data_3I7O
# 
_entry.id   3I7O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I7O         
RCSB  RCSB054067   
WWPDB D_1000054067 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7H 'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX'    unspecified 
PDB 3I7K 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX'    unspecified 
PDB 3I7L 'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2'   unspecified 
PDB 3I7N 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1'  unspecified 
PDB 3I7P 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I89 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I8C 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' unspecified 
PDB 3I8E 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I7O 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I7O 
_cell.length_a           63.759 
_cell.length_b           131.940 
_cell.length_c           181.271 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I7O 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1'                127399.766 1 ? ? ?               ? 
2 polymer syn 'IQ motif and WD repeat-containing protein 1' 1596.919   1 ? ? 'Residues 9-21' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
2 'NRIP, Nuclear receptor interaction protein, Androgen receptor complex-associated protein, ARCAP' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no HLLWDVRKRSLGL HLLWDVRKRSLGL B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    HIS n 
2 2    LEU n 
2 3    LEU n 
2 4    TRP n 
2 5    ASP n 
2 6    VAL n 
2 7    ARG n 
2 8    LYS n 
2 9    ARG n 
2 10   SER n 
2 11   LEU n 
2 12   GLY n 
2 13   LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN  Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1 ? 
2 UNP IQWD1_HUMAN Q58WW2 2 HLLWDVRKRSLGL 9 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I7O A 4 ? 1143 ? Q16531 1 ? 1140 ? 1 1140 
2 2 3I7O B 1 ? 13   ? Q58WW2 9 ? 21   ? 9 21   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I7O GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1 
1 3I7O SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2 
1 3I7O HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3 
1 3I7O TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4 
1 3I7O ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5 
1 3I7O VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I7O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.96 
_exptl_crystal.density_percent_sol   58.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005M DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I7O 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             44.46 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   30520 
_reflns.number_all                   37936 
_reflns.percent_possible_obs         80.5 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.872 
_reflns_shell.percent_possible_all   82.5 
_reflns_shell.Rmerge_I_obs           0.527 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1949 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3I7O 
_refine.ls_number_reflns_obs                     30520 
_refine.ls_number_reflns_all                     37936 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.46 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    83.34 
_refine.ls_R_factor_obs                          0.259 
_refine.ls_R_factor_all                          0.280 
_refine.ls_R_factor_R_work                       0.256 
_refine.ls_R_factor_R_free                       0.320 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1584 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.912 
_refine.correlation_coeff_Fo_to_Fc_free          0.843 
_refine.B_iso_mean                               83.210 
_refine.aniso_B[1][1]                            -0.07 
_refine.aniso_B[2][2]                            2.38 
_refine.aniso_B[3][3]                            -2.31 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.153 
_refine.pdbx_overall_ESU_R_Free                  0.522 
_refine.overall_SU_ML                            0.374 
_refine.overall_SU_B                             18.749 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8838 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8838 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        44.46 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.017  0.022  ? 9000  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.843  1.965  ? 12188 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   8.168  5.000  ? 1122  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   40.364 24.681 ? 408   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   22.040 15.000 ? 1595  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20.069 15.000 ? 50    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.115  0.200  ? 1404  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 6711  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.286  0.200  ? 4949  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.330  0.200  ? 6134  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.212  0.200  ? 386   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.235  0.200  ? 39    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.284  0.200  ? 5     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.872 
_refine_ls_shell.number_reflns_R_work             1949 
_refine_ls_shell.R_factor_R_work                  0.388 
_refine_ls_shell.percent_reflns_obs               73.09 
_refine_ls_shell.R_factor_R_free                  0.444 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             102 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1949 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3I7O 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, IQ motif and WD repeat-containing protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I7O 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;DDB1, IQWD1, DCAF6, H-Box Motif, Cytoplasm, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, Alternative splicing, WD repeat, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 253  ? GLN A 258  ? PRO A 250  GLN A 255  1 ? 6  
HELX_P HELX_P2  2  GLU A 345  ? GLY A 347  ? GLU A 342  GLY A 344  5 ? 3  
HELX_P HELX_P3  3  ALA A 384  ? GLY A 388  ? ALA A 381  GLY A 385  5 ? 5  
HELX_P HELX_P4  4  GLU A 731  ? SER A 733  ? GLU A 728  SER A 730  5 ? 3  
HELX_P HELX_P5  5  SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P6  6  GLU A 1072 ? ARG A 1077 ? GLU A 1069 ARG A 1074 1 ? 6  
HELX_P HELX_P7  7  GLY A 1094 ? PHE A 1100 ? GLY A 1091 PHE A 1097 1 ? 7  
HELX_P HELX_P8  8  LEU A 1101 ? ILE A 1103 ? LEU A 1098 ILE A 1100 5 ? 3  
HELX_P HELX_P9  9  SER A 1104 ? VAL A 1112 ? SER A 1101 VAL A 1109 1 ? 9  
HELX_P HELX_P10 10 ASP A 1130 ? ARG A 1141 ? ASP A 1127 ARG A 1138 1 ? 12 
HELX_P HELX_P11 11 HIS B 1    ? LEU B 11   ? HIS B 9    LEU B 19   1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            21 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            316 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             18 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             313 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.046 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           368 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            365 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ASP 
_struct_mon_prot_cis.pdbx_label_seq_id_2    369 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ASP 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     366 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
K ? 3 ? 
L ? 2 ? 
M ? 3 ? 
N ? 4 ? 
O ? 4 ? 
P ? 4 ? 
Q ? 3 ? 
R ? 5 ? 
S ? 4 ? 
T ? 3 ? 
U ? 3 ? 
V ? 4 ? 
W ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? parallel      
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
W 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
A 2 GLN A 1028 ? THR A 1035 ? GLN A 1025 THR A 1032 
A 3 ILE A 1040 ? SER A 1045 ? ILE A 1037 SER A 1042 
A 4 ASN A 7    ? GLN A 13   ? ASN A 4    GLN A 10   
A 5 PHE A 1091 ? ASP A 1093 ? PHE A 1088 ASP A 1090 
B 1 GLY A 20   ? SER A 28   ? GLY A 17   SER A 25   
B 2 ASP A 31   ? ALA A 37   ? ASP A 28   ALA A 34   
B 3 ARG A 41   ? VAL A 47   ? ARG A 38   VAL A 44   
B 4 LEU A 52   ? GLY A 59   ? LEU A 49   GLY A 56   
C 1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C 2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C 3 ASN A 88   ? SER A 97   ? ASN A 85   SER A 94   
C 4 SER A 100  ? ASN A 110  ? SER A 97   ASN A 107  
D 1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D 2 MET A 133  ? TYR A 139  ? MET A 130  TYR A 136  
D 3 LEU A 142  ? PRO A 147  ? LEU A 139  PRO A 144  
D 4 PHE A 158  ? ARG A 161  ? PHE A 155  ARG A 158  
E 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
E 2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
E 3 GLY A 190  ? GLU A 197  ? GLY A 187  GLU A 194  
F 1 MET A 221  ? ALA A 224  ? MET A 218  ALA A 221  
F 2 ALA A 232  ? ILE A 235  ? ALA A 229  ILE A 232  
F 3 ILE A 240  ? HIS A 243  ? ILE A 237  HIS A 240  
F 4 TYR A 248  ? ILE A 251  ? TYR A 245  ILE A 248  
G 1 ILE A 261  ? ARG A 266  ? ILE A 258  ARG A 263  
G 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
G 3 ARG A 282  ? GLU A 289  ? ARG A 279  GLU A 286  
G 4 ASP A 302  ? VAL A 305  ? ASP A 299  VAL A 302  
H 1 ILE A 261  ? ARG A 266  ? ILE A 258  ARG A 263  
H 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
H 3 ARG A 282  ? GLU A 289  ? ARG A 279  GLU A 286  
H 4 GLY A 309  ? GLU A 310  ? GLY A 306  GLU A 307  
I 1 CYS A 316  ? TYR A 319  ? CYS A 313  TYR A 316  
I 2 VAL A 324  ? GLY A 328  ? VAL A 321  GLY A 325  
I 3 SER A 334  ? ASN A 344  ? SER A 331  ASN A 341  
I 4 SER A 348  ? PHE A 356  ? SER A 345  PHE A 353  
J 1 ILE A 362  ? VAL A 368  ? ILE A 359  VAL A 365  
J 2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
J 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
J 4 LEU A 713  ? ARG A 716  ? LEU A 710  ARG A 713  
K 1 GLY A 412  ? TRP A 414  ? GLY A 409  TRP A 411  
K 2 VAL A 429  ? SER A 431  ? VAL A 426  SER A 428  
K 3 THR A 436  ? ARG A 437  ? THR A 433  ARG A 434  
L 1 GLN A 470  ? ILE A 474  ? GLN A 467  ILE A 471  
L 2 VAL A 479  ? SER A 483  ? VAL A 476  SER A 480  
M 1 GLN A 510  ? VAL A 511  ? GLN A 507  VAL A 508  
M 2 LEU A 522  ? GLN A 523  ? LEU A 519  GLN A 520  
M 3 ARG A 530  ? GLN A 531  ? ARG A 527  GLN A 528  
N 1 VAL A 541  ? ASP A 545  ? VAL A 538  ASP A 542  
N 2 CYS A 559  ? LEU A 563  ? CYS A 556  LEU A 560  
N 3 SER A 568  ? LEU A 572  ? SER A 565  LEU A 569  
N 4 LYS A 582  ? GLU A 583  ? LYS A 579  GLU A 580  
O 1 PRO A 591  ? THR A 598  ? PRO A 588  THR A 595  
O 2 HIS A 603  ? LEU A 609  ? HIS A 600  LEU A 606  
O 3 LEU A 614  ? LEU A 619  ? LEU A 611  LEU A 616  
O 4 LYS A 631  ? VAL A 632  ? LYS A 628  VAL A 629  
P 1 VAL A 640  ? THR A 643  ? VAL A 637  THR A 640  
P 2 VAL A 652  ? CYS A 655  ? VAL A 649  CYS A 652  
P 3 THR A 660  ? ILE A 662  ? THR A 657  ILE A 659  
P 4 SER A 672  ? ASN A 673  ? SER A 669  ASN A 670  
Q 1 TYR A 681  ? CYS A 683  ? TYR A 678  CYS A 680  
Q 2 LEU A 694  ? ASN A 698  ? LEU A 691  ASN A 695  
Q 3 THR A 701  ? GLY A 705  ? THR A 698  GLY A 702  
R 1 SER A 723  ? GLN A 730  ? SER A 720  GLN A 727  
R 2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
R 3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
R 4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
R 5 SER A 767  ? VAL A 768  ? SER A 764  VAL A 765  
S 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
S 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
S 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
S 4 LEU A 861  ? VAL A 869  ? LEU A 858  VAL A 866  
T 1 LEU A 883  ? SER A 886  ? LEU A 880  SER A 883  
T 2 VAL A 891  ? TRP A 896  ? VAL A 888  TRP A 893  
T 3 VAL A 902  ? HIS A 908  ? VAL A 899  HIS A 905  
U 1 ILE A 924  ? GLY A 927  ? ILE A 921  GLY A 924  
U 2 LEU A 934  ? LYS A 939  ? LEU A 931  LYS A 936  
U 3 ASN A 944  ? ALA A 949  ? ASN A 941  ALA A 946  
V 1 ALA A 959  ? ILE A 962  ? ALA A 956  ILE A 959  
V 2 PHE A 968  ? ALA A 971  ? PHE A 965  ALA A 968  
V 3 ASN A 976  ? LYS A 982  ? ASN A 973  LYS A 979  
V 4 LEU A 995  ? HIS A 1002 ? LEU A 992  HIS A 999  
W 1 HIS A 1080 ? THR A 1081 ? HIS A 1077 THR A 1078 
W 2 LYS A 1084 ? THR A 1085 ? LYS A 1081 THR A 1082 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 1011 ? N CYS A 1008 O LEU A 1032 ? O LEU A 1029 
A 2 3 N VAL A 1031 ? N VAL A 1028 O VAL A 1043 ? O VAL A 1040 
A 3 4 O ILE A 1040 ? O ILE A 1037 N ALA A 12   ? N ALA A 9    
A 4 5 N VAL A 9    ? N VAL A 6    O ILE A 1092 ? O ILE A 1089 
B 1 2 N GLY A 20   ? N GLY A 17   O ALA A 37   ? O ALA A 34   
B 2 3 N LEU A 32   ? N LEU A 29   O VAL A 47   ? O VAL A 44   
B 3 4 N VAL A 46   ? N VAL A 43   O ARG A 53   ? O ARG A 50   
C 1 2 N PHE A 70   ? N PHE A 67   O LEU A 79   ? O LEU A 76   
C 2 3 N LEU A 80   ? N LEU A 77   O LEU A 92   ? O LEU A 89   
C 3 4 N SER A 97   ? N SER A 94   O SER A 100  ? O SER A 97   
D 1 2 N ILE A 126  ? N ILE A 123  O GLY A 135  ? O GLY A 132  
D 2 3 N LEU A 136  ? N LEU A 133  O LYS A 144  ? O LYS A 141  
D 3 4 N VAL A 145  ? N VAL A 142  O PHE A 158  ? O PHE A 155  
E 1 2 N ILE A 168  ? N ILE A 165  O VAL A 184  ? O VAL A 181  
E 2 3 N TYR A 185  ? N TYR A 182  O HIS A 192  ? O HIS A 189  
F 1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
F 2 3 N ILE A 234  ? N ILE A 231  O THR A 241  ? O THR A 238  
F 3 4 N TYR A 242  ? N TYR A 239  O LEU A 249  ? O LEU A 246  
G 1 2 N ASN A 265  ? N ASN A 262  O LEU A 275  ? O LEU A 272  
G 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
G 3 4 N LEU A 287  ? N LEU A 284  O ARG A 304  ? O ARG A 301  
H 1 2 N ASN A 265  ? N ASN A 262  O LEU A 275  ? O LEU A 272  
H 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
H 3 4 N LEU A 283  ? N LEU A 280  O GLY A 309  ? O GLY A 306  
I 1 2 N CYS A 316  ? N CYS A 313  O GLY A 328  ? O GLY A 325  
I 2 3 N VAL A 327  ? N VAL A 324  O GLN A 335  ? O GLN A 332  
I 3 4 N SER A 334  ? N SER A 331  O PHE A 356  ? O PHE A 353  
J 1 2 N CYS A 366  ? N CYS A 363  O VAL A 379  ? O VAL A 376  
J 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
J 3 4 N ILE A 392  ? N ILE A 389  O ARG A 716  ? O ARG A 713  
K 1 2 N TRP A 414  ? N TRP A 411  O VAL A 429  ? O VAL A 426  
K 2 3 N LEU A 430  ? N LEU A 427  O ARG A 437  ? O ARG A 434  
L 1 2 N LEU A 471  ? N LEU A 468  O VAL A 482  ? O VAL A 479  
M 1 2 N VAL A 511  ? N VAL A 508  O LEU A 522  ? O LEU A 519  
M 2 3 N GLN A 523  ? N GLN A 520  O ARG A 530  ? O ARG A 527  
N 1 2 N CYS A 543  ? N CYS A 540  O GLY A 562  ? O GLY A 559  
N 2 3 N CYS A 559  ? N CYS A 556  O LEU A 572  ? O LEU A 569  
N 3 4 N ALA A 569  ? N ALA A 566  O GLU A 583  ? O GLU A 580  
O 1 2 N LEU A 595  ? N LEU A 592  O LEU A 606  ? O LEU A 603  
O 2 3 N LEU A 605  ? N LEU A 602  O PHE A 617  ? O PHE A 614  
O 3 4 N LEU A 614  ? N LEU A 611  O VAL A 632  ? O VAL A 629  
P 1 2 N VAL A 640  ? N VAL A 637  O CYS A 655  ? O CYS A 652  
P 2 3 N ALA A 654  ? N ALA A 651  O THR A 660  ? O THR A 657  
P 3 4 N VAL A 661  ? N VAL A 658  O SER A 672  ? O SER A 669  
Q 1 2 N CYS A 683  ? N CYS A 680  O ALA A 695  ? O ALA A 692  
Q 2 3 N LEU A 696  ? N LEU A 693  O THR A 703  ? O THR A 700  
R 1 2 N CYS A 728  ? N CYS A 725  O GLY A 737  ? O GLY A 734  
R 2 3 N ARG A 742  ? N ARG A 739  O VAL A 791  ? O VAL A 788  
R 3 4 N ILE A 796  ? N ILE A 793  O HIS A 806  ? O HIS A 803  
R 4 5 O GLN A 809  ? O GLN A 806  N SER A 767  ? N SER A 764  
S 1 2 N CYS A 822  ? N CYS A 819  O TYR A 831  ? O TYR A 828  
S 2 3 N PHE A 832  ? N PHE A 829  O PHE A 854  ? O PHE A 851  
S 3 4 N GLN A 855  ? N GLN A 852  O GLN A 862  ? O GLN A 859  
T 1 2 N LEU A 883  ? N LEU A 880  O TYR A 894  ? O TYR A 891  
T 2 3 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
U 1 2 N LEU A 925  ? N LEU A 922  O LEU A 936  ? O LEU A 933  
U 2 3 N LYS A 939  ? N LYS A 936  O ASN A 944  ? O ASN A 941  
V 1 2 N GLU A 961  ? N GLU A 958  O LEU A 969  ? O LEU A 966  
V 2 3 N PHE A 968  ? N PHE A 965  O CYS A 980  ? O CYS A 977  
V 3 4 N LEU A 977  ? N LEU A 974  O PHE A 1001 ? O PHE A 998  
W 1 2 N THR A 1081 ? N THR A 1078 O LYS A 1084 ? O LYS A 1081 
# 
_database_PDB_matrix.entry_id          3I7O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I7O 
_atom_sites.fract_transf_matrix[1][1]   0.015684 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007579 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005517 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 4    ? 24.051  25.405 11.534  1.00 81.34  ? 1    MET A N   1 
ATOM 2    C CA  . MET A 1 4    ? 23.187  26.118 10.536  1.00 81.34  ? 1    MET A CA  1 
ATOM 3    C C   . MET A 1 4    ? 21.761  26.551 11.025  1.00 81.34  ? 1    MET A C   1 
ATOM 4    O O   . MET A 1 4    ? 20.722  26.107 10.487  1.00 81.34  ? 1    MET A O   1 
ATOM 5    C CB  . MET A 1 4    ? 23.139  25.348 9.194   1.00 131.68 ? 1    MET A CB  1 
ATOM 6    C CG  . MET A 1 4    ? 22.624  23.903 9.245   1.00 131.68 ? 1    MET A CG  1 
ATOM 7    S SD  . MET A 1 4    ? 21.862  23.395 7.683   1.00 131.68 ? 1    MET A SD  1 
ATOM 8    C CE  . MET A 1 4    ? 21.716  21.620 7.938   1.00 131.68 ? 1    MET A CE  1 
ATOM 9    N N   . SER A 1 5    ? 21.736  27.416 12.044  1.00 160.76 ? 2    SER A N   1 
ATOM 10   C CA  . SER A 1 5    ? 20.530  28.150 12.454  1.00 160.76 ? 2    SER A CA  1 
ATOM 11   C C   . SER A 1 5    ? 20.624  29.553 11.914  1.00 160.76 ? 2    SER A C   1 
ATOM 12   O O   . SER A 1 5    ? 21.698  30.147 11.938  1.00 160.76 ? 2    SER A O   1 
ATOM 13   C CB  . SER A 1 5    ? 20.429  28.238 13.972  1.00 119.63 ? 2    SER A CB  1 
ATOM 14   O OG  . SER A 1 5    ? 19.972  29.515 14.399  1.00 119.63 ? 2    SER A OG  1 
ATOM 15   N N   . TYR A 1 6    ? 19.506  30.095 11.444  1.00 70.81  ? 3    TYR A N   1 
ATOM 16   C CA  . TYR A 1 6    ? 19.525  31.440 10.851  1.00 70.81  ? 3    TYR A CA  1 
ATOM 17   C C   . TYR A 1 6    ? 18.381  32.354 11.324  1.00 70.81  ? 3    TYR A C   1 
ATOM 18   O O   . TYR A 1 6    ? 17.213  32.124 11.003  1.00 70.81  ? 3    TYR A O   1 
ATOM 19   C CB  . TYR A 1 6    ? 19.561  31.380 9.315   1.00 105.46 ? 3    TYR A CB  1 
ATOM 20   C CG  . TYR A 1 6    ? 20.361  30.239 8.690   1.00 105.46 ? 3    TYR A CG  1 
ATOM 21   C CD1 . TYR A 1 6    ? 21.753  30.147 8.846   1.00 105.46 ? 3    TYR A CD1 1 
ATOM 22   C CD2 . TYR A 1 6    ? 19.720  29.272 7.906   1.00 105.46 ? 3    TYR A CD2 1 
ATOM 23   C CE1 . TYR A 1 6    ? 22.478  29.092 8.263   1.00 105.46 ? 3    TYR A CE1 1 
ATOM 24   C CE2 . TYR A 1 6    ? 20.429  28.226 7.309   1.00 105.46 ? 3    TYR A CE2 1 
ATOM 25   C CZ  . TYR A 1 6    ? 21.807  28.137 7.486   1.00 105.46 ? 3    TYR A CZ  1 
ATOM 26   O OH  . TYR A 1 6    ? 22.496  27.094 6.883   1.00 105.46 ? 3    TYR A OH  1 
ATOM 27   N N   . ASN A 1 7    ? 18.721  33.393 12.085  1.00 62.17  ? 4    ASN A N   1 
ATOM 28   C CA  . ASN A 1 7    ? 17.693  34.266 12.617  1.00 62.17  ? 4    ASN A CA  1 
ATOM 29   C C   . ASN A 1 7    ? 17.932  35.734 12.471  1.00 62.17  ? 4    ASN A C   1 
ATOM 30   O O   . ASN A 1 7    ? 19.057  36.195 12.227  1.00 62.17  ? 4    ASN A O   1 
ATOM 31   C CB  . ASN A 1 7    ? 17.429  33.968 14.073  1.00 48.57  ? 4    ASN A CB  1 
ATOM 32   C CG  . ASN A 1 7    ? 17.132  32.530 14.301  1.00 48.57  ? 4    ASN A CG  1 
ATOM 33   O OD1 . ASN A 1 7    ? 15.978  32.096 14.151  1.00 48.57  ? 4    ASN A OD1 1 
ATOM 34   N ND2 . ASN A 1 7    ? 18.180  31.750 14.648  1.00 48.57  ? 4    ASN A ND2 1 
ATOM 35   N N   . TYR A 1 8    ? 16.823  36.440 12.644  1.00 53.88  ? 5    TYR A N   1 
ATOM 36   C CA  . TYR A 1 8    ? 16.728  37.855 12.502  1.00 53.88  ? 5    TYR A CA  1 
ATOM 37   C C   . TYR A 1 8    ? 16.091  38.324 13.784  1.00 53.88  ? 5    TYR A C   1 
ATOM 38   O O   . TYR A 1 8    ? 15.176  37.674 14.272  1.00 53.88  ? 5    TYR A O   1 
ATOM 39   C CB  . TYR A 1 8    ? 15.786  38.122 11.373  1.00 50.35  ? 5    TYR A CB  1 
ATOM 40   C CG  . TYR A 1 8    ? 15.761  39.527 10.890  1.00 50.35  ? 5    TYR A CG  1 
ATOM 41   C CD1 . TYR A 1 8    ? 16.693  39.977 9.988   1.00 50.35  ? 5    TYR A CD1 1 
ATOM 42   C CD2 . TYR A 1 8    ? 14.762  40.405 11.293  1.00 50.35  ? 5    TYR A CD2 1 
ATOM 43   C CE1 . TYR A 1 8    ? 16.653  41.298 9.528   1.00 50.35  ? 5    TYR A CE1 1 
ATOM 44   C CE2 . TYR A 1 8    ? 14.719  41.709 10.827  1.00 50.35  ? 5    TYR A CE2 1 
ATOM 45   C CZ  . TYR A 1 8    ? 15.661  42.140 9.951   1.00 50.35  ? 5    TYR A CZ  1 
ATOM 46   O OH  . TYR A 1 8    ? 15.630  43.417 9.493   1.00 50.35  ? 5    TYR A OH  1 
ATOM 47   N N   . VAL A 1 9    ? 16.609  39.422 14.344  1.00 47.71  ? 6    VAL A N   1 
ATOM 48   C CA  . VAL A 1 9    ? 16.085  40.067 15.530  1.00 47.71  ? 6    VAL A CA  1 
ATOM 49   C C   . VAL A 1 9    ? 15.951  41.516 15.178  1.00 47.71  ? 6    VAL A C   1 
ATOM 50   O O   . VAL A 1 9    ? 16.839  42.082 14.548  1.00 47.71  ? 6    VAL A O   1 
ATOM 51   C CB  . VAL A 1 9    ? 17.031  39.988 16.744  1.00 49.66  ? 6    VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 9    ? 16.670  38.860 17.623  1.00 49.66  ? 6    VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 9    ? 18.469  39.867 16.347  1.00 49.66  ? 6    VAL A CG2 1 
ATOM 54   N N   . VAL A 1 10   ? 14.828  42.110 15.568  1.00 37.06  ? 7    VAL A N   1 
ATOM 55   C CA  . VAL A 1 10   ? 14.610  43.546 15.429  1.00 37.06  ? 7    VAL A CA  1 
ATOM 56   C C   . VAL A 1 10   ? 13.834  44.091 16.613  1.00 37.06  ? 7    VAL A C   1 
ATOM 57   O O   . VAL A 1 10   ? 13.003  43.401 17.210  1.00 37.06  ? 7    VAL A O   1 
ATOM 58   C CB  . VAL A 1 10   ? 13.711  43.866 14.275  1.00 41.16  ? 7    VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 10   ? 14.377  44.892 13.380  1.00 41.16  ? 7    VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 10   ? 13.295  42.588 13.569  1.00 41.16  ? 7    VAL A CG2 1 
ATOM 61   N N   . THR A 1 11   ? 14.103  45.350 16.936  1.00 37.90  ? 8    THR A N   1 
ATOM 62   C CA  . THR A 1 11   ? 13.272  46.086 17.856  1.00 37.90  ? 8    THR A CA  1 
ATOM 63   C C   . THR A 1 11   ? 11.895  46.331 17.200  1.00 37.90  ? 8    THR A C   1 
ATOM 64   O O   . THR A 1 11   ? 11.796  46.648 15.986  1.00 37.90  ? 8    THR A O   1 
ATOM 65   C CB  . THR A 1 11   ? 13.937  47.388 18.198  1.00 54.39  ? 8    THR A CB  1 
ATOM 66   O OG1 . THR A 1 11   ? 15.124  47.121 18.939  1.00 54.39  ? 8    THR A OG1 1 
ATOM 67   C CG2 . THR A 1 11   ? 13.045  48.214 19.035  1.00 54.39  ? 8    THR A CG2 1 
ATOM 68   N N   . ALA A 1 12   ? 10.845  46.130 18.000  1.00 55.43  ? 9    ALA A N   1 
ATOM 69   C CA  . ALA A 1 12   ? 9.488   46.541 17.641  1.00 55.43  ? 9    ALA A CA  1 
ATOM 70   C C   . ALA A 1 12   ? 9.160   47.801 18.394  1.00 55.43  ? 9    ALA A C   1 
ATOM 71   O O   . ALA A 1 12   ? 8.401   48.628 17.911  1.00 55.43  ? 9    ALA A O   1 
ATOM 72   C CB  . ALA A 1 12   ? 8.457   45.449 17.963  1.00 21.25  ? 9    ALA A CB  1 
ATOM 73   N N   . GLN A 1 13   ? 9.719   47.922 19.592  1.00 42.40  ? 10   GLN A N   1 
ATOM 74   C CA  . GLN A 1 13   ? 9.596   49.111 20.402  1.00 42.40  ? 10   GLN A CA  1 
ATOM 75   C C   . GLN A 1 13   ? 10.891  49.242 21.131  1.00 42.40  ? 10   GLN A C   1 
ATOM 76   O O   . GLN A 1 13   ? 11.375  48.252 21.684  1.00 42.40  ? 10   GLN A O   1 
ATOM 77   C CB  . GLN A 1 13   ? 8.501   48.917 21.414  1.00 45.74  ? 10   GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13   ? 8.575   49.844 22.582  1.00 45.74  ? 10   GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13   ? 8.109   51.215 22.239  1.00 45.74  ? 10   GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13   ? 7.056   51.393 21.607  1.00 45.74  ? 10   GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13   ? 8.886   52.217 22.646  1.00 45.74  ? 10   GLN A NE2 1 
ATOM 82   N N   . LYS A 1 14   ? 11.488  50.433 21.114  1.00 43.35  ? 11   LYS A N   1 
ATOM 83   C CA  . LYS A 1 14   ? 12.752  50.603 21.807  1.00 43.35  ? 11   LYS A CA  1 
ATOM 84   C C   . LYS A 1 14   ? 12.512  50.437 23.317  1.00 43.35  ? 11   LYS A C   1 
ATOM 85   O O   . LYS A 1 14   ? 11.380  50.582 23.792  1.00 43.35  ? 11   LYS A O   1 
ATOM 86   C CB  . LYS A 1 14   ? 13.344  51.970 21.523  1.00 56.14  ? 11   LYS A CB  1 
ATOM 87   C CG  . LYS A 1 14   ? 13.825  52.195 20.104  1.00 56.14  ? 11   LYS A CG  1 
ATOM 88   C CD  . LYS A 1 14   ? 14.586  53.544 20.008  1.00 56.14  ? 11   LYS A CD  1 
ATOM 89   C CE  . LYS A 1 14   ? 14.531  54.173 18.605  1.00 56.14  ? 11   LYS A CE  1 
ATOM 90   N NZ  . LYS A 1 14   ? 15.012  55.615 18.528  1.00 56.14  ? 11   LYS A NZ  1 
ATOM 91   N N   . PRO A 1 15   ? 13.572  50.132 24.085  1.00 45.24  ? 12   PRO A N   1 
ATOM 92   C CA  . PRO A 1 15   ? 13.456  50.220 25.540  1.00 45.24  ? 12   PRO A CA  1 
ATOM 93   C C   . PRO A 1 15   ? 12.825  51.539 26.017  1.00 45.24  ? 12   PRO A C   1 
ATOM 94   O O   . PRO A 1 15   ? 13.113  52.593 25.489  1.00 45.24  ? 12   PRO A O   1 
ATOM 95   C CB  . PRO A 1 15   ? 14.914  50.136 26.004  1.00 45.00  ? 12   PRO A CB  1 
ATOM 96   C CG  . PRO A 1 15   ? 15.742  50.262 24.766  1.00 45.00  ? 12   PRO A CG  1 
ATOM 97   C CD  . PRO A 1 15   ? 14.917  49.719 23.683  1.00 45.00  ? 12   PRO A CD  1 
ATOM 98   N N   . THR A 1 16   ? 11.960  51.488 27.011  1.00 44.00  ? 13   THR A N   1 
ATOM 99   C CA  . THR A 1 16   ? 11.283  52.688 27.481  1.00 44.00  ? 13   THR A CA  1 
ATOM 100  C C   . THR A 1 16   ? 11.698  52.986 28.892  1.00 44.00  ? 13   THR A C   1 
ATOM 101  O O   . THR A 1 16   ? 11.593  54.106 29.350  1.00 44.00  ? 13   THR A O   1 
ATOM 102  C CB  . THR A 1 16   ? 9.814   52.498 27.416  1.00 38.81  ? 13   THR A CB  1 
ATOM 103  O OG1 . THR A 1 16   ? 9.545   51.170 27.852  1.00 38.81  ? 13   THR A OG1 1 
ATOM 104  C CG2 . THR A 1 16   ? 9.333   52.604 25.995  1.00 38.81  ? 13   THR A CG2 1 
ATOM 105  N N   . ALA A 1 17   ? 12.225  51.988 29.577  1.00 48.92  ? 14   ALA A N   1 
ATOM 106  C CA  . ALA A 1 17   ? 12.782  52.217 30.891  1.00 48.92  ? 14   ALA A CA  1 
ATOM 107  C C   . ALA A 1 17   ? 13.940  53.170 30.846  1.00 48.92  ? 14   ALA A C   1 
ATOM 108  O O   . ALA A 1 17   ? 14.771  53.117 29.960  1.00 48.92  ? 14   ALA A O   1 
ATOM 109  C CB  . ALA A 1 17   ? 13.206  50.950 31.512  1.00 29.29  ? 14   ALA A CB  1 
ATOM 110  N N   . VAL A 1 18   ? 13.989  54.043 31.825  1.00 33.82  ? 15   VAL A N   1 
ATOM 111  C CA  . VAL A 1 18   ? 15.014  55.049 31.865  1.00 33.82  ? 15   VAL A CA  1 
ATOM 112  C C   . VAL A 1 18   ? 16.074  54.580 32.806  1.00 33.82  ? 15   VAL A C   1 
ATOM 113  O O   . VAL A 1 18   ? 15.824  54.337 33.993  1.00 33.82  ? 15   VAL A O   1 
ATOM 114  C CB  . VAL A 1 18   ? 14.505  56.427 32.317  1.00 20.66  ? 15   VAL A CB  1 
ATOM 115  C CG1 . VAL A 1 18   ? 15.617  57.238 32.920  1.00 20.66  ? 15   VAL A CG1 1 
ATOM 116  C CG2 . VAL A 1 18   ? 13.913  57.142 31.151  1.00 20.66  ? 15   VAL A CG2 1 
ATOM 117  N N   . ASN A 1 19   ? 17.270  54.457 32.256  1.00 48.41  ? 16   ASN A N   1 
ATOM 118  C CA  . ASN A 1 19   ? 18.311  53.831 32.999  1.00 48.41  ? 16   ASN A CA  1 
ATOM 119  C C   . ASN A 1 19   ? 19.192  54.858 33.672  1.00 48.41  ? 16   ASN A C   1 
ATOM 120  O O   . ASN A 1 19   ? 19.607  54.668 34.780  1.00 48.41  ? 16   ASN A O   1 
ATOM 121  C CB  . ASN A 1 19   ? 19.008  52.788 32.136  1.00 45.65  ? 16   ASN A CB  1 
ATOM 122  C CG  . ASN A 1 19   ? 18.098  51.573 31.847  1.00 45.65  ? 16   ASN A CG  1 
ATOM 123  O OD1 . ASN A 1 19   ? 17.814  50.792 32.767  1.00 45.65  ? 16   ASN A OD1 1 
ATOM 124  N ND2 . ASN A 1 19   ? 17.634  51.413 30.594  1.00 45.65  ? 16   ASN A ND2 1 
ATOM 125  N N   . GLY A 1 20   ? 19.378  56.002 33.049  1.00 37.03  ? 17   GLY A N   1 
ATOM 126  C CA  . GLY A 1 20   ? 20.113  57.080 33.684  1.00 37.03  ? 17   GLY A CA  1 
ATOM 127  C C   . GLY A 1 20   ? 19.744  58.392 33.055  1.00 37.03  ? 17   GLY A C   1 
ATOM 128  O O   . GLY A 1 20   ? 19.145  58.411 31.968  1.00 37.03  ? 17   GLY A O   1 
ATOM 129  N N   . CYS A 1 21   ? 20.082  59.495 33.695  1.00 45.00  ? 18   CYS A N   1 
ATOM 130  C CA  . CYS A 1 21   ? 19.761  60.780 33.106  1.00 45.00  ? 18   CYS A CA  1 
ATOM 131  C C   . CYS A 1 21   ? 20.613  61.817 33.753  1.00 45.00  ? 18   CYS A C   1 
ATOM 132  O O   . CYS A 1 21   ? 21.123  61.606 34.849  1.00 45.00  ? 18   CYS A O   1 
ATOM 133  C CB  . CYS A 1 21   ? 18.275  61.147 33.229  1.00 57.00  ? 18   CYS A CB  1 
ATOM 134  S SG  . CYS A 1 21   ? 17.707  61.512 34.914  1.00 57.00  ? 18   CYS A SG  1 
ATOM 135  N N   . VAL A 1 22   ? 20.772  62.957 33.100  1.00 40.07  ? 19   VAL A N   1 
ATOM 136  C CA  . VAL A 1 22   ? 21.825  63.870 33.494  1.00 40.07  ? 19   VAL A CA  1 
ATOM 137  C C   . VAL A 1 22   ? 21.473  65.196 32.822  1.00 40.07  ? 19   VAL A C   1 
ATOM 138  O O   . VAL A 1 22   ? 20.740  65.224 31.805  1.00 40.07  ? 19   VAL A O   1 
ATOM 139  C CB  . VAL A 1 22   ? 23.273  63.273 33.125  1.00 41.26  ? 19   VAL A CB  1 
ATOM 140  C CG1 . VAL A 1 22   ? 23.577  63.382 31.633  1.00 41.26  ? 19   VAL A CG1 1 
ATOM 141  C CG2 . VAL A 1 22   ? 24.342  63.947 33.860  1.00 41.26  ? 19   VAL A CG2 1 
ATOM 142  N N   . THR A 1 23   ? 22.005  66.265 33.411  1.00 49.40  ? 20   THR A N   1 
ATOM 143  C CA  . THR A 1 23   ? 21.666  67.631 33.084  1.00 49.40  ? 20   THR A CA  1 
ATOM 144  C C   . THR A 1 23   ? 22.916  68.508 32.932  1.00 49.40  ? 20   THR A C   1 
ATOM 145  O O   . THR A 1 23   ? 23.945  68.301 33.590  1.00 49.40  ? 20   THR A O   1 
ATOM 146  C CB  . THR A 1 23   ? 20.726  68.221 34.173  1.00 63.75  ? 20   THR A CB  1 
ATOM 147  O OG1 . THR A 1 23   ? 20.603  69.624 33.995  1.00 63.75  ? 20   THR A OG1 1 
ATOM 148  C CG2 . THR A 1 23   ? 21.243  67.986 35.586  1.00 63.75  ? 20   THR A CG2 1 
ATOM 149  N N   . GLY A 1 24   ? 22.831  69.503 32.064  1.00 72.90  ? 21   GLY A N   1 
ATOM 150  C CA  . GLY A 1 24   ? 23.946  70.415 31.872  1.00 72.90  ? 21   GLY A CA  1 
ATOM 151  C C   . GLY A 1 24   ? 23.890  71.025 30.498  1.00 72.90  ? 21   GLY A C   1 
ATOM 152  O O   . GLY A 1 24   ? 22.839  71.031 29.845  1.00 72.90  ? 21   GLY A O   1 
ATOM 153  N N   . HIS A 1 25   ? 25.032  71.517 30.041  1.00 58.52  ? 22   HIS A N   1 
ATOM 154  C CA  . HIS A 1 25   ? 25.097  72.260 28.783  1.00 58.52  ? 22   HIS A CA  1 
ATOM 155  C C   . HIS A 1 25   ? 26.035  71.580 27.824  1.00 58.52  ? 22   HIS A C   1 
ATOM 156  O O   . HIS A 1 25   ? 27.241  71.792 27.877  1.00 58.52  ? 22   HIS A O   1 
ATOM 157  C CB  . HIS A 1 25   ? 25.513  73.696 29.067  1.00 64.04  ? 22   HIS A CB  1 
ATOM 158  C CG  . HIS A 1 25   ? 24.775  74.304 30.217  1.00 64.04  ? 22   HIS A CG  1 
ATOM 159  N ND1 . HIS A 1 25   ? 25.141  74.091 31.529  1.00 64.04  ? 22   HIS A ND1 1 
ATOM 160  C CD2 . HIS A 1 25   ? 23.682  75.100 30.257  1.00 64.04  ? 22   HIS A CD2 1 
ATOM 161  C CE1 . HIS A 1 25   ? 24.312  74.738 32.331  1.00 64.04  ? 22   HIS A CE1 1 
ATOM 162  N NE2 . HIS A 1 25   ? 23.417  75.360 31.583  1.00 64.04  ? 22   HIS A NE2 1 
ATOM 163  N N   . PHE A 1 26   ? 25.459  70.756 26.961  1.00 66.63  ? 23   PHE A N   1 
ATOM 164  C CA  . PHE A 1 26   ? 26.183  69.824 26.099  1.00 66.63  ? 23   PHE A CA  1 
ATOM 165  C C   . PHE A 1 26   ? 25.901  70.257 24.673  1.00 66.63  ? 23   PHE A C   1 
ATOM 166  O O   . PHE A 1 26   ? 26.741  70.130 23.791  1.00 66.63  ? 23   PHE A O   1 
ATOM 167  C CB  . PHE A 1 26   ? 25.675  68.385 26.396  1.00 35.48  ? 23   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 26   ? 26.179  67.305 25.454  1.00 35.48  ? 23   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 26   ? 27.525  66.939 25.417  1.00 35.48  ? 23   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 26   ? 25.285  66.630 24.625  1.00 35.48  ? 23   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 26   ? 27.978  65.923 24.582  1.00 35.48  ? 23   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 26   ? 25.733  65.610 23.766  1.00 35.48  ? 23   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 26   ? 27.088  65.263 23.752  1.00 35.48  ? 23   PHE A CZ  1 
ATOM 174  N N   . THR A 1 27   ? 24.700  70.794 24.488  1.00 68.62  ? 24   THR A N   1 
ATOM 175  C CA  . THR A 1 27   ? 24.273  71.481 23.270  1.00 68.62  ? 24   THR A CA  1 
ATOM 176  C C   . THR A 1 27   ? 24.993  72.854 23.035  1.00 68.62  ? 24   THR A C   1 
ATOM 177  O O   . THR A 1 27   ? 25.569  73.076 21.967  1.00 68.62  ? 24   THR A O   1 
ATOM 178  C CB  . THR A 1 27   ? 22.724  71.588 23.274  1.00 61.43  ? 24   THR A CB  1 
ATOM 179  O OG1 . THR A 1 27   ? 22.161  70.398 22.698  1.00 61.43  ? 24   THR A OG1 1 
ATOM 180  C CG2 . THR A 1 27   ? 22.224  72.785 22.494  1.00 61.43  ? 24   THR A CG2 1 
ATOM 181  N N   . SER A 1 28   ? 24.952  73.745 24.033  1.00 91.47  ? 25   SER A N   1 
ATOM 182  C CA  . SER A 1 28   ? 25.594  75.069 23.987  1.00 91.47  ? 25   SER A CA  1 
ATOM 183  C C   . SER A 1 28   ? 25.967  75.455 25.396  1.00 91.47  ? 25   SER A C   1 
ATOM 184  O O   . SER A 1 28   ? 25.445  74.881 26.348  1.00 91.47  ? 25   SER A O   1 
ATOM 185  C CB  . SER A 1 28   ? 24.644  76.155 23.480  1.00 95.09  ? 25   SER A CB  1 
ATOM 186  O OG  . SER A 1 28   ? 23.702  75.681 22.545  1.00 95.09  ? 25   SER A OG  1 
ATOM 187  N N   . ALA A 1 29   ? 26.830  76.457 25.537  1.00 72.30  ? 26   ALA A N   1 
ATOM 188  C CA  . ALA A 1 29   ? 27.247  76.910 26.865  1.00 72.30  ? 26   ALA A CA  1 
ATOM 189  C C   . ALA A 1 29   ? 26.049  77.498 27.586  1.00 72.30  ? 26   ALA A C   1 
ATOM 190  O O   . ALA A 1 29   ? 25.928  77.411 28.799  1.00 72.30  ? 26   ALA A O   1 
ATOM 191  C CB  . ALA A 1 29   ? 28.366  77.932 26.757  1.00 93.07  ? 26   ALA A CB  1 
ATOM 192  N N   . GLU A 1 30   ? 25.146  78.108 26.826  1.00 76.33  ? 27   GLU A N   1 
ATOM 193  C CA  . GLU A 1 30   ? 23.960  78.724 27.413  1.00 76.33  ? 27   GLU A CA  1 
ATOM 194  C C   . GLU A 1 30   ? 22.667  78.016 27.017  1.00 76.33  ? 27   GLU A C   1 
ATOM 195  O O   . GLU A 1 30   ? 21.775  78.625 26.425  1.00 76.33  ? 27   GLU A O   1 
ATOM 196  C CB  . GLU A 1 30   ? 23.882  80.205 27.032  1.00 107.43 ? 27   GLU A CB  1 
ATOM 197  C CG  . GLU A 1 30   ? 25.075  81.029 27.488  1.00 107.43 ? 27   GLU A CG  1 
ATOM 198  C CD  . GLU A 1 30   ? 26.365  80.617 26.806  1.00 107.43 ? 27   GLU A CD  1 
ATOM 199  O OE1 . GLU A 1 30   ? 27.442  81.078 27.240  1.00 107.43 ? 27   GLU A OE1 1 
ATOM 200  O OE2 . GLU A 1 30   ? 26.303  79.832 25.836  1.00 107.43 ? 27   GLU A OE2 1 
ATOM 201  N N   . ASP A 1 31   ? 22.564  76.732 27.349  1.00 70.11  ? 28   ASP A N   1 
ATOM 202  C CA  . ASP A 1 31   ? 21.370  75.960 27.022  1.00 70.11  ? 28   ASP A CA  1 
ATOM 203  C C   . ASP A 1 31   ? 21.257  74.683 27.852  1.00 70.11  ? 28   ASP A C   1 
ATOM 204  O O   . ASP A 1 31   ? 22.107  73.797 27.760  1.00 70.11  ? 28   ASP A O   1 
ATOM 205  C CB  . ASP A 1 31   ? 21.352  75.605 25.532  1.00 62.95  ? 28   ASP A CB  1 
ATOM 206  C CG  . ASP A 1 31   ? 21.714  76.782 24.646  1.00 62.95  ? 28   ASP A CG  1 
ATOM 207  O OD1 . ASP A 1 31   ? 22.814  77.346 24.822  1.00 62.95  ? 28   ASP A OD1 1 
ATOM 208  O OD2 . ASP A 1 31   ? 20.902  77.134 23.764  1.00 62.95  ? 28   ASP A OD2 1 
ATOM 209  N N   . LEU A 1 32   ? 20.201  74.591 28.656  1.00 64.73  ? 29   LEU A N   1 
ATOM 210  C CA  . LEU A 1 32   ? 19.969  73.409 29.476  1.00 64.73  ? 29   LEU A CA  1 
ATOM 211  C C   . LEU A 1 32   ? 19.467  72.070 28.949  1.00 64.73  ? 29   LEU A C   1 
ATOM 212  O O   . LEU A 1 32   ? 18.277  71.904 28.678  1.00 64.73  ? 29   LEU A O   1 
ATOM 213  C CB  . LEU A 1 32   ? 18.792  74.265 29.948  1.00 47.99  ? 29   LEU A CB  1 
ATOM 214  C CG  . LEU A 1 32   ? 18.295  74.008 31.372  1.00 47.99  ? 29   LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 32   ? 19.455  73.658 32.291  1.00 47.99  ? 29   LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 32   ? 17.532  75.213 31.901  1.00 47.99  ? 29   LEU A CD2 1 
ATOM 217  N N   . ASN A 1 33   ? 20.383  71.119 28.803  1.00 55.55  ? 30   ASN A N   1 
ATOM 218  C CA  . ASN A 1 33   ? 20.048  69.800 28.265  1.00 55.55  ? 30   ASN A CA  1 
ATOM 219  C C   . ASN A 1 33   ? 19.758  68.800 29.373  1.00 55.55  ? 30   ASN A C   1 
ATOM 220  O O   . ASN A 1 33   ? 20.436  68.778 30.419  1.00 55.55  ? 30   ASN A O   1 
ATOM 221  C CB  . ASN A 1 33   ? 21.203  69.238 27.436  1.00 56.97  ? 30   ASN A CB  1 
ATOM 222  C CG  . ASN A 1 33   ? 21.687  70.203 26.383  1.00 56.97  ? 30   ASN A CG  1 
ATOM 223  O OD1 . ASN A 1 33   ? 21.068  70.342 25.322  1.00 56.97  ? 30   ASN A OD1 1 
ATOM 224  N ND2 . ASN A 1 33   ? 22.799  70.878 26.660  1.00 56.97  ? 30   ASN A ND2 1 
ATOM 225  N N   . LEU A 1 34   ? 18.749  67.974 29.143  1.00 53.69  ? 31   LEU A N   1 
ATOM 226  C CA  . LEU A 1 34   ? 18.647  66.721 29.857  1.00 53.69  ? 31   LEU A CA  1 
ATOM 227  C C   . LEU A 1 34   ? 18.995  65.587 28.874  1.00 53.69  ? 31   LEU A C   1 
ATOM 228  O O   . LEU A 1 34   ? 18.506  65.517 27.743  1.00 53.69  ? 31   LEU A O   1 
ATOM 229  C CB  . LEU A 1 34   ? 17.287  66.586 30.557  1.00 56.72  ? 31   LEU A CB  1 
ATOM 230  C CG  . LEU A 1 34   ? 16.549  65.263 30.654  1.00 56.72  ? 31   LEU A CG  1 
ATOM 231  C CD1 . LEU A 1 34   ? 16.320  64.880 32.072  1.00 56.72  ? 31   LEU A CD1 1 
ATOM 232  C CD2 . LEU A 1 34   ? 15.247  65.361 29.949  1.00 56.72  ? 31   LEU A CD2 1 
ATOM 233  N N   . LEU A 1 35   ? 19.926  64.750 29.314  1.00 44.17  ? 32   LEU A N   1 
ATOM 234  C CA  . LEU A 1 35   ? 20.322  63.533 28.583  1.00 44.17  ? 32   LEU A CA  1 
ATOM 235  C C   . LEU A 1 35   ? 19.729  62.364 29.335  1.00 44.17  ? 32   LEU A C   1 
ATOM 236  O O   . LEU A 1 35   ? 19.970  62.223 30.513  1.00 44.17  ? 32   LEU A O   1 
ATOM 237  C CB  . LEU A 1 35   ? 21.848  63.413 28.476  1.00 65.65  ? 32   LEU A CB  1 
ATOM 238  C CG  . LEU A 1 35   ? 22.522  64.298 27.414  1.00 65.65  ? 32   LEU A CG  1 
ATOM 239  C CD1 . LEU A 1 35   ? 22.382  65.767 27.702  1.00 65.65  ? 32   LEU A CD1 1 
ATOM 240  C CD2 . LEU A 1 35   ? 23.970  63.985 27.292  1.00 65.65  ? 32   LEU A CD2 1 
ATOM 241  N N   . ILE A 1 36   ? 18.884  61.587 28.660  1.00 45.18  ? 33   ILE A N   1 
ATOM 242  C CA  . ILE A 1 36   ? 18.234  60.429 29.253  1.00 45.18  ? 33   ILE A CA  1 
ATOM 243  C C   . ILE A 1 36   ? 18.803  59.210 28.604  1.00 45.18  ? 33   ILE A C   1 
ATOM 244  O O   . ILE A 1 36   ? 18.706  59.060 27.392  1.00 45.18  ? 33   ILE A O   1 
ATOM 245  C CB  . ILE A 1 36   ? 16.722  60.450 28.982  1.00 35.03  ? 33   ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 36   ? 16.053  61.553 29.804  1.00 35.03  ? 33   ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 36   ? 16.097  59.077 29.296  1.00 35.03  ? 33   ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 36   ? 14.655  61.816 29.360  1.00 35.03  ? 33   ILE A CD1 1 
ATOM 249  N N   . ALA A 1 37   ? 19.429  58.356 29.401  1.00 58.04  ? 34   ALA A N   1 
ATOM 250  C CA  . ALA A 1 37   ? 19.925  57.084 28.895  1.00 58.04  ? 34   ALA A CA  1 
ATOM 251  C C   . ALA A 1 37   ? 18.858  56.039 29.077  1.00 58.04  ? 34   ALA A C   1 
ATOM 252  O O   . ALA A 1 37   ? 18.467  55.767 30.203  1.00 58.04  ? 34   ALA A O   1 
ATOM 253  C CB  . ALA A 1 37   ? 21.165  56.669 29.631  1.00 38.37  ? 34   ALA A CB  1 
ATOM 254  N N   . LYS A 1 38   ? 18.364  55.480 27.981  1.00 60.05  ? 35   LYS A N   1 
ATOM 255  C CA  . LYS A 1 38   ? 17.615  54.243 28.034  1.00 60.05  ? 35   LYS A CA  1 
ATOM 256  C C   . LYS A 1 38   ? 18.610  53.058 28.090  1.00 60.05  ? 35   LYS A C   1 
ATOM 257  O O   . LYS A 1 38   ? 19.398  52.901 29.045  1.00 60.05  ? 35   LYS A O   1 
ATOM 258  C CB  . LYS A 1 38   ? 16.647  54.138 26.868  1.00 41.84  ? 35   LYS A CB  1 
ATOM 259  C CG  . LYS A 1 38   ? 15.256  54.742 27.090  1.00 41.84  ? 35   LYS A CG  1 
ATOM 260  C CD  . LYS A 1 38   ? 15.232  56.233 27.047  1.00 41.84  ? 35   LYS A CD  1 
ATOM 261  C CE  . LYS A 1 38   ? 13.913  56.835 27.615  1.00 41.84  ? 35   LYS A CE  1 
ATOM 262  N NZ  . LYS A 1 38   ? 12.942  57.325 26.601  1.00 41.84  ? 35   LYS A NZ  1 
ATOM 263  N N   . ASN A 1 39   ? 18.639  52.168 27.136  1.00 46.70  ? 36   ASN A N   1 
ATOM 264  C CA  . ASN A 1 39   ? 19.599  51.130 27.426  1.00 46.70  ? 36   ASN A CA  1 
ATOM 265  C C   . ASN A 1 39   ? 20.724  51.412 26.489  1.00 46.70  ? 36   ASN A C   1 
ATOM 266  O O   . ASN A 1 39   ? 21.804  51.835 26.890  1.00 46.70  ? 36   ASN A O   1 
ATOM 267  C CB  . ASN A 1 39   ? 18.976  49.753 27.267  1.00 34.14  ? 36   ASN A CB  1 
ATOM 268  C CG  . ASN A 1 39   ? 19.971  48.626 27.466  1.00 34.14  ? 36   ASN A CG  1 
ATOM 269  O OD1 . ASN A 1 39   ? 20.819  48.632 28.387  1.00 34.14  ? 36   ASN A OD1 1 
ATOM 270  N ND2 . ASN A 1 39   ? 19.867  47.628 26.604  1.00 34.14  ? 36   ASN A ND2 1 
ATOM 271  N N   . THR A 1 40   ? 20.395  51.282 25.216  1.00 40.81  ? 37   THR A N   1 
ATOM 272  C CA  . THR A 1 40   ? 21.318  51.477 24.140  1.00 40.81  ? 37   THR A CA  1 
ATOM 273  C C   . THR A 1 40   ? 20.896  52.716 23.347  1.00 40.81  ? 37   THR A C   1 
ATOM 274  O O   . THR A 1 40   ? 21.016  52.750 22.115  1.00 40.81  ? 37   THR A O   1 
ATOM 275  C CB  . THR A 1 40   ? 21.214  50.287 23.231  1.00 46.64  ? 37   THR A CB  1 
ATOM 276  O OG1 . THR A 1 40   ? 19.852  50.164 22.791  1.00 46.64  ? 37   THR A OG1 1 
ATOM 277  C CG2 . THR A 1 40   ? 21.639  49.033 23.970  1.00 46.64  ? 37   THR A CG2 1 
ATOM 278  N N   . ARG A 1 41   ? 20.365  53.707 24.054  1.00 48.19  ? 38   ARG A N   1 
ATOM 279  C CA  . ARG A 1 41   ? 19.837  54.889 23.434  1.00 48.19  ? 38   ARG A CA  1 
ATOM 280  C C   . ARG A 1 41   ? 20.216  56.072 24.308  1.00 48.19  ? 38   ARG A C   1 
ATOM 281  O O   . ARG A 1 41   ? 20.053  56.017 25.504  1.00 48.19  ? 38   ARG A O   1 
ATOM 282  C CB  . ARG A 1 41   ? 18.322  54.770 23.296  1.00 72.69  ? 38   ARG A CB  1 
ATOM 283  C CG  . ARG A 1 41   ? 17.849  54.049 22.041  1.00 72.69  ? 38   ARG A CG  1 
ATOM 284  C CD  . ARG A 1 41   ? 18.484  54.766 20.907  1.00 72.69  ? 38   ARG A CD  1 
ATOM 285  N NE  . ARG A 1 41   ? 17.810  54.765 19.615  1.00 72.69  ? 38   ARG A NE  1 
ATOM 286  C CZ  . ARG A 1 41   ? 18.377  54.288 18.519  1.00 72.69  ? 38   ARG A CZ  1 
ATOM 287  N NH1 . ARG A 1 41   ? 19.572  53.734 18.605  1.00 72.69  ? 38   ARG A NH1 1 
ATOM 288  N NH2 . ARG A 1 41   ? 17.754  54.346 17.352  1.00 72.69  ? 38   ARG A NH2 1 
ATOM 289  N N   . LEU A 1 42   ? 20.785  57.116 23.715  1.00 45.21  ? 39   LEU A N   1 
ATOM 290  C CA  . LEU A 1 42   ? 20.963  58.375 24.398  1.00 45.21  ? 39   LEU A CA  1 
ATOM 291  C C   . LEU A 1 42   ? 19.885  59.338 23.879  1.00 45.21  ? 39   LEU A C   1 
ATOM 292  O O   . LEU A 1 42   ? 19.684  59.439 22.688  1.00 45.21  ? 39   LEU A O   1 
ATOM 293  C CB  . LEU A 1 42   ? 22.360  58.921 24.115  1.00 52.47  ? 39   LEU A CB  1 
ATOM 294  C CG  . LEU A 1 42   ? 22.926  60.114 24.921  1.00 52.47  ? 39   LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 42   ? 23.430  59.707 26.303  1.00 52.47  ? 39   LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 42   ? 24.061  60.776 24.165  1.00 52.47  ? 39   LEU A CD2 1 
ATOM 297  N N   . GLU A 1 43   ? 19.162  60.022 24.759  1.00 46.43  ? 40   GLU A N   1 
ATOM 298  C CA  . GLU A 1 43   ? 18.144  60.998 24.331  1.00 46.43  ? 40   GLU A CA  1 
ATOM 299  C C   . GLU A 1 43   ? 18.562  62.361 24.793  1.00 46.43  ? 40   GLU A C   1 
ATOM 300  O O   . GLU A 1 43   ? 18.980  62.547 25.920  1.00 46.43  ? 40   GLU A O   1 
ATOM 301  C CB  . GLU A 1 43   ? 16.756  60.662 24.870  1.00 42.81  ? 40   GLU A CB  1 
ATOM 302  C CG  . GLU A 1 43   ? 15.773  60.193 23.828  1.00 42.81  ? 40   GLU A CG  1 
ATOM 303  C CD  . GLU A 1 43   ? 14.721  59.236 24.412  1.00 42.81  ? 40   GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 43   ? 14.367  59.482 25.597  1.00 42.81  ? 40   GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 43   ? 14.269  58.258 23.711  1.00 42.81  ? 40   GLU A OE2 1 
ATOM 306  N N   . ILE A 1 44   ? 18.447  63.313 23.890  1.00 50.28  ? 41   ILE A N   1 
ATOM 307  C CA  . ILE A 1 44   ? 18.959  64.654 24.111  1.00 50.28  ? 41   ILE A CA  1 
ATOM 308  C C   . ILE A 1 44   ? 17.819  65.669 23.981  1.00 50.28  ? 41   ILE A C   1 
ATOM 309  O O   . ILE A 1 44   ? 17.096  65.711 22.977  1.00 50.28  ? 41   ILE A O   1 
ATOM 310  C CB  . ILE A 1 44   ? 20.165  64.974 23.170  1.00 45.22  ? 41   ILE A CB  1 
ATOM 311  C CG1 . ILE A 1 44   ? 21.157  63.819 23.196  1.00 45.22  ? 41   ILE A CG1 1 
ATOM 312  C CG2 . ILE A 1 44   ? 20.856  66.255 23.598  1.00 45.22  ? 41   ILE A CG2 1 
ATOM 313  C CD1 . ILE A 1 44   ? 22.545  64.150 22.704  1.00 45.22  ? 41   ILE A CD1 1 
ATOM 314  N N   . TYR A 1 45   ? 17.673  66.469 25.025  1.00 39.43  ? 42   TYR A N   1 
ATOM 315  C CA  . TYR A 1 45   ? 16.579  67.381 25.132  1.00 39.43  ? 42   TYR A CA  1 
ATOM 316  C C   . TYR A 1 45   ? 17.075  68.768 25.449  1.00 39.43  ? 42   TYR A C   1 
ATOM 317  O O   . TYR A 1 45   ? 18.075  68.935 26.126  1.00 39.43  ? 42   TYR A O   1 
ATOM 318  C CB  . TYR A 1 45   ? 15.628  66.901 26.230  1.00 46.99  ? 42   TYR A CB  1 
ATOM 319  C CG  . TYR A 1 45   ? 14.922  65.611 25.865  1.00 46.99  ? 42   TYR A CG  1 
ATOM 320  C CD1 . TYR A 1 45   ? 15.353  64.396 26.365  1.00 46.99  ? 42   TYR A CD1 1 
ATOM 321  C CD2 . TYR A 1 45   ? 13.850  65.614 24.984  1.00 46.99  ? 42   TYR A CD2 1 
ATOM 322  C CE1 . TYR A 1 45   ? 14.735  63.218 26.017  1.00 46.99  ? 42   TYR A CE1 1 
ATOM 323  C CE2 . TYR A 1 45   ? 13.219  64.417 24.612  1.00 46.99  ? 42   TYR A CE2 1 
ATOM 324  C CZ  . TYR A 1 45   ? 13.665  63.229 25.143  1.00 46.99  ? 42   TYR A CZ  1 
ATOM 325  O OH  . TYR A 1 45   ? 13.043  62.062 24.802  1.00 46.99  ? 42   TYR A OH  1 
ATOM 326  N N   . VAL A 1 46   ? 16.402  69.790 24.949  1.00 56.38  ? 43   VAL A N   1 
ATOM 327  C CA  . VAL A 1 46   ? 16.601  71.055 25.603  1.00 56.38  ? 43   VAL A CA  1 
ATOM 328  C C   . VAL A 1 46   ? 15.395  71.256 26.483  1.00 56.38  ? 43   VAL A C   1 
ATOM 329  O O   . VAL A 1 46   ? 14.233  71.072 26.042  1.00 56.38  ? 43   VAL A O   1 
ATOM 330  C CB  . VAL A 1 46   ? 16.788  72.264 24.671  1.00 73.64  ? 43   VAL A CB  1 
ATOM 331  C CG1 . VAL A 1 46   ? 17.244  73.495 25.509  1.00 73.64  ? 43   VAL A CG1 1 
ATOM 332  C CG2 . VAL A 1 46   ? 17.801  71.962 23.582  1.00 73.64  ? 43   VAL A CG2 1 
ATOM 333  N N   . VAL A 1 47   ? 15.704  71.596 27.730  1.00 58.67  ? 44   VAL A N   1 
ATOM 334  C CA  . VAL A 1 47   ? 14.724  72.059 28.672  1.00 58.67  ? 44   VAL A CA  1 
ATOM 335  C C   . VAL A 1 47   ? 14.231  73.439 28.257  1.00 58.67  ? 44   VAL A C   1 
ATOM 336  O O   . VAL A 1 47   ? 15.025  74.374 28.085  1.00 58.67  ? 44   VAL A O   1 
ATOM 337  C CB  . VAL A 1 47   ? 15.313  72.176 30.080  1.00 48.36  ? 44   VAL A CB  1 
ATOM 338  C CG1 . VAL A 1 47   ? 14.195  72.479 31.101  1.00 48.36  ? 44   VAL A CG1 1 
ATOM 339  C CG2 . VAL A 1 47   ? 16.104  70.910 30.472  1.00 48.36  ? 44   VAL A CG2 1 
ATOM 340  N N   . THR A 1 48   ? 12.919  73.552 28.113  1.00 89.46  ? 45   THR A N   1 
ATOM 341  C CA  . THR A 1 48   ? 12.277  74.799 27.772  1.00 89.46  ? 45   THR A CA  1 
ATOM 342  C C   . THR A 1 48   ? 11.233  75.098 28.826  1.00 89.46  ? 45   THR A C   1 
ATOM 343  O O   . THR A 1 48   ? 10.857  74.213 29.594  1.00 89.46  ? 45   THR A O   1 
ATOM 344  C CB  . THR A 1 48   ? 11.571  74.712 26.392  1.00 84.41  ? 45   THR A CB  1 
ATOM 345  O OG1 . THR A 1 48   ? 10.544  73.702 26.423  1.00 84.41  ? 45   THR A OG1 1 
ATOM 346  C CG2 . THR A 1 48   ? 12.579  74.420 25.282  1.00 84.41  ? 45   THR A CG2 1 
ATOM 347  N N   . ALA A 1 49   ? 10.773  76.349 28.849  1.00 99.42  ? 46   ALA A N   1 
ATOM 348  C CA  . ALA A 1 49   ? 9.553   76.750 29.561  1.00 99.42  ? 46   ALA A CA  1 
ATOM 349  C C   . ALA A 1 49   ? 8.427   75.698 29.533  1.00 99.42  ? 46   ALA A C   1 
ATOM 350  O O   . ALA A 1 49   ? 7.813   75.418 30.566  1.00 99.42  ? 46   ALA A O   1 
ATOM 351  C CB  . ALA A 1 49   ? 9.047   78.057 28.998  1.00 56.31  ? 46   ALA A CB  1 
ATOM 352  N N   . GLU A 1 50   ? 8.156   75.129 28.358  1.00 121.35 ? 47   GLU A N   1 
ATOM 353  C CA  . GLU A 1 50   ? 7.159   74.063 28.221  1.00 121.35 ? 47   GLU A CA  1 
ATOM 354  C C   . GLU A 1 50   ? 7.634   72.786 28.906  1.00 121.35 ? 47   GLU A C   1 
ATOM 355  O O   . GLU A 1 50   ? 6.885   72.132 29.647  1.00 121.35 ? 47   GLU A O   1 
ATOM 356  C CB  . GLU A 1 50   ? 6.885   73.777 26.738  1.00 145.44 ? 47   GLU A CB  1 
ATOM 357  C CG  . GLU A 1 50   ? 5.672   72.866 26.453  1.00 145.44 ? 47   GLU A CG  1 
ATOM 358  C CD  . GLU A 1 50   ? 5.920   71.381 26.734  1.00 145.44 ? 47   GLU A CD  1 
ATOM 359  O OE1 . GLU A 1 50   ? 5.010   70.732 27.291  1.00 145.44 ? 47   GLU A OE1 1 
ATOM 360  O OE2 . GLU A 1 50   ? 7.010   70.860 26.405  1.00 145.44 ? 47   GLU A OE2 1 
ATOM 361  N N   . GLY A 1 51   ? 8.889   72.445 28.637  1.00 72.85  ? 48   GLY A N   1 
ATOM 362  C CA  . GLY A 1 51   ? 9.476   71.186 29.078  1.00 72.85  ? 48   GLY A CA  1 
ATOM 363  C C   . GLY A 1 51   ? 10.500  70.742 28.056  1.00 72.85  ? 48   GLY A C   1 
ATOM 364  O O   . GLY A 1 51   ? 11.348  71.522 27.624  1.00 72.85  ? 48   GLY A O   1 
ATOM 365  N N   . LEU A 1 52   ? 10.403  69.497 27.625  1.00 56.02  ? 49   LEU A N   1 
ATOM 366  C CA  . LEU A 1 52   ? 11.461  68.933 26.807  1.00 56.02  ? 49   LEU A CA  1 
ATOM 367  C C   . LEU A 1 52   ? 11.335  69.179 25.293  1.00 56.02  ? 49   LEU A C   1 
ATOM 368  O O   . LEU A 1 52   ? 10.333  68.814 24.660  1.00 56.02  ? 49   LEU A O   1 
ATOM 369  C CB  . LEU A 1 52   ? 11.602  67.457 27.138  1.00 44.08  ? 49   LEU A CB  1 
ATOM 370  C CG  . LEU A 1 52   ? 12.344  67.123 28.439  1.00 44.08  ? 49   LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 52   ? 12.532  68.253 29.398  1.00 44.08  ? 49   LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 52   ? 11.641  66.021 29.091  1.00 44.08  ? 49   LEU A CD2 1 
ATOM 373  N N   . ARG A 1 53   ? 12.363  69.818 24.724  1.00 57.49  ? 50   ARG A N   1 
ATOM 374  C CA  . ARG A 1 53   ? 12.496  69.920 23.273  1.00 57.49  ? 50   ARG A CA  1 
ATOM 375  C C   . ARG A 1 53   ? 13.521  68.873 22.938  1.00 57.49  ? 50   ARG A C   1 
ATOM 376  O O   . ARG A 1 53   ? 14.663  69.023 23.362  1.00 57.49  ? 50   ARG A O   1 
ATOM 377  C CB  . ARG A 1 53   ? 13.011  71.305 22.858  1.00 137.78 ? 50   ARG A CB  1 
ATOM 378  C CG  . ARG A 1 53   ? 12.979  71.585 21.342  1.00 137.78 ? 50   ARG A CG  1 
ATOM 379  C CD  . ARG A 1 53   ? 14.054  72.596 20.896  1.00 137.78 ? 50   ARG A CD  1 
ATOM 380  N NE  . ARG A 1 53   ? 14.088  73.790 21.746  1.00 137.78 ? 50   ARG A NE  1 
ATOM 381  C CZ  . ARG A 1 53   ? 13.421  74.920 21.507  1.00 137.78 ? 50   ARG A CZ  1 
ATOM 382  N NH1 . ARG A 1 53   ? 12.660  75.048 20.421  1.00 137.78 ? 50   ARG A NH1 1 
ATOM 383  N NH2 . ARG A 1 53   ? 13.520  75.934 22.361  1.00 137.78 ? 50   ARG A NH2 1 
ATOM 384  N N   . PRO A 1 54   ? 13.102  67.777 22.256  1.00 53.98  ? 51   PRO A N   1 
ATOM 385  C CA  . PRO A 1 54   ? 13.961  66.724 21.711  1.00 53.98  ? 51   PRO A CA  1 
ATOM 386  C C   . PRO A 1 54   ? 14.933  67.258 20.691  1.00 53.98  ? 51   PRO A C   1 
ATOM 387  O O   . PRO A 1 54   ? 14.588  68.042 19.813  1.00 53.98  ? 51   PRO A O   1 
ATOM 388  C CB  . PRO A 1 54   ? 12.984  65.779 21.023  1.00 55.78  ? 51   PRO A CB  1 
ATOM 389  C CG  . PRO A 1 54   ? 11.760  65.981 21.701  1.00 55.78  ? 51   PRO A CG  1 
ATOM 390  C CD  . PRO A 1 54   ? 11.691  67.449 22.037  1.00 55.78  ? 51   PRO A CD  1 
ATOM 391  N N   . VAL A 1 55   ? 16.165  66.822 20.804  1.00 60.07  ? 52   VAL A N   1 
ATOM 392  C CA  . VAL A 1 55   ? 17.170  67.361 19.936  1.00 60.07  ? 52   VAL A CA  1 
ATOM 393  C C   . VAL A 1 55   ? 17.934  66.277 19.198  1.00 60.07  ? 52   VAL A C   1 
ATOM 394  O O   . VAL A 1 55   ? 18.374  66.499 18.074  1.00 60.07  ? 52   VAL A O   1 
ATOM 395  C CB  . VAL A 1 55   ? 18.106  68.305 20.703  1.00 42.79  ? 52   VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 55   ? 19.363  68.517 19.904  1.00 42.79  ? 52   VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 55   ? 17.400  69.655 20.934  1.00 42.79  ? 52   VAL A CG2 1 
ATOM 398  N N   . LYS A 1 56   ? 18.076  65.107 19.821  1.00 66.88  ? 53   LYS A N   1 
ATOM 399  C CA  . LYS A 1 56   ? 18.902  64.033 19.255  1.00 66.88  ? 53   LYS A CA  1 
ATOM 400  C C   . LYS A 1 56   ? 18.621  62.719 19.963  1.00 66.88  ? 53   LYS A C   1 
ATOM 401  O O   . LYS A 1 56   ? 18.504  62.669 21.185  1.00 66.88  ? 53   LYS A O   1 
ATOM 402  C CB  . LYS A 1 56   ? 20.397  64.401 19.360  1.00 67.01  ? 53   LYS A CB  1 
ATOM 403  C CG  . LYS A 1 56   ? 21.340  63.769 18.350  1.00 67.01  ? 53   LYS A CG  1 
ATOM 404  C CD  . LYS A 1 56   ? 20.810  63.791 16.946  1.00 67.01  ? 53   LYS A CD  1 
ATOM 405  C CE  . LYS A 1 56   ? 21.824  63.139 16.028  1.00 67.01  ? 53   LYS A CE  1 
ATOM 406  N NZ  . LYS A 1 56   ? 21.196  62.436 14.889  1.00 67.01  ? 53   LYS A NZ  1 
ATOM 407  N N   . GLU A 1 57   ? 18.497  61.658 19.183  1.00 55.25  ? 54   GLU A N   1 
ATOM 408  C CA  . GLU A 1 57   ? 18.262  60.339 19.755  1.00 55.25  ? 54   GLU A CA  1 
ATOM 409  C C   . GLU A 1 57   ? 19.203  59.406 19.030  1.00 55.25  ? 54   GLU A C   1 
ATOM 410  O O   . GLU A 1 57   ? 18.836  58.760 18.009  1.00 55.25  ? 54   GLU A O   1 
ATOM 411  C CB  . GLU A 1 57   ? 16.797  59.868 19.591  1.00 58.05  ? 54   GLU A CB  1 
ATOM 412  C CG  . GLU A 1 57   ? 16.252  58.970 20.701  1.00 58.05  ? 54   GLU A CG  1 
ATOM 413  C CD  . GLU A 1 57   ? 16.365  57.445 20.448  1.00 58.05  ? 54   GLU A CD  1 
ATOM 414  O OE1 . GLU A 1 57   ? 15.953  56.651 21.356  1.00 58.05  ? 54   GLU A OE1 1 
ATOM 415  O OE2 . GLU A 1 57   ? 16.839  57.033 19.360  1.00 58.05  ? 54   GLU A OE2 1 
ATOM 416  N N   . VAL A 1 58   ? 20.425  59.362 19.548  1.00 66.88  ? 55   VAL A N   1 
ATOM 417  C CA  . VAL A 1 58   ? 21.414  58.414 19.077  1.00 66.88  ? 55   VAL A CA  1 
ATOM 418  C C   . VAL A 1 58   ? 21.343  57.086 19.837  1.00 66.88  ? 55   VAL A C   1 
ATOM 419  O O   . VAL A 1 58   ? 20.944  57.053 21.007  1.00 66.88  ? 55   VAL A O   1 
ATOM 420  C CB  . VAL A 1 58   ? 22.820  59.012 19.158  1.00 60.92  ? 55   VAL A CB  1 
ATOM 421  C CG1 . VAL A 1 58   ? 22.942  60.134 18.146  1.00 60.92  ? 55   VAL A CG1 1 
ATOM 422  C CG2 . VAL A 1 58   ? 23.132  59.507 20.586  1.00 60.92  ? 55   VAL A CG2 1 
ATOM 423  N N   . GLY A 1 59   ? 21.705  55.999 19.149  1.00 54.03  ? 56   GLY A N   1 
ATOM 424  C CA  . GLY A 1 59   ? 21.999  54.701 19.793  1.00 54.03  ? 56   GLY A CA  1 
ATOM 425  C C   . GLY A 1 59   ? 23.495  54.467 20.036  1.00 54.03  ? 56   GLY A C   1 
ATOM 426  O O   . GLY A 1 59   ? 24.334  55.114 19.430  1.00 54.03  ? 56   GLY A O   1 
ATOM 427  N N   . MET A 1 60   ? 23.833  53.558 20.942  1.00 59.00  ? 57   MET A N   1 
ATOM 428  C CA  . MET A 1 60   ? 25.207  53.081 21.041  1.00 59.00  ? 57   MET A CA  1 
ATOM 429  C C   . MET A 1 60   ? 25.302  51.580 20.950  1.00 59.00  ? 57   MET A C   1 
ATOM 430  O O   . MET A 1 60   ? 24.311  50.892 21.082  1.00 59.00  ? 57   MET A O   1 
ATOM 431  C CB  . MET A 1 60   ? 25.852  53.561 22.314  1.00 56.83  ? 57   MET A CB  1 
ATOM 432  C CG  . MET A 1 60   ? 26.131  55.019 22.274  1.00 56.83  ? 57   MET A CG  1 
ATOM 433  S SD  . MET A 1 60   ? 26.976  55.377 23.778  1.00 56.83  ? 57   MET A SD  1 
ATOM 434  C CE  . MET A 1 60   ? 28.423  54.366 23.509  1.00 56.83  ? 57   MET A CE  1 
ATOM 435  N N   . TYR A 1 61   ? 26.504  51.076 20.722  1.00 49.73  ? 58   TYR A N   1 
ATOM 436  C CA  . TYR A 1 61   ? 26.687  49.652 20.600  1.00 49.73  ? 58   TYR A CA  1 
ATOM 437  C C   . TYR A 1 61   ? 27.031  49.048 21.944  1.00 49.73  ? 58   TYR A C   1 
ATOM 438  O O   . TYR A 1 61   ? 28.053  48.383 22.109  1.00 49.73  ? 58   TYR A O   1 
ATOM 439  C CB  . TYR A 1 61   ? 27.712  49.311 19.494  1.00 51.89  ? 58   TYR A CB  1 
ATOM 440  C CG  . TYR A 1 61   ? 27.130  49.410 18.117  1.00 51.89  ? 58   TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 61   ? 25.756  49.252 17.895  1.00 51.89  ? 58   TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 61   ? 27.930  49.654 17.044  1.00 51.89  ? 58   TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 61   ? 25.192  49.352 16.631  1.00 51.89  ? 58   TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 61   ? 27.387  49.761 15.746  1.00 51.89  ? 58   TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 61   ? 26.013  49.606 15.539  1.00 51.89  ? 58   TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 61   ? 25.506  49.717 14.236  1.00 51.89  ? 58   TYR A OH  1 
ATOM 447  N N   . GLY A 1 62   ? 26.139  49.261 22.897  1.00 42.47  ? 59   GLY A N   1 
ATOM 448  C CA  . GLY A 1 62   ? 26.427  49.013 24.318  1.00 42.47  ? 59   GLY A CA  1 
ATOM 449  C C   . GLY A 1 62   ? 25.336  49.460 25.289  1.00 42.47  ? 59   GLY A C   1 
ATOM 450  O O   . GLY A 1 62   ? 24.477  50.318 24.994  1.00 42.47  ? 59   GLY A O   1 
ATOM 451  N N   . LYS A 1 63   ? 25.341  48.843 26.454  1.00 42.44  ? 60   LYS A N   1 
ATOM 452  C CA  . LYS A 1 63   ? 24.438  49.240 27.477  1.00 42.44  ? 60   LYS A CA  1 
ATOM 453  C C   . LYS A 1 63   ? 25.179  50.349 28.166  1.00 42.44  ? 60   LYS A C   1 
ATOM 454  O O   . LYS A 1 63   ? 26.239  50.096 28.701  1.00 42.44  ? 60   LYS A O   1 
ATOM 455  C CB  . LYS A 1 63   ? 24.202  48.072 28.414  1.00 40.85  ? 60   LYS A CB  1 
ATOM 456  C CG  . LYS A 1 63   ? 23.493  46.908 27.730  1.00 40.85  ? 60   LYS A CG  1 
ATOM 457  C CD  . LYS A 1 63   ? 23.201  45.756 28.713  1.00 40.85  ? 60   LYS A CD  1 
ATOM 458  C CE  . LYS A 1 63   ? 22.113  46.162 29.744  1.00 40.85  ? 60   LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 63   ? 20.810  46.115 28.969  1.00 40.85  ? 60   LYS A NZ  1 
ATOM 460  N N   . ILE A 1 64   ? 24.670  51.580 28.123  1.00 38.62  ? 61   ILE A N   1 
ATOM 461  C CA  . ILE A 1 64   ? 25.278  52.696 28.873  1.00 38.62  ? 61   ILE A CA  1 
ATOM 462  C C   . ILE A 1 64   ? 25.279  52.408 30.382  1.00 38.62  ? 61   ILE A C   1 
ATOM 463  O O   . ILE A 1 64   ? 24.210  52.171 30.951  1.00 38.62  ? 61   ILE A O   1 
ATOM 464  C CB  . ILE A 1 64   ? 24.555  53.999 28.586  1.00 31.63  ? 61   ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 64   ? 24.732  54.333 27.122  1.00 31.63  ? 61   ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 64   ? 25.138  55.124 29.391  1.00 31.63  ? 61   ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 64   ? 23.820  55.348 26.602  1.00 31.63  ? 61   ILE A CD1 1 
ATOM 468  N N   . ALA A 1 65   ? 26.464  52.369 31.000  1.00 39.10  ? 62   ALA A N   1 
ATOM 469  C CA  . ALA A 1 65   ? 26.598  52.111 32.422  1.00 39.10  ? 62   ALA A CA  1 
ATOM 470  C C   . ALA A 1 65   ? 26.982  53.368 33.125  1.00 39.10  ? 62   ALA A C   1 
ATOM 471  O O   . ALA A 1 65   ? 26.777  53.490 34.307  1.00 39.10  ? 62   ALA A O   1 
ATOM 472  C CB  . ALA A 1 65   ? 27.648  51.059 32.693  1.00 20.19  ? 62   ALA A CB  1 
ATOM 473  N N   . VAL A 1 66   ? 27.606  54.290 32.416  1.00 46.47  ? 63   VAL A N   1 
ATOM 474  C CA  . VAL A 1 66   ? 28.053  55.522 33.030  1.00 46.47  ? 63   VAL A CA  1 
ATOM 475  C C   . VAL A 1 66   ? 27.765  56.662 32.090  1.00 46.47  ? 63   VAL A C   1 
ATOM 476  O O   . VAL A 1 66   ? 28.049  56.585 30.916  1.00 46.47  ? 63   VAL A O   1 
ATOM 477  C CB  . VAL A 1 66   ? 29.547  55.482 33.467  1.00 40.73  ? 63   VAL A CB  1 
ATOM 478  C CG1 . VAL A 1 66   ? 29.940  56.747 34.228  1.00 40.73  ? 63   VAL A CG1 1 
ATOM 479  C CG2 . VAL A 1 66   ? 29.779  54.342 34.380  1.00 40.73  ? 63   VAL A CG2 1 
ATOM 480  N N   . MET A 1 67   ? 27.147  57.706 32.613  1.00 49.16  ? 64   MET A N   1 
ATOM 481  C CA  . MET A 1 67   ? 26.830  58.858 31.818  1.00 49.16  ? 64   MET A CA  1 
ATOM 482  C C   . MET A 1 67   ? 27.017  60.128 32.637  1.00 49.16  ? 64   MET A C   1 
ATOM 483  O O   . MET A 1 67   ? 26.221  60.454 33.537  1.00 49.16  ? 64   MET A O   1 
ATOM 484  C CB  . MET A 1 67   ? 25.433  58.734 31.303  1.00 38.17  ? 64   MET A CB  1 
ATOM 485  C CG  . MET A 1 67   ? 25.097  59.851 30.397  1.00 38.17  ? 64   MET A CG  1 
ATOM 486  S SD  . MET A 1 67   ? 23.468  59.659 29.622  1.00 38.17  ? 64   MET A SD  1 
ATOM 487  C CE  . MET A 1 67   ? 22.455  59.775 31.116  1.00 38.17  ? 64   MET A CE  1 
ATOM 488  N N   . GLU A 1 68   ? 28.111  60.825 32.364  1.00 56.26  ? 65   GLU A N   1 
ATOM 489  C CA  . GLU A 1 68   ? 28.384  62.064 33.055  1.00 56.26  ? 65   GLU A CA  1 
ATOM 490  C C   . GLU A 1 68   ? 28.756  63.166 32.089  1.00 56.26  ? 65   GLU A C   1 
ATOM 491  O O   . GLU A 1 68   ? 29.449  62.933 31.127  1.00 56.26  ? 65   GLU A O   1 
ATOM 492  C CB  . GLU A 1 68   ? 29.504  61.869 34.066  1.00 66.86  ? 65   GLU A CB  1 
ATOM 493  C CG  . GLU A 1 68   ? 29.162  60.948 35.214  1.00 66.86  ? 65   GLU A CG  1 
ATOM 494  C CD  . GLU A 1 68   ? 28.009  61.435 36.091  1.00 66.86  ? 65   GLU A CD  1 
ATOM 495  O OE1 . GLU A 1 68   ? 27.405  60.576 36.777  1.00 66.86  ? 65   GLU A OE1 1 
ATOM 496  O OE2 . GLU A 1 68   ? 27.715  62.658 36.114  1.00 66.86  ? 65   GLU A OE2 1 
ATOM 497  N N   . LEU A 1 69   ? 28.286  64.375 32.351  1.00 73.63  ? 66   LEU A N   1 
ATOM 498  C CA  . LEU A 1 69   ? 28.768  65.522 31.607  1.00 73.63  ? 66   LEU A CA  1 
ATOM 499  C C   . LEU A 1 69   ? 29.923  66.166 32.344  1.00 73.63  ? 66   LEU A C   1 
ATOM 500  O O   . LEU A 1 69   ? 29.965  66.159 33.564  1.00 73.63  ? 66   LEU A O   1 
ATOM 501  C CB  . LEU A 1 69   ? 27.650  66.522 31.342  1.00 50.17  ? 66   LEU A CB  1 
ATOM 502  C CG  . LEU A 1 69   ? 26.739  66.165 30.164  1.00 50.17  ? 66   LEU A CG  1 
ATOM 503  C CD1 . LEU A 1 69   ? 25.594  67.171 29.983  1.00 50.17  ? 66   LEU A CD1 1 
ATOM 504  C CD2 . LEU A 1 69   ? 27.505  66.028 28.873  1.00 50.17  ? 66   LEU A CD2 1 
ATOM 505  N N   . PHE A 1 70   ? 30.881  66.699 31.603  1.00 56.25  ? 67   PHE A N   1 
ATOM 506  C CA  . PHE A 1 70   ? 32.001  67.386 32.227  1.00 56.25  ? 67   PHE A CA  1 
ATOM 507  C C   . PHE A 1 70   ? 32.641  68.374 31.254  1.00 56.25  ? 67   PHE A C   1 
ATOM 508  O O   . PHE A 1 70   ? 32.353  68.368 30.055  1.00 56.25  ? 67   PHE A O   1 
ATOM 509  C CB  . PHE A 1 70   ? 33.046  66.384 32.735  1.00 57.71  ? 67   PHE A CB  1 
ATOM 510  C CG  . PHE A 1 70   ? 33.917  65.841 31.651  1.00 57.71  ? 67   PHE A CG  1 
ATOM 511  C CD1 . PHE A 1 70   ? 35.223  66.293 31.506  1.00 57.71  ? 67   PHE A CD1 1 
ATOM 512  C CD2 . PHE A 1 70   ? 33.410  64.914 30.730  1.00 57.71  ? 67   PHE A CD2 1 
ATOM 513  C CE1 . PHE A 1 70   ? 36.027  65.804 30.497  1.00 57.71  ? 67   PHE A CE1 1 
ATOM 514  C CE2 . PHE A 1 70   ? 34.206  64.433 29.712  1.00 57.71  ? 67   PHE A CE2 1 
ATOM 515  C CZ  . PHE A 1 70   ? 35.520  64.876 29.598  1.00 57.71  ? 67   PHE A CZ  1 
ATOM 516  N N   . ARG A 1 71   ? 33.518  69.214 31.798  1.00 76.10  ? 68   ARG A N   1 
ATOM 517  C CA  . ARG A 1 71   ? 34.139  70.292 31.049  1.00 76.10  ? 68   ARG A CA  1 
ATOM 518  C C   . ARG A 1 71   ? 35.468  70.629 31.702  1.00 76.10  ? 68   ARG A C   1 
ATOM 519  O O   . ARG A 1 71   ? 35.496  71.071 32.844  1.00 76.10  ? 68   ARG A O   1 
ATOM 520  C CB  . ARG A 1 71   ? 33.207  71.511 31.003  1.00 97.73  ? 68   ARG A CB  1 
ATOM 521  C CG  . ARG A 1 71   ? 33.726  72.687 30.208  1.00 97.73  ? 68   ARG A CG  1 
ATOM 522  C CD  . ARG A 1 71   ? 32.624  73.393 29.435  1.00 97.73  ? 68   ARG A CD  1 
ATOM 523  N NE  . ARG A 1 71   ? 31.550  73.919 30.279  1.00 97.73  ? 68   ARG A NE  1 
ATOM 524  C CZ  . ARG A 1 71   ? 30.678  74.862 29.912  1.00 97.73  ? 68   ARG A CZ  1 
ATOM 525  N NH1 . ARG A 1 71   ? 30.734  75.420 28.716  1.00 97.73  ? 68   ARG A NH1 1 
ATOM 526  N NH2 . ARG A 1 71   ? 29.740  75.262 30.754  1.00 97.73  ? 68   ARG A NH2 1 
ATOM 527  N N   . PRO A 1 72   ? 36.579  70.369 30.993  1.00 111.49 ? 69   PRO A N   1 
ATOM 528  C CA  . PRO A 1 72   ? 37.880  70.797 31.479  1.00 111.49 ? 69   PRO A CA  1 
ATOM 529  C C   . PRO A 1 72   ? 38.189  72.240 31.067  1.00 111.49 ? 69   PRO A C   1 
ATOM 530  O O   . PRO A 1 72   ? 37.301  72.956 30.580  1.00 111.49 ? 69   PRO A O   1 
ATOM 531  C CB  . PRO A 1 72   ? 38.853  69.812 30.805  1.00 63.98  ? 69   PRO A CB  1 
ATOM 532  C CG  . PRO A 1 72   ? 38.014  68.935 29.880  1.00 63.98  ? 69   PRO A CG  1 
ATOM 533  C CD  . PRO A 1 72   ? 36.696  69.633 29.724  1.00 63.98  ? 69   PRO A CD  1 
ATOM 534  N N   . LYS A 1 73   ? 39.439  72.653 31.280  1.00 78.18  ? 70   LYS A N   1 
ATOM 535  C CA  . LYS A 1 73   ? 39.917  73.995 30.920  1.00 78.18  ? 70   LYS A CA  1 
ATOM 536  C C   . LYS A 1 73   ? 39.935  74.206 29.411  1.00 78.18  ? 70   LYS A C   1 
ATOM 537  O O   . LYS A 1 73   ? 40.151  73.262 28.638  1.00 78.18  ? 70   LYS A O   1 
ATOM 538  C CB  . LYS A 1 73   ? 41.326  74.248 31.485  1.00 170.92 ? 70   LYS A CB  1 
ATOM 539  C CG  . LYS A 1 73   ? 41.503  73.967 32.977  1.00 170.92 ? 70   LYS A CG  1 
ATOM 540  C CD  . LYS A 1 73   ? 40.816  75.009 33.853  1.00 170.92 ? 70   LYS A CD  1 
ATOM 541  C CE  . LYS A 1 73   ? 40.661  74.509 35.290  1.00 170.92 ? 70   LYS A CE  1 
ATOM 542  N NZ  . LYS A 1 73   ? 39.788  73.291 35.364  1.00 170.92 ? 70   LYS A NZ  1 
ATOM 543  N N   . GLY A 1 74   ? 39.703  75.457 29.013  1.00 145.01 ? 71   GLY A N   1 
ATOM 544  C CA  . GLY A 1 74   ? 39.696  75.861 27.612  1.00 145.01 ? 71   GLY A CA  1 
ATOM 545  C C   . GLY A 1 74   ? 38.602  75.174 26.823  1.00 145.01 ? 71   GLY A C   1 
ATOM 546  O O   . GLY A 1 74   ? 38.773  74.897 25.635  1.00 145.01 ? 71   GLY A O   1 
ATOM 547  N N   . GLU A 1 75   ? 37.480  74.896 27.486  1.00 79.94  ? 72   GLU A N   1 
ATOM 548  C CA  . GLU A 1 75   ? 36.373  74.169 26.851  1.00 79.94  ? 72   GLU A CA  1 
ATOM 549  C C   . GLU A 1 75   ? 35.083  74.983 26.761  1.00 79.94  ? 72   GLU A C   1 
ATOM 550  O O   . GLU A 1 75   ? 34.600  75.523 27.753  1.00 79.94  ? 72   GLU A O   1 
ATOM 551  C CB  . GLU A 1 75   ? 36.144  72.820 27.539  1.00 74.36  ? 72   GLU A CB  1 
ATOM 552  C CG  . GLU A 1 75   ? 36.893  71.659 26.884  1.00 74.36  ? 72   GLU A CG  1 
ATOM 553  C CD  . GLU A 1 75   ? 36.397  71.350 25.467  1.00 74.36  ? 72   GLU A CD  1 
ATOM 554  O OE1 . GLU A 1 75   ? 37.131  70.648 24.730  1.00 74.36  ? 72   GLU A OE1 1 
ATOM 555  O OE2 . GLU A 1 75   ? 35.284  71.804 25.084  1.00 74.36  ? 72   GLU A OE2 1 
ATOM 556  N N   . SER A 1 76   ? 34.549  75.078 25.552  1.00 86.00  ? 73   SER A N   1 
ATOM 557  C CA  . SER A 1 76   ? 33.392  75.916 25.306  1.00 86.00  ? 73   SER A CA  1 
ATOM 558  C C   . SER A 1 76   ? 32.156  75.370 25.996  1.00 86.00  ? 73   SER A C   1 
ATOM 559  O O   . SER A 1 76   ? 31.468  76.116 26.688  1.00 86.00  ? 73   SER A O   1 
ATOM 560  C CB  . SER A 1 76   ? 33.153  76.095 23.811  1.00 75.86  ? 73   SER A CB  1 
ATOM 561  O OG  . SER A 1 76   ? 33.477  74.916 23.090  1.00 75.86  ? 73   SER A OG  1 
ATOM 562  N N   . LYS A 1 77   ? 31.903  74.068 25.841  1.00 82.51  ? 74   LYS A N   1 
ATOM 563  C CA  . LYS A 1 77   ? 30.715  73.406 26.388  1.00 82.51  ? 74   LYS A CA  1 
ATOM 564  C C   . LYS A 1 77   ? 31.027  72.012 26.925  1.00 82.51  ? 74   LYS A C   1 
ATOM 565  O O   . LYS A 1 77   ? 32.061  71.441 26.602  1.00 82.51  ? 74   LYS A O   1 
ATOM 566  C CB  . LYS A 1 77   ? 29.658  73.314 25.313  1.00 54.42  ? 74   LYS A CB  1 
ATOM 567  C CG  . LYS A 1 77   ? 30.231  72.809 24.036  1.00 54.42  ? 74   LYS A CG  1 
ATOM 568  C CD  . LYS A 1 77   ? 29.266  72.949 22.908  1.00 54.42  ? 74   LYS A CD  1 
ATOM 569  C CE  . LYS A 1 77   ? 29.525  71.866 21.865  1.00 54.42  ? 74   LYS A CE  1 
ATOM 570  N NZ  . LYS A 1 77   ? 30.981  71.532 21.609  1.00 54.42  ? 74   LYS A NZ  1 
ATOM 571  N N   . ASP A 1 78   ? 30.114  71.476 27.738  1.00 61.84  ? 75   ASP A N   1 
ATOM 572  C CA  . ASP A 1 78   ? 30.289  70.190 28.426  1.00 61.84  ? 75   ASP A CA  1 
ATOM 573  C C   . ASP A 1 78   ? 30.494  69.028 27.465  1.00 61.84  ? 75   ASP A C   1 
ATOM 574  O O   . ASP A 1 78   ? 29.657  68.759 26.622  1.00 61.84  ? 75   ASP A O   1 
ATOM 575  C CB  . ASP A 1 78   ? 29.074  69.881 29.310  1.00 73.28  ? 75   ASP A CB  1 
ATOM 576  C CG  . ASP A 1 78   ? 29.102  70.599 30.657  1.00 73.28  ? 75   ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 78   ? 28.254  70.271 31.520  1.00 73.28  ? 75   ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 78   ? 29.962  71.480 30.877  1.00 73.28  ? 75   ASP A OD2 1 
ATOM 579  N N   . LEU A 1 79   ? 31.624  68.351 27.586  1.00 52.58  ? 76   LEU A N   1 
ATOM 580  C CA  . LEU A 1 79   ? 31.800  67.021 26.971  1.00 52.58  ? 76   LEU A CA  1 
ATOM 581  C C   . LEU A 1 79   ? 31.014  65.906 27.722  1.00 52.58  ? 76   LEU A C   1 
ATOM 582  O O   . LEU A 1 79   ? 30.708  66.041 28.919  1.00 52.58  ? 76   LEU A O   1 
ATOM 583  C CB  . LEU A 1 79   ? 33.296  66.670 26.890  1.00 50.75  ? 76   LEU A CB  1 
ATOM 584  C CG  . LEU A 1 79   ? 34.081  67.560 25.916  1.00 50.75  ? 76   LEU A CG  1 
ATOM 585  C CD1 . LEU A 1 79   ? 35.394  66.938 25.531  1.00 50.75  ? 76   LEU A CD1 1 
ATOM 586  C CD2 . LEU A 1 79   ? 33.245  67.815 24.678  1.00 50.75  ? 76   LEU A CD2 1 
ATOM 587  N N   . LEU A 1 80   ? 30.701  64.810 27.037  1.00 53.15  ? 77   LEU A N   1 
ATOM 588  C CA  . LEU A 1 80   ? 30.025  63.708 27.697  1.00 53.15  ? 77   LEU A CA  1 
ATOM 589  C C   . LEU A 1 80   ? 30.904  62.509 27.745  1.00 53.15  ? 77   LEU A C   1 
ATOM 590  O O   . LEU A 1 80   ? 31.476  62.140 26.752  1.00 53.15  ? 77   LEU A O   1 
ATOM 591  C CB  . LEU A 1 80   ? 28.745  63.358 26.963  1.00 53.07  ? 77   LEU A CB  1 
ATOM 592  C CG  . LEU A 1 80   ? 28.003  62.087 27.372  1.00 53.07  ? 77   LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 80   ? 27.587  62.132 28.802  1.00 53.07  ? 77   LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 80   ? 26.809  61.845 26.451  1.00 53.07  ? 77   LEU A CD2 1 
ATOM 595  N N   . PHE A 1 81   ? 31.009  61.913 28.920  1.00 56.22  ? 78   PHE A N   1 
ATOM 596  C CA  . PHE A 1 81   ? 31.732  60.667 29.114  1.00 56.22  ? 78   PHE A CA  1 
ATOM 597  C C   . PHE A 1 81   ? 30.791  59.493 29.193  1.00 56.22  ? 78   PHE A C   1 
ATOM 598  O O   . PHE A 1 81   ? 29.794  59.527 29.933  1.00 56.22  ? 78   PHE A O   1 
ATOM 599  C CB  . PHE A 1 81   ? 32.534  60.664 30.399  1.00 46.30  ? 78   PHE A CB  1 
ATOM 600  C CG  . PHE A 1 81   ? 33.159  59.334 30.684  1.00 46.30  ? 78   PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 81   ? 34.204  58.864 29.900  1.00 46.30  ? 78   PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 81   ? 32.679  58.524 31.699  1.00 46.30  ? 78   PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 81   ? 34.756  57.618 30.144  1.00 46.30  ? 78   PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 81   ? 33.224  57.275 31.931  1.00 46.30  ? 78   PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 81   ? 34.259  56.826 31.166  1.00 46.30  ? 78   PHE A CZ  1 
ATOM 606  N N   . ILE A 1 82   ? 31.119  58.444 28.452  1.00 60.73  ? 79   ILE A N   1 
ATOM 607  C CA  . ILE A 1 82   ? 30.323  57.246 28.488  1.00 60.73  ? 79   ILE A CA  1 
ATOM 608  C C   . ILE A 1 82   ? 31.156  56.014 28.628  1.00 60.73  ? 79   ILE A C   1 
ATOM 609  O O   . ILE A 1 82   ? 32.070  55.772 27.865  1.00 60.73  ? 79   ILE A O   1 
ATOM 610  C CB  . ILE A 1 82   ? 29.481  57.093 27.256  1.00 39.58  ? 79   ILE A CB  1 
ATOM 611  C CG1 . ILE A 1 82   ? 28.472  58.229 27.180  1.00 39.58  ? 79   ILE A CG1 1 
ATOM 612  C CG2 . ILE A 1 82   ? 28.783  55.763 27.274  1.00 39.58  ? 79   ILE A CG2 1 
ATOM 613  C CD1 . ILE A 1 82   ? 27.085  57.825 26.789  1.00 39.58  ? 79   ILE A CD1 1 
ATOM 614  N N   . LEU A 1 83   ? 30.811  55.243 29.633  1.00 40.90  ? 80   LEU A N   1 
ATOM 615  C CA  . LEU A 1 83   ? 31.280  53.911 29.791  1.00 40.90  ? 80   LEU A CA  1 
ATOM 616  C C   . LEU A 1 83   ? 30.129  53.015 29.533  1.00 40.90  ? 80   LEU A C   1 
ATOM 617  O O   . LEU A 1 83   ? 29.131  53.105 30.193  1.00 40.90  ? 80   LEU A O   1 
ATOM 618  C CB  . LEU A 1 83   ? 31.686  53.632 31.230  1.00 25.61  ? 80   LEU A CB  1 
ATOM 619  C CG  . LEU A 1 83   ? 32.146  52.170 31.394  1.00 25.61  ? 80   LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 83   ? 33.118  51.800 30.311  1.00 25.61  ? 80   LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 83   ? 32.775  52.018 32.710  1.00 25.61  ? 80   LEU A CD2 1 
ATOM 622  N N   . THR A 1 84   ? 30.315  52.113 28.596  1.00 41.73  ? 81   THR A N   1 
ATOM 623  C CA  . THR A 1 84   ? 29.468  50.978 28.389  1.00 41.73  ? 81   THR A CA  1 
ATOM 624  C C   . THR A 1 84   ? 29.653  49.829 29.370  1.00 41.73  ? 81   THR A C   1 
ATOM 625  O O   . THR A 1 84   ? 30.644  49.749 30.111  1.00 41.73  ? 81   THR A O   1 
ATOM 626  C CB  . THR A 1 84   ? 29.846  50.467 27.094  1.00 27.57  ? 81   THR A CB  1 
ATOM 627  O OG1 . THR A 1 84   ? 28.816  50.807 26.187  1.00 27.57  ? 81   THR A OG1 1 
ATOM 628  C CG2 . THR A 1 84   ? 29.976  49.085 27.108  1.00 27.57  ? 81   THR A CG2 1 
ATOM 629  N N   . ALA A 1 85   ? 28.694  48.918 29.359  1.00 38.55  ? 82   ALA A N   1 
ATOM 630  C CA  . ALA A 1 85   ? 28.760  47.707 30.179  1.00 38.55  ? 82   ALA A CA  1 
ATOM 631  C C   . ALA A 1 85   ? 29.829  46.723 29.663  1.00 38.55  ? 82   ALA A C   1 
ATOM 632  O O   . ALA A 1 85   ? 30.420  46.038 30.429  1.00 38.55  ? 82   ALA A O   1 
ATOM 633  C CB  . ALA A 1 85   ? 27.352  47.030 30.286  1.00 20.56  ? 82   ALA A CB  1 
ATOM 634  N N   . LYS A 1 86   ? 30.090  46.645 28.378  1.00 60.50  ? 83   LYS A N   1 
ATOM 635  C CA  . LYS A 1 86   ? 31.179  45.811 27.911  1.00 60.50  ? 83   LYS A CA  1 
ATOM 636  C C   . LYS A 1 86   ? 32.493  46.580 28.005  1.00 60.50  ? 83   LYS A C   1 
ATOM 637  O O   . LYS A 1 86   ? 33.501  46.184 27.431  1.00 60.50  ? 83   LYS A O   1 
ATOM 638  C CB  . LYS A 1 86   ? 30.917  45.308 26.494  1.00 30.04  ? 83   LYS A CB  1 
ATOM 639  C CG  . LYS A 1 86   ? 29.976  44.132 26.435  1.00 30.04  ? 83   LYS A CG  1 
ATOM 640  C CD  . LYS A 1 86   ? 29.674  43.725 25.016  1.00 30.04  ? 83   LYS A CD  1 
ATOM 641  C CE  . LYS A 1 86   ? 29.000  42.375 25.036  1.00 30.04  ? 83   LYS A CE  1 
ATOM 642  N NZ  . LYS A 1 86   ? 28.865  41.658 23.701  1.00 30.04  ? 83   LYS A NZ  1 
ATOM 643  N N   . TYR A 1 87   ? 32.463  47.679 28.743  1.00 41.58  ? 84   TYR A N   1 
ATOM 644  C CA  . TYR A 1 87   ? 33.664  48.365 29.233  1.00 41.58  ? 84   TYR A CA  1 
ATOM 645  C C   . TYR A 1 87   ? 34.241  49.291 28.211  1.00 41.58  ? 84   TYR A C   1 
ATOM 646  O O   . TYR A 1 87   ? 35.364  49.752 28.355  1.00 41.58  ? 84   TYR A O   1 
ATOM 647  C CB  . TYR A 1 87   ? 34.727  47.405 29.802  1.00 39.75  ? 84   TYR A CB  1 
ATOM 648  C CG  . TYR A 1 87   ? 34.240  46.604 30.976  1.00 39.75  ? 84   TYR A CG  1 
ATOM 649  C CD1 . TYR A 1 87   ? 33.645  45.366 30.787  1.00 39.75  ? 84   TYR A CD1 1 
ATOM 650  C CD2 . TYR A 1 87   ? 34.311  47.098 32.279  1.00 39.75  ? 84   TYR A CD2 1 
ATOM 651  C CE1 . TYR A 1 87   ? 33.142  44.631 31.848  1.00 39.75  ? 84   TYR A CE1 1 
ATOM 652  C CE2 . TYR A 1 87   ? 33.804  46.363 33.348  1.00 39.75  ? 84   TYR A CE2 1 
ATOM 653  C CZ  . TYR A 1 87   ? 33.231  45.126 33.107  1.00 39.75  ? 84   TYR A CZ  1 
ATOM 654  O OH  . TYR A 1 87   ? 32.725  44.353 34.121  1.00 39.75  ? 84   TYR A OH  1 
ATOM 655  N N   . ASN A 1 88   ? 33.448  49.579 27.182  1.00 47.48  ? 85   ASN A N   1 
ATOM 656  C CA  . ASN A 1 88   ? 33.780  50.562 26.160  1.00 47.48  ? 85   ASN A CA  1 
ATOM 657  C C   . ASN A 1 88   ? 33.665  51.924 26.806  1.00 47.48  ? 85   ASN A C   1 
ATOM 658  O O   . ASN A 1 88   ? 32.582  52.318 27.246  1.00 47.48  ? 85   ASN A O   1 
ATOM 659  C CB  . ASN A 1 88   ? 32.805  50.495 24.979  1.00 52.74  ? 85   ASN A CB  1 
ATOM 660  C CG  . ASN A 1 88   ? 32.628  49.072 24.404  1.00 52.74  ? 85   ASN A CG  1 
ATOM 661  O OD1 . ASN A 1 88   ? 31.765  48.312 24.854  1.00 52.74  ? 85   ASN A OD1 1 
ATOM 662  N ND2 . ASN A 1 88   ? 33.397  48.741 23.377  1.00 52.74  ? 85   ASN A ND2 1 
ATOM 663  N N   . ALA A 1 89   ? 34.778  52.637 26.909  1.00 42.17  ? 86   ALA A N   1 
ATOM 664  C CA  . ALA A 1 89   ? 34.701  54.018 27.345  1.00 42.17  ? 86   ALA A CA  1 
ATOM 665  C C   . ALA A 1 89   ? 34.809  54.911 26.132  1.00 42.17  ? 86   ALA A C   1 
ATOM 666  O O   . ALA A 1 89   ? 35.455  54.549 25.155  1.00 42.17  ? 86   ALA A O   1 
ATOM 667  C CB  . ALA A 1 89   ? 35.785  54.339 28.338  1.00 33.87  ? 86   ALA A CB  1 
ATOM 668  N N   . CYS A 1 90   ? 34.160  56.064 26.202  1.00 48.18  ? 87   CYS A N   1 
ATOM 669  C CA  . CYS A 1 90   ? 34.273  57.061 25.155  1.00 48.18  ? 87   CYS A CA  1 
ATOM 670  C C   . CYS A 1 90   ? 33.982  58.456 25.688  1.00 48.18  ? 87   CYS A C   1 
ATOM 671  O O   . CYS A 1 90   ? 33.411  58.603 26.767  1.00 48.18  ? 87   CYS A O   1 
ATOM 672  C CB  . CYS A 1 90   ? 33.316  56.747 24.005  1.00 49.51  ? 87   CYS A CB  1 
ATOM 673  S SG  . CYS A 1 90   ? 31.545  56.868 24.428  1.00 49.51  ? 87   CYS A SG  1 
ATOM 674  N N   . ILE A 1 91   ? 34.383  59.471 24.929  1.00 53.85  ? 88   ILE A N   1 
ATOM 675  C CA  . ILE A 1 91   ? 34.062  60.841 25.262  1.00 53.85  ? 88   ILE A CA  1 
ATOM 676  C C   . ILE A 1 91   ? 33.398  61.488 24.089  1.00 53.85  ? 88   ILE A C   1 
ATOM 677  O O   . ILE A 1 91   ? 33.926  61.465 22.976  1.00 53.85  ? 88   ILE A O   1 
ATOM 678  C CB  . ILE A 1 91   ? 35.269  61.657 25.509  1.00 42.63  ? 88   ILE A CB  1 
ATOM 679  C CG1 . ILE A 1 91   ? 35.938  61.245 26.819  1.00 42.63  ? 88   ILE A CG1 1 
ATOM 680  C CG2 . ILE A 1 91   ? 34.874  63.134 25.506  1.00 42.63  ? 88   ILE A CG2 1 
ATOM 681  C CD1 . ILE A 1 91   ? 36.948  62.255 27.277  1.00 42.63  ? 88   ILE A CD1 1 
ATOM 682  N N   . LEU A 1 92   ? 32.250  62.100 24.354  1.00 40.04  ? 89   LEU A N   1 
ATOM 683  C CA  . LEU A 1 92   ? 31.360  62.548 23.297  1.00 40.04  ? 89   LEU A CA  1 
ATOM 684  C C   . LEU A 1 92   ? 31.210  64.066 23.314  1.00 40.04  ? 89   LEU A C   1 
ATOM 685  O O   . LEU A 1 92   ? 31.354  64.699 24.370  1.00 40.04  ? 89   LEU A O   1 
ATOM 686  C CB  . LEU A 1 92   ? 30.022  61.817 23.413  1.00 34.77  ? 89   LEU A CB  1 
ATOM 687  C CG  . LEU A 1 92   ? 30.151  60.304 23.176  1.00 34.77  ? 89   LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 92   ? 28.798  59.594 23.118  1.00 34.77  ? 89   LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 92   ? 30.932  59.917 21.903  1.00 34.77  ? 89   LEU A CD2 1 
ATOM 690  N N   . GLU A 1 93   ? 30.963  64.634 22.140  1.00 62.72  ? 90   GLU A N   1 
ATOM 691  C CA  . GLU A 1 93   ? 30.886  66.063 21.958  1.00 62.72  ? 90   GLU A CA  1 
ATOM 692  C C   . GLU A 1 93   ? 29.746  66.348 21.035  1.00 62.72  ? 90   GLU A C   1 
ATOM 693  O O   . GLU A 1 93   ? 29.627  65.740 19.960  1.00 62.72  ? 90   GLU A O   1 
ATOM 694  C CB  . GLU A 1 93   ? 32.162  66.594 21.327  1.00 78.11  ? 90   GLU A CB  1 
ATOM 695  C CG  . GLU A 1 93   ? 32.307  68.097 21.458  1.00 78.11  ? 90   GLU A CG  1 
ATOM 696  C CD  . GLU A 1 93   ? 33.121  68.709 20.337  1.00 78.11  ? 90   GLU A CD  1 
ATOM 697  O OE1 . GLU A 1 93   ? 34.366  68.528 20.314  1.00 78.11  ? 90   GLU A OE1 1 
ATOM 698  O OE2 . GLU A 1 93   ? 32.501  69.385 19.479  1.00 78.11  ? 90   GLU A OE2 1 
ATOM 699  N N   . TYR A 1 94   ? 28.895  67.274 21.453  1.00 92.13  ? 91   TYR A N   1 
ATOM 700  C CA  . TYR A 1 94   ? 27.753  67.609 20.646  1.00 92.13  ? 91   TYR A CA  1 
ATOM 701  C C   . TYR A 1 94   ? 28.162  68.616 19.622  1.00 92.13  ? 91   TYR A C   1 
ATOM 702  O O   . TYR A 1 94   ? 28.652  69.692 19.952  1.00 92.13  ? 91   TYR A O   1 
ATOM 703  C CB  . TYR A 1 94   ? 26.609  68.143 21.480  1.00 83.99  ? 91   TYR A CB  1 
ATOM 704  C CG  . TYR A 1 94   ? 25.383  68.346 20.651  1.00 83.99  ? 91   TYR A CG  1 
ATOM 705  C CD1 . TYR A 1 94   ? 24.574  67.273 20.306  1.00 83.99  ? 91   TYR A CD1 1 
ATOM 706  C CD2 . TYR A 1 94   ? 25.042  69.605 20.194  1.00 83.99  ? 91   TYR A CD2 1 
ATOM 707  C CE1 . TYR A 1 94   ? 23.441  67.455 19.536  1.00 83.99  ? 91   TYR A CE1 1 
ATOM 708  C CE2 . TYR A 1 94   ? 23.922  69.799 19.426  1.00 83.99  ? 91   TYR A CE2 1 
ATOM 709  C CZ  . TYR A 1 94   ? 23.122  68.726 19.093  1.00 83.99  ? 91   TYR A CZ  1 
ATOM 710  O OH  . TYR A 1 94   ? 22.001  68.937 18.312  1.00 83.99  ? 91   TYR A OH  1 
ATOM 711  N N   . LYS A 1 95   ? 27.963  68.248 18.367  1.00 63.83  ? 92   LYS A N   1 
ATOM 712  C CA  . LYS A 1 95   ? 28.391  69.093 17.261  1.00 63.83  ? 92   LYS A CA  1 
ATOM 713  C C   . LYS A 1 95   ? 27.260  69.267 16.269  1.00 63.83  ? 92   LYS A C   1 
ATOM 714  O O   . LYS A 1 95   ? 26.558  68.319 15.922  1.00 63.83  ? 92   LYS A O   1 
ATOM 715  C CB  . LYS A 1 95   ? 29.653  68.519 16.594  1.00 79.19  ? 92   LYS A CB  1 
ATOM 716  C CG  . LYS A 1 95   ? 30.220  69.360 15.440  1.00 79.19  ? 92   LYS A CG  1 
ATOM 717  C CD  . LYS A 1 95   ? 31.754  69.271 15.366  1.00 79.19  ? 92   LYS A CD  1 
ATOM 718  C CE  . LYS A 1 95   ? 32.290  69.621 13.973  1.00 79.19  ? 92   LYS A CE  1 
ATOM 719  N NZ  . LYS A 1 95   ? 32.184  68.473 13.033  1.00 79.19  ? 92   LYS A NZ  1 
ATOM 720  N N   . GLN A 1 96   ? 27.073  70.497 15.837  1.00 75.55  ? 93   GLN A N   1 
ATOM 721  C CA  . GLN A 1 96   ? 26.078  70.800 14.838  1.00 75.55  ? 93   GLN A CA  1 
ATOM 722  C C   . GLN A 1 96   ? 26.695  71.569 13.665  1.00 75.55  ? 93   GLN A C   1 
ATOM 723  O O   . GLN A 1 96   ? 27.434  72.555 13.862  1.00 75.55  ? 93   GLN A O   1 
ATOM 724  C CB  . GLN A 1 96   ? 24.972  71.617 15.471  1.00 96.72  ? 93   GLN A CB  1 
ATOM 725  C CG  . GLN A 1 96   ? 23.825  71.869 14.554  1.00 96.72  ? 93   GLN A CG  1 
ATOM 726  C CD  . GLN A 1 96   ? 22.654  72.411 15.292  1.00 96.72  ? 93   GLN A CD  1 
ATOM 727  O OE1 . GLN A 1 96   ? 22.786  72.899 16.422  1.00 96.72  ? 93   GLN A OE1 1 
ATOM 728  N NE2 . GLN A 1 96   ? 21.483  72.335 14.669  1.00 96.72  ? 93   GLN A NE2 1 
ATOM 729  N N   . SER A 1 97   ? 26.402  71.112 12.454  1.00 151.23 ? 94   SER A N   1 
ATOM 730  C CA  . SER A 1 97   ? 26.814  71.823 11.259  1.00 151.23 ? 94   SER A CA  1 
ATOM 731  C C   . SER A 1 97   ? 25.652  72.687 10.784  1.00 151.23 ? 94   SER A C   1 
ATOM 732  O O   . SER A 1 97   ? 25.103  72.472 9.700   1.00 151.23 ? 94   SER A O   1 
ATOM 733  C CB  . SER A 1 97   ? 27.250  70.835 10.180  1.00 120.58 ? 94   SER A CB  1 
ATOM 734  O OG  . SER A 1 97   ? 28.304  70.008 10.649  1.00 120.58 ? 94   SER A OG  1 
ATOM 735  N N   . GLY A 1 98   ? 25.280  73.661 11.617  1.00 78.94  ? 95   GLY A N   1 
ATOM 736  C CA  . GLY A 1 98   ? 24.133  74.533 11.344  1.00 78.94  ? 95   GLY A CA  1 
ATOM 737  C C   . GLY A 1 98   ? 22.791  73.801 11.342  1.00 78.94  ? 95   GLY A C   1 
ATOM 738  O O   . GLY A 1 98   ? 22.015  73.924 12.288  1.00 78.94  ? 95   GLY A O   1 
ATOM 739  N N   . GLU A 1 99   ? 22.522  73.043 10.278  1.00 73.24  ? 96   GLU A N   1 
ATOM 740  C CA  . GLU A 1 99   ? 21.305  72.242 10.186  1.00 73.24  ? 96   GLU A CA  1 
ATOM 741  C C   . GLU A 1 99   ? 21.543  70.728 10.482  1.00 73.24  ? 96   GLU A C   1 
ATOM 742  O O   . GLU A 1 99   ? 20.595  69.984 10.756  1.00 73.24  ? 96   GLU A O   1 
ATOM 743  C CB  . GLU A 1 99   ? 20.623  72.460 8.821   1.00 138.86 ? 96   GLU A CB  1 
ATOM 744  C CG  . GLU A 1 99   ? 21.088  71.562 7.650   1.00 138.86 ? 96   GLU A CG  1 
ATOM 745  C CD  . GLU A 1 99   ? 22.601  71.522 7.445   1.00 138.86 ? 96   GLU A CD  1 
ATOM 746  O OE1 . GLU A 1 99   ? 23.285  72.537 7.697   1.00 138.86 ? 96   GLU A OE1 1 
ATOM 747  O OE2 . GLU A 1 99   ? 23.106  70.460 7.025   1.00 138.86 ? 96   GLU A OE2 1 
ATOM 748  N N   . SER A 1 100  ? 22.798  70.278 10.418  1.00 97.91  ? 97   SER A N   1 
ATOM 749  C CA  . SER A 1 100  ? 23.107  68.869 10.677  1.00 97.91  ? 97   SER A CA  1 
ATOM 750  C C   . SER A 1 100  ? 23.724  68.660 12.041  1.00 97.91  ? 97   SER A C   1 
ATOM 751  O O   . SER A 1 100  ? 24.652  69.360 12.451  1.00 97.91  ? 97   SER A O   1 
ATOM 752  C CB  . SER A 1 100  ? 23.993  68.269 9.591   1.00 85.37  ? 97   SER A CB  1 
ATOM 753  O OG  . SER A 1 100  ? 23.195  67.610 8.628   1.00 85.37  ? 97   SER A OG  1 
ATOM 754  N N   . ILE A 1 101  ? 23.188  67.679 12.741  1.00 74.31  ? 98   ILE A N   1 
ATOM 755  C CA  . ILE A 1 101  ? 23.587  67.400 14.115  1.00 74.31  ? 98   ILE A CA  1 
ATOM 756  C C   . ILE A 1 101  ? 24.364  66.100 14.138  1.00 74.31  ? 98   ILE A C   1 
ATOM 757  O O   . ILE A 1 101  ? 23.926  65.088 13.576  1.00 74.31  ? 98   ILE A O   1 
ATOM 758  C CB  . ILE A 1 101  ? 22.361  67.318 15.071  1.00 72.24  ? 98   ILE A CB  1 
ATOM 759  C CG1 . ILE A 1 101  ? 21.214  66.449 14.467  1.00 72.24  ? 98   ILE A CG1 1 
ATOM 760  C CG2 . ILE A 1 101  ? 21.892  68.714 15.482  1.00 72.24  ? 98   ILE A CG2 1 
ATOM 761  C CD1 . ILE A 1 101  ? 20.809  66.714 12.988  1.00 72.24  ? 98   ILE A CD1 1 
ATOM 762  N N   . ASP A 1 102  ? 25.536  66.156 14.757  1.00 72.08  ? 99   ASP A N   1 
ATOM 763  C CA  . ASP A 1 102  ? 26.401  64.996 14.874  1.00 72.08  ? 99   ASP A CA  1 
ATOM 764  C C   . ASP A 1 102  ? 27.065  64.911 16.244  1.00 72.08  ? 99   ASP A C   1 
ATOM 765  O O   . ASP A 1 102  ? 27.625  65.894 16.733  1.00 72.08  ? 99   ASP A O   1 
ATOM 766  C CB  . ASP A 1 102  ? 27.452  64.993 13.763  1.00 92.17  ? 99   ASP A CB  1 
ATOM 767  C CG  . ASP A 1 102  ? 27.013  64.188 12.556  1.00 92.17  ? 99   ASP A CG  1 
ATOM 768  O OD1 . ASP A 1 102  ? 27.389  62.996 12.478  1.00 92.17  ? 99   ASP A OD1 1 
ATOM 769  O OD2 . ASP A 1 102  ? 26.276  64.737 11.707  1.00 92.17  ? 99   ASP A OD2 1 
ATOM 770  N N   . ILE A 1 103  ? 26.980  63.736 16.868  1.00 73.26  ? 100  ILE A N   1 
ATOM 771  C CA  . ILE A 1 103  ? 27.679  63.492 18.120  1.00 73.26  ? 100  ILE A CA  1 
ATOM 772  C C   . ILE A 1 103  ? 29.018  62.864 17.811  1.00 73.26  ? 100  ILE A C   1 
ATOM 773  O O   . ILE A 1 103  ? 29.082  61.841 17.104  1.00 73.26  ? 100  ILE A O   1 
ATOM 774  C CB  . ILE A 1 103  ? 26.893  62.572 19.006  1.00 69.31  ? 100  ILE A CB  1 
ATOM 775  C CG1 . ILE A 1 103  ? 25.646  63.301 19.508  1.00 69.31  ? 100  ILE A CG1 1 
ATOM 776  C CG2 . ILE A 1 103  ? 27.764  62.116 20.174  1.00 69.31  ? 100  ILE A CG2 1 
ATOM 777  C CD1 . ILE A 1 103  ? 24.538  62.383 19.929  1.00 69.31  ? 100  ILE A CD1 1 
ATOM 778  N N   . ILE A 1 104  ? 30.085  63.469 18.336  1.00 60.95  ? 101  ILE A N   1 
ATOM 779  C CA  . ILE A 1 104  ? 31.447  63.138 17.909  1.00 60.95  ? 101  ILE A CA  1 
ATOM 780  C C   . ILE A 1 104  ? 32.213  62.374 18.987  1.00 60.95  ? 101  ILE A C   1 
ATOM 781  O O   . ILE A 1 104  ? 32.012  62.578 20.169  1.00 60.95  ? 101  ILE A O   1 
ATOM 782  C CB  . ILE A 1 104  ? 32.213  64.424 17.415  1.00 80.83  ? 101  ILE A CB  1 
ATOM 783  C CG1 . ILE A 1 104  ? 32.663  64.258 15.972  1.00 80.83  ? 101  ILE A CG1 1 
ATOM 784  C CG2 . ILE A 1 104  ? 33.400  64.797 18.305  1.00 80.83  ? 101  ILE A CG2 1 
ATOM 785  C CD1 . ILE A 1 104  ? 32.832  65.562 15.224  1.00 80.83  ? 101  ILE A CD1 1 
ATOM 786  N N   . THR A 1 105  ? 33.092  61.479 18.573  1.00 55.40  ? 102  THR A N   1 
ATOM 787  C CA  . THR A 1 105  ? 33.940  60.764 19.518  1.00 55.40  ? 102  THR A CA  1 
ATOM 788  C C   . THR A 1 105  ? 35.341  61.323 19.583  1.00 55.40  ? 102  THR A C   1 
ATOM 789  O O   . THR A 1 105  ? 36.152  61.103 18.674  1.00 55.40  ? 102  THR A O   1 
ATOM 790  C CB  . THR A 1 105  ? 34.059  59.363 19.108  1.00 52.36  ? 102  THR A CB  1 
ATOM 791  O OG1 . THR A 1 105  ? 32.800  58.971 18.560  1.00 52.36  ? 102  THR A OG1 1 
ATOM 792  C CG2 . THR A 1 105  ? 34.414  58.518 20.272  1.00 52.36  ? 102  THR A CG2 1 
ATOM 793  N N   . ARG A 1 106  ? 35.598  62.009 20.693  1.00 57.23  ? 103  ARG A N   1 
ATOM 794  C CA  . ARG A 1 106  ? 36.828  62.713 20.975  1.00 57.23  ? 103  ARG A CA  1 
ATOM 795  C C   . ARG A 1 106  ? 37.860  61.765 21.479  1.00 57.23  ? 103  ARG A C   1 
ATOM 796  O O   . ARG A 1 106  ? 39.063  62.042 21.375  1.00 57.23  ? 103  ARG A O   1 
ATOM 797  C CB  . ARG A 1 106  ? 36.578  63.800 22.015  1.00 49.09  ? 103  ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106  ? 35.685  64.891 21.460  1.00 49.09  ? 103  ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106  ? 36.489  65.829 20.544  1.00 49.09  ? 103  ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106  ? 36.807  67.115 21.197  1.00 49.09  ? 103  ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106  ? 37.409  67.248 22.376  1.00 49.09  ? 103  ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106  ? 37.773  66.166 23.062  1.00 49.09  ? 103  ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106  ? 37.608  68.456 22.886  1.00 49.09  ? 103  ARG A NH2 1 
ATOM 804  N N   . ALA A 1 107  ? 37.385  60.651 22.032  1.00 51.74  ? 104  ALA A N   1 
ATOM 805  C CA  . ALA A 1 107  ? 38.243  59.576 22.502  1.00 51.74  ? 104  ALA A CA  1 
ATOM 806  C C   . ALA A 1 107  ? 37.464  58.344 22.776  1.00 51.74  ? 104  ALA A C   1 
ATOM 807  O O   . ALA A 1 107  ? 36.271  58.379 22.952  1.00 51.74  ? 104  ALA A O   1 
ATOM 808  C CB  . ALA A 1 107  ? 38.902  59.962 23.731  1.00 19.72  ? 104  ALA A CB  1 
ATOM 809  N N   . HIS A 1 108  ? 38.193  57.254 22.861  1.00 50.48  ? 105  HIS A N   1 
ATOM 810  C CA  . HIS A 1 108  ? 37.648  55.961 23.189  1.00 50.48  ? 105  HIS A CA  1 
ATOM 811  C C   . HIS A 1 108  ? 38.757  54.916 23.465  1.00 50.48  ? 105  HIS A C   1 
ATOM 812  O O   . HIS A 1 108  ? 39.944  55.094 23.155  1.00 50.48  ? 105  HIS A O   1 
ATOM 813  C CB  . HIS A 1 108  ? 36.715  55.490 22.090  1.00 69.73  ? 105  HIS A CB  1 
ATOM 814  C CG  . HIS A 1 108  ? 37.414  55.182 20.817  1.00 69.73  ? 105  HIS A CG  1 
ATOM 815  N ND1 . HIS A 1 108  ? 38.216  56.100 20.175  1.00 69.73  ? 105  HIS A ND1 1 
ATOM 816  C CD2 . HIS A 1 108  ? 37.454  54.051 20.075  1.00 69.73  ? 105  HIS A CD2 1 
ATOM 817  C CE1 . HIS A 1 108  ? 38.705  55.552 19.078  1.00 69.73  ? 105  HIS A CE1 1 
ATOM 818  N NE2 . HIS A 1 108  ? 38.259  54.309 18.994  1.00 69.73  ? 105  HIS A NE2 1 
ATOM 819  N N   . GLY A 1 109  ? 38.351  53.811 24.048  1.00 48.60  ? 106  GLY A N   1 
ATOM 820  C CA  . GLY A 1 109  ? 39.279  52.806 24.427  1.00 48.60  ? 106  GLY A CA  1 
ATOM 821  C C   . GLY A 1 109  ? 38.422  51.842 25.180  1.00 48.60  ? 106  GLY A C   1 
ATOM 822  O O   . GLY A 1 109  ? 37.394  52.225 25.752  1.00 48.60  ? 106  GLY A O   1 
ATOM 823  N N   . ASN A 1 110  ? 38.811  50.580 25.170  1.00 48.26  ? 107  ASN A N   1 
ATOM 824  C CA  . ASN A 1 110  ? 38.133  49.666 26.012  1.00 48.26  ? 107  ASN A CA  1 
ATOM 825  C C   . ASN A 1 110  ? 38.897  49.522 27.294  1.00 48.26  ? 107  ASN A C   1 
ATOM 826  O O   . ASN A 1 110  ? 40.087  49.275 27.281  1.00 48.26  ? 107  ASN A O   1 
ATOM 827  C CB  . ASN A 1 110  ? 37.914  48.338 25.350  1.00 43.74  ? 107  ASN A CB  1 
ATOM 828  C CG  . ASN A 1 110  ? 36.947  47.501 26.125  1.00 43.74  ? 107  ASN A CG  1 
ATOM 829  O OD1 . ASN A 1 110  ? 37.206  47.171 27.280  1.00 43.74  ? 107  ASN A OD1 1 
ATOM 830  N ND2 . ASN A 1 110  ? 35.804  47.175 25.521  1.00 43.74  ? 107  ASN A ND2 1 
ATOM 831  N N   . VAL A 1 111  ? 38.189  49.665 28.403  1.00 46.51  ? 108  VAL A N   1 
ATOM 832  C CA  . VAL A 1 111  ? 38.823  49.596 29.716  1.00 46.51  ? 108  VAL A CA  1 
ATOM 833  C C   . VAL A 1 111  ? 38.649  48.326 30.557  1.00 46.51  ? 108  VAL A C   1 
ATOM 834  O O   . VAL A 1 111  ? 39.134  48.246 31.679  1.00 46.51  ? 108  VAL A O   1 
ATOM 835  C CB  . VAL A 1 111  ? 38.468  50.793 30.536  1.00 29.94  ? 108  VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 111  ? 38.886  52.028 29.766  1.00 29.94  ? 108  VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 111  ? 36.982  50.826 30.758  1.00 29.94  ? 108  VAL A CG2 1 
ATOM 838  N N   . GLN A 1 112  ? 38.018  47.305 30.016  1.00 53.52  ? 109  GLN A N   1 
ATOM 839  C CA  . GLN A 1 112  ? 38.037  46.053 30.732  1.00 53.52  ? 109  GLN A CA  1 
ATOM 840  C C   . GLN A 1 112  ? 39.488  45.572 30.965  1.00 53.52  ? 109  GLN A C   1 
ATOM 841  O O   . GLN A 1 112  ? 40.357  45.828 30.149  1.00 53.52  ? 109  GLN A O   1 
ATOM 842  C CB  . GLN A 1 112  ? 37.217  45.005 30.002  1.00 71.02  ? 109  GLN A CB  1 
ATOM 843  C CG  . GLN A 1 112  ? 37.649  44.773 28.614  1.00 71.02  ? 109  GLN A CG  1 
ATOM 844  C CD  . GLN A 1 112  ? 37.669  43.338 28.322  1.00 71.02  ? 109  GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 112  ? 37.431  42.933 27.193  1.00 71.02  ? 109  GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 112  ? 37.961  42.527 29.340  1.00 71.02  ? 109  GLN A NE2 1 
ATOM 847  N N   . ASP A 1 113  ? 39.735  44.921 32.097  1.00 68.57  ? 110  ASP A N   1 
ATOM 848  C CA  . ASP A 1 113  ? 41.028  44.362 32.413  1.00 68.57  ? 110  ASP A CA  1 
ATOM 849  C C   . ASP A 1 113  ? 40.813  42.873 32.385  1.00 68.57  ? 110  ASP A C   1 
ATOM 850  O O   . ASP A 1 113  ? 39.775  42.431 32.854  1.00 68.57  ? 110  ASP A O   1 
ATOM 851  C CB  . ASP A 1 113  ? 41.429  44.852 33.785  1.00 57.44  ? 110  ASP A CB  1 
ATOM 852  C CG  . ASP A 1 113  ? 41.371  46.376 33.876  1.00 57.44  ? 110  ASP A CG  1 
ATOM 853  O OD1 . ASP A 1 113  ? 41.374  46.994 32.788  1.00 57.44  ? 110  ASP A OD1 1 
ATOM 854  O OD2 . ASP A 1 113  ? 41.299  46.989 34.984  1.00 57.44  ? 110  ASP A OD2 1 
ATOM 855  N N   . ARG A 1 114  ? 41.732  42.092 31.795  1.00 75.66  ? 111  ARG A N   1 
ATOM 856  C CA  . ARG A 1 114  ? 41.585  40.612 31.744  1.00 75.66  ? 111  ARG A CA  1 
ATOM 857  C C   . ARG A 1 114  ? 41.507  40.054 33.168  1.00 75.66  ? 111  ARG A C   1 
ATOM 858  O O   . ARG A 1 114  ? 40.801  39.073 33.452  1.00 75.66  ? 111  ARG A O   1 
ATOM 859  C CB  . ARG A 1 114  ? 42.768  39.982 31.001  1.00 163.65 ? 111  ARG A CB  1 
ATOM 860  C CG  . ARG A 1 114  ? 42.622  38.488 30.680  1.00 163.65 ? 111  ARG A CG  1 
ATOM 861  C CD  . ARG A 1 114  ? 41.773  38.231 29.435  1.00 163.65 ? 111  ARG A CD  1 
ATOM 862  N NE  . ARG A 1 114  ? 42.332  38.864 28.238  1.00 163.65 ? 111  ARG A NE  1 
ATOM 863  C CZ  . ARG A 1 114  ? 41.855  39.971 27.671  1.00 163.65 ? 111  ARG A CZ  1 
ATOM 864  N NH1 . ARG A 1 114  ? 40.796  40.591 28.177  1.00 163.65 ? 111  ARG A NH1 1 
ATOM 865  N NH2 . ARG A 1 114  ? 42.443  40.461 26.591  1.00 163.65 ? 111  ARG A NH2 1 
ATOM 866  N N   . ILE A 1 115  ? 42.252  40.717 34.048  1.00 121.45 ? 112  ILE A N   1 
ATOM 867  C CA  . ILE A 1 115  ? 42.226  40.489 35.478  1.00 121.45 ? 112  ILE A CA  1 
ATOM 868  C C   . ILE A 1 115  ? 40.954  41.084 36.080  1.00 121.45 ? 112  ILE A C   1 
ATOM 869  O O   . ILE A 1 115  ? 40.214  41.788 35.403  1.00 121.45 ? 112  ILE A O   1 
ATOM 870  C CB  . ILE A 1 115  ? 43.553  41.038 36.102  1.00 66.99  ? 112  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 115  ? 44.479  39.882 36.428  1.00 66.99  ? 112  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 115  ? 43.362  41.784 37.412  1.00 66.99  ? 112  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 115  ? 44.392  38.746 35.438  1.00 66.99  ? 112  ILE A CD1 1 
ATOM 874  N N   . GLY A 1 116  ? 40.673  40.774 37.338  1.00 78.11  ? 113  GLY A N   1 
ATOM 875  C CA  . GLY A 1 116  ? 39.599  41.467 38.048  1.00 78.11  ? 113  GLY A CA  1 
ATOM 876  C C   . GLY A 1 116  ? 38.213  40.843 37.954  1.00 78.11  ? 113  GLY A C   1 
ATOM 877  O O   . GLY A 1 116  ? 37.757  40.450 36.867  1.00 78.11  ? 113  GLY A O   1 
ATOM 878  N N   . ARG A 1 117  ? 37.565  40.747 39.120  1.00 69.35  ? 114  ARG A N   1 
ATOM 879  C CA  . ARG A 1 117  ? 36.173  40.333 39.251  1.00 69.35  ? 114  ARG A CA  1 
ATOM 880  C C   . ARG A 1 117  ? 35.288  41.595 39.335  1.00 69.35  ? 114  ARG A C   1 
ATOM 881  O O   . ARG A 1 117  ? 35.627  42.536 40.067  1.00 69.35  ? 114  ARG A O   1 
ATOM 882  C CB  . ARG A 1 117  ? 36.016  39.494 40.516  1.00 110.01 ? 114  ARG A CB  1 
ATOM 883  C CG  . ARG A 1 117  ? 34.837  38.546 40.487  1.00 110.01 ? 114  ARG A CG  1 
ATOM 884  C CD  . ARG A 1 117  ? 34.845  37.614 41.691  1.00 110.01 ? 114  ARG A CD  1 
ATOM 885  N NE  . ARG A 1 117  ? 34.456  38.279 42.937  1.00 110.01 ? 114  ARG A NE  1 
ATOM 886  C CZ  . ARG A 1 117  ? 34.076  37.630 44.039  1.00 110.01 ? 114  ARG A CZ  1 
ATOM 887  N NH1 . ARG A 1 117  ? 34.035  36.301 44.052  1.00 110.01 ? 114  ARG A NH1 1 
ATOM 888  N NH2 . ARG A 1 117  ? 33.732  38.304 45.133  1.00 110.01 ? 114  ARG A NH2 1 
ATOM 889  N N   . PRO A 1 118  ? 34.145  41.619 38.618  1.00 67.00  ? 115  PRO A N   1 
ATOM 890  C CA  . PRO A 1 118  ? 33.322  42.825 38.668  1.00 67.00  ? 115  PRO A CA  1 
ATOM 891  C C   . PRO A 1 118  ? 32.596  42.880 40.000  1.00 67.00  ? 115  PRO A C   1 
ATOM 892  O O   . PRO A 1 118  ? 31.949  41.906 40.397  1.00 67.00  ? 115  PRO A O   1 
ATOM 893  C CB  . PRO A 1 118  ? 32.332  42.651 37.514  1.00 47.95  ? 115  PRO A CB  1 
ATOM 894  C CG  . PRO A 1 118  ? 32.281  41.184 37.225  1.00 47.95  ? 115  PRO A CG  1 
ATOM 895  C CD  . PRO A 1 118  ? 33.522  40.543 37.824  1.00 47.95  ? 115  PRO A CD  1 
ATOM 896  N N   . SER A 1 119  ? 32.728  44.013 40.682  1.00 58.06  ? 116  SER A N   1 
ATOM 897  C CA  . SER A 1 119  ? 32.377  44.108 42.095  1.00 58.06  ? 116  SER A CA  1 
ATOM 898  C C   . SER A 1 119  ? 30.878  44.002 42.381  1.00 58.06  ? 116  SER A C   1 
ATOM 899  O O   . SER A 1 119  ? 30.069  43.983 41.456  1.00 58.06  ? 116  SER A O   1 
ATOM 900  C CB  . SER A 1 119  ? 32.958  45.388 42.701  1.00 46.36  ? 116  SER A CB  1 
ATOM 901  O OG  . SER A 1 119  ? 32.715  46.472 41.846  1.00 46.36  ? 116  SER A OG  1 
ATOM 902  N N   . GLU A 1 120  ? 30.535  43.891 43.664  1.00 159.60 ? 117  GLU A N   1 
ATOM 903  C CA  . GLU A 1 120  ? 29.155  43.995 44.110  1.00 159.60 ? 117  GLU A CA  1 
