93  ? 943  GLU A C   1 
ATOM 7288 O O   . GLU A 1 946  ? 12.277  12.654 26.245  1.00 84.93  ? 943  GLU A O   1 
ATOM 7289 C CB  . GLU A 1 946  ? 11.794  9.825  25.910  1.00 81.38  ? 943  GLU A CB  1 
ATOM 7290 C CG  . GLU A 1 946  ? 13.105  9.175  25.519  1.00 81.38  ? 943  GLU A CG  1 
ATOM 7291 C CD  . GLU A 1 946  ? 13.133  8.765  24.071  1.00 81.38  ? 943  GLU A CD  1 
ATOM 7292 O OE1 . GLU A 1 946  ? 14.243  8.753  23.498  1.00 81.38  ? 943  GLU A OE1 1 
ATOM 7293 O OE2 . GLU A 1 946  ? 12.054  8.468  23.506  1.00 81.38  ? 943  GLU A OE2 1 
ATOM 7294 N N   . GLU A 1 947  ? 13.670  12.032 27.905  1.00 37.79  ? 944  GLU A N   1 
ATOM 7295 C CA  . GLU A 1 947  ? 14.539  13.217 27.774  1.00 37.79  ? 944  GLU A CA  1 
ATOM 7296 C C   . GLU A 1 947  ? 15.306  13.046 26.502  1.00 37.79  ? 944  GLU A C   1 
ATOM 7297 O O   . GLU A 1 947  ? 16.209  12.223 26.465  1.00 37.79  ? 944  GLU A O   1 
ATOM 7298 C CB  . GLU A 1 947  ? 15.516  13.317 28.942  1.00 70.73  ? 944  GLU A CB  1 
ATOM 7299 C CG  . GLU A 1 947  ? 16.389  14.546 28.878  1.00 70.73  ? 944  GLU A CG  1 
ATOM 7300 C CD  . GLU A 1 947  ? 17.396  14.621 30.011  1.00 70.73  ? 944  GLU A CD  1 
ATOM 7301 O OE1 . GLU A 1 947  ? 18.546  15.026 29.739  1.00 70.73  ? 944  GLU A OE1 1 
ATOM 7302 O OE2 . GLU A 1 947  ? 17.055  14.290 31.172  1.00 70.73  ? 944  GLU A OE2 1 
ATOM 7303 N N   . ILE A 1 948  ? 14.942  13.779 25.455  1.00 47.06  ? 945  ILE A N   1 
ATOM 7304 C CA  . ILE A 1 948  ? 15.598  13.620 24.155  1.00 47.06  ? 945  ILE A CA  1 
ATOM 7305 C C   . ILE A 1 948  ? 17.031  14.155 24.089  1.00 47.06  ? 945  ILE A C   1 
ATOM 7306 O O   . ILE A 1 948  ? 17.953  13.440 23.660  1.00 47.06  ? 945  ILE A O   1 
ATOM 7307 C CB  . ILE A 1 948  ? 14.758  14.156 22.991  1.00 51.04  ? 945  ILE A CB  1 
ATOM 7308 C CG1 . ILE A 1 948  ? 13.851  13.039 22.508  1.00 51.04  ? 945  ILE A CG1 1 
ATOM 7309 C CG2 . ILE A 1 948  ? 15.643  14.598 21.833  1.00 51.04  ? 945  ILE A CG2 1 
ATOM 7310 C CD1 . ILE A 1 948  ? 12.631  13.493 21.751  1.00 51.04  ? 945  ILE A CD1 1 
ATOM 7311 N N   . ALA A 1 949  ? 17.227  15.400 24.498  1.00 52.37  ? 946  ALA A N   1 
ATOM 7312 C CA  . ALA A 1 949  ? 18.552  15.993 24.399  1.00 52.37  ? 946  ALA A CA  1 
ATOM 7313 C C   . ALA A 1 949  ? 18.650  17.222 25.278  1.00 52.37  ? 946  ALA A C   1 
ATOM 7314 O O   . ALA A 1 949  ? 17.633  17.755 25.707  1.00 52.37  ? 946  ALA A O   1 
ATOM 7315 C CB  . ALA A 1 949  ? 18.874  16.333 22.938  1.00 36.04  ? 946  ALA A CB  1 
ATOM 7316 N N   . ARG A 1 950  ? 19.869  17.661 25.567  1.00 43.53  ? 947  ARG A N   1 
ATOM 7317 C CA  . ARG A 1 950  ? 20.056  18.956 26.232  1.00 43.53  ? 947  ARG A CA  1 
ATOM 7318 C C   . ARG A 1 950  ? 21.248  19.787 25.736  1.00 43.53  ? 947  ARG A C   1 
ATOM 7319 O O   . ARG A 1 950  ? 22.086  19.315 24.972  1.00 43.53  ? 947  ARG A O   1 
ATOM 7320 C CB  . ARG A 1 950  ? 20.054  18.836 27.759  1.00 56.86  ? 947  ARG A CB  1 
ATOM 7321 C CG  . ARG A 1 950  ? 21.346  18.425 28.346  1.00 56.86  ? 947  ARG A CG  1 
ATOM 7322 C CD  . ARG A 1 950  ? 21.136  17.901 29.727  1.00 56.86  ? 947  ARG A CD  1 
ATOM 7323 N NE  . ARG A 1 950  ? 21.471  18.955 30.648  1.00 56.86  ? 947  ARG A NE  1 
ATOM 7324 C CZ  . ARG A 1 950  ? 22.155  18.763 31.766  1.00 56.86  ? 947  ARG A CZ  1 
ATOM 7325 N NH1 . ARG A 1 950  ? 22.570  17.533 32.083  1.00 56.86  ? 947  ARG A NH1 1 
ATOM 7326 N NH2 . ARG A 1 950  ? 22.448  19.801 32.553  1.00 56.86  ? 947  ARG A NH2 1 
ATOM 7327 N N   . ASP A 1 951  ? 21.259  21.052 26.130  1.00 39.95  ? 948  ASP A N   1 
ATOM 7328 C CA  . ASP A 1 951  ? 22.326  21.944 25.806  1.00 39.95  ? 948  ASP A CA  1 
ATOM 7329 C C   . ASP A 1 951  ? 23.181  21.989 27.034  1.00 39.95  ? 948  ASP A C   1 
ATOM 7330 O O   . ASP A 1 951  ? 22.689  22.208 28.153  1.00 39.95  ? 948  ASP A O   1 
ATOM 7331 C CB  . ASP A 1 951  ? 21.809  23.318 25.457  1.00 49.47  ? 948  ASP A CB  1 
ATOM 7332 C CG  . ASP A 1 951  ? 22.912  24.291 25.225  1.00 49.47  ? 948  ASP A CG  1 
ATOM 7333 O OD1 . ASP A 1 951  ? 23.993  24.103 25.813  1.00 49.47  ? 948  ASP A OD1 1 
ATOM 7334 O OD2 . ASP A 1 951  ? 22.711  25.251 24.461  1.00 49.47  ? 948  ASP A OD2 1 
ATOM 7335 N N   . PHE A 1 952  ? 24.468  21.756 26.823  1.00 46.22  ? 949  PHE A N   1 
ATOM 7336 C CA  . PHE A 1 952  ? 25.382  21.532 27.907  1.00 46.22  ? 949  PHE A CA  1 
ATOM 7337 C C   . PHE A 1 952  ? 26.194  22.805 28.146  1.00 46.22  ? 949  PHE A C   1 
ATOM 7338 O O   . PHE A 1 952  ? 27.424  22.796 28.026  1.00 46.22  ? 949  PHE A O   1 
ATOM 7339 C CB  . PHE A 1 952  ? 26.264  20.296 27.601  1.00 53.39  ? 949  PHE A CB  1 
ATOM 7340 C CG  . PHE A 1 952  ? 25.590  18.961 27.890  1.00 53.39  ? 949  PHE A CG  1 
ATOM 7341 C CD1 . PHE A 1 952  ? 25.056  18.190 26.859  1.00 53.39  ? 949  PHE A CD1 1 
ATOM 7342 C CD2 . PHE A 1 952  ? 25.490  18.472 29.201  1.00 53.39  ? 949  PHE A CD2 1 
ATOM 7343 C CE1 . PHE A 1 952  ? 24.410  16.951 27.127  1.00 53.39  ? 949  PHE A CE1 1 
ATOM 7344 C CE2 . PHE A 1 952  ? 24.857  17.242 29.474  1.00 53.39  ? 949  PHE A CE2 1 
ATOM 7345 C CZ  . PHE A 1 952  ? 24.324  16.486 28.435  1.00 53.39  ? 949  PHE A CZ  1 
ATOM 7346 N N   . ASN A 1 953  ? 25.505  23.901 28.482  1.00 39.03  ? 950  ASN A N   1 
ATOM 7347 C CA  . ASN A 1 953  ? 26.170  25.174 28.791  1.00 39.03  ? 950  ASN A CA  1 
ATOM 7348 C C   . ASN A 1 953  ? 25.558  25.864 29.993  1.00 39.03  ? 950  ASN A C   1 
ATOM 7349 O O   . ASN A 1 953  ? 24.401  25.658 30.294  1.00 39.03  ? 950  ASN A O   1 
ATOM 7350 C CB  . ASN A 1 953  ? 26.120  26.107 27.590  1.00 51.90  ? 950  ASN A CB  1 
ATOM 7351 C CG  . ASN A 1 953  ? 27.087  25.709 26.492  1.00 51.90  ? 950  ASN A CG  1 
ATOM 7352 O OD1 . ASN A 1 953  ? 26.685  25.415 25.358  1.00 51.90  ? 950  ASN A OD1 1 
ATOM 7353 N ND2 . ASN A 1 953  ? 28.370  25.723 26.815  1.00 51.90  ? 950  ASN A ND2 1 
ATOM 7354 N N   . PRO A 1 954  ? 26.327  26.704 30.690  1.00 47.83  ? 951  PRO A N   1 
ATOM 7355 C CA  . PRO A 1 954  ? 25.912  27.270 31.974  1.00 47.83  ? 951  PRO A CA  1 
ATOM 7356 C C   . PRO A 1 954  ? 25.022  28.512 31.883  1.00 47.83  ? 951  PRO A C   1 
ATOM 7357 O O   . PRO A 1 954  ? 25.224  29.466 32.654  1.00 47.83  ? 951  PRO A O   1 
ATOM 7358 C CB  . PRO A 1 954  ? 27.241  27.673 32.620  1.00 33.87  ? 951  PRO A CB  1 
ATOM 7359 C CG  . PRO A 1 954  ? 28.294  27.371 31.622  1.00 33.87  ? 951  PRO A CG  1 
ATOM 7360 C CD  . PRO A 1 954  ? 27.658  27.183 30.312  1.00 33.87  ? 951  PRO A CD  1 
ATOM 7361 N N   . ASN A 1 955  ? 24.054  28.484 30.963  1.00 28.34  ? 952  ASN A N   1 
ATOM 7362 C CA  . ASN A 1 955  ? 23.015  29.537 30.817  1.00 28.34  ? 952  ASN A CA  1 
ATOM 7363 C C   . ASN A 1 955  ? 21.984  29.600 31.929  1.00 28.34  ? 952  ASN A C   1 
ATOM 7364 O O   . ASN A 1 955  ? 21.178  28.701 32.038  1.00 28.34  ? 952  ASN A O   1 
ATOM 7365 C CB  . ASN A 1 955  ? 22.273  29.367 29.491  1.00 35.54  ? 952  ASN A CB  1 
ATOM 7366 C CG  . ASN A 1 955  ? 23.201  29.467 28.330  1.00 35.54  ? 952  ASN A CG  1 
ATOM 7367 O OD1 . ASN A 1 955  ? 24.187  30.213 28.417  1.00 35.54  ? 952  ASN A OD1 1 
ATOM 7368 N ND2 . ASN A 1 955  ? 22.936  28.716 27.247  1.00 35.54  ? 952  ASN A ND2 1 
ATOM 7369 N N   . TRP A 1 956  ? 22.019  30.651 32.748  1.00 31.30  ? 953  TRP A N   1 
ATOM 7370 C CA  . TRP A 1 956  ? 20.937  30.909 33.684  1.00 31.30  ? 953  TRP A CA  1 
ATOM 7371 C C   . TRP A 1 956  ? 19.764  31.529 32.919  1.00 31.30  ? 953  TRP A C   1 
ATOM 7372 O O   . TRP A 1 956  ? 19.654  32.742 32.807  1.00 31.30  ? 953  TRP A O   1 
ATOM 7373 C CB  . TRP A 1 956  ? 21.406  31.830 34.797  1.00 54.16  ? 953  TRP A CB  1 
ATOM 7374 C CG  . TRP A 1 956  ? 22.485  31.245 35.619  1.00 54.16  ? 953  TRP A CG  1 
ATOM 7375 C CD1 . TRP A 1 956  ? 23.685  30.775 35.180  1.00 54.16  ? 953  TRP A CD1 1 
ATOM 7376 C CD2 . TRP A 1 956  ? 22.478  31.063 37.041  1.00 54.16  ? 953  TRP A CD2 1 
ATOM 7377 N NE1 . TRP A 1 956  ? 24.420  30.307 36.234  1.00 54.16  ? 953  TRP A NE1 1 
ATOM 7378 C CE2 . TRP A 1 956  ? 23.705  30.471 37.388  1.00 54.16  ? 953  TRP A CE2 1 
ATOM 7379 C CE3 . TRP A 1 956  ? 21.549  31.343 38.057  1.00 54.16  ? 953  TRP A CE3 1 
ATOM 7380 C CZ2 . TRP A 1 956  ? 24.032  30.147 38.699  1.00 54.16  ? 953  TRP A CZ2 1 
ATOM 7381 C CZ3 . TRP A 1 956  ? 21.880  31.023 39.365  1.00 54.16  ? 953  TRP A CZ3 1 
ATOM 7382 C CH2 . TRP A 1 956  ? 23.115  30.432 39.671  1.00 54.16  ? 953  TRP A CH2 1 
ATOM 7383 N N   . MET A 1 957  ? 18.897  30.691 32.374  1.00 29.84  ? 954  MET A N   1 
ATOM 7384 C CA  . MET A 1 957  ? 17.731  31.153 31.640  1.00 29.84  ? 954  MET A CA  1 
ATOM 7385 C C   . MET A 1 957  ? 16.857  32.175 32.363  1.00 29.84  ? 954  MET A C   1 
ATOM 7386 O O   . MET A 1 957  ? 16.791  32.241 33.599  1.00 29.84  ? 954  MET A O   1 
ATOM 7387 C CB  . MET A 1 957  ? 16.845  29.960 31.317  1.00 28.23  ? 954  MET A CB  1 
ATOM 7388 C CG  . MET A 1 957  ? 17.568  28.800 30.701  1.00 28.23  ? 954  MET A CG  1 
ATOM 7389 S SD  . MET A 1 957  ? 18.619  29.340 29.386  1.00 28.23  ? 954  MET A SD  1 
ATOM 7390 C CE  . MET A 1 957  ? 17.441  29.927 28.174  1.00 28.23  ? 954  MET A CE  1 
ATOM 7391 N N   . SER A 1 958  ? 16.161  32.951 31.558  1.00 29.98  ? 955  SER A N   1 
ATOM 7392 C CA  . SER A 1 958  ? 15.041  33.740 32.013  1.00 29.98  ? 955  SER A CA  1 
ATOM 7393 C C   . SER A 1 958  ? 13.774  33.523 31.159  1.00 29.98  ? 955  SER A C   1 
ATOM 7394 O O   . SER A 1 958  ? 12.683  33.725 31.681  1.00 29.98  ? 955  SER A O   1 
ATOM 7395 C CB  . SER A 1 958  ? 15.483  35.218 31.956  1.00 32.23  ? 955  SER A CB  1 
ATOM 7396 O OG  . SER A 1 958  ? 15.694  35.636 30.601  1.00 32.23  ? 955  SER A OG  1 
ATOM 7397 N N   . ALA A 1 959  ? 13.934  33.120 29.874  1.00 22.19  ? 956  ALA A N   1 
ATOM 7398 C CA  . ALA A 1 959  ? 12.802  32.903 28.994  1.00 22.19  ? 956  ALA A CA  1 
ATOM 7399 C C   . ALA A 1 959  ? 13.153  31.943 27.877  1.00 22.19  ? 956  ALA A C   1 
ATOM 7400 O O   . ALA A 1 959  ? 14.289  31.958 27.416  1.00 22.19  ? 956  ALA A O   1 
ATOM 7401 C CB  . ALA A 1 959  ? 12.301  34.239 28.437  1.00 40.42  ? 956  ALA A CB  1 
ATOM 7402 N N   . VAL A 1 960  ? 12.162  31.157 27.422  1.00 30.20  ? 957  VAL A N   1 
ATOM 7403 C CA  . VAL A 1 960  ? 12.412  30.004 26.556  1.00 30.20  ? 957  VAL A CA  1 
ATOM 7404 C C   . VAL A 1 960  ? 11.346  29.958 25.469  1.00 30.20  ? 957  VAL A C   1 
ATOM 7405 O O   . VAL A 1 960  ? 10.192  30.241 25.747  1.00 30.20  ? 957  VAL A O   1 
ATOM 7406 C CB  . VAL A 1 960  ? 12.355  28.749 27.451  1.00 33.90  ? 957  VAL A CB  1 
ATOM 7407 C CG1 . VAL A 1 960  ? 11.797  27.560 26.734  1.00 33.90  ? 957  VAL A CG1 1 
ATOM 7408 C CG2 . VAL A 1 960  ? 13.704  28.466 28.087  1.00 33.90  ? 957  VAL A CG2 1 
ATOM 7409 N N   . GLU A 1 961  ? 11.685  29.661 24.224  1.00 44.68  ? 958  GLU A N   1 
ATOM 7410 C CA  . GLU A 1 961  ? 10.613  29.521 23.244  1.00 44.68  ? 958  GLU A CA  1 
ATOM 7411 C C   . GLU A 1 961  ? 10.940  28.445 22.257  1.00 44.68  ? 958  GLU A C   1 
ATOM 7412 O O   . GLU A 1 961  ? 12.122  28.092 22.083  1.00 44.68  ? 958  GLU A O   1 
ATOM 7413 C CB  . GLU A 1 961  ? 10.382  30.802 22.487  1.00 41.47  ? 958  GLU A CB  1 
ATOM 7414 C CG  . GLU A 1 961  ? 9.211   30.735 21.534  1.00 41.47  ? 958  GLU A CG  1 
ATOM 7415 C CD  . GLU A 1 961  ? 7.907   30.434 22.275  1.00 41.47  ? 958  GLU A CD  1 
ATOM 7416 O OE1 . GLU A 1 961  ? 7.488   29.244 22.305  1.00 41.47  ? 958  GLU A OE1 1 
ATOM 7417 O OE2 . GLU A 1 961  ? 7.332   31.392 22.862  1.00 41.47  ? 958  GLU A OE2 1 
ATOM 7418 N N   . ILE A 1 962  ? 9.904   27.904 21.616  1.00 36.90  ? 959  ILE A N   1 
ATOM 7419 C CA  . ILE A 1 962  ? 10.136  26.987 20.538  1.00 36.90  ? 959  ILE A CA  1 
ATOM 7420 C C   . ILE A 1 962  ? 9.838   27.740 19.279  1.00 36.90  ? 959  ILE A C   1 
ATOM 7421 O O   . ILE A 1 962  ? 8.729   28.178 19.097  1.00 36.90  ? 959  ILE A O   1 
ATOM 7422 C CB  . ILE A 1 962  ? 9.271   25.728 20.665  1.00 32.64  ? 959  ILE A CB  1 
ATOM 7423 C CG1 . ILE A 1 962  ? 9.717   24.898 21.880  1.00 32.64  ? 959  ILE A CG1 1 
ATOM 7424 C CG2 . ILE A 1 962  ? 9.383   24.884 19.382  1.00 32.64  ? 959  ILE A CG2 1 
ATOM 7425 C CD1 . ILE A 1 962  ? 8.725   23.796 22.293  1.00 32.64  ? 959  ILE A CD1 1 
ATOM 7426 N N   . LEU A 1 963  ? 10.810  27.934 18.407  1.00 50.88  ? 960  LEU A N   1 
ATOM 7427 C CA  . LEU A 1 963  ? 10.456  28.614 17.172  1.00 50.88  ? 960  LEU A CA  1 
ATOM 7428 C C   . LEU A 1 963  ? 9.954   27.591 16.190  1.00 50.88  ? 960  LEU A C   1 
ATOM 7429 O O   . LEU A 1 963  ? 9.133   27.912 15.329  1.00 50.88  ? 960  LEU A O   1 
ATOM 7430 C CB  . LEU A 1 963  ? 11.613  29.386 16.550  1.00 29.68  ? 960  LEU A CB  1 
ATOM 7431 C CG  . LEU A 1 963  ? 12.758  29.927 17.389  1.00 29.68  ? 960  LEU A CG  1 
ATOM 7432 C CD1 . LEU A 1 963  ? 13.830  30.249 16.424  1.00 29.68  ? 960  LEU A CD1 1 
ATOM 7433 C CD2 . LEU A 1 963  ? 12.303  31.167 18.059  1.00 29.68  ? 960  LEU A CD2 1 
ATOM 7434 N N   . ASP A 1 964  ? 10.456  26.366 16.307  1.00 57.51  ? 961  ASP A N   1 
ATOM 7435 C CA  . ASP A 1 964  ? 10.068  25.303 15.388  1.00 57.51  ? 961  ASP A CA  1 
ATOM 7436 C C   . ASP A 1 964  ? 10.601  23.934 15.815  1.00 57.51  ? 961  ASP A C   1 
ATOM 7437 O O   . ASP A 1 964  ? 11.368  23.820 16.803  1.00 57.51  ? 961  ASP A O   1 
ATOM 7438 C CB  . ASP A 1 964  ? 10.452  25.633 13.930  1.00 68.12  ? 961  ASP A CB  1 
ATOM 7439 C CG  . ASP A 1 964  ? 11.872  25.234 13.582  1.00 68.12  ? 961  ASP A CG  1 
ATOM 7440 O OD1 . ASP A 1 964  ? 12.325  25.602 12.480  1.00 68.12  ? 961  ASP A OD1 1 
ATOM 7441 O OD2 . ASP A 1 964  ? 12.540  24.553 14.382  1.00 68.12  ? 961  ASP A OD2 1 
ATOM 7442 N N   . ASP A 1 965  ? 10.197  22.908 15.054  1.00 50.14  ? 962  ASP A N   1 
ATOM 7443 C CA  . ASP A 1 965  ? 10.457  21.511 15.399  1.00 50.14  ? 962  ASP A CA  1 
ATOM 7444 C C   . ASP A 1 965  ? 11.872  21.214 15.879  1.00 50.14  ? 962  ASP A C   1 
ATOM 7445 O O   . ASP A 1 965  ? 12.103  20.285 16.669  1.00 50.14  ? 962  ASP A O   1 
ATOM 7446 C CB  . ASP A 1 965  ? 10.134  20.618 14.212  1.00 105.92 ? 962  ASP A CB  1 
ATOM 7447 C CG  . ASP A 1 965  ? 8.665   20.469 14.004  1.00 105.92 ? 962  ASP A CG  1 
ATOM 7448 O OD1 . ASP A 1 965  ? 8.101   21.283 13.247  1.00 105.92 ? 962  ASP A OD1 1 
ATOM 7449 O OD2 . ASP A 1 965  ? 8.081   19.549 14.613  1.00 105.92 ? 962  ASP A OD2 1 
ATOM 7450 N N   . ASP A 1 966  ? 12.812  22.012 15.395  1.00 83.24  ? 963  ASP A N   1 
ATOM 7451 C CA  . ASP A 1 966  ? 14.218  21.724 15.572  1.00 83.24  ? 963  ASP A CA  1 
ATOM 7452 C C   . ASP A 1 966  ? 14.944  22.924 16.158  1.00 83.24  ? 963  ASP A C   1 
ATOM 7453 O O   . ASP A 1 966  ? 16.044  22.775 16.677  1.00 83.24  ? 963  ASP A O   1 
ATOM 7454 C CB  . ASP A 1 966  ? 14.827  21.257 14.239  1.00 111.67 ? 963  ASP A CB  1 
ATOM 7455 C CG  . ASP A 1 966  ? 13.986  20.158 13.555  1.00 111.67 ? 963  ASP A CG  1 
ATOM 7456 O OD1 . ASP A 1 966  ? 13.706  19.118 14.189  1.00 111.67 ? 963  ASP A OD1 1 
ATOM 7457 O OD2 . ASP A 1 966  ? 13.595  20.336 12.382  1.00 111.67 ? 963  ASP A OD2 1 
ATOM 7458 N N   . ASN A 1 967  ? 14.300  24.095 16.116  1.00 63.53  ? 964  ASN A N   1 
ATOM 7459 C CA  . ASN A 1 967  ? 14.870  25.337 16.673  1.00 63.53  ? 964  ASN A CA  1 
ATOM 7460 C C   . ASN A 1 967  ? 14.267  25.821 17.974  1.00 63.53  ? 964  ASN A C   1 
ATOM 7461 O O   . ASN A 1 967  ? 13.078  26.094 18.060  1.00 63.53  ? 964  ASN A O   1 
ATOM 7462 C CB  . ASN A 1 967  ? 14.833  26.467 15.648  1.00 70.83  ? 964  ASN A CB  1 
ATOM 7463 C CG  . ASN A 1 967  ? 15.919  26.330 14.586  1.00 70.83  ? 964  ASN A CG  1 
ATOM 7464 O OD1 . ASN A 1 967  ? 16.872  25.544 14.728  1.00 70.83  ? 964  ASN A OD1 1 
ATOM 7465 N ND2 . ASN A 1 967  ? 15.784  27.110 13.512  1.00 70.83  ? 964  ASN A ND2 1 
ATOM 7466 N N   . PHE A 1 968  ? 15.127  25.929 18.977  1.00 29.65  ? 965  PHE A N   1 
ATOM 7467 C CA  . PHE A 1 968  ? 14.783  26.487 20.304  1.00 29.65  ? 965  PHE A CA  1 
ATOM 7468 C C   . PHE A 1 968  ? 15.477  27.815 20.711  1.00 29.65  ? 965  PHE A C   1 
ATOM 7469 O O   . PHE A 1 968  ? 16.682  27.838 20.843  1.00 29.65  ? 965  PHE A O   1 
ATOM 7470 C CB  . PHE A 1 968  ? 15.029  25.413 21.346  1.00 28.77  ? 965  PHE A CB  1 
ATOM 7471 C CG  . PHE A 1 968  ? 14.458  24.099 20.953  1.00 28.77  ? 965  PHE A CG  1 
ATOM 7472 C CD1 . PHE A 1 968  ? 15.246  22.946 20.959  1.00 28.77  ? 965  PHE A CD1 1 
ATOM 7473 C CD2 . PHE A 1 968  ? 13.120  24.017 20.513  1.00 28.77  ? 965  PHE A CD2 1 
ATOM 7474 C CE1 . PHE A 1 968  ? 14.723  21.699 20.564  1.00 28.77  ? 965  PHE A CE1 1 
ATOM 7475 C CE2 . PHE A 1 968  ? 12.565  22.804 20.114  1.00 28.77  ? 965  PHE A CE2 1 
ATOM 7476 C CZ  . PHE A 1 968  ? 13.361  21.626 20.144  1.00 28.77  ? 965  PHE A CZ  1 
ATOM 7477 N N   . LEU A 1 969  ? 14.698  28.896 20.897  1.00 32.19  ? 966  LEU A N   1 
ATOM 7478 C CA  . LEU A 1 969  ? 15.208  30.215 21.367  1.00 32.19  ? 966  LEU A CA  1 
ATOM 7479 C C   . LEU A 1 969  ? 15.334  30.303 22.852  1.00 32.19  ? 966  LEU A C   1 
ATOM 7480 O O   . LEU A 1 969  ? 14.469  29.819 23.587  1.00 32.19  ? 966  LEU A O   1 
ATOM 7481 C CB  . LEU A 1 969  ? 14.271  31.363 20.989  1.00 30.37  ? 966  LEU A CB  1 
ATOM 7482 C CG  . LEU A 1 969  ? 14.894  32.573 20.265  1.00 30.37  ? 966  LEU A CG  1 
ATOM 7483 C CD1 . LEU A 1 969  ? 13.884  33.661 20.301  1.00 30.37  ? 966  LEU A CD1 1 
ATOM 7484 C CD2 . LEU A 1 969  ? 16.224  33.053 20.829  1.00 30.37  ? 966  LEU A CD2 1 
ATOM 7485 N N   . GLY A 1 970  ? 16.374  30.982 23.304  1.00 34.07  ? 967  GLY A N   1 
ATOM 7486 C CA  . GLY A 1 970  ? 16.660  31.029 24.718  1.00 34.07  ? 967  GLY A CA  1 
ATOM 7487 C C   . GLY A 1 970  ? 17.195  32.406 24.971  1.00 34.07  ? 967  GLY A C   1 
ATOM 7488 O O   . GLY A 1 970  ? 17.839  32.975 24.086  1.00 34.07  ? 967  GLY A O   1 
ATOM 7489 N N   . ALA A 1 971  ? 16.895  32.930 26.168  1.00 27.86  ? 968  ALA A N   1 
ATOM 7490 C CA  . ALA A 1 971  ? 17.277  34.237 26.667  1.00 27.86  ? 968  ALA A CA  1 
ATOM 7491 C C   . ALA A 1 971  ? 17.766  33.997 28.049  1.00 27.86  ? 968  ALA A C   1 
ATOM 7492 O O   . ALA A 1 971  ? 17.143  33.230 28.785  1.00 27.86  ? 968  ALA A O   1 
ATOM 7493 C CB  . ALA A 1 971  ? 16.048  35.113 26.750  1.00 34.27  ? 968  ALA A CB  1 
ATOM 7494 N N   . GLU A 1 972  ? 18.836  34.664 28.471  1.00 18.24  ? 969  GLU A N   1 
ATOM 7495 C CA  . GLU A 1 972  ? 19.351  34.380 29.831  1.00 18.24  ? 969  GLU A CA  1 
ATOM 7496 C C   . GLU A 1 972  ? 19.964  35.518 30.607  1.00 18.24  ? 969  GLU A C   1 
ATOM 7497 O O   . GLU A 1 972  ? 20.411  36.497 30.058  1.00 18.24  ? 969  GLU A O   1 
ATOM 7498 C CB  . GLU A 1 972  ? 20.378  33.252 29.763  1.00 45.15  ? 969  GLU A CB  1 
ATOM 7499 C CG  . GLU A 1 972  ? 21.872  33.690 29.893  1.00 45.15  ? 969  GLU A CG  1 
ATOM 7500 C CD  . GLU A 1 972  ? 22.370  34.496 28.721  1.00 45.15  ? 969  GLU A CD  1 
ATOM 7501 O OE1 . GLU A 1 972  ? 22.022  34.152 27.596  1.00 45.15  ? 969  GLU A OE1 1 
ATOM 7502 O OE2 . GLU A 1 972  ? 23.105  35.460 28.927  1.00 45.15  ? 969  GLU A OE2 1 
ATOM 7503 N N   . ASN A 1 973  ? 19.947  35.367 31.921  1.00 36.72  ? 970  ASN A N   1 
ATOM 7504 C CA  . ASN A 1 973  ? 20.859  35.996 32.861  1.00 36.72  ? 970  ASN A CA  1 
ATOM 7505 C C   . ASN A 1 973  ? 21.677  37.184 32.376  1.00 36.72  ? 970  ASN A C   1 
ATOM 7506 O O   . ASN A 1 973  ? 21.841  38.154 33.096  1.00 36.72  ? 970  ASN A O   1 
ATOM 7507 C CB  . ASN A 1 973  ? 21.829  34.922 33.305  1.00 92.39  ? 970  ASN A CB  1 
ATOM 7508 C CG  . ASN A 1 973  ? 22.491  35.260 34.562  1.00 92.39  ? 970  ASN A CG  1 
ATOM 7509 O OD1 . ASN A 1 973  ? 21.938  35.984 35.372  1.00 92.39  ? 970  ASN A OD1 1 
ATOM 7510 N ND2 . ASN A 1 973  ? 23.695  34.746 34.757  1.00 92.39  ? 970  ASN A ND2 1 
ATOM 7511 N N   . ALA A 1 974  ? 22.229  37.103 31.173  1.00 36.92  ? 971  ALA A N   1 
ATOM 7512 C CA  . ALA A 1 974  ? 23.245  38.048 30.776  1.00 36.92  ? 971  ALA A CA  1 
ATOM 7513 C C   . ALA A 1 974  ? 22.913  38.777 29.453  1.00 36.92  ? 971  ALA A C   1 
ATOM 7514 O O   . ALA A 1 974  ? 23.782  39.169 28.647  1.00 36.92  ? 971  ALA A O   1 
ATOM 7515 C CB  . ALA A 1 974  ? 24.540  37.332 30.714  1.00 16.33  ? 971  ALA A CB  1 
ATOM 7516 N N   . PHE A 1 975  ? 21.624  38.976 29.251  1.00 31.00  ? 972  PHE A N   1 
ATOM 7517 C CA  . PHE A 1 975  ? 21.128  39.727 28.121  1.00 31.00  ? 972  PHE A CA  1 
ATOM 7518 C C   . PHE A 1 975  ? 21.655  39.175 26.835  1.00 31.00  ? 972  PHE A C   1 
ATOM 7519 O O   . PHE A 1 975  ? 21.872  39.950 25.922  1.00 31.00  ? 972  PHE A O   1 
ATOM 7520 C CB  . PHE A 1 975  ? 21.462  41.223 28.250  1.00 17.16  ? 972  PHE A CB  1 
ATOM 7521 C CG  . PHE A 1 975  ? 21.594  41.684 29.693  1.00 17.16  ? 972  PHE A CG  1 
ATOM 7522 C CD1 . PHE A 1 975  ? 22.822  42.062 30.204  1.00 17.16  ? 972  PHE A CD1 1 
ATOM 7523 C CD2 . PHE A 1 975  ? 20.495  41.681 30.542  1.00 17.16  ? 972  PHE A CD2 1 
ATOM 7524 C CE1 . PHE A 1 975  ? 22.944  42.469 31.527  1.00 17.16  ? 972  PHE A CE1 1 
ATOM 7525 C CE2 . PHE A 1 975  ? 20.609  42.080 31.882  1.00 17.16  ? 972  PHE A CE2 1 
ATOM 7526 C CZ  . PHE A 1 975  ? 21.828  42.477 32.369  1.00 17.16  ? 972  PHE A CZ  1 
ATOM 7527 N N   . ASN A 1 976  ? 21.829  37.848 26.752  1.00 37.03  ? 973  ASN A N   1 
ATOM 7528 C CA  . ASN A 1 976  ? 22.153  37.168 25.467  1.00 37.03  ? 973  ASN A CA  1 
ATOM 7529 C C   . ASN A 1 976  ? 20.970  36.346 24.957  1.00 37.03  ? 973  ASN A C   1 
ATOM 7530 O O   . ASN A 1 976  ? 20.146  35.880 25.726  1.00 37.03  ? 973  ASN A O   1 
ATOM 7531 C CB  . ASN A 1 976  ? 23.431  36.278 25.544  1.00 22.17  ? 973  ASN A CB  1 
ATOM 7532 C CG  . ASN A 1 976  ? 24.695  37.050 26.037  1.00 22.17  ? 973  ASN A CG  1 
ATOM 7533 O OD1 . ASN A 1 976  ? 25.090  38.056 25.439  1.00 22.17  ? 973  ASN A OD1 1 
ATOM 7534 N ND2 . ASN A 1 976  ? 25.314  36.573 27.126  1.00 22.17  ? 973  ASN A ND2 1 
ATOM 7535 N N   . LEU A 1 977  ? 20.891  36.188 23.652  1.00 32.28  ? 974  LEU A N   1 
ATOM 7536 C CA  . LEU A 1 977  ? 19.979  35.272 23.065  1.00 32.28  ? 974  LEU A CA  1 
ATOM 7537 C C   . LEU A 1 977  ? 20.760  34.110 22.453  1.00 32.28  ? 974  LEU A C   1 
ATOM 7538 O O   . LEU A 1 977  ? 21.931  34.284 22.018  1.00 32.28  ? 974  LEU A O   1 
ATOM 7539 C CB  . LEU A 1 977  ? 19.191  35.974 21.977  1.00 44.12  ? 974  LEU A CB  1 
ATOM 7540 C CG  . LEU A 1 977  ? 18.167  36.961 22.538  1.00 44.12  ? 974  LEU A CG  1 
ATOM 7541 C CD1 . LEU A 1 977  ? 17.517  37.690 21.414  1.00 44.12  ? 974  LEU A CD1 1 
ATOM 7542 C CD2 . LEU A 1 977  ? 17.124  36.252 23.430  1.00 44.12  ? 974  LEU A CD2 1 
ATOM 7543 N N   . PHE A 1 978  ? 20.134  32.925 22.412  1.00 31.78  ? 975  PHE A N   1 
ATOM 7544 C CA  . PHE A 1 978  ? 20.751  31.802 21.760  1.00 31.78  ? 975  PHE A CA  1 
ATOM 7545 C C   . PHE A 1 978  ? 19.764  30.816 21.147  1.00 31.78  ? 975  PHE A C   1 
ATOM 7546 O O   . PHE A 1 978  ? 18.617  30.688 21.553  1.00 31.78  ? 975  PHE A O   1 
ATOM 7547 C CB  . PHE A 1 978  ? 21.750  31.115 22.678  1.00 31.41  ? 975  PHE A CB  1 
ATOM 7548 C CG  . PHE A 1 978  ? 21.134  30.366 23.805  1.00 31.41  ? 975  PHE A CG  1 
ATOM 7549 C CD1 . PHE A 1 978  ? 20.762  29.026 23.658  1.00 31.41  ? 975  PHE A CD1 1 
ATOM 7550 C CD2 . PHE A 1 978  ? 20.951  30.970 25.043  1.00 31.41  ? 975  PHE A CD2 1 
ATOM 7551 C CE1 . PHE A 1 978  ? 20.202  28.309 24.725  1.00 31.41  ? 975  PHE A CE1 1 
ATOM 7552 C CE2 . PHE A 1 978  ? 20.381  30.245 26.133  1.00 31.41  ? 975  PHE A CE2 1 
ATOM 7553 C CZ  . PHE A 1 978  ? 20.028  28.919 25.962  1.00 31.41  ? 975  PHE A CZ  1 
ATOM 7554 N N   . VAL A 1 979  ? 20.225  30.107 20.146  1.00 35.80  ? 976  VAL A N   1 
ATOM 7555 C CA  . VAL A 1 979  ? 19.399  29.124 19.580  1.00 35.80  ? 976  VAL A CA  1 
ATOM 7556 C C   . VAL A 1 979  ? 20.093  27.766 19.687  1.00 35.80  ? 976  VAL A C   1 
ATOM 7557 O O   . VAL A 1 979  ? 21.293  27.656 19.473  1.00 35.80  ? 976  VAL A O   1 
ATOM 7558 C CB  . VAL A 1 979  ? 19.050  29.538 18.171  1.00 22.57  ? 976  VAL A CB  1 
ATOM 7559 C CG1 . VAL A 1 979  ? 18.326  28.395 17.412  1.00 22.57  ? 976  VAL A CG1 1 
ATOM 7560 C CG2 . VAL A 1 979  ? 18.181  30.750 18.264  1.00 22.57  ? 976  VAL A CG2 1 
ATOM 7561 N N   . CYS A 1 980  ? 19.326  26.750 20.059  1.00 38.86  ? 977  CYS A N   1 
ATOM 7562 C CA  . CYS A 1 980  ? 19.785  25.388 20.035  1.00 38.86  ? 977  CYS A CA  1 
ATOM 7563 C C   . CYS A 1 980  ? 19.025  24.627 18.965  1.00 38.86  ? 977  CYS A C   1 
ATOM 7564 O O   . CYS A 1 980  ? 17.864  24.940 18.659  1.00 38.86  ? 977  CYS A O   1 