ATOM 904  C C   . GLU A 1 120  ? 28.761  45.463 44.042  1.00 159.60 ? 117  GLU A C   1 
ATOM 905  O O   . GLU A 1 120  ? 29.515  46.332 44.490  1.00 159.60 ? 117  GLU A O   1 
ATOM 906  C CB  . GLU A 1 120  ? 29.019  43.437 45.536  1.00 116.91 ? 117  GLU A CB  1 
ATOM 907  C CG  . GLU A 1 120  ? 27.808  43.932 46.362  1.00 116.91 ? 117  GLU A CG  1 
ATOM 908  C CD  . GLU A 1 120  ? 26.471  43.321 45.940  1.00 116.91 ? 117  GLU A CD  1 
ATOM 909  O OE1 . GLU A 1 120  ? 26.257  43.119 44.721  1.00 116.91 ? 117  GLU A OE1 1 
ATOM 910  O OE2 . GLU A 1 120  ? 25.628  43.064 46.833  1.00 116.91 ? 117  GLU A OE2 1 
ATOM 911  N N   . THR A 1 121  ? 27.593  45.727 43.464  1.00 77.76  ? 118  THR A N   1 
ATOM 912  C CA  . THR A 1 121  ? 27.065  47.105 43.302  1.00 77.76  ? 118  THR A CA  1 
ATOM 913  C C   . THR A 1 121  ? 27.321  47.690 41.919  1.00 77.76  ? 118  THR A C   1 
ATOM 914  O O   . THR A 1 121  ? 26.999  48.848 41.664  1.00 77.76  ? 118  THR A O   1 
ATOM 915  C CB  . THR A 1 121  ? 27.557  48.099 44.422  1.00 105.58 ? 118  THR A CB  1 
ATOM 916  O OG1 . THR A 1 121  ? 26.744  47.921 45.599  1.00 105.58 ? 118  THR A OG1 1 
ATOM 917  C CG2 . THR A 1 121  ? 27.435  49.564 43.971  1.00 105.58 ? 118  THR A CG2 1 
ATOM 918  N N   . GLY A 1 122  ? 27.895  46.877 41.040  1.00 59.35  ? 119  GLY A N   1 
ATOM 919  C CA  . GLY A 1 122  ? 28.151  47.245 39.645  1.00 59.35  ? 119  GLY A CA  1 
ATOM 920  C C   . GLY A 1 122  ? 29.197  48.311 39.332  1.00 59.35  ? 119  GLY A C   1 
ATOM 921  O O   . GLY A 1 122  ? 29.945  48.774 40.195  1.00 59.35  ? 119  GLY A O   1 
ATOM 922  N N   . ILE A 1 123  ? 29.230  48.695 38.059  1.00 36.25  ? 120  ILE A N   1 
ATOM 923  C CA  . ILE A 1 123  ? 30.158  49.731 37.566  1.00 36.25  ? 120  ILE A CA  1 
ATOM 924  C C   . ILE A 1 123  ? 29.811  51.055 38.206  1.00 36.25  ? 120  ILE A C   1 
ATOM 925  O O   . ILE A 1 123  ? 28.654  51.286 38.540  1.00 36.25  ? 120  ILE A O   1 
ATOM 926  C CB  . ILE A 1 123  ? 30.141  49.900 36.016  1.00 32.61  ? 120  ILE A CB  1 
ATOM 927  C CG1 . ILE A 1 123  ? 30.742  48.692 35.324  1.00 32.61  ? 120  ILE A CG1 1 
ATOM 928  C CG2 . ILE A 1 123  ? 30.918  51.135 35.602  1.00 32.61  ? 120  ILE A CG2 1 
ATOM 929  C CD1 . ILE A 1 123  ? 30.100  48.363 34.044  1.00 32.61  ? 120  ILE A CD1 1 
ATOM 930  N N   . ILE A 1 124  ? 30.835  51.885 38.423  1.00 50.95  ? 121  ILE A N   1 
ATOM 931  C CA  . ILE A 1 124  ? 30.697  53.261 38.902  1.00 50.95  ? 121  ILE A CA  1 
ATOM 932  C C   . ILE A 1 124  ? 31.878  53.972 38.298  1.00 50.95  ? 121  ILE A C   1 
ATOM 933  O O   . ILE A 1 124  ? 33.018  53.568 38.506  1.00 50.95  ? 121  ILE A O   1 
ATOM 934  C CB  . ILE A 1 124  ? 30.846  53.376 40.443  1.00 50.01  ? 121  ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 124  ? 29.774  52.578 41.189  1.00 50.01  ? 121  ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 124  ? 30.882  54.845 40.907  1.00 50.01  ? 121  ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 124  ? 30.189  52.301 42.635  1.00 50.01  ? 121  ILE A CD1 1 
ATOM 938  N N   . GLY A 1 125  ? 31.612  55.008 37.531  1.00 48.84  ? 122  GLY A N   1 
ATOM 939  C CA  . GLY A 1 125  ? 32.658  55.811 36.979  1.00 48.84  ? 122  GLY A CA  1 
ATOM 940  C C   . GLY A 1 125  ? 32.499  57.119 37.669  1.00 48.84  ? 122  GLY A C   1 
ATOM 941  O O   . GLY A 1 125  ? 31.423  57.410 38.155  1.00 48.84  ? 122  GLY A O   1 
ATOM 942  N N   . ILE A 1 126  ? 33.557  57.910 37.759  1.00 42.55  ? 123  ILE A N   1 
ATOM 943  C CA  . ILE A 1 126  ? 33.398  59.268 38.282  1.00 42.55  ? 123  ILE A CA  1 
ATOM 944  C C   . ILE A 1 126  ? 34.395  60.268 37.737  1.00 42.55  ? 123  ILE A C   1 
ATOM 945  O O   . ILE A 1 126  ? 35.375  59.885 37.104  1.00 42.55  ? 123  ILE A O   1 
ATOM 946  C CB  . ILE A 1 126  ? 33.406  59.313 39.801  1.00 38.21  ? 123  ILE A CB  1 
ATOM 947  C CG1 . ILE A 1 126  ? 34.632  58.567 40.333  1.00 38.21  ? 123  ILE A CG1 1 
ATOM 948  C CG2 . ILE A 1 126  ? 32.061  58.819 40.333  1.00 38.21  ? 123  ILE A CG2 1 
ATOM 949  C CD1 . ILE A 1 126  ? 34.791  58.686 41.812  1.00 38.21  ? 123  ILE A CD1 1 
ATOM 950  N N   . ILE A 1 127  ? 34.117  61.546 37.989  1.00 52.56  ? 124  ILE A N   1 
ATOM 951  C CA  . ILE A 1 127  ? 34.921  62.635 37.457  1.00 52.56  ? 124  ILE A CA  1 
ATOM 952  C C   . ILE A 1 127  ? 35.244  63.776 38.420  1.00 52.56  ? 124  ILE A C   1 
ATOM 953  O O   . ILE A 1 127  ? 34.359  64.380 39.024  1.00 52.56  ? 124  ILE A O   1 
ATOM 954  C CB  . ILE A 1 127  ? 34.287  63.166 36.226  1.00 35.88  ? 124  ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127  ? 34.200  62.027 35.239  1.00 35.88  ? 124  ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127  ? 35.133  64.310 35.642  1.00 35.88  ? 124  ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127  ? 33.810  62.483 33.877  1.00 35.88  ? 124  ILE A CD1 1 
ATOM 958  N N   . ASP A 1 128  ? 36.535  64.063 38.555  1.00 64.22  ? 125  ASP A N   1 
ATOM 959  C CA  . ASP A 1 128  ? 36.994  65.079 39.499  1.00 64.22  ? 125  ASP A CA  1 
ATOM 960  C C   . ASP A 1 128  ? 36.501  66.462 39.045  1.00 64.22  ? 125  ASP A C   1 
ATOM 961  O O   . ASP A 1 128  ? 36.391  66.727 37.840  1.00 64.22  ? 125  ASP A O   1 
ATOM 962  C CB  . ASP A 1 128  ? 38.515  64.983 39.677  1.00 120.05 ? 125  ASP A CB  1 
ATOM 963  C CG  . ASP A 1 128  ? 39.218  66.303 39.486  1.00 120.05 ? 125  ASP A CG  1 
ATOM 964  O OD1 . ASP A 1 128  ? 39.580  66.951 40.491  1.00 120.05 ? 125  ASP A OD1 1 
ATOM 965  O OD2 . ASP A 1 128  ? 39.418  66.687 38.320  1.00 120.05 ? 125  ASP A OD2 1 
ATOM 966  N N   . PRO A 1 129  ? 36.076  67.297 40.005  1.00 60.34  ? 126  PRO A N   1 
ATOM 967  C CA  . PRO A 1 129  ? 35.698  68.698 39.828  1.00 60.34  ? 126  PRO A CA  1 
ATOM 968  C C   . PRO A 1 129  ? 36.607  69.487 38.893  1.00 60.34  ? 126  PRO A C   1 
ATOM 969  O O   . PRO A 1 129  ? 36.118  70.168 37.989  1.00 60.34  ? 126  PRO A O   1 
ATOM 970  C CB  . PRO A 1 129  ? 35.794  69.264 41.235  1.00 63.44  ? 126  PRO A CB  1 
ATOM 971  C CG  . PRO A 1 129  ? 35.849  68.078 42.175  1.00 63.44  ? 126  PRO A CG  1 
ATOM 972  C CD  . PRO A 1 129  ? 35.811  66.830 41.373  1.00 63.44  ? 126  PRO A CD  1 
ATOM 973  N N   . GLU A 1 130  ? 37.918  69.406 39.101  1.00 72.29  ? 127  GLU A N   1 
ATOM 974  C CA  . GLU A 1 130  ? 38.866  70.134 38.241  1.00 72.29  ? 127  GLU A CA  1 
ATOM 975  C C   . GLU A 1 130  ? 39.022  69.498 36.848  1.00 72.29  ? 127  GLU A C   1 
ATOM 976  O O   . GLU A 1 130  ? 39.667  70.081 35.964  1.00 72.29  ? 127  GLU A O   1 
ATOM 977  C CB  . GLU A 1 130  ? 40.232  70.242 38.917  1.00 113.18 ? 127  GLU A CB  1 
ATOM 978  C CG  . GLU A 1 130  ? 40.233  71.026 40.215  1.00 113.18 ? 127  GLU A CG  1 
ATOM 979  C CD  . GLU A 1 130  ? 41.368  70.601 41.143  1.00 113.18 ? 127  GLU A CD  1 
ATOM 980  O OE1 . GLU A 1 130  ? 42.198  71.480 41.493  1.00 113.18 ? 127  GLU A OE1 1 
ATOM 981  O OE2 . GLU A 1 130  ? 41.433  69.396 41.519  1.00 113.18 ? 127  GLU A OE2 1 
ATOM 982  N N   . CYS A 1 131  ? 38.434  68.307 36.671  1.00 53.73  ? 128  CYS A N   1 
ATOM 983  C CA  . CYS A 1 131  ? 38.509  67.535 35.428  1.00 53.73  ? 128  CYS A CA  1 
ATOM 984  C C   . CYS A 1 131  ? 39.924  67.105 35.080  1.00 53.73  ? 128  CYS A C   1 
ATOM 985  O O   . CYS A 1 131  ? 40.275  67.074 33.881  1.00 53.73  ? 128  CYS A O   1 
ATOM 986  C CB  . CYS A 1 131  ? 37.953  68.325 34.243  1.00 69.19  ? 128  CYS A CB  1 
ATOM 987  S SG  . CYS A 1 131  ? 36.230  68.128 34.027  1.00 69.19  ? 128  CYS A SG  1 
ATOM 988  N N   . ARG A 1 132  ? 40.744  66.804 36.082  1.00 121.94 ? 129  ARG A N   1 
ATOM 989  C CA  . ARG A 1 132  ? 42.069  66.272 35.805  1.00 121.94 ? 129  ARG A CA  1 
ATOM 990  C C   . ARG A 1 132  ? 41.921  64.862 35.245  1.00 121.94 ? 129  ARG A C   1 
ATOM 991  O O   . ARG A 1 132  ? 42.756  64.422 34.451  1.00 121.94 ? 129  ARG A O   1 
ATOM 992  C CB  . ARG A 1 132  ? 42.943  66.266 37.062  1.00 138.72 ? 129  ARG A CB  1 
ATOM 993  C CG  . ARG A 1 132  ? 43.583  67.612 37.418  1.00 138.72 ? 129  ARG A CG  1 
ATOM 994  C CD  . ARG A 1 132  ? 45.083  67.662 37.088  1.00 138.72 ? 129  ARG A CD  1 
ATOM 995  N NE  . ARG A 1 132  ? 45.900  66.839 37.991  1.00 138.72 ? 129  ARG A NE  1 
ATOM 996  C CZ  . ARG A 1 132  ? 46.502  67.274 39.103  1.00 138.72 ? 129  ARG A CZ  1 
ATOM 997  N NH1 . ARG A 1 132  ? 46.398  68.546 39.492  1.00 138.72 ? 129  ARG A NH1 1 
ATOM 998  N NH2 . ARG A 1 132  ? 47.216  66.424 39.835  1.00 138.72 ? 129  ARG A NH2 1 
ATOM 999  N N   . MET A 1 133  ? 40.837  64.177 35.631  1.00 100.91 ? 130  MET A N   1 
ATOM 1000 C CA  . MET A 1 133  ? 40.685  62.749 35.344  1.00 100.91 ? 130  MET A CA  1 
ATOM 1001 C C   . MET A 1 133  ? 39.292  62.131 35.450  1.00 100.91 ? 130  MET A C   1 
ATOM 1002 O O   . MET A 1 133  ? 38.307  62.791 35.766  1.00 100.91 ? 130  MET A O   1 
ATOM 1003 C CB  . MET A 1 133  ? 41.575  61.974 36.285  1.00 65.72  ? 130  MET A CB  1 
ATOM 1004 C CG  . MET A 1 133  ? 41.352  62.315 37.691  1.00 65.72  ? 130  MET A CG  1 
ATOM 1005 S SD  . MET A 1 133  ? 41.671  60.839 38.638  1.00 65.72  ? 130  MET A SD  1 
ATOM 1006 C CE  . MET A 1 133  ? 42.466  61.529 40.085  1.00 65.72  ? 130  MET A CE  1 
ATOM 1007 N N   . ILE A 1 134  ? 39.258  60.830 35.188  1.00 46.43  ? 131  ILE A N   1 
ATOM 1008 C CA  . ILE A 1 134  ? 38.102  59.991 35.357  1.00 46.43  ? 131  ILE A CA  1 
ATOM 1009 C C   . ILE A 1 134  ? 38.494  58.797 36.210  1.00 46.43  ? 131  ILE A C   1 
ATOM 1010 O O   . ILE A 1 134  ? 39.426  58.061 35.905  1.00 46.43  ? 131  ILE A O   1 
ATOM 1011 C CB  . ILE A 1 134  ? 37.624  59.457 34.011  1.00 55.00  ? 131  ILE A CB  1 
ATOM 1012 C CG1 . ILE A 1 134  ? 37.082  60.598 33.164  1.00 55.00  ? 131  ILE A CG1 1 
ATOM 1013 C CG2 . ILE A 1 134  ? 36.568  58.364 34.214  1.00 55.00  ? 131  ILE A CG2 1 
ATOM 1014 C CD1 . ILE A 1 134  ? 36.875  60.226 31.767  1.00 55.00  ? 131  ILE A CD1 1 
ATOM 1015 N N   . GLY A 1 135  ? 37.766  58.608 37.291  1.00 43.28  ? 132  GLY A N   1 
ATOM 1016 C CA  . GLY A 1 135  ? 38.003  57.477 38.148  1.00 43.28  ? 132  GLY A CA  1 
ATOM 1017 C C   . GLY A 1 135  ? 36.895  56.466 37.931  1.00 43.28  ? 132  GLY A C   1 
ATOM 1018 O O   . GLY A 1 135  ? 35.704  56.814 37.874  1.00 43.28  ? 132  GLY A O   1 
ATOM 1019 N N   . LEU A 1 136  ? 37.287  55.205 37.835  1.00 55.57  ? 133  LEU A N   1 
ATOM 1020 C CA  . LEU A 1 136  ? 36.360  54.136 37.620  1.00 55.57  ? 133  LEU A CA  1 
ATOM 1021 C C   . LEU A 1 136  ? 36.543  53.062 38.666  1.00 55.57  ? 133  LEU A C   1 
ATOM 1022 O O   . LEU A 1 136  ? 37.640  52.848 39.174  1.00 55.57  ? 133  LEU A O   1 
ATOM 1023 C CB  . LEU A 1 136  ? 36.670  53.538 36.276  1.00 47.34  ? 133  LEU A CB  1 
ATOM 1024 C CG  . LEU A 1 136  ? 35.797  53.813 35.076  1.00 47.34  ? 133  LEU A CG  1 
ATOM 1025 C CD1 . LEU A 1 136  ? 35.313  55.237 35.002  1.00 47.34  ? 133  LEU A CD1 1 
ATOM 1026 C CD2 . LEU A 1 136  ? 36.700  53.482 33.919  1.00 47.34  ? 133  LEU A CD2 1 
ATOM 1027 N N   . ARG A 1 137  ? 35.461  52.372 38.972  1.00 54.67  ? 134  ARG A N   1 
ATOM 1028 C CA  . ARG A 1 137  ? 35.550  51.173 39.763  1.00 54.67  ? 134  ARG A CA  1 
ATOM 1029 C C   . ARG A 1 137  ? 34.746  50.098 39.080  1.00 54.67  ? 134  ARG A C   1 
ATOM 1030 O O   . ARG A 1 137  ? 33.511  50.163 39.070  1.00 54.67  ? 134  ARG A O   1 
ATOM 1031 C CB  . ARG A 1 137  ? 35.022  51.405 41.166  1.00 50.14  ? 134  ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 137  ? 35.357  50.281 42.130  1.00 50.14  ? 134  ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 137  ? 34.621  49.002 41.760  1.00 50.14  ? 134  ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 137  ? 33.183  49.174 41.819  1.00 50.14  ? 134  ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 137  ? 32.417  48.871 42.860  1.00 50.14  ? 134  ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 137  ? 32.923  48.323 43.962  1.00 50.14  ? 134  ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 137  ? 31.122  49.095 42.778  1.00 50.14  ? 134  ARG A NH2 1 
ATOM 1038 N N   . LEU A 1 138  ? 35.465  49.130 38.510  1.00 54.47  ? 135  LEU A N   1 
ATOM 1039 C CA  . LEU A 1 138  ? 34.897  48.036 37.751  1.00 54.47  ? 135  LEU A CA  1 
ATOM 1040 C C   . LEU A 1 138  ? 35.118  46.734 38.462  1.00 54.47  ? 135  LEU A C   1 
ATOM 1041 O O   . LEU A 1 138  ? 34.331  45.817 38.392  1.00 54.47  ? 135  LEU A O   1 
ATOM 1042 C CB  . LEU A 1 138  ? 35.626  47.906 36.438  1.00 45.05  ? 135  LEU A CB  1 
ATOM 1043 C CG  . LEU A 1 138  ? 35.595  49.002 35.402  1.00 45.05  ? 135  LEU A CG  1 
ATOM 1044 C CD1 . LEU A 1 138  ? 34.188  49.153 34.771  1.00 45.05  ? 135  LEU A CD1 1 
ATOM 1045 C CD2 . LEU A 1 138  ? 35.998  50.306 36.012  1.00 45.05  ? 135  LEU A CD2 1 
ATOM 1046 N N   . TYR A 1 139  ? 36.254  46.634 39.114  1.00 61.13  ? 136  TYR A N   1 
ATOM 1047 C CA  . TYR A 1 139  ? 36.681  45.359 39.613  1.00 61.13  ? 136  TYR A CA  1 
ATOM 1048 C C   . TYR A 1 139  ? 36.925  45.554 41.055  1.00 61.13  ? 136  TYR A C   1 
ATOM 1049 O O   . TYR A 1 139  ? 37.261  46.649 41.476  1.00 61.13  ? 136  TYR A O   1 
ATOM 1050 C CB  . TYR A 1 139  ? 37.942  44.900 38.865  1.00 52.86  ? 136  TYR A CB  1 
ATOM 1051 C CG  . TYR A 1 139  ? 37.679  44.751 37.393  1.00 52.86  ? 136  TYR A CG  1 
ATOM 1052 C CD1 . TYR A 1 139  ? 38.203  45.639 36.461  1.00 52.86  ? 136  TYR A CD1 1 
ATOM 1053 C CD2 . TYR A 1 139  ? 36.836  43.747 36.938  1.00 52.86  ? 136  TYR A CD2 1 
ATOM 1054 C CE1 . TYR A 1 139  ? 37.907  45.487 35.093  1.00 52.86  ? 136  TYR A CE1 1 
ATOM 1055 C CE2 . TYR A 1 139  ? 36.545  43.592 35.606  1.00 52.86  ? 136  TYR A CE2 1 
ATOM 1056 C CZ  . TYR A 1 139  ? 37.079  44.450 34.695  1.00 52.86  ? 136  TYR A CZ  1 
ATOM 1057 O OH  . TYR A 1 139  ? 36.744  44.217 33.393  1.00 52.86  ? 136  TYR A OH  1 
ATOM 1058 N N   . ASP A 1 140  ? 36.694  44.498 41.817  1.00 45.03  ? 137  ASP A N   1 
ATOM 1059 C CA  . ASP A 1 140  ? 37.054  44.493 43.231  1.00 45.03  ? 137  ASP A CA  1 
ATOM 1060 C C   . ASP A 1 140  ? 38.560  44.607 43.364  1.00 45.03  ? 137  ASP A C   1 
ATOM 1061 O O   . ASP A 1 140  ? 39.293  44.031 42.568  1.00 45.03  ? 137  ASP A O   1 
ATOM 1062 C CB  . ASP A 1 140  ? 36.508  43.250 43.930  1.00 62.93  ? 137  ASP A CB  1 
ATOM 1063 C CG  . ASP A 1 140  ? 35.015  43.354 44.204  1.00 62.93  ? 137  ASP A CG  1 
ATOM 1064 O OD1 . ASP A 1 140  ? 34.594  44.441 44.677  1.00 62.93  ? 137  ASP A OD1 1 
ATOM 1065 O OD2 . ASP A 1 140  ? 34.266  42.376 43.924  1.00 62.93  ? 137  ASP A OD2 1 
ATOM 1066 N N   . GLY A 1 141  ? 39.002  45.419 44.311  1.00 61.78  ? 138  GLY A N   1 
ATOM 1067 C CA  . GLY A 1 141  ? 40.407  45.614 44.534  1.00 61.78  ? 138  GLY A CA  1 
ATOM 1068 C C   . GLY A 1 141  ? 41.049  46.651 43.651  1.00 61.78  ? 138  GLY A C   1 
ATOM 1069 O O   . GLY A 1 141  ? 42.069  47.201 44.013  1.00 61.78  ? 138  GLY A O   1 
ATOM 1070 N N   . LEU A 1 142  ? 40.478  46.918 42.487  1.00 47.74  ? 139  LEU A N   1 
ATOM 1071 C CA  . LEU A 1 142  ? 41.136  47.820 41.535  1.00 47.74  ? 139  LEU A CA  1 
ATOM 1072 C C   . LEU A 1 142  ? 40.392  49.096 41.368  1.00 47.74  ? 139  LEU A C   1 
ATOM 1073 O O   . LEU A 1 142  ? 39.178  49.105 41.318  1.00 47.74  ? 139  LEU A O   1 
ATOM 1074 C CB  . LEU A 1 142  ? 41.290  47.191 40.140  1.00 41.54  ? 139  LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 142  ? 41.988  45.849 40.062  1.00 41.54  ? 139  LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 142  ? 41.984  45.320 38.669  1.00 41.54  ? 139  LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 142  ? 43.416  46.040 40.599  1.00 41.54  ? 139  LEU A CD2 1 
ATOM 1078 N N   . PHE A 1 143  ? 41.120  50.181 41.253  1.00 54.30  ? 140  PHE A N   1 
ATOM 1079 C CA  . PHE A 1 143  ? 40.496  51.404 40.890  1.00 54.30  ? 140  PHE A CA  1 
ATOM 1080 C C   . PHE A 1 143  ? 41.258  51.850 39.659  1.00 54.30  ? 140  PHE A C   1 
ATOM 1081 O O   . PHE A 1 143  ? 42.493  51.826 39.647  1.00 54.30  ? 140  PHE A O   1 
ATOM 1082 C CB  . PHE A 1 143  ? 40.618  52.394 42.033  1.00 51.55  ? 140  PHE A CB  1 
ATOM 1083 C CG  . PHE A 1 143  ? 39.945  53.706 41.772  1.00 51.55  ? 140  PHE A CG  1 
ATOM 1084 C CD1 . PHE A 1 143  ? 38.567  53.815 41.830  1.00 51.55  ? 140  PHE A CD1 1 
ATOM 1085 C CD2 . PHE A 1 143  ? 40.701  54.843 41.471  1.00 51.55  ? 140  PHE A CD2 1 
ATOM 1086 C CE1 . PHE A 1 143  ? 37.957  55.032 41.576  1.00 51.55  ? 140  PHE A CE1 1 
ATOM 1087 C CE2 . PHE A 1 143  ? 40.104  56.068 41.218  1.00 51.55  ? 140  PHE A CE2 1 
ATOM 1088 C CZ  . PHE A 1 143  ? 38.729  56.160 41.268  1.00 51.55  ? 140  PHE A CZ  1 
ATOM 1089 N N   . LYS A 1 144  ? 40.527  52.242 38.615  1.00 45.48  ? 141  LYS A N   1 
ATOM 1090 C CA  . LYS A 1 144  ? 41.115  52.507 37.295  1.00 45.48  ? 141  LYS A CA  1 
ATOM 1091 C C   . LYS A 1 144  ? 41.154  54.016 37.075  1.00 45.48  ? 141  LYS A C   1 
ATOM 1092 O O   . LYS A 1 144  ? 40.158  54.707 37.285  1.00 45.48  ? 141  LYS A O   1 
ATOM 1093 C CB  . LYS A 1 144  ? 40.300  51.758 36.220  1.00 40.89  ? 141  LYS A CB  1 
ATOM 1094 C CG  . LYS A 1 144  ? 40.620  52.124 34.794  1.00 40.89  ? 141  LYS A CG  1 
ATOM 1095 C CD  . LYS A 1 144  ? 41.723  51.281 34.178  1.00 40.89  ? 141  LYS A CD  1 
ATOM 1096 C CE  . LYS A 1 144  ? 41.302  49.816 34.002  1.00 40.89  ? 141  LYS A CE  1 
ATOM 1097 N NZ  . LYS A 1 144  ? 40.778  49.610 32.669  1.00 40.89  ? 141  LYS A NZ  1 
ATOM 1098 N N   . VAL A 1 145  ? 42.306  54.543 36.687  1.00 56.68  ? 142  VAL A N   1 
ATOM 1099 C CA  . VAL A 1 145  ? 42.427  55.984 36.514  1.00 56.68  ? 142  VAL A CA  1 
ATOM 1100 C C   . VAL A 1 145  ? 42.778  56.330 35.087  1.00 56.68  ? 142  VAL A C   1 
ATOM 1101 O O   . VAL A 1 145  ? 43.614  55.702 34.465  1.00 56.68  ? 142  VAL A O   1 
ATOM 1102 C CB  . VAL A 1 145  ? 43.431  56.618 37.511  1.00 50.91  ? 142  VAL A CB  1 
ATOM 1103 C CG1 . VAL A 1 145  ? 43.722  58.070 37.162  1.00 50.91  ? 142  VAL A CG1 1 
ATOM 1104 C CG2 . VAL A 1 145  ? 42.880  56.542 38.897  1.00 50.91  ? 142  VAL A CG2 1 
ATOM 1105 N N   . ILE A 1 146  ? 42.108  57.351 34.591  1.00 43.47  ? 143  ILE A N   1 
ATOM 1106 C CA  . ILE A 1 146  ? 42.221  57.774 33.235  1.00 43.47  ? 143  ILE A CA  1 
ATOM 1107 C C   . ILE A 1 146  ? 42.473  59.250 33.355  1.00 43.47  ? 143  ILE A C   1 
ATOM 1108 O O   . ILE A 1 146  ? 41.536  60.005 33.616  1.00 43.47  ? 143  ILE A O   1 
ATOM 1109 C CB  . ILE A 1 146  ? 40.897  57.641 32.524  1.00 43.63  ? 143  ILE A CB  1 
ATOM 1110 C CG1 . ILE A 1 146  ? 40.524  56.159 32.359  1.00 43.63  ? 143  ILE A CG1 1 
ATOM 1111 C CG2 . ILE A 1 146  ? 40.914  58.479 31.222  1.00 43.63  ? 143  ILE A CG2 1 
ATOM 1112 C CD1 . ILE A 1 146  ? 39.119  55.873 31.804  1.00 43.63  ? 143  ILE A CD1 1 
ATOM 1113 N N   . PRO A 1 147  ? 43.731  59.679 33.164  1.00 61.25  ? 144  PRO A N   1 
ATOM 1114 C CA  . PRO A 1 147  ? 44.044  61.079 33.098  1.00 61.25  ? 144  PRO A CA  1 
ATOM 1115 C C   . PRO A 1 147  ? 43.277  61.697 31.942  1.00 61.25  ? 144  PRO A C   1 
ATOM 1116 O O   . PRO A 1 147  ? 43.029  61.025 30.945  1.00 61.25  ? 144  PRO A O   1 
ATOM 1117 C CB  . PRO A 1 147  ? 45.531  61.075 32.771  1.00 81.39  ? 144  PRO A CB  1 
ATOM 1118 C CG  . PRO A 1 147  ? 45.778  59.765 32.146  1.00 81.39  ? 144  PRO A CG  1 
ATOM 1119 C CD  . PRO A 1 147  ? 44.931  58.858 32.954  1.00 81.39  ? 144  PRO A CD  1 
ATOM 1120 N N   . LEU A 1 148  ? 42.892  62.956 32.076  1.00 73.95  ? 145  LEU A N   1 
ATOM 1121 C CA  . LEU A 1 148  ? 42.331  63.675 30.951  1.00 73.95  ? 145  LEU A CA  1 
ATOM 1122 C C   . LEU A 1 148  ? 43.347  64.704 30.466  1.00 73.95  ? 145  LEU A C   1 
ATOM 1123 O O   . LEU A 1 148  ? 43.789  65.562 31.236  1.00 73.95  ? 145  LEU A O   1 
ATOM 1124 C CB  . LEU A 1 148  ? 41.000  64.313 31.337  1.00 68.04  ? 145  LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 148  ? 39.866  63.294 31.515  1.00 68.04  ? 145  LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 148  ? 38.891  63.776 32.562  1.00 68.04  ? 145  LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 148  ? 39.145  62.974 30.202  1.00 68.04  ? 145  LEU A CD2 1 
ATOM 1128 N N   . ASP A 1 149  ? 43.755  64.563 29.207  1.00 112.33 ? 146  ASP A N   1 
ATOM 1129 C CA  . ASP A 1 149  ? 44.779  65.403 28.587  1.00 112.33 ? 146  ASP A CA  1 
ATOM 1130 C C   . ASP A 1 149  ? 44.408  65.516 27.136  1.00 112.33 ? 146  ASP A C   1 
ATOM 1131 O O   . ASP A 1 149  ? 43.869  64.572 26.564  1.00 112.33 ? 146  ASP A O   1 
ATOM 1132 C CB  . ASP A 1 149  ? 46.163  64.747 28.640  1.00 114.96 ? 146  ASP A CB  1 
ATOM 1133 C CG  . ASP A 1 149  ? 46.557  64.288 30.029  1.00 114.96 ? 146  ASP A CG  1 
ATOM 1134 O OD1 . ASP A 1 149  ? 46.762  63.068 30.197  1.00 114.96 ? 146  ASP A OD1 1 
ATOM 1135 O OD2 . ASP A 1 149  ? 46.681  65.136 30.941  1.00 114.96 ? 146  ASP A OD2 1 
ATOM 1136 N N   . ARG A 1 150  ? 44.724  66.655 26.530  1.00 84.17  ? 147  ARG A N   1 
ATOM 1137 C CA  . ARG A 1 150  ? 44.401  66.886 25.133  1.00 84.17  ? 147  ARG A CA  1 
ATOM 1138 C C   . ARG A 1 150  ? 44.588  65.611 24.345  1.00 84.17  ? 147  ARG A C   1 
ATOM 1139 O O   . ARG A 1 150  ? 43.712  65.216 23.591  1.00 84.17  ? 147  ARG A O   1 
ATOM 1140 C CB  . ARG A 1 150  ? 45.258  68.014 24.566  1.00 174.08 ? 147  ARG A CB  1 
ATOM 1141 C CG  . ARG A 1 150  ? 44.603  69.377 24.660  1.00 174.08 ? 147  ARG A CG  1 
ATOM 1142 C CD  . ARG A 1 150  ? 43.451  69.472 23.667  1.00 174.08 ? 147  ARG A CD  1 
ATOM 1143 N NE  . ARG A 1 150  ? 43.520  70.688 22.863  1.00 174.08 ? 147  ARG A NE  1 
ATOM 1144 C CZ  . ARG A 1 150  ? 44.443  70.928 21.930  1.00 174.08 ? 147  ARG A CZ  1 
ATOM 1145 N NH1 . ARG A 1 150  ? 45.403  70.042 21.678  1.00 174.08 ? 147  ARG A NH1 1 
ATOM 1146 N NH2 . ARG A 1 150  ? 44.414  72.066 21.253  1.00 174.08 ? 147  ARG A NH2 1 
ATOM 1147 N N   . ASP A 1 151  ? 45.726  64.959 24.566  1.00 180.69 ? 148  ASP A N   1 
ATOM 1148 C CA  . ASP A 1 151  ? 46.037  63.646 24.017  1.00 180.69 ? 148  ASP A CA  1 
ATOM 1149 C C   . ASP A 1 151  ? 45.103  62.570 24.576  1.00 180.69 ? 148  ASP A C   1 
ATOM 1150 O O   . ASP A 1 151  ? 43.888  62.720 24.519  1.00 180.69 ? 148  ASP A O   1 
ATOM 1151 C CB  . ASP A 1 151  ? 47.498  63.315 24.318  1.00 180.08 ? 148  ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 151  ? 47.998  63.983 25.593  1.00 180.08 ? 148  ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 151  ? 47.886  65.225 25.706  1.00 180.08 ? 148  ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 151  ? 48.508  63.270 26.482  1.00 180.08 ? 148  ASP A OD2 1 
ATOM 1155 N N   . ASN A 1 152  ? 45.671  61.490 25.107  1.00 94.39  ? 149  ASN A N   1 
ATOM 1156 C CA  . ASN A 1 152  ? 44.905  60.363 25.674  1.00 94.39  ? 149  ASN A CA  1 
ATOM 1157 C C   . ASN A 1 152  ? 43.575  60.044 24.962  1.00 94.39  ? 149  ASN A C   1 
ATOM 1158 O O   . ASN A 1 152  ? 42.570  59.713 25.581  1.00 94.39  ? 149  ASN A O   1 
ATOM 1159 C CB  . ASN A 1 152  ? 44.678  60.587 27.163  1.00 77.31  ? 149  ASN A CB  1 
ATOM 1160 C CG  . ASN A 1 152  ? 44.434  59.289 27.922  1.00 77.31  ? 149  ASN A CG  1 
ATOM 1161 O OD1 . ASN A 1 152  ? 44.460  58.203 27.345  1.00 77.31  ? 149  ASN A OD1 1 
ATOM 1162 N ND2 . ASN A 1 152  ? 44.207  59.400 29.228  1.00 77.31  ? 149  ASN A ND2 1 
ATOM 1163 N N   . LYS A 1 153  ? 43.604  60.142 23.641  1.00 54.78  ? 150  LYS A N   1 
ATOM 1164 C CA  . LYS A 1 153  ? 42.442  59.977 22.788  1.00 54.78  ? 150  LYS A CA  1 
ATOM 1165 C C   . LYS A 1 153  ? 41.988  58.540 22.810  1.00 54.78  ? 150  LYS A C   1 
ATOM 1166 O O   . LYS A 1 153  ? 40.921  58.184 22.295  1.00 54.78  ? 150  LYS A O   1 
ATOM 1167 C CB  . LYS A 1 153  ? 42.795  60.361 21.348  1.00 90.90  ? 150  LYS A CB  1 
ATOM 1168 C CG  . LYS A 1 153  ? 42.802  61.844 21.101  1.00 90.90  ? 150  LYS A CG  1 
ATOM 1169 C CD  . LYS A 1 153  ? 42.527  62.160 19.651  1.00 90.90  ? 150  LYS A CD  1 
ATOM 1170 C CE  . LYS A 1 153  ? 41.962  63.564 19.522  1.00 90.90  ? 150  LYS A CE  1 
ATOM 1171 N NZ  . LYS A 1 153  ? 42.879  64.601 20.093  1.00 90.90  ? 150  LYS A NZ  1 
ATOM 1172 N N   . GLU A 1 154  ? 42.845  57.724 23.396  1.00 59.49  ? 151  GLU A N   1 
ATOM 1173 C CA  . GLU A 1 154  ? 42.637  56.306 23.460  1.00 59.49  ? 151  GLU A CA  1 
ATOM 1174 C C   . GLU A 1 154  ? 42.265  55.956 24.893  1.00 59.49  ? 151  GLU A C   1 
ATOM 1175 O O   . GLU A 1 154  ? 42.122  54.778 25.227  1.00 59.49  ? 151  GLU A O   1 
ATOM 1176 C CB  . GLU A 1 154  ? 43.895  55.569 22.998  1.00 89.02  ? 151  GLU A CB  1 
ATOM 1177 C CG  . GLU A 1 154  ? 44.409  56.067 21.653  1.00 89.02  ? 151  GLU A CG  1 
ATOM 1178 C CD  . GLU A 1 154  ? 45.475  55.165 21.055  1.00 89.02  ? 151  GLU A CD  1 
ATOM 1179 O OE1 . GLU A 1 154  ? 45.311  54.750 19.869  1.00 89.02  ? 151  GLU A OE1 1 
ATOM 1180 O OE2 . GLU A 1 154  ? 46.469  54.869 21.770  1.00 89.02  ? 151  GLU A OE2 1 
ATOM 1181 N N   . LEU A 1 155  ? 42.104  56.979 25.728  1.00 61.31  ? 152  LEU A N   1 
ATOM 1182 C CA  . LEU A 1 155  ? 41.608  56.813 27.099  1.00 61.31  ? 152  LEU A CA  1 
ATOM 1183 C C   . LEU A 1 155  ? 42.348  55.741 27.833  1.00 61.31  ? 152  LEU A C   1 
ATOM 1184 O O   . LEU A 1 155  ? 41.763  54.942 28.545  1.00 61.31  ? 152  LEU A O   1 
ATOM 1185 C CB  . LEU A 1 155  ? 40.115  56.497 27.107  1.00 51.12  ? 152  LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 155  ? 39.242  57.626 26.594  1.00 51.12  ? 152  LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 155  ? 37.934  57.034 26.235  1.00 51.12  ? 152  LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 155  ? 39.085  58.649 27.682  1.00 51.12  ? 152  LEU A CD2 1 
ATOM 1189 N N   . LYS A 1 156  ? 43.654  55.714 27.640  1.00 56.30  ? 153  LYS A N   1 
ATOM 1190 C CA  . LYS A 1 156  ? 44.467  54.644 28.209  1.00 56.30  ? 153  LYS A CA  1 
ATOM 1191 C C   . LYS A 1 156  ? 44.463  54.850 29.712  1.00 56.30  ? 153  LYS A C   1 
ATOM 1192 O O   . LYS A 1 156  ? 44.322  55.963 30.159  1.00 56.30  ? 153  LYS A O   1 
ATOM 1193 C CB  . LYS A 1 156  ? 45.877  54.646 27.591  1.00 81.37  ? 153  LYS A CB  1 
ATOM 1194 C CG  . LYS A 1 156  ? 45.905  54.361 26.071  1.00 81.37  ? 153  LYS A CG  1 
ATOM 1195 C CD  . LYS A 1 156  ? 45.695  52.874 25.716  1.00 81.37  ? 153  LYS A CD  1 
ATOM 1196 C CE  . LYS A 1 156  ? 45.943  52.612 24.222  1.00 81.37  ? 153  LYS A CE  1 
ATOM 1197 N NZ  . LYS A 1 156  ? 46.329  51.201 23.956  1.00 81.37  ? 153  LYS A NZ  1 
ATOM 1198 N N   . ALA A 1 157  ? 44.579  53.794 30.498  1.00 68.09  ? 154  ALA A N   1 
ATOM 1199 C CA  . ALA A 1 157  ? 44.384  53.960 31.930  1.00 68.09  ? 154  ALA A CA  1 
ATOM 1200 C C   . ALA A 1 157  ? 45.190  53.014 32.772  1.00 68.09  ? 154  ALA A C   1 
ATOM 1201 O O   . ALA A 1 157  ? 45.190  51.805 32.519  1.00 68.09  ? 154  ALA A O   1 
ATOM 1202 C CB  . ALA A 1 157  ? 42.931  53.766 32.256  1.00 46.14  ? 154  ALA A CB  1 
ATOM 1203 N N   . PHE A 1 158  ? 45.832  53.532 33.808  1.00 68.11  ? 155  PHE A N   1 
ATOM 1204 C CA  . PHE A 1 158  ? 46.400  52.615 34.795  1.00 68.11  ? 155  PHE A CA  1 
ATOM 1205 C C   . PHE A 1 158  ? 45.375  52.248 35.885  1.00 68.11  ? 155  PHE A C   1 
ATOM 1206 O O   . PHE A 1 158  ? 44.392  52.975 36.086  1.00 68.11  ? 155  PHE A O   1 
ATOM 1207 C CB  . PHE A 1 158  ? 47.712  53.137 35.394  1.00 68.29  ? 155  PHE A CB  1 
ATOM 1208 C CG  . PHE A 1 158  ? 47.556  54.385 36.182  1.00 68.29  ? 155  PHE A CG  1 
ATOM 1209 C CD1 . PHE A 1 158  ? 47.579  54.341 37.571  1.00 68.29  ? 155  PHE A CD1 1 
ATOM 1210 C CD2 . PHE A 1 158  ? 47.381  55.612 35.535  1.00 68.29  ? 155  PHE A CD2 1 
ATOM 1211 C CE1 . PHE A 1 158  ? 47.440  55.504 38.313  1.00 68.29  ? 155  PHE A CE1 1 
ATOM 1212 C CE2 . PHE A 1 158  ? 47.231  56.779 36.259  1.00 68.29  ? 155  PHE A CE2 1 
ATOM 1213 C CZ  . PHE A 1 158  ? 47.270  56.729 37.662  1.00 68.29  ? 155  PHE A CZ  1 
ATOM 1214 N N   . ASN A 1 159  ? 45.604  51.094 36.529  1.00 54.87  ? 156  ASN A N   1 
ATOM 1215 C CA  . ASN A 1 159  ? 44.919  50.678 37.745  1.00 54.87  ? 156  ASN A CA  1 
ATOM 1216 C C   . ASN A 1 159  ? 45.766  51.084 38.943  1.00 54.87  ? 156  ASN A C   1 
ATOM 1217 O O   . ASN A 1 159  ? 46.955  51.328 38.809  1.00 54.87  ? 156  ASN A O   1 
ATOM 1218 C CB  . ASN A 1 159  ? 44.730  49.167 37.789  1.00 77.48  ? 156  ASN A CB  1 
ATOM 1219 C CG  . ASN A 1 159  ? 43.867  48.652 36.681  1.00 77.48  ? 156  ASN A CG  1 
ATOM 1220 O OD1 . ASN A 1 159  ? 42.845  49.230 36.339  1.00 77.48  ? 156  ASN A OD1 1 
ATOM 1221 N ND2 . ASN A 1 159  ? 44.267  47.526 36.122  1.00 77.48  ? 156  ASN A ND2 1 
ATOM 1222 N N   . ILE A 1 160  ? 45.137  51.155 40.111  1.00 73.48  ? 157  ILE A N   1 
ATOM 1223 C CA  . ILE A 1 160  ? 45.827  51.269 41.373  1.00 73.48  ? 157  ILE A CA  1 
ATOM 1224 C C   . ILE A 1 160  ? 45.242  50.226 42.300  1.00 73.48  ? 157  ILE A C   1 
ATOM 1225 O O   . ILE A 1 160  ? 44.037  49.957 42.236  1.00 73.48  ? 157  ILE A O   1 
ATOM 1226 C CB  . ILE A 1 160  ? 45.553  52.592 41.974  1.00 43.49  ? 157  ILE A CB  1 
ATOM 1227 C CG1 . ILE A 1 160  ? 45.797  53.693 40.919  1.00 43.49  ? 157  ILE A CG1 1 
ATOM 1228 C CG2 . ILE A 1 160  ? 46.352  52.731 43.274  1.00 43.49  ? 157  ILE A CG2 1 
ATOM 1229 C CD1 . ILE A 1 160  ? 45.410  55.104 41.356  1.00 43.49  ? 157  ILE A CD1 1 
ATOM 1230 N N   . ARG A 1 161  ? 46.065  49.623 43.154  1.00 79.61  ? 158  ARG A N   1 
ATOM 1231 C CA  . ARG A 1 161  ? 45.534  48.591 44.028  1.00 79.61  ? 158  ARG A CA  1 
ATOM 1232 C C   . ARG A 1 161  ? 44.734  49.250 45.146  1.00 79.61  ? 158  ARG A C   1 
ATOM 1233 O O   . ARG A 1 161  ? 45.024  50.377 45.527  1.00 79.61  ? 158  ARG A O   1 
ATOM 1234 C CB  . ARG A 1 161  ? 46.626  47.686 44.574  1.00 114.99 ? 158  ARG A CB  1 
ATOM 1235 C CG  . ARG A 1 161  ? 46.109  46.289 44.851  1.00 114.99 ? 158  ARG A CG  1 
ATOM 1236 C CD  . ARG A 1 161  ? 46.578  45.779 46.200  1.00 114.99 ? 158  ARG A CD  1 
ATOM 1237 N NE  . ARG A 1 161  ? 47.923  45.217 46.137  1.00 114.99 ? 158  ARG A NE  1 
ATOM 1238 C CZ  . ARG A 1 161  ? 48.607  44.792 47.193  1.00 114.99 ? 158  ARG A CZ  1 
ATOM 1239 N NH1 . ARG A 1 161  ? 48.074  44.876 48.402  1.00 114.99 ? 158  ARG A NH1 1 
ATOM 1240 N NH2 . ARG A 1 161  ? 49.826  44.288 47.037  1.00 114.99 ? 158  ARG A NH2 1 
ATOM 1241 N N   . LEU A 1 162  ? 43.713  48.550 45.639  1.00 52.88  ? 159  LEU A N   1 
ATOM 1242 C CA  . LEU A 1 162  ? 42.767  49.087 46.623  1.00 52.88  ? 159  LEU A CA  1 
ATOM 1243 C C   . LEU A 1 162  ? 42.498  48.043 47.692  1.00 52.88  ? 159  LEU A C   1 
ATOM 1244 O O   . LEU A 1 162  ? 41.775  47.085 47.465  1.00 52.88  ? 159  LEU A O   1 
ATOM 1245 C CB  . LEU A 1 162  ? 41.446  49.446 45.946  1.00 57.40  ? 159  LEU A CB  1 
ATOM 1246 C CG  . LEU A 1 162  ? 40.611  50.659 46.384  1.00 57.40  ? 159  LEU A CG  1 
ATOM 1247 C CD1 . LEU A 1 162  ? 39.517  50.931 45.352  1.00 57.40  ? 159  LEU A CD1 1 
ATOM 1248 C CD2 . LEU A 1 162  ? 39.983  50.432 47.764  1.00 57.40  ? 159  LEU A CD2 1 
ATOM 1249 N N   . GLU A 1 163  ? 43.077  48.257 48.869  1.00 56.65  ? 160  GLU A N   1 
ATOM 1250 C CA  . GLU A 1 163  ? 42.981  47.311 49.955  1.00 56.65  ? 160  GLU A CA  1 
ATOM 1251 C C   . GLU A 1 163  ? 41.513  46.928 50.149  1.00 56.65  ? 160  GLU A C   1 
ATOM 1252 O O   . GLU A 1 163  ? 41.177  45.743 50.297  1.00 56.65  ? 160  GLU A O   1 
ATOM 1253 C CB  . GLU A 1 163  ? 43.578  47.920 51.228  1.00 143.63 ? 160  GLU A CB  1 
ATOM 1254 C CG  . GLU A 1 163  ? 44.365  46.941 52.077  1.00 143.63 ? 160  GLU A CG  1 
ATOM 1255 C CD  . GLU A 1 163  ? 43.491  45.822 52.621  1.00 143.63 ? 160  GLU A CD  1 
ATOM 1256 O OE1 . GLU A 1 163  ? 42.840  46.024 53.683  1.00 143.63 ? 160  GLU A OE1 1 
ATOM 1257 O OE2 . GLU A 1 163  ? 43.454  44.736 51.975  1.00 143.63 ? 160  GLU A OE2 1 
ATOM 1258 N N   . GLU A 1 164  ? 40.637  47.935 50.096  1.00 58.05  ? 161  GLU A N   1 
ATOM 1259 C CA  . GLU A 1 164  ? 39.188  47.734 50.259  1.00 58.05  ? 161  GLU A CA  1 
ATOM 1260 C C   . GLU A 1 164  ? 38.563  46.993 49.080  1.00 58.05  ? 161  GLU A C   1 
ATOM 1261 O O   . GLU A 1 164  ? 38.299  47.566 48.014  1.00 58.05  ? 161  GLU A O   1 
ATOM 1262 C CB  . GLU A 1 164  ? 38.491  49.048 50.531  1.00 73.94  ? 161  GLU A CB  1 
ATOM 1263 C CG  . GLU A 1 164  ? 38.843  49.580 51.878  1.00 73.94  ? 161  GLU A CG  1 
ATOM 1264 C CD  . GLU A 1 164  ? 40.301  49.938 52.010  1.00 73.94  ? 161  GLU A CD  1 
ATOM 1265 O OE1 . GLU A 1 164  ? 40.792  50.708 51.156  1.00 73.94  ? 161  GLU A OE1 1 
ATOM 1266 O OE2 . GLU A 1 164  ? 40.945  49.452 52.980  1.00 73.94  ? 161  GLU A OE2 1 
ATOM 1267 N N   . LEU A 1 165  ? 38.360  45.701 49.319  1.00 72.19  ? 162  LEU A N   1 
ATOM 1268 C CA  . LEU A 1 165  ? 37.890  44.731 48.350  1.00 72.19  ? 162  LEU A CA  1 
ATOM 1269 C C   . LEU A 1 165  ? 36.400  44.851 48.044  1.00 72.19  ? 162  LEU A C   1 
ATOM 1270 O O   . LEU A 1 165  ? 35.951  44.374 47.010  1.00 72.19  ? 162  LEU A O   1 
ATOM 1271 C CB  . LEU A 1 165  ? 38.141  43.343 48.930  1.00 41.92  ? 162  LEU A CB  1 
ATOM 1272 C CG  . LEU A 1 165  ? 39.321  42.374 48.711  1.00 41.92  ? 162  LEU A CG  1 
ATOM 1273 C CD1 . LEU A 1 165  ? 38.776  41.090 47.966  1.00 41.92  ? 162  LEU A CD1 1 
ATOM 1274 C CD2 . LEU A 1 165  ? 40.608  43.027 48.049  1.00 41.92  ? 162  LEU A CD2 1 
ATOM 1275 N N   . HIS A 1 166  ? 35.638  45.470 48.948  1.00 65.74  ? 163  HIS A N   1 
ATOM 1276 C CA  . HIS A 1 166  ? 34.178  45.518 48.842  1.00 65.74  ? 163  HIS A CA  1 
ATOM 1277 C C   . HIS A 1 166  ? 33.623  46.944 49.005  1.00 65.74  ? 163  HIS A C   1 
ATOM 1278 O O   . HIS A 1 166  ? 32.907  47.227 49.940  1.00 65.74  ? 163  HIS A O   1 
ATOM 1279 C CB  . HIS A 1 166  ? 33.571  44.570 49.887  1.00 73.74  ? 163  HIS A CB  1 
ATOM 1280 C CG  . HIS A 1 166  ? 32.099  44.321 49.722  1.00 73.74  ? 163  HIS A CG  1 
ATOM 1281 N ND1 . HIS A 1 166  ? 31.193  45.321 49.427  1.00 73.74  ? 163  HIS A ND1 1 
ATOM 1282 C CD2 . HIS A 1 166  ? 31.371  43.180 49.835  1.00 73.74  ? 163  HIS A CD2 1 
ATOM 1283 C CE1 . HIS A 1 166  ? 29.977  44.806 49.352  1.00 73.74  ? 163  HIS A CE1 1 
ATOM 1284 N NE2 . HIS A 1 166  ? 30.057  43.509 49.591  1.00 73.74  ? 163  HIS A NE2 1 
ATOM 1285 N N   . VAL A 1 167  ? 33.975  47.840 48.094  1.00 47.72  ? 164  VAL A N   1 
ATOM 1286 C CA  . VAL A 1 167  ? 33.435  49.208 48.071  1.00 47.72  ? 164  VAL A CA  1 
ATOM 1287 C C   . VAL A 1 167  ? 31.937  49.296 47.672  1.00 47.72  ? 164  VAL A C   1 
ATOM 1288 O O   . VAL A 1 167  ? 31.477  48.561 46.806  1.00 47.72  ? 164  VAL A O   1 
ATOM 1289 C CB  . VAL A 1 167  ? 34.234  50.117 47.080  1.00 36.26  ? 164  VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 167  ? 33.597  51.522 46.973  1.00 36.26  ? 164  VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 167  ? 35.711  50.210 47.471  1.00 36.26  ? 164  VAL A CG2 1 
ATOM 1292 N N   . ILE A 1 168  ? 31.228  50.241 48.289  1.00 48.30  ? 165  ILE A N   1 
ATOM 1293 C CA  . ILE A 1 168  ? 29.814  50.506 48.053  1.00 48.30  ? 165  ILE A CA  1 
ATOM 1294 C C   . ILE A 1 168  ? 29.553  51.670 47.059  1.00 48.30  ? 165  ILE A C   1 
ATOM 1295 O O   . ILE A 1 168  ? 28.895  51.464 46.021  1.00 48.30  ? 165  ILE A O   1 
ATOM 1296 C CB  . ILE A 1 168  ? 29.051  50.747 49.401  1.00 38.33  ? 165  ILE A CB  1 
ATOM 1297 C CG1 . ILE A 1 168  ? 29.465  49.710 50.461  1.00 38.33  ? 165  ILE A CG1 1 
ATOM 1298 C CG2 . ILE A 1 168  ? 27.509  50.741 49.184  1.00 38.33  ? 165  ILE A CG2 1 
ATOM 1299 C CD1 . ILE A 1 168  ? 29.262  48.273 49.991  1.00 38.33  ? 165  ILE A CD1 1 
ATOM 1300 N N   . ASP A 1 169  ? 30.058  52.869 47.365  1.00 38.17  ? 166  ASP A N   1 
ATOM 1301 C CA  . ASP A 1 169  ? 29.910  54.013 46.447  1.00 38.17  ? 166  ASP A CA  1 
ATOM 1302 C C   . ASP A 1 169  ? 31.078  54.995 46.639  1.00 38.17  ? 166  ASP A C   1 
ATOM 1303 O O   . ASP A 1 169  ? 31.723  54.982 47.672  1.00 38.17  ? 166  ASP A O   1 
ATOM 1304 C CB  . ASP A 1 169  ? 28.564  54.720 46.643  1.00 52.15  ? 166  ASP A CB  1 
ATOM 1305 C CG  . ASP A 1 169  ? 28.330  55.852 45.642  1.00 52.15  ? 166  ASP A CG  1 
ATOM 1306 O OD1 . ASP A 1 169  ? 28.912  55.818 44.501  1.00 52.15  ? 166  ASP A OD1 1 
ATOM 1307 O OD2 . ASP A 1 169  ? 27.545  56.785 45.996  1.00 52.15  ? 166  ASP A OD2 1 
ATOM 1308 N N   . VAL A 1 170  ? 31.351  55.814 45.634  1.00 57.65  ? 167  VAL A N   1 
ATOM 1309 C CA  . VAL A 1 170  ? 32.525  56.633 45.617  1.00 57.65  ? 167  VAL A CA  1 
ATOM 1310 C C   . VAL A 1 170  ? 32.196  57.893 44.878  1.00 57.65  ? 167  VAL A C   1 
ATOM 1311 O O   . VAL A 1 170  ? 31.407  57.896 43.931  1.00 57.65  ? 167  VAL A O   1 
ATOM 1312 C CB  . VAL A 1 170  ? 33.702  55.992 44.826  1.00 47.21  ? 167  VAL A CB  1 
ATOM 1313 C CG1 . VAL A 1 170  ? 35.086  56.608 45.267  1.00 47.21  ? 167  VAL A CG1 1 
ATOM 1314 C CG2 . VAL A 1 170  ? 33.713  54.483 44.963  1.00 47.21  ? 167  VAL A CG2 1 
ATOM 1315 N N   . LYS A 1 171  ? 32.836  58.969 45.295  1.00 49.51  ? 168  LYS A N   1 
ATOM 1316 C CA  . LYS A 1 171  ? 32.643  60.232 44.665  1.00 49.51  ? 168  LYS A CA  1 
ATOM 1317 C C   . LYS A 1 171  ? 33.961  60.915 44.802  1.00 49.51  ? 168  LYS A C   1 
ATOM 1318 O O   . LYS A 1 171  ? 34.693  60.613 45.718  1.00 49.51  ? 168  LYS A O   1 
ATOM 1319 C CB  . LYS A 1 171  ? 31.551  61.006 45.414  1.00 37.18  ? 168  LYS A CB  1 
ATOM 1320 C CG  . LYS A 1 171  ? 30.116  60.386 45.303  1.00 37.18  ? 168  LYS A CG  1 
ATOM 1321 C CD  . LYS A 1 171  ? 29.432  60.833 44.033  1.00 37.18  ? 168  LYS A CD  1 
ATOM 1322 C CE  . LYS A 1 171  ? 28.583  59.757 43.449  1.00 37.18  ? 168  LYS A CE  1 
ATOM 1323 N NZ  . LYS A 1 171  ? 27.487  59.144 44.283  1.00 37.18  ? 168  LYS A NZ  1 
ATOM 1324 N N   . PHE A 1 172  ? 34.287  61.788 43.866  1.00 50.06  ? 169  PHE A N   1 
ATOM 1325 C CA  . PHE A 1 172  ? 35.397  62.690 44.019  1.00 50.06  ? 169  PHE A CA  1 
ATOM 1326 C C   . PHE A 1 172  ? 34.927  63.886 44.829  1.00 50.06  ? 169  PHE A C   1 
ATOM 1327 O O   . PHE A 1 172  ? 34.042  64.601 44.401  1.00 50.06  ? 169  PHE A O   1 
ATOM 1328 C CB  . PHE A 1 172  ? 35.889  63.191 42.668  1.00 62.39  ? 169  PHE A CB  1 
ATOM 1329 C CG  . PHE A 1 172  ? 36.918  62.323 42.026  1.00 62.39  ? 169  PHE A CG  1 
ATOM 1330 C CD1 . PHE A 1 172  ? 36.701  61.800 40.755  1.00 62.39  ? 169  PHE A CD1 1 
ATOM 1331 C CD2 . PHE A 1 172  ? 38.132  62.066 42.655  1.00 62.39  ? 169  PHE A CD2 1 
ATOM 1332 C CE1 . PHE A 1 172  ? 37.665  61.008 40.123  1.00 62.39  ? 169  PHE A CE1 1 
ATOM 1333 C CE2 . PHE A 1 172  ? 39.104  61.266 42.032  1.00 62.39  ? 169  PHE A CE2 1 
ATOM 1334 C CZ  . PHE A 1 172  ? 38.865  60.732 40.766  1.00 62.39  ? 169  PHE A CZ  1 
ATOM 1335 N N   . LEU A 1 173  ? 35.539  64.072 45.997  1.00 53.63  ? 170  LEU A N   1 
ATOM 1336 C CA  . LEU A 1 173  ? 35.344  65.212 46.884  1.00 53.63  ? 170  LEU A CA  1 
ATOM 1337 C C   . LEU A 1 173  ? 35.644  66.536 46.225  1.00 53.63  ? 170  LEU A C   1 
ATOM 1338 O O   . LEU A 1 173  ? 36.578  66.642 45.407  1.00 53.63  ? 170  LEU A O   1 
ATOM 1339 C CB  . LEU A 1 173  ? 36.295  65.096 48.054  1.00 55.12  ? 170  LEU A CB  1 
ATOM 1340 C CG  . LEU A 1 173  ? 35.826  64.174 49.162  1.00 55.12  ? 170  LEU A CG  1 
ATOM 1341 C CD1 . LEU A 1 173  ? 36.997  63.557 49.869  1.00 55.12  ? 170  LEU A CD1 1 
ATOM 1342 C CD2 . LEU A 1 173  ? 34.985  65.001 50.116  1.00 55.12  ? 170  LEU A CD2 1 
ATOM 1343 N N   . TYR A 1 174  ? 34.868  67.549 46.607  1.00 70.64  ? 171  TYR A N   1 
ATOM 1344 C CA  . TYR A 1 174  ? 35.054  68.914 46.152  1.00 70.64  ? 171  TYR A CA  1 
ATOM 1345 C C   . TYR A 1 174  ? 36.062  69.670 47.015  1.00 70.64  ? 171  TYR A C   1 
ATOM 1346 O O   . TYR A 1 174  ? 36.283  69.323 48.194  1.00 70.64  ? 171  TYR A O   1 
ATOM 1347 C CB  . TYR A 1 174  ? 33.735  69.641 46.248  1.00 56.11  ? 171  TYR A CB  1 
ATOM 1348 C CG  . TYR A 1 174  ? 32.814  69.394 45.090  1.00 56.11  ? 171  TYR A CG  1 
ATOM 1349 C CD1 . TYR A 1 174  ? 31.800  68.453 45.178  1.00 56.11  ? 171  TYR A CD1 1 
ATOM 1350 C CD2 . TYR A 1 174  ? 32.939  70.124 43.913  1.00 56.11  ? 171  TYR A CD2 1 
ATOM 1351 C CE1 . TYR A 1 174  ? 30.932  68.245 44.129  1.00 56.11  ? 171  TYR A CE1 1 
ATOM 1352 C CE2 . TYR A 1 174  ? 32.080  69.926 42.851  1.00 56.11  ? 171  TYR A CE2 1 
ATOM 1353 C CZ  . TYR A 1 174  ? 31.072  68.981 42.960  1.00 56.11  ? 171  TYR A CZ  1 
ATOM 1354 O OH  . TYR A 1 174  ? 30.203  68.763 41.907  1.00 56.11  ? 171  TYR A OH  1 
ATOM 1355 N N   . GLY A 1 175  ? 36.648  70.719 46.431  1.00 88.47  ? 172  GLY A N   1 
ATOM 1356 C CA  . GLY A 1 175  ? 37.583  71.592 47.136  1.00 88.47  ? 172  GLY A CA  1 
ATOM 1357 C C   . GLY A 1 175  ? 38.710  70.771 47.710  1.00 88.47  ? 172  GLY A C   1 
ATOM 1358 O O   . GLY A 1 175  ? 38.861  70.648 48.920  1.00 88.47  ? 172  GLY A O   1 
ATOM 1359 N N   . CYS A 1 176  ? 39.483  70.173 46.826  1.00 129.29 ? 173  CYS A N   1 
ATOM 1360 C CA  . CYS A 1 176  ? 40.543  69.307 47.252  1.00 129.29 ? 173  CYS A CA  1 
ATOM 1361 C C   . CYS A 1 176  ? 41.778  69.635 46.468  1.00 129.29 ? 173  CYS A C   1 
ATOM 1362 O O   . CYS A 1 176  ? 41.803  69.502 45.240  1.00 129.29 ? 173  CYS A O   1 
ATOM 1363 C CB  . CYS A 1 176  ? 40.143  67.858 47.042  1.00 73.16  ? 173  CYS A CB  1 
ATOM 1364 S SG  . CYS A 1 176  ? 39.341  67.147 48.484  1.00 73.16  ? 173  CYS A SG  1 
ATOM 1365 N N   . GLN A 1 177  ? 42.803  70.079 47.186  1.00 81.51  ? 174  GLN A N   1 
ATOM 1366 C CA  . GLN A 1 177  ? 44.050  70.476 46.551  1.00 81.51  ? 174  GLN A CA  1 
ATOM 1367 C C   . GLN A 1 177  ? 44.453  69.354 45.618  1.00 81.51  ? 174  GLN A C   1 
ATOM 1368 O O   . GLN A 1 177  ? 44.657  69.559 44.407  1.00 81.51  ? 174  GLN A O   1 
ATOM 1369 C CB  . GLN A 1 177  ? 45.137  70.742 47.603  1.00 137.77 ? 174  GLN A CB  1 
ATOM 1370 C CG  . GLN A 1 177  ? 44.820  71.887 48.580  1.00 137.77 ? 174  GLN A CG  1 
ATOM 1371 C CD  . GLN A 1 177  ? 44.589  73.242 47.896  1.00 137.77 ? 174  GLN A CD  1 
ATOM 1372 O OE1 . GLN A 1 177  ? 44.926  73.445 46.725  1.00 137.77 ? 174  GLN A OE1 1 
ATOM 1373 N NE2 . GLN A 1 177  ? 44.012  74.175 48.641  1.00 137.77 ? 174  GLN A NE2 1 
ATOM 1374 N N   . ALA A 1 178  ? 44.512  68.162 46.200  1.00 80.92  ? 175  ALA A N   1 
ATOM 1375 C CA  . ALA A 1 178  ? 44.708  66.959 45.444  1.00 80.92  ? 175  ALA A CA  1 
ATOM 1376 C C   . ALA A 1 178  ? 43.347  66.371 45.053  1.00 80.92  ? 175  ALA A C   1 
ATOM 1377 O O   . ALA A 1 178  ? 42.396  66.427 45.849  1.00 80.92  ? 175  ALA A O   1 
ATOM 1378 C CB  . ALA A 1 178  ? 45.487  65.984 46.263  1.00 64.11  ? 175  ALA A CB  1 
ATOM 1379 N N   . PRO A 1 179  ? 43.230  65.863 43.801  1.00 62.80  ? 176  PRO A N   1 
ATOM 1380 C CA  . PRO A 1 179  ? 42.236  64.848 43.472  1.00 62.80  ? 176  PRO A CA  1 
ATOM 1381 C C   . PRO A 1 179  ? 42.025  63.892 44.629  1.00 62.80  ? 176  PRO A C   1 
ATOM 1382 O O   . PRO A 1 179  ? 42.932  63.133 44.971  1.00 62.80  ? 176  PRO A O   1 
ATOM 1383 C CB  . PRO A 1 179  ? 42.886  64.120 42.307  1.00 77.94  ? 176  PRO A CB  1 
ATOM 1384 C CG  . PRO A 1 179  ? 43.593  65.207 41.575  1.00 77.94  ? 176  PRO A CG  1 
ATOM 1385 C CD  . PRO A 1 179  ? 43.968  66.272 42.592  1.00 77.94  ? 176  PRO A CD  1 
ATOM 1386 N N   . THR A 1 180  ? 40.851  63.968 45.243  1.00 65.36  ? 177  THR A N   1 
ATOM 1387 C CA  . THR A 1 180  ? 40.525  63.076 46.336  1.00 65.36  ? 177  THR A CA  1 
ATOM 1388 C C   . THR A 1 180  ? 39.191  62.340 46.157  1.00 65.36  ? 177  THR A C   1 
ATOM 1389 O O   . THR A 1 180  ? 38.228  62.882 45.620  1.00 65.36  ? 177  THR A O   1 
ATOM 1390 C CB  . THR A 1 180  ? 40.549  63.832 47.672  1.00 54.65  ? 177  THR A CB  1 
ATOM 1391 O OG1 . THR A 1 180  ? 41.870  64.335 47.882  1.00 54.65  ? 177  THR A OG1 1 
ATOM 1392 C CG2 . THR A 1 180  ? 40.204  62.902 48.836  1.00 54.65  ? 177  THR A CG2 1 
ATOM 1393 N N   . ILE A 1 181  ? 39.160  61.094 46.615  1.00 71.73  ? 178  ILE A N   1 
ATOM 1394 C CA  . ILE A 1 181  ? 37.961  60.278 46.546  1.00 71.73  ? 178  ILE A CA  1 
ATOM 1395 C C   . ILE A 1 181  ? 37.530  59.924 47.931  1.00 71.73  ? 178  ILE A C   1 
ATOM 1396 O O   . ILE A 1 181  ? 38.330  59.916 48.865  1.00 71.73  ? 178  ILE A O   1 
ATOM 1397 C CB  . ILE A 1 181  ? 38.168  58.947 45.802  1.00 72.70  ? 178  ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 181  ? 39.585  58.421 46.001  1.00 72.70  ? 178  ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 181  ? 37.886  59.097 44.334  1.00 72.70  ? 178  ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 181  ? 39.623  56.929 46.160  1.00 72.70  ? 178  ILE A CD1 1 
ATOM 1401 N N   . CYS A 1 182  ? 36.259  59.587 48.035  1.00 72.12  ? 179  CYS A N   1 
ATOM 1402 C CA  . CYS A 1 182  ? 35.625  59.333 49.286  1.00 72.12  ? 179  CYS A CA  1 
ATOM 1403 C C   . CYS A 1 182  ? 34.797  58.121 48.992  1.00 72.12  ? 179  CYS A C   1 
ATOM 1404 O O   . CYS A 1 182  ? 34.097  58.099 47.990  1.00 72.12  ? 179  CYS A O   1 
ATOM 1405 C CB  . CYS A 1 182  ? 34.730  60.519 49.623  1.00 55.67  ? 179  CYS A CB  1 
ATOM 1406 S SG  . CYS A 1 182  ? 33.823  60.358 51.157  1.00 55.67  ? 179  CYS A SG  1 
ATOM 1407 N N   . PHE A 1 183  ? 34.874  57.114 49.850  1.00 56.47  ? 180  PHE A N   1 
ATOM 1408 C CA  . PHE A 1 183  ? 34.141  55.893 49.587  1.00 56.47  ? 180  PHE A CA  1 
ATOM 1409 C C   . PHE A 1 183  ? 33.715  55.097 50.795  1.00 56.47  ? 180  PHE A C   1 
ATOM 1410 O O   . PHE A 1 183  ? 34.466  54.923 51.749  1.00 56.47  ? 180  PHE A O   1 
ATOM 1411 C CB  . PHE A 1 183  ? 34.901  54.982 48.594  1.00 55.26  ? 180  PHE A CB  1 
ATOM 1412 C CG  . PHE A 1 183  ? 36.180  54.397 49.131  1.00 55.26  ? 180  PHE A CG  1 
ATOM 1413 C CD1 . PHE A 1 183  ? 36.211  53.103 49.606  1.00 55.26  ? 180  PHE A CD1 1 
ATOM 1414 C CD2 . PHE A 1 183  ? 37.359  55.135 49.130  1.00 55.26  ? 180  PHE A CD2 1 
ATOM 1415 C CE1 . PHE A 1 183  ? 37.395  52.566 50.087  1.00 55.26  ? 180  PHE A CE1 1 
ATOM 1416 C CE2 . PHE A 1 183  ? 38.529  54.610 49.605  1.00 55.26  ? 180  PHE A CE2 1 
ATOM 1417 C CZ  . PHE A 1 183  ? 38.552  53.331 50.077  1.00 55.26  ? 180  PHE A CZ  1 
ATOM 1418 N N   . VAL A 1 184  ? 32.506  54.572 50.713  1.00 63.83  ? 181  VAL A N   1 
ATOM 1419 C CA  . VAL A 1 184  ? 31.956  53.720 51.743  1.00 63.83  ? 181  VAL A CA  1 
ATOM 1420 C C   . VAL A 1 184  ? 32.309  52.280 51.365  1.00 63.83  ? 181  VAL A C   1 
ATOM 1421 O O   . VAL A 1 184  ? 31.865  51.786 50.337  1.00 63.83  ? 181  VAL A O   1 
ATOM 1422 C CB  . VAL A 1 184  ? 30.411  53.909 51.805  1.00 26.06  ? 181  VAL A CB  1 
ATOM 1423 C CG1 . VAL A 1 184  ? 29.723  52.988 52.854  1.00 26.06  ? 181  VAL A CG1 1 
ATOM 1424 C CG2 . VAL A 1 184  ? 30.033  55.341 52.088  1.00 26.06  ? 181  VAL A CG2 1 
ATOM 1425 N N   . TYR A 1 185  ? 33.125  51.608 52.167  1.00 58.05  ? 182  TYR A N   1 
ATOM 1426 C CA  . TYR A 1 185  ? 33.422  50.192 51.911  1.00 58.05  ? 182  TYR A CA  1 
ATOM 1427 C C   . TYR A 1 185  ? 32.904  49.262 53.018  1.00 58.05  ? 182  TYR A C   1 
ATOM 1428 O O   . TYR A 1 185  ? 32.688  49.718 54.124  1.00 58.05  ? 182  TYR A O   1 
ATOM 1429 C CB  . TYR A 1 185  ? 34.914  50.005 51.691  1.00 70.27  ? 182  TYR A CB  1 
ATOM 1430 C CG  . TYR A 1 185  ? 35.768  50.219 52.913  1.00 70.27  ? 182  TYR A CG  1 
ATOM 1431 C CD1 . TYR A 1 185  ? 36.064  49.145 53.773  1.00 70.27  ? 182  TYR A CD1 1 
ATOM 1432 C CD2 . TYR A 1 185  ? 36.314  51.484 53.196  1.00 70.27  ? 182  TYR A CD2 1 
ATOM 1433 C CE1 . TYR A 1 185  ? 36.865  49.321 54.896  1.00 70.27  ? 182  TYR A CE1 1 
ATOM 1434 C CE2 . TYR A 1 185  ? 37.123  51.677 54.312  1.00 70.27  ? 182  TYR A CE2 1 
ATOM 1435 C CZ  . TYR A 1 185  ? 37.395  50.586 55.158  1.00 70.27  ? 182  TYR A CZ  1 
ATOM 1436 O OH  . TYR A 1 185  ? 38.182  50.757 56.270  1.00 70.27  ? 182  TYR A OH  1 
ATOM 1437 N N   . GLN A 1 186  ? 32.696  47.976 52.716  1.00 68.17  ? 183  GLN A N   1 
ATOM 1438 C CA  . GLN A 1 186  ? 32.151  47.017 53.693  1.00 68.17  ? 183  GLN A CA  1 
ATOM 1439 C C   . GLN A 1 186  ? 33.066  45.814 53.972  1.00 68.17  ? 183  GLN A C   1 
ATOM 1440 O O   . GLN A 1 186  ? 33.167  44.921 53.136  1.00 68.17  ? 183  GLN A O   1 
ATOM 1441 C CB  . GLN A 1 186  ? 30.775  46.506 53.255  1.00 69.66  ? 183  GLN A CB  1 
ATOM 1442 C CG  . GLN A 1 186  ? 30.090  45.601 54.300  1.00 69.66  ? 183  GLN A CG  1 
ATOM 1443 C CD  . GLN A 1 186  ? 29.024  44.664 53.705  1.00 69.66  ? 183  GLN A CD  1 
ATOM 1444 O OE1 . GLN A 1 186  ? 28.122  45.100 52.971  1.00 69.66  ? 183  GLN A OE1 1 
ATOM 1445 N NE2 . GLN A 1 186  ? 29.123  43.369 54.034  1.00 69.66  ? 183  GLN A NE2 1 
ATOM 1446 N N   . ASP A 1 187  ? 33.695  45.775 55.152  1.00 78.67  ? 184  ASP A N   1 
ATOM 1447 C CA  . ASP A 1 187  ? 34.468  44.596 55.602  1.00 78.67  ? 184  ASP A CA  1 
ATOM 1448 C C   . ASP A 1 187  ? 33.741  43.841 56.750  1.00 78.67  ? 184  ASP A C   1 
ATOM 1449 O O   . ASP A 1 187  ? 32.625  44.222 57.118  1.00 78.67  ? 184  ASP A O   1 
ATOM 1450 C CB  . ASP A 1 187  ? 35.887  45.020 55.997  1.00 65.11  ? 184  ASP A CB  1 
ATOM 1451 C CG  . ASP A 1 187  ? 35.911  45.909 57.222  1.00 65.11  ? 184  ASP A CG  1 
ATOM 1452 O OD1 . ASP A 1 187  ? 35.036  45.754 58.087  1.00 65.11  ? 184  ASP A OD1 1 
ATOM 1453 O OD2 . ASP A 1 187  ? 36.806  46.766 57.331  1.00 65.11  ? 184  ASP A OD2 1 
ATOM 1454 N N   . PRO A 1 188  ? 34.344  42.760 57.309  1.00 103.20 ? 185  PRO A N   1 
ATOM 1455 C CA  . PRO A 1 188  ? 33.673  42.248 58.500  1.00 103.20 ? 185  PRO A CA  1 
ATOM 1456 C C   . PRO A 1 188  ? 34.094  43.108 59.676  1.00 103.20 ? 185  PRO A C   1 
ATOM 1457 O O   . PRO A 1 188  ? 35.249  43.062 60.077  1.00 103.20 ? 185  PRO A O   1 
ATOM 1458 C CB  . PRO A 1 188  ? 34.198  40.802 58.642  1.00 59.01  ? 185  PRO A CB  1 
ATOM 1459 C CG  . PRO A 1 188  ? 35.214  40.615 57.587  1.00 59.01  ? 185  PRO A CG  1 
ATOM 1460 C CD  . PRO A 1 188  ? 35.545  41.966 56.997  1.00 59.01  ? 185  PRO A CD  1 
ATOM 1461 N N   . GLN A 1 189  ? 33.151  43.902 60.176  1.00 122.47 ? 186  GLN A N   1 
ATOM 1462 C CA  . GLN A 1 189  ? 33.321  44.914 61.232  1.00 122.47 ? 186  GLN A CA  1 
ATOM 1463 C C   . GLN A 1 189  ? 32.167  45.867 61.036  1.00 122.47 ? 186  GLN A C   1 
ATOM 1464 O O   . GLN A 1 189  ? 31.628  46.422 61.994  1.00 122.47 ? 186  GLN A O   1 
ATOM 1465 C CB  . GLN A 1 189  ? 34.605  45.730 61.088  1.00 96.60  ? 186  GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 189  ? 35.850  45.107 61.686  1.00 96.60  ? 186  GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 189  ? 37.084  45.433 60.868  1.00 96.60  ? 186  GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 189  ? 37.569  46.569 60.878  1.00 96.60  ? 186  GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 189  ? 37.596  44.438 60.143  1.00 96.60  ? 186  GLN A NE2 1 
ATOM 1470 N N   . GLY A 1 190  ? 31.812  46.045 59.764  1.00 101.62 ? 187  GLY A N   1 
ATOM 1471 C CA  . GLY A 1 190  ? 30.745  46.934 59.337  1.00 101.62 ? 187  GLY A CA  1 
ATOM 1472 C C   . GLY A 1 190  ? 31.133  47.628 58.054  1.00 101.62 ? 187  GLY A C   1 
ATOM 1473 O O   . GLY A 1 190  ? 31.767  47.046 57.186  1.00 101.62 ? 187  GLY A O   1 
ATOM 1474 N N   . ARG A 1 191  ? 30.762  48.892 57.965  1.00 59.76  ? 188  ARG A N   1 
ATOM 1475 C CA  . ARG A 1 191  ? 30.941  49.699 56.772  1.00 59.76  ? 188  ARG A CA  1 
ATOM 1476 C C   . ARG A 1 191  ? 31.624  50.992 57.150  1.00 59.76  ? 188  ARG A C   1 
ATOM 1477 O O   . ARG A 1 191  ? 31.376  51.546 58.212  1.00 59.76  ? 188  ARG A O   1 
ATOM 1478 C CB  . ARG A 1 191  ? 29.593  50.029 56.108  1.00 66.81  ? 188  ARG A CB  1 
ATOM 1479 C CG  . ARG A 1 191  ? 29.132  49.117 54.986  1.00 66.81  ? 188  ARG A CG  1 
ATOM 1480 C CD  . ARG A 1 191  ? 27.760  49.564 54.562  1.00 66.81  ? 188  ARG A CD  1 
ATOM 1481 N NE  . ARG A 1 191  ? 27.338  49.132 53.235  1.00 66.81  ? 188  ARG A NE  1 
ATOM 1482 C CZ  . ARG A 1 191  ? 26.797  47.949 52.967  1.00 66.81  ? 188  ARG A CZ  1 
ATOM 1483 N NH1 . ARG A 1 191  ? 26.652  47.045 53.915  1.00 66.81  ? 188  ARG A NH1 1 
ATOM 1484 N NH2 . ARG A 1 191  ? 26.419  47.644 51.742  1.00 66.81  ? 188  ARG A NH2 1 
ATOM 1485 N N   . HIS A 1 192  ? 32.470  51.486 56.264  1.00 71.81  ? 189  HIS A N   1 
ATOM 1486 C CA  . HIS A 1 192  ? 33.353  52.557 56.646  1.00 71.81  ? 189  HIS A CA  1 
ATOM 1487 C C   . HIS A 1 192  ? 33.534  53.554 55.533  1.00 71.81  ? 189  HIS A C   1 
ATOM 1488 O O   . HIS A 1 192  ? 33.560  53.189 54.364  1.00 71.81  ? 189  HIS A O   1 
ATOM 1489 C CB  . HIS A 1 192  ? 34.708  51.980 57.099  1.00 74.34  ? 189  HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 192  ? 34.584  50.820 58.040  1.00 74.34  ? 189  HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 192  ? 34.321  49.536 57.607  1.00 74.34  ? 189  HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 192  ? 34.643  50.757 59.390  1.00 74.34  ? 189  HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 192  ? 34.238  48.729 58.649  1.00 74.34  ? 189  HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 192  ? 34.433  49.444 59.744  1.00 74.34  ? 189  HIS A NE2 1 
ATOM 1495 N N   . VAL A 1 193  ? 33.627  54.824 55.903  1.00 63.31  ? 190  VAL A N   1 
ATOM 1496 C CA  . VAL A 1 193  ? 33.969  55.867 54.944  1.00 63.31  ? 190  VAL A CA  1 
ATOM 1497 C C   . VAL A 1 193  ? 35.485  56.034 54.976  1.00 63.31  ? 190  VAL A C   1 
ATOM 1498 O O   . VAL A 1 193  ? 36.110  55.871 56.011  1.00 63.31  ? 190  VAL A O   1 
ATOM 1499 C CB  . VAL A 1 193  ? 33.187  57.226 55.175  1.00 53.83  ? 190  VAL A CB  1 
ATOM 1500 C CG1 . VAL A 1 193  ? 33.179  57.666 56.656  1.00 53.83  ? 190  VAL A CG1 1 
ATOM 1501 C CG2 . VAL A 1 193  ? 33.732  58.360 54.263  1.00 53.83  ? 190  VAL A CG2 1 
ATOM 1502 N N   . LYS A 1 194  ? 36.075  56.314 53.830  1.00 53.66  ? 191  LYS A N   1 
ATOM 1503 C CA  . LYS A 1 194  ? 37.497  56.444 53.743  1.00 53.66  ? 191  LYS A CA  1 
ATOM 1504 C C   . LYS A 1 194  ? 37.826  57.363 52.582  1.00 53.66  ? 191  LYS A C   1 
ATOM 1505 O O   . LYS A 1 194  ? 36.996  57.612 51.717  1.00 53.66  ? 191  LYS A O   1 
ATOM 1506 C CB  . LYS A 1 194  ? 38.126  55.067 53.560  1.00 70.83  ? 191  LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 194  ? 39.623  55.024 53.774  1.00 70.83  ? 191  LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 194  ? 40.091  53.606 53.966  1.00 70.83  ? 191  LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 194  ? 41.517  53.488 53.502  1.00 70.83  ? 191  LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 194  ? 41.754  52.161 52.880  1.00 70.83  ? 191  LYS A NZ  1 
ATOM 1511 N N   . THR A 1 195  ? 39.051  57.859 52.572  1.00 52.77  ? 192  THR A N   1 
ATOM 1512 C CA  . THR A 1 195  ? 39.482  58.799 51.571  1.00 52.77  ? 192  THR A CA  1 
ATOM 1513 C C   . THR A 1 195  ? 40.884  58.478 51.089  1.00 52.77  ? 192  THR A C   1 
ATOM 1514 O O   . THR A 1 195  ? 41.677  57.833 51.821  1.00 52.77  ? 192  THR A O   1 
ATOM 1515 C CB  . THR A 1 195  ? 39.605  60.136 52.213  1.00 47.72  ? 192  THR A CB  1 
ATOM 1516 O OG1 . THR A 1 195  ? 39.754  59.917 53.630  1.00 47.72  ? 192  THR A OG1 1 
ATOM 1517 C CG2 . THR A 1 195  ? 38.399  60.960 51.916  1.00 47.72  ? 192  THR A CG2 1 
ATOM 1518 N N   . TYR A 1 196  ? 41.182  58.954 49.874  1.00 56.09  ? 193  TYR A N   1 
ATOM 1519 C CA  . TYR A 1 196  ? 42.542  58.991 49.339  1.00 56.09  ? 193  TYR A CA  1 
ATOM 1520 C C   . TYR A 1 196  ? 42.669  60.153 48.399  1.00 56.09  ? 193  TYR A C   1 
ATOM 1521 O O   . TYR A 1 196  ? 41.772  60.374 47.573  1.00 56.09  ? 193  TYR A O   1 
ATOM 1522 C CB  . TYR A 1 196  ? 42.870  57.789 48.480  1.00 59.78  ? 193  TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 196  ? 42.853  56.440 49.116  1.00 59.78  ? 193  TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 196  ? 41.898  55.509 48.726  1.00 59.78  ? 193  TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 196  ? 43.822  56.053 50.031  1.00 59.78  ? 193  TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 196  ? 41.878  54.220 49.256  1.00 59.78  ? 193  TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 196  ? 43.813  54.769 50.578  1.00 59.78  ? 193  TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 196  ? 42.826  53.857 50.186  1.00 59.78  ? 193  TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 196  ? 42.751  52.583 50.688  1.00 59.78  ? 193  TYR A OH  1 
ATOM 1530 N N   . GLU A 1 197  ? 43.801  60.850 48.477  1.00 57.33  ? 194  GLU A N   1 
ATOM 1531 C CA  . GLU A 1 197  ? 44.209  61.818 47.504  1.00 57.33  ? 194  GLU A CA  1 
ATOM 1532 C C   . GLU A 1 197  ? 44.646  60.954 46.391  1.00 57.33  ? 194  GLU A C   1 
ATOM 1533 O O   . GLU A 1 197  ? 44.723  59.761 46.548  1.00 57.33  ? 194  GLU A O   1 
ATOM 1534 C CB  . GLU A 1 197  ? 45.414  62.616 48.000  1.00 98.61  ? 194  GLU A CB  1 
ATOM 1535 C CG  . GLU A 1 197  ? 45.081  63.982 48.582  1.00 98.61  ? 194  GLU A CG  1 
ATOM 1536 C CD  . GLU A 1 197  ? 46.200  64.584 49.409  1.00 98.61  ? 194  GLU A CD  1 
ATOM 1537 O OE1 . GLU A 1 197  ? 47.293  64.777 48.868  1.00 98.61  ? 194  GLU A OE1 1 
ATOM 1538 O OE2 . GLU A 1 197  ? 45.990  64.884 50.595  1.00 98.61  ? 194  GLU A OE2 1 
ATOM 1539 N N   . VAL A 1 198  ? 44.566  61.447 45.202  1.00 97.03  ? 195  VAL A N   1 
ATOM 1540 C CA  . VAL A 1 198  ? 45.003  60.579 44.141  1.00 97.03  ? 195  VAL A CA  1 
ATOM 1541 C C   . VAL A 1 198  ? 46.074  61.204 43.287  1.00 97.03  ? 195  VAL A C   1 
ATOM 1542 O O   . VAL A 1 198  ? 45.885  62.261 42.729  1.00 97.03  ? 195  VAL A O   1 
ATOM 1543 C CB  . VAL A 1 198  ? 43.846  60.175 43.259  1.00 66.16  ? 195  VAL A CB  1 
ATOM 1544 C CG1 . VAL A 1 198  ? 44.346  59.533 42.028  1.00 66.16  ? 195  VAL A CG1 1 
ATOM 1545 C CG2 . VAL A 1 198  ? 42.975  59.231 43.970  1.00 66.16  ? 195  VAL A CG2 1 
ATOM 1546 N N   . SER A 1 199  ? 47.207  60.531 43.187  1.00 87.58  ? 196  SER A N   1 
ATOM 1547 C CA  . SER A 1 199  ? 48.322  61.018 42.397  1.00 87.58  ? 196  SER A CA  1 
ATOM 1548 C C   . SER A 1 199  ? 48.617  60.107 41.243  1.00 87.58  ? 196  SER A C   1 
ATOM 1549 O O   . SER A 1 199  ? 48.789  58.895 41.408  1.00 87.58  ? 196  SER A O   1 
ATOM 1550 C CB  . SER A 1 199  ? 49.590  61.189 43.229  1.00 130.97 ? 196  SER A CB  1 
ATOM 1551 O OG  . SER A 1 199  ? 50.677  61.531 42.381  1.00 130.97 ? 196  SER A OG  1 
ATOM 1552 N N   . LEU A 1 200  ? 48.682  60.726 40.074  1.00 113.92 ? 197  LEU A N   1 
ATOM 1553 C CA  . LEU A 1 200  ? 49.110  60.080 38.849  1.00 113.92 ? 197  LEU A CA  1 
ATOM 1554 C C   . LEU A 1 200  ? 50.614  60.196 38.759  1.00 113.92 ? 197  LEU A C   1 
ATOM 1555 O O   . LEU A 1 200  ? 51.284  59.302 38.243  1.00 113.92 ? 197  LEU A O   1 
ATOM 1556 C CB  . LEU A 1 200  ? 48.441  60.735 37.639  1.00 64.13  ? 197  LEU A CB  1 
ATOM 1557 C CG  . LEU A 1 200  ? 48.011  62.196 37.758  1.00 64.13  ? 197  LEU A CG  1 
ATOM 1558 C CD1 . LEU A 1 200  ? 46.998  62.569 36.640  1.00 64.13  ? 197  LEU A CD1 1 
ATOM 1559 C CD2 . LEU A 1 200  ? 47.455  62.514 39.149  1.00 64.13  ? 197  LEU A CD2 1 
ATOM 1560 N N   . ARG A 1 201  ? 51.132  61.296 39.295  1.00 157.38 ? 198  ARG A N   1 
ATOM 1561 C CA  . ARG A 1 201  ? 52.561  61.496 39.458  1.00 157.38 ? 198  ARG A CA  1 
ATOM 1562 C C   . ARG A 1 201  ? 53.310  60.179 39.753  1.00 157.38 ? 198  ARG A C   1 
ATOM 1563 O O   . ARG A 1 201  ? 54.401  59.960 39.221  1.00 157.38 ? 198  ARG A O   1 
ATOM 1564 C CB  . ARG A 1 201  ? 52.800  62.553 40.543  1.00 141.76 ? 198  ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 201  ? 54.248  62.949 40.759  1.00 141.76 ? 198  ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 201  ? 54.404  64.452 40.946  1.00 141.76 ? 198  ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 201  ? 53.835  65.228 39.839  1.00 141.76 ? 198  ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 201  ? 54.144  65.080 38.550  1.00 141.76 ? 198  ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 201  ? 55.009  64.159 38.152  1.00 141.76 ? 198  ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 201  ? 53.563  65.849 37.645  1.00 141.76 ? 198  ARG A NH2 1 
ATOM 1571 N N   . GLU A 1 202  ? 52.716  59.296 40.562  1.00 77.03  ? 199  GLU A N   1 
ATOM 1572 C CA  . GLU A 1 202  ? 53.369  58.031 40.910  1.00 77.03  ? 199  GLU A CA  1 
ATOM 1573 C C   . GLU A 1 202  ? 52.407  56.871 41.081  1.00 77.03  ? 199  GLU A C   1 
ATOM 1574 O O   . GLU A 1 202  ? 52.696  55.925 41.828  1.00 77.03  ? 199  GLU A O   1 
ATOM 1575 C CB  . GLU A 1 202  ? 54.277  58.168 42.143  1.00 152.68 ? 199  GLU A CB  1 
ATOM 1576 C CG  . GLU A 1 202  ? 53.714  58.999 43.285  1.00 152.68 ? 199  GLU A CG  1 
ATOM 1577 C CD  . GLU A 1 202  ? 54.166  60.453 43.233  1.00 152.68 ? 199  GLU A CD  1 
ATOM 1578 O OE1 . GLU A 1 202  ? 53.397  61.335 43.665  1.00 152.68 ? 199  GLU A OE1 1 
ATOM 1579 O OE2 . GLU A 1 202  ? 55.290  60.725 42.762  1.00 152.68 ? 199  GLU A OE2 1 
ATOM 1580 N N   . LYS A 1 203  ? 51.268  56.939 40.392  1.00 85.69  ? 200  LYS A N   1 
ATOM 1581 C CA  . LYS A 1 203  ? 50.309  55.812 40.315  1.00 85.69  ? 200  LYS A CA  1 
ATOM 1582 C C   . LYS A 1 203  ? 49.951  55.119 41.652  1.00 85.69  ? 200  LYS A C   1 
ATOM 1583 O O   . LYS A 1 203  ? 49.626  53.923 41.693  1.00 85.69  ? 200  LYS A O   1 
ATOM 1584 C CB  . LYS A 1 203  ? 50.782  54.756 39.301  1.00 94.45  ? 200  LYS A CB  1 
ATOM 1585 C CG  . LYS A 1 203  ? 51.140  55.295 37.930  1.00 94.45  ? 200  LYS A CG  1 
ATOM 1586 C CD  . LYS A 1 203  ? 51.070  54.170 36.900  1.00 94.45  ? 200  LYS A CD  1 
ATOM 1587 C CE  . LYS A 1 203  ? 51.850  54.512 35.627  1.00 94.45  ? 200  LYS A CE  1 
ATOM 1588 N NZ  . LYS A 1 203  ? 51.946  55.987 35.382  1.00 94.45  ? 200  LYS A NZ  1 
ATOM 1589 N N   . GLU A 1 204  ? 50.025  55.865 42.743  1.00 90.25  ? 201  GLU A N   1 
ATOM 1590 C CA  . GLU A 1 204  ? 49.522  55.373 44.007  1.00 90.25  ? 201  GLU A CA  1 
ATOM 1591 C C   . GLU A 1 204  ? 48.425  56.314 44.510  1.00 90.25  ? 201  GLU A C   1 
ATOM 1592 O O   . GLU A 1 204  ? 48.063  57.291 43.839  1.00 90.25  ? 201  GLU A O   1 
ATOM 1593 C CB  . GLU A 1 204  ? 50.651  55.172 45.036  1.00 118.54 ? 201  GLU A CB  1 
ATOM 1594 C CG  . GLU A 1 204  ? 51.669  56.335 45.142  1.00 118.54 ? 201  GLU A CG  1 
ATOM 1595 C CD  . GLU A 1 204  ? 52.653  56.098 46.306  1.00 118.54 ? 201  GLU A CD  1 
ATOM 1596 O OE1 . GLU A 1 204  ? 52.777  57.043 47.199  1.00 118.54 ? 201  GLU A OE1 1 
ATOM 1597 O OE2 . GLU A 1 204  ? 53.304  54.956 46.332  1.00 118.54 ? 201  GLU A OE2 1 
ATOM 1598 N N   . PHE A 1 205  ? 47.905  56.013 45.692  1.00 98.53  ? 202  PHE A N   1 
ATOM 1599 C CA  . PHE A 1 205  ? 46.818  56.781 46.257  1.00 98.53  ? 202  PHE A CA  1 
ATOM 1600 C C   . PHE A 1 205  ? 47.241  57.930 47.180  1.00 98.53  ? 202  PHE A C   1 
ATOM 1601 O O   . PHE A 1 205  ? 46.797  59.059 46.980  1.00 98.53  ? 202  PHE A O   1 
ATOM 1602 C CB  . PHE A 1 205  ? 45.849  55.853 46.978  1.00 67.74  ? 202  PHE A CB  1 
ATOM 1603 C CG  . PHE A 1 205  ? 44.757  55.300 46.094  1.00 67.74  ? 202  PHE A CG  1 
ATOM 1604 C CD1 . PHE A 1 205  ? 44.388  53.955 46.180  1.00 67.74  ? 202  PHE A CD1 1 
ATOM 1605 C CD2 . PHE A 1 205  ? 44.083  56.127 45.187  1.00 67.74  ? 202  PHE A CD2 1 
ATOM 1606 C CE1 . PHE A 1 205  ? 43.384  53.448 45.379  1.00 67.74  ? 202  PHE A CE1 1 
ATOM 1607 C CE2 . PHE A 1 205  ? 43.076  55.626 44.389  1.00 67.74  ? 202  PHE A CE2 1 
ATOM 1608 C CZ  . PHE A 1 205  ? 42.726  54.287 44.483  1.00 67.74  ? 202  PHE A CZ  1 
ATOM 1609 N N   . ASN A 1 206  ? 48.105  57.647 48.164  1.00 70.55  ? 203  ASN A N   1 
ATOM 1610 C CA  . ASN A 1 206  ? 48.353  58.556 49.313  1.00 70.55  ? 203  ASN A CA  1 
ATOM 1611 C C   . ASN A 1 206  ? 47.236  58.390 50.339  1.00 70.55  ? 203  ASN A C   1 
ATOM 1612 O O   . ASN A 1 206  ? 46.409  57.482 50.195  1.00 70.55  ? 203  ASN A O   1 
ATOM 1613 C CB  . ASN A 1 206  ? 48.440  60.017 48.864  1.00 68.11  ? 203  ASN A CB  1 
ATOM 1614 C CG  . ASN A 1 206  ? 49.745  60.324 48.232  1.00 68.11  ? 203  ASN A CG  1 
ATOM 1615 O OD1 . ASN A 1 206  ? 49.866  60.376 47.004  1.00 68.11  ? 203  ASN A OD1 1 
ATOM 1616 N ND2 . ASN A 1 206  ? 50.769  60.496 49.072  1.00 68.11  ? 203  ASN A ND2 1 
ATOM 1617 N N   . LYS A 1 207  ? 47.185  59.233 51.369  1.00 89.77  ? 204  LYS A N   1 
ATOM 1618 C CA  . LYS A 1 207  ? 45.998  59.199 52.206  1.00 89.77  ? 204  LYS A CA  1 
ATOM 1619 C C   . LYS A 1 207  ? 45.145  60.428 51.972  1.00 89.77  ? 204  LYS A C   1 
ATOM 1620 O O   . LYS A 1 207  ? 45.642  61.483 51.582  1.00 89.77  ? 204  LYS A O   1 
ATOM 1621 C CB  . LYS A 1 207  ? 46.316  59.002 53.688  1.00 176.02 ? 204  LYS A CB  1 
ATOM 1622 C CG  . LYS A 1 207  ? 45.162  58.343 54.448  1.00 176.02 ? 204  LYS A CG  1 
ATOM 1623 C CD  . LYS A 1 207  ? 44.938  59.002 55.796  1.00 176.02 ? 204  LYS A CD  1 
ATOM 1624 C CE  . LYS A 1 207  ? 43.463  59.065 56.145  1.00 176.02 ? 204  LYS A CE  1 
ATOM 1625 N NZ  . LYS A 1 207  ? 43.259  60.042 57.237  1.00 176.02 ? 204  LYS A NZ  1 
ATOM 1626 N N   . GLY A 1 208  ? 43.847  60.264 52.197  1.00 91.13  ? 205  GLY A N   1 
ATOM 1627 C CA  . GLY A 1 208  ? 42.901  61.348 52.033  1.00 91.13  ? 205  GLY A CA  1 
ATOM 1628 C C   . GLY A 1 208  ? 42.998  62.301 53.197  1.00 91.13  ? 205  GLY A C   1 
ATOM 1629 O O   . GLY A 1 208  ? 43.651  62.003 54.198  1.00 91.13  ? 205  GLY A O   1 
ATOM 1630 N N   . PRO A 1 209  ? 42.356  63.464 53.075  1.00 77.89  ? 206  PRO A N   1 
ATOM 1631 C CA  . PRO A 1 209  ? 42.367  64.404 54.176  1.00 77.89  ? 206  PRO A CA  1 
ATOM 1632 C C   . PRO A 1 209  ? 41.664  63.940 55.475  1.00 77.89  ? 206  PRO A C   1 
ATOM 1633 O O   . PRO A 1 209  ? 41.793  64.623 56.487  1.00 77.89  ? 206  PRO A O   1 
ATOM 1634 C CB  . PRO A 1 209  ? 41.679  65.643 53.581  1.00 93.84  ? 206  PRO A CB  1 
ATOM 1635 C CG  . PRO A 1 209  ? 41.758  65.454 52.106  1.00 93.84  ? 206  PRO A CG  1 
ATOM 1636 C CD  . PRO A 1 209  ? 41.623  63.996 51.918  1.00 93.84  ? 206  PRO A CD  1 
ATOM 1637 N N   . TRP A 1 210  ? 40.940  62.819 55.489  1.00 65.52  ? 207  TRP A N   1 
ATOM 1638 C CA  . TRP A 1 210  ? 40.388  62.396 56.794  1.00 65.52  ? 207  TRP A CA  1 
ATOM 1639 C C   . TRP A 1 210  ? 40.274  60.954 57.209  1.00 65.52  ? 207  TRP A C   1 
ATOM 1640 O O   . TRP A 1 210  ? 39.820  60.091 56.459  1.00 65.52  ? 207  TRP A O   1 
ATOM 1641 C CB  . TRP A 1 210  ? 39.087  63.121 57.168  1.00 85.44  ? 207  TRP A CB  1 
ATOM 1642 C CG  . TRP A 1 210  ? 38.015  63.181 56.124  1.00 85.44  ? 207  TRP A CG  1 
ATOM 1643 C CD1 . TRP A 1 210  ? 36.979  62.303 55.952  1.00 85.44  ? 207  TRP A CD1 1 
ATOM 1644 C CD2 . TRP A 1 210  ? 37.833  64.218 55.160  1.00 85.44  ? 207  TRP A CD2 1 
ATOM 1645 N NE1 . TRP A 1 210  ? 36.174  62.727 54.920  1.00 85.44  ? 207  TRP A NE1 1 
ATOM 1646 C CE2 . TRP A 1 210  ? 36.679  63.900 54.417  1.00 85.44  ? 207  TRP A CE2 1 
ATOM 1647 C CE3 . TRP A 1 210  ? 38.538  65.386 54.851  1.00 85.44  ? 207  TRP A CE3 1 
ATOM 1648 C CZ2 . TRP A 1 210  ? 36.217  64.703 53.375  1.00 85.44  ? 207  TRP A CZ2 1 
ATOM 1649 C CZ3 . TRP A 1 210  ? 38.081  66.186 53.818  1.00 85.44  ? 207  TRP A CZ3 1 
ATOM 1650 C CH2 . TRP A 1 210  ? 36.930  65.840 53.090  1.00 85.44  ? 207  TRP A CH2 1 
ATOM 1651 N N   . LYS A 1 211  ? 40.679  60.721 58.452  1.00 62.19  ? 208  LYS A N   1 
ATOM 1652 C CA  . LYS A 1 211  ? 40.547  59.435 59.106  1.00 62.19  ? 208  LYS A CA  1 
ATOM 1653 C C   . LYS A 1 211  ? 39.330  58.654 58.594  1.00 62.19  ? 208  LYS A C   1 
ATOM 1654 O O   . LYS A 1 211  ? 38.245  59.220 58.421  1.00 62.19  ? 208  LYS A O   1 
ATOM 1655 C CB  . LYS A 1 211  ? 40.412  59.668 60.614  1.00 99.24  ? 208  LYS A CB  1 
ATOM 1656 C CG  . LYS A 1 211  ? 41.724  59.724 61.399  1.00 99.24  ? 208  LYS A CG  1 
ATOM 1657 C CD  . LYS A 1 211  ? 42.558  60.981 61.148  1.00 99.24  ? 208  LYS A CD  1 
ATOM 1658 C CE  . LYS A 1 211  ? 43.759  60.999 62.086  1.00 99.24  ? 208  LYS A CE  1 
ATOM 1659 N NZ  . LYS A 1 211  ? 45.018  61.417 61.406  1.00 99.24  ? 208  LYS A NZ  1 
ATOM 1660 N N   . GLN A 1 212  ? 39.531  57.367 58.328  1.00 80.27  ? 209  GLN A N   1 
ATOM 1661 C CA  . GLN A 1 212  ? 38.431  56.465 58.056  1.00 80.27  ? 209  GLN A CA  1 
ATOM 1662 C C   . GLN A 1 212  ? 37.470  56.560 59.235  1.00 80.27  ? 209  GLN A C   1 
ATOM 1663 O O   . GLN A 1 212  ? 37.863  56.367 60.387  1.00 80.27  ? 209  GLN A O   1 
ATOM 1664 C CB  . GLN A 1 212  ? 38.926  55.028 57.901  1.00 140.11 ? 209  GLN A CB  1 
ATOM 1665 C CG  . GLN A 1 212  ? 37.811  54.015 57.689  1.00 140.11 ? 209  GLN A CG  1 
ATOM 1666 C CD  . GLN A 1 212  ? 37.923  52.824 58.616  1.00 140.11 ? 209  GLN A CD  1 
ATOM 1667 O OE1 . GLN A 1 212  ? 38.843  52.014 58.496  1.00 140.11 ? 209  GLN A OE1 1 
ATOM 1668 N NE2 . GLN A 1 212  ? 36.981  52.710 59.549  1.00 140.11 ? 209  GLN A NE2 1 
ATOM 1669 N N   . GLU A 1 213  ? 36.214  56.883 58.965  1.00 89.44  ? 210  GLU A N   1 
ATOM 1670 C CA  . GLU A 1 213  ? 35.245  56.893 60.037  1.00 89.44  ? 210  GLU A CA  1 
ATOM 1671 C C   . GLU A 1 213  ? 34.409  55.625 59.995  1.00 89.44  ? 210  GLU A C   1 
ATOM 1672 O O   . GLU A 1 213  ? 34.886  54.579 59.558  1.00 89.44  ? 210  GLU A O   1 
ATOM 1673 C CB  . GLU A 1 213  ? 34.399  58.167 60.004  1.00 126.85 ? 210  GLU A CB  1 
ATOM 1674 C CG  . GLU A 1 213  ? 35.214  59.464 60.143  1.00 126.85 ? 210  GLU A CG  1 
ATOM 1675 C CD  . GLU A 1 213  ? 35.738  59.731 61.556  1.00 126.85 ? 210  GLU A CD  1 
ATOM 1676 O OE1 . GLU A 1 213  ? 35.835  58.790 62.380  1.00 126.85 ? 210  GLU A OE1 1 
ATOM 1677 O OE2 . GLU A 1 213  ? 36.063  60.904 61.838  1.00 126.85 ? 210  GLU A OE2 1 
ATOM 1678 N N   . ASN A 1 214  ? 33.184  55.709 60.494  1.00 112.81 ? 211  ASN A N   1 
ATOM 1679 C CA  . ASN A 1 214  ? 32.229  54.637 60.353  1.00 112.81 ? 211  ASN A CA  1 
ATOM 1680 C C   . ASN A 1 214  ? 30.978  55.192 59.718  1.00 112.81 ? 211  ASN A C   1 
ATOM 1681 O O   . ASN A 1 214  ? 30.814  56.404 59.607  1.00 112.81 ? 211  ASN A O   1 
ATOM 1682 C CB  . ASN A 1 214  ? 31.885  54.034 61.711  1.00 73.82  ? 211  ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 214  ? 32.850  52.916 62.149  1.00 73.82  ? 211  ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 214  ? 33.669  52.412 61.369  1.00 73.82  ? 211  ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 214  ? 32.727  52.517 63.413  1.00 73.82  ? 211  ASN A ND2 1 
ATOM 1686 N N   . VAL A 1 215  ? 30.102  54.291 59.299  1.00 48.83  ? 212  VAL A N   1 
ATOM 1687 C CA  . VAL A 1 215  ? 28.824  54.634 58.669  1.00 48.83  ? 212  VAL A CA  1 
ATOM 1688 C C   . VAL A 1 215  ? 27.936  53.418 58.843  1.00 48.83  ? 212  VAL A C   1 
ATOM 1689 O O   . VAL A 1 215  ? 28.429  52.352 59.204  1.00 48.83  ? 212  VAL A O   1 
ATOM 1690 C CB  . VAL A 1 215  ? 28.960  54.935 57.165  1.00 79.16  ? 212  VAL A CB  1 
ATOM 1691 C CG1 . VAL A 1 215  ? 29.743  56.201 56.930  1.00 79.16  ? 212  VAL A CG1 1 
ATOM 1692 C CG2 . VAL A 1 215  ? 29.597  53.777 56.449  1.00 79.16  ? 212  VAL A CG2 1 
ATOM 1693 N N   . GLU A 1 216  ? 26.642  53.542 58.568  1.00 51.95  ? 213  GLU A N   1 
ATOM 1694 C CA  . GLU A 1 216  ? 25.711  52.446 58.894  1.00 51.95  ? 213  GLU A CA  1 
ATOM 1695 C C   . GLU A 1 216  ? 25.621  51.232 57.959  1.00 51.95  ? 213  GLU A C   1 
ATOM 1696 O O   . GLU A 1 216  ? 25.783  51.311 56.733  1.00 51.95  ? 213  GLU A O   1 
ATOM 1697 C CB  . GLU A 1 216  ? 24.320  52.984 59.171  1.00 51.95  ? 213  GLU A CB  1 
ATOM 1698 C CG  . GLU A 1 216  ? 23.654  53.587 57.972  1.00 51.95  ? 213  GLU A CG  1 
ATOM 1699 C CD  . GLU A 1 216  ? 22.161  53.506 58.086  1.00 51.95  ? 213  GLU A CD  1 
ATOM 1700 O OE1 . GLU A 1 216  ? 21.590  54.524 58.529  1.00 51.95  ? 213  GLU A OE1 1 
ATOM 1701 O OE2 . GLU A 1 216  ? 21.584  52.424 57.757  1.00 51.95  ? 213  GLU A OE2 1 
ATOM 1702 N N   . ALA A 1 217  ? 25.338  50.107 58.610  1.00 61.30  ? 214  ALA A N   1 
ATOM 1703 C CA  . ALA A 1 217  ? 25.146  48.787 58.000  1.00 61.30  ? 214  ALA A CA  1 
ATOM 1704 C C   . ALA A 1 217  ? 24.507  48.771 56.612  1.00 61.30  ? 214  ALA A C   1 
ATOM 1705 O O   . ALA A 1 217  ? 24.834  47.896 55.799  1.00 61.30  ? 214  ALA A O   1 
ATOM 1706 C CB  . ALA A 1 217  ? 24.314  47.913 58.932  1.00 40.64  ? 214  ALA A CB  1 
ATOM 1707 N N   . GLU A 1 218  ? 23.554  49.677 56.357  1.00 67.25  ? 215  GLU A N   1 
ATOM 1708 C CA  . GLU A 1 218  ? 22.939  49.729 55.036  1.00 67.25  ? 215  GLU A CA  1 
ATOM 1709 C C   . GLU A 1 218  ? 23.347  50.978 54.283  1.00 67.25  ? 215  GLU A C   1 
ATOM 1710 O O   . GLU A 1 218  ? 22.786  51.280 53.233  1.00 67.25  ? 215  GLU A O   1 
ATOM 1711 C CB  . GLU A 1 218  ? 21.425  49.530 55.091  1.00 88.21  ? 215  GLU A CB  1 
ATOM 1712 C CG  . GLU A 1 218  ? 20.990  48.070 55.308  1.00 88.21  ? 215  GLU A CG  1 
ATOM 1713 C CD  . GLU A 1 218  ? 21.111  47.162 54.056  1.00 88.21  ? 215  GLU A CD  1 
ATOM 1714 O OE1 . GLU A 1 218  ? 20.910  47.652 52.910  1.00 88.21  ? 215  GLU A OE1 1 
ATOM 1715 O OE2 . GLU A 1 218  ? 21.387  45.938 54.226  1.00 88.21  ? 215  GLU A OE2 1 
ATOM 1716 N N   . ALA A 1 219  ? 24.355  51.674 54.800  1.00 69.20  ? 216  ALA A N   1 
ATOM 1717 C CA  . ALA A 1 219  ? 24.900  52.852 54.128  1.00 69.20  ? 216  ALA A CA  1 
ATOM 1718 C C   . ALA A 1 219  ? 25.283  52.524 52.683  1.00 69.20  ? 216  ALA A C   1 
ATOM 1719 O O   . ALA A 1 219  ? 25.749  51.408 52.400  1.00 69.20  ? 216  ALA A O   1 
ATOM 1720 C CB  . ALA A 1 219  ? 26.080  53.376 54.876  1.00 44.42  ? 216  ALA A CB  1 
ATOM 1721 N N   . SER A 1 220  ? 25.067  53.474 51.764  1.00 44.75  ? 217  SER A N   1 
ATOM 1722 C CA  . SER A 1 220  ? 25.037  53.100 50.370  1.00 44.75  ? 217  SER A CA  1 
ATOM 1723 C C   . SER A 1 220  ? 25.088  54.195 49.324  1.00 44.75  ? 217  SER A C   1 
ATOM 1724 O O   . SER A 1 220  ? 25.223  53.899 48.127  1.00 44.75  ? 217  SER A O   1 
ATOM 1725 C CB  . SER A 1 220  ? 23.807  52.258 50.109  1.00 37.90  ? 217  SER A CB  1 
ATOM 1726 O OG  . SER A 1 220  ? 22.731  53.109 49.927  1.00 37.90  ? 217  SER A OG  1 
ATOM 1727 N N   . MET A 1 221  ? 24.965  55.447 49.709  1.00 41.18  ? 218  MET A N   1 
ATOM 1728 C CA  . MET A 1 221  ? 25.140  56.462 48.697  1.00 41.18  ? 218  MET A CA  1 
ATOM 1729 C C   . MET A 1 221  ? 26.146  57.418 49.232  1.00 41.18  ? 218  MET A C   1 
ATOM 1730 O O   . MET A 1 221  ? 26.116  57.738 50.401  1.00 41.18  ? 218  MET A O   1 
ATOM 1731 C CB  . MET A 1 221  ? 23.832  57.188 48.379  1.00 94.09  ? 218  MET A CB  1 
ATOM 1732 C CG  . MET A 1 221  ? 22.669  56.288 47.965  1.00 94.09  ? 218  MET A CG  1 
ATOM 1733 S SD  . MET A 1 221  ? 21.599  57.105 46.758  1.00 94.09  ? 218  MET A SD  1 
ATOM 1734 C CE  . MET A 1 221  ? 22.219  56.408 45.216  1.00 94.09  ? 218  MET A CE  1 
ATOM 1735 N N   . VAL A 1 222  ? 27.079  57.850 48.406  1.00 55.17  ? 219  VAL A N   1 
ATOM 1736 C CA  . VAL A 1 222  ? 27.954  58.907 48.821  1.00 55.17  ? 219  VAL A CA  1 
ATOM 1737 C C   . VAL A 1 222  ? 27.492  60.055 47.972  1.00 55.17  ? 219  VAL A C   1 
ATOM 1738 O O   . VAL A 1 222  ? 27.126  59.849 46.809  1.00 55.17  ? 219  VAL A O   1 
ATOM 1739 C CB  . VAL A 1 222  ? 29.424  58.605 48.506  1.00 41.47  ? 219  VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 222  ? 30.326  59.842 48.858  1.00 41.47  ? 219  VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 222  ? 29.912  57.290 49.214  1.00 41.47  ? 219  VAL A CG2 1 
ATOM 1742 N N   . ILE A 1 223  ? 27.467  61.254 48.554  1.00 64.39  ? 220  ILE A N   1 
ATOM 1743 C CA  . ILE A 1 223  ? 27.245  62.491 47.809  1.00 64.39  ? 220  ILE A CA  1 
ATOM 1744 C C   . ILE A 1 223  ? 28.363  63.447 48.174  1.00 64.39  ? 220  ILE A C   1 
ATOM 1745 O O   . ILE A 1 223  ? 28.678  63.604 49.343  1.00 64.39  ? 220  ILE A O   1 
ATOM 1746 C CB  . ILE A 1 223  ? 25.934  63.163 48.198  1.00 52.33  ? 220  ILE A CB  1 
ATOM 1747 C CG1 . ILE A 1 223  ? 24.806  62.128 48.330  1.00 52.33  ? 220  ILE A CG1 1 
ATOM 1748 C CG2 . ILE A 1 223  ? 25.652  64.314 47.235  1.00 52.33  ? 220  ILE A CG2 1 
ATOM 1749 C CD1 . ILE A 1 223  ? 23.416  62.700 48.317  1.00 52.33  ? 220  ILE A CD1 1 
ATOM 1750 N N   . ALA A 1 224  ? 28.980  64.071 47.186  1.00 61.94  ? 221  ALA A N   1 
ATOM 1751 C CA  . ALA A 1 224  ? 30.026  65.048 47.472  1.00 61.94  ? 221  ALA A CA  1 
ATOM 1752 C C   . ALA A 1 224  ? 29.430  66.431 47.300  1.00 61.94  ? 221  ALA A C   1 
ATOM 1753 O O   . ALA A 1 224  ? 28.837  66.734 46.270  1.00 61.94  ? 221  ALA A O   1 
ATOM 1754 C CB  . ALA A 1 224  ? 31.241  64.851 46.553  1.00 41.58  ? 221  ALA A CB  1 
ATOM 1755 N N   . VAL A 1 225  ? 29.574  67.266 48.315  1.00 72.79  ? 222  VAL A N   1 
ATOM 1756 C CA  . VAL A 1 225  ? 28.916  68.545 48.288  1.00 72.79  ? 222  VAL A CA  1 
ATOM 1757 C C   . VAL A 1 225  ? 29.865  69.596 47.768  1.00 72.79  ? 222  VAL A C   1 
ATOM 1758 O O   . VAL A 1 225  ? 31.019  69.626 48.141  1.00 72.79  ? 222  VAL A O   1 
ATOM 1759 C CB  . VAL A 1 225  ? 28.311  68.874 49.643  1.00 83.98  ? 222  VAL A CB  1 
ATOM 1760 C CG1 . VAL A 1 225  ? 27.504  70.162 49.576  1.00 83.98  ? 222  VAL A CG1 1 
ATOM 1761 C CG2 . VAL A 1 225  ? 27.422  67.721 50.078  1.00 83.98  ? 222  VAL A CG2 1 
ATOM 1762 N N   . PRO A 1 226  ? 29.386  70.409 46.830  1.00 51.59  ? 223  PRO A N   1 
ATOM 1763 C CA  . PRO A 1 226  ? 30.148  71.409 46.096  1.00 51.59  ? 223  PRO A CA  1 
ATOM 1764 C C   . PRO A 1 226  ? 30.855  72.430 46.961  1.00 51.59  ? 223  PRO A C   1 
ATOM 1765 O O   . PRO A 1 226  ? 30.480  72.664 48.111  1.00 51.59  ? 223  PRO A O   1 
ATOM 1766 C CB  . PRO A 1 226  ? 29.092  72.103 45.233  1.00 75.81  ? 223  PRO A CB  1 
ATOM 1767 C CG  . PRO A 1 226  ? 27.789  71.666 45.747  1.00 75.81  ? 223  PRO A CG  1 
ATOM 1768 C CD  . PRO A 1 226  ? 27.994  70.341 46.348  1.00 75.81  ? 223  PRO A CD  1 
ATOM 1769 N N   . GLU A 1 227  ? 31.877  73.023 46.338  1.00 212.91 ? 224  GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227  ? 32.810  74.031 46.875  1.00 212.91 ? 224  GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227  ? 32.430  74.884 48.090  1.00 212.91 ? 224  GLU A C   1 
ATOM 1772 O O   . GLU A 1 227  ? 33.252  75.033 48.997  1.00 212.91 ? 224  GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227  ? 33.294  74.944 45.738  1.00 118.23 ? 224  GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227  ? 34.643  74.546 45.145  1.00 118.23 ? 224  GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227  ? 35.810  75.226 45.845  1.00 118.23 ? 224  GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227  ? 36.474  74.572 46.679  1.00 118.23 ? 224  GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227  ? 36.050  76.421 45.563  1.00 118.23 ? 224  GLU A OE2 1 
ATOM 1778 N N   . PRO A 1 228  ? 31.221  75.481 48.106  1.00 100.50 ? 225  PRO A N   1 
ATOM 1779 C CA  . PRO A 1 228  ? 30.932  76.281 49.303  1.00 100.50 ? 225  PRO A CA  1 
ATOM 1780 C C   . PRO A 1 228  ? 30.907  75.481 50.619  1.00 100.50 ? 225  PRO A C   1 
ATOM 1781 O O   . PRO A 1 228  ? 31.155  76.064 51.667  1.00 100.50 ? 225  PRO A O   1 
ATOM 1782 C CB  . PRO A 1 228  ? 29.549  76.874 49.010  1.00 112.68 ? 225  PRO A CB  1 
ATOM 1783 C CG  . PRO A 1 228  ? 29.382  76.760 47.523  1.00 112.68 ? 225  PRO A CG  1 
ATOM 1784 C CD  . PRO A 1 228  ? 30.109  75.522 47.137  1.00 112.68 ? 225  PRO A CD  1 
ATOM 1785 N N   . PHE A 1 229  ? 30.649  74.168 50.554  1.00 103.61 ? 226  PHE A N   1 
ATOM 1786 C CA  . PHE A 1 229  ? 30.462  73.320 51.750  1.00 103.61 ? 226  PHE A CA  1 
ATOM 1787 C C   . PHE A 1 229  ? 31.488  72.195 51.937  1.00 103.61 ? 226  PHE A C   1 
ATOM 1788 O O   . PHE A 1 229  ? 31.901  71.912 53.061  1.00 103.61 ? 226  PHE A O   1 
ATOM 1789 C CB  . PHE A 1 229  ? 29.080  72.674 51.728  1.00 146.43 ? 226  PHE A CB  1 
ATOM 1790 C CG  . PHE A 1 229  ? 27.946  73.647 51.676  1.00 146.43 ? 226  PHE A CG  1 
ATOM 1791 C CD1 . PHE A 1 229  ? 27.494  74.145 50.460  1.00 146.43 ? 226  PHE A CD1 1 
ATOM 1792 C CD2 . PHE A 1 229  ? 27.308  74.047 52.843  1.00 146.43 ? 226  PHE A CD2 1 
ATOM 1793 C CE1 . PHE A 1 229  ? 26.432  75.040 50.412  1.00 146.43 ? 226  PHE A CE1 1 
ATOM 1794 C CE2 . PHE A 1 229  ? 26.250  74.936 52.803  1.00 146.43 ? 226  PHE A CE2 1 
ATOM 1795 C CZ  . PHE A 1 229  ? 25.810  75.435 51.584  1.00 146.43 ? 226  PHE A CZ  1 
ATOM 1796 N N   . GLY A 1 230  ? 31.848  71.527 50.838  1.00 61.95  ? 227  GLY A N   1 
ATOM 1797 C CA  . GLY A 1 230  ? 32.754  70.381 50.853  1.00 61.95  ? 227  GLY A CA  1 
ATOM 1798 C C   . GLY A 1 230  ? 32.160  69.173 51.529  1.00 61.95  ? 227  GLY A C   1 
ATOM 1799 O O   . GLY A 1 230  ? 31.038  69.203 51.981  1.00 61.95  ? 227  GLY A O   1 
ATOM 1800 N N   . GLY A 1 231  ? 32.927  68.098 51.599  1.00 52.52  ? 228  GLY A N   1 
ATOM 1801 C CA  . GLY A 1 231  ? 32.530  66.929 52.384  1.00 52.52  ? 228  GLY A CA  1 
ATOM 1802 C C   . GLY A 1 231  ? 31.520  65.991 51.721  1.00 52.52  ? 228  GLY A C   1 
ATOM 1803 O O   . GLY A 1 231  ? 31.126  66.201 50.570  1.00 52.52  ? 228  GLY A O   1 
ATOM 1804 N N   . ALA A 1 232  ? 31.100  64.970 52.467  1.00 64.86  ? 229  ALA A N   1 
ATOM 1805 C CA  . ALA A 1 232  ? 30.255  63.921 51.930  1.00 64.86  ? 229  ALA A CA  1 
ATOM 1806 C C   . ALA A 1 232  ? 28.980  63.746 52.701  1.00 64.86  ? 229  ALA A C   1 
ATOM 1807 O O   . ALA A 1 232  ? 28.982  63.666 53.921  1.00 64.86  ? 229  ALA A O   1 
ATOM 1808 C CB  . ALA A 1 232  ? 31.013  62.567 51.856  1.00 46.23  ? 229  ALA A CB  1 
ATOM 1809 N N   . ILE A 1 233  ? 27.885  63.659 51.964  1.00 53.04  ? 230  ILE A N   1 
ATOM 1810 C CA  . ILE A 1 233  ? 26.632  63.247 52.546  1.00 53.04  ? 230  ILE A CA  1 
ATOM 1811 C C   . ILE A 1 233  ? 26.573  61.764 52.261  1.00 53.04  ? 230  ILE A C   1 
ATOM 1812 O O   . ILE A 1 233  ? 26.826  61.366 51.138  1.00 53.04  ? 230  ILE A O   1 
ATOM 1813 C CB  . ILE A 1 233  ? 25.461  63.996 51.935  1.00 72.53  ? 230  ILE A CB  1 
ATOM 1814 C CG1 . ILE A 1 233  ? 25.480  65.432 52.434  1.00 72.53  ? 230  ILE A CG1 1 
ATOM 1815 C CG2 . ILE A 1 233  ? 24.164  63.374 52.352  1.00 72.53  ? 230  ILE A CG2 1 
ATOM 1816 C CD1 . ILE A 1 233  ? 24.469  66.322 51.746  1.00 72.53  ? 230  ILE A CD1 1 
ATOM 1817 N N   . ILE A 1 234  ? 26.290  60.967 53.286  1.00 49.68  ? 231  ILE A N   1 
ATOM 1818 C CA  . ILE A 1 234  ? 26.242  59.519 53.201  1.00 49.68  ? 231  ILE A CA  1 
ATOM 1819 C C   . ILE A 1 234  ? 24.846  59.087 53.634  1.00 49.68  ? 231  ILE A C   1 
ATOM 1820 O O   . ILE A 1 234  ? 24.416  59.434 54.738  1.00 49.68  ? 231  ILE A O   1 
ATOM 1821 C CB  . ILE A 1 234  ? 27.287  58.845 54.172  1.00 41.19  ? 231  ILE A CB  1 
ATOM 1822 C CG1 . ILE A 1 234  ? 28.733  58.982 53.660  1.00 41.19  ? 231  ILE A CG1 1 
ATOM 1823 C CG2 . ILE A 1 234  ? 27.004  57.347 54.324  1.00 41.19  ? 231  ILE A CG2 1 
ATOM 1824 C CD1 . ILE A 1 234  ? 29.232  60.377 53.617  1.00 41.19  ? 231  ILE A CD1 1 
ATOM 1825 N N   . ILE A 1 235  ? 24.147  58.302 52.810  1.00 58.60  ? 232  ILE A N   1 
ATOM 1826 C CA  . ILE A 1 235  ? 22.756  57.979 53.106  1.00 58.60  ? 232  ILE A CA  1 
ATOM 1827 C C   . ILE A 1 235  ? 22.521  56.521 53.434  1.00 58.60  ? 232  ILE A C   1 
ATOM 1828 O O   . ILE A 1 235  ? 22.695  55.636 52.583  1.00 58.60  ? 232  ILE A O   1 
ATOM 1829 C CB  . ILE A 1 235  ? 21.809  58.408 51.957  1.00 57.81  ? 232  ILE A CB  1 
ATOM 1830 C CG1 . ILE A 1 235  ? 22.043  59.881 51.606  1.00 57.81  ? 232  ILE A CG1 1 
ATOM 1831 C CG2 . ILE A 1 235  ? 20.322  58.120 52.323  1.00 57.81  ? 232  ILE A CG2 1 
ATOM 1832 C CD1 . ILE A 1 235  ? 21.144  60.408 50.540  1.00 57.81  ? 232  ILE A CD1 1 
ATOM 1833 N N   . GLY A 1 236  ? 22.090  56.271 54.661  1.00 48.55  ? 233  GLY A N   1 
ATOM 1834 C CA  . GLY A 1 236  ? 21.777  54.911 55.090  1.00 48.55  ? 233  GLY A CA  1 
ATOM 1835 C C   . GLY A 1 236  ? 20.324  54.578 54.846  1.00 48.55  ? 233  GLY A C   1 
ATOM 1836 O O   . GLY A 1 236  ? 19.657  55.307 54.102  1.00 48.55  ? 233  GLY A O   1 
ATOM 1837 N N   . GLN A 1 237  ? 19.864  53.455 55.420  1.00 64.68  ? 234  GLN A N   1 
ATOM 1838 C CA  . GLN A 1 237  ? 18.444  53.224 55.696  1.00 64.68  ? 234  GLN A CA  1 
ATOM 1839 C C   . GLN A 1 237  ? 18.088  53.942 56.997  1.00 64.68  ? 234  GLN A C   1 
ATOM 1840 O O   . GLN A 1 237  ? 18.969  54.229 57.798  1.00 64.68  ? 234  GLN A O   1 
ATOM 1841 C CB  . GLN A 1 237  ? 18.118  51.736 55.796  1.00 80.88  ? 234  GLN A CB  1 
ATOM 1842 C CG  . GLN A 1 237  ? 17.294  51.191 54.614  1.00 80.88  ? 234  GLN A CG  1 
ATOM 1843 C CD  . GLN A 1 237  ? 15.812  51.675 54.599  1.00 80.88  ? 234  GLN A CD  1 
ATOM 1844 O OE1 . GLN A 1 237  ? 15.506  52.893 54.526  1.00 80.88  ? 234  GLN A OE1 1 
ATOM 1845 N NE2 . GLN A 1 237  ? 14.891  50.707 54.659  1.00 80.88  ? 234  GLN A NE2 1 
ATOM 1846 N N   . GLU A 1 238  ? 16.819  54.280 57.202  1.00 131.18 ? 235  GLU A N   1 
ATOM 1847 C CA  . GLU A 1 238  ? 16.400  55.071 58.391  1.00 131.18 ? 235  GLU A CA  1 
ATOM 1848 C C   . GLU A 1 238  ? 17.350  56.195 58.880  1.00 131.18 ? 235  GLU A C   1 
ATOM 1849 O O   . GLU A 1 238  ? 17.158  56.728 59.979  1.00 131.18 ? 235  GLU A O   1 
ATOM 1850 C CB  . GLU A 1 238  ? 15.964  54.167 59.577  1.00 118.12 ? 235  GLU A CB  1 
ATOM 1851 C CG  . GLU A 1 238  ? 16.742  52.859 59.801  1.00 118.12 ? 235  GLU A CG  1 
ATOM 1852 C CD  . GLU A 1 238  ? 17.966  53.013 60.697  1.00 118.12 ? 235  GLU A CD  1 
ATOM 1853 O OE1 . GLU A 1 238  ? 18.598  54.090 60.692  1.00 118.12 ? 235  GLU A OE1 1 
ATOM 1854 O OE2 . GLU A 1 238  ? 18.306  52.041 61.408  1.00 118.12 ? 235  GLU A OE2 1 
ATOM 1855 N N   . SER A 1 239  ? 18.341  56.569 58.064  1.00 84.95  ? 236  SER A N   1 
ATOM 1856 C CA  . SER A 1 239  ? 19.351  57.536 58.487  1.00 84.95  ? 236  SER A CA  1 
ATOM 1857 C C   . SER A 1 239  ? 20.246  58.146 57.387  1.00 84.95  ? 236  SER A C   1 
ATOM 1858 O O   . SER A 1 239  ? 20.403  57.571 56.318  1.00 84.95  ? 236  SER A O   1 
ATOM 1859 C CB  . SER A 1 239  ? 20.213  56.884 59.541  1.00 45.57  ? 236  SER A CB  1 
ATOM 1860 O OG  . SER A 1 239  ? 21.586  57.021 59.201  1.00 45.57  ? 236  SER A OG  1 
ATOM 1861 N N   . ILE A 1 240  ? 20.849  59.297 57.693  1.00 64.61  ? 237  ILE A N   1 
ATOM 1862 C CA  . ILE A 1 240  ? 21.594  60.129 56.743  1.00 64.61  ? 237  ILE A CA  1 
ATOM 1863 C C   . ILE A 1 240  ? 22.631  60.889 57.558  1.00 64.61  ? 237  ILE A C   1 
ATOM 1864 O O   . ILE A 1 240  ? 22.338  61.286 58.688  1.00 64.61  ? 237  ILE A O   1 
ATOM 1865 C CB  . ILE A 1 240  ? 20.698  61.251 56.145  1.00 51.70  ? 237  ILE A CB  1 
ATOM 1866 C CG1 . ILE A 1 240  ? 19.591  60.702 55.261  1.00 51.70  ? 237  ILE A CG1 1 
ATOM 1867 C CG2 . ILE A 1 240  ? 21.522  62.353 55.388  1.00 51.70  ? 237  ILE A CG2 1 
ATOM 1868 C CD1 . ILE A 1 240  ? 18.834  61.803 54.617  1.00 51.70  ? 237  ILE A CD1 1 
ATOM 1869 N N   . THR A 1 241  ? 23.825  61.109 57.006  1.00 97.66  ? 238  THR A N   1 
ATOM 1870 C CA  . THR A 1 241  ? 24.886  61.786 57.754  1.00 97.66  ? 238  THR A CA  1 
ATOM 1871 C C   . THR A 1 241  ? 25.813  62.635 56.879  1.00 97.66  ? 238  THR A C   1 
ATOM 1872 O O   . THR A 1 241  ? 25.759  62.578 55.660  1.00 97.66  ? 238  THR A O   1 
ATOM 1873 C CB  . THR A 1 241  ? 25.730  60.804 58.659  1.00 78.24  ? 238  THR A CB  1 
ATOM 1874 O OG1 . THR A 1 241  ? 26.976  60.502 58.031  1.00 78.24  ? 238  THR A OG1 1 
ATOM 1875 C CG2 . THR A 1 241  ? 24.976  59.494 58.991  1.00 78.24  ? 238  THR A CG2 1 
ATOM 1876 N N   . TYR A 1 242  ? 26.650  63.440 57.524  1.00 85.28  ? 239  TYR A N   1 
ATOM 1877 C CA  . TYR A 1 242  ? 27.593  64.322 56.843  1.00 85.28  ? 239  TYR A CA  1 
ATOM 1878 C C   . TYR A 1 242  ? 28.970  64.181 57.441  1.00 85.28  ? 239  TYR A C   1 
ATOM 1879 O O   . TYR A 1 242  ? 29.137  63.925 58.641  1.00 85.28  ? 239  TYR A O   1 
ATOM 1880 C CB  . TYR A 1 242  ? 27.161  65.782 56.938  1.00 64.12  ? 239  TYR A CB  1 
ATOM 1881 C CG  . TYR A 1 242  ? 28.097  66.797 56.303  1.00 64.12  ? 239  TYR A CG  1 
ATOM 1882 C CD1 . TYR A 1 242  ? 28.155  66.960 54.924  1.00 64.12  ? 239  TYR A CD1 1 
ATOM 1883 C CD2 . TYR A 1 242  ? 28.891  67.617 57.082  1.00 64.12  ? 239  TYR A CD2 1 
ATOM 1884 C CE1 . TYR A 1 242  ? 29.003  67.899 54.336  1.00 64.12  ? 239  TYR A CE1 1 
ATOM 1885 C CE2 . TYR A 1 242  ? 29.738  68.576 56.502  1.00 64.12  ? 239  TYR A CE2 1 
ATOM 1886 C CZ  . TYR A 1 242  ? 29.783  68.699 55.133  1.00 64.12  ? 239  TYR A CZ  1 
ATOM 1887 O OH  . TYR A 1 242  ? 30.608  69.629 54.560  1.00 64.12  ? 239  TYR A OH  1 
ATOM 1888 N N   . HIS A 1 243  ? 29.958  64.369 56.582  1.00 56.88  ? 240  HIS A N   1 
ATOM 1889 C CA  . HIS A 1 243  ? 31.319  64.176 56.950  1.00 56.88  ? 240  HIS A CA  1 
ATOM 1890 C C   . HIS A 1 243  ? 32.109  65.245 56.277  1.00 56.88  ? 240  HIS A C   1 
ATOM 1891 O O   . HIS A 1 243  ? 31.915  65.529 55.095  1.00 56.88  ? 240  HIS A O   1 
ATOM 1892 C CB  . HIS A 1 243  ? 31.781  62.816 56.466  1.00 68.72  ? 240  HIS A CB  1 
ATOM 1893 C CG  . HIS A 1 243  ? 31.190  61.680 57.230  1.00 68.72  ? 240  HIS A CG  1 
ATOM 1894 N ND1 . HIS A 1 243  ? 31.702  61.250 58.435  1.00 68.72  ? 240  HIS A ND1 1 
ATOM 1895 C CD2 . HIS A 1 243  ? 30.132  60.880 56.963  1.00 68.72  ? 240  HIS A CD2 1 
ATOM 1896 C CE1 . HIS A 1 243  ? 30.985  60.229 58.874  1.00 68.72  ? 240  HIS A CE1 1 
ATOM 1897 N NE2 . HIS A 1 243  ? 30.026  59.983 57.998  1.00 68.72  ? 240  HIS A NE2 1 
ATOM 1898 N N   . ASN A 1 244  ? 32.970  65.871 57.061  1.00 98.93  ? 241  ASN A N   1 
ATOM 1899 C CA  . ASN A 1 244  ? 34.089  66.641 56.551  1.00 98.93  ? 241  ASN A CA  1 
ATOM 1900 C C   . ASN A 1 244  ? 35.142  66.549 57.627  1.00 98.93  ? 241  ASN A C   1 
ATOM 1901 O O   . ASN A 1 244  ? 34.822  66.122 58.751  1.00 98.93  ? 241  ASN A O   1 
ATOM 1902 C CB  . ASN A 1 244  ? 33.712  68.090 56.270  1.00 85.58  ? 241  ASN A CB  1 
ATOM 1903 C CG  . ASN A 1 244  ? 34.652  68.737 55.293  1.00 85.58  ? 241  ASN A CG  1 
ATOM 1904 O OD1 . ASN A 1 244  ? 35.852  68.455 55.304  1.00 85.58  ? 241  ASN A OD1 1 
ATOM 1905 N ND2 . ASN A 1 244  ? 34.124  69.603 54.431  1.00 85.58  ? 241  ASN A ND2 1 
ATOM 1906 N N   . GLY A 1 245  ? 36.386  66.911 57.291  1.00 118.77 ? 242  GLY A N   1 
ATOM 1907 C CA  . GLY A 1 245  ? 37.524  66.753 58.201  1.00 118.77 ? 242  GLY A CA  1 
ATOM 1908 C C   . GLY A 1 245  ? 37.133  66.226 59.574  1.00 118.77 ? 242  GLY A C   1 
ATOM 1909 O O   . GLY A 1 245  ? 37.177  65.010 59.828  1.00 118.77 ? 242  GLY A O   1 
ATOM 1910 N N   . ASP A 1 246  ? 36.717  67.153 60.440  1.00 99.79  ? 243  ASP A N   1 
ATOM 1911 C CA  . ASP A 1 246  ? 36.341  66.852 61.816  1.00 99.79  ? 243  ASP A CA  1 
ATOM 1912 C C   . ASP A 1 246  ? 34.826  66.843 62.009  1.00 99.79  ? 243  ASP A C   1 
ATOM 1913 O O   . ASP A 1 246  ? 34.323  66.307 63.006  1.00 99.79  ? 243  ASP A O   1 
ATOM 1914 C CB  . ASP A 1 246  ? 36.975  67.879 62.765  1.00 187.93 ? 243  ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 246  ? 38.446  68.149 62.452  1.00 187.93 ? 243  ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 246  ? 38.922  69.271 62.728  1.00 187.93 ? 243  ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 246  ? 39.131  67.248 61.929  1.00 187.93 ? 243  ASP A OD2 1 
ATOM 1918 N N   . LYS A 1 247  ? 34.111  67.439 61.050  1.00 61.52  ? 244  LYS A N   1 
ATOM 1919 C CA  . LYS A 1 247  ? 32.644  67.613 61.143  1.00 61.52  ? 244  LYS A CA  1 
ATOM 1920 C C   . LYS A 1 247  ? 31.858  66.338 60.883  1.00 61.52  ? 244  LYS A C   1 
ATOM 1921 O O   . LYS A 1 247  ? 32.141  65.606 59.920  1.00 61.52  ? 244  LYS A O   1 
ATOM 1922 C CB  . LYS A 1 247  ? 32.146  68.721 60.209  1.00 58.37  ? 244  LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 247  ? 30.747  69.230 60.581  1.00 58.37  ? 244  LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 247  ? 30.785  70.492 61.508  1.00 58.37  ? 244  LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 247  ? 29.430  70.769 62.234  1.00 58.37  ? 244  LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 247  ? 28.981  69.602 63.122  1.00 58.37  ? 244  LYS A NZ  1 
ATOM 1927 N N   . TYR A 1 248  ? 30.872  66.100 61.753  1.00 56.27  ? 245  TYR A N   1 
ATOM 1928 C CA  . TYR A 1 248  ? 29.967  64.949 61.663  1.00 56.27  ? 245  TYR A CA  1 
ATOM 1929 C C   . TYR A 1 248  ? 28.535  65.368 61.999  1.00 56.27  ? 245  TYR A C   1 
ATOM 1930 O O   . TYR A 1 248  ? 28.261  65.687 63.134  1.00 56.27  ? 245  TYR A O   1 
ATOM 1931 C CB  . TYR A 1 248  ? 30.396  63.859 62.633  1.00 79.04  ? 245  TYR A CB  1 
ATOM 1932 C CG  . TYR A 1 248  ? 29.455  62.688 62.649  1.00 79.04  ? 245  TYR A CG  1 
ATOM 1933 C CD1 . TYR A 1 248  ? 29.600  61.658 61.735  1.00 79.04  ? 245  TYR A CD1 1 
ATOM 1934 C CD2 . TYR A 1 248  ? 28.417  62.603 63.570  1.00 79.04  ? 245  TYR A CD2 1 
ATOM 1935 C CE1 . TYR A 1 248  ? 28.747  60.554 61.731  1.00 79.04  ? 245  TYR A CE1 1 
ATOM 1936 C CE2 . TYR A 1 248  ? 27.541  61.499 63.581  1.00 79.04  ? 245  TYR A CE2 1 
ATOM 1937 C CZ  . TYR A 1 248  ? 27.719  60.478 62.651  1.00 79.04  ? 245  TYR A CZ  1 
ATOM 1938 O OH  . TYR A 1 248  ? 26.884  59.378 62.616  1.00 79.04  ? 245  TYR A OH  1 
ATOM 1939 N N   . LEU A 1 249  ? 27.623  65.364 61.035  1.00 66.27  ? 246  LEU A N   1 
ATOM 1940 C CA  . LEU A 1 249  ? 26.219  65.696 61.313  1.00 66.27  ? 246  LEU A CA  1 
ATOM 1941 C C   . LEU A 1 249  ? 25.342  64.501 61.002  1.00 66.27  ? 246  LEU A C   1 
ATOM 1942 O O   . LEU A 1 249  ? 25.630  63.777 60.084  1.00 66.27  ? 246  LEU A O   1 
ATOM 1943 C CB  . LEU A 1 249  ? 25.771  66.901 60.486  1.00 86.13  ? 246  LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 249  ? 26.072  68.271 61.098  1.00 86.13  ? 246  LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 249  ? 25.772  69.374 60.098  1.00 86.13  ? 246  LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 249  ? 25.285  68.491 62.402  1.00 86.13  ? 246  LEU A CD2 1 
ATOM 1947 N N   . ALA A 1 250  ? 24.268  64.282 61.740  1.00 69.73  ? 247  ALA A N   1 
ATOM 1948 C CA  . ALA A 1 250  ? 23.491  63.073 61.515  1.00 69.73  ? 247  ALA A CA  1 
ATOM 1949 C C   . ALA A 1 250  ? 21.989  63.286 61.732  1.00 69.73  ? 247  ALA A C   1 
ATOM 1950 O O   . ALA A 1 250  ? 21.604  64.217 62.424  1.00 69.73  ? 247  ALA A O   1 
ATOM 1951 C CB  . ALA A 1 250  ? 24.032  61.957 62.403  1.00 30.83  ? 247  ALA A CB  1 
ATOM 1952 N N   . ILE A 1 251  ? 21.153  62.457 61.115  1.00 84.97  ? 248  ILE A N   1 
ATOM 1953 C CA  . ILE A 1 251  ? 19.698  62.526 61.309  1.00 84.97  ? 248  ILE A CA  1 
ATOM 1954 C C   . ILE A 1 251  ? 19.014  61.204 61.040  1.00 84.97  ? 248  ILE A C   1 
ATOM 1955 O O   . ILE A 1 251  ? 19.297  60.525 60.041  1.00 84.97  ? 248  ILE A O   1 
ATOM 1956 C CB  . ILE A 1 251  ? 18.969  63.580 60.411  1.00 65.07  ? 248  ILE A CB  1 
ATOM 1957 C CG1 . ILE A 1 251  ? 19.776  63.898 59.141  1.00 65.07  ? 248  ILE A CG1 1 
ATOM 1958 C CG2 . ILE A 1 251  ? 18.571  64.832 61.230  1.00 65.07  ? 248  ILE A CG2 1 
ATOM 1959 C CD1 . ILE A 1 251  ? 18.916  64.438 57.957  1.00 65.07  ? 248  ILE A CD1 1 
ATOM 1960 N N   . ALA A 1 252  ? 18.080  60.860 61.912  1.00 70.88  ? 249  ALA A N   1 
ATOM 1961 C CA  . ALA A 1 252  ? 17.372  59.617 61.755  1.00 70.88  ? 249  ALA A CA  1 
ATOM 1962 C C   . ALA A 1 252  ? 15.844  59.809 61.707  1.00 70.88  ? 249  ALA A C   1 
ATOM 1963 O O   . ALA A 1 252  ? 15.121  59.326 62.617  1.00 70.88  ? 249  ALA A O   1 
ATOM 1964 C CB  . ALA A 1 252  ? 17.783  58.637 62.847  1.00 45.09  ? 249  ALA A CB  1 
ATOM 1965 N N   . PRO A 1 253  ? 15.345  60.500 60.644  1.00 55.97  ? 250  PRO A N   1 
ATOM 1966 C CA  . PRO A 1 253  ? 13.919  60.677 60.498  1.00 55.97  ? 250  PRO A CA  1 
ATOM 1967 C C   . PRO A 1 253  ? 13.289  59.337 60.207  1.00 55.97  ? 250  PRO A C   1 
ATOM 1968 O O   . PRO A 1 253  ? 13.701  58.653 59.250  1.00 55.97  ? 250  PRO A O   1 
ATOM 1969 C CB  . PRO A 1 253  ? 13.804  61.565 59.260  1.00 66.99  ? 250  PRO A CB  1 
ATOM 1970 C CG  . PRO A 1 253  ? 15.016  61.248 58.478  1.00 66.99  ? 250  PRO A CG  1 
ATOM 1971 C CD  . PRO A 1 253  ? 16.069  61.137 59.531  1.00 66.99  ? 250  PRO A CD  1 
ATOM 1972 N N   . PRO A 1 254  ? 12.291  58.956 61.017  1.00 90.34  ? 251  PRO A N   1 
ATOM 1973 C CA  . PRO A 1 254  ? 11.539  57.717 60.814  1.00 90.34  ? 251  PRO A CA  1 
ATOM 1974 C C   . PRO A 1 254  ? 10.870  57.749 59.459  1.00 90.34  ? 251  PRO A C   1 
ATOM 1975 O O   . PRO A 1 254  ? 10.585  56.697 58.893  1.00 90.34  ? 251  PRO A O   1 
ATOM 1976 C CB  . PRO A 1 254  ? 10.468  57.751 61.909  1.00 68.92  ? 251  PRO A CB  1 
ATOM 1977 C CG  . PRO A 1 254  ? 10.954  58.755 62.924  1.00 68.92  ? 251  PRO A CG  1 
ATOM 1978 C CD  . PRO A 1 254  ? 11.827  59.727 62.183  1.00 68.92  ? 251  PRO A CD  1 
ATOM 1979 N N   . ILE A 1 255  ? 10.634  58.953 58.943  1.00 81.95  ? 252  ILE A N   1 
ATOM 1980 C CA  . ILE A 1 255  ? 9.969   59.125 57.650  1.00 81.95  ? 252  ILE A CA  1 
ATOM 1981 C C   . ILE A 1 255  ? 10.734  58.446 56.494  1.00 81.95  ? 252  ILE A C   1 
ATOM 1982 O O   . ILE A 1 255  ? 10.116  58.024 55.503  1.00 81.95  ? 252  ILE A O   1 
ATOM 1983 C CB  . ILE A 1 255  ? 9.683   60.604 57.349  1.00 45.72  ? 252  ILE A CB  1 
ATOM 1984 C CG1 . ILE A 1 255  ? 8.583   60.754 56.311  1.00 45.72  ? 252  ILE A CG1 1 
ATOM 1985 C CG2 . ILE A 1 255  ? 10.917  61.335 56.894  1.00 45.72  ? 252  ILE A CG2 1 
ATOM 1986 C CD1 . ILE A 1 255  ? 8.280   62.262 55.985  1.00 45.72  ? 252  ILE A CD1 1 
ATOM 1987 N N   . ILE A 1 256  ? 12.060  58.318 56.628  1.00 55.95  ? 253  ILE A N   1 
ATOM 1988 C CA  . ILE A 1 256  ? 12.812  57.539 55.652  1.00 55.95  ? 253  ILE A CA  1 
ATOM 1989 C C   . ILE A 1 256  ? 12.900  56.064 55.990  1.00 55.95  ? 253  ILE A C   1 
ATOM 1990 O O   . ILE A 1 256  ? 13.116  55.261 55.108  1.00 55.95  ? 253  ILE A O   1 
ATOM 1991 C CB  . ILE A 1 256  ? 14.205  58.147 55.323  1.00 47.57  ? 253  ILE A CB  1 
ATOM 1992 C CG1 . ILE A 1 256  ? 15.278  57.717 56.358  1.00 47.57  ? 253  ILE A CG1 1 