ATOM 7565 C CB  . CYS A 1 980  ? 19.544  24.733 21.371  1.00 47.64  ? 977  CYS A CB  1 
ATOM 7566 S SG  . CYS A 1 980  ? 20.503  25.508 22.632  1.00 47.64  ? 977  CYS A SG  1 
ATOM 7567 N N   . GLN A 1 981  ? 19.705  23.650 18.364  1.00 57.53  ? 978  GLN A N   1 
ATOM 7568 C CA  . GLN A 1 981  ? 19.019  22.599 17.619  1.00 57.53  ? 978  GLN A CA  1 
ATOM 7569 C C   . GLN A 1 981  ? 19.591  21.209 17.890  1.00 57.53  ? 978  GLN A C   1 
ATOM 7570 O O   . GLN A 1 981  ? 20.703  21.084 18.384  1.00 57.53  ? 978  GLN A O   1 
ATOM 7571 C CB  . GLN A 1 981  ? 18.911  22.906 16.124  1.00 46.28  ? 978  GLN A CB  1 
ATOM 7572 C CG  . GLN A 1 981  ? 20.144  23.259 15.413  1.00 46.28  ? 978  GLN A CG  1 
ATOM 7573 C CD  . GLN A 1 981  ? 19.827  23.574 13.967  1.00 46.28  ? 978  GLN A CD  1 
ATOM 7574 O OE1 . GLN A 1 981  ? 19.492  22.693 13.195  1.00 46.28  ? 978  GLN A OE1 1 
ATOM 7575 N NE2 . GLN A 1 981  ? 19.910  24.849 13.597  1.00 46.28  ? 978  GLN A NE2 1 
ATOM 7576 N N   . LYS A 1 982  ? 18.797  20.178 17.610  1.00 56.48  ? 979  LYS A N   1 
ATOM 7577 C CA  . LYS A 1 982  ? 19.249  18.803 17.760  1.00 56.48  ? 979  LYS A CA  1 
ATOM 7578 C C   . LYS A 1 982  ? 20.318  18.487 16.701  1.00 56.48  ? 979  LYS A C   1 
ATOM 7579 O O   . LYS A 1 982  ? 20.236  18.924 15.554  1.00 56.48  ? 979  LYS A O   1 
ATOM 7580 C CB  . LYS A 1 982  ? 18.080  17.805 17.723  1.00 89.29  ? 979  LYS A CB  1 
ATOM 7581 C CG  . LYS A 1 982  ? 17.224  17.851 16.467  1.00 89.29  ? 979  LYS A CG  1 
ATOM 7582 C CD  . LYS A 1 982  ? 15.904  18.565 16.707  1.00 89.29  ? 979  LYS A CD  1 
ATOM 7583 C CE  . LYS A 1 982  ? 14.732  17.583 16.799  1.00 89.29  ? 979  LYS A CE  1 
ATOM 7584 N NZ  . LYS A 1 982  ? 14.822  16.690 17.983  1.00 89.29  ? 979  LYS A NZ  1 
ATOM 7585 N N   . ASP A 1 983  ? 21.331  17.742 17.118  1.00 152.60 ? 980  ASP A N   1 
ATOM 7586 C CA  . ASP A 1 983  ? 22.464  17.448 16.265  1.00 152.60 ? 980  ASP A CA  1 
ATOM 7587 C C   . ASP A 1 983  ? 22.167  16.258 15.355  1.00 152.60 ? 980  ASP A C   1 
ATOM 7588 O O   . ASP A 1 983  ? 22.300  15.105 15.771  1.00 152.60 ? 980  ASP A O   1 
ATOM 7589 C CB  . ASP A 1 983  ? 23.688  17.187 17.145  1.00 98.36  ? 980  ASP A CB  1 
ATOM 7590 C CG  . ASP A 1 983  ? 24.922  16.826 16.356  1.00 98.36  ? 980  ASP A CG  1 
ATOM 7591 O OD1 . ASP A 1 983  ? 25.077  17.307 15.213  1.00 98.36  ? 980  ASP A OD1 1 
ATOM 7592 O OD2 . ASP A 1 983  ? 25.749  16.063 16.899  1.00 98.36  ? 980  ASP A OD2 1 
ATOM 7593 N N   . SER A 1 984  ? 21.741  16.537 14.123  1.00 93.80  ? 981  SER A N   1 
ATOM 7594 C CA  . SER A 1 984  ? 21.670  15.497 13.099  1.00 93.80  ? 981  SER A CA  1 
ATOM 7595 C C   . SER A 1 984  ? 23.085  14.915 12.909  1.00 93.80  ? 981  SER A C   1 
ATOM 7596 O O   . SER A 1 984  ? 23.977  15.582 12.358  1.00 93.80  ? 981  SER A O   1 
ATOM 7597 C CB  . SER A 1 984  ? 21.129  16.065 11.787  1.00 113.91 ? 981  SER A CB  1 
ATOM 7598 O OG  . SER A 1 984  ? 19.803  16.521 11.953  1.00 113.91 ? 981  SER A OG  1 
ATOM 7599 N N   . ALA A 1 985  ? 23.282  13.680 13.387  1.00 69.46  ? 982  ALA A N   1 
ATOM 7600 C CA  . ALA A 1 985  ? 24.621  13.091 13.539  1.00 69.46  ? 982  ALA A CA  1 
ATOM 7601 C C   . ALA A 1 985  ? 24.634  11.577 13.699  1.00 69.46  ? 982  ALA A C   1 
ATOM 7602 O O   . ALA A 1 985  ? 23.853  10.996 14.460  1.00 69.46  ? 982  ALA A O   1 
ATOM 7603 C CB  . ALA A 1 985  ? 25.355  13.725 14.727  1.00 73.27  ? 982  ALA A CB  1 
ATOM 7604 N N   . ALA A 1 986  ? 25.570  10.956 12.989  1.00 162.31 ? 983  ALA A N   1 
ATOM 7605 C CA  . ALA A 1 986  ? 25.956  9.572  13.210  1.00 162.31 ? 983  ALA A CA  1 
ATOM 7606 C C   . ALA A 1 986  ? 26.324  9.368  14.690  1.00 162.31 ? 983  ALA A C   1 
ATOM 7607 O O   . ALA A 1 986  ? 26.594  10.341 15.402  1.00 162.31 ? 983  ALA A O   1 
ATOM 7608 C CB  . ALA A 1 986  ? 27.128  9.231  12.296  1.00 44.34  ? 983  ALA A CB  1 
ATOM 7609 N N   . THR A 1 987  ? 26.325  8.110  15.143  1.00 76.06  ? 984  THR A N   1 
ATOM 7610 C CA  . THR A 1 987  ? 26.590  7.731  16.557  1.00 76.06  ? 984  THR A CA  1 
ATOM 7611 C C   . THR A 1 987  ? 25.442  8.174  17.480  1.00 76.06  ? 984  THR A C   1 
ATOM 7612 O O   . THR A 1 987  ? 25.650  8.593  18.639  1.00 76.06  ? 984  THR A O   1 
ATOM 7613 C CB  . THR A 1 987  ? 27.973  8.236  17.097  1.00 158.54 ? 984  THR A CB  1 
ATOM 7614 O OG1 . THR A 1 987  ? 27.866  9.597  17.538  1.00 158.54 ? 984  THR A OG1 1 
ATOM 7615 C CG2 . THR A 1 987  ? 29.076  8.113  16.035  1.00 158.54 ? 984  THR A CG2 1 
ATOM 7616 N N   . THR A 1 988  ? 24.233  8.023  16.938  1.00 155.84 ? 985  THR A N   1 
ATOM 7617 C CA  . THR A 1 988  ? 22.994  8.607  17.458  1.00 155.84 ? 985  THR A CA  1 
ATOM 7618 C C   . THR A 1 988  ? 22.641  8.176  18.882  1.00 155.84 ? 985  THR A C   1 
ATOM 7619 O O   . THR A 1 988  ? 21.618  7.528  19.115  1.00 155.84 ? 985  THR A O   1 
ATOM 7620 C CB  . THR A 1 988  ? 21.800  8.314  16.507  1.00 128.00 ? 985  THR A CB  1 
ATOM 7621 O OG1 . THR A 1 988  ? 21.160  7.090  16.885  1.00 128.00 ? 985  THR A OG1 1 
ATOM 7622 C CG2 . THR A 1 988  ? 22.269  8.207  15.057  1.00 128.00 ? 985  THR A CG2 1 
ATOM 7623 N N   . ASP A 1 989  ? 23.486  8.565  19.831  1.00 143.81 ? 986  ASP A N   1 
ATOM 7624 C CA  . ASP A 1 989  ? 23.278  8.240  21.233  1.00 143.81 ? 986  ASP A CA  1 
ATOM 7625 C C   . ASP A 1 989  ? 23.924  9.260  22.146  1.00 143.81 ? 986  ASP A C   1 
ATOM 7626 O O   . ASP A 1 989  ? 23.454  9.493  23.279  1.00 143.81 ? 986  ASP A O   1 
ATOM 7627 C CB  . ASP A 1 989  ? 23.833  6.851  21.545  1.00 98.85  ? 986  ASP A CB  1 
ATOM 7628 C CG  . ASP A 1 989  ? 22.744  5.850  21.857  1.00 98.85  ? 986  ASP A CG  1 
ATOM 7629 O OD1 . ASP A 1 989  ? 21.621  5.981  21.325  1.00 98.85  ? 986  ASP A OD1 1 
ATOM 7630 O OD2 . ASP A 1 989  ? 23.018  4.932  22.654  1.00 98.85  ? 986  ASP A OD2 1 
ATOM 7631 N N   . GLU A 1 990  ? 25.005  9.868  21.646  1.00 73.40  ? 987  GLU A N   1 
ATOM 7632 C CA  . GLU A 1 990  ? 25.694  10.886 22.405  1.00 73.40  ? 987  GLU A CA  1 
ATOM 7633 C C   . GLU A 1 990  ? 25.623  12.207 21.641  1.00 73.40  ? 987  GLU A C   1 
ATOM 7634 O O   . GLU A 1 990  ? 25.187  13.224 22.177  1.00 73.40  ? 987  GLU A O   1 
ATOM 7635 C CB  . GLU A 1 990  ? 27.145  10.470 22.657  1.00 183.63 ? 987  GLU A CB  1 
ATOM 7636 C CG  . GLU A 1 990  ? 27.760  11.070 23.919  1.00 183.63 ? 987  GLU A CG  1 
ATOM 7637 C CD  . GLU A 1 990  ? 27.236  10.439 25.199  1.00 183.63 ? 987  GLU A CD  1 
ATOM 7638 O OE1 . GLU A 1 990  ? 26.813  9.263  25.165  1.00 183.63 ? 987  GLU A OE1 1 
ATOM 7639 O OE2 . GLU A 1 990  ? 27.252  11.123 26.244  1.00 183.63 ? 987  GLU A OE2 1 
ATOM 7640 N N   . GLU A 1 991  ? 26.044  12.178 20.381  1.00 97.13  ? 988  GLU A N   1 
ATOM 7641 C CA  . GLU A 1 991  ? 25.897  13.325 19.502  1.00 97.13  ? 988  GLU A CA  1 
ATOM 7642 C C   . GLU A 1 991  ? 24.425  13.682 19.377  1.00 97.13  ? 988  GLU A C   1 
ATOM 7643 O O   . GLU A 1 991  ? 24.079  14.847 19.248  1.00 97.13  ? 988  GLU A O   1 
ATOM 7644 C CB  . GLU A 1 991  ? 26.504  13.028 18.132  1.00 105.10 ? 988  GLU A CB  1 
ATOM 7645 C CG  . GLU A 1 991  ? 28.021  13.206 18.083  1.00 105.10 ? 988  GLU A CG  1 
ATOM 7646 C CD  . GLU A 1 991  ? 28.660  12.510 16.895  1.00 105.10 ? 988  GLU A CD  1 
ATOM 7647 O OE1 . GLU A 1 991  ? 28.270  12.791 15.738  1.00 105.10 ? 988  GLU A OE1 1 
ATOM 7648 O OE2 . GLU A 1 991  ? 29.560  11.677 17.126  1.00 105.10 ? 988  GLU A OE2 1 
ATOM 7649 N N   . ARG A 1 992  ? 23.573  12.661 19.440  1.00 97.37  ? 989  ARG A N   1 
ATOM 7650 C CA  . ARG A 1 992  ? 22.120  12.818 19.408  1.00 97.37  ? 989  ARG A CA  1 
ATOM 7651 C C   . ARG A 1 992  ? 21.593  13.412 20.712  1.00 97.37  ? 989  ARG A C   1 
ATOM 7652 O O   . ARG A 1 992  ? 20.651  14.204 20.715  1.00 97.37  ? 989  ARG A O   1 
ATOM 7653 C CB  . ARG A 1 992  ? 21.465  11.455 19.164  1.00 147.65 ? 989  ARG A CB  1 
ATOM 7654 C CG  . ARG A 1 992  ? 19.995  11.500 18.790  1.00 147.65 ? 989  ARG A CG  1 
ATOM 7655 C CD  . ARG A 1 992  ? 19.790  12.182 17.449  1.00 147.65 ? 989  ARG A CD  1 
ATOM 7656 N NE  . ARG A 1 992  ? 20.323  11.396 16.337  1.00 147.65 ? 989  ARG A NE  1 
ATOM 7657 C CZ  . ARG A 1 992  ? 20.327  11.795 15.066  1.00 147.65 ? 989  ARG A CZ  1 
ATOM 7658 N NH1 . ARG A 1 992  ? 19.833  12.984 14.729  1.00 147.65 ? 989  ARG A NH1 1 
ATOM 7659 N NH2 . ARG A 1 992  ? 20.828  11.006 14.127  1.00 147.65 ? 989  ARG A NH2 1 
ATOM 7660 N N   . GLN A 1 993  ? 22.215  13.011 21.815  1.00 82.58  ? 990  GLN A N   1 
ATOM 7661 C CA  . GLN A 1 993  ? 21.799  13.392 23.155  1.00 82.58  ? 990  GLN A CA  1 
ATOM 7662 C C   . GLN A 1 993  ? 22.174  14.845 23.437  1.00 82.58  ? 990  GLN A C   1 
ATOM 7663 O O   . GLN A 1 993  ? 21.879  15.376 24.515  1.00 82.58  ? 990  GLN A O   1 
ATOM 7664 C CB  . GLN A 1 993  ? 22.473  12.460 24.176  1.00 123.04 ? 990  GLN A CB  1 
ATOM 7665 C CG  . GLN A 1 993  ? 21.887  12.480 25.588  1.00 123.04 ? 990  GLN A CG  1 
ATOM 7666 C CD  . GLN A 1 993  ? 20.676  11.578 25.741  1.00 123.04 ? 990  GLN A CD  1 
ATOM 7667 O OE1 . GLN A 1 993  ? 19.584  12.035 26.084  1.00 123.04 ? 990  GLN A OE1 1 
ATOM 7668 N NE2 . GLN A 1 993  ? 20.863  10.290 25.488  1.00 123.04 ? 990  GLN A NE2 1 
ATOM 7669 N N   . HIS A 1 994  ? 22.841  15.480 22.475  1.00 77.52  ? 991  HIS A N   1 
ATOM 7670 C CA  . HIS A 1 994  ? 23.389  16.825 22.668  1.00 77.52  ? 991  HIS A CA  1 
ATOM 7671 C C   . HIS A 1 994  ? 22.797  17.754 21.621  1.00 77.52  ? 991  HIS A C   1 
ATOM 7672 O O   . HIS A 1 994  ? 22.514  17.338 20.492  1.00 77.52  ? 991  HIS A O   1 
ATOM 7673 C CB  . HIS A 1 994  ? 24.930  16.803 22.620  1.00 94.12  ? 991  HIS A CB  1 
ATOM 7674 C CG  . HIS A 1 994  ? 25.572  16.054 23.763  1.00 94.12  ? 991  HIS A CG  1 
ATOM 7675 N ND1 . HIS A 1 994  ? 26.757  16.454 24.346  1.00 94.12  ? 991  HIS A ND1 1 
ATOM 7676 C CD2 . HIS A 1 994  ? 25.192  14.936 24.434  1.00 94.12  ? 991  HIS A CD2 1 
ATOM 7677 C CE1 . HIS A 1 994  ? 27.078  15.620 25.321  1.00 94.12  ? 991  HIS A CE1 1 
ATOM 7678 N NE2 . HIS A 1 994  ? 26.145  14.689 25.395  1.00 94.12  ? 991  HIS A NE2 1 
ATOM 7679 N N   . LEU A 1 995  ? 22.536  19.000 22.004  1.00 62.80  ? 992  LEU A N   1 
ATOM 7680 C CA  . LEU A 1 995  ? 22.057  19.973 21.009  1.00 62.80  ? 992  LEU A CA  1 
ATOM 7681 C C   . LEU A 1 995  ? 22.912  21.212 20.976  1.00 62.80  ? 992  LEU A C   1 
ATOM 7682 O O   . LEU A 1 995  ? 23.321  21.729 21.994  1.00 62.80  ? 992  LEU A O   1 
ATOM 7683 C CB  . LEU A 1 995  ? 20.535  20.282 21.083  1.00 52.02  ? 992  LEU A CB  1 
ATOM 7684 C CG  . LEU A 1 995  ? 19.667  20.382 22.342  1.00 52.02  ? 992  LEU A CG  1 
ATOM 7685 C CD1 . LEU A 1 995  ? 20.158  21.453 23.263  1.00 52.02  ? 992  LEU A CD1 1 
ATOM 7686 C CD2 . LEU A 1 995  ? 18.242  20.677 21.915  1.00 52.02  ? 992  LEU A CD2 1 
ATOM 7687 N N   . GLN A 1 996  ? 23.198  21.673 19.780  1.00 43.97  ? 993  GLN A N   1 
ATOM 7688 C CA  . GLN A 1 996  ? 24.212  22.671 19.639  1.00 43.97  ? 993  GLN A CA  1 
ATOM 7689 C C   . GLN A 1 996  ? 23.672  24.091 19.545  1.00 43.97  ? 993  GLN A C   1 
ATOM 7690 O O   . GLN A 1 996  ? 22.609  24.345 18.919  1.00 43.97  ? 993  GLN A O   1 
ATOM 7691 C CB  . GLN A 1 996  ? 25.121  22.346 18.444  1.00 132.97 ? 993  GLN A CB  1 
ATOM 7692 C CG  . GLN A 1 996  ? 26.203  21.301 18.745  1.00 132.97 ? 993  GLN A CG  1 
ATOM 7693 C CD  . GLN A 1 996  ? 25.627  19.951 19.124  1.00 132.97 ? 993  GLN A CD  1 
ATOM 7694 O OE1 . GLN A 1 996  ? 24.673  19.485 18.506  1.00 132.97 ? 993  GLN A OE1 1 
ATOM 7695 N NE2 . GLN A 1 996  ? 26.197  19.322 20.148  1.00 132.97 ? 993  GLN A NE2 1 
ATOM 7696 N N   . GLU A 1 997  ? 24.435  25.003 20.160  1.00 57.27  ? 994  GLU A N   1 
ATOM 7697 C CA  . GLU A 1 997  ? 24.191  26.436 20.074  1.00 57.27  ? 994  GLU A CA  1 
ATOM 7698 C C   . GLU A 1 997  ? 24.507  26.937 18.668  1.00 57.27  ? 994  GLU A C   1 
ATOM 7699 O O   . GLU A 1 997  ? 25.639  27.324 18.373  1.00 57.27  ? 994  GLU A O   1 
ATOM 7700 C CB  . GLU A 1 997  ? 24.990  27.186 21.141  1.00 48.91  ? 994  GLU A CB  1 
ATOM 7701 C CG  . GLU A 1 997  ? 24.827  26.558 22.508  1.00 48.91  ? 994  GLU A CG  1 
ATOM 7702 C CD  . GLU A 1 997  ? 24.704  27.555 23.649  1.00 48.91  ? 994  GLU A CD  1 
ATOM 7703 O OE1 . GLU A 1 997  ? 25.302  28.647 23.517  1.00 48.91  ? 994  GLU A OE1 1 
ATOM 7704 O OE2 . GLU A 1 997  ? 24.028  27.247 24.672  1.00 48.91  ? 994  GLU A OE2 1 
ATOM 7705 N N   . VAL A 1 998  ? 23.499  26.937 17.799  1.00 36.94  ? 995  VAL A N   1 
ATOM 7706 C CA  . VAL A 1 998  ? 23.730  27.283 16.405  1.00 36.94  ? 995  VAL A CA  1 
ATOM 7707 C C   . VAL A 1 998  ? 23.494  28.740 16.143  1.00 36.94  ? 995  VAL A C   1 
ATOM 7708 O O   . VAL A 1 998  ? 23.459  29.140 14.977  1.00 36.94  ? 995  VAL A O   1 
ATOM 7709 C CB  . VAL A 1 998  ? 22.850  26.455 15.420  1.00 25.23  ? 995  VAL A CB  1 
ATOM 7710 C CG1 . VAL A 1 998  ? 23.248  24.955 15.444  1.00 25.23  ? 995  VAL A CG1 1 
ATOM 7711 C CG2 . VAL A 1 998  ? 21.393  26.616 15.747  1.00 25.23  ? 995  VAL A CG2 1 
ATOM 7712 N N   . GLY A 1 999  ? 23.307  29.515 17.212  1.00 36.78  ? 996  GLY A N   1 
ATOM 7713 C CA  . GLY A 1 999  ? 23.094  30.968 17.122  1.00 36.78  ? 996  GLY A CA  1 
ATOM 7714 C C   . GLY A 1 999  ? 23.298  31.677 18.451  1.00 36.78  ? 996  GLY A C   1 
ATOM 7715 O O   . GLY A 1 999  ? 22.849  31.210 19.488  1.00 36.78  ? 996  GLY A O   1 
ATOM 7716 N N   . LEU A 1 1000 ? 23.998  32.800 18.424  1.00 38.74  ? 997  LEU A N   1 
ATOM 7717 C CA  . LEU A 1 1000 ? 24.329  33.526 19.641  1.00 38.74  ? 997  LEU A CA  1 
ATOM 7718 C C   . LEU A 1 1000 ? 24.294  34.993 19.265  1.00 38.74  ? 997  LEU A C   1 
ATOM 7719 O O   . LEU A 1 1000 ? 24.518  35.323 18.089  1.00 38.74  ? 997  LEU A O   1 
ATOM 7720 C CB  . LEU A 1 1000 ? 25.736  33.176 20.123  1.00 21.60  ? 997  LEU A CB  1 
ATOM 7721 C CG  . LEU A 1 1000 ? 26.219  31.725 20.226  1.00 21.60  ? 997  LEU A CG  1 
ATOM 7722 C CD1 . LEU A 1 1000 ? 27.720  31.730 20.323  1.00 21.60  ? 997  LEU A CD1 1 
ATOM 7723 C CD2 . LEU A 1 1000 ? 25.629  31.020 21.465  1.00 21.60  ? 997  LEU A CD2 1 
ATOM 7724 N N   . PHE A 1 1001 ? 24.036  35.869 20.240  1.00 39.04  ? 998  PHE A N   1 
ATOM 7725 C CA  . PHE A 1 1001 ? 23.765  37.273 19.940  1.00 39.04  ? 998  PHE A CA  1 
ATOM 7726 C C   . PHE A 1 1001 ? 23.485  38.059 21.215  1.00 39.04  ? 998  PHE A C   1 
ATOM 7727 O O   . PHE A 1 1001 ? 22.584  37.709 21.989  1.00 39.04  ? 998  PHE A O   1 
ATOM 7728 C CB  . PHE A 1 1001 ? 22.566  37.340 19.007  1.00 37.20  ? 998  PHE A CB  1 
ATOM 7729 C CG  . PHE A 1 1001 ? 22.141  38.724 18.650  1.00 37.20  ? 998  PHE A CG  1 
ATOM 7730 C CD1 . PHE A 1 1001 ? 22.524  39.290 17.454  1.00 37.20  ? 998  PHE A CD1 1 
ATOM 7731 C CD2 . PHE A 1 1001 ? 21.332  39.464 19.500  1.00 37.20  ? 998  PHE A CD2 1 
ATOM 7732 C CE1 . PHE A 1 1001 ? 22.120  40.583 17.122  1.00 37.20  ? 998  PHE A CE1 1 
ATOM 7733 C CE2 . PHE A 1 1001 ? 20.923  40.747 19.160  1.00 37.20  ? 998  PHE A CE2 1 
ATOM 7734 C CZ  . PHE A 1 1001 ? 21.311  41.298 17.977  1.00 37.20  ? 998  PHE A CZ  1 
ATOM 7735 N N   . HIS A 1 1002 ? 24.236  39.131 21.453  1.00 23.94  ? 999  HIS A N   1 
ATOM 7736 C CA  . HIS A 1 1002 ? 23.959  39.921 22.659  1.00 23.94  ? 999  HIS A CA  1 
ATOM 7737 C C   . HIS A 1 1002 ? 22.839  40.924 22.355  1.00 23.94  ? 999  HIS A C   1 
ATOM 7738 O O   . HIS A 1 1002 ? 23.013  41.817 21.522  1.00 23.94  ? 999  HIS A O   1 
ATOM 7739 C CB  . HIS A 1 1002 ? 25.197  40.652 23.079  1.00 36.77  ? 999  HIS A CB  1 
ATOM 7740 C CG  . HIS A 1 1002 ? 25.078  41.352 24.395  1.00 36.77  ? 999  HIS A CG  1 
ATOM 7741 N ND1 . HIS A 1 1002 ? 25.274  40.706 25.599  1.00 36.77  ? 999  HIS A ND1 1 
ATOM 7742 C CD2 . HIS A 1 1002 ? 24.886  42.662 24.690  1.00 36.77  ? 999  HIS A CD2 1 
ATOM 7743 C CE1 . HIS A 1 1002 ? 25.184  41.586 26.579  1.00 36.77  ? 999  HIS A CE1 1 
ATOM 7744 N NE2 . HIS A 1 1002 ? 24.965  42.783 26.055  1.00 36.77  ? 999  HIS A NE2 1 
ATOM 7745 N N   . LEU A 1 1003 ? 21.687  40.751 23.007  1.00 42.23  ? 1000 LEU A N   1 
ATOM 7746 C CA  . LEU A 1 1003 ? 20.530  41.654 22.822  1.00 42.23  ? 1000 LEU A CA  1 
ATOM 7747 C C   . LEU A 1 1003 ? 20.671  42.964 23.573  1.00 42.23  ? 1000 LEU A C   1 
ATOM 7748 O O   . LEU A 1 1003 ? 20.431  44.014 23.014  1.00 42.23  ? 1000 LEU A O   1 
ATOM 7749 C CB  . LEU A 1 1003 ? 19.258  40.981 23.308  1.00 20.43  ? 1000 LEU A CB  1 
ATOM 7750 C CG  . LEU A 1 1003 ? 17.926  41.116 22.583  1.00 20.43  ? 1000 LEU A CG  1 
ATOM 7751 C CD1 . LEU A 1 1003 ? 16.859  41.213 23.688  1.00 20.43  ? 1000 LEU A CD1 1 
ATOM 7752 C CD2 . LEU A 1 1003 ? 17.858  42.311 21.678  1.00 20.43  ? 1000 LEU A CD2 1 
ATOM 7753 N N   . GLY A 1 1004 ? 21.064  42.889 24.844  1.00 29.54  ? 1001 GLY A N   1 
ATOM 7754 C CA  . GLY A 1 1004 ? 21.251  44.062 25.669  1.00 29.54  ? 1001 GLY A CA  1 
ATOM 7755 C C   . GLY A 1 1004 ? 20.016  44.299 26.527  1.00 29.54  ? 1001 GLY A C   1 
ATOM 7756 O O   . GLY A 1 1004 ? 19.884  45.353 27.156  1.00 29.54  ? 1001 GLY A O   1 
ATOM 7757 N N   . GLU A 1 1005 ? 19.116  43.326 26.569  1.00 31.43  ? 1002 GLU A N   1 
ATOM 7758 C CA  . GLU A 1 1005 ? 17.916  43.432 27.386  1.00 31.43  ? 1002 GLU A CA  1 
ATOM 7759 C C   . GLU A 1 1005 ? 17.657  42.164 28.151  1.00 31.43  ? 1002 GLU A C   1 
ATOM 7760 O O   . GLU A 1 1005 ? 18.020  41.107 27.703  1.00 31.43  ? 1002 GLU A O   1 
ATOM 7761 C CB  . GLU A 1 1005 ? 16.692  43.709 26.525  1.00 33.27  ? 1002 GLU A CB  1 
ATOM 7762 C CG  . GLU A 1 1005 ? 16.708  45.040 25.857  1.00 33.27  ? 1002 GLU A CG  1 
ATOM 7763 C CD  . GLU A 1 1005 ? 16.475  46.189 26.790  1.00 33.27  ? 1002 GLU A CD  1 
ATOM 7764 O OE1 . GLU A 1 1005 ? 16.490  47.295 26.263  1.00 33.27  ? 1002 GLU A OE1 1 
ATOM 7765 O OE2 . GLU A 1 1005 ? 16.274  46.020 28.017  1.00 33.27  ? 1002 GLU A OE2 1 
ATOM 7766 N N   . PHE A 1 1006 ? 16.998  42.258 29.288  1.00 21.83  ? 1003 PHE A N   1 
ATOM 7767 C CA  . PHE A 1 1006 ? 16.590  41.064 30.001  1.00 21.83  ? 1003 PHE A CA  1 
ATOM 7768 C C   . PHE A 1 1006 ? 15.185  40.610 29.542  1.00 21.83  ? 1003 PHE A C   1 
ATOM 7769 O O   . PHE A 1 1006 ? 14.186  41.376 29.675  1.00 21.83  ? 1003 PHE A O   1 
ATOM 7770 C CB  . PHE A 1 1006 ? 16.590  41.354 31.479  1.00 20.78  ? 1003 PHE A CB  1 
ATOM 7771 C CG  . PHE A 1 1006 ? 16.515  40.139 32.322  1.00 20.78  ? 1003 PHE A CG  1 
ATOM 7772 C CD1 . PHE A 1 1006 ? 17.670  39.558 32.832  1.00 20.78  ? 1003 PHE A CD1 1 
ATOM 7773 C CD2 . PHE A 1 1006 ? 15.284  39.549 32.614  1.00 20.78  ? 1003 PHE A CD2 1 
ATOM 7774 C CE1 . PHE A 1 1006 ? 17.573  38.406 33.636  1.00 20.78  ? 1003 PHE A CE1 1 
ATOM 7775 C CE2 . PHE A 1 1006 ? 15.191  38.454 33.441  1.00 20.78  ? 1003 PHE A CE2 1 
ATOM 7776 C CZ  . PHE A 1 1006 ? 16.318  37.875 33.943  1.00 20.78  ? 1003 PHE A CZ  1 
ATOM 7777 N N   . VAL A 1 1007 ? 15.091  39.414 28.970  1.00 22.94  ? 1004 VAL A N   1 
ATOM 7778 C CA  . VAL A 1 1007 ? 13.801  38.961 28.420  1.00 22.94  ? 1004 VAL A CA  1 
ATOM 7779 C C   . VAL A 1 1007 ? 12.879  38.215 29.454  1.00 22.94  ? 1004 VAL A C   1 
ATOM 7780 O O   . VAL A 1 1007 ? 13.269  37.181 29.988  1.00 22.94  ? 1004 VAL A O   1 
ATOM 7781 C CB  . VAL A 1 1007 ? 13.989  38.162 27.121  1.00 14.05  ? 1004 VAL A CB  1 
ATOM 7782 C CG1 . VAL A 1 1007 ? 12.649  37.804 26.599  1.00 14.05  ? 1004 VAL A CG1 1 
ATOM 7783 C CG2 . VAL A 1 1007 ? 14.673  39.020 26.046  1.00 14.05  ? 1004 VAL A CG2 1 
ATOM 7784 N N   . ASN A 1 1008 ? 11.698  38.733 29.779  1.00 19.41  ? 1005 ASN A N   1 
ATOM 7785 C CA  . ASN A 1 1008 ? 10.794  37.989 30.667  1.00 19.41  ? 1005 ASN A CA  1 
ATOM 7786 C C   . ASN A 1 1008 ? 9.844   37.060 29.893  1.00 19.41  ? 1005 ASN A C   1 
ATOM 7787 O O   . ASN A 1 1008 ? 9.500   36.026 30.410  1.00 19.41  ? 1005 ASN A O   1 
ATOM 7788 C CB  . ASN A 1 1008 ? 9.976   38.914 31.539  1.00 17.66  ? 1005 ASN A CB  1 
ATOM 7789 C CG  . ASN A 1 1008 ? 10.795  39.548 32.609  1.00 17.66  ? 1005 ASN A CG  1 
ATOM 7790 O OD1 . ASN A 1 1008 ? 11.665  38.871 33.166  1.00 17.66  ? 1005 ASN A OD1 1 
ATOM 7791 N ND2 . ASN A 1 1008 ? 10.511  40.836 32.964  1.00 17.66  ? 1005 ASN A ND2 1 
ATOM 7792 N N   . VAL A 1 1009 ? 9.451   37.384 28.661  1.00 20.56  ? 1006 VAL A N   1 
ATOM 7793 C CA  . VAL A 1 1009 ? 8.439   36.588 28.026  1.00 20.56  ? 1006 VAL A CA  1 
ATOM 7794 C C   . VAL A 1 1009 ? 8.602   36.500 26.526  1.00 20.56  ? 1006 VAL A C   1 
ATOM 7795 O O   . VAL A 1 1009 ? 8.751   37.502 25.843  1.00 20.56  ? 1006 VAL A O   1 
ATOM 7796 C CB  . VAL A 1 1009 ? 6.979   37.101 28.363  1.00 20.97  ? 1006 VAL A CB  1 
ATOM 7797 C CG1 . VAL A 1 1009 ? 6.839   38.621 28.163  1.00 20.97  ? 1006 VAL A CG1 1 
ATOM 7798 C CG2 . VAL A 1 1009 ? 5.889   36.389 27.513  1.00 20.97  ? 1006 VAL A CG2 1 
ATOM 7799 N N   . PHE A 1 1010 ? 8.525   35.294 26.002  1.00 31.08  ? 1007 PHE A N   1 
ATOM 7800 C CA  . PHE A 1 1010 ? 8.394   35.128 24.569  1.00 31.08  ? 1007 PHE A CA  1 
ATOM 7801 C C   . PHE A 1 1010 ? 6.977   34.665 24.352  1.00 31.08  ? 1007 PHE A C   1 
ATOM 7802 O O   . PHE A 1 1010 ? 6.426   33.914 25.166  1.00 31.08  ? 1007 PHE A O   1 
ATOM 7803 C CB  . PHE A 1 1010 ? 9.316   33.985 24.049  1.00 20.33  ? 1007 PHE A CB  1 
ATOM 7804 C CG  . PHE A 1 1010 ? 10.766  34.312 24.044  1.00 20.33  ? 1007 PHE A CG  1 
ATOM 7805 C CD1 . PHE A 1 1010 ? 11.630  33.643 24.902  1.00 20.33  ? 1007 PHE A CD1 1 
ATOM 7806 C CD2 . PHE A 1 1010 ? 11.269  35.295 23.180  1.00 20.33  ? 1007 PHE A CD2 1 
ATOM 7807 C CE1 . PHE A 1 1010 ? 13.016  33.931 24.893  1.00 20.33  ? 1007 PHE A CE1 1 
ATOM 7808 C CE2 . PHE A 1 1010 ? 12.661  35.625 23.163  1.00 20.33  ? 1007 PHE A CE2 1 
ATOM 7809 C CZ  . PHE A 1 1010 ? 13.537  34.935 24.001  1.00 20.33  ? 1007 PHE A CZ  1 
ATOM 7810 N N   . CYS A 1 1011 ? 6.392   35.085 23.242  1.00 42.16  ? 1008 CYS A N   1 
ATOM 7811 C CA  . CYS A 1 1011 ? 5.181   34.443 22.787  1.00 42.16  ? 1008 CYS A CA  1 
ATOM 7812 C C   . CYS A 1 1011 ? 5.015   34.655 21.317  1.00 42.16  ? 1008 CYS A C   1 
ATOM 7813 O O   . CYS A 1 1011 ? 5.389   35.686 20.793  1.00 42.16  ? 1008 CYS A O   1 
ATOM 7814 C CB  . CYS A 1 1011 ? 3.970   34.924 23.549  1.00 48.48  ? 1008 CYS A CB  1 
ATOM 7815 S SG  . CYS A 1 1011 ? 3.576   36.545 23.163  1.00 48.48  ? 1008 CYS A SG  1 
ATOM 7816 N N   . HIS A 1 1012 ? 4.509   33.626 20.650  1.00 44.08  ? 1009 HIS A N   1 
ATOM 7817 C CA  . HIS A 1 1012 ? 4.208   33.708 19.241  1.00 44.08  ? 1009 HIS A CA  1 
ATOM 7818 C C   . HIS A 1 1012 ? 3.043   34.645 19.100  1.00 44.08  ? 1009 HIS A C   1 
ATOM 7819 O O   . HIS A 1 1012 ? 2.115   34.592 19.904  1.00 44.08  ? 1009 HIS A O   1 
ATOM 7820 C CB  . HIS A 1 1012 ? 3.826   32.328 18.720  1.00 37.10  ? 1009 HIS A CB  1 
ATOM 7821 C CG  . HIS A 1 1012 ? 4.949   31.359 18.764  1.00 37.10  ? 1009 HIS A CG  1 
ATOM 7822 N ND1 . HIS A 1 1012 ? 5.705   31.049 17.648  1.00 37.10  ? 1009 HIS A ND1 1 
ATOM 7823 C CD2 . HIS A 1 1012 ? 5.500   30.682 19.807  1.00 37.10  ? 1009 HIS A CD2 1 
ATOM 7824 C CE1 . HIS A 1 1012 ? 6.653   30.190 17.996  1.00 37.10  ? 1009 HIS A CE1 1 
ATOM 7825 N NE2 . HIS A 1 1012 ? 6.555   29.954 19.300  1.00 37.10  ? 1009 HIS A NE2 1 
ATOM 7826 N N   . GLY A 1 1013 ? 3.114   35.500 18.087  1.00 28.34  ? 1010 GLY A N   1 
ATOM 7827 C CA  . GLY A 1 1013 ? 2.076   36.469 17.759  1.00 28.34  ? 1010 GLY A CA  1 
ATOM 7828 C C   . GLY A 1 1013 ? 2.691   37.559 16.890  1.00 28.34  ? 1010 GLY A C   1 
ATOM 7829 O O   . GLY A 1 1013 ? 3.875   37.529 16.579  1.00 28.34  ? 1010 GLY A O   1 
ATOM 7830 N N   . SER A 1 1014 ? 1.884   38.521 16.470  1.00 48.23  ? 1011 SER A N   1 
ATOM 7831 C CA  . SER A 1 1014 ? 2.393   39.656 15.719  1.00 48.23  ? 1011 SER A CA  1 
ATOM 7832 C C   . SER A 1 1014 ? 1.448   40.801 15.927  1.00 48.23  ? 1011 SER A C   1 
ATOM 7833 O O   . SER A 1 1014 ? 0.259   40.587 16.137  1.00 48.23  ? 1011 SER A O   1 
ATOM 7834 C CB  . SER A 1 1014 ? 2.489   39.339 14.230  1.00 36.88  ? 1011 SER A CB  1 
ATOM 7835 O OG  . SER A 1 1014 ? 2.353   40.522 13.451  1.00 36.88  ? 1011 SER A OG  1 
ATOM 7836 N N   . LEU A 1 1015 ? 1.921   42.004 15.712  1.00 32.51  ? 1012 LEU A N   1 
ATOM 7837 C CA  . LEU A 1 1015 ? 1.089   43.148 15.908  1.00 32.51  ? 1012 LEU A CA  1 
ATOM 7838 C C   . LEU A 1 1015 ? 0.545   43.736 14.650  1.00 32.51  ? 1012 LEU A C   1 
ATOM 7839 O O   . LEU A 1 1015 ? -0.089  44.745 14.683  1.00 32.51  ? 1012 LEU A O   1 
ATOM 7840 C CB  . LEU A 1 1015 ? 1.882   44.197 16.631  1.00 60.92  ? 1012 LEU A CB  1 
ATOM 7841 C CG  . LEU A 1 1015 ? 2.198   43.868 18.071  1.00 60.92  ? 1012 LEU A CG  1 