ATOM 1993 C CG2 . ILE A 1 256  ? 14.054  59.700 55.055  1.00 47.57  ? 253  ILE A CG2 1 
ATOM 1994 C CD1 . ILE A 1 256  ? 16.558  58.606 56.378  1.00 47.57  ? 253  ILE A CD1 1 
ATOM 1995 N N   . LYS A 1 257  ? 12.705  55.699 57.243  1.00 65.80  ? 254  LYS A N   1 
ATOM 1996 C CA  . LYS A 1 257  ? 12.838  54.308 57.643  1.00 65.80  ? 254  LYS A CA  1 
ATOM 1997 C C   . LYS A 1 257  ? 12.119  53.340 56.704  1.00 65.80  ? 254  LYS A C   1 
ATOM 1998 O O   . LYS A 1 257  ? 12.653  52.271 56.422  1.00 65.80  ? 254  LYS A O   1 
ATOM 1999 C CB  . LYS A 1 257  ? 12.339  54.124 59.085  1.00 94.65  ? 254  LYS A CB  1 
ATOM 2000 C CG  . LYS A 1 257  ? 12.862  52.893 59.839  1.00 94.65  ? 254  LYS A CG  1 
ATOM 2001 C CD  . LYS A 1 257  ? 12.698  53.079 61.361  1.00 94.65  ? 254  LYS A CD  1 
ATOM 2002 C CE  . LYS A 1 257  ? 12.996  51.797 62.135  1.00 94.65  ? 254  LYS A CE  1 
ATOM 2003 N NZ  . LYS A 1 257  ? 14.335  51.209 61.806  1.00 94.65  ? 254  LYS A NZ  1 
ATOM 2004 N N   . GLN A 1 258  ? 10.928  53.701 56.210  1.00 59.57  ? 255  GLN A N   1 
ATOM 2005 C CA  . GLN A 1 258  ? 10.049  52.701 55.556  1.00 59.57  ? 255  GLN A CA  1 
ATOM 2006 C C   . GLN A 1 258  ? 10.541  52.250 54.194  1.00 59.57  ? 255  GLN A C   1 
ATOM 2007 O O   . GLN A 1 258  ? 10.124  51.212 53.676  1.00 59.57  ? 255  GLN A O   1 
ATOM 2008 C CB  . GLN A 1 258  ? 8.595   53.172 55.437  1.00 118.50 ? 255  GLN A CB  1 
ATOM 2009 C CG  . GLN A 1 258  ? 7.837   53.273 56.747  1.00 118.50 ? 255  GLN A CG  1 
ATOM 2010 C CD  . GLN A 1 258  ? 7.605   54.712 57.167  1.00 118.50 ? 255  GLN A CD  1 
ATOM 2011 O OE1 . GLN A 1 258  ? 8.371   55.614 56.805  1.00 118.50 ? 255  GLN A OE1 1 
ATOM 2012 N NE2 . GLN A 1 258  ? 6.536   54.938 57.926  1.00 118.50 ? 255  GLN A NE2 1 
ATOM 2013 N N   . SER A 1 259  ? 11.411  53.050 53.602  1.00 62.21  ? 256  SER A N   1 
ATOM 2014 C CA  . SER A 1 259  ? 11.952  52.675 52.323  1.00 62.21  ? 256  SER A CA  1 
ATOM 2015 C C   . SER A 1 259  ? 13.340  53.215 52.117  1.00 62.21  ? 256  SER A C   1 
ATOM 2016 O O   . SER A 1 259  ? 13.681  54.274 52.640  1.00 62.21  ? 256  SER A O   1 
ATOM 2017 C CB  . SER A 1 259  ? 11.032  53.115 51.199  1.00 60.47  ? 256  SER A CB  1 
ATOM 2018 O OG  . SER A 1 259  ? 11.000  52.137 50.161  1.00 60.47  ? 256  SER A OG  1 
ATOM 2019 N N   . THR A 1 260  ? 14.130  52.463 51.350  1.00 67.01  ? 257  THR A N   1 
ATOM 2020 C CA  . THR A 1 260  ? 15.516  52.799 51.078  1.00 67.01  ? 257  THR A CA  1 
ATOM 2021 C C   . THR A 1 260  ? 15.530  53.949 50.125  1.00 67.01  ? 257  THR A C   1 
ATOM 2022 O O   . THR A 1 260  ? 14.817  53.943 49.127  1.00 67.01  ? 257  THR A O   1 
ATOM 2023 C CB  . THR A 1 260  ? 16.268  51.644 50.383  1.00 63.28  ? 257  THR A CB  1 
ATOM 2024 O OG1 . THR A 1 260  ? 15.890  50.397 50.977  1.00 63.28  ? 257  THR A OG1 1 
ATOM 2025 C CG2 . THR A 1 260  ? 17.776  51.839 50.508  1.00 63.28  ? 257  THR A CG2 1 
ATOM 2026 N N   . ILE A 1 261  ? 16.354  54.940 50.422  1.00 48.61  ? 258  ILE A N   1 
ATOM 2027 C CA  . ILE A 1 261  ? 16.567  56.004 49.467  1.00 48.61  ? 258  ILE A CA  1 
ATOM 2028 C C   . ILE A 1 261  ? 17.278  55.335 48.321  1.00 48.61  ? 258  ILE A C   1 
ATOM 2029 O O   . ILE A 1 261  ? 17.733  54.229 48.468  1.00 48.61  ? 258  ILE A O   1 
ATOM 2030 C CB  . ILE A 1 261  ? 17.274  57.157 50.110  1.00 40.97  ? 258  ILE A CB  1 
ATOM 2031 C CG1 . ILE A 1 261  ? 16.277  57.807 51.078  1.00 40.97  ? 258  ILE A CG1 1 
ATOM 2032 C CG2 . ILE A 1 261  ? 17.758  58.161 49.074  1.00 40.97  ? 258  ILE A CG2 1 
ATOM 2033 C CD1 . ILE A 1 261  ? 16.648  59.205 51.538  1.00 40.97  ? 258  ILE A CD1 1 
ATOM 2034 N N   . VAL A 1 262  ? 17.318  55.923 47.146  1.00 46.07  ? 259  VAL A N   1 
ATOM 2035 C CA  . VAL A 1 262  ? 17.650  55.101 45.984  1.00 46.07  ? 259  VAL A CA  1 
ATOM 2036 C C   . VAL A 1 262  ? 18.277  55.919 44.901  1.00 46.07  ? 259  VAL A C   1 
ATOM 2037 O O   . VAL A 1 262  ? 18.927  55.370 44.037  1.00 46.07  ? 259  VAL A O   1 
ATOM 2038 C CB  . VAL A 1 262  ? 16.382  54.293 45.515  1.00 35.85  ? 259  VAL A CB  1 
ATOM 2039 C CG1 . VAL A 1 262  ? 15.880  54.660 44.130  1.00 35.85  ? 259  VAL A CG1 1 
ATOM 2040 C CG2 . VAL A 1 262  ? 16.613  52.832 45.651  1.00 35.85  ? 259  VAL A CG2 1 
ATOM 2041 N N   . CYS A 1 263  ? 18.059  57.231 44.960  1.00 59.78  ? 260  CYS A N   1 
ATOM 2042 C CA  . CYS A 1 263  ? 18.717  58.214 44.096  1.00 59.78  ? 260  CYS A CA  1 
ATOM 2043 C C   . CYS A 1 263  ? 18.664  59.549 44.755  1.00 59.78  ? 260  CYS A C   1 
ATOM 2044 O O   . CYS A 1 263  ? 17.719  59.856 45.445  1.00 59.78  ? 260  CYS A O   1 
ATOM 2045 C CB  . CYS A 1 263  ? 18.008  58.364 42.766  1.00 45.12  ? 260  CYS A CB  1 
ATOM 2046 S SG  . CYS A 1 263  ? 16.229  58.073 42.827  1.00 45.12  ? 260  CYS A SG  1 
ATOM 2047 N N   . HIS A 1 264  ? 19.687  60.342 44.515  1.00 42.64  ? 261  HIS A N   1 
ATOM 2048 C CA  . HIS A 1 264  ? 19.723  61.712 44.940  1.00 42.64  ? 261  HIS A CA  1 
ATOM 2049 C C   . HIS A 1 264  ? 19.950  62.531 43.706  1.00 42.64  ? 261  HIS A C   1 
ATOM 2050 O O   . HIS A 1 264  ? 20.283  61.986 42.659  1.00 42.64  ? 261  HIS A O   1 
ATOM 2051 C CB  . HIS A 1 264  ? 20.914  61.890 45.840  1.00 54.23  ? 261  HIS A CB  1 
ATOM 2052 C CG  . HIS A 1 264  ? 22.144  61.256 45.301  1.00 54.23  ? 261  HIS A CG  1 
ATOM 2053 N ND1 . HIS A 1 264  ? 23.040  61.939 44.508  1.00 54.23  ? 261  HIS A ND1 1 
ATOM 2054 C CD2 . HIS A 1 264  ? 22.596  59.982 45.386  1.00 54.23  ? 261  HIS A CD2 1 
ATOM 2055 C CE1 . HIS A 1 264  ? 24.008  61.113 44.154  1.00 54.23  ? 261  HIS A CE1 1 
ATOM 2056 N NE2 . HIS A 1 264  ? 23.759  59.919 44.666  1.00 54.23  ? 261  HIS A NE2 1 
ATOM 2057 N N   . ASN A 1 265  ? 19.806  63.834 43.812  1.00 43.86  ? 262  ASN A N   1 
ATOM 2058 C CA  . ASN A 1 265  ? 20.163  64.724 42.734  1.00 43.86  ? 262  ASN A CA  1 
ATOM 2059 C C   . ASN A 1 265  ? 20.234  66.103 43.379  1.00 43.86  ? 262  ASN A C   1 
ATOM 2060 O O   . ASN A 1 265  ? 19.428  66.400 44.271  1.00 43.86  ? 262  ASN A O   1 
ATOM 2061 C CB  . ASN A 1 265  ? 19.113  64.678 41.648  1.00 59.08  ? 262  ASN A CB  1 
ATOM 2062 C CG  . ASN A 1 265  ? 19.167  65.892 40.730  1.00 59.08  ? 262  ASN A CG  1 
ATOM 2063 O OD1 . ASN A 1 265  ? 19.867  65.883 39.712  1.00 59.08  ? 262  ASN A OD1 1 
ATOM 2064 N ND2 . ASN A 1 265  ? 18.434  66.945 41.085  1.00 59.08  ? 262  ASN A ND2 1 
ATOM 2065 N N   . ARG A 1 266  ? 21.210  66.927 42.987  1.00 47.76  ? 263  ARG A N   1 
ATOM 2066 C CA  . ARG A 1 266  ? 21.403  68.221 43.604  1.00 47.76  ? 263  ARG A CA  1 
ATOM 2067 C C   . ARG A 1 266  ? 20.477  69.193 42.889  1.00 47.76  ? 263  ARG A C   1 
ATOM 2068 O O   . ARG A 1 266  ? 20.278  69.084 41.696  1.00 47.76  ? 263  ARG A O   1 
ATOM 2069 C CB  . ARG A 1 266  ? 22.865  68.615 43.471  1.00 55.99  ? 263  ARG A CB  1 
ATOM 2070 C CG  . ARG A 1 266  ? 23.192  70.064 43.789  1.00 55.99  ? 263  ARG A CG  1 
ATOM 2071 C CD  . ARG A 1 266  ? 24.587  70.291 44.365  1.00 55.99  ? 263  ARG A CD  1 
ATOM 2072 N NE  . ARG A 1 266  ? 25.593  69.477 43.712  1.00 55.99  ? 263  ARG A NE  1 
ATOM 2073 C CZ  . ARG A 1 266  ? 25.992  69.609 42.448  1.00 55.99  ? 263  ARG A CZ  1 
ATOM 2074 N NH1 . ARG A 1 266  ? 25.496  70.550 41.651  1.00 55.99  ? 263  ARG A NH1 1 
ATOM 2075 N NH2 . ARG A 1 266  ? 26.909  68.781 41.975  1.00 55.99  ? 263  ARG A NH2 1 
ATOM 2076 N N   . VAL A 1 267  ? 19.893  70.129 43.622  1.00 48.82  ? 264  VAL A N   1 
ATOM 2077 C CA  . VAL A 1 267  ? 18.948  71.098 43.064  1.00 48.82  ? 264  VAL A CA  1 
ATOM 2078 C C   . VAL A 1 267  ? 19.662  72.427 42.855  1.00 48.82  ? 264  VAL A C   1 
ATOM 2079 O O   . VAL A 1 267  ? 19.566  73.073 41.785  1.00 48.82  ? 264  VAL A O   1 
ATOM 2080 C CB  . VAL A 1 267  ? 17.751  71.343 44.059  1.00 67.22  ? 264  VAL A CB  1 
ATOM 2081 C CG1 . VAL A 1 267  ? 16.900  72.534 43.642  1.00 67.22  ? 264  VAL A CG1 1 
ATOM 2082 C CG2 . VAL A 1 267  ? 16.887  70.111 44.177  1.00 67.22  ? 264  VAL A CG2 1 
ATOM 2083 N N   . ASP A 1 268  ? 20.348  72.832 43.911  1.00 70.66  ? 265  ASP A N   1 
ATOM 2084 C CA  . ASP A 1 268  ? 20.986  74.110 43.955  1.00 70.66  ? 265  ASP A CA  1 
ATOM 2085 C C   . ASP A 1 268  ? 22.479  73.841 43.845  1.00 70.66  ? 265  ASP A C   1 
ATOM 2086 O O   . ASP A 1 268  ? 23.014  73.000 44.558  1.00 70.66  ? 265  ASP A O   1 
ATOM 2087 C CB  . ASP A 1 268  ? 20.660  74.829 45.284  1.00 66.53  ? 265  ASP A CB  1 
ATOM 2088 C CG  . ASP A 1 268  ? 19.155  75.113 45.474  1.00 66.53  ? 265  ASP A CG  1 
ATOM 2089 O OD1 . ASP A 1 268  ? 18.529  75.717 44.563  1.00 66.53  ? 265  ASP A OD1 1 
ATOM 2090 O OD2 . ASP A 1 268  ? 18.615  74.758 46.554  1.00 66.53  ? 265  ASP A OD2 1 
ATOM 2091 N N   . PRO A 1 269  ? 23.159  74.558 42.952  1.00 64.30  ? 266  PRO A N   1 
ATOM 2092 C CA  . PRO A 1 269  ? 24.588  74.371 42.763  1.00 64.30  ? 266  PRO A CA  1 
ATOM 2093 C C   . PRO A 1 269  ? 25.378  74.402 44.052  1.00 64.30  ? 266  PRO A C   1 
ATOM 2094 O O   . PRO A 1 269  ? 26.319  73.647 44.213  1.00 64.30  ? 266  PRO A O   1 
ATOM 2095 C CB  . PRO A 1 269  ? 24.976  75.557 41.895  1.00 44.97  ? 266  PRO A CB  1 
ATOM 2096 C CG  . PRO A 1 269  ? 23.749  75.794 41.050  1.00 44.97  ? 266  PRO A CG  1 
ATOM 2097 C CD  . PRO A 1 269  ? 22.608  75.581 42.046  1.00 44.97  ? 266  PRO A CD  1 
ATOM 2098 N N   . ASN A 1 270  ? 25.003  75.274 44.964  1.00 53.38  ? 267  ASN A N   1 
ATOM 2099 C CA  . ASN A 1 270  ? 25.690  75.356 46.236  1.00 53.38  ? 267  ASN A CA  1 
ATOM 2100 C C   . ASN A 1 270  ? 25.498  74.035 46.973  1.00 53.38  ? 267  ASN A C   1 
ATOM 2101 O O   . ASN A 1 270  ? 26.363  73.607 47.765  1.00 53.38  ? 267  ASN A O   1 
ATOM 2102 C CB  . ASN A 1 270  ? 25.139  76.522 47.066  1.00 75.39  ? 267  ASN A CB  1 
ATOM 2103 C CG  . ASN A 1 270  ? 23.655  76.348 47.412  1.00 75.39  ? 267  ASN A CG  1 
ATOM 2104 O OD1 . ASN A 1 270  ? 22.913  75.655 46.697  1.00 75.39  ? 267  ASN A OD1 1 
ATOM 2105 N ND2 . ASN A 1 270  ? 23.220  76.968 48.518  1.00 75.39  ? 267  ASN A ND2 1 
ATOM 2106 N N   . GLY A 1 271  ? 24.369  73.377 46.707  1.00 54.81  ? 268  GLY A N   1 
ATOM 2107 C CA  . GLY A 1 271  ? 24.028  72.152 47.429  1.00 54.81  ? 268  GLY A CA  1 
ATOM 2108 C C   . GLY A 1 271  ? 23.322  72.434 48.742  1.00 54.81  ? 268  GLY A C   1 
ATOM 2109 O O   . GLY A 1 271  ? 23.274  71.575 49.648  1.00 54.81  ? 268  GLY A O   1 
ATOM 2110 N N   . SER A 1 272  ? 22.769  73.639 48.861  1.00 78.98  ? 269  SER A N   1 
ATOM 2111 C CA  . SER A 1 272  ? 21.871  73.897 49.964  1.00 78.98  ? 269  SER A CA  1 
ATOM 2112 C C   . SER A 1 272  ? 20.789  72.840 49.880  1.00 78.98  ? 269  SER A C   1 
ATOM 2113 O O   . SER A 1 272  ? 20.411  72.266 50.896  1.00 78.98  ? 269  SER A O   1 
ATOM 2114 C CB  . SER A 1 272  ? 21.271  75.298 49.910  1.00 89.74  ? 269  SER A CB  1 
ATOM 2115 O OG  . SER A 1 272  ? 20.253  75.388 48.930  1.00 89.74  ? 269  SER A OG  1 
ATOM 2116 N N   . ARG A 1 273  ? 20.335  72.553 48.658  1.00 66.78  ? 270  ARG A N   1 
ATOM 2117 C CA  . ARG A 1 273  ? 19.258  71.572 48.443  1.00 66.78  ? 270  ARG A CA  1 
ATOM 2118 C C   . ARG A 1 273  ? 19.607  70.340 47.598  1.00 66.78  ? 270  ARG A C   1 
ATOM 2119 O O   . ARG A 1 273  ? 20.395  70.415 46.654  1.00 66.78  ? 270  ARG A O   1 
ATOM 2120 C CB  . ARG A 1 273  ? 18.009  72.257 47.867  1.00 59.27  ? 270  ARG A CB  1 
ATOM 2121 C CG  . ARG A 1 273  ? 17.238  73.118 48.890  1.00 59.27  ? 270  ARG A CG  1 
ATOM 2122 C CD  . ARG A 1 273  ? 15.935  73.655 48.369  1.00 59.27  ? 270  ARG A CD  1 
ATOM 2123 N NE  . ARG A 1 273  ? 16.094  74.172 47.026  1.00 59.27  ? 270  ARG A NE  1 
ATOM 2124 C CZ  . ARG A 1 273  ? 15.128  74.777 46.355  1.00 59.27  ? 270  ARG A CZ  1 
ATOM 2125 N NH1 . ARG A 1 273  ? 13.931  74.968 46.921  1.00 59.27  ? 270  ARG A NH1 1 
ATOM 2126 N NH2 . ARG A 1 273  ? 15.365  75.198 45.123  1.00 59.27  ? 270  ARG A NH2 1 
ATOM 2127 N N   . TYR A 1 274  ? 18.982  69.215 47.956  1.00 46.07  ? 271  TYR A N   1 
ATOM 2128 C CA  . TYR A 1 274  ? 19.113  67.917 47.264  1.00 46.07  ? 271  TYR A CA  1 
ATOM 2129 C C   . TYR A 1 274  ? 17.761  67.204 47.246  1.00 46.07  ? 271  TYR A C   1 
ATOM 2130 O O   . TYR A 1 274  ? 16.993  67.323 48.198  1.00 46.07  ? 271  TYR A O   1 
ATOM 2131 C CB  . TYR A 1 274  ? 20.120  67.019 47.992  1.00 62.78  ? 271  TYR A CB  1 
ATOM 2132 C CG  . TYR A 1 274  ? 21.562  67.290 47.654  1.00 62.78  ? 271  TYR A CG  1 
ATOM 2133 C CD1 . TYR A 1 274  ? 22.310  68.197 48.398  1.00 62.78  ? 271  TYR A CD1 1 
ATOM 2134 C CD2 . TYR A 1 274  ? 22.181  66.643 46.582  1.00 62.78  ? 271  TYR A CD2 1 
ATOM 2135 C CE1 . TYR A 1 274  ? 23.649  68.456 48.098  1.00 62.78  ? 271  TYR A CE1 1 
ATOM 2136 C CE2 . TYR A 1 274  ? 23.511  66.906 46.253  1.00 62.78  ? 271  TYR A CE2 1 
ATOM 2137 C CZ  . TYR A 1 274  ? 24.240  67.815 47.021  1.00 62.78  ? 271  TYR A CZ  1 
ATOM 2138 O OH  . TYR A 1 274  ? 25.549  68.084 46.720  1.00 62.78  ? 271  TYR A OH  1 
ATOM 2139 N N   . LEU A 1 275  ? 17.493  66.471 46.163  1.00 46.06  ? 272  LEU A N   1 
ATOM 2140 C CA  . LEU A 1 275  ? 16.327  65.580 45.995  1.00 46.06  ? 272  LEU A CA  1 
ATOM 2141 C C   . LEU A 1 275  ? 16.683  64.118 46.283  1.00 46.06  ? 272  LEU A C   1 
ATOM 2142 O O   . LEU A 1 275  ? 17.717  63.661 45.862  1.00 46.06  ? 272  LEU A O   1 
ATOM 2143 C CB  . LEU A 1 275  ? 15.838  65.647 44.543  1.00 46.72  ? 272  LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 275  ? 15.160  66.939 44.079  1.00 46.72  ? 272  LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 275  ? 14.844  66.943 42.577  1.00 46.72  ? 272  LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 275  ? 13.899  67.205 44.894  1.00 46.72  ? 272  LEU A CD2 1 
ATOM 2147 N N   . LEU A 1 276  ? 15.830  63.376 46.971  1.00 49.70  ? 273  LEU A N   1 
ATOM 2148 C CA  . LEU A 1 276  ? 16.088  61.982 47.219  1.00 49.70  ? 273  LEU A CA  1 
ATOM 2149 C C   . LEU A 1 276  ? 14.884  61.179 46.787  1.00 49.70  ? 273  LEU A C   1 
ATOM 2150 O O   . LEU A 1 276  ? 13.783  61.595 47.015  1.00 49.70  ? 273  LEU A O   1 
ATOM 2151 C CB  . LEU A 1 276  ? 16.389  61.763 48.691  1.00 62.33  ? 273  LEU A CB  1 
ATOM 2152 C CG  . LEU A 1 276  ? 17.419  62.716 49.325  1.00 62.33  ? 273  LEU A CG  1 
ATOM 2153 C CD1 . LEU A 1 276  ? 17.586  62.516 50.827  1.00 62.33  ? 273  LEU A CD1 1 
ATOM 2154 C CD2 . LEU A 1 276  ? 18.764  62.616 48.643  1.00 62.33  ? 273  LEU A CD2 1 
ATOM 2155 N N   . GLY A 1 277  ? 15.089  60.052 46.110  1.00 50.09  ? 274  GLY A N   1 
ATOM 2156 C CA  . GLY A 1 277  ? 14.009  59.126 45.737  1.00 50.09  ? 274  GLY A CA  1 
ATOM 2157 C C   . GLY A 1 277  ? 14.104  57.804 46.500  1.00 50.09  ? 274  GLY A C   1 
ATOM 2158 O O   . GLY A 1 277  ? 15.123  57.514 47.151  1.00 50.09  ? 274  GLY A O   1 
ATOM 2159 N N   . ASP A 1 278  ? 13.077  56.971 46.370  1.00 45.37  ? 275  ASP A N   1 
ATOM 2160 C CA  . ASP A 1 278  ? 12.791  55.927 47.318  1.00 45.37  ? 275  ASP A CA  1 
ATOM 2161 C C   . ASP A 1 278  ? 12.331  54.648 46.600  1.00 45.37  ? 275  ASP A C   1 
ATOM 2162 O O   . ASP A 1 278  ? 11.722  54.755 45.541  1.00 45.37  ? 275  ASP A O   1 
ATOM 2163 C CB  . ASP A 1 278  ? 11.601  56.456 48.098  1.00 86.36  ? 275  ASP A CB  1 
ATOM 2164 C CG  . ASP A 1 278  ? 11.494  55.879 49.461  1.00 86.36  ? 275  ASP A CG  1 
ATOM 2165 O OD1 . ASP A 1 278  ? 10.756  56.478 50.271  1.00 86.36  ? 275  ASP A OD1 1 
ATOM 2166 O OD2 . ASP A 1 278  ? 12.134  54.843 49.741  1.00 86.36  ? 275  ASP A OD2 1 
ATOM 2167 N N   . MET A 1 279  ? 12.515  53.449 47.175  1.00 40.72  ? 276  MET A N   1 
ATOM 2168 C CA  . MET A 1 279  ? 11.884  52.247 46.577  1.00 40.72  ? 276  MET A CA  1 
ATOM 2169 C C   . MET A 1 279  ? 10.379  52.468 46.438  1.00 40.72  ? 276  MET A C   1 
ATOM 2170 O O   . MET A 1 279  ? 9.704   51.719 45.722  1.00 40.72  ? 276  MET A O   1 
ATOM 2171 C CB  . MET A 1 279  ? 12.158  50.958 47.384  1.00 100.72 ? 276  MET A CB  1 
ATOM 2172 C CG  . MET A 1 279  ? 11.447  49.647 46.834  1.00 100.72 ? 276  MET A CG  1 
ATOM 2173 S SD  . MET A 1 279  ? 9.807   49.068 47.486  1.00 100.72 ? 276  MET A SD  1 
ATOM 2174 C CE  . MET A 1 279  ? 10.193  47.426 48.140  1.00 100.72 ? 276  MET A CE  1 
ATOM 2175 N N   . GLU A 1 280  ? 9.868   53.490 47.135  1.00 54.19  ? 277  GLU A N   1 
ATOM 2176 C CA  . GLU A 1 280  ? 8.434   53.763 47.256  1.00 54.19  ? 277  GLU A CA  1 
ATOM 2177 C C   . GLU A 1 280  ? 7.845   54.734 46.226  1.00 54.19  ? 277  GLU A C   1 
ATOM 2178 O O   . GLU A 1 280  ? 6.646   54.695 45.949  1.00 54.19  ? 277  GLU A O   1 
ATOM 2179 C CB  . GLU A 1 280  ? 8.112   54.338 48.633  1.00 126.04 ? 277  GLU A CB  1 
ATOM 2180 C CG  . GLU A 1 280  ? 8.306   53.410 49.803  1.00 126.04 ? 277  GLU A CG  1 
ATOM 2181 C CD  . GLU A 1 280  ? 7.506   52.134 49.720  1.00 126.04 ? 277  GLU A CD  1 
ATOM 2182 O OE1 . GLU A 1 280  ? 6.714   51.971 48.767  1.00 126.04 ? 277  GLU A OE1 1 
ATOM 2183 O OE2 . GLU A 1 280  ? 7.682   51.289 50.625  1.00 126.04 ? 277  GLU A OE2 1 
ATOM 2184 N N   . GLY A 1 281  ? 8.660   55.636 45.698  1.00 48.82  ? 278  GLY A N   1 
ATOM 2185 C CA  . GLY A 1 281  ? 8.126   56.698 44.850  1.00 48.82  ? 278  GLY A CA  1 
ATOM 2186 C C   . GLY A 1 281  ? 8.084   58.046 45.547  1.00 48.82  ? 278  GLY A C   1 
ATOM 2187 O O   . GLY A 1 281  ? 7.888   59.066 44.908  1.00 48.82  ? 278  GLY A O   1 
ATOM 2188 N N   . ARG A 1 282  ? 8.283   58.030 46.862  1.00 36.08  ? 279  ARG A N   1 
ATOM 2189 C CA  . ARG A 1 282  ? 8.299   59.229 47.715  1.00 36.08  ? 279  ARG A CA  1 
ATOM 2190 C C   . ARG A 1 282  ? 9.451   60.092 47.335  1.00 36.08  ? 279  ARG A C   1 
ATOM 2191 O O   . ARG A 1 282  ? 10.517  59.599 46.961  1.00 36.08  ? 279  ARG A O   1 
ATOM 2192 C CB  . ARG A 1 282  ? 8.348   58.861 49.199  1.00 66.76  ? 279  ARG A CB  1 
ATOM 2193 C CG  . ARG A 1 282  ? 7.083   58.116 49.613  1.00 66.76  ? 279  ARG A CG  1 
ATOM 2194 C CD  . ARG A 1 282  ? 6.958   57.990 51.109  1.00 66.76  ? 279  ARG A CD  1 
ATOM 2195 N NE  . ARG A 1 282  ? 7.698   56.850 51.657  1.00 66.76  ? 279  ARG A NE  1 
ATOM 2196 C CZ  . ARG A 1 282  ? 8.203   56.829 52.883  1.00 66.76  ? 279  ARG A CZ  1 
ATOM 2197 N NH1 . ARG A 1 282  ? 8.052   57.879 53.681  1.00 66.76  ? 279  ARG A NH1 1 
ATOM 2198 N NH2 . ARG A 1 282  ? 8.861   55.769 53.313  1.00 66.76  ? 279  ARG A NH2 1 
ATOM 2199 N N   . LEU A 1 283  ? 9.229   61.392 47.361  1.00 49.65  ? 280  LEU A N   1 
ATOM 2200 C CA  . LEU A 1 283  ? 10.238  62.296 46.886  1.00 49.65  ? 280  LEU A CA  1 
ATOM 2201 C C   . LEU A 1 283  ? 10.596  63.102 48.078  1.00 49.65  ? 280  LEU A C   1 
ATOM 2202 O O   . LEU A 1 283  ? 9.720   63.700 48.682  1.00 49.65  ? 280  LEU A O   1 
ATOM 2203 C CB  . LEU A 1 283  ? 9.676   63.173 45.787  1.00 41.55  ? 280  LEU A CB  1 
ATOM 2204 C CG  . LEU A 1 283  ? 10.722  64.069 45.134  1.00 41.55  ? 280  LEU A CG  1 
ATOM 2205 C CD1 . LEU A 1 283  ? 11.773  63.245 44.373  1.00 41.55  ? 280  LEU A CD1 1 
ATOM 2206 C CD2 . LEU A 1 283  ? 10.140  65.182 44.224  1.00 41.55  ? 280  LEU A CD2 1 
ATOM 2207 N N   . PHE A 1 284  ? 11.858  63.089 48.465  1.00 60.02  ? 281  PHE A N   1 
ATOM 2208 C CA  . PHE A 1 284  ? 12.265  63.864 49.604  1.00 60.02  ? 281  PHE A CA  1 
ATOM 2209 C C   . PHE A 1 284  ? 13.028  65.032 49.114  1.00 60.02  ? 281  PHE A C   1 
ATOM 2210 O O   . PHE A 1 284  ? 13.306  65.131 47.923  1.00 60.02  ? 281  PHE A O   1 
ATOM 2211 C CB  . PHE A 1 284  ? 13.068  63.023 50.576  1.00 57.66  ? 281  PHE A CB  1 
ATOM 2212 C CG  . PHE A 1 284  ? 12.279  61.896 51.154  1.00 57.66  ? 281  PHE A CG  1 
ATOM 2213 C CD1 . PHE A 1 284  ? 12.388  60.615 50.634  1.00 57.66  ? 281  PHE A CD1 1 
ATOM 2214 C CD2 . PHE A 1 284  ? 11.368  62.128 52.186  1.00 57.66  ? 281  PHE A CD2 1 
ATOM 2215 C CE1 . PHE A 1 284  ? 11.629  59.560 51.162  1.00 57.66  ? 281  PHE A CE1 1 
ATOM 2216 C CE2 . PHE A 1 284  ? 10.604  61.106 52.714  1.00 57.66  ? 281  PHE A CE2 1 
ATOM 2217 C CZ  . PHE A 1 284  ? 10.734  59.809 52.203  1.00 57.66  ? 281  PHE A CZ  1 
ATOM 2218 N N   . MET A 1 285  ? 13.295  65.953 50.030  1.00 44.06  ? 282  MET A N   1 
ATOM 2219 C CA  . MET A 1 285  ? 14.070  67.143 49.763  1.00 44.06  ? 282  MET A CA  1 
ATOM 2220 C C   . MET A 1 285  ? 14.990  67.148 50.940  1.00 44.06  ? 282  MET A C   1 
ATOM 2221 O O   . MET A 1 285  ? 14.523  66.971 52.077  1.00 44.06  ? 282  MET A O   1 
ATOM 2222 C CB  . MET A 1 285  ? 13.206  68.381 49.746  1.00 63.26  ? 282  MET A CB  1 
ATOM 2223 C CG  . MET A 1 285  ? 13.997  69.654 49.711  1.00 63.26  ? 282  MET A CG  1 
ATOM 2224 S SD  . MET A 1 285  ? 14.920  69.929 48.173  1.00 63.26  ? 282  MET A SD  1 
ATOM 2225 C CE  . MET A 1 285  ? 13.646  70.478 47.031  1.00 63.26  ? 282  MET A CE  1 
ATOM 2226 N N   . LEU A 1 286  ? 16.293  67.288 50.684  1.00 57.52  ? 283  LEU A N   1 
ATOM 2227 C CA  . LEU A 1 286  ? 17.285  67.147 51.733  1.00 57.52  ? 283  LEU A CA  1 
ATOM 2228 C C   . LEU A 1 286  ? 17.957  68.461 51.837  1.00 57.52  ? 283  LEU A C   1 
ATOM 2229 O O   . LEU A 1 286  ? 18.670  68.884 50.908  1.00 57.52  ? 283  LEU A O   1 
ATOM 2230 C CB  . LEU A 1 286  ? 18.324  66.093 51.380  1.00 52.45  ? 283  LEU A CB  1 
ATOM 2231 C CG  . LEU A 1 286  ? 19.326  65.538 52.419  1.00 52.45  ? 283  LEU A CG  1 
ATOM 2232 C CD1 . LEU A 1 286  ? 20.683  65.380 51.727  1.00 52.45  ? 283  LEU A CD1 1 
ATOM 2233 C CD2 . LEU A 1 286  ? 19.488  66.385 53.682  1.00 52.45  ? 283  LEU A CD2 1 
ATOM 2234 N N   . LEU A 1 287  ? 17.729  69.138 52.953  1.00 57.62  ? 284  LEU A N   1 
ATOM 2235 C CA  . LEU A 1 287  ? 18.168  70.524 53.009  1.00 57.62  ? 284  LEU A CA  1 
ATOM 2236 C C   . LEU A 1 287  ? 19.343  70.628 53.941  1.00 57.62  ? 284  LEU A C   1 
ATOM 2237 O O   . LEU A 1 287  ? 19.414  69.950 54.979  1.00 57.62  ? 284  LEU A O   1 
ATOM 2238 C CB  . LEU A 1 287  ? 17.034  71.511 53.346  1.00 64.65  ? 284  LEU A CB  1 
ATOM 2239 C CG  . LEU A 1 287  ? 15.735  71.312 52.544  1.00 64.65  ? 284  LEU A CG  1 
ATOM 2240 C CD1 . LEU A 1 287  ? 14.701  70.583 53.390  1.00 64.65  ? 284  LEU A CD1 1 
ATOM 2241 C CD2 . LEU A 1 287  ? 15.144  72.612 51.964  1.00 64.65  ? 284  LEU A CD2 1 
ATOM 2242 N N   . LEU A 1 288  ? 20.284  71.448 53.495  1.00 70.40  ? 285  LEU A N   1 
ATOM 2243 C CA  . LEU A 1 288  ? 21.433  71.807 54.255  1.00 70.40  ? 285  LEU A CA  1 
ATOM 2244 C C   . LEU A 1 288  ? 21.167  73.163 54.878  1.00 70.40  ? 285  LEU A C   1 
ATOM 2245 O O   . LEU A 1 288  ? 21.496  74.219 54.301  1.00 70.40  ? 285  LEU A O   1 
ATOM 2246 C CB  . LEU A 1 288  ? 22.663  71.834 53.356  1.00 71.80  ? 285  LEU A CB  1 
ATOM 2247 C CG  . LEU A 1 288  ? 23.137  70.457 52.868  1.00 71.80  ? 285  LEU A CG  1 
ATOM 2248 C CD1 . LEU A 1 288  ? 24.569  70.544 52.347  1.00 71.80  ? 285  LEU A CD1 1 
ATOM 2249 C CD2 . LEU A 1 288  ? 23.030  69.382 53.966  1.00 71.80  ? 285  LEU A CD2 1 
ATOM 2250 N N   . GLU A 1 289  ? 20.586  73.159 56.073  1.00 74.43  ? 286  GLU A N   1 
ATOM 2251 C CA  . GLU A 1 289  ? 20.303  74.407 56.774  1.00 74.43  ? 286  GLU A CA  1 
ATOM 2252 C C   . GLU A 1 289  ? 21.484  75.367 56.646  1.00 74.43  ? 286  GLU A C   1 
ATOM 2253 O O   . GLU A 1 289  ? 22.620  75.011 56.960  1.00 74.43  ? 286  GLU A O   1 
ATOM 2254 C CB  . GLU A 1 289  ? 19.998  74.137 58.248  1.00 94.65  ? 286  GLU A CB  1 
ATOM 2255 C CG  . GLU A 1 289  ? 19.620  75.376 59.042  1.00 94.65  ? 286  GLU A CG  1 
ATOM 2256 C CD  . GLU A 1 289  ? 18.318  75.994 58.572  1.00 94.65  ? 286  GLU A CD  1 
ATOM 2257 O OE1 . GLU A 1 289  ? 17.586  75.333 57.805  1.00 94.65  ? 286  GLU A OE1 1 
ATOM 2258 O OE2 . GLU A 1 289  ? 18.024  77.141 58.971  1.00 94.65  ? 286  GLU A OE2 1 
ATOM 2259 N N   . LYS A 1 290  ? 21.210  76.583 56.183  1.00 77.93  ? 287  LYS A N   1 
ATOM 2260 C CA  . LYS A 1 290  ? 22.250  77.592 56.001  1.00 77.93  ? 287  LYS A CA  1 
ATOM 2261 C C   . LYS A 1 290  ? 22.957  77.942 57.309  1.00 77.93  ? 287  LYS A C   1 
ATOM 2262 O O   . LYS A 1 290  ? 22.617  77.416 58.370  1.00 77.93  ? 287  LYS A O   1 
ATOM 2263 C CB  . LYS A 1 290  ? 21.663  78.857 55.369  1.00 86.10  ? 287  LYS A CB  1 
ATOM 2264 C CG  . LYS A 1 290  ? 21.049  78.636 53.996  1.00 86.10  ? 287  LYS A CG  1 
ATOM 2265 C CD  . LYS A 1 290  ? 20.501  79.932 53.422  1.00 86.10  ? 287  LYS A CD  1 
ATOM 2266 C CE  . LYS A 1 290  ? 19.895  79.714 52.046  1.00 86.10  ? 287  LYS A CE  1 
ATOM 2267 N NZ  . LYS A 1 290  ? 19.355  80.976 51.469  1.00 86.10  ? 287  LYS A NZ  1 
ATOM 2268 N N   . GLU A 1 291  ? 23.941  78.833 57.225  1.00 172.64 ? 288  GLU A N   1 
ATOM 2269 C CA  . GLU A 1 291  ? 24.699  79.256 58.399  1.00 172.64 ? 288  GLU A CA  1 
ATOM 2270 C C   . GLU A 1 291  ? 26.038  79.856 57.979  1.00 172.64 ? 288  GLU A C   1 
ATOM 2271 O O   . GLU A 1 291  ? 26.542  79.561 56.895  1.00 172.64 ? 288  GLU A O   1 
ATOM 2272 C CB  . GLU A 1 291  ? 24.923  78.077 59.348  1.00 114.94 ? 288  GLU A CB  1 
ATOM 2273 C CG  . GLU A 1 291  ? 25.704  78.431 60.603  1.00 114.94 ? 288  GLU A CG  1 
ATOM 2274 C CD  . GLU A 1 291  ? 25.903  77.240 61.520  1.00 114.94 ? 288  GLU A CD  1 
ATOM 2275 O OE1 . GLU A 1 291  ? 25.432  76.137 61.174  1.00 114.94 ? 288  GLU A OE1 1 
ATOM 2276 O OE2 . GLU A 1 291  ? 26.531  77.408 62.586  1.00 114.94 ? 288  GLU A OE2 1 
ATOM 2277 N N   . GLU A 1 292  ? 26.613  80.699 58.833  1.00 201.26 ? 289  GLU A N   1 
ATOM 2278 C CA  . GLU A 1 292  ? 27.892  81.330 58.520  1.00 201.26 ? 289  GLU A CA  1 
ATOM 2279 C C   . GLU A 1 292  ? 28.540  82.020 59.720  1.00 201.26 ? 289  GLU A C   1 
ATOM 2280 O O   . GLU A 1 292  ? 28.055  81.925 60.848  1.00 201.26 ? 289  GLU A O   1 
ATOM 2281 C CB  . GLU A 1 292  ? 27.726  82.329 57.372  1.00 199.38 ? 289  GLU A CB  1 
ATOM 2282 C CG  . GLU A 1 292  ? 29.010  83.041 56.978  1.00 199.38 ? 289  GLU A CG  1 
ATOM 2283 C CD  . GLU A 1 292  ? 28.805  84.025 55.844  1.00 199.38 ? 289  GLU A CD  1 
ATOM 2284 O OE1 . GLU A 1 292  ? 27.659  84.150 55.363  1.00 199.38 ? 289  GLU A OE1 1 
ATOM 2285 O OE2 . GLU A 1 292  ? 29.790  84.674 55.432  1.00 199.38 ? 289  GLU A OE2 1 
ATOM 2286 N N   . GLN A 1 293  ? 29.643  82.714 59.456  1.00 206.94 ? 290  GLN A N   1 
ATOM 2287 C CA  . GLN A 1 293  ? 30.391  83.431 60.479  1.00 206.94 ? 290  GLN A CA  1 
ATOM 2288 C C   . GLN A 1 293  ? 31.282  84.496 59.828  1.00 206.94 ? 290  GLN A C   1 
ATOM 2289 O O   . GLN A 1 293  ? 32.494  84.323 59.679  1.00 206.94 ? 290  GLN A O   1 
ATOM 2290 C CB  . GLN A 1 293  ? 31.143  82.465 61.416  1.00 106.21 ? 290  GLN A CB  1 
ATOM 2291 C CG  . GLN A 1 293  ? 32.092  81.473 60.748  1.00 106.21 ? 290  GLN A CG  1 
ATOM 2292 C CD  . GLN A 1 293  ? 33.554  81.748 61.073  1.00 106.21 ? 290  GLN A CD  1 
ATOM 2293 O OE1 . GLN A 1 293  ? 33.895  82.727 61.750  1.00 106.21 ? 290  GLN A OE1 1 
ATOM 2294 N NE2 . GLN A 1 293  ? 34.427  80.870 60.597  1.00 106.21 ? 290  GLN A NE2 1 
ATOM 2295 N N   . MET A 1 294  ? 30.631  85.592 59.426  1.00 212.91 ? 291  MET A N   1 
ATOM 2296 C CA  . MET A 1 294  ? 31.258  86.748 58.760  1.00 212.91 ? 291  MET A CA  1 
ATOM 2297 C C   . MET A 1 294  ? 32.278  86.367 57.686  1.00 212.91 ? 291  MET A C   1 
ATOM 2298 O O   . MET A 1 294  ? 32.080  85.387 56.965  1.00 212.91 ? 291  MET A O   1 
ATOM 2299 C CB  . MET A 1 294  ? 31.867  87.711 59.785  1.00 169.60 ? 291  MET A CB  1 
ATOM 2300 C CG  . MET A 1 294  ? 30.871  88.695 60.371  1.00 169.60 ? 291  MET A CG  1 
ATOM 2301 S SD  . MET A 1 294  ? 31.601  89.752 61.631  1.00 169.60 ? 291  MET A SD  1 
ATOM 2302 C CE  . MET A 1 294  ? 32.751  90.718 60.656  1.00 169.60 ? 291  MET A CE  1 
ATOM 2303 N N   . ASP A 1 295  ? 33.349  87.156 57.575  1.00 167.84 ? 292  ASP A N   1 
ATOM 2304 C CA  . ASP A 1 295  ? 34.465  86.847 56.686  1.00 167.84 ? 292  ASP A CA  1 
ATOM 2305 C C   . ASP A 1 295  ? 34.984  85.447 56.995  1.00 167.84 ? 292  ASP A C   1 
ATOM 2306 O O   . ASP A 1 295  ? 35.790  85.243 57.907  1.00 167.84 ? 292  ASP A O   1 
ATOM 2307 C CB  . ASP A 1 295  ? 35.574  87.888 56.828  1.00 212.91 ? 292  ASP A CB  1 
ATOM 2308 C CG  . ASP A 1 295  ? 35.906  88.191 58.274  1.00 212.91 ? 292  ASP A CG  1 
ATOM 2309 O OD1 . ASP A 1 295  ? 35.030  88.724 58.990  1.00 212.91 ? 292  ASP A OD1 1 
ATOM 2310 O OD2 . ASP A 1 295  ? 37.044  87.892 58.693  1.00 212.91 ? 292  ASP A OD2 1 
ATOM 2311 N N   . GLY A 1 296  ? 34.482  84.487 56.224  1.00 188.73 ? 293  GLY A N   1 
ATOM 2312 C CA  . GLY A 1 296  ? 34.724  83.068 56.446  1.00 188.73 ? 293  GLY A CA  1 
ATOM 2313 C C   . GLY A 1 296  ? 33.592  82.263 55.835  1.00 188.73 ? 293  GLY A C   1 
ATOM 2314 O O   . GLY A 1 296  ? 32.416  82.575 56.050  1.00 188.73 ? 293  GLY A O   1 
ATOM 2315 N N   . THR A 1 297  ? 33.956  81.224 55.082  1.00 212.91 ? 294  THR A N   1 
ATOM 2316 C CA  . THR A 1 297  ? 33.010  80.417 54.294  1.00 212.91 ? 294  THR A CA  1 
ATOM 2317 C C   . THR A 1 297  ? 31.859  79.836 55.134  1.00 212.91 ? 294  THR A C   1 
ATOM 2318 O O   . THR A 1 297  ? 31.974  79.693 56.357  1.00 212.91 ? 294  THR A O   1 
ATOM 2319 C CB  . THR A 1 297  ? 33.738  79.276 53.503  1.00 130.65 ? 294  THR A CB  1 
ATOM 2320 O OG1 . THR A 1 297  ? 35.046  79.707 53.101  1.00 130.65 ? 294  THR A OG1 1 
ATOM 2321 C CG2 . THR A 1 297  ? 32.951  78.870 52.255  1.00 130.65 ? 294  THR A CG2 1 
ATOM 2322 N N   . VAL A 1 298  ? 30.752  79.520 54.458  1.00 162.50 ? 295  VAL A N   1 
ATOM 2323 C CA  . VAL A 1 298  ? 29.548  78.969 55.094  1.00 162.50 ? 295  VAL A CA  1 
ATOM 2324 C C   . VAL A 1 298  ? 29.776  77.598 55.752  1.00 162.50 ? 295  VAL A C   1 
ATOM 2325 O O   . VAL A 1 298  ? 30.344  76.684 55.152  1.00 162.50 ? 295  VAL A O   1 
ATOM 2326 C CB  . VAL A 1 298  ? 28.311  78.916 54.109  1.00 142.79 ? 295  VAL A CB  1 
ATOM 2327 C CG1 . VAL A 1 298  ? 27.595  80.268 54.043  1.00 142.79 ? 295  VAL A CG1 1 
ATOM 2328 C CG2 . VAL A 1 298  ? 28.712  78.444 52.694  1.00 142.79 ? 295  VAL A CG2 1 
ATOM 2329 N N   . THR A 1 299  ? 29.336  77.484 57.000  1.00 112.77 ? 296  THR A N   1 
ATOM 2330 C CA  . THR A 1 299  ? 29.347  76.224 57.735  1.00 112.77 ? 296  THR A CA  1 
ATOM 2331 C C   . THR A 1 299  ? 28.081  75.410 57.393  1.00 112.77 ? 296  THR A C   1 
ATOM 2332 O O   . THR A 1 299  ? 27.448  75.644 56.367  1.00 112.77 ? 296  THR A O   1 
ATOM 2333 C CB  . THR A 1 299  ? 29.539  76.471 59.279  1.00 117.76 ? 296  THR A CB  1 
ATOM 2334 O OG1 . THR A 1 299  ? 28.872  75.454 60.038  1.00 117.76 ? 296  THR A OG1 1 
ATOM 2335 C CG2 . THR A 1 299  ? 29.009  77.845 59.710  1.00 117.76 ? 296  THR A CG2 1 
ATOM 2336 N N   . LEU A 1 300  ? 27.732  74.437 58.225  1.00 126.14 ? 297  LEU A N   1 
ATOM 2337 C CA  . LEU A 1 300  ? 26.493  73.696 58.057  1.00 126.14 ? 297  LEU A CA  1 
ATOM 2338 C C   . LEU A 1 300  ? 25.929  73.439 59.433  1.00 126.14 ? 297  LEU A C   1 
ATOM 2339 O O   . LEU A 1 300  ? 26.431  72.583 60.161  1.00 126.14 ? 297  LEU A O   1 
ATOM 2340 C CB  . LEU A 1 300  ? 26.740  72.358 57.362  1.00 212.91 ? 297  LEU A CB  1 
ATOM 2341 C CG  . LEU A 1 300  ? 27.216  72.284 55.914  1.00 212.91 ? 297  LEU A CG  1 
ATOM 2342 C CD1 . LEU A 1 300  ? 28.720  72.458 55.809  1.00 212.91 ? 297  LEU A CD1 1 
ATOM 2343 C CD2 . LEU A 1 300  ? 26.816  70.945 55.338  1.00 212.91 ? 297  LEU A CD2 1 
ATOM 2344 N N   . LYS A 1 301  ? 24.895  74.172 59.812  1.00 86.99  ? 298  LYS A N   1 
ATOM 2345 C CA  . LYS A 1 301  ? 24.392  74.006 61.157  1.00 86.99  ? 298  LYS A CA  1 
ATOM 2346 C C   . LYS A 1 301  ? 23.670  72.687 61.266  1.00 86.99  ? 298  LYS A C   1 
ATOM 2347 O O   . LYS A 1 301  ? 23.786  71.999 62.288  1.00 86.99  ? 298  LYS A O   1 
ATOM 2348 C CB  . LYS A 1 301  ? 23.475  75.164 61.594  1.00 139.90 ? 298  LYS A CB  1 
ATOM 2349 C CG  . LYS A 1 301  ? 22.772  74.976 62.975  1.00 139.90 ? 298  LYS A CG  1 
ATOM 2350 C CD  . LYS A 1 301  ? 23.727  74.589 64.128  1.00 139.90 ? 298  LYS A CD  1 
ATOM 2351 C CE  . LYS A 1 301  ? 23.962  75.726 65.103  1.00 139.90 ? 298  LYS A CE  1 
ATOM 2352 N NZ  . LYS A 1 301  ? 22.895  75.780 66.131  1.00 139.90 ? 298  LYS A NZ  1 
ATOM 2353 N N   . ASP A 1 302  ? 22.939  72.331 60.207  1.00 73.16  ? 299  ASP A N   1 
ATOM 2354 C CA  . ASP A 1 302  ? 21.963  71.237 60.289  1.00 73.16  ? 299  ASP A CA  1 
ATOM 2355 C C   . ASP A 1 302  ? 21.574  70.710 58.908  1.00 73.16  ? 299  ASP A C   1 
ATOM 2356 O O   . ASP A 1 302  ? 22.019  71.259 57.874  1.00 73.16  ? 299  ASP A O   1 
ATOM 2357 C CB  . ASP A 1 302  ? 20.713  71.750 61.014  1.00 78.20  ? 299  ASP A CB  1 
ATOM 2358 C CG  . ASP A 1 302  ? 19.915  70.649 61.675  1.00 78.20  ? 299  ASP A CG  1 
ATOM 2359 O OD1 . ASP A 1 302  ? 20.440  69.526 61.844  1.00 78.20  ? 299  ASP A OD1 1 
ATOM 2360 O OD2 . ASP A 1 302  ? 18.749  70.918 62.048  1.00 78.20  ? 299  ASP A OD2 1 
ATOM 2361 N N   . LEU A 1 303  ? 20.747  69.657 58.897  1.00 71.09  ? 300  LEU A N   1 
ATOM 2362 C CA  . LEU A 1 303  ? 20.087  69.182 57.673  1.00 71.09  ? 300  LEU A CA  1 
ATOM 2363 C C   . LEU A 1 303  ? 18.806  68.424 57.982  1.00 71.09  ? 300  LEU A C   1 
ATOM 2364 O O   . LEU A 1 303  ? 18.745  67.694 58.973  1.00 71.09  ? 300  LEU A O   1 
ATOM 2365 C CB  . LEU A 1 303  ? 21.027  68.314 56.829  1.00 83.80  ? 300  LEU A CB  1 
ATOM 2366 C CG  . LEU A 1 303  ? 21.498  66.945 57.311  1.00 83.80  ? 300  LEU A CG  1 
ATOM 2367 C CD1 . LEU A 1 303  ? 22.223  66.276 56.173  1.00 83.80  ? 300  LEU A CD1 1 
ATOM 2368 C CD2 . LEU A 1 303  ? 22.390  67.032 58.548  1.00 83.80  ? 300  LEU A CD2 1 
ATOM 2369 N N   . ARG A 1 304  ? 17.782  68.586 57.134  1.00 66.31  ? 301  ARG A N   1 
ATOM 2370 C CA  . ARG A 1 304  ? 16.518  67.822 57.325  1.00 66.31  ? 301  ARG A CA  1 
ATOM 2371 C C   . ARG A 1 304  ? 15.812  67.333 56.050  1.00 66.31  ? 301  ARG A C   1 
ATOM 2372 O O   . ARG A 1 304  ? 16.030  67.818 54.936  1.00 66.31  ? 301  ARG A O   1 
ATOM 2373 C CB  . ARG A 1 304  ? 15.507  68.584 58.221  1.00 63.30  ? 301  ARG A CB  1 
ATOM 2374 C CG  . ARG A 1 304  ? 14.644  69.640 57.465  1.00 63.30  ? 301  ARG A CG  1 
ATOM 2375 C CD  . ARG A 1 304  ? 14.546  70.992 58.201  1.00 63.30  ? 301  ARG A CD  1 
ATOM 2376 N NE  . ARG A 1 304  ? 14.826  72.100 57.279  1.00 63.30  ? 301  ARG A NE  1 
ATOM 2377 C CZ  . ARG A 1 304  ? 13.947  72.572 56.397  1.00 63.30  ? 301  ARG A CZ  1 
ATOM 2378 N NH1 . ARG A 1 304  ? 12.728  72.042 56.337  1.00 63.30  ? 301  ARG A NH1 1 
ATOM 2379 N NH2 . ARG A 1 304  ? 14.281  73.568 55.572  1.00 63.30  ? 301  ARG A NH2 1 
ATOM 2380 N N   . VAL A 1 305  ? 14.931  66.375 56.278  1.00 54.39  ? 302  VAL A N   1 
ATOM 2381 C CA  . VAL A 1 305  ? 14.099  65.790 55.253  1.00 54.39  ? 302  VAL A CA  1 
ATOM 2382 C C   . VAL A 1 305  ? 12.729  66.434 55.200  1.00 54.39  ? 302  VAL A C   1 
ATOM 2383 O O   . VAL A 1 305  ? 12.027  66.526 56.217  1.00 54.39  ? 302  VAL A O   1 
ATOM 2384 C CB  . VAL A 1 305  ? 13.865  64.285 55.568  1.00 43.63  ? 302  VAL A CB  1 
ATOM 2385 C CG1 . VAL A 1 305  ? 12.559  63.772 54.915  1.00 43.63  ? 302  VAL A CG1 1 
ATOM 2386 C CG2 . VAL A 1 305  ? 15.085  63.465 55.131  1.00 43.63  ? 302  VAL A CG2 1 
ATOM 2387 N N   . GLU A 1 306  ? 12.326  66.840 54.013  1.00 51.11  ? 303  GLU A N   1 
ATOM 2388 C CA  . GLU A 1 306  ? 10.941  67.132 53.820  1.00 51.11  ? 303  GLU A CA  1 
ATOM 2389 C C   . GLU A 1 306  ? 10.298  66.251 52.748  1.00 51.11  ? 303  GLU A C   1 
ATOM 2390 O O   . GLU A 1 306  ? 10.499  66.462 51.548  1.00 51.11  ? 303  GLU A O   1 
ATOM 2391 C CB  . GLU A 1 306  ? 10.777  68.606 53.504  1.00 81.74  ? 303  GLU A CB  1 
ATOM 2392 C CG  . GLU A 1 306  ? 10.561  69.421 54.759  1.00 81.74  ? 303  GLU A CG  1 
ATOM 2393 C CD  . GLU A 1 306  ? 10.381  70.893 54.476  1.00 81.74  ? 303  GLU A CD  1 
ATOM 2394 O OE1 . GLU A 1 306  ? 10.520  71.285 53.294  1.00 81.74  ? 303  GLU A OE1 1 
ATOM 2395 O OE2 . GLU A 1 306  ? 10.112  71.652 55.434  1.00 81.74  ? 303  GLU A OE2 1 
ATOM 2396 N N   . LEU A 1 307  ? 9.512   65.276 53.165  1.00 66.53  ? 304  LEU A N   1 
ATOM 2397 C CA  . LEU A 1 307  ? 8.673   64.579 52.216  1.00 66.53  ? 304  LEU A CA  1 
ATOM 2398 C C   . LEU A 1 307  ? 7.952   65.590 51.330  1.00 66.53  ? 304  LEU A C   1 
ATOM 2399 O O   . LEU A 1 307  ? 7.189   66.430 51.815  1.00 66.53  ? 304  LEU A O   1 
ATOM 2400 C CB  . LEU A 1 307  ? 7.671   63.693 52.936  1.00 50.35  ? 304  LEU A CB  1 
ATOM 2401 C CG  . LEU A 1 307  ? 6.610   63.035 52.058  1.00 50.35  ? 304  LEU A CG  1 
ATOM 2402 C CD1 . LEU A 1 307  ? 7.190   62.523 50.747  1.00 50.35  ? 304  LEU A CD1 1 
ATOM 2403 C CD2 . LEU A 1 307  ? 5.991   61.898 52.826  1.00 50.35  ? 304  LEU A CD2 1 
ATOM 2404 N N   . LEU A 1 308  ? 8.218   65.517 50.034  1.00 54.33  ? 305  LEU A N   1 
ATOM 2405 C CA  . LEU A 1 308  ? 7.624   66.414 49.079  1.00 54.33  ? 305  LEU A CA  1 
ATOM 2406 C C   . LEU A 1 308  ? 6.383   65.790 48.474  1.00 54.33  ? 305  LEU A C   1 
ATOM 2407 O O   . LEU A 1 308  ? 5.457   66.482 48.039  1.00 54.33  ? 305  LEU A O   1 
ATOM 2408 C CB  . LEU A 1 308  ? 8.611   66.716 47.973  1.00 44.53  ? 305  LEU A CB  1 
ATOM 2409 C CG  . LEU A 1 308  ? 9.816   67.567 48.352  1.00 44.53  ? 305  LEU A CG  1 
ATOM 2410 C CD1 . LEU A 1 308  ? 10.622  68.032 47.105  1.00 44.53  ? 305  LEU A CD1 1 
ATOM 2411 C CD2 . LEU A 1 308  ? 9.369   68.729 49.182  1.00 44.53  ? 305  LEU A CD2 1 
ATOM 2412 N N   . GLY A 1 309  ? 6.351   64.477 48.430  1.00 45.48  ? 306  GLY A N   1 
ATOM 2413 C CA  . GLY A 1 309  ? 5.223   63.808 47.853  1.00 45.48  ? 306  GLY A CA  1 
ATOM 2414 C C   . GLY A 1 309  ? 5.663   62.529 47.196  1.00 45.48  ? 306  GLY A C   1 
ATOM 2415 O O   . GLY A 1 309  ? 6.584   61.849 47.653  1.00 45.48  ? 306  GLY A O   1 
ATOM 2416 N N   . GLU A 1 310  ? 5.018   62.214 46.087  1.00 61.87  ? 307  GLU A N   1 
ATOM 2417 C CA  . GLU A 1 310  ? 5.240   60.943 45.453  1.00 61.87  ? 307  GLU A CA  1 
ATOM 2418 C C   . GLU A 1 310  ? 5.401   61.075 43.948  1.00 61.87  ? 307  GLU A C   1 
ATOM 2419 O O   . GLU A 1 310  ? 4.843   61.947 43.324  1.00 61.87  ? 307  GLU A O   1 
ATOM 2420 C CB  . GLU A 1 310  ? 4.132   59.993 45.882  1.00 61.85  ? 307  GLU A CB  1 
ATOM 2421 C CG  . GLU A 1 310  ? 3.316   59.374 44.785  1.00 61.85  ? 307  GLU A CG  1 
ATOM 2422 C CD  . GLU A 1 310  ? 2.504   58.198 45.293  1.00 61.85  ? 307  GLU A CD  1 
ATOM 2423 O OE1 . GLU A 1 310  ? 2.542   57.921 46.526  1.00 61.85  ? 307  GLU A OE1 1 
ATOM 2424 O OE2 . GLU A 1 310  ? 1.842   57.546 44.452  1.00 61.85  ? 307  GLU A OE2 1 
ATOM 2425 N N   . THR A 1 311  ? 6.220   60.220 43.376  1.00 42.04  ? 308  THR A N   1 
ATOM 2426 C CA  . THR A 1 311  ? 6.497   60.268 41.966  1.00 42.04  ? 308  THR A CA  1 
ATOM 2427 C C   . THR A 1 311  ? 6.301   58.853 41.518  1.00 42.04  ? 308  THR A C   1 
ATOM 2428 O O   . THR A 1 311  ? 5.894   58.042 42.314  1.00 42.04  ? 308  THR A O   1 
ATOM 2429 C CB  . THR A 1 311  ? 7.944   60.621 41.748  1.00 37.33  ? 308  THR A CB  1 
ATOM 2430 O OG1 . THR A 1 311  ? 8.727   59.648 42.432  1.00 37.33  ? 308  THR A OG1 1 
ATOM 2431 C CG2 . THR A 1 311  ? 8.293   62.015 42.290  1.00 37.33  ? 308  THR A CG2 1 
ATOM 2432 N N   . SER A 1 312  ? 6.597   58.535 40.265  1.00 45.86  ? 309  SER A N   1 
ATOM 2433 C CA  . SER A 1 312  ? 6.807   57.135 39.906  1.00 45.86  ? 309  SER A CA  1 
ATOM 2434 C C   . SER A 1 312  ? 8.094   56.690 40.609  1.00 45.86  ? 309  SER A C   1 
ATOM 2435 O O   . SER A 1 312  ? 8.921   57.523 41.024  1.00 45.86  ? 309  SER A O   1 
ATOM 2436 C CB  . SER A 1 312  ? 6.956   56.960 38.412  1.00 35.37  ? 309  SER A CB  1 
ATOM 2437 O OG  . SER A 1 312  ? 5.918   57.626 37.677  1.00 35.37  ? 309  SER A OG  1 
ATOM 2438 N N   . ILE A 1 313  ? 8.256   55.388 40.792  1.00 51.49  ? 310  ILE A N   1 
ATOM 2439 C CA  . ILE A 1 313  ? 9.497   54.895 41.349  1.00 51.49  ? 310  ILE A CA  1 
ATOM 2440 C C   . ILE A 1 313  ? 10.630  55.392 40.449  1.00 51.49  ? 310  ILE A C   1 
ATOM 2441 O O   . ILE A 1 313  ? 10.555  55.316 39.219  1.00 51.49  ? 310  ILE A O   1 
ATOM 2442 C CB  . ILE A 1 313  ? 9.510   53.380 41.419  1.00 46.57  ? 310  ILE A CB  1 
ATOM 2443 C CG1 . ILE A 1 313  ? 8.106   52.870 41.727  1.00 46.57  ? 310  ILE A CG1 1 
ATOM 2444 C CG2 . ILE A 1 313  ? 10.540  52.893 42.417  1.00 46.57  ? 310  ILE A CG2 1 
ATOM 2445 C CD1 . ILE A 1 313  ? 7.944   52.347 43.104  1.00 46.57  ? 310  ILE A CD1 1 
ATOM 2446 N N   . ALA A 1 314  ? 11.667  55.913 41.089  1.00 31.61  ? 311  ALA A N   1 
ATOM 2447 C CA  . ALA A 1 314  ? 12.738  56.616 40.404  1.00 31.61  ? 311  ALA A CA  1 
ATOM 2448 C C   . ALA A 1 314  ? 14.017  55.833 40.353  1.00 31.61  ? 311  ALA A C   1 
ATOM 2449 O O   . ALA A 1 314  ? 14.612  55.530 41.411  1.00 31.61  ? 311  ALA A O   1 
ATOM 2450 C CB  . ALA A 1 314  ? 13.034  57.963 41.111  1.00 13.91  ? 311  ALA A CB  1 
ATOM 2451 N N   . GLU A 1 315  ? 14.486  55.569 39.140  1.00 49.77  ? 312  GLU A N   1 
ATOM 2452 C CA  . GLU A 1 315  ? 15.888  55.276 39.022  1.00 49.77  ? 312  GLU A CA  1 
ATOM 2453 C C   . GLU A 1 315  ? 16.577  56.600 39.037  1.00 49.77  ? 312  GLU A C   1 
ATOM 2454 O O   . GLU A 1 315  ? 17.338  56.879 39.936  1.00 49.77  ? 312  GLU A O   1 
ATOM 2455 C CB  . GLU A 1 315  ? 16.222  54.477 37.785  1.00 57.28  ? 312  GLU A CB  1 
ATOM 2456 C CG  . GLU A 1 315  ? 16.170  52.996 38.089  1.00 57.28  ? 312  GLU A CG  1 
ATOM 2457 C CD  . GLU A 1 315  ? 17.533  52.393 38.266  1.00 57.28  ? 312  GLU A CD  1 
ATOM 2458 O OE1 . GLU A 1 315  ? 18.528  53.009 37.793  1.00 57.28  ? 312  GLU A OE1 1 
ATOM 2459 O OE2 . GLU A 1 315  ? 17.598  51.287 38.864  1.00 57.28  ? 312  GLU A OE2 1 
ATOM 2460 N N   . CYS A 1 316  ? 16.234  57.436 38.072  1.00 50.48  ? 313  CYS A N   1 
ATOM 2461 C CA  . CYS A 1 316  ? 16.937  58.683 37.823  1.00 50.48  ? 313  CYS A CA  1 
ATOM 2462 C C   . CYS A 1 316  ? 16.100  59.842 38.354  1.00 50.48  ? 313  CYS A C   1 
ATOM 2463 O O   . CYS A 1 316  ? 14.894  59.814 38.237  1.00 50.48  ? 313  CYS A O   1 
ATOM 2464 C CB  . CYS A 1 316  ? 17.164  58.863 36.330  1.00 184.79 ? 313  CYS A CB  1 
ATOM 2465 S SG  . CYS A 1 316  ? 18.507  59.973 36.000  1.00 184.79 ? 313  CYS A SG  1 
ATOM 2466 N N   . LEU A 1 317  ? 16.762  60.841 38.924  1.00 58.65  ? 314  LEU A N   1 
ATOM 2467 C CA  . LEU A 1 317  ? 16.135  62.084 39.297  1.00 58.65  ? 314  LEU A CA  1 
ATOM 2468 C C   . LEU A 1 317  ? 16.979  63.280 38.894  1.00 58.65  ? 314  LEU A C   1 
ATOM 2469 O O   . LEU A 1 317  ? 18.197  63.282 39.057  1.00 58.65  ? 314  LEU A O   1 
ATOM 2470 C CB  . LEU A 1 317  ? 15.880  62.112 40.794  1.00 39.87  ? 314  LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 317  ? 14.460  62.105 41.367  1.00 39.87  ? 314  LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 317  ? 13.350  61.531 40.445  1.00 39.87  ? 314  LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 317  ? 14.492  61.320 42.629  1.00 39.87  ? 314  LEU A CD2 1 
ATOM 2474 N N   . THR A 1 318  ? 16.326  64.300 38.359  1.00 45.39  ? 315  THR A N   1 
ATOM 2475 C CA  . THR A 1 318  ? 17.042  65.477 37.850  1.00 45.39  ? 315  THR A CA  1 
ATOM 2476 C C   . THR A 1 318  ? 16.219  66.776 37.893  1.00 45.39  ? 315  THR A C   1 
ATOM 2477 O O   . THR A 1 318  ? 15.274  66.949 37.116  1.00 45.39  ? 315  THR A O   1 
ATOM 2478 C CB  . THR A 1 318  ? 17.567  65.208 36.424  1.00 55.25  ? 315  THR A CB  1 
ATOM 2479 O OG1 . THR A 1 318  ? 18.462  64.088 36.474  1.00 55.25  ? 315  THR A OG1 1 
ATOM 2480 C CG2 . THR A 1 318  ? 18.327  66.377 35.884  1.00 55.25  ? 315  THR A CG2 1 
ATOM 2481 N N   . TYR A 1 319  ? 16.583  67.655 38.836  1.00 37.43  ? 316  TYR A N   1 
ATOM 2482 C CA  . TYR A 1 319  ? 16.004  68.980 38.922  1.00 37.43  ? 316  TYR A CA  1 
ATOM 2483 C C   . TYR A 1 319  ? 16.363  69.622 37.600  1.00 37.43  ? 316  TYR A C   1 
ATOM 2484 O O   . TYR A 1 319  ? 17.482  69.408 37.127  1.00 37.43  ? 316  TYR A O   1 
ATOM 2485 C CB  . TYR A 1 319  ? 16.609  69.788 40.062  1.00 63.09  ? 316  TYR A CB  1 
ATOM 2486 C CG  . TYR A 1 319  ? 16.024  71.183 40.145  1.00 63.09  ? 316  TYR A CG  1 
ATOM 2487 C CD1 . TYR A 1 319  ? 14.704  71.382 40.570  1.00 63.09  ? 316  TYR A CD1 1 
ATOM 2488 C CD2 . TYR A 1 319  ? 16.787  72.312 39.795  1.00 63.09  ? 316  TYR A CD2 1 
ATOM 2489 C CE1 . TYR A 1 319  ? 14.148  72.661 40.650  1.00 63.09  ? 316  TYR A CE1 1 
ATOM 2490 C CE2 . TYR A 1 319  ? 16.237  73.611 39.852  1.00 63.09  ? 316  TYR A CE2 1 
ATOM 2491 C CZ  . TYR A 1 319  ? 14.911  73.771 40.289  1.00 63.09  ? 316  TYR A CZ  1 
ATOM 2492 O OH  . TYR A 1 319  ? 14.343  75.031 40.359  1.00 63.09  ? 316  TYR A OH  1 
ATOM 2493 N N   . LEU A 1 320  ? 15.441  70.366 36.982  1.00 53.49  ? 317  LEU A N   1 
ATOM 2494 C CA  . LEU A 1 320  ? 15.743  71.036 35.712  1.00 53.49  ? 317  LEU A CA  1 
ATOM 2495 C C   . LEU A 1 320  ? 15.710  72.521 35.971  1.00 53.49  ? 317  LEU A C   1 
ATOM 2496 O O   . LEU A 1 320  ? 16.365  73.008 36.901  1.00 53.49  ? 317  LEU A O   1 
ATOM 2497 C CB  . LEU A 1 320  ? 14.702  70.689 34.649  1.00 55.22  ? 317  LEU A CB  1 
ATOM 2498 C CG  . LEU A 1 320  ? 14.504  69.231 34.260  1.00 55.22  ? 317  LEU A CG  1 
ATOM 2499 C CD1 . LEU A 1 320  ? 13.914  69.164 32.868  1.00 55.22  ? 317  LEU A CD1 1 
ATOM 2500 C CD2 . LEU A 1 320  ? 15.818  68.441 34.316  1.00 55.22  ? 317  LEU A CD2 1 
ATOM 2501 N N   . ASP A 1 321  ? 14.903  73.244 35.197  1.00 95.43  ? 318  ASP A N   1 
ATOM 2502 C CA  . ASP A 1 321  ? 14.597  74.622 35.535  1.00 95.43  ? 318  ASP A CA  1 
ATOM 2503 C C   . ASP A 1 321  ? 13.724  74.710 36.781  1.00 95.43  ? 318  ASP A C   1 
ATOM 2504 O O   . ASP A 1 321  ? 13.852  73.915 37.704  1.00 95.43  ? 318  ASP A O   1 
ATOM 2505 C CB  . ASP A 1 321  ? 13.977  75.372 34.352  1.00 154.46 ? 318  ASP A CB  1 
ATOM 2506 C CG  . ASP A 1 321  ? 14.914  76.420 33.769  1.00 154.46 ? 318  ASP A CG  1 
ATOM 2507 O OD1 . ASP A 1 321  ? 14.734  76.779 32.583  1.00 154.46 ? 318  ASP A OD1 1 
ATOM 2508 O OD2 . ASP A 1 321  ? 15.825  76.889 34.493  1.00 154.46 ? 318  ASP A OD2 1 
ATOM 2509 N N   . ASN A 1 322  ? 12.816  75.670 36.780  1.00 52.13  ? 319  ASN A N   1 
ATOM 2510 C CA  . ASN A 1 322  ? 12.231  76.183 37.998  1.00 52.13  ? 319  ASN A CA  1 
ATOM 2511 C C   . ASN A 1 322  ? 11.129  75.288 38.537  1.00 52.13  ? 319  ASN A C   1 
ATOM 2512 O O   . ASN A 1 322  ? 9.992   75.264 38.014  1.00 52.13  ? 319  ASN A O   1 
ATOM 2513 C CB  . ASN A 1 322  ? 11.711  77.600 37.763  1.00 97.42  ? 319  ASN A CB  1 
ATOM 2514 C CG  . ASN A 1 322  ? 12.699  78.455 37.001  1.00 97.42  ? 319  ASN A CG  1 
ATOM 2515 O OD1 . ASN A 1 322  ? 13.870  78.582 37.383  1.00 97.42  ? 319  ASN A OD1 1 
ATOM 2516 N ND2 . ASN A 1 322  ? 12.237  79.038 35.904  1.00 97.42  ? 319  ASN A ND2 1 
ATOM 2517 N N   . GLY A 1 323  ? 11.502  74.541 39.583  1.00 72.89  ? 320  GLY A N   1 
ATOM 2518 C CA  . GLY A 1 323  ? 10.584  73.717 40.349  1.00 72.89  ? 320  GLY A CA  1 
ATOM 2519 C C   . GLY A 1 323  ? 10.218  72.472 39.591  1.00 72.89  ? 320  GLY A C   1 
ATOM 2520 O O   . GLY A 1 323  ? 9.498   71.611 40.090  1.00 72.89  ? 320  GLY A O   1 
ATOM 2521 N N   . VAL A 1 324  ? 10.711  72.378 38.373  1.00 54.62  ? 321  VAL A N   1 
ATOM 2522 C CA  . VAL A 1 324  ? 10.455  71.203 37.565  1.00 54.62  ? 321  VAL A CA  1 
ATOM 2523 C C   . VAL A 1 324  ? 11.552  70.137 37.763  1.00 54.62  ? 321  VAL A C   1 
ATOM 2524 O O   . VAL A 1 324  ? 12.774  70.443 37.870  1.00 54.62  ? 321  VAL A O   1 
ATOM 2525 C CB  . VAL A 1 324  ? 10.363  71.566 36.099  1.00 66.18  ? 321  VAL A CB  1 
ATOM 2526 C CG1 . VAL A 1 324  ? 9.721   70.432 35.350  1.00 66.18  ? 321  VAL A CG1 1 
ATOM 2527 C CG2 . VAL A 1 324  ? 9.572   72.896 35.930  1.00 66.18  ? 321  VAL A CG2 1 
ATOM 2528 N N   . VAL A 1 325  ? 11.106  68.889 37.819  1.00 39.20  ? 322  VAL A N   1 
ATOM 2529 C CA  . VAL A 1 325  ? 12.006  67.787 38.006  1.00 39.20  ? 322  VAL A CA  1 
ATOM 2530 C C   . VAL A 1 325  ? 11.611  66.650 37.089  1.00 39.20  ? 322  VAL A C   1 
ATOM 2531 O O   . VAL A 1 325  ? 10.428  66.316 36.994  1.00 39.20  ? 322  VAL A O   1 
ATOM 2532 C CB  . VAL A 1 325  ? 11.928  67.313 39.436  1.00 41.94  ? 322  VAL A CB  1 
ATOM 2533 C CG1 . VAL A 1 325  ? 12.652  65.992 39.605  1.00 41.94  ? 322  VAL A CG1 1 
ATOM 2534 C CG2 . VAL A 1 325  ? 12.493  68.359 40.352  1.00 41.94  ? 322  VAL A CG2 1 
ATOM 2535 N N   . PHE A 1 326  ? 12.593  66.052 36.423  1.00 45.97  ? 323  PHE A N   1 
ATOM 2536 C CA  . PHE A 1 326  ? 12.318  64.907 35.593  1.00 45.97  ? 323  PHE A CA  1 
ATOM 2537 C C   . PHE A 1 326  ? 12.532  63.697 36.411  1.00 45.97  ? 323  PHE A C   1 
ATOM 2538 O O   . PHE A 1 326  ? 13.547  63.547 37.090  1.00 45.97  ? 323  PHE A O   1 
ATOM 2539 C CB  . PHE A 1 326  ? 13.272  64.846 34.432  1.00 41.70  ? 323  PHE A CB  1 
ATOM 2540 C CG  . PHE A 1 326  ? 13.199  63.558 33.668  1.00 41.70  ? 323  PHE A CG  1 
ATOM 2541 C CD1 . PHE A 1 326  ? 12.191  63.345 32.732  1.00 41.70  ? 323  PHE A CD1 1 
ATOM 2542 C CD2 . PHE A 1 326  ? 14.122  62.556 33.886  1.00 41.70  ? 323  PHE A CD2 1 
ATOM 2543 C CE1 . PHE A 1 326  ? 12.126  62.162 32.027  1.00 41.70  ? 323  PHE A CE1 1 
ATOM 2544 C CE2 . PHE A 1 326  ? 14.056  61.403 33.196  1.00 41.70  ? 323  PHE A CE2 1 
ATOM 2545 C CZ  . PHE A 1 326  ? 13.057  61.203 32.262  1.00 41.70  ? 323  PHE A CZ  1 
ATOM 2546 N N   . VAL A 1 327  ? 11.591  62.789 36.342  1.00 41.85  ? 324  VAL A N   1 
ATOM 2547 C CA  . VAL A 1 327  ? 11.707  61.623 37.162  1.00 41.85  ? 324  VAL A CA  1 
ATOM 2548 C C   . VAL A 1 327  ? 12.019  60.481 36.250  1.00 41.85  ? 324  VAL A C   1 
ATOM 2549 O O   . VAL A 1 327  ? 11.190  60.098 35.424  1.00 41.85  ? 324  VAL A O   1 
ATOM 2550 C CB  . VAL A 1 327  ? 10.425  61.408 37.940  1.00 40.77  ? 324  VAL A CB  1 
ATOM 2551 C CG1 . VAL A 1 327  ? 10.271  59.962 38.352  1.00 40.77  ? 324  VAL A CG1 1 
ATOM 2552 C CG2 . VAL A 1 327  ? 10.436  62.311 39.155  1.00 40.77  ? 324  VAL A CG2 1 
ATOM 2553 N N   . GLY A 1 328  ? 13.245  59.969 36.352  1.00 41.40  ? 325  GLY A N   1 
ATOM 2554 C CA  . GLY A 1 328  ? 13.651  58.838 35.531  1.00 41.40  ? 325  GLY A CA  1 
ATOM 2555 C C   . GLY A 1 328  ? 13.184  57.551 36.161  1.00 41.40  ? 325  GLY A C   1 
ATOM 2556 O O   . GLY A 1 328  ? 13.659  57.152 37.243  1.00 41.40  ? 325  GLY A O   1 
ATOM 2557 N N   . SER A 1 329  ? 12.263  56.890 35.482  1.00 39.29  ? 326  SER A N   1 
ATOM 2558 C CA  . SER A 1 329  ? 11.729  55.660 35.991  1.00 39.29  ? 326  SER A CA  1 
ATOM 2559 C C   . SER A 1 329  ? 12.023  54.456 35.105  1.00 39.29  ? 326  SER A C   1 
ATOM 2560 O O   . SER A 1 329  ? 11.988  54.538 33.875  1.00 39.29  ? 326  SER A O   1 
ATOM 2561 C CB  . SER A 1 329  ? 10.237  55.796 36.198  1.00 40.67  ? 326  SER A CB  1 
ATOM 2562 O OG  . SER A 1 329  ? 9.701   54.645 36.816  1.00 40.67  ? 326  SER A OG  1 
ATOM 2563 N N   . ARG A 1 330  ? 12.270  53.324 35.763  1.00 41.64  ? 327  ARG A N   1 
ATOM 2564 C CA  . ARG A 1 330  ? 12.519  52.051 35.121  1.00 41.64  ? 327  ARG A CA  1 
ATOM 2565 C C   . ARG A 1 330  ? 11.416  51.005 35.467  1.00 41.64  ? 327  ARG A C   1 
ATOM 2566 O O   . ARG A 1 330  ? 10.988  50.209 34.619  1.00 41.64  ? 327  ARG A O   1 
ATOM 2567 C CB  . ARG A 1 330  ? 13.952  51.646 35.523  1.00 51.90  ? 327  ARG A CB  1 
ATOM 2568 C CG  . ARG A 1 330  ? 14.344  50.171 35.237  1.00 51.90  ? 327  ARG A CG  1 
ATOM 2569 C CD  . ARG A 1 330  ? 15.794  49.940 35.784  1.00 51.90  ? 327  ARG A CD  1 
ATOM 2570 N NE  . ARG A 1 330  ? 15.741  49.967 37.220  1.00 51.90  ? 327  ARG A NE  1 
ATOM 2571 C CZ  . ARG A 1 330  ? 15.295  48.937 37.936  1.00 51.90  ? 327  ARG A CZ  1 
ATOM 2572 N NH1 . ARG A 1 330  ? 14.921  47.800 37.301  1.00 51.90  ? 327  ARG A NH1 1 
ATOM 2573 N NH2 . ARG A 1 330  ? 15.217  49.048 39.273  1.00 51.90  ? 327  ARG A NH2 1 
ATOM 2574 N N   . LEU A 1 331  ? 10.939  51.033 36.711  1.00 36.82  ? 328  LEU A N   1 
ATOM 2575 C CA  . LEU A 1 331  ? 9.810   50.181 37.144  1.00 36.82  ? 328  LEU A CA  1 
ATOM 2576 C C   . LEU A 1 331  ? 8.451   50.668 36.682  1.00 36.82  ? 328  LEU A C   1 
ATOM 2577 O O   . LEU A 1 331  ? 7.464   49.916 36.722  1.00 36.82  ? 328  LEU A O   1 
ATOM 2578 C CB  . LEU A 1 331  ? 9.722   50.085 38.659  1.00 32.05  ? 328  LEU A CB  1 
ATOM 2579 C CG  . LEU A 1 331  ? 10.866  49.382 39.366  1.00 32.05  ? 328  LEU A CG  1 
ATOM 2580 C CD1 . LEU A 1 331  ? 10.409  48.996 40.722  1.00 32.05  ? 328  LEU A CD1 1 
ATOM 2581 C CD2 . LEU A 1 331  ? 11.390  48.182 38.558  1.00 32.05  ? 328  LEU A CD2 1 
ATOM 2582 N N   . GLY A 1 332  ? 8.388   51.940 36.314  1.00 29.66  ? 329  GLY A N   1 
ATOM 2583 C CA  . GLY A 1 332  ? 7.157   52.468 35.811  1.00 29.66  ? 329  GLY A CA  1 
ATOM 2584 C C   . GLY A 1 332  ? 7.392   53.642 34.917  1.00 29.66  ? 329  GLY A C   1 
ATOM 2585 O O   . GLY A 1 332  ? 8.548   54.021 34.662  1.00 29.66  ? 329  GLY A O   1 
ATOM 2586 N N   . ASP A 1 333  ? 6.275   54.224 34.461  1.00 40.62  ? 330  ASP A N   1 
ATOM 2587 C CA  . ASP A 1 333  ? 6.254   55.420 33.605  1.00 40.62  ? 330  ASP A CA  1 
ATOM 2588 C C   . ASP A 1 333  ? 7.151   56.569 34.131  1.00 40.62  ? 330  ASP A C   1 
ATOM 2589 O O   . ASP A 1 333  ? 7.114   56.921 35.319  1.00 40.62  ? 330  ASP A O   1 
ATOM 2590 C CB  . ASP A 1 333  ? 4.826   55.904 33.493  1.00 28.22  ? 330  ASP A CB  1 
ATOM 2591 C CG  . ASP A 1 333  ? 3.947   55.099 32.450  1.00 28.22  ? 330  ASP A CG  1 
ATOM 2592 O OD1 . ASP A 1 333  ? 4.305   54.096 31.677  1.00 28.22  ? 330  ASP A OD1 1 
ATOM 2593 O OD2 . ASP A 1 333  ? 2.772   55.576 32.378  1.00 28.22  ? 330  ASP A OD2 1 
ATOM 2594 N N   . SER A 1 334  ? 7.962   57.150 33.259  1.00 44.87  ? 331  SER A N   1 
ATOM 2595 C CA  . SER A 1 334  ? 8.751   58.313 33.656  1.00 44.87  ? 331  SER A CA  1 
ATOM 2596 C C   . SER A 1 334  ? 7.870   59.565 33.625  1.00 44.87  ? 331  SER A C   1 
ATOM 2597 O O   . SER A 1 334  ? 6.786   59.597 33.019  1.00 44.87  ? 331  SER A O   1 
ATOM 2598 C CB  . SER A 1 334  ? 9.972   58.497 32.753  1.00 50.94  ? 331  SER A CB  1 
ATOM 2599 O OG  . SER A 1 334  ? 11.055  57.704 33.181  1.00 50.94  ? 331  SER A OG  1 
ATOM 2600 N N   . GLN A 1 335  ? 8.322   60.619 34.264  1.00 45.72  ? 332  GLN A N   1 
ATOM 2601 C CA  . GLN A 1 335  ? 7.464   61.763 34.290  1.00 45.72  ? 332  GLN A CA  1 
ATOM 2602 C C   . GLN A 1 335  ? 8.167   63.090 34.476  1.00 45.72  ? 332  GLN A C   1 
ATOM 2603 O O   . GLN A 1 335  ? 9.314   63.157 34.943  1.00 45.72  ? 332  GLN A O   1 
ATOM 2604 C CB  . GLN A 1 335  ? 6.339   61.568 35.316  1.00 38.48  ? 332  GLN A CB  1 
ATOM 2605 C CG  . GLN A 1 335  ? 6.763   61.765 36.738  1.00 38.48  ? 332  GLN A CG  1 
ATOM 2606 C CD  . GLN A 1 335  ? 5.994   60.870 37.707  1.00 38.48  ? 332  GLN A CD  1 
ATOM 2607 O OE1 . GLN A 1 335  ? 4.958   60.307 37.363  1.00 38.48  ? 332  GLN A OE1 1 
ATOM 2608 N NE2 . GLN A 1 335  ? 6.532   60.713 38.925  1.00 38.48  ? 332  GLN A NE2 1 
ATOM 2609 N N   . LEU A 1 336  ? 7.448   64.140 34.083  1.00 51.21  ? 333  LEU A N   1 
ATOM 2610 C CA  . LEU A 1 336  ? 7.843   65.503 34.382  1.00 51.21  ? 333  LEU A CA  1 
ATOM 2611 C C   . LEU A 1 336  ? 6.956   65.985 35.488  1.00 51.21  ? 333  LEU A C   1 
ATOM 2612 O O   . LEU A 1 336  ? 5.808   65.631 35.567  1.00 51.21  ? 333  LEU A O   1 
ATOM 2613 C CB  . LEU A 1 336  ? 7.707   66.374 33.149  1.00 61.97  ? 333  LEU A CB  1 
ATOM 2614 C CG  . LEU A 1 336  ? 8.921   67.224 32.880  1.00 61.97  ? 333  LEU A CG  1 
ATOM 2615 C CD1 . LEU A 1 336  ? 10.052  66.838 33.789  1.00 61.97  ? 333  LEU A CD1 1 
ATOM 2616 C CD2 . LEU A 1 336  ? 9.274   66.951 31.478  1.00 61.97  ? 333  LEU A CD2 1 
ATOM 2617 N N   . VAL A 1 337  ? 7.501   66.786 36.363  1.00 43.24  ? 334  VAL A N   1 
ATOM 2618 C CA  . VAL A 1 337  ? 6.885   66.965 37.644  1.00 43.24  ? 334  VAL A CA  1 
ATOM 2619 C C   . VAL A 1 337  ? 7.297   68.290 38.223  1.00 43.24  ? 334  VAL A C   1 
ATOM 2620 O O   . VAL A 1 337  ? 8.493   68.594 38.308  1.00 43.24  ? 334  VAL A O   1 
ATOM 2621 C CB  . VAL A 1 337  ? 7.288   65.810 38.578  1.00 40.90  ? 334  VAL A CB  1 
ATOM 2622 C CG1 . VAL A 1 337  ? 7.633   66.289 39.968  1.00 40.90  ? 334  VAL A CG1 1 
ATOM 2623 C CG2 . VAL A 1 337  ? 6.195   64.823 38.611  1.00 40.90  ? 334  VAL A CG2 1 
ATOM 2624 N N   . LYS A 1 338  ? 6.284   69.064 38.611  1.00 58.56  ? 335  LYS A N   1 
ATOM 2625 C CA  . LYS A 1 338  ? 6.433   70.395 39.181  1.00 58.56  ? 335  LYS A CA  1 
ATOM 2626 C C   . LYS A 1 338  ? 6.452   70.286 40.678  1.00 58.56  ? 335  LYS A C   1 
ATOM 2627 O O   . LYS A 1 338  ? 5.605   69.597 41.237  1.00 58.56  ? 335  LYS A O   1 
ATOM 2628 C CB  . LYS A 1 338  ? 5.251   71.284 38.760  1.00 55.93  ? 335  LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 338  ? 5.299   72.721 39.270  1.00 55.93  ? 335  LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 338  ? 6.265   73.565 38.449  1.00 55.93  ? 335  LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 338  ? 7.018   74.561 39.344  1.00 55.93  ? 335  LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 338  ? 6.271   75.821 39.590  1.00 55.93  ? 335  LYS A NZ  1 
ATOM 2633 N N   . LEU A 1 339  ? 7.425   70.958 41.299  1.00 58.39  ? 336  LEU A N   1 
ATOM 2634 C CA  . LEU A 1 339  ? 7.490   71.180 42.739  1.00 58.39  ? 336  LEU A CA  1 
ATOM 2635 C C   . LEU A 1 339  ? 7.083   72.620 43.041  1.00 58.39  ? 336  LEU A C   1 
ATOM 2636 O O   . LEU A 1 339  ? 7.536   73.562 42.369  1.00 58.39  ? 336  LEU A O   1 
ATOM 2637 C CB  . LEU A 1 339  ? 8.920   71.054 43.253  1.00 33.18  ? 336  LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 339  ? 9.844   69.870 43.022  1.00 33.18  ? 336  LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 339  ? 11.224  70.255 43.599  1.00 33.18  ? 336  LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 339  ? 9.266   68.602 43.676  1.00 33.18  ? 336  LEU A CD2 1 
ATOM 2641 N N   . ASN A 1 340  ? 6.292   72.792 44.092  1.00 44.43  ? 337  ASN A N   1 
ATOM 2642 C CA  . ASN A 1 340  ? 5.710   74.066 44.405  1.00 44.43  ? 337  ASN A CA  1 
ATOM 2643 C C   . ASN A 1 340  ? 5.996   74.397 45.815  1.00 44.43  ? 337  ASN A C   1 
ATOM 2644 O O   . ASN A 1 340  ? 6.032   73.501 46.639  1.00 44.43  ? 337  ASN A O   1 
ATOM 2645 C CB  . ASN A 1 340  ? 4.227   73.947 44.297  1.00 41.82  ? 337  ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 340  ? 3.792   73.631 42.924  1.00 41.82  ? 337  ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 340  ? 3.124   72.619 42.708  1.00 41.82  ? 337  ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 340  ? 4.167   74.480 41.956  1.00 41.82  ? 337  ASN A ND2 1 
ATOM 2649 N N   . VAL A 1 341  ? 6.142   75.679 46.129  1.00 66.27  ? 338  VAL A N   1 
ATOM 2650 C CA  . VAL A 1 341  ? 6.278   76.100 47.521  1.00 66.27  ? 338  VAL A CA  1 
ATOM 2651 C C   . VAL A 1 341  ? 5.050   75.695 48.364  1.00 66.27  ? 338  VAL A C   1 
ATOM 2652 O O   . VAL A 1 341  ? 5.178   75.410 49.572  1.00 66.27  ? 338  VAL A O   1 
ATOM 2653 C CB  . VAL A 1 341  ? 6.546   77.614 47.621  1.00 94.36  ? 338  VAL A CB  1 
ATOM 2654 C CG1 . VAL A 1 341  ? 7.190   77.962 48.959  1.00 94.36  ? 338  VAL A CG1 1 
ATOM 2655 C CG2 . VAL A 1 341  ? 7.453   78.057 46.468  1.00 94.36  ? 338  VAL A CG2 1 
ATOM 2656 N N   . ASP A 1 342  ? 3.877   75.638 47.714  1.00 62.10  ? 339  ASP A N   1 
ATOM 2657 C CA  . ASP A 1 342  ? 2.636   75.259 48.409  1.00 62.10  ? 339  ASP A CA  1 
ATOM 2658 C C   . ASP A 1 342  ? 2.111   73.873 48.098  1.00 62.10  ? 339  ASP A C   1 
ATOM 2659 O O   . ASP A 1 342  ? 2.031   73.485 46.939  1.00 62.10  ? 339  ASP A O   1 
ATOM 2660 C CB  . ASP A 1 342  ? 1.536   76.279 48.124  1.00 80.65  ? 339  ASP A CB  1 
ATOM 2661 C CG  . ASP A 1 342  ? 1.749   77.580 48.871  1.00 80.65  ? 339  ASP A CG  1 
ATOM 2662 O OD1 . ASP A 1 342  ? 1.909   77.542 50.113  1.00 80.65  ? 339  ASP A OD1 1 
ATOM 2663 O OD2 . ASP A 1 342  ? 1.756   78.633 48.206  1.00 80.65  ? 339  ASP A OD2 1 
ATOM 2664 N N   . SER A 1 343  ? 1.752   73.129 49.139  1.00 69.87  ? 340  SER A N   1 
ATOM 2665 C CA  . SER A 1 343  ? 1.230   71.778 48.972  1.00 69.87  ? 340  SER A CA  1 
ATOM 2666 C C   . SER A 1 343  ? -0.295  71.774 48.965  1.00 69.87  ? 340  SER A C   1 
ATOM 2667 O O   . SER A 1 343  ? -0.931  71.900 50.013  1.00 69.87  ? 340  SER A O   1 
ATOM 2668 C CB  . SER A 1 343  ? 1.753   70.861 50.079  1.00 72.33  ? 340  SER A CB  1 
ATOM 2669 O OG  . SER A 1 343  ? 1.361   71.329 51.358  1.00 72.33  ? 340  SER A OG  1 
ATOM 2670 N N   . ASN A 1 344  ? -0.876  71.630 47.779  1.00 80.08  ? 341  ASN A N   1 
ATOM 2671 C CA  . ASN A 1 344  ? -2.327  71.610 47.634  1.00 80.08  ? 341  ASN A CA  1 
ATOM 2672 C C   . ASN A 1 344  ? -2.958  70.395 48.305  1.00 80.08  ? 341  ASN A C   1 
ATOM 2673 O O   . ASN A 1 344  ? -2.333  69.741 49.140  1.00 80.08  ? 341  ASN A O   1 
ATOM 2674 C CB  . ASN A 1 344  ? -2.718  71.656 46.155  1.00 52.08  ? 341  ASN A CB  1 
ATOM 2675 C CG  . ASN A 1 344  ? -2.170  70.479 45.371  1.00 52.08  ? 341  ASN A CG  1 
ATOM 2676 O OD1 . ASN A 1 344  ? -1.491  69.614 45.923  1.00 52.08  ? 341  ASN A OD1 1 
ATOM 2677 N ND2 . ASN A 1 344  ? -2.464  70.442 44.077  1.00 52.08  ? 341  ASN A ND2 1 
ATOM 2678 N N   . GLU A 1 345  ? -4.199  70.098 47.935  1.00 98.72  ? 342  GLU A N   1 
ATOM 2679 C CA  . GLU A 1 345  ? -4.916  68.962 48.500  1.00 98.72  ? 342  GLU A CA  1 
ATOM 2680 C C   . GLU A 1 345  ? -3.970  67.802 48.792  1.00 98.72  ? 342  GLU A C   1 
ATOM 2681 O O   . GLU A 1 345  ? -2.914  67.679 48.170  1.00 98.72  ? 342  GLU A O   1 
ATOM 2682 C CB  . GLU A 1 345  ? -6.029  68.507 47.554  1.00 138.25 ? 342  GLU A CB  1 
ATOM 2683 C CG  . GLU A 1 345  ? -7.070  69.575 47.260  1.00 138.25 ? 342  GLU A CG  1 
ATOM 2684 C CD  . GLU A 1 345  ? -7.778  70.058 48.510  1.00 138.25 ? 342  GLU A CD  1 
ATOM 2685 O OE1 . GLU A 1 345  ? -7.457  69.557 49.608  1.00 138.25 ? 342  GLU A OE1 1 
ATOM 2686 O OE2 . GLU A 1 345  ? -8.656  70.939 48.396  1.00 138.25 ? 342  GLU A OE2 1 
ATOM 2687 N N   . GLN A 1 346  ? -4.355  66.956 49.741  1.00 84.40  ? 343  GLN A N   1 
ATOM 2688 C CA  . GLN A 1 346  ? -3.541  65.805 50.117  1.00 84.40  ? 343  GLN A CA  1 
ATOM 2689 C C   . GLN A 1 346  ? -2.202  66.244 50.699  1.00 84.40  ? 343  GLN A C   1 
ATOM 2690 O O   . GLN A 1 346  ? -1.533  65.476 51.390  1.00 84.40  ? 343  GLN A O   1 
ATOM 2691 C CB  . GLN A 1 346  ? -3.316  64.891 48.910  1.00 180.73 ? 343  GLN A CB  1 
ATOM 2692 C CG  . GLN A 1 346  ? -2.470  63.665 49.210  1.00 180.73 ? 343  GLN A CG  1 
ATOM 2693 C CD  . GLN A 1 346  ? -2.264  62.787 47.992  1.00 180.73 ? 343  GLN A CD  1 
ATOM 2694 O OE1 . GLN A 1 346  ? -2.755  63.089 46.904  1.00 180.73 ? 343  GLN A OE1 1 
ATOM 2695 N NE2 . GLN A 1 346  ? -1.532  61.693 48.168  1.00 180.73 ? 343  GLN A NE2 1 
ATOM 2696 N N   . GLY A 1 347  ? -1.817  67.484 50.415  1.00 55.63  ? 344  GLY A N   1 
ATOM 2697 C CA  . GLY A 1 347  ? -0.563  68.024 50.907  1.00 55.63  ? 344  GLY A CA  1 
ATOM 2698 C C   . GLY A 1 347  ? 0.636   67.486 50.151  1.00 55.63  ? 344  GLY A C   1 
ATOM 2699 O O   . GLY A 1 347  ? 1.541   66.897 50.742  1.00 55.63  ? 344  GLY A O   1 
ATOM 2700 N N   . SER A 1 348  ? 0.642   67.690 48.838  1.00 54.02  ? 345  SER A N   1 
ATOM 2701 C CA  . SER A 1 348  ? 1.736   67.224 47.995  1.00 54.02  ? 345  SER A CA  1 
ATOM 2702 C C   . SER A 1 348  ? 2.288   68.352 47.130  1.00 54.02  ? 345  SER A C   1 
ATOM 2703 O O   . SER A 1 348  ? 1.684   68.729 46.126  1.00 54.02  ? 345  SER A O   1 
ATOM 2704 C CB  . SER A 1 348  ? 1.275   66.062 47.113  1.00 46.56  ? 345  SER A CB  1 
ATOM 2705 O OG  . SER A 1 348  ? 2.329   65.598 46.287  1.00 46.56  ? 345  SER A OG  1 
ATOM 2706 N N   . TYR A 1 349  ? 3.438   68.887 47.527  1.00 55.99  ? 346  TYR A N   1 
ATOM 2707 C CA  . TYR A 1 349  ? 4.072   69.969 46.791  1.00 55.99  ? 346  TYR A CA  1 
ATOM 2708 C C   . TYR A 1 349  ? 4.449   69.461 45.406  1.00 55.99  ? 346  TYR A C   1 
ATOM 2709 O O   . TYR A 1 349  ? 4.884   70.226 44.545  1.00 55.99  ? 346  TYR A O   1 
ATOM 2710 C CB  . TYR A 1 349  ? 5.315   70.467 47.529  1.00 66.05  ? 346  TYR A CB  1 
ATOM 2711 C CG  . TYR A 1 349  ? 5.039   70.959 48.931  1.00 66.05  ? 346  TYR A CG  1 
ATOM 2712 C CD1 . TYR A 1 349  ? 5.098   70.094 50.016  1.00 66.05  ? 346  TYR A CD1 1 
ATOM 2713 C CD2 . TYR A 1 349  ? 4.718   72.289 49.171  1.00 66.05  ? 346  TYR A CD2 1 
ATOM 2714 C CE1 . TYR A 1 349  ? 4.847   70.539 51.300  1.00 66.05  ? 346  TYR A CE1 1 
ATOM 2715 C CE2 . TYR A 1 349  ? 4.465   72.743 50.452  1.00 66.05  ? 346  TYR A CE2 1 
ATOM 2716 C CZ  . TYR A 1 349  ? 4.531   71.864 51.512  1.00 66.05  ? 346  TYR A CZ  1 
ATOM 2717 O OH  . TYR A 1 349  ? 4.279   72.312 52.789  1.00 66.05  ? 346  TYR A OH  1 
ATOM 2718 N N   . VAL A 1 350  ? 4.296   68.163 45.180  1.00 64.70  ? 347  VAL A N   1 
ATOM 2719 C CA  . VAL A 1 350  ? 4.671   67.591 43.890  1.00 64.70  ? 347  VAL A CA  1 
ATOM 2720 C C   . VAL A 1 350  ? 3.494   67.310 42.961  1.00 64.70  ? 347  VAL A C   1 
ATOM 2721 O O   . VAL A 1 350  ? 2.770   66.332 43.148  1.00 64.70  ? 347  VAL A O   1 
ATOM 2722 C CB  . VAL A 1 350  ? 5.481   66.291 44.069  1.00 70.71  ? 347  VAL A CB  1 
ATOM 2723 C CG1 . VAL A 1 350  ? 5.797   65.672 42.716  1.00 70.71  ? 347  VAL A CG1 1 
ATOM 2724 C CG2 . VAL A 1 350  ? 6.758   66.566 44.849  1.00 70.71  ? 347  VAL A CG2 1 
ATOM 2725 N N   . VAL A 1 351  ? 3.310   68.160 41.953  1.00 53.51  ? 348  VAL A N   1 
ATOM 2726 C CA  . VAL A 1 351  ? 2.247   67.943 40.995  1.00 53.51  ? 348  VAL A CA  1 
ATOM 2727 C C   . VAL A 1 351  ? 2.847   67.411 39.686  1.00 53.51  ? 348  VAL A C   1 
ATOM 2728 O O   . VAL A 1 351  ? 3.830   67.962 39.185  1.00 53.51  ? 348  VAL A O   1 
ATOM 2729 C CB  . VAL A 1 351  ? 1.516   69.241 40.698  1.00 44.55  ? 348  VAL A CB  1 
ATOM 2730 C CG1 . VAL A 1 351  ? 0.466   69.031 39.575  1.00 44.55  ? 348  VAL A CG1 1 
ATOM 2731 C CG2 . VAL A 1 351  ? 0.894   69.838 41.995  1.00 44.55  ? 348  VAL A CG2 1 
ATOM 2732 N N   . ALA A 1 352  ? 2.265   66.349 39.132  1.00 35.27  ? 349  ALA A N   1 
ATOM 2733 C CA  . ALA A 1 352  ? 2.774   65.789 37.883  1.00 35.27  ? 349  ALA A CA  1 
ATOM 2734 C C   . ALA A 1 352  ? 2.374   66.661 36.726  1.00 35.27  ? 349  ALA A C   1 
ATOM 2735 O O   . ALA A 1 352  ? 1.293   67.172 36.763  1.00 35.27  ? 349  ALA A O   1 
ATOM 2736 C CB  . ALA A 1 352  ? 2.261   64.332 37.668  1.00 13.91  ? 349  ALA A CB  1 
ATOM 2737 N N   . MET A 1 353  ? 3.256   66.833 35.744  1.00 63.81  ? 350  MET A N   1 
ATOM 2738 C CA  . MET A 1 353  ? 3.028   67.686 34.586  1.00 63.81  ? 350  MET A CA  1 
ATOM 2739 C C   . MET A 1 353  ? 2.936   66.790 33.396  1.00 63.81  ? 350  MET A C   1 
ATOM 2740 O O   . MET A 1 353  ? 1.903   66.703 32.734  1.00 63.81  ? 350  MET A O   1 
ATOM 2741 C CB  . MET A 1 353  ? 4.211   68.610 34.355  1.00 59.74  ? 350  MET A CB  1 
ATOM 2742 C CG  . MET A 1 353  ? 4.570   69.495 35.546  1.00 59.74  ? 350  MET A CG  1 
ATOM 2743 S SD  . MET A 1 353  ? 6.097   70.469 35.284  1.00 59.74  ? 350  MET A SD  1 
ATOM 2744 C CE  . MET A 1 353  ? 6.017   70.941 33.524  1.00 59.74  ? 350  MET A CE  1 
ATOM 2745 N N   . GLU A 1 354  ? 4.037   66.118 33.113  1.00 64.43  ? 351  GLU A N   1 
ATOM 2746 C CA  . GLU A 1 354  ? 3.995   65.083 32.127  1.00 64.43  ? 351  GLU A CA  1 
ATOM 2747 C C   . GLU A 1 354  ? 4.307   63.677 32.648  1.00 64.43  ? 351  GLU A C   1 
ATOM 2748 O O   . GLU A 1 354  ? 5.018   63.475 33.622  1.00 64.43  ? 351  GLU A O   1 
ATOM 2749 C CB  . GLU A 1 354  ? 4.849   65.436 30.921  1.00 78.44  ? 351  GLU A CB  1 
ATOM 2750 C CG  . GLU A 1 354  ? 4.446   64.637 29.714  1.00 78.44  ? 351  GLU A CG  1 
ATOM 2751 C CD  . GLU A 1 354  ? 4.667   65.386 28.461  1.00 78.44  ? 351  GLU A CD  1 
ATOM 2752 O OE1 . GLU A 1 354  ? 5.317   66.445 28.520  1.00 78.44  ? 351  GLU A OE1 1 
ATOM 2753 O OE2 . GLU A 1 354  ? 4.190   64.913 27.416  1.00 78.44  ? 351  GLU A OE2 1 
ATOM 2754 N N   . THR A 1 355  ? 3.729   62.723 31.938  1.00 37.95  ? 352  THR A N   1 
ATOM 2755 C CA  . THR A 1 355  ? 3.888   61.319 32.150  1.00 37.95  ? 352  THR A CA  1 
ATOM 2756 C C   . THR A 1 355  ? 4.354   60.576 30.892  1.00 37.95  ? 352  THR A C   1 
ATOM 2757 O O   . THR A 1 355  ? 3.650   60.526 29.899  1.00 37.95  ? 352  THR A O   1 
ATOM 2758 C CB  . THR A 1 355  ? 2.593   60.787 32.587  1.00 40.69  ? 352  THR A CB  1 
ATOM 2759 O OG1 . THR A 1 355  ? 2.515   60.997 34.000  1.00 40.69  ? 352  THR A OG1 1 
ATOM 2760 C CG2 . THR A 1 355  ? 2.565   59.371 32.309  1.00 40.69  ? 352  THR A CG2 1 
ATOM 2761 N N   . PHE A 1 356  ? 5.536   59.972 30.943  1.00 48.72  ? 353  PHE A N   1 
ATOM 2762 C CA  . PHE A 1 356  ? 6.113   59.340 29.756  1.00 48.72  ? 353  PHE A CA  1 
ATOM 2763 C C   . PHE A 1 356  ? 6.009   57.826 29.814  1.00 48.72  ? 353  PHE A C   1 
ATOM 2764 O O   . PHE A 1 356  ? 6.446   57.211 30.805  1.00 48.72  ? 353  PHE A O   1 
ATOM 2765 C CB  . PHE A 1 356  ? 7.558   59.765 29.640  1.00 42.02  ? 353  PHE A CB  1 
ATOM 2766 C CG  . PHE A 1 356  ? 7.750   61.235 29.690  1.00 42.02  ? 353  PHE A CG  1 
ATOM 2767 C CD1 . PHE A 1 356  ? 8.073   61.853 30.876  1.00 42.02  ? 353  PHE A CD1 1 
ATOM 2768 C CD2 . PHE A 1 356  ? 7.588   62.007 28.544  1.00 42.02  ? 353  PHE A CD2 1 
ATOM 2769 C CE1 . PHE A 1 356  ? 8.252   63.237 30.916  1.00 42.02  ? 353  PHE A CE1 1 
ATOM 2770 C CE2 . PHE A 1 356  ? 7.754   63.383 28.574  1.00 42.02  ? 353  PHE A CE2 1 
ATOM 2771 C CZ  . PHE A 1 356  ? 8.092   64.005 29.745  1.00 42.02  ? 353  PHE A CZ  1 
ATOM 2772 N N   . THR A 1 357  ? 5.434   57.210 28.778  1.00 45.49  ? 354  THR A N   1 
ATOM 2773 C CA  . THR A 1 357  ? 5.085   55.795 28.935  1.00 45.49  ? 354  THR A CA  1 
ATOM 2774 C C   . THR A 1 357  ? 6.315   54.964 28.973  1.00 45.49  ? 354  THR A C   1 
ATOM 2775 O O   . THR A 1 357  ? 7.211   55.145 28.162  1.00 45.49  ? 354  THR A O   1 
ATOM 2776 C CB  . THR A 1 357  ? 4.012   55.197 27.934  1.00 49.61  ? 354  THR A CB  1 
ATOM 2777 O OG1 . THR A 1 357  ? 4.185   55.739 26.641  1.00 49.61  ? 354  THR A OG1 1 
ATOM 2778 C CG2 . THR A 1 357  ? 2.613   55.542 28.382  1.00 49.61  ? 354  THR A CG2 1 
ATOM 2779 N N   . ASN A 1 358  ? 6.361   54.110 29.985  1.00 34.43  ? 355  ASN A N   1 
ATOM 2780 C CA  . ASN A 1 358  ? 7.329   53.022 30.107  1.00 34.43  ? 355  ASN A CA  1 
ATOM 2781 C C   . ASN A 1 358  ? 6.553   51.731 29.973  1.00 34.43  ? 355  ASN A C   1 
ATOM 2782 O O   . ASN A 1 358  ? 5.697   51.445 30.827  1.00 34.43  ? 355  ASN A O   1 
ATOM 2783 C CB  . ASN A 1 358  ? 7.929   53.056 31.513  1.00 34.10  ? 355  ASN A CB  1 
ATOM 2784 C CG  . ASN A 1 358  ? 9.091   52.120 31.667  1.00 34.10  ? 355  ASN A CG  1 
ATOM 2785 O OD1 . ASN A 1 358  ? 9.481   51.444 30.713  1.00 34.10  ? 355  ASN A OD1 1 
ATOM 2786 N ND2 . ASN A 1 358  ? 9.660   52.069 32.862  1.00 34.10  ? 355  ASN A ND2 1 
ATOM 2787 N N   . LEU A 1 359  ? 6.822   50.949 28.927  1.00 36.30  ? 356  LEU A N   1 
ATOM 2788 C CA  . LEU A 1 359  ? 6.361   49.545 28.882  1.00 36.30  ? 356  LEU A CA  1 
ATOM 2789 C C   . LEU A 1 359  ? 6.979   48.668 30.000  1.00 36.30  ? 356  LEU A C   1 
ATOM 2790 O O   . LEU A 1 359  ? 6.681   47.486 30.079  1.00 36.30  ? 356  LEU A O   1 
ATOM 2791 C CB  . LEU A 1 359  ? 6.574   48.904 27.521  1.00 25.85  ? 356  LEU A CB  1 
ATOM 2792 C CG  . LEU A 1 359  ? 5.818   49.569 26.373  1.00 25.85  ? 356  LEU A CG  1 
ATOM 2793 C CD1 . LEU A 1 359  ? 5.844   48.696 25.126  1.00 25.85  ? 356  LEU A CD1 1 
ATOM 2794 C CD2 . LEU A 1 359  ? 4.348   49.903 26.795  1.00 25.85  ? 356  LEU A CD2 1 
ATOM 2795 N N   . GLY A 1 360  ? 7.822   49.295 30.832  1.00 77.29  ? 357  GLY A N   1 
ATOM 2796 C CA  . GLY A 1 360  ? 8.107   48.889 32.211  1.00 77.29  ? 357  GLY A CA  1 
ATOM 2797 C C   . GLY A 1 360  ? 9.027   47.742 32.104  1.00 77.29  ? 357  GLY A C   1 
ATOM 2798 O O   . GLY A 1 360  ? 9.494   47.484 31.024  1.00 77.29  ? 357  GLY A O   1 
ATOM 2799 N N   . PRO A 1 361  ? 9.333   47.061 33.215  1.00 42.29  ? 358  PRO A N   1 
ATOM 2800 C CA  . PRO A 1 361  ? 9.713   45.654 32.929  1.00 42.29  ? 358  PRO A CA  1 
ATOM 2801 C C   . PRO A 1 361  ? 8.457   44.907 32.479  1.00 42.29  ? 358  PRO A C   1 
ATOM 2802 O O   . PRO A 1 361  ? 7.446   44.941 33.157  1.00 42.29  ? 358  PRO A O   1 
ATOM 2803 C CB  . PRO A 1 361  ? 10.297  45.135 34.249  1.00 29.24  ? 358  PRO A CB  1 
ATOM 2804 C CG  . PRO A 1 361  ? 9.700   46.042 35.319  1.00 29.24  ? 358  PRO A CG  1 
ATOM 2805 C CD  . PRO A 1 361  ? 9.399   47.416 34.644  1.00 29.24  ? 358  PRO A CD  1 
ATOM 2806 N N   . ILE A 1 362  ? 8.508   44.319 31.293  1.00 31.84  ? 359  ILE A N   1 
ATOM 2807 C CA  . ILE A 1 362  ? 7.446   43.467 30.781  1.00 31.84  ? 359  ILE A CA  1 
ATOM 2808 C C   . ILE A 1 362  ? 7.675   42.072 31.296  1.00 31.84  ? 359  ILE A C   1 
ATOM 2809 O O   . ILE A 1 362  ? 8.585   41.380 30.884  1.00 31.84  ? 359  ILE A O   1 
ATOM 2810 C CB  . ILE A 1 362  ? 7.461   43.370 29.264  1.00 27.11  ? 359  ILE A CB  1 
ATOM 2811 C CG1 . ILE A 1 362  ? 7.349   44.778 28.652  1.00 27.11  ? 359  ILE A CG1 1 
ATOM 2812 C CG2 . ILE A 1 362  ? 6.346   42.436 28.792  1.00 27.11  ? 359  ILE A CG2 1 
ATOM 2813 C CD1 . ILE A 1 362  ? 7.414   44.794 27.174  1.00 27.11  ? 359  ILE A CD1 1 
ATOM 2814 N N   . VAL A 1 363  ? 6.808   41.658 32.196  1.00 41.86  ? 360  VAL A N   1 
ATOM 2815 C CA  . VAL A 1 363  ? 7.019   40.500 33.008  1.00 41.86  ? 360  VAL A CA  1 
ATOM 2816 C C   . VAL A 1 363  ? 6.379   39.246 32.402  1.00 41.86  ? 360  VAL A C   1 
ATOM 2817 O O   . VAL A 1 363  ? 6.824   38.108 32.632  1.00 41.86  ? 360  VAL A O   1 
ATOM 2818 C CB  . VAL A 1 363  ? 6.525   40.882 34.349  1.00 46.94  ? 360  VAL A CB  1 
ATOM 2819 C CG1 . VAL A 1 363  ? 5.611   39.849 34.953  1.00 46.94  ? 360  VAL A CG1 1 
ATOM 2820 C CG2 . VAL A 1 363  ? 7.741   41.257 35.196  1.00 46.94  ? 360  VAL A CG2 1 
ATOM 2821 N N   . ASP A 1 364  ? 5.381   39.466 31.571  1.00 33.06  ? 361  ASP A N   1 
ATOM 2822 C CA  . ASP A 1 364  ? 4.761   38.413 30.814  1.00 33.06  ? 361  ASP A CA  1 
ATOM 2823 C C   . ASP A 1 364  ? 3.903   39.193 29.875  1.00 33.06  ? 361  ASP A C   1 
ATOM 2824 O O   . ASP A 1 364  ? 3.720   40.397 30.069  1.00 33.06  ? 361  ASP A O   1 
ATOM 2825 C CB  . ASP A 1 364  ? 3.899   37.523 31.727  1.00 53.77  ? 361  ASP A CB  1 
ATOM 2826 C CG  . ASP A 1 364  ? 3.237   36.356 30.980  1.00 53.77  ? 361  ASP A CG  1 
ATOM 2827 O OD1 . ASP A 1 364  ? 2.396   35.676 31.601  1.00 53.77  ? 361  ASP A OD1 1 
ATOM 2828 O OD2 . ASP A 1 364  ? 3.521   36.120 29.780  1.00 53.77  ? 361  ASP A OD2 1 
ATOM 2829 N N   . MET A 1 365  ? 3.383   38.539 28.854  1.00 32.53  ? 362  MET A N   1 
ATOM 2830 C CA  . MET A 1 365  ? 2.597   39.215 27.846  1.00 32.53  ? 362  MET A CA  1 
ATOM 2831 C C   . MET A 1 365  ? 1.860   38.171 26.957  1.00 32.53  ? 362  MET A C   1 
ATOM 2832 O O   . MET A 1 365  ? 2.104   36.979 27.083  1.00 32.53  ? 362  MET A O   1 
ATOM 2833 C CB  . MET A 1 365  ? 3.522   40.133 27.039  1.00 44.48  ? 362  MET A CB  1 
ATOM 2834 C CG  . MET A 1 365  ? 4.476   39.408 26.138  1.00 44.48  ? 362  MET A CG  1 
ATOM 2835 S SD  . MET A 1 365  ? 5.584   40.435 25.140  1.00 44.48  ? 362  MET A SD  1 
ATOM 2836 C CE  . MET A 1 365  ? 6.113   39.184 23.988  1.00 44.48  ? 362  MET A CE  1 
ATOM 2837 N N   . CYS A 1 366  ? 0.979   38.646 26.083  1.00 44.91  ? 363  CYS A N   1 
ATOM 2838 C CA  . CYS A 1 366  ? 0.229   37.762 25.198  1.00 44.91  ? 363  CYS A CA  1 
ATOM 2839 C C   . CYS A 1 366  ? -0.435  38.539 24.067  1.00 44.91  ? 363  CYS A C   1 
ATOM 2840 O O   . CYS A 1 366  ? -0.721  39.729 24.202  1.00 44.91  ? 363  CYS A O   1 
ATOM 2841 C CB  . CYS A 1 366  ? -0.823  36.981 25.988  1.00 45.31  ? 363  CYS A CB  1 
ATOM 2842 S SG  . CYS A 1 366  ? -2.049  38.015 26.823  1.00 45.31  ? 363  CYS A SG  1 
ATOM 2843 N N   . VAL A 1 367  ? -0.673  37.860 22.949  1.00 53.58  ? 364  VAL A N   1 
ATOM 2844 C CA  . VAL A 1 367  ? -1.292  38.486 21.787  1.00 53.58  ? 364  VAL A CA  1 
ATOM 2845 C C   . VAL A 1 367  ? -2.801  38.634 21.951  1.00 53.58  ? 364  VAL A C   1 
ATOM 2846 O O   . VAL A 1 367  ? -3.386  38.126 22.907  1.00 53.58  ? 364  VAL A O   1 
ATOM 2847 C CB  . VAL A 1 367  ? -1.003  37.692 20.498  1.00 44.80  ? 364  VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 367  ? -1.716  38.326 19.314  1.00 44.80  ? 364  VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 367  ? 0.496   37.615 20.249  1.00 44.80  ? 364  VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 368  ? -3.423  39.334 21.007  1.00 77.01  ? 365  VAL A N   1 
ATOM 2851 C CA  . VAL A 1 368  ? -4.864  39.555 21.033  1.00 77.01  ? 365  VAL A CA  1 
ATOM 2852 C C   . VAL A 1 368  ? -5.360  40.032 19.672  1.00 77.01  ? 365  VAL A C   1 
ATOM 2853 O O   . VAL A 1 368  ? -4.644  40.729 18.952  1.00 77.01  ? 365  VAL A O   1 
ATOM 2854 C CB  . VAL A 1 368  ? -5.258  40.588 22.104  1.00 43.41  ? 365  VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 368  ? -6.755  40.851 22.061  1.00 43.41  ? 365  VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 368  ? -4.833  40.109 23.484  1.00 43.41  ? 365  VAL A CG2 1 
ATOM 2857 N N   . ASP A 1 369  ? -6.585  39.653 19.320  1.00 125.41 ? 366  ASP A N   1 
ATOM 2858 C CA  . ASP A 1 369  ? -7.421  38.827 20.185  1.00 125.41 ? 366  ASP A CA  1 
ATOM 2859 C C   . ASP A 1 369  ? -8.421  39.681 20.958  1.00 125.41 ? 366  ASP A C   1 
ATOM 2860 O O   . ASP A 1 369  ? -8.841  39.320 22.058  1.00 125.41 ? 366  ASP A O   1 
ATOM 2861 C CB  . ASP A 1 369  ? -6.562  38.010 21.152  1.00 78.75  ? 366  ASP A CB  1 
ATOM 2862 C CG  . ASP A 1 369  ? -5.800  36.898 20.457  1.00 78.75  ? 366  ASP A CG  1 
ATOM 2863 O OD1 . ASP A 1 369  ? -6.141  36.574 19.300  1.00 78.75  ? 366  ASP A OD1 1 
ATOM 2864 O OD2 . ASP A 1 369  ? -4.859  36.350 21.067  1.00 78.75  ? 366  ASP A OD2 1 
ATOM 2865 N N   . LEU A 1 370  ? -8.798  40.815 20.376  1.00 122.99 ? 367  LEU A N   1 
ATOM 2866 C CA  . LEU A 1 370  ? -9.750  41.721 21.006  1.00 122.99 ? 367  LEU A CA  1 
ATOM 2867 C C   . LEU A 1 370  ? -10.994 41.892 20.140  1.00 122.99 ? 367  LEU A C   1 
ATOM 2868 O O   . LEU A 1 370  ? -12.001 41.214 20.343  1.00 122.99 ? 367  LEU A O   1 
ATOM 2869 C CB  . LEU A 1 370  ? -9.102  43.081 21.272  1.00 88.30  ? 367  LEU A CB  1 
ATOM 2870 C CG  . LEU A 1 370  ? -7.878  43.081 22.191  1.00 88.30  ? 367  LEU A CG  1 
ATOM 2871 C CD1 . LEU A 1 370  ? -7.292  44.480 22.306  1.00 88.30  ? 367  LEU A CD1 1 
ATOM 2872 C CD2 . LEU A 1 370  ? -8.236  42.530 23.563  1.00 88.30  ? 367  LEU A CD2 1 
ATOM 2873 N N   . GLU A 1 371  ? -10.916 42.801 19.173  1.00 144.65 ? 368  GLU A N   1 
ATOM 2874 C CA  . GLU A 1 371  ? -12.034 43.058 18.273  1.00 144.65 ? 368  GLU A CA  1 
ATOM 2875 C C   . GLU A 1 371  ? -12.103 42.014 17.163  1.00 144.65 ? 368  GLU A C   1 
ATOM 2876 O O   . GLU A 1 371  ? -12.470 42.324 16.030  1.00 144.65 ? 368  GLU A O   1 
ATOM 2877 C CB  . GLU A 1 371  ? -11.926 44.460 17.670  1.00 145.77 ? 368  GLU A CB  1 
ATOM 2878 C CG  . GLU A 1 371  ? -10.666 44.691 16.851  1.00 145.77 ? 368  GLU A CG  1 
ATOM 2879 C CD  . GLU A 1 371  ? -9.404  44.626 17.690  1.00 145.77 ? 368  GLU A CD  1 
ATOM 2880 O OE1 . GLU A 1 371  ? -9.515  44.609 18.934  1.00 145.77 ? 368  GLU A OE1 1 
ATOM 2881 O OE2 . GLU A 1 371  ? -8.301  44.596 17.105  1.00 145.77 ? 368  GLU A OE2 1 
ATOM 2882 N N   . ARG A 1 372  ? -11.749 40.777 17.497  1.00 185.29 ? 369  ARG A N   1 
ATOM 2883 C CA  . ARG A 1 372  ? -11.772 39.688 16.528  1.00 185.29 ? 369  ARG A CA  1 
ATOM 2884 C C   . ARG A 1 372  ? -11.603 40.213 15.106  1.00 185.29 ? 369  ARG A C   1 
ATOM 2885 O O   . ARG A 1 372  ? -12.496 40.071 14.272  1.00 185.29 ? 369  ARG A O   1 
ATOM 2886 C CB  . ARG A 1 372  ? -13.075 38.896 16.644  1.00 130.11 ? 369  ARG A CB  1 
ATOM 2887 C CG  . ARG A 1 372  ? -13.184 37.732 15.672  1.00 130.11 ? 369  ARG A CG  1 
ATOM 2888 C CD  . ARG A 1 372  ? -14.510 37.006 15.826  1.00 130.11 ? 369  ARG A CD  1 
ATOM 2889 N NE  . ARG A 1 372  ? -14.689 36.473 17.173  1.00 130.11 ? 369  ARG A NE  1 
ATOM 2890 C CZ  . ARG A 1 372  ? -15.763 35.801 17.574  1.00 130.11 ? 369  ARG A CZ  1 
ATOM 2891 N NH1 . ARG A 1 372  ? -16.761 35.577 16.730  1.00 130.11 ? 369  ARG A NH1 1 
ATOM 2892 N NH2 . ARG A 1 372  ? -15.841 35.353 18.819  1.00 130.11 ? 369  ARG A NH2 1 
ATOM 2893 N N   . GLN A 1 373  ? -10.451 40.819 14.837  1.00 127.65 ? 370  GLN A N   1 
ATOM 2894 C CA  . GLN A 1 373  ? -10.163 41.366 13.517  1.00 127.65 ? 370  GLN A CA  1 
ATOM 2895 C C   . GLN A 1 373  ? -9.246  40.444 12.721  1.00 127.65 ? 370  GLN A C   1 
ATOM 2896 O O   . GLN A 1 373  ? -9.706  39.660 11.890  1.00 127.65 ? 370  GLN A O   1 
ATOM 2897 C CB  . GLN A 1 373  ? -9.535  42.756 13.637  1.00 103.03 ? 370  GLN A CB  1 
ATOM 2898 C CG  . GLN A 1 373  ? -10.425 43.783 14.317  1.00 103.03 ? 370  GLN A CG  1 
ATOM 2899 C CD  . GLN A 1 373  ? -9.777  45.151 14.402  1.00 103.03 ? 370  GLN A CD  1 
ATOM 2900 O OE1 . GLN A 1 373  ? -8.631  45.334 13.992  1.00 103.03 ? 370  GLN A OE1 1 
ATOM 2901 N NE2 . GLN A 1 373  ? -10.509 46.121 14.937  1.00 103.03 ? 370  GLN A NE2 1 
ATOM 2902 N N   . GLY A 1 374  ? -7.946  40.543 12.979  1.00 68.05  ? 371  GLY A N   1 
ATOM 2903 C CA  . GLY A 1 374  ? -6.971  39.727 12.291  1.00 68.05  ? 371  GLY A CA  1 
ATOM 2904 C C   . GLY A 1 374  ? -5.574  40.212 12.617  1.00 68.05  ? 371  GLY A C   1 
ATOM 2905 O O   . GLY A 1 374  ? -4.593  39.599 12.212  1.00 68.05  ? 371  GLY A O   1 
ATOM 2906 N N   . GLN A 1 375  ? -5.487  41.333 13.330  1.00 86.70  ? 372  GLN A N   1 
ATOM 2907 C CA  . GLN A 1 375  ? -4.217  41.822 13.840  1.00 86.70  ? 372  GLN A CA  1 
ATOM 2908 C C   . GLN A 1 375  ? -4.092  41.419 15.293  1.00 86.70  ? 372  GLN A C   1 
ATOM 2909 O O   . GLN A 1 375  ? -5.084  41.157 15.950  1.00 86.70  ? 372  GLN A O   1 
ATOM 2910 C CB  . GLN A 1 375  ? -4.079  43.348 13.682  1.00 117.83 ? 372  GLN A CB  1 
ATOM 2911 C CG  . GLN A 1 375  ? -5.309  44.196 14.005  1.00 117.83 ? 372  GLN A CG  1 
ATOM 2912 C CD  . GLN A 1 375  ? -5.930  43.887 15.357  1.00 117.83 ? 372  GLN A CD  1 
ATOM 2913 O OE1 . GLN A 1 375  ? -5.670  44.566 16.344  1.00 117.83 ? 372  GLN A OE1 1 
ATOM 2914 N NE2 . GLN A 1 375  ? -6.758  42.858 15.403  1.00 117.83 ? 372  GLN A NE2 1 
ATOM 2915 N N   . GLY A 1 376  ? -2.870  41.359 15.792  1.00 88.71  ? 373  GLY A N   1 
ATOM 2916 C CA  . GLY A 1 376  ? -2.660  41.101 17.198  1.00 88.71  ? 373  GLY A CA  1 
ATOM 2917 C C   . GLY A 1 376  ? -2.436  42.392 17.941  1.00 88.71  ? 373  GLY A C   1 
ATOM 2918 O O   . GLY A 1 376  ? -1.705  43.258 17.473  1.00 88.71  ? 373  GLY A O   1 
ATOM 2919 N N   . GLN A 1 377  ? -3.104  42.531 19.082  1.00 44.96  ? 374  GLN A N   1 
ATOM 2920 C CA  . GLN A 1 377  ? -2.815  43.591 20.027  1.00 44.96  ? 374  GLN A CA  1 
ATOM 2921 C C   . GLN A 1 377  ? -1.952  42.836 20.970  1.00 44.96  ? 374  GLN A C   1 
ATOM 2922 O O   . GLN A 1 377  ? -2.173  41.663 21.181  1.00 44.96  ? 374  GLN A O   1 
ATOM 2923 C CB  . GLN A 1 377  ? -4.064  44.063 20.766  1.00 89.43  ? 374  GLN A CB  1 
ATOM 2924 C CG  . GLN A 1 377  ? -5.236  44.451 19.903  1.00 89.43  ? 374  GLN A CG  1 
ATOM 2925 C CD  . GLN A 1 377  ? -5.477  45.953 19.785  1.00 89.43  ? 374  GLN A CD  1 
ATOM 2926 O OE1 . GLN A 1 377  ? -5.901  46.411 18.732  1.00 89.43  ? 374  GLN A OE1 1 
ATOM 2927 N NE2 . GLN A 1 377  ? -5.250  46.716 20.858  1.00 89.43  ? 374  GLN A NE2 1 
ATOM 2928 N N   . LEU A 1 378  ? -0.954  43.480 21.539  1.00 54.57  ? 375  LEU A N   1 
ATOM 2929 C CA  . LEU A 1 378  ? -0.090  42.789 22.487  1.00 54.57  ? 375  LEU A CA  1 
ATOM 2930 C C   . LEU A 1 378  ? -0.413  43.267 23.857  1.00 54.57  ? 375  LEU A C   1 
ATOM 2931 O O   . LEU A 1 378  ? -0.536  44.466 24.065  1.00 54.57  ? 375  LEU A O   1 
ATOM 2932 C CB  . LEU A 1 378  ? 1.340   43.124 22.200  1.00 41.56  ? 375  LEU A CB  1 
ATOM 2933 C CG  . LEU A 1 378  ? 2.322   42.263 22.953  1.00 41.56  ? 375  LEU A CG  1 
ATOM 2934 C CD1 . LEU A 1 378  ? 2.373   40.853 22.371  1.00 41.56  ? 375  LEU A CD1 1 
ATOM 2935 C CD2 . LEU A 1 378  ? 3.646   42.989 22.839  1.00 41.56  ? 375  LEU A CD2 1 
ATOM 2936 N N   . VAL A 1 379  ? -0.577  42.352 24.800  1.00 48.23  ? 376  VAL A N   1 
ATOM 2937 C CA  . VAL A 1 379  ? -1.063  42.757 26.128  1.00 48.23  ? 376  VAL A CA  1 
ATOM 2938 C C   . VAL A 1 379  ? -0.036  42.313 27.108  1.00 48.23  ? 376  VAL A C   1 
ATOM 2939 O O   . VAL A 1 379  ? 0.339   41.145 27.110  1.00 48.23  ? 376  VAL A O   1 
ATOM 2940 C CB  . VAL A 1 379  ? -2.396  42.098 26.451  1.00 33.04  ? 376  VAL A CB  1 
ATOM 2941 C CG1 . VAL A 1 379  ? -2.807  42.311 27.908  1.00 33.04  ? 376  VAL A CG1 1 
ATOM 2942 C CG2 . VAL A 1 379  ? -3.523  42.551 25.396  1.00 33.04  ? 376  VAL A CG2 1 
ATOM 2943 N N   . THR A 1 380  ? 0.445   43.248 27.915  1.00 43.31  ? 377  THR A N   1 
ATOM 2944 C CA  . THR A 1 380  ? 1.626   43.011 28.707  1.00 43.31  ? 377  THR A CA  1 
ATOM 2945 C C   . THR A 1 380  ? 1.387   43.387 30.136  1.00 43.31  ? 377  THR A C   1 
ATOM 2946 O O   . THR A 1 380  ? 0.808   44.442 30.412  1.00 43.31  ? 377  THR A O   1 
ATOM 2947 C CB  . THR A 1 380  ? 2.748   43.951 28.297  1.00 23.78  ? 377  THR A CB  1 
ATOM 2948 O OG1 . THR A 1 380  ? 2.381   45.282 28.667  1.00 23.78  ? 377  THR A OG1 1 
ATOM 2949 C CG2 . THR A 1 380  ? 3.051   43.902 26.806  1.00 23.78  ? 377  THR A CG2 1 
ATOM 2950 N N   . CYS A 1 381  ? 1.886   42.546 31.036  1.00 28.05  ? 378  CYS A N   1 
ATOM 2951 C CA  . CYS A 1 381  ? 1.986   42.851 32.455  1.00 28.05  ? 378  CYS A CA  1 
ATOM 2952 C C   . CYS A 1 381  ? 3.223   43.662 32.646  1.00 28.05  ? 378  CYS A C   1 
ATOM 2953 O O   . CYS A 1 381  ? 4.294   43.209 32.237  1.00 28.05  ? 378  CYS A O   1 
ATOM 2954 C CB  . CYS A 1 381  ? 2.146   41.570 33.237  1.00 37.95  ? 378  CYS A CB  1 
ATOM 2955 S SG  . CYS A 1 381  ? 0.937   40.402 32.733  1.00 37.95  ? 378  CYS A SG  1 
ATOM 2956 N N   . SER A 1 382  ? 3.118   44.820 33.267  1.00 37.26  ? 379  SER A N   1 
ATOM 2957 C CA  . SER A 1 382  ? 4.210   45.742 33.180  1.00 37.26  ? 379  SER A CA  1 
ATOM 2958 C C   . SER A 1 382  ? 4.405   46.367 34.492  1.00 37.26  ? 379  SER A C   1 
ATOM 2959 O O   . SER A 1 382  ? 3.504   46.375 35.315  1.00 37.26  ? 379  SER A O   1 
ATOM 2960 C CB  . SER A 1 382  ? 3.952   46.858 32.141  1.00 39.06  ? 379  SER A CB  1 
ATOM 2961 O OG  . SER A 1 382  ? 3.780   46.367 30.819  1.00 39.06  ? 379  SER A OG  1 
ATOM 2962 N N   . GLY A 1 383  ? 5.580   46.923 34.693  1.00 31.25  ? 380  GLY A N   1 
ATOM 2963 C CA  . GLY A 1 383  ? 5.821   47.654 35.883  1.00 31.25  ? 380  GLY A CA  1 
ATOM 2964 C C   . GLY A 1 383  ? 5.904   46.688 37.018  1.00 31.25  ? 380  GLY A C   1 
ATOM 2965 O O   . GLY A 1 383  ? 6.010   45.449 36.839  1.00 31.25  ? 380  GLY A O   1 
ATOM 2966 N N   . ALA A 1 384  ? 5.858   47.241 38.211  1.00 42.16  ? 381  ALA A N   1 
ATOM 2967 C CA  . ALA A 1 384  ? 6.045   46.454 39.393  1.00 42.16  ? 381  ALA A CA  1 
ATOM 2968 C C   . ALA A 1 384  ? 5.456   47.286 40.529  1.00 42.16  ? 381  ALA A C   1 
ATOM 2969 O O   . ALA A 1 384  ? 5.430   48.515 40.477  1.00 42.16  ? 381  ALA A O   1 
ATOM 2970 C CB  . ALA A 1 384  ? 7.553   46.222 39.594  1.00 43.35  ? 381  ALA A CB  1 
ATOM 2971 N N   . PHE A 1 385  ? 4.977   46.626 41.553  1.00 45.34  ? 382  PHE A N   1 
ATOM 2972 C CA  . PHE A 1 385  ? 4.438   47.363 42.686  1.00 45.34  ? 382  PHE A CA  1 
ATOM 2973 C C   . PHE A 1 385  ? 3.363   48.366 42.212  1.00 45.34  ? 382  PHE A C   1 
ATOM 2974 O O   . PHE A 1 385  ? 2.536   48.002 41.396  1.00 45.34  ? 382  PHE A O   1 
ATOM 2975 C CB  . PHE A 1 385  ? 5.586   48.021 43.455  1.00 23.62  ? 382  PHE A CB  1 
ATOM 2976 C CG  . PHE A 1 385  ? 6.860   47.165 43.538  1.00 23.62  ? 382  PHE A CG  1 
ATOM 2977 C CD1 . PHE A 1 385  ? 8.046   47.580 42.898  1.00 23.62  ? 382  PHE A CD1 1 
ATOM 2978 C CD2 . PHE A 1 385  ? 6.896   45.958 44.316  1.00 23.62  ? 382  PHE A CD2 1 
ATOM 2979 C CE1 . PHE A 1 385  ? 9.235   46.801 43.014  1.00 23.62  ? 382  PHE A CE1 1 
ATOM 2980 C CE2 . PHE A 1 385  ? 8.069   45.138 44.393  1.00 23.62  ? 382  PHE A CE2 1 
ATOM 2981 C CZ  . PHE A 1 385  ? 9.239   45.560 43.755  1.00 23.62  ? 382  PHE A CZ  1 
ATOM 2982 N N   . LYS A 1 386  ? 3.385   49.615 42.669  1.00 48.25  ? 383  LYS A N   1 
ATOM 2983 C CA  . LYS A 1 386  ? 2.330   50.571 42.294  1.00 48.25  ? 383  LYS A CA  1 
ATOM 2984 C C   . LYS A 1 386  ? 2.330   50.998 40.845  1.00 48.25  ? 383  LYS A C   1 
ATOM 2985 O O   . LYS A 1 386  ? 1.308   51.450 40.347  1.00 48.25  ? 383  LYS A O   1 
ATOM 2986 C CB  . LYS A 1 386  ? 2.279   51.785 43.230  1.00 29.65  ? 383  LYS A CB  1 
ATOM 2987 C CG  . LYS A 1 386  ? 3.032   53.010 42.786  1.00 29.65  ? 383  LYS A CG  1 
ATOM 2988 C CD  . LYS A 1 386  ? 3.707   53.664 43.981  1.00 29.65  ? 383  LYS A CD  1 
ATOM 2989 C CE  . LYS A 1 386  ? 4.214   55.119 43.717  1.00 29.65  ? 383  LYS A CE  1 
ATOM 2990 N NZ  . LYS A 1 386  ? 4.066   55.722 42.334  1.00 29.65  ? 383  LYS A NZ  1 
ATOM 2991 N N   . GLU A 1 387  ? 3.449   50.819 40.152  1.00 36.46  ? 384  GLU A N   1 
ATOM 2992 C CA  . GLU A 1 387  ? 3.489   51.090 38.699  1.00 36.46  ? 384  GLU A CA  1 
ATOM 2993 C C   . GLU A 1 387  ? 2.885   49.964 37.905  1.00 36.46  ? 384  GLU A C   1 
ATOM 2994 O O   . GLU A 1 387  ? 2.866   49.961 36.673  1.00 36.46  ? 384  GLU A O   1 
ATOM 2995 C CB  . GLU A 1 387  ? 4.896   51.367 38.243  1.00 40.21  ? 384  GLU A CB  1 
ATOM 2996 C CG  . GLU A 1 387  ? 5.588   52.216 39.212  1.00 40.21  ? 384  GLU A CG  1 
ATOM 2997 C CD  . GLU A 1 387  ? 4.878   53.552 39.421  1.00 40.21  ? 384  GLU A CD  1 
ATOM 2998 O OE1 . GLU A 1 387  ? 4.139   54.008 38.482  1.00 40.21  ? 384  GLU A OE1 1 
ATOM 2999 O OE2 . GLU A 1 387  ? 5.087   54.166 40.507  1.00 40.21  ? 384  GLU A OE2 1 
ATOM 3000 N N   . GLY A 1 388  ? 2.371   48.987 38.610  1.00 20.70  ? 385  GLY A N   1 
ATOM 3001 C CA  . GLY A 1 388  ? 2.058   47.783 37.925  1.00 20.70  ? 385  GLY A CA  1 
ATOM 3002 C C   . GLY A 1 388  ? 0.955   48.089 36.962  1.00 20.70  ? 385  GLY A C   1 
ATOM 3003 O O   . GLY A 1 388  ? 0.125   48.964 37.231  1.00 20.70  ? 385  GLY A O   1 
ATOM 3004 N N   . SER A 1 389  ? 0.906   47.392 35.841  1.00 33.69  ? 386  SER A N   1 
ATOM 3005 C CA  . SER A 1 389  ? -0.112  47.727 34.918  1.00 33.69  ? 386  SER A CA  1 
ATOM 3006 C C   . SER A 1 389  ? -0.266  46.686 33.854  1.00 33.69  ? 386  SER A C   1 
ATOM 3007 O O   . SER A 1 389  ? 0.567   45.791 33.704  1.00 33.69  ? 386  SER A O   1 
ATOM 3008 C CB  . SER A 1 389  ? 0.256   49.033 34.234  1.00 38.98  ? 386  SER A CB  1 
ATOM 3009 O OG  . SER A 1 389  ? 0.984   48.736 33.057  1.00 38.98  ? 386  SER A OG  1 
ATOM 3010 N N   . LEU A 1 390  ? -1.381  46.781 33.134  1.00 37.01  ? 387  LEU A N   1 
ATOM 3011 C CA  . LEU A 1 390  ? -1.431  46.222 31.811  1.00 37.01  ? 387  LEU A CA  1 
ATOM 3012 C C   . LEU A 1 390  ? -1.200  47.387 30.856  1.00 37.01  ? 387  LEU A C   1 
ATOM 3013 O O   . LEU A 1 390  ? -1.311  48.564 31.253  1.00 37.01  ? 387  LEU A O   1 
ATOM 3014 C CB  . LEU A 1 390  ? -2.744  45.529 31.513  1.00 23.37  ? 387  LEU A CB  1 
ATOM 3015 C CG  . LEU A 1 390  ? -3.161  44.374 32.423  1.00 23.37  ? 387  LEU A CG  1 
ATOM 3016 C CD1 . LEU A 1 390  ? -4.456  43.659 31.874  1.00 23.37  ? 387  LEU A CD1 1 
ATOM 3017 C CD2 . LEU A 1 390  ? -2.015  43.355 32.625  1.00 23.37  ? 387  LEU A CD2 1 
ATOM 3018 N N   . ARG A 1 391  ? -0.797  47.013 29.638  1.00 43.41  ? 388  ARG A N   1 
ATOM 3019 C CA  . ARG A 1 391  ? -0.540  47.889 28.514  1.00 43.41  ? 388  ARG A CA  1 
ATOM 3020 C C   . ARG A 1 391  ? -0.962  47.086 27.298  1.00 43.41  ? 388  ARG A C   1 
ATOM 3021 O O   . ARG A 1 391  ? -0.380  45.999 26.968  1.00 43.41  ? 388  ARG A O   1 
ATOM 3022 C CB  . ARG A 1 391  ? 0.934   48.186 28.353  1.00 34.91  ? 388  ARG A CB  1 
ATOM 3023 C CG  . ARG A 1 391  ? 1.614   48.783 29.573  1.00 34.91  ? 388  ARG A CG  1 
ATOM 3024 C CD  . ARG A 1 391  ? 1.158   50.208 29.876  1.00 34.91  ? 388  ARG A CD  1 
ATOM 3025 N NE  . ARG A 1 391  ? 1.799   50.720 31.060  1.00 34.91  ? 388  ARG A NE  1 
ATOM 3026 C CZ  . ARG A 1 391  ? 2.193   51.979 31.158  1.00 34.91  ? 388  ARG A CZ  1 
ATOM 3027 N NH1 . ARG A 1 391  ? 1.993   52.794 30.120  1.00 34.91  ? 388  ARG A NH1 1 
ATOM 3028 N NH2 . ARG A 1 391  ? 2.764   52.455 32.264  1.00 34.91  ? 388  ARG A NH2 1 
ATOM 3029 N N   . ILE A 1 392  ? -1.995  47.603 26.627  1.00 53.84  ? 389  ILE A N   1 
ATOM 3030 C CA  . ILE A 1 392  ? -2.396  47.006 25.371  1.00 53.84  ? 389  ILE A CA  1 
ATOM 3031 C C   . ILE A 1 392  ? -1.682  47.807 24.303  1.00 53.84  ? 389  ILE A C   1 
ATOM 3032 O O   . ILE A 1 392  ? -1.641  49.015 24.367  1.00 53.84  ? 389  ILE A O   1 
ATOM 3033 C CB  . ILE A 1 392  ? -3.932  46.945 25.199  1.00 40.00  ? 389  ILE A CB  1 
ATOM 3034 C CG1 . ILE A 1 392  ? -4.593  46.340 26.420  1.00 40.00  ? 389  ILE A CG1 1 
ATOM 3035 C CG2 . ILE A 1 392  ? -4.274  46.060 24.014  1.00 40.00  ? 389  ILE A CG2 1 
ATOM 3036 C CD1 . ILE A 1 392  ? -4.734  47.301 27.496  1.00 40.00  ? 389  ILE A CD1 1 
ATOM 3037 N N   . ILE A 1 393  ? -1.032  47.110 23.383  1.00 57.55  ? 390  ILE A N   1 
ATOM 3038 C CA  . ILE A 1 393  ? -0.277  47.763 22.332  1.00 57.55  ? 390  ILE A CA  1 
ATOM 3039 C C   . ILE A 1 393  ? -0.832  47.270 21.027  1.00 57.55  ? 390  ILE A C   1 
ATOM 3040 O O   . ILE A 1 393  ? -0.877  46.062 20.781  1.00 57.55  ? 390  ILE A O   1 
ATOM 3041 C CB  . ILE A 1 393  ? 1.236   47.460 22.342  1.00 45.34  ? 390  ILE A CB  1 
ATOM 3042 C CG1 . ILE A 1 393  ? 1.732   46.743 23.613  1.00 45.34  ? 390  ILE A CG1 1 
ATOM 3043 C CG2 . ILE A 1 393  ? 1.984   48.729 22.125  1.00 45.34  ? 390  ILE A CG2 1 
ATOM 3044 C CD1 . ILE A 1 393  ? 2.154   47.635 24.726  1.00 45.34  ? 390  ILE A CD1 1 
ATOM 3045 N N   . ARG A 1 394  ? -1.274  48.221 20.209  1.00 48.28  ? 391  ARG A N   1 
ATOM 3046 C CA  . ARG A 1 394  ? -1.915  47.983 18.923  1.00 48.28  ? 391  ARG A CA  1 
ATOM 3047 C C   . ARG A 1 394  ? -1.043  48.718 17.901  1.00 48.28  ? 391  ARG A C   1 
ATOM 3048 O O   . ARG A 1 394  ? -0.765  49.918 18.043  1.00 48.28  ? 391  ARG A O   1 
ATOM 3049 C CB  . ARG A 1 394  ? -3.302  48.640 18.979  1.00 83.04  ? 391  ARG A CB  1 
ATOM 3050 C CG  . ARG A 1 394  ? -4.268  48.335 17.843  1.00 83.04  ? 391  ARG A CG  1 
ATOM 3051 C CD  . ARG A 1 394  ? -4.481  49.468 16.839  1.00 83.04  ? 391  ARG A CD  1 
ATOM 3052 N NE  . ARG A 1 394  ? -4.742  50.807 17.377  1.00 83.04  ? 391  ARG A NE  1 
ATOM 3053 C CZ  . ARG A 1 394  ? -5.710  51.129 18.231  1.00 83.04  ? 391  ARG A CZ  1 
ATOM 3054 N NH1 . ARG A 1 394  ? -6.516  50.205 18.727  1.00 83.04  ? 391  ARG A NH1 1 
ATOM 3055 N NH2 . ARG A 1 394  ? -5.853  52.389 18.621  1.00 83.04  ? 391  ARG A NH2 1 
ATOM 3056 N N   . ASN A 1 395  ? -0.599  48.010 16.879  1.00 62.95  ? 392  ASN A N   1 
ATOM 3057 C CA  . ASN A 1 395  ? 0.130   48.652 15.798  1.00 62.95  ? 392  ASN A CA  1 
ATOM 3058 C C   . ASN A 1 395  ? -0.836  49.423 14.917  1.00 62.95  ? 392  ASN A C   1 
ATOM 3059 O O   . ASN A 1 395  ? -1.881  48.930 14.539  1.00 62.95  ? 392  ASN A O   1 
ATOM 3060 C CB  . ASN A 1 395  ? 0.889   47.611 14.977  1.00 152.25 ? 392  ASN A CB  1 
ATOM 3061 C CG  . ASN A 1 395  ? 2.326   48.003 14.725  1.00 152.25 ? 392  ASN A CG  1 
ATOM 3062 O OD1 . ASN A 1 395  ? 3.236   47.197 14.903  1.00 152.25 ? 392  ASN A OD1 1 
ATOM 3063 N ND2 . ASN A 1 395  ? 2.543   49.248 14.322  1.00 152.25 ? 392  ASN A ND2 1 
ATOM 3064 N N   . GLY A 1 396  ? -0.488  50.662 14.627  1.00 49.87  ? 393  GLY A N   1 
ATOM 3065 C CA  . GLY A 1 396  ? -1.183  51.451 13.618  1.00 49.87  ? 393  GLY A CA  1 
ATOM 3066 C C   . GLY A 1 396  ? -2.291  52.345 14.127  1.00 49.87  ? 393  GLY A C   1 
ATOM 3067 O O   . GLY A 1 396  ? -2.621  52.356 15.307  1.00 49.87  ? 393  GLY A O   1 
ATOM 3068 N N   . ILE A 1 397  ? -2.862  53.103 13.217  1.00 76.10  ? 394  ILE A N   1 
ATOM 3069 C CA  . ILE A 1 397  ? -3.840  54.078 13.573  1.00 76.10  ? 394  ILE A CA  1 
ATOM 3070 C C   . ILE A 1 397  ? -5.198  53.539 13.136  1.00 76.10  ? 394  ILE A C   1 
ATOM 3071 O O   . ILE A 1 397  ? -5.427  53.287 11.956  1.00 76.10  ? 394  ILE A O   1 
ATOM 3072 C CB  . ILE A 1 397  ? -3.478  55.415 12.907  1.00 45.39  ? 394  ILE A CB  1 
ATOM 3073 C CG1 . ILE A 1 397  ? -2.055  55.810 13.296  1.00 45.39  ? 394  ILE A CG1 1 
ATOM 3074 C CG2 . ILE A 1 397  ? -4.520  56.533 13.229  1.00 45.39  ? 394  ILE A CG2 1 
ATOM 3075 C CD1 . ILE A 1 397  ? -1.518  56.975 12.547  1.00 45.39  ? 394  ILE A CD1 1 
ATOM 3076 N N   . GLY A 1 398  ? -6.080  53.315 14.104  1.00 61.07  ? 395  GLY A N   1 
ATOM 3077 C CA  . GLY A 1 398  ? -7.399  52.821 13.801  1.00 61.07  ? 395  GLY A CA  1 
ATOM 3078 C C   . GLY A 1 398  ? -8.289  54.002 13.491  1.00 61.07  ? 395  GLY A C   1 
ATOM 3079 O O   . GLY A 1 398  ? -7.880  55.177 13.652  1.00 61.07  ? 395  GLY A O   1 
ATOM 3080 N N   . ILE A 1 399  ? -9.502  53.682 13.039  1.00 58.83  ? 396  ILE A N   1 
ATOM 3081 C CA  . ILE A 1 399  ? -10.565 54.663 12.752  1.00 58.83  ? 396  ILE A CA  1 
ATOM 3082 C C   . ILE A 1 399  ? -11.932 54.057 13.131  1.00 58.83  ? 396  ILE A C   1 
ATOM 3083 O O   . ILE A 1 399  ? -12.165 52.861 12.897  1.00 58.83  ? 396  ILE A O   1 
ATOM 3084 C CB  . ILE A 1 399  ? -10.572 55.117 11.225  1.00 76.05  ? 396  ILE A CB  1 
ATOM 3085 C CG1 . ILE A 1 399  ? -11.456 54.215 10.333  1.00 76.05  ? 396  ILE A CG1 1 
ATOM 3086 C CG2 . ILE A 1 399  ? -9.156  55.262 10.644  1.00 76.05  ? 396  ILE A CG2 1 
ATOM 3087 C CD1 . ILE A 1 399  ? -11.293 52.688 10.503  1.00 76.05  ? 396  ILE A CD1 1 
ATOM 3088 N N   . HIS A 1 400  ? -12.835 54.870 13.682  1.00 84.97  ? 397  HIS A N   1 
ATOM 3089 C CA  . HIS A 1 400  ? -14.132 54.356 14.139  1.00 84.97  ? 397  HIS A CA  1 
ATOM 3090 C C   . HIS A 1 400  ? -15.302 54.649 13.182  1.00 84.97  ? 397  HIS A C   1 