ATOM 7842 C CD1 . LEU A 1 1015 ? 2.971   44.963 18.678  1.00 60.92  ? 1012 LEU A CD1 1 
ATOM 7843 C CD2 . LEU A 1 1015 ? 0.957   43.687 18.811  1.00 60.92  ? 1012 LEU A CD2 1 
ATOM 7844 N N   . VAL A 1 1016 ? 0.768   43.097 13.505  1.00 60.33  ? 1013 VAL A N   1 
ATOM 7845 C CA  . VAL A 1 1016 ? 0.534   43.763 12.214  1.00 60.33  ? 1013 VAL A CA  1 
ATOM 7846 C C   . VAL A 1 1016 ? -0.799  43.595 11.452  1.00 60.33  ? 1013 VAL A C   1 
ATOM 7847 O O   . VAL A 1 1016 ? -1.816  44.206 11.784  1.00 60.33  ? 1013 VAL A O   1 
ATOM 7848 C CB  . VAL A 1 1016 ? 1.681   43.446 11.224  1.00 56.49  ? 1013 VAL A CB  1 
ATOM 7849 C CG1 . VAL A 1 1016 ? 2.571   44.665 11.036  1.00 56.49  ? 1013 VAL A CG1 1 
ATOM 7850 C CG2 . VAL A 1 1016 ? 2.491   42.255 11.714  1.00 56.49  ? 1013 VAL A CG2 1 
ATOM 7851 N N   . MET A 1 1017 ? -0.680  42.718 10.454  1.00 78.76  ? 1014 MET A N   1 
ATOM 7852 C CA  . MET A 1 1017 ? -1.492  42.603 9.252   1.00 78.76  ? 1014 MET A CA  1 
ATOM 7853 C C   . MET A 1 1017 ? -2.984  42.702 9.447   1.00 78.76  ? 1014 MET A C   1 
ATOM 7854 O O   . MET A 1 1017 ? -3.461  43.268 10.431  1.00 78.76  ? 1014 MET A O   1 
ATOM 7855 C CB  . MET A 1 1017 ? -1.157  41.301 8.516   1.00 110.99 ? 1014 MET A CB  1 
ATOM 7856 C CG  . MET A 1 1017 ? -1.936  40.092 9.008   1.00 110.99 ? 1014 MET A CG  1 
ATOM 7857 S SD  . MET A 1 1017 ? -1.688  38.636 7.974   1.00 110.99 ? 1014 MET A SD  1 
ATOM 7858 C CE  . MET A 1 1017 ? -2.585  37.400 8.909   1.00 110.99 ? 1014 MET A CE  1 
ATOM 7859 N N   . GLN A 1 1018 ? -3.725  42.156 8.489   1.00 81.46  ? 1015 GLN A N   1 
ATOM 7860 C CA  . GLN A 1 1018 ? -5.180  42.348 8.521   1.00 81.46  ? 1015 GLN A CA  1 
ATOM 7861 C C   . GLN A 1 1018 ? -5.714  42.538 9.944   1.00 81.46  ? 1015 GLN A C   1 
ATOM 7862 O O   . GLN A 1 1018 ? -6.910  42.747 10.162  1.00 81.46  ? 1015 GLN A O   1 
ATOM 7863 C CB  . GLN A 1 1018 ? -5.904  41.174 7.833   1.00 143.48 ? 1015 GLN A CB  1 
ATOM 7864 C CG  . GLN A 1 1018 ? -5.271  40.636 6.526   1.00 143.48 ? 1015 GLN A CG  1 
ATOM 7865 C CD  . GLN A 1 1018 ? -5.254  41.629 5.371   1.00 143.48 ? 1015 GLN A CD  1 
ATOM 7866 O OE1 . GLN A 1 1018 ? -6.230  42.341 5.118   1.00 143.48 ? 1015 GLN A OE1 1 
ATOM 7867 N NE2 . GLN A 1 1018 ? -4.139  41.662 4.648   1.00 143.48 ? 1015 GLN A NE2 1 
ATOM 7868 N N   . PRO A 1 1026 ? 9.695   36.094 2.586   1.00 85.61  ? 1023 PRO A N   1 
ATOM 7869 C CA  . PRO A 1 1026 ? 10.921  36.763 3.092   1.00 85.61  ? 1023 PRO A CA  1 
ATOM 7870 C C   . PRO A 1 1026 ? 11.318  36.227 4.456   1.00 85.61  ? 1023 PRO A C   1 
ATOM 7871 O O   . PRO A 1 1026 ? 12.482  35.864 4.657   1.00 85.61  ? 1023 PRO A O   1 
ATOM 7872 C CB  . PRO A 1 1026 ? 10.535  38.257 3.198   1.00 49.61  ? 1023 PRO A CB  1 
ATOM 7873 C CG  . PRO A 1 1026 ? 9.204   38.378 2.444   1.00 49.61  ? 1023 PRO A CG  1 
ATOM 7874 C CD  . PRO A 1 1026 ? 8.541   37.003 2.457   1.00 49.61  ? 1023 PRO A CD  1 
ATOM 7875 N N   . THR A 1 1027 ? 10.345  36.174 5.370   1.00 59.34  ? 1024 THR A N   1 
ATOM 7876 C CA  . THR A 1 1027 ? 10.563  35.732 6.755   1.00 59.34  ? 1024 THR A CA  1 
ATOM 7877 C C   . THR A 1 1027 ? 9.526   34.712 7.216   1.00 59.34  ? 1024 THR A C   1 
ATOM 7878 O O   . THR A 1 1027 ? 8.394   34.693 6.727   1.00 59.34  ? 1024 THR A O   1 
ATOM 7879 C CB  . THR A 1 1027 ? 10.548  36.898 7.727   1.00 80.28  ? 1024 THR A CB  1 
ATOM 7880 O OG1 . THR A 1 1027 ? 9.478   37.781 7.376   1.00 80.28  ? 1024 THR A OG1 1 
ATOM 7881 C CG2 . THR A 1 1027 ? 11.875  37.633 7.695   1.00 80.28  ? 1024 THR A CG2 1 
ATOM 7882 N N   . GLN A 1 1028 ? 9.937   33.862 8.152   1.00 49.61  ? 1025 GLN A N   1 
ATOM 7883 C CA  . GLN A 1 1028 ? 9.103   32.795 8.659   1.00 49.61  ? 1025 GLN A CA  1 
ATOM 7884 C C   . GLN A 1 1028 ? 8.945   32.967 10.176  1.00 49.61  ? 1025 GLN A C   1 
ATOM 7885 O O   . GLN A 1 1028 ? 9.898   33.306 10.866  1.00 49.61  ? 1025 GLN A O   1 
ATOM 7886 C CB  . GLN A 1 1028 ? 9.708   31.426 8.319   1.00 189.26 ? 1025 GLN A CB  1 
ATOM 7887 C CG  . GLN A 1 1028 ? 8.711   30.265 8.368   1.00 189.26 ? 1025 GLN A CG  1 
ATOM 7888 C CD  . GLN A 1 1028 ? 9.328   28.925 7.984   1.00 189.26 ? 1025 GLN A CD  1 
ATOM 7889 O OE1 . GLN A 1 1028 ? 10.207  28.405 8.677   1.00 189.26 ? 1025 GLN A OE1 1 
ATOM 7890 N NE2 . GLN A 1 1028 ? 8.855   28.354 6.881   1.00 189.26 ? 1025 GLN A NE2 1 
ATOM 7891 N N   . GLY A 1 1029 ? 7.733   32.736 10.678  1.00 57.15  ? 1026 GLY A N   1 
ATOM 7892 C CA  . GLY A 1 1029 ? 7.417   32.869 12.090  1.00 57.15  ? 1026 GLY A CA  1 
ATOM 7893 C C   . GLY A 1 1029 ? 7.339   34.320 12.504  1.00 57.15  ? 1026 GLY A C   1 
ATOM 7894 O O   . GLY A 1 1029 ? 7.744   35.217 11.755  1.00 57.15  ? 1026 GLY A O   1 
ATOM 7895 N N   . SER A 1 1030 ? 6.801   34.550 13.700  1.00 38.11  ? 1027 SER A N   1 
ATOM 7896 C CA  . SER A 1 1030 ? 6.965   35.830 14.384  1.00 38.11  ? 1027 SER A CA  1 
ATOM 7897 C C   . SER A 1 1030 ? 6.891   35.610 15.889  1.00 38.11  ? 1027 SER A C   1 
ATOM 7898 O O   . SER A 1 1030 ? 5.856   35.199 16.427  1.00 38.11  ? 1027 SER A O   1 
ATOM 7899 C CB  . SER A 1 1030 ? 5.932   36.849 13.883  1.00 41.43  ? 1027 SER A CB  1 
ATOM 7900 O OG  . SER A 1 1030 ? 5.942   38.061 14.617  1.00 41.43  ? 1027 SER A OG  1 
ATOM 7901 N N   . VAL A 1 1031 ? 8.008   35.841 16.569  1.00 35.30  ? 1028 VAL A N   1 
ATOM 7902 C CA  . VAL A 1 1031 ? 8.007   35.685 18.031  1.00 35.30  ? 1028 VAL A CA  1 
ATOM 7903 C C   . VAL A 1 1031 ? 8.259   36.966 18.778  1.00 35.30  ? 1028 VAL A C   1 
ATOM 7904 O O   . VAL A 1 1031 ? 9.258   37.629 18.561  1.00 35.30  ? 1028 VAL A O   1 
ATOM 7905 C CB  . VAL A 1 1031 ? 8.910   34.564 18.542  1.00 15.90  ? 1028 VAL A CB  1 
ATOM 7906 C CG1 . VAL A 1 1031 ? 9.168   34.738 20.031  1.00 15.90  ? 1028 VAL A CG1 1 
ATOM 7907 C CG2 . VAL A 1 1031 ? 8.197   33.243 18.359  1.00 15.90  ? 1028 VAL A CG2 1 
ATOM 7908 N N   . LEU A 1 1032 ? 7.309   37.337 19.623  1.00 40.14  ? 1029 LEU A N   1 
ATOM 7909 C CA  . LEU A 1 1032 ? 7.373   38.632 20.231  1.00 40.14  ? 1029 LEU A CA  1 
ATOM 7910 C C   . LEU A 1 1032 ? 7.990   38.442 21.573  1.00 40.14  ? 1029 LEU A C   1 
ATOM 7911 O O   . LEU A 1 1032 ? 7.801   37.401 22.256  1.00 40.14  ? 1029 LEU A O   1 
ATOM 7912 C CB  . LEU A 1 1032 ? 6.000   39.327 20.344  1.00 25.96  ? 1029 LEU A CB  1 
ATOM 7913 C CG  . LEU A 1 1032 ? 5.418   39.943 19.036  1.00 25.96  ? 1029 LEU A CG  1 
ATOM 7914 C CD1 . LEU A 1 1032 ? 3.876   39.997 18.990  1.00 25.96  ? 1029 LEU A CD1 1 
ATOM 7915 C CD2 . LEU A 1 1032 ? 6.019   41.295 18.687  1.00 25.96  ? 1029 LEU A CD2 1 
ATOM 7916 N N   . PHE A 1 1033 ? 8.784   39.429 21.955  1.00 28.73  ? 1030 PHE A N   1 
ATOM 7917 C CA  . PHE A 1 1033 ? 9.345   39.336 23.272  1.00 28.73  ? 1030 PHE A CA  1 
ATOM 7918 C C   . PHE A 1 1033 ? 9.284   40.585 24.030  1.00 28.73  ? 1030 PHE A C   1 
ATOM 7919 O O   . PHE A 1 1033 ? 9.313   41.713 23.492  1.00 28.73  ? 1030 PHE A O   1 
ATOM 7920 C CB  . PHE A 1 1033 ? 10.747  38.752 23.344  1.00 21.01  ? 1030 PHE A CB  1 
ATOM 7921 C CG  . PHE A 1 1033 ? 11.787  39.567 22.698  1.00 21.01  ? 1030 PHE A CG  1 
ATOM 7922 C CD1 . PHE A 1 1033 ? 12.463  40.540 23.423  1.00 21.01  ? 1030 PHE A CD1 1 
ATOM 7923 C CD2 . PHE A 1 1033 ? 12.157  39.320 21.364  1.00 21.01  ? 1030 PHE A CD2 1 
ATOM 7924 C CE1 . PHE A 1 1033 ? 13.484  41.308 22.805  1.00 21.01  ? 1030 PHE A CE1 1 
ATOM 7925 C CE2 . PHE A 1 1033 ? 13.171  40.087 20.746  1.00 21.01  ? 1030 PHE A CE2 1 
ATOM 7926 C CZ  . PHE A 1 1033 ? 13.833  41.082 21.481  1.00 21.01  ? 1030 PHE A CZ  1 
ATOM 7927 N N   . GLY A 1 1034 ? 9.191   40.364 25.324  1.00 25.44  ? 1031 GLY A N   1 
ATOM 7928 C CA  . GLY A 1 1034 ? 8.874   41.442 26.236  1.00 25.44  ? 1031 GLY A CA  1 
ATOM 7929 C C   . GLY A 1 1034 ? 9.981   41.499 27.279  1.00 25.44  ? 1031 GLY A C   1 
ATOM 7930 O O   . GLY A 1 1034 ? 10.396  40.508 27.956  1.00 25.44  ? 1031 GLY A O   1 
ATOM 7931 N N   . THR A 1 1035 ? 10.501  42.701 27.419  1.00 18.62  ? 1032 THR A N   1 
ATOM 7932 C CA  . THR A 1 1035 ? 11.732  42.852 28.206  1.00 18.62  ? 1032 THR A CA  1 
ATOM 7933 C C   . THR A 1 1035 ? 11.554  43.717 29.468  1.00 18.62  ? 1032 THR A C   1 
ATOM 7934 O O   . THR A 1 1035 ? 10.595  44.430 29.699  1.00 18.62  ? 1032 THR A O   1 
ATOM 7935 C CB  . THR A 1 1035 ? 12.859  43.580 27.494  1.00 25.19  ? 1032 THR A CB  1 
ATOM 7936 O OG1 . THR A 1 1035 ? 12.644  45.031 27.558  1.00 25.19  ? 1032 THR A OG1 1 
ATOM 7937 C CG2 . THR A 1 1035 ? 12.996  43.102 26.000  1.00 25.19  ? 1032 THR A CG2 1 
ATOM 7938 N N   . VAL A 1 1036 ? 12.529  43.678 30.383  1.00 21.59  ? 1033 VAL A N   1 
ATOM 7939 C CA  . VAL A 1 1036 ? 12.417  44.360 31.630  1.00 21.59  ? 1033 VAL A CA  1 
ATOM 7940 C C   . VAL A 1 1036 ? 12.430  45.881 31.537  1.00 21.59  ? 1033 VAL A C   1 
ATOM 7941 O O   . VAL A 1 1036 ? 12.314  46.622 32.542  1.00 21.59  ? 1033 VAL A O   1 
ATOM 7942 C CB  . VAL A 1 1036 ? 13.650  43.991 32.525  1.00 14.06  ? 1033 VAL A CB  1 
ATOM 7943 C CG1 . VAL A 1 1036 ? 13.952  44.928 33.647  1.00 14.06  ? 1033 VAL A CG1 1 
ATOM 7944 C CG2 . VAL A 1 1036 ? 13.567  42.548 33.116  1.00 14.06  ? 1033 VAL A CG2 1 
ATOM 7945 N N   . ASN A 1 1037 ? 12.590  46.396 30.325  1.00 28.35  ? 1034 ASN A N   1 
ATOM 7946 C CA  . ASN A 1 1037 ? 12.989  47.805 30.216  1.00 28.35  ? 1034 ASN A CA  1 
ATOM 7947 C C   . ASN A 1 1037 ? 11.944  48.569 29.480  1.00 28.35  ? 1034 ASN A C   1 
ATOM 7948 O O   . ASN A 1 1037 ? 11.956  49.802 29.422  1.00 28.35  ? 1034 ASN A O   1 
ATOM 7949 C CB  . ASN A 1 1037 ? 14.296  47.881 29.457  1.00 20.00  ? 1034 ASN A CB  1 
ATOM 7950 C CG  . ASN A 1 1037 ? 15.485  48.114 30.352  1.00 20.00  ? 1034 ASN A CG  1 
ATOM 7951 O OD1 . ASN A 1 1037 ? 15.371  48.314 31.556  1.00 20.00  ? 1034 ASN A OD1 1 
ATOM 7952 N ND2 . ASN A 1 1037 ? 16.670  48.092 29.738  1.00 20.00  ? 1034 ASN A ND2 1 
ATOM 7953 N N   . GLY A 1 1038 ? 11.059  47.784 28.876  1.00 36.18  ? 1035 GLY A N   1 
ATOM 7954 C CA  . GLY A 1 1038 ? 9.880   48.271 28.218  1.00 36.18  ? 1035 GLY A CA  1 
ATOM 7955 C C   . GLY A 1 1038 ? 10.092  48.034 26.777  1.00 36.18  ? 1035 GLY A C   1 
ATOM 7956 O O   . GLY A 1 1038 ? 9.229   48.339 25.977  1.00 36.18  ? 1035 GLY A O   1 
ATOM 7957 N N   . MET A 1 1039 ? 11.266  47.506 26.457  1.00 28.71  ? 1036 MET A N   1 
ATOM 7958 C CA  . MET A 1 1039 ? 11.610  47.160 25.104  1.00 28.71  ? 1036 MET A CA  1 
ATOM 7959 C C   . MET A 1 1039 ? 10.747  45.960 24.718  1.00 28.71  ? 1036 MET A C   1 
ATOM 7960 O O   . MET A 1 1039 ? 10.690  44.944 25.433  1.00 28.71  ? 1036 MET A O   1 
ATOM 7961 C CB  . MET A 1 1039 ? 13.111  46.844 25.026  1.00 32.44  ? 1036 MET A CB  1 
ATOM 7962 C CG  . MET A 1 1039 ? 13.673  46.662 23.641  1.00 32.44  ? 1036 MET A CG  1 
ATOM 7963 S SD  . MET A 1 1039 ? 13.634  44.940 23.131  1.00 32.44  ? 1036 MET A SD  1 
ATOM 7964 C CE  . MET A 1 1039 ? 14.224  44.999 21.446  1.00 32.44  ? 1036 MET A CE  1 
ATOM 7965 N N   . ILE A 1 1040 ? 10.054  46.100 23.596  1.00 35.09  ? 1037 ILE A N   1 
ATOM 7966 C CA  . ILE A 1 1040 ? 9.411   44.985 22.940  1.00 35.09  ? 1037 ILE A CA  1 
ATOM 7967 C C   . ILE A 1 1040 ? 10.181  44.703 21.657  1.00 35.09  ? 1037 ILE A C   1 
ATOM 7968 O O   . ILE A 1 1040 ? 10.297  45.585 20.808  1.00 35.09  ? 1037 ILE A O   1 
ATOM 7969 C CB  . ILE A 1 1040 ? 7.957   45.333 22.547  1.00 23.52  ? 1037 ILE A CB  1 
ATOM 7970 C CG1 . ILE A 1 1040 ? 7.114   45.701 23.758  1.00 23.52  ? 1037 ILE A CG1 1 
ATOM 7971 C CG2 . ILE A 1 1040 ? 7.291   44.165 21.737  1.00 23.52  ? 1037 ILE A CG2 1 
ATOM 7972 C CD1 . ILE A 1 1040 ? 5.722   46.140 23.317  1.00 23.52  ? 1037 ILE A CD1 1 
ATOM 7973 N N   . GLY A 1 1041 ? 10.681  43.477 21.509  1.00 59.46  ? 1038 GLY A N   1 
ATOM 7974 C CA  . GLY A 1 1041 ? 11.336  43.050 20.266  1.00 59.46  ? 1038 GLY A CA  1 
ATOM 7975 C C   . GLY A 1 1041 ? 10.592  41.963 19.492  1.00 59.46  ? 1038 GLY A C   1 
ATOM 7976 O O   . GLY A 1 1041 ? 9.487   41.563 19.866  1.00 59.46  ? 1038 GLY A O   1 
ATOM 7977 N N   . LEU A 1 1042 ? 11.218  41.482 18.415  1.00 25.27  ? 1039 LEU A N   1 
ATOM 7978 C CA  . LEU A 1 1042 ? 10.659  40.434 17.520  1.00 25.27  ? 1039 LEU A CA  1 
ATOM 7979 C C   . LEU A 1 1042 ? 11.721  39.470 16.977  1.00 25.27  ? 1039 LEU A C   1 
ATOM 7980 O O   . LEU A 1 1042 ? 12.706  39.911 16.432  1.00 25.27  ? 1039 LEU A O   1 
ATOM 7981 C CB  . LEU A 1 1042 ? 9.974   41.101 16.320  1.00 48.66  ? 1039 LEU A CB  1 
ATOM 7982 C CG  . LEU A 1 1042 ? 9.541   40.244 15.118  1.00 48.66  ? 1039 LEU A CG  1 
ATOM 7983 C CD1 . LEU A 1 1042 ? 8.594   39.133 15.540  1.00 48.66  ? 1039 LEU A CD1 1 
ATOM 7984 C CD2 . LEU A 1 1042 ? 8.865   41.131 14.118  1.00 48.66  ? 1039 LEU A CD2 1 
ATOM 7985 N N   . VAL A 1 1043 ? 11.529  38.165 17.088  1.00 50.04  ? 1040 VAL A N   1 
ATOM 7986 C CA  . VAL A 1 1043 ? 12.473  37.224 16.451  1.00 50.04  ? 1040 VAL A CA  1 
ATOM 7987 C C   . VAL A 1 1043 ? 11.797  36.503 15.287  1.00 50.04  ? 1040 VAL A C   1 
ATOM 7988 O O   . VAL A 1 1043 ? 10.740  35.892 15.470  1.00 50.04  ? 1040 VAL A O   1 
ATOM 7989 C CB  . VAL A 1 1043 ? 13.061  36.185 17.456  1.00 25.05  ? 1040 VAL A CB  1 
ATOM 7990 C CG1 . VAL A 1 1043 ? 13.874  35.128 16.735  1.00 25.05  ? 1040 VAL A CG1 1 
ATOM 7991 C CG2 . VAL A 1 1043 ? 13.927  36.868 18.488  1.00 25.05  ? 1040 VAL A CG2 1 
ATOM 7992 N N   . THR A 1 1044 ? 12.396  36.565 14.097  1.00 57.26  ? 1041 THR A N   1 
ATOM 7993 C CA  . THR A 1 1044 ? 11.877  35.820 12.934  1.00 57.26  ? 1041 THR A CA  1 
ATOM 7994 C C   . THR A 1 1044 ? 12.947  34.926 12.375  1.00 57.26  ? 1041 THR A C   1 
ATOM 7995 O O   . THR A 1 1044 ? 14.115  35.034 12.761  1.00 57.26  ? 1041 THR A O   1 
ATOM 7996 C CB  . THR A 1 1044 ? 11.344  36.758 11.826  1.00 43.27  ? 1041 THR A CB  1 
ATOM 7997 O OG1 . THR A 1 1044 ? 10.387  37.658 12.405  1.00 43.27  ? 1041 THR A OG1 1 
ATOM 7998 C CG2 . THR A 1 1044 ? 10.643  35.984 10.764  1.00 43.27  ? 1041 THR A CG2 1 
ATOM 7999 N N   . SER A 1 1045 ? 12.524  34.043 11.473  1.00 49.20  ? 1042 SER A N   1 
ATOM 8000 C CA  . SER A 1 1045 ? 13.402  33.086 10.793  1.00 49.20  ? 1042 SER A CA  1 
ATOM 8001 C C   . SER A 1 1045 ? 13.671  33.436 9.299   1.00 49.20  ? 1042 SER A C   1 
ATOM 8002 O O   . SER A 1 1045 ? 12.914  34.168 8.662   1.00 49.20  ? 1042 SER A O   1 
ATOM 8003 C CB  . SER A 1 1045 ? 12.875  31.668 10.995  1.00 65.67  ? 1042 SER A CB  1 
ATOM 8004 O OG  . SER A 1 1045 ? 12.854  31.347 12.386  1.00 65.67  ? 1042 SER A OG  1 
ATOM 8005 N N   . LEU A 1 1046 ? 14.778  32.940 8.760   1.00 68.14  ? 1043 LEU A N   1 
ATOM 8006 C CA  . LEU A 1 1046 ? 15.244  33.375 7.458   1.00 68.14  ? 1043 LEU A CA  1 
ATOM 8007 C C   . LEU A 1 1046 ? 15.584  32.200 6.550   1.00 68.14  ? 1043 LEU A C   1 
ATOM 8008 O O   . LEU A 1 1046 ? 15.830  31.089 7.026   1.00 68.14  ? 1043 LEU A O   1 
ATOM 8009 C CB  . LEU A 1 1046 ? 16.488  34.240 7.640   1.00 30.91  ? 1043 LEU A CB  1 
ATOM 8010 C CG  . LEU A 1 1046 ? 16.387  35.710 8.064   1.00 30.91  ? 1043 LEU A CG  1 
ATOM 8011 C CD1 . LEU A 1 1046 ? 17.640  36.105 8.812   1.00 30.91  ? 1043 LEU A CD1 1 
ATOM 8012 C CD2 . LEU A 1 1046 ? 16.169  36.657 6.885   1.00 30.91  ? 1043 LEU A CD2 1 
ATOM 8013 N N   . SER A 1 1047 ? 15.588  32.462 5.243   1.00 66.05  ? 1044 SER A N   1 
ATOM 8014 C CA  . SER A 1 1047 ? 16.271  31.617 4.262   1.00 66.05  ? 1044 SER A CA  1 
ATOM 8015 C C   . SER A 1 1047 ? 17.788  31.857 4.371   1.00 66.05  ? 1044 SER A C   1 
ATOM 8016 O O   . SER A 1 1047 ? 18.228  32.988 4.613   1.00 66.05  ? 1044 SER A O   1 
ATOM 8017 C CB  . SER A 1 1047 ? 15.815  31.976 2.854   1.00 79.59  ? 1044 SER A CB  1 
ATOM 8018 O OG  . SER A 1 1047 ? 16.279  33.268 2.503   1.00 79.59  ? 1044 SER A OG  1 
ATOM 8019 N N   . GLU A 1 1048 ? 18.577  30.792 4.198   1.00 51.76  ? 1045 GLU A N   1 
ATOM 8020 C CA  . GLU A 1 1048 ? 20.056  30.865 4.195   1.00 51.76  ? 1045 GLU A CA  1 
ATOM 8021 C C   . GLU A 1 1048 ? 20.548  31.952 3.263   1.00 51.76  ? 1045 GLU A C   1 
ATOM 8022 O O   . GLU A 1 1048 ? 21.531  32.616 3.546   1.00 51.76  ? 1045 GLU A O   1 
ATOM 8023 C CB  . GLU A 1 1048 ? 20.680  29.506 3.818   1.00 111.18 ? 1045 GLU A CB  1 
ATOM 8024 C CG  . GLU A 1 1048 ? 20.478  29.047 2.358   1.00 111.18 ? 1045 GLU A CG  1 
ATOM 8025 C CD  . GLU A 1 1048 ? 19.024  28.731 2.002   1.00 111.18 ? 1045 GLU A CD  1 
ATOM 8026 O OE1 . GLU A 1 1048 ? 18.502  27.695 2.475   1.00 111.18 ? 1045 GLU A OE1 1 
ATOM 8027 O OE2 . GLU A 1 1048 ? 18.412  29.513 1.237   1.00 111.18 ? 1045 GLU A OE2 1 
ATOM 8028 N N   . SER A 1 1049 ? 19.830  32.151 2.165   1.00 46.81  ? 1046 SER A N   1 
ATOM 8029 C CA  . SER A 1 1049 ? 20.232  33.144 1.194   1.00 46.81  ? 1046 SER A CA  1 
ATOM 8030 C C   . SER A 1 1049 ? 19.918  34.535 1.695   1.00 46.81  ? 1046 SER A C   1 
ATOM 8031 O O   . SER A 1 1049 ? 20.791  35.422 1.648   1.00 46.81  ? 1046 SER A O   1 
ATOM 8032 C CB  . SER A 1 1049 ? 19.639  32.878 -0.204  1.00 59.05  ? 1046 SER A CB  1 
ATOM 8033 O OG  . SER A 1 1049 ? 18.281  32.470 -0.145  1.00 59.05  ? 1046 SER A OG  1 
ATOM 8034 N N   . TRP A 1 1050 ? 18.700  34.720 2.198   1.00 61.92  ? 1047 TRP A N   1 
ATOM 8035 C CA  . TRP A 1 1050 ? 18.360  35.959 2.897   1.00 61.92  ? 1047 TRP A CA  1 
ATOM 8036 C C   . TRP A 1 1050 ? 19.325  36.264 4.034   1.00 61.92  ? 1047 TRP A C   1 
ATOM 8037 O O   . TRP A 1 1050 ? 19.796  37.396 4.176   1.00 61.92  ? 1047 TRP A O   1 
ATOM 8038 C CB  . TRP A 1 1050 ? 16.921  35.929 3.372   1.00 81.46  ? 1047 TRP A CB  1 
ATOM 8039 C CG  . TRP A 1 1050 ? 16.085  36.496 2.341   1.00 81.46  ? 1047 TRP A CG  1 
ATOM 8040 C CD1 . TRP A 1 1050 ? 15.869  35.990 1.100   1.00 81.46  ? 1047 TRP A CD1 1 
ATOM 8041 C CD2 . TRP A 1 1050 ? 15.390  37.728 2.401   1.00 81.46  ? 1047 TRP A CD2 1 
ATOM 8042 N NE1 . TRP A 1 1050 ? 15.059  36.823 0.386   1.00 81.46  ? 1047 TRP A NE1 1 
ATOM 8043 C CE2 . TRP A 1 1050 ? 14.750  37.903 1.165   1.00 81.46  ? 1047 TRP A CE2 1 
ATOM 8044 C CE3 . TRP A 1 1050 ? 15.222  38.692 3.390   1.00 81.46  ? 1047 TRP A CE3 1 
ATOM 8045 C CZ2 . TRP A 1 1050 ? 13.958  39.010 0.885   1.00 81.46  ? 1047 TRP A CZ2 1 
ATOM 8046 C CZ3 . TRP A 1 1050 ? 14.431  39.791 3.116   1.00 81.46  ? 1047 TRP A CZ3 1 
ATOM 8047 C CH2 . TRP A 1 1050 ? 13.807  39.943 1.873   1.00 81.46  ? 1047 TRP A CH2 1 
ATOM 8048 N N   . TYR A 1 1051 ? 19.657  35.241 4.814   1.00 49.48  ? 1048 TYR A N   1 
ATOM 8049 C CA  . TYR A 1 1051 ? 20.614  35.415 5.879   1.00 49.48  ? 1048 TYR A CA  1 
ATOM 8050 C C   . TYR A 1 1051 ? 21.870  35.947 5.282   1.00 49.48  ? 1048 TYR A C   1 
ATOM 8051 O O   . TYR A 1 1051 ? 22.364  37.003 5.700   1.00 49.48  ? 1048 TYR A O   1 
ATOM 8052 C CB  . TYR A 1 1051 ? 20.914  34.106 6.582   1.00 62.84  ? 1048 TYR A CB  1 
ATOM 8053 C CG  . TYR A 1 1051 ? 21.950  34.249 7.659   1.00 62.84  ? 1048 TYR A CG  1 
ATOM 8054 C CD1 . TYR A 1 1051 ? 21.596  34.677 8.937   1.00 62.84  ? 1048 TYR A CD1 1 
ATOM 8055 C CD2 . TYR A 1 1051 ? 23.284  33.961 7.405   1.00 62.84  ? 1048 TYR A CD2 1 
ATOM 8056 C CE1 . TYR A 1 1051 ? 22.548  34.803 9.942   1.00 62.84  ? 1048 TYR A CE1 1 
ATOM 8057 C CE2 . TYR A 1 1051 ? 24.243  34.081 8.396   1.00 62.84  ? 1048 TYR A CE2 1 
ATOM 8058 C CZ  . TYR A 1 1051 ? 23.867  34.501 9.661   1.00 62.84  ? 1048 TYR A CZ  1 
ATOM 8059 O OH  . TYR A 1 1051 ? 24.819  34.625 10.636  1.00 62.84  ? 1048 TYR A OH  1 
ATOM 8060 N N   . ASN A 1 1052 ? 22.371  35.222 4.277   1.00 32.07  ? 1049 ASN A N   1 
ATOM 8061 C CA  . ASN A 1 1052 ? 23.656  35.573 3.662   1.00 32.07  ? 1049 ASN A CA  1 
ATOM 8062 C C   . ASN A 1 1052 ? 23.667  36.981 3.076   1.00 32.07  ? 1049 ASN A C   1 
ATOM 8063 O O   . ASN A 1 1052 ? 24.583  37.773 3.354   1.00 32.07  ? 1049 ASN A O   1 
ATOM 8064 C CB  . ASN A 1 1052 ? 24.155  34.463 2.745   1.00 57.70  ? 1049 ASN A CB  1 
ATOM 8065 C CG  . ASN A 1 1052 ? 24.681  33.284 3.556   1.00 57.70  ? 1049 ASN A CG  1 
ATOM 8066 O OD1 . ASN A 1 1052 ? 25.434  33.478 4.508   1.00 57.70  ? 1049 ASN A OD1 1 
ATOM 8067 N ND2 . ASN A 1 1052 ? 24.265  32.073 3.218   1.00 57.70  ? 1049 ASN A ND2 1 
ATOM 8068 N N   . LEU A 1 1053 ? 22.597  37.317 2.359   1.00 47.20  ? 1050 LEU A N   1 
ATOM 8069 C CA  . LEU A 1 1053 ? 22.472  38.664 1.830   1.00 47.20  ? 1050 LEU A CA  1 
ATOM 8070 C C   . LEU A 1 1053 ? 22.680  39.645 2.966   1.00 47.20  ? 1050 LEU A C   1 
ATOM 8071 O O   . LEU A 1 1053 ? 23.513  40.557 2.880   1.00 47.20  ? 1050 LEU A O   1 
ATOM 8072 C CB  . LEU A 1 1053 ? 21.104  38.882 1.211   1.00 42.54  ? 1050 LEU A CB  1 
ATOM 8073 C CG  . LEU A 1 1053 ? 21.095  39.974 0.129   1.00 42.54  ? 1050 LEU A CG  1 
ATOM 8074 C CD1 . LEU A 1 1053 ? 19.645  40.315 -0.319  1.00 42.54  ? 1050 LEU A CD1 1 
ATOM 8075 C CD2 . LEU A 1 1053 ? 21.887  41.254 0.512   1.00 42.54  ? 1050 LEU A CD2 1 
ATOM 8076 N N   . LEU A 1 1054 ? 21.946  39.413 4.046   1.00 59.01  ? 1051 LEU A N   1 
ATOM 8077 C CA  . LEU A 1 1054 ? 21.871  40.364 5.139   1.00 59.01  ? 1051 LEU A CA  1 
ATOM 8078 C C   . LEU A 1 1054 ? 23.161  40.446 5.956   1.00 59.01  ? 1051 LEU A C   1 
ATOM 8079 O O   . LEU A 1 1054 ? 23.592  41.546 6.313   1.00 59.01  ? 1051 LEU A O   1 
ATOM 8080 C CB  . LEU A 1 1054 ? 20.635  40.078 6.017   1.00 29.01  ? 1051 LEU A CB  1 
ATOM 8081 C CG  . LEU A 1 1054 ? 19.262  40.372 5.384   1.00 29.01  ? 1051 LEU A CG  1 
ATOM 8082 C CD1 . LEU A 1 1054 ? 18.188  39.792 6.268   1.00 29.01  ? 1051 LEU A CD1 1 
ATOM 8083 C CD2 . LEU A 1 1054 ? 19.077  41.863 5.189   1.00 29.01  ? 1051 LEU A CD2 1 
ATOM 8084 N N   . LEU A 1 1055 ? 23.767  39.288 6.230   1.00 44.71  ? 1052 LEU A N   1 
ATOM 8085 C CA  . LEU A 1 1055 ? 25.059  39.230 6.913   1.00 44.71  ? 1052 LEU A CA  1 
ATOM 8086 C C   . LEU A 1 1055 ? 26.084  40.123 6.228   1.00 44.71  ? 1052 LEU A C   1 
ATOM 8087 O O   . LEU A 1 1055 ? 26.786  40.936 6.854   1.00 44.71  ? 1052 LEU A O   1 
ATOM 8088 C CB  . LEU A 1 1055 ? 25.612  37.814 6.879   1.00 34.08  ? 1052 LEU A CB  1 
ATOM 8089 C CG  . LEU A 1 1055 ? 26.496  37.458 8.082   1.00 34.08  ? 1052 LEU A CG  1 
ATOM 8090 C CD1 . LEU A 1 1055 ? 27.063  36.084 7.839   1.00 34.08  ? 1052 LEU A CD1 1 
ATOM 8091 C CD2 . LEU A 1 1055 ? 27.594  38.448 8.391   1.00 34.08  ? 1052 LEU A CD2 1 
ATOM 8092 N N   . ASP A 1 1056 ? 26.172  39.916 4.921   1.00 62.45  ? 1053 ASP A N   1 
ATOM 8093 C CA  . ASP A 1 1056 ? 27.086  40.646 4.109   1.00 62.45  ? 1053 ASP A CA  1 
ATOM 8094 C C   . ASP A 1 1056 ? 26.778  42.102 4.355   1.00 62.45  ? 1053 ASP A C   1 
ATOM 8095 O O   . ASP A 1 1056 ? 27.599  42.833 4.928   1.00 62.45  ? 1053 ASP A O   1 
ATOM 8096 C CB  . ASP A 1 1056 ? 26.889  40.291 2.640   1.00 89.95  ? 1053 ASP A CB  1 
ATOM 8097 C CG  . ASP A 1 1056 ? 28.096  40.641 1.800   1.00 89.95  ? 1053 ASP A CG  1 
ATOM 8098 O OD1 . ASP A 1 1056 ? 29.080  39.872 1.865   1.00 89.95  ? 1053 ASP A OD1 1 
ATOM 8099 O OD2 . ASP A 1 1056 ? 28.071  41.681 1.091   1.00 89.95  ? 1053 ASP A OD2 1 
ATOM 8100 N N   . MET A 1 1057 ? 25.566  42.495 3.963   1.00 63.79  ? 1054 MET A N   1 
ATOM 8101 C CA  . MET A 1 1057 ? 25.121  43.875 4.087   1.00 63.79  ? 1054 MET A CA  1 
ATOM 8102 C C   . MET A 1 1057 ? 25.245  44.435 5.523   1.00 63.79  ? 1054 MET A C   1 
ATOM 8103 O O   . MET A 1 1057 ? 25.396  45.639 5.716   1.00 63.79  ? 1054 MET A O   1 
ATOM 8104 C CB  . MET A 1 1057 ? 23.703  44.024 3.557   1.00 76.33  ? 1054 MET A CB  1 
ATOM 8105 C CG  . MET A 1 1057 ? 23.160  45.405 3.797   1.00 76.33  ? 1054 MET A CG  1 
ATOM 8106 S SD  . MET A 1 1057 ? 21.738  45.858 2.808   1.00 76.33  ? 1054 MET A SD  1 
ATOM 8107 C CE  . MET A 1 1057 ? 20.469  44.803 3.503   1.00 76.33  ? 1054 MET A CE  1 
ATOM 8108 N N   . GLN A 1 1058 ? 25.192  43.552 6.518   1.00 57.27  ? 1055 GLN A N   1 
ATOM 8109 C CA  . GLN A 1 1058 ? 25.472  43.938 7.894   1.00 57.27  ? 1055 GLN A CA  1 
ATOM 8110 C C   . GLN A 1 1058 ? 26.893  44.479 7.984   1.00 57.27  ? 1055 GLN A C   1 
ATOM 8111 O O   . GLN A 1 1058 ? 27.115  45.535 8.560   1.00 57.27  ? 1055 GLN A O   1 
ATOM 8112 C CB  . GLN A 1 1058 ? 25.303  42.743 8.817   1.00 57.64  ? 1055 GLN A CB  1 
ATOM 8113 C CG  . GLN A 1 1058 ? 24.430  42.973 10.032  1.00 57.64  ? 1055 GLN A CG  1 
ATOM 8114 C CD  . GLN A 1 1058 ? 24.670  41.907 11.093  1.00 57.64  ? 1055 GLN A CD  1 
ATOM 8115 O OE1 . GLN A 1 1058 ? 23.751  41.505 11.827  1.00 57.64  ? 1055 GLN A OE1 1 
ATOM 8116 N NE2 . GLN A 1 1058 ? 25.919  41.437 11.181  1.00 57.64  ? 1055 GLN A NE2 1 
ATOM 8117 N N   . ASN A 1 1059 ? 27.841  43.772 7.367   1.00 39.74  ? 1056 ASN A N   1 
ATOM 8118 C CA  . ASN A 1 1059 ? 29.269  44.177 7.395   1.00 39.74  ? 1056 ASN A CA  1 
ATOM 8119 C C   . ASN A 1 1059 ? 29.602  45.389 6.529   1.00 39.74  ? 1056 ASN A C   1 
ATOM 8120 O O   . ASN A 1 1059 ? 30.347  46.293 6.962   1.00 39.74  ? 1056 ASN A O   1 
ATOM 8121 C CB  . ASN A 1 1059 ? 30.183  43.000 7.101   1.00 60.52  ? 1056 ASN A CB  1 
ATOM 8122 C CG  . ASN A 1 1059 ? 30.060  41.909 8.153   1.00 60.52  ? 1056 ASN A CG  1 
ATOM 8123 O OD1 . ASN A 1 1059 ? 30.001  40.717 7.830   1.00 60.52  ? 1056 ASN A OD1 1 
ATOM 8124 N ND2 . ASN A 1 1059 ? 29.995  42.316 9.426   1.00 60.52  ? 1056 ASN A ND2 1 
ATOM 8125 N N   . ARG A 1 1060 ? 29.021  45.448 5.334   1.00 48.37  ? 1057 ARG A N   1 
ATOM 8126 C CA  . ARG A 1 1060 ? 29.219  46.617 4.503   1.00 48.37  ? 1057 ARG A CA  1 
ATOM 8127 C C   . ARG A 1 1060 ? 28.811  47.842 5.326   1.00 48.37  ? 1057 ARG A C   1 
ATOM 8128 O O   . ARG A 1 1060 ? 29.576  48.799 5.467   1.00 48.37  ? 1057 ARG A O   1 
ATOM 8129 C CB  . ARG A 1 1060 ? 28.386  46.516 3.242   1.00 71.84  ? 1057 ARG A CB  1 
ATOM 8130 C CG  . ARG A 1 1060 ? 28.509  45.199 2.522   1.00 71.84  ? 1057 ARG A CG  1 
ATOM 8131 C CD  . ARG A 1 1060 ? 28.700  45.489 1.071   1.00 71.84  ? 1057 ARG A CD  1 
ATOM 8132 N NE  . ARG A 1 1060 ? 28.522  44.346 0.190   1.00 71.84  ? 1057 ARG A NE  1 
ATOM 8133 C CZ  . ARG A 1 1060 ? 28.884  44.362 -1.090  1.00 71.84  ? 1057 ARG A CZ  1 
ATOM 8134 N NH1 . ARG A 1 1060 ? 29.448  45.449 -1.604  1.00 71.84  ? 1057 ARG A NH1 1 
ATOM 8135 N NH2 . ARG A 1 1060 ? 28.698  43.297 -1.857  1.00 71.84  ? 1057 ARG A NH2 1 
ATOM 8136 N N   . LEU A 1 1061 ? 27.618  47.758 5.919   1.00 65.92  ? 1058 LEU A N   1 
ATOM 8137 C CA  . LEU A 1 1061 ? 26.987  48.851 6.662   1.00 65.92  ? 1058 LEU A CA  1 
ATOM 8138 C C   . LEU A 1 1061 ? 27.793  49.383 7.801   1.00 65.92  ? 1058 LEU A C   1 
ATOM 8139 O O   . LEU A 1 1061 ? 27.671  50.550 8.162   1.00 65.92  ? 1058 LEU A O   1 
ATOM 8140 C CB  . LEU A 1 1061 ? 25.647  48.407 7.235   1.00 45.42  ? 1058 LEU A CB  1 
ATOM 8141 C CG  . LEU A 1 1061 ? 24.420  48.807 6.415   1.00 45.42  ? 1058 LEU A CG  1 
ATOM 8142 C CD1 . LEU A 1 1061 ? 23.213  48.012 6.870   1.00 45.42  ? 1058 LEU A CD1 1 
ATOM 8143 C CD2 . LEU A 1 1061 ? 24.170  50.328 6.489   1.00 45.42  ? 1058 LEU A CD2 1 
ATOM 8144 N N   . ASN A 1 1062 ? 28.595  48.519 8.399   1.00 60.61  ? 1059 ASN A N   1 
ATOM 8145 C CA  . ASN A 1 1062 ? 29.384  48.956 9.524   1.00 60.61  ? 1059 ASN A CA  1 
ATOM 8146 C C   . ASN A 1 1062 ? 30.586  49.818 9.170   1.00 60.61  ? 1059 ASN A C   1 
ATOM 8147 O O   . ASN A 1 1062 ? 30.902  50.761 9.905   1.00 60.61  ? 1059 ASN A O   1 
ATOM 8148 C CB  . ASN A 1 1062 ? 29.750  47.771 10.380  1.00 54.24  ? 1059 ASN A CB  1 
ATOM 8149 C CG  . ASN A 1 1062 ? 28.583  47.305 11.199  1.00 54.24  ? 1059 ASN A CG  1 
ATOM 8150 O OD1 . ASN A 1 1062 ? 27.930  48.104 11.893  1.00 54.24  ? 1059 ASN A OD1 1 
ATOM 8151 N ND2 . ASN A 1 1062 ? 28.294  46.019 11.117  1.00 54.24  ? 1059 ASN A ND2 1 
ATOM 8152 N N   . LYS A 1 1063 ? 31.226  49.520 8.035   1.00 57.75  ? 1060 LYS A N   1 
ATOM 8153 C CA  . LYS A 1 1063 ? 32.258  50.392 7.472   1.00 57.75  ? 1060 LYS A CA  1 
ATOM 8154 C C   . LYS A 1 1063 ? 31.726  51.820 7.225   1.00 57.75  ? 1060 LYS A C   1 
ATOM 8155 O O   . LYS A 1 1063 ? 32.337  52.811 7.639   1.00 57.75  ? 1060 LYS A O   1 
ATOM 8156 C CB  . LYS A 1 1063 ? 32.845  49.768 6.199   1.00 70.33  ? 1060 LYS A CB  1 
ATOM 8157 C CG  . LYS A 1 1063 ? 33.851  48.650 6.477   1.00 70.33  ? 1060 LYS A CG  1 
ATOM 8158 C CD  . LYS A 1 1063 ? 34.944  48.571 5.408   1.00 70.33  ? 1060 LYS A CD  1 
ATOM 8159 C CE  . LYS A 1 1063 ? 35.709  47.253 5.492   1.00 70.33  ? 1060 LYS A CE  1 
ATOM 8160 N NZ  . LYS A 1 1063 ? 34.828  46.122 5.068   1.00 70.33  ? 1060 LYS A NZ  1 
ATOM 8161 N N   . VAL A 1 1064 ? 30.563  51.912 6.597   1.00 69.23  ? 1061 VAL A N   1 
ATOM 8162 C CA  . VAL A 1 1064 ? 29.968  53.205 6.250   1.00 69.23  ? 1061 VAL A CA  1 
ATOM 8163 C C   . VAL A 1 1064 ? 29.526  54.071 7.456   1.00 69.23  ? 1061 VAL A C   1 
ATOM 8164 O O   . VAL A 1 1064 ? 29.759  55.294 7.461   1.00 69.23  ? 1061 VAL A O   1 
ATOM 8165 C CB  . VAL A 1 1064 ? 28.810  52.999 5.254   1.00 82.21  ? 1061 VAL A CB  1 
ATOM 8166 C CG1 . VAL A 1 1064 ? 28.065  54.277 5.015   1.00 82.21  ? 1061 VAL A CG1 1 
ATOM 8167 C CG2 . VAL A 1 1064 ? 29.341  52.449 3.939   1.00 82.21  ? 1061 VAL A CG2 1 
ATOM 8168 N N   . ILE A 1 1065 ? 28.916  53.432 8.465   1.00 75.60  ? 1062 ILE A N   1 
ATOM 8169 C CA  . ILE A 1 1065 ? 28.310  54.132 9.622   1.00 75.60  ? 1062 ILE A CA  1 
ATOM 8170 C C   . ILE A 1 1065 ? 29.211  54.364 10.838  1.00 75.60  ? 1062 ILE A C   1 
ATOM 8171 O O   . ILE A 1 1065 ? 29.741  53.431 11.458  1.00 75.60  ? 1062 ILE A O   1 
ATOM 8172 C CB  . ILE A 1 1065 ? 27.039  53.426 10.175  1.00 39.73  ? 1062 ILE A CB  1 
ATOM 8173 C CG1 . ILE A 1 1065 ? 25.983  53.199 9.087   1.00 39.73  ? 1062 ILE A CG1 1 
ATOM 8174 C CG2 . ILE A 1 1065 ? 26.450  54.233 11.370  1.00 39.73  ? 1062 ILE A CG2 1 
ATOM 8175 C CD1 . ILE A 1 1065 ? 24.901  52.187 9.521   1.00 39.73  ? 1062 ILE A CD1 1 
ATOM 8176 N N   . LYS A 1 1066 ? 29.310  55.638 11.192  1.00 72.75  ? 1063 LYS A N   1 
ATOM 8177 C CA  . LYS A 1 1066 ? 29.936  56.086 12.426  1.00 72.75  ? 1063 LYS A CA  1 
ATOM 8178 C C   . LYS A 1 1066 ? 29.074  55.691 13.618  1.00 72.75  ? 1063 LYS A C   1 
ATOM 8179 O O   . LYS A 1 1066 ? 27.921  56.105 13.741  1.00 72.75  ? 1063 LYS A O   1 
ATOM 8180 C CB  . LYS A 1 1066 ? 30.158  57.610 12.391  1.00 116.62 ? 1063 LYS A CB  1 
ATOM 8181 C CG  . LYS A 1 1066 ? 28.949  58.442 11.916  1.00 116.62 ? 1063 LYS A CG  1 
ATOM 8182 C CD  . LYS A 1 1066 ? 28.814  58.463 10.397  1.00 116.62 ? 1063 LYS A CD  1 
ATOM 8183 C CE  . LYS A 1 1066 ? 27.371  58.700 9.974   1.00 116.62 ? 1063 LYS A CE  1 
ATOM 8184 N NZ  . LYS A 1 1066 ? 27.271  58.851 8.495   1.00 116.62 ? 1063 LYS A NZ  1 
ATOM 8185 N N   . SER A 1 1067 ? 29.645  54.861 14.477  1.00 31.37  ? 1064 SER A N   1 
ATOM 8186 C CA  . SER A 1 1067 ? 28.963  54.387 15.675  1.00 31.37  ? 1064 SER A CA  1 
ATOM 8187 C C   . SER A 1 1067 ? 29.331  55.427 16.669  1.00 31.37  ? 1064 SER A C   1 
ATOM 8188 O O   . SER A 1 1067 ? 30.431  55.912 16.578  1.00 31.37  ? 1064 SER A O   1 
ATOM 8189 C CB  . SER A 1 1067 ? 29.490  53.017 16.128  1.00 50.99  ? 1064 SER A CB  1 
ATOM 8190 O OG  . SER A 1 1067 ? 30.341  53.167 17.298  1.00 50.99  ? 1064 SER A OG  1 
ATOM 8191 N N   . VAL A 1 1068 ? 28.464  55.722 17.632  1.00 63.24  ? 1065 VAL A N   1 
ATOM 8192 C CA  . VAL A 1 1068 ? 28.682  56.874 18.478  1.00 63.24  ? 1065 VAL A CA  1 
ATOM 8193 C C   . VAL A 1 1068 ? 30.018  56.863 19.191  1.00 63.24  ? 1065 VAL A C   1 
ATOM 8194 O O   . VAL A 1 1068 ? 30.983  57.328 18.611  1.00 63.24  ? 1065 VAL A O   1 
ATOM 8195 C CB  . VAL A 1 1068 ? 27.493  57.227 19.378  1.00 39.30  ? 1065 VAL A CB  1 
ATOM 8196 C CG1 . VAL A 1 1068 ? 27.869  58.335 20.411  1.00 39.30  ? 1065 VAL A CG1 1 
ATOM 8197 C CG2 . VAL A 1 1068 ? 26.300  57.669 18.505  1.00 39.30  ? 1065 VAL A CG2 1 
ATOM 8198 N N   . GLY A 1 1069 ? 30.125  56.346 20.403  1.00 37.35  ? 1066 GLY A N   1 
ATOM 8199 C CA  . GLY A 1 1069 ? 31.407  56.476 21.119  1.00 37.35  ? 1066 GLY A CA  1 
ATOM 8200 C C   . GLY A 1 1069 ? 32.478  55.653 20.390  1.00 37.35  ? 1066 GLY A C   1 
ATOM 8201 O O   . GLY A 1 1069 ? 33.455  55.168 21.005  1.00 37.35  ? 1066 GLY A O   1 
ATOM 8202 N N   . LYS A 1 1070 ? 32.275  55.456 19.082  1.00 51.75  ? 1067 LYS A N   1 
ATOM 8203 C CA  . LYS A 1 1070 ? 33.177  54.685 18.257  1.00 51.75  ? 1067 LYS A CA  1 
ATOM 8204 C C   . LYS A 1 1070 ? 33.214  53.266 18.773  1.00 51.75  ? 1067 LYS A C   1 
ATOM 8205 O O   . LYS A 1 1070 ? 34.277  52.647 18.760  1.00 51.75  ? 1067 LYS A O   1 
ATOM 8206 C CB  . LYS A 1 1070 ? 34.592  55.265 18.302  1.00 68.25  ? 1067 LYS A CB  1 
ATOM 8207 C CG  . LYS A 1 1070 ? 34.744  56.656 17.707  1.00 68.25  ? 1067 LYS A CG  1 
ATOM 8208 C CD  . LYS A 1 1070 ? 34.944  56.592 16.201  1.00 68.25  ? 1067 LYS A CD  1 
ATOM 8209 C CE  . LYS A 1 1070 ? 35.207  57.975 15.633  1.00 68.25  ? 1067 LYS A CE  1 
ATOM 8210 N NZ  . LYS A 1 1070 ? 36.598  58.476 15.916  1.00 68.25  ? 1067 LYS A NZ  1 
ATOM 8211 N N   . ILE A 1 1071 ? 32.068  52.764 19.249  1.00 30.06  ? 1068 ILE A N   1 
ATOM 8212 C CA  . ILE A 1 1071 ? 31.933  51.364 19.675  1.00 30.06  ? 1068 ILE A CA  1 
ATOM 8213 C C   . ILE A 1 1071 ? 31.798  50.483 18.454  1.00 30.06  ? 1068 ILE A C   1 
ATOM 8214 O O   . ILE A 1 1071 ? 31.066  50.791 17.543  1.00 30.06  ? 1068 ILE A O   1 
ATOM 8215 C CB  . ILE A 1 1071 ? 30.693  51.113 20.632  1.00 27.80  ? 1068 ILE A CB  1 
ATOM 8216 C CG1 . ILE A 1 1071 ? 30.828  51.888 21.938  1.00 27.80  ? 1068 ILE A CG1 1 
ATOM 8217 C CG2 . ILE A 1 1071 ? 30.587  49.644 21.032  1.00 27.80  ? 1068 ILE A CG2 1 
ATOM 8218 C CD1 . ILE A 1 1071 ? 29.724  51.616 22.889  1.00 27.80  ? 1068 ILE A CD1 1 
ATOM 8219 N N   . GLU A 1 1072 ? 32.501  49.361 18.446  1.00 38.43  ? 1069 GLU A N   1 
ATOM 8220 C CA  . GLU A 1 1072 ? 32.383  48.414 17.333  1.00 38.43  ? 1069 GLU A CA  1 
ATOM 8221 C C   . GLU A 1 1072 ? 31.073  47.606 17.424  1.00 38.43  ? 1069 GLU A C   1 
ATOM 8222 O O   . GLU A 1 1072 ? 30.822  46.894 18.399  1.00 38.43  ? 1069 GLU A O   1 
ATOM 8223 C CB  . GLU A 1 1072 ? 33.625  47.499 17.294  1.00 148.37 ? 1069 GLU A CB  1 
ATOM 8224 C CG  . GLU A 1 1072 ? 33.619  46.385 16.238  1.00 148.37 ? 1069 GLU A CG  1 
ATOM 8225 C CD  . GLU A 1 1072 ? 33.643  46.893 14.803  1.00 148.37 ? 1069 GLU A CD  1 
ATOM 8226 O OE1 . GLU A 1 1072 ? 33.169  46.149 13.914  1.00 148.37 ? 1069 GLU A OE1 1 
ATOM 8227 O OE2 . GLU A 1 1072 ? 34.131  48.022 14.562  1.00 148.37 ? 1069 GLU A OE2 1 
ATOM 8228 N N   . HIS A 1 1073 ? 30.262  47.719 16.386  1.00 31.54  ? 1070 HIS A N   1 
ATOM 8229 C CA  . HIS A 1 1073 ? 29.000  46.977 16.300  1.00 31.54  ? 1070 HIS A CA  1 
ATOM 8230 C C   . HIS A 1 1073 ? 29.054  45.531 16.756  1.00 31.54  ? 1070 HIS A C   1 
ATOM 8231 O O   . HIS A 1 1073 ? 28.223  45.076 17.574  1.00 31.54  ? 1070 HIS A O   1 
ATOM 8232 C CB  . HIS A 1 1073 ? 28.456  46.968 14.877  1.00 28.79  ? 1070 HIS A CB  1 
ATOM 8233 C CG  . HIS A 1 1073 ? 27.195  46.185 14.753  1.00 28.79  ? 1070 HIS A CG  1 
ATOM 8234 N ND1 . HIS A 1 1073 ? 25.946  46.777 14.782  1.00 28.79  ? 1070 HIS A ND1 1 
ATOM 8235 C CD2 . HIS A 1 1073 ? 26.981  44.845 14.677  1.00 28.79  ? 1070 HIS A CD2 1 
ATOM 8236 C CE1 . HIS A 1 1073 ? 25.019  45.834 14.708  1.00 28.79  ? 1070 HIS A CE1 1 
ATOM 8237 N NE2 . HIS A 1 1073 ? 25.620  44.654 14.644  1.00 28.79  ? 1070 HIS A NE2 1 
ATOM 8238 N N   . SER A 1 1074 ? 30.006  44.809 16.165  1.00 38.18  ? 1071 SER A N   1 
ATOM 8239 C CA  . SER A 1 1074 ? 30.234  43.401 16.464  1.00 38.18  ? 1071 SER A CA  1 
ATOM 8240 C C   . SER A 1 1074 ? 30.848  43.207 17.846  1.00 38.18  ? 1071 SER A C   1 
ATOM 8241 O O   . SER A 1 1074 ? 30.698  42.149 18.420  1.00 38.18  ? 1071 SER A O   1 
ATOM 8242 C CB  . SER A 1 1074 ? 31.081  42.745 15.390  1.00 53.16  ? 1071 SER A CB  1 
ATOM 8243 O OG  . SER A 1 1074 ? 32.303  43.440 15.277  1.00 53.16  ? 1071 SER A OG  1 
ATOM 8244 N N   . PHE A 1 1075 ? 31.505  44.207 18.422  1.00 42.66  ? 1072 PHE A N   1 
ATOM 8245 C CA  . PHE A 1 1075 ? 31.865  44.042 19.817  1.00 42.66  ? 1072 PHE A CA  1 
ATOM 8246 C C   . PHE A 1 1075 ? 30.595  44.035 20.642  1.00 42.66  ? 1072 PHE A C   1 
ATOM 8247 O O   . PHE A 1 1075 ? 30.447  43.249 21.586  1.00 42.66  ? 1072 PHE A O   1 
ATOM 8248 C CB  . PHE A 1 1075 ? 32.760  45.156 20.296  1.00 25.20  ? 1072 PHE A CB  1 
ATOM 8249 C CG  . PHE A 1 1075 ? 33.095  45.072 21.761  1.00 25.20  ? 1072 PHE A CG  1 
ATOM 8250 C CD1 . PHE A 1 1075 ? 34.073  44.179 22.217  1.00 25.20  ? 1072 PHE A CD1 1 
ATOM 8251 C CD2 . PHE A 1 1075 ? 32.425  45.885 22.698  1.00 25.20  ? 1072 PHE A CD2 1 
ATOM 8252 C CE1 . PHE A 1 1075 ? 34.401  44.078 23.598  1.00 25.20  ? 1072 PHE A CE1 1 
ATOM 8253 C CE2 . PHE A 1 1075 ? 32.736  45.804 24.105  1.00 25.20  ? 1072 PHE A CE2 1 
ATOM 8254 C CZ  . PHE A 1 1075 ? 33.729  44.878 24.548  1.00 25.20  ? 1072 PHE A CZ  1 
ATOM 8255 N N   . TRP A 1 1076 ? 29.686  44.931 20.274  1.00 39.15  ? 1073 TRP A N   1 
ATOM 8256 C CA  . TRP A 1 1076 ? 28.410  45.078 20.916  1.00 39.15  ? 1073 TRP A CA  1 
ATOM 8257 C C   . TRP A 1 1076 ? 27.634  43.772 20.785  1.00 39.15  ? 1073 TRP A C   1 
ATOM 8258 O O   . TRP A 1 1076 ? 27.229  43.190 21.808  1.00 39.15  ? 1073 TRP A O   1 
ATOM 8259 C CB  . TRP A 1 1076 ? 27.710  46.313 20.335  1.00 34.13  ? 1073 TRP A CB  1 
ATOM 8260 C CG  . TRP A 1 1076 ? 26.227  46.502 20.583  1.00 34.13  ? 1073 TRP A CG  1 
ATOM 8261 C CD1 . TRP A 1 1076 ? 25.282  46.752 19.627  1.00 34.13  ? 1073 TRP A CD1 1 
ATOM 8262 C CD2 . TRP A 1 1076 ? 25.524  46.473 21.841  1.00 34.13  ? 1073 TRP A CD2 1 
ATOM 8263 N NE1 . TRP A 1 1076 ? 24.037  46.868 20.205  1.00 34.13  ? 1073 TRP A NE1 1 
ATOM 8264 C CE2 . TRP A 1 1076 ? 24.152  46.697 21.559  1.00 34.13  ? 1073 TRP A CE2 1 
ATOM 8265 C CE3 . TRP A 1 1076 ? 25.909  46.253 23.165  1.00 34.13  ? 1073 TRP A CE3 1 
ATOM 8266 C CZ2 . TRP A 1 1076 ? 23.165  46.716 22.554  1.00 34.13  ? 1073 TRP A CZ2 1 
ATOM 8267 C CZ3 . TRP A 1 1076 ? 24.925  46.300 24.163  1.00 34.13  ? 1073 TRP A CZ3 1 
ATOM 8268 C CH2 . TRP A 1 1076 ? 23.570  46.523 23.844  1.00 34.13  ? 1073 TRP A CH2 1 
ATOM 8269 N N   . ARG A 1 1077 ? 27.487  43.255 19.564  1.00 28.64  ? 1074 ARG A N   1 
ATOM 8270 C CA  . ARG A 1 1077 ? 26.613  42.110 19.402  1.00 28.64  ? 1074 ARG A CA  1 
ATOM 8271 C C   . ARG A 1 1077 ? 27.191  40.810 19.856  1.00 28.64  ? 1074 ARG A C   1 
ATOM 8272 O O   . ARG A 1 1077 ? 26.659  39.734 19.535  1.00 28.64  ? 1074 ARG A O   1 
ATOM 8273 C CB  . ARG A 1 1077 ? 26.135  41.946 17.989  1.00 33.66  ? 1074 ARG A CB  1 
ATOM 8274 C CG  . ARG A 1 1077 ? 24.973  42.817 17.639  1.00 33.66  ? 1074 ARG A CG  1 
ATOM 8275 C CD  . ARG A 1 1077 ? 24.083  43.097 18.813  1.00 33.66  ? 1074 ARG A CD  1 
ATOM 8276 N NE  . ARG A 1 1077 ? 22.978  43.974 18.436  1.00 33.66  ? 1074 ARG A NE  1 
ATOM 8277 C CZ  . ARG A 1 1077 ? 21.981  44.315 19.238  1.00 33.66  ? 1074 ARG A CZ  1 
ATOM 8278 N NH1 . ARG A 1 1077 ? 21.908  43.877 20.493  1.00 33.66  ? 1074 ARG A NH1 1 
ATOM 8279 N NH2 . ARG A 1 1077 ? 21.050  45.102 18.767  1.00 33.66  ? 1074 ARG A NH2 1 
ATOM 8280 N N   . SER A 1 1078 ? 28.252  40.870 20.641  1.00 27.15  ? 1075 SER A N   1 
ATOM 8281 C CA  . SER A 1 1078 ? 29.010  39.638 20.887  1.00 27.15  ? 1075 SER A CA  1 
ATOM 8282 C C   . SER A 1 1078 ? 28.453  38.839 22.023  1.00 27.15  ? 1075 SER A C   1 
ATOM 8283 O O   . SER A 1 1078 ? 28.328  39.360 23.133  1.00 27.15  ? 1075 SER A O   1 
ATOM 8284 C CB  . SER A 1 1078 ? 30.466  39.983 21.146  1.00 39.20  ? 1075 SER A CB  1 
ATOM 8285 O OG  . SER A 1 1078 ? 31.119  40.030 19.901  1.00 39.20  ? 1075 SER A OG  1 
ATOM 8286 N N   . PHE A 1 1079 ? 28.118  37.586 21.764  1.00 39.42  ? 1076 PHE A N   1 
ATOM 8287 C CA  . PHE A 1 1079 ? 27.620  36.747 22.852  1.00 39.42  ? 1076 PHE A CA  1 
ATOM 8288 C C   . PHE A 1 1079 ? 28.598  36.804 23.994  1.00 39.42  ? 1076 PHE A C   1 
ATOM 8289 O O   . PHE A 1 1079 ? 29.779  36.493 23.810  1.00 39.42  ? 1076 PHE A O   1 
ATOM 8290 C CB  . PHE A 1 1079 ? 27.450  35.294 22.433  1.00 43.70  ? 1076 PHE A CB  1 
ATOM 8291 C CG  . PHE A 1 1079 ? 26.876  34.425 23.526  1.00 43.70  ? 1076 PHE A CG  1 
ATOM 8292 C CD1 . PHE A 1 1079 ? 25.557  33.971 23.449  1.00 43.70  ? 1076 PHE A CD1 1 
ATOM 8293 C CD2 . PHE A 1 1079 ? 27.651  34.079 24.643  1.00 43.70  ? 1076 PHE A CD2 1 
ATOM 8294 C CE1 . PHE A 1 1079 ? 25.041  33.185 24.452  1.00 43.70  ? 1076 PHE A CE1 1 
ATOM 8295 C CE2 . PHE A 1 1079 ? 27.134  33.319 25.657  1.00 43.70  ? 1076 PHE A CE2 1 
ATOM 8296 C CZ  . PHE A 1 1079 ? 25.837  32.867 25.572  1.00 43.70  ? 1076 PHE A CZ  1 
ATOM 8297 N N   . HIS A 1 1080 ? 28.123  37.193 25.172  1.00 31.15  ? 1077 HIS A N   1 
ATOM 8298 C CA  . HIS A 1 1080 ? 29.061  37.502 26.245  1.00 31.15  ? 1077 HIS A CA  1 
ATOM 8299 C C   . HIS A 1 1080 ? 28.619  37.245 27.688  1.00 31.15  ? 1077 HIS A C   1 
ATOM 8300 O O   . HIS A 1 1080 ? 27.528  37.600 28.127  1.00 31.15  ? 1077 HIS A O   1 
ATOM 8301 C CB  . HIS A 1 1080 ? 29.503  38.950 26.130  1.00 47.40  ? 1077 HIS A CB  1 
ATOM 8302 C CG  . HIS A 1 1080 ? 30.132  39.461 27.379  1.00 47.40  ? 1077 HIS A CG  1 
ATOM 8303 N ND1 . HIS A 1 1080 ? 31.496  39.447 27.582  1.00 47.40  ? 1077 HIS A ND1 1 
ATOM 8304 C CD2 . HIS A 1 1080 ? 29.581  39.933 28.522  1.00 47.40  ? 1077 HIS A CD2 1 
ATOM 8305 C CE1 . HIS A 1 1080 ? 31.759  39.920 28.788  1.00 47.40  ? 1077 HIS A CE1 1 
ATOM 8306 N NE2 . HIS A 1 1080 ? 30.614  40.221 29.380  1.00 47.40  ? 1077 HIS A NE2 1 
ATOM 8307 N N   . THR A 1 1081 ? 29.510  36.645 28.450  1.00 51.48  ? 1078 THR A N   1 
ATOM 8308 C CA  . THR A 1 1081 ? 29.273  36.441 29.868  1.00 51.48  ? 1078 THR A CA  1 
ATOM 8309 C C   . THR A 1 1081 ? 30.580  36.741 30.567  1.00 51.48  ? 1078 THR A C   1 
ATOM 8310 O O   . THR A 1 1081 ? 31.609  36.796 29.923  1.00 51.48  ? 1078 THR A O   1 
ATOM 8311 C CB  . THR A 1 1081 ? 28.834  34.979 30.157  1.00 44.10  ? 1078 THR A CB  1 
ATOM 8312 O OG1 . THR A 1 1081 ? 29.944  34.088 29.989  1.00 44.10  ? 1078 THR A OG1 1 
ATOM 8313 C CG2 . THR A 1 1081 ? 27.676  34.542 29.224  1.00 44.10  ? 1078 THR A CG2 1 
ATOM 8314 N N   . GLU A 1 1082 ? 30.567  36.909 31.878  1.00 81.43  ? 1079 GLU A N   1 
ATOM 8315 C CA  . GLU A 1 1082 ? 31.832  37.036 32.572  1.00 81.43  ? 1079 GLU A CA  1 
ATOM 8316 C C   . GLU A 1 1082 ? 32.477  35.658 32.739  1.00 81.43  ? 1079 GLU A C   1 
ATOM 8317 O O   . GLU A 1 1082 ? 32.971  35.322 33.811  1.00 81.43  ? 1079 GLU A O   1 
ATOM 8318 C CB  . GLU A 1 1082 ? 31.689  37.799 33.900  1.00 201.00 ? 1079 GLU A CB  1 
ATOM 8319 C CG  . GLU A 1 1082 ? 33.003  38.401 34.458  1.00 201.00 ? 1079 GLU A CG  1 
ATOM 8320 C CD  . GLU A 1 1082 ? 33.572  39.553 33.625  1.00 201.00 ? 1079 GLU A CD  1 
ATOM 8321 O OE1 . GLU A 1 1082 ? 33.696  40.671 34.170  1.00 201.00 ? 1079 GLU A OE1 1 
ATOM 8322 O OE2 . GLU A 1 1082 ? 33.905  39.346 32.438  1.00 201.00 ? 1079 GLU A OE2 1 
ATOM 8323 N N   . ARG A 1 1083 ? 32.452  34.863 31.667  1.00 49.85  ? 1080 ARG A N   1 
ATOM 8324 C CA  . ARG A 1 1083 ? 33.155  33.587 31.588  1.00 49.85  ? 1080 ARG A CA  1 
ATOM 8325 C C   . ARG A 1 1083 ? 33.470  33.277 30.132  1.00 49.85  ? 1080 ARG A C   1 
ATOM 8326 O O   . ARG A 1 1083 ? 34.310  32.417 29.854  1.00 49.85  ? 1080 ARG A O   1 
ATOM 8327 C CB  . ARG A 1 1083 ? 32.383  32.433 32.247  1.00 117.10 ? 1080 ARG A CB  1 
ATOM 8328 C CG  . ARG A 1 1083 ? 31.345  31.756 31.368  1.00 117.10 ? 1080 ARG A CG  1 
ATOM 8329 C CD  . ARG A 1 1083 ? 31.052  30.332 31.827  1.00 117.10 ? 1080 ARG A CD  1 
ATOM 8330 N NE  . ARG A 1 1083 ? 31.910  29.329 31.185  1.00 117.10 ? 1080 ARG A NE  1 
ATOM 8331 C CZ  . ARG A 1 1083 ? 31.660  28.745 30.008  1.00 117.10 ? 1080 ARG A CZ  1 
ATOM 8332 N NH1 . ARG A 1 1083 ? 30.579  29.055 29.302  1.00 117.10 ? 1080 ARG A NH1 1 
ATOM 8333 N NH2 . ARG A 1 1083 ? 32.504  27.845 29.525  1.00 117.10 ? 1080 ARG A NH2 1 
ATOM 8334 N N   . LYS A 1 1084 ? 32.821  33.973 29.198  1.00 60.26  ? 1081 LYS A N   1 
ATOM 8335 C CA  . LYS A 1 1084 ? 33.156  33.787 27.789  1.00 60.26  ? 1081 LYS A CA  1 
ATOM 8336 C C   . LYS A 1 1084 ? 32.691  34.922 26.889  1.00 60.26  ? 1081 LYS A C   1 
ATOM 8337 O O   . LYS A 1 1084 ? 31.749  35.635 27.229  1.00 60.26  ? 1081 LYS A O   1 
ATOM 8338 C CB  . LYS A 1 1084 ? 32.713  32.399 27.275  1.00 43.50  ? 1081 LYS A CB  1 
ATOM 8339 C CG  . LYS A 1 1084 ? 31.354  32.265 26.604  1.00 43.50  ? 1081 LYS A CG  1 
ATOM 8340 C CD  . LYS A 1 1084 ? 31.068  30.787 26.278  1.00 43.50  ? 1081 LYS A CD  1 
ATOM 8341 C CE  . LYS A 1 1084 ? 29.888  30.629 25.319  1.00 43.50  ? 1081 LYS A CE  1 
ATOM 8342 N NZ  . LYS A 1 1084 ? 29.953  29.431 24.408  1.00 43.50  ? 1081 LYS A NZ  1 
ATOM 8343 N N   . THR A 1 1085 ? 33.388  35.096 25.762  1.00 39.92  ? 1082 THR A N   1 
ATOM 8344 C CA  . THR A 1 1085 ? 32.988  36.057 24.735  1.00 39.92  ? 1082 THR A CA  1 
ATOM 8345 C C   . THR A 1 1085 ? 33.243  35.515 23.323  1.00 39.92  ? 1082 THR A C   1 
ATOM 8346 O O   . THR A 1 1085 ? 34.380  35.399 22.899  1.00 39.92  ? 1082 THR A O   1 
ATOM 8347 C CB  . THR A 1 1085 ? 33.631  37.440 24.933  1.00 36.74  ? 1082 THR A CB  1 
ATOM 8348 O OG1 . THR A 1 1085 ? 33.301  37.945 26.240  1.00 36.74  ? 1082 THR A OG1 1 
ATOM 8349 C CG2 . THR A 1 1085 ? 33.156  38.410 23.845  1.00 36.74  ? 1082 THR A CG2 1 
ATOM 8350 N N   . GLU A 1 1086 ? 32.156  35.171 22.629  1.00 42.68  ? 1083 GLU A N   1 
ATOM 8351 C CA  . GLU A 1 1086 ? 32.165  34.704 21.256  1.00 42.68  ? 1083 GLU A CA  1 
ATOM 8352 C C   . GLU A 1 1086 ? 31.422  35.724 20.405  1.00 42.68  ? 1083 GLU A C   1 
ATOM 8353 O O   . GLU A 1 1086 ? 30.593  36.438 20.926  1.00 42.68  ? 1083 GLU A O   1 
ATOM 8354 C CB  . GLU A 1 1086 ? 31.462  33.346 21.160  1.00 81.23  ? 1083 GLU A CB  1 
ATOM 8355 C CG  . GLU A 1 1086 ? 31.950  32.315 22.154  1.00 81.23  ? 1083 GLU A CG  1 
ATOM 8356 C CD  . GLU A 1 1086 ? 33.381  31.850 21.883  1.00 81.23  ? 1083 GLU A CD  1 
ATOM 8357 O OE1 . GLU A 1 1086 ? 34.064  31.415 22.852  1.00 81.23  ? 1083 GLU A OE1 1 
ATOM 8358 O OE2 . GLU A 1 1086 ? 33.825  31.910 20.703  1.00 81.23  ? 1083 GLU A OE2 1 
ATOM 8359 N N   . PRO A 1 1087 ? 31.726  35.814 19.098  1.00 43.12  ? 1084 PRO A N   1 
ATOM 8360 C CA  . PRO A 1 1087 ? 30.947  36.645 18.191  1.00 43.12  ? 1084 PRO A CA  1 
ATOM 8361 C C   . PRO A 1 1087 ? 29.588  36.058 17.861  1.00 43.12  ? 1084 PRO A C   1 
ATOM 8362 O O   . PRO A 1 1087 ? 29.329  34.859 18.051  1.00 43.12  ? 1084 PRO A O   1 
ATOM 8363 C CB  . PRO A 1 1087 ? 31.768  36.631 16.907  1.00 31.86  ? 1084 PRO A CB  1 
ATOM 8364 C CG  . PRO A 1 1087 ? 33.091  36.110 17.294  1.00 31.86  ? 1084 PRO A CG  1 
ATOM 8365 C CD  . PRO A 1 1087 ? 32.843  35.172 18.386  1.00 31.86  ? 1084 PRO A CD  1 
ATOM 8366 N N   . ALA A 1 1088 ? 28.739  36.917 17.322  1.00 37.58  ? 1085 ALA A N   1 
ATOM 8367 C CA  . ALA A 1 1088 ? 27.366  36.574 17.115  1.00 37.58  ? 1085 ALA A CA  1 
ATOM 8368 C C   . ALA A 1 1088 ? 27.251  35.721 15.876  1.00 37.58  ? 1085 ALA A C   1 
ATOM 8369 O O   . ALA A 1 1088 ? 27.864  36.010 14.854  1.00 37.58  ? 1085 ALA A O   1 
ATOM 8370 C CB  . ALA A 1 1088 ? 26.548  37.839 16.977  1.00 6.87   ? 1085 ALA A CB  1 
ATOM 8371 N N   . THR A 1 1089 ? 26.457  34.670 15.948  1.00 25.17  ? 1086 THR A N   1 
ATOM 8372 C CA  . THR A 1 1089 ? 26.217  33.868 14.751  1.00 25.17  ? 1086 THR A CA  1 
ATOM 8373 C C   . THR A 1 1089 ? 24.719  33.663 14.543  1.00 25.17  ? 1086 THR A C   1 
ATOM 8374 O O   . THR A 1 1089 ? 23.950  33.605 15.513  1.00 25.17  ? 1086 THR A O   1 
ATOM 8375 C CB  . THR A 1 1089 ? 26.906  32.469 14.867  1.00 41.89  ? 1086 THR A CB  1 
ATOM 8376 O OG1 . THR A 1 1089 ? 26.140  31.614 15.735  1.00 41.89  ? 1086 THR A OG1 1 
ATOM 8377 C CG2 . THR A 1 1089 ? 28.297  32.619 15.447  1.00 41.89  ? 1086 THR A CG2 1 
ATOM 8378 N N   . GLY A 1 1090 ? 24.294  33.526 13.302  1.00 42.00  ? 1087 GLY A N   1 
ATOM 8379 C CA  . GLY A 1 1090 ? 22.903  33.145 13.060  1.00 42.00  ? 1087 GLY A CA  1 
ATOM 8380 C C   . GLY A 1 1090 ? 21.842  34.123 13.546  1.00 42.00  ? 1087 GLY A C   1 
ATOM 8381 O O   . GLY A 1 1090 ? 20.681  33.741 13.750  1.00 42.00  ? 1087 GLY A O   1 
ATOM 8382 N N   . PHE A 1 1091 ? 22.260  35.381 13.706  1.00 40.57  ? 1088 PHE A N   1 
ATOM 8383 C CA  . PHE A 1 1091 ? 21.384  36.462 14.096  1.00 40.57  ? 1088 PHE A CA  1 
ATOM 8384 C C   . PHE A 1 1091 ? 21.650  37.796 13.357  1.00 40.57  ? 1088 PHE A C   1 
ATOM 8385 O O   . PHE A 1 1091 ? 22.797  38.166 13.090  1.00 40.57  ? 1088 PHE A O   1 
ATOM 8386 C CB  . PHE A 1 1091 ? 21.502  36.682 15.598  1.00 40.25  ? 1088 PHE A CB  1 
ATOM 8387 C CG  . PHE A 1 1091 ? 20.635  35.786 16.422  1.00 40.25  ? 1088 PHE A CG  1 
ATOM 8388 C CD1 . PHE A 1 1091 ? 21.060  34.506 16.785  1.00 40.25  ? 1088 PHE A CD1 1 
ATOM 8389 C CD2 . PHE A 1 1091 ? 19.407  36.238 16.891  1.00 40.25  ? 1088 PHE A CD2 1 
ATOM 8390 C CE1 . PHE A 1 1091 ? 20.246  33.676 17.584  1.00 40.25  ? 1088 PHE A CE1 1 
ATOM 8391 C CE2 . PHE A 1 1091 ? 18.601  35.417 17.673  1.00 40.25  ? 1088 PHE A CE2 1 
ATOM 8392 C CZ  . PHE A 1 1091 ? 19.031  34.131 18.018  1.00 40.25  ? 1088 PHE A CZ  1 
ATOM 8393 N N   . ILE A 1 1092 ? 20.573  38.534 13.093  1.00 52.21  ? 1089 ILE A N   1 
ATOM 8394 C CA  . ILE A 1 1092 ? 20.635  39.813 12.383  1.00 52.21  ? 1089 ILE A CA  1 
ATOM 8395 C C   . ILE A 1 1092 ? 19.848  40.931 13.094  1.00 52.21  ? 1089 ILE A C   1 
ATOM 8396 O O   . ILE A 1 1092 ? 18.636  40.822 13.248  1.00 52.21  ? 1089 ILE A O   1 