ATOM 3091 O O   . HIS A 1 400  ? -15.701 55.799 13.034  1.00 84.97  ? 397  HIS A O   1 
ATOM 3092 C CB  . HIS A 1 400  ? -14.432 54.867 15.549  1.00 135.90 ? 397  HIS A CB  1 
ATOM 3093 C CG  . HIS A 1 400  ? -13.290 54.701 16.504  1.00 135.90 ? 397  HIS A CG  1 
ATOM 3094 N ND1 . HIS A 1 400  ? -12.899 53.471 16.993  1.00 135.90 ? 397  HIS A ND1 1 
ATOM 3095 C CD2 . HIS A 1 400  ? -12.452 55.610 17.059  1.00 135.90 ? 397  HIS A CD2 1 
ATOM 3096 C CE1 . HIS A 1 400  ? -11.872 53.631 17.808  1.00 135.90 ? 397  HIS A CE1 1 
ATOM 3097 N NE2 . HIS A 1 400  ? -11.583 54.919 17.868  1.00 135.90 ? 397  HIS A NE2 1 
ATOM 3098 N N   . GLU A 1 401  ? -15.857 53.595 12.573  1.00 97.07  ? 398  GLU A N   1 
ATOM 3099 C CA  . GLU A 1 401  ? -16.904 53.711 11.525  1.00 97.07  ? 398  GLU A CA  1 
ATOM 3100 C C   . GLU A 1 401  ? -18.360 53.902 11.994  1.00 97.07  ? 398  GLU A C   1 
ATOM 3101 O O   . GLU A 1 401  ? -18.886 53.109 12.776  1.00 97.07  ? 398  GLU A O   1 
ATOM 3102 C CB  . GLU A 1 401  ? -16.842 52.531 10.543  1.00 112.03 ? 398  GLU A CB  1 
ATOM 3103 C CG  . GLU A 1 401  ? -17.488 51.240 11.038  1.00 112.03 ? 398  GLU A CG  1 
ATOM 3104 C CD  . GLU A 1 401  ? -17.579 50.180 9.954   1.00 112.03 ? 398  GLU A CD  1 
ATOM 3105 O OE1 . GLU A 1 401  ? -18.166 50.472 8.886   1.00 112.03 ? 398  GLU A OE1 1 
ATOM 3106 O OE2 . GLU A 1 401  ? -17.074 49.051 10.174  1.00 112.03 ? 398  GLU A OE2 1 
ATOM 3107 N N   . HIS A 1 402  ? -19.020 54.925 11.464  1.00 199.07 ? 399  HIS A N   1 
ATOM 3108 C CA  . HIS A 1 402  ? -20.379 55.241 11.889  1.00 199.07 ? 399  HIS A CA  1 
ATOM 3109 C C   . HIS A 1 402  ? -21.454 54.828 10.869  1.00 199.07 ? 399  HIS A C   1 
ATOM 3110 O O   . HIS A 1 402  ? -22.281 53.965 11.167  1.00 199.07 ? 399  HIS A O   1 
ATOM 3111 C CB  . HIS A 1 402  ? -20.483 56.715 12.299  1.00 98.41  ? 399  HIS A CB  1 
ATOM 3112 C CG  . HIS A 1 402  ? -19.500 57.121 13.361  1.00 98.41  ? 399  HIS A CG  1 
ATOM 3113 N ND1 . HIS A 1 402  ? -19.027 58.413 13.486  1.00 98.41  ? 399  HIS A ND1 1 
ATOM 3114 C CD2 . HIS A 1 402  ? -18.899 56.407 14.344  1.00 98.41  ? 399  HIS A CD2 1 
ATOM 3115 C CE1 . HIS A 1 402  ? -18.187 58.478 14.503  1.00 98.41  ? 399  HIS A CE1 1 
ATOM 3116 N NE2 . HIS A 1 402  ? -18.090 57.275 15.039  1.00 98.41  ? 399  HIS A NE2 1 
ATOM 3117 N N   . ALA A 1 403  ? -21.441 55.431 9.679   1.00 80.33  ? 400  ALA A N   1 
ATOM 3118 C CA  . ALA A 1 403  ? -22.310 54.995 8.574   1.00 80.33  ? 400  ALA A CA  1 
ATOM 3119 C C   . ALA A 1 403  ? -21.477 54.220 7.567   1.00 80.33  ? 400  ALA A C   1 
ATOM 3120 O O   . ALA A 1 403  ? -20.272 54.064 7.757   1.00 80.33  ? 400  ALA A O   1 
ATOM 3121 C CB  . ALA A 1 403  ? -23.003 56.179 7.908   1.00 42.79  ? 400  ALA A CB  1 
ATOM 3122 N N   . SER A 1 404  ? -22.109 53.731 6.507   1.00 110.52 ? 401  SER A N   1 
ATOM 3123 C CA  . SER A 1 404  ? -21.415 52.814 5.620   1.00 110.52 ? 401  SER A CA  1 
ATOM 3124 C C   . SER A 1 404  ? -22.151 52.555 4.298   1.00 110.52 ? 401  SER A C   1 
ATOM 3125 O O   . SER A 1 404  ? -22.754 51.502 4.094   1.00 110.52 ? 401  SER A O   1 
ATOM 3126 C CB  . SER A 1 404  ? -21.152 51.506 6.366   1.00 73.63  ? 401  SER A CB  1 
ATOM 3127 O OG  . SER A 1 404  ? -19.936 50.919 5.944   1.00 73.63  ? 401  SER A OG  1 
ATOM 3128 N N   . ILE A 1 405  ? -22.077 53.515 3.390   1.00 203.68 ? 402  ILE A N   1 
ATOM 3129 C CA  . ILE A 1 405  ? -22.845 53.425 2.163   1.00 203.68 ? 402  ILE A CA  1 
ATOM 3130 C C   . ILE A 1 405  ? -22.020 52.797 1.037   1.00 203.68 ? 402  ILE A C   1 
ATOM 3131 O O   . ILE A 1 405  ? -21.039 53.380 0.577   1.00 203.68 ? 402  ILE A O   1 
ATOM 3132 C CB  . ILE A 1 405  ? -23.412 54.798 1.759   1.00 75.61  ? 402  ILE A CB  1 
ATOM 3133 C CG1 . ILE A 1 405  ? -24.192 55.437 2.917   1.00 75.61  ? 402  ILE A CG1 1 
ATOM 3134 C CG2 . ILE A 1 405  ? -24.341 54.660 0.560   1.00 75.61  ? 402  ILE A CG2 1 
ATOM 3135 C CD1 . ILE A 1 405  ? -23.409 56.448 3.713   1.00 75.61  ? 402  ILE A CD1 1 
ATOM 3136 N N   . ASP A 1 406  ? -22.442 51.611 0.599   1.00 153.26 ? 403  ASP A N   1 
ATOM 3137 C CA  . ASP A 1 406  ? -21.703 50.799 -0.389  1.00 153.26 ? 403  ASP A CA  1 
ATOM 3138 C C   . ASP A 1 406  ? -21.743 51.335 -1.826  1.00 153.26 ? 403  ASP A C   1 
ATOM 3139 O O   . ASP A 1 406  ? -22.649 51.002 -2.598  1.00 153.26 ? 403  ASP A O   1 
ATOM 3140 C CB  . ASP A 1 406  ? -22.185 49.339 -0.352  1.00 141.71 ? 403  ASP A CB  1 
ATOM 3141 C CG  . ASP A 1 406  ? -23.701 49.218 -0.258  1.00 141.71 ? 403  ASP A CG  1 
ATOM 3142 O OD1 . ASP A 1 406  ? -24.264 48.272 -0.861  1.00 141.71 ? 403  ASP A OD1 1 
ATOM 3143 O OD2 . ASP A 1 406  ? -24.332 50.061 0.419   1.00 141.71 ? 403  ASP A OD2 1 
ATOM 3144 N N   . LEU A 1 407  ? -20.733 52.134 -2.181  1.00 198.96 ? 404  LEU A N   1 
ATOM 3145 C CA  . LEU A 1 407  ? -20.696 52.849 -3.466  1.00 198.96 ? 404  LEU A CA  1 
ATOM 3146 C C   . LEU A 1 407  ? -19.443 52.560 -4.311  1.00 198.96 ? 404  LEU A C   1 
ATOM 3147 O O   . LEU A 1 407  ? -18.408 53.209 -4.132  1.00 198.96 ? 404  LEU A O   1 
ATOM 3148 C CB  . LEU A 1 407  ? -20.864 54.361 -3.242  1.00 70.70  ? 404  LEU A CB  1 
ATOM 3149 C CG  . LEU A 1 407  ? -22.154 54.802 -2.525  1.00 70.70  ? 404  LEU A CG  1 
ATOM 3150 C CD1 . LEU A 1 407  ? -22.118 56.295 -2.058  1.00 70.70  ? 404  LEU A CD1 1 
ATOM 3151 C CD2 . LEU A 1 407  ? -23.420 54.479 -3.373  1.00 70.70  ? 404  LEU A CD2 1 
ATOM 3152 N N   . PRO A 1 408  ? -19.544 51.588 -5.243  1.00 179.59 ? 405  PRO A N   1 
ATOM 3153 C CA  . PRO A 1 408  ? -18.452 51.117 -6.116  1.00 179.59 ? 405  PRO A CA  1 
ATOM 3154 C C   . PRO A 1 408  ? -17.893 52.128 -7.132  1.00 179.59 ? 405  PRO A C   1 
ATOM 3155 O O   . PRO A 1 408  ? -17.238 51.730 -8.101  1.00 179.59 ? 405  PRO A O   1 
ATOM 3156 C CB  . PRO A 1 408  ? -19.073 49.910 -6.839  1.00 158.17 ? 405  PRO A CB  1 
ATOM 3157 C CG  . PRO A 1 408  ? -20.273 49.539 -6.031  1.00 158.17 ? 405  PRO A CG  1 
ATOM 3158 C CD  . PRO A 1 408  ? -20.782 50.827 -5.484  1.00 158.17 ? 405  PRO A CD  1 
ATOM 3159 N N   . GLY A 1 409  ? -18.122 53.415 -6.902  1.00 134.93 ? 406  GLY A N   1 
ATOM 3160 C CA  . GLY A 1 409  ? -17.648 54.438 -7.817  1.00 134.93 ? 406  GLY A CA  1 
ATOM 3161 C C   . GLY A 1 409  ? -16.670 55.404 -7.188  1.00 134.93 ? 406  GLY A C   1 
ATOM 3162 O O   . GLY A 1 409  ? -15.543 55.534 -7.652  1.00 134.93 ? 406  GLY A O   1 
ATOM 3163 N N   . ILE A 1 410  ? -17.103 56.055 -6.114  1.00 129.27 ? 407  ILE A N   1 
ATOM 3164 C CA  . ILE A 1 410  ? -16.439 57.237 -5.555  1.00 129.27 ? 407  ILE A CA  1 
ATOM 3165 C C   . ILE A 1 410  ? -15.002 57.491 -6.017  1.00 129.27 ? 407  ILE A C   1 
ATOM 3166 O O   . ILE A 1 410  ? -14.103 56.694 -5.777  1.00 129.27 ? 407  ILE A O   1 
ATOM 3167 C CB  . ILE A 1 410  ? -16.548 57.279 -4.027  1.00 73.00  ? 407  ILE A CB  1 
ATOM 3168 C CG1 . ILE A 1 410  ? -17.937 56.761 -3.594  1.00 73.00  ? 407  ILE A CG1 1 
ATOM 3169 C CG2 . ILE A 1 410  ? -16.291 58.701 -3.533  1.00 73.00  ? 407  ILE A CG2 1 
ATOM 3170 C CD1 . ILE A 1 410  ? -18.231 56.775 -2.070  1.00 73.00  ? 407  ILE A CD1 1 
ATOM 3171 N N   . LYS A 1 411  ? -14.821 58.637 -6.666  1.00 99.34  ? 408  LYS A N   1 
ATOM 3172 C CA  . LYS A 1 411  ? -13.604 58.979 -7.388  1.00 99.34  ? 408  LYS A CA  1 
ATOM 3173 C C   . LYS A 1 411  ? -12.956 60.216 -6.821  1.00 99.34  ? 408  LYS A C   1 
ATOM 3174 O O   . LYS A 1 411  ? -12.001 60.757 -7.373  1.00 99.34  ? 408  LYS A O   1 
ATOM 3175 C CB  . LYS A 1 411  ? -13.930 59.237 -8.845  1.00 63.75  ? 408  LYS A CB  1 
ATOM 3176 C CG  . LYS A 1 411  ? -14.337 58.020 -9.608  1.00 63.75  ? 408  LYS A CG  1 
ATOM 3177 C CD  . LYS A 1 411  ? -13.189 57.023 -9.769  1.00 63.75  ? 408  LYS A CD  1 
ATOM 3178 C CE  . LYS A 1 411  ? -13.643 55.788 -10.578 1.00 63.75  ? 408  LYS A CE  1 
ATOM 3179 N NZ  . LYS A 1 411  ? -12.556 54.804 -10.733 1.00 63.75  ? 408  LYS A NZ  1 
ATOM 3180 N N   . GLY A 1 412  ? -13.485 60.652 -5.698  1.00 66.75  ? 409  GLY A N   1 
ATOM 3181 C CA  . GLY A 1 412  ? -12.998 61.844 -5.028  1.00 66.75  ? 409  GLY A CA  1 
ATOM 3182 C C   . GLY A 1 412  ? -14.162 62.237 -4.171  1.00 66.75  ? 409  GLY A C   1 
ATOM 3183 O O   . GLY A 1 412  ? -15.281 61.744 -4.383  1.00 66.75  ? 409  GLY A O   1 
ATOM 3184 N N   . LEU A 1 413  ? -13.908 63.077 -3.176  1.00 68.32  ? 410  LEU A N   1 
ATOM 3185 C CA  . LEU A 1 413  ? -14.991 63.630 -2.361  1.00 68.32  ? 410  LEU A CA  1 
ATOM 3186 C C   . LEU A 1 413  ? -14.566 64.867 -1.609  1.00 68.32  ? 410  LEU A C   1 
ATOM 3187 O O   . LEU A 1 413  ? -13.394 65.009 -1.246  1.00 68.32  ? 410  LEU A O   1 
ATOM 3188 C CB  . LEU A 1 413  ? -15.606 62.590 -1.412  1.00 110.92 ? 410  LEU A CB  1 
ATOM 3189 C CG  . LEU A 1 413  ? -14.760 61.445 -0.866  1.00 110.92 ? 410  LEU A CG  1 
ATOM 3190 C CD1 . LEU A 1 413  ? -13.876 61.908 0.276   1.00 110.92 ? 410  LEU A CD1 1 
ATOM 3191 C CD2 . LEU A 1 413  ? -15.677 60.332 -0.420  1.00 110.92 ? 410  LEU A CD2 1 
ATOM 3192 N N   . TRP A 1 414  ? -15.536 65.760 -1.404  1.00 116.46 ? 411  TRP A N   1 
ATOM 3193 C CA  . TRP A 1 414  ? -15.279 67.124 -0.951  1.00 116.46 ? 411  TRP A CA  1 
ATOM 3194 C C   . TRP A 1 414  ? -16.300 67.539 0.098   1.00 116.46 ? 411  TRP A C   1 
ATOM 3195 O O   . TRP A 1 414  ? -17.474 67.172 -0.032  1.00 116.46 ? 411  TRP A O   1 
ATOM 3196 C CB  . TRP A 1 414  ? -15.308 68.088 -2.147  1.00 70.99  ? 411  TRP A CB  1 
ATOM 3197 C CG  . TRP A 1 414  ? -14.310 67.719 -3.180  1.00 70.99  ? 411  TRP A CG  1 
ATOM 3198 C CD1 . TRP A 1 414  ? -13.025 68.155 -3.260  1.00 70.99  ? 411  TRP A CD1 1 
ATOM 3199 C CD2 . TRP A 1 414  ? -14.496 66.798 -4.259  1.00 70.99  ? 411  TRP A CD2 1 
ATOM 3200 N NE1 . TRP A 1 414  ? -12.394 67.566 -4.323  1.00 70.99  ? 411  TRP A NE1 1 
ATOM 3201 C CE2 . TRP A 1 414  ? -13.275 66.728 -4.958  1.00 70.99  ? 411  TRP A CE2 1 
ATOM 3202 C CE3 . TRP A 1 414  ? -15.581 66.020 -4.703  1.00 70.99  ? 411  TRP A CE3 1 
ATOM 3203 C CZ2 . TRP A 1 414  ? -13.102 65.919 -6.095  1.00 70.99  ? 411  TRP A CZ2 1 
ATOM 3204 C CZ3 . TRP A 1 414  ? -15.414 65.206 -5.829  1.00 70.99  ? 411  TRP A CZ3 1 
ATOM 3205 C CH2 . TRP A 1 414  ? -14.179 65.166 -6.515  1.00 70.99  ? 411  TRP A CH2 1 
ATOM 3206 N N   . PRO A 1 415  ? -15.810 68.275 1.100   1.00 109.01 ? 412  PRO A N   1 
ATOM 3207 C CA  . PRO A 1 415  ? -16.541 68.758 2.289   1.00 109.01 ? 412  PRO A CA  1 
ATOM 3208 C C   . PRO A 1 415  ? -17.523 69.944 2.427   1.00 109.01 ? 412  PRO A C   1 
ATOM 3209 O O   . PRO A 1 415  ? -17.234 70.851 3.207   1.00 109.01 ? 412  PRO A O   1 
ATOM 3210 C CB  . PRO A 1 415  ? -15.409 68.962 3.309   1.00 101.48 ? 412  PRO A CB  1 
ATOM 3211 C CG  . PRO A 1 415  ? -14.218 69.282 2.480   1.00 101.48 ? 412  PRO A CG  1 
ATOM 3212 C CD  . PRO A 1 415  ? -14.353 68.454 1.233   1.00 101.48 ? 412  PRO A CD  1 
ATOM 3213 N N   . LEU A 1 416  ? -18.653 69.927 1.733   1.00 166.16 ? 413  LEU A N   1 
ATOM 3214 C CA  . LEU A 1 416  ? -19.691 70.978 1.874   1.00 166.16 ? 413  LEU A CA  1 
ATOM 3215 C C   . LEU A 1 416  ? -20.813 71.278 2.887   1.00 166.16 ? 413  LEU A C   1 
ATOM 3216 O O   . LEU A 1 416  ? -21.782 70.526 3.018   1.00 166.16 ? 413  LEU A O   1 
ATOM 3217 C CB  . LEU A 1 416  ? -20.247 70.209 0.668   1.00 159.05 ? 413  LEU A CB  1 
ATOM 3218 C CG  . LEU A 1 416  ? -20.702 71.061 -0.510  1.00 159.05 ? 413  LEU A CG  1 
ATOM 3219 C CD1 . LEU A 1 416  ? -19.522 71.839 -1.071  1.00 159.05 ? 413  LEU A CD1 1 
ATOM 3220 C CD2 . LEU A 1 416  ? -21.306 70.173 -1.567  1.00 159.05 ? 413  LEU A CD2 1 
ATOM 3221 N N   . ARG A 1 417  ? -20.661 72.403 3.578   1.00 148.80 ? 414  ARG A N   1 
ATOM 3222 C CA  . ARG A 1 417  ? -21.696 72.992 4.428   1.00 148.80 ? 414  ARG A CA  1 
ATOM 3223 C C   . ARG A 1 417  ? -22.739 73.643 3.528   1.00 148.80 ? 414  ARG A C   1 
ATOM 3224 O O   . ARG A 1 417  ? -22.396 74.191 2.479   1.00 148.80 ? 414  ARG A O   1 
ATOM 3225 C CB  . ARG A 1 417  ? -21.055 74.063 5.306   1.00 72.10  ? 414  ARG A CB  1 
ATOM 3226 C CG  . ARG A 1 417  ? -20.019 74.845 4.513   1.00 72.10  ? 414  ARG A CG  1 
ATOM 3227 C CD  . ARG A 1 417  ? -19.725 76.198 5.056   1.00 72.10  ? 414  ARG A CD  1 
ATOM 3228 N NE  . ARG A 1 417  ? -18.847 76.101 6.209   1.00 72.10  ? 414  ARG A NE  1 
ATOM 3229 C CZ  . ARG A 1 417  ? -17.537 75.841 6.159   1.00 72.10  ? 414  ARG A CZ  1 
ATOM 3230 N NH1 . ARG A 1 417  ? -16.916 75.629 4.990   1.00 72.10  ? 414  ARG A NH1 1 
ATOM 3231 N NH2 . ARG A 1 417  ? -16.834 75.798 7.294   1.00 72.10  ? 414  ARG A NH2 1 
ATOM 3232 N N   . SER A 1 418  ? -24.006 73.597 3.927   1.00 128.99 ? 415  SER A N   1 
ATOM 3233 C CA  . SER A 1 418  ? -25.054 74.226 3.122   1.00 128.99 ? 415  SER A CA  1 
ATOM 3234 C C   . SER A 1 418  ? -25.597 75.480 3.811   1.00 128.99 ? 415  SER A C   1 
ATOM 3235 O O   . SER A 1 418  ? -26.381 76.232 3.229   1.00 128.99 ? 415  SER A O   1 
ATOM 3236 C CB  . SER A 1 418  ? -26.176 73.228 2.817   1.00 112.45 ? 415  SER A CB  1 
ATOM 3237 O OG  . SER A 1 418  ? -26.739 73.437 1.534   1.00 112.45 ? 415  SER A OG  1 
ATOM 3238 N N   . ASP A 1 419  ? -25.168 75.700 5.050   1.00 212.57 ? 416  ASP A N   1 
ATOM 3239 C CA  . ASP A 1 419  ? -25.561 76.882 5.800   1.00 212.57 ? 416  ASP A CA  1 
ATOM 3240 C C   . ASP A 1 419  ? -24.312 77.676 6.204   1.00 212.57 ? 416  ASP A C   1 
ATOM 3241 O O   . ASP A 1 419  ? -23.488 77.186 6.981   1.00 212.57 ? 416  ASP A O   1 
ATOM 3242 C CB  . ASP A 1 419  ? -26.398 76.485 7.018   1.00 180.91 ? 416  ASP A CB  1 
ATOM 3243 C CG  . ASP A 1 419  ? -27.482 77.495 7.345   1.00 180.91 ? 416  ASP A CG  1 
ATOM 3244 O OD1 . ASP A 1 419  ? -28.593 77.063 7.717   1.00 180.91 ? 416  ASP A OD1 1 
ATOM 3245 O OD2 . ASP A 1 419  ? -27.236 78.715 7.234   1.00 180.91 ? 416  ASP A OD2 1 
ATOM 3246 N N   . PRO A 1 420  ? -24.162 78.896 5.646   1.00 168.63 ? 417  PRO A N   1 
ATOM 3247 C CA  . PRO A 1 420  ? -23.058 79.852 5.833   1.00 168.63 ? 417  PRO A CA  1 
ATOM 3248 C C   . PRO A 1 420  ? -22.517 79.963 7.260   1.00 168.63 ? 417  PRO A C   1 
ATOM 3249 O O   . PRO A 1 420  ? -21.304 80.094 7.453   1.00 168.63 ? 417  PRO A O   1 
ATOM 3250 C CB  . PRO A 1 420  ? -23.691 81.188 5.440   1.00 138.92 ? 417  PRO A CB  1 
ATOM 3251 C CG  . PRO A 1 420  ? -24.735 80.833 4.446   1.00 138.92 ? 417  PRO A CG  1 
ATOM 3252 C CD  . PRO A 1 420  ? -25.167 79.413 4.697   1.00 138.92 ? 417  PRO A CD  1 
ATOM 3253 N N   . ASN A 1 421  ? -23.419 79.924 8.238   1.00 212.33 ? 418  ASN A N   1 
ATOM 3254 C CA  . ASN A 1 421  ? -23.071 80.096 9.648   1.00 212.33 ? 418  ASN A CA  1 
ATOM 3255 C C   . ASN A 1 421  ? -22.381 78.885 10.263  1.00 212.33 ? 418  ASN A C   1 
ATOM 3256 O O   . ASN A 1 421  ? -21.233 78.981 10.704  1.00 212.33 ? 418  ASN A O   1 
ATOM 3257 C CB  . ASN A 1 421  ? -24.309 80.491 10.474  1.00 127.91 ? 418  ASN A CB  1 
ATOM 3258 C CG  . ASN A 1 421  ? -25.621 80.008 9.850   1.00 127.91 ? 418  ASN A CG  1 
ATOM 3259 O OD1 . ASN A 1 421  ? -26.317 80.771 9.175   1.00 127.91 ? 418  ASN A OD1 1 
ATOM 3260 N ND2 . ASN A 1 421  ? -25.953 78.737 10.065  1.00 127.91 ? 418  ASN A ND2 1 
ATOM 3261 N N   . ARG A 1 422  ? -23.086 77.754 10.273  1.00 212.91 ? 419  ARG A N   1 
ATOM 3262 C CA  . ARG A 1 422  ? -22.637 76.528 10.938  1.00 212.91 ? 419  ARG A CA  1 
ATOM 3263 C C   . ARG A 1 422  ? -21.323 75.980 10.380  1.00 212.91 ? 419  ARG A C   1 
ATOM 3264 O O   . ARG A 1 422  ? -21.119 75.947 9.161   1.00 212.91 ? 419  ARG A O   1 
ATOM 3265 C CB  . ARG A 1 422  ? -23.735 75.450 10.901  1.00 138.83 ? 419  ARG A CB  1 
ATOM 3266 C CG  . ARG A 1 422  ? -24.415 75.269 9.540   1.00 138.83 ? 419  ARG A CG  1 
ATOM 3267 C CD  . ARG A 1 422  ? -25.200 73.953 9.426   1.00 138.83 ? 419  ARG A CD  1 
ATOM 3268 N NE  . ARG A 1 422  ? -26.431 73.931 10.226  1.00 138.83 ? 419  ARG A NE  1 
ATOM 3269 C CZ  . ARG A 1 422  ? -27.312 72.926 10.238  1.00 138.83 ? 419  ARG A CZ  1 
ATOM 3270 N NH1 . ARG A 1 422  ? -27.113 71.839 9.490   1.00 138.83 ? 419  ARG A NH1 1 
ATOM 3271 N NH2 . ARG A 1 422  ? -28.399 73.005 11.004  1.00 138.83 ? 419  ARG A NH2 1 
ATOM 3272 N N   . GLU A 1 423  ? -20.442 75.558 11.291  1.00 131.38 ? 420  GLU A N   1 
ATOM 3273 C CA  . GLU A 1 423  ? -19.152 74.953 10.939  1.00 131.38 ? 420  GLU A CA  1 
ATOM 3274 C C   . GLU A 1 423  ? -19.358 73.537 10.407  1.00 131.38 ? 420  GLU A C   1 
ATOM 3275 O O   . GLU A 1 423  ? -18.406 72.870 9.994   1.00 131.38 ? 420  GLU A O   1 
ATOM 3276 C CB  . GLU A 1 423  ? -18.200 74.931 12.147  1.00 129.73 ? 420  GLU A CB  1 
ATOM 3277 C CG  . GLU A 1 423  ? -17.887 76.305 12.773  1.00 129.73 ? 420  GLU A CG  1 
ATOM 3278 C CD  . GLU A 1 423  ? -16.986 77.191 11.910  1.00 129.73 ? 420  GLU A CD  1 
ATOM 3279 O OE1 . GLU A 1 423  ? -15.924 76.714 11.454  1.00 129.73 ? 420  GLU A OE1 1 
ATOM 3280 O OE2 . GLU A 1 423  ? -17.338 78.374 11.706  1.00 129.73 ? 420  GLU A OE2 1 
ATOM 3281 N N   . THR A 1 424  ? -20.615 73.095 10.415  1.00 152.16 ? 421  THR A N   1 
ATOM 3282 C CA  . THR A 1 424  ? -20.974 71.765 9.939   1.00 152.16 ? 421  THR A CA  1 
ATOM 3283 C C   . THR A 1 424  ? -21.324 71.749 8.443   1.00 152.16 ? 421  THR A C   1 
ATOM 3284 O O   . THR A 1 424  ? -21.813 72.735 7.883   1.00 152.16 ? 421  THR A O   1 
ATOM 3285 C CB  . THR A 1 424  ? -22.108 71.099 10.796  1.00 133.64 ? 421  THR A CB  1 
ATOM 3286 O OG1 . THR A 1 424  ? -23.367 71.157 10.107  1.00 133.64 ? 421  THR A OG1 1 
ATOM 3287 C CG2 . THR A 1 424  ? -22.224 71.745 12.189  1.00 133.64 ? 421  THR A CG2 1 
ATOM 3288 N N   . TYR A 1 425  ? -21.052 70.604 7.826   1.00 120.05 ? 422  TYR A N   1 
ATOM 3289 C CA  . TYR A 1 425  ? -21.264 70.362 6.412   1.00 120.05 ? 422  TYR A CA  1 
ATOM 3290 C C   . TYR A 1 425  ? -22.302 69.255 6.299   1.00 120.05 ? 422  TYR A C   1 
ATOM 3291 O O   . TYR A 1 425  ? -22.050 68.109 6.685   1.00 120.05 ? 422  TYR A O   1 
ATOM 3292 C CB  . TYR A 1 425  ? -19.956 69.914 5.752   1.00 151.84 ? 422  TYR A CB  1 
ATOM 3293 C CG  . TYR A 1 425  ? -18.738 70.669 6.226   1.00 151.84 ? 422  TYR A CG  1 
ATOM 3294 C CD1 . TYR A 1 425  ? -18.160 70.384 7.463   1.00 151.84 ? 422  TYR A CD1 1 
ATOM 3295 C CD2 . TYR A 1 425  ? -18.161 71.662 5.443   1.00 151.84 ? 422  TYR A CD2 1 
ATOM 3296 C CE1 . TYR A 1 425  ? -17.046 71.072 7.914   1.00 151.84 ? 422  TYR A CE1 1 
ATOM 3297 C CE2 . TYR A 1 425  ? -17.041 72.358 5.883   1.00 151.84 ? 422  TYR A CE2 1 
ATOM 3298 C CZ  . TYR A 1 425  ? -16.490 72.056 7.123   1.00 151.84 ? 422  TYR A CZ  1 
ATOM 3299 O OH  . TYR A 1 425  ? -15.380 72.733 7.574   1.00 151.84 ? 422  TYR A OH  1 
ATOM 3300 N N   . ASP A 1 426  ? -23.473 69.606 5.782   1.00 136.97 ? 423  ASP A N   1 
ATOM 3301 C CA  . ASP A 1 426  ? -24.585 68.666 5.697   1.00 136.97 ? 423  ASP A CA  1 
ATOM 3302 C C   . ASP A 1 426  ? -24.684 67.997 4.322   1.00 136.97 ? 423  ASP A C   1 
ATOM 3303 O O   . ASP A 1 426  ? -25.592 67.199 4.076   1.00 136.97 ? 423  ASP A O   1 
ATOM 3304 C CB  . ASP A 1 426  ? -25.898 69.376 6.038   1.00 120.77 ? 423  ASP A CB  1 
ATOM 3305 C CG  . ASP A 1 426  ? -26.331 70.358 4.957   1.00 120.77 ? 423  ASP A CG  1 
ATOM 3306 O OD1 . ASP A 1 426  ? -27.472 70.865 5.049   1.00 120.77 ? 423  ASP A OD1 1 
ATOM 3307 O OD2 . ASP A 1 426  ? -25.536 70.620 4.021   1.00 120.77 ? 423  ASP A OD2 1 
ATOM 3308 N N   . THR A 1 427  ? -23.761 68.336 3.427   1.00 98.00  ? 424  THR A N   1 
ATOM 3309 C CA  . THR A 1 427  ? -23.747 67.730 2.099   1.00 98.00  ? 424  THR A CA  1 
ATOM 3310 C C   . THR A 1 427  ? -22.433 67.017 1.800   1.00 98.00  ? 424  THR A C   1 
ATOM 3311 O O   . THR A 1 427  ? -21.367 67.436 2.243   1.00 98.00  ? 424  THR A O   1 
ATOM 3312 C CB  . THR A 1 427  ? -24.048 68.764 0.995   1.00 138.85 ? 424  THR A CB  1 
ATOM 3313 O OG1 . THR A 1 427  ? -25.183 69.550 1.375   1.00 138.85 ? 424  THR A OG1 1 
ATOM 3314 C CG2 . THR A 1 427  ? -24.340 68.070 -0.330  1.00 138.85 ? 424  THR A CG2 1 
ATOM 3315 N N   . LEU A 1 428  ? -22.518 65.924 1.058   1.00 173.54 ? 425  LEU A N   1 
ATOM 3316 C CA  . LEU A 1 428  ? -21.325 65.371 0.464   1.00 173.54 ? 425  LEU A CA  1 
ATOM 3317 C C   . LEU A 1 428  ? -21.503 65.274 -1.038  1.00 173.54 ? 425  LEU A C   1 
ATOM 3318 O O   . LEU A 1 428  ? -22.341 64.515 -1.532  1.00 173.54 ? 425  LEU A O   1 
ATOM 3319 C CB  . LEU A 1 428  ? -20.943 64.022 1.077   1.00 169.75 ? 425  LEU A CB  1 
ATOM 3320 C CG  . LEU A 1 428  ? -19.459 63.692 0.870   1.00 169.75 ? 425  LEU A CG  1 
ATOM 3321 C CD1 . LEU A 1 428  ? -18.577 64.488 1.832   1.00 169.75 ? 425  LEU A CD1 1 
ATOM 3322 C CD2 . LEU A 1 428  ? -19.187 62.202 0.999   1.00 169.75 ? 425  LEU A CD2 1 
ATOM 3323 N N   . VAL A 1 429  ? -20.733 66.087 -1.756  1.00 180.87 ? 426  VAL A N   1 
ATOM 3324 C CA  . VAL A 1 429  ? -20.609 65.924 -3.187  1.00 180.87 ? 426  VAL A CA  1 
ATOM 3325 C C   . VAL A 1 429  ? -19.362 65.092 -3.435  1.00 180.87 ? 426  VAL A C   1 
ATOM 3326 O O   . VAL A 1 429  ? -18.288 65.353 -2.882  1.00 180.87 ? 426  VAL A O   1 
ATOM 3327 C CB  . VAL A 1 429  ? -20.585 67.268 -3.936  1.00 186.65 ? 426  VAL A CB  1 
ATOM 3328 C CG1 . VAL A 1 429  ? -20.088 67.085 -5.361  1.00 186.65 ? 426  VAL A CG1 1 
ATOM 3329 C CG2 . VAL A 1 429  ? -21.974 67.866 -3.960  1.00 186.65 ? 426  VAL A CG2 1 
ATOM 3330 N N   . LEU A 1 430  ? -19.540 64.071 -4.258  1.00 107.21 ? 427  LEU A N   1 
ATOM 3331 C CA  . LEU A 1 430  ? -18.514 63.092 -4.526  1.00 107.21 ? 427  LEU A CA  1 
ATOM 3332 C C   . LEU A 1 430  ? -18.415 62.781 -6.023  1.00 107.21 ? 427  LEU A C   1 
ATOM 3333 O O   . LEU A 1 430  ? -19.426 62.555 -6.692  1.00 107.21 ? 427  LEU A O   1 
ATOM 3334 C CB  . LEU A 1 430  ? -18.805 61.820 -3.723  1.00 118.96 ? 427  LEU A CB  1 
ATOM 3335 C CG  . LEU A 1 430  ? -20.253 61.327 -3.600  1.00 118.96 ? 427  LEU A CG  1 
ATOM 3336 C CD1 . LEU A 1 430  ? -20.696 60.548 -4.818  1.00 118.96 ? 427  LEU A CD1 1 
ATOM 3337 C CD2 . LEU A 1 430  ? -20.386 60.461 -2.372  1.00 118.96 ? 427  LEU A CD2 1 
ATOM 3338 N N   . SER A 1 431  ? -17.189 62.776 -6.538  1.00 109.48 ? 428  SER A N   1 
ATOM 3339 C CA  . SER A 1 431  ? -16.927 62.386 -7.912  1.00 109.48 ? 428  SER A CA  1 
ATOM 3340 C C   . SER A 1 431  ? -17.407 60.960 -8.099  1.00 109.48 ? 428  SER A C   1 
ATOM 3341 O O   . SER A 1 431  ? -17.307 60.146 -7.183  1.00 109.48 ? 428  SER A O   1 
ATOM 3342 C CB  . SER A 1 431  ? -15.436 62.468 -8.211  1.00 158.21 ? 428  SER A CB  1 
ATOM 3343 O OG  . SER A 1 431  ? -15.192 62.246 -9.584  1.00 158.21 ? 428  SER A OG  1 
ATOM 3344 N N   . PHE A 1 432  ? -17.932 60.660 -9.280  1.00 99.66  ? 429  PHE A N   1 
ATOM 3345 C CA  . PHE A 1 432  ? -18.490 59.342 -9.545  1.00 99.66  ? 429  PHE A CA  1 
ATOM 3346 C C   . PHE A 1 432  ? -18.089 58.847 -10.944 1.00 99.66  ? 429  PHE A C   1 
ATOM 3347 O O   . PHE A 1 432  ? -17.333 59.523 -11.661 1.00 99.66  ? 429  PHE A O   1 
ATOM 3348 C CB  . PHE A 1 432  ? -20.009 59.419 -9.422  1.00 137.69 ? 429  PHE A CB  1 
ATOM 3349 C CG  . PHE A 1 432  ? -20.614 58.357 -8.554  1.00 137.69 ? 429  PHE A CG  1 
ATOM 3350 C CD1 . PHE A 1 432  ? -20.607 57.021 -8.943  1.00 137.69 ? 429  PHE A CD1 1 
ATOM 3351 C CD2 . PHE A 1 432  ? -21.228 58.702 -7.360  1.00 137.69 ? 429  PHE A CD2 1 
ATOM 3352 C CE1 . PHE A 1 432  ? -21.185 56.048 -8.143  1.00 137.69 ? 429  PHE A CE1 1 
ATOM 3353 C CE2 . PHE A 1 432  ? -21.804 57.740 -6.556  1.00 137.69 ? 429  PHE A CE2 1 
ATOM 3354 C CZ  . PHE A 1 432  ? -21.785 56.410 -6.945  1.00 137.69 ? 429  PHE A CZ  1 
ATOM 3355 N N   . VAL A 1 433  ? -18.600 57.668 -11.314 1.00 173.79 ? 430  VAL A N   1 
ATOM 3356 C CA  . VAL A 1 433  ? -18.405 57.056 -12.641 1.00 173.79 ? 430  VAL A CA  1 
ATOM 3357 C C   . VAL A 1 433  ? -18.851 58.017 -13.751 1.00 173.79 ? 430  VAL A C   1 
ATOM 3358 O O   . VAL A 1 433  ? -19.902 57.827 -14.370 1.00 173.79 ? 430  VAL A O   1 
ATOM 3359 C CB  . VAL A 1 433  ? -19.175 55.691 -12.765 1.00 146.06 ? 430  VAL A CB  1 
ATOM 3360 C CG1 . VAL A 1 433  ? -18.846 54.978 -14.084 1.00 146.06 ? 430  VAL A CG1 1 
ATOM 3361 C CG2 . VAL A 1 433  ? -18.887 54.778 -11.564 1.00 146.06 ? 430  VAL A CG2 1 
ATOM 3362 N N   . GLY A 1 434  ? -18.047 59.053 -13.987 1.00 96.37  ? 431  GLY A N   1 
ATOM 3363 C CA  . GLY A 1 434  ? -18.421 60.139 -14.891 1.00 96.37  ? 431  GLY A CA  1 
ATOM 3364 C C   . GLY A 1 434  ? -19.706 60.850 -14.492 1.00 96.37  ? 431  GLY A C   1 
ATOM 3365 O O   . GLY A 1 434  ? -20.477 61.266 -15.353 1.00 96.37  ? 431  GLY A O   1 
ATOM 3366 N N   . GLN A 1 435  ? -19.933 60.976 -13.185 1.00 119.78 ? 432  GLN A N   1 
ATOM 3367 C CA  . GLN A 1 435  ? -21.155 61.567 -12.633 1.00 119.78 ? 432  GLN A CA  1 
ATOM 3368 C C   . GLN A 1 435  ? -20.827 62.385 -11.390 1.00 119.78 ? 432  GLN A C   1 
ATOM 3369 O O   . GLN A 1 435  ? -19.673 62.446 -10.968 1.00 119.78 ? 432  GLN A O   1 
ATOM 3370 C CB  . GLN A 1 435  ? -22.156 60.472 -12.240 1.00 126.65 ? 432  GLN A CB  1 
ATOM 3371 C CG  . GLN A 1 435  ? -22.658 59.562 -13.371 1.00 126.65 ? 432  GLN A CG  1 
ATOM 3372 C CD  . GLN A 1 435  ? -23.321 58.284 -12.857 1.00 126.65 ? 432  GLN A CD  1 
ATOM 3373 O OE1 . GLN A 1 435  ? -22.865 57.175 -13.146 1.00 126.65 ? 432  GLN A OE1 1 
ATOM 3374 N NE2 . GLN A 1 435  ? -24.393 58.438 -12.084 1.00 126.65 ? 432  GLN A NE2 1 
ATOM 3375 N N   . THR A 1 436  ? -21.844 63.020 -10.816 1.00 208.82 ? 433  THR A N   1 
ATOM 3376 C CA  . THR A 1 436  ? -21.746 63.603 -9.479  1.00 208.82 ? 433  THR A CA  1 
ATOM 3377 C C   . THR A 1 436  ? -23.055 63.382 -8.745  1.00 208.82 ? 433  THR A C   1 
ATOM 3378 O O   . THR A 1 436  ? -24.116 63.837 -9.181  1.00 208.82 ? 433  THR A O   1 
ATOM 3379 C CB  . THR A 1 436  ? -21.391 65.115 -9.498  1.00 72.99  ? 433  THR A CB  1 
ATOM 3380 O OG1 . THR A 1 436  ? -20.025 65.273 -9.879  1.00 72.99  ? 433  THR A OG1 1 
ATOM 3381 C CG2 . THR A 1 436  ? -21.547 65.750 -8.134  1.00 72.99  ? 433  THR A CG2 1 
ATOM 3382 N N   . ARG A 1 437  ? -22.971 62.652 -7.641  1.00 118.52 ? 434  ARG A N   1 
ATOM 3383 C CA  . ARG A 1 437  ? -24.094 62.520 -6.734  1.00 118.52 ? 434  ARG A CA  1 
ATOM 3384 C C   . ARG A 1 437  ? -23.911 63.533 -5.607  1.00 118.52 ? 434  ARG A C   1 
ATOM 3385 O O   . ARG A 1 437  ? -22.792 63.831 -5.191  1.00 118.52 ? 434  ARG A O   1 
ATOM 3386 C CB  . ARG A 1 437  ? -24.213 61.082 -6.206  1.00 171.72 ? 434  ARG A CB  1 
ATOM 3387 C CG  . ARG A 1 437  ? -24.490 60.022 -7.293  1.00 171.72 ? 434  ARG A CG  1 
ATOM 3388 C CD  . ARG A 1 437  ? -25.919 59.458 -7.263  1.00 171.72 ? 434  ARG A CD  1 
ATOM 3389 N NE  . ARG A 1 437  ? -26.929 60.321 -7.889  1.00 171.72 ? 434  ARG A NE  1 
ATOM 3390 C CZ  . ARG A 1 437  ? -27.210 60.353 -9.193  1.00 171.72 ? 434  ARG A CZ  1 
ATOM 3391 N NH1 . ARG A 1 437  ? -26.546 59.584 -10.048 1.00 171.72 ? 434  ARG A NH1 1 
ATOM 3392 N NH2 . ARG A 1 437  ? -28.154 61.170 -9.648  1.00 171.72 ? 434  ARG A NH2 1 
ATOM 3393 N N   . VAL A 1 438  ? -25.025 64.091 -5.157  1.00 123.22 ? 435  VAL A N   1 
ATOM 3394 C CA  . VAL A 1 438  ? -25.043 65.054 -4.069  1.00 123.22 ? 435  VAL A CA  1 
ATOM 3395 C C   . VAL A 1 438  ? -25.642 64.323 -2.874  1.00 123.22 ? 435  VAL A C   1 
ATOM 3396 O O   . VAL A 1 438  ? -26.452 63.411 -3.055  1.00 123.22 ? 435  VAL A O   1 
ATOM 3397 C CB  . VAL A 1 438  ? -25.930 66.270 -4.420  1.00 128.93 ? 435  VAL A CB  1 
ATOM 3398 C CG1 . VAL A 1 438  ? -25.563 67.462 -3.558  1.00 128.93 ? 435  VAL A CG1 1 
ATOM 3399 C CG2 . VAL A 1 438  ? -25.831 66.632 -5.915  1.00 128.93 ? 435  VAL A CG2 1 
ATOM 3400 N N   . LEU A 1 439  ? -25.250 64.707 -1.661  1.00 212.91 ? 436  LEU A N   1 
ATOM 3401 C CA  . LEU A 1 439  ? -25.827 64.091 -0.467  1.00 212.91 ? 436  LEU A CA  1 
ATOM 3402 C C   . LEU A 1 439  ? -26.187 65.089 0.629   1.00 212.91 ? 436  LEU A C   1 
ATOM 3403 O O   . LEU A 1 439  ? -25.403 65.316 1.550   1.00 212.91 ? 436  LEU A O   1 
ATOM 3404 C CB  . LEU A 1 439  ? -24.915 62.985 0.094   1.00 115.94 ? 436  LEU A CB  1 
ATOM 3405 C CG  . LEU A 1 439  ? -24.591 61.706 -0.704  1.00 115.94 ? 436  LEU A CG  1 
ATOM 3406 C CD1 . LEU A 1 439  ? -23.608 60.809 0.057   1.00 115.94 ? 436  LEU A CD1 1 
ATOM 3407 C CD2 . LEU A 1 439  ? -25.838 60.916 -1.093  1.00 115.94 ? 436  LEU A CD2 1 
ATOM 3408 N N   . MET A 1 440  ? -27.373 65.687 0.520   1.00 139.29 ? 437  MET A N   1 
ATOM 3409 C CA  . MET A 1 440  ? -27.933 66.475 1.610   1.00 139.29 ? 437  MET A CA  1 
ATOM 3410 C C   . MET A 1 440  ? -28.287 65.495 2.724   1.00 139.29 ? 437  MET A C   1 
ATOM 3411 O O   . MET A 1 440  ? -29.208 64.691 2.580   1.00 139.29 ? 437  MET A O   1 
ATOM 3412 C CB  . MET A 1 440  ? -29.184 67.256 1.170   1.00 190.49 ? 437  MET A CB  1 
ATOM 3413 C CG  . MET A 1 440  ? -28.971 68.300 0.061   1.00 190.49 ? 437  MET A CG  1 
ATOM 3414 S SD  . MET A 1 440  ? -30.175 69.665 0.030   1.00 190.49 ? 437  MET A SD  1 
ATOM 3415 C CE  . MET A 1 440  ? -31.753 68.812 -0.071  1.00 190.49 ? 437  MET A CE  1 
ATOM 3416 N N   . LEU A 1 441  ? -27.528 65.546 3.815   1.00 212.52 ? 438  LEU A N   1 
ATOM 3417 C CA  . LEU A 1 441  ? -27.782 64.705 4.980   1.00 212.52 ? 438  LEU A CA  1 
ATOM 3418 C C   . LEU A 1 441  ? -28.775 65.403 5.911   1.00 212.52 ? 438  LEU A C   1 
ATOM 3419 O O   . LEU A 1 441  ? -28.622 66.588 6.211   1.00 212.52 ? 438  LEU A O   1 
ATOM 3420 C CB  . LEU A 1 441  ? -26.483 64.422 5.750   1.00 77.15  ? 438  LEU A CB  1 
ATOM 3421 C CG  . LEU A 1 441  ? -25.159 63.932 5.130   1.00 77.15  ? 438  LEU A CG  1 
ATOM 3422 C CD1 . LEU A 1 441  ? -23.985 64.710 5.725   1.00 77.15  ? 438  LEU A CD1 1 
ATOM 3423 C CD2 . LEU A 1 441  ? -24.938 62.409 5.270   1.00 77.15  ? 438  LEU A CD2 1 
ATOM 3424 N N   . ASN A 1 442  ? -29.786 64.668 6.370   1.00 202.35 ? 439  ASN A N   1 
ATOM 3425 C CA  . ASN A 1 442  ? -30.723 65.189 7.366   1.00 202.35 ? 439  ASN A CA  1 
ATOM 3426 C C   . ASN A 1 442  ? -30.119 65.063 8.772   1.00 202.35 ? 439  ASN A C   1 
ATOM 3427 O O   . ASN A 1 442  ? -30.730 64.503 9.684   1.00 202.35 ? 439  ASN A O   1 
ATOM 3428 C CB  . ASN A 1 442  ? -32.085 64.479 7.254   1.00 160.18 ? 439  ASN A CB  1 
ATOM 3429 C CG  . ASN A 1 442  ? -33.192 65.179 8.048   1.00 160.18 ? 439  ASN A CG  1 
ATOM 3430 O OD1 . ASN A 1 442  ? -33.915 64.539 8.818   1.00 160.18 ? 439  ASN A OD1 1 
ATOM 3431 N ND2 . ASN A 1 442  ? -33.327 66.492 7.862   1.00 160.18 ? 439  ASN A ND2 1 
ATOM 3432 N N   . GLY A 1 443  ? -28.909 65.599 8.928   1.00 105.18 ? 440  GLY A N   1 
ATOM 3433 C CA  . GLY A 1 443  ? -28.130 65.469 10.161  1.00 105.18 ? 440  GLY A CA  1 
ATOM 3434 C C   . GLY A 1 443  ? -27.244 64.233 10.154  1.00 105.18 ? 440  GLY A C   1 
ATOM 3435 O O   . GLY A 1 443  ? -26.063 64.299 9.790   1.00 105.18 ? 440  GLY A O   1 
ATOM 3436 N N   . GLU A 1 444  ? -27.827 63.107 10.561  1.00 94.62  ? 441  GLU A N   1 
ATOM 3437 C CA  . GLU A 1 444  ? -27.164 61.791 10.528  1.00 94.62  ? 441  GLU A CA  1 
ATOM 3438 C C   . GLU A 1 444  ? -27.779 60.863 9.460   1.00 94.62  ? 441  GLU A C   1 
ATOM 3439 O O   . GLU A 1 444  ? -27.391 59.695 9.340   1.00 94.62  ? 441  GLU A O   1 
ATOM 3440 C CB  . GLU A 1 444  ? -27.260 61.118 11.902  1.00 212.91 ? 441  GLU A CB  1 
ATOM 3441 C CG  . GLU A 1 444  ? -28.667 61.147 12.511  1.00 212.91 ? 441  GLU A CG  1 
ATOM 3442 C CD  . GLU A 1 444  ? -29.143 59.788 13.011  1.00 212.91 ? 441  GLU A CD  1 
ATOM 3443 O OE1 . GLU A 1 444  ? -29.903 59.753 14.002  1.00 212.91 ? 441  GLU A OE1 1 
ATOM 3444 O OE2 . GLU A 1 444  ? -28.775 58.756 12.409  1.00 212.91 ? 441  GLU A OE2 1 
ATOM 3445 N N   . GLU A 1 445  ? -28.737 61.395 8.698   1.00 162.86 ? 442  GLU A N   1 
ATOM 3446 C CA  . GLU A 1 445  ? -29.542 60.620 7.743   1.00 162.86 ? 442  GLU A CA  1 
ATOM 3447 C C   . GLU A 1 445  ? -29.071 60.854 6.301   1.00 162.86 ? 442  GLU A C   1 
ATOM 3448 O O   . GLU A 1 445  ? -28.705 61.975 5.946   1.00 162.86 ? 442  GLU A O   1 
ATOM 3449 C CB  . GLU A 1 445  ? -31.018 61.019 7.892   1.00 126.27 ? 442  GLU A CB  1 
ATOM 3450 C CG  . GLU A 1 445  ? -32.050 60.023 7.359   1.00 126.27 ? 442  GLU A CG  1 
ATOM 3451 C CD  . GLU A 1 445  ? -33.486 60.518 7.540   1.00 126.27 ? 442  GLU A CD  1 
ATOM 3452 O OE1 . GLU A 1 445  ? -34.305 60.345 6.613   1.00 126.27 ? 442  GLU A OE1 1 
ATOM 3453 O OE2 . GLU A 1 445  ? -33.798 61.092 8.608   1.00 126.27 ? 442  GLU A OE2 1 
ATOM 3454 N N   . VAL A 1 446  ? -29.085 59.796 5.481   1.00 192.75 ? 443  VAL A N   1 
ATOM 3455 C CA  . VAL A 1 446  ? -28.652 59.864 4.067   1.00 192.75 ? 443  VAL A CA  1 
ATOM 3456 C C   . VAL A 1 446  ? -29.815 60.021 3.082   1.00 192.75 ? 443  VAL A C   1 
ATOM 3457 O O   . VAL A 1 446  ? -30.820 59.309 3.165   1.00 192.75 ? 443  VAL A O   1 
ATOM 3458 C CB  . VAL A 1 446  ? -27.722 58.670 3.667   1.00 116.16 ? 443  VAL A CB  1 
ATOM 3459 C CG1 . VAL A 1 446  ? -27.834 58.319 2.168   1.00 116.16 ? 443  VAL A CG1 1 
ATOM 3460 C CG2 . VAL A 1 446  ? -26.280 58.982 4.044   1.00 116.16 ? 443  VAL A CG2 1 
ATOM 3461 N N   . GLU A 1 447  ? -29.647 60.952 2.145   1.00 211.75 ? 444  GLU A N   1 
ATOM 3462 C CA  . GLU A 1 447  ? -30.691 61.338 1.209   1.00 211.75 ? 444  GLU A CA  1 
ATOM 3463 C C   . GLU A 1 447  ? -30.052 62.033 0.005   1.00 211.75 ? 444  GLU A C   1 
ATOM 3464 O O   . GLU A 1 447  ? -29.297 62.995 0.167   1.00 211.75 ? 444  GLU A O   1 
ATOM 3465 C CB  . GLU A 1 447  ? -31.691 62.257 1.921   1.00 129.32 ? 444  GLU A CB  1 
ATOM 3466 C CG  . GLU A 1 447  ? -32.549 63.122 1.016   1.00 129.32 ? 444  GLU A CG  1 
ATOM 3467 C CD  . GLU A 1 447  ? -32.865 64.469 1.644   1.00 129.32 ? 444  GLU A CD  1 
ATOM 3468 O OE1 . GLU A 1 447  ? -31.928 65.148 2.121   1.00 129.32 ? 444  GLU A OE1 1 
ATOM 3469 O OE2 . GLU A 1 447  ? -34.053 64.854 1.655   1.00 129.32 ? 444  GLU A OE2 1 
ATOM 3470 N N   . GLU A 1 448  ? -30.356 61.539 -1.196  1.00 133.12 ? 445  GLU A N   1 
ATOM 3471 C CA  . GLU A 1 448  ? -29.724 62.029 -2.431  1.00 133.12 ? 445  GLU A CA  1 
ATOM 3472 C C   . GLU A 1 448  ? -30.650 62.837 -3.351  1.00 133.12 ? 445  GLU A C   1 
ATOM 3473 O O   . GLU A 1 448  ? -31.605 62.305 -3.926  1.00 133.12 ? 445  GLU A O   1 
ATOM 3474 C CB  . GLU A 1 448  ? -29.029 60.887 -3.189  1.00 202.29 ? 445  GLU A CB  1 
ATOM 3475 C CG  . GLU A 1 448  ? -29.807 59.581 -3.220  1.00 202.29 ? 445  GLU A CG  1 
ATOM 3476 C CD  . GLU A 1 448  ? -28.961 58.380 -2.830  1.00 202.29 ? 445  GLU A CD  1 
ATOM 3477 O OE1 . GLU A 1 448  ? -29.282 57.262 -3.279  1.00 202.29 ? 445  GLU A OE1 1 
ATOM 3478 O OE2 . GLU A 1 448  ? -27.986 58.544 -2.065  1.00 202.29 ? 445  GLU A OE2 1 
ATOM 3479 N N   . THR A 1 449  ? -30.337 64.126 -3.483  1.00 196.34 ? 446  THR A N   1 
ATOM 3480 C CA  . THR A 1 449  ? -31.148 65.071 -4.256  1.00 196.34 ? 446  THR A CA  1 
ATOM 3481 C C   . THR A 1 449  ? -30.314 65.960 -5.194  1.00 196.34 ? 446  THR A C   1 
ATOM 3482 O O   . THR A 1 449  ? -29.114 65.748 -5.376  1.00 196.34 ? 446  THR A O   1 
ATOM 3483 C CB  . THR A 1 449  ? -32.006 65.990 -3.330  1.00 92.00  ? 446  THR A CB  1 
ATOM 3484 O OG1 . THR A 1 449  ? -31.151 66.778 -2.485  1.00 92.00  ? 446  THR A OG1 1 
ATOM 3485 C CG2 . THR A 1 449  ? -32.997 65.171 -2.479  1.00 92.00  ? 446  THR A CG2 1 
ATOM 3486 N N   . GLU A 1 450  ? -30.984 66.949 -5.785  1.00 105.27 ? 447  GLU A N   1 
ATOM 3487 C CA  . GLU A 1 450  ? -30.378 67.972 -6.639  1.00 105.27 ? 447  GLU A CA  1 
ATOM 3488 C C   . GLU A 1 450  ? -29.620 69.042 -5.831  1.00 105.27 ? 447  GLU A C   1 
ATOM 3489 O O   . GLU A 1 450  ? -29.590 68.992 -4.599  1.00 105.27 ? 447  GLU A O   1 
ATOM 3490 C CB  . GLU A 1 450  ? -31.474 68.626 -7.497  1.00 172.73 ? 447  GLU A CB  1 
ATOM 3491 C CG  . GLU A 1 450  ? -32.740 68.995 -6.713  1.00 172.73 ? 447  GLU A CG  1 
ATOM 3492 C CD  . GLU A 1 450  ? -33.894 69.449 -7.597  1.00 172.73 ? 447  GLU A CD  1 
ATOM 3493 O OE1 . GLU A 1 450  ? -34.718 68.589 -7.978  1.00 172.73 ? 447  GLU A OE1 1 
ATOM 3494 O OE2 . GLU A 1 450  ? -33.986 70.660 -7.903  1.00 172.73 ? 447  GLU A OE2 1 
ATOM 3495 N N   . LEU A 1 451  ? -29.000 69.986 -6.544  1.00 207.60 ? 448  LEU A N   1 
ATOM 3496 C CA  . LEU A 1 451  ? -28.434 71.214 -5.964  1.00 207.60 ? 448  LEU A CA  1 
ATOM 3497 C C   . LEU A 1 451  ? -28.044 72.188 -7.082  1.00 207.60 ? 448  LEU A C   1 
ATOM 3498 O O   . LEU A 1 451  ? -27.062 71.959 -7.792  1.00 207.60 ? 448  LEU A O   1 
ATOM 3499 C CB  . LEU A 1 451  ? -27.228 70.909 -5.071  1.00 100.50 ? 448  LEU A CB  1 
ATOM 3500 C CG  . LEU A 1 451  ? -27.026 71.782 -3.827  1.00 100.50 ? 448  LEU A CG  1 
ATOM 3501 C CD1 . LEU A 1 451  ? -27.998 71.386 -2.708  1.00 100.50 ? 448  LEU A CD1 1 
ATOM 3502 C CD2 . LEU A 1 451  ? -25.590 71.689 -3.334  1.00 100.50 ? 448  LEU A CD2 1 
ATOM 3503 N N   . MET A 1 452  ? -28.818 73.268 -7.220  1.00 200.41 ? 449  MET A N   1 
ATOM 3504 C CA  . MET A 1 452  ? -28.733 74.194 -8.363  1.00 200.41 ? 449  MET A CA  1 
ATOM 3505 C C   . MET A 1 452  ? -27.292 74.555 -8.715  1.00 200.41 ? 449  MET A C   1 
ATOM 3506 O O   . MET A 1 452  ? -26.505 74.911 -7.838  1.00 200.41 ? 449  MET A O   1 
ATOM 3507 C CB  . MET A 1 452  ? -29.524 75.486 -8.101  1.00 161.45 ? 449  MET A CB  1 
ATOM 3508 C CG  . MET A 1 452  ? -30.294 75.529 -6.785  1.00 161.45 ? 449  MET A CG  1 
ATOM 3509 S SD  . MET A 1 452  ? -32.093 75.435 -6.877  1.00 161.45 ? 449  MET A SD  1 
ATOM 3510 C CE  . MET A 1 452  ? -32.540 75.956 -5.217  1.00 161.45 ? 449  MET A CE  1 
ATOM 3511 N N   . GLY A 1 453  ? -26.957 74.450 -10.000 1.00 202.99 ? 450  GLY A N   1 
ATOM 3512 C CA  . GLY A 1 453  ? -25.627 74.807 -10.505 1.00 202.99 ? 450  GLY A CA  1 
ATOM 3513 C C   . GLY A 1 453  ? -24.520 73.809 -10.207 1.00 202.99 ? 450  GLY A C   1 
ATOM 3514 O O   . GLY A 1 453  ? -23.334 74.131 -10.319 1.00 202.99 ? 450  GLY A O   1 
ATOM 3515 N N   . PHE A 1 454  ? -24.907 72.595 -9.830  1.00 157.85 ? 451  PHE A N   1 
ATOM 3516 C CA  . PHE A 1 454  ? -23.952 71.543 -9.523  1.00 157.85 ? 451  PHE A CA  1 
ATOM 3517 C C   . PHE A 1 454  ? -24.237 70.292 -10.340 1.00 157.85 ? 451  PHE A C   1 
ATOM 3518 O O   . PHE A 1 454  ? -24.955 69.400 -9.886  1.00 157.85 ? 451  PHE A O   1 
ATOM 3519 C CB  . PHE A 1 454  ? -23.970 71.232 -8.029  1.00 155.10 ? 451  PHE A CB  1 
ATOM 3520 C CG  . PHE A 1 454  ? -22.994 72.037 -7.238  1.00 155.10 ? 451  PHE A CG  1 
ATOM 3521 C CD1 . PHE A 1 454  ? -23.060 73.421 -7.222  1.00 155.10 ? 451  PHE A CD1 1 
ATOM 3522 C CD2 . PHE A 1 454  ? -22.005 71.409 -6.499  1.00 155.10 ? 451  PHE A CD2 1 
ATOM 3523 C CE1 . PHE A 1 454  ? -22.152 74.165 -6.493  1.00 155.10 ? 451  PHE A CE1 1 
ATOM 3524 C CE2 . PHE A 1 454  ? -21.093 72.151 -5.763  1.00 155.10 ? 451  PHE A CE2 1 
ATOM 3525 C CZ  . PHE A 1 454  ? -21.170 73.532 -5.763  1.00 155.10 ? 451  PHE A CZ  1 
ATOM 3526 N N   . VAL A 1 455  ? -23.657 70.231 -11.539 1.00 97.91  ? 452  VAL A N   1 
ATOM 3527 C CA  . VAL A 1 455  ? -23.997 69.195 -12.521 1.00 97.91  ? 452  VAL A CA  1 
ATOM 3528 C C   . VAL A 1 455  ? -23.949 67.781 -11.962 1.00 97.91  ? 452  VAL A C   1 
ATOM 3529 O O   . VAL A 1 455  ? -22.981 67.380 -11.322 1.00 97.91  ? 452  VAL A O   1 
ATOM 3530 C CB  . VAL A 1 455  ? -23.169 69.274 -13.823 1.00 103.35 ? 452  VAL A CB  1 
ATOM 3531 C CG1 . VAL A 1 455  ? -23.934 70.037 -14.903 1.00 103.35 ? 452  VAL A CG1 1 
ATOM 3532 C CG2 . VAL A 1 455  ? -21.786 69.858 -13.571 1.00 103.35 ? 452  VAL A CG2 1 
ATOM 3533 N N   . ASP A 1 456  ? -25.032 67.056 -12.232 1.00 93.05  ? 453  ASP A N   1 
ATOM 3534 C CA  . ASP A 1 456  ? -25.291 65.709 -11.745 1.00 93.05  ? 453  ASP A CA  1 
ATOM 3535 C C   . ASP A 1 456  ? -24.909 64.639 -12.762 1.00 93.05  ? 453  ASP A C   1 
ATOM 3536 O O   . ASP A 1 456  ? -24.840 63.462 -12.417 1.00 93.05  ? 453  ASP A O   1 
ATOM 3537 C CB  . ASP A 1 456  ? -26.777 65.564 -11.373 1.00 200.81 ? 453  ASP A CB  1 
ATOM 3538 C CG  . ASP A 1 456  ? -27.719 66.104 -12.454 1.00 200.81 ? 453  ASP A CG  1 
ATOM 3539 O OD1 . ASP A 1 456  ? -27.397 66.005 -13.657 1.00 200.81 ? 453  ASP A OD1 1 
ATOM 3540 O OD2 . ASP A 1 456  ? -28.792 66.631 -12.095 1.00 200.81 ? 453  ASP A OD2 1 
ATOM 3541 N N   . ASP A 1 457  ? -24.681 65.040 -14.010 1.00 195.78 ? 454  ASP A N   1 
ATOM 3542 C CA  . ASP A 1 457  ? -24.303 64.102 -15.062 1.00 195.78 ? 454  ASP A CA  1 
ATOM 3543 C C   . ASP A 1 457  ? -22.871 64.357 -15.510 1.00 195.78 ? 454  ASP A C   1 
ATOM 3544 O O   . ASP A 1 457  ? -22.517 64.130 -16.668 1.00 195.78 ? 454  ASP A O   1 
ATOM 3545 C CB  . ASP A 1 457  ? -25.260 64.223 -16.245 1.00 172.52 ? 454  ASP A CB  1 
ATOM 3546 C CG  . ASP A 1 457  ? -25.222 65.596 -16.889 1.00 172.52 ? 454  ASP A CG  1 
ATOM 3547 O OD1 . ASP A 1 457  ? -25.332 65.662 -18.129 1.00 172.52 ? 454  ASP A OD1 1 
ATOM 3548 O OD2 . ASP A 1 457  ? -25.073 66.603 -16.161 1.00 172.52 ? 454  ASP A OD2 1 
ATOM 3549 N N   . GLN A 1 458  ? -22.052 64.826 -14.575 1.00 189.52 ? 455  GLN A N   1 
ATOM 3550 C CA  . GLN A 1 458  ? -20.684 65.235 -14.864 1.00 189.52 ? 455  GLN A CA  1 
ATOM 3551 C C   . GLN A 1 458  ? -19.727 64.835 -13.738 1.00 189.52 ? 455  GLN A C   1 
ATOM 3552 O O   . GLN A 1 458  ? -20.017 65.050 -12.563 1.00 189.52 ? 455  GLN A O   1 
ATOM 3553 C CB  . GLN A 1 458  ? -20.633 66.750 -15.074 1.00 133.62 ? 455  GLN A CB  1 
ATOM 3554 C CG  . GLN A 1 458  ? -21.235 67.258 -16.372 1.00 133.62 ? 455  GLN A CG  1 
ATOM 3555 C CD  . GLN A 1 458  ? -20.267 67.178 -17.526 1.00 133.62 ? 455  GLN A CD  1 
ATOM 3556 O OE1 . GLN A 1 458  ? -19.521 68.121 -17.790 1.00 133.62 ? 455  GLN A OE1 1 
ATOM 3557 N NE2 . GLN A 1 458  ? -20.258 66.045 -18.211 1.00 133.62 ? 455  GLN A NE2 1 
ATOM 3558 N N   . GLN A 1 459  ? -18.585 64.264 -14.108 1.00 135.44 ? 456  GLN A N   1 
ATOM 3559 C CA  . GLN A 1 459  ? -17.569 63.848 -13.147 1.00 135.44 ? 456  GLN A CA  1 
ATOM 3560 C C   . GLN A 1 459  ? -16.875 65.054 -12.514 1.00 135.44 ? 456  GLN A C   1 
ATOM 3561 O O   . GLN A 1 459  ? -15.875 65.530 -13.039 1.00 135.44 ? 456  GLN A O   1 
ATOM 3562 C CB  . GLN A 1 459  ? -16.540 62.958 -13.847 1.00 126.54 ? 456  GLN A CB  1 
ATOM 3563 C CG  . GLN A 1 459  ? -15.687 62.093 -12.925 1.00 126.54 ? 456  GLN A CG  1 
ATOM 3564 C CD  . GLN A 1 459  ? -14.752 61.152 -13.685 1.00 126.54 ? 456  GLN A CD  1 
ATOM 3565 O OE1 . GLN A 1 459  ? -13.731 60.714 -13.156 1.00 126.54 ? 456  GLN A OE1 1 
ATOM 3566 N NE2 . GLN A 1 459  ? -15.102 60.837 -14.926 1.00 126.54 ? 456  GLN A NE2 1 
ATOM 3567 N N   . THR A 1 460  ? -17.405 65.543 -11.392 1.00 120.05 ? 457  THR A N   1 
ATOM 3568 C CA  . THR A 1 460  ? -16.779 66.644 -10.640 1.00 120.05 ? 457  THR A CA  1 
ATOM 3569 C C   . THR A 1 460  ? -15.322 66.306 -10.280 1.00 120.05 ? 457  THR A C   1 
ATOM 3570 O O   . THR A 1 460  ? -14.994 65.152 -10.022 1.00 120.05 ? 457  THR A O   1 
ATOM 3571 C CB  . THR A 1 460  ? -17.562 66.984 -9.338  1.00 94.06  ? 457  THR A CB  1 
ATOM 3572 O OG1 . THR A 1 460  ? -18.938 67.232 -9.625  1.00 94.06  ? 457  THR A OG1 1 
ATOM 3573 C CG2 . THR A 1 460  ? -17.017 68.202 -8.700  1.00 94.06  ? 457  THR A CG2 1 
ATOM 3574 N N   . PHE A 1 461  ? -14.457 67.314 -10.270 1.00 89.09  ? 458  PHE A N   1 
ATOM 3575 C CA  . PHE A 1 461  ? -13.025 67.129 -9.989  1.00 89.09  ? 458  PHE A CA  1 
ATOM 3576 C C   . PHE A 1 461  ? -12.542 67.993 -8.834  1.00 89.09  ? 458  PHE A C   1 
ATOM 3577 O O   . PHE A 1 461  ? -11.353 68.046 -8.517  1.00 89.09  ? 458  PHE A O   1 
ATOM 3578 C CB  . PHE A 1 461  ? -12.187 67.439 -11.234 1.00 172.35 ? 458  PHE A CB  1 
ATOM 3579 C CG  . PHE A 1 461  ? -12.455 66.527 -12.396 1.00 172.35 ? 458  PHE A CG  1 
ATOM 3580 C CD1 . PHE A 1 461  ? -12.624 65.158 -12.206 1.00 172.35 ? 458  PHE A CD1 1 
ATOM 3581 C CD2 . PHE A 1 461  ? -12.511 67.034 -13.685 1.00 172.35 ? 458  PHE A CD2 1 
ATOM 3582 C CE1 . PHE A 1 461  ? -12.866 64.313 -13.280 1.00 172.35 ? 458  PHE A CE1 1 
ATOM 3583 C CE2 . PHE A 1 461  ? -12.746 66.196 -14.765 1.00 172.35 ? 458  PHE A CE2 1 
ATOM 3584 C CZ  . PHE A 1 461  ? -12.928 64.833 -14.563 1.00 172.35 ? 458  PHE A CZ  1 
ATOM 3585 N N   . PHE A 1 462  ? -13.490 68.686 -8.227  1.00 64.95  ? 459  PHE A N   1 
ATOM 3586 C CA  . PHE A 1 462  ? -13.253 69.579 -7.092  1.00 64.95  ? 459  PHE A CA  1 
ATOM 3587 C C   . PHE A 1 462  ? -14.589 70.178 -6.634  1.00 64.95  ? 459  PHE A C   1 
ATOM 3588 O O   . PHE A 1 462  ? -15.612 70.001 -7.311  1.00 64.95  ? 459  PHE A O   1 
ATOM 3589 C CB  . PHE A 1 462  ? -12.216 70.677 -7.387  1.00 86.50  ? 459  PHE A CB  1 
ATOM 3590 C CG  . PHE A 1 462  ? -11.611 71.261 -6.145  1.00 86.50  ? 459  PHE A CG  1 
ATOM 3591 C CD1 . PHE A 1 462  ? -10.463 70.707 -5.592  1.00 86.50  ? 459  PHE A CD1 1 
ATOM 3592 C CD2 . PHE A 1 462  ? -12.214 72.345 -5.497  1.00 86.50  ? 459  PHE A CD2 1 
ATOM 3593 C CE1 . PHE A 1 462  ? -9.911  71.234 -4.419  1.00 86.50  ? 459  PHE A CE1 1 
ATOM 3594 C CE2 . PHE A 1 462  ? -11.673 72.875 -4.312  1.00 86.50  ? 459  PHE A CE2 1 
ATOM 3595 C CZ  . PHE A 1 462  ? -10.521 72.326 -3.777  1.00 86.50  ? 459  PHE A CZ  1 
ATOM 3596 N N   . CYS A 1 463  ? -14.579 70.879 -5.495  1.00 102.50 ? 460  CYS A N   1 
ATOM 3597 C CA  . CYS A 1 463  ? -15.812 71.241 -4.813  1.00 102.50 ? 460  CYS A CA  1 
ATOM 3598 C C   . CYS A 1 463  ? -15.589 72.038 -3.539  1.00 102.50 ? 460  CYS A C   1 
ATOM 3599 O O   . CYS A 1 463  ? -16.421 71.963 -2.646  1.00 102.50 ? 460  CYS A O   1 
ATOM 3600 C CB  . CYS A 1 463  ? -16.566 69.957 -4.451  1.00 125.67 ? 460  CYS A CB  1 
ATOM 3601 S SG  . CYS A 1 463  ? -18.331 69.998 -4.675  1.00 125.67 ? 460  CYS A SG  1 
ATOM 3602 N N   . GLY A 1 464  ? -14.484 72.789 -3.455  1.00 90.05  ? 461  GLY A N   1 
ATOM 3603 C CA  . GLY A 1 464  ? -14.081 73.551 -2.242  1.00 90.05  ? 461  GLY A CA  1 
ATOM 3604 C C   . GLY A 1 464  ? -15.135 74.396 -1.510  1.00 90.05  ? 461  GLY A C   1 
ATOM 3605 O O   . GLY A 1 464  ? -16.340 74.329 -1.811  1.00 90.05  ? 461  GLY A O   1 
ATOM 3606 N N   . ASN A 1 465  ? -14.695 75.179 -0.523  1.00 212.91 ? 462  ASN A N   1 
ATOM 3607 C CA  . ASN A 1 465  ? -15.593 76.099 0.198   1.00 212.91 ? 462  ASN A CA  1 
ATOM 3608 C C   . ASN A 1 465  ? -15.214 77.566 -0.046  1.00 212.91 ? 462  ASN A C   1 
ATOM 3609 O O   . ASN A 1 465  ? -14.742 78.262 0.861   1.00 212.91 ? 462  ASN A O   1 
ATOM 3610 C CB  . ASN A 1 465  ? -15.649 75.770 1.703   1.00 205.04 ? 462  ASN A CB  1 
ATOM 3611 C CG  . ASN A 1 465  ? -16.536 74.566 2.014   1.00 205.04 ? 462  ASN A CG  1 
ATOM 3612 O OD1 . ASN A 1 465  ? -16.083 73.582 2.598   1.00 205.04 ? 462  ASN A OD1 1 
ATOM 3613 N ND2 . ASN A 1 465  ? -17.804 74.646 1.632   1.00 205.04 ? 462  ASN A ND2 1 
ATOM 3614 N N   . VAL A 1 466  ? -15.440 78.016 -1.283  1.00 117.85 ? 463  VAL A N   1 
ATOM 3615 C CA  . VAL A 1 466  ? -14.987 79.335 -1.763  1.00 117.85 ? 463  VAL A CA  1 
ATOM 3616 C C   . VAL A 1 466  ? -15.683 80.510 -1.082  1.00 117.85 ? 463  VAL A C   1 
ATOM 3617 O O   . VAL A 1 466  ? -16.911 80.594 -1.054  1.00 117.85 ? 463  VAL A O   1 
ATOM 3618 C CB  . VAL A 1 466  ? -15.069 79.477 -3.314  1.00 127.74 ? 463  VAL A CB  1 
ATOM 3619 C CG1 . VAL A 1 466  ? -13.962 78.688 -3.992  1.00 127.74 ? 463  VAL A CG1 1 
ATOM 3620 C CG2 . VAL A 1 466  ? -16.427 79.053 -3.841  1.00 127.74 ? 463  VAL A CG2 1 
ATOM 3621 N N   . ALA A 1 467  ? -14.868 81.409 -0.537  1.00 98.80  ? 464  ALA A N   1 
ATOM 3622 C CA  . ALA A 1 467  ? -15.334 82.556 0.237   1.00 98.80  ? 464  ALA A CA  1 
ATOM 3623 C C   . ALA A 1 467  ? -16.246 83.479 -0.590  1.00 98.80  ? 464  ALA A C   1 
ATOM 3624 O O   . ALA A 1 467  ? -16.482 83.222 -1.786  1.00 98.80  ? 464  ALA A O   1 
ATOM 3625 C CB  . ALA A 1 467  ? -14.132 83.328 0.816   1.00 122.43 ? 464  ALA A CB  1 
ATOM 3626 N N   . HIS A 1 468  ? -16.752 84.541 0.052   1.00 107.25 ? 465  HIS A N   1 
ATOM 3627 C CA  . HIS A 1 468  ? -17.689 85.499 -0.573  1.00 107.25 ? 465  HIS A CA  1 
ATOM 3628 C C   . HIS A 1 468  ? -19.041 84.843 -0.898  1.00 107.25 ? 465  HIS A C   1 
ATOM 3629 O O   . HIS A 1 468  ? -19.637 85.099 -1.950  1.00 107.25 ? 465  HIS A O   1 
ATOM 3630 C CB  . HIS A 1 468  ? -17.077 86.165 -1.822  1.00 139.72 ? 465  HIS A CB  1 
ATOM 3631 C CG  . HIS A 1 468  ? -15.708 86.740 -1.603  1.00 139.72 ? 465  HIS A CG  1 
ATOM 3632 N ND1 . HIS A 1 468  ? -14.849 86.288 -0.619  1.00 139.72 ? 465  HIS A ND1 1 
ATOM 3633 C CD2 . HIS A 1 468  ? -15.037 87.712 -2.267  1.00 139.72 ? 465  HIS A CD2 1 
ATOM 3634 C CE1 . HIS A 1 468  ? -13.717 86.966 -0.676  1.00 139.72 ? 465  HIS A CE1 1 
ATOM 3635 N NE2 . HIS A 1 468  ? -13.805 87.837 -1.667  1.00 139.72 ? 465  HIS A NE2 1 
ATOM 3636 N N   . GLN A 1 469  ? -19.492 83.983 0.022   1.00 95.70  ? 466  GLN A N   1 
ATOM 3637 C CA  . GLN A 1 469  ? -20.816 83.371 -0.003  1.00 95.70  ? 466  GLN A CA  1 
ATOM 3638 C C   . GLN A 1 469  ? -21.080 82.520 -1.236  1.00 95.70  ? 466  GLN A C   1 
ATOM 3639 O O   . GLN A 1 469  ? -22.203 82.479 -1.731  1.00 95.70  ? 466  GLN A O   1 
ATOM 3640 C CB  . GLN A 1 469  ? -21.915 84.438 0.095   1.00 112.55 ? 466  GLN A CB  1 
ATOM 3641 C CG  . GLN A 1 469  ? -22.082 85.151 1.428   1.00 112.55 ? 466  GLN A CG  1 
ATOM 3642 C CD  . GLN A 1 469  ? -23.287 86.099 1.410   1.00 112.55 ? 466  GLN A CD  1 
ATOM 3643 O OE1 . GLN A 1 469  ? -24.339 85.769 1.948   1.00 112.55 ? 466  GLN A OE1 1 
ATOM 3644 N NE2 . GLN A 1 469  ? -23.142 87.265 0.764   1.00 112.55 ? 466  GLN A NE2 1 
ATOM 3645 N N   . GLN A 1 470  ? -20.071 81.838 -1.748  1.00 171.61 ? 467  GLN A N   1 
ATOM 3646 C CA  . GLN A 1 470  ? -20.339 80.973 -2.893  1.00 171.61 ? 467  GLN A CA  1 
ATOM 3647 C C   . GLN A 1 470  ? -19.855 79.530 -2.781  1.00 171.61 ? 467  GLN A C   1 
ATOM 3648 O O   . GLN A 1 470  ? -19.018 79.195 -1.941  1.00 171.61 ? 467  GLN A O   1 
ATOM 3649 C CB  . GLN A 1 470  ? -19.944 81.619 -4.237  1.00 118.21 ? 467  GLN A CB  1 
ATOM 3650 C CG  . GLN A 1 470  ? -19.103 82.880 -4.164  1.00 118.21 ? 467  GLN A CG  1 
ATOM 3651 C CD  . GLN A 1 470  ? -19.467 83.855 -5.260  1.00 118.21 ? 467  GLN A CD  1 
ATOM 3652 O OE1 . GLN A 1 470  ? -18.604 84.323 -5.999  1.00 118.21 ? 467  GLN A OE1 1 
ATOM 3653 N NE2 . GLN A 1 470  ? -20.759 84.160 -5.381  1.00 118.21 ? 467  GLN A NE2 1 
ATOM 3654 N N   . LEU A 1 471  ? -20.449 78.685 -3.621  1.00 175.20 ? 468  LEU A N   1 
ATOM 3655 C CA  . LEU A 1 471  ? -20.048 77.300 -3.798  1.00 175.20 ? 468  LEU A CA  1 
ATOM 3656 C C   . LEU A 1 471  ? -19.403 77.153 -5.167  1.00 175.20 ? 468  LEU A C   1 
ATOM 3657 O O   . LEU A 1 471  ? -19.675 77.936 -6.080  1.00 175.20 ? 468  LEU A O   1 
ATOM 3658 C CB  . LEU A 1 471  ? -21.258 76.369 -3.738  1.00 109.94 ? 468  LEU A CB  1 
ATOM 3659 C CG  . LEU A 1 471  ? -22.427 76.532 -2.767  1.00 109.94 ? 468  LEU A CG  1 
ATOM 3660 C CD1 . LEU A 1 471  ? -23.524 75.491 -3.067  1.00 109.94 ? 468  LEU A CD1 1 
ATOM 3661 C CD2 . LEU A 1 471  ? -21.959 76.432 -1.329  1.00 109.94 ? 468  LEU A CD2 1 
ATOM 3662 N N   . ILE A 1 472  ? -18.569 76.130 -5.306  1.00 129.70 ? 469  ILE A N   1 
ATOM 3663 C CA  . ILE A 1 472  ? -17.839 75.868 -6.540  1.00 129.70 ? 469  ILE A CA  1 
ATOM 3664 C C   . ILE A 1 472  ? -17.988 74.392 -6.928  1.00 129.70 ? 469  ILE A C   1 
ATOM 3665 O O   . ILE A 1 472  ? -18.075 73.527 -6.061  1.00 129.70 ? 469  ILE A O   1 
ATOM 3666 C CB  . ILE A 1 472  ? -16.338 76.296 -6.396  1.00 68.17  ? 469  ILE A CB  1 
ATOM 3667 C CG1 . ILE A 1 472  ? -15.579 76.190 -7.726  1.00 68.17  ? 469  ILE A CG1 1 
ATOM 3668 C CG2 . ILE A 1 472  ? -15.646 75.552 -5.240  1.00 68.17  ? 469  ILE A CG2 1 
ATOM 3669 C CD1 . ILE A 1 472  ? -15.090 74.795 -8.090  1.00 68.17  ? 469  ILE A CD1 1 
ATOM 3670 N N   . GLN A 1 473  ? -18.050 74.112 -8.224  1.00 96.49  ? 470  GLN A N   1 
ATOM 3671 C CA  . GLN A 1 473  ? -18.048 72.741 -8.709  1.00 96.49  ? 470  GLN A CA  1 
ATOM 3672 C C   . GLN A 1 473  ? -17.267 72.663 -10.015 1.00 96.49  ? 470  GLN A C   1 
ATOM 3673 O O   . GLN A 1 473  ? -17.833 72.832 -11.092 1.00 96.49  ? 470  GLN A O   1 
ATOM 3674 C CB  . GLN A 1 473  ? -19.473 72.230 -8.919  1.00 107.04 ? 470  GLN A CB  1 
ATOM 3675 C CG  . GLN A 1 473  ? -19.573 70.721 -9.157  1.00 107.04 ? 470  GLN A CG  1 
ATOM 3676 C CD  . GLN A 1 473  ? -20.740 70.330 -10.060 1.00 107.04 ? 470  GLN A CD  1 
ATOM 3677 O OE1 . GLN A 1 473  ? -21.273 71.158 -10.804 1.00 107.04 ? 470  GLN A OE1 1 
ATOM 3678 N NE2 . GLN A 1 473  ? -21.133 69.061 -10.003 1.00 107.04 ? 470  GLN A NE2 1 
ATOM 3679 N N   . ILE A 1 474  ? -15.963 72.419 -9.933  1.00 90.46  ? 471  ILE A N   1 
ATOM 3680 C CA  . ILE A 1 474  ? -15.197 72.180 -11.143 1.00 90.46  ? 471  ILE A CA  1 
ATOM 3681 C C   . ILE A 1 474  ? -15.599 70.816 -11.701 1.00 90.46  ? 471  ILE A C   1 
ATOM 3682 O O   . ILE A 1 474  ? -15.518 69.794 -11.026 1.00 90.46  ? 471  ILE A O   1 
ATOM 3683 C CB  . ILE A 1 474  ? -13.674 72.270 -10.928 1.00 60.76  ? 471  ILE A CB  1 
ATOM 3684 C CG1 . ILE A 1 474  ? -13.293 73.564 -10.182 1.00 60.76  ? 471  ILE A CG1 1 
ATOM 3685 C CG2 . ILE A 1 474  ? -12.972 72.205 -12.284 1.00 60.76  ? 471  ILE A CG2 1 
ATOM 3686 C CD1 . ILE A 1 474  ? -11.782 73.752 -9.852  1.00 60.76  ? 471  ILE A CD1 1 
ATOM 3687 N N   . THR A 1 475  ? -16.078 70.814 -12.930 1.00 84.79  ? 472  THR A N   1 
ATOM 3688 C CA  . THR A 1 475  ? -16.451 69.568 -13.567 1.00 84.79  ? 472  THR A CA  1 
ATOM 3689 C C   . THR A 1 475  ? -15.467 69.287 -14.717 1.00 84.79  ? 472  THR A C   1 
ATOM 3690 O O   . THR A 1 475  ? -14.554 70.095 -14.963 1.00 84.79  ? 472  THR A O   1 
ATOM 3691 C CB  . THR A 1 475  ? -17.952 69.572 -13.984 1.00 117.10 ? 472  THR A CB  1 
ATOM 3692 O OG1 . THR A 1 475  ? -18.390 68.231 -14.189 1.00 117.10 ? 472  THR A OG1 1 
ATOM 3693 C CG2 . THR A 1 475  ? -18.205 70.381 -15.243 1.00 117.10 ? 472  THR A CG2 1 
ATOM 3694 N N   . SER A 1 476  ? -15.621 68.135 -15.378 1.00 100.00 ? 473  SER A N   1 
ATOM 3695 C CA  . SER A 1 476  ? -14.847 67.815 -16.573 1.00 100.00 ? 473  SER A CA  1 
ATOM 3696 C C   . SER A 1 476  ? -14.778 69.113 -17.328 1.00 100.00 ? 473  SER A C   1 
ATOM 3697 O O   . SER A 1 476  ? -13.703 69.668 -17.551 1.00 100.00 ? 473  SER A O   1 
ATOM 3698 C CB  . SER A 1 476  ? -15.563 66.765 -17.443 1.00 116.00 ? 473  SER A CB  1 
ATOM 3699 O OG  . SER A 1 476  ? -15.661 65.490 -16.826 1.00 116.00 ? 473  SER A OG  1 
ATOM 3700 N N   . ALA A 1 477  ? -15.969 69.609 -17.649 1.00 129.75 ? 474  ALA A N   1 
ATOM 3701 C CA  . ALA A 1 477  ? -16.178 70.813 -18.423 1.00 129.75 ? 474  ALA A CA  1 
ATOM 3702 C C   . ALA A 1 477  ? -15.870 72.097 -17.658 1.00 129.75 ? 474  ALA A C   1 
ATOM 3703 O O   . ALA A 1 477  ? -14.712 72.425 -17.429 1.00 129.75 ? 474  ALA A O   1 
ATOM 3704 C CB  . ALA A 1 477  ? -17.597 70.833 -18.913 1.00 53.38  ? 474  ALA A CB  1 
ATOM 3705 N N   . SER A 1 478  ? -16.922 72.812 -17.267 1.00 95.65  ? 475  SER A N   1 
ATOM 3706 C CA  . SER A 1 478  ? -16.812 74.190 -16.817 1.00 95.65  ? 475  SER A CA  1 
ATOM 3707 C C   . SER A 1 478  ? -16.609 74.275 -15.326 1.00 95.65  ? 475  SER A C   1 
ATOM 3708 O O   . SER A 1 478  ? -17.223 73.524 -14.575 1.00 95.65  ? 475  SER A O   1 
ATOM 3709 C CB  . SER A 1 478  ? -18.082 74.944 -17.181 1.00 164.90 ? 475  SER A CB  1 
ATOM 3710 O OG  . SER A 1 478  ? -19.170 74.485 -16.400 1.00 164.90 ? 475  SER A OG  1 
ATOM 3711 N N   . VAL A 1 479  ? -15.755 75.204 -14.902 1.00 92.88  ? 476  VAL A N   1 
ATOM 3712 C CA  . VAL A 1 479  ? -15.554 75.473 -13.473 1.00 92.88  ? 476  VAL A CA  1 
ATOM 3713 C C   . VAL A 1 479  ? -16.705 76.341 -12.933 1.00 92.88  ? 476  VAL A C   1 
ATOM 3714 O O   . VAL A 1 479  ? -16.576 77.555 -12.796 1.00 92.88  ? 476  VAL A O   1 
ATOM 3715 C CB  . VAL A 1 479  ? -14.088 75.971 -13.156 1.00 99.77  ? 476  VAL A CB  1 
ATOM 3716 C CG1 . VAL A 1 479  ? -13.368 76.376 -14.409 1.00 99.77  ? 476  VAL A CG1 1 
ATOM 3717 C CG2 . VAL A 1 479  ? -14.034 77.065 -12.092 1.00 99.77  ? 476  VAL A CG2 1 
ATOM 3718 N N   . ARG A 1 480  ? -17.835 75.686 -12.646 1.00 97.77  ? 477  ARG A N   1 
ATOM 3719 C CA  . ARG A 1 480  ? -19.106 76.354 -12.320 1.00 97.77  ? 477  ARG A CA  1 
ATOM 3720 C C   . ARG A 1 480  ? -19.019 77.268 -11.104 1.00 97.77  ? 477  ARG A C   1 
ATOM 3721 O O   . ARG A 1 480  ? -17.997 77.307 -10.428 1.00 97.77  ? 477  ARG A O   1 
ATOM 3722 C CB  . ARG A 1 480  ? -20.215 75.325 -12.116 1.00 174.71 ? 477  ARG A CB  1 
ATOM 3723 C CG  . ARG A 1 480  ? -20.252 74.250 -13.170 1.00 174.71 ? 477  ARG A CG  1 
ATOM 3724 C CD  . ARG A 1 480  ? -21.548 73.497 -13.103 1.00 174.71 ? 477  ARG A CD  1 
ATOM 3725 N NE  . ARG A 1 480  ? -22.610 74.197 -13.818 1.00 174.71 ? 477  ARG A NE  1 
ATOM 3726 C CZ  . ARG A 1 480  ? -23.871 73.782 -13.891 1.00 174.71 ? 477  ARG A CZ  1 
ATOM 3727 N NH1 . ARG A 1 480  ? -24.250 72.667 -13.280 1.00 174.71 ? 477  ARG A NH1 1 
ATOM 3728 N NH2 . ARG A 1 480  ? -24.761 74.489 -14.573 1.00 174.71 ? 477  ARG A NH2 1 
ATOM 3729 N N   . LEU A 1 481  ? -20.088 78.015 -10.844 1.00 128.40 ? 478  LEU A N   1 
ATOM 3730 C CA  . LEU A 1 481  ? -20.181 78.852 -9.638  1.00 128.40 ? 478  LEU A CA  1 
ATOM 3731 C C   . LEU A 1 481  ? -21.627 79.007 -9.151  1.00 128.40 ? 478  LEU A C   1 
ATOM 3732 O O   . LEU A 1 481  ? -22.544 79.255 -9.943  1.00 128.40 ? 478  LEU A O   1 
ATOM 3733 C CB  . LEU A 1 481  ? -19.508 80.223 -9.849  1.00 88.65  ? 478  LEU A CB  1 
ATOM 3734 C CG  . LEU A 1 481  ? -19.398 81.210 -8.675  1.00 88.65  ? 478  LEU A CG  1 
ATOM 3735 C CD1 . LEU A 1 481  ? -18.497 80.716 -7.560  1.00 88.65  ? 478  LEU A CD1 1 
ATOM 3736 C CD2 . LEU A 1 481  ? -18.925 82.552 -9.166  1.00 88.65  ? 478  LEU A CD2 1 
ATOM 3737 N N   . VAL A 1 482  ? -21.811 78.859 -7.841  1.00 148.77 ? 479  VAL A N   1 
ATOM 3738 C CA  . VAL A 1 482  ? -23.136 78.819 -7.227  1.00 148.77 ? 479  VAL A CA  1 
ATOM 3739 C C   . VAL A 1 482  ? -23.156 79.623 -5.931  1.00 148.77 ? 479  VAL A C   1 
ATOM 3740 O O   . VAL A 1 482  ? -22.162 79.672 -5.220  1.00 148.77 ? 479  VAL A O   1 
ATOM 3741 C CB  . VAL A 1 482  ? -23.563 77.369 -6.978  1.00 106.32 ? 479  VAL A CB  1 
ATOM 3742 C CG1 . VAL A 1 482  ? -24.911 77.297 -6.255  1.00 106.32 ? 479  VAL A CG1 1 
ATOM 3743 C CG2 . VAL A 1 482  ? -23.614 76.620 -8.295  1.00 106.32 ? 479  VAL A CG2 1 
ATOM 3744 N N   . SER A 1 483  ? -24.294 80.248 -5.633  1.00 147.80 ? 480  SER A N   1 
ATOM 3745 C CA  . SER A 1 483  ? -24.381 81.229 -4.551  1.00 147.80 ? 480  SER A CA  1 
ATOM 3746 C C   . SER A 1 483  ? -24.916 80.706 -3.231  1.00 147.80 ? 480  SER A C   1 
ATOM 3747 O O   . SER A 1 483  ? -25.452 79.601 -3.150  1.00 147.80 ? 480  SER A O   1 
ATOM 3748 C CB  . SER A 1 483  ? -25.220 82.429 -4.989  1.00 94.23  ? 480  SER A CB  1 
ATOM 3749 O OG  . SER A 1 483  ? -24.392 83.463 -5.492  1.00 94.23  ? 480  SER A OG  1 
ATOM 3750 N N   . GLN A 1 484  ? -24.739 81.520 -2.196  1.00 212.91 ? 481  GLN A N   1 
ATOM 3751 C CA  . GLN A 1 484  ? -25.381 81.298 -0.913  1.00 212.91 ? 481  GLN A CA  1 
ATOM 3752 C C   . GLN A 1 484  ? -26.658 82.142 -0.846  1.00 212.91 ? 481  GLN A C   1 
ATOM 3753 O O   . GLN A 1 484  ? -27.699 81.662 -0.390  1.00 212.91 ? 481  GLN A O   1 
ATOM 3754 C CB  . GLN A 1 484  ? -24.433 81.636 0.246   1.00 116.72 ? 481  GLN A CB  1 
ATOM 3755 C CG  . GLN A 1 484  ? -23.174 80.763 0.344   1.00 116.72 ? 481  GLN A CG  1 
ATOM 3756 C CD  . GLN A 1 484  ? -23.427 79.405 0.952   1.00 116.72 ? 481  GLN A CD  1 
ATOM 3757 O OE1 . GLN A 1 484  ? -24.077 78.556 0.353   1.00 116.72 ? 481  GLN A OE1 1 
ATOM 3758 N NE2 . GLN A 1 484  ? -22.899 79.188 2.146   1.00 116.72 ? 481  GLN A NE2 1 
ATOM 3759 N N   . GLU A 1 485  ? -26.573 83.389 -1.315  1.00 188.11 ? 482  GLU A N   1 
ATOM 3760 C CA  . GLU A 1 485  ? -27.741 84.275 -1.387  1.00 188.11 ? 482  GLU A CA  1 
ATOM 3761 C C   . GLU A 1 485  ? -28.735 83.798 -2.472  1.00 188.11 ? 482  GLU A C   1 
ATOM 3762 O O   . GLU A 1 485  ? -29.804 83.292 -2.128  1.00 188.11 ? 482  GLU A O   1 
ATOM 3763 C CB  . GLU A 1 485  ? -27.330 85.748 -1.578  1.00 192.28 ? 482  GLU A CB  1 
ATOM 3764 C CG  . GLU A 1 485  ? -26.362 86.311 -0.525  1.00 192.28 ? 482  GLU A CG  1 
ATOM 3765 C CD  . GLU A 1 485  ? -27.058 86.857 0.723   1.00 192.28 ? 482  GLU A CD  1 
ATOM 3766 O OE1 . GLU A 1 485  ? -28.241 86.492 0.976   1.00 192.28 ? 482  GLU A OE1 1 
ATOM 3767 O OE2 . GLU A 1 485  ? -26.416 87.661 1.459   1.00 192.28 ? 482  GLU A OE2 1 
ATOM 3768 N N   . PRO A 1 486  ? -28.396 83.962 -3.775  1.00 212.91 ? 483  PRO A N   1 
ATOM 3769 C CA  . PRO A 1 486  ? -29.195 83.355 -4.852  1.00 212.91 ? 483  PRO A CA  1 
ATOM 3770 C C   . PRO A 1 486  ? -29.236 81.818 -4.854  1.00 212.91 ? 483  PRO A C   1 
ATOM 3771 O O   . PRO A 1 486  ? -30.329 81.247 -4.795  1.00 212.91 ? 483  PRO A O   1 
ATOM 3772 C CB  . PRO A 1 486  ? -28.518 83.874 -6.129  1.00 182.47 ? 483  PRO A CB  1 
ATOM 3773 C CG  . PRO A 1 486  ? -27.809 85.105 -5.705  1.00 182.47 ? 483  PRO A CG  1 
ATOM 3774 C CD  . PRO A 1 486  ? -27.308 84.784 -4.335  1.00 182.47 ? 483  PRO A CD  1 
ATOM 3775 N N   . LYS A 1 487  ? -28.071 81.166 -4.928  1.00 137.87 ? 484  LYS A N   1 
ATOM 3776 C CA  . LYS A 1 487  ? -27.986 79.697 -4.993  1.00 137.87 ? 484  LYS A CA  1 
ATOM 3777 C C   . LYS A 1 487  ? -28.453 79.181 -6.362  1.00 137.87 ? 484  LYS A C   1 
ATOM 3778 O O   . LYS A 1 487  ? -29.441 78.458 -6.482  1.00 137.87 ? 484  LYS A O   1 
ATOM 3779 C CB  . LYS A 1 487  ? -28.730 79.053 -3.795  1.00 110.39 ? 484  LYS A CB  1 
ATOM 3780 C CG  . LYS A 1 487  ? -29.384 77.684 -4.016  1.00 110.39 ? 484  LYS A CG  1 
ATOM 3781 C CD  . LYS A 1 487  ? -28.413 76.535 -3.825  1.00 110.39 ? 484  LYS A CD  1 
ATOM 3782 C CE  . LYS A 1 487  ? -28.353 76.096 -2.369  1.00 110.39 ? 484  LYS A CE  1 
ATOM 3783 N NZ  . LYS A 1 487  ? -27.554 74.849 -2.218  1.00 110.39 ? 484  LYS A NZ  1 
ATOM 3784 N N   . ALA A 1 488  ? -27.734 79.590 -7.400  1.00 205.77 ? 485  ALA A N   1 
ATOM 3785 C CA  . ALA A 1 488  ? -28.008 79.145 -8.760  1.00 205.77 ? 485  ALA A CA  1 
ATOM 3786 C C   . ALA A 1 488  ? -26.702 79.153 -9.551  1.00 205.77 ? 485  ALA A C   1 
ATOM 3787 O O   . ALA A 1 488  ? -25.665 78.762 -9.029  1.00 205.77 ? 485  ALA A O   1 
ATOM 3788 C CB  . ALA A 1 488  ? -29.066 80.037 -9.416  1.00 143.52 ? 485  ALA A CB  1 
ATOM 3789 N N   . LEU A 1 489  ? -26.747 79.601 -10.802 1.00 166.51 ? 486  LEU A N   1 
ATOM 3790 C CA  . LEU A 1 489  ? -25.559 79.629 -11.653 1.00 166.51 ? 486  LEU A CA  1 
ATOM 3791 C C   . LEU A 1 489  ? -24.987 81.049 -11.716 1.00 166.51 ? 486  LEU A C   1 
ATOM 3792 O O   . LEU A 1 489  ? -25.116 81.750 -12.726 1.00 166.51 ? 486  LEU A O   1 
ATOM 3793 C CB  . LEU A 1 489  ? -25.892 79.069 -13.049 1.00 117.94 ? 486  LEU A CB  1 
ATOM 3794 C CG  . LEU A 1 489  ? -24.845 78.504 -14.019 1.00 117.94 ? 486  LEU A CG  1 
ATOM 3795 C CD1 . LEU A 1 489  ? -23.791 77.649 -13.327 1.00 117.94 ? 486  LEU A CD1 1 
ATOM 3796 C CD2 . LEU A 1 489  ? -25.561 77.708 -15.110 1.00 117.94 ? 486  LEU A CD2 1 
ATOM 3797 N N   . VAL A 1 490  ? -24.366 81.455 -10.609 1.00 142.74 ? 487  VAL A N   1 
ATOM 3798 C CA  . VAL A 1 490  ? -23.713 82.762 -10.448 1.00 142.74 ? 487  VAL A CA  1 
ATOM 3799 C C   . VAL A 1 490  ? -22.813 83.114 -11.633 1.00 142.74 ? 487  VAL A C   1 
ATOM 3800 O O   . VAL A 1 490  ? -22.822 84.253 -12.109 1.00 142.74 ? 487  VAL A O   1 
ATOM 3801 C CB  . VAL A 1 490  ? -22.864 82.796 -9.143  1.00 79.16  ? 487  VAL A CB  1 
ATOM 3802 C CG1 . VAL A 1 490  ? -22.519 84.195 -8.742  1.00 79.16  ? 487  VAL A CG1 1 
ATOM 3803 C CG2 . VAL A 1 490  ? -23.617 82.173 -8.035  1.00 79.16  ? 487  VAL A CG2 1 
ATOM 3804 N N   . SER A 1 491  ? -22.042 82.129 -12.100 1.00 170.72 ? 488  SER A N   1 
ATOM 3805 C CA  . SER A 1 491  ? -21.119 82.318 -13.218 1.00 170.72 ? 488  SER A CA  1 
ATOM 3806 C C   . SER A 1 491  ? -21.048 81.079 -14.122 1.00 170.72 ? 488  SER A C   1 
ATOM 3807 O O   . SER A 1 491  ? -21.908 80.892 -14.997 1.00 170.72 ? 488  SER A O   1 
ATOM 3808 C CB  . SER A 1 491  ? -19.729 82.725 -12.702 1.00 178.36 ? 488  SER A CB  1 
ATOM 3809 O OG  . SER A 1 491  ? -18.857 83.097 -13.756 1.00 178.36 ? 488  SER A OG  1 
ATOM 3810 N N   . GLU A 1 492  ? -20.035 80.239 -13.882 1.00 122.33 ? 489  GLU A N   1 
ATOM 3811 C CA  . GLU A 1 492  ? -19.676 79.116 -14.752 1.00 122.33 ? 489  GLU A CA  1 
ATOM 3812 C C   . GLU A 1 492  ? -18.685 79.569 -15.813 1.00 122.33 ? 489  GLU A C   1 
ATOM 3813 O O   . GLU A 1 492  ? -19.033 80.325 -16.722 1.00 122.33 ? 489  GLU A O   1 
ATOM 3814 C CB  . GLU A 1 492  ? -20.897 78.432 -15.403 1.00 116.00 ? 489  GLU A CB  1 
ATOM 3815 C CG  . GLU A 1 492  ? -20.507 77.347 -16.426 1.00 116.00 ? 489  GLU A CG  1 
ATOM 3816 C CD  . GLU A 1 492  ? -21.680 76.627 -17.087 1.00 116.00 ? 489  GLU A CD  1 
ATOM 3817 O OE1 . GLU A 1 492  ? -22.796 77.188 -17.141 1.00 116.00 ? 489  GLU A OE1 1 
ATOM 3818 O OE2 . GLU A 1 492  ? -21.475 75.491 -17.578 1.00 116.00 ? 489  GLU A OE2 1 
ATOM 3819 N N   . TRP A 1 493  ? -17.450 79.094 -15.681 1.00 212.91 ? 490  TRP A N   1 
ATOM 3820 C CA  . TRP A 1 493  ? -16.387 79.325 -16.654 1.00 212.91 ? 490  TRP A CA  1 
ATOM 3821 C C   . TRP A 1 493  ? -16.591 78.354 -17.819 1.00 212.91 ? 490  TRP A C   1 
ATOM 3822 O O   . TRP A 1 493  ? -17.645 77.727 -17.936 1.00 212.91 ? 490  TRP A O   1 
ATOM 3823 C CB  . TRP A 1 493  ? -15.028 79.083 -15.977 1.00 112.50 ? 490  TRP A CB  1 
ATOM 3824 C CG  . TRP A 1 493  ? -13.809 79.730 -16.621 1.00 112.50 ? 490  TRP A CG  1 
ATOM 3825 C CD1 . TRP A 1 493  ? -13.507 81.054 -16.638 1.00 112.50 ? 490  TRP A CD1 1 
ATOM 3826 C CD2 . TRP A 1 493  ? -12.716 79.062 -17.284 1.00 112.50 ? 490  TRP A CD2 1 
ATOM 3827 N NE1 . TRP A 1 493  ? -12.315 81.260 -17.287 1.00 112.50 ? 490  TRP A NE1 1 
ATOM 3828 C CE2 . TRP A 1 493  ? -11.808 80.057 -17.695 1.00 112.50 ? 490  TRP A CE2 1 
ATOM 3829 C CE3 . TRP A 1 493  ? -12.425 77.721 -17.582 1.00 112.50 ? 490  TRP A CE3 1 
ATOM 3830 C CZ2 . TRP A 1 493  ? -10.628 79.760 -18.386 1.00 112.50 ? 490  TRP A CZ2 1 
ATOM 3831 C CZ3 . TRP A 1 493  ? -11.245 77.428 -18.269 1.00 112.50 ? 490  TRP A CZ3 1 
ATOM 3832 C CH2 . TRP A 1 493  ? -10.366 78.446 -18.664 1.00 112.50 ? 490  TRP A CH2 1 
ATOM 3833 N N   . LYS A 1 494  ? -15.585 78.259 -18.684 1.00 187.63 ? 491  LYS A N   1 
ATOM 3834 C CA  . LYS A 1 494  ? -15.535 77.304 -19.788 1.00 187.63 ? 491  LYS A CA  1 
ATOM 3835 C C   . LYS A 1 494  ? -14.345 77.704 -20.653 1.00 187.63 ? 491  LYS A C   1 
ATOM 3836 O O   . LYS A 1 494  ? -14.235 78.858 -21.071 1.00 187.63 ? 491  LYS A O   1 
ATOM 3837 C CB  . LYS A 1 494  ? -16.834 77.308 -20.602 1.00 105.58 ? 491  LYS A CB  1 
ATOM 3838 C CG  . LYS A 1 494  ? -17.014 76.119 -21.525 1.00 105.58 ? 491  LYS A CG  1 
ATOM 3839 C CD  . LYS A 1 494  ? -17.892 75.037 -20.916 1.00 105.58 ? 491  LYS A CD  1 
ATOM 3840 C CE  . LYS A 1 494  ? -18.251 73.981 -21.967 1.00 105.58 ? 491  LYS A CE  1 
ATOM 3841 N NZ  . LYS A 1 494  ? -19.083 72.861 -21.437 1.00 105.58 ? 491  LYS A NZ  1 
ATOM 3842 N N   . GLU A 1 495  ? -13.458 76.750 -20.917 1.00 111.61 ? 492  GLU A N   1 
ATOM 3843 C CA  . GLU A 1 495  ? -12.275 77.007 -21.730 1.00 111.61 ? 492  GLU A CA  1 
ATOM 3844 C C   . GLU A 1 495  ? -12.654 77.545 -23.107 1.00 111.61 ? 492  GLU A C   1 
ATOM 3845 O O   . GLU A 1 495  ? -13.521 76.992 -23.784 1.00 111.61 ? 492  GLU A O   1 
ATOM 3846 C CB  . GLU A 1 495  ? -11.435 75.735 -21.870 1.00 139.84 ? 492  GLU A CB  1 
ATOM 3847 C CG  . GLU A 1 495  ? -10.136 75.928 -22.635 1.00 139.84 ? 492  GLU A CG  1 
ATOM 3848 C CD  . GLU A 1 495  ? -10.365 76.278 -24.092 1.00 139.84 ? 492  GLU A CD  1 
ATOM 3849 O OE1 . GLU A 1 495  ? -11.518 76.166 -24.556 1.00 139.84 ? 492  GLU A OE1 1 
ATOM 3850 O OE2 . GLU A 1 495  ? -9.391  76.663 -24.773 1.00 139.84 ? 492  GLU A OE2 1 
ATOM 3851 N N   . PRO A 1 496  ? -11.998 78.627 -23.515 1.00 167.22 ? 493  PRO A N   1 
ATOM 3852 C CA  . PRO A 1 496  ? -12.266 79.249 -24.814 1.00 167.22 ? 493  PRO A CA  1 
ATOM 3853 C C   . PRO A 1 496  ? -11.819 78.368 -25.975 1.00 167.22 ? 493  PRO A C   1 
ATOM 3854 O O   . PRO A 1 496  ? -10.803 78.653 -26.608 1.00 167.22 ? 493  PRO A O   1 
ATOM 3855 C CB  . PRO A 1 496  ? -11.402 80.508 -24.746 1.00 83.07  ? 493  PRO A CB  1 
ATOM 3856 C CG  . PRO A 1 496  ? -11.546 80.898 -23.315 1.00 83.07  ? 493  PRO A CG  1 
ATOM 3857 C CD  . PRO A 1 496  ? -11.280 79.567 -22.638 1.00 83.07  ? 493  PRO A CD  1 
ATOM 3858 N N   . GLN A 1 497  ? -12.578 77.311 -26.246 1.00 83.06  ? 494  GLN A N   1 
ATOM 3859 C CA  . GLN A 1 497  ? -12.271 76.380 -27.327 1.00 83.06  ? 494  GLN A CA  1 
ATOM 3860 C C   . GLN A 1 497  ? -13.080 75.099 -27.171 1.00 83.06  ? 494  GLN A C   1 
ATOM 3861 O O   . GLN A 1 497  ? -13.069 74.232 -28.045 1.00 83.06  ? 494  GLN A O   1 
ATOM 3862 C CB  . GLN A 1 497  ? -10.776 76.055 -27.360 1.00 113.34 ? 494  GLN A CB  1 
ATOM 3863 C CG  . GLN A 1 497  ? -9.920  77.101 -28.056 1.00 113.34 ? 494  GLN A CG  1 
ATOM 3864 C CD  . GLN A 1 497  ? -10.313 77.304 -29.506 1.00 113.34 ? 494  GLN A CD  1 
ATOM 3865 O OE1 . GLN A 1 497  ? -11.233 76.659 -30.008 1.00 113.34 ? 494  GLN A OE1 1 
ATOM 3866 N NE2 . GLN A 1 497  ? -9.614  78.204 -30.188 1.00 113.34 ? 494  GLN A NE2 1 
ATOM 3867 N N   . ALA A 1 498  ? -13.781 74.988 -26.047 1.00 179.10 ? 495  ALA A N   1 
ATOM 3868 C CA  . ALA A 1 498  ? -14.608 73.805 -25.755 1.00 179.10 ? 495  ALA A CA  1 
ATOM 3869 C C   . ALA A 1 498  ? -13.763 72.625 -25.260 1.00 179.10 ? 495  ALA A C   1 
ATOM 3870 O O   . ALA A 1 498  ? -14.078 71.462 -25.524 1.00 179.10 ? 495  ALA A O   1 
ATOM 3871 C CB  . ALA A 1 498  ? -15.442 73.405 -26.990 1.00 73.11  ? 495  ALA A CB  1 
ATOM 3872 N N   . LYS A 1 499  ? -12.693 72.944 -24.536 1.00 103.65 ? 496  LYS A N   1 
ATOM 3873 C CA  . LYS A 1 499  ? -11.715 71.960 -24.098 1.00 103.65 ? 496  LYS A CA  1 
ATOM 3874 C C   . LYS A 1 499  ? -11.872 71.564 -22.636 1.00 103.65 ? 496  LYS A C   1 
ATOM 3875 O O   . LYS A 1 499  ? -12.159 72.407 -21.778 1.00 103.65 ? 496  LYS A O   1 
ATOM 3876 C CB  . LYS A 1 499  ? -10.294 72.476 -24.327 1.00 83.19  ? 496  LYS A CB  1 
ATOM 3877 C CG  . LYS A 1 499  ? -9.640  71.955 -25.597 1.00 83.19  ? 496  LYS A CG  1 
ATOM 3878 C CD  . LYS A 1 499  ? -8.144  72.249 -25.630 1.00 83.19  ? 496  LYS A CD  1 
ATOM 3879 C CE  . LYS A 1 499  ? -7.865  73.719 -25.822 1.00 83.19  ? 496  LYS A CE  1 
ATOM 3880 N NZ  . LYS A 1 499  ? -6.407  73.992 -25.758 1.00 83.19  ? 496  LYS A NZ  1 
ATOM 3881 N N   . ASN A 1 500  ? -11.637 70.278 -22.367 1.00 100.15 ? 497  ASN A N   1 
ATOM 3882 C CA  . ASN A 1 500  ? -11.793 69.688 -21.030 1.00 100.15 ? 497  ASN A CA  1 
ATOM 3883 C C   . ASN A 1 500  ? -10.691 69.980 -20.018 1.00 100.15 ? 497  ASN A C   1 
ATOM 3884 O O   . ASN A 1 500  ? -9.501  69.951 -20.334 1.00 100.15 ? 497  ASN A O   1 
ATOM 3885 C CB  . ASN A 1 500  ? -11.985 68.169 -21.137 1.00 106.44 ? 497  ASN A CB  1 
ATOM 3886 C CG  . ASN A 1 500  ? -13.448 67.758 -21.132 1.00 106.44 ? 497  ASN A CG  1 
ATOM 3887 O OD1 . ASN A 1 500  ? -14.296 68.448 -20.560 1.00 106.44 ? 497  ASN A OD1 1 
ATOM 3888 N ND2 . ASN A 1 500  ? -13.749 66.626 -21.760 1.00 106.44 ? 497  ASN A ND2 1 
ATOM 3889 N N   . ILE A 1 501  ? -11.116 70.250 -18.789 1.00 169.90 ? 498  ILE A N   1 
ATOM 3890 C CA  . ILE A 1 501  ? -10.201 70.368 -17.672 1.00 169.90 ? 498  ILE A CA  1 
ATOM 3891 C C   . ILE A 1 501  ? -9.678  68.977 -17.328 1.00 169.90 ? 498  ILE A C   1 
ATOM 3892 O O   . ILE A 1 501  ? -10.449 68.029 -17.176 1.00 169.90 ? 498  ILE A O   1 
ATOM 3893 C CB  . ILE A 1 501  ? -10.870 71.023 -16.448 1.00 126.12 ? 498  ILE A CB  1 
ATOM 3894 C CG1 . ILE A 1 501  ? -11.551 72.325 -16.870 1.00 126.12 ? 498  ILE A CG1 1 
ATOM 3895 C CG2 . ILE A 1 501  ? -9.836  71.278 -15.346 1.00 126.12 ? 498  ILE A CG2 1 
ATOM 3896 C CD1 . ILE A 1 501  ? -12.226 73.066 -15.754 1.00 126.12 ? 498  ILE A CD1 1 
ATOM 3897 N N   . SER A 1 502  ? -8.358  68.873 -17.236 1.00 77.61  ? 499  SER A N   1 
ATOM 3898 C CA  . SER A 1 502  ? -7.673  67.621 -16.956 1.00 77.61  ? 499  SER A CA  1 
ATOM 3899 C C   . SER A 1 502  ? -7.315  67.518 -15.481 1.00 77.61  ? 499  SER A C   1 
ATOM 3900 O O   . SER A 1 502  ? -7.470  66.457 -14.886 1.00 77.61  ? 499  SER A O   1 
ATOM 3901 C CB  . SER A 1 502  ? -6.409  67.471 -17.828 1.00 71.86  ? 499  SER A CB  1 
ATOM 3902 O OG  . SER A 1 502  ? -5.355  68.347 -17.427 1.00 71.86  ? 499  SER A OG  1 
ATOM 3903 N N   . VAL A 1 503  ? -6.853  68.622 -14.897 1.00 85.71  ? 500  VAL A N   1 
ATOM 3904 C CA  . VAL A 1 503  ? -6.385  68.624 -13.521 1.00 85.71  ? 500  VAL A CA  1 
ATOM 3905 C C   . VAL A 1 503  ? -6.923  69.824 -12.759 1.00 85.71  ? 500  VAL A C   1 
ATOM 3906 O O   . VAL A 1 503  ? -6.653  70.960 -13.122 1.00 85.71  ? 500  VAL A O   1 
ATOM 3907 C CB  . VAL A 1 503  ? -4.834  68.619 -13.461 1.00 60.26  ? 500  VAL A CB  1 
ATOM 3908 C CG1 . VAL A 1 503  ? -4.315  68.862 -12.030 1.00 60.26  ? 500  VAL A CG1 1 
ATOM 3909 C CG2 . VAL A 1 503  ? -4.283  67.316 -14.019 1.00 60.26  ? 500  VAL A CG2 1 
ATOM 3910 N N   . ALA A 1 504  ? -7.652  69.559 -11.682 1.00 131.82 ? 501  ALA A N   1 
ATOM 3911 C CA  . ALA A 1 504  ? -8.215  70.609 -10.836 1.00 131.82 ? 501  ALA A CA  1 
ATOM 3912 C C   . ALA A 1 504  ? -7.182  71.325 -9.943  1.00 131.82 ? 501  ALA A C   1 
ATOM 3913 O O   . ALA A 1 504  ? -5.970  71.229 -10.171 1.00 131.82 ? 501  ALA A O   1 
ATOM 3914 C CB  . ALA A 1 504  ? -9.347  70.038 -9.993  1.00 103.08 ? 501  ALA A CB  1 
ATOM 3915 N N   . SER A 1 505  ? -7.705  72.054 -8.950  1.00 169.20 ? 502  SER A N   1 
ATOM 3916 C CA  . SER A 1 505  ? -6.962  72.787 -7.905  1.00 169.20 ? 502  SER A CA  1 
ATOM 3917 C C   . SER A 1 505  ? -7.794  73.950 -7.364  1.00 169.20 ? 502  SER A C   1 
ATOM 3918 O O   . SER A 1 505  ? -8.590  74.537 -8.101  1.00 169.20 ? 502  SER A O   1 
ATOM 3919 C CB  . SER A 1 505  ? -5.608  73.311 -8.389  1.00 65.26  ? 502  SER A CB  1 
ATOM 3920 O OG  . SER A 1 505  ? -4.555  72.608 -7.758  1.00 65.26  ? 502  SER A OG  1 
ATOM 3921 N N   . CYS A 1 506  ? -7.597  74.273 -6.082  1.00 155.44 ? 503  CYS A N   1 
ATOM 3922 C CA  . CYS A 1 506  ? -8.303  75.364 -5.391  1.00 155.44 ? 503  CYS A CA  1 
ATOM 3923 C C   . CYS A 1 506  ? -8.163  75.284 -3.871  1.00 155.44 ? 503  CYS A C   1 
ATOM 3924 O O   . CYS A 1 506  ? -7.842  74.231 -3.315  1.00 155.44 ? 503  CYS A O   1 
ATOM 3925 C CB  . CYS A 1 506  ? -9.785  75.380 -5.769  1.00 137.79 ? 503  CYS A CB  1 
ATOM 3926 S SG  . CYS A 1 506  ? -10.818 76.318 -4.663  1.00 137.79 ? 503  CYS A SG  1 
ATOM 3927 N N   . ASN A 1 507  ? -8.414  76.407 -3.205  1.00 212.91 ? 504  ASN A N   1 
ATOM 3928 C CA  . ASN A 1 507  ? -8.463  76.447 -1.747  1.00 212.91 ? 504  ASN A CA  1 
ATOM 3929 C C   . ASN A 1 507  ? -9.825  76.941 -1.237  1.00 212.91 ? 504  ASN A C   1 
ATOM 3930 O O   . ASN A 1 507  ? -10.690 76.129 -0.903  1.00 212.91 ? 504  ASN A O   1 
ATOM 3931 C CB  . ASN A 1 507  ? -7.286  77.248 -1.163  1.00 88.33  ? 504  ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 507  ? -6.768  78.319 -2.110  1.00 88.33  ? 504  ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 507  ? -6.915  79.508 -1.859  1.00 88.33  ? 504  ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 507  ? -6.147  77.893 -3.194  1.00 88.33  ? 504  ASN A ND2 1 
ATOM 3935 N N   . SER A 1 508  ? -10.011 78.262 -1.190  1.00 173.27 ? 505  SER A N   1 
ATOM 3936 C CA  . SER A 1 508  ? -11.289 78.886 -0.819  1.00 173.27 ? 505  SER A CA  1 
ATOM 3937 C C   . SER A 1 508  ? -11.373 80.277 -1.434  1.00 173.27 ? 505  SER A C   1 
ATOM 3938 O O   . SER A 1 508  ? -12.347 81.002 -1.239  1.00 173.27 ? 505  SER A O   1 
ATOM 3939 C CB  . SER A 1 508  ? -11.455 78.973 0.708   1.00 118.37 ? 505  SER A CB  1 
ATOM 3940 O OG  . SER A 1 508  ? -12.094 77.820 1.258   1.00 118.37 ? 505  SER A OG  1 
ATOM 3941 N N   . SER A 1 509  ? -10.333 80.638 -2.179  1.00 148.96 ? 506  SER A N   1 
ATOM 3942 C CA  . SER A 1 509  ? -10.220 81.959 -2.785  1.00 148.96 ? 506  SER A CA  1 
ATOM 3943 C C   . SER A 1 509  ? -9.491  81.868 -4.121  1.00 148.96 ? 506  SER A C   1 
ATOM 3944 O O   . SER A 1 509  ? -9.866  82.522 -5.094  1.00 148.96 ? 506  SER A O   1 
ATOM 3945 C CB  . SER A 1 509  ? -9.473  82.905 -1.842  1.00 121.77 ? 506  SER A CB  1 
ATOM 3946 O OG  . SER A 1 509  ? -9.946  82.793 -0.504  1.00 121.77 ? 506  SER A OG  1 
ATOM 3947 N N   . GLN A 1 510  ? -8.450  81.043 -4.150  1.00 212.91 ? 507  GLN A N   1 
ATOM 3948 C CA  . GLN A 1 510  ? -7.646  80.820 -5.343  1.00 212.91 ? 507  GLN A CA  1 
ATOM 3949 C C   . GLN A 1 510  ? -8.233  79.676 -6.173  1.00 212.91 ? 507  GLN A C   1 
ATOM 3950 O O   . GLN A 1 510  ? -8.764  78.710 -5.621  1.00 212.91 ? 507  GLN A O   1 
ATOM 3951 C CB  . GLN A 1 510  ? -6.220  80.457 -4.928  1.00 97.37  ? 507  GLN A CB  1 
ATOM 3952 C CG  . GLN A 1 510  ? -5.126  80.978 -5.831  1.00 97.37  ? 507  GLN A CG  1 
ATOM 3953 C CD  . GLN A 1 510  ? -4.397  82.134 -5.208  1.00 97.37  ? 507  GLN A CD  1 
ATOM 3954 O OE1 . GLN A 1 510  ? -3.169  82.174 -5.210  1.00 97.37  ? 507  GLN A OE1 1 
ATOM 3955 N NE2 . GLN A 1 510  ? -5.148  83.075 -4.644  1.00 97.37  ? 507  GLN A NE2 1 
ATOM 3956 N N   . VAL A 1 511  ? -8.140  79.798 -7.497  1.00 212.91 ? 508  VAL A N   1 
ATOM 3957 C CA  . VAL A 1 511  ? -8.535  78.731 -8.426  1.00 212.91 ? 508  VAL A CA  1 
ATOM 3958 C C   . VAL A 1 511  ? -7.481  78.579 -9.522  1.00 212.91 ? 508  VAL A C   1 
ATOM 3959 O O   . VAL A 1 511  ? -7.129  79.547 -10.195 1.00 212.91 ? 508  VAL A O   1 
ATOM 3960 C CB  . VAL A 1 511  ? -9.932  78.986 -9.077  1.00 131.83 ? 508  VAL A CB  1 
ATOM 3961 C CG1 . VAL A 1 511  ? -10.321 77.851 -10.033 1.00 131.83 ? 508  VAL A CG1 1 
ATOM 3962 C CG2 . VAL A 1 511  ? -11.009 79.161 -8.017  1.00 131.83 ? 508  VAL A CG2 1 
ATOM 3963 N N   . VAL A 1 512  ? -6.970  77.359 -9.672  1.00 118.95 ? 509  VAL A N   1 
ATOM 3964 C CA  . VAL A 1 512  ? -6.082  76.983 -10.779 1.00 118.95 ? 509  VAL A CA  1 
ATOM 3965 C C   . VAL A 1 512  ? -6.564  75.662 -11.416 1.00 118.95 ? 509  VAL A C   1 
ATOM 3966 O O   . VAL A 1 512  ? -6.724  74.650 -10.737 1.00 118.95 ? 509  VAL A O   1 
ATOM 3967 C CB  . VAL A 1 512  ? -4.566  76.862 -10.340 1.00 57.08  ? 509  VAL A CB  1 
ATOM 3968 C CG1 . VAL A 1 512  ? -3.684  76.339 -11.496 1.00 57.08  ? 509  VAL A CG1 1 
ATOM 3969 C CG2 . VAL A 1 512  ? -4.008  78.207 -9.768  1.00 57.08  ? 509  VAL A CG2 1 
ATOM 3970 N N   . VAL A 1 513  ? -6.809  75.688 -12.721 1.00 90.49  ? 510  VAL A N   1 
ATOM 3971 C CA  . VAL A 1 513  ? -7.103  74.470 -13.483 1.00 90.49  ? 510  VAL A CA  1 
ATOM 3972 C C   . VAL A 1 513  ? -5.912  74.115 -14.409 1.00 90.49  ? 510  VAL A C   1 
ATOM 3973 O O   . VAL A 1 513  ? -4.912  74.848 -14.441 1.00 90.49  ? 510  VAL A O   1 
ATOM 3974 C CB  . VAL A 1 513  ? -8.436  74.614 -14.272 1.00 138.62 ? 510  VAL A CB  1 
ATOM 3975 C CG1 . VAL A 1 513  ? -9.623  74.539 -13.327 1.00 138.62 ? 510  VAL A CG1 1 
ATOM 3976 C CG2 . VAL A 1 513  ? -8.470  75.920 -15.050 1.00 138.62 ? 510  VAL A CG2 1 
ATOM 3977 N N   . ALA A 1 514  ? -5.988  72.986 -15.115 1.00 63.06  ? 511  ALA A N   1 
ATOM 3978 C CA  . ALA A 1 514  ? -5.070  72.718 -16.233 1.00 63.06  ? 511  ALA A CA  1 
ATOM 3979 C C   . ALA A 1 514  ? -5.812  71.922 -17.270 1.00 63.06  ? 511  ALA A C   1 
ATOM 3980 O O   . ALA A 1 514  ? -6.814  71.287 -16.937 1.00 63.06  ? 511  ALA A O   1 
ATOM 3981 C CB  . ALA A 1 514  ? -3.811  71.984 -15.789 1.00 70.09  ? 511  ALA A CB  1 
ATOM 3982 N N   . VAL A 1 515  ? -5.342  71.977 -18.520 1.00 87.41  ? 512  VAL A N   1 
ATOM 3983 C CA  . VAL A 1 515  ? -6.024  71.329 -19.652 1.00 87.41  ? 512  VAL A CA  1 
ATOM 3984 C C   . VAL A 1 515  ? -5.098  70.338 -20.380 1.00 87.41  ? 512  VAL A C   1 
ATOM 3985 O O   . VAL A 1 515  ? -5.452  69.758 -21.401 1.00 87.41  ? 512  VAL A O   1 
ATOM 3986 C CB  . VAL A 1 515  ? -6.592  72.394 -20.617 1.00 103.66 ? 512  VAL A CB  1 
ATOM 3987 C CG1 . VAL A 1 515  ? -7.298  71.757 -21.808 1.00 103.66 ? 512  VAL A CG1 1 
ATOM 3988 C CG2 . VAL A 1 515  ? -7.557  73.314 -19.872 1.00 103.66 ? 512  VAL A CG2 1 
ATOM 3989 N N   . GLY A 1 516  ? -3.931  70.100 -19.790 1.00 73.86  ? 513  GLY A N   1 
ATOM 3990 C CA  . GLY A 1 516  ? -2.825  69.432 -20.447 1.00 73.86  ? 513  GLY A CA  1 
ATOM 3991 C C   . GLY A 1 516  ? -1.358  69.766 -20.313 1.00 73.86  ? 513  GLY A C   1 
ATOM 3992 O O   . GLY A 1 516  ? -0.583  68.953 -19.815 1.00 73.86  ? 513  GLY A O   1 
ATOM 3993 N N   . ARG A 1 517  ? -0.969  70.941 -20.793 1.00 95.89  ? 514  ARG A N   1 
ATOM 3994 C CA  . ARG A 1 517  ? 0.404   71.447 -20.670 1.00 95.89  ? 514  ARG A CA  1 
ATOM 3995 C C   . ARG A 1 517  ? -0.029  72.853 -20.308 1.00 95.89  ? 514  ARG A C   1 
ATOM 3996 O O   . ARG A 1 517  ? 0.758   73.646 -19.810 1.00 95.89  ? 514  ARG A O   1 
ATOM 3997 C CB  . ARG A 1 517  ? 0.801   71.413 -22.145 1.00 87.33  ? 514  ARG A CB  1 
ATOM 3998 C CG  . ARG A 1 517  ? 1.116   70.037 -22.728 1.00 87.33  ? 514  ARG A CG  1 
ATOM 3999 C CD  . ARG A 1 517  ? 2.106   70.165 -23.893 1.00 87.33  ? 514  ARG A CD  1 
ATOM 4000 N NE  . ARG A 1 517  ? 2.015   71.466 -24.574 1.00 87.33  ? 514  ARG A NE  1 
ATOM 4001 C CZ  . ARG A 1 517  ? 1.204   71.735 -25.594 1.00 87.33  ? 514  ARG A CZ  1 
ATOM 4002 N NH1 . ARG A 1 517  ? 0.398   70.800 -26.076 1.00 87.33  ? 514  ARG A NH1 1 
ATOM 4003 N NH2 . ARG A 1 517  ? 1.195   72.946 -26.131 1.00 87.33  ? 514  ARG A NH2 1 
ATOM 4004 N N   . ALA A 1 518  ? -1.294  73.138 -20.586 1.00 83.44  ? 515  ALA A N   1 
ATOM 4005 C CA  . ALA A 1 518  ? -1.882  74.451 -20.397 1.00 83.44  ? 515  ALA A CA  1 
ATOM 4006 C C   . ALA A 1 518  ? -2.051  74.758 -18.923 1.00 83.44  ? 515  ALA A C   1 
ATOM 4007 O O   . ALA A 1 518  ? -2.240  73.861 -18.095 1.00 83.44  ? 515  ALA A O   1 
ATOM 4008 C CB  . ALA A 1 518  ? -3.232  74.535 -21.099 1.00 132.05 ? 515  ALA A CB  1 
ATOM 4009 N N   . LEU A 1 519  ? -1.980  76.038 -18.600 1.00 145.20 ? 516  LEU A N   1 
ATOM 4010 C CA  . LEU A 1 519  ? -2.265  76.471 -17.256 1.00 145.20 ? 516  LEU A CA  1 
ATOM 4011 C C   . LEU A 1 519  ? -3.097  77.741 -17.314 1.00 145.20 ? 516  LEU A C   1 
ATOM 4012 O O   . LEU A 1 519  ? -2.943  78.556 -18.226 1.00 145.20 ? 516  LEU A O   1 
ATOM 4013 C CB  . LEU A 1 519  ? -0.966  76.644 -16.456 1.00 84.75  ? 516  LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 519  ? -0.257  75.344 -16.029 1.00 84.75  ? 516  LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 519  ? 1.186   75.581 -15.632 1.00 84.75  ? 516  LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 519  ? -1.009  74.656 -14.893 1.00 84.75  ? 516  LEU A CD2 1 
ATOM 4017 N N   . TYR A 1 520  ? -4.019  77.871 -16.367 1.00 99.45  ? 517  TYR A N   1 
ATOM 4018 C CA  . TYR A 1 520  ? -4.812  79.084 -16.229 1.00 99.45  ? 517  TYR A CA  1 
ATOM 4019 C C   . TYR A 1 520  ? -4.666  79.705 -14.823 1.00 99.45  ? 517  TYR A C   1 
ATOM 4020 O O   . TYR A 1 520  ? -3.553  79.762 -14.263 1.00 99.45  ? 517  TYR A O   1 
ATOM 4021 C CB  . TYR A 1 520  ? -6.278  78.801 -16.567 1.00 133.51 ? 517  TYR A CB  1 
ATOM 4022 C CG  . TYR A 1 520  ? -6.541  78.574 -18.038 1.00 133.51 ? 517  TYR A CG  1 
ATOM 4023 C CD1 . TYR A 1 520  ? -6.397  77.310 -18.607 1.00 133.51 ? 517  TYR A CD1 1 
ATOM 4024 C CD2 . TYR A 1 520  ? -6.944  79.623 -18.858 1.00 133.51 ? 517  TYR A CD2 1 
ATOM 4025 C CE1 . TYR A 1 520  ? -6.647  77.098 -19.959 1.00 133.51 ? 517  TYR A CE1 1 
ATOM 4026 C CE2 . TYR A 1 520  ? -7.196  79.425 -20.213 1.00 133.51 ? 517  TYR A CE2 1 
ATOM 4027 C CZ  . TYR A 1 520  ? -7.046  78.161 -20.757 1.00 133.51 ? 517  TYR A CZ  1 
ATOM 4028 O OH  . TYR A 1 520  ? -7.296  77.966 -22.097 1.00 133.51 ? 517  TYR A OH  1 
ATOM 4029 N N   . TYR A 1 521  ? -5.791  80.158 -14.268 1.00 212.91 ? 518  TYR A N   1 
ATOM 4030 C CA  . TYR A 1 521  ? -5.853  80.842 -12.976 1.00 212.91 ? 518  TYR A CA  1 
ATOM 4031 C C   . TYR A 1 521  ? -7.098  81.722 -12.999 1.00 212.91 ? 518  TYR A C   1 
ATOM 4032 O O   . TYR A 1 521  ? -7.178  82.668 -13.783 1.00 212.91 ? 518  TYR A O   1 
ATOM 4033 C CB  . TYR A 1 521  ? -4.584  81.684 -12.735 1.00 106.85 ? 518  TYR A CB  1 
ATOM 4034 C CG  . TYR A 1 521  ? -4.558  82.567 -11.500 1.00 106.85 ? 518  TYR A CG  1 
ATOM 4035 C CD1 . TYR A 1 521  ? -3.351  83.032 -10.997 1.00 106.85 ? 518  TYR A CD1 1 
ATOM 4036 C CD2 . TYR A 1 521  ? -5.731  82.948 -10.843 1.00 106.85 ? 518  TYR A CD2 1 
ATOM 4037 C CE1 . TYR A 1 521  ? -3.313  83.860 -9.871  1.00 106.85 ? 518  TYR A CE1 1 
ATOM 4038 C CE2 . TYR A 1 521  ? -5.704  83.771 -9.716  1.00 106.85 ? 518  TYR A CE2 1 
ATOM 4039 C CZ  . TYR A 1 521  ? -4.492  84.225 -9.233  1.00 106.85 ? 518  TYR A CZ  1 
ATOM 4040 O OH  . TYR A 1 521  ? -4.456  85.045 -8.120  1.00 106.85 ? 518  TYR A OH  1 
ATOM 4041 N N   . LEU A 1 522  ? -8.070  81.395 -12.149 1.00 210.40 ? 519  LEU A N   1 
ATOM 4042 C CA  . LEU A 1 522  ? -9.305  82.178 -12.026 1.00 210.40 ? 519  LEU A CA  1 
ATOM 4043 C C   . LEU A 1 522  ? -9.450  82.756 -10.613 1.00 210.40 ? 519  LEU A C   1 
ATOM 4044 O O   . LEU A 1 522  ? -8.682  82.409 -9.717  1.00 210.40 ? 519  LEU A O   1 
ATOM 4045 C CB  . LEU A 1 522  ? -10.536 81.324 -12.370 1.00 139.02 ? 519  LEU A CB  1 
ATOM 4046 C CG  . LEU A 1 522  ? -10.520 80.247 -13.465 1.00 139.02 ? 519  LEU A CG  1 
ATOM 4047 C CD1 . LEU A 1 522  ? -11.887 79.593 -13.534 1.00 139.02 ? 519  LEU A CD1 1 
ATOM 4048 C CD2 . LEU A 1 522  ? -10.120 80.788 -14.829 1.00 139.02 ? 519  LEU A CD2 1 
ATOM 4049 N N   . GLN A 1 523  ? -10.425 83.645 -10.421 1.00 173.82 ? 520  GLN A N   1 
ATOM 4050 C CA  . GLN A 1 523  ? -10.747 84.165 -9.088  1.00 173.82 ? 520  GLN A CA  1 
ATOM 4051 C C   . GLN A 1 523  ? -12.253 84.310 -8.913  1.00 173.82 ? 520  GLN A C   1 
ATOM 4052 O O   . GLN A 1 523  ? -12.938 84.833 -9.796  1.00 173.82 ? 520  GLN A O   1 
ATOM 4053 C CB  . GLN A 1 523  ? -10.101 85.526 -8.845  1.00 127.27 ? 520  GLN A CB  1 
ATOM 4054 C CG  . GLN A 1 523  ? -8.721  85.699 -9.387  1.00 127.27 ? 520  GLN A CG  1 
ATOM 4055 C CD  . GLN A 1 523  ? -8.609  86.974 -10.180 1.00 127.27 ? 520  GLN A CD  1 
ATOM 4056 O OE1 . GLN A 1 523  ? -8.979  87.028 -11.356 1.00 127.27 ? 520  GLN A OE1 1 
ATOM 4057 N NE2 . GLN A 1 523  ? -8.103  88.019 -9.539  1.00 127.27 ? 520  GLN A NE2 1 
ATOM 4058 N N   . ILE A 1 524  ? -12.754 83.870 -7.759  1.00 178.77 ? 521  ILE A N   1 
ATOM 4059 C CA  . ILE A 1 524  ? -14.179 83.967 -7.434  1.00 178.77 ? 521  ILE A CA  1 
ATOM 4060 C C   . ILE A 1 524  ? -14.511 85.340 -6.830  1.00 178.77 ? 521  ILE A C   1 
ATOM 4061 O O   . ILE A 1 524  ? -15.086 85.433 -5.739  1.00 178.77 ? 521  ILE A O   1 
ATOM 4062 C CB  . ILE A 1 524  ? -14.638 82.840 -6.460  1.00 121.65 ? 521  ILE A CB  1 
ATOM 4063 C CG1 . ILE A 1 524  ? -13.870 81.527 -6.691  1.00 121.65 ? 521  ILE A CG1 1 
ATOM 4064 C CG2 . ILE A 1 524  ? -16.138 82.641 -6.558  1.00 121.65 ? 521  ILE A CG2 1 
ATOM 4065 C CD1 . ILE A 1 524  ? -14.589 80.482 -7.550  1.00 121.65 ? 521  ILE A CD1 1 
ATOM 4066 N N   . HIS A 1 525  ? -14.147 86.405 -7.539  1.00 188.82 ? 522  HIS A N   1 
ATOM 4067 C CA  . HIS A 1 525  ? -14.397 87.748 -7.037  1.00 188.82 ? 522  HIS A CA  1 
ATOM 4068 C C   . HIS A 1 525  ? -15.875 88.070 -7.073  1.00 188.82 ? 522  HIS A C   1 
ATOM 4069 O O   . HIS A 1 525  ? -16.567 87.674 -8.010  1.00 188.82 ? 522  HIS A O   1 
ATOM 4070 C CB  . HIS A 1 525  ? -13.517 88.781 -7.727  1.00 114.54 ? 522  HIS A CB  1 
ATOM 4071 C CG  . HIS A 1 525  ? -12.096 88.713 -7.270  1.00 114.54 ? 522  HIS A CG  1 
ATOM 4072 N ND1 . HIS A 1 525  ? -11.732 88.901 -5.951  1.00 114.54 ? 522  HIS A ND1 1 
ATOM 4073 C CD2 . HIS A 1 525  ? -10.954 88.418 -7.937  1.00 114.54 ? 522  HIS A CD2 1 
ATOM 4074 C CE1 . HIS A 1 525  ? -10.425 88.747 -5.828  1.00 114.54 ? 522  HIS A CE1 1 
ATOM 4075 N NE2 . HIS A 1 525  ? -9.928  88.452 -7.019  1.00 114.54 ? 522  HIS A NE2 1 
ATOM 4076 N N   . PRO A 1 526  ? -16.361 88.791 -6.043  1.00 175.60 ? 523  PRO A N   1 
ATOM 4077 C CA  . PRO A 1 526  ? -17.761 88.646 -5.616  1.00 175.60 ? 523  PRO A CA  1 
ATOM 4078 C C   . PRO A 1 526  ? -18.763 88.379 -6.752  1.00 175.60 ? 523  PRO A C   1 
ATOM 4079 O O   . PRO A 1 526  ? -19.113 89.284 -7.518  1.00 175.60 ? 523  PRO A O   1 
ATOM 4080 C CB  . PRO A 1 526  ? -18.044 89.959 -4.875  1.00 71.55  ? 523  PRO A CB  1 
ATOM 4081 C CG  . PRO A 1 526  ? -16.673 90.299 -4.223  1.00 71.55  ? 523  PRO A CG  1 
ATOM 4082 C CD  . PRO A 1 526  ? -15.638 89.823 -5.261  1.00 71.55  ? 523  PRO A CD  1 
ATOM 4083 N N   . GLN A 1 527  ? -19.164 87.109 -6.856  1.00 113.74 ? 524  GLN A N   1 
ATOM 4084 C CA  . GLN A 1 527  ? -20.273 86.638 -7.706  1.00 113.74 ? 524  GLN A CA  1 
ATOM 4085 C C   . GLN A 1 527  ? -19.919 86.345 -9.169  1.00 113.74 ? 524  GLN A C   1 
ATOM 4086 O O   . GLN A 1 527  ? -20.792 86.414 -10.042 1.00 113.74 ? 524  GLN A O   1 
ATOM 4087 C CB  . GLN A 1 527  ? -21.519 87.538 -7.589  1.00 120.94 ? 524  GLN A CB  1 
ATOM 4088 C CG  . GLN A 1 527  ? -22.108 87.610 -6.170  1.00 120.94 ? 524  GLN A CG  1 
ATOM 4089 C CD  . GLN A 1 527  ? -23.576 88.007 -6.149  1.00 120.94 ? 524  GLN A CD  1 
ATOM 4090 O OE1 . GLN A 1 527  ? -24.436 87.257 -6.610  1.00 120.94 ? 524  GLN A OE1 1 
ATOM 4091 N NE2 . GLN A 1 527  ? -23.869 89.182 -5.600  1.00 120.94 ? 524  GLN A NE2 1 
ATOM 4092 N N   . GLU A 1 528  ? -18.651 86.003 -9.418  1.00 99.20  ? 525  GLU A N   1 
ATOM 4093 C CA  . GLU A 1 528  ? -18.130 85.713 -10.774 1.00 99.20  ? 525  GLU A CA  1 
ATOM 4094 C C   . GLU A 1 528  ? -16.656 85.265 -10.794 1.00 99.20  ? 525  GLU A C   1 
ATOM 4095 O O   . GLU A 1 528  ? -15.866 85.646 -9.920  1.00 99.20  ? 525  GLU A O   1 
ATOM 4096 C CB  . GLU A 1 528  ? -18.312 86.925 -11.713 1.00 177.23 ? 525  GLU A CB  1 
ATOM 4097 C CG  . GLU A 1 528  ? -17.845 88.281 -11.152 1.00 177.23 ? 525  GLU A CG  1 
ATOM 4098 C CD  . GLU A 1 528  ? -16.364 88.543 -11.356 1.00 177.23 ? 525  GLU A CD  1 
ATOM 4099 O OE1 . GLU A 1 528  ? -15.627 88.610 -10.349 1.00 177.23 ? 525  GLU A OE1 1 
ATOM 4100 O OE2 . GLU A 1 528  ? -15.938 88.684 -12.521 1.00 177.23 ? 525  GLU A OE2 1 
ATOM 4101 N N   . LEU A 1 529  ? -16.298 84.493 -11.820 1.00 98.11  ? 526  LEU A N   1 
ATOM 4102 C CA  . LEU A 1 529  ? -14.924 84.031 -12.041 1.00 98.11  ? 526  LEU A CA  1 
ATOM 4103 C C   . LEU A 1 529  ? -14.116 84.890 -13.015 1.00 98.11  ? 526  LEU A C   1 
ATOM 4104 O O   . LEU A 1 529  ? -14.329 84.805 -14.221 1.00 98.11  ? 526  LEU A O   1 
ATOM 4105 C CB  . LEU A 1 529  ? -14.957 82.623 -12.612 1.00 90.40  ? 526  LEU A CB  1 
ATOM 4106 C CG  . LEU A 1 529  ? -15.833 81.607 -11.892 1.00 90.40  ? 526  LEU A CG  1 
ATOM 4107 C CD1 . LEU A 1 529  ? -16.628 80.788 -12.916 1.00 90.40  ? 526  LEU A CD1 1 
ATOM 4108 C CD2 . LEU A 1 529  ? -14.977 80.727 -10.987 1.00 90.40  ? 526  LEU A CD2 1 
ATOM 4109 N N   . ARG A 1 530  ? -13.171 85.687 -12.514 1.00 162.41 ? 527  ARG A N   1 
ATOM 4110 C CA  . ARG A 1 530  ? -12.291 86.453 -13.410 1.00 162.41 ? 527  ARG A CA  1 
ATOM 4111 C C   . ARG A 1 530  ? -10.925 85.806 -13.562 1.00 162.41 ? 527  ARG A C   1 
ATOM 4112 O O   . ARG A 1 530  ? -10.275 85.480 -12.571 1.00 162.41 ? 527  ARG A O   1 
ATOM 4113 C CB  . ARG A 1 530  ? -12.124 87.901 -12.960 1.00 108.89 ? 527  ARG A CB  1 
ATOM 4114 C CG  . ARG A 1 530  ? -11.762 88.849 -14.115 1.00 108.89 ? 527  ARG A CG  1 
ATOM 4115 C CD  . ARG A 1 530  ? -12.016 90.313 -13.774 1.00 108.89 ? 527  ARG A CD  1 
ATOM 4116 N NE  . ARG A 1 530  ? -13.081 90.457 -12.783 1.00 108.89 ? 527  ARG A NE  1 
ATOM 4117 C CZ  . ARG A 1 530  ? -12.873 90.597 -11.477 1.00 108.89 ? 527  ARG A CZ  1 
ATOM 4118 N NH1 . ARG A 1 530  ? -11.639 90.628 -10.991 1.00 108.89 ? 527  ARG A NH1 1 
ATOM 4119 N NH2 . ARG A 1 530  ? -13.903 90.711 -10.654 1.00 108.89 ? 527  ARG A NH2 1 
ATOM 4120 N N   . GLN A 1 531  ? -10.498 85.650 -14.815 1.00 140.22 ? 528  GLN A N   1 
ATOM 4121 C CA  . GLN A 1 531  ? -9.240  84.977 -15.165 1.00 140.22 ? 528  GLN A CA  1 
ATOM 4122 C C   . GLN A 1 531  ? -8.030  85.886 -14.911 1.00 140.22 ? 528  GLN A C   1 
ATOM 4123 O O   . GLN A 1 531  ? -8.202  87.068 -14.616 1.00 140.22 ? 528  GLN A O   1 
ATOM 4124 C CB  . GLN A 1 531  ? -9.279  84.522 -16.636 1.00 132.22 ? 528  GLN A CB  1 
ATOM 4125 C CG  . GLN A 1 531  ? -8.508  83.227 -16.944 1.00 132.22 ? 528  GLN A CG  1 
ATOM 4126 C CD  . GLN A 1 531  ? -8.154  83.071 -18.419 1.00 132.22 ? 528  GLN A CD  1 
ATOM 4127 O OE1 . GLN A 1 531  ? -8.797  82.317 -19.147 1.00 132.22 ? 528  GLN A OE1 1 
ATOM 4128 N NE2 . GLN A 1 531  ? -7.126  83.786 -18.863 1.00 132.22 ? 528  GLN A NE2 1 
ATOM 4129 N N   . ILE A 1 532  ? -6.820  85.322 -14.999 1.00 107.12 ? 529  ILE A N   1 
ATOM 4130 C CA  . ILE A 1 532  ? -5.575  86.093 -14.969 1.00 107.12 ? 529  ILE A CA  1 
ATOM 4131 C C   . ILE A 1 532  ? -4.578  85.625 -16.034 1.00 107.12 ? 529  ILE A C   1 
ATOM 4132 O O   . ILE A 1 532  ? -4.419  86.286 -17.066 1.00 107.12 ? 529  ILE A O   1 
ATOM 4133 C CB  . ILE A 1 532  ? -4.887  86.085 -13.585 1.00 51.60  ? 529  ILE A CB  1 
ATOM 4134 C CG1 . ILE A 1 532  ? -5.815  86.661 -12.493 1.00 51.60  ? 529  ILE A CG1 1 
ATOM 4135 C CG2 . ILE A 1 532  ? -3.525  86.827 -13.621 1.00 51.60  ? 529  ILE A CG2 1 
ATOM 4136 C CD1 . ILE A 1 532  ? -5.115  87.511 -11.371 1.00 51.60  ? 529  ILE A CD1 1 
ATOM 4137 N N   . SER A 1 533  ? -3.914  84.493 -15.789 1.00 103.20 ? 530  SER A N   1 
ATOM 4138 C CA  . SER A 1 533  ? -2.760  84.072 -16.604 1.00 103.20 ? 530  SER A CA  1 
ATOM 4139 C C   . SER A 1 533  ? -3.052  82.883 -17.523 1.00 103.20 ? 530  SER A C   1 
ATOM 4140 O O   . SER A 1 533  ? -4.152  82.323 -17.512 1.00 103.20 ? 530  SER A O   1 
ATOM 4141 C CB  . SER A 1 533  ? -1.555  83.745 -15.708 1.00 67.92  ? 530  SER A CB  1 
ATOM 4142 O OG  . SER A 1 533  ? -1.614  84.459 -14.477 1.00 67.92  ? 530  SER A OG  1 
ATOM 4143 N N   . HIS A 1 534  ? -2.051  82.527 -18.327 1.00 119.56 ? 531  HIS A N   1 
ATOM 4144 C CA  . HIS A 1 534  ? -2.057  81.324 -19.162 1.00 119.56 ? 531  HIS A CA  1 
ATOM 4145 C C   . HIS A 1 534  ? -0.608  81.012 -19.538 1.00 119.56 ? 531  HIS A C   1 
ATOM 4146 O O   . HIS A 1 534  ? 0.148   81.916 -19.913 1.00 119.56 ? 531  HIS A O   1 
ATOM 4147 C CB  . HIS A 1 534  ? -2.933  81.499 -20.415 1.00 149.24 ? 531  HIS A CB  1 
ATOM 4148 C CG  . HIS A 1 534  ? -2.859  80.348 -21.375 1.00 149.24 ? 531  HIS A CG  1 
ATOM 4149 N ND1 . HIS A 1 534  ? -3.455  79.130 -21.128 1.00 149.24 ? 531  HIS A ND1 1 
ATOM 4150 C CD2 . HIS A 1 534  ? -2.257  80.233 -22.585 1.00 149.24 ? 531  HIS A CD2 1 
ATOM 4151 C CE1 . HIS A 1 534  ? -3.221  78.314 -22.141 1.00 149.24 ? 531  HIS A CE1 1 
ATOM 4152 N NE2 . HIS A 1 534  ? -2.495  78.958 -23.038 1.00 149.24 ? 531  HIS A NE2 1 
ATOM 4153 N N   . THR A 1 535  ? -0.222  79.741 -19.412 1.00 127.18 ? 532  THR A N   1 
ATOM 4154 C CA  . THR A 1 535  ? 1.154   79.309 -19.649 1.00 127.18 ? 532  THR A CA  1 
ATOM 4155 C C   . THR A 1 535  ? 1.175   77.815 -19.899 1.00 127.18 ? 532  THR A C   1 
ATOM 4156 O O   . THR A 1 535  ? 0.644   77.043 -19.108 1.00 127.18 ? 532  THR A O   1 
ATOM 4157 C CB  . THR A 1 535  ? 2.078   79.652 -18.449 1.00 75.27  ? 532  THR A CB  1 
ATOM 4158 O OG1 . THR A 1 535  ? 2.010   81.064 -18.177 1.00 75.27  ? 532  THR A OG1 1 
ATOM 4159 C CG2 . THR A 1 535  ? 3.535   79.243 -18.727 1.00 75.27  ? 532  THR A CG2 1 
ATOM 4160 N N   . GLU A 1 536  ? 1.786   77.429 -21.015 1.00 75.17  ? 533  GLU A N   1 
ATOM 4161 C CA  . GLU A 1 536  ? 1.966   76.017 -21.411 1.00 75.17  ? 533  GLU A CA  1 
ATOM 4162 C C   . GLU A 1 536  ? 3.216   75.457 -20.727 1.00 75.17  ? 533  GLU A C   1 
ATOM 4163 O O   . GLU A 1 536  ? 4.007   76.226 -20.145 1.00 75.17  ? 533  GLU A O   1 
ATOM 4164 C CB  . GLU A 1 536  ? 2.126   75.884 -22.936 1.00 163.45 ? 533  GLU A CB  1 
ATOM 4165 C CG  . GLU A 1 536  ? 0.949   76.372 -23.789 1.00 163.45 ? 533  GLU A CG  1 
ATOM 4166 C CD  . GLU A 1 536  ? 1.354   76.681 -25.236 1.00 163.45 ? 533  GLU A CD  1 
ATOM 4167 O OE1 . GLU A 1 536  ? 2.091   75.873 -25.853 1.00 163.45 ? 533  GLU A OE1 1 
ATOM 4168 O OE2 . GLU A 1 536  ? 0.931   77.736 -25.761 1.00 163.45 ? 533  GLU A OE2 1 
ATOM 4169 N N   . MET A 1 537  ? 3.407   74.137 -20.784 1.00 65.26  ? 534  MET A N   1 
ATOM 4170 C CA  . MET A 1 537  ? 4.587   73.530 -20.162 1.00 65.26  ? 534  MET A CA  1 
ATOM 4171 C C   . MET A 1 537  ? 5.146   72.452 -21.047 1.00 65.26  ? 534  MET A C   1 
ATOM 4172 O O   . MET A 1 537  ? 4.427   71.856 -21.866 1.00 65.26  ? 534  MET A O   1 
ATOM 4173 C CB  . MET A 1 537  ? 4.272   72.899 -18.808 1.00 88.76  ? 534  MET A CB  1 
ATOM 4174 C CG  . MET A 1 537  ? 3.443   73.741 -17.850 1.00 88.76  ? 534  MET A CG  1 
ATOM 4175 S SD  . MET A 1 537  ? 4.323   74.634 -16.548 1.00 88.76  ? 534  MET A SD  1 
ATOM 4176 C CE  . MET A 1 537  ? 5.550   73.445 -15.992 1.00 88.76  ? 534  MET A CE  1 
ATOM 4177 N N   . GLU A 1 538  ? 6.435   72.196 -20.851 1.00 80.08  ? 535  GLU A N   1 
ATOM 4178 C CA  . GLU A 1 538  ? 7.152   71.158 -21.558 1.00 80.08  ? 535  GLU A CA  1 
ATOM 4179 C C   . GLU A 1 538  ? 6.219   69.992 -21.944 1.00 80.08  ? 535  GLU A C   1 
ATOM 4180 O O   . GLU A 1 538  ? 6.062   69.657 -23.131 1.00 80.08  ? 535  GLU A O   1 
ATOM 4181 C CB  . GLU A 1 538  ? 8.289   70.656 -20.664 1.00 132.20 ? 535  GLU A CB  1 
ATOM 4182 C CG  . GLU A 1 538  ? 9.331   71.702 -20.300 1.00 132.20 ? 535  GLU A CG  1 
ATOM 4183 C CD  . GLU A 1 538  ? 10.493  71.701 -21.260 1.00 132.20 ? 535  GLU A CD  1 
ATOM 4184 O OE1 . GLU A 1 538  ? 10.597  72.649 -22.061 1.00 132.20 ? 535  GLU A OE1 1 
ATOM 4185 O OE2 . GLU A 1 538  ? 11.291  70.742 -21.227 1.00 132.20 ? 535  GLU A OE2 1 
ATOM 4186 N N   . HIS A 1 539  ? 5.585   69.418 -20.917 1.00 70.51  ? 536  HIS A N   1 
ATOM 4187 C CA  . HIS A 1 539  ? 4.808   68.174 -21.000 1.00 70.51  ? 536  HIS A CA  1 
ATOM 4188 C C   . HIS A 1 539  ? 3.463   68.325 -20.296 1.00 70.51  ? 536  HIS A C   1 
ATOM 4189 O O   . HIS A 1 539  ? 3.148   69.395 -19.746 1.00 70.51  ? 536  HIS A O   1 
ATOM 4190 C CB  . HIS A 1 539  ? 5.605   67.028 -20.381 1.00 102.08 ? 536  HIS A CB  1 
ATOM 4191 C CG  . HIS A 1 539  ? 7.076   67.133 -20.618 1.00 102.08 ? 536  HIS A CG  1 
ATOM 4192 N ND1 . HIS A 1 539  ? 7.654   66.839 -21.833 1.00 102.08 ? 536  HIS A ND1 1 