ATOM 8397 C CB  . ILE A 1 1092 ? 20.071  39.631 10.956  1.00 60.40  ? 1089 ILE A CB  1 
ATOM 8398 C CG1 . ILE A 1 1092 ? 20.960  38.668 10.166  1.00 60.40  ? 1089 ILE A CG1 1 
ATOM 8399 C CG2 . ILE A 1 1092 ? 19.968  40.959 10.256  1.00 60.40  ? 1089 ILE A CG2 1 
ATOM 8400 C CD1 . ILE A 1 1092 ? 20.415  38.249 8.811   1.00 60.40  ? 1089 ILE A CD1 1 
ATOM 8401 N N   . ASP A 1 1093 ? 20.480  42.019 13.521  1.00 31.97  ? 1090 ASP A N   1 
ATOM 8402 C CA  . ASP A 1 1093 ? 19.588  43.104 13.955  1.00 31.97  ? 1090 ASP A CA  1 
ATOM 8403 C C   . ASP A 1 1093 ? 19.123  43.936 12.794  1.00 31.97  ? 1090 ASP A C   1 
ATOM 8404 O O   . ASP A 1 1093 ? 19.880  44.720 12.206  1.00 31.97  ? 1090 ASP A O   1 
ATOM 8405 C CB  . ASP A 1 1093 ? 20.036  43.982 15.170  1.00 35.19  ? 1090 ASP A CB  1 
ATOM 8406 C CG  . ASP A 1 1093 ? 21.429  44.381 15.084  1.00 35.19  ? 1090 ASP A CG  1 
ATOM 8407 O OD1 . ASP A 1 1093 ? 21.923  45.055 16.017  1.00 35.19  ? 1090 ASP A OD1 1 
ATOM 8408 O OD2 . ASP A 1 1093 ? 22.004  43.990 14.052  1.00 35.19  ? 1090 ASP A OD2 1 
ATOM 8409 N N   . GLY A 1 1094 ? 17.856  43.708 12.472  1.00 37.80  ? 1091 GLY A N   1 
ATOM 8410 C CA  . GLY A 1 1094 ? 17.151  44.544 11.549  1.00 37.80  ? 1091 GLY A CA  1 
ATOM 8411 C C   . GLY A 1 1094 ? 17.264  45.964 12.034  1.00 37.80  ? 1091 GLY A C   1 
ATOM 8412 O O   . GLY A 1 1094 ? 17.200  46.883 11.243  1.00 37.80  ? 1091 GLY A O   1 
ATOM 8413 N N   . ASP A 1 1095 ? 17.447  46.141 13.340  1.00 38.67  ? 1092 ASP A N   1 
ATOM 8414 C CA  . ASP A 1 1095 ? 17.703  47.448 13.901  1.00 38.67  ? 1092 ASP A CA  1 
ATOM 8415 C C   . ASP A 1 1095 ? 18.808  48.150 13.115  1.00 38.67  ? 1092 ASP A C   1 
ATOM 8416 O O   . ASP A 1 1095 ? 18.702  49.343 12.831  1.00 38.67  ? 1092 ASP A O   1 
ATOM 8417 C CB  . ASP A 1 1095 ? 18.108  47.291 15.350  1.00 31.42  ? 1092 ASP A CB  1 
ATOM 8418 C CG  . ASP A 1 1095 ? 16.967  47.552 16.304  1.00 31.42  ? 1092 ASP A CG  1 
ATOM 8419 O OD1 . ASP A 1 1095 ? 15.806  47.401 15.849  1.00 31.42  ? 1092 ASP A OD1 1 
ATOM 8420 O OD2 . ASP A 1 1095 ? 17.249  47.893 17.500  1.00 31.42  ? 1092 ASP A OD2 1 
ATOM 8421 N N   . LEU A 1 1096 ? 19.841  47.372 12.759  1.00 56.55  ? 1093 LEU A N   1 
ATOM 8422 C CA  . LEU A 1 1096 ? 21.025  47.812 11.995  1.00 56.55  ? 1093 LEU A CA  1 
ATOM 8423 C C   . LEU A 1 1096 ? 20.780  47.778 10.512  1.00 56.55  ? 1093 LEU A C   1 
ATOM 8424 O O   . LEU A 1 1096 ? 21.126  48.717 9.820   1.00 56.55  ? 1093 LEU A O   1 
ATOM 8425 C CB  . LEU A 1 1096 ? 22.227  46.912 12.284  1.00 29.40  ? 1093 LEU A CB  1 
ATOM 8426 C CG  . LEU A 1 1096 ? 23.643  47.226 11.760  1.00 29.40  ? 1093 LEU A CG  1 
ATOM 8427 C CD1 . LEU A 1 1096 ? 23.988  46.492 10.430  1.00 29.40  ? 1093 LEU A CD1 1 
ATOM 8428 C CD2 . LEU A 1 1096 ? 23.974  48.723 11.677  1.00 29.40  ? 1093 LEU A CD2 1 
ATOM 8429 N N   . ILE A 1 1097 ? 20.254  46.668 10.016  1.00 38.59  ? 1094 ILE A N   1 
ATOM 8430 C CA  . ILE A 1 1097 ? 19.763  46.622 8.650   1.00 38.59  ? 1094 ILE A CA  1 
ATOM 8431 C C   . ILE A 1 1097 ? 18.906  47.859 8.423   1.00 38.59  ? 1094 ILE A C   1 
ATOM 8432 O O   . ILE A 1 1097 ? 19.311  48.753 7.679   1.00 38.59  ? 1094 ILE A O   1 
ATOM 8433 C CB  . ILE A 1 1097 ? 18.904  45.377 8.388   1.00 29.66  ? 1094 ILE A CB  1 
ATOM 8434 C CG1 . ILE A 1 1097 ? 19.732  44.093 8.549   1.00 29.66  ? 1094 ILE A CG1 1 
ATOM 8435 C CG2 . ILE A 1 1097 ? 18.273  45.443 7.037   1.00 29.66  ? 1094 ILE A CG2 1 
ATOM 8436 C CD1 . ILE A 1 1097 ? 20.834  43.905 7.472   1.00 29.66  ? 1094 ILE A CD1 1 
ATOM 8437 N N   . GLU A 1 1098 ? 17.752  47.935 9.082   1.00 69.96  ? 1095 GLU A N   1 
ATOM 8438 C CA  . GLU A 1 1098 ? 16.852  49.078 8.943   1.00 69.96  ? 1095 GLU A CA  1 
ATOM 8439 C C   . GLU A 1 1098 ? 17.616  50.400 8.952   1.00 69.96  ? 1095 GLU A C   1 
ATOM 8440 O O   . GLU A 1 1098 ? 17.279  51.319 8.194   1.00 69.96  ? 1095 GLU A O   1 
ATOM 8441 C CB  . GLU A 1 1098 ? 15.768  49.075 10.036  1.00 57.00  ? 1095 GLU A CB  1 
ATOM 8442 C CG  . GLU A 1 1098 ? 14.614  48.084 9.797   1.00 57.00  ? 1095 GLU A CG  1 
ATOM 8443 C CD  . GLU A 1 1098 ? 13.493  48.165 10.844  1.00 57.00  ? 1095 GLU A CD  1 
ATOM 8444 O OE1 . GLU A 1 1098 ? 13.402  49.190 11.562  1.00 57.00  ? 1095 GLU A OE1 1 
ATOM 8445 O OE2 . GLU A 1 1098 ? 12.699  47.187 10.943  1.00 57.00  ? 1095 GLU A OE2 1 
ATOM 8446 N N   . SER A 1 1099 ? 18.653  50.478 9.791   1.00 55.36  ? 1096 SER A N   1 
ATOM 8447 C CA  . SER A 1 1099 ? 19.518  51.660 9.876   1.00 55.36  ? 1096 SER A CA  1 
ATOM 8448 C C   . SER A 1 1099 ? 19.851  52.199 8.468   1.00 55.36  ? 1096 SER A C   1 
ATOM 8449 O O   . SER A 1 1099 ? 19.822  53.405 8.229   1.00 55.36  ? 1096 SER A O   1 
ATOM 8450 C CB  . SER A 1 1099 ? 20.781  51.322 10.662  1.00 141.87 ? 1096 SER A CB  1 
ATOM 8451 O OG  . SER A 1 1099 ? 21.518  52.478 10.977  1.00 141.87 ? 1096 SER A OG  1 
ATOM 8452 N N   . PHE A 1 1100 ? 20.138  51.290 7.545   1.00 62.84  ? 1097 PHE A N   1 
ATOM 8453 C CA  . PHE A 1 1100 ? 20.305  51.599 6.129   1.00 62.84  ? 1097 PHE A CA  1 
ATOM 8454 C C   . PHE A 1 1100 ? 19.503  52.814 5.566   1.00 62.84  ? 1097 PHE A C   1 
ATOM 8455 O O   . PHE A 1 1100 ? 20.098  53.761 5.041   1.00 62.84  ? 1097 PHE A O   1 
ATOM 8456 C CB  . PHE A 1 1100 ? 20.007  50.335 5.335   1.00 73.23  ? 1097 PHE A CB  1 
ATOM 8457 C CG  . PHE A 1 1100 ? 20.345  50.422 3.894   1.00 73.23  ? 1097 PHE A CG  1 
ATOM 8458 C CD1 . PHE A 1 1100 ? 21.564  49.965 3.434   1.00 73.23  ? 1097 PHE A CD1 1 
ATOM 8459 C CD2 . PHE A 1 1100 ? 19.421  50.915 2.980   1.00 73.23  ? 1097 PHE A CD2 1 
ATOM 8460 C CE1 . PHE A 1 1100 ? 21.868  50.008 2.071   1.00 73.23  ? 1097 PHE A CE1 1 
ATOM 8461 C CE2 . PHE A 1 1100 ? 19.713  50.964 1.613   1.00 73.23  ? 1097 PHE A CE2 1 
ATOM 8462 C CZ  . PHE A 1 1100 ? 20.932  50.506 1.156   1.00 73.23  ? 1097 PHE A CZ  1 
ATOM 8463 N N   . LEU A 1 1101 ? 18.176  52.796 5.675   1.00 43.49  ? 1098 LEU A N   1 
ATOM 8464 C CA  . LEU A 1 1101 ? 17.345  53.885 5.103   1.00 43.49  ? 1098 LEU A CA  1 
ATOM 8465 C C   . LEU A 1 1101 ? 17.725  55.281 5.579   1.00 43.49  ? 1098 LEU A C   1 
ATOM 8466 O O   . LEU A 1 1101 ? 17.585  56.244 4.837   1.00 43.49  ? 1098 LEU A O   1 
ATOM 8467 C CB  . LEU A 1 1101 ? 15.847  53.656 5.328   1.00 43.24  ? 1098 LEU A CB  1 
ATOM 8468 C CG  . LEU A 1 1101 ? 15.330  52.268 4.888   1.00 43.24  ? 1098 LEU A CG  1 
ATOM 8469 C CD1 . LEU A 1 1101 ? 13.990  51.990 5.501   1.00 43.24  ? 1098 LEU A CD1 1 
ATOM 8470 C CD2 . LEU A 1 1101 ? 15.283  52.049 3.362   1.00 43.24  ? 1098 LEU A CD2 1 
ATOM 8471 N N   . ASP A 1 1102 ? 18.228  55.412 6.795   1.00 62.61  ? 1099 ASP A N   1 
ATOM 8472 C CA  . ASP A 1 1102 ? 18.600  56.742 7.270   1.00 62.61  ? 1099 ASP A CA  1 
ATOM 8473 C C   . ASP A 1 1102 ? 19.884  57.263 6.618   1.00 62.61  ? 1099 ASP A C   1 
ATOM 8474 O O   . ASP A 1 1102 ? 20.311  58.378 6.905   1.00 62.61  ? 1099 ASP A O   1 
ATOM 8475 C CB  . ASP A 1 1102 ? 18.706  56.767 8.794   1.00 98.89  ? 1099 ASP A CB  1 
ATOM 8476 C CG  . ASP A 1 1102 ? 17.463  56.218 9.469   1.00 98.89  ? 1099 ASP A CG  1 
ATOM 8477 O OD1 . ASP A 1 1102 ? 16.346  56.462 8.953   1.00 98.89  ? 1099 ASP A OD1 1 
ATOM 8478 O OD2 . ASP A 1 1102 ? 17.606  55.533 10.509  1.00 98.89  ? 1099 ASP A OD2 1 
ATOM 8479 N N   . ILE A 1 1103 ? 20.478  56.468 5.731   1.00 85.28  ? 1100 ILE A N   1 
ATOM 8480 C CA  . ILE A 1 1103 ? 21.765  56.807 5.109   1.00 85.28  ? 1100 ILE A CA  1 
ATOM 8481 C C   . ILE A 1 1103 ? 21.629  57.620 3.803   1.00 85.28  ? 1100 ILE A C   1 
ATOM 8482 O O   . ILE A 1 1103 ? 20.647  57.487 3.068   1.00 85.28  ? 1100 ILE A O   1 
ATOM 8483 C CB  . ILE A 1 1103 ? 22.604  55.524 4.882   1.00 90.79  ? 1100 ILE A CB  1 
ATOM 8484 C CG1 . ILE A 1 1103 ? 23.098  54.992 6.219   1.00 90.79  ? 1100 ILE A CG1 1 
ATOM 8485 C CG2 . ILE A 1 1103 ? 23.786  55.769 3.970   1.00 90.79  ? 1100 ILE A CG2 1 
ATOM 8486 C CD1 . ILE A 1 1103 ? 23.594  53.576 6.153   1.00 90.79  ? 1100 ILE A CD1 1 
ATOM 8487 N N   . SER A 1 1104 ? 22.622  58.468 3.539   1.00 109.19 ? 1101 SER A N   1 
ATOM 8488 C CA  . SER A 1 1104 ? 22.704  59.227 2.291   1.00 109.19 ? 1101 SER A CA  1 
ATOM 8489 C C   . SER A 1 1104 ? 22.980  58.297 1.109   1.00 109.19 ? 1101 SER A C   1 
ATOM 8490 O O   . SER A 1 1104 ? 23.773  57.364 1.228   1.00 109.19 ? 1101 SER A O   1 
ATOM 8491 C CB  . SER A 1 1104 ? 23.817  60.271 2.395   1.00 46.90  ? 1101 SER A CB  1 
ATOM 8492 O OG  . SER A 1 1104 ? 25.086  59.637 2.579   1.00 46.90  ? 1101 SER A OG  1 
ATOM 8493 N N   . ARG A 1 1105 ? 22.344  58.564 -0.033  1.00 171.25 ? 1102 ARG A N   1 
ATOM 8494 C CA  . ARG A 1 1105 ? 22.520  57.722 -1.228  1.00 171.25 ? 1102 ARG A CA  1 
ATOM 8495 C C   . ARG A 1 1105 ? 23.991  57.529 -1.657  1.00 171.25 ? 1102 ARG A C   1 
ATOM 8496 O O   . ARG A 1 1105 ? 24.346  56.458 -2.150  1.00 171.25 ? 1102 ARG A O   1 
ATOM 8497 C CB  . ARG A 1 1105 ? 21.624  58.175 -2.397  1.00 122.00 ? 1102 ARG A CB  1 
ATOM 8498 C CG  . ARG A 1 1105 ? 21.491  57.129 -3.511  1.00 122.00 ? 1102 ARG A CG  1 
ATOM 8499 C CD  . ARG A 1 1105 ? 20.113  57.104 -4.179  1.00 122.00 ? 1102 ARG A CD  1 
ATOM 8500 N NE  . ARG A 1 1105 ? 20.033  56.011 -5.157  1.00 122.00 ? 1102 ARG A NE  1 
ATOM 8501 C CZ  . ARG A 1 1105 ? 18.926  55.621 -5.790  1.00 122.00 ? 1102 ARG A CZ  1 
ATOM 8502 N NH1 . ARG A 1 1105 ? 17.765  56.225 -5.567  1.00 122.00 ? 1102 ARG A NH1 1 
ATOM 8503 N NH2 . ARG A 1 1105 ? 18.981  54.617 -6.655  1.00 122.00 ? 1102 ARG A NH2 1 
ATOM 8504 N N   . PRO A 1 1106 ? 24.842  58.564 -1.483  1.00 91.08  ? 1103 PRO A N   1 
ATOM 8505 C CA  . PRO A 1 1106 ? 26.306  58.363 -1.604  1.00 91.08  ? 1103 PRO A CA  1 
ATOM 8506 C C   . PRO A 1 1106 ? 26.847  57.227 -0.723  1.00 91.08  ? 1103 PRO A C   1 
ATOM 8507 O O   . PRO A 1 1106 ? 27.302  56.206 -1.243  1.00 91.08  ? 1103 PRO A O   1 
ATOM 8508 C CB  . PRO A 1 1106 ? 26.905  59.713 -1.157  1.00 78.14  ? 1103 PRO A CB  1 
ATOM 8509 C CG  . PRO A 1 1106 ? 25.740  60.543 -0.632  1.00 78.14  ? 1103 PRO A CG  1 
ATOM 8510 C CD  . PRO A 1 1106 ? 24.495  59.980 -1.236  1.00 78.14  ? 1103 PRO A CD  1 
ATOM 8511 N N   . LYS A 1 1107 ? 26.776  57.407 0.598   1.00 90.60  ? 1104 LYS A N   1 
ATOM 8512 C CA  . LYS A 1 1107 ? 27.199  56.390 1.564   1.00 90.60  ? 1104 LYS A CA  1 
ATOM 8513 C C   . LYS A 1 1107 ? 26.443  55.071 1.382   1.00 90.60  ? 1104 LYS A C   1 
ATOM 8514 O O   . LYS A 1 1107 ? 26.889  54.019 1.827   1.00 90.60  ? 1104 LYS A O   1 
ATOM 8515 C CB  . LYS A 1 1107 ? 27.060  56.924 2.988   1.00 165.14 ? 1104 LYS A CB  1 
ATOM 8516 C CG  . LYS A 1 1107 ? 27.939  58.130 3.257   1.00 165.14 ? 1104 LYS A CG  1 
ATOM 8517 C CD  . LYS A 1 1107 ? 28.733  57.966 4.543   1.00 165.14 ? 1104 LYS A CD  1 
ATOM 8518 C CE  . LYS A 1 1107 ? 30.014  58.792 4.513   1.00 165.14 ? 1104 LYS A CE  1 
ATOM 8519 N NZ  . LYS A 1 1107 ? 30.936  58.411 3.400   1.00 165.14 ? 1104 LYS A NZ  1 
ATOM 8520 N N   . MET A 1 1108 ? 25.316  55.152 0.686   1.00 56.81  ? 1105 MET A N   1 
ATOM 8521 C CA  . MET A 1 1108 ? 24.455  54.027 0.374   1.00 56.81  ? 1105 MET A CA  1 
ATOM 8522 C C   . MET A 1 1108 ? 24.954  53.298 -0.869  1.00 56.81  ? 1105 MET A C   1 
ATOM 8523 O O   . MET A 1 1108 ? 24.759  52.086 -1.021  1.00 56.81  ? 1105 MET A O   1 
ATOM 8524 C CB  . MET A 1 1108 ? 23.045  54.566 0.116   1.00 69.51  ? 1105 MET A CB  1 
ATOM 8525 C CG  . MET A 1 1108 ? 21.929  53.547 0.134   1.00 69.51  ? 1105 MET A CG  1 
ATOM 8526 S SD  . MET A 1 1108 ? 20.276  54.212 -0.207  1.00 69.51  ? 1105 MET A SD  1 
ATOM 8527 C CE  . MET A 1 1108 ? 20.133  55.598 0.932   1.00 69.51  ? 1105 MET A CE  1 
ATOM 8528 N N   . GLN A 1 1109 ? 25.577  54.044 -1.783  1.00 83.87  ? 1106 GLN A N   1 
ATOM 8529 C CA  . GLN A 1 1109 ? 26.137  53.444 -2.997  1.00 83.87  ? 1106 GLN A CA  1 
ATOM 8530 C C   . GLN A 1 1109 ? 27.280  52.525 -2.621  1.00 83.87  ? 1106 GLN A C   1 
ATOM 8531 O O   . GLN A 1 1109 ? 27.330  51.392 -3.084  1.00 83.87  ? 1106 GLN A O   1 
ATOM 8532 C CB  . GLN A 1 1109 ? 26.609  54.507 -4.002  1.00 81.06  ? 1106 GLN A CB  1 
ATOM 8533 C CG  . GLN A 1 1109 ? 25.535  55.070 -4.948  1.00 81.06  ? 1106 GLN A CG  1 
ATOM 8534 C CD  . GLN A 1 1109 ? 24.898  54.020 -5.867  1.00 81.06  ? 1106 GLN A CD  1 
ATOM 8535 O OE1 . GLN A 1 1109 ? 25.354  52.875 -5.963  1.00 81.06  ? 1106 GLN A OE1 1 
ATOM 8536 N NE2 . GLN A 1 1109 ? 23.828  54.416 -6.542  1.00 81.06  ? 1106 GLN A NE2 1 
ATOM 8537 N N   . GLU A 1 1110 ? 28.165  53.018 -1.752  1.00 70.58  ? 1107 GLU A N   1 
ATOM 8538 C CA  . GLU A 1 1110 ? 29.334  52.267 -1.260  1.00 70.58  ? 1107 GLU A CA  1 
ATOM 8539 C C   . GLU A 1 1110 ? 28.959  50.890 -0.737  1.00 70.58  ? 1107 GLU A C   1 
ATOM 8540 O O   . GLU A 1 1110 ? 29.694  49.903 -0.922  1.00 70.58  ? 1107 GLU A O   1 
ATOM 8541 C CB  . GLU A 1 1110 ? 30.039  53.017 -0.133  1.00 70.77  ? 1107 GLU A CB  1 
ATOM 8542 C CG  . GLU A 1 1110 ? 30.020  54.527 -0.276  1.00 70.77  ? 1107 GLU A CG  1 
ATOM 8543 C CD  . GLU A 1 1110 ? 30.922  55.225 0.724   1.00 70.77  ? 1107 GLU A CD  1 
ATOM 8544 O OE1 . GLU A 1 1110 ? 31.749  54.537 1.382   1.00 70.77  ? 1107 GLU A OE1 1 
ATOM 8545 O OE2 . GLU A 1 1110 ? 30.794  56.461 0.847   1.00 70.77  ? 1107 GLU A OE2 1 
ATOM 8546 N N   . VAL A 1 1111 ? 27.812  50.841 -0.072  1.00 97.56  ? 1108 VAL A N   1 
ATOM 8547 C CA  . VAL A 1 1111 ? 27.292  49.614 0.488   1.00 97.56  ? 1108 VAL A CA  1 
ATOM 8548 C C   . VAL A 1 1111 ? 27.222  48.547 -0.605  1.00 97.56  ? 1108 VAL A C   1 
ATOM 8549 O O   . VAL A 1 1111 ? 27.092  47.356 -0.327  1.00 97.56  ? 1108 VAL A O   1 
ATOM 8550 C CB  . VAL A 1 1111 ? 25.929  49.877 1.150   1.00 86.10  ? 1108 VAL A CB  1 
ATOM 8551 C CG1 . VAL A 1 1111 ? 25.299  48.589 1.653   1.00 86.10  ? 1108 VAL A CG1 1 
ATOM 8552 C CG2 . VAL A 1 1111 ? 26.088  50.879 2.296   1.00 86.10  ? 1108 VAL A CG2 1 
ATOM 8553 N N   . VAL A 1 1112 ? 27.344  48.976 -1.856  1.00 113.15 ? 1109 VAL A N   1 
ATOM 8554 C CA  . VAL A 1 1112 ? 27.419  48.024 -2.953  1.00 113.15 ? 1109 VAL A CA  1 
ATOM 8555 C C   . VAL A 1 1112 ? 28.609  48.195 -3.890  1.00 113.15 ? 1109 VAL A C   1 
ATOM 8556 O O   . VAL A 1 1112 ? 29.018  49.303 -4.233  1.00 113.15 ? 1109 VAL A O   1 
ATOM 8557 C CB  . VAL A 1 1112 ? 26.155  48.021 -3.787  1.00 44.41  ? 1109 VAL A CB  1 
ATOM 8558 C CG1 . VAL A 1 1112 ? 26.245  46.908 -4.872  1.00 44.41  ? 1109 VAL A CG1 1 
ATOM 8559 C CG2 . VAL A 1 1112 ? 24.905  47.888 -2.873  1.00 44.41  ? 1109 VAL A CG2 1 
ATOM 8560 N N   . ALA A 1 1113 ? 29.137  47.052 -4.298  1.00 138.92 ? 1110 ALA A N   1 
ATOM 8561 C CA  . ALA A 1 1113 ? 30.192  46.952 -5.265  1.00 138.92 ? 1110 ALA A CA  1 
ATOM 8562 C C   . ALA A 1 1113 ? 30.030  45.553 -5.818  1.00 138.92 ? 1110 ALA A C   1 
ATOM 8563 O O   . ALA A 1 1113 ? 30.657  45.185 -6.809  1.00 138.92 ? 1110 ALA A O   1 
ATOM 8564 C CB  . ALA A 1 1113 ? 31.497  47.104 -4.588  1.00 38.41  ? 1110 ALA A CB  1 
ATOM 8565 N N   . ASN A 1 1114 ? 29.186  44.785 -5.121  1.00 73.87  ? 1111 ASN A N   1 
ATOM 8566 C CA  . ASN A 1 1114 ? 28.644  43.473 -5.557  1.00 73.87  ? 1111 ASN A CA  1 
ATOM 8567 C C   . ASN A 1 1114 ? 27.522  42.947 -4.640  1.00 73.87  ? 1111 ASN A C   1 
ATOM 8568 O O   . ASN A 1 1114 ? 27.016  41.837 -4.821  1.00 73.87  ? 1111 ASN A O   1 
ATOM 8569 C CB  . ASN A 1 1114 ? 29.741  42.399 -5.779  1.00 108.39 ? 1111 ASN A CB  1 
ATOM 8570 C CG  . ASN A 1 1114 ? 30.777  42.336 -4.652  1.00 108.39 ? 1111 ASN A CG  1 
ATOM 8571 O OD1 . ASN A 1 1114 ? 30.941  43.277 -3.873  1.00 108.39 ? 1111 ASN A OD1 1 
ATOM 8572 N ND2 . ASN A 1 1114 ? 31.500  41.219 -4.587  1.00 108.39 ? 1111 ASN A ND2 1 
ATOM 8573 N N   . ARG A 1 1125 ? 22.155  35.266 -9.875  1.00 82.12  ? 1122 ARG A N   1 
ATOM 8574 C CA  . ARG A 1 1125 ? 22.564  36.223 -8.841  1.00 82.12  ? 1122 ARG A CA  1 
ATOM 8575 C C   . ARG A 1 1125 ? 23.084  37.540 -9.435  1.00 82.12  ? 1122 ARG A C   1 
ATOM 8576 O O   . ARG A 1 1125 ? 23.731  37.544 -10.490 1.00 82.12  ? 1122 ARG A O   1 
ATOM 8577 C CB  . ARG A 1 1125 ? 23.599  35.602 -7.894  1.00 119.75 ? 1122 ARG A CB  1 
ATOM 8578 C CG  . ARG A 1 1125 ? 24.832  35.060 -8.586  1.00 119.75 ? 1122 ARG A CG  1 
ATOM 8579 C CD  . ARG A 1 1125 ? 26.013  35.039 -7.645  1.00 119.75 ? 1122 ARG A CD  1 
ATOM 8580 N NE  . ARG A 1 1125 ? 27.283  35.185 -8.364  1.00 119.75 ? 1122 ARG A NE  1 
ATOM 8581 C CZ  . ARG A 1 1125 ? 28.078  36.258 -8.315  1.00 119.75 ? 1122 ARG A CZ  1 
ATOM 8582 N NH1 . ARG A 1 1125 ? 27.764  37.314 -7.573  1.00 119.75 ? 1122 ARG A NH1 1 
ATOM 8583 N NH2 . ARG A 1 1125 ? 29.205  36.271 -9.013  1.00 119.75 ? 1122 ARG A NH2 1 
ATOM 8584 N N   . GLU A 1 1126 ? 22.791  38.646 -8.741  1.00 146.65 ? 1123 GLU A N   1 
ATOM 8585 C CA  . GLU A 1 1126 ? 23.071  40.008 -9.223  1.00 146.65 ? 1123 GLU A CA  1 
ATOM 8586 C C   . GLU A 1 1126 ? 23.448  40.979 -8.082  1.00 146.65 ? 1123 GLU A C   1 
ATOM 8587 O O   . GLU A 1 1126 ? 23.499  40.586 -6.913  1.00 146.65 ? 1123 GLU A O   1 
ATOM 8588 C CB  . GLU A 1 1126 ? 21.852  40.536 -9.991  1.00 133.08 ? 1123 GLU A CB  1 
ATOM 8589 C CG  . GLU A 1 1126 ? 22.172  41.501 -11.130 1.00 133.08 ? 1123 GLU A CG  1 
ATOM 8590 C CD  . GLU A 1 1126 ? 21.049  42.497 -11.394 1.00 133.08 ? 1123 GLU A CD  1 
ATOM 8591 O OE1 . GLU A 1 1126 ? 19.889  42.071 -11.596 1.00 133.08 ? 1123 GLU A OE1 1 
ATOM 8592 O OE2 . GLU A 1 1126 ? 21.330  43.714 -11.399 1.00 133.08 ? 1123 GLU A OE2 1 
ATOM 8593 N N   . ALA A 1 1127 ? 23.722  42.238 -8.435  1.00 144.99 ? 1124 ALA A N   1 
ATOM 8594 C CA  . ALA A 1 1127 ? 24.035  43.302 -7.468  1.00 144.99 ? 1124 ALA A CA  1 
ATOM 8595 C C   . ALA A 1 1127 ? 23.454  44.633 -7.932  1.00 144.99 ? 1124 ALA A C   1 
ATOM 8596 O O   . ALA A 1 1127 ? 23.468  44.932 -9.132  1.00 144.99 ? 1124 ALA A O   1 
ATOM 8597 C CB  . ALA A 1 1127 ? 25.530  43.434 -7.288  1.00 108.82 ? 1124 ALA A CB  1 
ATOM 8598 N N   . THR A 1 1128 ? 22.966  45.437 -6.985  1.00 105.00 ? 1125 THR A N   1 
ATOM 8599 C CA  . THR A 1 1128 ? 22.237  46.668 -7.330  1.00 105.00 ? 1125 THR A CA  1 
ATOM 8600 C C   . THR A 1 1128 ? 22.485  47.831 -6.381  1.00 105.00 ? 1125 THR A C   1 
ATOM 8601 O O   . THR A 1 1128 ? 23.145  47.672 -5.360  1.00 105.00 ? 1125 THR A O   1 
ATOM 8602 C CB  . THR A 1 1128 ? 20.721  46.411 -7.400  1.00 57.95  ? 1125 THR A CB  1 
ATOM 8603 O OG1 . THR A 1 1128 ? 20.478  45.238 -8.201  1.00 57.95  ? 1125 THR A OG1 1 
ATOM 8604 C CG2 . THR A 1 1128 ? 19.963  47.646 -7.984  1.00 57.95  ? 1125 THR A CG2 1 
ATOM 8605 N N   . ALA A 1 1129 ? 21.918  48.990 -6.730  1.00 85.54  ? 1126 ALA A N   1 
ATOM 8606 C CA  . ALA A 1 1129 ? 22.115  50.252 -5.996  1.00 85.54  ? 1126 ALA A CA  1 
ATOM 8607 C C   . ALA A 1 1129 ? 20.935  50.679 -5.101  1.00 85.54  ? 1126 ALA A C   1 
ATOM 8608 O O   . ALA A 1 1129 ? 21.090  51.535 -4.231  1.00 85.54  ? 1126 ALA A O   1 
ATOM 8609 C CB  . ALA A 1 1129 ? 22.467  51.372 -6.982  1.00 114.05 ? 1126 ALA A CB  1 
ATOM 8610 N N   . ASP A 1 1130 ? 19.768  50.080 -5.320  1.00 80.98  ? 1127 ASP A N   1 
ATOM 8611 C CA  . ASP A 1 1130 ? 18.537  50.462 -4.617  1.00 80.98  ? 1127 ASP A CA  1 
ATOM 8612 C C   . ASP A 1 1130 ? 17.536  49.324 -4.722  1.00 80.98  ? 1127 ASP A C   1 
ATOM 8613 O O   . ASP A 1 1130 ? 16.335  49.490 -4.508  1.00 80.98  ? 1127 ASP A O   1 
ATOM 8614 C CB  . ASP A 1 1130 ? 17.948  51.740 -5.219  1.00 128.80 ? 1127 ASP A CB  1 
ATOM 8615 C CG  . ASP A 1 1130 ? 17.825  51.668 -6.726  1.00 128.80 ? 1127 ASP A CG  1 
ATOM 8616 O OD1 . ASP A 1 1130 ? 18.871  51.600 -7.412  1.00 128.80 ? 1127 ASP A OD1 1 
ATOM 8617 O OD2 . ASP A 1 1130 ? 16.680  51.682 -7.221  1.00 128.80 ? 1127 ASP A OD2 1 
ATOM 8618 N N   . ASP A 1 1131 ? 18.047  48.162 -5.099  1.00 116.62 ? 1128 ASP A N   1 
ATOM 8619 C CA  . ASP A 1 1131 ? 17.286  46.946 -4.991  1.00 116.62 ? 1128 ASP A CA  1 
ATOM 8620 C C   . ASP A 1 1131 ? 17.110  46.735 -3.500  1.00 116.62 ? 1128 ASP A C   1 
ATOM 8621 O O   . ASP A 1 1131 ? 16.074  46.250 -3.048  1.00 116.62 ? 1128 ASP A O   1 
ATOM 8622 C CB  . ASP A 1 1131 ? 18.080  45.782 -5.579  1.00 120.86 ? 1128 ASP A CB  1 
ATOM 8623 C CG  . ASP A 1 1131 ? 17.283  44.959 -6.569  1.00 120.86 ? 1128 ASP A CG  1 
ATOM 8624 O OD1 . ASP A 1 1131 ? 17.851  43.988 -7.111  1.00 120.86 ? 1128 ASP A OD1 1 
ATOM 8625 O OD2 . ASP A 1 1131 ? 16.098  45.279 -6.811  1.00 120.86 ? 1128 ASP A OD2 1 
ATOM 8626 N N   . LEU A 1 1132 ? 18.132  47.140 -2.743  1.00 54.25  ? 1129 LEU A N   1 
ATOM 8627 C CA  . LEU A 1 1132 ? 18.250  46.826 -1.308  1.00 54.25  ? 1129 LEU A CA  1 
ATOM 8628 C C   . LEU A 1 1132 ? 17.355  47.727 -0.496  1.00 54.25  ? 1129 LEU A C   1 
ATOM 8629 O O   . LEU A 1 1132 ? 16.624  47.262 0.383   1.00 54.25  ? 1129 LEU A O   1 
ATOM 8630 C CB  . LEU A 1 1132 ? 19.710  46.929 -0.841  1.00 63.68  ? 1129 LEU A CB  1 
ATOM 8631 C CG  . LEU A 1 1132 ? 20.624  45.722 -1.125  1.00 63.68  ? 1129 LEU A CG  1 
ATOM 8632 C CD1 . LEU A 1 1132 ? 20.399  44.629 -0.123  1.00 63.68  ? 1129 LEU A CD1 1 
ATOM 8633 C CD2 . LEU A 1 1132 ? 20.503  45.129 -2.545  1.00 63.68  ? 1129 LEU A CD2 1 
ATOM 8634 N N   . ILE A 1 1133 ? 17.406  49.015 -0.818  1.00 72.16  ? 1130 ILE A N   1 
ATOM 8635 C CA  . ILE A 1 1133 ? 16.391  49.973 -0.385  1.00 72.16  ? 1130 ILE A CA  1 
ATOM 8636 C C   . ILE A 1 1133 ? 14.978  49.335 -0.387  1.00 72.16  ? 1130 ILE A C   1 
ATOM 8637 O O   . ILE A 1 1133 ? 14.144  49.629 0.477   1.00 72.16  ? 1130 ILE A O   1 
ATOM 8638 C CB  . ILE A 1 1133 ? 16.447  51.240 -1.270  1.00 81.79  ? 1130 ILE A CB  1 
ATOM 8639 C CG1 . ILE A 1 1133 ? 16.372  52.507 -0.421  1.00 81.79  ? 1130 ILE A CG1 1 
ATOM 8640 C CG2 . ILE A 1 1133 ? 15.369  51.224 -2.357  1.00 81.79  ? 1130 ILE A CG2 1 
ATOM 8641 C CD1 . ILE A 1 1133 ? 17.129  53.695 -1.030  1.00 81.79  ? 1130 ILE A CD1 1 
ATOM 8642 N N   . LYS A 1 1134 ? 14.744  48.425 -1.331  1.00 75.31  ? 1131 LYS A N   1 
ATOM 8643 C CA  . LYS A 1 1134 ? 13.449  47.764 -1.480  1.00 75.31  ? 1131 LYS A CA  1 
ATOM 8644 C C   . LYS A 1 1134 ? 13.341  46.477 -0.640  1.00 75.31  ? 1131 LYS A C   1 
ATOM 8645 O O   . LYS A 1 1134 ? 12.260  46.135 -0.152  1.00 75.31  ? 1131 LYS A O   1 
ATOM 8646 C CB  . LYS A 1 1134 ? 13.191  47.469 -2.963  1.00 134.76 ? 1131 LYS A CB  1 
ATOM 8647 C CG  . LYS A 1 1134 ? 11.756  47.679 -3.430  1.00 134.76 ? 1131 LYS A CG  1 
ATOM 8648 C CD  . LYS A 1 1134 ? 11.724  48.389 -4.783  1.00 134.76 ? 1131 LYS A CD  1 
ATOM 8649 C CE  . LYS A 1 1134 ? 12.161  49.855 -4.652  1.00 134.76 ? 1131 LYS A CE  1 
ATOM 8650 N NZ  . LYS A 1 1134 ? 12.434  50.514 -5.964  1.00 134.76 ? 1131 LYS A NZ  1 
ATOM 8651 N N   . VAL A 1 1135 ? 14.455  45.759 -0.493  1.00 65.85  ? 1132 VAL A N   1 
ATOM 8652 C CA  . VAL A 1 1135 ? 14.515  44.614 0.412   1.00 65.85  ? 1132 VAL A CA  1 
ATOM 8653 C C   . VAL A 1 1135 ? 14.248  45.090 1.847   1.00 65.85  ? 1132 VAL A C   1 
ATOM 8654 O O   . VAL A 1 1135 ? 13.457  44.478 2.579   1.00 65.85  ? 1132 VAL A O   1 
ATOM 8655 C CB  . VAL A 1 1135 ? 15.900  43.923 0.348   1.00 71.53  ? 1132 VAL A CB  1 
ATOM 8656 C CG1 . VAL A 1 1135 ? 16.068  42.910 1.484   1.00 71.53  ? 1132 VAL A CG1 1 
ATOM 8657 C CG2 . VAL A 1 1135 ? 16.119  43.271 -1.013  1.00 71.53  ? 1132 VAL A CG2 1 
ATOM 8658 N N   . VAL A 1 1136 ? 14.912  46.186 2.227   1.00 80.54  ? 1133 VAL A N   1 
ATOM 8659 C CA  . VAL A 1 1136 ? 14.851  46.714 3.588   1.00 80.54  ? 1133 VAL A CA  1 
ATOM 8660 C C   . VAL A 1 1136 ? 13.463  47.260 3.945   1.00 80.54  ? 1133 VAL A C   1 
ATOM 8661 O O   . VAL A 1 1136 ? 12.961  47.013 5.045   1.00 80.54  ? 1133 VAL A O   1 
ATOM 8662 C CB  . VAL A 1 1136 ? 15.965  47.749 3.846   1.00 45.55  ? 1133 VAL A CB  1 
ATOM 8663 C CG1 . VAL A 1 1136 ? 15.660  48.602 5.060   1.00 45.55  ? 1133 VAL A CG1 1 
ATOM 8664 C CG2 . VAL A 1 1136 ? 17.281  47.048 4.081   1.00 45.55  ? 1133 VAL A CG2 1 
ATOM 8665 N N   . GLU A 1 1137 ? 12.844  47.992 3.020   1.00 70.20  ? 1134 GLU A N   1 
ATOM 8666 C CA  . GLU A 1 1137 ? 11.449  48.399 3.185   1.00 70.20  ? 1134 GLU A CA  1 
ATOM 8667 C C   . GLU A 1 1137 ? 10.610  47.169 3.498   1.00 70.20  ? 1134 GLU A C   1 
ATOM 8668 O O   . GLU A 1 1137 ? 9.968   47.096 4.559   1.00 70.20  ? 1134 GLU A O   1 
ATOM 8669 C CB  . GLU A 1 1137 ? 10.922  49.085 1.925   1.00 91.08  ? 1134 GLU A CB  1 
ATOM 8670 C CG  . GLU A 1 1137 ? 11.269  50.559 1.822   1.00 91.08  ? 1134 GLU A CG  1 
ATOM 8671 C CD  . GLU A 1 1137 ? 10.879  51.157 0.476   1.00 91.08  ? 1134 GLU A CD  1 
ATOM 8672 O OE1 . GLU A 1 1137 ? 11.038  50.475 -0.564  1.00 91.08  ? 1134 GLU A OE1 1 
ATOM 8673 O OE2 . GLU A 1 1137 ? 10.416  52.317 0.459   1.00 91.08  ? 1134 GLU A OE2 1 
ATOM 8674 N N   . GLU A 1 1138 ? 10.654  46.190 2.596   1.00 89.16  ? 1135 GLU A N   1 
ATOM 8675 C CA  . GLU A 1 1138 ? 9.842   44.997 2.755   1.00 89.16  ? 1135 GLU A CA  1 
ATOM 8676 C C   . GLU A 1 1138 ? 9.935   44.456 4.164   1.00 89.16  ? 1135 GLU A C   1 
ATOM 8677 O O   . GLU A 1 1138 ? 8.973   43.874 4.652   1.00 89.16  ? 1135 GLU A O   1 
ATOM 8678 C CB  . GLU A 1 1138 ? 10.182  43.902 1.739   1.00 158.60 ? 1135 GLU A CB  1 
ATOM 8679 C CG  . GLU A 1 1138 ? 9.068   43.645 0.723   1.00 158.60 ? 1135 GLU A CG  1 
ATOM 8680 C CD  . GLU A 1 1138 ? 8.589   42.198 0.718   1.00 158.60 ? 1135 GLU A CD  1 
ATOM 8681 O OE1 . GLU A 1 1138 ? 7.961   41.767 1.710   1.00 158.60 ? 1135 GLU A OE1 1 
ATOM 8682 O OE2 . GLU A 1 1138 ? 8.824   41.495 -0.285  1.00 158.60 ? 1135 GLU A OE2 1 
ATOM 8683 N N   . LEU A 1 1139 ? 11.071  44.671 4.827   1.00 68.83  ? 1136 LEU A N   1 
ATOM 8684 C CA  . LEU A 1 1139 ? 11.276  44.134 6.163   1.00 68.83  ? 1136 LEU A CA  1 
ATOM 8685 C C   . LEU A 1 1139 ? 10.623  44.979 7.221   1.00 68.83  ? 1136 LEU A C   1 
ATOM 8686 O O   . LEU A 1 1139 ? 9.915   44.452 8.063   1.00 68.83  ? 1136 LEU A O   1 
ATOM 8687 C CB  . LEU A 1 1139 ? 12.754  43.967 6.475   1.00 53.41  ? 1136 LEU A CB  1 
ATOM 8688 C CG  . LEU A 1 1139 ? 13.505  42.824 5.778   1.00 53.41  ? 1136 LEU A CG  1 
ATOM 8689 C CD1 . LEU A 1 1139 ? 15.027  43.023 5.933   1.00 53.41  ? 1136 LEU A CD1 1 
ATOM 8690 C CD2 . LEU A 1 1139 ? 13.079  41.444 6.292   1.00 53.41  ? 1136 LEU A CD2 1 
ATOM 8691 N N   . THR A 1 1140 ? 10.840  46.289 7.169   1.00 59.97  ? 1137 THR A N   1 
ATOM 8692 C CA  . THR A 1 1140 ? 10.290  47.198 8.182   1.00 59.97  ? 1137 THR A CA  1 
ATOM 8693 C C   . THR A 1 1140 ? 8.853   46.866 8.470   1.00 59.97  ? 1137 THR A C   1 
ATOM 8694 O O   . THR A 1 1140 ? 8.357   47.167 9.546   1.00 59.97  ? 1137 THR A O   1 
ATOM 8695 C CB  . THR A 1 1140 ? 10.263  48.660 7.732   1.00 42.59  ? 1137 THR A CB  1 
ATOM 8696 O OG1 . THR A 1 1140 ? 9.543   48.740 6.483   1.00 42.59  ? 1137 THR A OG1 1 
ATOM 8697 C CG2 . THR A 1 1140 ? 11.697  49.246 7.609   1.00 42.59  ? 1137 THR A CG2 1 
ATOM 8698 N N   . ARG A 1 1141 ? 8.178   46.253 7.508   1.00 58.22  ? 1138 ARG A N   1 
ATOM 8699 C CA  . ARG A 1 1141 ? 6.764   45.976 7.666   1.00 58.22  ? 1138 ARG A CA  1 
ATOM 8700 C C   . ARG A 1 1141 ? 6.426   44.625 8.347   1.00 58.22  ? 1138 ARG A C   1 
ATOM 8701 O O   . ARG A 1 1141 ? 5.299   44.126 8.223   1.00 58.22  ? 1138 ARG A O   1 
ATOM 8702 C CB  . ARG A 1 1141 ? 6.035   46.177 6.334   1.00 104.68 ? 1138 ARG A CB  1 
ATOM 8703 C CG  . ARG A 1 1141 ? 6.055   47.638 5.875   1.00 104.68 ? 1138 ARG A CG  1 
ATOM 8704 C CD  . ARG A 1 1141 ? 5.505   47.830 4.468   1.00 104.68 ? 1138 ARG A CD  1 
ATOM 8705 N NE  . ARG A 1 1141 ? 5.737   46.668 3.606   1.00 104.68 ? 1138 ARG A NE  1 
ATOM 8706 C CZ  . ARG A 1 1141 ? 6.143   46.731 2.339   1.00 104.68 ? 1138 ARG A CZ  1 
ATOM 8707 N NH1 . ARG A 1 1141 ? 6.396   47.908 1.776   1.00 104.68 ? 1138 ARG A NH1 1 
ATOM 8708 N NH2 . ARG A 1 1141 ? 6.321   45.614 1.641   1.00 104.68 ? 1138 ARG A NH2 1 
ATOM 8709 N N   . ILE A 1 1142 ? 7.374   44.043 9.085   1.00 50.38  ? 1139 ILE A N   1 
ATOM 8710 C CA  . ILE A 1 1142 ? 7.061   42.842 9.877   1.00 50.38  ? 1139 ILE A CA  1 
ATOM 8711 C C   . ILE A 1 1142 ? 6.460   43.204 11.235  1.00 50.38  ? 1139 ILE A C   1 
ATOM 8712 O O   . ILE A 1 1142 ? 5.969   42.337 11.957  1.00 50.38  ? 1139 ILE A O   1 
ATOM 8713 C CB  . ILE A 1 1142 ? 8.286   41.946 10.137  1.00 65.91  ? 1139 ILE A CB  1 
ATOM 8714 C CG1 . ILE A 1 1142 ? 8.922   41.473 8.841   1.00 65.91  ? 1139 ILE A CG1 1 
ATOM 8715 C CG2 . ILE A 1 1142 ? 7.860   40.704 10.898  1.00 65.91  ? 1139 ILE A CG2 1 
ATOM 8716 C CD1 . ILE A 1 1142 ? 10.049  40.494 9.077   1.00 65.91  ? 1139 ILE A CD1 1 
ATOM 8717 N N   . HIS A 1 1143 ? 6.506   44.483 11.587  1.00 45.40  ? 1140 HIS A N   1 
ATOM 8718 C CA  . HIS A 1 1143 ? 6.131   44.897 12.916  1.00 45.40  ? 1140 HIS A CA  1 
ATOM 8719 C C   . HIS A 1 1143 ? 5.516   46.291 12.890  1.00 45.40  ? 1140 HIS A C   1 
ATOM 8720 O O   . HIS A 1 1143 ? 6.020   47.188 12.222  1.00 45.40  ? 1140 HIS A O   1 
ATOM 8721 C CB  . HIS A 1 1143 ? 7.357   44.877 13.834  1.00 42.70  ? 1140 HIS A CB  1 
ATOM 8722 C CG  . HIS A 1 1143 ? 8.323   45.997 13.584  1.00 42.70  ? 1140 HIS A CG  1 
ATOM 8723 N ND1 . HIS A 1 1143 ? 9.202   46.002 12.520  1.00 42.70  ? 1140 HIS A ND1 1 
ATOM 8724 C CD2 . HIS A 1 1143 ? 8.543   47.153 14.256  1.00 42.70  ? 1140 HIS A CD2 1 
ATOM 8725 C CE1 . HIS A 1 1143 ? 9.934   47.101 12.554  1.00 42.70  ? 1140 HIS A CE1 1 
ATOM 8726 N NE2 . HIS A 1 1143 ? 9.557   47.817 13.599  1.00 42.70  ? 1140 HIS A NE2 1 
ATOM 8727 N N   . ASN B 2 1    ? 15.253  33.651 49.692  1.00 37.16  ? 5    ASN B N   1 
ATOM 8728 C CA  . ASN B 2 1    ? 14.302  32.680 49.191  1.00 37.16  ? 5    ASN B CA  1 
ATOM 8729 C C   . ASN B 2 1    ? 14.280  32.859 47.695  1.00 37.16  ? 5    ASN B C   1 
ATOM 8730 O O   . ASN B 2 1    ? 13.975  33.943 47.179  1.00 37.16  ? 5    ASN B O   1 
ATOM 8731 C CB  . ASN B 2 1    ? 12.923  32.901 49.794  1.00 43.80  ? 5    ASN B CB  1 
ATOM 8732 C CG  . ASN B 2 1    ? 11.977  31.764 49.509  1.00 43.80  ? 5    ASN B CG  1 
ATOM 8733 O OD1 . ASN B 2 1    ? 11.792  31.342 48.357  1.00 43.80  ? 5    ASN B OD1 1 
ATOM 8734 N ND2 . ASN B 2 1    ? 11.363  31.259 50.559  1.00 43.80  ? 5    ASN B ND2 1 
ATOM 8735 N N   . ILE B 2 2    ? 14.643  31.800 46.997  1.00 34.91  ? 6    ILE B N   1 
ATOM 8736 C CA  . ILE B 2 2    ? 14.940  31.896 45.596  1.00 34.91  ? 6    ILE B CA  1 
ATOM 8737 C C   . ILE B 2 2    ? 13.725  32.331 44.756  1.00 34.91  ? 6    ILE B C   1 
ATOM 8738 O O   . ILE B 2 2    ? 13.878  33.005 43.719  1.00 34.91  ? 6    ILE B O   1 
ATOM 8739 C CB  . ILE B 2 2    ? 15.518  30.580 45.104  1.00 34.58  ? 6    ILE B CB  1 
ATOM 8740 C CG1 . ILE B 2 2    ? 16.371  30.851 43.874  1.00 21.53  ? 6    ILE B CG1 1 
ATOM 8741 C CG2 . ILE B 2 2    ? 14.383  29.485 44.920  1.00 21.53  ? 6    ILE B CG2 1 
ATOM 8742 C CD1 . ILE B 2 2    ? 16.151  29.843 42.824  1.00 34.58  ? 6    ILE B CD1 1 
ATOM 8743 N N   . THR B 2 3    ? 12.532  31.915 45.198  1.00 37.27  ? 7    THR B N   1 
ATOM 8744 C CA  . THR B 2 3    ? 11.290  32.392 44.591  1.00 37.27  ? 7    THR B CA  1 
ATOM 8745 C C   . THR B 2 3    ? 11.202  33.913 44.712  1.00 37.27  ? 7    THR B C   1 
ATOM 8746 O O   . THR B 2 3    ? 10.827  34.601 43.772  1.00 37.27  ? 7    THR B O   1 
ATOM 8747 C CB  . THR B 2 3    ? 10.048  31.711 45.204  1.00 31.57  ? 7    THR B CB  1 
ATOM 8748 O OG1 . THR B 2 3    ? 10.137  30.300 44.978  1.00 19.22  ? 7    THR B OG1 1 
ATOM 8749 C CG2 . THR B 2 3    ? 8.787   32.174 44.535  1.00 31.57  ? 7    THR B CG2 1 
ATOM 8750 N N   . ARG B 2 4    ? 11.569  34.457 45.854  1.00 38.88  ? 8    ARG B N   1 
ATOM 8751 C CA  . ARG B 2 4    ? 11.525  35.904 45.959  1.00 38.88  ? 8    ARG B CA  1 
ATOM 8752 C C   . ARG B 2 4    ? 12.561  36.557 45.058  1.00 38.88  ? 8    ARG B C   1 
ATOM 8753 O O   . ARG B 2 4    ? 12.294  37.585 44.455  1.00 38.88  ? 8    ARG B O   1 
ATOM 8754 C CB  . ARG B 2 4    ? 11.586  36.373 47.397  1.00 77.57  ? 8    ARG B CB  1 
ATOM 8755 C CG  . ARG B 2 4    ? 10.317  35.990 48.079  1.00 42.53  ? 8    ARG B CG  1 
ATOM 8756 C CD  . ARG B 2 4    ? 10.075  36.765 49.335  1.00 42.53  ? 8    ARG B CD  1 
ATOM 8757 N NE  . ARG B 2 4    ? 9.296   37.976 49.059  1.00 42.53  ? 8    ARG B NE  1 
ATOM 8758 C CZ  . ARG B 2 4    ? 9.257   39.046 49.860  1.00 42.53  ? 8    ARG B CZ  1 
ATOM 8759 N NH1 . ARG B 2 4    ? 9.962   39.031 50.979  1.00 42.53  ? 8    ARG B NH1 1 
ATOM 8760 N NH2 . ARG B 2 4    ? 8.521   40.123 49.532  1.00 42.53  ? 8    ARG B NH2 1 
ATOM 8761 N N   . ASP B 2 5    ? 13.694  35.893 44.897  1.00 39.02  ? 9    ASP B N   1 
ATOM 8762 C CA  . ASP B 2 5    ? 14.788  36.434 44.102  1.00 39.02  ? 9    ASP B CA  1 
ATOM 8763 C C   . ASP B 2 5    ? 14.400  36.525 42.656  1.00 39.02  ? 9    ASP B C   1 
ATOM 8764 O O   . ASP B 2 5    ? 14.845  37.448 41.944  1.00 39.02  ? 9    ASP B O   1 
ATOM 8765 C CB  . ASP B 2 5    ? 16.042  35.550 44.182  1.00 65.55  ? 9    ASP B CB  1 
ATOM 8766 C CG  . ASP B 2 5    ? 16.513  35.308 45.595  1.00 65.55  ? 9    ASP B CG  1 
ATOM 8767 O OD1 . ASP B 2 5    ? 16.538  36.237 46.417  1.00 54.46  ? 9    ASP B OD1 1 
ATOM 8768 O OD2 . ASP B 2 5    ? 16.889  34.164 45.884  1.00 54.46  ? 9    ASP B OD2 1 
ATOM 8769 N N   . LEU B 2 6    ? 13.614  35.544 42.215  1.00 27.67  ? 10   LEU B N   1 
ATOM 8770 C CA  . LEU B 2 6    ? 13.256  35.479 40.823  1.00 27.67  ? 10   LEU B CA  1 
ATOM 8771 C C   . LEU B 2 6    ? 12.223  36.561 40.540  1.00 27.67  ? 10   LEU B C   1 
ATOM 8772 O O   . LEU B 2 6    ? 12.301  37.300 39.518  1.00 27.67  ? 10   LEU B O   1 
ATOM 8773 C CB  . LEU B 2 6    ? 12.750  34.116 40.489  1.00 25.26  ? 10   LEU B CB  1 
ATOM 8774 C CG  . LEU B 2 6    ? 13.909  33.110 40.610  1.00 25.26  ? 10   LEU B CG  1 
ATOM 8775 C CD1 . LEU B 2 6    ? 13.317  31.738 40.632  1.00 7.52   ? 10   LEU B CD1 1 
ATOM 8776 C CD2 . LEU B 2 6    ? 14.978  33.167 39.464  1.00 25.26  ? 10   LEU B CD2 1 
ATOM 8777 N N   . ILE B 2 7    ? 11.297  36.701 41.491  1.00 30.31  ? 11   ILE B N   1 
ATOM 8778 C CA  . ILE B 2 7    ? 10.320  37.738 41.431  1.00 30.31  ? 11   ILE B CA  1 
ATOM 8779 C C   . ILE B 2 7    ? 11.034  39.083 41.388  1.00 30.31  ? 11   ILE B C   1 
ATOM 8780 O O   . ILE B 2 7    ? 10.700  39.924 40.547  1.00 30.31  ? 11   ILE B O   1 
ATOM 8781 C CB  . ILE B 2 7    ? 9.244   37.579 42.533  1.00 43.21  ? 11   ILE B CB  1 
ATOM 8782 C CG1 . ILE B 2 7    ? 8.351   36.361 42.226  1.00 15.67  ? 11   ILE B CG1 1 
ATOM 8783 C CG2 . ILE B 2 7    ? 8.333   38.770 42.576  1.00 15.67  ? 11   ILE B CG2 1 
ATOM 8784 C CD1 . ILE B 2 7    ? 7.779   35.739 43.520  1.00 15.67  ? 11   ILE B CD1 1 
ATOM 8785 N N   . ARG B 2 8    ? 12.033  39.278 42.241  1.00 35.79  ? 12   ARG B N   1 
ATOM 8786 C CA  . ARG B 2 8    ? 12.865  40.467 42.161  1.00 35.79  ? 12   ARG B CA  1 
ATOM 8787 C C   . ARG B 2 8    ? 13.577  40.574 40.801  1.00 35.79  ? 12   ARG B C   1 
ATOM 8788 O O   . ARG B 2 8    ? 13.586  41.666 40.196  1.00 35.79  ? 12   ARG B O   1 
ATOM 8789 C CB  . ARG B 2 8    ? 13.830  40.543 43.336  1.00 99.95  ? 12   ARG B CB  1 
ATOM 8790 C CG  . ARG B 2 8    ? 13.159  41.029 44.589  1.00 99.95  ? 12   ARG B CG  1 
ATOM 8791 C CD  . ARG B 2 8    ? 13.655  40.327 45.852  1.00 74.65  ? 12   ARG B CD  1 
ATOM 8792 N NE  . ARG B 2 8    ? 12.608  40.367 46.883  1.00 74.65  ? 12   ARG B NE  1 
ATOM 8793 C CZ  . ARG B 2 8    ? 12.590  41.185 47.940  1.00 74.65  ? 12   ARG B CZ  1 
ATOM 8794 N NH1 . ARG B 2 8    ? 13.590  42.035 48.163  1.00 74.65  ? 12   ARG B NH1 1 
ATOM 8795 N NH2 . ARG B 2 8    ? 11.579  41.143 48.796  1.00 74.65  ? 12   ARG B NH2 1 
ATOM 8796 N N   . ARG B 2 9    ? 14.148  39.463 40.308  1.00 25.21  ? 13   ARG B N   1 
ATOM 8797 C CA  . ARG B 2 9    ? 14.909  39.480 39.029  1.00 25.21  ? 13   ARG B CA  1 
ATOM 8798 C C   . ARG B 2 9    ? 13.972  40.025 37.936  1.00 25.21  ? 13   ARG B C   1 
ATOM 8799 O O   . ARG B 2 9    ? 14.421  40.733 37.079  1.00 25.21  ? 13   ARG B O   1 
ATOM 8800 C CB  . ARG B 2 9    ? 15.589  38.077 38.684  1.00 25.80  ? 13   ARG B CB  1 
ATOM 8801 C CG  . ARG B 2 9    ? 16.604  37.927 37.452  1.00 25.80  ? 13   ARG B CG  1 
ATOM 8802 C CD  . ARG B 2 9    ? 17.011  36.393 37.104  1.00 25.80  ? 13   ARG B CD  1 
ATOM 8803 N NE  . ARG B 2 9    ? 15.933  35.524 36.514  1.00 25.80  ? 13   ARG B NE  1 
ATOM 8804 C CZ  . ARG B 2 9    ? 16.120  34.291 36.036  1.00 25.80  ? 13   ARG B CZ  1 
ATOM 8805 N NH1 . ARG B 2 9    ? 17.405  33.930 36.135  1.00 25.80  ? 13   ARG B NH1 1 
ATOM 8806 N NH2 . ARG B 2 9    ? 15.105  33.498 35.454  1.00 25.80  ? 13   ARG B NH2 1 
ATOM 8807 N N   . GLN B 2 10   ? 12.676  39.743 37.960  1.00 29.73  ? 14   GLN B N   1 
ATOM 8808 C CA  . GLN B 2 10   ? 11.867  40.121 36.791  1.00 29.73  ? 14   GLN B CA  1 
ATOM 8809 C C   . GLN B 2 10   ? 11.638  41.617 36.675  1.00 29.73  ? 14   GLN B C   1 
ATOM 8810 O O   . GLN B 2 10   ? 11.320  42.105 35.597  1.00 29.73  ? 14   GLN B O   1 
ATOM 8811 C CB  . GLN B 2 10   ? 10.528  39.419 36.733  1.00 40.82  ? 14   GLN B CB  1 
ATOM 8812 C CG  . GLN B 2 10   ? 10.614  37.975 36.900  1.00 40.82  ? 14   GLN B CG  1 
ATOM 8813 C CD  . GLN B 2 10   ? 9.275   37.379 37.079  1.00 40.82  ? 14   GLN B CD  1 
ATOM 8814 O OE1 . GLN B 2 10   ? 8.535   37.744 37.977  1.00 40.82  ? 14   GLN B OE1 1 
ATOM 8815 N NE2 . GLN B 2 10   ? 8.931   36.464 36.206  1.00 40.82  ? 14   GLN B NE2 1 
ATOM 8816 N N   . ILE B 2 11   ? 11.844  42.308 37.789  1.00 27.17  ? 15   ILE B N   1 
ATOM 8817 C CA  . ILE B 2 11   ? 11.722  43.745 37.950  1.00 27.17  ? 15   ILE B CA  1 
ATOM 8818 C C   . ILE B 2 11   ? 13.119  44.445 37.882  1.00 27.17  ? 15   ILE B C   1 
ATOM 8819 O O   . ILE B 2 11   ? 13.209  45.657 38.047  1.00 27.17  ? 15   ILE B O   1 
ATOM 8820 C CB  . ILE B 2 11   ? 11.044  43.952 39.360  1.00 35.15  ? 15   ILE B CB  1 
ATOM 8821 C CG1 . ILE B 2 11   ? 9.521   43.820 39.317  1.00 35.23  ? 15   ILE B CG1 1 
ATOM 8822 C CG2 . ILE B 2 11   ? 11.449  45.237 40.023  1.00 35.23  ? 15   ILE B CG2 1 
ATOM 8823 C CD1 . ILE B 2 11   ? 8.920   43.731 37.874  1.00 35.15  ? 15   ILE B CD1 1 
ATOM 8824 N N   . LYS B 2 12   ? 14.174  43.633 37.626  1.00 27.06  ? 16   LYS B N   1 
ATOM 8825 C CA  . LYS B 2 12   ? 15.693  43.857 37.607  1.00 27.06  ? 16   LYS B CA  1 
ATOM 8826 C C   . LYS B 2 12   ? 16.258  44.762 38.677  1.00 27.06  ? 16   LYS B C   1 
ATOM 8827 O O   . LYS B 2 12   ? 15.546  45.146 39.598  1.00 27.06  ? 16   LYS B O   1 
ATOM 8828 C CB  . LYS B 2 12   ? 16.244  44.176 36.193  1.00 30.76  ? 16   LYS B CB  1 
ATOM 8829 C CG  . LYS B 2 12   ? 17.824  44.229 35.925  1.00 30.76  ? 16   LYS B CG  1 
ATOM 8830 C CD  . LYS B 2 12   ? 18.167  44.078 34.371  1.00 30.76  ? 16   LYS B CD  1 
ATOM 8831 C CE  . LYS B 2 12   ? 18.092  45.377 33.469  1.00 30.76  ? 16   LYS B CE  1 
ATOM 8832 N NZ  . LYS B 2 12   ? 18.092  45.136 31.936  1.00 30.76  ? 16   LYS B NZ  1 
ATOM 8833 N N   . GLU B 2 13   ? 17.564  45.059 38.567  1.00 161.99 ? 17   GLU B N   1 
ATOM 8834 C CA  . GLU B 2 13   ? 18.403  45.789 39.569  1.00 161.99 ? 17   GLU B CA  1 
ATOM 8835 C C   . GLU B 2 13   ? 17.721  46.407 40.801  1.00 161.99 ? 17   GLU B C   1 
ATOM 8836 O O   . GLU B 2 13   ? 18.017  46.049 41.942  1.00 161.99 ? 17   GLU B O   1 
ATOM 8837 C CB  . GLU B 2 13   ? 19.307  46.840 38.885  1.00 138.87 ? 17   GLU B CB  1 
ATOM 8838 C CG  . GLU B 2 13   ? 20.829  46.607 39.043  1.00 138.87 ? 17   GLU B CG  1 
ATOM 8839 C CD  . GLU B 2 13   ? 21.436  47.257 40.300  1.00 94.14  ? 17   GLU B CD  1 
ATOM 8840 O OE1 . GLU B 2 13   ? 21.104  48.429 40.609  1.00 94.14  ? 17   GLU B OE1 1 
ATOM 8841 O OE2 . GLU B 2 13   ? 22.262  46.599 40.970  1.00 94.14  ? 17   GLU B OE2 1 
ATOM 8842 O OXT . GLU B 2 13   ? 16.880  47.294 40.694  1.00 145.00 ? 17   GLU B OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    GLY 1    -2   ?    ?   ?   A . n 
A 1 2    SER 2    -1   ?    ?   ?   A . n 
A 1 3    HIS 3    0    ?    ?   ?   A . n 
A 1 4    MET 4    1    1    MET MET A . n 
A 1 5    SER 5    2    2    SER SER A . n 
A 1 6    TYR 6    3    3    TYR TYR A . n 
A 1 7    ASN 7    4    4    ASN ASN A . n 
A 1 8    TYR 8    5    5    TYR TYR A . n 
A 1 9    VAL 9    6    6    VAL VAL A . n 
A 1 10   VAL 10   7    7    VAL VAL A . n 
A 1 11   THR 11   8    8    THR THR A . n 
A 1 12   ALA 12   9    9    ALA ALA A . n 
A 1 13   GLN 13   10   10   GLN GLN A . n 
A 1 14   LYS 14   11   11   LYS LYS A . n 
A 1 15   PRO 15   12   12   PRO PRO A . n 
A 1 16   THR 16   13   13   THR THR A . n 
A 1 17   ALA 17   14   14   ALA ALA A . n 
A 1 18   VAL 18   15   15   VAL VAL A . n 
A 1 19   ASN 19   16   16   ASN ASN A . n 
A 1 20   GLY 20   17   17   GLY GLY A . n 
A 1 21   CYS 21   18   18   CYS CYS A . n 
A 1 22   VAL 22   19   19   VAL VAL A . n 
A 1 23   THR 23   20   20   THR THR A . n 
A 1 24   GLY 24   21   21   GLY GLY A . n 
A 1 25   HIS 25   22   22   HIS HIS A . n 
A 1 26   PHE 26   23   23   PHE PHE A . n 
A 1 27   THR 27   24   24   THR THR A . n 
A 1 28   SER 28   25   25   SER SER A . n 
A 1 29   ALA 29   26   26   ALA ALA A . n 
A 1 30   GLU 30   27   27   GLU GLU A . n 
A 1 31   ASP 31   28   28   ASP ASP A . n 
A 1 32   LEU 32   29   29   LEU LEU A . n 
A 1 33   ASN 33   30   30   ASN ASN A . n 
A 1 34   LEU 34   31   31   LEU LEU A . n 
A 1 35   LEU 35   32   32   LEU LEU A . n 
A 1 36   ILE 36   33   33   ILE ILE A . n 
A 1 37   ALA 37   34   34   ALA ALA A . n 
A 1 38   LYS 38   35   35   LYS LYS A . n 
A 1 39   ASN 39   36   36   ASN ASN A . n 
A 1 40   THR 40   37   37   THR THR A . n 
A 1 41   ARG 41   38   38   ARG ARG A . n 
A 1 42   LEU 42   39   39   LEU LEU A . n 
A 1 43   GLU 43   40   40   GLU GLU A . n 
A 1 44   ILE 44   41   41   ILE ILE A . n 
A 1 45   TYR 45   42   42   TYR TYR A . n 
A 1 46   VAL 46   43   43   VAL VAL A . n 
A 1 47   VAL 47   44   44   VAL VAL A . n 
A 1 48   THR 48   45   45   THR THR A . n 
A 1 49   ALA 49   46   46   ALA ALA A . n 
A 1 50   GLU 50   47   47   GLU GLU A . n 
A 1 51   GLY 51   48   48   GLY GLY A . n 
A 1 52   LEU 52   49   49   LEU LEU A . n 
A 1 53   ARG 53   50   50   ARG ARG A . n 
A 1 54   PRO 54   51   51   PRO PRO A . n 
A 1 55   VAL 55   52   52   VAL VAL A . n 
A 1 56   LYS 56   53   53   LYS LYS A . n 
A 1 57   GLU 57   54   54   GLU GLU A . n 
A 1 58   VAL 58   55   55   VAL VAL A . n 
A 1 59   GLY 59   56   56   GLY GLY A . n 
A 1 60   MET 60   57   57   MET MET A . n 
A 1 61   TYR 61   58   58   TYR TYR A . n 
A 1 62   GLY 62   59   59   GLY GLY A . n 
A 1 63   LYS 63   60   60   LYS LYS A . n 
A 1 64   ILE 64   61   61   ILE ILE A . n 
A 1 65   ALA 65   62   62   ALA ALA A . n 
A 1 66   VAL 66   63   63   VAL VAL A . n 
A 1 67   MET 67   64   64   MET MET A . n 
A 1 68   GLU 68   65   65   GLU GLU A . n 
A 1 69   LEU 69   66   66   LEU LEU A . n 
A 1 70   PHE 70   67   67   PHE PHE A . n 
A 1 71   ARG 71   68   68   ARG ARG A . n 
A 1 72   PRO 72   69   69   PRO PRO A . n 
A 1 73   LYS 73   70   70   LYS LYS A . n 
A 1 74   GLY 74   71   71   GLY GLY A . n 
A 1 75   GLU 75   72   72   GLU GLU A . n 
A 1 76   SER 76   73   73   SER SER A . n 
A 1 77   LYS 77   74   74   LYS LYS A . n 
A 1 78   ASP 78   75   75   ASP ASP A . n 
A 1 79   LEU 79   76   76   LEU LEU A . n 
A 1 80   LEU 80   77   77   LEU LEU A . n 
A 1 81   PHE 81   78   78   PHE PHE A . n 
A 1 82   ILE 82   79   79   ILE ILE A . n 
A 1 83   LEU 83   80   80   LEU LEU A . n 
A 1 84   THR 84   81   81   THR THR A . n 
A 1 85   ALA 85   82   82   ALA ALA A . n 
A 1 86   LYS 86   83   83   LYS LYS A . n 
A 1 87   TYR 87   84   84   TYR TYR A . n 
A 1 88   ASN 88   85   85   ASN ASN A . n 
A 1 89   ALA 89   86   86   ALA ALA A . n 
A 1 90   CYS 90   87   87   CYS CYS A . n 
A 1 91   ILE 91   88   88   ILE ILE A . n 
A 1 92   LEU 92   89   89   LEU LEU A . n 
A 1 93   GLU 93   90   90   GLU GLU A . n 
A 1 94   TYR 94   91   91   TYR TYR A . n 
A 1 95   LYS 95   92   92   LYS LYS A . n 
A 1 96   GLN 96   93   93   GLN GLN A . n 
A 1 97   SER 97   94   94   SER SER A . n 
A 1 98   GLY 98   95   95   GLY GLY A . n 
A 1 99   GLU 99   96   96   GLU GLU A . n 
A 1 100  SER 100  97   97   SER SER A . n 
A 1 101  ILE 101  98   98   ILE ILE A . n 
A 1 102  ASP 102  99   99   ASP ASP A . n 
A 1 103  ILE 103  100  100  ILE ILE A . n 
A 1 104  ILE 104  101  101  ILE ILE A . n 
A 1 105  THR 105  102  102  THR THR A . n 
A 1 106  ARG 106  103  103  ARG ARG A . n 
A 1 107  ALA 107  104  104  ALA ALA A . n 
A 1 108  HIS 108  105  105  HIS HIS A . n 
A 1 109  GLY 109  106  106  GLY GLY A . n 
A 1 110  ASN 110  107  107  ASN ASN A . n 
A 1 111  VAL 111  108  108  VAL VAL A . n 
A 1 112  GLN 112  109  109  GLN GLN A . n 
A 1 113  ASP 113  110  110  ASP ASP A . n 
A 1 114  ARG 114  111  111  ARG ARG A . n 
A 1 115  ILE 115  112  112  ILE ILE A . n 
A 1 116  GLY 116  113  113  GLY GLY A . n 
A 1 117  ARG 117  114  114  ARG ARG A . n 
A 1 118  PRO 118  115  115  PRO PRO A . n 
A 1 119  SER 119  116  116  SER SER A . n 
A 1 120  GLU 120  117  117  GLU GLU A . n 
A 1 121  THR 121  118  118  THR THR A . n 
A 1 122  GLY 122  119  119  GLY GLY A . n 
A 1 123  ILE 123  120  120  ILE ILE A . n 
A 1 124  ILE 124  121  121  ILE ILE A . n 
A 1 125  GLY 125  122  122  GLY GLY A . n 
A 1 126  ILE 126  123  123  ILE ILE A . n 
A 1 127  ILE 127  124  124  ILE ILE A . n 
A 1 128  ASP 128  125  125  ASP ASP A . n 
A 1 129  PRO 129  126  126  PRO PRO A . n 
A 1 130  GLU 130  127  127  GLU GLU A . n 
A 1 131  CYS 131  128  128  CYS CYS A . n 
A 1 132  ARG 132  129  129  ARG ARG A . n 
A 1 133  MET 133  130  130  MET MET A . n 
A 1 134  ILE 134  131  131  ILE ILE A . n 
A 1 135  GLY 135  132  132  GLY GLY A . n 
A 1 136  LEU 136  133  133  LEU LEU A . n 
A 1 137  ARG 137  134  134  ARG ARG A . n 
A 1 138  LEU 138  135  135  LEU LEU A . n 
A 1 139  TYR 139  136  136  TYR TYR A . n 
A 1 140  ASP 140  137  137  ASP ASP A . n 
A 1 141  GLY 141  138  138  GLY GLY A . n 
A 1 142  LEU 142  139  139  LEU LEU A . n 
A 1 143  PHE 143  140  140  PHE PHE A . n 
A 1 144  LYS 144  141  141  LYS LYS A . n 
A 1 145  VAL 145  142  142  VAL VAL A . n 
A 1 146  ILE 146  143  143  ILE ILE A . n 
A 1 147  PRO 147  144  144  PRO PRO A . n 
A 1 148  LEU 148  145  145  LEU LEU A . n 
A 1 149  ASP 149  146  146  ASP ASP A . n 
A 1 150  ARG 150  147  147  ARG ARG A . n 
A 1 151  ASP 151  148  148  ASP ASP A . n 
A 1 152  ASN 152  149  149  ASN ASN A . n 
A 1 153  LYS 153  150  150  LYS LYS A . n 
A 1 154  GLU 154  151  151  GLU GLU A . n 
A 1 155  LEU 155  152  152  LEU LEU A . n 
A 1 156  LYS 156  153  153  LYS LYS A . n 
A 1 157  ALA 157  154  154  ALA ALA A . n 
A 1 158  PHE 158  155  155  PHE PHE A . n 
A 1 159  ASN 159  156  156  ASN ASN A . n 
A 1 160  ILE 160  157  157  ILE ILE A . n 
A 1 161  ARG 161  158  158  ARG ARG A . n 
A 1 162  LEU 162  159  159  LEU LEU A . n 
A 1 163  GLU 163  160  160  GLU GLU A . n 
A 1 164  GLU 164  161  161  GLU GLU A . n 
A 1 165  LEU 165  162  162  LEU LEU A . n 
A 1 166  HIS 166  163  163  HIS HIS A . n 
A 1 167  VAL 167  164  164  VAL VAL A . n 
A 1 168  ILE 168  165  165  ILE ILE A . n 
A 1 169  ASP 169  166  166  ASP ASP A . n 
A 1 170  VAL 170  167  167  VAL VAL A . n 
A 1 171  LYS 171  168  168  LYS LYS A . n 
A 1 172  PHE 172  169  169  PHE PHE A . n 
A 1 173  LEU 173  170  170  LEU LEU A . n 
A 1 174  TYR 174  171  171  TYR TYR A . n 
A 1 175  GLY 175  172  172  GLY GLY A . n 
A 1 176  CYS 176  173  173  CYS CYS A . n 
A 1 177  GLN 177  174  174  GLN GLN A . n 
A 1 178  ALA 178  175  175  ALA ALA A . n 
A 1 179  PRO 179  176  176  PRO PRO A . n 
A 1 180  THR 180  177  177  THR THR A . n 
A 1 181  ILE 181  178  178  ILE ILE A . n 
A 1 182  CYS 182  179  179  CYS CYS A . n 
A 1 183  PHE 183  180  180  PHE PHE A . n 
A 1 184  VAL 184  181  181  VAL VAL A . n 
A 1 185  TYR 185  182  182  TYR TYR A . n 
A 1 186  GLN 186  183  183  GLN GLN A . n 
A 1 187  ASP 187  184  184  ASP ASP A . n 
A 1 188  PRO 188  185  185  PRO PRO A . n 
A 1 189  GLN 189  186  186  GLN GLN A . n 
A 1 190  GLY 190  187  187  GLY GLY A . n 
A 1 191  ARG 191  188  188  ARG ARG A . n 
A 1 192  HIS 192  189  189  HIS HIS A . n 
A 1 193  VAL 193  190  190  VAL VAL A . n 
A 1 194  LYS 194  191  191  LYS LYS A . n 
A 1 195  THR 195  192  192  THR THR A . n 
A 1 196  TYR 196  193  193  TYR TYR A . n 
A 1 197  GLU 197  194  194  GLU GLU A . n 
A 1 198  VAL 198  195  195  VAL VAL A . n 
A 1 199  SER 199  196  196  SER SER A . n 
A 1 200  LEU 200  197  197  LEU LEU A . n 
A 1 201  ARG 201  198  198  ARG ARG A . n 
A 1 202  GLU 202  199  199  GLU GLU A . n 
A 1 203  LYS 203  200  200  LYS LYS A . n 
A 1 204  GLU 204  201  201  GLU GLU A . n 
A 1 205  PHE 205  202  202  PHE PHE A . n 
A 1 206  ASN 206  203  203  ASN ASN A . n 
A 1 207  LYS 207  204  204  LYS LYS A . n 
A 1 208  GLY 208  205  205  GLY GLY A . n 
A 1 209  PRO 209  206  206  PRO PRO A . n 
A 1 210  TRP 210  207  207  TRP TRP A . n 
A 1 211  LYS 211  208  208  LYS LYS A . n 
A 1 212  GLN 212  209  209  GLN GLN A . n 
A 1 213  GLU 213  210  210  GLU GLU A . n 
A 1 214  ASN 214  211  211  ASN ASN A . n 
A 1 215  VAL 215  212  212  VAL VAL A . n 
A 1 216  GLU 216  213  213  GLU GLU A . n 
A 1 217  ALA 217  214  214  ALA ALA A . n 
A 1 218  GLU 218  215  215  GLU GLU A . n 
A 1 219  ALA 219  216  216  ALA ALA A . n 
A 1 220  SER 220  217  217  SER SER A . n 
A 1 221  MET 221  218  218  MET MET A . n 