ATOM 4193 C CD2 . HIS A 1 539  ? 8.082   67.537 -19.810 1.00 102.08 ? 536  HIS A CD2 1 
ATOM 4194 C CE1 . HIS A 1 539  ? 8.958   67.040 -21.759 1.00 102.08 ? 536  HIS A CE1 1 
ATOM 4195 N NE2 . HIS A 1 539  ? 9.244   67.463 -20.541 1.00 102.08 ? 536  HIS A NE2 1 
ATOM 4196 N N   . GLU A 1 540  ? 2.671   67.253 -20.328 1.00 69.48  ? 537  GLU A N   1 
ATOM 4197 C CA  . GLU A 1 540  ? 1.310   67.271 -19.774 1.00 69.48  ? 537  GLU A CA  1 
ATOM 4198 C C   . GLU A 1 540  ? 1.313   67.404 -18.269 1.00 69.48  ? 537  GLU A C   1 
ATOM 4199 O O   . GLU A 1 540  ? 2.056   66.704 -17.582 1.00 69.48  ? 537  GLU A O   1 
ATOM 4200 C CB  . GLU A 1 540  ? 0.560   66.001 -20.162 1.00 79.42  ? 537  GLU A CB  1 
ATOM 4201 C CG  . GLU A 1 540  ? -0.712  66.187 -20.982 1.00 79.42  ? 537  GLU A CG  1 
ATOM 4202 C CD  . GLU A 1 540  ? -1.518  64.887 -21.034 1.00 79.42  ? 537  GLU A CD  1 
ATOM 4203 O OE1 . GLU A 1 540  ? -0.992  63.863 -21.544 1.00 79.42  ? 537  GLU A OE1 1 
ATOM 4204 O OE2 . GLU A 1 540  ? -2.667  64.880 -20.531 1.00 79.42  ? 537  GLU A OE2 1 
ATOM 4205 N N   . VAL A 1 541  ? 0.482   68.296 -17.752 1.00 64.38  ? 538  VAL A N   1 
ATOM 4206 C CA  . VAL A 1 541  ? 0.432   68.492 -16.309 1.00 64.38  ? 538  VAL A CA  1 
ATOM 4207 C C   . VAL A 1 541  ? -0.133  67.247 -15.621 1.00 64.38  ? 538  VAL A C   1 
ATOM 4208 O O   . VAL A 1 541  ? -1.302  66.914 -15.828 1.00 64.38  ? 538  VAL A O   1 
ATOM 4209 C CB  . VAL A 1 541  ? -0.412  69.728 -15.925 1.00 81.33  ? 538  VAL A CB  1 
ATOM 4210 C CG1 . VAL A 1 541  ? -0.632  69.766 -14.436 1.00 81.33  ? 538  VAL A CG1 1 
ATOM 4211 C CG2 . VAL A 1 541  ? 0.257   70.994 -16.382 1.00 81.33  ? 538  VAL A CG2 1 
ATOM 4212 N N   . ALA A 1 542  ? 0.683   66.550 -14.826 1.00 64.89  ? 539  ALA A N   1 
ATOM 4213 C CA  . ALA A 1 542  ? 0.176   65.404 -14.044 1.00 64.89  ? 539  ALA A CA  1 
ATOM 4214 C C   . ALA A 1 542  ? -0.622  65.845 -12.828 1.00 64.89  ? 539  ALA A C   1 
ATOM 4215 O O   . ALA A 1 542  ? -1.734  65.366 -12.631 1.00 64.89  ? 539  ALA A O   1 
ATOM 4216 C CB  . ALA A 1 542  ? 1.301   64.435 -13.632 1.00 51.92  ? 539  ALA A CB  1 
ATOM 4217 N N   . CYS A 1 543  ? -0.069  66.756 -12.029 1.00 70.93  ? 540  CYS A N   1 
ATOM 4218 C CA  . CYS A 1 543  ? -0.748  67.227 -10.811 1.00 70.93  ? 540  CYS A CA  1 
ATOM 4219 C C   . CYS A 1 543  ? -0.304  68.604 -10.338 1.00 70.93  ? 540  CYS A C   1 
ATOM 4220 O O   . CYS A 1 543  ? 0.780   69.067 -10.674 1.00 70.93  ? 540  CYS A O   1 
ATOM 4221 C CB  . CYS A 1 543  ? -0.598  66.205 -9.670  1.00 58.89  ? 540  CYS A CB  1 
ATOM 4222 S SG  . CYS A 1 543  ? 1.021   65.337 -9.605  1.00 58.89  ? 540  CYS A SG  1 
ATOM 4223 N N   . LEU A 1 544  ? -1.147  69.239 -9.532  1.00 106.89 ? 541  LEU A N   1 
ATOM 4224 C CA  . LEU A 1 544  ? -0.923  70.620 -9.115  1.00 106.89 ? 541  LEU A CA  1 
ATOM 4225 C C   . LEU A 1 544  ? -1.259  70.860 -7.661  1.00 106.89 ? 541  LEU A C   1 
ATOM 4226 O O   . LEU A 1 544  ? -2.343  70.506 -7.226  1.00 106.89 ? 541  LEU A O   1 
ATOM 4227 C CB  . LEU A 1 544  ? -1.795  71.540 -9.963  1.00 58.60  ? 541  LEU A CB  1 
ATOM 4228 C CG  . LEU A 1 544  ? -1.118  71.949 -11.262 1.00 58.60  ? 541  LEU A CG  1 
ATOM 4229 C CD1 . LEU A 1 544  ? -2.147  71.837 -12.392 1.00 58.60  ? 541  LEU A CD1 1 
ATOM 4230 C CD2 . LEU A 1 544  ? -0.505  73.357 -11.114 1.00 58.60  ? 541  LEU A CD2 1 
ATOM 4231 N N   . ASP A 1 545  ? -0.362  71.482 -6.906  1.00 208.66 ? 542  ASP A N   1 
ATOM 4232 C CA  . ASP A 1 545  ? -0.748  71.857 -5.555  1.00 208.66 ? 542  ASP A CA  1 
ATOM 4233 C C   . ASP A 1 545  ? -0.671  73.329 -5.267  1.00 208.66 ? 542  ASP A C   1 
ATOM 4234 O O   . ASP A 1 545  ? 0.286   73.998 -5.651  1.00 208.66 ? 542  ASP A O   1 
ATOM 4235 C CB  . ASP A 1 545  ? 0.011   71.083 -4.484  1.00 157.44 ? 542  ASP A CB  1 
ATOM 4236 C CG  . ASP A 1 545  ? -0.720  71.095 -3.154  1.00 157.44 ? 542  ASP A CG  1 
ATOM 4237 O OD1 . ASP A 1 545  ? -1.949  70.883 -3.149  1.00 157.44 ? 542  ASP A OD1 1 
ATOM 4238 O OD2 . ASP A 1 545  ? -0.084  71.332 -2.115  1.00 157.44 ? 542  ASP A OD2 1 
ATOM 4239 N N   . ILE A 1 546  ? -1.703  73.811 -4.579  1.00 188.31 ? 543  ILE A N   1 
ATOM 4240 C CA  . ILE A 1 546  ? -1.796  75.191 -4.124  1.00 188.31 ? 543  ILE A CA  1 
ATOM 4241 C C   . ILE A 1 546  ? -2.692  75.325 -2.900  1.00 188.31 ? 543  ILE A C   1 
ATOM 4242 O O   . ILE A 1 546  ? -3.867  74.951 -2.921  1.00 188.31 ? 543  ILE A O   1 
ATOM 4243 C CB  . ILE A 1 546  ? -2.329  76.122 -5.216  1.00 94.64  ? 543  ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 546  ? -3.548  75.506 -5.909  1.00 94.64  ? 543  ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 546  ? -1.237  76.471 -6.211  1.00 94.64  ? 543  ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 546  ? -4.853  76.202 -5.583  1.00 94.64  ? 543  ILE A CD1 1 
ATOM 4247 N N   . THR A 1 547  ? -2.114  75.853 -1.831  1.00 144.88 ? 544  THR A N   1 
ATOM 4248 C CA  . THR A 1 547  ? -2.850  76.188 -0.627  1.00 144.88 ? 544  THR A CA  1 
ATOM 4249 C C   . THR A 1 547  ? -2.121  77.381 -0.020  1.00 144.88 ? 544  THR A C   1 
ATOM 4250 O O   . THR A 1 547  ? -0.921  77.300 0.234   1.00 144.88 ? 544  THR A O   1 
ATOM 4251 C CB  . THR A 1 547  ? -2.909  75.010 0.399   1.00 119.33 ? 544  THR A CB  1 
ATOM 4252 O OG1 . THR A 1 547  ? -2.450  73.783 -0.194  1.00 119.33 ? 544  THR A OG1 1 
ATOM 4253 C CG2 . THR A 1 547  ? -4.331  74.826 0.927   1.00 119.33 ? 544  THR A CG2 1 
ATOM 4254 N N   . PRO A 1 548  ? -2.829  78.506 0.175   1.00 212.91 ? 545  PRO A N   1 
ATOM 4255 C CA  . PRO A 1 548  ? -2.234  79.694 0.790   1.00 212.91 ? 545  PRO A CA  1 
ATOM 4256 C C   . PRO A 1 548  ? -1.616  79.332 2.134   1.00 212.91 ? 545  PRO A C   1 
ATOM 4257 O O   . PRO A 1 548  ? -2.316  79.249 3.146   1.00 212.91 ? 545  PRO A O   1 
ATOM 4258 C CB  . PRO A 1 548  ? -3.423  80.651 0.954   1.00 168.39 ? 545  PRO A CB  1 
ATOM 4259 C CG  . PRO A 1 548  ? -4.653  79.821 0.715   1.00 168.39 ? 545  PRO A CG  1 
ATOM 4260 C CD  . PRO A 1 548  ? -4.239  78.715 -0.184  1.00 168.39 ? 545  PRO A CD  1 
ATOM 4261 N N   . LEU A 1 549  ? -0.304  79.112 2.118   1.00 133.76 ? 546  LEU A N   1 
ATOM 4262 C CA  . LEU A 1 549  ? 0.401   78.490 3.236   1.00 133.76 ? 546  LEU A CA  1 
ATOM 4263 C C   . LEU A 1 549  ? 0.369   79.306 4.550   1.00 133.76 ? 546  LEU A C   1 
ATOM 4264 O O   . LEU A 1 549  ? -0.618  79.257 5.292   1.00 133.76 ? 546  LEU A O   1 
ATOM 4265 C CB  . LEU A 1 549  ? 1.836   78.085 2.824   1.00 79.53  ? 546  LEU A CB  1 
ATOM 4266 C CG  . LEU A 1 549  ? 2.085   76.967 1.794   1.00 79.53  ? 546  LEU A CG  1 
ATOM 4267 C CD1 . LEU A 1 549  ? 2.101   77.530 0.381   1.00 79.53  ? 546  LEU A CD1 1 
ATOM 4268 C CD2 . LEU A 1 549  ? 3.400   76.248 2.057   1.00 79.53  ? 546  LEU A CD2 1 
ATOM 4269 N N   . GLY A 1 550  ? 1.435   80.054 4.829   1.00 163.43 ? 547  GLY A N   1 
ATOM 4270 C CA  . GLY A 1 550  ? 1.550   80.779 6.090   1.00 163.43 ? 547  GLY A CA  1 
ATOM 4271 C C   . GLY A 1 550  ? 1.013   82.192 6.012   1.00 163.43 ? 547  GLY A C   1 
ATOM 4272 O O   . GLY A 1 550  ? -0.128  82.461 6.402   1.00 163.43 ? 547  GLY A O   1 
ATOM 4273 N N   . ASP A 1 551  ? 1.851   83.091 5.499   1.00 206.39 ? 548  ASP A N   1 
ATOM 4274 C CA  . ASP A 1 551  ? 1.538   84.517 5.382   1.00 206.39 ? 548  ASP A CA  1 
ATOM 4275 C C   . ASP A 1 551  ? 0.614   84.812 4.197   1.00 206.39 ? 548  ASP A C   1 
ATOM 4276 O O   . ASP A 1 551  ? 0.944   85.606 3.312   1.00 206.39 ? 548  ASP A O   1 
ATOM 4277 C CB  . ASP A 1 551  ? 2.836   85.332 5.278   1.00 151.86 ? 548  ASP A CB  1 
ATOM 4278 C CG  . ASP A 1 551  ? 3.905   84.632 4.441   1.00 151.86 ? 548  ASP A CG  1 
ATOM 4279 O OD1 . ASP A 1 551  ? 4.987   84.343 5.001   1.00 151.86 ? 548  ASP A OD1 1 
ATOM 4280 O OD2 . ASP A 1 551  ? 3.663   84.359 3.240   1.00 151.86 ? 548  ASP A OD2 1 
ATOM 4281 N N   . SER A 1 552  ? -0.552  84.171 4.203   1.00 152.41 ? 549  SER A N   1 
ATOM 4282 C CA  . SER A 1 552  ? -1.525  84.284 3.124   1.00 152.41 ? 549  SER A CA  1 
ATOM 4283 C C   . SER A 1 552  ? -2.894  83.813 3.601   1.00 152.41 ? 549  SER A C   1 
ATOM 4284 O O   . SER A 1 552  ? -3.026  82.720 4.160   1.00 152.41 ? 549  SER A O   1 
ATOM 4285 C CB  . SER A 1 552  ? -1.070  83.470 1.908   1.00 146.38 ? 549  SER A CB  1 
ATOM 4286 O OG  . SER A 1 552  ? -0.433  82.260 2.290   1.00 146.38 ? 549  SER A OG  1 
ATOM 4287 N N   . ASN A 1 553  ? -3.908  84.649 3.388   1.00 141.78 ? 550  ASN A N   1 
ATOM 4288 C CA  . ASN A 1 553  ? -5.266  84.336 3.832   1.00 141.78 ? 550  ASN A CA  1 
ATOM 4289 C C   . ASN A 1 553  ? -6.247  84.177 2.671   1.00 141.78 ? 550  ASN A C   1 
ATOM 4290 O O   . ASN A 1 553  ? -6.973  85.113 2.311   1.00 141.78 ? 550  ASN A O   1 
ATOM 4291 C CB  . ASN A 1 553  ? -5.761  85.390 4.822   1.00 189.06 ? 550  ASN A CB  1 
ATOM 4292 C CG  . ASN A 1 553  ? -5.113  85.255 6.179   1.00 189.06 ? 550  ASN A CG  1 
ATOM 4293 O OD1 . ASN A 1 553  ? -5.745  84.794 7.130   1.00 189.06 ? 550  ASN A OD1 1 
ATOM 4294 N ND2 . ASN A 1 553  ? -3.840  85.641 6.277   1.00 189.06 ? 550  ASN A ND2 1 
ATOM 4295 N N   . GLY A 1 554  ? -6.260  82.981 2.090   1.00 170.35 ? 551  GLY A N   1 
ATOM 4296 C CA  . GLY A 1 554  ? -7.076  82.715 0.915   1.00 170.35 ? 551  GLY A CA  1 
ATOM 4297 C C   . GLY A 1 554  ? -6.306  82.887 -0.383  1.00 170.35 ? 551  GLY A C   1 
ATOM 4298 O O   . GLY A 1 554  ? -6.375  82.028 -1.262  1.00 170.35 ? 551  GLY A O   1 
ATOM 4299 N N   . LEU A 1 555  ? -5.581  83.997 -0.515  1.00 135.73 ? 552  LEU A N   1 
ATOM 4300 C CA  . LEU A 1 555  ? -4.770  84.225 -1.706  1.00 135.73 ? 552  LEU A CA  1 
ATOM 4301 C C   . LEU A 1 555  ? -3.400  83.572 -1.490  1.00 135.73 ? 552  LEU A C   1 
ATOM 4302 O O   . LEU A 1 555  ? -2.830  83.684 -0.407  1.00 135.73 ? 552  LEU A O   1 
ATOM 4303 C CB  . LEU A 1 555  ? -4.655  85.722 -2.020  1.00 107.48 ? 552  LEU A CB  1 
ATOM 4304 C CG  . LEU A 1 555  ? -5.026  86.121 -3.458  1.00 107.48 ? 552  LEU A CG  1 
ATOM 4305 C CD1 . LEU A 1 555  ? -6.457  86.672 -3.542  1.00 107.48 ? 552  LEU A CD1 1 
ATOM 4306 C CD2 . LEU A 1 555  ? -4.020  87.118 -4.040  1.00 107.48 ? 552  LEU A CD2 1 
ATOM 4307 N N   . SER A 1 556  ? -2.878  82.905 -2.523  1.00 121.14 ? 553  SER A N   1 
ATOM 4308 C CA  . SER A 1 556  ? -1.806  81.908 -2.360  1.00 121.14 ? 553  SER A CA  1 
ATOM 4309 C C   . SER A 1 556  ? -0.489  82.149 -3.126  1.00 121.14 ? 553  SER A C   1 
ATOM 4310 O O   . SER A 1 556  ? -0.495  82.222 -4.351  1.00 121.14 ? 553  SER A O   1 
ATOM 4311 C CB  . SER A 1 556  ? -2.353  80.521 -2.718  1.00 108.17 ? 553  SER A CB  1 
ATOM 4312 O OG  . SER A 1 556  ? -1.417  79.503 -2.416  1.00 108.17 ? 553  SER A OG  1 
ATOM 4313 N N   . PRO A 1 557  ? 0.647   82.228 -2.391  1.00 186.59 ? 554  PRO A N   1 
ATOM 4314 C CA  . PRO A 1 557  ? 2.014   82.393 -2.927  1.00 186.59 ? 554  PRO A CA  1 
ATOM 4315 C C   . PRO A 1 557  ? 2.429   81.371 -3.999  1.00 186.59 ? 554  PRO A C   1 
ATOM 4316 O O   . PRO A 1 557  ? 1.674   81.134 -4.945  1.00 186.59 ? 554  PRO A O   1 
ATOM 4317 C CB  . PRO A 1 557  ? 2.902   82.262 -1.679  1.00 118.78 ? 554  PRO A CB  1 
ATOM 4318 C CG  . PRO A 1 557  ? 2.025   82.685 -0.547  1.00 118.78 ? 554  PRO A CG  1 
ATOM 4319 C CD  . PRO A 1 557  ? 0.650   82.181 -0.914  1.00 118.78 ? 554  PRO A CD  1 
ATOM 4320 N N   . LEU A 1 558  ? 3.615   80.777 -3.849  1.00 149.93 ? 555  LEU A N   1 
ATOM 4321 C CA  . LEU A 1 558  ? 4.233   79.997 -4.936  1.00 149.93 ? 555  LEU A CA  1 
ATOM 4322 C C   . LEU A 1 558  ? 3.547   78.682 -5.315  1.00 149.93 ? 555  LEU A C   1 
ATOM 4323 O O   . LEU A 1 558  ? 2.434   78.398 -4.867  1.00 149.93 ? 555  LEU A O   1 
ATOM 4324 C CB  . LEU A 1 558  ? 5.743   79.806 -4.728  1.00 116.89 ? 555  LEU A CB  1 
ATOM 4325 C CG  . LEU A 1 558  ? 6.328   79.061 -3.534  1.00 116.89 ? 555  LEU A CG  1 
ATOM 4326 C CD1 . LEU A 1 558  ? 7.543   78.271 -3.979  1.00 116.89 ? 555  LEU A CD1 1 
ATOM 4327 C CD2 . LEU A 1 558  ? 6.689   80.049 -2.424  1.00 116.89 ? 555  LEU A CD2 1 
ATOM 4328 N N   . CYS A 1 559  ? 4.220   77.893 -6.154  1.00 137.48 ? 556  CYS A N   1 
ATOM 4329 C CA  . CYS A 1 559  ? 3.584   76.750 -6.799  1.00 137.48 ? 556  CYS A CA  1 
ATOM 4330 C C   . CYS A 1 559  ? 4.507   75.609 -7.239  1.00 137.48 ? 556  CYS A C   1 
ATOM 4331 O O   . CYS A 1 559  ? 5.701   75.787 -7.476  1.00 137.48 ? 556  CYS A O   1 
ATOM 4332 C CB  . CYS A 1 559  ? 2.745   77.214 -7.983  1.00 157.79 ? 556  CYS A CB  1 
ATOM 4333 S SG  . CYS A 1 559  ? 1.447   76.059 -8.376  1.00 157.79 ? 556  CYS A SG  1 
ATOM 4334 N N   . ALA A 1 560  ? 3.904   74.434 -7.363  1.00 112.33 ? 557  ALA A N   1 
ATOM 4335 C CA  . ALA A 1 560  ? 4.628   73.190 -7.490  1.00 112.33 ? 557  ALA A CA  1 
ATOM 4336 C C   . ALA A 1 560  ? 3.822   72.259 -8.355  1.00 112.33 ? 557  ALA A C   1 
ATOM 4337 O O   . ALA A 1 560  ? 2.590   72.193 -8.249  1.00 112.33 ? 557  ALA A O   1 
ATOM 4338 C CB  . ALA A 1 560  ? 4.843   72.578 -6.124  1.00 209.10 ? 557  ALA A CB  1 
ATOM 4339 N N   . ILE A 1 561  ? 4.525   71.518 -9.199  1.00 70.05  ? 558  ILE A N   1 
ATOM 4340 C CA  . ILE A 1 561  ? 3.866   70.818 -10.264 1.00 70.05  ? 558  ILE A CA  1 
ATOM 4341 C C   . ILE A 1 561  ? 4.564   69.513 -10.669 1.00 70.05  ? 558  ILE A C   1 
ATOM 4342 O O   . ILE A 1 561  ? 5.791   69.377 -10.644 1.00 70.05  ? 558  ILE A O   1 
ATOM 4343 C CB  . ILE A 1 561  ? 3.687   71.780 -11.458 1.00 95.81  ? 558  ILE A CB  1 
ATOM 4344 C CG1 . ILE A 1 561  ? 2.544   71.328 -12.365 1.00 95.81  ? 558  ILE A CG1 1 
ATOM 4345 C CG2 . ILE A 1 561  ? 5.017   72.020 -12.191 1.00 95.81  ? 558  ILE A CG2 1 
ATOM 4346 C CD1 . ILE A 1 561  ? 2.096   72.390 -13.328 1.00 95.81  ? 558  ILE A CD1 1 
ATOM 4347 N N   . GLY A 1 562  ? 3.752   68.536 -11.024 1.00 56.30  ? 559  GLY A N   1 
ATOM 4348 C CA  . GLY A 1 562  ? 4.266   67.310 -11.582 1.00 56.30  ? 559  GLY A CA  1 
ATOM 4349 C C   . GLY A 1 562  ? 3.679   67.198 -12.964 1.00 56.30  ? 559  GLY A C   1 
ATOM 4350 O O   . GLY A 1 562  ? 2.505   67.534 -13.149 1.00 56.30  ? 559  GLY A O   1 
ATOM 4351 N N   . LEU A 1 563  ? 4.574   66.830 -13.888 1.00 73.46  ? 560  LEU A N   1 
ATOM 4352 C CA  . LEU A 1 563  ? 4.372   66.676 -15.325 1.00 73.46  ? 560  LEU A CA  1 
ATOM 4353 C C   . LEU A 1 563  ? 4.430   65.257 -15.779 1.00 73.46  ? 560  LEU A C   1 
ATOM 4354 O O   . LEU A 1 563  ? 4.878   64.405 -15.075 1.00 73.46  ? 560  LEU A O   1 
ATOM 4355 C CB  . LEU A 1 563  ? 5.385   67.487 -16.110 1.00 85.53  ? 560  LEU A CB  1 
ATOM 4356 C CG  . LEU A 1 563  ? 5.348   69.003 -16.041 1.00 85.53  ? 560  LEU A CG  1 
ATOM 4357 C CD1 . LEU A 1 563  ? 5.599   69.560 -17.396 1.00 85.53  ? 560  LEU A CD1 1 
ATOM 4358 C CD2 . LEU A 1 563  ? 4.075   69.526 -15.478 1.00 85.53  ? 560  LEU A CD2 1 
ATOM 4359 N N   . TRP A 1 564  ? 3.976   65.045 -16.994 1.00 80.85  ? 561  TRP A N   1 
ATOM 4360 C CA  . TRP A 1 564  ? 3.847   63.750 -17.639 1.00 80.85  ? 561  TRP A CA  1 
ATOM 4361 C C   . TRP A 1 564  ? 4.801   62.950 -18.544 1.00 80.85  ? 561  TRP A C   1 
ATOM 4362 O O   . TRP A 1 564  ? 4.432   61.816 -18.817 1.00 80.85  ? 561  TRP A O   1 
ATOM 4363 C CB  . TRP A 1 564  ? 2.646   63.932 -18.527 1.00 75.49  ? 561  TRP A CB  1 
ATOM 4364 C CG  . TRP A 1 564  ? 1.450   63.358 -18.055 1.00 75.49  ? 561  TRP A CG  1 
ATOM 4365 C CD1 . TRP A 1 564  ? 0.507   63.959 -17.338 1.00 75.49  ? 561  TRP A CD1 1 
ATOM 4366 C CD2 . TRP A 1 564  ? 1.013   62.051 -18.300 1.00 75.49  ? 561  TRP A CD2 1 
ATOM 4367 N NE1 . TRP A 1 564  ? -0.511  63.107 -17.106 1.00 75.49  ? 561  TRP A NE1 1 
ATOM 4368 C CE2 . TRP A 1 564  ? -0.218  61.914 -17.695 1.00 75.49  ? 561  TRP A CE2 1 
ATOM 4369 C CE3 . TRP A 1 564  ? 1.548   60.974 -18.985 1.00 75.49  ? 561  TRP A CE3 1 
ATOM 4370 C CZ2 . TRP A 1 564  ? -0.928  60.743 -17.735 1.00 75.49  ? 561  TRP A CZ2 1 
ATOM 4371 C CZ3 . TRP A 1 564  ? 0.843   59.817 -19.025 1.00 75.49  ? 561  TRP A CZ3 1 
ATOM 4372 C CH2 . TRP A 1 564  ? -0.377  59.705 -18.403 1.00 75.49  ? 561  TRP A CH2 1 
ATOM 4373 N N   . THR A 1 565  ? 5.934   63.420 -19.056 1.00 91.61  ? 562  THR A N   1 
ATOM 4374 C CA  . THR A 1 565  ? 6.693   62.516 -19.947 1.00 91.61  ? 562  THR A CA  1 
ATOM 4375 C C   . THR A 1 565  ? 8.070   62.235 -19.475 1.00 91.61  ? 562  THR A C   1 
ATOM 4376 O O   . THR A 1 565  ? 8.675   61.178 -19.636 1.00 91.61  ? 562  THR A O   1 
ATOM 4377 C CB  . THR A 1 565  ? 6.751   63.050 -21.338 1.00 82.35  ? 562  THR A CB  1 
ATOM 4378 O OG1 . THR A 1 565  ? 5.456   62.942 -21.923 1.00 82.35  ? 562  THR A OG1 1 
ATOM 4379 C CG2 . THR A 1 565  ? 7.692   62.230 -22.126 1.00 82.35  ? 562  THR A CG2 1 
ATOM 4380 N N   . ASP A 1 566  ? 8.542   63.286 -18.897 1.00 88.57  ? 563  ASP A N   1 
ATOM 4381 C CA  . ASP A 1 566  ? 9.806   63.439 -18.199 1.00 88.57  ? 563  ASP A CA  1 
ATOM 4382 C C   . ASP A 1 566  ? 9.645   63.125 -16.709 1.00 88.57  ? 563  ASP A C   1 
ATOM 4383 O O   . ASP A 1 566  ? 10.627  63.101 -15.967 1.00 88.57  ? 563  ASP A O   1 
ATOM 4384 C CB  . ASP A 1 566  ? 10.332  64.849 -18.378 1.00 81.89  ? 563  ASP A CB  1 
ATOM 4385 C CG  . ASP A 1 566  ? 9.719   65.821 -17.400 1.00 81.89  ? 563  ASP A CG  1 
ATOM 4386 O OD1 . ASP A 1 566  ? 8.530   65.680 -17.036 1.00 81.89  ? 563  ASP A OD1 1 
ATOM 4387 O OD2 . ASP A 1 566  ? 10.440  66.752 -17.003 1.00 81.89  ? 563  ASP A OD2 1 
ATOM 4388 N N   . ILE A 1 567  ? 8.406   62.901 -16.272 1.00 131.87 ? 564  ILE A N   1 
ATOM 4389 C CA  . ILE A 1 567  ? 8.145   62.433 -14.916 1.00 131.87 ? 564  ILE A CA  1 
ATOM 4390 C C   . ILE A 1 567  ? 8.913   63.301 -13.918 1.00 131.87 ? 564  ILE A C   1 
ATOM 4391 O O   . ILE A 1 567  ? 9.892   62.879 -13.300 1.00 131.87 ? 564  ILE A O   1 
ATOM 4392 C CB  . ILE A 1 567  ? 8.484   60.921 -14.780 1.00 68.42  ? 564  ILE A CB  1 
ATOM 4393 C CG1 . ILE A 1 567  ? 7.500   60.080 -15.584 1.00 68.42  ? 564  ILE A CG1 1 
ATOM 4394 C CG2 . ILE A 1 567  ? 8.410   60.449 -13.321 1.00 68.42  ? 564  ILE A CG2 1 
ATOM 4395 C CD1 . ILE A 1 567  ? 8.032   59.582 -16.882 1.00 68.42  ? 564  ILE A CD1 1 
ATOM 4396 N N   . SER A 1 568  ? 8.468   64.537 -13.782 1.00 58.64  ? 565  SER A N   1 
ATOM 4397 C CA  . SER A 1 568  ? 9.221   65.504 -13.013 1.00 58.64  ? 565  SER A CA  1 
ATOM 4398 C C   . SER A 1 568  ? 8.327   66.363 -12.163 1.00 58.64  ? 565  SER A C   1 
ATOM 4399 O O   . SER A 1 568  ? 7.136   66.462 -12.398 1.00 58.64  ? 565  SER A O   1 
ATOM 4400 C CB  . SER A 1 568  ? 9.984   66.424 -13.944 1.00 78.37  ? 565  SER A CB  1 
ATOM 4401 O OG  . SER A 1 568  ? 9.168   67.528 -14.283 1.00 78.37  ? 565  SER A OG  1 
ATOM 4402 N N   . ALA A 1 569  ? 8.919   67.010 -11.178 1.00 70.99  ? 566  ALA A N   1 
ATOM 4403 C CA  . ALA A 1 569  ? 8.166   67.829 -10.271 1.00 70.99  ? 566  ALA A CA  1 
ATOM 4404 C C   . ALA A 1 569  ? 9.009   69.063 -10.034 1.00 70.99  ? 566  ALA A C   1 
ATOM 4405 O O   . ALA A 1 569  ? 10.251  68.977 -9.868  1.00 70.99  ? 566  ALA A O   1 
ATOM 4406 C CB  . ALA A 1 569  ? 7.897   67.088 -8.987  1.00 104.94 ? 566  ALA A CB  1 
ATOM 4407 N N   . ARG A 1 570  ? 8.329   70.209 -10.031 1.00 84.05  ? 567  ARG A N   1 
ATOM 4408 C CA  . ARG A 1 570  ? 9.001   71.469 -10.226 1.00 84.05  ? 567  ARG A CA  1 
ATOM 4409 C C   . ARG A 1 570  ? 8.309   72.655 -9.597  1.00 84.05  ? 567  ARG A C   1 
ATOM 4410 O O   . ARG A 1 570  ? 7.078   72.814 -9.673  1.00 84.05  ? 567  ARG A O   1 
ATOM 4411 C CB  . ARG A 1 570  ? 9.271   71.731 -11.716 1.00 112.36 ? 567  ARG A CB  1 
ATOM 4412 C CG  . ARG A 1 570  ? 8.236   71.180 -12.681 1.00 112.36 ? 567  ARG A CG  1 
ATOM 4413 C CD  . ARG A 1 570  ? 8.901   70.350 -13.774 1.00 112.36 ? 567  ARG A CD  1 
ATOM 4414 N NE  . ARG A 1 570  ? 9.422   71.157 -14.878 1.00 112.36 ? 567  ARG A NE  1 
ATOM 4415 C CZ  . ARG A 1 570  ? 10.029  70.665 -15.959 1.00 112.36 ? 567  ARG A CZ  1 
ATOM 4416 N NH1 . ARG A 1 570  ? 10.205  69.358 -16.105 1.00 112.36 ? 567  ARG A NH1 1 
ATOM 4417 N NH2 . ARG A 1 570  ? 10.460  71.489 -16.906 1.00 112.36 ? 567  ARG A NH2 1 
ATOM 4418 N N   . ILE A 1 571  ? 9.165   73.491 -9.009  1.00 136.29 ? 568  ILE A N   1 
ATOM 4419 C CA  . ILE A 1 571  ? 8.815   74.644 -8.206  1.00 136.29 ? 568  ILE A CA  1 
ATOM 4420 C C   . ILE A 1 571  ? 8.623   75.838 -9.113  1.00 136.29 ? 568  ILE A C   1 
ATOM 4421 O O   . ILE A 1 571  ? 9.519   76.179 -9.882  1.00 136.29 ? 568  ILE A O   1 
ATOM 4422 C CB  . ILE A 1 571  ? 9.974   74.993 -7.233  1.00 199.45 ? 568  ILE A CB  1 
ATOM 4423 C CG1 . ILE A 1 571  ? 10.602  73.734 -6.598  1.00 199.45 ? 568  ILE A CG1 1 
ATOM 4424 C CG2 . ILE A 1 571  ? 9.536   76.051 -6.209  1.00 199.45 ? 568  ILE A CG2 1 
ATOM 4425 C CD1 . ILE A 1 571  ? 9.719   72.969 -5.613  1.00 199.45 ? 568  ILE A CD1 1 
ATOM 4426 N N   . LEU A 1 572  ? 7.459   76.471 -9.015  1.00 203.48 ? 569  LEU A N   1 
ATOM 4427 C CA  . LEU A 1 572  ? 7.118   77.632 -9.837  1.00 203.48 ? 569  LEU A CA  1 
ATOM 4428 C C   . LEU A 1 572  ? 6.447   78.728 -8.998  1.00 203.48 ? 569  LEU A C   1 
ATOM 4429 O O   . LEU A 1 572  ? 6.214   78.532 -7.807  1.00 203.48 ? 569  LEU A O   1 
ATOM 4430 C CB  . LEU A 1 572  ? 6.236   77.207 -11.016 1.00 167.38 ? 569  LEU A CB  1 
ATOM 4431 C CG  . LEU A 1 572  ? 6.945   76.605 -12.242 1.00 167.38 ? 569  LEU A CG  1 
ATOM 4432 C CD1 . LEU A 1 572  ? 7.186   75.098 -12.122 1.00 167.38 ? 569  LEU A CD1 1 
ATOM 4433 C CD2 . LEU A 1 572  ? 6.145   76.901 -13.497 1.00 167.38 ? 569  LEU A CD2 1 
ATOM 4434 N N   . LYS A 1 573  ? 6.162   79.882 -9.607  1.00 149.52 ? 570  LYS A N   1 
ATOM 4435 C CA  . LYS A 1 573  ? 5.516   80.996 -8.891  1.00 149.52 ? 570  LYS A CA  1 
ATOM 4436 C C   . LYS A 1 573  ? 4.032   81.150 -9.268  1.00 149.52 ? 570  LYS A C   1 
ATOM 4437 O O   . LYS A 1 573  ? 3.325   80.147 -9.339  1.00 149.52 ? 570  LYS A O   1 
ATOM 4438 C CB  . LYS A 1 573  ? 6.293   82.299 -9.069  1.00 77.67  ? 570  LYS A CB  1 
ATOM 4439 C CG  . LYS A 1 573  ? 5.942   83.352 -8.038  1.00 77.67  ? 570  LYS A CG  1 
ATOM 4440 C CD  . LYS A 1 573  ? 6.178   84.753 -8.574  1.00 77.67  ? 570  LYS A CD  1 
ATOM 4441 C CE  . LYS A 1 573  ? 5.082   85.729 -8.130  1.00 77.67  ? 570  LYS A CE  1 
ATOM 4442 N NZ  . LYS A 1 573  ? 4.007   85.784 -9.165  1.00 77.67  ? 570  LYS A NZ  1 
ATOM 4443 N N   . LEU A 1 574  ? 3.548   82.377 -9.493  1.00 212.91 ? 571  LEU A N   1 
ATOM 4444 C CA  . LEU A 1 574  ? 2.117   82.558 -9.782  1.00 212.91 ? 571  LEU A CA  1 
ATOM 4445 C C   . LEU A 1 574  ? 1.727   83.332 -11.065 1.00 212.91 ? 571  LEU A C   1 
ATOM 4446 O O   . LEU A 1 574  ? 1.856   82.764 -12.148 1.00 212.91 ? 571  LEU A O   1 
ATOM 4447 C CB  . LEU A 1 574  ? 1.324   82.995 -8.543  1.00 114.20 ? 571  LEU A CB  1 
ATOM 4448 C CG  . LEU A 1 574  ? -0.197  82.783 -8.666  1.00 114.20 ? 571  LEU A CG  1 
ATOM 4449 C CD1 . LEU A 1 574  ? -0.581  81.337 -9.027  1.00 114.20 ? 571  LEU A CD1 1 
ATOM 4450 C CD2 . LEU A 1 574  ? -0.913  83.245 -7.406  1.00 114.20 ? 571  LEU A CD2 1 
ATOM 4451 N N   . PRO A 1 575  ? 1.252   84.606 -10.969 1.00 201.91 ? 572  PRO A N   1 
ATOM 4452 C CA  . PRO A 1 575  ? 0.671   85.154 -12.207 1.00 201.91 ? 572  PRO A CA  1 
ATOM 4453 C C   . PRO A 1 575  ? 1.644   85.040 -13.374 1.00 201.91 ? 572  PRO A C   1 
ATOM 4454 O O   . PRO A 1 575  ? 1.229   84.925 -14.528 1.00 201.91 ? 572  PRO A O   1 
ATOM 4455 C CB  . PRO A 1 575  ? 0.409   86.622 -11.855 1.00 190.85 ? 572  PRO A CB  1 
ATOM 4456 C CG  . PRO A 1 575  ? 0.249   86.629 -10.382 1.00 190.85 ? 572  PRO A CG  1 
ATOM 4457 C CD  . PRO A 1 575  ? 1.220   85.603 -9.879  1.00 190.85 ? 572  PRO A CD  1 
ATOM 4458 N N   . SER A 1 576  ? 2.932   85.050 -13.039 1.00 152.43 ? 573  SER A N   1 
ATOM 4459 C CA  . SER A 1 576  ? 4.013   84.792 -13.978 1.00 152.43 ? 573  SER A CA  1 
ATOM 4460 C C   . SER A 1 576  ? 4.021   83.332 -14.448 1.00 152.43 ? 573  SER A C   1 
ATOM 4461 O O   . SER A 1 576  ? 3.844   83.067 -15.641 1.00 152.43 ? 573  SER A O   1 
ATOM 4462 C CB  . SER A 1 576  ? 5.361   85.155 -13.339 1.00 140.79 ? 573  SER A CB  1 
ATOM 4463 O OG  . SER A 1 576  ? 5.579   84.423 -12.142 1.00 140.79 ? 573  SER A OG  1 
ATOM 4464 N N   . PHE A 1 577  ? 4.199   82.404 -13.499 1.00 131.16 ? 574  PHE A N   1 
ATOM 4465 C CA  . PHE A 1 577  ? 4.399   80.968 -13.763 1.00 131.16 ? 574  PHE A CA  1 
ATOM 4466 C C   . PHE A 1 577  ? 5.867   80.683 -14.101 1.00 131.16 ? 574  PHE A C   1 
ATOM 4467 O O   . PHE A 1 577  ? 6.159   79.952 -15.049 1.00 131.16 ? 574  PHE A O   1 
ATOM 4468 C CB  . PHE A 1 577  ? 3.509   80.451 -14.911 1.00 109.48 ? 574  PHE A CB  1 
ATOM 4469 C CG  . PHE A 1 577  ? 2.085   80.125 -14.519 1.00 109.48 ? 574  PHE A CG  1 
ATOM 4470 C CD1 . PHE A 1 577  ? 1.066   81.065 -14.676 1.00 109.48 ? 574  PHE A CD1 1 
ATOM 4471 C CD2 . PHE A 1 577  ? 1.751   78.858 -14.052 1.00 109.48 ? 574  PHE A CD2 1 
ATOM 4472 C CE1 . PHE A 1 577  ? -0.259  80.753 -14.335 1.00 109.48 ? 574  PHE A CE1 1 
ATOM 4473 C CE2 . PHE A 1 577  ? 0.432   78.547 -13.709 1.00 109.48 ? 574  PHE A CE2 1 
ATOM 4474 C CZ  . PHE A 1 577  ? -0.571  79.492 -13.853 1.00 109.48 ? 574  PHE A CZ  1 
ATOM 4475 N N   . GLU A 1 578  ? 6.791   81.254 -13.335 1.00 146.38 ? 575  GLU A N   1 
ATOM 4476 C CA  . GLU A 1 578  ? 8.212   81.107 -13.649 1.00 146.38 ? 575  GLU A CA  1 
ATOM 4477 C C   . GLU A 1 578  ? 8.888   79.924 -12.945 1.00 146.38 ? 575  GLU A C   1 
ATOM 4478 O O   . GLU A 1 578  ? 8.885   79.823 -11.720 1.00 146.38 ? 575  GLU A O   1 
ATOM 4479 C CB  . GLU A 1 578  ? 8.973   82.423 -13.427 1.00 148.98 ? 575  GLU A CB  1 
ATOM 4480 C CG  . GLU A 1 578  ? 8.640   83.144 -12.127 1.00 148.98 ? 575  GLU A CG  1 
ATOM 4481 C CD  . GLU A 1 578  ? 8.837   84.648 -12.209 1.00 148.98 ? 575  GLU A CD  1 
ATOM 4482 O OE1 . GLU A 1 578  ? 8.464   85.246 -13.241 1.00 148.98 ? 575  GLU A OE1 1 
ATOM 4483 O OE2 . GLU A 1 578  ? 9.353   85.234 -11.231 1.00 148.98 ? 575  GLU A OE2 1 
ATOM 4484 N N   . LEU A 1 579  ? 9.448   79.031 -13.757 1.00 95.98  ? 576  LEU A N   1 
ATOM 4485 C CA  . LEU A 1 579  ? 10.233  77.864 -13.315 1.00 95.98  ? 576  LEU A CA  1 
ATOM 4486 C C   . LEU A 1 579  ? 11.461  78.232 -12.474 1.00 95.98  ? 576  LEU A C   1 
ATOM 4487 O O   . LEU A 1 579  ? 12.343  78.963 -12.927 1.00 95.98  ? 576  LEU A O   1 
ATOM 4488 C CB  . LEU A 1 579  ? 10.650  77.034 -14.548 1.00 112.32 ? 576  LEU A CB  1 
ATOM 4489 C CG  . LEU A 1 579  ? 11.574  75.795 -14.601 1.00 112.32 ? 576  LEU A CG  1 
ATOM 4490 C CD1 . LEU A 1 579  ? 13.068  76.160 -14.623 1.00 112.32 ? 576  LEU A CD1 1 
ATOM 4491 C CD2 . LEU A 1 579  ? 11.271  74.740 -13.524 1.00 112.32 ? 576  LEU A CD2 1 
ATOM 4492 N N   . LEU A 1 580  ? 11.506  77.702 -11.255 1.00 206.81 ? 577  LEU A N   1 
ATOM 4493 C CA  . LEU A 1 580  ? 12.635  77.897 -10.348 1.00 206.81 ? 577  LEU A CA  1 
ATOM 4494 C C   . LEU A 1 580  ? 13.581  76.696 -10.408 1.00 206.81 ? 577  LEU A C   1 
ATOM 4495 O O   . LEU A 1 580  ? 14.179  76.405 -11.449 1.00 206.81 ? 577  LEU A O   1 
ATOM 4496 C CB  . LEU A 1 580  ? 12.137  78.103 -8.909  1.00 114.60 ? 577  LEU A CB  1 
ATOM 4497 C CG  . LEU A 1 580  ? 11.413  79.396 -8.530  1.00 114.60 ? 577  LEU A CG  1 
ATOM 4498 C CD1 . LEU A 1 580  ? 9.948   79.339 -8.903  1.00 114.60 ? 577  LEU A CD1 1 
ATOM 4499 C CD2 . LEU A 1 580  ? 11.572  79.662 -7.038  1.00 114.60 ? 577  LEU A CD2 1 
ATOM 4500 N N   . HIS A 1 581  ? 13.718  76.020 -9.270  1.00 109.51 ? 578  HIS A N   1 
ATOM 4501 C CA  . HIS A 1 581  ? 14.398  74.728 -9.177  1.00 109.51 ? 578  HIS A CA  1 
ATOM 4502 C C   . HIS A 1 581  ? 13.409  73.603 -9.510  1.00 109.51 ? 578  HIS A C   1 
ATOM 4503 O O   . HIS A 1 581  ? 12.181  73.813 -9.560  1.00 109.51 ? 578  HIS A O   1 
ATOM 4504 C CB  . HIS A 1 581  ? 15.001  74.550 -7.771  1.00 140.09 ? 578  HIS A CB  1 
ATOM 4505 C CG  . HIS A 1 581  ? 15.176  73.122 -7.351  1.00 140.09 ? 578  HIS A CG  1 
ATOM 4506 N ND1 . HIS A 1 581  ? 16.234  72.345 -7.772  1.00 140.09 ? 578  HIS A ND1 1 
ATOM 4507 C CD2 . HIS A 1 581  ? 14.426  72.332 -6.546  1.00 140.09 ? 578  HIS A CD2 1 
ATOM 4508 C CE1 . HIS A 1 581  ? 16.129  71.139 -7.245  1.00 140.09 ? 578  HIS A CE1 1 
ATOM 4509 N NE2 . HIS A 1 581  ? 15.038  71.103 -6.500  1.00 140.09 ? 578  HIS A NE2 1 
ATOM 4510 N N   . LYS A 1 582  ? 13.953  72.415 -9.744  1.00 111.44 ? 579  LYS A N   1 
ATOM 4511 C CA  . LYS A 1 582  ? 13.148  71.265 -10.111 1.00 111.44 ? 579  LYS A CA  1 
ATOM 4512 C C   . LYS A 1 582  ? 13.857  69.944 -9.794  1.00 111.44 ? 579  LYS A C   1 
ATOM 4513 O O   . LYS A 1 582  ? 15.084  69.902 -9.645  1.00 111.44 ? 579  LYS A O   1 
ATOM 4514 C CB  . LYS A 1 582  ? 12.822  71.337 -11.600 1.00 81.47  ? 579  LYS A CB  1 
ATOM 4515 C CG  . LYS A 1 582  ? 14.034  71.540 -12.502 1.00 81.47  ? 579  LYS A CG  1 
ATOM 4516 C CD  . LYS A 1 582  ? 14.057  70.476 -13.603 1.00 81.47  ? 579  LYS A CD  1 
ATOM 4517 C CE  . LYS A 1 582  ? 14.241  69.053 -13.014 1.00 81.47  ? 579  LYS A CE  1 
ATOM 4518 N NZ  . LYS A 1 582  ? 13.736  67.983 -13.928 1.00 81.47  ? 579  LYS A NZ  1 
ATOM 4519 N N   . GLU A 1 583  ? 13.089  68.866 -9.695  1.00 115.54 ? 580  GLU A N   1 
ATOM 4520 C CA  . GLU A 1 583  ? 13.699  67.549 -9.605  1.00 115.54 ? 580  GLU A CA  1 
ATOM 4521 C C   . GLU A 1 583  ? 13.273  66.683 -10.781 1.00 115.54 ? 580  GLU A C   1 
ATOM 4522 O O   . GLU A 1 583  ? 12.120  66.722 -11.214 1.00 115.54 ? 580  GLU A O   1 
ATOM 4523 C CB  . GLU A 1 583  ? 13.385  66.881 -8.262  1.00 130.34 ? 580  GLU A CB  1 
ATOM 4524 C CG  . GLU A 1 583  ? 13.793  65.407 -8.164  1.00 130.34 ? 580  GLU A CG  1 
ATOM 4525 C CD  . GLU A 1 583  ? 15.280  65.178 -8.325  1.00 130.34 ? 580  GLU A CD  1 
ATOM 4526 O OE1 . GLU A 1 583  ? 16.017  65.387 -7.343  1.00 130.34 ? 580  GLU A OE1 1 
ATOM 4527 O OE2 . GLU A 1 583  ? 15.704  64.772 -9.428  1.00 130.34 ? 580  GLU A OE2 1 
ATOM 4528 N N   . MET A 1 584  ? 14.227  65.925 -11.307 1.00 147.67 ? 581  MET A N   1 
ATOM 4529 C CA  . MET A 1 584  ? 13.960  65.008 -12.404 1.00 147.67 ? 581  MET A CA  1 
ATOM 4530 C C   . MET A 1 584  ? 13.857  63.576 -11.886 1.00 147.67 ? 581  MET A C   1 
ATOM 4531 O O   . MET A 1 584  ? 14.677  62.723 -12.246 1.00 147.67 ? 581  MET A O   1 
ATOM 4532 C CB  . MET A 1 584  ? 15.056  65.110 -13.484 1.00 101.29 ? 581  MET A CB  1 
ATOM 4533 C CG  . MET A 1 584  ? 14.583  64.770 -14.910 1.00 101.29 ? 581  MET A CG  1 
ATOM 4534 S SD  . MET A 1 584  ? 13.862  66.194 -15.759 1.00 101.29 ? 581  MET A SD  1 
ATOM 4535 C CE  . MET A 1 584  ? 15.217  66.699 -16.844 1.00 101.29 ? 581  MET A CE  1 
ATOM 4536 N N   . LEU A 1 585  ? 12.853  63.317 -11.046 1.00 78.00  ? 582  LEU A N   1 
ATOM 4537 C CA  . LEU A 1 585  ? 12.597  61.953 -10.538 1.00 78.00  ? 582  LEU A CA  1 
ATOM 4538 C C   . LEU A 1 585  ? 12.645  60.923 -11.659 1.00 78.00  ? 582  LEU A C   1 
ATOM 4539 O O   . LEU A 1 585  ? 12.274  61.219 -12.798 1.00 78.00  ? 582  LEU A O   1 
ATOM 4540 C CB  . LEU A 1 585  ? 11.230  61.856 -9.858  1.00 49.67  ? 582  LEU A CB  1 
ATOM 4541 C CG  . LEU A 1 585  ? 10.497  63.176 -9.587  1.00 49.67  ? 582  LEU A CG  1 
ATOM 4542 C CD1 . LEU A 1 585  ? 9.014   62.944 -9.804  1.00 49.67  ? 582  LEU A CD1 1 
ATOM 4543 C CD2 . LEU A 1 585  ? 10.804  63.736 -8.180  1.00 49.67  ? 582  LEU A CD2 1 
ATOM 4544 N N   . GLY A 1 586  ? 13.108  59.720 -11.344 1.00 81.11  ? 583  GLY A N   1 
ATOM 4545 C CA  . GLY A 1 586  ? 13.269  58.696 -12.367 1.00 81.11  ? 583  GLY A CA  1 
ATOM 4546 C C   . GLY A 1 586  ? 11.924  58.128 -12.774 1.00 81.11  ? 583  GLY A C   1 
ATOM 4547 O O   . GLY A 1 586  ? 10.871  58.735 -12.526 1.00 81.11  ? 583  GLY A O   1 
ATOM 4548 N N   . GLY A 1 587  ? 11.957  56.956 -13.398 1.00 100.88 ? 584  GLY A N   1 
ATOM 4549 C CA  . GLY A 1 587  ? 10.747  56.177 -13.628 1.00 100.88 ? 584  GLY A CA  1 
ATOM 4550 C C   . GLY A 1 587  ? 9.923   56.582 -14.836 1.00 100.88 ? 584  GLY A C   1 
ATOM 4551 O O   . GLY A 1 587  ? 9.964   57.734 -15.287 1.00 100.88 ? 584  GLY A O   1 
ATOM 4552 N N   . GLU A 1 588  ? 9.180   55.602 -15.347 1.00 165.20 ? 585  GLU A N   1 
ATOM 4553 C CA  . GLU A 1 588  ? 8.247   55.779 -16.456 1.00 165.20 ? 585  GLU A CA  1 
ATOM 4554 C C   . GLU A 1 588  ? 6.845   56.104 -15.919 1.00 165.20 ? 585  GLU A C   1 
ATOM 4555 O O   . GLU A 1 588  ? 5.940   56.465 -16.682 1.00 165.20 ? 585  GLU A O   1 
ATOM 4556 C CB  . GLU A 1 588  ? 8.220   54.514 -17.337 1.00 110.81 ? 585  GLU A CB  1 
ATOM 4557 C CG  . GLU A 1 588  ? 9.600   53.962 -17.754 1.00 110.81 ? 585  GLU A CG  1 
ATOM 4558 C CD  . GLU A 1 588  ? 10.380  54.893 -18.688 1.00 110.81 ? 585  GLU A CD  1 
ATOM 4559 O OE1 . GLU A 1 588  ? 10.870  55.948 -18.222 1.00 110.81 ? 585  GLU A OE1 1 
ATOM 4560 O OE2 . GLU A 1 588  ? 10.522  54.559 -19.891 1.00 110.81 ? 585  GLU A OE2 1 
ATOM 4561 N N   . ILE A 1 589  ? 6.687   55.985 -14.598 1.00 88.85  ? 586  ILE A N   1 
ATOM 4562 C CA  . ILE A 1 589  ? 5.405   56.228 -13.923 1.00 88.85  ? 586  ILE A CA  1 
ATOM 4563 C C   . ILE A 1 589  ? 5.270   57.660 -13.395 1.00 88.85  ? 586  ILE A C   1 
ATOM 4564 O O   . ILE A 1 589  ? 6.213   58.238 -12.841 1.00 88.85  ? 586  ILE A O   1 
ATOM 4565 C CB  . ILE A 1 589  ? 5.114   55.173 -12.809 1.00 87.33  ? 586  ILE A CB  1 
ATOM 4566 C CG1 . ILE A 1 589  ? 4.796   53.783 -13.416 1.00 87.33  ? 586  ILE A CG1 1 
ATOM 4567 C CG2 . ILE A 1 589  ? 4.008   55.656 -11.884 1.00 87.33  ? 586  ILE A CG2 1 
ATOM 4568 C CD1 . ILE A 1 589  ? 3.523   53.691 -14.272 1.00 87.33  ? 586  ILE A CD1 1 
ATOM 4569 N N   . ILE A 1 590  ? 4.069   58.202 -13.591 1.00 89.50  ? 587  ILE A N   1 
ATOM 4570 C CA  . ILE A 1 590  ? 3.741   59.604 -13.326 1.00 89.50  ? 587  ILE A CA  1 
ATOM 4571 C C   . ILE A 1 590  ? 3.303   59.922 -11.918 1.00 89.50  ? 587  ILE A C   1 
ATOM 4572 O O   . ILE A 1 590  ? 2.471   59.218 -11.336 1.00 89.50  ? 587  ILE A O   1 
ATOM 4573 C CB  . ILE A 1 590  ? 2.602   60.126 -14.227 1.00 62.51  ? 587  ILE A CB  1 
ATOM 4574 C CG1 . ILE A 1 590  ? 1.433   59.107 -14.331 1.00 62.51  ? 587  ILE A CG1 1 
ATOM 4575 C CG2 . ILE A 1 590  ? 3.164   60.623 -15.551 1.00 62.51  ? 587  ILE A CG2 1 
ATOM 4576 C CD1 . ILE A 1 590  ? 1.799   57.616 -14.716 1.00 62.51  ? 587  ILE A CD1 1 
ATOM 4577 N N   . PRO A 1 591  ? 3.816   61.040 -11.402 1.00 63.88  ? 588  PRO A N   1 
ATOM 4578 C CA  . PRO A 1 591  ? 3.488   61.579 -10.107 1.00 63.88  ? 588  PRO A CA  1 
ATOM 4579 C C   . PRO A 1 591  ? 1.994   61.804 -10.107 1.00 63.88  ? 588  PRO A C   1 
ATOM 4580 O O   . PRO A 1 591  ? 1.519   62.670 -10.842 1.00 63.88  ? 588  PRO A O   1 
ATOM 4581 C CB  . PRO A 1 591  ? 4.203   62.927 -10.119 1.00 63.04  ? 588  PRO A CB  1 
ATOM 4582 C CG  . PRO A 1 591  ? 4.407   63.247 -11.561 1.00 63.04  ? 588  PRO A CG  1 
ATOM 4583 C CD  . PRO A 1 591  ? 4.731   61.925 -12.139 1.00 63.04  ? 588  PRO A CD  1 
ATOM 4584 N N   . ARG A 1 592  ? 1.248   61.010 -9.352  1.00 72.19  ? 589  ARG A N   1 
ATOM 4585 C CA  . ARG A 1 592  ? -0.199  61.101 -9.394  1.00 72.19  ? 589  ARG A CA  1 
ATOM 4586 C C   . ARG A 1 592  ? -0.741  62.151 -8.398  1.00 72.19  ? 589  ARG A C   1 
ATOM 4587 O O   . ARG A 1 592  ? -1.955  62.369 -8.281  1.00 72.19  ? 589  ARG A O   1 
ATOM 4588 C CB  . ARG A 1 592  ? -0.804  59.718 -9.155  1.00 125.98 ? 589  ARG A CB  1 
ATOM 4589 C CG  . ARG A 1 592  ? -1.970  59.369 -10.082 1.00 125.98 ? 589  ARG A CG  1 
ATOM 4590 C CD  . ARG A 1 592  ? -3.303  59.687 -9.423  1.00 125.98 ? 589  ARG A CD  1 
ATOM 4591 N NE  . ARG A 1 592  ? -4.435  59.147 -10.163 1.00 125.98 ? 589  ARG A NE  1 
ATOM 4592 C CZ  . ARG A 1 592  ? -5.655  58.996 -9.658  1.00 125.98 ? 589  ARG A CZ  1 
ATOM 4593 N NH1 . ARG A 1 592  ? -5.910  59.342 -8.400  1.00 125.98 ? 589  ARG A NH1 1 
ATOM 4594 N NH2 . ARG A 1 592  ? -6.624  58.491 -10.412 1.00 125.98 ? 589  ARG A NH2 1 
ATOM 4595 N N   . SER A 1 593  ? 0.162   62.823 -7.691  1.00 59.56  ? 590  SER A N   1 
ATOM 4596 C CA  . SER A 1 593  ? -0.274  63.697 -6.614  1.00 59.56  ? 590  SER A CA  1 
ATOM 4597 C C   . SER A 1 593  ? 0.881   64.459 -6.002  1.00 59.56  ? 590  SER A C   1 
ATOM 4598 O O   . SER A 1 593  ? 1.886   63.867 -5.632  1.00 59.56  ? 590  SER A O   1 
ATOM 4599 C CB  . SER A 1 593  ? -0.956  62.881 -5.523  1.00 87.75  ? 590  SER A CB  1 
ATOM 4600 O OG  . SER A 1 593  ? -1.724  63.731 -4.697  1.00 87.75  ? 590  SER A OG  1 
ATOM 4601 N N   . ILE A 1 594  ? 0.719   65.770 -5.893  1.00 84.48  ? 591  ILE A N   1 
ATOM 4602 C CA  . ILE A 1 594  ? 1.757   66.620 -5.355  1.00 84.48  ? 591  ILE A CA  1 
ATOM 4603 C C   . ILE A 1 594  ? 1.131   67.437 -4.232  1.00 84.48  ? 591  ILE A C   1 
ATOM 4604 O O   . ILE A 1 594  ? -0.015  67.882 -4.356  1.00 84.48  ? 591  ILE A O   1 
ATOM 4605 C CB  . ILE A 1 594  ? 2.415   67.500 -6.491  1.00 91.89  ? 591  ILE A CB  1 
ATOM 4606 C CG1 . ILE A 1 594  ? 3.803   67.999 -6.100  1.00 91.89  ? 591  ILE A CG1 1 
ATOM 4607 C CG2 . ILE A 1 594  ? 1.534   68.655 -6.935  1.00 91.89  ? 591  ILE A CG2 1 
ATOM 4608 C CD1 . ILE A 1 594  ? 4.904   67.083 -6.537  1.00 91.89  ? 591  ILE A CD1 1 
ATOM 4609 N N   . LEU A 1 595  ? 1.849   67.601 -3.122  1.00 86.65  ? 592  LEU A N   1 
ATOM 4610 C CA  . LEU A 1 595  ? 1.289   68.364 -2.014  1.00 86.65  ? 592  LEU A CA  1 
ATOM 4611 C C   . LEU A 1 595  ? 2.277   69.280 -1.338  1.00 86.65  ? 592  LEU A C   1 
ATOM 4612 O O   . LEU A 1 595  ? 3.413   68.880 -1.062  1.00 86.65  ? 592  LEU A O   1 
ATOM 4613 C CB  . LEU A 1 595  ? 0.624   67.449 -0.980  1.00 146.13 ? 592  LEU A CB  1 
ATOM 4614 C CG  . LEU A 1 595  ? -0.166  68.066 0.191   1.00 146.13 ? 592  LEU A CG  1 
ATOM 4615 C CD1 . LEU A 1 595  ? -1.179  69.139 -0.215  1.00 146.13 ? 592  LEU A CD1 1 
ATOM 4616 C CD2 . LEU A 1 595  ? -0.878  66.978 0.958   1.00 146.13 ? 592  LEU A CD2 1 
ATOM 4617 N N   . MET A 1 596  ? 1.814   70.511 -1.092  1.00 134.96 ? 593  MET A N   1 
ATOM 4618 C CA  . MET A 1 596  ? 2.483   71.521 -0.265  1.00 134.96 ? 593  MET A CA  1 
ATOM 4619 C C   . MET A 1 596  ? 1.661   71.788 0.994   1.00 134.96 ? 593  MET A C   1 
ATOM 4620 O O   . MET A 1 596  ? 0.427   71.866 0.932   1.00 134.96 ? 593  MET A O   1 
ATOM 4621 C CB  . MET A 1 596  ? 2.679   72.835 -1.043  1.00 117.03 ? 593  MET A CB  1 
ATOM 4622 C CG  . MET A 1 596  ? 1.439   73.771 -1.111  1.00 117.03 ? 593  MET A CG  1 
ATOM 4623 S SD  . MET A 1 596  ? 1.622   75.323 -2.047  1.00 117.03 ? 593  MET A SD  1 
ATOM 4624 C CE  . MET A 1 596  ? 2.294   74.736 -3.608  1.00 117.03 ? 593  MET A CE  1 
ATOM 4625 N N   . THR A 1 597  ? 2.347   71.947 2.125   1.00 184.09 ? 594  THR A N   1 
ATOM 4626 C CA  . THR A 1 597  ? 1.685   72.140 3.422   1.00 184.09 ? 594  THR A CA  1 
ATOM 4627 C C   . THR A 1 597  ? 2.486   72.981 4.417   1.00 184.09 ? 594  THR A C   1 
ATOM 4628 O O   . THR A 1 597  ? 3.484   73.610 4.061   1.00 184.09 ? 594  THR A O   1 
ATOM 4629 C CB  . THR A 1 597  ? 1.438   70.801 4.125   1.00 82.81  ? 594  THR A CB  1 
ATOM 4630 O OG1 . THR A 1 597  ? 2.644   70.036 4.093   1.00 82.81  ? 594  THR A OG1 1 
ATOM 4631 C CG2 . THR A 1 597  ? 0.331   70.011 3.451   1.00 82.81  ? 594  THR A CG2 1 
ATOM 4632 N N   . THR A 1 598  ? 2.014   72.965 5.667   1.00 99.86  ? 595  THR A N   1 
ATOM 4633 C CA  . THR A 1 598  ? 2.675   73.566 6.844   1.00 99.86  ? 595  THR A CA  1 
ATOM 4634 C C   . THR A 1 598  ? 2.406   72.602 8.009   1.00 99.86  ? 595  THR A C   1 
ATOM 4635 O O   . THR A 1 598  ? 1.464   71.808 7.938   1.00 99.86  ? 595  THR A O   1 
ATOM 4636 C CB  . THR A 1 598  ? 2.125   74.991 7.166   1.00 186.76 ? 595  THR A CB  1 
ATOM 4637 O OG1 . THR A 1 598  ? 2.266   75.834 6.017   1.00 186.76 ? 595  THR A OG1 1 
ATOM 4638 C CG2 . THR A 1 598  ? 2.872   75.639 8.334   1.00 186.76 ? 595  THR A CG2 1 
ATOM 4639 N N   . PHE A 1 599  ? 3.217   72.656 9.070   1.00 164.41 ? 596  PHE A N   1 
ATOM 4640 C CA  . PHE A 1 599  ? 3.018   71.753 10.214  1.00 164.41 ? 596  PHE A CA  1 
ATOM 4641 C C   . PHE A 1 599  ? 3.128   72.367 11.616  1.00 164.41 ? 596  PHE A C   1 
ATOM 4642 O O   . PHE A 1 599  ? 2.140   72.879 12.144  1.00 164.41 ? 596  PHE A O   1 
ATOM 4643 C CB  . PHE A 1 599  ? 3.857   70.476 10.048  1.00 119.41 ? 596  PHE A CB  1 
ATOM 4644 C CG  . PHE A 1 599  ? 3.191   69.439 9.172   1.00 119.41 ? 596  PHE A CG  1 
ATOM 4645 C CD1 . PHE A 1 599  ? 3.373   69.447 7.793   1.00 119.41 ? 596  PHE A CD1 1 
ATOM 4646 C CD2 . PHE A 1 599  ? 2.347   68.478 9.727   1.00 119.41 ? 596  PHE A CD2 1 
ATOM 4647 C CE1 . PHE A 1 599  ? 2.748   68.506 6.979   1.00 119.41 ? 596  PHE A CE1 1 
ATOM 4648 C CE2 . PHE A 1 599  ? 1.717   67.528 8.921   1.00 119.41 ? 596  PHE A CE2 1 
ATOM 4649 C CZ  . PHE A 1 599  ? 1.919   67.545 7.542   1.00 119.41 ? 596  PHE A CZ  1 
ATOM 4650 N N   . GLU A 1 600  ? 4.308   72.308 12.223  1.00 184.43 ? 597  GLU A N   1 
ATOM 4651 C CA  . GLU A 1 600  ? 4.538   73.019 13.476  1.00 184.43 ? 597  GLU A CA  1 
ATOM 4652 C C   . GLU A 1 600  ? 5.091   74.390 13.111  1.00 184.43 ? 597  GLU A C   1 
ATOM 4653 O O   . GLU A 1 600  ? 4.435   75.416 13.303  1.00 184.43 ? 597  GLU A O   1 
ATOM 4654 C CB  . GLU A 1 600  ? 5.513   72.259 14.383  1.00 156.54 ? 597  GLU A CB  1 
ATOM 4655 C CG  . GLU A 1 600  ? 5.154   70.795 14.615  1.00 156.54 ? 597  GLU A CG  1 
ATOM 4656 C CD  . GLU A 1 600  ? 6.093   69.832 13.909  1.00 156.54 ? 597  GLU A CD  1 
ATOM 4657 O OE1 . GLU A 1 600  ? 7.155   69.532 14.482  1.00 156.54 ? 597  GLU A OE1 1 
ATOM 4658 O OE2 . GLU A 1 600  ? 5.768   69.361 12.797  1.00 156.54 ? 597  GLU A OE2 1 
ATOM 4659 N N   . SER A 1 601  ? 6.302   74.381 12.566  1.00 193.36 ? 598  SER A N   1 
ATOM 4660 C CA  . SER A 1 601  ? 6.925   75.561 11.996  1.00 193.36 ? 598  SER A CA  1 
ATOM 4661 C C   . SER A 1 601  ? 7.820   75.109 10.846  1.00 193.36 ? 598  SER A C   1 
ATOM 4662 O O   . SER A 1 601  ? 9.041   75.022 10.988  1.00 193.36 ? 598  SER A O   1 
ATOM 4663 C CB  . SER A 1 601  ? 7.712   76.336 13.061  1.00 147.83 ? 598  SER A CB  1 
ATOM 4664 O OG  . SER A 1 601  ? 6.853   77.152 13.838  1.00 147.83 ? 598  SER A OG  1 
ATOM 4665 N N   . SER A 1 602  ? 7.189   74.790 9.717   1.00 211.74 ? 599  SER A N   1 
ATOM 4666 C CA  . SER A 1 602  ? 7.887   74.379 8.496   1.00 211.74 ? 599  SER A CA  1 
ATOM 4667 C C   . SER A 1 602  ? 6.921   74.230 7.329   1.00 211.74 ? 599  SER A C   1 
ATOM 4668 O O   . SER A 1 602  ? 5.737   73.970 7.529   1.00 211.74 ? 599  SER A O   1 
ATOM 4669 C CB  . SER A 1 602  ? 8.629   73.054 8.700   1.00 135.13 ? 599  SER A CB  1 
ATOM 4670 O OG  . SER A 1 602  ? 9.124   72.548 7.469   1.00 135.13 ? 599  SER A OG  1 
ATOM 4671 N N   . HIS A 1 603  ? 7.441   74.389 6.114   1.00 211.73 ? 600  HIS A N   1 
ATOM 4672 C CA  . HIS A 1 603  ? 6.667   74.159 4.897   1.00 211.73 ? 600  HIS A CA  1 
ATOM 4673 C C   . HIS A 1 603  ? 7.271   72.990 4.114   1.00 211.73 ? 600  HIS A C   1 
ATOM 4674 O O   . HIS A 1 603  ? 8.492   72.816 4.090   1.00 211.73 ? 600  HIS A O   1 
ATOM 4675 C CB  . HIS A 1 603  ? 6.590   75.431 4.045   1.00 97.71  ? 600  HIS A CB  1 
ATOM 4676 C CG  . HIS A 1 603  ? 6.170   76.650 4.812   1.00 97.71  ? 600  HIS A CG  1 
ATOM 4677 N ND1 . HIS A 1 603  ? 4.850   77.012 4.973   1.00 97.71  ? 600  HIS A ND1 1 
ATOM 4678 C CD2 . HIS A 1 603  ? 6.898   77.584 5.470   1.00 97.71  ? 600  HIS A CD2 1 
ATOM 4679 C CE1 . HIS A 1 603  ? 4.782   78.117 5.695   1.00 97.71  ? 600  HIS A CE1 1 
ATOM 4680 N NE2 . HIS A 1 603  ? 6.011   78.488 6.004   1.00 97.71  ? 600  HIS A NE2 1 
ATOM 4681 N N   . TYR A 1 604  ? 6.408   72.195 3.483   1.00 110.79 ? 601  TYR A N   1 
ATOM 4682 C CA  . TYR A 1 604  ? 6.803   70.909 2.903   1.00 110.79 ? 601  TYR A CA  1 
ATOM 4683 C C   . TYR A 1 604  ? 6.286   70.677 1.481   1.00 110.79 ? 601  TYR A C   1 
ATOM 4684 O O   . TYR A 1 604  ? 5.192   71.121 1.120   1.00 110.79 ? 601  TYR A O   1 
ATOM 4685 C CB  . TYR A 1 604  ? 6.296   69.761 3.777   1.00 129.65 ? 601  TYR A CB  1 
ATOM 4686 C CG  . TYR A 1 604  ? 6.786   69.730 5.210   1.00 129.65 ? 601  TYR A CG  1 
ATOM 4687 C CD1 . TYR A 1 604  ? 6.155   70.477 6.202   1.00 129.65 ? 601  TYR A CD1 1 
ATOM 4688 C CD2 . TYR A 1 604  ? 7.848   68.911 5.584   1.00 129.65 ? 601  TYR A CD2 1 
ATOM 4689 C CE1 . TYR A 1 604  ? 6.587   70.426 7.526   1.00 129.65 ? 601  TYR A CE1 1 
ATOM 4690 C CE2 . TYR A 1 604  ? 8.287   68.853 6.906   1.00 129.65 ? 601  TYR A CE2 1 
ATOM 4691 C CZ  . TYR A 1 604  ? 7.651   69.611 7.871   1.00 129.65 ? 601  TYR A CZ  1 
ATOM 4692 O OH  . TYR A 1 604  ? 8.082   69.556 9.178   1.00 129.65 ? 601  TYR A OH  1 
ATOM 4693 N N   . LEU A 1 605  ? 7.077   69.946 0.698   1.00 141.76 ? 602  LEU A N   1 
ATOM 4694 C CA  . LEU A 1 605  ? 6.678   69.512 -0.633  1.00 141.76 ? 602  LEU A CA  1 
ATOM 4695 C C   . LEU A 1 605  ? 6.725   67.998 -0.776  1.00 141.76 ? 602  LEU A C   1 
ATOM 4696 O O   . LEU A 1 605  ? 7.778   67.362 -0.646  1.00 141.76 ? 602  LEU A O   1 
ATOM 4697 C CB  . LEU A 1 605  ? 7.533   70.174 -1.705  1.00 120.48 ? 602  LEU A CB  1 
ATOM 4698 C CG  . LEU A 1 605  ? 7.530   69.484 -3.069  1.00 120.48 ? 602  LEU A CG  1 
ATOM 4699 C CD1 . LEU A 1 605  ? 7.198   70.462 -4.161  1.00 120.48 ? 602  LEU A CD1 1 
ATOM 4700 C CD2 . LEU A 1 605  ? 8.856   68.782 -3.327  1.00 120.48 ? 602  LEU A CD2 1 
ATOM 4701 N N   . LEU A 1 606  ? 5.564   67.438 -1.079  1.00 116.74 ? 603  LEU A N   1 
ATOM 4702 C CA  . LEU A 1 606  ? 5.383   66.000 -1.117  1.00 116.74 ? 603  LEU A CA  1 
ATOM 4703 C C   . LEU A 1 606  ? 4.871   65.590 -2.468  1.00 116.74 ? 603  LEU A C   1 
ATOM 4704 O O   . LEU A 1 606  ? 4.002   66.245 -3.044  1.00 116.74 ? 603  LEU A O   1 
ATOM 4705 C CB  . LEU A 1 606  ? 4.378   65.557 -0.052  1.00 110.75 ? 603  LEU A CB  1 
ATOM 4706 C CG  . LEU A 1 606  ? 4.711   65.768 1.428   1.00 110.75 ? 603  LEU A CG  1 
ATOM 4707 C CD1 . LEU A 1 606  ? 4.239   67.122 1.980   1.00 110.75 ? 603  LEU A CD1 1 
ATOM 4708 C CD2 . LEU A 1 606  ? 4.089   64.634 2.204   1.00 110.75 ? 603  LEU A CD2 1 
ATOM 4709 N N   . CYS A 1 607  ? 5.408   64.487 -2.964  1.00 51.62  ? 604  CYS A N   1 
ATOM 4710 C CA  . CYS A 1 607  ? 4.988   63.995 -4.243  1.00 51.62  ? 604  CYS A CA  1 
ATOM 4711 C C   . CYS A 1 607  ? 4.811   62.490 -4.312  1.00 51.62  ? 604  CYS A C   1 
ATOM 4712 O O   . CYS A 1 607  ? 5.777   61.743 -4.203  1.00 51.62  ? 604  CYS A O   1 
ATOM 4713 C CB  . CYS A 1 607  ? 5.965   64.420 -5.316  1.00 81.74  ? 604  CYS A CB  1 
ATOM 4714 S SG  . CYS A 1 607  ? 5.366   63.901 -6.931  1.00 81.74  ? 604  CYS A SG  1 
ATOM 4715 N N   . ALA A 1 608  ? 3.581   62.041 -4.534  1.00 71.35  ? 605  ALA A N   1 
ATOM 4716 C CA  . ALA A 1 608  ? 3.313   60.614 -4.687  1.00 71.35  ? 605  ALA A CA  1 
ATOM 4717 C C   . ALA A 1 608  ? 3.297   60.270 -6.133  1.00 71.35  ? 605  ALA A C   1 
ATOM 4718 O O   . ALA A 1 608  ? 2.714   60.995 -6.930  1.00 71.35  ? 605  ALA A O   1 
ATOM 4719 C CB  . ALA A 1 608  ? 1.995   60.273 -4.101  1.00 60.45  ? 605  ALA A CB  1 
ATOM 4720 N N   . LEU A 1 609  ? 3.938   59.162 -6.470  1.00 67.60  ? 606  LEU A N   1 
ATOM 4721 C CA  . LEU A 1 609  ? 3.853   58.626 -7.808  1.00 67.60  ? 606  LEU A CA  1 
ATOM 4722 C C   . LEU A 1 609  ? 2.830   57.514 -7.817  1.00 67.60  ? 606  LEU A C   1 
ATOM 4723 O O   . LEU A 1 609  ? 2.270   57.172 -6.777  1.00 67.60  ? 606  LEU A O   1 
ATOM 4724 C CB  . LEU A 1 609  ? 5.181   58.053 -8.257  1.00 64.15  ? 606  LEU A CB  1 
ATOM 4725 C CG  . LEU A 1 609  ? 6.508   58.760 -8.064  1.00 64.15  ? 606  LEU A CG  1 
ATOM 4726 C CD1 . LEU A 1 609  ? 7.525   57.850 -8.712  1.00 64.15  ? 606  LEU A CD1 1 
ATOM 4727 C CD2 . LEU A 1 609  ? 6.565   60.176 -8.662  1.00 64.15  ? 606  LEU A CD2 1 
ATOM 4728 N N   . GLY A 1 610  ? 2.615   56.928 -8.987  1.00 55.02  ? 607  GLY A N   1 
ATOM 4729 C CA  . GLY A 1 610  ? 1.580   55.939 -9.172  1.00 55.02  ? 607  GLY A CA  1 
ATOM 4730 C C   . GLY A 1 610  ? 2.055   54.528 -8.910  1.00 55.02  ? 607  GLY A C   1 
ATOM 4731 O O   . GLY A 1 610  ? 1.242   53.605 -8.803  1.00 55.02  ? 607  GLY A O   1 
ATOM 4732 N N   . ASP A 1 611  ? 3.373   54.348 -8.821  1.00 103.55 ? 608  ASP A N   1 
ATOM 4733 C CA  . ASP A 1 611  ? 3.986   53.041 -8.533  1.00 103.55 ? 608  ASP A CA  1 
ATOM 4734 C C   . ASP A 1 611  ? 3.678   52.642 -7.102  1.00 103.55 ? 608  ASP A C   1 
ATOM 4735 O O   . ASP A 1 611  ? 3.775   51.465 -6.741  1.00 103.55 ? 608  ASP A O   1 
ATOM 4736 C CB  . ASP A 1 611  ? 5.498   53.132 -8.694  1.00 101.31 ? 608  ASP A CB  1 
ATOM 4737 C CG  . ASP A 1 611  ? 6.095   54.278 -7.891  1.00 101.31 ? 608  ASP A CG  1 
ATOM 4738 O OD1 . ASP A 1 611  ? 7.339   54.381 -7.829  1.00 101.31 ? 608  ASP A OD1 1 
ATOM 4739 O OD2 . ASP A 1 611  ? 5.317   55.080 -7.322  1.00 101.31 ? 608  ASP A OD2 1 
ATOM 4740 N N   . GLY A 1 612  ? 3.318   53.650 -6.305  1.00 90.73  ? 609  GLY A N   1 
ATOM 4741 C CA  . GLY A 1 612  ? 3.015   53.489 -4.896  1.00 90.73  ? 609  GLY A CA  1 
ATOM 4742 C C   . GLY A 1 612  ? 3.995   54.269 -4.044  1.00 90.73  ? 609  GLY A C   1 
ATOM 4743 O O   . GLY A 1 612  ? 3.652   54.715 -2.943  1.00 90.73  ? 609  GLY A O   1 
ATOM 4744 N N   . ALA A 1 613  ? 5.210   54.445 -4.573  1.00 65.10  ? 610  ALA A N   1 
ATOM 4745 C CA  . ALA A 1 613  ? 6.322   55.058 -3.842  1.00 65.10  ? 610  ALA A CA  1 
ATOM 4746 C C   . ALA A 1 613  ? 6.099   56.539 -3.660  1.00 65.10  ? 610  ALA A C   1 
ATOM 4747 O O   . ALA A 1 613  ? 5.179   57.087 -4.257  1.00 65.10  ? 610  ALA A O   1 
ATOM 4748 C CB  . ALA A 1 613  ? 7.636   54.793 -4.563  1.00 105.81 ? 610  ALA A CB  1 
ATOM 4749 N N   . LEU A 1 614  ? 6.908   57.180 -2.822  1.00 92.16  ? 611  LEU A N   1 
ATOM 4750 C CA  . LEU A 1 614  ? 6.792   58.615 -2.614  1.00 92.16  ? 611  LEU A CA  1 
ATOM 4751 C C   . LEU A 1 614  ? 8.148   59.327 -2.484  1.00 92.16  ? 611  LEU A C   1 
ATOM 4752 O O   . LEU A 1 614  ? 9.175   58.686 -2.270  1.00 92.16  ? 611  LEU A O   1 
ATOM 4753 C CB  . LEU A 1 614  ? 5.878   58.904 -1.426  1.00 64.46  ? 611  LEU A CB  1 
ATOM 4754 C CG  . LEU A 1 614  ? 5.738   60.362 -0.954  1.00 64.46  ? 611  LEU A CG  1 
ATOM 4755 C CD1 . LEU A 1 614  ? 4.339   60.728 -0.446  1.00 64.46  ? 611  LEU A CD1 1 
ATOM 4756 C CD2 . LEU A 1 614  ? 6.772   60.641 0.122   1.00 64.46  ? 611  LEU A CD2 1 
ATOM 4757 N N   . PHE A 1 615  ? 8.159   60.656 -2.563  1.00 89.44  ? 612  PHE A N   1 
ATOM 4758 C CA  . PHE A 1 615  ? 9.361   61.492 -2.433  1.00 89.44  ? 612  PHE A CA  1 
ATOM 4759 C C   . PHE A 1 615  ? 8.797   62.587 -1.583  1.00 89.44  ? 612  PHE A C   1 
ATOM 4760 O O   . PHE A 1 615  ? 7.691   62.972 -1.828  1.00 89.44  ? 612  PHE A O   1 
ATOM 4761 C CB  . PHE A 1 615  ? 9.793   62.035 -3.769  1.00 86.94  ? 612  PHE A CB  1 
ATOM 4762 C CG  . PHE A 1 615  ? 10.353  61.000 -4.677  1.00 86.94  ? 612  PHE A CG  1 
ATOM 4763 C CD1 . PHE A 1 615  ? 9.587   60.442 -5.647  1.00 86.94  ? 612  PHE A CD1 1 
ATOM 4764 C CD2 . PHE A 1 615  ? 11.648  60.585 -4.555  1.00 86.94  ? 612  PHE A CD2 1 
ATOM 4765 C CE1 . PHE A 1 615  ? 10.099  59.500 -6.465  1.00 86.94  ? 612  PHE A CE1 1 
ATOM 4766 C CE2 . PHE A 1 615  ? 12.158  59.642 -5.384  1.00 86.94  ? 612  PHE A CE2 1 
ATOM 4767 C CZ  . PHE A 1 615  ? 11.385  59.102 -6.335  1.00 86.94  ? 612  PHE A CZ  1 
ATOM 4768 N N   . TYR A 1 616  ? 9.530   63.072 -0.585  1.00 148.98 ? 613  TYR A N   1 
ATOM 4769 C CA  . TYR A 1 616  ? 9.076   64.145 0.325   1.00 148.98 ? 613  TYR A CA  1 
ATOM 4770 C C   . TYR A 1 616  ? 10.221  65.170 0.195   1.00 148.98 ? 613  TYR A C   1 
ATOM 4771 O O   . TYR A 1 616  ? 11.343  64.782 0.010   1.00 148.98 ? 613  TYR A O   1 
ATOM 4772 C CB  . TYR A 1 616  ? 8.968   63.624 1.752   1.00 155.42 ? 613  TYR A CB  1 
ATOM 4773 C CG  . TYR A 1 616  ? 9.714   64.435 2.785   1.00 155.42 ? 613  TYR A CG  1 
ATOM 4774 C CD1 . TYR A 1 616  ? 10.189  65.715 2.499   1.00 155.42 ? 613  TYR A CD1 1 
ATOM 4775 C CD2 . TYR A 1 616  ? 9.944   63.921 4.052   1.00 155.42 ? 613  TYR A CD2 1 
ATOM 4776 C CE1 . TYR A 1 616  ? 10.867  66.457 3.460   1.00 155.42 ? 613  TYR A CE1 1 
ATOM 4777 C CE2 . TYR A 1 616  ? 10.625  64.650 4.999   1.00 155.42 ? 613  TYR A CE2 1 
ATOM 4778 C CZ  . TYR A 1 616  ? 11.083  65.916 4.704   1.00 155.42 ? 613  TYR A CZ  1 
ATOM 4779 O OH  . TYR A 1 616  ? 11.758  66.626 5.671   1.00 155.42 ? 613  TYR A OH  1 
ATOM 4780 N N   . PHE A 1 617  ? 9.961   66.466 0.275   1.00 106.89 ? 614  PHE A N   1 
ATOM 4781 C CA  . PHE A 1 617  ? 11.037  67.452 0.159   1.00 106.89 ? 614  PHE A CA  1 
ATOM 4782 C C   . PHE A 1 617  ? 10.582  68.683 0.946   1.00 106.89 ? 614  PHE A C   1 
ATOM 4783 O O   . PHE A 1 617  ? 9.412   68.847 1.174   1.00 106.89 ? 614  PHE A O   1 
ATOM 4784 C CB  . PHE A 1 617  ? 11.310  67.811 -1.285  1.00 103.22 ? 614  PHE A CB  1 
ATOM 4785 C CG  . PHE A 1 617  ? 12.095  66.782 -2.006  1.00 103.22 ? 614  PHE A CG  1 
ATOM 4786 C CD1 . PHE A 1 617  ? 11.891  66.560 -3.346  1.00 103.22 ? 614  PHE A CD1 1 
ATOM 4787 C CD2 . PHE A 1 617  ? 13.021  66.017 -1.326  1.00 103.22 ? 614  PHE A CD2 1 
ATOM 4788 C CE1 . PHE A 1 617  ? 12.597  65.606 -3.995  1.00 103.22 ? 614  PHE A CE1 1 
ATOM 4789 C CE2 . PHE A 1 617  ? 13.736  65.075 -1.972  1.00 103.22 ? 614  PHE A CE2 1 
ATOM 4790 C CZ  . PHE A 1 617  ? 13.523  64.865 -3.321  1.00 103.22 ? 614  PHE A CZ  1 
ATOM 4791 N N   . GLY A 1 618  ? 11.486  69.555 1.377   1.00 122.38 ? 615  GLY A N   1 
ATOM 4792 C CA  . GLY A 1 618  ? 11.057  70.738 2.123   1.00 122.38 ? 615  GLY A CA  1 
ATOM 4793 C C   . GLY A 1 618  ? 11.035  71.986 1.255   1.00 122.38 ? 615  GLY A C   1 
ATOM 4794 O O   . GLY A 1 618  ? 12.008  72.317 0.567   1.00 122.38 ? 615  GLY A O   1 
ATOM 4795 N N   . LEU A 1 619  ? 9.900   72.674 1.302   1.00 212.91 ? 616  LEU A N   1 
ATOM 4796 C CA  . LEU A 1 619  ? 9.664   73.870 0.510   1.00 212.91 ? 616  LEU A CA  1 
ATOM 4797 C C   . LEU A 1 619  ? 9.944   75.117 1.333   1.00 212.91 ? 616  LEU A C   1 
ATOM 4798 O O   . LEU A 1 619  ? 9.844   75.100 2.563   1.00 212.91 ? 616  LEU A O   1 
ATOM 4799 C CB  . LEU A 1 619  ? 8.212   73.891 0.030   1.00 183.99 ? 616  LEU A CB  1 
ATOM 4800 C CG  . LEU A 1 619  ? 7.780   74.927 -1.008  1.00 183.99 ? 616  LEU A CG  1 
ATOM 4801 C CD1 . LEU A 1 619  ? 8.203   74.496 -2.404  1.00 183.99 ? 616  LEU A CD1 1 
ATOM 4802 C CD2 . LEU A 1 619  ? 6.277   75.121 -0.939  1.00 183.99 ? 616  LEU A CD2 1 
ATOM 4803 N N   . ASN A 1 620  ? 10.288  76.199 0.644   1.00 129.05 ? 617  ASN A N   1 
ATOM 4804 C CA  . ASN A 1 620  ? 10.534  77.468 1.303   1.00 129.05 ? 617  ASN A CA  1 
ATOM 4805 C C   . ASN A 1 620  ? 9.594   78.534 0.780   1.00 129.05 ? 617  ASN A C   1 
ATOM 4806 O O   . ASN A 1 620  ? 9.742   79.001 -0.346  1.00 129.05 ? 617  ASN A O   1 
ATOM 4807 C CB  . ASN A 1 620  ? 11.988  77.884 1.118   1.00 97.19  ? 617  ASN A CB  1 
ATOM 4808 C CG  . ASN A 1 620  ? 12.950  76.780 1.493   1.00 97.19  ? 617  ASN A CG  1 
ATOM 4809 O OD1 . ASN A 1 620  ? 13.259  76.587 2.672   1.00 97.19  ? 617  ASN A OD1 1 
ATOM 4810 N ND2 . ASN A 1 620  ? 13.421  76.032 0.489   1.00 97.19  ? 617  ASN A ND2 1 
ATOM 4811 N N   . ILE A 1 621  ? 8.612   78.891 1.603   1.00 208.69 ? 618  ILE A N   1 
ATOM 4812 C CA  . ILE A 1 621  ? 7.657   79.960 1.299   1.00 208.69 ? 618  ILE A CA  1 
ATOM 4813 C C   . ILE A 1 621  ? 8.314   81.188 0.673   1.00 208.69 ? 618  ILE A C   1 
ATOM 4814 O O   . ILE A 1 621  ? 7.669   81.942 -0.060  1.00 208.69 ? 618  ILE A O   1 
ATOM 4815 C CB  . ILE A 1 621  ? 6.903   80.408 2.565   1.00 160.17 ? 618  ILE A CB  1 
ATOM 4816 C CG1 . ILE A 1 621  ? 7.823   80.291 3.797   1.00 160.17 ? 618  ILE A CG1 1 
ATOM 4817 C CG2 . ILE A 1 621  ? 5.615   79.603 2.710   1.00 160.17 ? 618  ILE A CG2 1 
ATOM 4818 C CD1 . ILE A 1 621  ? 7.517   81.255 4.939   1.00 160.17 ? 618  ILE A CD1 1 
ATOM 4819 N N   . GLU A 1 622  ? 9.599   81.375 0.972   1.00 192.82 ? 619  GLU A N   1 
ATOM 4820 C CA  . GLU A 1 622  ? 10.370  82.510 0.477   1.00 192.82 ? 619  GLU A CA  1 
ATOM 4821 C C   . GLU A 1 622  ? 11.228  82.111 -0.729  1.00 192.82 ? 619  GLU A C   1 
ATOM 4822 O O   . GLU A 1 622  ? 11.087  82.671 -1.819  1.00 192.82 ? 619  GLU A O   1 
ATOM 4823 C CB  . GLU A 1 622  ? 11.256  83.090 1.597   1.00 179.60 ? 619  GLU A CB  1 
ATOM 4824 C CG  . GLU A 1 622  ? 10.633  83.096 3.010   1.00 179.60 ? 619  GLU A CG  1 
ATOM 4825 C CD  . GLU A 1 622  ? 9.790   84.337 3.323   1.00 179.60 ? 619  GLU A CD  1 
ATOM 4826 O OE1 . GLU A 1 622  ? 9.025   84.806 2.452   1.00 179.60 ? 619  GLU A OE1 1 
ATOM 4827 O OE2 . GLU A 1 622  ? 9.882   84.839 4.465   1.00 179.60 ? 619  GLU A OE2 1 
ATOM 4828 N N   . THR A 1 623  ? 12.089  81.116 -0.526  1.00 199.35 ? 620  THR A N   1 
ATOM 4829 C CA  . THR A 1 623  ? 13.179  80.818 -1.455  1.00 199.35 ? 620  THR A CA  1 
ATOM 4830 C C   . THR A 1 623  ? 12.833  79.730 -2.475  1.00 199.35 ? 620  THR A C   1 
ATOM 4831 O O   . THR A 1 623  ? 13.082  79.895 -3.670  1.00 199.35 ? 620  THR A O   1 
ATOM 4832 C CB  . THR A 1 623  ? 14.481  80.472 -0.687  1.00 93.83  ? 620  THR A CB  1 
ATOM 4833 O OG1 . THR A 1 623  ? 14.584  79.060 -0.478  1.00 93.83  ? 620  THR A OG1 1 
ATOM 4834 C CG2 . THR A 1 623  ? 14.526  81.197 0.672   1.00 93.83  ? 620  THR A CG2 1 
ATOM 4835 N N   . GLY A 1 624  ? 12.274  78.623 -1.988  1.00 210.83 ? 621  GLY A N   1 
ATOM 4836 C CA  . GLY A 1 624  ? 11.756  77.539 -2.829  1.00 210.83 ? 621  GLY A CA  1 
ATOM 4837 C C   . GLY A 1 624  ? 12.788  76.784 -3.645  1.00 210.83 ? 621  GLY A C   1 
ATOM 4838 O O   . GLY A 1 624  ? 13.020  77.115 -4.810  1.00 210.83 ? 621  GLY A O   1 
ATOM 4839 N N   . LEU A 1 625  ? 13.401  75.768 -3.035  1.00 167.30 ? 622  LEU A N   1 
ATOM 4840 C CA  . LEU A 1 625  ? 14.428  74.941 -3.695  1.00 167.30 ? 622  LEU A CA  1 
ATOM 4841 C C   . LEU A 1 625  ? 14.424  73.501 -3.128  1.00 167.30 ? 622  LEU A C   1 
ATOM 4842 O O   . LEU A 1 625  ? 13.498  73.140 -2.395  1.00 167.30 ? 622  LEU A O   1 
ATOM 4843 C CB  . LEU A 1 625  ? 15.821  75.601 -3.585  1.00 95.00  ? 622  LEU A CB  1 
ATOM 4844 C CG  . LEU A 1 625  ? 15.965  77.140 -3.518  1.00 95.00  ? 622  LEU A CG  1 
ATOM 4845 C CD1 . LEU A 1 625  ? 16.109  77.610 -2.079  1.00 95.00  ? 622  LEU A CD1 1 
ATOM 4846 C CD2 . LEU A 1 625  ? 17.147  77.656 -4.348  1.00 95.00  ? 622  LEU A CD2 1 
ATOM 4847 N N   . LEU A 1 626  ? 15.440  72.694 -3.473  1.00 124.40 ? 623  LEU A N   1 
ATOM 4848 C CA  . LEU A 1 626  ? 15.605  71.295 -2.985  1.00 124.40 ? 623  LEU A CA  1 
ATOM 4849 C C   . LEU A 1 626  ? 15.588  71.112 -1.442  1.00 124.40 ? 623  LEU A C   1 
ATOM 4850 O O   . LEU A 1 626  ? 15.408  72.083 -0.686  1.00 124.40 ? 623  LEU A O   1 
ATOM 4851 C CB  . LEU A 1 626  ? 16.904  70.680 -3.550  1.00 162.51 ? 623  LEU A CB  1 
ATOM 4852 C CG  . LEU A 1 626  ? 16.938  69.497 -4.529  1.00 162.51 ? 623  LEU A CG  1 
ATOM 4853 C CD1 . LEU A 1 626  ? 18.353  69.296 -5.047  1.00 162.51 ? 623  LEU A CD1 1 
ATOM 4854 C CD2 . LEU A 1 626  ? 16.422  68.209 -3.915  1.00 162.51 ? 623  LEU A CD2 1 
ATOM 4855 N N   . SER A 1 627  ? 15.772  69.861 -0.992  1.00 174.81 ? 624  SER A N   1 
ATOM 4856 C CA  . SER A 1 627  ? 15.849  69.505 0.443   1.00 174.81 ? 624  SER A CA  1 
ATOM 4857 C C   . SER A 1 627  ? 16.531  68.164 0.693   1.00 174.81 ? 624  SER A C   1 
ATOM 4858 O O   . SER A 1 627  ? 17.728  68.121 0.979   1.00 174.81 ? 624  SER A O   1 
ATOM 4859 C CB  . SER A 1 627  ? 14.464  69.455 1.079   1.00 86.46  ? 624  SER A CB  1 
ATOM 4860 O OG  . SER A 1 627  ? 13.644  70.484 0.558   1.00 86.46  ? 624  SER A OG  1 
ATOM 4861 N N   . ASP A 1 628  ? 15.754  67.079 0.605   1.00 130.29 ? 625  ASP A N   1 
ATOM 4862 C CA  . ASP A 1 628  ? 16.246  65.721 0.898   1.00 130.29 ? 625  ASP A CA  1 
ATOM 4863 C C   . ASP A 1 628  ? 15.672  64.640 -0.020  1.00 130.29 ? 625  ASP A C   1 
ATOM 4864 O O   . ASP A 1 628  ? 14.467  64.365 0.000   1.00 130.29 ? 625  ASP A O   1 
ATOM 4865 C CB  . ASP A 1 628  ? 15.985  65.336 2.368   1.00 184.44 ? 625  ASP A CB  1 
ATOM 4866 C CG  . ASP A 1 628  ? 17.267  65.219 3.194   1.00 184.44 ? 625  ASP A CG  1 
ATOM 4867 O OD1 . ASP A 1 628  ? 17.825  66.264 3.599   1.00 184.44 ? 625  ASP A OD1 1 
ATOM 4868 O OD2 . ASP A 1 628  ? 17.703  64.074 3.455   1.00 184.44 ? 625  ASP A OD2 1 
ATOM 4869 N N   . ARG A 1 629  ? 16.534  64.035 -0.830  1.00 154.99 ? 626  ARG A N   1 
ATOM 4870 C CA  . ARG A 1 629  ? 16.108  62.998 -1.766  1.00 154.99 ? 626  ARG A CA  1 
ATOM 4871 C C   . ARG A 1 629  ? 15.992  61.628 -1.104  1.00 154.99 ? 626  ARG A C   1 
ATOM 4872 O O   . ARG A 1 629  ? 16.975  61.092 -0.592  1.00 154.99 ? 626  ARG A O   1 
ATOM 4873 C CB  . ARG A 1 629  ? 17.069  62.925 -2.955  1.00 137.04 ? 626  ARG A CB  1 
ATOM 4874 C CG  . ARG A 1 629  ? 16.710  61.859 -3.978  1.00 137.04 ? 626  ARG A CG  1 
ATOM 4875 C CD  . ARG A 1 629  ? 17.706  61.837 -5.126  1.00 137.04 ? 626  ARG A CD  1 
ATOM 4876 N NE  . ARG A 1 629  ? 17.382  60.811 -6.112  1.00 137.04 ? 626  ARG A NE  1 
ATOM 4877 C CZ  . ARG A 1 629  ? 16.598  61.010 -7.167  1.00 137.04 ? 626  ARG A CZ  1 
ATOM 4878 N NH1 . ARG A 1 629  ? 16.053  62.201 -7.376  1.00 137.04 ? 626  ARG A NH1 1 
ATOM 4879 N NH2 . ARG A 1 629  ? 16.357  60.018 -8.013  1.00 137.04 ? 626  ARG A NH2 1 
ATOM 4880 N N   . LYS A 1 630  ? 14.787  61.068 -1.118  1.00 82.33  ? 627  LYS A N   1 
ATOM 4881 C CA  . LYS A 1 630  ? 14.545  59.761 -0.518  1.00 82.33  ? 627  LYS A CA  1 
ATOM 4882 C C   . LYS A 1 630  ? 13.106  59.306 -0.740  1.00 82.33  ? 627  LYS A C   1 
ATOM 4883 O O   . LYS A 1 630  ? 12.178  59.830 -0.124  1.00 82.33  ? 627  LYS A O   1 
ATOM 4884 C CB  . LYS A 1 630  ? 14.863  59.791 0.978   1.00 94.64  ? 627  LYS A CB  1 
ATOM 4885 C CG  . LYS A 1 630  ? 16.306  60.144 1.300   1.00 94.64  ? 627  LYS A CG  1 
ATOM 4886 C CD  . LYS A 1 630  ? 16.550  60.153 2.800   1.00 94.64  ? 627  LYS A CD  1 
ATOM 4887 C CE  . LYS A 1 630  ? 16.257  58.795 3.416   1.00 94.64  ? 627  LYS A CE  1 
ATOM 4888 N NZ  . LYS A 1 630  ? 17.111  57.724 2.833   1.00 94.64  ? 627  LYS A NZ  1 
ATOM 4889 N N   . LYS A 1 631  ? 12.929  58.328 -1.622  1.00 80.80  ? 628  LYS A N   1 
ATOM 4890 C CA  . LYS A 1 631  ? 11.605  57.800 -1.924  1.00 80.80  ? 628  LYS A CA  1 
ATOM 4891 C C   . LYS A 1 631  ? 11.212  56.711 -0.931  1.00 80.80  ? 628  LYS A C   1 
ATOM 4892 O O   . LYS A 1 631  ? 12.072  56.040 -0.360  1.00 80.80  ? 628  LYS A O   1 
ATOM 4893 C CB  . LYS A 1 631  ? 11.559  57.252 -3.352  1.00 75.45  ? 628  LYS A CB  1 
ATOM 4894 C CG  . LYS A 1 631  ? 10.209  56.679 -3.754  1.00 75.45  ? 628  LYS A CG  1 
ATOM 4895 C CD  . LYS A 1 631  ? 10.234  56.157 -5.181  1.00 75.45  ? 628  LYS A CD  1 
ATOM 4896 C CE  . LYS A 1 631  ? 11.269  55.057 -5.349  1.00 75.45  ? 628  LYS A CE  1 
ATOM 4897 N NZ  . LYS A 1 631  ? 11.305  54.536 -6.744  1.00 75.45  ? 628  LYS A NZ  1 
ATOM 4898 N N   . VAL A 1 632  ? 9.910   56.540 -0.730  1.00 105.57 ? 629  VAL A N   1 
ATOM 4899 C CA  . VAL A 1 632  ? 9.405   55.534 0.196   1.00 105.57 ? 629  VAL A CA  1 
ATOM 4900 C C   . VAL A 1 632  ? 8.158   54.847 -0.352  1.00 105.57 ? 629  VAL A C   1 
ATOM 4901 O O   . VAL A 1 632  ? 7.161   55.501 -0.659  1.00 105.57 ? 629  VAL A O   1 
ATOM 4902 C CB  . VAL A 1 632  ? 9.080   56.145 1.571   1.00 71.81  ? 629  VAL A CB  1 
ATOM 4903 C CG1 . VAL A 1 632  ? 8.490   55.090 2.494   1.00 71.81  ? 629  VAL A CG1 1 
ATOM 4904 C CG2 . VAL A 1 632  ? 10.326  56.764 2.185   1.00 71.81  ? 629  VAL A CG2 1 
ATOM 4905 N N   . THR A 1 633  ? 8.222   53.525 -0.472  1.00 89.55  ? 630  THR A N   1 
ATOM 4906 C CA  . THR A 1 633  ? 7.099   52.747 -0.983  1.00 89.55  ? 630  THR A CA  1 
ATOM 4907 C C   . THR A 1 633  ? 5.965   52.682 0.034   1.00 89.55  ? 630  THR A C   1 
ATOM 4908 O O   . THR A 1 633  ? 6.193   52.777 1.240   1.00 89.55  ? 630  THR A O   1 
ATOM 4909 C CB  . THR A 1 633  ? 7.527   51.315 -1.353  1.00 93.64  ? 630  THR A CB  1 
ATOM 4910 O OG1 . THR A 1 633  ? 6.399   50.592 -1.860  1.00 93.64  ? 630  THR A OG1 1 
ATOM 4911 C CG2 . THR A 1 633  ? 8.081   50.593 -0.134  1.00 93.64  ? 630  THR A CG2 1 
ATOM 4912 N N   . LEU A 1 634  ? 4.742   52.518 -0.461  1.00 71.34  ? 631  LEU A N   1 
ATOM 4913 C CA  . LEU A 1 634  ? 3.570   52.439 0.402   1.00 71.34  ? 631  LEU A CA  1 
ATOM 4914 C C   . LEU A 1 634  ? 2.428   51.705 -0.292  1.00 71.34  ? 631  LEU A C   1 
ATOM 4915 O O   . LEU A 1 634  ? 2.398   50.475 -0.328  1.00 71.34  ? 631  LEU A O   1 
ATOM 4916 C CB  . LEU A 1 634  ? 3.118   53.839 0.822   1.00 64.69  ? 631  LEU A CB  1 
ATOM 4917 C CG  . LEU A 1 634  ? 4.138   54.678 1.593   1.00 64.69  ? 631  LEU A CG  1 
ATOM 4918 C CD1 . LEU A 1 634  ? 3.589   56.069 1.872   1.00 64.69  ? 631  LEU A CD1 1 
ATOM 4919 C CD2 . LEU A 1 634  ? 4.538   53.985 2.886   1.00 64.69  ? 631  LEU A CD2 1 
ATOM 4920 N N   . GLY A 1 635  ? 1.490   52.468 -0.844  1.00 79.75  ? 632  GLY A N   1 
ATOM 4921 C CA  . GLY A 1 635  ? 0.352   51.895 -1.538  1.00 79.75  ? 632  GLY A CA  1 
ATOM 4922 C C   . GLY A 1 635  ? 0.675   51.550 -2.978  1.00 79.75  ? 632  GLY A C   1 
ATOM 4923 O O   . GLY A 1 635  ? 0.805   52.436 -3.824  1.00 79.75  ? 632  GLY A O   1 
ATOM 4924 N N   . THR A 1 636  ? 0.808   50.258 -3.258  1.00 87.79  ? 633  THR A N   1 
ATOM 4925 C CA  . THR A 1 636  ? 1.124   49.795 -4.603  1.00 87.79  ? 633  THR A CA  1 
ATOM 4926 C C   . THR A 1 636  ? 0.331   50.597 -5.627  1.00 87.79  ? 633  THR A C   1 
ATOM 4927 O O   . THR A 1 636  ? 0.728   50.711 -6.787  1.00 87.79  ? 633  THR A O   1 
ATOM 4928 C CB  . THR A 1 636  ? 0.807   48.299 -4.775  1.00 106.15 ? 633  THR A CB  1 
ATOM 4929 O OG1 . THR A 1 636  ? -0.589  48.073 -4.544  1.00 106.15 ? 633  THR A OG1 1 
ATOM 4930 C CG2 . THR A 1 636  ? 1.620   47.466 -3.795  1.00 106.15 ? 633  THR A CG2 1 
ATOM 4931 N N   . GLN A 1 637  ? -0.793  51.152 -5.186  1.00 92.43  ? 634  GLN A N   1 
ATOM 4932 C CA  . GLN A 1 637  ? -1.648  51.954 -6.054  1.00 92.43  ? 634  GLN A CA  1 
ATOM 4933 C C   . GLN A 1 637  ? -1.432  53.445 -5.816  1.00 92.43  ? 634  GLN A C   1 
ATOM 4934 O O   . GLN A 1 637  ? -1.327  53.892 -4.674  1.00 92.43  ? 634  GLN A O   1 
ATOM 4935 C CB  . GLN A 1 637  ? -3.119  51.594 -5.838  1.00 99.73  ? 634  GLN A CB  1 
ATOM 4936 C CG  . GLN A 1 637  ? -3.450  50.139 -6.124  1.00 99.73  ? 634  GLN A CG  1 
ATOM 4937 C CD  . GLN A 1 637  ? -3.145  49.742 -7.555  1.00 99.73  ? 634  GLN A CD  1 
ATOM 4938 O OE1 . GLN A 1 637  ? -2.679  50.557 -8.352  1.00 99.73  ? 634  GLN A OE1 1 
ATOM 4939 N NE2 . GLN A 1 637  ? -3.406  48.484 -7.889  1.00 99.73  ? 634  GLN A NE2 1 
ATOM 4940 N N   . PRO A 1 638  ? -1.368  54.209 -6.902  1.00 87.24  ? 635  PRO A N   1 
ATOM 4941 C CA  . PRO A 1 638  ? -1.166  55.647 -6.814  1.00 87.24  ? 635  PRO A CA  1 
ATOM 4942 C C   . PRO A 1 638  ? -1.668  56.150 -5.480  1.00 87.24  ? 635  PRO A C   1 
ATOM 4943 O O   . PRO A 1 638  ? -2.728  55.752 -5.023  1.00 87.24  ? 635  PRO A O   1 
ATOM 4944 C CB  . PRO A 1 638  ? -2.046  56.203 -7.939  1.00 103.57 ? 635  PRO A CB  1 
ATOM 4945 C CG  . PRO A 1 638  ? -2.783  55.030 -8.510  1.00 103.57 ? 635  PRO A CG  1 
ATOM 4946 C CD  . PRO A 1 638  ? -1.992  53.829 -8.177  1.00 103.57 ? 635  PRO A CD  1 
ATOM 4947 N N   . THR A 1 639  ? -0.889  56.997 -4.847  1.00 64.75  ? 636  THR A N   1 
ATOM 4948 C CA  . THR A 1 639  ? -1.281  57.567 -3.583  1.00 64.75  ? 636  THR A CA  1 
ATOM 4949 C C   . THR A 1 639  ? -1.916  58.946 -3.787  1.00 64.75  ? 636  THR A C   1 
ATOM 4950 O O   . THR A 1 639  ? -1.348  59.826 -4.456  1.00 64.75  ? 636  THR A O   1 
ATOM 4951 C CB  . THR A 1 639  ? -0.084  57.630 -2.650  1.00 70.02  ? 636  THR A CB  1 
ATOM 4952 O OG1 . THR A 1 639  ? 0.475   56.313 -2.540  1.00 70.02  ? 636  THR A OG1 1 
ATOM 4953 C CG2 . THR A 1 639  ? -0.491  58.112 -1.299  1.00 70.02  ? 636  THR A CG2 1 
ATOM 4954 N N   . VAL A 1 640  ? -3.118  59.109 -3.250  1.00 54.68  ? 637  VAL A N   1 
ATOM 4955 C CA  . VAL A 1 640  ? -3.787  60.407 -3.203  1.00 54.68  ? 637  VAL A CA  1 
ATOM 4956 C C   . VAL A 1 640  ? -3.432  60.927 -1.852  1.00 54.68  ? 637  VAL A C   1 
ATOM 4957 O O   . VAL A 1 640  ? -3.477  60.166 -0.890  1.00 54.68  ? 637  VAL A O   1 
ATOM 4958 C CB  . VAL A 1 640  ? -5.341  60.271 -3.248  1.00 55.41  ? 637  VAL A CB  1 
ATOM 4959 C CG1 . VAL A 1 640  ? -6.035  61.629 -3.086  1.00 55.41  ? 637  VAL A CG1 1 
ATOM 4960 C CG2 . VAL A 1 640  ? -5.780  59.555 -4.515  1.00 55.41  ? 637  VAL A CG2 1 
ATOM 4961 N N   . LEU A 1 641  ? -3.073  62.202 -1.785  1.00 74.58  ? 638  LEU A N   1 
ATOM 4962 C CA  . LEU A 1 641  ? -2.786  62.866 -0.524  1.00 74.58  ? 638  LEU A CA  1 
ATOM 4963 C C   . LEU A 1 641  ? -3.849  63.911 -0.226  1.00 74.58  ? 638  LEU A C   1 
ATOM 4964 O O   . LEU A 1 641  ? -4.291  64.647 -1.114  1.00 74.58  ? 638  LEU A O   1 
ATOM 4965 C CB  . LEU A 1 641  ? -1.405  63.517 -0.545  1.00 66.06  ? 638  LEU A CB  1 
ATOM 4966 C CG  . LEU A 1 641  ? -0.261  62.722 -1.171  1.00 66.06  ? 638  LEU A CG  1 
ATOM 4967 C CD1 . LEU A 1 641  ? 0.665   63.649 -1.908  1.00 66.06  ? 638  LEU A CD1 1 
ATOM 4968 C CD2 . LEU A 1 641  ? 0.513   61.876 -0.164  1.00 66.06  ? 638  LEU A CD2 1 
ATOM 4969 N N   . ARG A 1 642  ? -4.272  63.944 1.030   1.00 75.03  ? 639  ARG A N   1 
ATOM 4970 C CA  . ARG A 1 642  ? -5.222  64.939 1.508   1.00 75.03  ? 639  ARG A CA  1 
ATOM 4971 C C   . ARG A 1 642  ? -4.761  65.451 2.862   1.00 75.03  ? 639  ARG A C   1 
ATOM 4972 O O   . ARG A 1 642  ? -3.636  65.165 3.299   1.00 75.03  ? 639  ARG A O   1 
ATOM 4973 C CB  . ARG A 1 642  ? -6.647  64.380 1.575   1.00 180.18 ? 639  ARG A CB  1 
ATOM 4974 C CG  . ARG A 1 642  ? -7.696  65.419 1.971   1.00 180.18 ? 639  ARG A CG  1 
ATOM 4975 C CD  . ARG A 1 642  ? -7.849  66.487 0.911   1.00 180.18 ? 639  ARG A CD  1 
ATOM 4976 N NE  . ARG A 1 642  ? -8.736  66.018 -0.144  1.00 180.18 ? 639  ARG A NE  1 
ATOM 4977 C CZ  . ARG A 1 642  ? -10.019 66.353 -0.241  1.00 180.18 ? 639  ARG A CZ  1 
ATOM 4978 N NH1 . ARG A 1 642  ? -10.563 67.180 0.643   1.00 180.18 ? 639  ARG A NH1 1 
ATOM 4979 N NH2 . ARG A 1 642  ? -10.758 65.869 -1.230  1.00 180.18 ? 639  ARG A NH2 1 
ATOM 4980 N N   . THR A 1 643  ? -5.624  66.231 3.504   1.00 122.08 ? 640  THR A N   1 
ATOM 4981 C CA  . THR A 1 643  ? -5.315  66.863 4.772   1.00 122.08 ? 640  THR A CA  1 
ATOM 4982 C C   . THR A 1 643  ? -6.591  66.996 5.585   1.00 122.08 ? 640  THR A C   1 
ATOM 4983 O O   . THR A 1 643  ? -7.630  67.392 5.058   1.00 122.08 ? 640  THR A O   1 
ATOM 4984 C CB  . THR A 1 643  ? -4.530  68.182 4.548   1.00 73.93  ? 640  THR A CB  1 
ATOM 4985 O OG1 . THR A 1 643  ? -3.121  67.884 4.638   1.00 73.93  ? 640  THR A OG1 1 
ATOM 4986 C CG2 . THR A 1 643  ? -4.907  69.301 5.558   1.00 73.93  ? 640  THR A CG2 1 
ATOM 4987 N N   . PHE A 1 644  ? -6.490  66.627 6.863   1.00 142.19 ? 641  PHE A N   1 
ATOM 4988 C CA  . PHE A 1 644  ? -7.649  66.352 7.714   1.00 142.19 ? 641  PHE A CA  1 
ATOM 4989 C C   . PHE A 1 644  ? -7.649  67.102 9.052   1.00 142.19 ? 641  PHE A C   1 
ATOM 4990 O O   . PHE A 1 644  ? -6.641  67.699 9.459   1.00 142.19 ? 641  PHE A O   1 
ATOM 4991 C CB  . PHE A 1 644  ? -7.791  64.827 7.954   1.00 85.11  ? 641  PHE A CB  1 
ATOM 4992 C CG  . PHE A 1 644  ? -6.593  64.188 8.648   1.00 85.11  ? 641  PHE A CG  1 
ATOM 4993 C CD1 . PHE A 1 644  ? -6.572  64.031 10.039  1.00 85.11  ? 641  PHE A CD1 1 
ATOM 4994 C CD2 . PHE A 1 644  ? -5.491  63.749 7.910   1.00 85.11  ? 641  PHE A CD2 1 
ATOM 4995 C CE1 . PHE A 1 644  ? -5.457  63.459 10.692  1.00 85.11  ? 641  PHE A CE1 1 
ATOM 4996 C CE2 . PHE A 1 644  ? -4.378  63.178 8.545   1.00 85.11  ? 641  PHE A CE2 1 
ATOM 4997 C CZ  . PHE A 1 644  ? -4.359  63.030 9.939   1.00 85.11  ? 641  PHE A CZ  1 
ATOM 4998 N N   . ARG A 1 645  ? -8.796  67.044 9.728   1.00 196.40 ? 642  ARG A N   1 
ATOM 4999 C CA  . ARG A 1 645  ? -8.960  67.612 11.061  1.00 196.40 ? 642  ARG A CA  1 
ATOM 5000 C C   . ARG A 1 645  ? -8.561  66.619 12.163  1.00 196.40 ? 642  ARG A C   1 
ATOM 5001 O O   . ARG A 1 645  ? -9.005  65.464 12.181  1.00 196.40 ? 642  ARG A O   1 
ATOM 5002 C CB  . ARG A 1 645  ? -10.396 68.135 11.251  1.00 116.55 ? 642  ARG A CB  1 
ATOM 5003 C CG  . ARG A 1 645  ? -10.720 68.634 12.676  1.00 116.55 ? 642  ARG A CG  1 
ATOM 5004 C CD  . ARG A 1 645  ? -11.458 69.977 12.719  1.00 116.55 ? 642  ARG A CD  1 
ATOM 5005 N NE  . ARG A 1 645  ? -12.774 69.942 12.081  1.00 116.55 ? 642  ARG A NE  1 
ATOM 5006 C CZ  . ARG A 1 645  ? -13.801 70.711 12.435  1.00 116.55 ? 642  ARG A CZ  1 
ATOM 5007 N NH1 . ARG A 1 645  ? -13.686 71.571 13.443  1.00 116.55 ? 642  ARG A NH1 1 
ATOM 5008 N NH2 . ARG A 1 645  ? -14.952 70.609 11.788  1.00 116.55 ? 642  ARG A NH2 1 
ATOM 5009 N N   . SER A 1 646  ? -7.714  67.093 13.073  1.00 212.91 ? 643  SER A N   1 
ATOM 5010 C CA  . SER A 1 646  ? -7.198  66.288 14.170  1.00 212.91 ? 643  SER A CA  1 
ATOM 5011 C C   . SER A 1 646  ? -7.158  67.097 15.473  1.00 212.91 ? 643  SER A C   1 
ATOM 5012 O O   . SER A 1 646  ? -7.993  66.895 16.359  1.00 212.91 ? 643  SER A O   1 
ATOM 5013 C CB  . SER A 1 646  ? -5.809  65.757 13.810  1.00 102.47 ? 643  SER A CB  1 
ATOM 5014 O OG  . SER A 1 646  ? -4.986  66.819 13.356  1.00 102.47 ? 643  SER A OG  1 
ATOM 5015 N N   . LEU A 1 647  ? -6.199  68.019 15.574  1.00 156.08 ? 644  LEU A N   1 
ATOM 5016 C CA  . LEU A 1 647  ? -5.993  68.829 16.783  1.00 156.08 ? 644  LEU A CA  1 
ATOM 5017 C C   . LEU A 1 647  ? -5.420  70.209 16.416  1.00 156.08 ? 644  LEU A C   1 
ATOM 5018 O O   . LEU A 1 647  ? -6.175  71.154 16.154  1.00 156.08 ? 644  LEU A O   1 
ATOM 5019 C CB  . LEU A 1 647  ? -5.103  68.077 17.813  1.00 97.42  ? 644  LEU A CB  1 
ATOM 5020 C CG  . LEU A 1 647  ? -3.604  67.755 17.564  1.00 97.42  ? 644  LEU A CG  1 
ATOM 5021 C CD1 . LEU A 1 647  ? -2.945  67.049 18.764  1.00 97.42  ? 644  LEU A CD1 1 
ATOM 5022 C CD2 . LEU A 1 647  ? -3.348  66.964 16.264  1.00 97.42  ? 644  LEU A CD2 1 
ATOM 5023 N N   . SER A 1 648  ? -4.088  70.305 16.391  1.00 168.66 ? 645  SER A N   1 
ATOM 5024 C CA  . SER A 1 648  ? -3.378  71.519 16.014  1.00 168.66 ? 645  SER A CA  1 
ATOM 5025 C C   . SER A 1 648  ? -2.472  71.217 14.828  1.00 168.66 ? 645  SER A C   1 
ATOM 5026 O O   . SER A 1 648  ? -2.593  71.823 13.760  1.00 168.66 ? 645  SER A O   1 
ATOM 5027 C CB  . SER A 1 648  ? -2.540  72.042 17.193  1.00 164.23 ? 645  SER A CB  1 
ATOM 5028 O OG  . SER A 1 648  ? -1.445  71.181 17.487  1.00 164.23 ? 645  SER A OG  1 
ATOM 5029 N N   . THR A 1 649  ? -1.583  70.249 15.032  1.00 212.91 ? 646  THR A N   1 
ATOM 5030 C CA  . THR A 1 649  ? -0.545  69.890 14.073  1.00 212.91 ? 646  THR A CA  1 
ATOM 5031 C C   . THR A 1 649  ? -1.110  69.273 12.787  1.00 212.91 ? 646  THR A C   1 
ATOM 5032 O O   . THR A 1 649  ? -0.352  68.808 11.934  1.00 212.91 ? 646  THR A O   1 
ATOM 5033 C CB  . THR A 1 649  ? 0.464   68.921 14.722  1.00 101.79 ? 646  THR A CB  1 
ATOM 5034 O OG1 . THR A 1 649  ? -0.220  67.731 15.134  1.00 101.79 ? 646  THR A OG1 1 
ATOM 5035 C CG2 . THR A 1 649  ? 1.135   69.572 15.946  1.00 101.79 ? 646  THR A CG2 1 
ATOM 5036 N N   . THR A 1 650  ? -2.442  69.292 12.674  1.00 165.78 ? 647  THR A N   1 
ATOM 5037 C CA  . THR A 1 650  ? -3.230  68.783 11.531  1.00 165.78 ? 647  THR A CA  1 
ATOM 5038 C C   . THR A 1 650  ? -2.445  68.324 10.312  1.00 165.78 ? 647  THR A C   1 
ATOM 5039 O O   . THR A 1 650  ? -1.674  69.088 9.731   1.00 165.78 ? 647  THR A O   1 
ATOM 5040 C CB  . THR A 1 650  ? -4.224  69.821 11.070  1.00 92.78  ? 647  THR A CB  1 
ATOM 5041 O OG1 . THR A 1 650  ? -3.529  71.059 10.900  1.00 92.78  ? 647  THR A OG1 1 
ATOM 5042 C CG2 . THR A 1 650  ? -5.330  69.983 12.112  1.00 92.78  ? 647  THR A CG2 1 
ATOM 5043 N N   . ASN A 1 651  ? -2.696  67.088 9.899   1.00 143.85 ? 648  ASN A N   1 
ATOM 5044 C CA  . ASN A 1 651  ? -1.725  66.363 9.099   1.00 143.85 ? 648  ASN A CA  1 
ATOM 5045 C C   . ASN A 1 651  ? -2.215  65.868 7.747   1.00 143.85 ? 648  ASN A C   1 
ATOM 5046 O O   . ASN A 1 651  ? -3.331  66.178 7.326   1.00 143.85 ? 648  ASN A O   1 
ATOM 5047 C CB  . ASN A 1 651  ? -1.142  65.209 9.921   1.00 180.50 ? 648  ASN A CB  1 
ATOM 5048 C CG  . ASN A 1 651  ? -0.681  65.653 11.297  1.00 180.50 ? 648  ASN A CG  1 
ATOM 5049 O OD1 . ASN A 1 651  ? 0.493   65.958 11.501  1.00 180.50 ? 648  ASN A OD1 1 
ATOM 5050 N ND2 . ASN A 1 651  ? -1.613  65.713 12.246  1.00 180.50 ? 648  ASN A ND2 1 
ATOM 5051 N N   . VAL A 1 652  ? -1.350  65.098 7.087   1.00 97.83  ? 649  VAL A N   1 
ATOM 5052 C CA  . VAL A 1 652  ? -1.591  64.570 5.744   1.00 97.83  ? 649  VAL A CA  1 
ATOM 5053 C C   . VAL A 1 652  ? -1.897  63.069 5.744   1.00 97.83  ? 649  VAL A C   1 
ATOM 5054 O O   . VAL A 1 652  ? -1.145  62.259 6.303   1.00 97.83  ? 649  VAL A O   1 
ATOM 5055 C CB  . VAL A 1 652  ? -0.396  64.854 4.802   1.00 116.79 ? 649  VAL A CB  1 
ATOM 5056 C CG1 . VAL A 1 652  ? -0.606  64.217 3.432   1.00 116.79 ? 649  VAL A CG1 1 
ATOM 5057 C CG2 . VAL A 1 652  ? -0.176  66.348 4.668   1.00 116.79 ? 649  VAL A CG2 1 
ATOM 5058 N N   . PHE A 1 653  ? -3.010  62.733 5.095   1.00 61.10  ? 650  PHE A N   1 
ATOM 5059 C CA  . PHE A 1 653  ? -3.466  61.373 4.903   1.00 61.10  ? 650  PHE A CA  1 
ATOM 5060 C C   . PHE A 1 653  ? -3.039  60.852 3.531   1.00 61.10  ? 650  PHE A C   1 
ATOM 5061 O O   . PHE A 1 653  ? -3.347  61.461 2.507   1.00 61.10  ? 650  PHE A O   1 
ATOM 5062 C CB  . PHE A 1 653  ? -4.987  61.340 5.007   1.00 82.93  ? 650  PHE A CB  1 
ATOM 5063 C CG  . PHE A 1 653  ? -5.563  59.953 5.035   1.00 82.93  ? 650  PHE A CG  1 
ATOM 5064 C CD1 . PHE A 1 653  ? -6.069  59.421 6.219   1.00 82.93  ? 650  PHE A CD1 1 
ATOM 5065 C CD2 . PHE A 1 653  ? -5.603  59.173 3.883   1.00 82.93  ? 650  PHE A CD2 1 
ATOM 5066 C CE1 . PHE A 1 653  ? -6.596  58.139 6.256   1.00 82.93  ? 650  PHE A CE1 1 
ATOM 5067 C CE2 . PHE A 1 653  ? -6.131  57.897 3.918   1.00 82.93  ? 650  PHE A CE2 1 
ATOM 5068 C CZ  . PHE A 1 653  ? -6.627  57.380 5.111   1.00 82.93  ? 650  PHE A CZ  1 
ATOM 5069 N N   . ALA A 1 654  ? -2.350  59.717 3.522   1.00 55.80  ? 651  ALA A N   1 
ATOM 5070 C CA  . ALA A 1 654  ? -1.987  59.005 2.296   1.00 55.80  ? 651  ALA A CA  1 
ATOM 5071 C C   . ALA A 1 654  ? -2.990  57.873 1.956   1.00 55.80  ? 651  ALA A C   1 
ATOM 5072 O O   . ALA A 1 654  ? -3.093  56.891 2.713   1.00 55.80  ? 651  ALA A O   1 
ATOM 5073 C CB  . ALA A 1 654  ? -0.592  58.434 2.439   1.00 71.16  ? 651  ALA A CB  1 
ATOM 5074 N N   . CYS A 1 655  ? -3.716  57.999 0.837   1.00 62.17  ? 652  CYS A N   1 
ATOM 5075 C CA  . CYS A 1 655  ? -4.658  56.954 0.422   1.00 62.17  ? 652  CYS A CA  1 
ATOM 5076 C C   . CYS A 1 655  ? -3.988  55.988 -0.524  1.00 62.17  ? 652  CYS A C   1 
ATOM 5077 O O   . CYS A 1 655  ? -3.392  56.395 -1.489  1.00 62.17  ? 652  CYS A O   1 
ATOM 5078 C CB  . CYS A 1 655  ? -5.899  57.549 -0.241  1.00 75.61  ? 652  CYS A CB  1 
ATOM 5079 S SG  . CYS A 1 655  ? -6.731  58.849 0.705   1.00 75.61  ? 652  CYS A SG  1 
ATOM 5080 N N   . SER A 1 656  ? -4.059  54.705 -0.224  1.00 58.73  ? 653  SER A N   1 
ATOM 5081 C CA  . SER A 1 656  ? -3.490  53.657 -1.085  1.00 58.73  ? 653  SER A CA  1 
ATOM 5082 C C   . SER A 1 656  ? -4.106  52.310 -0.716  1.00 58.73  ? 653  SER A C   1 
ATOM 5083 O O   . SER A 1 656  ? -4.994  52.251 0.164   1.00 58.73  ? 653  SER A O   1 
ATOM 5084 C CB  . SER A 1 656  ? -1.985  53.526 -0.884  1.00 64.01  ? 653  SER A CB  1 
ATOM 5085 O OG  . SER A 1 656  ? -1.452  54.679 -0.278  1.00 64.01  ? 653  SER A OG  1 
ATOM 5086 N N   . ASP A 1 657  ? -3.624  51.237 -1.349  1.00 76.68  ? 654  ASP A N   1 
ATOM 5087 C CA  . ASP A 1 657  ? -3.838  49.905 -0.788  1.00 76.68  ? 654  ASP A CA  1 
ATOM 5088 C C   . ASP A 1 657  ? -3.318  49.859 0.651   1.00 76.68  ? 654  ASP A C   1 
ATOM 5089 O O   . ASP A 1 657  ? -3.961  49.278 1.511   1.00 76.68  ? 654  ASP A O   1 
ATOM 5090 C CB  . ASP A 1 657  ? -3.230  48.775 -1.643  1.00 109.54 ? 654  ASP A CB  1 
ATOM 5091 C CG  . ASP A 1 657  ? -1.789  49.034 -2.048  1.00 109.54 ? 654  ASP A CG  1 
ATOM 5092 O OD1 . ASP A 1 657  ? -1.572  49.936 -2.883  1.00 109.54 ? 654  ASP A OD1 1 
ATOM 5093 O OD2 . ASP A 1 657  ? -0.885  48.314 -1.562  1.00 109.54 ? 654  ASP A OD2 1 
ATOM 5094 N N   . ARG A 1 658  ? -2.183  50.514 0.911   1.00 59.91  ? 655  ARG A N   1 
ATOM 5095 C CA  . ARG A 1 658  ? -1.609  50.612 2.255   1.00 59.91  ? 655  ARG A CA  1 
ATOM 5096 C C   . ARG A 1 658  ? -1.777  52.026 2.851   1.00 59.91  ? 655  ARG A C   1 
ATOM 5097 O O   . ARG A 1 658  ? -0.829  52.814 2.842   1.00 59.91  ? 655  ARG A O   1 
ATOM 5098 C CB  . ARG A 1 658  ? -0.130  50.225 2.239   1.00 118.87 ? 655  ARG A CB  1 
ATOM 5099 C CG  . ARG A 1 658  ? 0.291   49.413 3.455   1.00 118.87 ? 655  ARG A CG  1 
ATOM 5100 C CD  . ARG A 1 658  ? 1.714   49.740 3.943   1.00 118.87 ? 655  ARG A CD  1 
ATOM 5101 N NE  . ARG A 1 658  ? 2.798   49.490 2.983   1.00 118.87 ? 655  ARG A NE  1 
ATOM 5102 C CZ  . ARG A 1 658  ? 2.834   48.529 2.055   1.00 118.87 ? 655  ARG A CZ  1 
ATOM 5103 N NH1 . ARG A 1 658  ? 1.836   47.662 1.916   1.00 118.87 ? 655  ARG A NH1 1 
ATOM 5104 N NH2 . ARG A 1 658  ? 3.889   48.435 1.251   1.00 118.87 ? 655  ARG A NH2 1 
ATOM 5105 N N   . PRO A 1 659  ? -2.979  52.345 3.367   1.00 50.79  ? 656  PRO A N   1 
ATOM 5106 C CA  . PRO A 1 659  ? -3.229  53.691 3.832   1.00 50.79  ? 656  PRO A CA  1 
ATOM 5107 C C   . PRO A 1 659  ? -2.282  54.095 4.936   1.00 50.79  ? 656  PRO A C   1 
ATOM 5108 O O   . PRO A 1 659  ? -2.017  53.328 5.860   1.00 50.79  ? 656  PRO A O   1 
ATOM 5109 C CB  . PRO A 1 659  ? -4.658  53.632 4.369   1.00 62.22  ? 656  PRO A CB  1 
ATOM 5110 C CG  . PRO A 1 659  ? -4.945  52.195 4.551   1.00 62.22  ? 656  PRO A CG  1 
ATOM 5111 C CD  . PRO A 1 659  ? -4.160  51.486 3.522   1.00 62.22  ? 656  PRO A CD  1 
ATOM 5112 N N   . THR A 1 660  ? -1.790  55.316 4.847   1.00 49.68  ? 657  THR A N   1 
ATOM 5113 C CA  . THR A 1 660  ? -0.770  55.765 5.738   1.00 49.68  ? 657  THR A CA  1 
ATOM 5114 C C   . THR A 1 660  ? -1.192  57.126 6.240   1.00 49.68  ? 657  THR A C   1 
ATOM 5115 O O   . THR A 1 660  ? -1.860  57.871 5.531   1.00 49.68  ? 657  THR A O   1 
ATOM 5116 C CB  . THR A 1 660  ? 0.580   55.879 4.970   1.00 56.11  ? 657  THR A CB  1 
ATOM 5117 O OG1 . THR A 1 660  ? 0.904   54.607 4.389   1.00 56.11  ? 657  THR A OG1 1 
ATOM 5118 C CG2 . THR A 1 660  ? 1.729   56.332 5.880   1.00 56.11  ? 657  THR A CG2 1 
ATOM 5119 N N   . VAL A 1 661  ? -0.832  57.435 7.477   1.00 57.09  ? 658  VAL A N   1 
ATOM 5120 C CA  . VAL A 1 661  ? -0.760  58.805 7.883   1.00 57.09  ? 658  VAL A CA  1 
ATOM 5121 C C   . VAL A 1 661  ? 0.692   59.244 7.931   1.00 57.09  ? 658  VAL A C   1 
ATOM 5122 O O   . VAL A 1 661  ? 1.621   58.446 8.190   1.00 57.09  ? 658  VAL A O   1 
ATOM 5123 C CB  . VAL A 1 661  ? -1.335  59.056 9.247   1.00 42.66  ? 658  VAL A CB  1 
ATOM 5124 C CG1 . VAL A 1 661  ? -1.095  60.507 9.589   1.00 42.66  ? 658  VAL A CG1 1 
ATOM 5125 C CG2 . VAL A 1 661  ? -2.830  58.781 9.283   1.00 42.66  ? 658  VAL A CG2 1 
ATOM 5126 N N   . ILE A 1 662  ? 0.844   60.553 7.821   1.00 134.14 ? 659  ILE A N   1 
ATOM 5127 C CA  . ILE A 1 662  ? 2.112   61.252 7.890   1.00 134.14 ? 659  ILE A CA  1 
ATOM 5128 C C   . ILE A 1 662  ? 1.976   62.253 9.046   1.00 134.14 ? 659  ILE A C   1 
ATOM 5129 O O   . ILE A 1 662  ? 1.354   63.293 8.882   1.00 134.14 ? 659  ILE A O   1 
ATOM 5130 C CB  . ILE A 1 662  ? 2.319   62.036 6.653   1.00 106.61 ? 659  ILE A CB  1 
ATOM 5131 C CG1 . ILE A 1 662  ? 3.391   61.371 5.802   1.00 106.61 ? 659  ILE A CG1 1 
ATOM 5132 C CG2 . ILE A 1 662  ? 2.708   63.404 7.025   1.00 106.61 ? 659  ILE A CG2 1 
ATOM 5133 C CD1 . ILE A 1 662  ? 2.846   60.519 4.688   1.00 106.61 ? 659  ILE A CD1 1 
ATOM 5134 N N   . TYR A 1 663  ? 2.553   61.916 10.206  1.00 157.68 ? 660  TYR A N   1 
ATOM 5135 C CA  . TYR A 1 663  ? 2.515   62.708 11.453  1.00 157.68 ? 660  TYR A CA  1 
ATOM 5136 C C   . TYR A 1 663  ? 3.420   63.967 11.464  1.00 157.68 ? 660  TYR A C   1 
ATOM 5137 O O   . TYR A 1 663  ? 3.422   64.754 10.544  1.00 157.68 ? 660  TYR A O   1 
ATOM 5138 C CB  . TYR A 1 663  ? 2.903   61.791 12.659  1.00 157.75 ? 660  TYR A CB  1 
ATOM 5139 C CG  . TYR A 1 663  ? 3.048   62.341 14.110  1.00 157.75 ? 660  TYR A CG  1 
ATOM 5140 C CD1 . TYR A 1 663  ? 1.964   62.641 14.937  1.00 157.75 ? 660  TYR A CD1 1 
ATOM 5141 C CD2 . TYR A 1 663  ? 4.323   62.556 14.638  1.00 157.75 ? 660  TYR A CD2 1 
ATOM 5142 C CE1 . TYR A 1 663  ? 2.176   63.150 16.274  1.00 157.75 ? 660  TYR A CE1 1 
ATOM 5143 C CE2 . TYR A 1 663  ? 4.538   63.043 15.947  1.00 157.75 ? 660  TYR A CE2 1 
ATOM 5144 C CZ  . TYR A 1 663  ? 3.483   63.346 16.757  1.00 157.75 ? 660  TYR A CZ  1 
ATOM 5145 O OH  . TYR A 1 663  ? 3.768   63.820 18.025  1.00 157.75 ? 660  TYR A OH  1 
ATOM 5146 N N   . SER A 1 664  ? 4.180   64.122 12.549  1.00 212.91 ? 661  SER A N   1 
ATOM 5147 C CA  . SER A 1 664  ? 5.112   65.228 12.794  1.00 212.91 ? 661  SER A CA  1 
ATOM 5148 C C   . SER A 1 664  ? 5.919   64.933 14.070  1.00 212.91 ? 661  SER A C   1 
ATOM 5149 O O   . SER A 1 664  ? 5.594   65.409 15.146  1.00 212.91 ? 661  SER A O   1 
ATOM 5150 C CB  . SER A 1 664  ? 4.344   66.523 12.931  1.00 107.57 ? 661  SER A CB  1 
ATOM 5151 O OG  . SER A 1 664  ? 3.401   66.618 11.888  1.00 107.57 ? 661  SER A OG  1 
ATOM 5152 N N   . SER A 1 665  ? 6.968   64.131 13.896  1.00 161.65 ? 662  SER A N   1 
ATOM 5153 C CA  . SER A 1 665  ? 7.921   63.625 14.891  1.00 161.65 ? 662  SER A CA  1 
ATOM 5154 C C   . SER A 1 665  ? 8.615   64.794 15.619  1.00 161.65 ? 662  SER A C   1 
ATOM 5155 O O   . SER A 1 665  ? 7.954   65.738 16.057  1.00 161.65 ? 662  SER A O   1 
ATOM 5156 C CB  . SER A 1 665  ? 8.925   62.664 14.213  1.00 81.06  ? 662  SER A CB  1 
ATOM 5157 O OG  . SER A 1 665  ? 10.061  62.380 15.015  1.00 81.06  ? 662  SER A OG  1 
ATOM 5158 N N   . ASN A 1 666  ? 9.938   64.725 15.743  1.00 193.83 ? 663  ASN A N   1 
ATOM 5159 C CA  . ASN A 1 666  ? 10.743  65.766 16.377  1.00 193.83 ? 663  ASN A CA  1 
ATOM 5160 C C   . ASN A 1 666  ? 10.921  66.970 15.453  1.00 193.83 ? 663  ASN A C   1 
ATOM 5161 O O   . ASN A 1 666  ? 12.050  67.387 15.165  1.00 193.83 ? 663  ASN A O   1 
ATOM 5162 C CB  . ASN A 1 666  ? 12.105  65.183 16.761  1.00 165.29 ? 663  ASN A CB  1 
ATOM 5163 C CG  . ASN A 1 666  ? 12.703  64.305 15.657  1.00 165.29 ? 663  ASN A CG  1 
ATOM 5164 O OD1 . ASN A 1 666  ? 12.914  64.759 14.527  1.00 165.29 ? 663  ASN A OD1 1 
ATOM 5165 N ND2 . ASN A 1 666  ? 12.975  63.043 15.985  1.00 165.29 ? 663  ASN A ND2 1 
ATOM 5166 N N   . HIS A 1 667  ? 9.791   67.530 15.012  1.00 92.68  ? 664  HIS A N   1 
ATOM 5167 C CA  . HIS A 1 667  ? 9.721   68.445 13.858  1.00 92.68  ? 664  HIS A CA  1 
ATOM 5168 C C   . HIS A 1 667  ? 10.045  67.664 12.583  1.00 92.68  ? 664  HIS A C   1 
ATOM 5169 O O   . HIS A 1 667  ? 10.447  68.229 11.569  1.00 92.68  ? 664  HIS A O   1 
ATOM 5170 C CB  . HIS A 1 667  ? 10.599  69.706 14.031  1.00 132.11 ? 664  HIS A CB  1 
ATOM 5171 C CG  . HIS A 1 667  ? 10.322  70.789 13.027  1.00 132.11 ? 664  HIS A CG  1 
ATOM 5172 N ND1 . HIS A 1 667  ? 10.997  70.884 11.828  1.00 132.11 ? 664  HIS A ND1 1 
ATOM 5173 C CD2 . HIS A 1 667  ? 9.447   71.822 13.046  1.00 132.11 ? 664  HIS A CD2 1 
ATOM 5174 C CE1 . HIS A 1 667  ? 10.547  71.925 11.150  1.00 132.11 ? 664  HIS A CE1 1 
ATOM 5175 N NE2 . HIS A 1 667  ? 9.604   72.509 11.865  1.00 132.11 ? 664  HIS A NE2 1 
ATOM 5176 N N   . LYS A 1 668  ? 9.869   66.349 12.653  1.00 212.91 ? 665  LYS A N   1 
ATOM 5177 C CA  . LYS A 1 668  ? 9.909   65.517 11.467  1.00 212.91 ? 665  LYS A CA  1 
ATOM 5178 C C   . LYS A 1 668  ? 8.478   65.127 11.108  1.00 212.91 ? 665  LYS A C   1 
ATOM 5179 O O   . LYS A 1 668  ? 7.533   65.795 11.529  1.00 212.91 ? 665  LYS A O   1 
ATOM 5180 C CB  . LYS A 1 668  ? 10.771  64.284 11.699  1.00 89.81  ? 665  LYS A CB  1 
ATOM 5181 C CG  . LYS A 1 668  ? 12.263  64.483 11.499  1.00 89.81  ? 665  LYS A CG  1 
ATOM 5182 C CD  . LYS A 1 668  ? 12.754  63.388 10.564  1.00 89.81  ? 665  LYS A CD  1 
ATOM 5183 C CE  . LYS A 1 668  ? 13.823  62.517 11.172  1.00 89.81  ? 665  LYS A CE  1 
ATOM 5184 N NZ  . LYS A 1 668  ? 13.750  61.195 10.484  1.00 89.81  ? 665  LYS A NZ  1 
ATOM 5185 N N   . LEU A 1 669  ? 8.321   64.051 10.342  1.00 91.94  ? 666  LEU A N   1 
ATOM 5186 C CA  . LEU A 1 669  ? 7.009   63.647 9.828   1.00 91.94  ? 666  LEU A CA  1 
ATOM 5187 C C   . LEU A 1 669  ? 6.852   62.151 9.935   1.00 91.94  ? 666  LEU A C   1 
ATOM 5188 O O   . LEU A 1 669  ? 7.631   61.412 9.343   1.00 91.94  ? 666  LEU A O   1 
ATOM 5189 C CB  . LEU A 1 669  ? 6.837   64.058 8.354   1.00 115.04 ? 666  LEU A CB  1 
ATOM 5190 C CG  . LEU A 1 669  ? 6.791   65.506 7.839   1.00 115.04 ? 666  LEU A CG  1 
ATOM 5191 C CD1 . LEU A 1 669  ? 6.249   65.518 6.416   1.00 115.04 ? 666  LEU A CD1 1 
ATOM 5192 C CD2 . LEU A 1 669  ? 5.962   66.434 8.704   1.00 115.04 ? 666  LEU A CD2 1 
ATOM 5193 N N   . VAL A 1 670  ? 5.858   61.720 10.633  1.00 144.85 ? 667  VAL A N   1 
ATOM 5194 C CA  . VAL A 1 670  ? 5.652   60.299 10.910  1.00 144.85 ? 667  VAL A CA  1 
ATOM 5195 C C   . VAL A 1 670  ? 5.109   59.618 9.658   1.00 144.85 ? 667  VAL A C   1 
ATOM 5196 O O   . VAL A 1 670  ? 4.604   60.285 8.757   1.00 144.85 ? 667  VAL A O   1 
ATOM 5197 C CB  . VAL A 1 670  ? 4.722   60.065 12.151  1.00 85.14  ? 667  VAL A CB  1 
ATOM 5198 C CG1 . VAL A 1 670  ? 4.412   58.582 12.360  1.00 85.14  ? 667  VAL A CG1 1 
ATOM 5199 C CG2 . VAL A 1 670  ? 5.370   60.589 13.402  1.00 85.14  ? 667  VAL A CG2 1 
ATOM 5200 N N   . PHE A 1 671  ? 5.235   58.291 9.650   1.00 151.04 ? 668  PHE A N   1 
ATOM 5201 C CA  . PHE A 1 671  ? 4.777   57.473 8.529   1.00 151.04 ? 668  PHE A CA  1 
ATOM 5202 C C   . PHE A 1 671  ? 4.102   56.183 8.993   1.00 151.04 ? 668  PHE A C   1 
ATOM 5203 O O   . PHE A 1 671  ? 4.487   55.077 8.600   1.00 151.04 ? 668  PHE A O   1 
ATOM 5204 C CB  . PHE A 1 671  ? 5.942   57.175 7.592   1.00 143.10 ? 668  PHE A CB  1 
ATOM 5205 C CG  . PHE A 1 671  ? 6.174   58.246 6.584   1.00 143.10 ? 668  PHE A CG  1 
ATOM 5206 C CD1 . PHE A 1 671  ? 6.789   59.437 6.945   1.00 143.10 ? 668  PHE A CD1 1 
ATOM 5207 C CD2 . PHE A 1 671  ? 5.763   58.073 5.273   1.00 143.10 ? 668  PHE A CD2 1 
ATOM 5208 C CE1 . PHE A 1 671  ? 6.993   60.437 6.019   1.00 143.10 ? 668  PHE A CE1 1 
ATOM 5209 C CE2 . PHE A 1 671  ? 5.970   59.065 4.336   1.00 143.10 ? 668  PHE A CE2 1 
ATOM 5210 C CZ  . PHE A 1 671  ? 6.587   60.250 4.710   1.00 143.10 ? 668  PHE A CZ  1 
ATOM 5211 N N   . SER A 1 672  ? 3.083   56.348 9.826   1.00 61.69  ? 669  SER A N   1 
ATOM 5212 C CA  . SER A 1 672  ? 2.384   55.230 10.438  1.00 61.69  ? 669  SER A CA  1 
ATOM 5213 C C   . SER A 1 672  ? 1.248   54.652 9.575   1.00 61.69  ? 669  SER A C   1 
ATOM 5214 O O   . SER A 1 672  ? 0.467   55.399 8.968   1.00 61.69  ? 669  SER A O   1 
ATOM 5215 C CB  . SER A 1 672  ? 1.810   55.638 11.798  1.00 194.13 ? 669  SER A CB  1 
ATOM 5216 O OG  . SER A 1 672  ? 2.823   56.077 12.681  1.00 194.13 ? 669  SER A OG  1 
ATOM 5217 N N   . ASN A 1 673  ? 1.167   53.319 9.543   1.00 49.25  ? 670  ASN A N   1 
ATOM 5218 C CA  . ASN A 1 673  ? 0.037   52.617 8.952   1.00 49.25  ? 670  ASN A CA  1 
ATOM 5219 C C   . ASN A 1 673  ? -1.320  52.974 9.546   1.00 49.25  ? 670  ASN A C   1 
ATOM 5220 O O   . ASN A 1 673  ? -1.437  53.324 10.722  1.00 49.25  ? 670  ASN A O   1 
ATOM 5221 C CB  . ASN A 1 673  ? 0.227   51.121 9.097   1.00 72.55  ? 670  ASN A CB  1 
ATOM 5222 C CG  . ASN A 1 673  ? 1.319   50.602 8.244   1.00 72.55  ? 670  ASN A CG  1 
ATOM 5223 O OD1 . ASN A 1 673  ? 1.626   51.174 7.199   1.00 72.55  ? 670  ASN A OD1 1 
ATOM 5224 N ND2 . ASN A 1 673  ? 1.920   49.497 8.665   1.00 72.55  ? 670  ASN A ND2 1 
ATOM 5225 N N   . VAL A 1 674  ? -2.343  52.865 8.703   1.00 59.24  ? 671  VAL A N   1 
ATOM 5226 C CA  . VAL A 1 674  ? -3.728  53.025 9.122   1.00 59.24  ? 671  VAL A CA  1 
ATOM 5227 C C   . VAL A 1 674  ? -4.430  51.694 9.009   1.00 59.24  ? 671  VAL A C   1 
ATOM 5228 O O   . VAL A 1 674  ? -4.283  50.976 8.029   1.00 59.24  ? 671  VAL A O   1 
ATOM 5229 C CB  . VAL A 1 674  ? -4.451  54.095 8.287   1.00 46.25  ? 671  VAL A CB  1 
ATOM 5230 C CG1 . VAL A 1 674  ? -5.984  53.882 8.291   1.00 46.25  ? 671  VAL A CG1 1 
ATOM 5231 C CG2 . VAL A 1 674  ? -4.091  55.467 8.777   1.00 46.25  ? 671  VAL A CG2 1 
ATOM 5232 N N   . ASN A 1 675  ? -5.199  51.375 10.028  1.00 68.66  ? 672  ASN A N   1 
ATOM 5233 C CA  . ASN A 1 675  ? -5.834  50.092 10.099  1.00 68.66  ? 672  ASN A CA  1 
ATOM 5234 C C   . ASN A 1 675  ? -7.098  49.988 9.250   1.00 68.66  ? 672  ASN A C   1 
ATOM 5235 O O   . ASN A 1 675  ? -8.153  49.608 9.762   1.00 68.66  ? 672  ASN A O   1 
ATOM 5236 C CB  . ASN A 1 675  ? -6.193  49.774 11.541  1.00 47.41  ? 672  ASN A CB  1 
ATOM 5237 C CG  . ASN A 1 675  ? -4.967  49.639 12.471  1.00 47.41  ? 672  ASN A CG  1 
ATOM 5238 O OD1 . ASN A 1 675  ? -3.883  49.204 12.063  1.00 47.41  ? 672  ASN A OD1 1 
ATOM 5239 N ND2 . ASN A 1 675  ? -5.168  49.996 13.755  1.00 47.41  ? 672  ASN A ND2 1 
ATOM 5240 N N   . LEU A 1 676  ? -6.997  50.312 7.961   1.00 65.35  ? 673  LEU A N   1 
ATOM 5241 C CA  . LEU A 1 676  ? -8.103  50.074 7.027   1.00 65.35  ? 673  LEU A CA  1 
ATOM 5242 C C   . LEU A 1 676  ? -7.745  49.160 5.867   1.00 65.35  ? 673  LEU A C   1 
ATOM 5243 O O   . LEU A 1 676  ? -6.574  48.928 5.567   1.00 65.35  ? 673  LEU A O   1 
ATOM 5244 C CB  . LEU A 1 676  ? -8.712  51.369 6.514   1.00 56.13  ? 673  LEU A CB  1 
ATOM 5245 C CG  . LEU A 1 676  ? -9.560  52.065 7.565   1.00 56.13  ? 673  LEU A CG  1 
ATOM 5246 C CD1 . LEU A 1 676  ? -10.103 53.396 7.041   1.00 56.13  ? 673  LEU A CD1 1 
ATOM 5247 C CD2 . LEU A 1 676  ? -10.690 51.138 8.021   1.00 56.13  ? 673  LEU A CD2 1 
ATOM 5248 N N   . LYS A 1 677  ? -8.794  48.635 5.243   1.00 90.14  ? 674  LYS A N   1 
ATOM 5249 C CA  . LYS A 1 677  ? -8.683  47.655 4.179   1.00 90.14  ? 674  LYS A CA  1 
ATOM 5250 C C   . LYS A 1 677  ? -8.013  48.339 2.998   1.00 90.14  ? 674  LYS A C   1 
ATOM 5251 O O   . LYS A 1 677  ? -7.020  47.841 2.476   1.00 90.14  ? 674  LYS A O   1 
ATOM 5252 C CB  . LYS A 1 677  ? -10.081 47.119 3.816   1.00 93.81  ? 674  LYS A CB  1 
ATOM 5253 C CG  . LYS A 1 677  ? -10.116 45.761 3.105   1.00 93.81  ? 674  LYS A CG  1 
ATOM 5254 C CD  . LYS A 1 677  ? -11.494 45.516 2.484   1.00 93.81  ? 674  LYS A CD  1 
ATOM 5255 C CE  . LYS A 1 677  ? -11.514 44.213 1.698   1.00 93.81  ? 674  LYS A CE  1 
ATOM 5256 N NZ  . LYS A 1 677  ? -12.874 43.931 1.148   1.00 93.81  ? 674  LYS A NZ  1 
ATOM 5257 N N   . GLU A 1 678  ? -8.545  49.492 2.601   1.00 74.30  ? 675  GLU A N   1 
ATOM 5258 C CA  . GLU A 1 678  ? -7.964  50.317 1.547   1.00 74.30  ? 675  GLU A CA  1 
ATOM 5259 C C   . GLU A 1 678  ? -8.653  51.644 1.634   1.00 74.30  ? 675  GLU A C   1 
ATOM 5260 O O   . GLU A 1 678  ? -9.795  51.710 2.096   1.00 74.30  ? 675  GLU A O   1 
ATOM 5261 C CB  . GLU A 1 678  ? -8.214  49.720 0.167   1.00 140.92 ? 675  GLU A CB  1 
ATOM 5262 C CG  . GLU A 1 678  ? -7.421  50.414 -0.922  1.00 140.92 ? 675  GLU A CG  1 
ATOM 5263 C CD  . GLU A 1 678  ? -7.748  49.928 -2.315  1.00 140.92 ? 675  GLU A CD  1 
ATOM 5264 O OE1 . GLU A 1 678  ? -8.856  49.382 -2.521  1.00 140.92 ? 675  GLU A OE1 1 
ATOM 5265 O OE2 . GLU A 1 678  ? -6.892  50.108 -3.209  1.00 140.92 ? 675  GLU A OE2 1 
ATOM 5266 N N   . VAL A 1 679  ? -7.964  52.707 1.236   1.00 75.93  ? 676  VAL A N   1 
ATOM 5267 C CA  . VAL A 1 679  ? -8.634  53.985 1.076   1.00 75.93  ? 676  VAL A CA  1 
ATOM 5268 C C   . VAL A 1 679  ? -8.288  54.539 -0.285  1.00 75.93  ? 676  VAL A C   1 
ATOM 5269 O O   . VAL A 1 679  ? -7.139  54.460 -0.707  1.00 75.93  ? 676  VAL A O   1 
ATOM 5270 C CB  . VAL A 1 679  ? -8.308  55.009 2.192   1.00 62.06  ? 676  VAL A CB  1 
ATOM 5271 C CG1 . VAL A 1 679  ? -9.316  56.113 2.183   1.00 62.06  ? 676  VAL A CG1 1 
ATOM 5272 C CG2 . VAL A 1 679  ? -8.349  54.367 3.533   1.00 62.06  ? 676  VAL A CG2 1 
ATOM 5273 N N   . ASN A 1 680  ? -9.308  55.072 -0.963  1.00 77.66  ? 677  ASN A N   1 
ATOM 5274 C CA  . ASN A 1 680  ? -9.194  55.679 -2.283  1.00 77.66  ? 677  ASN A CA  1 
ATOM 5275 C C   . ASN A 1 680  ? -9.044  57.181 -2.177  1.00 77.66  ? 677  ASN A C   1 
ATOM 5276 O O   . ASN A 1 680  ? -8.061  57.758 -2.642  1.00 77.66  ? 677  ASN A O   1 
ATOM 5277 C CB  . ASN A 1 680  ? -10.407 55.321 -3.128  1.00 112.33 ? 677  ASN A CB  1 
ATOM 5278 C CG  . ASN A 1 680  ? -10.345 53.913 -3.665  1.00 112.33 ? 677  ASN A CG  1 
ATOM 5279 O OD1 . ASN A 1 680  ? -9.311  53.249 -3.594  1.00 112.33 ? 677  ASN A OD1 1 
ATOM 5280 N ND2 . ASN A 1 680  ? -11.456 53.450 -4.226  1.00 112.33 ? 677  ASN A ND2 1 
ATOM 5281 N N   . TYR A 1 681  ? -10.027 57.814 -1.549  1.00 61.21  ? 678  TYR A N   1 
ATOM 5282 C CA  . TYR A 1 681  ? -9.991  59.265 -1.295  1.00 61.21  ? 678  TYR A CA  1 
ATOM 5283 C C   . TYR A 1 681  ? -10.580 59.408 0.071   1.00 61.21  ? 678  TYR A C   1 
ATOM 5284 O O   . TYR A 1 681  ? -11.198 58.460 0.573   1.00 61.21  ? 678  TYR A O   1 
ATOM 5285 C CB  . TYR A 1 681  ? -10.793 60.068 -2.339  1.00 74.98  ? 678  TYR A CB  1 
ATOM 5286 C CG  . TYR A 1 681  ? -10.640 59.476 -3.698  1.00 74.98  ? 678  TYR A CG  1 
ATOM 5287 C CD1 . TYR A 1 681  ? -11.448 58.415 -4.093  1.00 74.98  ? 678  TYR A CD1 1 
ATOM 5288 C CD2 . TYR A 1 681  ? -9.641  59.906 -4.553  1.00 74.98  ? 678  TYR A CD2 1 
ATOM 5289 C CE1 . TYR A 1 681  ? -11.279 57.821 -5.300  1.00 74.98  ? 678  TYR A CE1 1 
ATOM 5290 C CE2 . TYR A 1 681  ? -9.470  59.326 -5.773  1.00 74.98  ? 678  TYR A CE2 1 
ATOM 5291 C CZ  . TYR A 1 681  ? -10.294 58.280 -6.140  1.00 74.98  ? 678  TYR A CZ  1 
ATOM 5292 O OH  . TYR A 1 681  ? -10.154 57.674 -7.363  1.00 74.98  ? 678  TYR A OH  1 
ATOM 5293 N N   . MET A 1 682  ? -10.382 60.582 0.657   1.00 81.10  ? 679  MET A N   1 
ATOM 5294 C CA  . MET A 1 682  ? -10.567 60.799 2.065   1.00 81.10  ? 679  MET A CA  1 