A 1 222  VAL 222  219  219  VAL VAL A . n 
A 1 223  ILE 223  220  220  ILE ILE A . n 
A 1 224  ALA 224  221  221  ALA ALA A . n 
A 1 225  VAL 225  222  222  VAL VAL A . n 
A 1 226  PRO 226  223  223  PRO PRO A . n 
A 1 227  GLU 227  224  224  GLU GLU A . n 
A 1 228  PRO 228  225  225  PRO PRO A . n 
A 1 229  PHE 229  226  226  PHE PHE A . n 
A 1 230  GLY 230  227  227  GLY GLY A . n 
A 1 231  GLY 231  228  228  GLY GLY A . n 
A 1 232  ALA 232  229  229  ALA ALA A . n 
A 1 233  ILE 233  230  230  ILE ILE A . n 
A 1 234  ILE 234  231  231  ILE ILE A . n 
A 1 235  ILE 235  232  232  ILE ILE A . n 
A 1 236  GLY 236  233  233  GLY GLY A . n 
A 1 237  GLN 237  234  234  GLN GLN A . n 
A 1 238  GLU 238  235  235  GLU GLU A . n 
A 1 239  SER 239  236  236  SER SER A . n 
A 1 240  ILE 240  237  237  ILE ILE A . n 
A 1 241  THR 241  238  238  THR THR A . n 
A 1 242  TYR 242  239  239  TYR TYR A . n 
A 1 243  HIS 243  240  240  HIS HIS A . n 
A 1 244  ASN 244  241  241  ASN ASN A . n 
A 1 245  GLY 245  242  242  GLY GLY A . n 
A 1 246  ASP 246  243  243  ASP ASP A . n 
A 1 247  LYS 247  244  244  LYS LYS A . n 
A 1 248  TYR 248  245  245  TYR TYR A . n 
A 1 249  LEU 249  246  246  LEU LEU A . n 
A 1 250  ALA 250  247  247  ALA ALA A . n 
A 1 251  ILE 251  248  248  ILE ILE A . n 
A 1 252  ALA 252  249  249  ALA ALA A . n 
A 1 253  PRO 253  250  250  PRO PRO A . n 
A 1 254  PRO 254  251  251  PRO PRO A . n 
A 1 255  ILE 255  252  252  ILE ILE A . n 
A 1 256  ILE 256  253  253  ILE ILE A . n 
A 1 257  LYS 257  254  254  LYS LYS A . n 
A 1 258  GLN 258  255  255  GLN GLN A . n 
A 1 259  SER 259  256  256  SER SER A . n 
A 1 260  THR 260  257  257  THR THR A . n 
A 1 261  ILE 261  258  258  ILE ILE A . n 
A 1 262  VAL 262  259  259  VAL VAL A . n 
A 1 263  CYS 263  260  260  CYS CYS A . n 
A 1 264  HIS 264  261  261  HIS HIS A . n 
A 1 265  ASN 265  262  262  ASN ASN A . n 
A 1 266  ARG 266  263  263  ARG ARG A . n 
A 1 267  VAL 267  264  264  VAL VAL A . n 
A 1 268  ASP 268  265  265  ASP ASP A . n 
A 1 269  PRO 269  266  266  PRO PRO A . n 
A 1 270  ASN 270  267  267  ASN ASN A . n 
A 1 271  GLY 271  268  268  GLY GLY A . n 
A 1 272  SER 272  269  269  SER SER A . n 
A 1 273  ARG 273  270  270  ARG ARG A . n 
A 1 274  TYR 274  271  271  TYR TYR A . n 
A 1 275  LEU 275  272  272  LEU LEU A . n 
A 1 276  LEU 276  273  273  LEU LEU A . n 
A 1 277  GLY 277  274  274  GLY GLY A . n 
A 1 278  ASP 278  275  275  ASP ASP A . n 
A 1 279  MET 279  276  276  MET MET A . n 
A 1 280  GLU 280  277  277  GLU GLU A . n 
A 1 281  GLY 281  278  278  GLY GLY A . n 
A 1 282  ARG 282  279  279  ARG ARG A . n 
A 1 283  LEU 283  280  280  LEU LEU A . n 
A 1 284  PHE 284  281  281  PHE PHE A . n 
A 1 285  MET 285  282  282  MET MET A . n 
A 1 286  LEU 286  283  283  LEU LEU A . n 
A 1 287  LEU 287  284  284  LEU LEU A . n 
A 1 288  LEU 288  285  285  LEU LEU A . n 
A 1 289  GLU 289  286  286  GLU GLU A . n 
A 1 290  LYS 290  287  287  LYS LYS A . n 
A 1 291  GLU 291  288  288  GLU GLU A . n 
A 1 292  GLU 292  289  289  GLU GLU A . n 
A 1 293  GLN 293  290  290  GLN GLN A . n 
A 1 294  MET 294  291  291  MET MET A . n 
A 1 295  ASP 295  292  292  ASP ASP A . n 
A 1 296  GLY 296  293  293  GLY GLY A . n 
A 1 297  THR 297  294  294  THR THR A . n 
A 1 298  VAL 298  295  295  VAL VAL A . n 
A 1 299  THR 299  296  296  THR THR A . n 
A 1 300  LEU 300  297  297  LEU LEU A . n 
A 1 301  LYS 301  298  298  LYS LYS A . n 
A 1 302  ASP 302  299  299  ASP ASP A . n 
A 1 303  LEU 303  300  300  LEU LEU A . n 
A 1 304  ARG 304  301  301  ARG ARG A . n 
A 1 305  VAL 305  302  302  VAL VAL A . n 
A 1 306  GLU 306  303  303  GLU GLU A . n 
A 1 307  LEU 307  304  304  LEU LEU A . n 
A 1 308  LEU 308  305  305  LEU LEU A . n 
A 1 309  GLY 309  306  306  GLY GLY A . n 
A 1 310  GLU 310  307  307  GLU GLU A . n 
A 1 311  THR 311  308  308  THR THR A . n 
A 1 312  SER 312  309  309  SER SER A . n 
A 1 313  ILE 313  310  310  ILE ILE A . n 
A 1 314  ALA 314  311  311  ALA ALA A . n 
A 1 315  GLU 315  312  312  GLU GLU A . n 
A 1 316  CYS 316  313  313  CYS CYS A . n 
A 1 317  LEU 317  314  314  LEU LEU A . n 
A 1 318  THR 318  315  315  THR THR A . n 
A 1 319  TYR 319  316  316  TYR TYR A . n 
A 1 320  LEU 320  317  317  LEU LEU A . n 
A 1 321  ASP 321  318  318  ASP ASP A . n 
A 1 322  ASN 322  319  319  ASN ASN A . n 
A 1 323  GLY 323  320  320  GLY GLY A . n 
A 1 324  VAL 324  321  321  VAL VAL A . n 
A 1 325  VAL 325  322  322  VAL VAL A . n 
A 1 326  PHE 326  323  323  PHE PHE A . n 
A 1 327  VAL 327  324  324  VAL VAL A . n 
A 1 328  GLY 328  325  325  GLY GLY A . n 
A 1 329  SER 329  326  326  SER SER A . n 
A 1 330  ARG 330  327  327  ARG ARG A . n 
A 1 331  LEU 331  328  328  LEU LEU A . n 
A 1 332  GLY 332  329  329  GLY GLY A . n 
A 1 333  ASP 333  330  330  ASP ASP A . n 
A 1 334  SER 334  331  331  SER SER A . n 
A 1 335  GLN 335  332  332  GLN GLN A . n 
A 1 336  LEU 336  333  333  LEU LEU A . n 
A 1 337  VAL 337  334  334  VAL VAL A . n 
A 1 338  LYS 338  335  335  LYS LYS A . n 
A 1 339  LEU 339  336  336  LEU LEU A . n 
A 1 340  ASN 340  337  337  ASN ASN A . n 
A 1 341  VAL 341  338  338  VAL VAL A . n 
A 1 342  ASP 342  339  339  ASP ASP A . n 
A 1 343  SER 343  340  340  SER SER A . n 
A 1 344  ASN 344  341  341  ASN ASN A . n 
A 1 345  GLU 345  342  342  GLU GLU A . n 
A 1 346  GLN 346  343  343  GLN GLN A . n 
A 1 347  GLY 347  344  344  GLY GLY A . n 
A 1 348  SER 348  345  345  SER SER A . n 
A 1 349  TYR 349  346  346  TYR TYR A . n 
A 1 350  VAL 350  347  347  VAL VAL A . n 
A 1 351  VAL 351  348  348  VAL VAL A . n 
A 1 352  ALA 352  349  349  ALA ALA A . n 
A 1 353  MET 353  350  350  MET MET A . n 
A 1 354  GLU 354  351  351  GLU GLU A . n 
A 1 355  THR 355  352  352  THR THR A . n 
A 1 356  PHE 356  353  353  PHE PHE A . n 
A 1 357  THR 357  354  354  THR THR A . n 
A 1 358  ASN 358  355  355  ASN ASN A . n 
A 1 359  LEU 359  356  356  LEU LEU A . n 
A 1 360  GLY 360  357  357  GLY GLY A . n 
A 1 361  PRO 361  358  358  PRO PRO A . n 
A 1 362  ILE 362  359  359  ILE ILE A . n 
A 1 363  VAL 363  360  360  VAL VAL A . n 
A 1 364  ASP 364  361  361  ASP ASP A . n 
A 1 365  MET 365  362  362  MET MET A . n 
A 1 366  CYS 366  363  363  CYS CYS A . n 
A 1 367  VAL 367  364  364  VAL VAL A . n 
A 1 368  VAL 368  365  365  VAL VAL A . n 
A 1 369  ASP 369  366  366  ASP ASP A . n 
A 1 370  LEU 370  367  367  LEU LEU A . n 
A 1 371  GLU 371  368  368  GLU GLU A . n 
A 1 372  ARG 372  369  369  ARG ARG A . n 
A 1 373  GLN 373  370  370  GLN GLN A . n 
A 1 374  GLY 374  371  371  GLY GLY A . n 
A 1 375  GLN 375  372  372  GLN GLN A . n 
A 1 376  GLY 376  373  373  GLY GLY A . n 
A 1 377  GLN 377  374  374  GLN GLN A . n 
A 1 378  LEU 378  375  375  LEU LEU A . n 
A 1 379  VAL 379  376  376  VAL VAL A . n 
A 1 380  THR 380  377  377  THR THR A . n 
A 1 381  CYS 381  378  378  CYS CYS A . n 
A 1 382  SER 382  379  379  SER SER A . n 
A 1 383  GLY 383  380  380  GLY GLY A . n 
A 1 384  ALA 384  381  381  ALA ALA A . n 
A 1 385  PHE 385  382  382  PHE PHE A . n 
A 1 386  LYS 386  383  383  LYS LYS A . n 
A 1 387  GLU 387  384  384  GLU GLU A . n 
A 1 388  GLY 388  385  385  GLY GLY A . n 
A 1 389  SER 389  386  386  SER SER A . n 
A 1 390  LEU 390  387  387  LEU LEU A . n 
A 1 391  ARG 391  388  388  ARG ARG A . n 
A 1 392  ILE 392  389  389  ILE ILE A . n 
A 1 393  ILE 393  390  390  ILE ILE A . n 
A 1 394  ARG 394  391  391  ARG ARG A . n 
A 1 395  ASN 395  392  392  ASN ASN A . n 
A 1 396  GLY 396  393  393  GLY GLY A . n 
A 1 397  ILE 397  394  394  ILE ILE A . n 
A 1 398  GLY 398  395  395  GLY GLY A . n 
A 1 399  ILE 399  396  396  ILE ILE A . n 
A 1 400  HIS 400  397  397  HIS HIS A . n 
A 1 401  GLU 401  398  398  GLU GLU A . n 
A 1 402  HIS 402  399  399  HIS HIS A . n 
A 1 403  ALA 403  400  400  ALA ALA A . n 
A 1 404  SER 404  401  401  SER SER A . n 
A 1 405  ILE 405  402  402  ILE ILE A . n 
A 1 406  ASP 406  403  403  ASP ASP A . n 
A 1 407  LEU 407  404  404  LEU LEU A . n 
A 1 408  PRO 408  405  405  PRO PRO A . n 
A 1 409  GLY 409  406  406  GLY GLY A . n 
A 1 410  ILE 410  407  407  ILE ILE A . n 
A 1 411  LYS 411  408  408  LYS LYS A . n 
A 1 412  GLY 412  409  409  GLY GLY A . n 
A 1 413  LEU 413  410  410  LEU LEU A . n 
A 1 414  TRP 414  411  411  TRP TRP A . n 
A 1 415  PRO 415  412  412  PRO PRO A . n 
A 1 416  LEU 416  413  413  LEU LEU A . n 
A 1 417  ARG 417  414  414  ARG ARG A . n 
A 1 418  SER 418  415  415  SER SER A . n 
A 1 419  ASP 419  416  416  ASP ASP A . n 
A 1 420  PRO 420  417  417  PRO PRO A . n 
A 1 421  ASN 421  418  418  ASN ASN A . n 
A 1 422  ARG 422  419  419  ARG ARG A . n 
A 1 423  GLU 423  420  420  GLU GLU A . n 
A 1 424  THR 424  421  421  THR THR A . n 
A 1 425  TYR 425  422  422  TYR TYR A . n 
A 1 426  ASP 426  423  423  ASP ASP A . n 
A 1 427  THR 427  424  424  THR THR A . n 
A 1 428  LEU 428  425  425  LEU LEU A . n 
A 1 429  VAL 429  426  426  VAL VAL A . n 
A 1 430  LEU 430  427  427  LEU LEU A . n 
A 1 431  SER 431  428  428  SER SER A . n 
A 1 432  PHE 432  429  429  PHE PHE A . n 
A 1 433  VAL 433  430  430  VAL VAL A . n 
A 1 434  GLY 434  431  431  GLY GLY A . n 
A 1 435  GLN 435  432  432  GLN GLN A . n 
A 1 436  THR 436  433  433  THR THR A . n 
A 1 437  ARG 437  434  434  ARG ARG A . n 
A 1 438  VAL 438  435  435  VAL VAL A . n 
A 1 439  LEU 439  436  436  LEU LEU A . n 
A 1 440  MET 440  437  437  MET MET A . n 
A 1 441  LEU 441  438  438  LEU LEU A . n 
A 1 442  ASN 442  439  439  ASN ASN A . n 
A 1 443  GLY 443  440  440  GLY GLY A . n 
A 1 444  GLU 444  441  441  GLU GLU A . n 
A 1 445  GLU 445  442  442  GLU GLU A . n 
A 1 446  VAL 446  443  443  VAL VAL A . n 
A 1 447  GLU 447  444  444  GLU GLU A . n 
A 1 448  GLU 448  445  445  GLU GLU A . n 
A 1 449  THR 449  446  446  THR THR A . n 
A 1 450  GLU 450  447  447  GLU GLU A . n 
A 1 451  LEU 451  448  448  LEU LEU A . n 
A 1 452  MET 452  449  449  MET MET A . n 
A 1 453  GLY 453  450  450  GLY GLY A . n 
A 1 454  PHE 454  451  451  PHE PHE A . n 
A 1 455  VAL 455  452  452  VAL VAL A . n 
A 1 456  ASP 456  453  453  ASP ASP A . n 
A 1 457  ASP 457  454  454  ASP ASP A . n 
A 1 458  GLN 458  455  455  GLN GLN A . n 
A 1 459  GLN 459  456  456  GLN GLN A . n 
A 1 460  THR 460  457  457  THR THR A . n 
A 1 461  PHE 461  458  458  PHE PHE A . n 
A 1 462  PHE 462  459  459  PHE PHE A . n 
A 1 463  CYS 463  460  460  CYS CYS A . n 
A 1 464  GLY 464  461  461  GLY GLY A . n 
A 1 465  ASN 465  462  462  ASN ASN A . n 
A 1 466  VAL 466  463  463  VAL VAL A . n 
A 1 467  ALA 467  464  464  ALA ALA A . n 
A 1 468  HIS 468  465  465  HIS HIS A . n 
A 1 469  GLN 469  466  466  GLN GLN A . n 
A 1 470  GLN 470  467  467  GLN GLN A . n 
A 1 471  LEU 471  468  468  LEU LEU A . n 
A 1 472  ILE 472  469  469  ILE ILE A . n 
A 1 473  GLN 473  470  470  GLN GLN A . n 
A 1 474  ILE 474  471  471  ILE ILE A . n 
A 1 475  THR 475  472  472  THR THR A . n 
A 1 476  SER 476  473  473  SER SER A . n 
A 1 477  ALA 477  474  474  ALA ALA A . n 
A 1 478  SER 478  475  475  SER SER A . n 
A 1 479  VAL 479  476  476  VAL VAL A . n 
A 1 480  ARG 480  477  477  ARG ARG A . n 
A 1 481  LEU 481  478  478  LEU LEU A . n 
A 1 482  VAL 482  479  479  VAL VAL A . n 
A 1 483  SER 483  480  480  SER SER A . n 
A 1 484  GLN 484  481  481  GLN GLN A . n 
A 1 485  GLU 485  482  482  GLU GLU A . n 
A 1 486  PRO 486  483  483  PRO PRO A . n 
A 1 487  LYS 487  484  484  LYS LYS A . n 
A 1 488  ALA 488  485  485  ALA ALA A . n 
A 1 489  LEU 489  486  486  LEU LEU A . n 
A 1 490  VAL 490  487  487  VAL VAL A . n 
A 1 491  SER 491  488  488  SER SER A . n 
A 1 492  GLU 492  489  489  GLU GLU A . n 
A 1 493  TRP 493  490  490  TRP TRP A . n 
A 1 494  LYS 494  491  491  LYS LYS A . n 
A 1 495  GLU 495  492  492  GLU GLU A . n 
A 1 496  PRO 496  493  493  PRO PRO A . n 
A 1 497  GLN 497  494  494  GLN GLN A . n 
A 1 498  ALA 498  495  495  ALA ALA A . n 
A 1 499  LYS 499  496  496  LYS LYS A . n 
A 1 500  ASN 500  497  497  ASN ASN A . n 
A 1 501  ILE 501  498  498  ILE ILE A . n 
A 1 502  SER 502  499  499  SER SER A . n 
A 1 503  VAL 503  500  500  VAL VAL A . n 
A 1 504  ALA 504  501  501  ALA ALA A . n 
A 1 505  SER 505  502  502  SER SER A . n 
A 1 506  CYS 506  503  503  CYS CYS A . n 
A 1 507  ASN 507  504  504  ASN ASN A . n 
A 1 508  SER 508  505  505  SER SER A . n 
A 1 509  SER 509  506  506  SER SER A . n 
A 1 510  GLN 510  507  507  GLN GLN A . n 
A 1 511  VAL 511  508  508  VAL VAL A . n 
A 1 512  VAL 512  509  509  VAL VAL A . n 
A 1 513  VAL 513  510  510  VAL VAL A . n 
A 1 514  ALA 514  511  511  ALA ALA A . n 
A 1 515  VAL 515  512  512  VAL VAL A . n 
A 1 516  GLY 516  513  513  GLY GLY A . n 
A 1 517  ARG 517  514  514  ARG ARG A . n 
A 1 518  ALA 518  515  515  ALA ALA A . n 
A 1 519  LEU 519  516  516  LEU LEU A . n 
A 1 520  TYR 520  517  517  TYR TYR A . n 
A 1 521  TYR 521  518  518  TYR TYR A . n 
A 1 522  LEU 522  519  519  LEU LEU A . n 
A 1 523  GLN 523  520  520  GLN GLN A . n 
A 1 524  ILE 524  521  521  ILE ILE A . n 
A 1 525  HIS 525  522  522  HIS HIS A . n 
A 1 526  PRO 526  523  523  PRO PRO A . n 
A 1 527  GLN 527  524  524  GLN GLN A . n 
A 1 528  GLU 528  525  525  GLU GLU A . n 
A 1 529  LEU 529  526  526  LEU LEU A . n 
A 1 530  ARG 530  527  527  ARG ARG A . n 
A 1 531  GLN 531  528  528  GLN GLN A . n 
A 1 532  ILE 532  529  529  ILE ILE A . n 
A 1 533  SER 533  530  530  SER SER A . n 
A 1 534  HIS 534  531  531  HIS HIS A . n 
A 1 535  THR 535  532  532  THR THR A . n 
A 1 536  GLU 536  533  533  GLU GLU A . n 
A 1 537  MET 537  534  534  MET MET A . n 
A 1 538  GLU 538  535  535  GLU GLU A . n 
A 1 539  HIS 539  536  536  HIS HIS A . n 
A 1 540  GLU 540  537  537  GLU GLU A . n 
A 1 541  VAL 541  538  538  VAL VAL A . n 
A 1 542  ALA 542  539  539  ALA ALA A . n 
A 1 543  CYS 543  540  540  CYS CYS A . n 
A 1 544  LEU 544  541  541  LEU LEU A . n 
A 1 545  ASP 545  542  542  ASP ASP A . n 
A 1 546  ILE 546  543  543  ILE ILE A . n 
A 1 547  THR 547  544  544  THR THR A . n 
A 1 548  PRO 548  545  545  PRO PRO A . n 
A 1 549  LEU 549  546  546  LEU LEU A . n 
A 1 550  GLY 550  547  547  GLY GLY A . n 
A 1 551  ASP 551  548  548  ASP ASP A . n 
A 1 552  SER 552  549  549  SER SER A . n 
A 1 553  ASN 553  550  550  ASN ASN A . n 
A 1 554  GLY 554  551  551  GLY GLY A . n 
A 1 555  LEU 555  552  552  LEU LEU A . n 
A 1 556  SER 556  553  553  SER SER A . n 
A 1 557  PRO 557  554  554  PRO PRO A . n 
A 1 558  LEU 558  555  555  LEU LEU A . n 
A 1 559  CYS 559  556  556  CYS CYS A . n 
A 1 560  ALA 560  557  557  ALA ALA A . n 
A 1 561  ILE 561  558  558  ILE ILE A . n 
A 1 562  GLY 562  559  559  GLY GLY A . n 
A 1 563  LEU 563  560  560  LEU LEU A . n 
A 1 564  TRP 564  561  561  TRP TRP A . n 
A 1 565  THR 565  562  562  THR THR A . n 
A 1 566  ASP 566  563  563  ASP ASP A . n 
A 1 567  ILE 567  564  564  ILE ILE A . n 
A 1 568  SER 568  565  565  SER SER A . n 
A 1 569  ALA 569  566  566  ALA ALA A . n 
A 1 570  ARG 570  567  567  ARG ARG A . n 
A 1 571  ILE 571  568  568  ILE ILE A . n 
A 1 572  LEU 572  569  569  LEU LEU A . n 
A 1 573  LYS 573  570  570  LYS LYS A . n 
A 1 574  LEU 574  571  571  LEU LEU A . n 
A 1 575  PRO 575  572  572  PRO PRO A . n 
A 1 576  SER 576  573  573  SER SER A . n 
A 1 577  PHE 577  574  574  PHE PHE A . n 
A 1 578  GLU 578  575  575  GLU GLU A . n 
A 1 579  LEU 579  576  576  LEU LEU A . n 
A 1 580  LEU 580  577  577  LEU LEU A . n 
A 1 581  HIS 581  578  578  HIS HIS A . n 
A 1 582  LYS 582  579  579  LYS LYS A . n 
A 1 583  GLU 583  580  580  GLU GLU A . n 
A 1 584  MET 584  581  581  MET MET A . n 
A 1 585  LEU 585  582  582  LEU LEU A . n 
A 1 586  GLY 586  583  583  GLY GLY A . n 
A 1 587  GLY 587  584  584  GLY GLY A . n 
A 1 588  GLU 588  585  585  GLU GLU A . n 
A 1 589  ILE 589  586  586  ILE ILE A . n 
A 1 590  ILE 590  587  587  ILE ILE A . n 
A 1 591  PRO 591  588  588  PRO PRO A . n 
A 1 592  ARG 592  589  589  ARG ARG A . n 
A 1 593  SER 593  590  590  SER SER A . n 
A 1 594  ILE 594  591  591  ILE ILE A . n 
A 1 595  LEU 595  592  592  LEU LEU A . n 
A 1 596  MET 596  593  593  MET MET A . n 
A 1 597  THR 597  594  594  THR THR A . n 
A 1 598  THR 598  595  595  THR THR A . n 
A 1 599  PHE 599  596  596  PHE PHE A . n 
A 1 600  GLU 600  597  597  GLU GLU A . n 
A 1 601  SER 601  598  598  SER SER A . n 
A 1 602  SER 602  599  599  SER SER A . n 
A 1 603  HIS 603  600  600  HIS HIS A . n 
A 1 604  TYR 604  601  601  TYR TYR A . n 
A 1 605  LEU 605  602  602  LEU LEU A . n 
A 1 606  LEU 606  603  603  LEU LEU A . n 
A 1 607  CYS 607  604  604  CYS CYS A . n 
A 1 608  ALA 608  605  605  ALA ALA A . n 
A 1 609  LEU 609  606  606  LEU LEU A . n 
A 1 610  GLY 610  607  607  GLY GLY A . n 
A 1 611  ASP 611  608  608  ASP ASP A . n 
A 1 612  GLY 612  609  609  GLY GLY A . n 
A 1 613  ALA 613  610  610  ALA ALA A . n 
A 1 614  LEU 614  611  611  LEU LEU A . n 
A 1 615  PHE 615  612  612  PHE PHE A . n 
A 1 616  TYR 616  613  613  TYR TYR A . n 
A 1 617  PHE 617  614  614  PHE PHE A . n 
A 1 618  GLY 618  615  615  GLY GLY A . n 
A 1 619  LEU 619  616  616  LEU LEU A . n 
A 1 620  ASN 620  617  617  ASN ASN A . n 
A 1 621  ILE 621  618  618  ILE ILE A . n 
A 1 622  GLU 622  619  619  GLU GLU A . n 
A 1 623  THR 623  620  620  THR THR A . n 
A 1 624  GLY 624  621  621  GLY GLY A . n 
A 1 625  LEU 625  622  622  LEU LEU A . n 
A 1 626  LEU 626  623  623  LEU LEU A . n 
A 1 627  SER 627  624  624  SER SER A . n 
A 1 628  ASP 628  625  625  ASP ASP A . n 
A 1 629  ARG 629  626  626  ARG ARG A . n 
A 1 630  LYS 630  627  627  LYS LYS A . n 
A 1 631  LYS 631  628  628  LYS LYS A . n 
A 1 632  VAL 632  629  629  VAL VAL A . n 
A 1 633  THR 633  630  630  THR THR A . n 
A 1 634  LEU 634  631  631  LEU LEU A . n 
A 1 635  GLY 635  632  632  GLY GLY A . n 
A 1 636  THR 636  633  633  THR THR A . n 
A 1 637  GLN 637  634  634  GLN GLN A . n 
A 1 638  PRO 638  635  635  PRO PRO A . n 
A 1 639  THR 639  636  636  THR THR A . n 
A 1 640  VAL 640  637  637  VAL VAL A . n 
A 1 641  LEU 641  638  638  LEU LEU A . n 
A 1 642  ARG 642  639  639  ARG ARG A . n 
A 1 643  THR 643  640  640  THR THR A . n 
A 1 644  PHE 644  641  641  PHE PHE A . n 
A 1 645  ARG 645  642  642  ARG ARG A . n 
A 1 646  SER 646  643  643  SER SER A . n 
A 1 647  LEU 647  644  644  LEU LEU A . n 
A 1 648  SER 648  645  645  SER SER A . n 
A 1 649  THR 649  646  646  THR THR A . n 
A 1 650  THR 650  647  647  THR THR A . n 
A 1 651  ASN 651  648  648  ASN ASN A . n 
A 1 652  VAL 652  649  649  VAL VAL A . n 
A 1 653  PHE 653  650  650  PHE PHE A . n 
A 1 654  ALA 654  651  651  ALA ALA A . n 
A 1 655  CYS 655  652  652  CYS CYS A . n 
A 1 656  SER 656  653  653  SER SER A . n 
A 1 657  ASP 657  654  654  ASP ASP A . n 
A 1 658  ARG 658  655  655  ARG ARG A . n 
A 1 659  PRO 659  656  656  PRO PRO A . n 
A 1 660  THR 660  657  657  THR THR A . n 
A 1 661  VAL 661  658  658  VAL VAL A . n 
A 1 662  ILE 662  659  659  ILE ILE A . n 
A 1 663  TYR 663  660  660  TYR TYR A . n 
A 1 664  SER 664  661  661  SER SER A . n 
A 1 665  SER 665  662  662  SER SER A . n 
A 1 666  ASN 666  663  663  ASN ASN A . n 
A 1 667  HIS 667  664  664  HIS HIS A . n 
A 1 668  LYS 668  665  665  LYS LYS A . n 
A 1 669  LEU 669  666  666  LEU LEU A . n 
A 1 670  VAL 670  667  667  VAL VAL A . n 
A 1 671  PHE 671  668  668  PHE PHE A . n 
A 1 672  SER 672  669  669  SER SER A . n 
A 1 673  ASN 673  670  670  ASN ASN A . n 
A 1 674  VAL 674  671  671  VAL VAL A . n 
A 1 675  ASN 675  672  672  ASN ASN A . n 
A 1 676  LEU 676  673  673  LEU LEU A . n 
A 1 677  LYS 677  674  674  LYS LYS A . n 
A 1 678  GLU 678  675  675  GLU GLU A . n 
A 1 679  VAL 679  676  676  VAL VAL A . n 
A 1 680  ASN 680  677  677  ASN ASN A . n 
A 1 681  TYR 681  678  678  TYR TYR A . n 
A 1 682  MET 682  679  679  MET MET A . n 
A 1 683  CYS 683  680  680  CYS CYS A . n 
A 1 684  PRO 684  681  681  PRO PRO A . n 
A 1 685  LEU 685  682  682  LEU LEU A . n 
A 1 686  ASN 686  683  683  ASN ASN A . n 
A 1 687  SER 687  684  684  SER SER A . n 
A 1 688  ASP 688  685  685  ASP ASP A . n 
A 1 689  GLY 689  686  686  GLY GLY A . n 
A 1 690  TYR 690  687  687  TYR TYR A . n 
A 1 691  PRO 691  688  688  PRO PRO A . n 
A 1 692  ASP 692  689  689  ASP ASP A . n 
A 1 693  SER 693  690  690  SER SER A . n 
A 1 694  LEU 694  691  691  LEU LEU A . n 
A 1 695  ALA 695  692  692  ALA ALA A . n 
A 1 696  LEU 696  693  693  LEU LEU A . n 
A 1 697  ALA 697  694  694  ALA ALA A . n 
A 1 698  ASN 698  695  695  ASN ASN A . n 
A 1 699  ASN 699  696  696  ASN ASN A . n 
A 1 700  SER 700  697  697  SER SER A . n 
A 1 701  THR 701  698  698  THR THR A . n 
A 1 702  LEU 702  699  699  LEU LEU A . n 
A 1 703  THR 703  700  700  THR THR A . n 
A 1 704  ILE 704  701  701  ILE ILE A . n 
A 1 705  GLY 705  702  702  GLY GLY A . n 
A 1 706  THR 706  703  703  THR THR A . n 
A 1 707  ILE 707  704  704  ILE ILE A . n 
A 1 708  ASP 708  705  705  ASP ASP A . n 
A 1 709  GLU 709  706  706  GLU GLU A . n 
A 1 710  ILE 710  707  707  ILE ILE A . n 
A 1 711  GLN 711  708  708  GLN GLN A . n 
A 1 712  LYS 712  709  709  LYS LYS A . n 
A 1 713  LEU 713  710  710  LEU LEU A . n 
A 1 714  HIS 714  711  711  HIS HIS A . n 
A 1 715  ILE 715  712  712  ILE ILE A . n 
A 1 716  ARG 716  713  713  ARG ARG A . n 
A 1 717  THR 717  714  714  THR THR A . n 
A 1 718  VAL 718  715  715  VAL VAL A . n 
A 1 719  PRO 719  716  716  PRO PRO A . n 
A 1 720  LEU 720  717  717  LEU LEU A . n 
A 1 721  TYR 721  718  718  TYR TYR A . n 
A 1 722  GLU 722  719  719  GLU GLU A . n 
A 1 723  SER 723  720  720  SER SER A . n 
A 1 724  PRO 724  721  721  PRO PRO A . n 
A 1 725  ARG 725  722  722  ARG ARG A . n 
A 1 726  LYS 726  723  723  LYS LYS A . n 
A 1 727  ILE 727  724  724  ILE ILE A . n 
A 1 728  CYS 728  725  725  CYS CYS A . n 
A 1 729  TYR 729  726  726  TYR TYR A . n 
A 1 730  GLN 730  727  727  GLN GLN A . n 
A 1 731  GLU 731  728  728  GLU GLU A . n 
A 1 732  VAL 732  729  729  VAL VAL A . n 
A 1 733  SER 733  730  730  SER SER A . n 
A 1 734  GLN 734  731  731  GLN GLN A . n 
A 1 735  CYS 735  732  732  CYS CYS A . n 
A 1 736  PHE 736  733  733  PHE PHE A . n 
A 1 737  GLY 737  734  734  GLY GLY A . n 
A 1 738  VAL 738  735  735  VAL VAL A . n 
A 1 739  LEU 739  736  736  LEU LEU A . n 
A 1 740  SER 740  737  737  SER SER A . n 
A 1 741  SER 741  738  738  SER SER A . n 
A 1 742  ARG 742  739  739  ARG ARG A . n 
A 1 743  ILE 743  740  740  ILE ILE A . n 
A 1 744  GLU 744  741  741  GLU GLU A . n 
A 1 745  VAL 745  742  742  VAL VAL A . n 
A 1 746  GLN 746  743  743  GLN GLN A . n 
A 1 747  ASP 747  744  744  ASP ASP A . n 
A 1 748  THR 748  745  745  THR THR A . n 
A 1 749  SER 749  746  746  SER SER A . n 
A 1 750  GLY 750  747  747  GLY GLY A . n 
A 1 751  GLY 751  748  748  GLY GLY A . n 
A 1 752  THR 752  749  749  THR THR A . n 
A 1 753  THR 753  750  750  THR THR A . n 
A 1 754  ALA 754  751  751  ALA ALA A . n 
A 1 755  LEU 755  752  752  LEU LEU A . n 
A 1 756  ARG 756  753  753  ARG ARG A . n 
A 1 757  PRO 757  754  754  PRO PRO A . n 
A 1 758  SER 758  755  755  SER SER A . n 
A 1 759  ALA 759  756  756  ALA ALA A . n 
A 1 760  SER 760  757  757  SER SER A . n 
A 1 761  THR 761  758  758  THR THR A . n 
A 1 762  GLN 762  759  759  GLN GLN A . n 
A 1 763  ALA 763  760  760  ALA ALA A . n 
A 1 764  LEU 764  761  761  LEU LEU A . n 
A 1 765  SER 765  762  762  SER SER A . n 
A 1 766  SER 766  763  763  SER SER A . n 
A 1 767  SER 767  764  764  SER SER A . n 
A 1 768  VAL 768  765  765  VAL VAL A . n 
A 1 769  SER 769  766  766  SER SER A . n 
A 1 770  SER 770  767  767  SER SER A . n 
A 1 771  SER 771  768  768  SER SER A . n 
A 1 772  LYS 772  769  769  LYS LYS A . n 
A 1 773  LEU 773  770  770  LEU LEU A . n 
A 1 774  PHE 774  771  771  PHE PHE A . n 
A 1 775  SER 775  772  772  SER SER A . n 
A 1 776  SER 776  773  773  SER SER A . n 
A 1 777  SER 777  774  ?    ?   ?   A . n 
A 1 778  THR 778  775  ?    ?   ?   A . n 
A 1 779  ALA 779  776  ?    ?   ?   A . n 
A 1 780  PRO 780  777  ?    ?   ?   A . n 
A 1 781  HIS 781  778  ?    ?   ?   A . n 
A 1 782  GLU 782  779  ?    ?   ?   A . n 
A 1 783  THR 783  780  ?    ?   ?   A . n 
A 1 784  SER 784  781  ?    ?   ?   A . n 
A 1 785  PHE 785  782  ?    ?   ?   A . n 
A 1 786  GLY 786  783  783  GLY GLY A . n 
A 1 787  GLU 787  784  784  GLU GLU A . n 
A 1 788  GLU 788  785  785  GLU GLU A . n 
A 1 789  VAL 789  786  786  VAL VAL A . n 
A 1 790  GLU 790  787  787  GLU GLU A . n 
A 1 791  VAL 791  788  788  VAL VAL A . n 
A 1 792  HIS 792  789  789  HIS HIS A . n 
A 1 793  ASN 793  790  790  ASN ASN A . n 
A 1 794  LEU 794  791  791  LEU LEU A . n 
A 1 795  LEU 795  792  792  LEU LEU A . n 
A 1 796  ILE 796  793  793  ILE ILE A . n 
A 1 797  ILE 797  794  794  ILE ILE A . n 
A 1 798  ASP 798  795  795  ASP ASP A . n 
A 1 799  GLN 799  796  796  GLN GLN A . n 
A 1 800  HIS 800  797  797  HIS HIS A . n 
A 1 801  THR 801  798  798  THR THR A . n 
A 1 802  PHE 802  799  799  PHE PHE A . n 
A 1 803  GLU 803  800  800  GLU GLU A . n 
A 1 804  VAL 804  801  801  VAL VAL A . n 
A 1 805  LEU 805  802  802  LEU LEU A . n 
A 1 806  HIS 806  803  803  HIS HIS A . n 
A 1 807  ALA 807  804  804  ALA ALA A . n 
A 1 808  HIS 808  805  805  HIS HIS A . n 
A 1 809  GLN 809  806  806  GLN GLN A . n 
A 1 810  PHE 810  807  807  PHE PHE A . n 
A 1 811  LEU 811  808  808  LEU LEU A . n 
A 1 812  GLN 812  809  809  GLN GLN A . n 
A 1 813  ASN 813  810  810  ASN ASN A . n 
A 1 814  GLU 814  811  811  GLU GLU A . n 
A 1 815  TYR 815  812  812  TYR TYR A . n 
A 1 816  ALA 816  813  813  ALA ALA A . n 
A 1 817  LEU 817  814  814  LEU LEU A . n 
A 1 818  SER 818  815  815  SER SER A . n 
A 1 819  LEU 819  816  816  LEU LEU A . n 
A 1 820  VAL 820  817  817  VAL VAL A . n 
A 1 821  SER 821  818  818  SER SER A . n 
A 1 822  CYS 822  819  819  CYS CYS A . n 
A 1 823  LYS 823  820  820  LYS LYS A . n 
A 1 824  LEU 824  821  821  LEU LEU A . n 
A 1 825  GLY 825  822  822  GLY GLY A . n 
A 1 826  LYS 826  823  823  LYS LYS A . n 
A 1 827  ASP 827  824  824  ASP ASP A . n 
A 1 828  PRO 828  825  825  PRO PRO A . n 
A 1 829  ASN 829  826  826  ASN ASN A . n 
A 1 830  THR 830  827  827  THR THR A . n 
A 1 831  TYR 831  828  828  TYR TYR A . n 
A 1 832  PHE 832  829  829  PHE PHE A . n 
A 1 833  ILE 833  830  830  ILE ILE A . n 
A 1 834  VAL 834  831  831  VAL VAL A . n 
A 1 835  GLY 835  832  832  GLY GLY A . n 
A 1 836  THR 836  833  833  THR THR A . n 
A 1 837  ALA 837  834  834  ALA ALA A . n 
A 1 838  MET 838  835  835  MET MET A . n 
A 1 839  VAL 839  836  836  VAL VAL A . n 
A 1 840  TYR 840  837  837  TYR TYR A . n 
A 1 841  PRO 841  838  838  PRO PRO A . n 
A 1 842  GLU 842  839  839  GLU GLU A . n 
A 1 843  GLU 843  840  840  GLU GLU A . n 
A 1 844  ALA 844  841  841  ALA ALA A . n 
A 1 845  GLU 845  842  842  GLU GLU A . n 
A 1 846  PRO 846  843  843  PRO PRO A . n 
A 1 847  LYS 847  844  844  LYS LYS A . n 
A 1 848  GLN 848  845  845  GLN GLN A . n 
A 1 849  GLY 849  846  846  GLY GLY A . n 
A 1 850  ARG 850  847  847  ARG ARG A . n 
A 1 851  ILE 851  848  848  ILE ILE A . n 
A 1 852  VAL 852  849  849  VAL VAL A . n 
A 1 853  VAL 853  850  850  VAL VAL A . n 
A 1 854  PHE 854  851  851  PHE PHE A . n 
A 1 855  GLN 855  852  852  GLN GLN A . n 
A 1 856  TYR 856  853  853  TYR TYR A . n 
A 1 857  SER 857  854  854  SER SER A . n 
A 1 858  ASP 858  855  855  ASP ASP A . n 
A 1 859  GLY 859  856  856  GLY GLY A . n 
A 1 860  LYS 860  857  857  LYS LYS A . n 
A 1 861  LEU 861  858  858  LEU LEU A . n 
A 1 862  GLN 862  859  859  GLN GLN A . n 
A 1 863  THR 863  860  860  THR THR A . n 
A 1 864  VAL 864  861  861  VAL VAL A . n 
A 1 865  ALA 865  862  862  ALA ALA A . n 
A 1 866  GLU 866  863  863  GLU GLU A . n 
A 1 867  LYS 867  864  864  LYS LYS A . n 
A 1 868  GLU 868  865  865  GLU GLU A . n 
A 1 869  VAL 869  866  866  VAL VAL A . n 
A 1 870  LYS 870  867  867  LYS LYS A . n 
A 1 871  GLY 871  868  868  GLY GLY A . n 
A 1 872  ALA 872  869  869  ALA ALA A . n 
A 1 873  VAL 873  870  870  VAL VAL A . n 
A 1 874  TYR 874  871  871  TYR TYR A . n 
A 1 875  SER 875  872  872  SER SER A . n 
A 1 876  MET 876  873  873  MET MET A . n 
A 1 877  VAL 877  874  874  VAL VAL A . n 
A 1 878  GLU 878  875  875  GLU GLU A . n 
A 1 879  PHE 879  876  876  PHE PHE A . n 
A 1 880  ASN 880  877  877  ASN ASN A . n 
A 1 881  GLY 881  878  878  GLY GLY A . n 
A 1 882  LYS 882  879  879  LYS LYS A . n 
A 1 883  LEU 883  880  880  LEU LEU A . n 
A 1 884  LEU 884  881  881  LEU LEU A . n 
A 1 885  ALA 885  882  882  ALA ALA A . n 
A 1 886  SER 886  883  883  SER SER A . n 
A 1 887  ILE 887  884  884  ILE ILE A . n 
A 1 888  ASN 888  885  885  ASN ASN A . n 
A 1 889  SER 889  886  886  SER SER A . n 
A 1 890  THR 890  887  887  THR THR A . n 
A 1 891  VAL 891  888  888  VAL VAL A . n 
A 1 892  ARG 892  889  889  ARG ARG A . n 
A 1 893  LEU 893  890  890  LEU LEU A . n 
A 1 894  TYR 894  891  891  TYR TYR A . n 
A 1 895  GLU 895  892  892  GLU GLU A . n 
A 1 896  TRP 896  893  893  TRP TRP A . n 
A 1 897  THR 897  894  894  THR THR A . n 
A 1 898  THR 898  895  895  THR THR A . n 
A 1 899  GLU 899  896  896  GLU GLU A . n 
A 1 900  LYS 900  897  897  LYS LYS A . n 
A 1 901  ASP 901  898  898  ASP ASP A . n 
A 1 902  VAL 902  899  899  VAL VAL A . n 
A 1 903  ARG 903  900  900  ARG ARG A . n 
A 1 904  THR 904  901  901  THR THR A . n 
A 1 905  GLU 905  902  902  GLU GLU A . n 
A 1 906  CYS 906  903  903  CYS CYS A . n 
A 1 907  ASN 907  904  904  ASN ASN A . n 
A 1 908  HIS 908  905  905  HIS HIS A . n 
A 1 909  TYR 909  906  906  TYR TYR A . n 
A 1 910  ASN 910  907  907  ASN ASN A . n 
A 1 911  ASN 911  908  908  ASN ASN A . n 
A 1 912  ILE 912  909  909  ILE ILE A . n 
A 1 913  MET 913  910  910  MET MET A . n 
A 1 914  ALA 914  911  911  ALA ALA A . n 
A 1 915  LEU 915  912  912  LEU LEU A . n 
A 1 916  TYR 916  913  913  TYR TYR A . n 
A 1 917  LEU 917  914  914  LEU LEU A . n 
A 1 918  LYS 918  915  915  LYS LYS A . n 
A 1 919  THR 919  916  916  THR THR A . n 
A 1 920  LYS 920  917  917  LYS LYS A . n 
A 1 921  GLY 921  918  918  GLY GLY A . n 
A 1 922  ASP 922  919  919  ASP ASP A . n 
A 1 923  PHE 923  920  920  PHE PHE A . n 
A 1 924  ILE 924  921  921  ILE ILE A . n 
A 1 925  LEU 925  922  922  LEU LEU A . n 
A 1 926  VAL 926  923  923  VAL VAL A . n 
A 1 927  GLY 927  924  924  GLY GLY A . n 
A 1 928  ASP 928  925  925  ASP ASP A . n 
A 1 929  LEU 929  926  926  LEU LEU A . n 
A 1 930  MET 930  927  927  MET MET A . n 
A 1 931  ARG 931  928  928  ARG ARG A . n 
A 1 932  SER 932  929  929  SER SER A . n 
A 1 933  VAL 933  930  930  VAL VAL A . n 
A 1 934  LEU 934  931  931  LEU LEU A . n 
A 1 935  LEU 935  932  932  LEU LEU A . n 
A 1 936  LEU 936  933  933  LEU LEU A . n 
A 1 937  ALA 937  934  934  ALA ALA A . n 
A 1 938  TYR 938  935  935  TYR TYR A . n 
A 1 939  LYS 939  936  936  LYS LYS A . n 
A 1 940  PRO 940  937  937  PRO PRO A . n 
A 1 941  MET 941  938  938  MET MET A . n 
A 1 942  GLU 942  939  939  GLU GLU A . n 
A 1 943  GLY 943  940  940  GLY GLY A . n 
A 1 944  ASN 944  941  941  ASN ASN A . n 
A 1 945  PHE 945  942  942  PHE PHE A . n 
A 1 946  GLU 946  943  943  GLU GLU A . n 
A 1 947  GLU 947  944  944  GLU GLU A . n 
A 1 948  ILE 948  945  945  ILE ILE A . n 
A 1 949  ALA 949  946  946  ALA ALA A . n 
A 1 950  ARG 950  947  947  ARG ARG A . n 
A 1 951  ASP 951  948  948  ASP ASP A . n 
A 1 952  PHE 952  949  949  PHE PHE A . n 
A 1 953  ASN 953  950  950  ASN ASN A . n 
A 1 954  PRO 954  951  951  PRO PRO A . n 
A 1 955  ASN 955  952  952  ASN ASN A . n 
A 1 956  TRP 956  953  953  TRP TRP A . n 
A 1 957  MET 957  954  954  MET MET A . n 
A 1 958  SER 958  955  955  SER SER A . n 
A 1 959  ALA 959  956  956  ALA ALA A . n 
A 1 960  VAL 960  957  957  VAL VAL A . n 
A 1 961  GLU 961  958  958  GLU GLU A . n 
A 1 962  ILE 962  959  959  ILE ILE A . n 
A 1 963  LEU 963  960  960  LEU LEU A . n 
A 1 964  ASP 964  961  961  ASP ASP A . n 
A 1 965  ASP 965  962  962  ASP ASP A . n 
A 1 966  ASP 966  963  963  ASP ASP A . n 
A 1 967  ASN 967  964  964  ASN ASN A . n 
A 1 968  PHE 968  965  965  PHE PHE A . n 
A 1 969  LEU 969  966  966  LEU LEU A . n 
A 1 970  GLY 970  967  967  GLY GLY A . n 
A 1 971  ALA 971  968  968  ALA ALA A . n 
A 1 972  GLU 972  969  969  GLU GLU A . n 
A 1 973  ASN 973  970  970  ASN ASN A . n 
A 1 974  ALA 974  971  971  ALA ALA A . n 
A 1 975  PHE 975  972  972  PHE PHE A . n 
A 1 976  ASN 976  973  973  ASN ASN A . n 
A 1 977  LEU 977  974  974  LEU LEU A . n 
A 1 978  PHE 978  975  975  PHE PHE A . n 
A 1 979  VAL 979  976  976  VAL VAL A . n 
A 1 980  CYS 980  977  977  CYS CYS A . n 
A 1 981  GLN 981  978  978  GLN GLN A . n 
A 1 982  LYS 982  979  979  LYS LYS A . n 
A 1 983  ASP 983  980  980  ASP ASP A . n 
A 1 984  SER 984  981  981  SER SER A . n 
A 1 985  ALA 985  982  982  ALA ALA A . n 
A 1 986  ALA 986  983  983  ALA ALA A . n 
A 1 987  THR 987  984  984  THR THR A . n 
A 1 988  THR 988  985  985  THR THR A . n 
A 1 989  ASP 989  986  986  ASP ASP A . n 
A 1 990  GLU 990  987  987  GLU GLU A . n 
A 1 991  GLU 991  988  988  GLU GLU A . n 
A 1 992  ARG 992  989  989  ARG ARG A . n 
A 1 993  GLN 993  990  990  GLN GLN A . n 
A 1 994  HIS 994  991  991  HIS HIS A . n 
A 1 995  LEU 995  992  992  LEU LEU A . n 
A 1 996  GLN 996  993  993  GLN GLN A . n 
A 1 997  GLU 997  994  994  GLU GLU A . n 
A 1 998  VAL 998  995  995  VAL VAL A . n 
A 1 999  GLY 999  996  996  GLY GLY A . n 
A 1 1000 LEU 1000 997  997  LEU LEU A . n 
A 1 1001 PHE 1001 998  998  PHE PHE A . n 
A 1 1002 HIS 1002 999  999  HIS HIS A . n 
A 1 1003 LEU 1003 1000 1000 LEU LEU A . n 
A 1 1004 GLY 1004 1001 1001 GLY GLY A . n 
A 1 1005 GLU 1005 1002 1002 GLU GLU A . n 
A 1 1006 PHE 1006 1003 1003 PHE PHE A . n 
A 1 1007 VAL 1007 1004 1004 VAL VAL A . n 
A 1 1008 ASN 1008 1005 1005 ASN ASN A . n 
A 1 1009 VAL 1009 1006 1006 VAL VAL A . n 
A 1 1010 PHE 1010 1007 1007 PHE PHE A . n 
A 1 1011 CYS 1011 1008 1008 CYS CYS A . n 
A 1 1012 HIS 1012 1009 1009 HIS HIS A . n 
A 1 1013 GLY 1013 1010 1010 GLY GLY A . n 
A 1 1014 SER 1014 1011 1011 SER SER A . n 
A 1 1015 LEU 1015 1012 1012 LEU LEU A . n 
A 1 1016 VAL 1016 1013 1013 VAL VAL A . n 
A 1 1017 MET 1017 1014 1014 MET MET A . n 
A 1 1018 GLN 1018 1015 1015 GLN GLN A . n 
A 1 1019 ASN 1019 1016 ?    ?   ?   A . n 
A 1 1020 LEU 1020 1017 ?    ?   ?   A . n 
A 1 1021 GLY 1021 1018 ?    ?   ?   A . n 
A 1 1022 GLU 1022 1019 ?    ?   ?   A . n 
A 1 1023 THR 1023 1020 ?    ?   ?   A . n 
A 1 1024 SER 1024 1021 ?    ?   ?   A . n 
A 1 1025 THR 1025 1022 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1023 1023 PRO PRO A . n 
A 1 1027 THR 1027 1024 1024 THR THR A . n 
A 1 1028 GLN 1028 1025 1025 GLN GLN A . n 
A 1 1029 GLY 1029 1026 1026 GLY GLY A . n 
A 1 1030 SER 1030 1027 1027 SER SER A . n 
A 1 1031 VAL 1031 1028 1028 VAL VAL A . n 
A 1 1032 LEU 1032 1029 1029 LEU LEU A . n 
A 1 1033 PHE 1033 1030 1030 PHE PHE A . n 
A 1 1034 GLY 1034 1031 1031 GLY GLY A . n 
A 1 1035 THR 1035 1032 1032 THR THR A . n 
A 1 1036 VAL 1036 1033 1033 VAL VAL A . n 
A 1 1037 ASN 1037 1034 1034 ASN ASN A . n 
A 1 1038 GLY 1038 1035 1035 GLY GLY A . n 
A 1 1039 MET 1039 1036 1036 MET MET A . n 
A 1 1040 ILE 1040 1037 1037 ILE ILE A . n 
A 1 1041 GLY 1041 1038 1038 GLY GLY A . n 
A 1 1042 LEU 1042 1039 1039 LEU LEU A . n 
A 1 1043 VAL 1043 1040 1040 VAL VAL A . n 
A 1 1044 THR 1044 1041 1041 THR THR A . n 
A 1 1045 SER 1045 1042 1042 SER SER A . n 
A 1 1046 LEU 1046 1043 1043 LEU LEU A . n 
A 1 1047 SER 1047 1044 1044 SER SER A . n 
A 1 1048 GLU 1048 1045 1045 GLU GLU A . n 
A 1 1049 SER 1049 1046 1046 SER SER A . n 
A 1 1050 TRP 1050 1047 1047 TRP TRP A . n 
A 1 1051 TYR 1051 1048 1048 TYR TYR A . n 
A 1 1052 ASN 1052 1049 1049 ASN ASN A . n 
A 1 1053 LEU 1053 1050 1050 LEU LEU A . n 
A 1 1054 LEU 1054 1051 1051 LEU LEU A . n 
A 1 1055 LEU 1055 1052 1052 LEU LEU A . n 
A 1 1056 ASP 1056 1053 1053 ASP ASP A . n 
A 1 1057 MET 1057 1054 1054 MET MET A . n 
A 1 1058 GLN 1058 1055 1055 GLN GLN A . n 
A 1 1059 ASN 1059 1056 1056 ASN ASN A . n 
A 1 1060 ARG 1060 1057 1057 ARG ARG A . n 
A 1 1061 LEU 1061 1058 1058 LEU LEU A . n 
A 1 1062 ASN 1062 1059 1059 ASN ASN A . n 
A 1 1063 LYS 1063 1060 1060 LYS LYS A . n 
A 1 1064 VAL 1064 1061 1061 VAL VAL A . n 
A 1 1065 ILE 1065 1062 1062 ILE ILE A . n 
A 1 1066 LYS 1066 1063 1063 LYS LYS A . n 
A 1 1067 SER 1067 1064 1064 SER SER A . n 
A 1 1068 VAL 1068 1065 1065 VAL VAL A . n 
A 1 1069 GLY 1069 1066 1066 GLY GLY A . n 
A 1 1070 LYS 1070 1067 1067 LYS LYS A . n 
A 1 1071 ILE 1071 1068 1068 ILE ILE A . n 
A 1 1072 GLU 1072 1069 1069 GLU GLU A . n 
A 1 1073 HIS 1073 1070 1070 HIS HIS A . n 
A 1 1074 SER 1074 1071 1071 SER SER A . n 
A 1 1075 PHE 1075 1072 1072 PHE PHE A . n 
A 1 1076 TRP 1076 1073 1073 TRP TRP A . n 
A 1 1077 ARG 1077 1074 1074 ARG ARG A . n 
A 1 1078 SER 1078 1075 1075 SER SER A . n 
A 1 1079 PHE 1079 1076 1076 PHE PHE A . n 
A 1 1080 HIS 1080 1077 1077 HIS HIS A . n 
A 1 1081 THR 1081 1078 1078 THR THR A . n 
A 1 1082 GLU 1082 1079 1079 GLU GLU A . n 
A 1 1083 ARG 1083 1080 1080 ARG ARG A . n 
A 1 1084 LYS 1084 1081 1081 LYS LYS A . n 
A 1 1085 THR 1085 1082 1082 THR THR A . n 
A 1 1086 GLU 1086 1083 1083 GLU GLU A . n 
A 1 1087 PRO 1087 1084 1084 PRO PRO A . n 
A 1 1088 ALA 1088 1085 1085 ALA ALA A . n 
A 1 1089 THR 1089 1086 1086 THR THR A . n 
A 1 1090 GLY 1090 1087 1087 GLY GLY A . n 
A 1 1091 PHE 1091 1088 1088 PHE PHE A . n 
A 1 1092 ILE 1092 1089 1089 ILE ILE A . n 
A 1 1093 ASP 1093 1090 1090 ASP ASP A . n 
A 1 1094 GLY 1094 1091 1091 GLY GLY A . n 
A 1 1095 ASP 1095 1092 1092 ASP ASP A . n 
A 1 1096 LEU 1096 1093 1093 LEU LEU A . n 
A 1 1097 ILE 1097 1094 1094 ILE ILE A . n 
A 1 1098 GLU 1098 1095 1095 GLU GLU A . n 
A 1 1099 SER 1099 1096 1096 SER SER A . n 
A 1 1100 PHE 1100 1097 1097 PHE PHE A . n 
A 1 1101 LEU 1101 1098 1098 LEU LEU A . n 
A 1 1102 ASP 1102 1099 1099 ASP ASP A . n 
A 1 1103 ILE 1103 1100 1100 ILE ILE A . n 
A 1 1104 SER 1104 1101 1101 SER SER A . n 
A 1 1105 ARG 1105 1102 1102 ARG ARG A . n 
A 1 1106 PRO 1106 1103 1103 PRO PRO A . n 
A 1 1107 LYS 1107 1104 1104 LYS LYS A . n 
A 1 1108 MET 1108 1105 1105 MET MET A . n 
A 1 1109 GLN 1109 1106 1106 GLN GLN A . n 
A 1 1110 GLU 1110 1107 1107 GLU GLU A . n 
A 1 1111 VAL 1111 1108 1108 VAL VAL A . n 
A 1 1112 VAL 1112 1109 1109 VAL VAL A . n 
A 1 1113 ALA 1113 1110 1110 ALA ALA A . n 
A 1 1114 ASN 1114 1111 1111 ASN ASN A . n 
A 1 1115 LEU 1115 1112 ?    ?   ?   A . n 
A 1 1116 GLN 1116 1113 ?    ?   ?   A . n 
A 1 1117 TYR 1117 1114 ?    ?   ?   A . n 
A 1 1118 ASP 1118 1115 ?    ?   ?   A . n 
A 1 1119 ASP 1119 1116 ?    ?   ?   A . n 
A 1 1120 GLY 1120 1117 ?    ?   ?   A . n 
A 1 1121 SER 1121 1118 ?    ?   ?   A . n 
A 1 1122 GLY 1122 1119 ?    ?   ?   A . n 
A 1 1123 MET 1123 1120 ?    ?   ?   A . n 
A 1 1124 LYS 1124 1121 ?    ?   ?   A . n 
A 1 1125 ARG 1125 1122 1122 ARG ARG A . n 
A 1 1126 GLU 1126 1123 1123 GLU GLU A . n 
A 1 1127 ALA 1127 1124 1124 ALA ALA A . n 
A 1 1128 THR 1128 1125 1125 THR THR A . n 
A 1 1129 ALA 1129 1126 1126 ALA ALA A . n 
A 1 1130 ASP 1130 1127 1127 ASP ASP A . n 
A 1 1131 ASP 1131 1128 1128 ASP ASP A . n 
A 1 1132 LEU 1132 1129 1129 LEU LEU A . n 
A 1 1133 ILE 1133 1130 1130 ILE ILE A . n 
A 1 1134 LYS 1134 1131 1131 LYS LYS A . n 
A 1 1135 VAL 1135 1132 1132 VAL VAL A . n 
A 1 1136 VAL 1136 1133 1133 VAL VAL A . n 
A 1 1137 GLU 1137 1134 1134 GLU GLU A . n 
A 1 1138 GLU 1138 1135 1135 GLU GLU A . n 
A 1 1139 LEU 1139 1136 1136 LEU LEU A . n 
A 1 1140 THR 1140 1137 1137 THR THR A . n 
A 1 1141 ARG 1141 1138 1138 ARG ARG A . n 
A 1 1142 ILE 1142 1139 1139 ILE ILE A . n 
A 1 1143 HIS 1143 1140 1140 HIS HIS A . n 
B 2 1    ASN 1    5    5    ASN ASN B . n 
B 2 2    ILE 2    6    6    ILE ILE B . n 
B 2 3    THR 3    7    7    THR THR B . n 
B 2 4    ARG 4    8    8    ARG ARG B . n 
B 2 5    ASP 5    9    9    ASP ASP B . n 
B 2 6    LEU 6    10   10   LEU LEU B . n 
B 2 7    ILE 7    11   11   ILE ILE B . n 
B 2 8    ARG 8    12   12   ARG ARG B . n 
B 2 9    ARG 9    13   13   ARG ARG B . n 
B 2 10   GLN 10   14   14   GLN GLN B . n 
B 2 11   ILE 11   15   15   ILE ILE B . n 
B 2 12   LYS 12   16   16   LYS LYS B . n 
B 2 13   GLU 13   17   17   GLU GLU B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1750  ? 
1 MORE         -5    ? 
1 'SSA (A^2)'  47820 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3I7N 
_pdbx_entry_details.sequence_details     'MUTATIONS OCCURRED DURING THE CLONING OF DDB1' 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG  A GLU 384  ? ? CD  A GLU 384  ? ? 1.607 1.515 0.092  0.015 N 
2 1 CB  A CYS 725  ? ? SG  A CYS 725  ? ? 1.650 1.812 -0.162 0.016 N 
3 1 CE1 A TYR 913  ? ? CZ  A TYR 913  ? ? 1.487 1.381 0.106  0.013 N 
4 1 N   A ASP 925  ? ? CA  A ASP 925  ? ? 1.581 1.459 0.122  0.020 N 
5 1 CB  A CYS 1008 ? ? SG  A CYS 1008 ? ? 1.712 1.812 -0.100 0.016 N 
6 1 CZ  B ARG 13   ? ? NH2 B ARG 13   ? ? 1.413 1.326 0.087  0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C  A ASP 184 ? ? N  A PRO 185 ? ? CD  A PRO 185 ? ? 102.84 128.40 -25.56 2.10 Y 
2  1 N  A GLY 187 ? ? CA A GLY 187 ? ? C   A GLY 187 ? ? 131.51 113.10 18.41  2.50 N 
3  1 CB A ASP 330 ? ? CG A ASP 330 ? ? OD1 A ASP 330 ? ? 128.86 118.30 10.56  0.90 N 
4  1 CB A ASP 330 ? ? CG A ASP 330 ? ? OD2 A ASP 330 ? ? 112.13 118.30 -6.17  0.90 N 
5  1 CB A GLU 342 ? ? CA A GLU 342 ? ? C   A GLU 342 ? ? 94.45  110.40 -15.95 2.00 N 
6  1 N  A GLU 342 ? ? CA A GLU 342 ? ? C   A GLU 342 ? ? 147.72 111.00 36.72  2.70 N 
7  1 N  A GLN 343 ? ? CA A GLN 343 ? ? CB  A GLN 343 ? ? 94.38  110.60 -16.22 1.80 N 
8  1 N  A GLN 343 ? ? CA A GLN 343 ? ? C   A GLN 343 ? ? 92.50  111.00 -18.50 2.70 N 
9  1 N  A LEU 367 ? ? CA A LEU 367 ? ? C   A LEU 367 ? ? 89.05  111.00 -21.95 2.70 N 
10 1 NE A ARG 388 ? ? CZ A ARG 388 ? ? NH1 A ARG 388 ? ? 117.18 120.30 -3.12  0.50 N 
11 1 CA A LEU 468 ? ? CB A LEU 468 ? ? CG  A LEU 468 ? ? 129.43 115.30 14.13  2.30 N 
12 1 CB A TRP 561 ? ? CA A TRP 561 ? ? C   A TRP 561 ? ? 76.47  110.40 -33.93 2.00 N 
13 1 N  A TRP 561 ? ? CA A TRP 561 ? ? C   A TRP 561 ? ? 156.59 111.00 45.59  2.70 N 
14 1 N  A THR 562 ? ? CA A THR 562 ? ? CB  A THR 562 ? ? 93.12  110.30 -17.18 1.90 N 
15 1 N  A ILE 564 ? ? CA A ILE 564 ? ? C   A ILE 564 ? ? 86.95  111.00 -24.05 2.70 N 
16 1 N  A THR 714 ? ? CA A THR 714 ? ? CB  A THR 714 ? ? 96.62  110.30 -13.68 1.90 N 
17 1 N  A THR 714 ? ? CA A THR 714 ? ? C   A THR 714 ? ? 127.75 111.00 16.75  2.70 N 
18 1 NE B ARG 13  ? ? CZ B ARG 13  ? ? NH1 B ARG 13  ? ? 110.91 120.30 -9.39  0.50 N 
19 1 NE B ARG 13  ? ? CZ B ARG 13  ? ? NH2 B ARG 13  ? ? 124.39 120.30 4.09   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASP A 28   ? ? -175.89 142.17  
2   1 LYS A 35   ? ? -80.76  -113.56 
3   1 TYR A 58   ? ? -92.66  51.24   
4   1 PRO A 69   ? ? -70.61  -130.62 
5   1 SER A 94   ? ? -62.84  70.22   
6   1 SER A 116  ? ? -81.27  -159.50 
7   1 THR A 118  ? ? 92.71   7.60    
8   1 ASP A 148  ? ? -79.53  -118.36 
9   1 ASN A 149  ? ? 35.79   36.71   
10  1 PRO A 176  ? ? -39.90  118.99  
11  1 ASP A 184  ? ? -128.61 -150.83 
12  1 GLN A 186  ? ? 91.32   38.68   
13  1 LYS A 200  ? ? 78.09   38.80   
14  1 PHE A 202  ? ? -95.04  -105.99 
15  1 ASN A 203  ? ? 136.76  169.59  
16  1 GLN A 209  ? ? -54.66  103.87  
17  1 GLU A 224  ? ? -29.04  -51.63  
18  1 GLU A 235  ? ? 52.07   7.25    
19  1 ASN A 241  ? ? -172.84 119.67  
20  1 LYS A 287  ? ? -62.51  -170.22 
21  1 GLU A 288  ? ? -175.66 120.61  
22  1 MET A 291  ? ? -28.42  148.78  
23  1 THR A 294  ? ? -17.52  -101.84 
24  1 THR A 296  ? ? -136.72 -154.68 
25  1 LEU A 317  ? ? -114.49 -119.78 
26  1 ASP A 318  ? ? -72.17  -127.24 
27  1 GLU A 368  ? ? -56.43  -4.14   
28  1 GLN A 370  ? ? -106.90 -84.49  
29  1 PHE A 382  ? ? 37.17   -137.34 
30  1 PRO A 405  ? ? -66.74  70.30   
31  1 ILE A 407  ? ? -18.87  115.24  
32  1 LEU A 410  ? ? -177.26 138.13  
33  1 LEU A 413  ? ? -164.53 99.36   
34  1 PRO A 417  ? ? -65.66  10.49   
35  1 ASN A 418  ? ? -108.16 -81.38  
36  1 VAL A 430  ? ? -62.93  66.84   
37  1 ASN A 439  ? ? -85.57  32.62   
38  1 PHE A 459  ? ? 170.92  164.41  
39  1 CYS A 460  ? ? -175.14 11.76   
40  1 ASN A 462  ? ? -115.64 72.90   
41  1 HIS A 465  ? ? 82.13   33.40   
42  1 ALA A 474  ? ? -56.51  -101.50 
43  1 VAL A 476  ? ? -52.42  98.55   
44  1 GLU A 482  ? ? -67.65  -77.87  
45  1 LYS A 484  ? ? 52.69   71.20   
46  1 ALA A 485  ? ? -165.02 -124.45 
47  1 LEU A 486  ? ? -113.29 72.44   
48  1 GLU A 489  ? ? 169.80  109.29  
49  1 PRO A 493  ? ? -51.92  18.35   
50  1 GLN A 494  ? ? -152.46 -2.40   
51  1 CYS A 503  ? ? 160.91  140.09  
52  1 ASN A 504  ? ? -105.78 -67.55  
53  1 SER A 505  ? ? -167.76 10.58   
54  1 SER A 506  ? ? -155.72 -40.82  
55  1 TYR A 517  ? ? -75.25  -152.46 
56  1 TYR A 518  ? ? 176.94  122.21  
57  1 PRO A 523  ? ? -46.11  94.00   
58  1 GLN A 524  ? ? 83.00   11.00   
59  1 ILE A 529  ? ? -133.76 -79.94  
60  1 PRO A 545  ? ? -56.42  101.50  
61  1 LEU A 546  ? ? -63.95  -74.92  
62  1 ASP A 548  ? ? -87.27  38.35   
63  1 PRO A 554  ? ? -55.37  -137.45 
64  1 LYS A 570  ? ? -105.31 -155.63 
65  1 LEU A 571  ? ? -101.61 -86.46  
66  1 LEU A 577  ? ? -102.59 -127.82 
67  1 PHE A 596  ? ? -137.04 -58.40  
68  1 GLU A 597  ? ? -134.42 -65.39  
69  1 THR A 620  ? ? -112.58 -74.94  
70  1 LEU A 622  ? ? -149.07 -123.52 
71  1 SER A 624  ? ? -143.60 -127.96 
72  1 VAL A 629  ? ? -101.81 -151.93 
73  1 THR A 630  ? ? -155.29 10.90   
74  1 LEU A 631  ? ? -13.31  -111.78 
75  1 SER A 643  ? ? -146.86 -120.52 
76  1 LEU A 644  ? ? -87.44  -150.38 
77  1 TYR A 660  ? ? -92.15  -125.86 
78  1 SER A 662  ? ? -86.84  -123.72 
79  1 LYS A 665  ? ? -73.34  -144.51 
80  1 ASN A 683  ? ? -174.97 6.31    
81  1 SER A 684  ? ? -42.61  153.30  
82  1 TYR A 687  ? ? -158.87 40.42   
83  1 ASP A 689  ? ? 26.64   36.43   
84  1 LEU A 693  ? ? -163.78 112.10  
85  1 ASN A 695  ? ? -115.38 -160.99 
86  1 SER A 697  ? ? -165.21 96.85   
87  1 THR A 698  ? ? 154.91  124.41  
88  1 ASP A 705  ? ? -80.52  -130.44 
89  1 GLU A 706  ? ? -86.99  -106.22 
90  1 ILE A 707  ? ? -165.41 -46.84  
91  1 GLN A 708  ? ? -51.66  -179.67 
92  1 THR A 750  ? ? -93.41  -86.15  
93  1 ALA A 751  ? ? 138.35  147.92  
94  1 SER A 762  ? ? -128.59 -169.23 
95  1 SER A 768  ? ? 7.55    132.58  
96  1 SER A 772  ? ? -156.69 -51.57  
97  1 VAL A 801  ? ? -67.68  89.27   
98  1 THR A 833  ? ? -127.58 -165.21 
99  1 ALA A 834  ? ? -179.00 139.96  
100 1 SER A 854  ? ? -94.63  -119.36 
101 1 THR A 860  ? ? -66.64  92.74   
102 1 ALA A 862  ? ? 174.23  145.88  
103 1 LYS A 867  ? ? -107.34 44.22   
104 1 MET A 873  ? ? -165.74 112.91  
105 1 PHE A 876  ? ? -77.50  -94.35  
106 1 ALA A 882  ? ? -112.28 -124.26 
107 1 SER A 883  ? ? 150.62  115.42  
108 1 ASN A 885  ? ? 54.86   -20.56  
109 1 SER A 886  ? ? 159.38  1.46    
110 1 GLU A 896  ? ? -62.57  5.76    
111 1 MET A 910  ? ? -172.29 100.30  
112 1 ASP A 919  ? ? -56.27  -167.44 
113 1 PHE A 920  ? ? -85.36  31.01   
114 1 ASP A 925  ? ? 176.79  160.34  
115 1 SER A 929  ? ? 37.68   -122.50 
116 1 PRO A 937  ? ? -61.75  58.42   
117 1 MET A 938  ? ? -110.84 -99.24  
118 1 PHE A 949  ? ? -102.43 60.79   
119 1 PRO A 951  ? ? -83.60  42.52   
120 1 ASN A 970  ? ? 16.33   -43.15  
121 1 SER A 981  ? ? -59.15  107.92  
122 1 THR A 985  ? ? -59.62  64.89   
123 1 ASP A 986  ? ? -153.27 -29.00  
124 1 GLU A 994  ? ? -69.95  90.88   
125 1 PHE A 998  ? ? 179.30  124.37  
126 1 VAL A 1013 ? ? -95.16  -101.26 
127 1 MET A 1014 ? ? -44.64  -157.70 
128 1 VAL A 1065 ? ? -56.36  -92.42  
129 1 GLU A 1079 ? ? -77.87  44.31   
130 1 ARG A 1080 ? ? -153.53 -15.61  
131 1 PHE A 1097 ? ? -29.16  -58.35  
132 1 ALA A 1110 ? ? -156.50 -11.49  
133 1 ASP A 1127 ? ? -160.76 15.67   
134 1 ILE A 1130 ? ? -36.91  -33.57  
135 1 LYS B 16   ? ? 38.66   -173.41 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2   ? A GLY 1    
2  1 Y 1 A SER -1   ? A SER 2    
3  1 Y 1 A HIS 0    ? A HIS 3    
4  1 Y 1 A SER 774  ? A SER 777  
5  1 Y 1 A THR 775  ? A THR 778  
6  1 Y 1 A ALA 776  ? A ALA 779  
7  1 Y 1 A PRO 777  ? A PRO 780  
8  1 Y 1 A HIS 778  ? A HIS 781  
9  1 Y 1 A GLU 779  ? A GLU 782  
10 1 Y 1 A THR 780  ? A THR 783  
11 1 Y 1 A SER 781  ? A SER 784  
12 1 Y 1 A PHE 782  ? A PHE 785  
13 1 Y 1 A ASN 1016 ? A ASN 1019 
14 1 Y 1 A LEU 1017 ? A LEU 1020 
15 1 Y 1 A GLY 1018 ? A GLY 1021 
16 1 Y 1 A GLU 1019 ? A GLU 1022 
17 1 Y 1 A THR 1020 ? A THR 1023 
18 1 Y 1 A SER 1021 ? A SER 1024 
19 1 Y 1 A THR 1022 ? A THR 1025 
20 1 Y 1 A LEU 1112 ? A LEU 1115 
21 1 Y 1 A GLN 1113 ? A GLN 1116 
22 1 Y 1 A TYR 1114 ? A TYR 1117 
23 1 Y 1 A ASP 1115 ? A ASP 1118 
24 1 Y 1 A ASP 1116 ? A ASP 1119 
25 1 Y 1 A GLY 1117 ? A GLY 1120 
26 1 Y 1 A SER 1118 ? A SER 1121 
27 1 Y 1 A GLY 1119 ? A GLY 1122 
28 1 Y 1 A MET 1120 ? A MET 1123 
29 1 Y 1 A LYS 1121 ? A LYS 1124 
#