ATOM 5295 C C   . MET A 1 682  ? -10.613 62.303 2.294   1.00 81.10  ? 679  MET A C   1 
ATOM 5296 O O   . MET A 1 682  ? -9.846  63.024 1.675   1.00 81.10  ? 679  MET A O   1 
ATOM 5297 C CB  . MET A 1 682  ? -9.390  60.169 2.820   1.00 94.61  ? 679  MET A CB  1 
ATOM 5298 C CG  . MET A 1 682  ? -9.120  60.765 4.173   1.00 94.61  ? 679  MET A CG  1 
ATOM 5299 S SD  . MET A 1 682  ? -8.372  62.371 3.932   1.00 94.61  ? 679  MET A SD  1 
ATOM 5300 C CE  . MET A 1 682  ? -8.876  63.269 5.382   1.00 94.61  ? 679  MET A CE  1 
ATOM 5301 N N   . CYS A 1 683  ? -11.502 62.776 3.167   1.00 135.70 ? 680  CYS A N   1 
ATOM 5302 C CA  . CYS A 1 683  ? -11.542 64.202 3.533   1.00 135.70 ? 680  CYS A CA  1 
ATOM 5303 C C   . CYS A 1 683  ? -12.101 64.442 4.935   1.00 135.70 ? 680  CYS A C   1 
ATOM 5304 O O   . CYS A 1 683  ? -12.830 63.596 5.446   1.00 135.70 ? 680  CYS A O   1 
ATOM 5305 C CB  . CYS A 1 683  ? -12.292 65.047 2.481   1.00 109.44 ? 680  CYS A CB  1 
ATOM 5306 S SG  . CYS A 1 683  ? -14.018 64.617 2.065   1.00 109.44 ? 680  CYS A SG  1 
ATOM 5307 N N   . PRO A 1 684  ? -11.752 65.592 5.560   1.00 119.67 ? 681  PRO A N   1 
ATOM 5308 C CA  . PRO A 1 684  ? -12.287 65.977 6.873   1.00 119.67 ? 681  PRO A CA  1 
ATOM 5309 C C   . PRO A 1 684  ? -13.815 66.156 6.865   1.00 119.67 ? 681  PRO A C   1 
ATOM 5310 O O   . PRO A 1 684  ? -14.451 65.891 5.846   1.00 119.67 ? 681  PRO A O   1 
ATOM 5311 C CB  . PRO A 1 684  ? -11.586 67.312 7.177   1.00 88.87  ? 681  PRO A CB  1 
ATOM 5312 C CG  . PRO A 1 684  ? -10.483 67.402 6.261   1.00 88.87  ? 681  PRO A CG  1 
ATOM 5313 C CD  . PRO A 1 684  ? -10.812 66.599 5.048   1.00 88.87  ? 681  PRO A CD  1 
ATOM 5314 N N   . LEU A 1 685  ? -14.394 66.587 7.991   1.00 212.24 ? 682  LEU A N   1 
ATOM 5315 C CA  . LEU A 1 685  ? -15.858 66.697 8.132   1.00 212.24 ? 682  LEU A CA  1 
ATOM 5316 C C   . LEU A 1 685  ? -16.273 67.301 9.478   1.00 212.24 ? 682  LEU A C   1 
ATOM 5317 O O   . LEU A 1 685  ? -15.415 67.564 10.328  1.00 212.24 ? 682  LEU A O   1 
ATOM 5318 C CB  . LEU A 1 685  ? -16.501 65.315 7.972   1.00 85.77  ? 682  LEU A CB  1 
ATOM 5319 C CG  . LEU A 1 685  ? -17.896 65.156 7.363   1.00 85.77  ? 682  LEU A CG  1 
ATOM 5320 C CD1 . LEU A 1 685  ? -17.873 65.413 5.875   1.00 85.77  ? 682  LEU A CD1 1 
ATOM 5321 C CD2 . LEU A 1 685  ? -18.451 63.761 7.639   1.00 85.77  ? 682  LEU A CD2 1 
ATOM 5322 N N   . ASN A 1 686  ? -17.583 67.516 9.664   1.00 159.54 ? 683  ASN A N   1 
ATOM 5323 C CA  . ASN A 1 686  ? -18.135 68.032 10.928  1.00 159.54 ? 683  ASN A CA  1 
ATOM 5324 C C   . ASN A 1 686  ? -19.675 68.136 11.046  1.00 159.54 ? 683  ASN A C   1 
ATOM 5325 O O   . ASN A 1 686  ? -20.172 68.866 11.906  1.00 159.54 ? 683  ASN A O   1 
ATOM 5326 C CB  . ASN A 1 686  ? -17.496 69.386 11.274  1.00 116.61 ? 683  ASN A CB  1 
ATOM 5327 C CG  . ASN A 1 686  ? -17.756 69.806 12.704  1.00 116.61 ? 683  ASN A CG  1 
ATOM 5328 O OD1 . ASN A 1 686  ? -17.907 68.971 13.595  1.00 116.61 ? 683  ASN A OD1 1 
ATOM 5329 N ND2 . ASN A 1 686  ? -17.820 71.112 12.930  1.00 116.61 ? 683  ASN A ND2 1 
ATOM 5330 N N   . SER A 1 687  ? -20.419 67.401 10.215  1.00 163.05 ? 684  SER A N   1 
ATOM 5331 C CA  . SER A 1 687  ? -21.904 67.417 10.220  1.00 163.05 ? 684  SER A CA  1 
ATOM 5332 C C   . SER A 1 687  ? -22.545 67.433 11.628  1.00 163.05 ? 684  SER A C   1 
ATOM 5333 O O   . SER A 1 687  ? -21.975 66.885 12.578  1.00 163.05 ? 684  SER A O   1 
ATOM 5334 C CB  . SER A 1 687  ? -22.445 66.228 9.403   1.00 130.39 ? 684  SER A CB  1 
ATOM 5335 O OG  . SER A 1 687  ? -23.864 66.249 9.285   1.00 130.39 ? 684  SER A OG  1 
ATOM 5336 N N   . ASP A 1 688  ? -23.718 68.061 11.765  1.00 179.43 ? 685  ASP A N   1 
ATOM 5337 C CA  . ASP A 1 688  ? -24.450 68.031 13.047  1.00 179.43 ? 685  ASP A CA  1 
ATOM 5338 C C   . ASP A 1 688  ? -25.040 66.642 13.283  1.00 179.43 ? 685  ASP A C   1 
ATOM 5339 O O   . ASP A 1 688  ? -26.255 66.452 13.378  1.00 179.43 ? 685  ASP A O   1 
ATOM 5340 C CB  . ASP A 1 688  ? -25.497 69.164 13.177  1.00 94.26  ? 685  ASP A CB  1 
ATOM 5341 C CG  . ASP A 1 688  ? -26.579 69.137 12.083  1.00 94.26  ? 685  ASP A CG  1 
ATOM 5342 O OD1 . ASP A 1 688  ? -26.779 68.109 11.392  1.00 94.26  ? 685  ASP A OD1 1 
ATOM 5343 O OD2 . ASP A 1 688  ? -27.253 70.179 11.928  1.00 94.26  ? 685  ASP A OD2 1 
ATOM 5344 N N   . GLY A 1 689  ? -24.137 65.674 13.391  1.00 85.12  ? 686  GLY A N   1 
ATOM 5345 C CA  . GLY A 1 689  ? -24.476 64.245 13.337  1.00 85.12  ? 686  GLY A CA  1 
ATOM 5346 C C   . GLY A 1 689  ? -23.316 63.353 12.883  1.00 85.12  ? 686  GLY A C   1 
ATOM 5347 O O   . GLY A 1 689  ? -23.427 62.118 12.891  1.00 85.12  ? 686  GLY A O   1 
ATOM 5348 N N   . TYR A 1 690  ? -22.219 63.997 12.464  1.00 77.65  ? 687  TYR A N   1 
ATOM 5349 C CA  . TYR A 1 690  ? -20.929 63.367 12.178  1.00 77.65  ? 687  TYR A CA  1 
ATOM 5350 C C   . TYR A 1 690  ? -19.758 64.355 12.429  1.00 77.65  ? 687  TYR A C   1 
ATOM 5351 O O   . TYR A 1 690  ? -19.029 64.697 11.496  1.00 77.65  ? 687  TYR A O   1 
ATOM 5352 C CB  . TYR A 1 690  ? -20.897 62.854 10.743  1.00 99.19  ? 687  TYR A CB  1 
ATOM 5353 C CG  . TYR A 1 690  ? -21.691 61.602 10.546  1.00 99.19  ? 687  TYR A CG  1 
ATOM 5354 C CD1 . TYR A 1 690  ? -21.268 60.398 11.090  1.00 99.19  ? 687  TYR A CD1 1 
ATOM 5355 C CD2 . TYR A 1 690  ? -22.867 61.615 9.811   1.00 99.19  ? 687  TYR A CD2 1 
ATOM 5356 C CE1 . TYR A 1 690  ? -21.994 59.240 10.908  1.00 99.19  ? 687  TYR A CE1 1 
ATOM 5357 C CE2 . TYR A 1 690  ? -23.604 60.461 9.622   1.00 99.19  ? 687  TYR A CE2 1 
ATOM 5358 C CZ  . TYR A 1 690  ? -23.157 59.281 10.171  1.00 99.19  ? 687  TYR A CZ  1 
ATOM 5359 O OH  . TYR A 1 690  ? -23.877 58.137 9.983   1.00 99.19  ? 687  TYR A OH  1 
ATOM 5360 N N   . PRO A 1 691  ? -19.602 64.791 13.675  1.00 119.60 ? 688  PRO A N   1 
ATOM 5361 C CA  . PRO A 1 691  ? -18.535 65.726 14.035  1.00 119.60 ? 688  PRO A CA  1 
ATOM 5362 C C   . PRO A 1 691  ? -17.169 65.242 13.559  1.00 119.60 ? 688  PRO A C   1 
ATOM 5363 O O   . PRO A 1 691  ? -17.045 64.108 13.096  1.00 119.60 ? 688  PRO A O   1 
ATOM 5364 C CB  . PRO A 1 691  ? -18.598 65.705 15.563  1.00 94.24  ? 688  PRO A CB  1 
ATOM 5365 C CG  . PRO A 1 691  ? -20.064 65.600 15.804  1.00 94.24  ? 688  PRO A CG  1 
ATOM 5366 C CD  . PRO A 1 691  ? -20.419 64.469 14.857  1.00 94.24  ? 688  PRO A CD  1 
ATOM 5367 N N   . ASP A 1 692  ? -16.160 66.098 13.675  1.00 109.10 ? 689  ASP A N   1 
ATOM 5368 C CA  . ASP A 1 692  ? -14.808 65.750 13.255  1.00 109.10 ? 689  ASP A CA  1 
ATOM 5369 C C   . ASP A 1 692  ? -14.697 64.265 12.927  1.00 109.10 ? 689  ASP A C   1 
ATOM 5370 O O   . ASP A 1 692  ? -14.777 63.416 13.815  1.00 109.10 ? 689  ASP A O   1 
ATOM 5371 C CB  . ASP A 1 692  ? -13.796 66.126 14.339  1.00 106.80 ? 689  ASP A CB  1 
ATOM 5372 C CG  . ASP A 1 692  ? -12.371 65.784 13.950  1.00 106.80 ? 689  ASP A CG  1 
ATOM 5373 O OD1 . ASP A 1 692  ? -12.168 65.256 12.837  1.00 106.80 ? 689  ASP A OD1 1 
ATOM 5374 O OD2 . ASP A 1 692  ? -11.454 66.044 14.758  1.00 106.80 ? 689  ASP A OD2 1 
ATOM 5375 N N   . SER A 1 693  ? -14.657 64.031 11.651  1.00 202.06 ? 690  SER A N   1 
ATOM 5376 C CA  . SER A 1 693  ? -14.614 62.726 11.144  1.00 202.06 ? 690  SER A CA  1 
ATOM 5377 C C   . SER A 1 693  ? -14.062 63.012 9.795   1.00 202.06 ? 690  SER A C   1 
ATOM 5378 O O   . SER A 1 693  ? -14.170 64.128 9.300   1.00 202.06 ? 690  SER A O   1 
ATOM 5379 C CB  . SER A 1 693  ? -16.035 62.203 11.054  1.00 95.90  ? 690  SER A CB  1 
ATOM 5380 O OG  . SER A 1 693  ? -16.534 62.362 9.760   1.00 95.90  ? 690  SER A OG  1 
ATOM 5381 N N   . LEU A 1 694  ? -13.453 62.009 9.209   1.00 63.46  ? 691  LEU A N   1 
ATOM 5382 C CA  . LEU A 1 694  ? -12.885 62.165 7.929   1.00 63.46  ? 691  LEU A CA  1 
ATOM 5383 C C   . LEU A 1 694  ? -13.626 61.173 7.144   1.00 63.46  ? 691  LEU A C   1 
ATOM 5384 O O   . LEU A 1 694  ? -13.627 60.027 7.500   1.00 63.46  ? 691  LEU A O   1 
ATOM 5385 C CB  . LEU A 1 694  ? -11.438 61.737 7.994   1.00 64.98  ? 691  LEU A CB  1 
ATOM 5386 C CG  . LEU A 1 694  ? -10.834 61.908 9.375   1.00 64.98  ? 691  LEU A CG  1 
ATOM 5387 C CD1 . LEU A 1 694  ? -9.364  61.695 9.329   1.00 64.98  ? 691  LEU A CD1 1 
ATOM 5388 C CD2 . LEU A 1 694  ? -11.153 63.260 9.922   1.00 64.98  ? 691  LEU A CD2 1 
ATOM 5389 N N   . ALA A 1 695  ? -14.285 61.563 6.075   1.00 99.34  ? 692  ALA A N   1 
ATOM 5390 C CA  . ALA A 1 695  ? -14.945 60.455 5.395   1.00 99.34  ? 692  ALA A CA  1 
ATOM 5391 C C   . ALA A 1 695  ? -13.970 59.702 4.497   1.00 99.34  ? 692  ALA A C   1 
ATOM 5392 O O   . ALA A 1 695  ? -13.164 60.310 3.793   1.00 99.34  ? 692  ALA A O   1 
ATOM 5393 C CB  . ALA A 1 695  ? -16.132 60.959 4.589   1.00 125.11 ? 692  ALA A CB  1 
ATOM 5394 N N   . LEU A 1 696  ? -14.049 58.376 4.527   1.00 78.28  ? 693  LEU A N   1 
ATOM 5395 C CA  . LEU A 1 696  ? -13.173 57.538 3.717   1.00 78.28  ? 693  LEU A CA  1 
ATOM 5396 C C   . LEU A 1 696  ? -13.969 56.711 2.713   1.00 78.28  ? 693  LEU A C   1 
ATOM 5397 O O   . LEU A 1 696  ? -15.079 56.265 3.004   1.00 78.28  ? 693  LEU A O   1 
ATOM 5398 C CB  . LEU A 1 696  ? -12.335 56.619 4.608   1.00 69.34  ? 693  LEU A CB  1 
ATOM 5399 C CG  . LEU A 1 696  ? -11.413 57.308 5.616   1.00 69.34  ? 693  LEU A CG  1 
ATOM 5400 C CD1 . LEU A 1 696  ? -12.206 58.234 6.525   1.00 69.34  ? 693  LEU A CD1 1 
ATOM 5401 C CD2 . LEU A 1 696  ? -10.643 56.280 6.431   1.00 69.34  ? 693  LEU A CD2 1 
ATOM 5402 N N   . ALA A 1 697  ? -13.395 56.510 1.532   1.00 72.31  ? 694  ALA A N   1 
ATOM 5403 C CA  . ALA A 1 697  ? -14.048 55.736 0.483   1.00 72.31  ? 694  ALA A CA  1 
ATOM 5404 C C   . ALA A 1 697  ? -13.068 54.787 -0.200  1.00 72.31  ? 694  ALA A C   1 
ATOM 5405 O O   . ALA A 1 697  ? -11.961 55.181 -0.568  1.00 72.31  ? 694  ALA A O   1 
ATOM 5406 C CB  . ALA A 1 697  ? -14.690 56.664 -0.538  1.00 165.53 ? 694  ALA A CB  1 
ATOM 5407 N N   . ASN A 1 698  ? -13.484 53.536 -0.366  1.00 102.56 ? 695  ASN A N   1 
ATOM 5408 C CA  . ASN A 1 698  ? -12.658 52.539 -0.998  1.00 102.56 ? 695  ASN A CA  1 
ATOM 5409 C C   . ASN A 1 698  ? -13.399 52.055 -2.234  1.00 102.56 ? 695  ASN A C   1 
ATOM 5410 O O   . ASN A 1 698  ? -14.309 52.739 -2.720  1.00 102.56 ? 695  ASN A O   1 
ATOM 5411 C CB  . ASN A 1 698  ? -12.390 51.384 -0.038  1.00 137.94 ? 695  ASN A CB  1 
ATOM 5412 C CG  . ASN A 1 698  ? -13.642 50.612 0.301   1.00 137.94 ? 695  ASN A CG  1 
ATOM 5413 O OD1 . ASN A 1 698  ? -14.529 51.114 0.989   1.00 137.94 ? 695  ASN A OD1 1 
ATOM 5414 N ND2 . ASN A 1 698  ? -13.726 49.385 -0.191  1.00 137.94 ? 695  ASN A ND2 1 
ATOM 5415 N N   . ASN A 1 699  ? -12.996 50.888 -2.741  1.00 107.46 ? 696  ASN A N   1 
ATOM 5416 C CA  . ASN A 1 699  ? -13.667 50.225 -3.860  1.00 107.46 ? 696  ASN A CA  1 
ATOM 5417 C C   . ASN A 1 699  ? -15.167 50.496 -3.841  1.00 107.46 ? 696  ASN A C   1 
ATOM 5418 O O   . ASN A 1 699  ? -15.682 51.112 -4.761  1.00 107.46 ? 696  ASN A O   1 
ATOM 5419 C CB  . ASN A 1 699  ? -13.386 48.722 -3.833  1.00 177.63 ? 696  ASN A CB  1 
ATOM 5420 C CG  . ASN A 1 699  ? -13.541 48.077 -5.190  1.00 177.63 ? 696  ASN A CG  1 
ATOM 5421 O OD1 . ASN A 1 699  ? -14.626 48.082 -5.779  1.00 177.63 ? 696  ASN A OD1 1 
ATOM 5422 N ND2 . ASN A 1 699  ? -12.453 47.506 -5.694  1.00 177.63 ? 696  ASN A ND2 1 
ATOM 5423 N N   . SER A 1 700  ? -15.848 50.068 -2.777  1.00 95.61  ? 697  SER A N   1 
ATOM 5424 C CA  . SER A 1 700  ? -17.260 50.384 -2.583  1.00 95.61  ? 697  SER A CA  1 
ATOM 5425 C C   . SER A 1 700  ? -17.640 50.542 -1.119  1.00 95.61  ? 697  SER A C   1 
ATOM 5426 O O   . SER A 1 700  ? -17.837 49.545 -0.427  1.00 95.61  ? 697  SER A O   1 
ATOM 5427 C CB  . SER A 1 700  ? -18.143 49.310 -3.221  1.00 143.27 ? 697  SER A CB  1 
ATOM 5428 O OG  . SER A 1 700  ? -17.906 48.042 -2.649  1.00 143.27 ? 697  SER A OG  1 
ATOM 5429 N N   . THR A 1 701  ? -17.752 51.790 -0.659  1.00 95.26  ? 698  THR A N   1 
ATOM 5430 C CA  . THR A 1 701  ? -18.236 52.112 0.691   1.00 95.26  ? 698  THR A CA  1 
ATOM 5431 C C   . THR A 1 701  ? -17.782 53.495 1.144   1.00 95.26  ? 698  THR A C   1 
ATOM 5432 O O   . THR A 1 701  ? -16.600 53.822 1.071   1.00 95.26  ? 698  THR A O   1 
ATOM 5433 C CB  . THR A 1 701  ? -17.837 51.025 1.749   1.00 152.66 ? 698  THR A CB  1 
ATOM 5434 O OG1 . THR A 1 701  ? -18.868 50.034 1.824   1.00 152.66 ? 698  THR A OG1 1 
ATOM 5435 C CG2 . THR A 1 701  ? -17.623 51.614 3.143   1.00 152.66 ? 698  THR A CG2 1 
ATOM 5436 N N   . LEU A 1 702  ? -18.725 54.316 1.596   1.00 95.51  ? 699  LEU A N   1 
ATOM 5437 C CA  . LEU A 1 702  ? -18.364 55.544 2.282   1.00 95.51  ? 699  LEU A CA  1 
ATOM 5438 C C   . LEU A 1 702  ? -18.208 55.227 3.763   1.00 95.51  ? 699  LEU A C   1 
ATOM 5439 O O   . LEU A 1 702  ? -18.860 54.320 4.279   1.00 95.51  ? 699  LEU A O   1 
ATOM 5440 C CB  . LEU A 1 702  ? -19.400 56.663 2.065   1.00 63.20  ? 699  LEU A CB  1 
ATOM 5441 C CG  . LEU A 1 702  ? -19.041 58.031 2.700   1.00 63.20  ? 699  LEU A CG  1 
ATOM 5442 C CD1 . LEU A 1 702  ? -17.829 58.701 2.038   1.00 63.20  ? 699  LEU A CD1 1 
ATOM 5443 C CD2 . LEU A 1 702  ? -20.211 58.982 2.693   1.00 63.20  ? 699  LEU A CD2 1 
ATOM 5444 N N   . THR A 1 703  ? -17.324 55.972 4.424   1.00 111.24 ? 700  THR A N   1 
ATOM 5445 C CA  . THR A 1 703  ? -17.032 55.803 5.841   1.00 111.24 ? 700  THR A CA  1 
ATOM 5446 C C   . THR A 1 703  ? -16.515 57.085 6.472   1.00 111.24 ? 700  THR A C   1 
ATOM 5447 O O   . THR A 1 703  ? -15.914 57.919 5.809   1.00 111.24 ? 700  THR A O   1 
ATOM 5448 C CB  . THR A 1 703  ? -16.064 54.626 6.119   1.00 100.34 ? 700  THR A CB  1 
ATOM 5449 O OG1 . THR A 1 703  ? -15.570 54.087 4.883   1.00 100.34 ? 700  THR A OG1 1 
ATOM 5450 C CG2 . THR A 1 703  ? -16.793 53.524 6.852   1.00 100.34 ? 700  THR A CG2 1 
ATOM 5451 N N   . ILE A 1 704  ? -16.762 57.213 7.770   1.00 90.24  ? 701  ILE A N   1 
ATOM 5452 C CA  . ILE A 1 704  ? -16.633 58.450 8.520   1.00 90.24  ? 701  ILE A CA  1 
ATOM 5453 C C   . ILE A 1 704  ? -16.371 58.086 9.982   1.00 90.24  ? 701  ILE A C   1 
ATOM 5454 O O   . ILE A 1 704  ? -17.084 57.234 10.526  1.00 90.24  ? 701  ILE A O   1 
ATOM 5455 C CB  . ILE A 1 704  ? -17.948 59.257 8.454   1.00 103.09 ? 701  ILE A CB  1 
ATOM 5456 C CG1 . ILE A 1 704  ? -19.166 58.406 8.895   1.00 103.09 ? 701  ILE A CG1 1 
ATOM 5457 C CG2 . ILE A 1 704  ? -18.151 59.869 7.082   1.00 103.09 ? 701  ILE A CG2 1 
ATOM 5458 C CD1 . ILE A 1 704  ? -19.456 57.149 8.093   1.00 103.09 ? 701  ILE A CD1 1 
ATOM 5459 N N   . GLY A 1 705  ? -15.376 58.716 10.617  1.00 58.78  ? 702  GLY A N   1 
ATOM 5460 C CA  . GLY A 1 705  ? -14.999 58.380 12.003  1.00 58.78  ? 702  GLY A CA  1 
ATOM 5461 C C   . GLY A 1 705  ? -13.844 59.227 12.518  1.00 58.78  ? 702  GLY A C   1 
ATOM 5462 O O   . GLY A 1 705  ? -13.334 60.076 11.781  1.00 58.78  ? 702  GLY A O   1 
ATOM 5463 N N   . THR A 1 706  ? -13.439 58.998 13.763  1.00 72.88  ? 703  THR A N   1 
ATOM 5464 C CA  . THR A 1 706  ? -12.340 59.747 14.361  1.00 72.88  ? 703  THR A CA  1 
ATOM 5465 C C   . THR A 1 706  ? -11.010 59.032 14.148  1.00 72.88  ? 703  THR A C   1 
ATOM 5466 O O   . THR A 1 706  ? -10.975 57.892 13.685  1.00 72.88  ? 703  THR A O   1 
ATOM 5467 C CB  . THR A 1 706  ? -12.560 59.965 15.869  1.00 115.05 ? 703  THR A CB  1 
ATOM 5468 O OG1 . THR A 1 706  ? -12.643 58.696 16.531  1.00 115.05 ? 703  THR A OG1 1 
ATOM 5469 C CG2 . THR A 1 706  ? -13.843 60.744 16.113  1.00 115.05 ? 703  THR A CG2 1 
ATOM 5470 N N   . ILE A 1 707  ? -9.918  59.708 14.490  1.00 81.16  ? 704  ILE A N   1 
ATOM 5471 C CA  . ILE A 1 707  ? -8.585  59.138 14.336  1.00 81.16  ? 704  ILE A CA  1 
ATOM 5472 C C   . ILE A 1 707  ? -7.812  59.176 15.650  1.00 81.16  ? 704  ILE A C   1 
ATOM 5473 O O   . ILE A 1 707  ? -7.746  60.212 16.312  1.00 81.16  ? 704  ILE A O   1 
ATOM 5474 C CB  . ILE A 1 707  ? -7.776  59.877 13.254  1.00 85.69  ? 704  ILE A CB  1 
ATOM 5475 C CG1 . ILE A 1 707  ? -8.520  59.845 11.917  1.00 85.69  ? 704  ILE A CG1 1 
ATOM 5476 C CG2 . ILE A 1 707  ? -6.391  59.264 13.113  1.00 85.69  ? 704  ILE A CG2 1 
ATOM 5477 C CD1 . ILE A 1 707  ? -8.775  58.449 11.393  1.00 85.69  ? 704  ILE A CD1 1 
ATOM 5478 N N   . ASP A 1 708  ? -7.230  58.041 16.022  1.00 58.40  ? 705  ASP A N   1 
ATOM 5479 C CA  . ASP A 1 708  ? -6.461  57.944 17.256  1.00 58.40  ? 705  ASP A CA  1 
ATOM 5480 C C   . ASP A 1 708  ? -5.365  59.003 17.306  1.00 58.40  ? 705  ASP A C   1 
ATOM 5481 O O   . ASP A 1 708  ? -5.486  60.064 16.693  1.00 58.40  ? 705  ASP A O   1 
ATOM 5482 C CB  . ASP A 1 708  ? -5.850  56.549 17.399  1.00 122.78 ? 705  ASP A CB  1 
ATOM 5483 C CG  . ASP A 1 708  ? -6.898  55.454 17.430  1.00 122.78 ? 705  ASP A CG  1 
ATOM 5484 O OD1 . ASP A 1 708  ? -8.101  55.778 17.341  1.00 122.78 ? 705  ASP A OD1 1 
ATOM 5485 O OD2 . ASP A 1 708  ? -6.520  54.269 17.544  1.00 122.78 ? 705  ASP A OD2 1 
ATOM 5486 N N   . GLU A 1 709  ? -4.296  58.709 18.039  1.00 127.07 ? 706  GLU A N   1 
ATOM 5487 C CA  . GLU A 1 709  ? -3.178  59.635 18.168  1.00 127.07 ? 706  GLU A CA  1 
ATOM 5488 C C   . GLU A 1 709  ? -2.350  59.681 16.888  1.00 127.07 ? 706  GLU A C   1 
ATOM 5489 O O   . GLU A 1 709  ? -2.733  60.328 15.913  1.00 127.07 ? 706  GLU A O   1 
ATOM 5490 C CB  . GLU A 1 709  ? -2.293  59.244 19.353  1.00 146.82 ? 706  GLU A CB  1 
ATOM 5491 C CG  . GLU A 1 709  ? -1.101  60.163 19.568  1.00 146.82 ? 706  GLU A CG  1 
ATOM 5492 C CD  . GLU A 1 709  ? -1.512  61.597 19.835  1.00 146.82 ? 706  GLU A CD  1 
ATOM 5493 O OE1 . GLU A 1 709  ? -2.729  61.875 19.853  1.00 146.82 ? 706  GLU A OE1 1 
ATOM 5494 O OE2 . GLU A 1 709  ? -0.617  62.447 20.028  1.00 146.82 ? 706  GLU A OE2 1 
ATOM 5495 N N   . ILE A 1 710  ? -1.215  58.990 16.899  1.00 57.45  ? 707  ILE A N   1 
ATOM 5496 C CA  . ILE A 1 710  ? -0.332  58.949 15.740  1.00 57.45  ? 707  ILE A CA  1 
ATOM 5497 C C   . ILE A 1 710  ? 0.782   57.925 15.934  1.00 57.45  ? 707  ILE A C   1 
ATOM 5498 O O   . ILE A 1 710  ? 0.687   56.793 15.461  1.00 57.45  ? 707  ILE A O   1 
ATOM 5499 C CB  . ILE A 1 710  ? 0.295   60.327 15.458  1.00 93.69  ? 707  ILE A CB  1 
ATOM 5500 C CG1 . ILE A 1 710  ? 0.992   60.326 14.095  1.00 93.69  ? 707  ILE A CG1 1 
ATOM 5501 C CG2 . ILE A 1 710  ? 1.273   60.704 16.560  1.00 93.69  ? 707  ILE A CG2 1 
ATOM 5502 C CD1 . ILE A 1 710  ? 0.046   60.165 12.926  1.00 93.69  ? 707  ILE A CD1 1 
ATOM 5503 N N   . GLN A 1 711  ? 1.836   58.331 16.634  1.00 55.43  ? 708  GLN A N   1 
ATOM 5504 C CA  . GLN A 1 711  ? 2.969   57.451 16.893  1.00 55.43  ? 708  GLN A CA  1 
ATOM 5505 C C   . GLN A 1 711  ? 2.733   56.064 16.304  1.00 55.43  ? 708  GLN A C   1 
ATOM 5506 O O   . GLN A 1 711  ? 1.807   55.358 16.702  1.00 55.43  ? 708  GLN A O   1 
ATOM 5507 C CB  . GLN A 1 711  ? 3.233   57.345 18.397  1.00 152.18 ? 708  GLN A CB  1 
ATOM 5508 C CG  . GLN A 1 711  ? 2.062   56.796 19.196  1.00 152.18 ? 708  GLN A CG  1 
ATOM 5509 C CD  . GLN A 1 711  ? 2.359   56.710 20.680  1.00 152.18 ? 708  GLN A CD  1 
ATOM 5510 O OE1 . GLN A 1 711  ? 3.451   57.062 21.128  1.00 152.18 ? 708  GLN A OE1 1 
ATOM 5511 N NE2 . GLN A 1 711  ? 1.386   56.241 21.452  1.00 152.18 ? 708  GLN A NE2 1 
ATOM 5512 N N   . LYS A 1 712  ? 3.578   55.681 15.352  1.00 77.67  ? 709  LYS A N   1 
ATOM 5513 C CA  . LYS A 1 712  ? 3.467   54.381 14.702  1.00 77.67  ? 709  LYS A CA  1 
ATOM 5514 C C   . LYS A 1 712  ? 2.509   53.455 15.445  1.00 77.67  ? 709  LYS A C   1 
ATOM 5515 O O   . LYS A 1 712  ? 1.507   53.008 14.888  1.00 77.67  ? 709  LYS A O   1 
ATOM 5516 C CB  . LYS A 1 712  ? 4.844   53.723 14.582  1.00 130.73 ? 709  LYS A CB  1 
ATOM 5517 C CG  . LYS A 1 712  ? 4.823   52.356 13.917  1.00 130.73 ? 709  LYS A CG  1 
ATOM 5518 C CD  . LYS A 1 712  ? 6.219   51.763 13.830  1.00 130.73 ? 709  LYS A CD  1 
ATOM 5519 C CE  . LYS A 1 712  ? 6.197   50.394 13.170  1.00 130.73 ? 709  LYS A CE  1 
ATOM 5520 N NZ  . LYS A 1 712  ? 5.651   50.453 11.786  1.00 130.73 ? 709  LYS A NZ  1 
ATOM 5521 N N   . LEU A 1 713  ? 2.869   53.160 16.712  1.00 59.80  ? 710  LEU A N   1 
ATOM 5522 C CA  . LEU A 1 713  ? 2.161   52.280 17.691  1.00 59.80  ? 710  LEU A CA  1 
ATOM 5523 C C   . LEU A 1 713  ? 1.329   52.996 18.752  1.00 59.80  ? 710  LEU A C   1 
ATOM 5524 O O   . LEU A 1 713  ? 1.694   54.069 19.195  1.00 59.80  ? 710  LEU A O   1 
ATOM 5525 C CB  . LEU A 1 713  ? 3.133   51.413 18.495  1.00 58.67  ? 710  LEU A CB  1 
ATOM 5526 C CG  . LEU A 1 713  ? 4.269   50.518 18.000  1.00 58.67  ? 710  LEU A CG  1 
ATOM 5527 C CD1 . LEU A 1 713  ? 5.018   49.937 19.169  1.00 58.67  ? 710  LEU A CD1 1 
ATOM 5528 C CD2 . LEU A 1 713  ? 3.790   49.398 17.128  1.00 58.67  ? 710  LEU A CD2 1 
ATOM 5529 N N   . HIS A 1 714  ? 0.221   52.377 19.171  1.00 76.03  ? 711  HIS A N   1 
ATOM 5530 C CA  . HIS A 1 714  ? -0.652  52.991 20.159  1.00 76.03  ? 711  HIS A CA  1 
ATOM 5531 C C   . HIS A 1 714  ? -0.567  52.110 21.396  1.00 76.03  ? 711  HIS A C   1 
ATOM 5532 O O   . HIS A 1 714  ? -0.447  50.892 21.283  1.00 76.03  ? 711  HIS A O   1 
ATOM 5533 C CB  . HIS A 1 714  ? -2.092  53.062 19.637  1.00 90.90  ? 711  HIS A CB  1 
ATOM 5534 C CG  . HIS A 1 714  ? -3.100  53.451 20.676  1.00 90.90  ? 711  HIS A CG  1 
ATOM 5535 N ND1 . HIS A 1 714  ? -3.153  54.714 21.230  1.00 90.90  ? 711  HIS A ND1 1 
ATOM 5536 C CD2 . HIS A 1 714  ? -4.099  52.742 21.259  1.00 90.90  ? 711  HIS A CD2 1 
ATOM 5537 C CE1 . HIS A 1 714  ? -4.136  54.763 22.114  1.00 90.90  ? 711  HIS A CE1 1 
ATOM 5538 N NE2 . HIS A 1 714  ? -4.728  53.582 22.146  1.00 90.90  ? 711  HIS A NE2 1 
ATOM 5539 N N   . ILE A 1 715  ? -0.702  52.744 22.548  1.00 62.88  ? 712  ILE A N   1 
ATOM 5540 C CA  . ILE A 1 715  ? -0.661  52.079 23.819  1.00 62.88  ? 712  ILE A CA  1 
ATOM 5541 C C   . ILE A 1 715  ? -1.747  52.448 24.807  1.00 62.88  ? 712  ILE A C   1 
ATOM 5542 O O   . ILE A 1 715  ? -1.842  53.585 25.238  1.00 62.88  ? 712  ILE A O   1 
ATOM 5543 C CB  . ILE A 1 715  ? 0.614   52.434 24.516  1.00 62.51  ? 712  ILE A CB  1 
ATOM 5544 C CG1 . ILE A 1 715  ? 1.774   52.251 23.580  1.00 62.51  ? 712  ILE A CG1 1 
ATOM 5545 C CG2 . ILE A 1 715  ? 0.833   51.541 25.663  1.00 62.51  ? 712  ILE A CG2 1 
ATOM 5546 C CD1 . ILE A 1 715  ? 3.011   52.158 24.292  1.00 62.51  ? 712  ILE A CD1 1 
ATOM 5547 N N   . ARG A 1 716  ? -2.551  51.462 25.173  1.00 72.32  ? 713  ARG A N   1 
ATOM 5548 C CA  . ARG A 1 716  ? -3.635  51.632 26.122  1.00 72.32  ? 713  ARG A CA  1 
ATOM 5549 C C   . ARG A 1 716  ? -3.197  51.126 27.446  1.00 72.32  ? 713  ARG A C   1 
ATOM 5550 O O   . ARG A 1 716  ? -2.582  50.083 27.580  1.00 72.32  ? 713  ARG A O   1 
ATOM 5551 C CB  . ARG A 1 716  ? -4.883  50.886 25.669  1.00 59.01  ? 713  ARG A CB  1 
ATOM 5552 C CG  . ARG A 1 716  ? -6.112  50.992 26.565  1.00 59.01  ? 713  ARG A CG  1 
ATOM 5553 C CD  . ARG A 1 716  ? -7.141  50.015 26.014  1.00 59.01  ? 713  ARG A CD  1 
ATOM 5554 N NE  . ARG A 1 716  ? -8.397  49.875 26.740  1.00 59.01  ? 713  ARG A NE  1 
ATOM 5555 C CZ  . ARG A 1 716  ? -8.746  50.591 27.784  1.00 59.01  ? 713  ARG A CZ  1 
ATOM 5556 N NH1 . ARG A 1 716  ? -7.942  51.516 28.257  1.00 59.01  ? 713  ARG A NH1 1 
ATOM 5557 N NH2 . ARG A 1 716  ? -9.904  50.380 28.343  1.00 59.01  ? 713  ARG A NH2 1 
ATOM 5558 N N   . THR A 1 717  ? -3.537  51.860 28.459  1.00 40.65  ? 714  THR A N   1 
ATOM 5559 C CA  . THR A 1 717  ? -3.105  51.449 29.733  1.00 40.65  ? 714  THR A CA  1 
ATOM 5560 C C   . THR A 1 717  ? -3.982  51.240 30.918  1.00 40.65  ? 714  THR A C   1 
ATOM 5561 O O   . THR A 1 717  ? -4.467  52.200 31.455  1.00 40.65  ? 714  THR A O   1 
ATOM 5562 C CB  . THR A 1 717  ? -2.190  52.563 30.172  1.00 31.69  ? 714  THR A CB  1 
ATOM 5563 O OG1 . THR A 1 717  ? -1.254  52.801 29.139  1.00 31.69  ? 714  THR A OG1 1 
ATOM 5564 C CG2 . THR A 1 717  ? -1.503  52.259 31.415  1.00 31.69  ? 714  THR A CG2 1 
ATOM 5565 N N   . VAL A 1 718  ? -4.149  49.991 31.337  1.00 40.95  ? 715  VAL A N   1 
ATOM 5566 C CA  . VAL A 1 718  ? -4.884  49.678 32.546  1.00 40.95  ? 715  VAL A CA  1 
ATOM 5567 C C   . VAL A 1 718  ? -3.966  49.788 33.751  1.00 40.95  ? 715  VAL A C   1 
ATOM 5568 O O   . VAL A 1 718  ? -3.228  48.859 34.074  1.00 40.95  ? 715  VAL A O   1 
ATOM 5569 C CB  . VAL A 1 718  ? -5.468  48.253 32.515  1.00 53.48  ? 715  VAL A CB  1 
ATOM 5570 C CG1 . VAL A 1 718  ? -6.253  47.953 33.789  1.00 53.48  ? 715  VAL A CG1 1 
ATOM 5571 C CG2 . VAL A 1 718  ? -6.345  48.084 31.323  1.00 53.48  ? 715  VAL A CG2 1 
ATOM 5572 N N   . PRO A 1 719  ? -4.018  50.900 34.465  1.00 31.57  ? 716  PRO A N   1 
ATOM 5573 C CA  . PRO A 1 719  ? -3.233  50.995 35.729  1.00 31.57  ? 716  PRO A CA  1 
ATOM 5574 C C   . PRO A 1 719  ? -3.699  49.977 36.792  1.00 31.57  ? 716  PRO A C   1 
ATOM 5575 O O   . PRO A 1 719  ? -4.883  49.972 37.101  1.00 31.57  ? 716  PRO A O   1 
ATOM 5576 C CB  . PRO A 1 719  ? -3.557  52.397 36.251  1.00 22.72  ? 716  PRO A CB  1 
ATOM 5577 C CG  . PRO A 1 719  ? -4.246  53.117 35.104  1.00 22.72  ? 716  PRO A CG  1 
ATOM 5578 C CD  . PRO A 1 719  ? -4.809  52.097 34.167  1.00 22.72  ? 716  PRO A CD  1 
ATOM 5579 N N   . LEU A 1 720  ? -2.808  49.142 37.350  1.00 40.16  ? 717  LEU A N   1 
ATOM 5580 C CA  . LEU A 1 720  ? -3.177  48.110 38.354  1.00 40.16  ? 717  LEU A CA  1 
ATOM 5581 C C   . LEU A 1 720  ? -2.875  48.491 39.776  1.00 40.16  ? 717  LEU A C   1 
ATOM 5582 O O   . LEU A 1 720  ? -3.461  47.925 40.678  1.00 40.16  ? 717  LEU A O   1 
ATOM 5583 C CB  . LEU A 1 720  ? -2.474  46.795 38.082  1.00 37.04  ? 717  LEU A CB  1 
ATOM 5584 C CG  . LEU A 1 720  ? -2.943  46.136 36.799  1.00 37.04  ? 717  LEU A CG  1 
ATOM 5585 C CD1 . LEU A 1 720  ? -2.223  44.813 36.512  1.00 37.04  ? 717  LEU A CD1 1 
ATOM 5586 C CD2 . LEU A 1 720  ? -4.442  45.920 36.850  1.00 37.04  ? 717  LEU A CD2 1 
ATOM 5587 N N   . TYR A 1 721  ? -1.966  49.428 40.002  1.00 41.05  ? 718  TYR A N   1 
ATOM 5588 C CA  . TYR A 1 721  ? -1.558  49.801 41.365  1.00 41.05  ? 718  TYR A CA  1 
ATOM 5589 C C   . TYR A 1 721  ? -0.833  48.736 42.108  1.00 41.05  ? 718  TYR A C   1 
ATOM 5590 O O   . TYR A 1 721  ? -0.160  49.018 43.088  1.00 41.05  ? 718  TYR A O   1 
ATOM 5591 C CB  . TYR A 1 721  ? -2.711  50.431 42.195  1.00 30.63  ? 718  TYR A CB  1 
ATOM 5592 C CG  . TYR A 1 721  ? -3.273  51.503 41.382  1.00 30.63  ? 718  TYR A CG  1 
ATOM 5593 C CD1 . TYR A 1 721  ? -4.378  51.244 40.544  1.00 30.63  ? 718  TYR A CD1 1 
ATOM 5594 C CD2 . TYR A 1 721  ? -2.592  52.729 41.288  1.00 30.63  ? 718  TYR A CD2 1 
ATOM 5595 C CE1 . TYR A 1 721  ? -4.821  52.181 39.676  1.00 30.63  ? 718  TYR A CE1 1 
ATOM 5596 C CE2 . TYR A 1 721  ? -3.033  53.717 40.413  1.00 30.63  ? 718  TYR A CE2 1 
ATOM 5597 C CZ  . TYR A 1 721  ? -4.154  53.432 39.632  1.00 30.63  ? 718  TYR A CZ  1 
ATOM 5598 O OH  . TYR A 1 721  ? -4.596  54.373 38.751  1.00 30.63  ? 718  TYR A OH  1 
ATOM 5599 N N   . GLU A 1 722  ? -0.948  47.514 41.643  1.00 82.06  ? 719  GLU A N   1 
ATOM 5600 C CA  . GLU A 1 722  ? -0.124  46.468 42.144  1.00 82.06  ? 719  GLU A CA  1 
ATOM 5601 C C   . GLU A 1 722  ? 0.647   45.890 40.987  1.00 82.06  ? 719  GLU A C   1 
ATOM 5602 O O   . GLU A 1 722  ? 0.637   46.446 39.897  1.00 82.06  ? 719  GLU A O   1 
ATOM 5603 C CB  . GLU A 1 722  ? -0.971  45.434 42.831  1.00 44.79  ? 719  GLU A CB  1 
ATOM 5604 C CG  . GLU A 1 722  ? -2.008  44.744 41.955  1.00 44.79  ? 719  GLU A CG  1 
ATOM 5605 C CD  . GLU A 1 722  ? -2.936  43.888 42.798  1.00 44.79  ? 719  GLU A CD  1 
ATOM 5606 O OE1 . GLU A 1 722  ? -3.007  42.665 42.542  1.00 44.79  ? 719  GLU A OE1 1 
ATOM 5607 O OE2 . GLU A 1 722  ? -3.565  44.429 43.744  1.00 44.79  ? 719  GLU A OE2 1 
ATOM 5608 N N   . SER A 1 723  ? 1.321   44.774 41.218  1.00 29.79  ? 720  SER A N   1 
ATOM 5609 C CA  . SER A 1 723  ? 2.333   44.341 40.288  1.00 29.79  ? 720  SER A CA  1 
ATOM 5610 C C   . SER A 1 723  ? 1.943   43.095 39.620  1.00 29.79  ? 720  SER A C   1 
ATOM 5611 O O   . SER A 1 723  ? 1.994   42.091 40.227  1.00 29.79  ? 720  SER A O   1 
ATOM 5612 C CB  . SER A 1 723  ? 3.674   44.144 41.001  1.00 40.81  ? 720  SER A CB  1 
ATOM 5613 O OG  . SER A 1 723  ? 3.510   43.350 42.118  1.00 40.81  ? 720  SER A OG  1 
ATOM 5614 N N   . PRO A 1 724  ? 1.672   43.131 38.318  1.00 24.22  ? 721  PRO A N   1 
ATOM 5615 C CA  . PRO A 1 724  ? 1.103   41.914 37.696  1.00 24.22  ? 721  PRO A CA  1 
ATOM 5616 C C   . PRO A 1 724  ? 2.265   40.951 37.492  1.00 24.22  ? 721  PRO A C   1 
ATOM 5617 O O   . PRO A 1 724  ? 3.410   41.420 37.458  1.00 24.22  ? 721  PRO A O   1 
ATOM 5618 C CB  . PRO A 1 724  ? 0.640   42.399 36.334  1.00 27.95  ? 721  PRO A CB  1 
ATOM 5619 C CG  . PRO A 1 724  ? 1.406   43.686 36.083  1.00 27.95  ? 721  PRO A CG  1 
ATOM 5620 C CD  . PRO A 1 724  ? 2.019   44.183 37.341  1.00 27.95  ? 721  PRO A CD  1 
ATOM 5621 N N   . ARG A 1 725  ? 1.998   39.650 37.340  1.00 48.35  ? 722  ARG A N   1 
ATOM 5622 C CA  . ARG A 1 725  ? 3.052   38.657 37.146  1.00 48.35  ? 722  ARG A CA  1 
ATOM 5623 C C   . ARG A 1 725  ? 2.896   37.770 35.919  1.00 48.35  ? 722  ARG A C   1 
ATOM 5624 O O   . ARG A 1 725  ? 3.873   37.533 35.190  1.00 48.35  ? 722  ARG A O   1 
ATOM 5625 C CB  . ARG A 1 725  ? 3.161   37.751 38.361  1.00 32.74  ? 722  ARG A CB  1 
ATOM 5626 C CG  . ARG A 1 725  ? 3.195   38.441 39.756  1.00 32.74  ? 722  ARG A CG  1 
ATOM 5627 C CD  . ARG A 1 725  ? 4.557   39.060 40.029  1.00 32.74  ? 722  ARG A CD  1 
ATOM 5628 N NE  . ARG A 1 725  ? 4.775   39.311 41.467  1.00 32.74  ? 722  ARG A NE  1 
ATOM 5629 C CZ  . ARG A 1 725  ? 5.292   38.420 42.317  1.00 32.74  ? 722  ARG A CZ  1 
ATOM 5630 N NH1 . ARG A 1 725  ? 5.605   37.188 41.875  1.00 32.74  ? 722  ARG A NH1 1 
ATOM 5631 N NH2 . ARG A 1 725  ? 5.506   38.785 43.597  1.00 32.74  ? 722  ARG A NH2 1 
ATOM 5632 N N   . LYS A 1 726  ? 1.692   37.240 35.699  1.00 31.91  ? 723  LYS A N   1 
ATOM 5633 C CA  . LYS A 1 726  ? 1.431   36.373 34.479  1.00 31.91  ? 723  LYS A CA  1 
ATOM 5634 C C   . LYS A 1 726  ? 0.118   36.751 33.896  1.00 31.91  ? 723  LYS A C   1 
ATOM 5635 O O   . LYS A 1 726  ? -0.554  37.576 34.511  1.00 31.91  ? 723  LYS A O   1 
ATOM 5636 C CB  . LYS A 1 726  ? 1.485   34.872 34.771  1.00 41.76  ? 723  LYS A CB  1 
ATOM 5637 C CG  . LYS A 1 726  ? 2.927   34.372 35.075  1.00 41.76  ? 723  LYS A CG  1 
ATOM 5638 C CD  . LYS A 1 726  ? 3.872   34.391 33.829  1.00 41.76  ? 723  LYS A CD  1 
ATOM 5639 C CE  . LYS A 1 726  ? 4.209   32.977 33.357  1.00 41.76  ? 723  LYS A CE  1 
ATOM 5640 N NZ  . LYS A 1 726  ? 4.794   32.347 34.647  1.00 41.76  ? 723  LYS A NZ  1 
ATOM 5641 N N   . ILE A 1 727  ? -0.250  36.246 32.721  1.00 30.59  ? 724  ILE A N   1 
ATOM 5642 C CA  . ILE A 1 727  ? -1.505  36.675 32.144  1.00 30.59  ? 724  ILE A CA  1 
ATOM 5643 C C   . ILE A 1 727  ? -1.996  35.796 31.002  1.00 30.59  ? 724  ILE A C   1 
ATOM 5644 O O   . ILE A 1 727  ? -1.231  35.381 30.121  1.00 30.59  ? 724  ILE A O   1 
ATOM 5645 C CB  . ILE A 1 727  ? -1.458  38.146 31.689  1.00 27.03  ? 724  ILE A CB  1 
ATOM 5646 C CG1 . ILE A 1 727  ? -2.788  38.534 31.006  1.00 27.03  ? 724  ILE A CG1 1 
ATOM 5647 C CG2 . ILE A 1 727  ? -0.245  38.387 30.765  1.00 27.03  ? 724  ILE A CG2 1 
ATOM 5648 C CD1 . ILE A 1 727  ? -2.924  39.975 30.520  1.00 27.03  ? 724  ILE A CD1 1 
ATOM 5649 N N   . CYS A 1 728  ? -3.296  35.515 31.028  1.00 44.94  ? 725  CYS A N   1 
ATOM 5650 C CA  . CYS A 1 728  ? -3.919  34.607 30.061  1.00 44.94  ? 725  CYS A CA  1 
ATOM 5651 C C   . CYS A 1 728  ? -5.176  35.166 29.490  1.00 44.94  ? 725  CYS A C   1 
ATOM 5652 O O   . CYS A 1 728  ? -5.988  35.751 30.233  1.00 44.94  ? 725  CYS A O   1 
ATOM 5653 C CB  . CYS A 1 728  ? -4.289  33.308 30.726  1.00 74.90  ? 725  CYS A CB  1 
ATOM 5654 S SG  . CYS A 1 728  ? -2.883  32.356 30.732  1.00 74.90  ? 725  CYS A SG  1 
ATOM 5655 N N   . TYR A 1 729  ? -5.360  34.941 28.198  1.00 62.25  ? 726  TYR A N   1 
ATOM 5656 C CA  . TYR A 1 729  ? -6.609  35.266 27.584  1.00 62.25  ? 726  TYR A CA  1 
ATOM 5657 C C   . TYR A 1 729  ? -7.420  33.988 27.445  1.00 62.25  ? 726  TYR A C   1 
ATOM 5658 O O   . TYR A 1 729  ? -6.918  32.947 27.015  1.00 62.25  ? 726  TYR A O   1 
ATOM 5659 C CB  . TYR A 1 729  ? -6.382  35.953 26.252  1.00 52.31  ? 726  TYR A CB  1 
ATOM 5660 C CG  . TYR A 1 729  ? -7.630  36.326 25.504  1.00 52.31  ? 726  TYR A CG  1 
ATOM 5661 C CD1 . TYR A 1 729  ? -8.513  37.252 26.013  1.00 52.31  ? 726  TYR A CD1 1 
ATOM 5662 C CD2 . TYR A 1 729  ? -7.919  35.757 24.267  1.00 52.31  ? 726  TYR A CD2 1 
ATOM 5663 C CE1 . TYR A 1 729  ? -9.656  37.600 25.329  1.00 52.31  ? 726  TYR A CE1 1 
ATOM 5664 C CE2 . TYR A 1 729  ? -9.050  36.120 23.562  1.00 52.31  ? 726  TYR A CE2 1 
ATOM 5665 C CZ  . TYR A 1 729  ? -9.919  37.037 24.105  1.00 52.31  ? 726  TYR A CZ  1 
ATOM 5666 O OH  . TYR A 1 729  ? -11.066 37.403 23.434  1.00 52.31  ? 726  TYR A OH  1 
ATOM 5667 N N   . GLN A 1 730  ? -8.675  34.093 27.888  1.00 40.54  ? 727  GLN A N   1 
ATOM 5668 C CA  . GLN A 1 730  ? -9.716  33.055 27.766  1.00 40.54  ? 727  GLN A CA  1 
ATOM 5669 C C   . GLN A 1 730  ? -10.833 33.651 26.863  1.00 40.54  ? 727  GLN A C   1 
ATOM 5670 O O   . GLN A 1 730  ? -11.819 34.296 27.329  1.00 40.54  ? 727  GLN A O   1 
ATOM 5671 C CB  . GLN A 1 730  ? -10.243 32.739 29.157  1.00 57.27  ? 727  GLN A CB  1 
ATOM 5672 C CG  . GLN A 1 730  ? -11.097 31.522 29.235  1.00 57.27  ? 727  GLN A CG  1 
ATOM 5673 C CD  . GLN A 1 730  ? -11.186 31.000 30.645  1.00 57.27  ? 727  GLN A CD  1 
ATOM 5674 O OE1 . GLN A 1 730  ? -10.620 29.938 30.961  1.00 57.27  ? 727  GLN A OE1 1 
ATOM 5675 N NE2 . GLN A 1 730  ? -11.873 31.747 31.516  1.00 57.27  ? 727  GLN A NE2 1 
ATOM 5676 N N   . GLU A 1 731  ? -10.640 33.493 25.563  1.00 66.38  ? 728  GLU A N   1 
ATOM 5677 C CA  . GLU A 1 731  ? -11.556 34.088 24.612  1.00 66.38  ? 728  GLU A CA  1 
ATOM 5678 C C   . GLU A 1 731  ? -13.030 33.752 24.890  1.00 66.38  ? 728  GLU A C   1 
ATOM 5679 O O   . GLU A 1 731  ? -13.825 34.676 25.066  1.00 66.38  ? 728  GLU A O   1 
ATOM 5680 C CB  . GLU A 1 731  ? -11.126 33.739 23.200  1.00 97.56  ? 728  GLU A CB  1 
ATOM 5681 C CG  . GLU A 1 731  ? -12.180 33.823 22.175  1.00 97.56  ? 728  GLU A CG  1 
ATOM 5682 C CD  . GLU A 1 731  ? -12.161 32.577 21.342  1.00 97.56  ? 728  GLU A CD  1 
ATOM 5683 O OE1 . GLU A 1 731  ? -11.730 32.669 20.173  1.00 97.56  ? 728  GLU A OE1 1 
ATOM 5684 O OE2 . GLU A 1 731  ? -12.537 31.498 21.878  1.00 97.56  ? 728  GLU A OE2 1 
ATOM 5685 N N   . VAL A 1 732  ? -13.380 32.459 24.985  1.00 63.80  ? 729  VAL A N   1 
ATOM 5686 C CA  . VAL A 1 732  ? -14.800 32.037 25.164  1.00 63.80  ? 729  VAL A CA  1 
ATOM 5687 C C   . VAL A 1 732  ? -15.551 32.890 26.194  1.00 63.80  ? 729  VAL A C   1 
ATOM 5688 O O   . VAL A 1 732  ? -16.734 33.205 26.003  1.00 63.80  ? 729  VAL A O   1 
ATOM 5689 C CB  . VAL A 1 732  ? -15.002 30.500 25.491  1.00 52.16  ? 729  VAL A CB  1 
ATOM 5690 C CG1 . VAL A 1 732  ? -14.350 29.608 24.417  1.00 52.16  ? 729  VAL A CG1 1 
ATOM 5691 C CG2 . VAL A 1 732  ? -14.536 30.165 26.894  1.00 52.16  ? 729  VAL A CG2 1 
ATOM 5692 N N   . SER A 1 733  ? -14.829 33.291 27.240  1.00 50.33  ? 730  SER A N   1 
ATOM 5693 C CA  . SER A 1 733  ? -15.358 34.069 28.347  1.00 50.33  ? 730  SER A CA  1 
ATOM 5694 C C   . SER A 1 733  ? -15.004 35.525 28.245  1.00 50.33  ? 730  SER A C   1 
ATOM 5695 O O   . SER A 1 733  ? -15.231 36.285 29.195  1.00 50.33  ? 730  SER A O   1 
ATOM 5696 C CB  . SER A 1 733  ? -14.737 33.549 29.615  1.00 61.41  ? 730  SER A CB  1 
ATOM 5697 O OG  . SER A 1 733  ? -14.410 32.187 29.419  1.00 61.41  ? 730  SER A OG  1 
ATOM 5698 N N   . GLN A 1 734  ? -14.408 35.912 27.114  1.00 63.89  ? 731  GLN A N   1 
ATOM 5699 C CA  . GLN A 1 734  ? -14.058 37.315 26.830  1.00 63.89  ? 731  GLN A CA  1 
ATOM 5700 C C   . GLN A 1 734  ? -13.451 38.073 28.016  1.00 63.89  ? 731  GLN A C   1 
ATOM 5701 O O   . GLN A 1 734  ? -13.970 39.087 28.449  1.00 63.89  ? 731  GLN A O   1 
ATOM 5702 C CB  . GLN A 1 734  ? -15.278 38.055 26.276  1.00 64.72  ? 731  GLN A CB  1 
ATOM 5703 C CG  . GLN A 1 734  ? -15.973 37.301 25.183  1.00 64.72  ? 731  GLN A CG  1 
ATOM 5704 C CD  . GLN A 1 734  ? -15.398 37.603 23.824  1.00 64.72  ? 731  GLN A CD  1 
ATOM 5705 O OE1 . GLN A 1 734  ? -15.276 38.761 23.432  1.00 64.72  ? 731  GLN A OE1 1 
ATOM 5706 N NE2 . GLN A 1 734  ? -15.065 36.561 23.078  1.00 64.72  ? 731  GLN A NE2 1 
ATOM 5707 N N   . CYS A 1 735  ? -12.342 37.556 28.526  1.00 47.63  ? 732  CYS A N   1 
ATOM 5708 C CA  . CYS A 1 735  ? -11.603 38.198 29.602  1.00 47.63  ? 732  CYS A CA  1 
ATOM 5709 C C   . CYS A 1 735  ? -10.178 37.671 29.687  1.00 47.63  ? 732  CYS A C   1 
ATOM 5710 O O   . CYS A 1 735  ? -9.838  36.604 29.133  1.00 47.63  ? 732  CYS A O   1 
ATOM 5711 C CB  . CYS A 1 735  ? -12.280 37.903 30.917  1.00 79.44  ? 732  CYS A CB  1 
ATOM 5712 S SG  . CYS A 1 735  ? -12.613 36.166 31.015  1.00 79.44  ? 732  CYS A SG  1 
ATOM 5713 N N   . PHE A 1 736  ? -9.349  38.410 30.410  1.00 51.99  ? 733  PHE A N   1 
ATOM 5714 C CA  . PHE A 1 736  ? -8.010  37.958 30.732  1.00 51.99  ? 733  PHE A CA  1 
ATOM 5715 C C   . PHE A 1 736  ? -7.968  37.585 32.188  1.00 51.99  ? 733  PHE A C   1 
ATOM 5716 O O   . PHE A 1 736  ? -8.536  38.291 33.023  1.00 51.99  ? 733  PHE A O   1 
ATOM 5717 C CB  . PHE A 1 736  ? -6.964  39.072 30.543  1.00 39.76  ? 733  PHE A CB  1 
ATOM 5718 C CG  . PHE A 1 736  ? -6.827  39.580 29.135  1.00 39.76  ? 733  PHE A CG  1 
ATOM 5719 C CD1 . PHE A 1 736  ? -7.263  40.857 28.806  1.00 39.76  ? 733  PHE A CD1 1 
ATOM 5720 C CD2 . PHE A 1 736  ? -6.249  38.799 28.159  1.00 39.76  ? 733  PHE A CD2 1 
ATOM 5721 C CE1 . PHE A 1 736  ? -7.134  41.352 27.520  1.00 39.76  ? 733  PHE A CE1 1 
ATOM 5722 C CE2 . PHE A 1 736  ? -6.119  39.274 26.853  1.00 39.76  ? 733  PHE A CE2 1 
ATOM 5723 C CZ  . PHE A 1 736  ? -6.556  40.562 26.527  1.00 39.76  ? 733  PHE A CZ  1 
ATOM 5724 N N   . GLY A 1 737  ? -7.273  36.493 32.505  1.00 37.80  ? 734  GLY A N   1 
ATOM 5725 C CA  . GLY A 1 737  ? -6.832  36.260 33.894  1.00 37.80  ? 734  GLY A CA  1 
ATOM 5726 C C   . GLY A 1 737  ? -5.437  36.853 34.040  1.00 37.80  ? 734  GLY A C   1 
ATOM 5727 O O   . GLY A 1 737  ? -4.620  36.808 33.115  1.00 37.80  ? 734  GLY A O   1 
ATOM 5728 N N   . VAL A 1 738  ? -5.140  37.401 35.199  1.00 32.43  ? 735  VAL A N   1 
ATOM 5729 C CA  . VAL A 1 738  ? -3.850  37.986 35.415  1.00 32.43  ? 735  VAL A CA  1 
ATOM 5730 C C   . VAL A 1 738  ? -3.491  37.611 36.805  1.00 32.43  ? 735  VAL A C   1 
ATOM 5731 O O   . VAL A 1 738  ? -4.315  37.779 37.708  1.00 32.43  ? 735  VAL A O   1 
ATOM 5732 C CB  . VAL A 1 738  ? -3.979  39.468 35.300  1.00 25.33  ? 735  VAL A CB  1 
ATOM 5733 C CG1 . VAL A 1 738  ? -2.804  40.236 35.944  1.00 25.33  ? 735  VAL A CG1 1 
ATOM 5734 C CG2 . VAL A 1 738  ? -4.055  39.783 33.830  1.00 25.33  ? 735  VAL A CG2 1 
ATOM 5735 N N   . LEU A 1 739  ? -2.301  37.046 36.996  1.00 35.56  ? 736  LEU A N   1 
ATOM 5736 C CA  . LEU A 1 739  ? -1.833  36.783 38.330  1.00 35.56  ? 736  LEU A CA  1 
ATOM 5737 C C   . LEU A 1 739  ? -1.263  38.089 38.701  1.00 35.56  ? 736  LEU A C   1 
ATOM 5738 O O   . LEU A 1 739  ? -0.687  38.737 37.869  1.00 35.56  ? 736  LEU A O   1 
ATOM 5739 C CB  . LEU A 1 739  ? -0.780  35.681 38.361  1.00 48.89  ? 736  LEU A CB  1 
ATOM 5740 C CG  . LEU A 1 739  ? -1.295  34.314 37.935  1.00 48.89  ? 736  LEU A CG  1 
ATOM 5741 C CD1 . LEU A 1 739  ? -0.263  33.230 38.269  1.00 48.89  ? 736  LEU A CD1 1 
ATOM 5742 C CD2 . LEU A 1 739  ? -2.601  34.021 38.657  1.00 48.89  ? 736  LEU A CD2 1 
ATOM 5743 N N   . SER A 1 740  ? -1.435  38.479 39.944  1.00 34.78  ? 737  SER A N   1 
ATOM 5744 C CA  . SER A 1 740  ? -0.948  39.739 40.456  1.00 34.78  ? 737  SER A CA  1 
ATOM 5745 C C   . SER A 1 740  ? -0.602  39.544 41.914  1.00 34.78  ? 737  SER A C   1 
ATOM 5746 O O   . SER A 1 740  ? -0.999  38.551 42.508  1.00 34.78  ? 737  SER A O   1 
ATOM 5747 C CB  . SER A 1 740  ? -2.061  40.768 40.390  1.00 70.39  ? 737  SER A CB  1 
ATOM 5748 O OG  . SER A 1 740  ? -3.057  40.469 41.356  1.00 70.39  ? 737  SER A OG  1 
ATOM 5749 N N   . SER A 1 741  ? 0.137   40.505 42.466  1.00 34.61  ? 738  SER A N   1 
ATOM 5750 C CA  . SER A 1 741  ? 0.554   40.515 43.843  1.00 34.61  ? 738  SER A CA  1 
ATOM 5751 C C   . SER A 1 741  ? 0.520   41.970 44.352  1.00 34.61  ? 738  SER A C   1 
ATOM 5752 O O   . SER A 1 741  ? 0.914   42.906 43.630  1.00 34.61  ? 738  SER A O   1 
ATOM 5753 C CB  . SER A 1 741  ? 1.966   39.990 43.968  1.00 46.77  ? 738  SER A CB  1 
ATOM 5754 O OG  . SER A 1 741  ? 2.691   40.749 44.945  1.00 46.77  ? 738  SER A OG  1 
ATOM 5755 N N   . ARG A 1 742  ? 0.028   42.179 45.569  1.00 29.28  ? 739  ARG A N   1 
ATOM 5756 C CA  . ARG A 1 742  ? 0.305   43.440 46.243  1.00 29.28  ? 739  ARG A CA  1 
ATOM 5757 C C   . ARG A 1 742  ? 1.050   43.063 47.505  1.00 29.28  ? 739  ARG A C   1 
ATOM 5758 O O   . ARG A 1 742  ? 1.201   41.843 47.821  1.00 29.28  ? 739  ARG A O   1 
ATOM 5759 C CB  . ARG A 1 742  ? -0.965  44.208 46.567  1.00 56.51  ? 739  ARG A CB  1 
ATOM 5760 C CG  . ARG A 1 742  ? -1.896  43.546 47.575  1.00 56.51  ? 739  ARG A CG  1 
ATOM 5761 C CD  . ARG A 1 742  ? -3.300  43.896 47.203  1.00 56.51  ? 739  ARG A CD  1 
ATOM 5762 N NE  . ARG A 1 742  ? -4.262  43.446 48.184  1.00 56.51  ? 739  ARG A NE  1 
ATOM 5763 C CZ  . ARG A 1 742  ? -4.861  42.256 48.159  1.00 56.51  ? 739  ARG A CZ  1 
ATOM 5764 N NH1 . ARG A 1 742  ? -4.582  41.360 47.206  1.00 56.51  ? 739  ARG A NH1 1 
ATOM 5765 N NH2 . ARG A 1 742  ? -5.744  41.954 49.102  1.00 56.51  ? 739  ARG A NH2 1 
ATOM 5766 N N   . ILE A 1 743  ? 1.500   44.093 48.201  1.00 50.21  ? 740  ILE A N   1 
ATOM 5767 C CA  . ILE A 1 743  ? 2.319   44.012 49.374  1.00 50.21  ? 740  ILE A CA  1 
ATOM 5768 C C   . ILE A 1 743  ? 1.410   44.663 50.409  1.00 50.21  ? 740  ILE A C   1 
ATOM 5769 O O   . ILE A 1 743  ? 0.509   45.433 50.041  1.00 50.21  ? 740  ILE A O   1 
ATOM 5770 C CB  . ILE A 1 743  ? 3.614   44.853 49.110  1.00 40.15  ? 740  ILE A CB  1 
ATOM 5771 C CG1 . ILE A 1 743  ? 4.645   44.043 48.287  1.00 40.15  ? 740  ILE A CG1 1 
ATOM 5772 C CG2 . ILE A 1 743  ? 4.235   45.431 50.389  1.00 40.15  ? 740  ILE A CG2 1 
ATOM 5773 C CD1 . ILE A 1 743  ? 5.804   44.877 47.738  1.00 40.15  ? 740  ILE A CD1 1 
ATOM 5774 N N   . GLU A 1 744  ? 1.620   44.370 51.687  1.00 61.08  ? 741  GLU A N   1 
ATOM 5775 C CA  . GLU A 1 744  ? 0.745   44.806 52.764  1.00 61.08  ? 741  GLU A CA  1 
ATOM 5776 C C   . GLU A 1 744  ? 1.550   44.650 54.009  1.00 61.08  ? 741  GLU A C   1 
ATOM 5777 O O   . GLU A 1 744  ? 2.397   43.765 54.056  1.00 61.08  ? 741  GLU A O   1 
ATOM 5778 C CB  . GLU A 1 744  ? -0.442  43.864 52.896  1.00 63.94  ? 741  GLU A CB  1 
ATOM 5779 C CG  . GLU A 1 744  ? -1.533  44.030 51.857  1.00 63.94  ? 741  GLU A CG  1 
ATOM 5780 C CD  . GLU A 1 744  ? -2.789  43.211 52.170  1.00 63.94  ? 741  GLU A CD  1 
ATOM 5781 O OE1 . GLU A 1 744  ? -3.034  42.931 53.387  1.00 63.94  ? 741  GLU A OE1 1 
ATOM 5782 O OE2 . GLU A 1 744  ? -3.523  42.863 51.185  1.00 63.94  ? 741  GLU A OE2 1 
ATOM 5783 N N   . VAL A 1 745  ? 1.274   45.455 55.040  1.00 64.80  ? 742  VAL A N   1 
ATOM 5784 C CA  . VAL A 1 745  ? 2.064   45.381 56.287  1.00 64.80  ? 742  VAL A CA  1 
ATOM 5785 C C   . VAL A 1 745  ? 1.450   44.469 57.348  1.00 64.80  ? 742  VAL A C   1 
ATOM 5786 O O   . VAL A 1 745  ? 0.243   44.212 57.311  1.00 64.80  ? 742  VAL A O   1 
ATOM 5787 C CB  . VAL A 1 745  ? 2.326   46.769 56.885  1.00 66.74  ? 742  VAL A CB  1 
ATOM 5788 C CG1 . VAL A 1 745  ? 2.628   47.765 55.751  1.00 66.74  ? 742  VAL A CG1 1 
ATOM 5789 C CG2 . VAL A 1 745  ? 1.145   47.225 57.775  1.00 66.74  ? 742  VAL A CG2 1 
ATOM 5790 N N   . GLN A 1 746  ? 2.297   43.960 58.253  1.00 101.90 ? 743  GLN A N   1 
ATOM 5791 C CA  . GLN A 1 746  ? 1.853   43.298 59.482  1.00 101.90 ? 743  GLN A CA  1 
ATOM 5792 C C   . GLN A 1 746  ? 1.129   44.365 60.305  1.00 101.90 ? 743  GLN A C   1 
ATOM 5793 O O   . GLN A 1 746  ? 1.542   45.537 60.338  1.00 101.90 ? 743  GLN A O   1 
ATOM 5794 C CB  . GLN A 1 746  ? 3.037   42.754 60.295  1.00 90.94  ? 743  GLN A CB  1 
ATOM 5795 C CG  . GLN A 1 746  ? 3.810   43.863 61.073  1.00 90.94  ? 743  GLN A CG  1 
ATOM 5796 C CD  . GLN A 1 746  ? 4.789   43.350 62.125  1.00 90.94  ? 743  GLN A CD  1 
ATOM 5797 O OE1 . GLN A 1 746  ? 5.965   43.719 62.111  1.00 90.94  ? 743  GLN A OE1 1 
ATOM 5798 N NE2 . GLN A 1 746  ? 4.304   42.516 63.050  1.00 90.94  ? 743  GLN A NE2 1 
ATOM 5799 N N   . ASP A 1 747  ? 0.059   43.958 60.972  1.00 146.65 ? 744  ASP A N   1 
ATOM 5800 C CA  . ASP A 1 747  ? -0.755  44.905 61.711  1.00 146.65 ? 744  ASP A CA  1 
ATOM 5801 C C   . ASP A 1 747  ? -0.244  45.142 63.131  1.00 146.65 ? 744  ASP A C   1 
ATOM 5802 O O   . ASP A 1 747  ? 0.946   44.963 63.416  1.00 146.65 ? 744  ASP A O   1 
ATOM 5803 C CB  . ASP A 1 747  ? -2.212  44.438 61.719  1.00 106.34 ? 744  ASP A CB  1 
ATOM 5804 C CG  . ASP A 1 747  ? -3.056  45.161 60.693  1.00 106.34 ? 744  ASP A CG  1 
ATOM 5805 O OD1 . ASP A 1 747  ? -3.113  46.412 60.745  1.00 106.34 ? 744  ASP A OD1 1 
ATOM 5806 O OD2 . ASP A 1 747  ? -3.662  44.481 59.839  1.00 106.34 ? 744  ASP A OD2 1 
ATOM 5807 N N   . THR A 1 748  ? -1.148  45.544 64.019  1.00 98.49  ? 745  THR A N   1 
ATOM 5808 C CA  . THR A 1 748  ? -0.792  45.803 65.409  1.00 98.49  ? 745  THR A CA  1 
ATOM 5809 C C   . THR A 1 748  ? -0.591  44.498 66.171  1.00 98.49  ? 745  THR A C   1 
ATOM 5810 O O   . THR A 1 748  ? -0.256  44.504 67.355  1.00 98.49  ? 745  THR A O   1 
ATOM 5811 C CB  . THR A 1 748  ? -1.870  46.641 66.120  1.00 86.52  ? 745  THR A CB  1 
ATOM 5812 O OG1 . THR A 1 748  ? -3.117  45.934 66.106  1.00 86.52  ? 745  THR A OG1 1 
ATOM 5813 C CG2 . THR A 1 748  ? -2.045  47.984 65.426  1.00 86.52  ? 745  THR A CG2 1 
ATOM 5814 N N   . SER A 1 749  ? -0.796  43.380 65.482  1.00 95.16  ? 746  SER A N   1 
ATOM 5815 C CA  . SER A 1 749  ? -0.638  42.064 66.089  1.00 95.16  ? 746  SER A CA  1 
ATOM 5816 C C   . SER A 1 749  ? -0.096  41.055 65.082  1.00 95.16  ? 746  SER A C   1 
ATOM 5817 O O   . SER A 1 749  ? 0.549   40.076 65.457  1.00 95.16  ? 746  SER A O   1 
ATOM 5818 C CB  . SER A 1 749  ? -1.970  41.574 66.660  1.00 136.04 ? 746  SER A CB  1 
ATOM 5819 O OG  . SER A 1 749  ? -2.954  41.475 65.645  1.00 136.04 ? 746  SER A OG  1 
ATOM 5820 N N   . GLY A 1 750  ? -0.362  41.301 63.804  1.00 92.62  ? 747  GLY A N   1 
ATOM 5821 C CA  . GLY A 1 750  ? 0.097   40.419 62.746  1.00 92.62  ? 747  GLY A CA  1 
ATOM 5822 C C   . GLY A 1 750  ? -0.626  40.655 61.435  1.00 92.62  ? 747  GLY A C   1 
ATOM 5823 O O   . GLY A 1 750  ? -0.014  40.644 60.367  1.00 92.62  ? 747  GLY A O   1 
ATOM 5824 N N   . GLY A 1 751  ? -1.935  40.869 61.516  1.00 125.36 ? 748  GLY A N   1 
ATOM 5825 C CA  . GLY A 1 751  ? -2.744  41.108 60.335  1.00 125.36 ? 748  GLY A CA  1 
ATOM 5826 C C   . GLY A 1 751  ? -2.097  42.083 59.372  1.00 125.36 ? 748  GLY A C   1 
ATOM 5827 O O   . GLY A 1 751  ? -1.101  42.727 59.701  1.00 125.36 ? 748  GLY A O   1 
ATOM 5828 N N   . THR A 1 752  ? -2.667  42.192 58.176  1.00 79.02  ? 749  THR A N   1 
ATOM 5829 C CA  . THR A 1 752  ? -2.145  43.094 57.157  1.00 79.02  ? 749  THR A CA  1 
ATOM 5830 C C   . THR A 1 752  ? -3.233  44.026 56.636  1.00 79.02  ? 749  THR A C   1 
ATOM 5831 O O   . THR A 1 752  ? -4.371  43.609 56.421  1.00 79.02  ? 749  THR A O   1 
ATOM 5832 C CB  . THR A 1 752  ? -1.537  42.318 55.974  1.00 48.94  ? 749  THR A CB  1 
ATOM 5833 O OG1 . THR A 1 752  ? -2.545  41.501 55.367  1.00 48.94  ? 749  THR A OG1 1 
ATOM 5834 C CG2 . THR A 1 752  ? -0.392  41.435 56.448  1.00 48.94  ? 749  THR A CG2 1 
ATOM 5835 N N   . THR A 1 753  ? -2.876  45.291 56.434  1.00 119.66 ? 750  THR A N   1 
ATOM 5836 C CA  . THR A 1 753  ? -3.821  46.284 55.938  1.00 119.66 ? 750  THR A CA  1 
ATOM 5837 C C   . THR A 1 753  ? -3.797  46.356 54.415  1.00 119.66 ? 750  THR A C   1 
ATOM 5838 O O   . THR A 1 753  ? -3.946  45.342 53.734  1.00 119.66 ? 750  THR A O   1 
ATOM 5839 C CB  . THR A 1 753  ? -3.525  47.681 56.514  1.00 112.44 ? 750  THR A CB  1 
ATOM 5840 O OG1 . THR A 1 753  ? -2.208  48.092 56.125  1.00 112.44 ? 750  THR A OG1 1 
ATOM 5841 C CG2 . THR A 1 753  ? -3.618  47.663 58.032  1.00 112.44 ? 750  THR A CG2 1 
ATOM 5842 N N   . ALA A 1 754  ? -3.609  47.562 53.888  1.00 92.20  ? 751  ALA A N   1 
ATOM 5843 C CA  . ALA A 1 754  ? -3.566  47.768 52.445  1.00 92.20  ? 751  ALA A CA  1 
ATOM 5844 C C   . ALA A 1 754  ? -3.317  49.234 52.106  1.00 92.20  ? 751  ALA A C   1 
ATOM 5845 O O   . ALA A 1 754  ? -4.234  49.953 51.707  1.00 92.20  ? 751  ALA A O   1 
ATOM 5846 C CB  . ALA A 1 754  ? -4.856  47.284 51.801  1.00 49.07  ? 751  ALA A CB  1 
ATOM 5847 N N   . LEU A 1 755  ? -2.072  49.671 52.266  1.00 54.49  ? 752  LEU A N   1 
ATOM 5848 C CA  . LEU A 1 755  ? -1.700  51.050 51.977  1.00 54.49  ? 752  LEU A CA  1 
ATOM 5849 C C   . LEU A 1 755  ? -2.678  51.695 51.000  1.00 54.49  ? 752  LEU A C   1 
ATOM 5850 O O   . LEU A 1 755  ? -3.655  52.323 51.407  1.00 54.49  ? 752  LEU A O   1 
ATOM 5851 C CB  . LEU A 1 755  ? -0.278  51.116 51.418  1.00 71.72  ? 752  LEU A CB  1 
ATOM 5852 C CG  . LEU A 1 755  ? 0.843   50.690 52.367  1.00 71.72  ? 752  LEU A CG  1 
ATOM 5853 C CD1 . LEU A 1 755  ? 2.181   50.662 51.642  1.00 71.72  ? 752  LEU A CD1 1 
ATOM 5854 C CD2 . LEU A 1 755  ? 0.903   51.611 53.576  1.00 71.72  ? 752  LEU A CD2 1 
ATOM 5855 N N   . ARG A 1 756  ? -2.408  51.534 49.709  1.00 41.21  ? 753  ARG A N   1 
ATOM 5856 C CA  . ARG A 1 756  ? -3.261  52.100 48.671  1.00 41.21  ? 753  ARG A CA  1 
ATOM 5857 C C   . ARG A 1 756  ? -4.094  51.017 47.993  1.00 41.21  ? 753  ARG A C   1 
ATOM 5858 O O   . ARG A 1 756  ? -3.706  49.849 47.965  1.00 41.21  ? 753  ARG A O   1 
ATOM 5859 C CB  . ARG A 1 756  ? -2.420  52.844 47.631  1.00 61.54  ? 753  ARG A CB  1 
ATOM 5860 C CG  . ARG A 1 756  ? -1.405  51.968 46.914  1.00 61.54  ? 753  ARG A CG  1 
ATOM 5861 C CD  . ARG A 1 756  ? -0.602  52.769 45.902  1.00 61.54  ? 753  ARG A CD  1 
ATOM 5862 N NE  . ARG A 1 756  ? 0.146   53.853 46.532  1.00 61.54  ? 753  ARG A NE  1 
ATOM 5863 C CZ  . ARG A 1 756  ? 1.384   53.734 46.999  1.00 61.54  ? 753  ARG A CZ  1 
ATOM 5864 N NH1 . ARG A 1 756  ? 2.020   52.573 46.909  1.00 61.54  ? 753  ARG A NH1 1 
ATOM 5865 N NH2 . ARG A 1 756  ? 1.988   54.774 47.558  1.00 61.54  ? 753  ARG A NH2 1 
ATOM 5866 N N   . PRO A 1 757  ? -5.240  51.412 47.448  1.00 53.46  ? 754  PRO A N   1 
ATOM 5867 C CA  . PRO A 1 757  ? -6.127  50.476 46.771  1.00 53.46  ? 754  PRO A CA  1 
ATOM 5868 C C   . PRO A 1 757  ? -5.424  49.988 45.511  1.00 53.46  ? 754  PRO A C   1 
ATOM 5869 O O   . PRO A 1 757  ? -4.682  50.746 44.889  1.00 53.46  ? 754  PRO A O   1 
ATOM 5870 C CB  . PRO A 1 757  ? -7.349  51.335 46.411  1.00 40.59  ? 754  PRO A CB  1 
ATOM 5871 C CG  . PRO A 1 757  ? -6.840  52.753 46.356  1.00 40.59  ? 754  PRO A CG  1 
ATOM 5872 C CD  . PRO A 1 757  ? -5.622  52.830 47.275  1.00 40.59  ? 754  PRO A CD  1 
ATOM 5873 N N   . SER A 1 758  ? -5.615  48.728 45.159  1.00 52.98  ? 755  SER A N   1 
ATOM 5874 C CA  . SER A 1 758  ? -5.046  48.214 43.928  1.00 52.98  ? 755  SER A CA  1 
ATOM 5875 C C   . SER A 1 758  ? -6.147  47.529 43.187  1.00 52.98  ? 755  SER A C   1 
ATOM 5876 O O   . SER A 1 758  ? -7.286  47.522 43.646  1.00 52.98  ? 755  SER A O   1 
ATOM 5877 C CB  . SER A 1 758  ? -3.947  47.216 44.212  1.00 41.83  ? 755  SER A CB  1 
ATOM 5878 O OG  . SER A 1 758  ? -4.102  46.619 45.481  1.00 41.83  ? 755  SER A OG  1 
ATOM 5879 N N   . ALA A 1 759  ? -5.820  46.948 42.048  1.00 46.91  ? 756  ALA A N   1 
ATOM 5880 C CA  . ALA A 1 759  ? -6.808  46.260 41.282  1.00 46.91  ? 756  ALA A CA  1 
ATOM 5881 C C   . ALA A 1 759  ? -7.459  45.133 42.019  1.00 46.91  ? 756  ALA A C   1 
ATOM 5882 O O   . ALA A 1 759  ? -8.522  44.719 41.620  1.00 46.91  ? 756  ALA A O   1 
ATOM 5883 C CB  . ALA A 1 759  ? -6.211  45.718 40.038  1.00 13.91  ? 756  ALA A CB  1 
ATOM 5884 N N   . SER A 1 760  ? -6.818  44.583 43.035  1.00 50.24  ? 757  SER A N   1 
ATOM 5885 C CA  . SER A 1 760  ? -7.325  43.344 43.626  1.00 50.24  ? 757  SER A CA  1 
ATOM 5886 C C   . SER A 1 760  ? -8.344  43.579 44.800  1.00 50.24  ? 757  SER A C   1 
ATOM 5887 O O   . SER A 1 760  ? -9.076  42.672 45.260  1.00 50.24  ? 757  SER A O   1 
ATOM 5888 C CB  . SER A 1 760  ? -6.136  42.477 44.054  1.00 41.74  ? 757  SER A CB  1 
ATOM 5889 O OG  . SER A 1 760  ? -5.295  43.193 44.955  1.00 41.74  ? 757  SER A OG  1 
ATOM 5890 N N   . THR A 1 761  ? -8.374  44.819 45.253  1.00 44.87  ? 758  THR A N   1 
ATOM 5891 C CA  . THR A 1 761  ? -9.145  45.224 46.358  1.00 44.87  ? 758  THR A CA  1 
ATOM 5892 C C   . THR A 1 761  ? -10.259 46.135 45.844  1.00 44.87  ? 758  THR A C   1 
ATOM 5893 O O   . THR A 1 761  ? -11.321 46.261 46.462  1.00 44.87  ? 758  THR A O   1 
ATOM 5894 C CB  . THR A 1 761  ? -8.251  45.978 47.290  1.00 43.95  ? 758  THR A CB  1 
ATOM 5895 O OG1 . THR A 1 761  ? -7.896  47.245 46.710  1.00 43.95  ? 758  THR A OG1 1 
ATOM 5896 C CG2 . THR A 1 761  ? -7.002  45.178 47.508  1.00 43.95  ? 758  THR A CG2 1 
ATOM 5897 N N   . GLN A 1 762  ? -10.033 46.786 44.713  1.00 45.31  ? 759  GLN A N   1 
ATOM 5898 C CA  . GLN A 1 762  ? -11.085 47.582 44.117  1.00 45.31  ? 759  GLN A CA  1 
ATOM 5899 C C   . GLN A 1 762  ? -11.923 46.711 43.191  1.00 45.31  ? 759  GLN A C   1 
ATOM 5900 O O   . GLN A 1 762  ? -12.651 47.221 42.383  1.00 45.31  ? 759  GLN A O   1 
ATOM 5901 C CB  . GLN A 1 762  ? -10.503 48.777 43.362  1.00 83.25  ? 759  GLN A CB  1 
ATOM 5902 C CG  . GLN A 1 762  ? -9.672  49.679 44.218  1.00 83.25  ? 759  GLN A CG  1 
ATOM 5903 C CD  . GLN A 1 762  ? -10.245 49.829 45.617  1.00 83.25  ? 759  GLN A CD  1 
ATOM 5904 O OE1 . GLN A 1 762  ? -10.153 48.920 46.456  1.00 83.25  ? 759  GLN A OE1 1 
ATOM 5905 N NE2 . GLN A 1 762  ? -10.828 50.993 45.883  1.00 83.25  ? 759  GLN A NE2 1 
ATOM 5906 N N   . ALA A 1 763  ? -11.821 45.397 43.295  1.00 48.13  ? 760  ALA A N   1 
ATOM 5907 C CA  . ALA A 1 763  ? -12.393 44.527 42.261  1.00 48.13  ? 760  ALA A CA  1 
ATOM 5908 C C   . ALA A 1 763  ? -13.928 44.595 42.228  1.00 48.13  ? 760  ALA A C   1 
ATOM 5909 O O   . ALA A 1 763  ? -14.541 44.830 43.258  1.00 48.13  ? 760  ALA A O   1 
ATOM 5910 C CB  . ALA A 1 763  ? -11.926 43.105 42.485  1.00 54.14  ? 760  ALA A CB  1 
ATOM 5911 N N   . LEU A 1 764  ? -14.569 44.384 41.085  1.00 76.56  ? 761  LEU A N   1 
ATOM 5912 C CA  . LEU A 1 764  ? -16.042 44.407 41.083  1.00 76.56  ? 761  LEU A CA  1 
ATOM 5913 C C   . LEU A 1 764  ? -16.648 43.416 42.080  1.00 76.56  ? 761  LEU A C   1 
ATOM 5914 O O   . LEU A 1 764  ? -17.405 43.818 42.990  1.00 76.56  ? 761  LEU A O   1 
ATOM 5915 C CB  . LEU A 1 764  ? -16.645 44.248 39.675  1.00 59.25  ? 761  LEU A CB  1 
ATOM 5916 C CG  . LEU A 1 764  ? -16.239 45.328 38.646  1.00 59.25  ? 761  LEU A CG  1 
ATOM 5917 C CD1 . LEU A 1 764  ? -17.191 45.283 37.521  1.00 59.25  ? 761  LEU A CD1 1 
ATOM 5918 C CD2 . LEU A 1 764  ? -16.165 46.731 39.211  1.00 59.25  ? 761  LEU A CD2 1 
ATOM 5919 N N   . SER A 1 765  ? -16.302 42.140 41.911  1.00 81.33  ? 762  SER A N   1 
ATOM 5920 C CA  . SER A 1 765  ? -16.633 41.104 42.889  1.00 81.33  ? 762  SER A CA  1 
ATOM 5921 C C   . SER A 1 765  ? -15.344 40.604 43.573  1.00 81.33  ? 762  SER A C   1 
ATOM 5922 O O   . SER A 1 765  ? -14.357 41.352 43.607  1.00 81.33  ? 762  SER A O   1 
ATOM 5923 C CB  . SER A 1 765  ? -17.401 39.978 42.217  1.00 63.43  ? 762  SER A CB  1 
ATOM 5924 O OG  . SER A 1 765  ? -16.534 39.146 41.463  1.00 63.43  ? 762  SER A OG  1 
ATOM 5925 N N   . SER A 1 766  ? -15.343 39.379 44.126  1.00 69.29  ? 763  SER A N   1 
ATOM 5926 C CA  . SER A 1 766  ? -14.139 38.832 44.774  1.00 69.29  ? 763  SER A CA  1 
ATOM 5927 C C   . SER A 1 766  ? -14.275 37.494 45.552  1.00 69.29  ? 763  SER A C   1 
ATOM 5928 O O   . SER A 1 766  ? -15.368 36.962 45.661  1.00 69.29  ? 763  SER A O   1 
ATOM 5929 C CB  . SER A 1 766  ? -13.533 39.877 45.672  1.00 42.33  ? 763  SER A CB  1 
ATOM 5930 O OG  . SER A 1 766  ? -14.073 39.699 46.939  1.00 42.33  ? 763  SER A OG  1 
ATOM 5931 N N   . SER A 1 767  ? -13.153 36.985 46.089  1.00 43.60  ? 764  SER A N   1 
ATOM 5932 C CA  . SER A 1 767  ? -13.023 35.622 46.635  1.00 43.60  ? 764  SER A CA  1 
ATOM 5933 C C   . SER A 1 767  ? -11.784 35.512 47.492  1.00 43.60  ? 764  SER A C   1 
ATOM 5934 O O   . SER A 1 767  ? -10.907 36.381 47.453  1.00 43.60  ? 764  SER A O   1 
ATOM 5935 C CB  . SER A 1 767  ? -12.800 34.606 45.538  1.00 41.99  ? 764  SER A CB  1 
ATOM 5936 O OG  . SER A 1 767  ? -13.897 34.466 44.675  1.00 41.99  ? 764  SER A OG  1 
ATOM 5937 N N   . VAL A 1 768  ? -11.691 34.457 48.283  1.00 57.27  ? 765  VAL A N   1 
ATOM 5938 C CA  . VAL A 1 768  ? -10.443 34.155 48.929  1.00 57.27  ? 765  VAL A CA  1 
ATOM 5939 C C   . VAL A 1 768  ? -10.414 32.680 48.900  1.00 57.27  ? 765  VAL A C   1 
ATOM 5940 O O   . VAL A 1 768  ? -11.456 32.065 48.682  1.00 57.27  ? 765  VAL A O   1 
ATOM 5941 C CB  . VAL A 1 768  ? -10.418 34.551 50.362  1.00 43.17  ? 765  VAL A CB  1 
ATOM 5942 C CG1 . VAL A 1 768  ? -10.925 33.378 51.225  1.00 43.17  ? 765  VAL A CG1 1 
ATOM 5943 C CG2 . VAL A 1 768  ? -8.976  34.860 50.792  1.00 43.17  ? 765  VAL A CG2 1 
ATOM 5944 N N   . SER A 1 769  ? -9.240  32.088 49.090  1.00 62.82  ? 766  SER A N   1 
ATOM 5945 C CA  . SER A 1 769  ? -9.195  30.647 49.037  1.00 62.82  ? 766  SER A CA  1 
ATOM 5946 C C   . SER A 1 769  ? -9.781  30.128 50.300  1.00 62.82  ? 766  SER A C   1 
ATOM 5947 O O   . SER A 1 769  ? -9.522  30.663 51.391  1.00 62.82  ? 766  SER A O   1 
ATOM 5948 C CB  . SER A 1 769  ? -7.793  30.095 48.804  1.00 55.97  ? 766  SER A CB  1 
ATOM 5949 O OG  . SER A 1 769  ? -7.758  29.392 47.551  1.00 55.97  ? 766  SER A OG  1 
ATOM 5950 N N   . SER A 1 770  ? -10.620 29.117 50.152  1.00 69.35  ? 767  SER A N   1 
ATOM 5951 C CA  . SER A 1 770  ? -11.137 28.469 51.330  1.00 69.35  ? 767  SER A CA  1 
ATOM 5952 C C   . SER A 1 770  ? -10.163 27.348 51.705  1.00 69.35  ? 767  SER A C   1 
ATOM 5953 O O   . SER A 1 770  ? -9.606  27.380 52.806  1.00 69.35  ? 767  SER A O   1 
ATOM 5954 C CB  . SER A 1 770  ? -12.603 28.027 51.152  1.00 56.81  ? 767  SER A CB  1 
ATOM 5955 O OG  . SER A 1 770  ? -12.704 26.880 50.340  1.00 56.81  ? 767  SER A OG  1 
ATOM 5956 N N   . SER A 1 771  ? -9.927  26.415 50.778  1.00 68.66  ? 768  SER A N   1 
ATOM 5957 C CA  . SER A 1 771  ? -8.968  25.276 50.928  1.00 68.66  ? 768  SER A CA  1 
ATOM 5958 C C   . SER A 1 771  ? -8.105  25.164 52.199  1.00 68.66  ? 768  SER A C   1 
ATOM 5959 O O   . SER A 1 771  ? -7.415  26.108 52.587  1.00 68.66  ? 768  SER A O   1 
ATOM 5960 C CB  . SER A 1 771  ? -8.050  25.181 49.705  1.00 63.16  ? 768  SER A CB  1 
ATOM 5961 O OG  . SER A 1 771  ? -6.961  24.297 49.957  1.00 63.16  ? 768  SER A OG  1 
ATOM 5962 N N   . LYS A 1 772  ? -8.124  23.981 52.809  1.00 85.38  ? 769  LYS A N   1 
ATOM 5963 C CA  . LYS A 1 772  ? -7.540  23.799 54.131  1.00 85.38  ? 769  LYS A CA  1 
ATOM 5964 C C   . LYS A 1 772  ? -6.301  22.932 54.099  1.00 85.38  ? 769  LYS A C   1 
ATOM 5965 O O   . LYS A 1 772  ? -5.806  22.514 55.159  1.00 85.38  ? 769  LYS A O   1 
ATOM 5966 C CB  . LYS A 1 772  ? -8.574  23.199 55.097  1.00 106.88 ? 769  LYS A CB  1 
ATOM 5967 C CG  . LYS A 1 772  ? -9.404  24.215 55.874  1.00 106.88 ? 769  LYS A CG  1 
ATOM 5968 C CD  . LYS A 1 772  ? -8.580  24.965 56.932  1.00 106.88 ? 769  LYS A CD  1 
ATOM 5969 C CE  . LYS A 1 772  ? -9.222  26.309 57.314  1.00 106.88 ? 769  LYS A CE  1 
ATOM 5970 N NZ  . LYS A 1 772  ? -9.571  27.185 56.132  1.00 106.88 ? 769  LYS A NZ  1 
ATOM 5971 N N   . LEU A 1 773  ? -5.795  22.691 52.887  1.00 88.40  ? 770  LEU A N   1 
ATOM 5972 C CA  . LEU A 1 773  ? -4.737  21.694 52.605  1.00 88.40  ? 770  LEU A CA  1 
ATOM 5973 C C   . LEU A 1 773  ? -3.469  21.678 53.481  1.00 88.40  ? 770  LEU A C   1 
ATOM 5974 O O   . LEU A 1 773  ? -2.649  20.755 53.362  1.00 88.40  ? 770  LEU A O   1 
ATOM 5975 C CB  . LEU A 1 773  ? -4.309  21.793 51.141  1.00 80.57  ? 770  LEU A CB  1 
ATOM 5976 C CG  . LEU A 1 773  ? -5.336  21.468 50.073  1.00 80.57  ? 770  LEU A CG  1 
ATOM 5977 C CD1 . LEU A 1 773  ? -4.590  21.054 48.830  1.00 80.57  ? 770  LEU A CD1 1 
ATOM 5978 C CD2 . LEU A 1 773  ? -6.272  20.363 50.540  1.00 80.57  ? 770  LEU A CD2 1 
ATOM 5979 N N   . PHE A 1 774  ? -3.316  22.688 54.341  1.00 92.15  ? 771  PHE A N   1 
ATOM 5980 C CA  . PHE A 1 774  ? -2.113  22.867 55.156  1.00 92.15  ? 771  PHE A CA  1 
ATOM 5981 C C   . PHE A 1 774  ? -2.422  22.994 56.664  1.00 92.15  ? 771  PHE A C   1 
ATOM 5982 O O   . PHE A 1 774  ? -3.586  22.882 57.076  1.00 92.15  ? 771  PHE A O   1 
ATOM 5983 C CB  . PHE A 1 774  ? -1.295  24.059 54.614  1.00 79.51  ? 771  PHE A CB  1 
ATOM 5984 C CG  . PHE A 1 774  ? -0.947  23.936 53.126  1.00 79.51  ? 771  PHE A CG  1 
ATOM 5985 C CD1 . PHE A 1 774  ? -1.655  24.649 52.161  1.00 79.51  ? 771  PHE A CD1 1 
ATOM 5986 C CD2 . PHE A 1 774  ? 0.074   23.082 52.692  1.00 79.51  ? 771  PHE A CD2 1 
ATOM 5987 C CE1 . PHE A 1 774  ? -1.345  24.521 50.797  1.00 79.51  ? 771  PHE A CE1 1 
ATOM 5988 C CE2 . PHE A 1 774  ? 0.382   22.950 51.325  1.00 79.51  ? 771  PHE A CE2 1 
ATOM 5989 C CZ  . PHE A 1 774  ? -0.334  23.669 50.384  1.00 79.51  ? 771  PHE A CZ  1 
ATOM 5990 N N   . SER A 1 775  ? -1.366  23.208 57.455  1.00 212.91 ? 772  SER A N   1 
ATOM 5991 C CA  . SER A 1 775  ? -1.481  23.349 58.908  1.00 212.91 ? 772  SER A CA  1 
ATOM 5992 C C   . SER A 1 775  ? -0.190  23.070 59.709  1.00 212.91 ? 772  SER A C   1 
ATOM 5993 O O   . SER A 1 775  ? 0.201   21.919 59.900  1.00 212.91 ? 772  SER A O   1 
ATOM 5994 C CB  . SER A 1 775  ? -2.617  22.468 59.436  1.00 75.66  ? 772  SER A CB  1 
ATOM 5995 O OG  . SER A 1 775  ? -3.258  23.074 60.545  1.00 75.66  ? 772  SER A OG  1 
ATOM 5996 N N   . SER A 1 776  ? 0.450   24.143 60.174  1.00 200.83 ? 773  SER A N   1 
ATOM 5997 C CA  . SER A 1 776  ? 1.690   24.102 60.983  1.00 200.83 ? 773  SER A CA  1 
ATOM 5998 C C   . SER A 1 776  ? 1.392   25.446 61.733  1.00 200.83 ? 773  SER A C   1 
ATOM 5999 O O   . SER A 1 776  ? 2.331   26.712 60.827  1.00 200.83 ? 773  SER A O   1 
ATOM 6000 C CB  . SER A 1 776  ? 2.964   24.174 60.077  1.00 94.40  ? 773  SER A CB  1 
ATOM 6001 O OG  . SER A 1 776  ? 2.671   24.575 58.721  1.00 94.40  ? 773  SER A OG  1 
ATOM 6002 N N   . GLY A 1 786  ? 5.801   47.169 60.058  1.00 123.65 ? 783  GLY A N   1 
ATOM 6003 C CA  . GLY A 1 786  ? 6.884   46.181 60.162  1.00 123.65 ? 783  GLY A CA  1 
ATOM 6004 C C   . GLY A 1 786  ? 6.908   45.166 59.026  1.00 123.65 ? 783  GLY A C   1 
ATOM 6005 O O   . GLY A 1 786  ? 7.251   45.500 57.890  1.00 123.65 ? 783  GLY A O   1 
ATOM 6006 N N   . GLU A 1 787  ? 6.532   43.926 59.341  1.00 82.73  ? 784  GLU A N   1 
ATOM 6007 C CA  . GLU A 1 787  ? 6.666   42.776 58.424  1.00 82.73  ? 784  GLU A CA  1 
ATOM 6008 C C   . GLU A 1 787  ? 5.896   42.928 57.088  1.00 82.73  ? 784  GLU A C   1 
ATOM 6009 O O   . GLU A 1 787  ? 4.669   43.112 57.072  1.00 82.73  ? 784  GLU A O   1 
ATOM 6010 C CB  . GLU A 1 787  ? 6.291   41.464 59.144  1.00 123.64 ? 784  GLU A CB  1 
ATOM 6011 C CG  . GLU A 1 787  ? 7.341   40.970 60.151  1.00 123.64 ? 784  GLU A CG  1 
ATOM 6012 C CD  . GLU A 1 787  ? 6.763   40.188 61.347  1.00 123.64 ? 784  GLU A CD  1 
ATOM 6013 O OE1 . GLU A 1 787  ? 7.391   40.236 62.429  1.00 123.64 ? 784  GLU A OE1 1 
ATOM 6014 O OE2 . GLU A 1 787  ? 5.702   39.527 61.228  1.00 123.64 ? 784  GLU A OE2 1 
ATOM 6015 N N   . GLU A 1 788  ? 6.633   42.864 55.976  1.00 77.54  ? 785  GLU A N   1 
ATOM 6016 C CA  . GLU A 1 788  ? 6.032   42.965 54.649  1.00 77.54  ? 785  GLU A CA  1 
ATOM 6017 C C   . GLU A 1 788  ? 5.659   41.593 54.136  1.00 77.54  ? 785  GLU A C   1 
ATOM 6018 O O   . GLU A 1 788  ? 6.425   40.637 54.282  1.00 77.54  ? 785  GLU A O   1 
ATOM 6019 C CB  . GLU A 1 788  ? 6.997   43.603 53.668  1.00 74.69  ? 785  GLU A CB  1 
ATOM 6020 C CG  . GLU A 1 788  ? 6.782   45.069 53.446  1.00 74.69  ? 785  GLU A CG  1 
ATOM 6021 C CD  . GLU A 1 788  ? 7.690   45.618 52.367  1.00 74.69  ? 785  GLU A CD  1 
ATOM 6022 O OE1 . GLU A 1 788  ? 8.237   44.817 51.569  1.00 74.69  ? 785  GLU A OE1 1 
ATOM 6023 O OE2 . GLU A 1 788  ? 7.864   46.858 52.310  1.00 74.69  ? 785  GLU A OE2 1 
ATOM 6024 N N   . VAL A 1 789  ? 4.480   41.494 53.535  1.00 54.65  ? 786  VAL A N   1 
ATOM 6025 C CA  . VAL A 1 789  ? 4.035   40.245 52.956  1.00 54.65  ? 786  VAL A CA  1 
ATOM 6026 C C   . VAL A 1 789  ? 3.479   40.566 51.573  1.00 54.65  ? 786  VAL A C   1 
ATOM 6027 O O   . VAL A 1 789  ? 3.161   41.707 51.273  1.00 54.65  ? 786  VAL A O   1 
ATOM 6028 C CB  . VAL A 1 789  ? 2.954   39.565 53.837  1.00 69.69  ? 786  VAL A CB  1 
ATOM 6029 C CG1 . VAL A 1 789  ? 1.581   40.241 53.629  1.00 69.69  ? 786  VAL A CG1 1 
ATOM 6030 C CG2 . VAL A 1 789  ? 2.861   38.034 53.556  1.00 69.69  ? 786  VAL A CG2 1 
ATOM 6031 N N   . GLU A 1 790  ? 3.382   39.553 50.734  1.00 38.26  ? 787  GLU A N   1 
ATOM 6032 C CA  . GLU A 1 790  ? 2.814   39.715 49.449  1.00 38.26  ? 787  GLU A CA  1 
ATOM 6033 C C   . GLU A 1 790  ? 1.469   39.054 49.473  1.00 38.26  ? 787  GLU A C   1 
ATOM 6034 O O   . GLU A 1 790  ? 1.302   38.045 50.146  1.00 38.26  ? 787  GLU A O   1 
ATOM 6035 C CB  . GLU A 1 790  ? 3.673   38.964 48.481  1.00 35.72  ? 787  GLU A CB  1 
ATOM 6036 C CG  . GLU A 1 790  ? 4.914   39.718 48.092  1.00 35.72  ? 787  GLU A CG  1 
ATOM 6037 C CD  . GLU A 1 790  ? 5.516   39.218 46.778  1.00 35.72  ? 787  GLU A CD  1 
ATOM 6038 O OE1 . GLU A 1 790  ? 6.479   39.875 46.329  1.00 35.72  ? 787  GLU A OE1 1 
ATOM 6039 O OE2 . GLU A 1 790  ? 5.070   38.188 46.195  1.00 35.72  ? 787  GLU A OE2 1 
ATOM 6040 N N   . VAL A 1 791  ? 0.488   39.578 48.757  1.00 51.48  ? 788  VAL A N   1 
ATOM 6041 C CA  . VAL A 1 791  ? -0.772  38.871 48.695  1.00 51.48  ? 788  VAL A CA  1 
ATOM 6042 C C   . VAL A 1 791  ? -0.978  38.753 47.228  1.00 51.48  ? 788  VAL A C   1 
ATOM 6043 O O   . VAL A 1 791  ? -0.809  39.743 46.527  1.00 51.48  ? 788  VAL A O   1 
ATOM 6044 C CB  . VAL A 1 791  ? -1.968  39.647 49.372  1.00 39.17  ? 788  VAL A CB  1 
ATOM 6045 C CG1 . VAL A 1 791  ? -3.236  38.844 49.289  1.00 39.17  ? 788  VAL A CG1 1 
ATOM 6046 C CG2 . VAL A 1 791  ? -1.712  39.928 50.823  1.00 39.17  ? 788  VAL A CG2 1 
ATOM 6047 N N   . HIS A 1 792  ? -1.367  37.573 46.776  1.00 54.56  ? 789  HIS A N   1 
ATOM 6048 C CA  . HIS A 1 792  ? -1.408  37.243 45.384  1.00 54.56  ? 789  HIS A CA  1 
ATOM 6049 C C   . HIS A 1 792  ? -2.801  36.913 44.947  1.00 54.56  ? 789  HIS A C   1 
ATOM 6050 O O   . HIS A 1 792  ? -3.521  36.320 45.705  1.00 54.56  ? 789  HIS A O   1 
ATOM 6051 C CB  . HIS A 1 792  ? -0.571  35.995 45.158  1.00 44.79  ? 789  HIS A CB  1 
ATOM 6052 C CG  . HIS A 1 792  ? 0.891   36.251 45.108  1.00 44.79  ? 789  HIS A CG  1 
ATOM 6053 N ND1 . HIS A 1 792  ? 1.640   36.030 43.974  1.00 44.79  ? 789  HIS A ND1 1 
ATOM 6054 C CD2 . HIS A 1 792  ? 1.753   36.693 46.051  1.00 44.79  ? 789  HIS A CD2 1 
ATOM 6055 C CE1 . HIS A 1 792  ? 2.903   36.348 44.214  1.00 44.79  ? 789  HIS A CE1 1 
ATOM 6056 N NE2 . HIS A 1 792  ? 2.996   36.758 45.466  1.00 44.79  ? 789  HIS A NE2 1 
ATOM 6057 N N   . ASN A 1 793  ? -3.158  37.227 43.701  1.00 44.99  ? 790  ASN A N   1 
ATOM 6058 C CA  . ASN A 1 793  ? -4.517  37.062 43.225  1.00 44.99  ? 790  ASN A CA  1 
ATOM 6059 C C   . ASN A 1 793  ? -4.539  36.605 41.809  1.00 44.99  ? 790  ASN A C   1 
ATOM 6060 O O   . ASN A 1 793  ? -3.605  36.860 41.092  1.00 44.99  ? 790  ASN A O   1 
ATOM 6061 C CB  . ASN A 1 793  ? -5.252  38.388 43.254  1.00 56.03  ? 790  ASN A CB  1 
ATOM 6062 C CG  . ASN A 1 793  ? -5.210  39.031 44.598  1.00 56.03  ? 790  ASN A CG  1 
ATOM 6063 O OD1 . ASN A 1 793  ? -6.176  38.961 45.345  1.00 56.03  ? 790  ASN A OD1 1 
ATOM 6064 N ND2 . ASN A 1 793  ? -4.079  39.648 44.938  1.00 56.03  ? 790  ASN A ND2 1 
ATOM 6065 N N   . LEU A 1 794  ? -5.612  35.918 41.410  1.00 48.18  ? 791  LEU A N   1 
ATOM 6066 C CA  . LEU A 1 794  ? -6.009  35.771 40.015  1.00 48.18  ? 791  LEU A CA  1 
ATOM 6067 C C   . LEU A 1 794  ? -7.024  36.894 39.811  1.00 48.18  ? 791  LEU A C   1 
ATOM 6068 O O   . LEU A 1 794  ? -7.736  37.203 40.715  1.00 48.18  ? 791  LEU A O   1 
ATOM 6069 C CB  . LEU A 1 794  ? -6.669  34.417 39.830  1.00 33.89  ? 791  LEU A CB  1 
ATOM 6070 C CG  . LEU A 1 794  ? -7.267  34.216 38.440  1.00 33.89  ? 791  LEU A CG  1 
ATOM 6071 C CD1 . LEU A 1 794  ? -6.178  34.454 37.299  1.00 33.89  ? 791  LEU A CD1 1 
ATOM 6072 C CD2 . LEU A 1 794  ? -8.015  32.868 38.314  1.00 33.89  ? 791  LEU A CD2 1 
ATOM 6073 N N   . LEU A 1 795  ? -7.060  37.547 38.660  1.00 39.42  ? 792  LEU A N   1 
ATOM 6074 C CA  . LEU A 1 795  ? -7.917  38.720 38.462  1.00 39.42  ? 792  LEU A CA  1 
ATOM 6075 C C   . LEU A 1 795  ? -8.723  38.435 37.241  1.00 39.42  ? 792  LEU A C   1 
ATOM 6076 O O   . LEU A 1 795  ? -8.196  37.895 36.300  1.00 39.42  ? 792  LEU A O   1 
ATOM 6077 C CB  . LEU A 1 795  ? -7.080  39.964 38.255  1.00 33.65  ? 792  LEU A CB  1 
ATOM 6078 C CG  . LEU A 1 795  ? -6.315  40.364 39.521  1.00 33.65  ? 792  LEU A CG  1 
ATOM 6079 C CD1 . LEU A 1 795  ? -5.456  41.602 39.424  1.00 33.65  ? 792  LEU A CD1 1 
ATOM 6080 C CD2 . LEU A 1 795  ? -7.285  40.562 40.608  1.00 33.65  ? 792  LEU A CD2 1 
ATOM 6081 N N   . ILE A 1 796  ? -10.017 38.691 37.222  1.00 38.85  ? 793  ILE A N   1 
ATOM 6082 C CA  . ILE A 1 796  ? -10.652 38.496 35.938  1.00 38.85  ? 793  ILE A CA  1 
ATOM 6083 C C   . ILE A 1 796  ? -10.796 39.860 35.323  1.00 38.85  ? 793  ILE A C   1 
ATOM 6084 O O   . ILE A 1 796  ? -11.387 40.728 35.939  1.00 38.85  ? 793  ILE A O   1 
ATOM 6085 C CB  . ILE A 1 796  ? -11.969 37.666 36.000  1.00 50.24  ? 793  ILE A CB  1 
ATOM 6086 C CG1 . ILE A 1 796  ? -11.688 36.225 36.478  1.00 50.24  ? 793  ILE A CG1 1 
ATOM 6087 C CG2 . ILE A 1 796  ? -12.676 37.579 34.603  1.00 50.24  ? 793  ILE A CG2 1 
ATOM 6088 C CD1 . ILE A 1 796  ? -10.494 35.527 35.816  1.00 50.24  ? 793  ILE A CD1 1 
ATOM 6089 N N   . ILE A 1 797  ? -10.201 40.066 34.156  1.00 41.17  ? 794  ILE A N   1 
ATOM 6090 C CA  . ILE A 1 797  ? -10.247 41.377 33.488  1.00 41.17  ? 794  ILE A CA  1 
ATOM 6091 C C   . ILE A 1 797  ? -11.140 41.352 32.244  1.00 41.17  ? 794  ILE A C   1 
ATOM 6092 O O   . ILE A 1 797  ? -10.903 40.556 31.308  1.00 41.17  ? 794  ILE A O   1 
ATOM 6093 C CB  . ILE A 1 797  ? -8.843  41.926 33.095  1.00 43.16  ? 794  ILE A CB  1 
ATOM 6094 C CG1 . ILE A 1 797  ? -8.139  42.542 34.298  1.00 43.16  ? 794  ILE A CG1 1 
ATOM 6095 C CG2 . ILE A 1 797  ? -8.987  43.031 32.111  1.00 43.16  ? 794  ILE A CG2 1 
ATOM 6096 C CD1 . ILE A 1 797  ? -7.283  41.587 35.022  1.00 43.16  ? 794  ILE A CD1 1 
ATOM 6097 N N   . ASP A 1 798  ? -12.160 42.217 32.225  1.00 37.82  ? 795  ASP A N   1 
ATOM 6098 C CA  . ASP A 1 798  ? -13.003 42.250 31.027  1.00 37.82  ? 795  ASP A CA  1 
ATOM 6099 C C   . ASP A 1 798  ? -12.109 42.674 29.860  1.00 37.82  ? 795  ASP A C   1 
ATOM 6100 O O   . ASP A 1 798  ? -11.335 43.673 29.959  1.00 37.82  ? 795  ASP A O   1 
ATOM 6101 C CB  . ASP A 1 798  ? -14.219 43.183 31.199  1.00 53.75  ? 795  ASP A CB  1 
ATOM 6102 C CG  . ASP A 1 798  ? -15.239 43.066 30.038  1.00 53.75  ? 795  ASP A CG  1 
ATOM 6103 O OD1 . ASP A 1 798  ? -15.218 43.951 29.141  1.00 53.75  ? 795  ASP A OD1 1 
ATOM 6104 O OD2 . ASP A 1 798  ? -16.065 42.112 30.022  1.00 53.75  ? 795  ASP A OD2 1 
ATOM 6105 N N   . GLN A 1 799  ? -12.166 41.915 28.766  1.00 51.48  ? 796  GLN A N   1 
ATOM 6106 C CA  . GLN A 1 799  ? -11.394 42.328 27.585  1.00 51.48  ? 796  GLN A CA  1 
ATOM 6107 C C   . GLN A 1 799  ? -11.886 43.646 26.992  1.00 51.48  ? 796  GLN A C   1 
ATOM 6108 O O   . GLN A 1 799  ? -11.121 44.324 26.314  1.00 51.48  ? 796  GLN A O   1 
ATOM 6109 C CB  . GLN A 1 799  ? -11.330 41.254 26.515  1.00 62.00  ? 796  GLN A CB  1 
ATOM 6110 C CG  . GLN A 1 799  ? -12.399 41.312 25.460  1.00 62.00  ? 796  GLN A CG  1 
ATOM 6111 C CD  . GLN A 1 799  ? -12.328 40.108 24.514  1.00 62.00  ? 796  GLN A CD  1 
ATOM 6112 O OE1 . GLN A 1 799  ? -12.136 40.266 23.311  1.00 62.00  ? 796  GLN A OE1 1 
ATOM 6113 N NE2 . GLN A 1 799  ? -12.464 38.907 25.059  1.00 62.00  ? 796  GLN A NE2 1 
ATOM 6114 N N   . HIS A 1 800  ? -13.136 44.032 27.231  1.00 53.44  ? 797  HIS A N   1 
ATOM 6115 C CA  . HIS A 1 800  ? -13.649 45.191 26.527  1.00 53.44  ? 797  HIS A CA  1 
ATOM 6116 C C   . HIS A 1 800  ? -13.395 46.418 27.360  1.00 53.44  ? 797  HIS A C   1 
ATOM 6117 O O   . HIS A 1 800  ? -13.011 47.483 26.877  1.00 53.44  ? 797  HIS A O   1 
ATOM 6118 C CB  . HIS A 1 800  ? -15.132 45.032 26.236  1.00 55.79  ? 797  HIS A CB  1 
ATOM 6119 C CG  . HIS A 1 800  ? -15.438 43.899 25.327  1.00 55.79  ? 797  HIS A CG  1 
ATOM 6120 N ND1 . HIS A 1 800  ? -15.478 44.041 23.961  1.00 55.79  ? 797  HIS A ND1 1 
ATOM 6121 C CD2 . HIS A 1 800  ? -15.685 42.593 25.579  1.00 55.79  ? 797  HIS A CD2 1 
ATOM 6122 C CE1 . HIS A 1 800  ? -15.753 42.872 23.404  1.00 55.79  ? 797  HIS A CE1 1 
ATOM 6123 N NE2 . HIS A 1 800  ? -15.877 41.974 24.363  1.00 55.79  ? 797  HIS A NE2 1 
ATOM 6124 N N   . THR A 1 801  ? -13.581 46.252 28.639  1.00 51.10  ? 798  THR A N   1 
ATOM 6125 C CA  . THR A 1 801  ? -13.655 47.394 29.502  1.00 51.10  ? 798  THR A CA  1 
ATOM 6126 C C   . THR A 1 801  ? -12.386 47.536 30.367  1.00 51.10  ? 798  THR A C   1 
ATOM 6127 O O   . THR A 1 801  ? -12.076 48.610 30.867  1.00 51.10  ? 798  THR A O   1 
ATOM 6128 C CB  . THR A 1 801  ? -15.013 47.301 30.296  1.00 49.19  ? 798  THR A CB  1 
ATOM 6129 O OG1 . THR A 1 801  ? -15.022 46.159 31.188  1.00 49.19  ? 798  THR A OG1 1 
ATOM 6130 C CG2 . THR A 1 801  ? -16.160 47.145 29.273  1.00 49.19  ? 798  THR A CG2 1 
ATOM 6131 N N   . PHE A 1 802  ? -11.663 46.423 30.508  1.00 52.09  ? 799  PHE A N   1 
ATOM 6132 C CA  . PHE A 1 802  ? -10.474 46.293 31.360  1.00 52.09  ? 799  PHE A CA  1 
ATOM 6133 C C   . PHE A 1 802  ? -10.780 46.680 32.801  1.00 52.09  ? 799  PHE A C   1 
ATOM 6134 O O   . PHE A 1 802  ? -10.025 47.352 33.507  1.00 52.09  ? 799  PHE A O   1 
ATOM 6135 C CB  . PHE A 1 802  ? -9.242  46.935 30.703  1.00 48.86  ? 799  PHE A CB  1 
ATOM 6136 C CG  . PHE A 1 802  ? -8.703  46.113 29.533  1.00 48.86  ? 799  PHE A CG  1 
ATOM 6137 C CD1 . PHE A 1 802  ? -9.124  46.362 28.225  1.00 48.86  ? 799  PHE A CD1 1 
ATOM 6138 C CD2 . PHE A 1 802  ? -7.828  45.058 29.751  1.00 48.86  ? 799  PHE A CD2 1 
ATOM 6139 C CE1 . PHE A 1 802  ? -8.675  45.596 27.165  1.00 48.86  ? 799  PHE A CE1 1 
ATOM 6140 C CE2 . PHE A 1 802  ? -7.390  44.275 28.690  1.00 48.86  ? 799  PHE A CE2 1 
ATOM 6141 C CZ  . PHE A 1 802  ? -7.816  44.547 27.390  1.00 48.86  ? 799  PHE A CZ  1 
ATOM 6142 N N   . GLU A 1 803  ? -11.975 46.239 33.196  1.00 59.62  ? 800  GLU A N   1 
ATOM 6143 C CA  . GLU A 1 803  ? -12.450 46.294 34.567  1.00 59.62  ? 800  GLU A CA  1 
ATOM 6144 C C   . GLU A 1 803  ? -12.029 44.977 35.184  1.00 59.62  ? 800  GLU A C   1 
ATOM 6145 O O   . GLU A 1 803  ? -12.027 43.919 34.535  1.00 59.62  ? 800  GLU A O   1 
ATOM 6146 C CB  . GLU A 1 803  ? -13.982 46.404 34.619  1.00 106.78 ? 800  GLU A CB  1 
ATOM 6147 C CG  . GLU A 1 803  ? -14.605 47.634 33.940  1.00 106.78 ? 800  GLU A CG  1 
ATOM 6148 C CD  . GLU A 1 803  ? -16.156 47.660 34.000  1.00 106.78 ? 800  GLU A CD  1 
ATOM 6149 O OE1 . GLU A 1 803  ? -16.711 48.749 34.303  1.00 106.78 ? 800  GLU A OE1 1 
ATOM 6150 O OE2 . GLU A 1 803  ? -16.816 46.613 33.742  1.00 106.78 ? 800  GLU A OE2 1 
ATOM 6151 N N   . VAL A 1 804  ? -11.657 45.056 36.446  1.00 44.51  ? 801  VAL A N   1 
ATOM 6152 C CA  . VAL A 1 804  ? -11.431 43.882 37.262  1.00 44.51  ? 801  VAL A CA  1 
ATOM 6153 C C   . VAL A 1 804  ? -12.784 43.182 37.640  1.00 44.51  ? 801  VAL A C   1 
ATOM 6154 O O   . VAL A 1 804  ? -13.299 43.348 38.733  1.00 44.51  ? 801  VAL A O   1 
ATOM 6155 C CB  . VAL A 1 804  ? -10.637 44.300 38.513  1.00 40.60  ? 801  VAL A CB  1 
ATOM 6156 C CG1 . VAL A 1 804  ? -10.112 43.053 39.277  1.00 40.60  ? 801  VAL A CG1 1 
ATOM 6157 C CG2 . VAL A 1 804  ? -9.520  45.248 38.133  1.00 40.60  ? 801  VAL A CG2 1 
ATOM 6158 N N   . LEU A 1 805  ? -13.348 42.425 36.701  1.00 52.13  ? 802  LEU A N   1 
ATOM 6159 C CA  . LEU A 1 805  ? -14.584 41.709 36.918  1.00 52.13  ? 802  LEU A CA  1 
ATOM 6160 C C   . LEU A 1 805  ? -14.580 41.048 38.317  1.00 52.13  ? 802  LEU A C   1 
ATOM 6161 O O   . LEU A 1 805  ? -15.394 41.395 39.200  1.00 52.13  ? 802  LEU A O   1 
ATOM 6162 C CB  . LEU A 1 805  ? -14.806 40.681 35.813  1.00 50.85  ? 802  LEU A CB  1 
ATOM 6163 C CG  . LEU A 1 805  ? -15.128 41.050 34.335  1.00 50.85  ? 802  LEU A CG  1 
ATOM 6164 C CD1 . LEU A 1 805  ? -15.496 39.788 33.516  1.00 50.85  ? 802  LEU A CD1 1 
ATOM 6165 C CD2 . LEU A 1 805  ? -16.213 42.132 34.101  1.00 50.85  ? 802  LEU A CD2 1 
ATOM 6166 N N   . HIS A 1 806  ? -13.618 40.152 38.545  1.00 62.49  ? 803  HIS A N   1 
ATOM 6167 C CA  . HIS A 1 806  ? -13.515 39.405 39.799  1.00 62.49  ? 803  HIS A CA  1 
ATOM 6168 C C   . HIS A 1 806  ? -12.049 39.345 40.309  1.00 62.49  ? 803  HIS A C   1 
ATOM 6169 O O   . HIS A 1 806  ? -11.110 39.361 39.510  1.00 62.49  ? 803  HIS A O   1 
ATOM 6170 C CB  . HIS A 1 806  ? -14.120 38.004 39.561  1.00 54.03  ? 803  HIS A CB  1 
ATOM 6171 C CG  . HIS A 1 806  ? -14.014 37.091 40.740  1.00 54.03  ? 803  HIS A CG  1 
ATOM 6172 N ND1 . HIS A 1 806  ? -14.145 37.530 42.044  1.00 54.03  ? 803  HIS A ND1 1 
ATOM 6173 C CD2 . HIS A 1 806  ? -13.771 35.762 40.817  1.00 54.03  ? 803  HIS A CD2 1 
ATOM 6174 C CE1 . HIS A 1 806  ? -13.965 36.515 42.872  1.00 54.03  ? 803  HIS A CE1 1 
ATOM 6175 N NE2 . HIS A 1 806  ? -13.736 35.430 42.153  1.00 54.03  ? 803  HIS A NE2 1 
ATOM 6176 N N   . ALA A 1 807  ? -11.856 39.296 41.627  1.00 65.69  ? 804  ALA A N   1 
ATOM 6177 C CA  . ALA A 1 807  ? -10.535 38.941 42.227  1.00 65.69  ? 804  ALA A CA  1 
ATOM 6178 C C   . ALA A 1 807  ? -10.586 37.686 43.117  1.00 65.69  ? 804  ALA A C   1 
ATOM 6179 O O   . ALA A 1 807  ? -11.372 37.628 44.069  1.00 65.69  ? 804  ALA A O   1 
ATOM 6180 C CB  . ALA A 1 807  ? -9.915  40.131 43.044  1.00 40.81  ? 804  ALA A CB  1 
ATOM 6181 N N   . HIS A 1 808  ? -9.742  36.691 42.823  1.00 46.06  ? 805  HIS A N   1 
ATOM 6182 C CA  . HIS A 1 808  ? -9.548  35.599 43.759  1.00 46.06  ? 805  HIS A CA  1 
ATOM 6183 C C   . HIS A 1 808  ? -8.284  35.748 44.619  1.00 46.06  ? 805  HIS A C   1 
ATOM 6184 O O   . HIS A 1 808  ? -7.185  35.702 44.097  1.00 46.06  ? 805  HIS A O   1 
ATOM 6185 C CB  . HIS A 1 808  ? -9.555  34.255 43.075  1.00 77.35  ? 805  HIS A CB  1 
ATOM 6186 C CG  . HIS A 1 808  ? -9.382  33.134 44.037  1.00 77.35  ? 805  HIS A CG  1 
ATOM 6187 N ND1 . HIS A 1 808  ? -10.312 32.858 45.013  1.00 77.35  ? 805  HIS A ND1 1 
ATOM 6188 C CD2 . HIS A 1 808  ? -8.359  32.272 44.233  1.00 77.35  ? 805  HIS A CD2 1 
ATOM 6189 C CE1 . HIS A 1 808  ? -9.891  31.844 45.743  1.00 77.35  ? 805  HIS A CE1 1 
ATOM 6190 N NE2 . HIS A 1 808  ? -8.706  31.472 45.295  1.00 77.35  ? 805  HIS A NE2 1 
ATOM 6191 N N   . GLN A 1 809  ? -8.427  35.923 45.925  1.00 60.26  ? 806  GLN A N   1 
ATOM 6192 C CA  . GLN A 1 809  ? -7.246  35.983 46.779  1.00 60.26  ? 806  GLN A CA  1 
ATOM 6193 C C   . GLN A 1 809  ? -6.757  34.600 47.199  1.00 60.26  ? 806  GLN A C   1 
ATOM 6194 O O   . GLN A 1 809  ? -7.547  33.703 47.527  1.00 60.26  ? 806  GLN A O   1 
ATOM 6195 C CB  . GLN A 1 809  ? -7.483  36.829 48.014  1.00 46.30  ? 806  GLN A CB  1 
ATOM 6196 C CG  . GLN A 1 809  ? -6.228  36.995 48.799  1.00 46.30  ? 806  GLN A CG  1 
ATOM 6197 C CD  . GLN A 1 809  ? -6.351  37.982 49.929  1.00 46.30  ? 806  GLN A CD  1 
ATOM 6198 O OE1 . GLN A 1 809  ? -6.912  39.066 49.789  1.00 46.30  ? 806  GLN A OE1 1 
ATOM 6199 N NE2 . GLN A 1 809  ? -5.772  37.633 51.053  1.00 46.30  ? 806  GLN A NE2 1 
ATOM 6200 N N   . PHE A 1 810  ? -5.445  34.422 47.197  1.00 47.57  ? 807  PHE A N   1 
ATOM 6201 C CA  . PHE A 1 810  ? -4.879  33.114 47.424  1.00 47.57  ? 807  PHE A CA  1 
ATOM 6202 C C   . PHE A 1 810  ? -4.566  33.028 48.878  1.00 47.57  ? 807  PHE A C   1 
ATOM 6203 O O   . PHE A 1 810  ? -4.838  33.992 49.597  1.00 47.57  ? 807  PHE A O   1 
ATOM 6204 C CB  . PHE A 1 810  ? -3.646  32.919 46.561  1.00 33.88  ? 807  PHE A CB  1 
ATOM 6205 C CG  . PHE A 1 810  ? -3.959  32.601 45.132  1.00 33.88  ? 807  PHE A CG  1 
ATOM 6206 C CD1 . PHE A 1 810  ? -3.861  33.560 44.161  1.00 33.88  ? 807  PHE A CD1 1 
ATOM 6207 C CD2 . PHE A 1 810  ? -4.368  31.359 44.769  1.00 33.88  ? 807  PHE A CD2 1 
ATOM 6208 C CE1 . PHE A 1 810  ? -4.144  33.276 42.833  1.00 33.88  ? 807  PHE A CE1 1 
ATOM 6209 C CE2 . PHE A 1 810  ? -4.686  31.073 43.424  1.00 33.88  ? 807  PHE A CE2 1 
ATOM 6210 C CZ  . PHE A 1 810  ? -4.559  32.034 42.458  1.00 33.88  ? 807  PHE A CZ  1 
ATOM 6211 N N   . LEU A 1 811  ? -4.010  31.890 49.322  1.00 40.99  ? 808  LEU A N   1 
ATOM 6212 C CA  . LEU A 1 811  ? -3.835  31.660 50.755  1.00 40.99  ? 808  LEU A CA  1 
ATOM 6213 C C   . LEU A 1 811  ? -2.777  32.582 51.305  1.00 40.99  ? 808  LEU A C   1 
ATOM 6214 O O   . LEU A 1 811  ? -2.000  33.133 50.558  1.00 40.99  ? 808  LEU A O   1 
ATOM 6215 C CB  . LEU A 1 811  ? -3.491  30.214 51.082  1.00 70.87  ? 808  LEU A CB  1 
ATOM 6216 C CG  . LEU A 1 811  ? -4.446  29.128 50.602  1.00 70.87  ? 808  LEU A CG  1 
ATOM 6217 C CD1 . LEU A 1 811  ? -3.711  27.805 50.680  1.00 70.87  ? 808  LEU A CD1 1 
ATOM 6218 C CD2 . LEU A 1 811  ? -5.734  29.096 51.389  1.00 70.87  ? 808  LEU A CD2 1 
ATOM 6219 N N   . GLN A 1 812  ? -2.759  32.763 52.618  1.00 65.95  ? 809  GLN A N   1 
ATOM 6220 C CA  . GLN A 1 812  ? -1.634  33.404 53.235  1.00 65.95  ? 809  GLN A CA  1 
ATOM 6221 C C   . GLN A 1 812  ? -0.375  32.713 52.726  1.00 65.95  ? 809  GLN A C   1 
ATOM 6222 O O   . GLN A 1 812  ? -0.295  31.494 52.705  1.00 65.95  ? 809  GLN A O   1 
ATOM 6223 C CB  . GLN A 1 812  ? -1.732  33.273 54.730  1.00 80.41  ? 809  GLN A CB  1 
ATOM 6224 C CG  . GLN A 1 812  ? -1.067  34.397 55.460  1.00 80.41  ? 809  GLN A CG  1 
ATOM 6225 C CD  . GLN A 1 812  ? -1.703  34.648 56.802  1.00 80.41  ? 809  GLN A CD  1 
ATOM 6226 O OE1 . GLN A 1 812  ? -1.068  35.200 57.695  1.00 80.41  ? 809  GLN A OE1 1 
ATOM 6227 N NE2 . GLN A 1 812  ? -2.969  34.244 56.956  1.00 80.41  ? 809  GLN A NE2 1 
ATOM 6228 N N   . ASN A 1 813  ? 0.576   33.510 52.254  1.00 60.07  ? 810  ASN A N   1 
ATOM 6229 C CA  . ASN A 1 813  ? 1.900   33.043 51.797  1.00 60.07  ? 810  ASN A CA  1 
ATOM 6230 C C   . ASN A 1 813  ? 1.929   32.115 50.616  1.00 60.07  ? 810  ASN A C   1 
ATOM 6231 O O   . ASN A 1 813  ? 2.946   31.470 50.351  1.00 60.07  ? 810  ASN A O   1 
ATOM 6232 C CB  . ASN A 1 813  ? 2.701   32.468 52.952  1.00 55.34  ? 810  ASN A CB  1 
ATOM 6233 C CG  . ASN A 1 813  ? 3.004   33.510 53.981  1.00 55.34  ? 810  ASN A CG  1 
ATOM 6234 O OD1 . ASN A 1 813  ? 3.459   34.613 53.635  1.00 55.34  ? 810  ASN A OD1 1 
ATOM 6235 N ND2 . ASN A 1 813  ? 2.718   33.202 55.253  1.00 55.34  ? 810  ASN A ND2 1 
ATOM 6236 N N   . GLU A 1 814  ? 0.823   32.066 49.901  1.00 58.57  ? 811  GLU A N   1 
ATOM 6237 C CA  . GLU A 1 814  ? 0.778   31.340 48.662  1.00 58.57  ? 811  GLU A CA  1 
ATOM 6238 C C   . GLU A 1 814  ? 0.999   32.246 47.446  1.00 58.57  ? 811  GLU A C   1 
ATOM 6239 O O   . GLU A 1 814  ? 0.401   33.332 47.335  1.00 58.57  ? 811  GLU A O   1 
ATOM 6240 C CB  . GLU A 1 814  ? -0.554  30.682 48.523  1.00 37.88  ? 811  GLU A CB  1 
ATOM 6241 C CG  . GLU A 1 814  ? -0.730  30.005 47.231  1.00 37.88  ? 811  GLU A CG  1 
ATOM 6242 C CD  . GLU A 1 814  ? -2.017  29.322 47.287  1.00 37.88  ? 811  GLU A CD  1 
ATOM 6243 O OE1 . GLU A 1 814  ? -2.774  29.851 48.101  1.00 37.88  ? 811  GLU A OE1 1 
ATOM 6244 O OE2 . GLU A 1 814  ? -2.281  28.308 46.623  1.00 37.88  ? 811  GLU A OE2 1 
ATOM 6245 N N   . TYR A 1 815  ? 1.829   31.743 46.526  1.00 59.84  ? 812  TYR A N   1 
ATOM 6246 C CA  . TYR A 1 815  ? 2.258   32.430 45.333  1.00 59.84  ? 812  TYR A CA  1 
ATOM 6247 C C   . TYR A 1 815  ? 1.725   31.807 44.132  1.00 59.84  ? 812  TYR A C   1 
ATOM 6248 O O   . TYR A 1 815  ? 2.045   30.648 43.848  1.00 59.84  ? 812  TYR A O   1 
ATOM 6249 C CB  . TYR A 1 815  ? 3.743   32.283 45.215  1.00 34.52  ? 812  TYR A CB  1 
ATOM 6250 C CG  . TYR A 1 815  ? 4.331   33.289 46.101  1.00 34.52  ? 812  TYR A CG  1 
ATOM 6251 C CD1 . TYR A 1 815  ? 5.376   34.135 45.667  1.00 34.52  ? 812  TYR A CD1 1 
ATOM 6252 C CD2 . TYR A 1 815  ? 3.766   33.461 47.384  1.00 34.52  ? 812  TYR A CD2 1 
ATOM 6253 C CE1 . TYR A 1 815  ? 5.870   35.112 46.486  1.00 34.52  ? 812  TYR A CE1 1 
ATOM 6254 C CE2 . TYR A 1 815  ? 4.237   34.399 48.232  1.00 34.52  ? 812  TYR A CE2 1 
ATOM 6255 C CZ  . TYR A 1 815  ? 5.290   35.243 47.758  1.00 34.52  ? 812  TYR A CZ  1 
ATOM 6256 O OH  . TYR A 1 815  ? 5.702   36.214 48.653  1.00 34.52  ? 812  TYR A OH  1 
ATOM 6257 N N   . ALA A 1 816  ? 0.955   32.583 43.383  1.00 40.96  ? 813  ALA A N   1 
ATOM 6258 C CA  . ALA A 1 816  ? 0.556   32.117 42.090  1.00 40.96  ? 813  ALA A CA  1 
ATOM 6259 C C   . ALA A 1 816  ? 1.779   32.383 41.191  1.00 40.96  ? 813  ALA A C   1 
ATOM 6260 O O   . ALA A 1 816  ? 2.435   33.430 41.307  1.00 40.96  ? 813  ALA A O   1 
ATOM 6261 C CB  . ALA A 1 816  ? -0.633  32.895 41.667  1.00 35.95  ? 813  ALA A CB  1 
ATOM 6262 N N   . LEU A 1 817  ? 2.184   31.414 40.388  1.00 41.66  ? 814  LEU A N   1 
ATOM 6263 C CA  . LEU A 1 817  ? 3.410   31.615 39.603  1.00 41.66  ? 814  LEU A CA  1 
ATOM 6264 C C   . LEU A 1 817  ? 3.218   31.242 38.153  1.00 41.66  ? 814  LEU A C   1 
ATOM 6265 O O   . LEU A 1 817  ? 3.995   31.688 37.292  1.00 41.66  ? 814  LEU A O   1 
ATOM 6266 C CB  . LEU A 1 817  ? 4.549   30.781 40.150  1.00 28.40  ? 814  LEU A CB  1 
ATOM 6267 C CG  . LEU A 1 817  ? 4.955   30.752 41.631  1.00 28.40  ? 814  LEU A CG  1 
ATOM 6268 C CD1 . LEU A 1 817  ? 5.977   29.674 41.761  1.00 28.40  ? 814  LEU A CD1 1 
ATOM 6269 C CD2 . LEU A 1 817  ? 5.455   32.061 42.145  1.00 28.40  ? 814  LEU A CD2 1 
ATOM 6270 N N   . SER A 1 818  ? 2.194   30.440 37.880  1.00 45.13  ? 815  SER A N   1 
ATOM 6271 C CA  . SER A 1 818  ? 1.916   29.992 36.546  1.00 45.13  ? 815  SER A CA  1 
ATOM 6272 C C   . SER A 1 818  ? 0.436   30.081 36.205  1.00 45.13  ? 815  SER A C   1 
ATOM 6273 O O   . SER A 1 818  ? -0.409  29.754 37.040  1.00 45.13  ? 815  SER A O   1 
ATOM 6274 C CB  . SER A 1 818  ? 2.354   28.552 36.476  1.00 35.37  ? 815  SER A CB  1 
ATOM 6275 O OG  . SER A 1 818  ? 2.817   28.218 37.771  1.00 35.37  ? 815  SER A OG  1 
ATOM 6276 N N   . LEU A 1 819  ? 0.110   30.465 34.972  1.00 30.74  ? 816  LEU A N   1 
ATOM 6277 C CA  . LEU A 1 819  ? -1.287  30.604 34.653  1.00 30.74  ? 816  LEU A CA  1 
ATOM 6278 C C   . LEU A 1 819  ? -1.715  30.057 33.321  1.00 30.74  ? 816  LEU A C   1 
ATOM 6279 O O   . LEU A 1 819  ? -1.270  30.531 32.315  1.00 30.74  ? 816  LEU A O   1 
ATOM 6280 C CB  . LEU A 1 819  ? -1.653  32.069 34.720  1.00 40.70  ? 816  LEU A CB  1 
ATOM 6281 C CG  . LEU A 1 819  ? -3.111  32.383 34.461  1.00 40.70  ? 816  LEU A CG  1 
ATOM 6282 C CD1 . LEU A 1 819  ? -3.915  31.963 35.645  1.00 40.70  ? 816  LEU A CD1 1 
ATOM 6283 C CD2 . LEU A 1 819  ? -3.269  33.887 34.208  1.00 40.70  ? 816  LEU A CD2 1 
ATOM 6284 N N   . VAL A 1 820  ? -2.598  29.078 33.265  1.00 52.32  ? 817  VAL A N   1 
ATOM 6285 C CA  . VAL A 1 820  ? -3.116  28.701 31.945  1.00 52.32  ? 817  VAL A CA  1 
ATOM 6286 C C   . VAL A 1 820  ? -4.604  28.923 31.857  1.00 52.32  ? 817  VAL A C   1 
ATOM 6287 O O   . VAL A 1 820  ? -5.298  29.127 32.850  1.00 52.32  ? 817  VAL A O   1 
ATOM 6288 C CB  . VAL A 1 820  ? -2.783  27.260 31.509  1.00 56.83  ? 817  VAL A CB  1 
ATOM 6289 C CG1 . VAL A 1 820  ? -1.353  26.948 31.769  1.00 56.83  ? 817  VAL A CG1 1 
ATOM 6290 C CG2 . VAL A 1 820  ? -3.639  26.280 32.254  1.00 56.83  ? 817  VAL A CG2 1 
ATOM 6291 N N   . SER A 1 821  ? -5.081  28.894 30.635  1.00 45.65  ? 818  SER A N   1 
ATOM 6292 C CA  . SER A 1 821  ? -6.480  28.917 30.386  1.00 45.65  ? 818  SER A CA  1 
ATOM 6293 C C   . SER A 1 821  ? -6.673  27.869 29.310  1.00 45.65  ? 818  SER A C   1 
ATOM 6294 O O   . SER A 1 821  ? -6.225  28.028 28.181  1.00 45.65  ? 818  SER A O   1 
ATOM 6295 C CB  . SER A 1 821  ? -6.886  30.291 29.919  1.00 41.57  ? 818  SER A CB  1 
ATOM 6296 O OG  . SER A 1 821  ? -8.190  30.262 29.379  1.00 41.57  ? 818  SER A OG  1 
ATOM 6297 N N   . CYS A 1 822  ? -7.284  26.759 29.671  1.00 66.95  ? 819  CYS A N   1 
ATOM 6298 C CA  . CYS A 1 822  ? -7.437  25.716 28.700  1.00 66.95  ? 819  CYS A CA  1 
ATOM 6299 C C   . CYS A 1 822  ? -8.653  24.851 28.988  1.00 66.95  ? 819  CYS A C   1 
ATOM 6300 O O   . CYS A 1 822  ? -9.243  24.944 30.074  1.00 66.95  ? 819  CYS A O   1 
ATOM 6301 C CB  . CYS A 1 822  ? -6.154  24.883 28.637  1.00 49.42  ? 819  CYS A CB  1 
ATOM 6302 S SG  . CYS A 1 822  ? -5.644  24.127 30.230  1.00 49.42  ? 819  CYS A SG  1 
ATOM 6303 N N   . LYS A 1 823  ? -9.030  24.055 27.984  1.00 64.35  ? 820  LYS A N   1 
ATOM 6304 C CA  . LYS A 1 823  ? -9.920  22.912 28.145  1.00 64.35  ? 820  LYS A CA  1 
ATOM 6305 C C   . LYS A 1 823  ? -9.063  21.734 28.480  1.00 64.35  ? 820  LYS A C   1 
ATOM 6306 O O   . LYS A 1 823  ? -7.979  21.579 27.920  1.00 64.35  ? 820  LYS A O   1 
ATOM 6307 C CB  . LYS A 1 823  ? -10.659 22.609 26.848  1.00 60.97  ? 820  LYS A CB  1 
ATOM 6308 C CG  . LYS A 1 823  ? -12.071 23.204 26.801  1.00 60.97  ? 820  LYS A CG  1 
ATOM 6309 C CD  . LYS A 1 823  ? -12.478 23.676 25.412  1.00 60.97  ? 820  LYS A CD  1 
ATOM 6310 C CE  . LYS A 1 823  ? -13.015 22.551 24.574  1.00 60.97  ? 820  LYS A CE  1 
ATOM 6311 N NZ  . LYS A 1 823  ? -13.396 23.072 23.230  1.00 60.97  ? 820  LYS A NZ  1 
ATOM 6312 N N   . LEU A 1 824  ? -9.540  20.898 29.391  1.00 75.88  ? 821  LEU A N   1 
ATOM 6313 C CA  . LEU A 1 824  ? -8.788  19.709 29.776  1.00 75.88  ? 821  LEU A CA  1 
ATOM 6314 C C   . LEU A 1 824  ? -9.553  18.407 29.524  1.00 75.88  ? 821  LEU A C   1 
ATOM 6315 O O   . LEU A 1 824  ? -10.764 18.339 29.746  1.00 75.88  ? 821  LEU A O   1 
ATOM 6316 C CB  . LEU A 1 824  ? -8.328  19.825 31.225  1.00 64.60  ? 821  LEU A CB  1 
ATOM 6317 C CG  . LEU A 1 824  ? -7.039  20.625 31.445  1.00 64.60  ? 821  LEU A CG  1 
ATOM 6318 C CD1 . LEU A 1 824  ? -6.488  20.364 32.819  1.00 64.60  ? 821  LEU A CD1 1 
ATOM 6319 C CD2 . LEU A 1 824  ? -5.982  20.276 30.396  1.00 64.60  ? 821  LEU A CD2 1 
ATOM 6320 N N   . GLY A 1 825  ? -8.838  17.392 29.033  1.00 74.33  ? 822  GLY A N   1 
ATOM 6321 C CA  . GLY A 1 825  ? -9.427  16.097 28.638  1.00 74.33  ? 822  GLY A CA  1 
ATOM 6322 C C   . GLY A 1 825  ? -10.684 16.185 27.769  1.00 74.33  ? 822  GLY A C   1 
ATOM 6323 O O   . GLY A 1 825  ? -10.844 17.139 26.980  1.00 74.33  ? 822  GLY A O   1 
ATOM 6324 N N   . LYS A 1 826  ? -11.575 15.191 27.929  1.00 82.26  ? 823  LYS A N   1 
ATOM 6325 C CA  . LYS A 1 826  ? -12.893 15.133 27.249  1.00 82.26  ? 823  LYS A CA  1 
ATOM 6326 C C   . LYS A 1 826  ? -13.842 16.304 27.624  1.00 82.26  ? 823  LYS A C   1 
ATOM 6327 O O   . LYS A 1 826  ? -14.632 16.800 26.800  1.00 82.26  ? 823  LYS A O   1 
ATOM 6328 C CB  . LYS A 1 826  ? -13.568 13.775 27.522  1.00 102.82 ? 823  LYS A CB  1 
ATOM 6329 C CG  . LYS A 1 826  ? -13.357 12.690 26.423  1.00 102.82 ? 823  LYS A CG  1 
ATOM 6330 C CD  . LYS A 1 826  ? -12.134 11.772 26.658  1.00 102.82 ? 823  LYS A CD  1 
ATOM 6331 C CE  . LYS A 1 826  ? -12.429 10.647 27.671  1.00 102.82 ? 823  LYS A CE  1 
ATOM 6332 N NZ  . LYS A 1 826  ? -11.377 9.583  27.718  1.00 102.82 ? 823  LYS A NZ  1 
ATOM 6333 N N   . ASP A 1 827  ? -13.733 16.711 28.885  1.00 66.02  ? 824  ASP A N   1 
ATOM 6334 C CA  . ASP A 1 827  ? -14.373 17.889 29.485  1.00 66.02  ? 824  ASP A CA  1 
ATOM 6335 C C   . ASP A 1 827  ? -14.407 19.136 28.584  1.00 66.02  ? 824  ASP A C   1 
ATOM 6336 O O   . ASP A 1 827  ? -13.365 19.777 28.330  1.00 66.02  ? 824  ASP A O   1 
ATOM 6337 C CB  . ASP A 1 827  ? -13.651 18.174 30.819  1.00 62.43  ? 824  ASP A CB  1 
ATOM 6338 C CG  . ASP A 1 827  ? -14.192 19.373 31.559  1.00 62.43  ? 824  ASP A CG  1 
ATOM 6339 O OD1 . ASP A 1 827  ? -14.924 20.203 30.938  1.00 62.43  ? 824  ASP A OD1 1 
ATOM 6340 O OD2 . ASP A 1 827  ? -13.855 19.472 32.774  1.00 62.43  ? 824  ASP A OD2 1 
ATOM 6341 N N   . PRO A 1 828  ? -15.627 19.510 28.131  1.00 81.80  ? 825  PRO A N   1 
ATOM 6342 C CA  . PRO A 1 828  ? -15.813 20.591 27.164  1.00 81.80  ? 825  PRO A CA  1 
ATOM 6343 C C   . PRO A 1 828  ? -15.862 21.957 27.868  1.00 81.80  ? 825  PRO A C   1 
ATOM 6344 O O   . PRO A 1 828  ? -16.485 22.907 27.365  1.00 81.80  ? 825  PRO A O   1 
ATOM 6345 C CB  . PRO A 1 828  ? -17.163 20.246 26.528  1.00 121.81 ? 825  PRO A CB  1 
ATOM 6346 C CG  . PRO A 1 828  ? -17.923 19.590 27.618  1.00 121.81 ? 825  PRO A CG  1 
ATOM 6347 C CD  . PRO A 1 828  ? -16.922 18.941 28.555  1.00 121.81 ? 825  PRO A CD  1 
ATOM 6348 N N   . ASN A 1 829  ? -15.221 22.041 29.030  1.00 99.09  ? 826  ASN A N   1 
ATOM 6349 C CA  . ASN A 1 829  ? -15.174 23.282 29.778  1.00 99.09  ? 826  ASN A CA  1 
ATOM 6350 C C   . ASN A 1 829  ? -13.787 23.898 29.799  1.00 99.09  ? 826  ASN A C   1 
ATOM 6351 O O   . ASN A 1 829  ? -12.797 23.184 29.659  1.00 99.09  ? 826  ASN A O   1 
ATOM 6352 C CB  . ASN A 1 829  ? -15.697 23.063 31.186  1.00 65.02  ? 826  ASN A CB  1 
ATOM 6353 C CG  . ASN A 1 829  ? -17.052 23.657 31.374  1.00 65.02  ? 826  ASN A CG  1 
ATOM 6354 O OD1 . ASN A 1 829  ? -17.736 23.991 30.403  1.00 65.02  ? 826  ASN A OD1 1 
ATOM 6355 N ND2 . ASN A 1 829  ? -17.456 23.806 32.623  1.00 65.02  ? 826  ASN A ND2 1 
ATOM 6356 N N   . THR A 1 830  ? -13.716 25.216 29.969  1.00 67.27  ? 827  THR A N   1 
ATOM 6357 C CA  . THR A 1 830  ? -12.445 25.917 29.870  1.00 67.27  ? 827  THR A CA  1 
ATOM 6358 C C   . THR A 1 830  ? -12.018 26.572 31.170  1.00 67.27  ? 827  THR A C   1 
ATOM 6359 O O   . THR A 1 830  ? -12.710 27.457 31.711  1.00 67.27  ? 827  THR A O   1 
ATOM 6360 C CB  . THR A 1 830  ? -12.455 26.971 28.764  1.00 64.86  ? 827  THR A CB  1 
ATOM 6361 O OG1 . THR A 1 830  ? -12.697 26.332 27.500  1.00 64.86  ? 827  THR A OG1 1 
ATOM 6362 C CG2 . THR A 1 830  ? -11.105 27.703 28.737  1.00 64.86  ? 827  THR A CG2 1 
ATOM 6363 N N   . TYR A 1 831  ? -10.849 26.158 31.649  1.00 46.83  ? 828  TYR A N   1 
ATOM 6364 C CA  . TYR A 1 831  ? -10.420 26.542 32.989  1.00 46.83  ? 828  TYR A CA  1 
ATOM 6365 C C   . TYR A 1 831  ? -9.306  27.634 33.024  1.00 46.83  ? 828  TYR A C   1 
ATOM 6366 O O   . TYR A 1 831  ? -8.667  27.939 32.008  1.00 46.83  ? 828  TYR A O   1 
ATOM 6367 C CB  . TYR A 1 831  ? -10.043 25.274 33.763  1.00 74.87  ? 828  TYR A CB  1 
ATOM 6368 C CG  . TYR A 1 831  ? -11.174 24.265 33.797  1.00 74.87  ? 828  TYR A CG  1 
ATOM 6369 C CD1 . TYR A 1 831  ? -11.398 23.401 32.725  1.00 74.87  ? 828  TYR A CD1 1 
ATOM 6370 C CD2 . TYR A 1 831  ? -12.044 24.195 34.887  1.00 74.87  ? 828  TYR A CD2 1 
ATOM 6371 C CE1 . TYR A 1 831  ? -12.446 22.476 32.735  1.00 74.87  ? 828  TYR A CE1 1 
ATOM 6372 C CE2 . TYR A 1 831  ? -13.102 23.268 34.916  1.00 74.87  ? 828  TYR A CE2 1 
ATOM 6373 C CZ  . TYR A 1 831  ? -13.302 22.413 33.833  1.00 74.87  ? 828  TYR A CZ  1 
ATOM 6374 O OH  . TYR A 1 831  ? -14.347 21.500 33.846  1.00 74.87  ? 828  TYR A OH  1 
ATOM 6375 N N   . PHE A 1 832  ? -9.156  28.261 34.182  1.00 43.98  ? 829  PHE A N   1 
ATOM 6376 C CA  . PHE A 1 832  ? -8.022  29.066 34.494  1.00 43.98  ? 829  PHE A CA  1 
ATOM 6377 C C   . PHE A 1 832  ? -7.255  28.278 35.558  1.00 43.98  ? 829  PHE A C   1 
ATOM 6378 O O   . PHE A 1 832  ? -7.626  28.278 36.745  1.00 43.98  ? 829  PHE A O   1 
ATOM 6379 C CB  . PHE A 1 832  ? -8.473  30.362 35.118  1.00 45.70  ? 829  PHE A CB  1 
ATOM 6380 C CG  . PHE A 1 832  ? -8.785  31.450 34.150  1.00 45.70  ? 829  PHE A CG  1 
ATOM 6381 C CD1 . PHE A 1 832  ? -8.063  31.593 32.959  1.00 45.70  ? 829  PHE A CD1 1 
ATOM 6382 C CD2 . PHE A 1 832  ? -9.758  32.412 34.481  1.00 45.70  ? 829  PHE A CD2 1 
ATOM 6383 C CE1 . PHE A 1 832  ? -8.341  32.667 32.072  1.00 45.70  ? 829  PHE A CE1 1 
ATOM 6384 C CE2 . PHE A 1 832  ? -10.049 33.453 33.639  1.00 45.70  ? 829  PHE A CE2 1 
ATOM 6385 C CZ  . PHE A 1 832  ? -9.331  33.596 32.425  1.00 45.70  ? 829  PHE A CZ  1 
ATOM 6386 N N   . ILE A 1 833  ? -6.195  27.592 35.158  1.00 62.55  ? 830  ILE A N   1 
ATOM 6387 C CA  . ILE A 1 833  ? -5.445  26.823 36.140  1.00 62.55  ? 830  ILE A CA  1 
ATOM 6388 C C   . ILE A 1 833  ? -4.294  27.654 36.630  1.00 62.55  ? 830  ILE A C   1 
ATOM 6389 O O   . ILE A 1 833  ? -3.788  28.499 35.910  1.00 62.55  ? 830  ILE A O   1 
ATOM 6390 C CB  . ILE A 1 833  ? -4.969  25.513 35.552  1.00 42.94  ? 830  ILE A CB  1 
ATOM 6391 C CG1 . ILE A 1 833  ? -6.174  24.781 34.942  1.00 42.94  ? 830  ILE A CG1 1 
ATOM 6392 C CG2 . ILE A 1 833  ? -4.308  24.678 36.614  1.00 42.94  ? 830  ILE A CG2 1 
ATOM 6393 C CD1 . ILE A 1 833  ? -5.832  23.779 33.858  1.00 42.94  ? 830  ILE A CD1 1 
ATOM 6394 N N   . VAL A 1 834  ? -3.890  27.450 37.868  1.00 47.06  ? 831  VAL A N   1 
ATOM 6395 C CA  . VAL A 1 834  ? -2.900  28.332 38.441  1.00 47.06  ? 831  VAL A CA  1 
ATOM 6396 C C   . VAL A 1 834  ? -1.981  27.573 39.333  1.00 47.06  ? 831  VAL A C   1 
ATOM 6397 O O   . VAL A 1 834  ? -2.431  27.018 40.316  1.00 47.06  ? 831  VAL A O   1 
ATOM 6398 C CB  . VAL A 1 834  ? -3.550  29.369 39.305  1.00 34.97  ? 831  VAL A CB  1 
ATOM 6399 C CG1 . VAL A 1 834  ? -2.469  30.177 40.060  1.00 34.97  ? 831  VAL A CG1 1 
ATOM 6400 C CG2 . VAL A 1 834  ? -4.498  30.241 38.459  1.00 34.97  ? 831  VAL A CG2 1 
ATOM 6401 N N   . GLY A 1 835  ? -0.697  27.545 38.995  1.00 64.62  ? 832  GLY A N   1 
ATOM 6402 C CA  . GLY A 1 835  ? 0.297   26.863 39.803  1.00 64.62  ? 832  GLY A CA  1 
ATOM 6403 C C   . GLY A 1 835  ? 0.846   27.807 40.844  1.00 64.62  ? 832  GLY A C   1 
ATOM 6404 O O   . GLY A 1 835  ? 1.028   29.000 40.590  1.00 64.62  ? 832  GLY A O   1 
ATOM 6405 N N   . THR A 1 836  ? 1.132   27.279 42.020  1.00 45.57  ? 833  THR A N   1 
ATOM 6406 C CA  . THR A 1 836  ? 1.406   28.136 43.169  1.00 45.57  ? 833  THR A CA  1 
ATOM 6407 C C   . THR A 1 836  ? 2.523   27.621 44.067  1.00 45.57  ? 833  THR A C   1 
ATOM 6408 O O   . THR A 1 836  ? 3.146   26.624 43.760  1.00 45.57  ? 833  THR A O   1 
ATOM 6409 C CB  . THR A 1 836  ? 0.154   28.283 44.055  1.00 51.22  ? 833  THR A CB  1 
ATOM 6410 O OG1 . THR A 1 836  ? -0.175  26.999 44.591  1.00 51.22  ? 833  THR A OG1 1 
ATOM 6411 C CG2 . THR A 1 836  ? -1.030  28.832 43.267  1.00 51.22  ? 833  THR A CG2 1 
ATOM 6412 N N   . ALA A 1 837  ? 2.748   28.260 45.204  1.00 46.14  ? 834  ALA A N   1 
ATOM 6413 C CA  . ALA A 1 837  ? 3.917   27.912 45.977  1.00 46.14  ? 834  ALA A CA  1 
ATOM 6414 C C   . ALA A 1 837  ? 3.897   28.468 47.393  1.00 46.14  ? 834  ALA A C   1 
ATOM 6415 O O   . ALA A 1 837  ? 3.767   29.656 47.616  1.00 46.14  ? 834  ALA A O   1 
ATOM 6416 C CB  . ALA A 1 837  ? 5.171   28.397 45.236  1.00 30.66  ? 834  ALA A CB  1 
ATOM 6417 N N   . MET A 1 838  ? 4.050   27.621 48.374  1.00 45.82  ? 835  MET A N   1 
ATOM 6418 C CA  . MET A 1 838  ? 3.830   28.106 49.695  1.00 45.82  ? 835  MET A CA  1 
ATOM 6419 C C   . MET A 1 838  ? 5.143   28.626 50.209  1.00 45.82  ? 835  MET A C   1 
ATOM 6420 O O   . MET A 1 838  ? 6.065   27.844 50.404  1.00 45.82  ? 835  MET A O   1 
ATOM 6421 C CB  . MET A 1 838  ? 3.281   26.960 50.543  1.00 43.49  ? 835  MET A CB  1 
ATOM 6422 C CG  . MET A 1 838  ? 1.922   26.470 50.103  1.00 43.49  ? 835  MET A CG  1 
ATOM 6423 S SD  . MET A 1 838  ? 0.787   27.864 50.344  1.00 43.49  ? 835  MET A SD  1 
ATOM 6424 C CE  . MET A 1 838  ? 1.361   28.609 51.885  1.00 43.49  ? 835  MET A CE  1 
ATOM 6425 N N   . VAL A 1 839  ? 5.262   29.929 50.417  1.00 51.75  ? 836  VAL A N   1 
ATOM 6426 C CA  . VAL A 1 839  ? 6.596   30.520 50.469  1.00 51.75  ? 836  VAL A CA  1 
ATOM 6427 C C   . VAL A 1 839  ? 6.940   31.107 51.802  1.00 51.75  ? 836  VAL A C   1 
ATOM 6428 O O   . VAL A 1 839  ? 6.412   32.182 52.173  1.00 51.75  ? 836  VAL A O   1 
ATOM 6429 C CB  . VAL A 1 839  ? 6.754   31.668 49.419  1.00 37.82  ? 836  VAL A CB  1 
ATOM 6430 C CG1 . VAL A 1 839  ? 7.942   32.637 49.775  1.00 37.82  ? 836  VAL A CG1 1 
ATOM 6431 C CG2 . VAL A 1 839  ? 6.851   31.119 47.996  1.00 37.82  ? 836  VAL A CG2 1 
ATOM 6432 N N   . TYR A 1 840  ? 7.874   30.483 52.507  1.00 68.79  ? 837  TYR A N   1 
ATOM 6433 C CA  . TYR A 1 840  ? 8.331   31.111 53.745  1.00 68.79  ? 837  TYR A CA  1 
ATOM 6434 C C   . TYR A 1 840  ? 9.801   31.437 53.753  1.00 68.79  ? 837  TYR A C   1 
ATOM 6435 O O   . TYR A 1 840  ? 10.598  30.601 53.336  1.00 68.79  ? 837  TYR A O   1 
ATOM 6436 C CB  . TYR A 1 840  ? 8.025   30.221 54.903  1.00 36.62  ? 837  TYR A CB  1 
ATOM 6437 C CG  . TYR A 1 840  ? 6.608   29.662 54.882  1.00 36.62  ? 837  TYR A CG  1 
ATOM 6438 C CD1 . TYR A 1 840  ? 6.312   28.507 54.171  1.00 36.62  ? 837  TYR A CD1 1 
ATOM 6439 C CD2 . TYR A 1 840  ? 5.580   30.291 55.604  1.00 36.62  ? 837  TYR A CD2 1 
ATOM 6440 C CE1 . TYR A 1 840  ? 5.039   27.977 54.157  1.00 36.62  ? 837  TYR A CE1 1 
ATOM 6441 C CE2 . TYR A 1 840  ? 4.296   29.765 55.620  1.00 36.62  ? 837  TYR A CE2 1 
ATOM 6442 C CZ  . TYR A 1 840  ? 4.027   28.609 54.882  1.00 36.62  ? 837  TYR A CZ  1 
ATOM 6443 O OH  . TYR A 1 840  ? 2.732   28.076 54.880  1.00 36.62  ? 837  TYR A OH  1 
ATOM 6444 N N   . PRO A 1 841  ? 10.161  32.664 54.222  1.00 89.98  ? 838  PRO A N   1 
ATOM 6445 C CA  . PRO A 1 841  ? 11.546  33.219 54.398  1.00 89.98  ? 838  PRO A CA  1 
ATOM 6446 C C   . PRO A 1 841  ? 12.562  32.337 55.155  1.00 89.98  ? 838  PRO A C   1 
ATOM 6447 O O   . PRO A 1 841  ? 13.718  32.718 55.300  1.00 89.98  ? 838  PRO A O   1 
ATOM 6448 C CB  . PRO A 1 841  ? 11.303  34.539 55.155  1.00 84.42  ? 838  PRO A CB  1 
ATOM 6449 C CG  . PRO A 1 841  ? 9.942   34.969 54.679  1.00 84.42  ? 838  PRO A CG  1 
ATOM 6450 C CD  . PRO A 1 841  ? 9.138   33.672 54.590  1.00 84.42  ? 838  PRO A CD  1 
ATOM 6451 N N   . GLU A 1 842  ? 12.112  31.177 55.622  1.00 84.01  ? 839  GLU A N   1 
ATOM 6452 C CA  . GLU A 1 842  ? 12.977  30.258 56.353  1.00 84.01  ? 839  GLU A CA  1 
ATOM 6453 C C   . GLU A 1 842  ? 13.844  29.442 55.400  1.00 84.01  ? 839  GLU A C   1 
ATOM 6454 O O   . GLU A 1 842  ? 15.064  29.385 55.550  1.00 84.01  ? 839  GLU A O   1 
ATOM 6455 C CB  . GLU A 1 842  ? 12.144  29.326 57.235  1.00 100.20 ? 839  GLU A CB  1 
ATOM 6456 C CG  . GLU A 1 842  ? 11.285  30.046 58.262  1.00 100.20 ? 839  GLU A CG  1 
ATOM 6457 C CD  . GLU A 1 842  ? 12.106  30.888 59.220  1.00 100.20 ? 839  GLU A CD  1 
ATOM 6458 O OE1 . GLU A 1 842  ? 13.347  30.908 59.082  1.00 100.20 ? 839  GLU A OE1 1 
ATOM 6459 O OE2 . GLU A 1 842  ? 11.510  31.529 60.111  1.00 100.20 ? 839  GLU A OE2 1 
ATOM 6460 N N   . GLU A 1 843  ? 13.205  28.810 54.420  1.00 75.23  ? 840  GLU A N   1 
ATOM 6461 C CA  . GLU A 1 843  ? 13.917  27.996 53.442  1.00 75.23  ? 840  GLU A CA  1 
ATOM 6462 C C   . GLU A 1 843  ? 14.251  28.803 52.192  1.00 75.23  ? 840  GLU A C   1 
ATOM 6463 O O   . GLU A 1 843  ? 14.542  29.997 52.271  1.00 75.23  ? 840  GLU A O   1 
ATOM 6464 C CB  . GLU A 1 843  ? 13.090  26.765 53.067  1.00 74.39  ? 840  GLU A CB  1 
ATOM 6465 C CG  . GLU A 1 843  ? 12.771  25.851 54.239  1.00 74.39  ? 840  GLU A CG  1 
ATOM 6466 C CD  . GLU A 1 843  ? 11.953  24.642 53.830  1.00 74.39  ? 840  GLU A CD  1 
ATOM 6467 O OE1 . GLU A 1 843  ? 11.633  24.518 52.629  1.00 74.39  ? 840  GLU A OE1 1 
ATOM 6468 O OE2 . GLU A 1 843  ? 11.629  23.816 54.709  1.00 74.39  ? 840  GLU A OE2 1 
ATOM 6469 N N   . ALA A 1 844  ? 14.207  28.144 51.039  1.00 72.29  ? 841  ALA A N   1 
ATOM 6470 C CA  . ALA A 1 844  ? 14.505  28.799 49.770  1.00 72.29  ? 841  ALA A CA  1 
ATOM 6471 C C   . ALA A 1 844  ? 14.388  27.824 48.603  1.00 72.29  ? 841  ALA A C   1 
ATOM 6472 O O   . ALA A 1 844  ? 15.262  27.769 47.739  1.00 72.29  ? 841  ALA A O   1 
ATOM 6473 C CB  . ALA A 1 844  ? 15.893  29.421 49.808  1.00 57.81  ? 841  ALA A CB  1 
ATOM 6474 N N   . GLU A 1 845  ? 13.304  27.053 48.609  1.00 59.41  ? 842  GLU A N   1 
ATOM 6475 C CA  . GLU A 1 845  ? 13.033  26.056 47.580  1.00 59.41  ? 842  GLU A CA  1 
ATOM 6476 C C   . GLU A 1 845  ? 11.730  25.328 47.905  1.00 59.41  ? 842  GLU A C   1 
ATOM 6477 O O   . GLU A 1 845  ? 11.694  24.101 47.992  1.00 59.41  ? 842  GLU A O   1 
ATOM 6478 C CB  . GLU A 1 845  ? 14.186  25.057 47.480  1.00 60.09  ? 842  GLU A CB  1 
ATOM 6479 C CG  . GLU A 1 845  ? 13.981  23.974 46.434  1.00 60.09  ? 842  GLU A CG  1 
ATOM 6480 C CD  . GLU A 1 845  ? 15.139  22.997 46.371  1.00 60.09  ? 842  GLU A CD  1 
ATOM 6481 O OE1 . GLU A 1 845  ? 16.104  23.167 47.146  1.00 60.09  ? 842  GLU A OE1 1 
ATOM 6482 O OE2 . GLU A 1 845  ? 15.084  22.060 45.547  1.00 60.09  ? 842  GLU A OE2 1 
ATOM 6483 N N   . PRO A 1 846  ? 10.668  26.106 48.088  1.00 82.19  ? 843  PRO A N   1 
ATOM 6484 C CA  . PRO A 1 846  ? 9.336   25.587 48.418  1.00 82.19  ? 843  PRO A CA  1 
ATOM 6485 C C   . PRO A 1 846  ? 9.184   24.068 48.318  1.00 82.19  ? 843  PRO A C   1 
ATOM 6486 O O   . PRO A 1 846  ? 9.589   23.460 47.326  1.00 82.19  ? 843  PRO A O   1 
ATOM 6487 C CB  . PRO A 1 846  ? 8.461   26.269 47.364  1.00 40.51  ? 843  PRO A CB  1 
ATOM 6488 C CG  . PRO A 1 846  ? 9.101   27.611 47.262  1.00 40.51  ? 843  PRO A CG  1 
ATOM 6489 C CD  . PRO A 1 846  ? 10.559  27.213 47.124  1.00 40.51  ? 843  PRO A CD  1 
ATOM 6490 N N   . LYS A 1 847  ? 8.588   23.474 49.348  1.00 75.23  ? 844  LYS A N   1 
ATOM 6491 C CA  . LYS A 1 847  ? 8.343   22.039 49.395  1.00 75.23  ? 844  LYS A CA  1 
ATOM 6492 C C   . LYS A 1 847  ? 6.847   21.762 49.238  1.00 75.23  ? 844  LYS A C   1 
ATOM 6493 O O   . LYS A 1 847  ? 6.420   20.620 49.042  1.00 75.23  ? 844  LYS A O   1 
ATOM 6494 C CB  . LYS A 1 847  ? 8.902   21.426 50.690  1.00 182.04 ? 844  LYS A CB  1 
ATOM 6495 C CG  . LYS A 1 847  ? 8.357   22.033 51.980  1.00 182.04 ? 844  LYS A CG  1 
ATOM 6496 C CD  . LYS A 1 847  ? 8.739   23.501 52.103  1.00 182.04 ? 844  LYS A CD  1 
ATOM 6497 C CE  . LYS A 1 847  ? 7.502   24.371 52.289  1.00 182.04 ? 844  LYS A CE  1 
ATOM 6498 N NZ  . LYS A 1 847  ? 7.582   25.656 51.534  1.00 182.04 ? 844  LYS A NZ  1 
ATOM 6499 N N   . GLN A 1 848  ? 6.042   22.812 49.306  1.00 68.91  ? 845  GLN A N   1 
ATOM 6500 C CA  . GLN A 1 848  ? 4.619   22.658 49.026  1.00 68.91  ? 845  GLN A CA  1 
ATOM 6501 C C   . GLN A 1 848  ? 4.063   23.742 48.120  1.00 68.91  ? 845  GLN A C   1 
ATOM 6502 O O   . GLN A 1 848  ? 4.555   24.865 48.098  1.00 68.91  ? 845  GLN A O   1 
ATOM 6503 C CB  . GLN A 1 848  ? 3.841   22.626 50.329  1.00 78.94  ? 845  GLN A CB  1 
ATOM 6504 C CG  . GLN A 1 848  ? 4.389   23.591 51.330  1.00 78.94  ? 845  GLN A CG  1 
ATOM 6505 C CD  . GLN A 1 848  ? 3.748   23.457 52.690  1.00 78.94  ? 845  GLN A CD  1 
ATOM 6506 O OE1 . GLN A 1 848  ? 3.655   24.447 53.442  1.00 78.94  ? 845  GLN A OE1 1 
ATOM 6507 N NE2 . GLN A 1 848  ? 3.298   22.240 53.025  1.00 78.94  ? 845  GLN A NE2 1 
ATOM 6508 N N   . GLY A 1 849  ? 3.026   23.397 47.372  1.00 47.32  ? 846  GLY A N   1 
ATOM 6509 C CA  . GLY A 1 849  ? 2.285   24.393 46.599  1.00 47.32  ? 846  GLY A CA  1 
ATOM 6510 C C   . GLY A 1 849  ? 1.115   23.694 45.964  1.00 47.32  ? 846  GLY A C   1 
ATOM 6511 O O   . GLY A 1 849  ? 0.907   22.499 46.191  1.00 47.32  ? 846  GLY A O   1 
ATOM 6512 N N   . ARG A 1 850  ? 0.363   24.410 45.140  1.00 55.32  ? 847  ARG A N   1 
ATOM 6513 C CA  . ARG A 1 850  ? -0.807  23.788 44.520  1.00 55.32  ? 847  ARG A CA  1 
ATOM 6514 C C   . ARG A 1 850  ? -1.130  24.131 43.096  1.00 55.32  ? 847  ARG A C   1 
ATOM 6515 O O   . ARG A 1 850  ? -0.731  25.131 42.538  1.00 55.32  ? 847  ARG A O   1 
ATOM 6516 C CB  . ARG A 1 850  ? -2.083  23.962 45.379  1.00 69.80  ? 847  ARG A CB  1 
ATOM 6517 C CG  . ARG A 1 850  ? -2.338  25.329 45.915  1.00 69.80  ? 847  ARG A CG  1 
ATOM 6518 C CD  . ARG A 1 850  ? -3.230  25.270 47.163  1.00 69.80  ? 847  ARG A CD  1 
ATOM 6519 N NE  . ARG A 1 850  ? -3.798  26.590 47.476  1.00 69.80  ? 847  ARG A NE  1 
ATOM 6520 C CZ  . ARG A 1 850  ? -5.021  26.991 47.138  1.00 69.80  ? 847  ARG A CZ  1 
ATOM 6521 N NH1 . ARG A 1 850  ? -5.851  26.184 46.498  1.00 69.80  ? 847  ARG A NH1 1 
ATOM 6522 N NH2 . ARG A 1 850  ? -5.409  28.210 47.447  1.00 69.80  ? 847  ARG A NH2 1 
ATOM 6523 N N   . ILE A 1 851  ? -1.917  23.267 42.532  1.00 52.13  ? 848  ILE A N   1 
ATOM 6524 C CA  . ILE A 1 851  ? -2.476  23.534 41.269  1.00 52.13  ? 848  ILE A CA  1 
ATOM 6525 C C   . ILE A 1 851  ? -3.990  23.702 41.474  1.00 52.13  ? 848  ILE A C   1 
ATOM 6526 O O   . ILE A 1 851  ? -4.631  22.836 42.055  1.00 52.13  ? 848  ILE A O   1 
ATOM 6527 C CB  . ILE A 1 851  ? -2.137  22.384 40.378  1.00 34.62  ? 848  ILE A CB  1 
ATOM 6528 C CG1 . ILE A 1 851  ? -0.610  22.338 40.229  1.00 34.62  ? 848  ILE A CG1 1 
ATOM 6529 C CG2 . ILE A 1 851  ? -2.849  22.538 39.015  1.00 34.62  ? 848  ILE A CG2 1 
ATOM 6530 C CD1 . ILE A 1 851  ? -0.089  21.054 39.656  1.00 34.62  ? 848  ILE A CD1 1 
ATOM 6531 N N   . VAL A 1 852  ? -4.563  24.812 41.042  1.00 53.12  ? 849  VAL A N   1 
ATOM 6532 C CA  . VAL A 1 852  ? -5.966  25.024 41.282  1.00 53.12  ? 849  VAL A CA  1 
ATOM 6533 C C   . VAL A 1 852  ? -6.714  25.185 39.970  1.00 53.12  ? 849  VAL A C   1 
ATOM 6534 O O   . VAL A 1 852  ? -6.302  25.941 39.082  1.00 53.12  ? 849  VAL A O   1 
ATOM 6535 C CB  . VAL A 1 852  ? -6.232  26.289 42.114  1.00 36.61  ? 849  VAL A CB  1 
ATOM 6536 C CG1 . VAL A 1 852  ? -7.629  26.213 42.762  1.00 36.61  ? 849  VAL A CG1 1 
ATOM 6537 C CG2 . VAL A 1 852  ? -5.076  26.617 43.182  1.00 36.61  ? 849  VAL A CG2 1 
ATOM 6538 N N   . VAL A 1 853  ? -7.839  24.522 39.834  1.00 74.09  ? 850  VAL A N   1 
ATOM 6539 C CA  . VAL A 1 853  ? -8.526  24.664 38.587  1.00 74.09  ? 850  VAL A CA  1 
ATOM 6540 C C   . VAL A 1 853  ? -9.763  25.498 38.721  1.00 74.09  ? 850  VAL A C   1 
ATOM 6541 O O   . VAL A 1 853  ? -10.712 25.063 39.349  1.00 74.09  ? 850  VAL A O   1 
ATOM 6542 C CB  . VAL A 1 853  ? -8.922  23.351 38.051  1.00 37.72  ? 850  VAL A CB  1 
ATOM 6543 C CG1 . VAL A 1 853  ? -9.711  23.573 36.803  1.00 37.72  ? 850  VAL A CG1 1 
ATOM 6544 C CG2 . VAL A 1 853  ? -7.683  22.559 37.729  1.00 37.72  ? 850  VAL A CG2 1 
ATOM 6545 N N   . PHE A 1 854  ? -9.764  26.685 38.116  1.00 56.73  ? 851  PHE A N   1 
ATOM 6546 C CA  . PHE A 1 854  ? -10.909 27.584 38.260  1.00 56.73  ? 851  PHE A CA  1 
ATOM 6547 C C   . PHE A 1 854  ? -11.801 27.569 37.031  1.00 56.73  ? 851  PHE A C   1 
ATOM 6548 O O   . PHE A 1 854  ? -11.338 27.374 35.908  1.00 56.73  ? 851  PHE A O   1 
ATOM 6549 C CB  . PHE A 1 854  ? -10.491 29.030 38.503  1.00 52.49  ? 851  PHE A CB  1 
ATOM 6550 C CG  . PHE A 1 854  ? -9.631  29.241 39.699  1.00 52.49  ? 851  PHE A CG  1 
ATOM 6551 C CD1 . PHE A 1 854  ? -8.248  29.042 39.625  1.00 52.49  ? 851  PHE A CD1 1 
ATOM 6552 C CD2 . PHE A 1 854  ? -10.181 29.728 40.874  1.00 52.49  ? 851  PHE A CD2 1 
ATOM 6553 C CE1 . PHE A 1 854  ? -7.409  29.270 40.730  1.00 52.49  ? 851  PHE A CE1 1 
ATOM 6554 C CE2 . PHE A 1 854  ? -9.381  29.978 41.997  1.00 52.49  ? 851  PHE A CE2 1 
ATOM 6555 C CZ  . PHE A 1 854  ? -7.978  29.742 41.927  1.00 52.49  ? 851  PHE A CZ  1 
ATOM 6556 N N   . GLN A 1 855  ? -13.090 27.799 37.255  1.00 78.68  ? 852  GLN A N   1 
ATOM 6557 C CA  . GLN A 1 855  ? -13.942 28.210 36.160  1.00 78.68  ? 852  GLN A CA  1 
ATOM 6558 C C   . GLN A 1 855  ? -14.662 29.506 36.453  1.00 78.68  ? 852  GLN A C   1 
ATOM 6559 O O   . GLN A 1 855  ? -15.068 29.783 37.576  1.00 78.68  ? 852  GLN A O   1 
ATOM 6560 C CB  . GLN A 1 855  ? -14.928 27.133 35.761  1.00 63.14  ? 852  GLN A CB  1 
ATOM 6561 C CG  . GLN A 1 855  ? -15.571 27.415 34.428  1.00 63.14  ? 852  GLN A CG  1 
ATOM 6562 C CD  . GLN A 1 855  ? -16.624 26.387 34.063  1.00 63.14  ? 852  GLN A CD  1 
ATOM 6563 O OE1 . GLN A 1 855  ? -16.849 25.401 34.805  1.00 63.14  ? 852  GLN A OE1 1 
ATOM 6564 N NE2 . GLN A 1 855  ? -17.286 26.604 32.909  1.00 63.14  ? 852  GLN A NE2 1 
ATOM 6565 N N   . TYR A 1 856  ? -14.777 30.294 35.394  1.00 52.96  ? 853  TYR A N   1 
ATOM 6566 C CA  . TYR A 1 856  ? -15.463 31.575 35.403  1.00 52.96  ? 853  TYR A CA  1 
ATOM 6567 C C   . TYR A 1 856  ? -16.814 31.389 34.681  1.00 52.96  ? 853  TYR A C   1 
ATOM 6568 O O   . TYR A 1 856  ? -16.852 31.165 33.461  1.00 52.96  ? 853  TYR A O   1 
ATOM 6569 C CB  . TYR A 1 856  ? -14.574 32.667 34.762  1.00 57.97  ? 853  TYR A CB  1 
ATOM 6570 C CG  . TYR A 1 856  ? -15.062 34.074 35.018  1.00 57.97  ? 853  TYR A CG  1 
ATOM 6571 C CD1 . TYR A 1 856  ? -15.086 34.608 36.320  1.00 57.97  ? 853  TYR A CD1 1 
ATOM 6572 C CD2 . TYR A 1 856  ? -15.515 34.874 33.970  1.00 57.97  ? 853  TYR A CD2 1 
ATOM 6573 C CE1 . TYR A 1 856  ? -15.535 35.898 36.567  1.00 57.97  ? 853  TYR A CE1 1 
ATOM 6574 C CE2 . TYR A 1 856  ? -15.983 36.175 34.206  1.00 57.97  ? 853  TYR A CE2 1 
ATOM 6575 C CZ  . TYR A 1 856  ? -15.984 36.670 35.502  1.00 57.97  ? 853  TYR A CZ  1 
ATOM 6576 O OH  . TYR A 1 856  ? -16.427 37.943 35.720  1.00 57.97  ? 853  TYR A OH  1 
ATOM 6577 N N   . SER A 1 857  ? -17.895 31.471 35.457  1.00 137.00 ? 854  SER A N   1 
ATOM 6578 C CA  . SER A 1 857  ? -19.242 31.122 35.006  1.00 137.00 ? 854  SER A CA  1 
ATOM 6579 C C   . SER A 1 857  ? -19.964 32.346 34.413  1.00 137.00 ? 854  SER A C   1 
ATOM 6580 O O   . SER A 1 857  ? -19.337 33.151 33.719  1.00 137.00 ? 854  SER A O   1 
ATOM 6581 C CB  . SER A 1 857  ? -20.051 30.482 36.159  1.00 84.14  ? 854  SER A CB  1 
ATOM 6582 O OG  . SER A 1 857  ? -19.226 29.817 37.117  1.00 84.14  ? 854  SER A OG  1 
ATOM 6583 N N   . ASP A 1 858  ? -21.269 32.477 34.670  1.00 139.02 ? 855  ASP A N   1 
ATOM 6584 C CA  . ASP A 1 858  ? -22.045 33.612 34.172  1.00 139.02 ? 855  ASP A CA  1 
ATOM 6585 C C   . ASP A 1 858  ? -21.342 34.900 34.553  1.00 139.02 ? 855  ASP A C   1 
ATOM 6586 O O   . ASP A 1 858  ? -20.932 35.669 33.687  1.00 139.02 ? 855  ASP A O   1 
ATOM 6587 C CB  . ASP A 1 858  ? -23.484 33.596 34.703  1.00 123.89 ? 855  ASP A CB  1 
ATOM 6588 C CG  . ASP A 1 858  ? -24.406 32.700 33.880  1.00 123.89 ? 855  ASP A CG  1 
ATOM 6589 O OD1 . ASP A 1 858  ? -24.257 31.460 33.947  1.00 123.89 ? 855  ASP A OD1 1 
ATOM 6590 O OD2 . ASP A 1 858  ? -25.289 33.234 33.170  1.00 123.89 ? 855  ASP A OD2 1 
ATOM 6591 N N   . GLY A 1 859  ? -21.188 35.115 35.855  1.00 81.23  ? 856  GLY A N   1 
ATOM 6592 C CA  . GLY A 1 859  ? -20.336 36.184 36.371  1.00 81.23  ? 856  GLY A CA  1 
ATOM 6593 C C   . GLY A 1 859  ? -19.459 35.631 37.469  1.00 81.23  ? 856  GLY A C   1 
ATOM 6594 O O   . GLY A 1 859  ? -18.932 36.375 38.305  1.00 81.23  ? 856  GLY A O   1 
ATOM 6595 N N   . LYS A 1 860  ? -19.290 34.308 37.432  1.00 63.19  ? 857  LYS A N   1 
ATOM 6596 C CA  . LYS A 1 860  ? -18.854 33.533 38.602  1.00 63.19  ? 857  LYS A CA  1 
ATOM 6597 C C   . LYS A 1 860  ? -17.484 32.798 38.450  1.00 63.19  ? 857  LYS A C   1 
ATOM 6598 O O   . LYS A 1 860  ? -17.121 32.369 37.351  1.00 63.19  ? 857  LYS A O   1 
ATOM 6599 C CB  . LYS A 1 860  ? -19.980 32.567 38.997  1.00 156.63 ? 857  LYS A CB  1 
ATOM 6600 C CG  . LYS A 1 860  ? -21.296 32.875 38.269  1.00 156.63 ? 857  LYS A CG  1 
ATOM 6601 C CD  . LYS A 1 860  ? -22.507 32.879 39.163  1.00 156.63 ? 857  LYS A CD  1 
ATOM 6602 C CE  . LYS A 1 860  ? -23.697 33.423 38.401  1.00 156.63 ? 857  LYS A CE  1 
ATOM 6603 N NZ  . LYS A 1 860  ? -24.877 33.581 39.281  1.00 156.63 ? 857  LYS A NZ  1 
ATOM 6604 N N   . LEU A 1 861  ? -16.737 32.696 39.555  1.00 72.09  ? 858  LEU A N   1 
ATOM 6605 C CA  . LEU A 1 861  ? -15.478 31.965 39.594  1.00 72.09  ? 858  LEU A CA  1 
ATOM 6606 C C   . LEU A 1 861  ? -15.634 30.700 40.453  1.00 72.09  ? 858  LEU A C   1 
ATOM 6607 O O   . LEU A 1 861  ? -15.686 30.754 41.661  1.00 72.09  ? 858  LEU A O   1 
ATOM 6608 C CB  . LEU A 1 861  ? -14.353 32.876 40.126  1.00 47.01  ? 858  LEU A CB  1 
ATOM 6609 C CG  . LEU A 1 861  ? -12.920 32.996 39.488  1.00 47.01  ? 858  LEU A CG  1 
ATOM 6610 C CD1 . LEU A 1 861  ? -11.797 32.735 40.466  1.00 47.01  ? 858  LEU A CD1 1 
ATOM 6611 C CD2 . LEU A 1 861  ? -12.722 32.211 38.172  1.00 47.01  ? 858  LEU A CD2 1 
ATOM 6612 N N   . GLN A 1 862  ? -15.716 29.548 39.813  1.00 50.96  ? 859  GLN A N   1 
ATOM 6613 C CA  . GLN A 1 862  ? -15.894 28.272 40.520  1.00 50.96  ? 859  GLN A CA  1 
ATOM 6614 C C   . GLN A 1 862  ? -14.533 27.523 40.714  1.00 50.96  ? 859  GLN A C   1 
ATOM 6615 O O   . GLN A 1 862  ? -13.909 27.056 39.719  1.00 50.96  ? 859  GLN A O   1 
ATOM 6616 C CB  . GLN A 1 862  ? -16.887 27.402 39.728  1.00 116.53 ? 859  GLN A CB  1 
ATOM 6617 C CG  . GLN A 1 862  ? -17.661 26.369 40.560  1.00 116.53 ? 859  GLN A CG  1 
ATOM 6618 C CD  . GLN A 1 862  ? -18.480 25.392 39.711  1.00 116.53 ? 859  GLN A CD  1 
ATOM 6619 O OE1 . GLN A 1 862  ? -18.773 25.647 38.536  1.00 116.53 ? 859  GLN A OE1 1 
ATOM 6620 N NE2 . GLN A 1 862  ? -18.850 24.266 40.313  1.00 116.53 ? 859  GLN A NE2 1 
ATOM 6621 N N   . THR A 1 863  ? -14.060 27.445 41.970  1.00 62.24  ? 860  THR A N   1 
ATOM 6622 C CA  . THR A 1 863  ? -12.895 26.617 42.281  1.00 62.24  ? 860  THR A CA  1 
ATOM 6623 C C   . THR A 1 863  ? -13.296 25.192 41.940  1.00 62.24  ? 860  THR A C   1 
ATOM 6624 O O   . THR A 1 863  ? -13.993 24.536 42.737  1.00 62.24  ? 860  THR A O   1 
ATOM 6625 C CB  . THR A 1 863  ? -12.506 26.645 43.781  1.00 54.12  ? 860  THR A CB  1 
ATOM 6626 O OG1 . THR A 1 863  ? -12.142 27.970 44.176  1.00 54.12  ? 860  THR A OG1 1 
ATOM 6627 C CG2 . THR A 1 863  ? -11.334 25.676 44.061  1.00 54.12  ? 860  THR A CG2 1 
ATOM 6628 N N   . VAL A 1 864  ? -12.895 24.728 40.755  1.00 55.59  ? 861  VAL A N   1 
ATOM 6629 C CA  . VAL A 1 864  ? -13.318 23.419 40.254  1.00 55.59  ? 861  VAL A CA  1 
ATOM 6630 C C   . VAL A 1 864  ? -12.553 22.286 40.901  1.00 55.59  ? 861  VAL A C   1 
ATOM 6631 O O   . VAL A 1 864  ? -13.123 21.222 41.133  1.00 55.59  ? 861  VAL A O   1 
ATOM 6632 C CB  . VAL A 1 864  ? -13.132 23.292 38.747  1.00 49.83  ? 861  VAL A CB  1 
ATOM 6633 C CG1 . VAL A 1 864  ? -13.699 21.936 38.205  1.00 49.83  ? 861  VAL A CG1 1 
ATOM 6634 C CG2 . VAL A 1 864  ? -13.742 24.495 38.030  1.00 49.83  ? 861  VAL A CG2 1 
ATOM 6635 N N   . ALA A 1 865  ? -11.270 22.482 41.172  1.00 60.95  ? 862  ALA A N   1 
ATOM 6636 C CA  . ALA A 1 865  ? -10.431 21.384 41.625  1.00 60.95  ? 862  ALA A CA  1 
ATOM 6637 C C   . ALA A 1 865  ? -9.166  21.954 42.177  1.00 60.95  ? 862  ALA A C   1 
ATOM 6638 O O   . ALA A 1 865  ? -8.702  22.978 41.695  1.00 60.95  ? 862  ALA A O   1 
ATOM 6639 C CB  . ALA A 1 865  ? -10.100 20.465 40.462  1.00 50.35  ? 862  ALA A CB  1 
ATOM 6640 N N   . GLU A 1 866  ? -8.602  21.302 43.180  1.00 80.08  ? 863  GLU A N   1 
ATOM 6641 C CA  . GLU A 1 866  ? -7.260  21.633 43.603  1.00 80.08  ? 863  GLU A CA  1 
ATOM 6642 C C   . GLU A 1 866  ? -6.399  20.392 43.701  1.00 80.08  ? 863  GLU A C   1 
ATOM 6643 O O   . GLU A 1 866  ? -6.894  19.273 43.561  1.00 80.08  ? 863  GLU A O   1 
ATOM 6644 C CB  . GLU A 1 866  ? -7.252  22.455 44.888  1.00 72.40  ? 863  GLU A CB  1 
ATOM 6645 C CG  . GLU A 1 866  ? -7.621  21.724 46.145  1.00 72.40  ? 863  GLU A CG  1 
ATOM 6646 C CD  . GLU A 1 866  ? -7.522  22.622 47.383  1.00 72.40  ? 863  GLU A CD  1 
ATOM 6647 O OE1 . GLU A 1 866  ? -6.771  23.628 47.330  1.00 72.40  ? 863  GLU A OE1 1 
ATOM 6648 O OE2 . GLU A 1 866  ? -8.179  22.314 48.412  1.00 72.40  ? 863  GLU A OE2 1 
ATOM 6649 N N   . LYS A 1 867  ? -5.109  20.599 43.907  1.00 56.48  ? 864  LYS A N   1 
ATOM 6650 C CA  . LYS A 1 867  ? -4.142  19.523 43.879  1.00 56.48  ? 864  LYS A CA  1 
ATOM 6651 C C   . LYS A 1 867  ? -2.964  19.953 44.714  1.00 56.48  ? 864  LYS A C   1 
ATOM 6652 O O   . LYS A 1 867  ? -2.378  20.975 44.420  1.00 56.48  ? 864  LYS A O   1 
ATOM 6653 C CB  . LYS A 1 867  ? -3.668  19.308 42.452  1.00 82.14  ? 864  LYS A CB  1 
ATOM 6654 C CG  . LYS A 1 867  ? -2.770  18.107 42.301  1.00 82.14  ? 864  LYS A CG  1 
ATOM 6655 C CD  . LYS A 1 867  ? -3.598  16.863 42.211  1.00 82.14  ? 864  LYS A CD  1 
ATOM 6656 C CE  . LYS A 1 867  ? -2.766  15.644 42.460  1.00 82.14  ? 864  LYS A CE  1 
ATOM 6657 N NZ  . LYS A 1 867  ? -3.631  14.455 42.231  1.00 82.14  ? 864  LYS A NZ  1 
ATOM 6658 N N   . GLU A 1 868  ? -2.602  19.224 45.762  1.00 59.61  ? 865  GLU A N   1 
ATOM 6659 C CA  . GLU A 1 868  ? -1.438  19.639 46.519  1.00 59.61  ? 865  GLU A CA  1 
ATOM 6660 C C   . GLU A 1 868  ? -0.262  19.206 45.681  1.00 59.61  ? 865  GLU A C   1 
ATOM 6661 O O   . GLU A 1 868  ? -0.382  18.297 44.840  1.00 59.61  ? 865  GLU A O   1 
ATOM 6662 C CB  . GLU A 1 868  ? -1.402  18.978 47.885  1.00 67.97  ? 865  GLU A CB  1 
ATOM 6663 C CG  . GLU A 1 868  ? -0.302  19.492 48.836  1.00 67.97  ? 865  GLU A CG  1 
ATOM 6664 C CD  . GLU A 1 868  ? -0.221  18.711 50.178  1.00 67.97  ? 865  GLU A CD  1 
ATOM 6665 O OE1 . GLU A 1 868  ? 0.260   19.277 51.196  1.00 67.97  ? 865  GLU A OE1 1 
ATOM 6666 O OE2 . GLU A 1 868  ? -0.644  17.529 50.223  1.00 67.97  ? 865  GLU A OE2 1 
ATOM 6667 N N   . VAL A 1 869  ? 0.864   19.885 45.869  1.00 54.57  ? 866  VAL A N   1 
ATOM 6668 C CA  . VAL A 1 869  ? 2.119   19.476 45.233  1.00 54.57  ? 866  VAL A CA  1 
ATOM 6669 C C   . VAL A 1 869  ? 3.288   19.705 46.190  1.00 54.57  ? 866  VAL A C   1 
ATOM 6670 O O   . VAL A 1 869  ? 3.177   20.493 47.155  1.00 54.57  ? 866  VAL A O   1 
ATOM 6671 C CB  . VAL A 1 869  ? 2.359   20.172 43.874  1.00 65.81  ? 866  VAL A CB  1 
ATOM 6672 C CG1 . VAL A 1 869  ? 1.338   19.702 42.850  1.00 65.81  ? 866  VAL A CG1 1 
ATOM 6673 C CG2 . VAL A 1 869  ? 2.308   21.672 44.013  1.00 65.81  ? 866  VAL A CG2 1 
ATOM 6674 N N   . LYS A 1 870  ? 4.394   19.002 45.932  1.00 73.75  ? 867  LYS A N   1 
ATOM 6675 C CA  . LYS A 1 870  ? 5.546   19.023 46.841  1.00 73.75  ? 867  LYS A CA  1 
ATOM 6676 C C   . LYS A 1 870  ? 6.686   19.918 46.330  1.00 73.75  ? 867  LYS A C   1 
ATOM 6677 O O   . LYS A 1 870  ? 7.861   19.539 46.354  1.00 73.75  ? 867  LYS A O   1 
ATOM 6678 C CB  . LYS A 1 870  ? 6.044   17.598 47.149  1.00 75.02  ? 867  LYS A CB  1 
ATOM 6679 C CG  . LYS A 1 870  ? 5.056   16.689 47.913  1.00 75.02  ? 867  LYS A CG  1 
ATOM 6680 C CD  . LYS A 1 870  ? 5.408   15.170 47.766  1.00 75.02  ? 867  LYS A CD  1 
ATOM 6681 C CE  . LYS A 1 870  ? 5.361   14.685 46.282  1.00 75.02  ? 867  LYS A CE  1 
ATOM 6682 N NZ  . LYS A 1 870  ? 6.125   13.415 45.988  1.00 75.02  ? 867  LYS A NZ  1 
ATOM 6683 N N   . GLY A 1 871  ? 6.323   21.120 45.902  1.00 75.79  ? 868  GLY A N   1 
ATOM 6684 C CA  . GLY A 1 871  ? 7.283   22.100 45.429  1.00 75.79  ? 868  GLY A CA  1 
ATOM 6685 C C   . GLY A 1 871  ? 6.552   23.241 44.760  1.00 75.79  ? 868  GLY A C   1 
ATOM 6686 O O   . GLY A 1 871  ? 5.314   23.266 44.748  1.00 75.79  ? 868  GLY A O   1 
ATOM 6687 N N   . ALA A 1 872  ? 7.315   24.176 44.197  1.00 47.81  ? 869  ALA A N   1 
ATOM 6688 C CA  . ALA A 1 872  ? 6.761   25.369 43.545  1.00 47.81  ? 869  ALA A CA  1 
ATOM 6689 C C   . ALA A 1 872  ? 6.342   25.078 42.126  1.00 47.81  ? 869  ALA A C   1 
ATOM 6690 O O   . ALA A 1 872  ? 7.168   24.704 41.308  1.00 47.81  ? 869  ALA A O   1 
ATOM 6691 C CB  . ALA A 1 872  ? 7.797   26.454 43.533  1.00 38.00  ? 869  ALA A CB  1 
ATOM 6692 N N   . VAL A 1 873  ? 5.074   25.253 41.795  1.00 56.50  ? 870  VAL A N   1 
ATOM 6693 C CA  . VAL A 1 873  ? 4.681   25.106 40.395  1.00 56.50  ? 870  VAL A CA  1 
ATOM 6694 C C   . VAL A 1 873  ? 5.175   26.308 39.574  1.00 56.50  ? 870  VAL A C   1 
ATOM 6695 O O   . VAL A 1 873  ? 4.557   27.378 39.581  1.00 56.50  ? 870  VAL A O   1 
ATOM 6696 C CB  . VAL A 1 873  ? 3.193   24.963 40.254  1.00 46.77  ? 870  VAL A CB  1 
ATOM 6697 C CG1 . VAL A 1 873  ? 2.893   24.095 39.062  1.00 46.77  ? 870  VAL A CG1 1 
ATOM 6698 C CG2 . VAL A 1 873  ? 2.594   24.406 41.505  1.00 46.77  ? 870  VAL A CG2 1 
ATOM 6699 N N   . TYR A 1 874  ? 6.309   26.126 38.897  1.00 57.44  ? 871  TYR A N   1 
ATOM 6700 C CA  . TYR A 1 874  ? 6.982   27.241 38.245  1.00 57.44  ? 871  TYR A CA  1 
ATOM 6701 C C   . TYR A 1 874  ? 6.349   27.648 36.964  1.00 57.44  ? 871  TYR A C   1 
ATOM 6702 O O   . TYR A 1 874  ? 6.028   28.804 36.770  1.00 57.44  ? 871  TYR A O   1 
ATOM 6703 C CB  . TYR A 1 874  ? 8.449   26.963 38.003  1.00 46.36  ? 871  TYR A CB  1 
ATOM 6704 C CG  . TYR A 1 874  ? 9.224   27.185 39.232  1.00 46.36  ? 871  TYR A CG  1 
ATOM 6705 C CD1 . TYR A 1 874  ? 9.680   26.103 39.975  1.00 46.36  ? 871  TYR A CD1 1 
ATOM 6706 C CD2 . TYR A 1 874  ? 9.461   28.487 39.705  1.00 46.36  ? 871  TYR A CD2 1 
ATOM 6707 C CE1 . TYR A 1 874  ? 10.394  26.305 41.159  1.00 46.36  ? 871  TYR A CE1 1 
ATOM 6708 C CE2 . TYR A 1 874  ? 10.170  28.709 40.860  1.00 46.36  ? 871  TYR A CE2 1 
ATOM 6709 C CZ  . TYR A 1 874  ? 10.627  27.614 41.598  1.00 46.36  ? 871  TYR A CZ  1 
ATOM 6710 O OH  . TYR A 1 874  ? 11.331  27.798 42.784  1.00 46.36  ? 871  TYR A OH  1 
ATOM 6711 N N   . SER A 1 875  ? 6.198   26.714 36.062  1.00 52.86  ? 872  SER A N   1 
ATOM 6712 C CA  . SER A 1 875  ? 5.494   27.026 34.872  1.00 52.86  ? 872  SER A CA  1 
ATOM 6713 C C   . SER A 1 875  ? 4.619   25.823 34.605  1.00 52.86  ? 872  SER A C   1 
ATOM 6714 O O   . SER A 1 875  ? 4.811   24.784 35.218  1.00 52.86  ? 872  SER A O   1 
ATOM 6715 C CB  . SER A 1 875  ? 6.480   27.335 33.729  1.00 39.99  ? 872  SER A CB  1 
ATOM 6716 O OG  . SER A 1 875  ? 6.887   26.135 33.030  1.00 39.99  ? 872  SER A OG  1 
ATOM 6717 N N   . MET A 1 876  ? 3.627   25.979 33.736  1.00 46.73  ? 873  MET A N   1 
ATOM 6718 C CA  . MET A 1 876  ? 2.815   24.846 33.299  1.00 46.73  ? 873  MET A CA  1 
ATOM 6719 C C   . MET A 1 876  ? 2.158   25.204 31.992  1.00 46.73  ? 873  MET A C   1 
ATOM 6720 O O   . MET A 1 876  ? 1.354   26.110 31.934  1.00 46.73  ? 873  MET A O   1 
ATOM 6721 C CB  . MET A 1 876  ? 1.732   24.444 34.326  1.00 49.81  ? 873  MET A CB  1 
ATOM 6722 C CG  . MET A 1 876  ? 0.743   25.549 34.734  1.00 49.81  ? 873  MET A CG  1 
ATOM 6723 S SD  . MET A 1 876  ? -0.365  25.200 36.149  1.00 49.81  ? 873  MET A SD  1 
ATOM 6724 C CE  . MET A 1 876  ? 0.281   23.670 36.791  1.00 49.81  ? 873  MET A CE  1 
ATOM 6725 N N   . VAL A 1 877  ? 2.496   24.530 30.917  1.00 56.77  ? 874  VAL A N   1 
ATOM 6726 C CA  . VAL A 1 877  ? 1.770   24.815 29.725  1.00 56.77  ? 874  VAL A CA  1 
ATOM 6727 C C   . VAL A 1 877  ? 0.714   23.730 29.729  1.00 56.77  ? 874  VAL A C   1 
ATOM 6728 O O   . VAL A 1 877  ? 0.885   22.706 30.389  1.00 56.77  ? 874  VAL A O   1 
ATOM 6729 C CB  . VAL A 1 877  ? 2.684   24.697 28.511  1.00 49.29  ? 874  VAL A CB  1 
ATOM 6730 C CG1 . VAL A 1 877  ? 3.602   23.484 28.681  1.00 49.29  ? 874  VAL A CG1 1 
ATOM 6731 C CG2 . VAL A 1 877  ? 1.863   24.578 27.162  1.00 49.29  ? 874  VAL A CG2 1 
ATOM 6732 N N   . GLU A 1 878  ? -0.379  23.971 29.014  1.00 70.57  ? 875  GLU A N   1 
ATOM 6733 C CA  . GLU A 1 878  ? -1.338  22.940 28.630  1.00 70.57  ? 875  GLU A CA  1 
ATOM 6734 C C   . GLU A 1 878  ? -0.695  22.067 27.541  1.00 70.57  ? 875  GLU A C   1 
ATOM 6735 O O   . GLU A 1 878  ? -0.307  22.574 26.495  1.00 70.57  ? 875  GLU A O   1 
ATOM 6736 C CB  . GLU A 1 878  ? -2.630  23.625 28.120  1.00 82.44  ? 875  GLU A CB  1 
ATOM 6737 C CG  . GLU A 1 878  ? -3.678  22.723 27.450  1.00 82.44  ? 875  GLU A CG  1 
ATOM 6738 C CD  . GLU A 1 878  ? -3.534  22.626 25.933  1.00 82.44  ? 875  GLU A CD  1 
ATOM 6739 O OE1 . GLU A 1 878  ? -3.062  23.601 25.297  1.00 82.44  ? 875  GLU A OE1 1 
ATOM 6740 O OE2 . GLU A 1 878  ? -3.913  21.566 25.376  1.00 82.44  ? 875  GLU A OE2 1 
ATOM 6741 N N   . PHE A 1 879  ? -0.576  20.765 27.770  1.00 101.39 ? 876  PHE A N   1 
ATOM 6742 C CA  . PHE A 1 879  ? 0.079   19.924 26.774  1.00 101.39 ? 876  PHE A CA  1 
ATOM 6743 C C   . PHE A 1 879  ? -0.865  19.488 25.665  1.00 101.39 ? 876  PHE A C   1 
ATOM 6744 O O   . PHE A 1 879  ? -1.024  20.198 24.671  1.00 101.39 ? 876  PHE A O   1 
ATOM 6745 C CB  . PHE A 1 879  ? 0.803   18.729 27.414  1.00 65.80  ? 876  PHE A CB  1 
ATOM 6746 C CG  . PHE A 1 879  ? 1.803   18.058 26.501  1.00 65.80  ? 876  PHE A CG  1 
ATOM 6747 C CD1 . PHE A 1 879  ? 2.674   18.819 25.708  1.00 65.80  ? 876  PHE A CD1 1 
ATOM 6748 C CD2 . PHE A 1 879  ? 1.884   16.666 26.435  1.00 65.80  ? 876  PHE A CD2 1 
ATOM 6749 C CE1 . PHE A 1 879  ? 3.602   18.207 24.857  1.00 65.80  ? 876  PHE A CE1 1 
ATOM 6750 C CE2 . PHE A 1 879  ? 2.810   16.041 25.591  1.00 65.80  ? 876  PHE A CE2 1 
ATOM 6751 C CZ  . PHE A 1 879  ? 3.676   16.817 24.806  1.00 65.80  ? 876  PHE A CZ  1 
ATOM 6752 N N   . ASN A 1 880  ? -1.491  18.330 25.847  1.00 67.85  ? 877  ASN A N   1 
ATOM 6753 C CA  . ASN A 1 880  ? -2.221  17.676 24.775  1.00 67.85  ? 877  ASN A CA  1 
ATOM 6754 C C   . ASN A 1 880  ? -3.564  17.155 25.273  1.00 67.85  ? 877  ASN A C   1 
ATOM 6755 O O   . ASN A 1 880  ? -3.850  15.950 25.213  1.00 67.85  ? 877  ASN A O   1 
ATOM 6756 C CB  . ASN A 1 880  ? -1.388  16.513 24.218  1.00 59.54  ? 877  ASN A CB  1 
ATOM 6757 C CG  . ASN A 1 880  ? -0.599  16.888 22.981  1.00 59.54  ? 877  ASN A CG  1 
ATOM 6758 O OD1 . ASN A 1 880  ? -1.102  17.593 22.093  1.00 59.54  ? 877  ASN A OD1 1 
ATOM 6759 N ND2 . ASN A 1 880  ? 0.642   16.396 22.899  1.00 59.54  ? 877  ASN A ND2 1 
ATOM 6760 N N   . GLY A 1 881  ? -4.396  18.075 25.758  1.00 62.04  ? 878  GLY A N   1 
ATOM 6761 C CA  . GLY A 1 881  ? -5.611  17.704 26.483  1.00 62.04  ? 878  GLY A CA  1 
ATOM 6762 C C   . GLY A 1 881  ? -5.259  17.364 27.917  1.00 62.04  ? 878  GLY A C   1 
ATOM 6763 O O   . GLY A 1 881  ? -6.138  17.214 28.772  1.00 62.04  ? 878  GLY A O   1 
ATOM 6764 N N   . LYS A 1 882  ? -3.966  17.228 28.184  1.00 53.01  ? 879  LYS A N   1 
ATOM 6765 C CA  . LYS A 1 882  ? -3.500  17.052 29.544  1.00 53.01  ? 879  LYS A CA  1 
ATOM 6766 C C   . LYS A 1 882  ? -2.845  18.372 30.012  1.00 53.01  ? 879  LYS A C   1 
ATOM 6767 O O   . LYS A 1 882  ? -2.816  19.367 29.281  1.00 53.01  ? 879  LYS A O   1 
ATOM 6768 C CB  . LYS A 1 882  ? -2.566  15.844 29.617  1.00 74.64  ? 879  LYS A CB  1 
ATOM 6769 C CG  . LYS A 1 882  ? -3.012  14.677 28.687  1.00 74.64  ? 879  LYS A CG  1 
ATOM 6770 C CD  . LYS A 1 882  ? -2.056  13.459 28.692  1.00 74.64  ? 879  LYS A CD  1 
ATOM 6771 C CE  . LYS A 1 882  ? -2.531  12.303 27.779  1.00 74.64  ? 879  LYS A CE  1 
ATOM 6772 N NZ  . LYS A 1 882  ? -2.101  12.418 26.342  1.00 74.64  ? 879  LYS A NZ  1 
ATOM 6773 N N   . LEU A 1 883  ? -2.355  18.377 31.245  1.00 59.31  ? 880  LEU A N   1 
ATOM 6774 C CA  . LEU A 1 883  ? -1.757  19.542 31.887  1.00 59.31  ? 880  LEU A CA  1 
ATOM 6775 C C   . LEU A 1 883  ? -0.327  19.222 32.335  1.00 59.31  ? 880  LEU A C   1 
ATOM 6776 O O   . LEU A 1 883  ? -0.099  18.486 33.308  1.00 59.31  ? 880  LEU A O   1 
ATOM 6777 C CB  . LEU A 1 883  ? -2.622  20.008 33.073  1.00 44.95  ? 880  LEU A CB  1 
ATOM 6778 C CG  . LEU A 1 883  ? -2.138  20.936 34.204  1.00 44.95  ? 880  LEU A CG  1 
ATOM 6779 C CD1 . LEU A 1 883  ? -1.409  22.200 33.757  1.00 44.95  ? 880  LEU A CD1 1 
ATOM 6780 C CD2 . LEU A 1 883  ? -3.337  21.355 35.031  1.00 44.95  ? 880  LEU A CD2 1 
ATOM 6781 N N   . LEU A 1 884  ? 0.619   19.793 31.588  1.00 48.62  ? 881  LEU A N   1 
ATOM 6782 C CA  . LEU A 1 884  ? 2.038   19.679 31.890  1.00 48.62  ? 881  LEU A CA  1 
ATOM 6783 C C   . LEU A 1 884  ? 2.459   20.818 32.788  1.00 48.62  ? 881  LEU A C   1 
ATOM 6784 O O   . LEU A 1 884  ? 2.061   21.955 32.557  1.00 48.62  ? 881  LEU A O   1 
ATOM 6785 C CB  . LEU A 1 884  ? 2.852   19.719 30.607  1.00 67.11  ? 881  LEU A CB  1 
ATOM 6786 C CG  . LEU A 1 884  ? 4.352   19.840 30.848  1.00 67.11  ? 881  LEU A CG  1 
ATOM 6787 C CD1 . LEU A 1 884  ? 4.928   18.517 31.312  1.00 67.11  ? 881  LEU A CD1 1 
ATOM 6788 C CD2 . LEU A 1 884  ? 4.987   20.290 29.564  1.00 67.11  ? 881  LEU A CD2 1 
ATOM 6789 N N   . ALA A 1 885  ? 3.283   20.512 33.783  1.00 50.46  ? 882  ALA A N   1 
ATOM 6790 C CA  . ALA A 1 885  ? 3.498   21.425 34.873  1.00 50.46  ? 882  ALA A CA  1 
ATOM 6791 C C   . ALA A 1 885  ? 4.832   21.177 35.534  1.00 50.46  ? 882  ALA A C   1 
ATOM 6792 O O   . ALA A 1 885  ? 5.157   20.037 35.867  1.00 50.46  ? 882  ALA A O   1 
ATOM 6793 C CB  . ALA A 1 885  ? 2.429   21.234 35.861  1.00 39.84  ? 882  ALA A CB  1 
ATOM 6794 N N   . SER A 1 886  ? 5.616   22.229 35.732  1.00 51.62  ? 883  SER A N   1 
ATOM 6795 C CA  . SER A 1 886  ? 6.912   22.047 36.359  1.00 51.62  ? 883  SER A CA  1 
ATOM 6796 C C   . SER A 1 886  ? 6.734   22.285 37.836  1.00 51.62  ? 883  SER A C   1 
ATOM 6797 O O   . SER A 1 886  ? 6.241   23.338 38.233  1.00 51.62  ? 883  SER A O   1 
ATOM 6798 C CB  . SER A 1 886  ? 7.978   22.983 35.774  1.00 97.04  ? 883  SER A CB  1 
ATOM 6799 O OG  . SER A 1 886  ? 7.862   24.305 36.267  1.00 97.04  ? 883  SER A OG  1 
ATOM 6800 N N   . ILE A 1 887  ? 7.114   21.302 38.648  1.00 56.47  ? 884  ILE A N   1 
ATOM 6801 C CA  . ILE A 1 887  ? 6.950   21.397 40.096  1.00 56.47  ? 884  ILE A CA  1 
ATOM 6802 C C   . ILE A 1 887  ? 8.261   21.377 40.880  1.00 56.47  ? 884  ILE A C   1 
ATOM 6803 O O   . ILE A 1 887  ? 8.510   20.466 41.669  1.00 56.47  ? 884  ILE A O   1 
ATOM 6804 C CB  . ILE A 1 887  ? 6.038   20.274 40.630  1.00 49.56  ? 884  ILE A CB  1 
ATOM 6805 C CG1 . ILE A 1 887  ? 4.676   20.317 39.935  1.00 49.56  ? 884  ILE A CG1 1 
ATOM 6806 C CG2 . ILE A 1 887  ? 5.876   20.391 42.138  1.00 49.56  ? 884  ILE A CG2 1 
ATOM 6807 C CD1 . ILE A 1 887  ? 4.751   20.139 38.434  1.00 49.56  ? 884  ILE A CD1 1 
ATOM 6808 N N   . ASN A 1 888  ? 9.109   22.343 40.663  1.00 63.69  ? 885  ASN A N   1 
ATOM 6809 C CA  . ASN A 1 888  ? 10.381  22.469 41.355  1.00 63.69  ? 885  ASN A CA  1 
ATOM 6810 C C   . ASN A 1 888  ? 11.306  21.330 41.132  1.00 63.69  ? 885  ASN A C   1 
ATOM 6811 O O   . ASN A 1 888  ? 11.296  20.411 41.899  1.00 63.69  ? 885  ASN A O   1 
ATOM 6812 C CB  . ASN A 1 888  ? 10.163  22.689 42.854  1.00 62.63  ? 885  ASN A CB  1 
ATOM 6813 C CG  . ASN A 1 888  ? 11.422  22.877 43.588  1.00 62.63  ? 885  ASN A CG  1 
ATOM 6814 O OD1 . ASN A 1 888  ? 11.407  23.048 44.804  1.00 62.63  ? 885  ASN A OD1 1 
ATOM 6815 N ND2 . ASN A 1 888  ? 12.538  22.831 42.877  1.00 62.63  ? 885  ASN A ND2 1 
ATOM 6816 N N   . SER A 1 889  ? 12.115  21.405 40.080  1.00 50.44  ? 886  SER A N   1 
ATOM 6817 C CA  . SER A 1 889  ? 13.089  20.362 39.776  1.00 50.44  ? 886  SER A CA  1 
ATOM 6818 C C   . SER A 1 889  ? 12.488  19.170 39.035  1.00 50.44  ? 886  SER A C   1 
ATOM 6819 O O   . SER A 1 889  ? 13.184  18.485 38.285  1.00 50.44  ? 886  SER A O   1 
ATOM 6820 C CB  . SER A 1 889  ? 13.776  19.885 41.058  1.00 50.56  ? 886  SER A CB  1 
ATOM 6821 O OG  . SER A 1 889  ? 14.725  18.870 40.781  1.00 50.56  ? 886  SER A OG  1 
ATOM 6822 N N   . THR A 1 890  ? 11.200  18.922 39.247  1.00 70.34  ? 887  THR A N   1 
ATOM 6823 C CA  . THR A 1 890  ? 10.535  17.797 38.600  1.00 70.34  ? 887  THR A CA  1 
ATOM 6824 C C   . THR A 1 890  ? 9.325   18.221 37.773  1.00 70.34  ? 887  THR A C   1 
ATOM 6825 O O   . THR A 1 890  ? 8.372   18.797 38.296  1.00 70.34  ? 887  THR A O   1 
ATOM 6826 C CB  . THR A 1 890  ? 10.090  16.740 39.629  1.00 50.80  ? 887  THR A CB  1 
ATOM 6827 O OG1 . THR A 1 890  ? 11.234  16.252 40.342  1.00 50.80  ? 887  THR A OG1 1 
ATOM 6828 C CG2 . THR A 1 890  ? 9.397   15.578 38.934  1.00 50.80  ? 887  THR A CG2 1 
ATOM 6829 N N   . VAL A 1 891  ? 9.371   17.925 36.477  1.00 64.87  ? 888  VAL A N   1 
ATOM 6830 C CA  . VAL A 1 891  ? 8.275   18.251 35.576  1.00 64.87  ? 888  VAL A CA  1 
ATOM 6831 C C   . VAL A 1 891  ? 7.326   17.062 35.574  1.00 64.87  ? 888  VAL A C   1 
ATOM 6832 O O   . VAL A 1 891  ? 7.764   15.915 35.478  1.00 64.87  ? 888  VAL A O   1 
ATOM 6833 C CB  . VAL A 1 891  ? 8.773   18.512 34.146  1.00 39.15  ? 888  VAL A CB  1 
ATOM 6834 C CG1 . VAL A 1 891  ? 7.599   18.782 33.217  1.00 39.15  ? 888  VAL A CG1 1 
ATOM 6835 C CG2 . VAL A 1 891  ? 9.752   19.676 34.130  1.00 39.15  ? 888  VAL A CG2 1 
ATOM 6836 N N   . ARG A 1 892  ? 6.029   17.326 35.689  1.00 50.15  ? 889  ARG A N   1 
ATOM 6837 C CA  . ARG A 1 892  ? 5.080   16.273 35.738  1.00 50.15  ? 889  ARG A CA  1 
ATOM 6838 C C   . ARG A 1 892  ? 4.034   16.492 34.738  1.00 50.15  ? 889  ARG A C   1 
ATOM 6839 O O   . ARG A 1 892  ? 3.910   17.554 34.230  1.00 50.15  ? 889  ARG A O   1 
ATOM 6840 C CB  . ARG A 1 892  ? 4.431   16.328 37.090  1.00 50.56  ? 889  ARG A CB  1 
ATOM 6841 C CG  . ARG A 1 892  ? 4.395   15.042 37.791  1.00 50.56  ? 889  ARG A CG  1 
ATOM 6842 C CD  . ARG A 1 892  ? 3.360   15.038 38.845  1.00 50.56  ? 889  ARG A CD  1 
ATOM 6843 N NE  . ARG A 1 892  ? 3.767   15.763 40.022  1.00 50.56  ? 889  ARG A NE  1 
ATOM 6844 C CZ  . ARG A 1 892  ? 4.758   15.391 40.796  1.00 50.56  ? 889  ARG A CZ  1 
ATOM 6845 N NH1 . ARG A 1 892  ? 5.439   14.321 40.489  1.00 50.56  ? 889  ARG A NH1 1 
ATOM 6846 N NH2 . ARG A 1 892  ? 5.071   16.085 41.861  1.00 50.56  ? 889  ARG A NH2 1 
ATOM 6847 N N   . LEU A 1 893  ? 3.252   15.475 34.473  1.00 65.48  ? 890  LEU A N   1 
ATOM 6848 C CA  . LEU A 1 893  ? 2.191   15.593 33.507  1.00 65.48  ? 890  LEU A CA  1 
ATOM 6849 C C   . LEU A 1 893  ? 0.890   15.102 34.100  1.00 65.48  ? 890  LEU A C   1 
ATOM 6850 O O   . LEU A 1 893  ? 0.745   13.935 34.327  1.00 65.48  ? 890  LEU A O   1 
ATOM 6851 C CB  . LEU A 1 893  ? 2.540   14.762 32.305  1.00 63.71  ? 890  LEU A CB  1 
ATOM 6852 C CG  . LEU A 1 893  ? 1.430   14.577 31.314  1.00 63.71  ? 890  LEU A CG  1 
ATOM 6853 C CD1 . LEU A 1 893  ? 1.064   15.874 30.709  1.00 63.71  ? 890  LEU A CD1 1 
ATOM 6854 C CD2 . LEU A 1 893  ? 1.900   13.639 30.274  1.00 63.71  ? 890  LEU A CD2 1 
ATOM 6855 N N   . TYR A 1 894  ? -0.052  16.005 34.348  1.00 62.62  ? 891  TYR A N   1 
ATOM 6856 C CA  . TYR A 1 894  ? -1.338  15.656 34.960  1.00 62.62  ? 891  TYR A CA  1 
ATOM 6857 C C   . TYR A 1 894  ? -2.476  15.460 33.976  1.00 62.62  ? 891  TYR A C   1 
ATOM 6858 O O   . TYR A 1 894  ? -2.651  16.204 33.026  1.00 62.62  ? 891  TYR A O   1 
ATOM 6859 C CB  . TYR A 1 894  ? -1.764  16.685 35.969  1.00 56.04  ? 891  TYR A CB  1 
ATOM 6860 C CG  . TYR A 1 894  ? -0.831  16.918 37.138  1.00 56.04  ? 891  TYR A CG  1 
ATOM 6861 C CD1 . TYR A 1 894  ? 0.280   17.774 37.019  1.00 56.04  ? 891  TYR A CD1 1 
ATOM 6862 C CD2 . TYR A 1 894  ? -1.105  16.362 38.402  1.00 56.04  ? 891  TYR A CD2 1 
ATOM 6863 C CE1 . TYR A 1 894  ? 1.106   18.035 38.104  1.00 56.04  ? 891  TYR A CE1 1 
ATOM 6864 C CE2 . TYR A 1 894  ? -0.286  16.634 39.509  1.00 56.04  ? 891  TYR A CE2 1 
ATOM 6865 C CZ  . TYR A 1 894  ? 0.817   17.472 39.350  1.00 56.04  ? 891  TYR A CZ  1 
ATOM 6866 O OH  . TYR A 1 894  ? 1.641   17.746 40.436  1.00 56.04  ? 891  TYR A OH  1 
ATOM 6867 N N   . GLU A 1 895  ? -3.259  14.425 34.234  1.00 75.10  ? 892  GLU A N   1 
ATOM 6868 C CA  . GLU A 1 895  ? -4.427  14.129 33.431  1.00 75.10  ? 892  GLU A CA  1 
ATOM 6869 C C   . GLU A 1 895  ? -5.669  14.525 34.190  1.00 75.10  ? 892  GLU A C   1 
ATOM 6870 O O   . GLU A 1 895  ? -5.657  14.652 35.425  1.00 75.10  ? 892  GLU A O   1 
ATOM 6871 C CB  . GLU A 1 895  ? -4.488  12.647 33.108  1.00 68.58  ? 892  GLU A CB  1 
ATOM 6872 C CG  . GLU A 1 895  ? -3.922  12.271 31.777  1.00 68.58  ? 892  GLU A CG  1 
ATOM 6873 C CD  . GLU A 1 895  ? -3.810  10.763 31.629  1.00 68.58  ? 892  GLU A CD  1 
ATOM 6874 O OE1 . GLU A 1 895  ? -3.573  10.097 32.673  1.00 68.58  ? 892  GLU A OE1 1 
ATOM 6875 O OE2 . GLU A 1 895  ? -3.951  10.242 30.483  1.00 68.58  ? 892  GLU A OE2 1 
ATOM 6876 N N   . TRP A 1 896  ? -6.733  14.696 33.421  1.00 53.30  ? 893  TRP A N   1 
ATOM 6877 C CA  . TRP A 1 896  ? -8.009  15.147 33.906  1.00 53.30  ? 893  TRP A CA  1 
ATOM 6878 C C   . TRP A 1 896  ? -8.968  13.974 33.822  1.00 53.30  ? 893  TRP A C   1 
ATOM 6879 O O   . TRP A 1 896  ? -9.419  13.581 32.712  1.00 53.30  ? 893  TRP A O   1 
ATOM 6880 C CB  . TRP A 1 896  ? -8.494  16.242 32.977  1.00 51.10  ? 893  TRP A CB  1 
ATOM 6881 C CG  . TRP A 1 896  ? -9.513  17.171 33.512  1.00 51.10  ? 893  TRP A CG  1 
ATOM 6882 C CD1 . TRP A 1 896  ? -10.581 17.679 32.836  1.00 51.10  ? 893  TRP A CD1 1 
ATOM 6883 C CD2 . TRP A 1 896  ? -9.529  17.782 34.807  1.00 51.10  ? 893  TRP A CD2 1 
ATOM 6884 N NE1 . TRP A 1 896  ? -11.273 18.559 33.638  1.00 51.10  ? 893  TRP A NE1 1 
ATOM 6885 C CE2 . TRP A 1 896  ? -10.649 18.636 34.850  1.00 51.10  ? 893  TRP A CE2 1 
ATOM 6886 C CE3 . TRP A 1 896  ? -8.706  17.687 35.936  1.00 51.10  ? 893  TRP A CE3 1 
ATOM 6887 C CZ2 . TRP A 1 896  ? -10.980 19.366 35.971  1.00 51.10  ? 893  TRP A CZ2 1 
ATOM 6888 C CZ3 . TRP A 1 896  ? -9.018  18.433 37.044  1.00 51.10  ? 893  TRP A CZ3 1 
ATOM 6889 C CH2 . TRP A 1 896  ? -10.155 19.260 37.059  1.00 51.10  ? 893  TRP A CH2 1 
ATOM 6890 N N   . THR A 1 897  ? -9.298  13.414 34.979  1.00 97.07  ? 894  THR A N   1 
ATOM 6891 C CA  . THR A 1 897  ? -10.357 12.426 35.037  1.00 97.07  ? 894  THR A CA  1 
ATOM 6892 C C   . THR A 1 897  ? -11.630 12.991 34.391  1.00 97.07  ? 894  THR A C   1 
ATOM 6893 O O   . THR A 1 897  ? -11.847 14.207 34.333  1.00 97.07  ? 894  THR A O   1 
ATOM 6894 C CB  . THR A 1 897  ? -10.702 12.021 36.490  1.00 62.64  ? 894  THR A CB  1 
ATOM 6895 O OG1 . THR A 1 897  ? -11.305 13.130 37.164  1.00 62.64  ? 894  THR A OG1 1 
ATOM 6896 C CG2 . THR A 1 897  ? -9.469  11.542 37.287  1.00 62.64  ? 894  THR A CG2 1 
ATOM 6897 N N   . THR A 1 898  ? -12.442 12.082 33.873  1.00 113.54 ? 895  THR A N   1 
ATOM 6898 C CA  . THR A 1 898  ? -13.846 12.332 33.612  1.00 113.54 ? 895  THR A CA  1 
ATOM 6899 C C   . THR A 1 898  ? -14.449 12.894 34.881  1.00 113.54 ? 895  THR A C   1 
ATOM 6900 O O   . THR A 1 898  ? -15.151 13.905 34.869  1.00 113.54 ? 895  THR A O   1 
ATOM 6901 C CB  . THR A 1 898  ? -14.551 11.008 33.387  1.00 98.52  ? 895  THR A CB  1 
ATOM 6902 O OG1 . THR A 1 898  ? -14.044 10.063 34.347  1.00 98.52  ? 895  THR A OG1 1 
ATOM 6903 C CG2 . THR A 1 898  ? -14.317 10.483 31.956  1.00 98.52  ? 895  THR A CG2 1 
ATOM 6904 N N   . GLU A 1 899  ? -14.156 12.209 35.981  1.00 82.31  ? 896  GLU A N   1 
ATOM 6905 C CA  . GLU A 1 899  ? -14.588 12.606 37.319  1.00 82.31  ? 896  GLU A CA  1 
ATOM 6906 C C   . GLU A 1 899  ? -13.885 13.884 37.816  1.00 82.31  ? 896  GLU A C   1 
ATOM 6907 O O   . GLU A 1 899  ? -13.715 14.068 39.032  1.00 82.31  ? 896  GLU A O   1 
ATOM 6908 C CB  . GLU A 1 899  ? -14.393 11.446 38.320  1.00 93.78  ? 896  GLU A CB  1 
ATOM 6909 C CG  . GLU A 1 899  ? -13.312 10.405 37.916  1.00 93.78  ? 896  GLU A CG  1 
ATOM 6910 C CD  . GLU A 1 899  ? -12.428 9.921  39.090  1.00 93.78  ? 896  GLU A CD  1 
ATOM 6911 O OE1 . GLU A 1 899  ? -12.114 10.729 39.999  1.00 93.78  ? 896  GLU A OE1 1 
ATOM 6912 O OE2 . GLU A 1 899  ? -12.035 8.730  39.097  1.00 93.78  ? 896  GLU A OE2 1 
ATOM 6913 N N   . LYS A 1 900  ? -13.456 14.729 36.857  1.00 70.79  ? 897  LYS A N   1 
ATOM 6914 C CA  . LYS A 1 900  ? -12.926 16.107 37.072  1.00 70.79  ? 897  LYS A CA  1 
ATOM 6915 C C   . LYS A 1 900  ? -11.826 16.289 38.135  1.00 70.79  ? 897  LYS A C   1 
ATOM 6916 O O   . LYS A 1 900  ? -11.991 17.078 39.085  1.00 70.79  ? 897  LYS A O   1 
ATOM 6917 C CB  . LYS A 1 900  ? -14.064 17.090 37.372  1.00 65.73  ? 897  LYS A CB  1 
ATOM 6918 C CG  . LYS A 1 900  ? -15.012 17.376 36.208  1.00 65.73  ? 897  LYS A CG  1 
ATOM 6919 C CD  . LYS A 1 900  ? -15.680 18.749 36.438  1.00 65.73  ? 897  LYS A CD  1 
ATOM 6920 C CE  . LYS A 1 900  ? -16.828 19.030 35.450  1.00 65.73  ? 897  LYS A CE  1 
ATOM 6921 N NZ  . LYS A 1 900  ? -16.598 18.482 34.077  1.00 65.73  ? 897  LYS A NZ  1 
ATOM 6922 N N   . ASP A 1 901  ? -10.706 15.579 37.971  1.00 55.43  ? 898  ASP A N   1 
ATOM 6923 C CA  . ASP A 1 901  ? -9.576  15.752 38.893  1.00 55.43  ? 898  ASP A CA  1 
ATOM 6924 C C   . ASP A 1 901  ? -8.192  15.678 38.215  1.00 55.43  ? 898  ASP A C   1 
ATOM 6925 O O   . ASP A 1 901  ? -8.048  14.954 37.211  1.00 55.43  ? 898  ASP A O   1 
ATOM 6926 C CB  . ASP A 1 901  ? -9.663  14.771 40.040  1.00 100.71 ? 898  ASP A CB  1 
ATOM 6927 C CG  . ASP A 1 901  ? -9.308  15.409 41.327  1.00 100.71 ? 898  ASP A CG  1 
ATOM 6928 O OD1 . ASP A 1 901  ? -9.329  14.706 42.355  1.00 100.71 ? 898  ASP A OD1 1 
ATOM 6929 O OD2 . ASP A 1 901  ? -9.011  16.629 41.306  1.00 100.71 ? 898  ASP A OD2 1 
ATOM 6930 N N   . VAL A 1 902  ? -7.207  16.452 38.709  1.00 62.02  ? 899  VAL A N   1 
ATOM 6931 C CA  . VAL A 1 902  ? -5.863  16.373 38.096  1.00 62.02  ? 899  VAL A CA  1 
ATOM 6932 C C   . VAL A 1 902  ? -5.066  15.216 38.706  1.00 62.02  ? 899  VAL A C   1 
ATOM 6933 O O   . VAL A 1 902  ? -4.621  15.300 39.873  1.00 62.02  ? 899  VAL A O   1 
ATOM 6934 C CB  . VAL A 1 902  ? -4.989  17.757 37.979  1.00 48.24  ? 899  VAL A CB  1 
ATOM 6935 C CG1 . VAL A 1 902  ? -5.116  18.412 36.599  1.00 48.24  ? 899  VAL A CG1 1 
ATOM 6936 C CG2 . VAL A 1 902  ? -5.320  18.770 39.031  1.00 48.24  ? 899  VAL A CG2 1 
ATOM 6937 N N   . ARG A 1 903  ? -4.898  14.140 37.920  1.00 56.93  ? 900  ARG A N   1 
ATOM 6938 C CA  . ARG A 1 903  ? -4.063  13.008 38.371  1.00 56.93  ? 900  ARG A CA  1 
ATOM 6939 C C   . ARG A 1 903  ? -2.921  12.554 37.424  1.00 56.93  ? 900  ARG A C   1 
ATOM 6940 O O   . ARG A 1 903  ? -3.077  12.491 36.182  1.00 56.93  ? 900  ARG A O   1 
ATOM 6941 C CB  . ARG A 1 903  ? -4.925  11.829 38.834  1.00 71.51  ? 900  ARG A CB  1 
ATOM 6942 C CG  . ARG A 1 903  ? -5.430  10.910 37.742  1.00 71.51  ? 900  ARG A CG  1 
ATOM 6943 C CD  . ARG A 1 903  ? -4.612  9.615  37.668  1.00 71.51  ? 900  ARG A CD  1 
ATOM 6944 N NE  . ARG A 1 903  ? -4.780  9.089  36.326  1.00 71.51  ? 900  ARG A NE  1 
ATOM 6945 C CZ  . ARG A 1 903  ? -5.807  8.341  35.935  1.00 71.51  ? 900  ARG A CZ  1 
ATOM 6946 N NH1 . ARG A 1 903  ? -6.754  7.975  36.796  1.00 71.51  ? 900  ARG A NH1 1 
ATOM 6947 N NH2 . ARG A 1 903  ? -5.874  7.943  34.678  1.00 71.51  ? 900  ARG A NH2 1 
ATOM 6948 N N   . THR A 1 904  ? -1.790  12.217 38.059  1.00 65.82  ? 901  THR A N   1 
ATOM 6949 C CA  . THR A 1 904  ? -0.492  11.994 37.416  1.00 65.82  ? 901  THR A CA  1 
ATOM 6950 C C   . THR A 1 904  ? -0.464  10.881 36.358  1.00 65.82  ? 901  THR A C   1 
ATOM 6951 O O   . THR A 1 904  ? -1.269  9.949  36.387  1.00 65.82  ? 901  THR A O   1 
ATOM 6952 C CB  . THR A 1 904  ? 0.591   11.723 38.475  1.00 78.53  ? 901  THR A CB  1 
ATOM 6953 O OG1 . THR A 1 904  ? 0.545   12.740 39.468  1.00 78.53  ? 901  THR A OG1 1 
ATOM 6954 C CG2 . THR A 1 904  ? 1.980   11.735 37.860  1.00 78.53  ? 901  THR A CG2 1 
ATOM 6955 N N   . GLU A 1 905  ? 0.458   11.001 35.412  1.00 208.91 ? 902  GLU A N   1 
ATOM 6956 C CA  . GLU A 1 905  ? 0.784   9.900  34.531  1.00 208.91 ? 902  GLU A CA  1 
ATOM 6957 C C   . GLU A 1 905  ? 2.282   9.670  34.579  1.00 208.91 ? 902  GLU A C   1 
ATOM 6958 O O   . GLU A 1 905  ? 2.737   8.568  34.895  1.00 208.91 ? 902  GLU A O   1 
ATOM 6959 C CB  . GLU A 1 905  ? 0.334   10.188 33.106  1.00 139.98 ? 902  GLU A CB  1 
ATOM 6960 C CG  . GLU A 1 905  ? 0.710   9.087  32.136  1.00 139.98 ? 902  GLU A CG  1 
ATOM 6961 C CD  . GLU A 1 905  ? 0.172   9.316  30.741  1.00 139.98 ? 902  GLU A CD  1 
ATOM 6962 O OE1 . GLU A 1 905  ? -0.146  10.478 30.392  1.00 139.98 ? 902  GLU A OE1 1 
ATOM 6963 O OE2 . GLU A 1 905  ? 0.070   8.324  29.988  1.00 139.98 ? 902  GLU A OE2 1 
ATOM 6964 N N   . CYS A 1 906  ? 3.041   10.721 34.272  1.00 180.38 ? 903  CYS A N   1 
ATOM 6965 C CA  . CYS A 1 906  ? 4.496   10.640 34.268  1.00 180.38 ? 903  CYS A CA  1 
ATOM 6966 C C   . CYS A 1 906  ? 5.199   11.871 34.791  1.00 180.38 ? 903  CYS A C   1 
ATOM 6967 O O   . CYS A 1 906  ? 4.637   12.964 34.848  1.00 180.38 ? 903  CYS A O   1 
ATOM 6968 C CB  . CYS A 1 906  ? 5.033   10.331 32.870  1.00 71.88  ? 903  CYS A CB  1 
ATOM 6969 S SG  . CYS A 1 906  ? 4.307   11.266 31.518  1.00 71.88  ? 903  CYS A SG  1 
ATOM 6970 N N   . ASN A 1 907  ? 6.447   11.649 35.185  1.00 68.65  ? 904  ASN A N   1 
ATOM 6971 C CA  . ASN A 1 907  ? 7.388   12.708 35.488  1.00 68.65  ? 904  ASN A CA  1 
ATOM 6972 C C   . ASN A 1 907  ? 8.839   12.444 35.035  1.00 68.65  ? 904  ASN A C   1 
ATOM 6973 O O   . ASN A 1 907  ? 9.243   11.305 34.780  1.00 68.65  ? 904  ASN A O   1 
ATOM 6974 C CB  . ASN A 1 907  ? 7.324   13.144 36.955  1.00 90.34  ? 904  ASN A CB  1 
ATOM 6975 C CG  . ASN A 1 907  ? 6.806   12.075 37.850  1.00 90.34  ? 904  ASN A CG  1 
ATOM 6976 O OD1 . ASN A 1 907  ? 7.580   11.368 38.481  1.00 90.34  ? 904  ASN A OD1 1 
ATOM 6977 N ND2 . ASN A 1 907  ? 5.483   11.940 37.919  1.00 90.34  ? 904  ASN A ND2 1 
ATOM 6978 N N   . HIS A 1 908  ? 9.576   13.545 34.910  1.00 68.37  ? 905  HIS A N   1 
ATOM 6979 C CA  . HIS A 1 908  ? 10.962  13.580 34.563  1.00 68.37  ? 905  HIS A CA  1 
ATOM 6980 C C   . HIS A 1 908  ? 11.640  14.371 35.660  1.00 68.37  ? 905  HIS A C   1 
ATOM 6981 O O   . HIS A 1 908  ? 11.057  15.336 36.148  1.00 68.37  ? 905  HIS A O   1 
ATOM 6982 C CB  . HIS A 1 908  ? 11.077  14.307 33.247  1.00 66.54  ? 905  HIS A CB  1 
ATOM 6983 C CG  . HIS A 1 908  ? 12.437  14.855 32.976  1.00 66.54  ? 905  HIS A CG  1 
ATOM 6984 N ND1 . HIS A 1 908  ? 13.312  14.264 32.090  1.00 66.54  ? 905  HIS A ND1 1 
ATOM 6985 C CD2 . HIS A 1 908  ? 13.066  15.958 33.449  1.00 66.54  ? 905  HIS A CD2 1 
ATOM 6986 C CE1 . HIS A 1 908  ? 14.423  14.978 32.032  1.00 66.54  ? 905  HIS A CE1 1 
ATOM 6987 N NE2 . HIS A 1 908  ? 14.303  16.008 32.851  1.00 66.54  ? 905  HIS A NE2 1 
ATOM 6988 N N   . TYR A 1 909  ? 12.863  13.978 36.038  1.00 59.27  ? 906  TYR A N   1 
ATOM 6989 C CA  . TYR A 1 909  ? 13.538  14.533 37.219  1.00 59.27  ? 906  TYR A CA  1 
ATOM 6990 C C   . TYR A 1 909  ? 14.899  15.133 36.968  1.00 59.27  ? 906  TYR A C   1 
ATOM 6991 O O   . TYR A 1 909  ? 15.524  15.661 37.906  1.00 59.27  ? 906  TYR A O   1 
ATOM 6992 C CB  . TYR A 1 909  ? 13.729  13.445 38.253  1.00 88.52  ? 906  TYR A CB  1 
ATOM 6993 C CG  . TYR A 1 909  ? 12.457  13.039 38.903  1.00 88.52  ? 906  TYR A CG  1 
ATOM 6994 C CD1 . TYR A 1 909  ? 11.671  12.028 38.354  1.00 88.52  ? 906  TYR A CD1 1 
ATOM 6995 C CD2 . TYR A 1 909  ? 12.030  13.671 40.069  1.00 88.52  ? 906  TYR A CD2 1 
ATOM 6996 C CE1 . TYR A 1 909  ? 10.492  11.650 38.948  1.00 88.52  ? 906  TYR A CE1 1 
ATOM 6997 C CE2 . TYR A 1 909  ? 10.850  13.305 40.677  1.00 88.52  ? 906  TYR A CE2 1 
ATOM 6998 C CZ  . TYR A 1 909  ? 10.080  12.292 40.108  1.00 88.52  ? 906  TYR A CZ  1 
ATOM 6999 O OH  . TYR A 1 909  ? 8.899   11.920 40.711  1.00 88.52  ? 906  TYR A OH  1 
ATOM 7000 N N   . ASN A 1 910  ? 15.373  15.021 35.728  1.00 72.92  ? 907  ASN A N   1 
ATOM 7001 C CA  . ASN A 1 910  ? 16.702  15.502 35.334  1.00 72.92  ? 907  ASN A CA  1 
ATOM 7002 C C   . ASN A 1 910  ? 16.767  17.047 35.221  1.00 72.92  ? 907  ASN A C   1 
ATOM 7003 O O   . ASN A 1 910  ? 17.210  17.602 34.203  1.00 72.92  ? 907  ASN A O   1 
ATOM 7004 C CB  . ASN A 1 910  ? 17.108  14.818 34.016  1.00 82.08  ? 907  ASN A CB  1 
ATOM 7005 C CG  . ASN A 1 910  ? 18.591  14.963 33.695  1.00 82.08  ? 907  ASN A CG  1 
ATOM 7006 O OD1 . ASN A 1 910  ? 18.982  15.117 32.524  1.00 82.08  ? 907  ASN A OD1 1 
ATOM 7007 N ND2 . ASN A 1 910  ? 19.429  14.914 34.732  1.00 82.08  ? 907  ASN A ND2 1 
ATOM 7008 N N   . ASN A 1 911  ? 16.327  17.742 36.269  1.00 80.69  ? 908  ASN A N   1 
ATOM 7009 C CA  . ASN A 1 911  ? 16.137  19.187 36.204  1.00 80.69  ? 908  ASN A CA  1 
ATOM 7010 C C   . ASN A 1 911  ? 16.611  19.858 37.430  1.00 80.69  ? 908  ASN A C   1 
ATOM 7011 O O   . ASN A 1 911  ? 16.048  19.678 38.490  1.00 80.69  ? 908  ASN A O   1 
ATOM 7012 C CB  . ASN A 1 911  ? 14.666  19.526 36.122  1.00 58.20  ? 908  ASN A CB  1 
ATOM 7013 C CG  . ASN A 1 911  ? 14.094  19.309 34.763  1.00 58.20  ? 908  ASN A CG  1 
ATOM 7014 O OD1 . ASN A 1 911  ? 14.549  19.922 33.776  1.00 58.20  ? 908  ASN A OD1 1 
ATOM 7015 N ND2 . ASN A 1 911  ? 13.051  18.466 34.687  1.00 58.20  ? 908  ASN A ND2 1 
ATOM 7016 N N   . ILE A 1 912  ? 17.614  20.687 37.290  1.00 83.04  ? 909  ILE A N   1 
ATOM 7017 C CA  . ILE A 1 912  ? 18.082  21.426 38.423  1.00 83.04  ? 909  ILE A CA  1 
ATOM 7018 C C   . ILE A 1 912  ? 16.947  22.329 38.980  1.00 83.04  ? 909  ILE A C   1 
ATOM 7019 O O   . ILE A 1 912  ? 16.637  22.267 40.172  1.00 83.04  ? 909  ILE A O   1 
ATOM 7020 C CB  . ILE A 1 912  ? 19.384  22.147 38.053  1.00 77.28  ? 909  ILE A CB  1 
ATOM 7021 C CG1 . ILE A 1 912  ? 20.390  22.007 39.183  1.00 77.28  ? 909  ILE A CG1 1 
ATOM 7022 C CG2 . ILE A 1 912  ? 19.130  23.592 37.580  1.00 77.28  ? 909  ILE A CG2 1 
ATOM 7023 C CD1 . ILE A 1 912  ? 21.047  20.677 39.223  1.00 77.28  ? 909  ILE A CD1 1 
ATOM 7024 N N   . MET A 1 913  ? 16.320  23.126 38.106  1.00 74.71  ? 910  MET A N   1 
ATOM 7025 C CA  . MET A 1 913  ? 15.066  23.849 38.406  1.00 74.71  ? 910  MET A CA  1 
ATOM 7026 C C   . MET A 1 913  ? 14.357  24.243 37.108  1.00 74.71  ? 910  MET A C   1 
ATOM 7027 O O   . MET A 1 913  ? 14.720  25.235 36.467  1.00 74.71  ? 910  MET A O   1 
ATOM 7028 C CB  . MET A 1 913  ? 15.313  25.093 39.255  1.00 65.06  ? 910  MET A CB  1 
ATOM 7029 C CG  . MET A 1 913  ? 14.159  25.482 40.164  1.00 65.06  ? 910  MET A CG  1 
ATOM 7030 S SD  . MET A 1 913  ? 14.706  26.760 41.370  1.00 65.06  ? 910  MET A SD  1 
ATOM 7031 C CE  . MET A 1 913  ? 14.376  28.345 40.578  1.00 65.06  ? 910  MET A CE  1 
ATOM 7032 N N   . ALA A 1 914  ? 13.355  23.449 36.730  1.00 52.47  ? 911  ALA A N   1 
ATOM 7033 C CA  . ALA A 1 914  ? 12.542  23.693 35.527  1.00 52.47  ? 911  ALA A CA  1 
ATOM 7034 C C   . ALA A 1 914  ? 11.722  24.994 35.611  1.00 52.47  ? 911  ALA A C   1 
ATOM 7035 O O   . ALA A 1 914  ? 10.705  25.047 36.276  1.00 52.47  ? 911  ALA A O   1 
ATOM 7036 C CB  . ALA A 1 914  ? 11.629  22.501 35.269  1.00 47.39  ? 911  ALA A CB  1 
ATOM 7037 N N   . LEU A 1 915  ? 12.157  26.049 34.941  1.00 54.83  ? 912  LEU A N   1 
ATOM 7038 C CA  . LEU A 1 915  ? 11.491  27.321 35.147  1.00 54.83  ? 912  LEU A CA  1 
ATOM 7039 C C   . LEU A 1 915  ? 10.542  27.605 34.021  1.00 54.83  ? 912  LEU A C   1 
ATOM 7040 O O   . LEU A 1 915  ? 9.615   28.391 34.149  1.00 54.83  ? 912  LEU A O   1 
ATOM 7041 C CB  . LEU A 1 915  ? 12.501  28.463 35.267  1.00 30.54  ? 912  LEU A CB  1 
ATOM 7042 C CG  . LEU A 1 915  ? 13.573  28.383 36.344  1.00 30.54  ? 912  LEU A CG  1 
ATOM 7043 C CD1 . LEU A 1 915  ? 14.226  29.741 36.515  1.00 30.54  ? 912  LEU A CD1 1 
ATOM 7044 C CD2 . LEU A 1 915  ? 12.938  27.932 37.645  1.00 30.54  ? 912  LEU A CD2 1 
ATOM 7045 N N   . TYR A 1 916  ? 10.785  26.961 32.906  1.00 38.31  ? 913  TYR A N   1 
ATOM 7046 C CA  . TYR A 1 916  ? 10.111  27.324 31.699  1.00 38.31  ? 913  TYR A CA  1 
ATOM 7047 C C   . TYR A 1 916  ? 9.912   26.046 30.877  1.00 38.31  ? 913  TYR A C   1 
ATOM 7048 O O   . TYR A 1 916  ? 10.775  25.176 30.816  1.00 38.31  ? 913  TYR A O   1 
ATOM 7049 C CB  . TYR A 1 916  ? 10.965  28.365 30.919  1.00 26.53  ? 913  TYR A CB  1 
ATOM 7050 C CG  . TYR A 1 916  ? 11.634  29.408 31.784  1.00 26.53  ? 913  TYR A CG  1 
ATOM 7051 C CD1 . TYR A 1 916  ? 13.006  29.357 32.055  1.00 26.53  ? 913  TYR A CD1 1 
ATOM 7052 C CD2 . TYR A 1 916  ? 10.880  30.419 32.376  1.00 26.53  ? 913  TYR A CD2 1 
ATOM 7053 C CE1 . TYR A 1 916  ? 13.609  30.311 32.888  1.00 26.53  ? 913  TYR A CE1 1 
ATOM 7054 C CE2 . TYR A 1 916  ? 11.453  31.361 33.182  1.00 26.53  ? 913  TYR A CE2 1 
ATOM 7055 C CZ  . TYR A 1 916  ? 12.806  31.315 33.436  1.00 26.53  ? 913  TYR A CZ  1 
ATOM 7056 O OH  . TYR A 1 916  ? 13.312  32.284 34.280  1.00 26.53  ? 913  TYR A OH  1 
ATOM 7057 N N   . LEU A 1 917  ? 8.754   25.918 30.273  1.00 35.86  ? 914  LEU A N   1 
ATOM 7058 C CA  . LEU A 1 917  ? 8.479   24.777 29.440  1.00 35.86  ? 914  LEU A CA  1 
ATOM 7059 C C   . LEU A 1 917  ? 7.746   25.402 28.293  1.00 35.86  ? 914  LEU A C   1 
ATOM 7060 O O   . LEU A 1 917  ? 7.201   26.496 28.451  1.00 35.86  ? 914  LEU A O   1 
ATOM 7061 C CB  . LEU A 1 917  ? 7.591   23.703 30.159  1.00 31.74  ? 914  LEU A CB  1 
ATOM 7062 C CG  . LEU A 1 917  ? 7.904   23.453 31.644  1.00 31.74  ? 914  LEU A CG  1 
ATOM 7063 C CD1 . LEU A 1 917  ? 6.743   22.785 32.487  1.00 31.74  ? 914  LEU A CD1 1 
ATOM 7064 C CD2 . LEU A 1 917  ? 9.267   22.734 31.815  1.00 31.74  ? 914  LEU A CD2 1 
ATOM 7065 N N   . LYS A 1 918  ? 7.749   24.734 27.147  1.00 51.35  ? 915  LYS A N   1 
ATOM 7066 C CA  . LYS A 1 918  ? 6.973   25.155 26.015  1.00 51.35  ? 915  LYS A CA  1 
ATOM 7067 C C   . LYS A 1 918  ? 6.762   23.894 25.218  1.00 51.35  ? 915  LYS A C   1 
ATOM 7068 O O   . LYS A 1 918  ? 7.476   22.915 25.407  1.00 51.35  ? 915  LYS A O   1 
ATOM 7069 C CB  . LYS A 1 918  ? 7.732   26.188 25.183  1.00 36.70  ? 915  LYS A CB  1 
ATOM 7070 C CG  . LYS A 1 918  ? 7.875   27.575 25.789  1.00 36.70  ? 915  LYS A CG  1 
ATOM 7071 C CD  . LYS A 1 918  ? 6.800   28.554 25.281  1.00 36.70  ? 915  LYS A CD  1 
ATOM 7072 C CE  . LYS A 1 918  ? 6.716   29.764 26.218  1.00 36.70  ? 915  LYS A CE  1 
ATOM 7073 N NZ  . LYS A 1 918  ? 7.446   30.934 25.598  1.00 36.70  ? 915  LYS A NZ  1 
ATOM 7074 N N   . THR A 1 919  ? 5.800   23.919 24.304  1.00 46.48  ? 916  THR A N   1 
ATOM 7075 C CA  . THR A 1 919  ? 5.292   22.696 23.719  1.00 46.48  ? 916  THR A CA  1 
ATOM 7076 C C   . THR A 1 919  ? 5.073   22.903 22.268  1.00 46.48  ? 916  THR A C   1 
ATOM 7077 O O   . THR A 1 919  ? 4.316   23.749 21.871  1.00 46.48  ? 916  THR A O   1 
ATOM 7078 C CB  . THR A 1 919  ? 3.976   22.292 24.391  1.00 60.07  ? 916  THR A CB  1 
ATOM 7079 O OG1 . THR A 1 919  ? 4.288   21.612 25.606  1.00 60.07  ? 916  THR A OG1 1 
ATOM 7080 C CG2 . THR A 1 919  ? 3.116   21.390 23.476  1.00 60.07  ? 916  THR A CG2 1 
ATOM 7081 N N   . LYS A 1 920  ? 5.766   22.142 21.455  1.00 83.96  ? 917  LYS A N   1 
ATOM 7082 C CA  . LYS A 1 920  ? 5.496   22.217 20.051  1.00 83.96  ? 917  LYS A CA  1 
ATOM 7083 C C   . LYS A 1 920  ? 4.484   21.112 19.881  1.00 83.96  ? 917  LYS A C   1 
ATOM 7084 O O   . LYS A 1 920  ? 4.816   19.941 20.089  1.00 83.96  ? 917  LYS A O   1 
ATOM 7085 C CB  . LYS A 1 920  ? 6.781   21.991 19.253  1.00 206.86 ? 917  LYS A CB  1 
ATOM 7086 C CG  . LYS A 1 920  ? 6.685   22.239 17.748  1.00 206.86 ? 917  LYS A CG  1 
ATOM 7087 C CD  . LYS A 1 920  ? 6.492   20.943 16.962  1.00 206.86 ? 917  LYS A CD  1 
ATOM 7088 C CE  . LYS A 1 920  ? 7.631   19.949 17.192  1.00 206.86 ? 917  LYS A CE  1 
ATOM 7089 N NZ  . LYS A 1 920  ? 7.513   19.176 18.453  1.00 206.86 ? 917  LYS A NZ  1 
ATOM 7090 N N   . GLY A 1 921  ? 3.248   21.508 19.569  1.00 182.83 ? 918  GLY A N   1 
ATOM 7091 C CA  . GLY A 1 921  ? 2.101   20.608 19.431  1.00 182.83 ? 918  GLY A CA  1 
ATOM 7092 C C   . GLY A 1 921  ? 2.393   19.163 19.774  1.00 182.83 ? 918  GLY A C   1 
ATOM 7093 O O   . GLY A 1 921  ? 1.764   18.585 20.666  1.00 182.83 ? 918  GLY A O   1 
ATOM 7094 N N   . ASP A 1 922  ? 3.367   18.598 19.059  1.00 101.12 ? 919  ASP A N   1 
ATOM 7095 C CA  . ASP A 1 922  ? 3.852   17.248 19.288  1.00 101.12 ? 919  ASP A CA  1 
ATOM 7096 C C   . ASP A 1 922  ? 4.245   17.035 20.744  1.00 101.12 ? 919  ASP A C   1 
ATOM 7097 O O   . ASP A 1 922  ? 4.328   17.971 21.538  1.00 101.12 ? 919  ASP A O   1 
ATOM 7098 C CB  . ASP A 1 922  ? 5.041   16.952 18.364  1.00 212.91 ? 919  ASP A CB  1 
ATOM 7099 C CG  . ASP A 1 922  ? 5.259   15.464 18.139  1.00 212.91 ? 919  ASP A CG  1 
ATOM 7100 O OD1 . ASP A 1 922  ? 4.263   14.714 18.044  1.00 212.91 ? 919  ASP A OD1 1 
ATOM 7101 O OD2 . ASP A 1 922  ? 6.430   15.042 18.049  1.00 212.91 ? 919  ASP A OD2 1 
ATOM 7102 N N   . PHE A 1 923  ? 4.483   15.778 21.076  1.00 86.05  ? 920  PHE A N   1 
ATOM 7103 C CA  . PHE A 1 923  ? 4.763   15.370 22.427  1.00 86.05  ? 920  PHE A CA  1 
ATOM 7104 C C   . PHE A 1 923  ? 6.178   15.809 22.813  1.00 86.05  ? 920  PHE A C   1 
ATOM 7105 O O   . PHE A 1 923  ? 6.964   15.028 23.342  1.00 86.05  ? 920  PHE A O   1 
ATOM 7106 C CB  . PHE A 1 923  ? 4.555   13.854 22.551  1.00 127.02 ? 920  PHE A CB  1 
ATOM 7107 C CG  . PHE A 1 923  ? 3.403   13.323 21.720  1.00 127.02 ? 920  PHE A CG  1 
ATOM 7108 C CD1 . PHE A 1 923  ? 2.080   13.654 22.033  1.00 127.02 ? 920  PHE A CD1 1 
ATOM 7109 C CD2 . PHE A 1 923  ? 3.644   12.493 20.618  1.00 127.02 ? 920  PHE A CD2 1 
ATOM 7110 C CE1 . PHE A 1 923  ? 1.014   13.170 21.258  1.00 127.02 ? 920  PHE A CE1 1 
ATOM 7111 C CE2 . PHE A 1 923  ? 2.585   12.000 19.839  1.00 127.02 ? 920  PHE A CE2 1 
ATOM 7112 C CZ  . PHE A 1 923  ? 1.270   12.340 20.159  1.00 127.02 ? 920  PHE A CZ  1 
ATOM 7113 N N   . ILE A 1 924  ? 6.484   17.078 22.547  1.00 52.12  ? 921  ILE A N   1 
ATOM 7114 C CA  . ILE A 1 924  ? 7.829   17.630 22.738  1.00 52.12  ? 921  ILE A CA  1 
ATOM 7115 C C   . ILE A 1 924  ? 7.808   18.845 23.710  1.00 52.12  ? 921  ILE A C   1 
ATOM 7116 O O   . ILE A 1 924  ? 6.968   19.726 23.568  1.00 52.12  ? 921  ILE A O   1 
ATOM 7117 C CB  . ILE A 1 924  ? 8.530   17.865 21.329  1.00 51.57  ? 921  ILE A CB  1 
ATOM 7118 C CG1 . ILE A 1 924  ? 8.930   16.508 20.696  1.00 51.57  ? 921  ILE A CG1 1 
ATOM 7119 C CG2 . ILE A 1 924  ? 9.785   18.691 21.454  1.00 51.57  ? 921  ILE A CG2 1 
ATOM 7120 C CD1 . ILE A 1 924  ? 9.046   16.430 19.121  1.00 51.57  ? 921  ILE A CD1 1 
ATOM 7121 N N   . LEU A 1 925  ? 8.699   18.839 24.709  1.00 51.87  ? 922  LEU A N   1 
ATOM 7122 C CA  . LEU A 1 925  ? 8.843   19.906 25.719  1.00 51.87  ? 922  LEU A CA  1 
ATOM 7123 C C   . LEU A 1 925  ? 10.299  20.335 25.882  1.00 51.87  ? 922  LEU A C   1 
ATOM 7124 O O   . LEU A 1 925  ? 11.173  19.693 25.334  1.00 51.87  ? 922  LEU A O   1 
ATOM 7125 C CB  . LEU A 1 925  ? 8.392   19.418 27.085  1.00 54.81  ? 922  LEU A CB  1 
ATOM 7126 C CG  . LEU A 1 925  ? 7.139   18.602 27.421  1.00 54.81  ? 922  LEU A CG  1 
ATOM 7127 C CD1 . LEU A 1 925  ? 6.779   17.444 26.453  1.00 54.81  ? 922  LEU A CD1 1 
ATOM 7128 C CD2 . LEU A 1 925  ? 7.390   18.040 28.822  1.00 54.81  ? 922  LEU A CD2 1 
ATOM 7129 N N   . VAL A 1 926  ? 10.573  21.358 26.706  1.00 55.31  ? 923  VAL A N   1 
ATOM 7130 C CA  . VAL A 1 926  ? 11.874  22.058 26.717  1.00 55.31  ? 923  VAL A CA  1 
ATOM 7131 C C   . VAL A 1 926  ? 12.035  22.966 27.914  1.00 55.31  ? 923  VAL A C   1 
ATOM 7132 O O   . VAL A 1 926  ? 11.141  23.770 28.071  1.00 55.31  ? 923  VAL A O   1 
ATOM 7133 C CB  . VAL A 1 926  ? 11.893  23.010 25.482  1.00 48.59  ? 923  VAL A CB  1 
ATOM 7134 C CG1 . VAL A 1 926  ? 10.713  23.925 25.536  1.00 48.59  ? 923  VAL A CG1 1 
ATOM 7135 C CG2 . VAL A 1 926  ? 13.211  23.832 25.315  1.00 48.59  ? 923  VAL A CG2 1 
ATOM 7136 N N   . GLY A 1 927  ? 13.131  22.888 28.716  1.00 79.28  ? 924  GLY A N   1 
ATOM 7137 C CA  . GLY A 1 927  ? 13.582  24.028 29.613  1.00 79.28  ? 924  GLY A CA  1 
ATOM 7138 C C   . GLY A 1 927  ? 14.725  23.874 30.654  1.00 79.28  ? 924  GLY A C   1 
ATOM 7139 O O   . GLY A 1 927  ? 15.351  22.795 30.684  1.00 79.28  ? 924  GLY A O   1 
ATOM 7140 N N   . ASP A 1 928  ? 15.013  24.936 31.475  1.00 99.74  ? 925  ASP A N   1 
ATOM 7141 C CA  . ASP A 1 928  ? 15.769  24.873 32.822  1.00 99.74  ? 925  ASP A CA  1 
ATOM 7142 C C   . ASP A 1 928  ? 16.390  26.159 33.408  1.00 99.74  ? 925  ASP A C   1 
ATOM 7143 O O   . ASP A 1 928  ? 16.554  27.117 32.704  1.00 99.74  ? 925  ASP A O   1 
ATOM 7144 C CB  . ASP A 1 928  ? 16.839  23.751 32.908  1.00 76.95  ? 925  ASP A CB  1 
ATOM 7145 C CG  . ASP A 1 928  ? 17.333  23.478 34.378  1.00 76.95  ? 925  ASP A CG  1 
ATOM 7146 O OD1 . ASP A 1 928  ? 16.888  22.478 34.978  1.00 76.95  ? 925  ASP A OD1 1 
ATOM 7147 O OD2 . ASP A 1 928  ? 18.151  24.250 34.935  1.00 76.95  ? 925  ASP A OD2 1 
ATOM 7148 N N   . LEU A 1 929  ? 16.772  26.145 34.692  1.00 64.17  ? 926  LEU A N   1 
ATOM 7149 C CA  . LEU A 1 929  ? 17.281  27.326 35.444  1.00 64.17  ? 926  LEU A CA  1 
ATOM 7150 C C   . LEU A 1 929  ? 18.753  27.649 35.271  1.00 64.17  ? 926  LEU A C   1 
ATOM 7151 O O   . LEU A 1 929  ? 19.112  28.720 34.815  1.00 64.17  ? 926  LEU A O   1 
ATOM 7152 C CB  . LEU A 1 929  ? 17.022  27.223 36.972  1.00 54.29  ? 926  LEU A CB  1 
ATOM 7153 C CG  . LEU A 1 929  ? 17.989  28.066 37.867  1.00 54.29  ? 926  LEU A CG  1 
ATOM 7154 C CD1 . LEU A 1 929  ? 17.545  29.498 38.217  1.00 54.29  ? 926  LEU A CD1 1 
ATOM 7155 C CD2 . LEU A 1 929  ? 18.397  27.398 39.168  1.00 54.29  ? 926  LEU A CD2 1 
ATOM 7156 N N   . MET A 1 930  ? 19.634  26.775 35.712  1.00 59.45  ? 927  MET A N   1 
ATOM 7157 C CA  . MET A 1 930  ? 21.027  27.170 35.640  1.00 59.45  ? 927  MET A CA  1 
ATOM 7158 C C   . MET A 1 930  ? 21.817  26.314 34.661  1.00 59.45  ? 927  MET A C   1 
ATOM 7159 O O   . MET A 1 930  ? 23.042  26.447 34.578  1.00 59.45  ? 927  MET A O   1 
ATOM 7160 C CB  . MET A 1 930  ? 21.672  27.195 37.024  1.00 68.67  ? 927  MET A CB  1 
ATOM 7161 C CG  . MET A 1 930  ? 22.439  25.909 37.390  1.00 68.67  ? 927  MET A CG  1 
ATOM 7162 S SD  . MET A 1 930  ? 23.147  26.003 39.042  1.00 68.67  ? 927  MET A SD  1 
ATOM 7163 C CE  . MET A 1 930  ? 21.817  25.275 40.030  1.00 68.67  ? 927  MET A CE  1 
ATOM 7164 N N   . ARG A 1 931  ? 21.159  25.396 33.997  1.00 48.23  ? 928  ARG A N   1 
ATOM 7165 C CA  . ARG A 1 931  ? 21.831  24.528 33.078  1.00 48.23  ? 928  ARG A CA  1 
ATOM 7166 C C   . ARG A 1 931  ? 20.925  24.496 31.967  1.00 48.23  ? 928  ARG A C   1 
ATOM 7167 O O   . ARG A 1 931  ? 20.226  23.576 31.848  1.00 48.23  ? 928  ARG A O   1 
ATOM 7168 C CB  . ARG A 1 931  ? 21.885  23.114 33.595  1.00 75.24  ? 928  ARG A CB  1 
ATOM 7169 C CG  . ARG A 1 931  ? 21.915  22.974 35.061  1.00 75.24  ? 928  ARG A CG  1 
ATOM 7170 C CD  . ARG A 1 931  ? 22.068  21.537 35.403  1.00 75.24  ? 928  ARG A CD  1 
ATOM 7171 N NE  . ARG A 1 931  ? 21.089  20.740 34.695  1.00 75.24  ? 928  ARG A NE  1 
ATOM 7172 C CZ  . ARG A 1 931  ? 20.930  19.441 34.854  1.00 75.24  ? 928  ARG A CZ  1 
ATOM 7173 N NH1 . ARG A 1 931  ? 21.691  18.781 35.685  1.00 75.24  ? 928  ARG A NH1 1 
ATOM 7174 N NH2 . ARG A 1 931  ? 20.004  18.805 34.183  1.00 75.24  ? 928  ARG A NH2 1 
ATOM 7175 N N   . SER A 1 932  ? 20.985  25.560 31.183  1.00 55.25  ? 929  SER A N   1 
ATOM 7176 C CA  . SER A 1 932  ? 20.183  25.860 30.003  1.00 55.25  ? 929  SER A CA  1 
ATOM 7177 C C   . SER A 1 932  ? 19.617  24.897 28.949  1.00 55.25  ? 929  SER A C   1 
ATOM 7178 O O   . SER A 1 932  ? 20.308  24.479 28.020  1.00 55.25  ? 929  SER A O   1 
ATOM 7179 C CB  . SER A 1 932  ? 20.854  27.019 29.249  1.00 62.43  ? 929  SER A CB  1 
ATOM 7180 O OG  . SER A 1 932  ? 22.065  26.601 28.643  1.00 62.43  ? 929  SER A OG  1 
ATOM 7181 N N   . VAL A 1 933  ? 18.334  24.591 29.110  1.00 40.26  ? 930  VAL A N   1 
ATOM 7182 C CA  . VAL A 1 933  ? 17.535  23.771 28.158  1.00 40.26  ? 930  VAL A CA  1 
ATOM 7183 C C   . VAL A 1 933  ? 17.590  22.318 27.645  1.00 40.26  ? 930  VAL A C   1 
ATOM 7184 O O   . VAL A 1 933  ? 18.359  21.888 26.811  1.00 40.26  ? 930  VAL A O   1 
ATOM 7185 C CB  . VAL A 1 933  ? 17.050  24.612 26.982  1.00 44.96  ? 930  VAL A CB  1 
ATOM 7186 C CG1 . VAL A 1 933  ? 16.878  25.990 27.366  1.00 44.96  ? 930  VAL A CG1 1 
ATOM 7187 C CG2 . VAL A 1 933  ? 17.939  24.496 25.840  1.00 44.96  ? 930  VAL A CG2 1 
ATOM 7188 N N   . LEU A 1 934  ? 16.635  21.578 28.144  1.00 63.53  ? 931  LEU A N   1 
ATOM 7189 C CA  . LEU A 1 934  ? 16.478  20.158 27.794  1.00 63.53  ? 931  LEU A CA  1 
ATOM 7190 C C   . LEU A 1 934  ? 15.343  20.065 26.785  1.00 63.53  ? 931  LEU A C   1 
ATOM 7191 O O   . LEU A 1 934  ? 14.529  20.972 26.672  1.00 63.53  ? 931  LEU A O   1 
ATOM 7192 C CB  . LEU A 1 934  ? 16.157  19.301 29.016  1.00 66.36  ? 931  LEU A CB  1 
ATOM 7193 C CG  . LEU A 1 934  ? 17.097  19.222 30.226  1.00 66.36  ? 931  LEU A CG  1 
ATOM 7194 C CD1 . LEU A 1 934  ? 17.468  20.581 30.892  1.00 66.36  ? 931  LEU A CD1 1 
ATOM 7195 C CD2 . LEU A 1 934  ? 16.478  18.300 31.253  1.00 66.36  ? 931  LEU A CD2 1 
ATOM 7196 N N   . LEU A 1 935  ? 15.322  18.975 26.033  1.00 66.60  ? 932  LEU A N   1 
ATOM 7197 C CA  . LEU A 1 935  ? 14.282  18.690 25.067  1.00 66.60  ? 932  LEU A CA  1 
ATOM 7198 C C   . LEU A 1 935  ? 13.742  17.350 25.474  1.00 66.60  ? 932  LEU A C   1 
ATOM 7199 O O   . LEU A 1 935  ? 14.492  16.469 25.896  1.00 66.60  ? 932  LEU A O   1 
ATOM 7200 C CB  . LEU A 1 935  ? 14.874  18.582 23.669  1.00 49.12  ? 932  LEU A CB  1 
ATOM 7201 C CG  . LEU A 1 935  ? 13.979  18.043 22.539  1.00 49.12  ? 932  LEU A CG  1 
ATOM 7202 C CD1 . LEU A 1 935  ? 12.796  18.978 22.284  1.00 49.12  ? 932  LEU A CD1 1 
ATOM 7203 C CD2 . LEU A 1 935  ? 14.734  17.820 21.234  1.00 49.12  ? 932  LEU A CD2 1 
ATOM 7204 N N   . LEU A 1 936  ? 12.443  17.184 25.375  1.00 82.66  ? 933  LEU A N   1 
ATOM 7205 C CA  . LEU A 1 936  ? 11.865  15.966 25.868  1.00 82.66  ? 933  LEU A CA  1 
ATOM 7206 C C   . LEU A 1 936  ? 10.655  15.598 25.062  1.00 82.66  ? 933  LEU A C   1 
ATOM 7207 O O   . LEU A 1 936  ? 9.928   16.468 24.596  1.00 82.66  ? 933  LEU A O   1 
ATOM 7208 C CB  . LEU A 1 936  ? 11.473  16.130 27.329  1.00 65.05  ? 933  LEU A CB  1 
ATOM 7209 C CG  . LEU A 1 936  ? 12.565  16.043 28.387  1.00 65.05  ? 933  LEU A CG  1 
ATOM 7210 C CD1 . LEU A 1 936  ? 13.392  17.319 28.465  1.00 65.05  ? 933  LEU A CD1 1 
ATOM 7211 C CD2 . LEU A 1 936  ? 11.892  15.824 29.690  1.00 65.05  ? 933  LEU A CD2 1 
ATOM 7212 N N   . ALA A 1 937  ? 10.444  14.302 24.888  1.00 70.23  ? 934  ALA A N   1 
ATOM 7213 C CA  . ALA A 1 937  ? 9.229   13.847 24.258  1.00 70.23  ? 934  ALA A CA  1 
ATOM 7214 C C   . ALA A 1 937  ? 8.340   13.147 25.260  1.00 70.23  ? 934  ALA A C   1 
ATOM 7215 O O   . ALA A 1 937  ? 8.751   12.761 26.375  1.00 70.23  ? 934  ALA A O   1 
ATOM 7216 C CB  . ALA A 1 937  ? 9.512   12.937 23.037  1.00 32.04  ? 934  ALA A CB  1 
ATOM 7217 N N   . TYR A 1 938  ? 7.097   13.000 24.846  1.00 92.68  ? 935  TYR A N   1 
ATOM 7218 C CA  . TYR A 1 938  ? 6.184   12.206 25.580  1.00 92.68  ? 935  TYR A CA  1 
ATOM 7219 C C   . TYR A 1 938  ? 5.824   11.016 24.717  1.00 92.68  ? 935  TYR A C   1 
ATOM 7220 O O   . TYR A 1 938  ? 5.615   11.130 23.506  1.00 92.68  ? 935  TYR A O   1 
ATOM 7221 C CB  . TYR A 1 938  ? 4.975   13.023 25.945  1.00 64.63  ? 935  TYR A CB  1 
ATOM 7222 C CG  . TYR A 1 938  ? 3.855   12.178 26.396  1.00 64.63  ? 935  TYR A CG  1 
ATOM 7223 C CD1 . TYR A 1 938  ? 3.815   11.706 27.705  1.00 64.63  ? 935  TYR A CD1 1 
ATOM 7224 C CD2 . TYR A 1 938  ? 2.834   11.804 25.506  1.00 64.63  ? 935  TYR A CD2 1 
ATOM 7225 C CE1 . TYR A 1 938  ? 2.776   10.904 28.133  1.00 64.63  ? 935  TYR A CE1 1 
ATOM 7226 C CE2 . TYR A 1 938  ? 1.790   10.992 25.925  1.00 64.63  ? 935  TYR A CE2 1 
ATOM 7227 C CZ  . TYR A 1 938  ? 1.770   10.558 27.242  1.00 64.63  ? 935  TYR A CZ  1 
ATOM 7228 O OH  . TYR A 1 938  ? 0.741   9.781  27.694  1.00 64.63  ? 935  TYR A OH  1 
ATOM 7229 N N   . LYS A 1 939  ? 5.756   9.868  25.371  1.00 84.78  ? 936  LYS A N   1 
ATOM 7230 C CA  . LYS A 1 939  ? 5.702   8.590  24.702  1.00 84.78  ? 936  LYS A CA  1 
ATOM 7231 C C   . LYS A 1 939  ? 4.363   7.886  24.928  1.00 84.78  ? 936  LYS A C   1 
ATOM 7232 O O   . LYS A 1 939  ? 4.149   7.304  26.000  1.00 84.78  ? 936  LYS A O   1 
ATOM 7233 C CB  . LYS A 1 939  ? 6.859   7.715  25.219  1.00 64.54  ? 936  LYS A CB  1 
ATOM 7234 C CG  . LYS A 1 939  ? 8.265   8.293  25.034  1.00 64.54  ? 936  LYS A CG  1 
ATOM 7235 C CD  . LYS A 1 939  ? 8.458   8.910  23.632  1.00 64.54  ? 936  LYS A CD  1 
ATOM 7236 C CE  . LYS A 1 939  ? 8.662   7.860  22.544  1.00 64.54  ? 936  LYS A CE  1 
ATOM 7237 N NZ  . LYS A 1 939  ? 10.043  7.319  22.653  1.00 64.54  ? 936  LYS A NZ  1 
ATOM 7238 N N   . PRO A 1 940  ? 3.453   7.939  23.929  1.00 72.33  ? 937  PRO A N   1 
ATOM 7239 C CA  . PRO A 1 940  ? 2.254   7.071  23.901  1.00 72.33  ? 937  PRO A CA  1 
ATOM 7240 C C   . PRO A 1 940  ? 2.696   5.591  23.844  1.00 72.33  ? 937  PRO A C   1 
ATOM 7241 O O   . PRO A 1 940  ? 2.241   4.762  23.028  1.00 72.33  ? 937  PRO A O   1 
ATOM 7242 C CB  . PRO A 1 940  ? 1.527   7.519  22.632  1.00 65.93  ? 937  PRO A CB  1 
ATOM 7243 C CG  . PRO A 1 940  ? 2.048   8.924  22.363  1.00 65.93  ? 937  PRO A CG  1 
ATOM 7244 C CD  . PRO A 1 940  ? 3.498   8.842  22.766  1.00 65.93  ? 937  PRO A CD  1 
ATOM 7245 N N   . MET A 1 941  ? 3.638   5.312  24.721  1.00 109.97 ? 938  MET A N   1 
ATOM 7246 C CA  . MET A 1 941  ? 4.261   4.043  24.861  1.00 109.97 ? 938  MET A CA  1 
ATOM 7247 C C   . MET A 1 941  ? 3.797   3.865  26.272  1.00 109.97 ? 938  MET A C   1 
ATOM 7248 O O   . MET A 1 941  ? 2.613   4.065  26.533  1.00 109.97 ? 938  MET A O   1 
ATOM 7249 C CB  . MET A 1 941  ? 5.773   4.251  24.750  1.00 141.69 ? 938  MET A CB  1 
ATOM 7250 C CG  . MET A 1 941  ? 6.672   3.096  25.182  1.00 141.69 ? 938  MET A CG  1 
ATOM 7251 S SD  . MET A 1 941  ? 8.358   3.674  25.522  1.00 141.69 ? 938  MET A SD  1 
ATOM 7252 C CE  . MET A 1 941  ? 8.975   3.963  23.851  1.00 141.69 ? 938  MET A CE  1 
ATOM 7253 N N   . GLU A 1 942  ? 4.707   3.556  27.192  1.00 153.90 ? 939  GLU A N   1 
ATOM 7254 C CA  . GLU A 1 942  ? 4.381   3.573  28.611  1.00 153.90 ? 939  GLU A CA  1 
ATOM 7255 C C   . GLU A 1 942  ? 4.016   4.997  29.046  1.00 153.90 ? 939  GLU A C   1 
ATOM 7256 O O   . GLU A 1 942  ? 4.421   5.457  30.116  1.00 153.90 ? 939  GLU A O   1 
ATOM 7257 C CB  . GLU A 1 942  ? 5.508   2.961  29.472  1.00 169.57 ? 939  GLU A CB  1 
ATOM 7258 C CG  . GLU A 1 942  ? 6.892   3.604  29.342  1.00 169.57 ? 939  GLU A CG  1 
ATOM 7259 C CD  . GLU A 1 942  ? 7.793   3.323  30.544  1.00 169.57 ? 939  GLU A CD  1 
ATOM 7260 O OE1 . GLU A 1 942  ? 8.118   4.281  31.281  1.00 169.57 ? 939  GLU A OE1 1 
ATOM 7261 O OE2 . GLU A 1 942  ? 8.175   2.148  30.759  1.00 169.57 ? 939  GLU A OE2 1 
ATOM 7262 N N   . GLY A 1 943  ? 3.237   5.677  28.198  1.00 152.73 ? 940  GLY A N   1 
ATOM 7263 C CA  . GLY A 1 943  ? 2.792   7.045  28.438  1.00 152.73 ? 940  GLY A CA  1 
ATOM 7264 C C   . GLY A 1 943  ? 3.844   7.774  29.231  1.00 152.73 ? 940  GLY A C   1 
ATOM 7265 O O   . GLY A 1 943  ? 3.589   8.200  30.354  1.00 152.73 ? 940  GLY A O   1 
ATOM 7266 N N   . ASN A 1 944  ? 5.037   7.893  28.653  1.00 82.33  ? 941  ASN A N   1 
ATOM 7267 C CA  . ASN A 1 944  ? 6.208   8.311  29.425  1.00 82.33  ? 941  ASN A CA  1 
ATOM 7268 C C   . ASN A 1 944  ? 7.056   9.427  28.806  1.00 82.33  ? 941  ASN A C   1 
ATOM 7269 O O   . ASN A 1 944  ? 6.813   9.890  27.678  1.00 82.33  ? 941  ASN A O   1 
ATOM 7270 C CB  . ASN A 1 944  ? 7.091   7.101  29.768  1.00 171.53 ? 941  ASN A CB  1 
ATOM 7271 C CG  . ASN A 1 944  ? 8.029   7.367  30.937  1.00 171.53 ? 941  ASN A CG  1 
ATOM 7272 O OD1 . ASN A 1 944  ? 9.200   6.996  30.901  1.00 171.53 ? 941  ASN A OD1 1 
ATOM 7273 N ND2 . ASN A 1 944  ? 7.519   8.018  31.973  1.00 171.53 ? 941  ASN A ND2 1 
ATOM 7274 N N   . PHE A 1 945  ? 8.045   9.869  29.578  1.00 49.62  ? 942  PHE A N   1 
ATOM 7275 C CA  . PHE A 1 945  ? 8.936   10.882 29.099  1.00 49.62  ? 942  PHE A CA  1 
ATOM 7276 C C   . PHE A 1 945  ? 10.280  10.284 28.756  1.00 49.62  ? 942  PHE A C   1 
ATOM 7277 O O   . PHE A 1 945  ? 10.948  9.682  29.622  1.00 49.62  ? 942  PHE A O   1 
ATOM 7278 C CB  . PHE A 1 945  ? 9.120   11.989 30.137  1.00 47.89  ? 942  PHE A CB  1 
ATOM 7279 C CG  . PHE A 1 945  ? 7.998   12.986 30.162  1.00 47.89  ? 942  PHE A CG  1 
ATOM 7280 C CD1 . PHE A 1 945  ? 7.579   13.541 31.371  1.00 47.89  ? 942  PHE A CD1 1 
ATOM 7281 C CD2 . PHE A 1 945  ? 7.372   13.375 28.981  1.00 47.89  ? 942  PHE A CD2 1 
ATOM 7282 C CE1 . PHE A 1 945  ? 6.561   14.469 31.410  1.00 47.89  ? 942  PHE A CE1 1 
ATOM 7283 C CE2 . PHE A 1 945  ? 6.333   14.293 29.019  1.00 47.89  ? 942  PHE A CE2 1 
ATOM 7284 C CZ  . PHE A 1 945  ? 5.927   14.838 30.256  1.00 47.89  ? 942  PHE A CZ  1 
ATOM 7285 N N   . GLU A 1 946  ? 10.653  10.473 27.496  1.00 96.84  ? 943  GLU A N   1 
ATOM 7286 C CA  . GLU A 1 946  ? 11.975  10.175 27.020  1.00 96.84  ? 943  GLU A CA  1 
ATOM 7287 C C   . GLU A 1 946  ? 12.714  11.495 26.798  1.00 96.84  ? 943  GLU A C   1 
ATOM 7288 O O   . GLU A 1 946  ? 12.301  12.326 25.981  1.00 96.84  ? 943  GLU A O   1 
ATOM 7289 C CB  . GLU A 1 946  ? 11.872  9.394  25.720  1.00 93.29  ? 943  GLU A CB  1 
ATOM 7290 C CG  . GLU A 1 946  ? 13.179  8.799  25.268  1.00 93.29  ? 943  GLU A CG  1 
ATOM 7291 C CD  . GLU A 1 946  ? 13.197  8.489  23.786  1.00 93.29  ? 943  GLU A CD  1 
ATOM 7292 O OE1 . GLU A 1 946  ? 14.225  7.936  23.329  1.00 93.29  ? 943  GLU A OE1 1 
ATOM 7293 O OE2 . GLU A 1 946  ? 12.205  8.795  23.076  1.00 93.29  ? 943  GLU A OE2 1 
ATOM 7294 N N   . GLU A 1 947  ? 13.794  11.687 27.549  1.00 49.70  ? 944  GLU A N   1 
ATOM 7295 C CA  . GLU A 1 947  ? 14.679  12.878 27.394  1.00 49.70  ? 944  GLU A CA  1 
ATOM 7296 C C   . GLU A 1 947  ? 15.486  12.738 26.097  1.00 49.70  ? 944  GLU A C   1 
ATOM 7297 O O   . GLU A 1 947  ? 16.514  12.025 26.069  1.00 49.70  ? 944  GLU A O   1 
ATOM 7298 C CB  . GLU A 1 947  ? 15.597  13.010 28.619  1.00 82.64  ? 944  GLU A CB  1 
ATOM 7299 C CG  . GLU A 1 947  ? 16.830  13.872 28.449  1.00 82.64  ? 944  GLU A CG  1 
ATOM 7300 C CD  . GLU A 1 947  ? 17.600  14.081 29.768  1.00 82.64  ? 944  GLU A CD  1 
ATOM 7301 O OE1 . GLU A 1 947  ? 18.735  14.607 29.728  1.00 82.64  ? 944  GLU A OE1 1 
ATOM 7302 O OE2 . GLU A 1 947  ? 17.079  13.731 30.854  1.00 82.64  ? 944  GLU A OE2 1 
ATOM 7303 N N   . ILE A 1 948  ? 14.998  13.368 25.025  1.00 58.97  ? 945  ILE A N   1 
ATOM 7304 C CA  . ILE A 1 948  ? 15.667  13.311 23.718  1.00 58.97  ? 945  ILE A CA  1 
ATOM 7305 C C   . ILE A 1 948  ? 17.062  13.949 23.677  1.00 58.97  ? 945  ILE A C   1 
ATOM 7306 O O   . ILE A 1 948  ? 17.964  13.408 23.045  1.00 58.97  ? 945  ILE A O   1 
ATOM 7307 C CB  . ILE A 1 948  ? 14.822  13.930 22.614  1.00 62.95  ? 945  ILE A CB  1 
ATOM 7308 C CG1 . ILE A 1 948  ? 13.679  12.985 22.240  1.00 62.95  ? 945  ILE A CG1 1 
ATOM 7309 C CG2 . ILE A 1 948  ? 15.674  14.211 21.384  1.00 62.95  ? 945  ILE A CG2 1 
ATOM 7310 C CD1 . ILE A 1 948  ? 12.408  13.724 21.757  1.00 62.95  ? 945  ILE A CD1 1 
ATOM 7311 N N   . ALA A 1 949  ? 17.242  15.082 24.349  1.00 64.28  ? 946  ALA A N   1 
ATOM 7312 C CA  . ALA A 1 949  ? 18.510  15.810 24.277  1.00 64.28  ? 946  ALA A CA  1 
ATOM 7313 C C   . ALA A 1 949  ? 18.548  17.013 25.217  1.00 64.28  ? 946  ALA A C   1 
ATOM 7314 O O   . ALA A 1 949  ? 17.530  17.666 25.436  1.00 64.28  ? 946  ALA A O   1 
ATOM 7315 C CB  . ALA A 1 949  ? 18.789  16.276 22.816  1.00 47.95  ? 946  ALA A CB  1 
ATOM 7316 N N   . ARG A 1 950  ? 19.722  17.314 25.760  1.00 55.44  ? 947  ARG A N   1 
ATOM 7317 C CA  . ARG A 1 950  ? 19.907  18.596 26.421  1.00 55.44  ? 947  ARG A CA  1 
ATOM 7318 C C   . ARG A 1 950  ? 20.999  19.423 25.749  1.00 55.44  ? 947  ARG A C   1 
ATOM 7319 O O   . ARG A 1 950  ? 21.359  19.191 24.588  1.00 55.44  ? 947  ARG A O   1 
ATOM 7320 C CB  . ARG A 1 950  ? 20.168  18.442 27.918  1.00 68.77  ? 947  ARG A CB  1 
ATOM 7321 C CG  . ARG A 1 950  ? 21.386  17.678 28.203  1.00 68.77  ? 947  ARG A CG  1 
ATOM 7322 C CD  . ARG A 1 950  ? 21.402  17.219 29.600  1.00 68.77  ? 947  ARG A CD  1 
ATOM 7323 N NE  . ARG A 1 950  ? 21.908  18.277 30.444  1.00 68.77  ? 947  ARG A NE  1 
ATOM 7324 C CZ  . ARG A 1 950  ? 22.409  18.091 31.659  1.00 68.77  ? 947  ARG A CZ  1 
ATOM 7325 N NH1 . ARG A 1 950  ? 22.482  16.862 32.171  1.00 68.77  ? 947  ARG A NH1 1 
ATOM 7326 N NH2 . ARG A 1 950  ? 22.824  19.143 32.364  1.00 68.77  ? 947  ARG A NH2 1 
ATOM 7327 N N   . ASP A 1 951  ? 21.476  20.421 26.479  1.00 51.86  ? 948  ASP A N   1 
ATOM 7328 C CA  . ASP A 1 951  ? 22.530  21.281 26.027  1.00 51.86  ? 948  ASP A CA  1 
ATOM 7329 C C   . ASP A 1 951  ? 23.410  21.474 27.231  1.00 51.86  ? 948  ASP A C   1 
ATOM 7330 O O   . ASP A 1 951  ? 22.976  21.864 28.318  1.00 51.86  ? 948  ASP A O   1 
ATOM 7331 C CB  . ASP A 1 951  ? 21.964  22.593 25.530  1.00 61.38  ? 948  ASP A CB  1 
ATOM 7332 C CG  . ASP A 1 951  ? 23.027  23.613 25.228  1.00 61.38  ? 948  ASP A CG  1 
ATOM 7333 O OD1 . ASP A 1 951  ? 24.139  23.556 25.813  1.00 61.38  ? 948  ASP A OD1 1 
ATOM 7334 O OD2 . ASP A 1 951  ? 22.724  24.500 24.407  1.00 61.38  ? 948  ASP A OD2 1 
ATOM 7335 N N   . PHE A 1 952  ? 24.671  21.177 27.033  1.00 58.13  ? 949  PHE A N   1 
ATOM 7336 C CA  . PHE A 1 952  ? 25.534  20.980 28.159  1.00 58.13  ? 949  PHE A CA  1 
ATOM 7337 C C   . PHE A 1 952  ? 26.298  22.258 28.483  1.00 58.13  ? 949  PHE A C   1 
ATOM 7338 O O   . PHE A 1 952  ? 27.370  22.220 29.129  1.00 58.13  ? 949  PHE A O   1 
ATOM 7339 C CB  . PHE A 1 952  ? 26.422  19.737 27.925  1.00 65.30  ? 949  PHE A CB  1 
ATOM 7340 C CG  . PHE A 1 952  ? 25.667  18.397 28.033  1.00 65.30  ? 949  PHE A CG  1 
ATOM 7341 C CD1 . PHE A 1 952  ? 24.921  17.907 26.966  1.00 65.30  ? 949  PHE A CD1 1 
ATOM 7342 C CD2 . PHE A 1 952  ? 25.713  17.641 29.220  1.00 65.30  ? 949  PHE A CD2 1 
ATOM 7343 C CE1 . PHE A 1 952  ? 24.242  16.695 27.072  1.00 65.30  ? 949  PHE A CE1 1 
ATOM 7344 C CE2 . PHE A 1 952  ? 25.027  16.425 29.337  1.00 65.30  ? 949  PHE A CE2 1 
ATOM 7345 C CZ  . PHE A 1 952  ? 24.301  15.948 28.258  1.00 65.30  ? 949  PHE A CZ  1 
ATOM 7346 N N   . ASN A 1 953  ? 25.724  23.402 28.075  1.00 50.94  ? 950  ASN A N   1 
ATOM 7347 C CA  . ASN A 1 953  ? 26.269  24.695 28.520  1.00 50.94  ? 950  ASN A CA  1 
ATOM 7348 C C   . ASN A 1 953  ? 25.654  25.214 29.829  1.00 50.94  ? 950  ASN A C   1 
ATOM 7349 O O   . ASN A 1 953  ? 24.542  24.805 30.193  1.00 50.94  ? 950  ASN A O   1 
ATOM 7350 C CB  . ASN A 1 953  ? 26.221  25.714 27.411  1.00 63.81  ? 950  ASN A CB  1 
ATOM 7351 C CG  . ASN A 1 953  ? 27.224  25.424 26.340  1.00 63.81  ? 950  ASN A CG  1 
ATOM 7352 O OD1 . ASN A 1 953  ? 26.879  24.926 25.266  1.00 63.81  ? 950  ASN A OD1 1 
ATOM 7353 N ND2 . ASN A 1 953  ? 28.488  25.711 26.627  1.00 63.81  ? 950  ASN A ND2 1 
ATOM 7354 N N   . PRO A 1 954  ? 26.384  26.091 30.567  1.00 59.74  ? 951  PRO A N   1 
ATOM 7355 C CA  . PRO A 1 954  ? 25.916  26.466 31.908  1.00 59.74  ? 951  PRO A CA  1 
ATOM 7356 C C   . PRO A 1 954  ? 25.105  27.762 31.899  1.00 59.74  ? 951  PRO A C   1 
ATOM 7357 O O   . PRO A 1 954  ? 25.337  28.671 32.711  1.00 59.74  ? 951  PRO A O   1 
ATOM 7358 C CB  . PRO A 1 954  ? 27.227  26.618 32.688  1.00 45.78  ? 951  PRO A CB  1 
ATOM 7359 C CG  . PRO A 1 954  ? 28.306  26.882 31.614  1.00 45.78  ? 951  PRO A CG  1 
ATOM 7360 C CD  . PRO A 1 954  ? 27.657  26.762 30.253  1.00 45.78  ? 951  PRO A CD  1 
ATOM 7361 N N   . ASN A 1 955  ? 24.143  27.820 30.979  1.00 40.25  ? 952  ASN A N   1 
ATOM 7362 C CA  . ASN A 1 955  ? 23.273  29.007 30.792  1.00 40.25  ? 952  ASN A CA  1 
ATOM 7363 C C   . ASN A 1 955  ? 22.191  29.247 31.857  1.00 40.25  ? 952  ASN A C   1 
ATOM 7364 O O   . ASN A 1 955  ? 21.272  28.448 32.003  1.00 40.25  ? 952  ASN A O   1 
ATOM 7365 C CB  . ASN A 1 955  ? 22.641  28.932 29.409  1.00 47.45  ? 952  ASN A CB  1 
ATOM 7366 C CG  . ASN A 1 955  ? 23.644  29.188 28.301  1.00 47.45  ? 952  ASN A CG  1 
ATOM 7367 O OD1 . ASN A 1 955  ? 24.399  30.156 28.366  1.00 47.45  ? 952  ASN A OD1 1 
ATOM 7368 N ND2 . ASN A 1 955  ? 23.626  28.350 27.263  1.00 47.45  ? 952  ASN A ND2 1 
ATOM 7369 N N   . TRP A 1 956  ? 22.299  30.326 32.620  1.00 43.21  ? 953  TRP A N   1 
ATOM 7370 C CA  . TRP A 1 956  ? 21.214  30.692 33.533  1.00 43.21  ? 953  TRP A CA  1 
ATOM 7371 C C   . TRP A 1 956  ? 20.030  31.337 32.753  1.00 43.21  ? 953  TRP A C   1 
ATOM 7372 O O   . TRP A 1 956  ? 20.015  32.525 32.508  1.00 43.21  ? 953  TRP A O   1 
ATOM 7373 C CB  . TRP A 1 956  ? 21.733  31.651 34.546  1.00 66.07  ? 953  TRP A CB  1 
ATOM 7374 C CG  . TRP A 1 956  ? 22.677  31.063 35.442  1.00 66.07  ? 953  TRP A CG  1 
ATOM 7375 C CD1 . TRP A 1 956  ? 23.921  30.626 35.143  1.00 66.07  ? 953  TRP A CD1 1 
ATOM 7376 C CD2 . TRP A 1 956  ? 22.497  30.861 36.843  1.00 66.07  ? 953  TRP A CD2 1 
ATOM 7377 N NE1 . TRP A 1 956  ? 24.539  30.143 36.274  1.00 66.07  ? 953  TRP A NE1 1 
ATOM 7378 C CE2 . TRP A 1 956  ? 23.687  30.283 37.335  1.00 66.07  ? 953  TRP A CE2 1 
ATOM 7379 C CE3 . TRP A 1 956  ? 21.446  31.115 37.734  1.00 66.07  ? 953  TRP A CE3 1 
ATOM 7380 C CZ2 . TRP A 1 956  ? 23.850  29.934 38.679  1.00 66.07  ? 953  TRP A CZ2 1 
ATOM 7381 C CZ3 . TRP A 1 956  ? 21.608  30.772 39.071  1.00 66.07  ? 953  TRP A CZ3 1 
ATOM 7382 C CH2 . TRP A 1 956  ? 22.803  30.181 39.533  1.00 66.07  ? 953  TRP A CH2 1 
ATOM 7383 N N   . MET A 1 957  ? 19.067  30.518 32.351  1.00 41.75  ? 954  MET A N   1 
ATOM 7384 C CA  . MET A 1 957  ? 17.952  30.909 31.515  1.00 41.75  ? 954  MET A CA  1 
ATOM 7385 C C   . MET A 1 957  ? 16.974  31.877 32.155  1.00 41.75  ? 954  MET A C   1 
ATOM 7386 O O   . MET A 1 957  ? 16.829  31.913 33.365  1.00 41.75  ? 954  MET A O   1 
ATOM 7387 C CB  . MET A 1 957  ? 17.170  29.664 31.103  1.00 40.14  ? 954  MET A CB  1 
ATOM 7388 C CG  . MET A 1 957  ? 18.039  28.584 30.520  1.00 40.14  ? 954  MET A CG  1 
ATOM 7389 S SD  . MET A 1 957  ? 18.960  29.176 29.117  1.00 40.14  ? 954  MET A SD  1 
ATOM 7390 C CE  . MET A 1 957  ? 17.696  29.315 27.888  1.00 40.14  ? 954  MET A CE  1 
ATOM 7391 N N   . SER A 1 958  ? 16.286  32.631 31.299  1.00 41.89  ? 955  SER A N   1 
ATOM 7392 C CA  . SER A 1 958  ? 15.245  33.551 31.734  1.00 41.89  ? 955  SER A CA  1 
ATOM 7393 C C   . SER A 1 958  ? 13.976  33.361 30.904  1.00 41.89  ? 955  SER A C   1 
ATOM 7394 O O   . SER A 1 958  ? 12.865  33.550 31.400  1.00 41.89  ? 955  SER A O   1 
ATOM 7395 C CB  . SER A 1 958  ? 15.737  34.966 31.553  1.00 44.14  ? 955  SER A CB  1 
ATOM 7396 O OG  . SER A 1 958  ? 15.982  35.205 30.196  1.00 44.14  ? 955  SER A OG  1 
ATOM 7397 N N   . ALA A 1 959  ? 14.164  32.955 29.650  1.00 34.10  ? 956  ALA A N   1 
ATOM 7398 C CA  . ALA A 1 959  ? 13.079  32.713 28.751  1.00 34.10  ? 956  ALA A CA  1 
ATOM 7399 C C   . ALA A 1 959  ? 13.460  31.644 27.758  1.00 34.10  ? 956  ALA A C   1 
ATOM 7400 O O   . ALA A 1 959  ? 14.620  31.388 27.572  1.00 34.10  ? 956  ALA A O   1 
ATOM 7401 C CB  . ALA A 1 959  ? 12.744  33.970 28.047  1.00 52.33  ? 956  ALA A CB  1 
ATOM 7402 N N   . VAL A 1 960  ? 12.487  31.070 27.060  1.00 42.11  ? 957  VAL A N   1 
ATOM 7403 C CA  . VAL A 1 960  ? 12.707  29.843 26.308  1.00 42.11  ? 957  VAL A CA  1 
ATOM 7404 C C   . VAL A 1 960  ? 11.555  29.662 25.357  1.00 42.11  ? 957  VAL A C   1 
ATOM 7405 O O   . VAL A 1 960  ? 10.406  29.738 25.765  1.00 42.11  ? 957  VAL A O   1 
ATOM 7406 C CB  . VAL A 1 960  ? 12.757  28.631 27.314  1.00 45.81  ? 957  VAL A CB  1 
ATOM 7407 C CG1 . VAL A 1 960  ? 11.797  27.461 26.959  1.00 45.81  ? 957  VAL A CG1 1 
ATOM 7408 C CG2 . VAL A 1 960  ? 14.175  28.167 27.558  1.00 45.81  ? 957  VAL A CG2 1 
ATOM 7409 N N   . GLU A 1 961  ? 11.818  29.419 24.091  1.00 56.59  ? 958  GLU A N   1 
ATOM 7410 C CA  . GLU A 1 961  ? 10.717  29.255 23.167  1.00 56.59  ? 958  GLU A CA  1 
ATOM 7411 C C   . GLU A 1 961  ? 11.045  28.193 22.138  1.00 56.59  ? 958  GLU A C   1 
ATOM 7412 O O   . GLU A 1 961  ? 12.216  27.969 21.813  1.00 56.59  ? 958  GLU A O   1 
ATOM 7413 C CB  . GLU A 1 961  ? 10.450  30.576 22.464  1.00 53.38  ? 958  GLU A CB  1 
ATOM 7414 C CG  . GLU A 1 961  ? 9.236   30.597 21.508  1.00 53.38  ? 958  GLU A CG  1 
ATOM 7415 C CD  . GLU A 1 961  ? 7.945   30.248 22.241  1.00 53.38  ? 958  GLU A CD  1 
ATOM 7416 O OE1 . GLU A 1 961  ? 7.452   29.094 22.023  1.00 53.38  ? 958  GLU A OE1 1 
ATOM 7417 O OE2 . GLU A 1 961  ? 7.463   31.115 23.058  1.00 53.38  ? 958  GLU A OE2 1 
ATOM 7418 N N   . ILE A 1 962  ? 10.025  27.535 21.613  1.00 48.81  ? 959  ILE A N   1 
ATOM 7419 C CA  . ILE A 1 962  ? 10.250  26.653 20.508  1.00 48.81  ? 959  ILE A CA  1 
ATOM 7420 C C   . ILE A 1 962  ? 9.962   27.449 19.237  1.00 48.81  ? 959  ILE A C   1 
ATOM 7421 O O   . ILE A 1 962  ? 8.881   28.003 19.097  1.00 48.81  ? 959  ILE A O   1 
ATOM 7422 C CB  . ILE A 1 962  ? 9.381   25.390 20.635  1.00 44.55  ? 959  ILE A CB  1 
ATOM 7423 C CG1 . ILE A 1 962  ? 9.859   24.552 21.845  1.00 44.55  ? 959  ILE A CG1 1 
ATOM 7424 C CG2 . ILE A 1 962  ? 9.421   24.584 19.343  1.00 44.55  ? 959  ILE A CG2 1 
ATOM 7425 C CD1 . ILE A 1 962  ? 8.833   23.615 22.459  1.00 44.55  ? 959  ILE A CD1 1 
ATOM 7426 N N   . LEU A 1 963  ? 10.922  27.534 18.314  1.00 62.79  ? 960  LEU A N   1 
ATOM 7427 C CA  . LEU A 1 963  ? 10.614  28.137 17.010  1.00 62.79  ? 960  LEU A CA  1 
ATOM 7428 C C   . LEU A 1 963  ? 10.108  27.116 15.973  1.00 62.79  ? 960  LEU A C   1 
ATOM 7429 O O   . LEU A 1 963  ? 9.179   27.394 15.205  1.00 62.79  ? 960  LEU A O   1 
ATOM 7430 C CB  . LEU A 1 963  ? 11.804  28.885 16.449  1.00 41.59  ? 960  LEU A CB  1 
ATOM 7431 C CG  . LEU A 1 963  ? 12.743  29.559 17.442  1.00 41.59  ? 960  LEU A CG  1 
ATOM 7432 C CD1 . LEU A 1 963  ? 14.088  29.755 16.767  1.00 41.59  ? 960  LEU A CD1 1 
ATOM 7433 C CD2 . LEU A 1 963  ? 12.177  30.900 18.031  1.00 41.59  ? 960  LEU A CD2 1 
ATOM 7434 N N   . ASP A 1 964  ? 10.735  25.946 15.928  1.00 69.42  ? 961  ASP A N   1 
ATOM 7435 C CA  . ASP A 1 964  ? 10.224  24.864 15.115  1.00 69.42  ? 961  ASP A CA  1 
ATOM 7436 C C   . ASP A 1 964  ? 10.689  23.538 15.707  1.00 69.42  ? 961  ASP A C   1 
ATOM 7437 O O   . ASP A 1 964  ? 11.341  23.520 16.766  1.00 69.42  ? 961  ASP A O   1 
ATOM 7438 C CB  . ASP A 1 964  ? 10.629  25.032 13.644  1.00 80.03  ? 961  ASP A CB  1 
ATOM 7439 C CG  . ASP A 1 964  ? 12.125  24.942 13.428  1.00 80.03  ? 961  ASP A CG  1 
ATOM 7440 O OD1 . ASP A 1 964  ? 12.631  25.694 12.561  1.00 80.03  ? 961  ASP A OD1 1 
ATOM 7441 O OD2 . ASP A 1 964  ? 12.794  24.122 14.103  1.00 80.03  ? 961  ASP A OD2 1 
ATOM 7442 N N   . ASP A 1 965  ? 10.362  22.444 15.018  1.00 62.05  ? 962  ASP A N   1 
ATOM 7443 C CA  . ASP A 1 965  ? 10.590  21.092 15.526  1.00 62.05  ? 962  ASP A CA  1 
ATOM 7444 C C   . ASP A 1 965  ? 12.049  20.832 15.879  1.00 62.05  ? 962  ASP A C   1 
ATOM 7445 O O   . ASP A 1 965  ? 12.369  19.889 16.614  1.00 62.05  ? 962  ASP A O   1 
ATOM 7446 C CB  . ASP A 1 965  ? 10.132  20.057 14.496  1.00 117.83 ? 962  ASP A CB  1 
ATOM 7447 C CG  . ASP A 1 965  ? 8.681   20.222 14.110  1.00 117.83 ? 962  ASP A CG  1 
ATOM 7448 O OD1 . ASP A 1 965  ? 8.297   21.331 13.673  1.00 117.83 ? 962  ASP A OD1 1 
ATOM 7449 O OD2 . ASP A 1 965  ? 7.930   19.234 14.236  1.00 117.83 ? 962  ASP A OD2 1 
ATOM 7450 N N   . ASP A 1 966  ? 12.934  21.664 15.337  1.00 95.15  ? 963  ASP A N   1 
ATOM 7451 C CA  . ASP A 1 966  ? 14.360  21.489 15.545  1.00 95.15  ? 963  ASP A CA  1 
ATOM 7452 C C   . ASP A 1 966  ? 14.960  22.666 16.308  1.00 95.15  ? 963  ASP A C   1 
ATOM 7453 O O   . ASP A 1 966  ? 15.863  22.470 17.113  1.00 95.15  ? 963  ASP A O   1 
ATOM 7454 C CB  . ASP A 1 966  ? 15.081  21.241 14.209  1.00 123.58 ? 963  ASP A CB  1 
ATOM 7455 C CG  . ASP A 1 966  ? 14.535  20.016 13.453  1.00 123.58 ? 963  ASP A CG  1 
ATOM 7456 O OD1 . ASP A 1 966  ? 14.810  18.869 13.867  1.00 123.58 ? 963  ASP A OD1 1 
ATOM 7457 O OD2 . ASP A 1 966  ? 13.839  20.201 12.428  1.00 123.58 ? 963  ASP A OD2 1 
ATOM 7458 N N   . ASN A 1 967  ? 14.433  23.873 16.092  1.00 75.44  ? 964  ASN A N   1 
ATOM 7459 C CA  . ASN A 1 967  ? 15.043  25.082 16.658  1.00 75.44  ? 964  ASN A CA  1 
ATOM 7460 C C   . ASN A 1 967  ? 14.506  25.572 17.978  1.00 75.44  ? 964  ASN A C   1 
ATOM 7461 O O   . ASN A 1 967  ? 13.312  25.858 18.119  1.00 75.44  ? 964  ASN A O   1 
ATOM 7462 C CB  . ASN A 1 967  ? 15.058  26.223 15.646  1.00 82.74  ? 964  ASN A CB  1 
ATOM 7463 C CG  . ASN A 1 967  ? 16.308  26.217 14.818  1.00 82.74  ? 964  ASN A CG  1 
ATOM 7464 O OD1 . ASN A 1 967  ? 17.197  25.396 15.051  1.00 82.74  ? 964  ASN A OD1 1 
ATOM 7465 N ND2 . ASN A 1 967  ? 16.397  27.124 13.846  1.00 82.74  ? 964  ASN A ND2 1 
ATOM 7466 N N   . PHE A 1 968  ? 15.422  25.694 18.931  1.00 41.56  ? 965  PHE A N   1 
ATOM 7467 C CA  . PHE A 1 968  ? 15.078  26.142 20.271  1.00 41.56  ? 965  PHE A CA  1 
ATOM 7468 C C   . PHE A 1 968  ? 15.794  27.416 20.735  1.00 41.56  ? 965  PHE A C   1 
ATOM 7469 O O   . PHE A 1 968  ? 17.012  27.430 20.933  1.00 41.56  ? 965  PHE A O   1 
ATOM 7470 C CB  . PHE A 1 968  ? 15.262  24.994 21.250  1.00 40.68  ? 965  PHE A CB  1 
ATOM 7471 C CG  . PHE A 1 968  ? 14.619  23.736 20.775  1.00 40.68  ? 965  PHE A CG  1 
ATOM 7472 C CD1 . PHE A 1 968  ? 15.380  22.558 20.596  1.00 40.68  ? 965  PHE A CD1 1 
ATOM 7473 C CD2 . PHE A 1 968  ? 13.250  23.723 20.447  1.00 40.68  ? 965  PHE A CD2 1 
ATOM 7474 C CE1 . PHE A 1 968  ? 14.779  21.368 20.131  1.00 40.68  ? 965  PHE A CE1 1 
ATOM 7475 C CE2 . PHE A 1 968  ? 12.630  22.575 19.982  1.00 40.68  ? 965  PHE A CE2 1 
ATOM 7476 C CZ  . PHE A 1 968  ? 13.389  21.394 19.816  1.00 40.68  ? 965  PHE A CZ  1 
ATOM 7477 N N   . LEU A 1 969  ? 15.008  28.488 20.887  1.00 44.10  ? 966  LEU A N   1 
ATOM 7478 C CA  . LEU A 1 969  ? 15.519  29.789 21.304  1.00 44.10  ? 966  LEU A CA  1 
ATOM 7479 C C   . LEU A 1 969  ? 15.539  29.869 22.788  1.00 44.10  ? 966  LEU A C   1 
ATOM 7480 O O   . LEU A 1 969  ? 14.652  29.367 23.454  1.00 44.10  ? 966  LEU A O   1 
ATOM 7481 C CB  . LEU A 1 969  ? 14.614  30.901 20.819  1.00 42.28  ? 966  LEU A CB  1 
ATOM 7482 C CG  . LEU A 1 969  ? 15.358  32.155 20.335  1.00 42.28  ? 966  LEU A CG  1 
ATOM 7483 C CD1 . LEU A 1 969  ? 14.368  33.303 20.176  1.00 42.28  ? 966  LEU A CD1 1 
ATOM 7484 C CD2 . LEU A 1 969  ? 16.517  32.566 21.211  1.00 42.28  ? 966  LEU A CD2 1 
ATOM 7485 N N   . GLY A 1 970  ? 16.551  30.531 23.302  1.00 45.98  ? 967  GLY A N   1 
ATOM 7486 C CA  . GLY A 1 970  ? 16.683  30.731 24.720  1.00 45.98  ? 967  GLY A CA  1 
ATOM 7487 C C   . GLY A 1 970  ? 17.236  32.126 24.849  1.00 45.98  ? 967  GLY A C   1 
ATOM 7488 O O   . GLY A 1 970  ? 17.942  32.588 23.938  1.00 45.98  ? 967  GLY A O   1 
ATOM 7489 N N   . ALA A 1 971  ? 16.853  32.798 25.944  1.00 39.77  ? 968  ALA A N   1 
ATOM 7490 C CA  . ALA A 1 971  ? 17.415  34.055 26.391  1.00 39.77  ? 968  ALA A CA  1 
ATOM 7491 C C   . ALA A 1 971  ? 18.102  33.765 27.705  1.00 39.77  ? 968  ALA A C   1 
ATOM 7492 O O   . ALA A 1 971  ? 17.694  32.833 28.389  1.00 39.77  ? 968  ALA A O   1 
ATOM 7493 C CB  . ALA A 1 971  ? 16.292  35.013 26.628  1.00 46.18  ? 968  ALA A CB  1 
ATOM 7494 N N   . GLU A 1 972  ? 19.080  34.473 28.145  1.00 30.15  ? 969  GLU A N   1 
ATOM 7495 C CA  . GLU A 1 972  ? 19.527  33.988 29.400  1.00 30.15  ? 969  GLU A CA  1 
ATOM 7496 C C   . GLU A 1 972  ? 19.890  35.044 30.370  1.00 30.15  ? 969  GLU A C   1 
ATOM 7497 O O   . GLU A 1 972  ? 19.054  35.671 30.893  1.00 30.15  ? 969  GLU A O   1 
ATOM 7498 C CB  . GLU A 1 972  ? 20.628  32.975 29.185  1.00 57.06  ? 969  GLU A CB  1 
ATOM 7499 C CG  . GLU A 1 972  ? 21.882  33.299 29.818  1.00 57.06  ? 969  GLU A CG  1 
ATOM 7500 C CD  . GLU A 1 972  ? 22.636  34.247 29.009  1.00 57.06  ? 969  GLU A CD  1 
ATOM 7501 O OE1 . GLU A 1 972  ? 22.720  34.029 27.817  1.00 57.06  ? 969  GLU A OE1 1 
ATOM 7502 O OE2 . GLU A 1 972  ? 23.128  35.219 29.556  1.00 57.06  ? 969  GLU A OE2 1 
ATOM 7503 N N   . ASN A 1 973  ? 21.118  35.289 30.670  1.00 48.63  ? 970  ASN A N   1 
ATOM 7504 C CA  . ASN A 1 973  ? 21.192  36.299 31.643  1.00 48.63  ? 970  ASN A CA  1 
ATOM 7505 C C   . ASN A 1 973  ? 22.190  37.338 31.584  1.00 48.63  ? 970  ASN A C   1 
ATOM 7506 O O   . ASN A 1 973  ? 22.278  38.165 32.467  1.00 48.63  ? 970  ASN A O   1 
ATOM 7507 C CB  . ASN A 1 973  ? 21.343  35.644 33.006  1.00 104.30 ? 970  ASN A CB  1 
ATOM 7508 C CG  . ASN A 1 973  ? 20.029  35.312 33.655  1.00 104.30 ? 970  ASN A CG  1 
ATOM 7509 O OD1 . ASN A 1 973  ? 18.990  35.741 33.218  1.00 104.30 ? 970  ASN A OD1 1 
ATOM 7510 N ND2 . ASN A 1 973  ? 20.079  34.556 34.727  1.00 104.30 ? 970  ASN A ND2 1 
ATOM 7511 N N   . ALA A 1 974  ? 22.976  37.224 30.552  1.00 48.83  ? 971  ALA A N   1 
ATOM 7512 C CA  . ALA A 1 974  ? 24.001  38.139 30.335  1.00 48.83  ? 971  ALA A CA  1 
ATOM 7513 C C   . ALA A 1 974  ? 23.391  38.962 29.295  1.00 48.83  ? 971  ALA A C   1 
ATOM 7514 O O   . ALA A 1 974  ? 24.006  39.884 28.884  1.00 48.83  ? 971  ALA A O   1 
ATOM 7515 C CB  . ALA A 1 974  ? 25.163  37.477 29.842  1.00 28.24  ? 971  ALA A CB  1 
ATOM 7516 N N   . PHE A 1 975  ? 22.172  38.612 28.906  1.00 42.91  ? 972  PHE A N   1 
ATOM 7517 C CA  . PHE A 1 975  ? 21.418  39.328 27.918  1.00 42.91  ? 972  PHE A CA  1 
ATOM 7518 C C   . PHE A 1 975  ? 21.760  38.764 26.612  1.00 42.91  ? 972  PHE A C   1 
ATOM 7519 O O   . PHE A 1 975  ? 21.832  39.435 25.604  1.00 42.91  ? 972  PHE A O   1 
ATOM 7520 C CB  . PHE A 1 975  ? 21.854  40.752 28.004  1.00 29.07  ? 972  PHE A CB  1 
ATOM 7521 C CG  . PHE A 1 975  ? 21.752  41.297 29.365  1.00 29.07  ? 972  PHE A CG  1 
ATOM 7522 C CD1 . PHE A 1 975  ? 22.788  41.920 29.954  1.00 29.07  ? 972  PHE A CD1 1 
ATOM 7523 C CD2 . PHE A 1 975  ? 20.616  41.174 30.059  1.00 29.07  ? 972  PHE A CD2 1 
ATOM 7524 C CE1 . PHE A 1 975  ? 22.672  42.385 31.187  1.00 29.07  ? 972  PHE A CE1 1 
ATOM 7525 C CE2 . PHE A 1 975  ? 20.518  41.657 31.275  1.00 29.07  ? 972  PHE A CE2 1 
ATOM 7526 C CZ  . PHE A 1 975  ? 21.535  42.254 31.837  1.00 29.07  ? 972  PHE A CZ  1 
ATOM 7527 N N   . ASN A 1 976  ? 21.956  37.477 26.623  1.00 48.94  ? 973  ASN A N   1 
ATOM 7528 C CA  . ASN A 1 976  ? 22.385  36.833 25.391  1.00 48.94  ? 973  ASN A CA  1 
ATOM 7529 C C   . ASN A 1 976  ? 21.277  35.932 24.874  1.00 48.94  ? 973  ASN A C   1 
ATOM 7530 O O   . ASN A 1 976  ? 20.568  35.337 25.616  1.00 48.94  ? 973  ASN A O   1 
ATOM 7531 C CB  . ASN A 1 976  ? 23.698  36.044 25.592  1.00 34.08  ? 973  ASN A CB  1 
ATOM 7532 C CG  . ASN A 1 976  ? 24.923  36.943 25.859  1.00 34.08  ? 973  ASN A CG  1 
ATOM 7533 O OD1 . ASN A 1 976  ? 25.142  37.933 25.166  1.00 34.08  ? 973  ASN A OD1 1 
ATOM 7534 N ND2 . ASN A 1 976  ? 25.739  36.566 26.835  1.00 34.08  ? 973  ASN A ND2 1 
ATOM 7535 N N   . LEU A 1 977  ? 21.108  35.876 23.579  1.00 44.19  ? 974  LEU A N   1 
ATOM 7536 C CA  . LEU A 1 977  ? 20.228  34.911 22.968  1.00 44.19  ? 974  LEU A CA  1 
ATOM 7537 C C   . LEU A 1 977  ? 21.082  33.789 22.426  1.00 44.19  ? 974  LEU A C   1 
ATOM 7538 O O   . LEU A 1 977  ? 22.305  33.971 22.164  1.00 44.19  ? 974  LEU A O   1 
ATOM 7539 C CB  . LEU A 1 977  ? 19.522  35.539 21.800  1.00 56.03  ? 974  LEU A CB  1 
ATOM 7540 C CG  . LEU A 1 977  ? 18.565  36.597 22.234  1.00 56.03  ? 974  LEU A CG  1 
ATOM 7541 C CD1 . LEU A 1 977  ? 17.712  36.918 21.069  1.00 56.03  ? 974  LEU A CD1 1 
ATOM 7542 C CD2 . LEU A 1 977  ? 17.758  35.993 23.344  1.00 56.03  ? 974  LEU A CD2 1 
ATOM 7543 N N   . PHE A 1 978  ? 20.448  32.629 22.237  1.00 43.69  ? 975  PHE A N   1 
ATOM 7544 C CA  . PHE A 1 978  ? 21.121  31.494 21.625  1.00 43.69  ? 975  PHE A CA  1 
ATOM 7545 C C   . PHE A 1 978  ? 20.132  30.494 21.094  1.00 43.69  ? 975  PHE A C   1 
ATOM 7546 O O   . PHE A 1 978  ? 19.049  30.280 21.638  1.00 43.69  ? 975  PHE A O   1 
ATOM 7547 C CB  . PHE A 1 978  ? 22.083  30.823 22.597  1.00 43.32  ? 975  PHE A CB  1 
ATOM 7548 C CG  . PHE A 1 978  ? 21.411  30.134 23.730  1.00 43.32  ? 975  PHE A CG  1 
ATOM 7549 C CD1 . PHE A 1 978  ? 20.967  28.819 23.601  1.00 43.32  ? 975  PHE A CD1 1 
ATOM 7550 C CD2 . PHE A 1 978  ? 21.218  30.783 24.927  1.00 43.32  ? 975  PHE A CD2 1 
ATOM 7551 C CE1 . PHE A 1 978  ? 20.333  28.165 24.645  1.00 43.32  ? 975  PHE A CE1 1 
ATOM 7552 C CE2 . PHE A 1 978  ? 20.583  30.117 25.999  1.00 43.32  ? 975  PHE A CE2 1 
ATOM 7553 C CZ  . PHE A 1 978  ? 20.156  28.803 25.840  1.00 43.32  ? 975  PHE A CZ  1 
ATOM 7554 N N   . VAL A 1 979  ? 20.492  29.867 20.004  1.00 47.71  ? 976  VAL A N   1 
ATOM 7555 C CA  . VAL A 1 979  ? 19.580  28.910 19.467  1.00 47.71  ? 976  VAL A CA  1 
ATOM 7556 C C   . VAL A 1 979  ? 20.222  27.541 19.610  1.00 47.71  ? 976  VAL A C   1 
ATOM 7557 O O   . VAL A 1 979  ? 21.437  27.427 19.643  1.00 47.71  ? 976  VAL A O   1 
ATOM 7558 C CB  . VAL A 1 979  ? 19.213  29.310 18.073  1.00 34.48  ? 976  VAL A CB  1 
ATOM 7559 C CG1 . VAL A 1 979  ? 18.392  28.243 17.392  1.00 34.48  ? 976  VAL A CG1 1 
ATOM 7560 C CG2 . VAL A 1 979  ? 18.454  30.597 18.122  1.00 34.48  ? 976  VAL A CG2 1 
ATOM 7561 N N   . CYS A 1 980  ? 19.390  26.531 19.794  1.00 50.77  ? 977  CYS A N   1 
ATOM 7562 C CA  . CYS A 1 980  ? 19.838  25.172 19.900  1.00 50.77  ? 977  CYS A CA  1 
ATOM 7563 C C   . CYS A 1 980  ? 19.126  24.358 18.866  1.00 50.77  ? 977  CYS A C   1 
ATOM 7564 O O   . CYS A 1 980  ? 17.971  24.656 18.538  1.00 50.77  ? 977  CYS A O   1 
ATOM 7565 C CB  . CYS A 1 980  ? 19.473  24.625 21.246  1.00 59.55  ? 977  CYS A CB  1 
ATOM 7566 S SG  . CYS A 1 980  ? 20.685  25.047 22.463  1.00 59.55  ? 977  CYS A SG  1 
ATOM 7567 N N   . GLN A 1 981  ? 19.811  23.355 18.326  1.00 69.44  ? 978  GLN A N   1 
ATOM 7568 C CA  . GLN A 1 981  ? 19.118  22.326 17.571  1.00 69.44  ? 978  GLN A CA  1 
ATOM 7569 C C   . GLN A 1 981  ? 19.719  20.941 17.727  1.00 69.44  ? 978  GLN A C   1 
ATOM 7570 O O   . GLN A 1 981  ? 20.835  20.788 18.250  1.00 69.44  ? 978  GLN A O   1 
ATOM 7571 C CB  . GLN A 1 981  ? 18.935  22.699 16.113  1.00 58.19  ? 978  GLN A CB  1 
ATOM 7572 C CG  . GLN A 1 981  ? 20.175  23.060 15.374  1.00 58.19  ? 978  GLN A CG  1 
ATOM 7573 C CD  . GLN A 1 981  ? 19.824  23.533 13.986  1.00 58.19  ? 978  GLN A CD  1 
ATOM 7574 O OE1 . GLN A 1 981  ? 20.100  22.850 13.008  1.00 58.19  ? 978  GLN A OE1 1 
ATOM 7575 N NE2 . GLN A 1 981  ? 19.165  24.676 13.889  1.00 58.19  ? 978  GLN A NE2 1 
ATOM 7576 N N   . LYS A 1 982  ? 18.940  19.940 17.312  1.00 68.39  ? 979  LYS A N   1 
ATOM 7577 C CA  . LYS A 1 982  ? 19.351  18.545 17.404  1.00 68.39  ? 979  LYS A CA  1 
ATOM 7578 C C   . LYS A 1 982  ? 20.388  18.228 16.332  1.00 68.39  ? 979  LYS A C   1 
ATOM 7579 O O   . LYS A 1 982  ? 20.249  18.622 15.166  1.00 68.39  ? 979  LYS A O   1 
ATOM 7580 C CB  . LYS A 1 982  ? 18.157  17.589 17.309  1.00 101.20 ? 979  LYS A CB  1 
ATOM 7581 C CG  . LYS A 1 982  ? 17.178  17.909 16.201  1.00 101.20 ? 979  LYS A CG  1 
ATOM 7582 C CD  . LYS A 1 982  ? 15.858  18.382 16.753  1.00 101.20 ? 979  LYS A CD  1 
ATOM 7583 C CE  . LYS A 1 982  ? 14.901  17.215 16.944  1.00 101.20 ? 979  LYS A CE  1 
ATOM 7584 N NZ  . LYS A 1 982  ? 15.313  16.352 18.084  1.00 101.20 ? 979  LYS A NZ  1 
ATOM 7585 N N   . ASP A 1 983  ? 21.417  17.503 16.750  1.00 164.51 ? 980  ASP A N   1 
ATOM 7586 C CA  . ASP A 1 983  ? 22.573  17.209 15.929  1.00 164.51 ? 980  ASP A CA  1 
ATOM 7587 C C   . ASP A 1 983  ? 22.306  16.033 14.997  1.00 164.51 ? 980  ASP A C   1 
ATOM 7588 O O   . ASP A 1 983  ? 22.261  14.888 15.446  1.00 164.51 ? 980  ASP A O   1 
ATOM 7589 C CB  . ASP A 1 983  ? 23.737  16.893 16.865  1.00 110.27 ? 980  ASP A CB  1 
ATOM 7590 C CG  . ASP A 1 983  ? 25.029  16.642 16.140  1.00 110.27 ? 980  ASP A CG  1 
ATOM 7591 O OD1 . ASP A 1 983  ? 25.104  16.902 14.918  1.00 110.27 ? 980  ASP A OD1 1 
ATOM 7592 O OD2 . ASP A 1 983  ? 25.978  16.183 16.813  1.00 110.27 ? 980  ASP A OD2 1 
ATOM 7593 N N   . SER A 1 984  ? 22.127  16.314 13.706  1.00 105.71 ? 981  SER A N   1 
ATOM 7594 C CA  . SER A 1 984  ? 22.044  15.247 12.692  1.00 105.71 ? 981  SER A CA  1 
ATOM 7595 C C   . SER A 1 984  ? 23.402  14.530 12.557  1.00 105.71 ? 981  SER A C   1 
ATOM 7596 O O   . SER A 1 984  ? 24.262  14.927 11.761  1.00 105.71 ? 981  SER A O   1 
ATOM 7597 C CB  . SER A 1 984  ? 21.561  15.788 11.338  1.00 125.82 ? 981  SER A CB  1 
ATOM 7598 O OG  . SER A 1 984  ? 20.147  15.900 11.296  1.00 125.82 ? 981  SER A OG  1 
ATOM 7599 N N   . ALA A 1 985  ? 23.581  13.477 13.356  1.00 81.37  ? 982  ALA A N   1 
ATOM 7600 C CA  . ALA A 1 985  ? 24.889  12.856 13.540  1.00 81.37  ? 982  ALA A CA  1 
ATOM 7601 C C   . ALA A 1 985  ? 24.896  11.326 13.732  1.00 81.37  ? 982  ALA A C   1 
ATOM 7602 O O   . ALA A 1 985  ? 24.082  10.740 14.465  1.00 81.37  ? 982  ALA A O   1 
ATOM 7603 C CB  . ALA A 1 985  ? 25.660  13.546 14.665  1.00 85.18  ? 982  ALA A CB  1 
ATOM 7604 N N   . ALA A 1 986  ? 25.841  10.706 13.033  1.00 174.22 ? 983  ALA A N   1 
ATOM 7605 C CA  . ALA A 1 986  ? 26.215  9.317  13.219  1.00 174.22 ? 983  ALA A CA  1 
ATOM 7606 C C   . ALA A 1 986  ? 26.474  9.067  14.698  1.00 174.22 ? 983  ALA A C   1 
ATOM 7607 O O   . ALA A 1 986  ? 26.684  10.017 15.457  1.00 174.22 ? 983  ALA A O   1 
ATOM 7608 C CB  . ALA A 1 986  ? 27.464  9.043  12.417  1.00 56.25  ? 983  ALA A CB  1 
ATOM 7609 N N   . THR A 1 987  ? 26.468  7.797  15.105  1.00 87.97  ? 984  THR A N   1 
ATOM 7610 C CA  . THR A 1 987  ? 26.734  7.417  16.511  1.00 87.97  ? 984  THR A CA  1 
ATOM 7611 C C   . THR A 1 987  ? 25.593  7.901  17.431  1.00 87.97  ? 984  THR A C   1 
ATOM 7612 O O   . THR A 1 987  ? 25.822  8.423  18.545  1.00 87.97  ? 984  THR A O   1 
ATOM 7613 C CB  . THR A 1 987  ? 28.127  7.927  17.026  1.00 170.45 ? 984  THR A CB  1 
ATOM 7614 O OG1 . THR A 1 987  ? 28.022  9.282  17.483  1.00 170.45 ? 984  THR A OG1 1 
ATOM 7615 C CG2 . THR A 1 987  ? 29.201  7.838  15.931  1.00 170.45 ? 984  THR A CG2 1 
ATOM 7616 N N   . THR A 1 988  ? 24.372  7.654  16.951  1.00 167.75 ? 985  THR A N   1 
ATOM 7617 C CA  . THR A 1 988  ? 23.145  8.377  17.331  1.00 167.75 ? 985  THR A CA  1 
ATOM 7618 C C   . THR A 1 988  ? 22.585  8.125  18.743  1.00 167.75 ? 985  THR A C   1 
ATOM 7619 O O   . THR A 1 988  ? 21.365  8.037  18.932  1.00 167.75 ? 985  THR A O   1 
ATOM 7620 C CB  . THR A 1 988  ? 22.022  8.156  16.268  1.00 139.91 ? 985  THR A CB  1 
ATOM 7621 O OG1 . THR A 1 988  ? 21.203  7.039  16.636  1.00 139.91 ? 985  THR A OG1 1 
ATOM 7622 C CG2 . THR A 1 988  ? 22.617  7.925  14.876  1.00 139.91 ? 985  THR A CG2 1 
ATOM 7623 N N   . ASP A 1 989  ? 23.477  8.041  19.725  1.00 155.72 ? 986  ASP A N   1 
ATOM 7624 C CA  . ASP A 1 989  ? 23.093  7.896  21.124  1.00 155.72 ? 986  ASP A CA  1 
ATOM 7625 C C   . ASP A 1 989  ? 24.000  8.731  22.021  1.00 155.72 ? 986  ASP A C   1 
ATOM 7626 O O   . ASP A 1 989  ? 24.169  8.444  23.205  1.00 155.72 ? 986  ASP A O   1 
ATOM 7627 C CB  . ASP A 1 989  ? 23.132  6.423  21.533  1.00 110.76 ? 986  ASP A CB  1 
ATOM 7628 C CG  . ASP A 1 989  ? 21.784  5.743  21.389  1.00 110.76 ? 986  ASP A CG  1 
ATOM 7629 O OD1 . ASP A 1 989  ? 21.096  5.966  20.370  1.00 110.76 ? 986  ASP A OD1 1 
ATOM 7630 O OD2 . ASP A 1 989  ? 21.411  4.980  22.305  1.00 110.76 ? 986  ASP A OD2 1 
ATOM 7631 N N   . GLU A 1 990  ? 24.571  9.777  21.440  1.00 85.31  ? 987  GLU A N   1 
ATOM 7632 C CA  . GLU A 1 990  ? 25.548  10.604 22.118  1.00 85.31  ? 987  GLU A CA  1 
ATOM 7633 C C   . GLU A 1 990  ? 25.503  11.975 21.455  1.00 85.31  ? 987  GLU A C   1 
ATOM 7634 O O   . GLU A 1 990  ? 24.933  12.917 21.995  1.00 85.31  ? 987  GLU A O   1 
ATOM 7635 C CB  . GLU A 1 990  ? 26.943  9.973  21.998  1.00 195.54 ? 987  GLU A CB  1 
ATOM 7636 C CG  . GLU A 1 990  ? 28.084  10.794 22.593  1.00 195.54 ? 987  GLU A CG  1 
ATOM 7637 C CD  . GLU A 1 990  ? 27.958  10.983 24.091  1.00 195.54 ? 987  GLU A CD  1 
ATOM 7638 O OE1 . GLU A 1 990  ? 28.104  9.992  24.839  1.00 195.54 ? 987  GLU A OE1 1 
ATOM 7639 O OE2 . GLU A 1 990  ? 27.721  12.131 24.520  1.00 195.54 ? 987  GLU A OE2 1 
ATOM 7640 N N   . GLU A 1 991  ? 26.091  12.071 20.268  1.00 109.04 ? 988  GLU A N   1 
ATOM 7641 C CA  . GLU A 1 991  ? 25.963  13.267 19.456  1.00 109.04 ? 988  GLU A CA  1 
ATOM 7642 C C   . GLU A 1 991  ? 24.473  13.590 19.326  1.00 109.04 ? 988  GLU A C   1 
ATOM 7643 O O   . GLU A 1 991  ? 24.097  14.740 19.143  1.00 109.04 ? 988  GLU A O   1 
ATOM 7644 C CB  . GLU A 1 991  ? 26.613  13.051 18.082  1.00 117.01 ? 988  GLU A CB  1 
ATOM 7645 C CG  . GLU A 1 991  ? 28.099  12.613 18.121  1.00 117.01 ? 988  GLU A CG  1 
ATOM 7646 C CD  . GLU A 1 991  ? 28.748  12.480 16.733  1.00 117.01 ? 988  GLU A CD  1 
ATOM 7647 O OE1 . GLU A 1 991  ? 28.332  13.190 15.787  1.00 117.01 ? 988  GLU A OE1 1 
ATOM 7648 O OE2 . GLU A 1 991  ? 29.689  11.662 16.594  1.00 117.01 ? 988  GLU A OE2 1 
ATOM 7649 N N   . ARG A 1 992  ? 23.643  12.553 19.453  1.00 109.28 ? 989  ARG A N   1 
ATOM 7650 C CA  . ARG A 1 992  ? 22.184  12.658 19.472  1.00 109.28 ? 989  ARG A CA  1 
ATOM 7651 C C   . ARG A 1 992  ? 21.682  13.324 20.755  1.00 109.28 ? 989  ARG A C   1 
ATOM 7652 O O   . ARG A 1 992  ? 20.869  14.250 20.729  1.00 109.28 ? 989  ARG A O   1 
ATOM 7653 C CB  . ARG A 1 992  ? 21.593  11.251 19.382  1.00 159.56 ? 989  ARG A CB  1 
ATOM 7654 C CG  . ARG A 1 992  ? 20.086  11.176 19.203  1.00 159.56 ? 989  ARG A CG  1 
ATOM 7655 C CD  . ARG A 1 992  ? 19.679  11.667 17.827  1.00 159.56 ? 989  ARG A CD  1 
ATOM 7656 N NE  . ARG A 1 992  ? 20.383  10.980 16.741  1.00 159.56 ? 989  ARG A NE  1 
ATOM 7657 C CZ  . ARG A 1 992  ? 20.613  11.508 15.537  1.00 159.56 ? 989  ARG A CZ  1 
ATOM 7658 N NH1 . ARG A 1 992  ? 20.210  12.741 15.250  1.00 159.56 ? 989  ARG A NH1 1 
ATOM 7659 N NH2 . ARG A 1 992  ? 21.258  10.808 14.614  1.00 159.56 ? 989  ARG A NH2 1 
ATOM 7660 N N   . GLN A 1 993  ? 22.188  12.820 21.874  1.00 94.49  ? 990  GLN A N   1 
ATOM 7661 C CA  . GLN A 1 993  ? 21.786  13.222 23.203  1.00 94.49  ? 990  GLN A CA  1 
ATOM 7662 C C   . GLN A 1 993  ? 22.184  14.667 23.497  1.00 94.49  ? 990  GLN A C   1 
ATOM 7663 O O   . GLN A 1 993  ? 21.797  15.226 24.529  1.00 94.49  ? 990  GLN A O   1 
ATOM 7664 C CB  . GLN A 1 993  ? 22.467  12.288 24.206  1.00 134.95 ? 990  GLN A CB  1 
ATOM 7665 C CG  . GLN A 1 993  ? 21.719  12.085 25.502  1.00 134.95 ? 990  GLN A CG  1 
ATOM 7666 C CD  . GLN A 1 993  ? 20.408  11.365 25.304  1.00 134.95 ? 990  GLN A CD  1 
ATOM 7667 O OE1 . GLN A 1 993  ? 19.345  11.906 25.596  1.00 134.95 ? 990  GLN A OE1 1 
ATOM 7668 N NE2 . GLN A 1 993  ? 20.472  10.143 24.792  1.00 134.95 ? 990  GLN A NE2 1 
ATOM 7669 N N   . HIS A 1 994  ? 22.976  15.258 22.600  1.00 89.43  ? 991  HIS A N   1 
ATOM 7670 C CA  . HIS A 1 994  ? 23.554  16.594 22.816  1.00 89.43  ? 991  HIS A CA  1 
ATOM 7671 C C   . HIS A 1 994  ? 23.124  17.530 21.691  1.00 89.43  ? 991  HIS A C   1 
ATOM 7672 O O   . HIS A 1 994  ? 23.417  17.265 20.526  1.00 89.43  ? 991  HIS A O   1 
ATOM 7673 C CB  . HIS A 1 994  ? 25.091  16.524 22.869  1.00 106.03 ? 991  HIS A CB  1 
ATOM 7674 C CG  . HIS A 1 994  ? 25.644  15.824 24.079  1.00 106.03 ? 991  HIS A CG  1 
ATOM 7675 N ND1 . HIS A 1 994  ? 26.709  16.322 24.802  1.00 106.03 ? 991  HIS A ND1 1 
ATOM 7676 C CD2 . HIS A 1 994  ? 25.299  14.658 24.681  1.00 106.03 ? 991  HIS A CD2 1 
ATOM 7677 C CE1 . HIS A 1 994  ? 26.988  15.501 25.801  1.00 106.03 ? 991  HIS A CE1 1 
ATOM 7678 N NE2 . HIS A 1 994  ? 26.146  14.485 25.751  1.00 106.03 ? 991  HIS A NE2 1 
ATOM 7679 N N   . LEU A 1 995  ? 22.408  18.606 22.027  1.00 74.71  ? 992  LEU A N   1 
ATOM 7680 C CA  . LEU A 1 995  ? 22.047  19.610 21.006  1.00 74.71  ? 992  LEU A CA  1 
ATOM 7681 C C   . LEU A 1 995  ? 23.002  20.780 21.034  1.00 74.71  ? 992  LEU A C   1 
ATOM 7682 O O   . LEU A 1 995  ? 23.500  21.164 22.093  1.00 74.71  ? 992  LEU A O   1 
ATOM 7683 C CB  . LEU A 1 995  ? 20.558  20.060 21.008  1.00 63.93  ? 992  LEU A CB  1 
ATOM 7684 C CG  . LEU A 1 995  ? 19.529  20.070 22.153  1.00 63.93  ? 992  LEU A CG  1 
ATOM 7685 C CD1 . LEU A 1 995  ? 19.807  21.071 23.255  1.00 63.93  ? 992  LEU A CD1 1 
ATOM 7686 C CD2 . LEU A 1 995  ? 18.168  20.343 21.538  1.00 63.93  ? 992  LEU A CD2 1 
ATOM 7687 N N   . GLN A 1 996  ? 23.275  21.327 19.857  1.00 55.88  ? 993  GLN A N   1 
ATOM 7688 C CA  . GLN A 1 996  ? 24.321  22.305 19.747  1.00 55.88  ? 993  GLN A CA  1 
ATOM 7689 C C   . GLN A 1 996  ? 23.781  23.719 19.613  1.00 55.88  ? 993  GLN A C   1 
ATOM 7690 O O   . GLN A 1 996  ? 22.919  23.992 18.753  1.00 55.88  ? 993  GLN A O   1 
ATOM 7691 C CB  . GLN A 1 996  ? 25.260  21.972 18.584  1.00 144.88 ? 993  GLN A CB  1 
ATOM 7692 C CG  . GLN A 1 996  ? 26.432  21.080 18.971  1.00 144.88 ? 993  GLN A CG  1 
ATOM 7693 C CD  . GLN A 1 996  ? 26.015  19.656 19.288  1.00 144.88 ? 993  GLN A CD  1 
ATOM 7694 O OE1 . GLN A 1 996  ? 25.165  19.082 18.609  1.00 144.88 ? 993  GLN A OE1 1 
ATOM 7695 N NE2 . GLN A 1 996  ? 26.616  19.076 20.324  1.00 144.88 ? 993  GLN A NE2 1 
ATOM 7696 N N   . GLU A 1 997  ? 24.314  24.606 20.460  1.00 69.18  ? 994  GLU A N   1 
ATOM 7697 C CA  . GLU A 1 997  ? 24.147  26.056 20.311  1.00 69.18  ? 994  GLU A CA  1 
ATOM 7698 C C   . GLU A 1 997  ? 24.619  26.504 18.941  1.00 69.18  ? 994  GLU A C   1 
ATOM 7699 O O   . GLU A 1 997  ? 25.816  26.685 18.738  1.00 69.18  ? 994  GLU A O   1 
ATOM 7700 C CB  . GLU A 1 997  ? 24.945  26.807 21.375  1.00 60.82  ? 994  GLU A CB  1 
ATOM 7701 C CG  . GLU A 1 997  ? 24.956  26.103 22.704  1.00 60.82  ? 994  GLU A CG  1 
ATOM 7702 C CD  . GLU A 1 997  ? 24.785  27.026 23.877  1.00 60.82  ? 994  GLU A CD  1 
ATOM 7703 O OE1 . GLU A 1 997  ? 25.053  28.241 23.734  1.00 60.82  ? 994  GLU A OE1 1 
ATOM 7704 O OE2 . GLU A 1 997  ? 24.376  26.523 24.946  1.00 60.82  ? 994  GLU A OE2 1 
ATOM 7705 N N   . VAL A 1 998  ? 23.690  26.683 18.006  1.00 48.85  ? 995  VAL A N   1 
ATOM 7706 C CA  . VAL A 1 998  ? 24.070  26.987 16.636  1.00 48.85  ? 995  VAL A CA  1 
ATOM 7707 C C   . VAL A 1 998  ? 23.694  28.383 16.235  1.00 48.85  ? 995  VAL A C   1 
ATOM 7708 O O   . VAL A 1 998  ? 23.573  28.685 15.039  1.00 48.85  ? 995  VAL A O   1 
ATOM 7709 C CB  . VAL A 1 998  ? 23.456  25.997 15.594  1.00 37.14  ? 995  VAL A CB  1 
ATOM 7710 C CG1 . VAL A 1 998  ? 23.868  24.581 15.922  1.00 37.14  ? 995  VAL A CG1 1 
ATOM 7711 C CG2 . VAL A 1 998  ? 21.960  26.126 15.537  1.00 37.14  ? 995  VAL A CG2 1 
ATOM 7712 N N   . GLY A 1 999  ? 23.464  29.222 17.233  1.00 48.69  ? 996  GLY A N   1 
ATOM 7713 C CA  . GLY A 1 999  ? 23.162  30.632 16.998  1.00 48.69  ? 996  GLY A CA  1 
ATOM 7714 C C   . GLY A 1 999  ? 23.457  31.306 18.304  1.00 48.69  ? 996  GLY A C   1 
ATOM 7715 O O   . GLY A 1 999  ? 23.001  30.827 19.345  1.00 48.69  ? 996  GLY A O   1 
ATOM 7716 N N   . LEU A 1 1000 ? 24.276  32.347 18.273  1.00 50.65  ? 997  LEU A N   1 
ATOM 7717 C CA  . LEU A 1 1000 ? 24.580  33.088 19.489  1.00 50.65  ? 997  LEU A CA  1 
ATOM 7718 C C   . LEU A 1 1000 ? 24.456  34.539 19.158  1.00 50.65  ? 997  LEU A C   1 
ATOM 7719 O O   . LEU A 1 1000 ? 24.505  34.899 17.976  1.00 50.65  ? 997  LEU A O   1 
ATOM 7720 C CB  . LEU A 1 1000 ? 26.012  32.858 19.977  1.00 33.51  ? 997  LEU A CB  1 
ATOM 7721 C CG  . LEU A 1 1000 ? 26.651  31.489 20.102  1.00 33.51  ? 997  LEU A CG  1 
ATOM 7722 C CD1 . LEU A 1 1000 ? 27.856  31.534 21.084  1.00 33.51  ? 997  LEU A CD1 1 
ATOM 7723 C CD2 . LEU A 1 1000 ? 25.571  30.585 20.624  1.00 33.51  ? 997  LEU A CD2 1 
ATOM 7724 N N   . PHE A 1 1001 ? 24.367  35.376 20.191  1.00 50.95  ? 998  PHE A N   1 
ATOM 7725 C CA  . PHE A 1 1001 ? 24.031  36.773 19.992  1.00 50.95  ? 998  PHE A CA  1 
ATOM 7726 C C   . PHE A 1 1001 ? 23.902  37.497 21.292  1.00 50.95  ? 998  PHE A C   1 
ATOM 7727 O O   . PHE A 1 1001 ? 23.265  37.019 22.225  1.00 50.95  ? 998  PHE A O   1 
ATOM 7728 C CB  . PHE A 1 1001 ? 22.691  36.853 19.270  1.00 49.11  ? 998  PHE A CB  1 
ATOM 7729 C CG  . PHE A 1 1001 ? 22.319  38.223 18.831  1.00 49.11  ? 998  PHE A CG  1 
ATOM 7730 C CD1 . PHE A 1 1001 ? 22.959  38.818 17.750  1.00 49.11  ? 998  PHE A CD1 1 
ATOM 7731 C CD2 . PHE A 1 1001 ? 21.286  38.910 19.469  1.00 49.11  ? 998  PHE A CD2 1 
ATOM 7732 C CE1 . PHE A 1 1001 ? 22.593  40.093 17.320  1.00 49.11  ? 998  PHE A CE1 1 
ATOM 7733 C CE2 . PHE A 1 1001 ? 20.908  40.188 19.036  1.00 49.11  ? 998  PHE A CE2 1 
ATOM 7734 C CZ  . PHE A 1 1001 ? 21.571  40.780 17.969  1.00 49.11  ? 998  PHE A CZ  1 
ATOM 7735 N N   . HIS A 1 1002 ? 24.488  38.672 21.364  1.00 35.85  ? 999  HIS A N   1 
ATOM 7736 C CA  . HIS A 1 1002 ? 24.269  39.465 22.547  1.00 35.85  ? 999  HIS A CA  1 
ATOM 7737 C C   . HIS A 1 1002 ? 23.234  40.544 22.251  1.00 35.85  ? 999  HIS A C   1 
ATOM 7738 O O   . HIS A 1 1002 ? 23.494  41.470 21.484  1.00 35.85  ? 999  HIS A O   1 
ATOM 7739 C CB  . HIS A 1 1002 ? 25.557  40.054 23.070  1.00 48.68  ? 999  HIS A CB  1 
ATOM 7740 C CG  . HIS A 1 1002 ? 25.362  40.932 24.266  1.00 48.68  ? 999  HIS A CG  1 
ATOM 7741 N ND1 . HIS A 1 1002 ? 25.636  40.513 25.547  1.00 48.68  ? 999  HIS A ND1 1 
ATOM 7742 C CD2 . HIS A 1 1002 ? 24.927  42.209 24.370  1.00 48.68  ? 999  HIS A CD2 1 
ATOM 7743 C CE1 . HIS A 1 1002 ? 25.392  41.497 26.388  1.00 48.68  ? 999  HIS A CE1 1 
ATOM 7744 N NE2 . HIS A 1 1002 ? 24.972  42.539 25.697  1.00 48.68  ? 999  HIS A NE2 1 
ATOM 7745 N N   . LEU A 1 1003 ? 22.055  40.383 22.871  1.00 54.14  ? 1000 LEU A N   1 
ATOM 7746 C CA  . LEU A 1 1003 ? 20.846  41.205 22.617  1.00 54.14  ? 1000 LEU A CA  1 
ATOM 7747 C C   . LEU A 1 1003 ? 20.910  42.555 23.253  1.00 54.14  ? 1000 LEU A C   1 
ATOM 7748 O O   . LEU A 1 1003 ? 20.586  43.527 22.624  1.00 54.14  ? 1000 LEU A O   1 
ATOM 7749 C CB  . LEU A 1 1003 ? 19.614  40.523 23.171  1.00 32.34  ? 1000 LEU A CB  1 
ATOM 7750 C CG  . LEU A 1 1003 ? 18.217  40.560 22.563  1.00 32.34  ? 1000 LEU A CG  1 
ATOM 7751 C CD1 . LEU A 1 1003 ? 17.321  40.852 23.722  1.00 32.34  ? 1000 LEU A CD1 1 
ATOM 7752 C CD2 . LEU A 1 1003 ? 18.031  41.547 21.483  1.00 32.34  ? 1000 LEU A CD2 1 
ATOM 7753 N N   . GLY A 1 1004 ? 21.316  42.596 24.513  1.00 41.45  ? 1001 GLY A N   1 
ATOM 7754 C CA  . GLY A 1 1004 ? 21.512  43.839 25.225  1.00 41.45  ? 1001 GLY A CA  1 
ATOM 7755 C C   . GLY A 1 1004 ? 20.373  44.011 26.190  1.00 41.45  ? 1001 GLY A C   1 
ATOM 7756 O O   . GLY A 1 1004 ? 20.282  45.028 26.874  1.00 41.45  ? 1001 GLY A O   1 
ATOM 7757 N N   . GLU A 1 1005 ? 19.527  42.997 26.268  1.00 43.34  ? 1002 GLU A N   1 
ATOM 7758 C CA  . GLU A 1 1005 ? 18.321  43.056 27.059  1.00 43.34  ? 1002 GLU A CA  1 
ATOM 7759 C C   . GLU A 1 1005 ? 17.973  41.754 27.813  1.00 43.34  ? 1002 GLU A C   1 
ATOM 7760 O O   . GLU A 1 1005 ? 18.300  40.678 27.367  1.00 43.34  ? 1002 GLU A O   1 
ATOM 7761 C CB  . GLU A 1 1005 ? 17.151  43.390 26.137  1.00 45.18  ? 1002 GLU A CB  1 
ATOM 7762 C CG  . GLU A 1 1005 ? 17.263  44.680 25.430  1.00 45.18  ? 1002 GLU A CG  1 
ATOM 7763 C CD  . GLU A 1 1005 ? 16.813  45.830 26.273  1.00 45.18  ? 1002 GLU A CD  1 
ATOM 7764 O OE1 . GLU A 1 1005 ? 16.705  46.908 25.671  1.00 45.18  ? 1002 GLU A OE1 1 
ATOM 7765 O OE2 . GLU A 1 1005 ? 16.559  45.689 27.501  1.00 45.18  ? 1002 GLU A OE2 1 
ATOM 7766 N N   . PHE A 1 1006 ? 17.248  41.855 28.917  1.00 33.74  ? 1003 PHE A N   1 
ATOM 7767 C CA  . PHE A 1 1006 ? 16.777  40.695 29.655  1.00 33.74  ? 1003 PHE A CA  1 
ATOM 7768 C C   . PHE A 1 1006 ? 15.396  40.261 29.182  1.00 33.74  ? 1003 PHE A C   1 
ATOM 7769 O O   . PHE A 1 1006 ? 14.428  40.931 29.420  1.00 33.74  ? 1003 PHE A O   1 
ATOM 7770 C CB  . PHE A 1 1006 ? 16.670  41.075 31.103  1.00 32.69  ? 1003 PHE A CB  1 
ATOM 7771 C CG  . PHE A 1 1006 ? 16.583  39.923 32.006  1.00 32.69  ? 1003 PHE A CG  1 
ATOM 7772 C CD1 . PHE A 1 1006 ? 17.728  39.451 32.664  1.00 32.69  ? 1003 PHE A CD1 1 
ATOM 7773 C CD2 . PHE A 1 1006 ? 15.388  39.286 32.212  1.00 32.69  ? 1003 PHE A CD2 1 
ATOM 7774 C CE1 . PHE A 1 1006 ? 17.667  38.367 33.512  1.00 32.69  ? 1003 PHE A CE1 1 
ATOM 7775 C CE2 . PHE A 1 1006 ? 15.321  38.177 33.055  1.00 32.69  ? 1003 PHE A CE2 1 
ATOM 7776 C CZ  . PHE A 1 1006 ? 16.456  37.731 33.706  1.00 32.69  ? 1003 PHE A CZ  1 
ATOM 7777 N N   . VAL A 1 1007 ? 15.283  39.136 28.526  1.00 34.85  ? 1004 VAL A N   1 
ATOM 7778 C CA  . VAL A 1 1007 ? 14.004  38.707 27.997  1.00 34.85  ? 1004 VAL A CA  1 
ATOM 7779 C C   . VAL A 1 1007 ? 13.185  37.901 29.021  1.00 34.85  ? 1004 VAL A C   1 
ATOM 7780 O O   . VAL A 1 1007 ? 13.529  36.794 29.366  1.00 34.85  ? 1004 VAL A O   1 
ATOM 7781 C CB  . VAL A 1 1007 ? 14.281  37.883 26.751  1.00 25.96  ? 1004 VAL A CB  1 
ATOM 7782 C CG1 . VAL A 1 1007 ? 13.008  37.521 26.006  1.00 25.96  ? 1004 VAL A CG1 1 
ATOM 7783 C CG2 . VAL A 1 1007 ? 15.200  38.655 25.862  1.00 25.96  ? 1004 VAL A CG2 1 
ATOM 7784 N N   . ASN A 1 1008 ? 12.102  38.458 29.524  1.00 31.32  ? 1005 ASN A N   1 
ATOM 7785 C CA  . ASN A 1 1008 ? 11.151  37.686 30.349  1.00 31.32  ? 1005 ASN A CA  1 
ATOM 7786 C C   . ASN A 1 1008 ? 10.235  36.676 29.599  1.00 31.32  ? 1005 ASN A C   1 
ATOM 7787 O O   . ASN A 1 1008 ? 9.966   35.618 30.104  1.00 31.32  ? 1005 ASN A O   1 
ATOM 7788 C CB  . ASN A 1 1008 ? 10.283  38.646 31.104  1.00 29.57  ? 1005 ASN A CB  1 
ATOM 7789 C CG  . ASN A 1 1008 ? 11.036  39.370 32.140  1.00 29.57  ? 1005 ASN A CG  1 
ATOM 7790 O OD1 . ASN A 1 1008 ? 11.841  38.775 32.840  1.00 29.57  ? 1005 ASN A OD1 1 
ATOM 7791 N ND2 . ASN A 1 1008 ? 10.752  40.663 32.303  1.00 29.57  ? 1005 ASN A ND2 1 
ATOM 7792 N N   . VAL A 1 1009 ? 9.789   36.990 28.393  1.00 32.47  ? 1006 VAL A N   1 
ATOM 7793 C CA  . VAL A 1 1009 ? 8.726   36.232 27.786  1.00 32.47  ? 1006 VAL A CA  1 
ATOM 7794 C C   . VAL A 1 1009 ? 8.913   36.066 26.279  1.00 32.47  ? 1006 VAL A C   1 
ATOM 7795 O O   . VAL A 1 1009 ? 9.199   37.026 25.580  1.00 32.47  ? 1006 VAL A O   1 
ATOM 7796 C CB  . VAL A 1 1009 ? 7.311   36.890 28.098  1.00 32.88  ? 1006 VAL A CB  1 
ATOM 7797 C CG1 . VAL A 1 1009 ? 7.379   38.399 28.130  1.00 32.88  ? 1006 VAL A CG1 1 
ATOM 7798 C CG2 . VAL A 1 1009 ? 6.181   36.397 27.132  1.00 32.88  ? 1006 VAL A CG2 1 
ATOM 7799 N N   . PHE A 1 1010 ? 8.738   34.881 25.746  1.00 42.99  ? 1007 PHE A N   1 
ATOM 7800 C CA  . PHE A 1 1010 ? 8.615   34.828 24.319  1.00 42.99  ? 1007 PHE A CA  1 
ATOM 7801 C C   . PHE A 1 1010 ? 7.182   34.480 24.042  1.00 42.99  ? 1007 PHE A C   1 
ATOM 7802 O O   . PHE A 1 1010 ? 6.538   33.838 24.847  1.00 42.99  ? 1007 PHE A O   1 
ATOM 7803 C CB  . PHE A 1 1010 ? 9.480   33.720 23.719  1.00 32.24  ? 1007 PHE A CB  1 
ATOM 7804 C CG  . PHE A 1 1010 ? 10.941  33.970 23.785  1.00 32.24  ? 1007 PHE A CG  1 
ATOM 7805 C CD1 . PHE A 1 1010 ? 11.731  33.323 24.740  1.00 32.24  ? 1007 PHE A CD1 1 
ATOM 7806 C CD2 . PHE A 1 1010 ? 11.556  34.823 22.875  1.00 32.24  ? 1007 PHE A CD2 1 
ATOM 7807 C CE1 . PHE A 1 1010 ? 13.137  33.548 24.800  1.00 32.24  ? 1007 PHE A CE1 1 
ATOM 7808 C CE2 . PHE A 1 1010 ? 12.932  35.048 22.937  1.00 32.24  ? 1007 PHE A CE2 1 
ATOM 7809 C CZ  . PHE A 1 1010 ? 13.723  34.399 23.898  1.00 32.24  ? 1007 PHE A CZ  1 
ATOM 7810 N N   . CYS A 1 1011 ? 6.667   34.888 22.898  1.00 54.07  ? 1008 CYS A N   1 
ATOM 7811 C CA  . CYS A 1 1011 ? 5.468   34.255 22.388  1.00 54.07  ? 1008 CYS A CA  1 
ATOM 7812 C C   . CYS A 1 1011 ? 5.320   34.421 20.924  1.00 54.07  ? 1008 CYS A C   1 
ATOM 7813 O O   . CYS A 1 1011 ? 5.731   35.399 20.338  1.00 54.07  ? 1008 CYS A O   1 
ATOM 7814 C CB  . CYS A 1 1011 ? 4.197   34.695 23.106  1.00 60.39  ? 1008 CYS A CB  1 
ATOM 7815 S SG  . CYS A 1 1011 ? 3.688   36.314 22.747  1.00 60.39  ? 1008 CYS A SG  1 
ATOM 7816 N N   . HIS A 1 1012 ? 4.765   33.385 20.341  1.00 55.99  ? 1009 HIS A N   1 
ATOM 7817 C CA  . HIS A 1 1012 ? 4.304   33.431 18.984  1.00 55.99  ? 1009 HIS A CA  1 
ATOM 7818 C C   . HIS A 1 1012 ? 3.109   34.348 18.909  1.00 55.99  ? 1009 HIS A C   1 
ATOM 7819 O O   . HIS A 1 1012 ? 2.189   34.258 19.701  1.00 55.99  ? 1009 HIS A O   1 
ATOM 7820 C CB  . HIS A 1 1012 ? 3.977   32.025 18.508  1.00 49.01  ? 1009 HIS A CB  1 
ATOM 7821 C CG  . HIS A 1 1012 ? 5.102   31.073 18.715  1.00 49.01  ? 1009 HIS A CG  1 
ATOM 7822 N ND1 . HIS A 1 1012 ? 5.946   30.690 17.692  1.00 49.01  ? 1009 HIS A ND1 1 
ATOM 7823 C CD2 . HIS A 1 1012 ? 5.566   30.476 19.840  1.00 49.01  ? 1009 HIS A CD2 1 
ATOM 7824 C CE1 . HIS A 1 1012 ? 6.857   29.859 18.171  1.00 49.01  ? 1009 HIS A CE1 1 
ATOM 7825 N NE2 . HIS A 1 1012 ? 6.651   29.716 19.475  1.00 49.01  ? 1009 HIS A NE2 1 
ATOM 7826 N N   . GLY A 1 1013 ? 3.175   35.254 17.963  1.00 40.25  ? 1010 GLY A N   1 
ATOM 7827 C CA  . GLY A 1 1013 ? 2.190   36.299 17.780  1.00 40.25  ? 1010 GLY A CA  1 
ATOM 7828 C C   . GLY A 1 1013 ? 2.812   37.229 16.763  1.00 40.25  ? 1010 GLY A C   1 
ATOM 7829 O O   . GLY A 1 1013 ? 3.968   37.013 16.357  1.00 40.25  ? 1010 GLY A O   1 
ATOM 7830 N N   . SER A 1 1014 ? 2.058   38.227 16.320  1.00 60.14  ? 1011 SER A N   1 
ATOM 7831 C CA  . SER A 1 1014 ? 2.622   39.331 15.555  1.00 60.14  ? 1011 SER A CA  1 
ATOM 7832 C C   . SER A 1 1014 ? 1.729   40.555 15.694  1.00 60.14  ? 1011 SER A C   1 
ATOM 7833 O O   . SER A 1 1014 ? 0.533   40.452 15.940  1.00 60.14  ? 1011 SER A O   1 
ATOM 7834 C CB  . SER A 1 1014 ? 2.819   38.969 14.096  1.00 48.79  ? 1011 SER A CB  1 
ATOM 7835 O OG  . SER A 1 1014 ? 3.181   40.122 13.355  1.00 48.79  ? 1011 SER A OG  1 
ATOM 7836 N N   . LEU A 1 1015 ? 2.328   41.720 15.556  1.00 44.42  ? 1012 LEU A N   1 
ATOM 7837 C CA  . LEU A 1 1015 ? 1.601   42.938 15.752  1.00 44.42  ? 1012 LEU A CA  1 
ATOM 7838 C C   . LEU A 1 1015 ? 0.863   43.438 14.505  1.00 44.42  ? 1012 LEU A C   1 
ATOM 7839 O O   . LEU A 1 1015 ? 0.092   44.412 14.606  1.00 44.42  ? 1012 LEU A O   1 
ATOM 7840 C CB  . LEU A 1 1015 ? 2.532   44.023 16.268  1.00 72.83  ? 1012 LEU A CB  1 
ATOM 7841 C CG  . LEU A 1 1015 ? 2.791   43.983 17.765  1.00 72.83  ? 1012 LEU A CG  1 
ATOM 7842 C CD1 . LEU A 1 1015 ? 3.286   45.369 18.201  1.00 72.83  ? 1012 LEU A CD1 1 
ATOM 7843 C CD2 . LEU A 1 1015 ? 1.539   43.587 18.528  1.00 72.83  ? 1012 LEU A CD2 1 
ATOM 7844 N N   . VAL A 1 1016 ? 1.070   42.738 13.386  1.00 72.24  ? 1013 VAL A N   1 
ATOM 7845 C CA  . VAL A 1 1016 ? 0.860   43.259 12.033  1.00 72.24  ? 1013 VAL A CA  1 
ATOM 7846 C C   . VAL A 1 1016 ? -0.148  42.482 11.203  1.00 72.24  ? 1013 VAL A C   1 
ATOM 7847 O O   . VAL A 1 1016 ? -0.955  41.741 11.721  1.00 72.24  ? 1013 VAL A O   1 
ATOM 7848 C CB  . VAL A 1 1016 ? 2.213   43.278 11.220  1.00 68.40  ? 1013 VAL A CB  1 
ATOM 7849 C CG1 . VAL A 1 1016 ? 3.174   44.299 11.786  1.00 68.40  ? 1013 VAL A CG1 1 
ATOM 7850 C CG2 . VAL A 1 1016 ? 2.877   41.892 11.166  1.00 68.40  ? 1013 VAL A CG2 1 
ATOM 7851 N N   . MET A 1 1017 ? -0.052  42.648 9.888   1.00 90.67  ? 1014 MET A N   1 
ATOM 7852 C CA  . MET A 1 1017 ? -0.884  41.948 8.901   1.00 90.67  ? 1014 MET A CA  1 
ATOM 7853 C C   . MET A 1 1017 ? -2.371  42.173 9.148   1.00 90.67  ? 1014 MET A C   1 
ATOM 7854 O O   . MET A 1 1017 ? -2.742  42.964 10.016  1.00 90.67  ? 1014 MET A O   1 
ATOM 7855 C CB  . MET A 1 1017 ? -0.472  40.472 8.732   1.00 122.90 ? 1014 MET A CB  1 
ATOM 7856 C CG  . MET A 1 1017 ? -1.078  39.485 9.696   1.00 122.90 ? 1014 MET A CG  1 
ATOM 7857 S SD  . MET A 1 1017 ? -2.546  38.786 8.952   1.00 122.90 ? 1014 MET A SD  1 
ATOM 7858 C CE  . MET A 1 1017 ? -2.977  37.532 10.160  1.00 122.90 ? 1014 MET A CE  1 
ATOM 7859 N N   . GLN A 1 1018 ? -3.198  41.491 8.356   1.00 93.37  ? 1015 GLN A N   1 
ATOM 7860 C CA  . GLN A 1 1018 ? -4.651  41.727 8.283   1.00 93.37  ? 1015 GLN A CA  1 
ATOM 7861 C C   . GLN A 1 1018 ? -5.308  42.001 9.634   1.00 93.37  ? 1015 GLN A C   1 
ATOM 7862 O O   . GLN A 1 1018 ? -6.130  42.902 9.758   1.00 93.37  ? 1015 GLN A O   1 
ATOM 7863 C CB  . GLN A 1 1018 ? -5.355  40.545 7.593   1.00 155.39 ? 1015 GLN A CB  1 
ATOM 7864 C CG  . GLN A 1 1018 ? -4.715  40.074 6.277   1.00 155.39 ? 1015 GLN A CG  1 
ATOM 7865 C CD  . GLN A 1 1018 ? -4.894  41.058 5.134   1.00 155.39 ? 1015 GLN A CD  1 
ATOM 7866 O OE1 . GLN A 1 1018 ? -6.013  41.443 4.794   1.00 155.39 ? 1015 GLN A OE1 1 
ATOM 7867 N NE2 . GLN A 1 1018 ? -3.786  41.460 4.526   1.00 155.39 ? 1015 GLN A NE2 1 
ATOM 7868 N N   . PRO A 1 1026 ? 10.049  35.925 2.674   1.00 97.52  ? 1023 PRO A N   1 
ATOM 7869 C CA  . PRO A 1 1026 ? 11.134  36.752 3.229   1.00 97.52  ? 1023 PRO A CA  1 
ATOM 7870 C C   . PRO A 1 1026 ? 11.599  36.232 4.591   1.00 97.52  ? 1023 PRO A C   1 
ATOM 7871 O O   . PRO A 1 1026 ? 12.772  35.859 4.724   1.00 97.52  ? 1023 PRO A O   1 
ATOM 7872 C CB  . PRO A 1 1026 ? 10.499  38.147 3.354   1.00 61.52  ? 1023 PRO A CB  1 
ATOM 7873 C CG  . PRO A 1 1026 ? 9.351   38.124 2.344   1.00 61.52  ? 1023 PRO A CG  1 
ATOM 7874 C CD  . PRO A 1 1026 ? 8.826   36.702 2.405   1.00 61.52  ? 1023 PRO A CD  1 
ATOM 7875 N N   . THR A 1 1027 ? 10.680  36.212 5.572   1.00 71.25  ? 1024 THR A N   1 
ATOM 7876 C CA  . THR A 1 1027 ? 10.897  35.614 6.912   1.00 71.25  ? 1024 THR A CA  1 
ATOM 7877 C C   . THR A 1 1027 ? 9.904   34.487 7.211   1.00 71.25  ? 1024 THR A C   1 
ATOM 7878 O O   . THR A 1 1027 ? 8.910   34.323 6.507   1.00 71.25  ? 1024 THR A O   1 
ATOM 7879 C CB  . THR A 1 1027 ? 10.835  36.660 8.024   1.00 92.19  ? 1024 THR A CB  1 
ATOM 7880 O OG1 . THR A 1 1027 ? 9.655   37.456 7.871   1.00 92.19  ? 1024 THR A OG1 1 
ATOM 7881 C CG2 . THR A 1 1027 ? 12.065  37.547 7.978   1.00 92.19  ? 1024 THR A CG2 1 
ATOM 7882 N N   . GLN A 1 1028 ? 10.187  33.703 8.241   1.00 61.52  ? 1025 GLN A N   1 
ATOM 7883 C CA  . GLN A 1 1028 ? 9.397   32.521 8.566   1.00 61.52  ? 1025 GLN A CA  1 
ATOM 7884 C C   . GLN A 1 1028 ? 9.198   32.472 10.099  1.00 61.52  ? 1025 GLN A C   1 
ATOM 7885 O O   . GLN A 1 1028 ? 10.181  32.488 10.866  1.00 61.52  ? 1025 GLN A O   1 
ATOM 7886 C CB  . GLN A 1 1028 ? 10.108  31.257 8.079   1.00 201.17 ? 1025 GLN A CB  1 
ATOM 7887 C CG  . GLN A 1 1028 ? 9.252   30.002 8.101   1.00 201.17 ? 1025 GLN A CG  1 
ATOM 7888 C CD  . GLN A 1 1028 ? 10.026  28.783 8.567   1.00 201.17 ? 1025 GLN A CD  1 
ATOM 7889 O OE1 . GLN A 1 1028 ? 10.190  28.559 9.767   1.00 201.17 ? 1025 GLN A OE1 1 
ATOM 7890 N NE2 . GLN A 1 1028 ? 10.497  27.983 7.618   1.00 201.17 ? 1025 GLN A NE2 1 
ATOM 7891 N N   . GLY A 1 1029 ? 7.942   32.394 10.554  1.00 69.06  ? 1026 GLY A N   1 
ATOM 7892 C CA  . GLY A 1 1029 ? 7.650   32.459 11.983  1.00 69.06  ? 1026 GLY A CA  1 
ATOM 7893 C C   . GLY A 1 1029 ? 7.727   33.902 12.447  1.00 69.06  ? 1026 GLY A C   1 
ATOM 7894 O O   . GLY A 1 1029 ? 8.233   34.771 11.733  1.00 69.06  ? 1026 GLY A O   1 
ATOM 7895 N N   . SER A 1 1030 ? 7.193   34.163 13.634  1.00 50.02  ? 1027 SER A N   1 
ATOM 7896 C CA  . SER A 1 1030 ? 7.291   35.472 14.279  1.00 50.02  ? 1027 SER A CA  1 
ATOM 7897 C C   . SER A 1 1030 ? 7.138   35.326 15.806  1.00 50.02  ? 1027 SER A C   1 
ATOM 7898 O O   . SER A 1 1030 ? 6.020   35.164 16.332  1.00 50.02  ? 1027 SER A O   1 
ATOM 7899 C CB  . SER A 1 1030 ? 6.230   36.417 13.752  1.00 53.34  ? 1027 SER A CB  1 
ATOM 7900 O OG  . SER A 1 1030 ? 6.206   37.603 14.526  1.00 53.34  ? 1027 SER A OG  1 
ATOM 7901 N N   . VAL A 1 1031 ? 8.268   35.389 16.510  1.00 47.21  ? 1028 VAL A N   1 
ATOM 7902 C CA  . VAL A 1 1031 ? 8.232   35.279 17.956  1.00 47.21  ? 1028 VAL A CA  1 
ATOM 7903 C C   . VAL A 1 1031 ? 8.480   36.626 18.559  1.00 47.21  ? 1028 VAL A C   1 
ATOM 7904 O O   . VAL A 1 1031 ? 9.496   37.259 18.230  1.00 47.21  ? 1028 VAL A O   1 
ATOM 7905 C CB  . VAL A 1 1031 ? 9.253   34.282 18.469  1.00 27.81  ? 1028 VAL A CB  1 
ATOM 7906 C CG1 . VAL A 1 1031 ? 9.490   34.511 19.959  1.00 27.81  ? 1028 VAL A CG1 1 
ATOM 7907 C CG2 . VAL A 1 1031 ? 8.686   32.859 18.211  1.00 27.81  ? 1028 VAL A CG2 1 
ATOM 7908 N N   . LEU A 1 1032 ? 7.555   37.085 19.406  1.00 52.05  ? 1029 LEU A N   1 
ATOM 7909 C CA  . LEU A 1 1032 ? 7.703   38.396 20.032  1.00 52.05  ? 1029 LEU A CA  1 
ATOM 7910 C C   . LEU A 1 1032 ? 8.406   38.253 21.366  1.00 52.05  ? 1029 LEU A C   1 
ATOM 7911 O O   . LEU A 1 1032 ? 8.368   37.190 21.969  1.00 52.05  ? 1029 LEU A O   1 
ATOM 7912 C CB  . LEU A 1 1032 ? 6.344   39.045 20.228  1.00 37.87  ? 1029 LEU A CB  1 
ATOM 7913 C CG  . LEU A 1 1032 ? 5.824   39.792 18.995  1.00 37.87  ? 1029 LEU A CG  1 
ATOM 7914 C CD1 . LEU A 1 1032 ? 4.274   39.653 18.842  1.00 37.87  ? 1029 LEU A CD1 1 
ATOM 7915 C CD2 . LEU A 1 1032 ? 6.279   41.292 18.980  1.00 37.87  ? 1029 LEU A CD2 1 
ATOM 7916 N N   . PHE A 1 1033 ? 9.063   39.303 21.830  1.00 40.64  ? 1030 PHE A N   1 
ATOM 7917 C CA  . PHE A 1 1033 ? 9.592   39.255 23.179  1.00 40.64  ? 1030 PHE A CA  1 
ATOM 7918 C C   . PHE A 1 1033 ? 9.466   40.552 23.941  1.00 40.64  ? 1030 PHE A C   1 
ATOM 7919 O O   . PHE A 1 1033 ? 9.386   41.625 23.344  1.00 40.64  ? 1030 PHE A O   1 
ATOM 7920 C CB  . PHE A 1 1033 ? 10.988  38.626 23.280  1.00 32.92  ? 1030 PHE A CB  1 
ATOM 7921 C CG  . PHE A 1 1033 ? 12.069  39.368 22.552  1.00 32.92  ? 1030 PHE A CG  1 
ATOM 7922 C CD1 . PHE A 1 1033 ? 12.788  40.349 23.181  1.00 32.92  ? 1030 PHE A CD1 1 
ATOM 7923 C CD2 . PHE A 1 1033 ? 12.420  39.014 21.246  1.00 32.92  ? 1030 PHE A CD2 1 
ATOM 7924 C CE1 . PHE A 1 1033 ? 13.801  40.997 22.481  1.00 32.92  ? 1030 PHE A CE1 1 
ATOM 7925 C CE2 . PHE A 1 1033 ? 13.410  39.655 20.557  1.00 32.92  ? 1030 PHE A CE2 1 
ATOM 7926 C CZ  . PHE A 1 1033 ? 14.098  40.637 21.156  1.00 32.92  ? 1030 PHE A CZ  1 
ATOM 7927 N N   . GLY A 1 1034 ? 9.364   40.432 25.267  1.00 37.35  ? 1031 GLY A N   1 
ATOM 7928 C CA  . GLY A 1 1034 ? 9.232   41.570 26.140  1.00 37.35  ? 1031 GLY A CA  1 
ATOM 7929 C C   . GLY A 1 1034 ? 10.378  41.491 27.102  1.00 37.35  ? 1031 GLY A C   1 
ATOM 7930 O O   . GLY A 1 1034 ? 10.713  40.413 27.662  1.00 37.35  ? 1031 GLY A O   1 
ATOM 7931 N N   . THR A 1 1035 ? 10.973  42.650 27.307  1.00 30.53  ? 1032 THR A N   1 
ATOM 7932 C CA  . THR A 1 1035 ? 12.173  42.754 28.096  1.00 30.53  ? 1032 THR A CA  1 
ATOM 7933 C C   . THR A 1 1035 ? 11.943  43.499 29.405  1.00 30.53  ? 1032 THR A C   1 
ATOM 7934 O O   . THR A 1 1035 ? 11.046  44.298 29.535  1.00 30.53  ? 1032 THR A O   1 
ATOM 7935 C CB  . THR A 1 1035 ? 13.244  43.474 27.273  1.00 37.10  ? 1032 THR A CB  1 
ATOM 7936 O OG1 . THR A 1 1035 ? 12.863  44.836 27.067  1.00 37.10  ? 1032 THR A OG1 1 
ATOM 7937 C CG2 . THR A 1 1035 ? 13.394  42.826 25.917  1.00 37.10  ? 1032 THR A CG2 1 
ATOM 7938 N N   . VAL A 1 1036 ? 12.797  43.261 30.375  1.00 33.50  ? 1033 VAL A N   1 
ATOM 7939 C CA  . VAL A 1 1036 ? 12.863  44.098 31.554  1.00 33.50  ? 1033 VAL A CA  1 
ATOM 7940 C C   . VAL A 1 1036 ? 12.898  45.601 31.260  1.00 33.50  ? 1033 VAL A C   1 
ATOM 7941 O O   . VAL A 1 1036 ? 12.616  46.395 32.121  1.00 33.50  ? 1033 VAL A O   1 
ATOM 7942 C CB  . VAL A 1 1036 ? 14.112  43.727 32.329  1.00 25.97  ? 1033 VAL A CB  1 
ATOM 7943 C CG1 . VAL A 1 1036 ? 14.529  44.786 33.295  1.00 25.97  ? 1033 VAL A CG1 1 
ATOM 7944 C CG2 . VAL A 1 1036 ? 13.946  42.434 32.993  1.00 25.97  ? 1033 VAL A CG2 1 
ATOM 7945 N N   . ASN A 1 1037 ? 13.285  46.012 30.068  1.00 40.26  ? 1034 ASN A N   1 
ATOM 7946 C CA  . ASN A 1 1037 ? 13.457  47.436 29.809  1.00 40.26  ? 1034 ASN A CA  1 
ATOM 7947 C C   . ASN A 1 1037 ? 12.288  48.041 29.074  1.00 40.26  ? 1034 ASN A C   1 
ATOM 7948 O O   . ASN A 1 1037 ? 12.217  49.262 28.876  1.00 40.26  ? 1034 ASN A O   1 
ATOM 7949 C CB  . ASN A 1 1037 ? 14.692  47.669 28.982  1.00 31.91  ? 1034 ASN A CB  1 
ATOM 7950 C CG  . ASN A 1 1037 ? 15.869  47.906 29.807  1.00 31.91  ? 1034 ASN A CG  1 
ATOM 7951 O OD1 . ASN A 1 1037 ? 15.762  48.255 30.988  1.00 31.91  ? 1034 ASN A OD1 1 
ATOM 7952 N ND2 . ASN A 1 1037 ? 17.037  47.750 29.205  1.00 31.91  ? 1034 ASN A ND2 1 
ATOM 7953 N N   . GLY A 1 1038 ? 11.387  47.172 28.634  1.00 48.09  ? 1035 GLY A N   1 
ATOM 7954 C CA  . GLY A 1 1038 ? 10.235  47.624 27.930  1.00 48.09  ? 1035 GLY A CA  1 
ATOM 7955 C C   . GLY A 1 1038 ? 10.509  47.579 26.484  1.00 48.09  ? 1035 GLY A C   1 
ATOM 7956 O O   . GLY A 1 1038 ? 9.694   48.022 25.691  1.00 48.09  ? 1035 GLY A O   1 
ATOM 7957 N N   . MET A 1 1039 ? 11.661  47.032 26.118  1.00 40.62  ? 1036 MET A N   1 
ATOM 7958 C CA  . MET A 1 1039 ? 11.903  46.786 24.724  1.00 40.62  ? 1036 MET A CA  1 
ATOM 7959 C C   . MET A 1 1039 ? 11.012  45.623 24.365  1.00 40.62  ? 1036 MET A C   1 
ATOM 7960 O O   . MET A 1 1039 ? 10.835  44.700 25.133  1.00 40.62  ? 1036 MET A O   1 
ATOM 7961 C CB  . MET A 1 1039 ? 13.381  46.553 24.459  1.00 44.35  ? 1036 MET A CB  1 
ATOM 7962 C CG  . MET A 1 1039 ? 13.718  46.426 23.039  1.00 44.35  ? 1036 MET A CG  1 
ATOM 7963 S SD  . MET A 1 1039 ? 14.155  44.738 22.737  1.00 44.35  ? 1036 MET A SD  1 
ATOM 7964 C CE  . MET A 1 1039 ? 14.588  44.641 21.003  1.00 44.35  ? 1036 MET A CE  1 
ATOM 7965 N N   . ILE A 1 1040 ? 10.376  45.724 23.221  1.00 47.00  ? 1037 ILE A N   1 
ATOM 7966 C CA  . ILE A 1 1040 ? 9.785   44.585 22.584  1.00 47.00  ? 1037 ILE A CA  1 
ATOM 7967 C C   . ILE A 1 1040 ? 10.630  44.286 21.371  1.00 47.00  ? 1037 ILE A C   1 
ATOM 7968 O O   . ILE A 1 1040 ? 10.819  45.135 20.503  1.00 47.00  ? 1037 ILE A O   1 
ATOM 7969 C CB  . ILE A 1 1040 ? 8.364   44.881 22.144  1.00 35.43  ? 1037 ILE A CB  1 
ATOM 7970 C CG1 . ILE A 1 1040 ? 7.546   45.307 23.371  1.00 35.43  ? 1037 ILE A CG1 1 
ATOM 7971 C CG2 . ILE A 1 1040 ? 7.793   43.688 21.390  1.00 35.43  ? 1037 ILE A CG2 1 
ATOM 7972 C CD1 . ILE A 1 1040 ? 6.023   45.484 23.159  1.00 35.43  ? 1037 ILE A CD1 1 
ATOM 7973 N N   . GLY A 1 1041 ? 11.158  43.080 21.324  1.00 71.37  ? 1038 GLY A N   1 
ATOM 7974 C CA  . GLY A 1 1041 ? 11.822  42.632 20.133  1.00 71.37  ? 1038 GLY A CA  1 
ATOM 7975 C C   . GLY A 1 1041 ? 10.884  41.743 19.367  1.00 71.37  ? 1038 GLY A C   1 
ATOM 7976 O O   . GLY A 1 1041 ? 9.703   41.656 19.694  1.00 71.37  ? 1038 GLY A O   1 
ATOM 7977 N N   . LEU A 1 1042 ? 11.438  41.090 18.347  1.00 37.18  ? 1039 LEU A N   1 
ATOM 7978 C CA  . LEU A 1 1042 ? 10.766  40.145 17.464  1.00 37.18  ? 1039 LEU A CA  1 
ATOM 7979 C C   . LEU A 1 1042 ? 11.839  39.253 16.869  1.00 37.18  ? 1039 LEU A C   1 
ATOM 7980 O O   . LEU A 1 1042 ? 12.842  39.744 16.431  1.00 37.18  ? 1039 LEU A O   1 
ATOM 7981 C CB  . LEU A 1 1042 ? 10.076  40.913 16.341  1.00 60.57  ? 1039 LEU A CB  1 
ATOM 7982 C CG  . LEU A 1 1042 ? 9.507   40.180 15.130  1.00 60.57  ? 1039 LEU A CG  1 
ATOM 7983 C CD1 . LEU A 1 1042 ? 8.595   39.061 15.530  1.00 60.57  ? 1039 LEU A CD1 1 
ATOM 7984 C CD2 . LEU A 1 1042 ? 8.762   41.173 14.331  1.00 60.57  ? 1039 LEU A CD2 1 
ATOM 7985 N N   . VAL A 1 1043 ? 11.649  37.948 16.847  1.00 61.95  ? 1040 VAL A N   1 
ATOM 7986 C CA  . VAL A 1 1043 ? 12.646  37.071 16.259  1.00 61.95  ? 1040 VAL A CA  1 
ATOM 7987 C C   . VAL A 1 1043 ? 12.013  36.220 15.174  1.00 61.95  ? 1040 VAL A C   1 
ATOM 7988 O O   . VAL A 1 1043 ? 10.995  35.563 15.394  1.00 61.95  ? 1040 VAL A O   1 
ATOM 7989 C CB  . VAL A 1 1043 ? 13.261  36.125 17.282  1.00 36.96  ? 1040 VAL A CB  1 
ATOM 7990 C CG1 . VAL A 1 1043 ? 14.080  35.055 16.579  1.00 36.96  ? 1040 VAL A CG1 1 
ATOM 7991 C CG2 . VAL A 1 1043 ? 14.109  36.861 18.244  1.00 36.96  ? 1040 VAL A CG2 1 
ATOM 7992 N N   . THR A 1 1044 ? 12.632  36.221 14.006  1.00 69.17  ? 1041 THR A N   1 
ATOM 7993 C CA  . THR A 1 1044 ? 12.141  35.444 12.898  1.00 69.17  ? 1041 THR A CA  1 
ATOM 7994 C C   . THR A 1 1044 ? 13.253  34.567 12.416  1.00 69.17  ? 1041 THR A C   1 
ATOM 7995 O O   . THR A 1 1044 ? 14.419  34.783 12.760  1.00 69.17  ? 1041 THR A O   1 
ATOM 7996 C CB  . THR A 1 1044 ? 11.699  36.352 11.775  1.00 55.18  ? 1041 THR A CB  1 
ATOM 7997 O OG1 . THR A 1 1044 ? 10.887  37.399 12.322  1.00 55.18  ? 1041 THR A OG1 1 
ATOM 7998 C CG2 . THR A 1 1044 ? 10.889  35.593 10.784  1.00 55.18  ? 1041 THR A CG2 1 
ATOM 7999 N N   . SER A 1 1045 ? 12.873  33.561 11.639  1.00 61.11  ? 1042 SER A N   1 
ATOM 8000 C CA  . SER A 1 1045 ? 13.821  32.649 11.028  1.00 61.11  ? 1042 SER A CA  1 
ATOM 8001 C C   . SER A 1 1045 ? 14.017  32.957 9.549   1.00 61.11  ? 1042 SER A C   1 
ATOM 8002 O O   . SER A 1 1045 ? 13.241  33.701 8.935   1.00 61.11  ? 1042 SER A O   1 
ATOM 8003 C CB  . SER A 1 1045 ? 13.425  31.197 11.273  1.00 77.58  ? 1042 SER A CB  1 
ATOM 8004 O OG  . SER A 1 1045 ? 13.715  30.820 12.619  1.00 77.58  ? 1042 SER A OG  1 
ATOM 8005 N N   . LEU A 1 1046 ? 15.085  32.388 8.998   1.00 80.05  ? 1043 LEU A N   1 
ATOM 8006 C CA  . LEU A 1 1046 ? 15.655  32.840 7.741   1.00 80.05  ? 1043 LEU A CA  1 
ATOM 8007 C C   . LEU A 1 1046 ? 16.049  31.690 6.843   1.00 80.05  ? 1043 LEU A C   1 
ATOM 8008 O O   . LEU A 1 1046 ? 16.492  30.644 7.330   1.00 80.05  ? 1043 LEU A O   1 
ATOM 8009 C CB  . LEU A 1 1046 ? 16.926  33.629 8.037   1.00 42.82  ? 1043 LEU A CB  1 
ATOM 8010 C CG  . LEU A 1 1046 ? 16.871  35.130 8.391   1.00 42.82  ? 1043 LEU A CG  1 
ATOM 8011 C CD1 . LEU A 1 1046 ? 18.275  35.577 8.836   1.00 42.82  ? 1043 LEU A CD1 1 
ATOM 8012 C CD2 . LEU A 1 1046 ? 16.361  36.007 7.257   1.00 42.82  ? 1043 LEU A CD2 1 
ATOM 8013 N N   . SER A 1 1047 ? 15.897  31.903 5.534   1.00 77.96  ? 1044 SER A N   1 
ATOM 8014 C CA  . SER A 1 1047 ? 16.570  31.105 4.507   1.00 77.96  ? 1044 SER A CA  1 
ATOM 8015 C C   . SER A 1 1047 ? 18.086  31.347 4.594   1.00 77.96  ? 1044 SER A C   1 
ATOM 8016 O O   . SER A 1 1047 ? 18.522  32.484 4.851   1.00 77.96  ? 1044 SER A O   1 
ATOM 8017 C CB  . SER A 1 1047 ? 16.104  31.572 3.142   1.00 91.50  ? 1044 SER A CB  1 
ATOM 8018 O OG  . SER A 1 1047 ? 16.711  32.816 2.832   1.00 91.50  ? 1044 SER A OG  1 
ATOM 8019 N N   . GLU A 1 1048 ? 18.891  30.306 4.362   1.00 63.67  ? 1045 GLU A N   1 
ATOM 8020 C CA  . GLU A 1 1048 ? 20.366  30.461 4.333   1.00 63.67  ? 1045 GLU A CA  1 
ATOM 8021 C C   . GLU A 1 1048 ? 20.784  31.629 3.421   1.00 63.67  ? 1045 GLU A C   1 
ATOM 8022 O O   . GLU A 1 1048 ? 21.747  32.340 3.712   1.00 63.67  ? 1045 GLU A O   1 
ATOM 8023 C CB  . GLU A 1 1048 ? 21.062  29.157 3.916   1.00 123.09 ? 1045 GLU A CB  1 
ATOM 8024 C CG  . GLU A 1 1048 ? 21.130  28.894 2.400   1.00 123.09 ? 1045 GLU A CG  1 
ATOM 8025 C CD  . GLU A 1 1048 ? 19.765  28.607 1.745   1.00 123.09 ? 1045 GLU A CD  1 
ATOM 8026 O OE1 . GLU A 1 1048 ? 19.405  27.409 1.602   1.00 123.09 ? 1045 GLU A OE1 1 
ATOM 8027 O OE2 . GLU A 1 1048 ? 19.070  29.576 1.345   1.00 123.09 ? 1045 GLU A OE2 1 
ATOM 8028 N N   . SER A 1 1049 ? 20.023  31.848 2.345   1.00 58.72  ? 1046 SER A N   1 
ATOM 8029 C CA  . SER A 1 1049 ? 20.384  32.864 1.342   1.00 58.72  ? 1046 SER A CA  1 
ATOM 8030 C C   . SER A 1 1049 ? 20.130  34.294 1.778   1.00 58.72  ? 1046 SER A C   1 
ATOM 8031 O O   . SER A 1 1049 ? 20.956  35.183 1.518   1.00 58.72  ? 1046 SER A O   1 
ATOM 8032 C CB  . SER A 1 1049 ? 19.764  32.588 -0.056  1.00 70.96  ? 1046 SER A CB  1 
ATOM 8033 O OG  . SER A 1 1049 ? 18.410  32.171 0.002   1.00 70.96  ? 1046 SER A OG  1 
ATOM 8034 N N   . TRP A 1 1050 ? 18.988  34.515 2.419   1.00 73.83  ? 1047 TRP A N   1 
ATOM 8035 C CA  . TRP A 1 1050 ? 18.729  35.793 3.052   1.00 73.83  ? 1047 TRP A CA  1 
ATOM 8036 C C   . TRP A 1 1050 ? 19.738  35.985 4.146   1.00 73.83  ? 1047 TRP A C   1 
ATOM 8037 O O   . TRP A 1 1050 ? 20.323  37.051 4.265   1.00 73.83  ? 1047 TRP A O   1 
ATOM 8038 C CB  . TRP A 1 1050 ? 17.338  35.809 3.630   1.00 93.37  ? 1047 TRP A CB  1 
ATOM 8039 C CG  . TRP A 1 1050 ? 16.352  36.020 2.608   1.00 93.37  ? 1047 TRP A CG  1 
ATOM 8040 C CD1 . TRP A 1 1050 ? 15.792  35.086 1.817   1.00 93.37  ? 1047 TRP A CD1 1 
ATOM 8041 C CD2 . TRP A 1 1050 ? 15.806  37.265 2.223   1.00 93.37  ? 1047 TRP A CD2 1 
ATOM 8042 N NE1 . TRP A 1 1050 ? 14.908  35.668 0.957   1.00 93.37  ? 1047 TRP A NE1 1 
ATOM 8043 C CE2 . TRP A 1 1050 ? 14.900  37.015 1.187   1.00 93.37  ? 1047 TRP A CE2 1 
ATOM 8044 C CE3 . TRP A 1 1050 ? 15.990  38.577 2.658   1.00 93.37  ? 1047 TRP A CE3 1 
ATOM 8045 C CZ2 . TRP A 1 1050 ? 14.171  38.029 0.573   1.00 93.37  ? 1047 TRP A CZ2 1 
ATOM 8046 C CZ3 . TRP A 1 1050 ? 15.266  39.582 2.052   1.00 93.37  ? 1047 TRP A CZ3 1 
ATOM 8047 C CH2 . TRP A 1 1050 ? 14.371  39.306 1.021   1.00 93.37  ? 1047 TRP A CH2 1 
ATOM 8048 N N   . TYR A 1 1051 ? 19.966  34.931 4.927   1.00 61.39  ? 1048 TYR A N   1 
ATOM 8049 C CA  . TYR A 1 1051 ? 20.989  35.004 5.944   1.00 61.39  ? 1048 TYR A CA  1 
ATOM 8050 C C   . TYR A 1 1051 ? 22.221  35.616 5.307   1.00 61.39  ? 1048 TYR A C   1 
ATOM 8051 O O   . TYR A 1 1051 ? 22.650  36.695 5.717   1.00 61.39  ? 1048 TYR A O   1 
ATOM 8052 C CB  . TYR A 1 1051 ? 21.302  33.648 6.576   1.00 74.75  ? 1048 TYR A CB  1 
ATOM 8053 C CG  . TYR A 1 1051 ? 22.284  33.752 7.723   1.00 74.75  ? 1048 TYR A CG  1 
ATOM 8054 C CD1 . TYR A 1 1051 ? 21.965  34.450 8.900   1.00 74.75  ? 1048 TYR A CD1 1 
ATOM 8055 C CD2 . TYR A 1 1051 ? 23.533  33.167 7.642   1.00 74.75  ? 1048 TYR A CD2 1 
ATOM 8056 C CE1 . TYR A 1 1051 ? 22.879  34.555 9.965   1.00 74.75  ? 1048 TYR A CE1 1 
ATOM 8057 C CE2 . TYR A 1 1051 ? 24.442  33.256 8.699   1.00 74.75  ? 1048 TYR A CE2 1 
ATOM 8058 C CZ  . TYR A 1 1051 ? 24.112  33.949 9.849   1.00 74.75  ? 1048 TYR A CZ  1 
ATOM 8059 O OH  . TYR A 1 1051 ? 25.032  34.023 10.864  1.00 74.75  ? 1048 TYR A OH  1 
ATOM 8060 N N   . ASN A 1 1052 ? 22.738  34.969 4.256   1.00 43.98  ? 1049 ASN A N   1 
ATOM 8061 C CA  . ASN A 1 1052 ? 24.002  35.391 3.638   1.00 43.98  ? 1049 ASN A CA  1 
ATOM 8062 C C   . ASN A 1 1052 ? 23.934  36.775 3.023   1.00 43.98  ? 1049 ASN A C   1 
ATOM 8063 O O   . ASN A 1 1052 ? 24.751  37.657 3.349   1.00 43.98  ? 1049 ASN A O   1 
ATOM 8064 C CB  . ASN A 1 1052 ? 24.523  34.318 2.705   1.00 69.61  ? 1049 ASN A CB  1 
ATOM 8065 C CG  . ASN A 1 1052 ? 24.825  33.046 3.457   1.00 69.61  ? 1049 ASN A CG  1 
ATOM 8066 O OD1 . ASN A 1 1052 ? 25.497  33.076 4.487   1.00 69.61  ? 1049 ASN A OD1 1 
ATOM 8067 N ND2 . ASN A 1 1052 ? 24.303  31.928 2.976   1.00 69.61  ? 1049 ASN A ND2 1 
ATOM 8068 N N   . LEU A 1 1053 ? 22.933  37.003 2.196   1.00 59.11  ? 1050 LEU A N   1 
ATOM 8069 C CA  . LEU A 1 1053 ? 22.702  38.342 1.755   1.00 59.11  ? 1050 LEU A CA  1 
ATOM 8070 C C   . LEU A 1 1053 ? 22.940  39.291 2.949   1.00 59.11  ? 1050 LEU A C   1 
ATOM 8071 O O   . LEU A 1 1053 ? 23.766  40.208 2.897   1.00 59.11  ? 1050 LEU A O   1 
ATOM 8072 C CB  . LEU A 1 1053 ? 21.276  38.445 1.277   1.00 54.45  ? 1050 LEU A CB  1 
ATOM 8073 C CG  . LEU A 1 1053 ? 21.090  39.303 0.038   1.00 54.45  ? 1050 LEU A CG  1 
ATOM 8074 C CD1 . LEU A 1 1053 ? 19.572  39.350 -0.324  1.00 54.45  ? 1050 LEU A CD1 1 
ATOM 8075 C CD2 . LEU A 1 1053 ? 21.700  40.719 0.148   1.00 54.45  ? 1050 LEU A CD2 1 
ATOM 8076 N N   . LEU A 1 1054 ? 22.253  39.006 4.044   1.00 70.92  ? 1051 LEU A N   1 
ATOM 8077 C CA  . LEU A 1 1054 ? 22.173  39.914 5.169   1.00 70.92  ? 1051 LEU A CA  1 
ATOM 8078 C C   . LEU A 1 1054 ? 23.421  39.894 6.038   1.00 70.92  ? 1051 LEU A C   1 
ATOM 8079 O O   . LEU A 1 1054 ? 23.880  40.943 6.512   1.00 70.92  ? 1051 LEU A O   1 
ATOM 8080 C CB  . LEU A 1 1054 ? 20.929  39.567 5.995   1.00 40.92  ? 1051 LEU A CB  1 
ATOM 8081 C CG  . LEU A 1 1054 ? 19.602  39.909 5.347   1.00 40.92  ? 1051 LEU A CG  1 
ATOM 8082 C CD1 . LEU A 1 1054 ? 18.527  39.310 6.155   1.00 40.92  ? 1051 LEU A CD1 1 
ATOM 8083 C CD2 . LEU A 1 1054 ? 19.470  41.401 5.267   1.00 40.92  ? 1051 LEU A CD2 1 
ATOM 8084 N N   . LEU A 1 1055 ? 23.946  38.689 6.258   1.00 56.62  ? 1052 LEU A N   1 
ATOM 8085 C CA  . LEU A 1 1055 ? 25.183  38.518 6.989   1.00 56.62  ? 1052 LEU A CA  1 
ATOM 8086 C C   . LEU A 1 1055 ? 26.243  39.342 6.284   1.00 56.62  ? 1052 LEU A C   1 
ATOM 8087 O O   . LEU A 1 1055 ? 26.967  40.110 6.914   1.00 56.62  ? 1052 LEU A O   1 
ATOM 8088 C CB  . LEU A 1 1055 ? 25.630  37.037 7.076   1.00 45.99  ? 1052 LEU A CB  1 
ATOM 8089 C CG  . LEU A 1 1055 ? 26.646  36.742 8.226   1.00 45.99  ? 1052 LEU A CG  1 
ATOM 8090 C CD1 . LEU A 1 1055 ? 27.172  35.337 8.163   1.00 45.99  ? 1052 LEU A CD1 1 
ATOM 8091 C CD2 . LEU A 1 1055 ? 27.838  37.659 8.259   1.00 45.99  ? 1052 LEU A CD2 1 
ATOM 8092 N N   . ASP A 1 1056 ? 26.326  39.202 4.965   1.00 74.36  ? 1053 ASP A N   1 
ATOM 8093 C CA  . ASP A 1 1056 ? 27.334  39.955 4.265   1.00 74.36  ? 1053 ASP A CA  1 
ATOM 8094 C C   . ASP A 1 1056 ? 27.052  41.420 4.449   1.00 74.36  ? 1053 ASP A C   1 
ATOM 8095 O O   . ASP A 1 1056 ? 27.898  42.168 4.937   1.00 74.36  ? 1053 ASP A O   1 
ATOM 8096 C CB  . ASP A 1 1056 ? 27.419  39.606 2.791   1.00 101.86 ? 1053 ASP A CB  1 
ATOM 8097 C CG  . ASP A 1 1056 ? 28.684  40.150 2.163   1.00 101.86 ? 1053 ASP A CG  1 
ATOM 8098 O OD1 . ASP A 1 1056 ? 29.770  39.593 2.476   1.00 101.86 ? 1053 ASP A OD1 1 
ATOM 8099 O OD2 . ASP A 1 1056 ? 28.593  41.143 1.393   1.00 101.86 ? 1053 ASP A OD2 1 
ATOM 8100 N N   . MET A 1 1057 ? 25.835  41.806 4.092   1.00 75.70  ? 1054 MET A N   1 
ATOM 8101 C CA  . MET A 1 1057 ? 25.384  43.178 4.264   1.00 75.70  ? 1054 MET A CA  1 
ATOM 8102 C C   . MET A 1 1057 ? 25.690  43.758 5.656   1.00 75.70  ? 1054 MET A C   1 
ATOM 8103 O O   . MET A 1 1057 ? 26.010  44.950 5.774   1.00 75.70  ? 1054 MET A O   1 
ATOM 8104 C CB  . MET A 1 1057 ? 23.906  43.283 3.961   1.00 88.24  ? 1054 MET A CB  1 
ATOM 8105 C CG  . MET A 1 1057 ? 23.439  44.690 4.050   1.00 88.24  ? 1054 MET A CG  1 
ATOM 8106 S SD  . MET A 1 1057 ? 22.034  44.926 2.993   1.00 88.24  ? 1054 MET A SD  1 
ATOM 8107 C CE  . MET A 1 1057 ? 20.753  44.201 3.994   1.00 88.24  ? 1054 MET A CE  1 
ATOM 8108 N N   . GLN A 1 1058 ? 25.608  42.918 6.693   1.00 69.18  ? 1055 GLN A N   1 
ATOM 8109 C CA  . GLN A 1 1058 ? 25.965  43.365 8.024   1.00 69.18  ? 1055 GLN A CA  1 
ATOM 8110 C C   . GLN A 1 1058 ? 27.375  43.883 8.058   1.00 69.18  ? 1055 GLN A C   1 
ATOM 8111 O O   . GLN A 1 1058 ? 27.603  44.949 8.602   1.00 69.18  ? 1055 GLN A O   1 
ATOM 8112 C CB  . GLN A 1 1058 ? 25.759  42.289 9.075   1.00 69.55  ? 1055 GLN A CB  1 
ATOM 8113 C CG  . GLN A 1 1058 ? 24.404  42.402 9.787   1.00 69.55  ? 1055 GLN A CG  1 
ATOM 8114 C CD  . GLN A 1 1058 ? 24.359  41.669 11.111  1.00 69.55  ? 1055 GLN A CD  1 
ATOM 8115 O OE1 . GLN A 1 1058 ? 23.354  41.714 11.819  1.00 69.55  ? 1055 GLN A OE1 1 
ATOM 8116 N NE2 . GLN A 1 1058 ? 25.447  40.993 11.459  1.00 69.55  ? 1055 GLN A NE2 1 
ATOM 8117 N N   . ASN A 1 1059 ? 28.302  43.163 7.421   1.00 51.65  ? 1056 ASN A N   1 
ATOM 8118 C CA  . ASN A 1 1059 ? 29.734  43.526 7.409   1.00 51.65  ? 1056 ASN A CA  1 
ATOM 8119 C C   . ASN A 1 1059 ? 30.011  44.778 6.585   1.00 51.65  ? 1056 ASN A C   1 
ATOM 8120 O O   . ASN A 1 1059 ? 30.692  45.710 7.034   1.00 51.65  ? 1056 ASN A O   1 
ATOM 8121 C CB  . ASN A 1 1059 ? 30.593  42.326 6.972   1.00 72.43  ? 1056 ASN A CB  1 
ATOM 8122 C CG  . ASN A 1 1059 ? 30.493  41.142 7.962   1.00 72.43  ? 1056 ASN A CG  1 
ATOM 8123 O OD1 . ASN A 1 1059 ? 30.591  39.980 7.584   1.00 72.43  ? 1056 ASN A OD1 1 
ATOM 8124 N ND2 . ASN A 1 1059 ? 30.283  41.455 9.235   1.00 72.43  ? 1056 ASN A ND2 1 
ATOM 8125 N N   . ARG A 1 1060 ? 29.436  44.814 5.392   1.00 60.28  ? 1057 ARG A N   1 
ATOM 8126 C CA  . ARG A 1 1060 ? 29.525  45.980 4.535   1.00 60.28  ? 1057 ARG A CA  1 
ATOM 8127 C C   . ARG A 1 1060 ? 29.051  47.193 5.335   1.00 60.28  ? 1057 ARG A C   1 
ATOM 8128 O O   . ARG A 1 1060 ? 29.779  48.168 5.471   1.00 60.28  ? 1057 ARG A O   1 
ATOM 8129 C CB  . ARG A 1 1060 ? 28.646  45.799 3.293   1.00 83.75  ? 1057 ARG A CB  1 
ATOM 8130 C CG  . ARG A 1 1060 ? 28.734  44.444 2.579   1.00 83.75  ? 1057 ARG A CG  1 
ATOM 8131 C CD  . ARG A 1 1060 ? 29.596  44.525 1.343   1.00 83.75  ? 1057 ARG A CD  1 
ATOM 8132 N NE  . ARG A 1 1060 ? 29.097  43.695 0.255   1.00 83.75  ? 1057 ARG A NE  1 
ATOM 8133 C CZ  . ARG A 1 1060 ? 29.457  43.840 -1.015  1.00 83.75  ? 1057 ARG A CZ  1 
ATOM 8134 N NH1 . ARG A 1 1060 ? 30.319  44.785 -1.355  1.00 83.75  ? 1057 ARG A NH1 1 
ATOM 8135 N NH2 . ARG A 1 1060 ? 28.951  43.045 -1.946  1.00 83.75  ? 1057 ARG A NH2 1 
ATOM 8136 N N   . LEU A 1 1061 ? 27.841  47.095 5.898   1.00 77.83  ? 1058 LEU A N   1 
ATOM 8137 C CA  . LEU A 1 1061 ? 27.216  48.188 6.661   1.00 77.83  ? 1058 LEU A CA  1 
ATOM 8138 C C   . LEU A 1 1061 ? 28.051  48.773 7.783   1.00 77.83  ? 1058 LEU A C   1 
ATOM 8139 O O   . LEU A 1 1061 ? 27.929  49.954 8.086   1.00 77.83  ? 1058 LEU A O   1 
ATOM 8140 C CB  . LEU A 1 1061 ? 25.851  47.775 7.208   1.00 57.33  ? 1058 LEU A CB  1 
ATOM 8141 C CG  . LEU A 1 1061 ? 24.646  48.308 6.430   1.00 57.33  ? 1058 LEU A CG  1 
ATOM 8142 C CD1 . LEU A 1 1061 ? 23.414  47.506 6.703   1.00 57.33  ? 1058 LEU A CD1 1 
ATOM 8143 C CD2 . LEU A 1 1061 ? 24.405  49.750 6.760   1.00 57.33  ? 1058 LEU A CD2 1 
ATOM 8144 N N   . ASN A 1 1062 ? 28.900  47.951 8.386   1.00 72.52  ? 1059 ASN A N   1 
ATOM 8145 C CA  . ASN A 1 1062 ? 29.714  48.391 9.518   1.00 72.52  ? 1059 ASN A CA  1 
ATOM 8146 C C   . ASN A 1 1062 ? 31.016  49.117 9.200   1.00 72.52  ? 1059 ASN A C   1 
ATOM 8147 O O   . ASN A 1 1062 ? 31.456  49.966 9.987   1.00 72.52  ? 1059 ASN A O   1 
ATOM 8148 C CB  . ASN A 1 1062 ? 29.967  47.251 10.499  1.00 66.15  ? 1059 ASN A CB  1 
ATOM 8149 C CG  . ASN A 1 1062 ? 28.706  46.815 11.232  1.00 66.15  ? 1059 ASN A CG  1 
ATOM 8150 O OD1 . ASN A 1 1062 ? 28.110  47.555 12.025  1.00 66.15  ? 1059 ASN A OD1 1 
ATOM 8151 N ND2 . ASN A 1 1062 ? 28.301  45.605 10.966  1.00 66.15  ? 1059 ASN A ND2 1 
ATOM 8152 N N   . LYS A 1 1063 ? 31.623  48.806 8.054   1.00 69.66  ? 1060 LYS A N   1 
ATOM 8153 C CA  . LYS A 1 1063 ? 32.725  49.620 7.545   1.00 69.66  ? 1060 LYS A CA  1 
ATOM 8154 C C   . LYS A 1 1063 ? 32.223  51.047 7.259   1.00 69.66  ? 1060 LYS A C   1 
ATOM 8155 O O   . LYS A 1 1063 ? 32.955  52.018 7.380   1.00 69.66  ? 1060 LYS A O   1 
ATOM 8156 C CB  . LYS A 1 1063 ? 33.311  48.981 6.293   1.00 82.24  ? 1060 LYS A CB  1 
ATOM 8157 C CG  . LYS A 1 1063 ? 34.208  47.769 6.538   1.00 82.24  ? 1060 LYS A CG  1 
ATOM 8158 C CD  . LYS A 1 1063 ? 35.266  47.682 5.415   1.00 82.24  ? 1060 LYS A CD  1 
ATOM 8159 C CE  . LYS A 1 1063 ? 35.958  46.333 5.336   1.00 82.24  ? 1060 LYS A CE  1 
ATOM 8160 N NZ  . LYS A 1 1063 ? 34.984  45.228 5.070   1.00 82.24  ? 1060 LYS A NZ  1 
ATOM 8161 N N   . VAL A 1 1064 ? 30.944  51.160 6.935   1.00 81.14  ? 1061 VAL A N   1 
ATOM 8162 C CA  . VAL A 1 1064 ? 30.358  52.402 6.455   1.00 81.14  ? 1061 VAL A CA  1 
ATOM 8163 C C   . VAL A 1 1064 ? 29.733  53.314 7.514   1.00 81.14  ? 1061 VAL A C   1 
ATOM 8164 O O   . VAL A 1 1064 ? 29.834  54.536 7.398   1.00 81.14  ? 1061 VAL A O   1 
ATOM 8165 C CB  . VAL A 1 1064 ? 29.310  52.088 5.414   1.00 94.12  ? 1061 VAL A CB  1 
ATOM 8166 C CG1 . VAL A 1 1064 ? 28.801  53.361 4.782   1.00 94.12  ? 1061 VAL A CG1 1 
ATOM 8167 C CG2 . VAL A 1 1064 ? 29.902  51.168 4.375   1.00 94.12  ? 1061 VAL A CG2 1 
ATOM 8168 N N   . ILE A 1 1065 ? 29.070  52.725 8.514   1.00 87.51  ? 1062 ILE A N   1 
ATOM 8169 C CA  . ILE A 1 1065 ? 28.465  53.493 9.621   1.00 87.51  ? 1062 ILE A CA  1 
ATOM 8170 C C   . ILE A 1 1065 ? 29.449  53.899 10.715  1.00 87.51  ? 1062 ILE A C   1 
ATOM 8171 O O   . ILE A 1 1065 ? 30.209  53.072 11.255  1.00 87.51  ? 1062 ILE A O   1 
ATOM 8172 C CB  . ILE A 1 1065 ? 27.295  52.749 10.300  1.00 51.64  ? 1062 ILE A CB  1 
ATOM 8173 C CG1 . ILE A 1 1065 ? 26.012  52.959 9.511   1.00 51.64  ? 1062 ILE A CG1 1 
ATOM 8174 C CG2 . ILE A 1 1065 ? 27.080  53.256 11.749  1.00 51.64  ? 1062 ILE A CG2 1 
ATOM 8175 C CD1 . ILE A 1 1065 ? 25.167  51.759 9.561   1.00 51.64  ? 1062 ILE A CD1 1 
ATOM 8176 N N   . LYS A 1 1066 ? 29.386  55.183 11.048  1.00 84.66  ? 1063 LYS A N   1 
ATOM 8177 C CA  . LYS A 1 1066 ? 30.117  55.751 12.180  1.00 84.66  ? 1063 LYS A CA  1 
ATOM 8178 C C   . LYS A 1 1066 ? 29.431  55.414 13.527  1.00 84.66  ? 1063 LYS A C   1 
ATOM 8179 O O   . LYS A 1 1066 ? 28.503  56.114 13.969  1.00 84.66  ? 1063 LYS A O   1 
ATOM 8180 C CB  . LYS A 1 1066 ? 30.293  57.270 11.982  1.00 128.53 ? 1063 LYS A CB  1 
ATOM 8181 C CG  . LYS A 1 1066 ? 29.012  58.035 11.614  1.00 128.53 ? 1063 LYS A CG  1 
ATOM 8182 C CD  . LYS A 1 1066 ? 28.617  57.873 10.155  1.00 128.53 ? 1063 LYS A CD  1 
ATOM 8183 C CE  . LYS A 1 1066 ? 27.123  58.080 9.979   1.00 128.53 ? 1063 LYS A CE  1 
ATOM 8184 N NZ  . LYS A 1 1066 ? 26.829  58.655 8.638   1.00 128.53 ? 1063 LYS A NZ  1 
ATOM 8185 N N   . SER A 1 1067 ? 29.892  54.332 14.160  1.00 43.28  ? 1064 SER A N   1 
ATOM 8186 C CA  . SER A 1 1067 ? 29.291  53.827 15.384  1.00 43.28  ? 1064 SER A CA  1 
ATOM 8187 C C   . SER A 1 1067 ? 29.639  54.785 16.488  1.00 43.28  ? 1064 SER A C   1 
ATOM 8188 O O   . SER A 1 1067 ? 30.807  55.011 16.739  1.00 43.28  ? 1064 SER A O   1 
ATOM 8189 C CB  . SER A 1 1067 ? 29.801  52.446 15.740  1.00 62.90  ? 1064 SER A CB  1 
ATOM 8190 O OG  . SER A 1 1067 ? 30.427  52.453 17.003  1.00 62.90  ? 1064 SER A OG  1 
ATOM 8191 N N   . VAL A 1 1068 ? 28.615  55.291 17.176  1.00 75.15  ? 1065 VAL A N   1 
ATOM 8192 C CA  . VAL A 1 1068 ? 28.767  56.508 17.943  1.00 75.15  ? 1065 VAL A CA  1 
ATOM 8193 C C   . VAL A 1 1068 ? 30.120  56.568 18.577  1.00 75.15  ? 1065 VAL A C   1 
ATOM 8194 O O   . VAL A 1 1068 ? 31.007  57.202 18.007  1.00 75.15  ? 1065 VAL A O   1 
ATOM 8195 C CB  . VAL A 1 1068 ? 27.604  56.790 18.907  1.00 51.21  ? 1065 VAL A CB  1 
ATOM 8196 C CG1 . VAL A 1 1068 ? 27.914  57.938 19.854  1.00 51.21  ? 1065 VAL A CG1 1 
ATOM 8197 C CG2 . VAL A 1 1068 ? 26.366  57.150 18.074  1.00 51.21  ? 1065 VAL A CG2 1 
ATOM 8198 N N   . GLY A 1 1069 ? 30.309  55.877 19.694  1.00 49.26  ? 1066 GLY A N   1 
ATOM 8199 C CA  . GLY A 1 1069 ? 31.562  55.989 20.433  1.00 49.26  ? 1066 GLY A CA  1 
ATOM 8200 C C   . GLY A 1 1069 ? 32.624  55.075 19.852  1.00 49.26  ? 1066 GLY A C   1 
ATOM 8201 O O   . GLY A 1 1069 ? 33.448  54.557 20.579  1.00 49.26  ? 1066 GLY A O   1 
ATOM 8202 N N   . LYS A 1 1070 ? 32.588  54.857 18.544  1.00 63.66  ? 1067 LYS A N   1 
ATOM 8203 C CA  . LYS A 1 1070 ? 33.581  54.062 17.839  1.00 63.66  ? 1067 LYS A CA  1 
ATOM 8204 C C   . LYS A 1 1070 ? 33.627  52.689 18.435  1.00 63.66  ? 1067 LYS A C   1 
ATOM 8205 O O   . LYS A 1 1070 ? 34.689  52.224 18.791  1.00 63.66  ? 1067 LYS A O   1 
ATOM 8206 C CB  . LYS A 1 1070 ? 34.977  54.700 17.905  1.00 80.16  ? 1067 LYS A CB  1 
ATOM 8207 C CG  . LYS A 1 1070 ? 35.073  56.183 17.519  1.00 80.16  ? 1067 LYS A CG  1 
ATOM 8208 C CD  . LYS A 1 1070 ? 35.510  56.410 16.081  1.00 80.16  ? 1067 LYS A CD  1 
ATOM 8209 C CE  . LYS A 1 1070 ? 35.894  57.874 15.834  1.00 80.16  ? 1067 LYS A CE  1 
ATOM 8210 N NZ  . LYS A 1 1070 ? 37.286  58.227 16.269  1.00 80.16  ? 1067 LYS A NZ  1 
ATOM 8211 N N   . ILE A 1 1071 ? 32.468  52.055 18.572  1.00 41.97  ? 1068 ILE A N   1 
ATOM 8212 C CA  . ILE A 1 1071 ? 32.362  50.687 19.108  1.00 41.97  ? 1068 ILE A CA  1 
ATOM 8213 C C   . ILE A 1 1071 ? 32.148  49.713 17.973  1.00 41.97  ? 1068 ILE A C   1 
ATOM 8214 O O   . ILE A 1 1071 ? 31.312  49.926 17.104  1.00 41.97  ? 1068 ILE A O   1 
ATOM 8215 C CB  . ILE A 1 1071 ? 31.242  50.532 20.196  1.00 39.71  ? 1068 ILE A CB  1 
ATOM 8216 C CG1 . ILE A 1 1071 ? 31.611  51.321 21.454  1.00 39.71  ? 1068 ILE A CG1 1 
ATOM 8217 C CG2 . ILE A 1 1071 ? 31.002  49.081 20.569  1.00 39.71  ? 1068 ILE A CG2 1 
ATOM 8218 C CD1 . ILE A 1 1071 ? 30.488  51.460 22.428  1.00 39.71  ? 1068 ILE A CD1 1 
ATOM 8219 N N   . GLU A 1 1072 ? 32.930  48.642 17.969  1.00 50.34  ? 1069 GLU A N   1 
ATOM 8220 C CA  . GLU A 1 1072 ? 32.754  47.617 16.983  1.00 50.34  ? 1069 GLU A CA  1 
ATOM 8221 C C   . GLU A 1 1072 ? 31.377  46.987 17.250  1.00 50.34  ? 1069 GLU A C   1 
ATOM 8222 O O   . GLU A 1 1072 ? 31.098  46.428 18.312  1.00 50.34  ? 1069 GLU A O   1 
ATOM 8223 C CB  . GLU A 1 1072 ? 33.900  46.605 17.063  1.00 160.28 ? 1069 GLU A CB  1 
ATOM 8224 C CG  . GLU A 1 1072 ? 33.774  45.397 16.144  1.00 160.28 ? 1069 GLU A CG  1 
ATOM 8225 C CD  . GLU A 1 1072 ? 33.718  45.747 14.660  1.00 160.28 ? 1069 GLU A CD  1 
ATOM 8226 O OE1 . GLU A 1 1072 ? 33.623  44.792 13.845  1.00 160.28 ? 1069 GLU A OE1 1 
ATOM 8227 O OE2 . GLU A 1 1072 ? 33.763  46.952 14.304  1.00 160.28 ? 1069 GLU A OE2 1 
ATOM 8228 N N   . HIS A 1 1073 ? 30.505  47.125 16.274  1.00 43.45  ? 1070 HIS A N   1 
ATOM 8229 C CA  . HIS A 1 1073 ? 29.262  46.418 16.288  1.00 43.45  ? 1070 HIS A CA  1 
ATOM 8230 C C   . HIS A 1 1073 ? 29.359  44.913 16.592  1.00 43.45  ? 1070 HIS A C   1 
ATOM 8231 O O   . HIS A 1 1073 ? 28.485  44.320 17.257  1.00 43.45  ? 1070 HIS A O   1 
ATOM 8232 C CB  . HIS A 1 1073 ? 28.589  46.560 14.949  1.00 40.70  ? 1070 HIS A CB  1 
ATOM 8233 C CG  . HIS A 1 1073 ? 27.481  45.579 14.772  1.00 40.70  ? 1070 HIS A CG  1 
ATOM 8234 N ND1 . HIS A 1 1073 ? 26.160  45.913 14.974  1.00 40.70  ? 1070 HIS A ND1 1 
ATOM 8235 C CD2 . HIS A 1 1073 ? 27.496  44.255 14.484  1.00 40.70  ? 1070 HIS A CD2 1 
ATOM 8236 C CE1 . HIS A 1 1073 ? 25.405  44.848 14.775  1.00 40.70  ? 1070 HIS A CE1 1 
ATOM 8237 N NE2 . HIS A 1 1073 ? 26.192  43.829 14.485  1.00 40.70  ? 1070 HIS A NE2 1 
ATOM 8238 N N   . SER A 1 1074 ? 30.376  44.283 16.024  1.00 50.09  ? 1071 SER A N   1 
ATOM 8239 C CA  . SER A 1 1074 ? 30.475  42.824 16.033  1.00 50.09  ? 1071 SER A CA  1 
ATOM 8240 C C   . SER A 1 1074 ? 30.927  42.439 17.418  1.00 50.09  ? 1071 SER A C   1 
ATOM 8241 O O   . SER A 1 1074 ? 30.633  41.352 17.889  1.00 50.09  ? 1071 SER A O   1 
ATOM 8242 C CB  . SER A 1 1074 ? 31.453  42.313 14.950  1.00 65.07  ? 1071 SER A CB  1 
ATOM 8243 O OG  . SER A 1 1074 ? 32.824  42.528 15.305  1.00 65.07  ? 1071 SER A OG  1 
ATOM 8244 N N   . PHE A 1 1075 ? 31.652  43.367 18.044  1.00 54.57  ? 1072 PHE A N   1 
ATOM 8245 C CA  . PHE A 1 1075 ? 32.105  43.238 19.403  1.00 54.57  ? 1072 PHE A CA  1 
ATOM 8246 C C   . PHE A 1 1075 ? 30.908  43.331 20.379  1.00 54.57  ? 1072 PHE A C   1 
ATOM 8247 O O   . PHE A 1 1075 ? 30.792  42.557 21.326  1.00 54.57  ? 1072 PHE A O   1 
ATOM 8248 C CB  . PHE A 1 1075 ? 33.101  44.346 19.673  1.00 37.11  ? 1072 PHE A CB  1 
ATOM 8249 C CG  . PHE A 1 1075 ? 33.367  44.536 21.104  1.00 37.11  ? 1072 PHE A CG  1 
ATOM 8250 C CD1 . PHE A 1 1075 ? 34.277  43.709 21.759  1.00 37.11  ? 1072 PHE A CD1 1 
ATOM 8251 C CD2 . PHE A 1 1075 ? 32.624  45.454 21.843  1.00 37.11  ? 1072 PHE A CD2 1 
ATOM 8252 C CE1 . PHE A 1 1075 ? 34.501  43.830 23.103  1.00 37.11  ? 1072 PHE A CE1 1 
ATOM 8253 C CE2 . PHE A 1 1075 ? 32.832  45.575 23.203  1.00 37.11  ? 1072 PHE A CE2 1 
ATOM 8254 C CZ  . PHE A 1 1075 ? 33.785  44.759 23.827  1.00 37.11  ? 1072 PHE A CZ  1 
ATOM 8255 N N   . TRP A 1 1076 ? 30.052  44.314 20.123  1.00 51.06  ? 1073 TRP A N   1 
ATOM 8256 C CA  . TRP A 1 1076 ? 28.801  44.518 20.780  1.00 51.06  ? 1073 TRP A CA  1 
ATOM 8257 C C   . TRP A 1 1076 ? 27.890  43.309 20.728  1.00 51.06  ? 1073 TRP A C   1 
ATOM 8258 O O   . TRP A 1 1076 ? 27.346  42.938 21.764  1.00 51.06  ? 1073 TRP A O   1 
ATOM 8259 C CB  . TRP A 1 1076 ? 28.133  45.777 20.182  1.00 46.04  ? 1073 TRP A CB  1 
ATOM 8260 C CG  . TRP A 1 1076 ? 26.639  45.990 20.412  1.00 46.04  ? 1073 TRP A CG  1 
ATOM 8261 C CD1 . TRP A 1 1076 ? 25.696  46.230 19.453  1.00 46.04  ? 1073 TRP A CD1 1 
ATOM 8262 C CD2 . TRP A 1 1076 ? 25.937  45.994 21.653  1.00 46.04  ? 1073 TRP A CD2 1 
ATOM 8263 N NE1 . TRP A 1 1076 ? 24.458  46.385 20.014  1.00 46.04  ? 1073 TRP A NE1 1 
ATOM 8264 C CE2 . TRP A 1 1076 ? 24.574  46.229 21.363  1.00 46.04  ? 1073 TRP A CE2 1 
ATOM 8265 C CE3 . TRP A 1 1076 ? 26.317  45.801 22.978  1.00 46.04  ? 1073 TRP A CE3 1 
ATOM 8266 C CZ2 . TRP A 1 1076 ? 23.614  46.292 22.342  1.00 46.04  ? 1073 TRP A CZ2 1 
ATOM 8267 C CZ3 . TRP A 1 1076 ? 25.356  45.874 23.946  1.00 46.04  ? 1073 TRP A CZ3 1 
ATOM 8268 C CH2 . TRP A 1 1076 ? 24.031  46.112 23.630  1.00 46.04  ? 1073 TRP A CH2 1 
ATOM 8269 N N   . ARG A 1 1077 ? 27.727  42.681 19.558  1.00 40.55  ? 1074 ARG A N   1 
ATOM 8270 C CA  . ARG A 1 1077 ? 26.711  41.632 19.406  1.00 40.55  ? 1074 ARG A CA  1 
ATOM 8271 C C   . ARG A 1 1077 ? 27.255  40.299 19.779  1.00 40.55  ? 1074 ARG A C   1 
ATOM 8272 O O   . ARG A 1 1077 ? 26.689  39.266 19.420  1.00 40.55  ? 1074 ARG A O   1 
ATOM 8273 C CB  . ARG A 1 1077 ? 26.226  41.511 17.988  1.00 45.57  ? 1074 ARG A CB  1 
ATOM 8274 C CG  . ARG A 1 1077 ? 25.280  42.528 17.602  1.00 45.57  ? 1074 ARG A CG  1 
ATOM 8275 C CD  . ARG A 1 1077 ? 24.367  42.817 18.730  1.00 45.57  ? 1074 ARG A CD  1 
ATOM 8276 N NE  . ARG A 1 1077 ? 23.227  43.644 18.341  1.00 45.57  ? 1074 ARG A NE  1 
ATOM 8277 C CZ  . ARG A 1 1077 ? 22.278  44.032 19.187  1.00 45.57  ? 1074 ARG A CZ  1 
ATOM 8278 N NH1 . ARG A 1 1077 ? 22.322  43.694 20.463  1.00 45.57  ? 1074 ARG A NH1 1 
ATOM 8279 N NH2 . ARG A 1 1077 ? 21.293  44.776 18.761  1.00 45.57  ? 1074 ARG A NH2 1 
ATOM 8280 N N   . SER A 1 1078 ? 28.378  40.307 20.468  1.00 39.06  ? 1075 SER A N   1 
ATOM 8281 C CA  . SER A 1 1078 ? 29.122  39.096 20.710  1.00 39.06  ? 1075 SER A CA  1 
ATOM 8282 C C   . SER A 1 1078 ? 28.567  38.390 21.906  1.00 39.06  ? 1075 SER A C   1 
ATOM 8283 O O   . SER A 1 1078 ? 28.653  38.923 23.035  1.00 39.06  ? 1075 SER A O   1 
ATOM 8284 C CB  . SER A 1 1078 ? 30.580  39.445 21.022  1.00 51.11  ? 1075 SER A CB  1 
ATOM 8285 O OG  . SER A 1 1078 ? 31.289  39.718 19.839  1.00 51.11  ? 1075 SER A OG  1 
ATOM 8286 N N   . PHE A 1 1079 ? 28.026  37.197 21.714  1.00 51.33  ? 1076 PHE A N   1 
ATOM 8287 C CA  . PHE A 1 1079 ? 27.622  36.409 22.887  1.00 51.33  ? 1076 PHE A CA  1 
ATOM 8288 C C   . PHE A 1 1079 ? 28.729  36.493 23.935  1.00 51.33  ? 1076 PHE A C   1 
ATOM 8289 O O   . PHE A 1 1079 ? 29.891  36.233 23.641  1.00 51.33  ? 1076 PHE A O   1 
ATOM 8290 C CB  . PHE A 1 1079 ? 27.323  34.960 22.538  1.00 55.61  ? 1076 PHE A CB  1 
ATOM 8291 C CG  . PHE A 1 1079 ? 26.974  34.131 23.721  1.00 55.61  ? 1076 PHE A CG  1 
ATOM 8292 C CD1 . PHE A 1 1079 ? 25.729  33.499 23.803  1.00 55.61  ? 1076 PHE A CD1 1 
ATOM 8293 C CD2 . PHE A 1 1079 ? 27.882  33.974 24.770  1.00 55.61  ? 1076 PHE A CD2 1 
ATOM 8294 C CE1 . PHE A 1 1079 ? 25.402  32.730 24.908  1.00 55.61  ? 1076 PHE A CE1 1 
ATOM 8295 C CE2 . PHE A 1 1079 ? 27.559  33.215 25.867  1.00 55.61  ? 1076 PHE A CE2 1 
ATOM 8296 C CZ  . PHE A 1 1079 ? 26.319  32.593 25.943  1.00 55.61  ? 1076 PHE A CZ  1 
ATOM 8297 N N   . HIS A 1 1080 ? 28.362  36.916 25.141  1.00 43.06  ? 1077 HIS A N   1 
ATOM 8298 C CA  . HIS A 1 1080 ? 29.334  37.188 26.200  1.00 43.06  ? 1077 HIS A CA  1 
ATOM 8299 C C   . HIS A 1 1080 ? 28.792  37.036 27.660  1.00 43.06  ? 1077 HIS A C   1 
ATOM 8300 O O   . HIS A 1 1080 ? 27.883  37.736 28.091  1.00 43.06  ? 1077 HIS A O   1 
ATOM 8301 C CB  . HIS A 1 1080 ? 29.954  38.567 25.993  1.00 59.31  ? 1077 HIS A CB  1 
ATOM 8302 C CG  . HIS A 1 1080 ? 30.670  39.067 27.197  1.00 59.31  ? 1077 HIS A CG  1 
ATOM 8303 N ND1 . HIS A 1 1080 ? 31.948  38.667 27.514  1.00 59.31  ? 1077 HIS A ND1 1 
ATOM 8304 C CD2 . HIS A 1 1080 ? 30.260  39.869 28.210  1.00 59.31  ? 1077 HIS A CD2 1 
ATOM 8305 C CE1 . HIS A 1 1080 ? 32.309  39.228 28.658  1.00 59.31  ? 1077 HIS A CE1 1 
ATOM 8306 N NE2 . HIS A 1 1080 ? 31.301  39.958 29.103  1.00 59.31  ? 1077 HIS A NE2 1 
ATOM 8307 N N   . THR A 1 1081 ? 29.371  36.102 28.397  1.00 63.39  ? 1078 THR A N   1 
ATOM 8308 C CA  . THR A 1 1081 ? 29.157  35.977 29.828  1.00 63.39  ? 1078 THR A CA  1 
ATOM 8309 C C   . THR A 1 1081 ? 30.477  36.372 30.487  1.00 63.39  ? 1078 THR A C   1 
ATOM 8310 O O   . THR A 1 1081 ? 31.513  36.470 29.817  1.00 63.39  ? 1078 THR A O   1 
ATOM 8311 C CB  . THR A 1 1081 ? 28.869  34.521 30.217  1.00 56.01  ? 1078 THR A CB  1 
ATOM 8312 O OG1 . THR A 1 1081 ? 30.012  33.733 29.880  1.00 56.01  ? 1078 THR A OG1 1 
ATOM 8313 C CG2 . THR A 1 1081 ? 27.673  33.948 29.455  1.00 56.01  ? 1078 THR A CG2 1 
ATOM 8314 N N   . GLU A 1 1082 ? 30.460  36.566 31.797  1.00 93.34  ? 1079 GLU A N   1 
ATOM 8315 C CA  . GLU A 1 1082 ? 31.694  36.824 32.529  1.00 93.34  ? 1079 GLU A CA  1 
ATOM 8316 C C   . GLU A 1 1082 ? 32.393  35.491 32.707  1.00 93.34  ? 1079 GLU A C   1 
ATOM 8317 O O   . GLU A 1 1082 ? 32.570  35.031 33.837  1.00 93.34  ? 1079 GLU A O   1 
ATOM 8318 C CB  . GLU A 1 1082 ? 31.409  37.520 33.877  1.00 212.91 ? 1079 GLU A CB  1 
ATOM 8319 C CG  . GLU A 1 1082 ? 32.639  37.858 34.755  1.00 212.91 ? 1079 GLU A CG  1 
ATOM 8320 C CD  . GLU A 1 1082 ? 33.612  38.842 34.112  1.00 212.91 ? 1079 GLU A CD  1 
ATOM 8321 O OE1 . GLU A 1 1082 ? 33.746  39.971 34.626  1.00 212.91 ? 1079 GLU A OE1 1 
ATOM 8322 O OE2 . GLU A 1 1082 ? 34.251  38.491 33.098  1.00 212.91 ? 1079 GLU A OE2 1 
ATOM 8323 N N   . ARG A 1 1083 ? 32.757  34.878 31.572  1.00 61.76  ? 1080 ARG A N   1 
ATOM 8324 C CA  . ARG A 1 1083 ? 33.418  33.560 31.501  1.00 61.76  ? 1080 ARG A CA  1 
ATOM 8325 C C   . ARG A 1 1083 ? 33.485  32.987 30.076  1.00 61.76  ? 1080 ARG A C   1 
ATOM 8326 O O   . ARG A 1 1083 ? 33.769  31.796 29.897  1.00 61.76  ? 1080 ARG A O   1 
ATOM 8327 C CB  . ARG A 1 1083 ? 32.763  32.520 32.430  1.00 129.01 ? 1080 ARG A CB  1 
ATOM 8328 C CG  . ARG A 1 1083 ? 31.323  32.176 32.083  1.00 129.01 ? 1080 ARG A CG  1 
ATOM 8329 C CD  . ARG A 1 1083 ? 30.978  30.740 32.438  1.00 129.01 ? 1080 ARG A CD  1 
ATOM 8330 N NE  . ARG A 1 1083 ? 31.401  29.783 31.412  1.00 129.01 ? 1080 ARG A NE  1 
ATOM 8331 C CZ  . ARG A 1 1083 ? 30.706  29.491 30.312  1.00 129.01 ? 1080 ARG A CZ  1 
ATOM 8332 N NH1 . ARG A 1 1083 ? 29.545  30.087 30.068  1.00 129.01 ? 1080 ARG A NH1 1 
ATOM 8333 N NH2 . ARG A 1 1083 ? 31.177  28.600 29.446  1.00 129.01 ? 1080 ARG A NH2 1 
ATOM 8334 N N   . LYS A 1 1084 ? 33.217  33.802 29.064  1.00 72.17  ? 1081 LYS A N   1 
ATOM 8335 C CA  . LYS A 1 1084 ? 33.242  33.303 27.687  1.00 72.17  ? 1081 LYS A CA  1 
ATOM 8336 C C   . LYS A 1 1084 ? 32.848  34.435 26.743  1.00 72.17  ? 1081 LYS A C   1 
ATOM 8337 O O   . LYS A 1 1084 ? 31.960  35.234 27.070  1.00 72.17  ? 1081 LYS A O   1 
ATOM 8338 C CB  . LYS A 1 1084 ? 32.354  32.035 27.522  1.00 55.41  ? 1081 LYS A CB  1 
ATOM 8339 C CG  . LYS A 1 1084 ? 31.757  31.740 26.115  1.00 55.41  ? 1081 LYS A CG  1 
ATOM 8340 C CD  . LYS A 1 1084 ? 31.094  30.360 26.063  1.00 55.41  ? 1081 LYS A CD  1 
ATOM 8341 C CE  . LYS A 1 1084 ? 30.031  30.268 24.967  1.00 55.41  ? 1081 LYS A CE  1 
ATOM 8342 N NZ  . LYS A 1 1084 ? 29.693  28.867 24.524  1.00 55.41  ? 1081 LYS A NZ  1 
ATOM 8343 N N   . THR A 1 1085 ? 33.542  34.536 25.603  1.00 51.83  ? 1082 THR A N   1 
ATOM 8344 C CA  . THR A 1 1085 ? 33.130  35.506 24.608  1.00 51.83  ? 1082 THR A CA  1 
ATOM 8345 C C   . THR A 1 1085 ? 33.297  35.003 23.189  1.00 51.83  ? 1082 THR A C   1 
ATOM 8346 O O   . THR A 1 1085 ? 34.400  34.839 22.714  1.00 51.83  ? 1082 THR A O   1 
ATOM 8347 C CB  . THR A 1 1085 ? 33.823  36.842 24.811  1.00 48.65  ? 1082 THR A CB  1 
ATOM 8348 O OG1 . THR A 1 1085 ? 33.605  37.264 26.157  1.00 48.65  ? 1082 THR A OG1 1 
ATOM 8349 C CG2 . THR A 1 1085 ? 33.236  37.867 23.882  1.00 48.65  ? 1082 THR A CG2 1 
ATOM 8350 N N   . GLU A 1 1086 ? 32.177  34.765 22.523  1.00 54.59  ? 1083 GLU A N   1 
ATOM 8351 C CA  . GLU A 1 1086 ? 32.169  34.275 21.171  1.00 54.59  ? 1083 GLU A CA  1 
ATOM 8352 C C   . GLU A 1 1086 ? 31.466  35.321 20.327  1.00 54.59  ? 1083 GLU A C   1 
ATOM 8353 O O   . GLU A 1 1086 ? 30.635  36.048 20.847  1.00 54.59  ? 1083 GLU A O   1 
ATOM 8354 C CB  . GLU A 1 1086 ? 31.401  32.955 21.106  1.00 93.14  ? 1083 GLU A CB  1 
ATOM 8355 C CG  . GLU A 1 1086 ? 31.797  31.950 22.174  1.00 93.14  ? 1083 GLU A CG  1 
ATOM 8356 C CD  . GLU A 1 1086 ? 33.253  31.517 22.080  1.00 93.14  ? 1083 GLU A CD  1 
ATOM 8357 O OE1 . GLU A 1 1086 ? 33.831  31.103 23.115  1.00 93.14  ? 1083 GLU A OE1 1 
ATOM 8358 O OE2 . GLU A 1 1086 ? 33.817  31.583 20.972  1.00 93.14  ? 1083 GLU A OE2 1 
ATOM 8359 N N   . PRO A 1 1087 ? 31.821  35.427 19.035  1.00 55.03  ? 1084 PRO A N   1 
ATOM 8360 C CA  . PRO A 1 1087 ? 31.087  36.277 18.083  1.00 55.03  ? 1084 PRO A CA  1 
ATOM 8361 C C   . PRO A 1 1087 ? 29.700  35.713 17.768  1.00 55.03  ? 1084 PRO A C   1 
ATOM 8362 O O   . PRO A 1 1087 ? 29.440  34.533 18.022  1.00 55.03  ? 1084 PRO A O   1 
ATOM 8363 C CB  . PRO A 1 1087 ? 31.985  36.258 16.840  1.00 43.77  ? 1084 PRO A CB  1 
ATOM 8364 C CG  . PRO A 1 1087 ? 33.318  35.817 17.374  1.00 43.77  ? 1084 PRO A CG  1 
ATOM 8365 C CD  . PRO A 1 1087 ? 32.994  34.811 18.401  1.00 43.77  ? 1084 PRO A CD  1 
ATOM 8366 N N   . ALA A 1 1088 ? 28.810  36.554 17.247  1.00 49.49  ? 1085 ALA A N   1 
ATOM 8367 C CA  . ALA A 1 1088 ? 27.411  36.140 17.073  1.00 49.49  ? 1085 ALA A CA  1 
ATOM 8368 C C   . ALA A 1 1088 ? 27.345  35.247 15.893  1.00 49.49  ? 1085 ALA A C   1 
ATOM 8369 O O   . ALA A 1 1088 ? 28.064  35.446 14.950  1.00 49.49  ? 1085 ALA A O   1 
ATOM 8370 C CB  . ALA A 1 1088 ? 26.472  37.361 16.868  1.00 18.78  ? 1085 ALA A CB  1 
ATOM 8371 N N   . THR A 1 1089 ? 26.479  34.259 15.921  1.00 37.08  ? 1086 THR A N   1 
ATOM 8372 C CA  . THR A 1 1089 ? 26.288  33.426 14.716  1.00 37.08  ? 1086 THR A CA  1 
ATOM 8373 C C   . THR A 1 1089 ? 24.800  33.230 14.532  1.00 37.08  ? 1086 THR A C   1 
ATOM 8374 O O   . THR A 1 1089 ? 24.053  33.272 15.517  1.00 37.08  ? 1086 THR A O   1 
ATOM 8375 C CB  . THR A 1 1089 ? 26.892  32.024 14.908  1.00 53.80  ? 1086 THR A CB  1 
ATOM 8376 O OG1 . THR A 1 1089 ? 26.174  31.342 15.957  1.00 53.80  ? 1086 THR A OG1 1 
ATOM 8377 C CG2 . THR A 1 1089 ? 28.378  32.120 15.283  1.00 53.80  ? 1086 THR A CG2 1 
ATOM 8378 N N   . GLY A 1 1090 ? 24.355  32.993 13.312  1.00 53.91  ? 1087 GLY A N   1 
ATOM 8379 C CA  . GLY A 1 1090 ? 22.950  32.711 13.128  1.00 53.91  ? 1087 GLY A CA  1 
ATOM 8380 C C   . GLY A 1 1090 ? 21.996  33.829 13.517  1.00 53.91  ? 1087 GLY A C   1 
ATOM 8381 O O   . GLY A 1 1090 ? 20.790  33.602 13.599  1.00 53.91  ? 1087 GLY A O   1 
ATOM 8382 N N   . PHE A 1 1091 ? 22.509  35.043 13.712  1.00 52.48  ? 1088 PHE A N   1 
ATOM 8383 C CA  . PHE A 1 1091 ? 21.643  36.165 14.023  1.00 52.48  ? 1088 PHE A CA  1 
ATOM 8384 C C   . PHE A 1 1091 ? 21.943  37.447 13.258  1.00 52.48  ? 1088 PHE A C   1 
ATOM 8385 O O   . PHE A 1 1091 ? 23.118  37.779 13.030  1.00 52.48  ? 1088 PHE A O   1 
ATOM 8386 C CB  . PHE A 1 1091 ? 21.741  36.488 15.510  1.00 52.16  ? 1088 PHE A CB  1 
ATOM 8387 C CG  . PHE A 1 1091 ? 20.948  35.595 16.362  1.00 52.16  ? 1088 PHE A CG  1 
ATOM 8388 C CD1 . PHE A 1 1091 ? 21.527  34.503 16.954  1.00 52.16  ? 1088 PHE A CD1 1 
ATOM 8389 C CD2 . PHE A 1 1091 ? 19.612  35.845 16.572  1.00 52.16  ? 1088 PHE A CD2 1 
ATOM 8390 C CE1 . PHE A 1 1091 ? 20.801  33.675 17.741  1.00 52.16  ? 1088 PHE A CE1 1 
ATOM 8391 C CE2 . PHE A 1 1091 ? 18.869  35.014 17.356  1.00 52.16  ? 1088 PHE A CE2 1 
ATOM 8392 C CZ  . PHE A 1 1091 ? 19.463  33.926 17.934  1.00 52.16  ? 1088 PHE A CZ  1 
ATOM 8393 N N   . ILE A 1 1092 ? 20.888  38.195 12.934  1.00 64.12  ? 1089 ILE A N   1 
ATOM 8394 C CA  . ILE A 1 1092 ? 21.020  39.508 12.345  1.00 64.12  ? 1089 ILE A CA  1 
ATOM 8395 C C   . ILE A 1 1092 ? 20.206  40.536 13.122  1.00 64.12  ? 1089 ILE A C   1 
ATOM 8396 O O   . ILE A 1 1092 ? 19.019  40.299 13.372  1.00 64.12  ? 1089 ILE A O   1 
ATOM 8397 C CB  . ILE A 1 1092 ? 20.430  39.503 10.945  1.00 72.31  ? 1089 ILE A CB  1 
ATOM 8398 C CG1 . ILE A 1 1092 ? 20.575  38.130 10.321  1.00 72.31  ? 1089 ILE A CG1 1 
ATOM 8399 C CG2 . ILE A 1 1092 ? 21.093  40.531 10.082  1.00 72.31  ? 1089 ILE A CG2 1 
ATOM 8400 C CD1 . ILE A 1 1092 ? 20.234  38.098 8.863   1.00 72.31  ? 1089 ILE A CD1 1 
ATOM 8401 N N   . ASP A 1 1093 ? 20.779  41.693 13.473  1.00 43.88  ? 1090 ASP A N   1 
ATOM 8402 C CA  . ASP A 1 1093 ? 19.848  42.751 13.885  1.00 43.88  ? 1090 ASP A CA  1 
ATOM 8403 C C   . ASP A 1 1093 ? 19.358  43.430 12.661  1.00 43.88  ? 1090 ASP A C   1 
ATOM 8404 O O   . ASP A 1 1093 ? 20.102  44.113 11.952  1.00 43.88  ? 1090 ASP A O   1 
ATOM 8405 C CB  . ASP A 1 1093 ? 20.310  43.779 14.965  1.00 47.10  ? 1090 ASP A CB  1 
ATOM 8406 C CG  . ASP A 1 1093 ? 21.753  43.954 14.981  1.00 47.10  ? 1090 ASP A CG  1 
ATOM 8407 O OD1 . ASP A 1 1093 ? 22.283  44.608 15.905  1.00 47.10  ? 1090 ASP A OD1 1 
ATOM 8408 O OD2 . ASP A 1 1093 ? 22.348  43.381 14.050  1.00 47.10  ? 1090 ASP A OD2 1 
ATOM 8409 N N   . GLY A 1 1094 ? 18.090  43.172 12.394  1.00 49.71  ? 1091 GLY A N   1 
ATOM 8410 C CA  . GLY A 1 1094 ? 17.353  44.042 11.542  1.00 49.71  ? 1091 GLY A CA  1 
ATOM 8411 C C   . GLY A 1 1094 ? 17.601  45.464 11.970  1.00 49.71  ? 1091 GLY A C   1 
ATOM 8412 O O   . GLY A 1 1094 ? 17.458  46.355 11.177  1.00 49.71  ? 1091 GLY A O   1 
ATOM 8413 N N   . ASP A 1 1095 ? 17.985  45.674 13.219  1.00 50.58  ? 1092 ASP A N   1 
ATOM 8414 C CA  . ASP A 1 1095 ? 18.196  47.012 13.713  1.00 50.58  ? 1092 ASP A CA  1 
ATOM 8415 C C   . ASP A 1 1095 ? 19.391  47.585 12.987  1.00 50.58  ? 1092 ASP A C   1 
ATOM 8416 O O   . ASP A 1 1095 ? 19.454  48.756 12.653  1.00 50.58  ? 1092 ASP A O   1 
ATOM 8417 C CB  . ASP A 1 1095 ? 18.491  46.968 15.205  1.00 43.33  ? 1092 ASP A CB  1 
ATOM 8418 C CG  . ASP A 1 1095 ? 17.251  46.962 16.063  1.00 43.33  ? 1092 ASP A CG  1 
ATOM 8419 O OD1 . ASP A 1 1095 ? 16.157  46.915 15.503  1.00 43.33  ? 1092 ASP A OD1 1 
ATOM 8420 O OD2 . ASP A 1 1095 ? 17.387  46.996 17.310  1.00 43.33  ? 1092 ASP A OD2 1 
ATOM 8421 N N   . LEU A 1 1096 ? 20.360  46.719 12.755  1.00 68.46  ? 1093 LEU A N   1 
ATOM 8422 C CA  . LEU A 1 1096 ? 21.483  47.077 11.930  1.00 68.46  ? 1093 LEU A CA  1 
ATOM 8423 C C   . LEU A 1 1096 ? 21.015  47.160 10.508  1.00 68.46  ? 1093 LEU A C   1 
ATOM 8424 O O   . LEU A 1 1096 ? 21.112  48.200 9.888   1.00 68.46  ? 1093 LEU A O   1 
ATOM 8425 C CB  . LEU A 1 1096 ? 22.580  46.050 12.027  1.00 41.31  ? 1093 LEU A CB  1 
ATOM 8426 C CG  . LEU A 1 1096 ? 23.855  46.706 11.537  1.00 41.31  ? 1093 LEU A CG  1 
ATOM 8427 C CD1 . LEU A 1 1096 ? 24.124  46.377 10.088  1.00 41.31  ? 1093 LEU A CD1 1 
ATOM 8428 C CD2 . LEU A 1 1096 ? 23.778  48.205 11.736  1.00 41.31  ? 1093 LEU A CD2 1 
ATOM 8429 N N   . ILE A 1 1097 ? 20.502  46.052 9.994   1.00 50.50  ? 1094 ILE A N   1 
ATOM 8430 C CA  . ILE A 1 1097 ? 20.001  46.055 8.647   1.00 50.50  ? 1094 ILE A CA  1 
ATOM 8431 C C   . ILE A 1 1097 ? 19.284  47.350 8.378   1.00 50.50  ? 1094 ILE A C   1 
ATOM 8432 O O   . ILE A 1 1097 ? 19.663  48.073 7.477   1.00 50.50  ? 1094 ILE A O   1 
ATOM 8433 C CB  . ILE A 1 1097 ? 19.076  44.877 8.352   1.00 41.57  ? 1094 ILE A CB  1 
ATOM 8434 C CG1 . ILE A 1 1097 ? 19.812  43.547 8.547   1.00 41.57  ? 1094 ILE A CG1 1 
ATOM 8435 C CG2 . ILE A 1 1097 ? 18.570  44.967 6.947   1.00 41.57  ? 1094 ILE A CG2 1 
ATOM 8436 C CD1 . ILE A 1 1097 ? 21.146  43.430 7.776   1.00 41.57  ? 1094 ILE A CD1 1 
ATOM 8437 N N   . GLU A 1 1098 ? 18.277  47.662 9.178   1.00 81.87  ? 1095 GLU A N   1 
ATOM 8438 C CA  . GLU A 1 1098 ? 17.489  48.866 8.965   1.00 81.87  ? 1095 GLU A CA  1 
ATOM 8439 C C   . GLU A 1 1098 ? 18.310  50.148 9.015   1.00 81.87  ? 1095 GLU A C   1 
ATOM 8440 O O   . GLU A 1 1098 ? 17.950  51.112 8.359   1.00 81.87  ? 1095 GLU A O   1 
ATOM 8441 C CB  . GLU A 1 1098 ? 16.286  48.910 9.910   1.00 68.91  ? 1095 GLU A CB  1 
ATOM 8442 C CG  . GLU A 1 1098 ? 15.132  48.041 9.405   1.00 68.91  ? 1095 GLU A CG  1 
ATOM 8443 C CD  . GLU A 1 1098 ? 14.110  47.651 10.472  1.00 68.91  ? 1095 GLU A CD  1 
ATOM 8444 O OE1 . GLU A 1 1098 ? 13.864  48.447 11.423  1.00 68.91  ? 1095 GLU A OE1 1 
ATOM 8445 O OE2 . GLU A 1 1098 ? 13.557  46.523 10.342  1.00 68.91  ? 1095 GLU A OE2 1 
ATOM 8446 N N   . SER A 1 1099 ? 19.420  50.154 9.759   1.00 67.27  ? 1096 SER A N   1 
ATOM 8447 C CA  . SER A 1 1099 ? 20.367  51.277 9.726   1.00 67.27  ? 1096 SER A CA  1 
ATOM 8448 C C   . SER A 1 1099 ? 20.557  51.739 8.279   1.00 67.27  ? 1096 SER A C   1 
ATOM 8449 O O   . SER A 1 1099 ? 20.694  52.929 8.009   1.00 67.27  ? 1096 SER A O   1 
ATOM 8450 C CB  . SER A 1 1099 ? 21.722  50.886 10.316  1.00 153.78 ? 1096 SER A CB  1 
ATOM 8451 O OG  . SER A 1 1099 ? 21.585  50.155 11.516  1.00 153.78 ? 1096 SER A OG  1 
ATOM 8452 N N   . PHE A 1 1100 ? 20.550  50.785 7.356   1.00 74.75  ? 1097 PHE A N   1 
ATOM 8453 C CA  . PHE A 1 1100 ? 20.693  51.063 5.946   1.00 74.75  ? 1097 PHE A CA  1 
ATOM 8454 C C   . PHE A 1 1100 ? 19.912  52.312 5.541   1.00 74.75  ? 1097 PHE A C   1 
ATOM 8455 O O   . PHE A 1 1100 ? 20.499  53.366 5.335   1.00 74.75  ? 1097 PHE A O   1 
ATOM 8456 C CB  . PHE A 1 1100 ? 20.249  49.850 5.134   1.00 85.14  ? 1097 PHE A CB  1 
ATOM 8457 C CG  . PHE A 1 1100 ? 20.874  49.763 3.774   1.00 85.14  ? 1097 PHE A CG  1 
ATOM 8458 C CD1 . PHE A 1 1100 ? 22.255  49.670 3.633   1.00 85.14  ? 1097 PHE A CD1 1 
ATOM 8459 C CD2 . PHE A 1 1100 ? 20.073  49.746 2.627   1.00 85.14  ? 1097 PHE A CD2 1 
ATOM 8460 C CE1 . PHE A 1 1100 ? 22.835  49.584 2.374   1.00 85.14  ? 1097 PHE A CE1 1 
ATOM 8461 C CE2 . PHE A 1 1100 ? 20.642  49.653 1.360   1.00 85.14  ? 1097 PHE A CE2 1 
ATOM 8462 C CZ  . PHE A 1 1100 ? 22.035  49.566 1.237   1.00 85.14  ? 1097 PHE A CZ  1 
ATOM 8463 N N   . LEU A 1 1101 ? 18.590  52.200 5.471   1.00 55.40  ? 1098 LEU A N   1 
ATOM 8464 C CA  . LEU A 1 1101 ? 17.725  53.278 4.990   1.00 55.40  ? 1098 LEU A CA  1 
ATOM 8465 C C   . LEU A 1 1101 ? 18.061  54.698 5.486   1.00 55.40  ? 1098 LEU A C   1 
ATOM 8466 O O   . LEU A 1 1101 ? 17.901  55.657 4.741   1.00 55.40  ? 1098 LEU A O   1 
ATOM 8467 C CB  . LEU A 1 1101 ? 16.273  52.949 5.316   1.00 55.15  ? 1098 LEU A CB  1 
ATOM 8468 C CG  . LEU A 1 1101 ? 15.775  51.543 4.940   1.00 55.15  ? 1098 LEU A CG  1 
ATOM 8469 C CD1 . LEU A 1 1101 ? 14.329  51.377 5.338   1.00 55.15  ? 1098 LEU A CD1 1 
ATOM 8470 C CD2 . LEU A 1 1101 ? 15.912  51.275 3.454   1.00 55.15  ? 1098 LEU A CD2 1 
ATOM 8471 N N   . ASP A 1 1102 ? 18.510  54.850 6.728   1.00 74.52  ? 1099 ASP A N   1 
ATOM 8472 C CA  . ASP A 1 1102 ? 18.871  56.165 7.243   1.00 74.52  ? 1099 ASP A CA  1 
ATOM 8473 C C   . ASP A 1 1102 ? 20.213  56.595 6.674   1.00 74.52  ? 1099 ASP A C   1 
ATOM 8474 O O   . ASP A 1 1102 ? 20.927  57.396 7.271   1.00 74.52  ? 1099 ASP A O   1 
ATOM 8475 C CB  . ASP A 1 1102 ? 18.963  56.141 8.773   1.00 110.80 ? 1099 ASP A CB  1 
ATOM 8476 C CG  . ASP A 1 1102 ? 17.627  55.871 9.453   1.00 110.80 ? 1099 ASP A CG  1 
ATOM 8477 O OD1 . ASP A 1 1102 ? 16.912  54.934 9.036   1.00 110.80 ? 1099 ASP A OD1 1 
ATOM 8478 O OD2 . ASP A 1 1102 ? 17.307  56.590 10.428  1.00 110.80 ? 1099 ASP A OD2 1 
ATOM 8479 N N   . ILE A 1 1103 ? 20.564  56.050 5.521   1.00 97.19  ? 1100 ILE A N   1 
ATOM 8480 C CA  . ILE A 1 1103 ? 21.863  56.299 4.927   1.00 97.19  ? 1100 ILE A CA  1 
ATOM 8481 C C   . ILE A 1 1103 ? 21.743  57.082 3.622   1.00 97.19  ? 1100 ILE A C   1 
ATOM 8482 O O   . ILE A 1 1103 ? 20.833  56.862 2.814   1.00 97.19  ? 1100 ILE A O   1 
ATOM 8483 C CB  . ILE A 1 1103 ? 22.649  54.974 4.762   1.00 102.70 ? 1100 ILE A CB  1 
ATOM 8484 C CG1 . ILE A 1 1103 ? 23.474  54.708 6.002   1.00 102.70 ? 1100 ILE A CG1 1 
ATOM 8485 C CG2 . ILE A 1 1103 ? 23.573  54.996 3.597   1.00 102.70 ? 1100 ILE A CG2 1 
ATOM 8486 C CD1 . ILE A 1 1103 ? 24.238  53.431 5.916   1.00 102.70 ? 1100 ILE A CD1 1 
ATOM 8487 N N   . SER A 1 1104 ? 22.670  58.016 3.453   1.00 121.10 ? 1101 SER A N   1 
ATOM 8488 C CA  . SER A 1 1104 ? 22.858  58.750 2.210   1.00 121.10 ? 1101 SER A CA  1 
ATOM 8489 C C   . SER A 1 1104 ? 23.181  57.788 1.064   1.00 121.10 ? 1101 SER A C   1 
ATOM 8490 O O   . SER A 1 1104 ? 23.881  56.793 1.262   1.00 121.10 ? 1101 SER A O   1 
ATOM 8491 C CB  . SER A 1 1104 ? 24.038  59.688 2.389   1.00 58.81  ? 1101 SER A CB  1 
ATOM 8492 O OG  . SER A 1 1104 ? 25.223  58.897 2.418   1.00 58.81  ? 1101 SER A OG  1 
ATOM 8493 N N   . ARG A 1 1105 ? 22.712  58.107 -0.138  1.00 183.16 ? 1102 ARG A N   1 
ATOM 8494 C CA  . ARG A 1 1105 ? 22.963  57.252 -1.300  1.00 183.16 ? 1102 ARG A CA  1 
ATOM 8495 C C   . ARG A 1 1105 ? 24.455  56.969 -1.582  1.00 183.16 ? 1102 ARG A C   1 
ATOM 8496 O O   . ARG A 1 1105 ? 24.793  55.848 -1.964  1.00 183.16 ? 1102 ARG A O   1 
ATOM 8497 C CB  . ARG A 1 1105 ? 22.243  57.777 -2.548  1.00 133.91 ? 1102 ARG A CB  1 
ATOM 8498 C CG  . ARG A 1 1105 ? 21.936  56.700 -3.593  1.00 133.91 ? 1102 ARG A CG  1 
ATOM 8499 C CD  . ARG A 1 1105 ? 20.889  57.158 -4.608  1.00 133.91 ? 1102 ARG A CD  1 
ATOM 8500 N NE  . ARG A 1 1105 ? 20.766  56.209 -5.714  1.00 133.91 ? 1102 ARG A NE  1 
ATOM 8501 C CZ  . ARG A 1 1105 ? 19.945  55.160 -5.727  1.00 133.91 ? 1102 ARG A CZ  1 
ATOM 8502 N NH1 . ARG A 1 1105 ? 19.153  54.909 -4.692  1.00 133.91 ? 1102 ARG A NH1 1 
ATOM 8503 N NH2 . ARG A 1 1105 ? 19.914  54.358 -6.782  1.00 133.91 ? 1102 ARG A NH2 1 
ATOM 8504 N N   . PRO A 1 1106 ? 25.347  57.974 -1.400  1.00 102.99 ? 1103 PRO A N   1 
ATOM 8505 C CA  . PRO A 1 1106 ? 26.774  57.677 -1.584  1.00 102.99 ? 1103 PRO A CA  1 
ATOM 8506 C C   . PRO A 1 1106 ? 27.245  56.527 -0.715  1.00 102.99 ? 1103 PRO A C   1 
ATOM 8507 O O   . PRO A 1 1106 ? 27.862  55.595 -1.229  1.00 102.99 ? 1103 PRO A O   1 
ATOM 8508 C CB  . PRO A 1 1106 ? 27.481  58.977 -1.165  1.00 90.05  ? 1103 PRO A CB  1 
ATOM 8509 C CG  . PRO A 1 1106 ? 26.449  59.807 -0.483  1.00 90.05  ? 1103 PRO A CG  1 
ATOM 8510 C CD  . PRO A 1 1106 ? 25.133  59.393 -1.065  1.00 90.05  ? 1103 PRO A CD  1 
ATOM 8511 N N   . LYS A 1 1107 ? 26.926  56.593 0.581   1.00 102.51 ? 1104 LYS A N   1 
ATOM 8512 C CA  . LYS A 1 1107 ? 27.362  55.603 1.573   1.00 102.51 ? 1104 LYS A CA  1 
ATOM 8513 C C   . LYS A 1 1107 ? 26.711  54.269 1.272   1.00 102.51 ? 1104 LYS A C   1 
ATOM 8514 O O   . LYS A 1 1107 ? 27.228  53.208 1.603   1.00 102.51 ? 1104 LYS A O   1 
ATOM 8515 C CB  . LYS A 1 1107 ? 27.010  56.065 2.992   1.00 177.05 ? 1104 LYS A CB  1 
ATOM 8516 C CG  . LYS A 1 1107 ? 27.775  57.294 3.490   1.00 177.05 ? 1104 LYS A CG  1 
ATOM 8517 C CD  . LYS A 1 1107 ? 29.189  56.949 3.944   1.00 177.05 ? 1104 LYS A CD  1 
ATOM 8518 C CE  . LYS A 1 1107 ? 30.016  58.203 4.188   1.00 177.05 ? 1104 LYS A CE  1 
ATOM 8519 N NZ  . LYS A 1 1107 ? 30.230  59.011 2.943   1.00 177.05 ? 1104 LYS A NZ  1 
ATOM 8520 N N   . MET A 1 1108 ? 25.577  54.360 0.603   1.00 68.72  ? 1105 MET A N   1 
ATOM 8521 C CA  . MET A 1 1108 ? 24.761  53.221 0.265   1.00 68.72  ? 1105 MET A CA  1 
ATOM 8522 C C   . MET A 1 1108 ? 25.323  52.469 -0.936  1.00 68.72  ? 1105 MET A C   1 
ATOM 8523 O O   . MET A 1 1108 ? 25.411  51.241 -0.924  1.00 68.72  ? 1105 MET A O   1 
ATOM 8524 C CB  . MET A 1 1108 ? 23.372  53.732 -0.071  1.00 81.42  ? 1105 MET A CB  1 
ATOM 8525 C CG  . MET A 1 1108 ? 22.263  52.805 0.277   1.00 81.42  ? 1105 MET A CG  1 
ATOM 8526 S SD  . MET A 1 1108 ? 20.702  53.641 0.002   1.00 81.42  ? 1105 MET A SD  1 
ATOM 8527 C CE  . MET A 1 1108 ? 20.791  55.040 1.120   1.00 81.42  ? 1105 MET A CE  1 
ATOM 8528 N N   . GLN A 1 1109 ? 25.684  53.220 -1.979  1.00 95.78  ? 1106 GLN A N   1 
ATOM 8529 C CA  . GLN A 1 1109 ? 26.288  52.655 -3.196  1.00 95.78  ? 1106 GLN A CA  1 
ATOM 8530 C C   . GLN A 1 1109 ? 27.560  51.878 -2.867  1.00 95.78  ? 1106 GLN A C   1 
ATOM 8531 O O   . GLN A 1 1109 ? 27.768  50.775 -3.368  1.00 95.78  ? 1106 GLN A O   1 
ATOM 8532 C CB  . GLN A 1 1109 ? 26.568  53.756 -4.236  1.00 92.97  ? 1106 GLN A CB  1 
ATOM 8533 C CG  . GLN A 1 1109 ? 25.321  54.389 -4.873  1.00 92.97  ? 1106 GLN A CG  1 
ATOM 8534 C CD  . GLN A 1 1109 ? 24.480  53.405 -5.687  1.00 92.97  ? 1106 GLN A CD  1 
ATOM 8535 O OE1 . GLN A 1 1109 ? 24.946  52.327 -6.086  1.00 92.97  ? 1106 GLN A OE1 1 
ATOM 8536 N NE2 . GLN A 1 1109 ? 23.227  53.775 -5.932  1.00 92.97  ? 1106 GLN A NE2 1 
ATOM 8537 N N   . GLU A 1 1110 ? 28.384  52.475 -2.007  1.00 82.49  ? 1107 GLU A N   1 
ATOM 8538 C CA  . GLU A 1 1110 ? 29.540  51.824 -1.393  1.00 82.49  ? 1107 GLU A CA  1 
ATOM 8539 C C   . GLU A 1 1110 ? 29.262  50.433 -0.856  1.00 82.49  ? 1107 GLU A C   1 
ATOM 8540 O O   . GLU A 1 1110 ? 30.097  49.547 -0.951  1.00 82.49  ? 1107 GLU A O   1 
ATOM 8541 C CB  . GLU A 1 1110 ? 30.014  52.644 -0.210  1.00 82.68  ? 1107 GLU A CB  1 
ATOM 8542 C CG  . GLU A 1 1110 ? 30.470  54.036 -0.527  1.00 82.68  ? 1107 GLU A CG  1 
ATOM 8543 C CD  . GLU A 1 1110 ? 30.984  54.725 0.709   1.00 82.68  ? 1107 GLU A CD  1 
ATOM 8544 O OE1 . GLU A 1 1110 ? 31.775  54.089 1.457   1.00 82.68  ? 1107 GLU A OE1 1 
ATOM 8545 O OE2 . GLU A 1 1110 ? 30.588  55.893 0.940   1.00 82.68  ? 1107 GLU A OE2 1 
ATOM 8546 N N   . VAL A 1 1111 ? 28.086  50.261 -0.269  1.00 109.47 ? 1108 VAL A N   1 
ATOM 8547 C CA  . VAL A 1 1111 ? 27.707  49.013 0.371   1.00 109.47 ? 1108 VAL A CA  1 
ATOM 8548 C C   . VAL A 1 1111 ? 27.586  47.895 -0.659  1.00 109.47 ? 1108 VAL A C   1 
ATOM 8549 O O   . VAL A 1 1111 ? 27.696  46.716 -0.332  1.00 109.47 ? 1108 VAL A O   1 
ATOM 8550 C CB  . VAL A 1 1111 ? 26.407  49.191 1.184   1.00 98.01  ? 1108 VAL A CB  1 
ATOM 8551 C CG1 . VAL A 1 1111 ? 26.142  47.983 2.069   1.00 98.01  ? 1108 VAL A CG1 1 
ATOM 8552 C CG2 . VAL A 1 1111 ? 26.496  50.444 2.046   1.00 98.01  ? 1108 VAL A CG2 1 
ATOM 8553 N N   . VAL A 1 1112 ? 27.390  48.265 -1.916  1.00 125.06 ? 1109 VAL A N   1 
ATOM 8554 C CA  . VAL A 1 1112 ? 27.463  47.264 -2.965  1.00 125.06 ? 1109 VAL A CA  1 
ATOM 8555 C C   . VAL A 1 1112 ? 28.724  47.373 -3.838  1.00 125.06 ? 1109 VAL A C   1 
ATOM 8556 O O   . VAL A 1 1112 ? 28.941  48.353 -4.555  1.00 125.06 ? 1109 VAL A O   1 
ATOM 8557 C CB  . VAL A 1 1112 ? 26.178  47.182 -3.807  1.00 56.32  ? 1109 VAL A CB  1 
ATOM 8558 C CG1 . VAL A 1 1112 ? 26.272  45.966 -4.747  1.00 56.32  ? 1109 VAL A CG1 1 
ATOM 8559 C CG2 . VAL A 1 1112 ? 24.956  47.089 -2.892  1.00 56.32  ? 1109 VAL A CG2 1 
ATOM 8560 N N   . ALA A 1 1113 ? 29.558  46.349 -3.734  1.00 150.83 ? 1110 ALA A N   1 
ATOM 8561 C CA  . ALA A 1 1113 ? 30.726  46.214 -4.567  1.00 150.83 ? 1110 ALA A CA  1 
ATOM 8562 C C   . ALA A 1 1113 ? 30.571  44.888 -5.293  1.00 150.83 ? 1110 ALA A C   1 
ATOM 8563 O O   . ALA A 1 1113 ? 31.240  44.630 -6.291  1.00 150.83 ? 1110 ALA A O   1 
ATOM 8564 C CB  . ALA A 1 1113 ? 31.959  46.243 -3.721  1.00 50.32  ? 1110 ALA A CB  1 
ATOM 8565 N N   . ASN A 1 1114 ? 29.675  44.062 -4.751  1.00 85.78  ? 1111 ASN A N   1 
ATOM 8566 C CA  . ASN A 1 1114 ? 29.074  42.885 -5.416  1.00 85.78  ? 1111 ASN A CA  1 
ATOM 8567 C C   . ASN A 1 1114 ? 27.994  42.219 -4.532  1.00 85.78  ? 1111 ASN A C   1 
ATOM 8568 O O   . ASN A 1 1114 ? 27.658  41.035 -4.684  1.00 85.78  ? 1111 ASN A O   1 
ATOM 8569 C CB  . ASN A 1 1114 ? 30.132  41.862 -5.850  1.00 120.30 ? 1111 ASN A CB  1 
ATOM 8570 C CG  . ASN A 1 1114 ? 30.946  41.324 -4.684  1.00 120.30 ? 1111 ASN A CG  1 
ATOM 8571 O OD1 . ASN A 1 1114 ? 30.839  41.811 -3.554  1.00 120.30 ? 1111 ASN A OD1 1 
ATOM 8572 N ND2 . ASN A 1 1114 ? 31.771  40.316 -4.955  1.00 120.30 ? 1111 ASN A ND2 1 
ATOM 8573 N N   . ARG A 1 1125 ? 21.460  34.779 -9.501  1.00 94.03  ? 1122 ARG A N   1 
ATOM 8574 C CA  . ARG A 1 1125 ? 21.971  35.689 -8.473  1.00 94.03  ? 1122 ARG A CA  1 
ATOM 8575 C C   . ARG A 1 1125 ? 22.617  36.970 -9.049  1.00 94.03  ? 1122 ARG A C   1 
ATOM 8576 O O   . ARG A 1 1125 ? 23.100  36.977 -10.195 1.00 94.03  ? 1122 ARG A O   1 
ATOM 8577 C CB  . ARG A 1 1125 ? 22.936  34.958 -7.521  1.00 131.66 ? 1122 ARG A CB  1 
ATOM 8578 C CG  . ARG A 1 1125 ? 24.145  34.312 -8.185  1.00 131.66 ? 1122 ARG A CG  1 
ATOM 8579 C CD  . ARG A 1 1125 ? 25.327  34.297 -7.232  1.00 131.66 ? 1122 ARG A CD  1 
ATOM 8580 N NE  . ARG A 1 1125 ? 26.604  34.182 -7.933  1.00 131.66 ? 1122 ARG A NE  1 
ATOM 8581 C CZ  . ARG A 1 1125 ? 27.234  35.186 -8.543  1.00 131.66 ? 1122 ARG A CZ  1 
ATOM 8582 N NH1 . ARG A 1 1125 ? 26.712  36.408 -8.562  1.00 131.66 ? 1122 ARG A NH1 1 
ATOM 8583 N NH2 . ARG A 1 1125 ? 28.392  34.958 -9.147  1.00 131.66 ? 1122 ARG A NH2 1 
ATOM 8584 N N   . GLU A 1 1126 ? 22.613  38.042 -8.246  1.00 158.56 ? 1123 GLU A N   1 
ATOM 8585 C CA  . GLU A 1 1126 ? 23.170  39.342 -8.643  1.00 158.56 ? 1123 GLU A CA  1 
ATOM 8586 C C   . GLU A 1 1126 ? 23.526  40.227 -7.441  1.00 158.56 ? 1123 GLU A C   1 
ATOM 8587 O O   . GLU A 1 1126 ? 23.469  39.782 -6.290  1.00 158.56 ? 1123 GLU A O   1 
ATOM 8588 C CB  . GLU A 1 1126 ? 22.186  40.080 -9.557  1.00 144.99 ? 1123 GLU A CB  1 
ATOM 8589 C CG  . GLU A 1 1126 ? 22.852  41.016 -10.554 1.00 144.99 ? 1123 GLU A CG  1 
ATOM 8590 C CD  . GLU A 1 1126 ? 21.888  42.024 -11.149 1.00 144.99 ? 1123 GLU A CD  1 
ATOM 8591 O OE1 . GLU A 1 1126 ? 20.947  42.464 -10.444 1.00 144.99 ? 1123 GLU A OE1 1 
ATOM 8592 O OE2 . GLU A 1 1126 ? 22.079  42.384 -12.328 1.00 144.99 ? 1123 GLU A OE2 1 
ATOM 8593 N N   . ALA A 1 1127 ? 23.907  41.473 -7.729  1.00 156.90 ? 1124 ALA A N   1 
ATOM 8594 C CA  . ALA A 1 1127 ? 24.156  42.500 -6.717  1.00 156.90 ? 1124 ALA A CA  1 
ATOM 8595 C C   . ALA A 1 1127 ? 23.893  43.867 -7.322  1.00 156.90 ? 1124 ALA A C   1 
ATOM 8596 O O   . ALA A 1 1127 ? 24.536  44.249 -8.301  1.00 156.90 ? 1124 ALA A O   1 
ATOM 8597 C CB  . ALA A 1 1127 ? 25.566  42.425 -6.237  1.00 120.73 ? 1124 ALA A CB  1 
ATOM 8598 N N   . THR A 1 1128 ? 22.964  44.612 -6.734  1.00 116.91 ? 1125 THR A N   1 
ATOM 8599 C CA  . THR A 1 1128 ? 22.475  45.821 -7.394  1.00 116.91 ? 1125 THR A CA  1 
ATOM 8600 C C   . THR A 1 1128 ? 23.010  47.092 -6.777  1.00 116.91 ? 1125 THR A C   1 
ATOM 8601 O O   . THR A 1 1128 ? 24.204  47.348 -6.866  1.00 116.91 ? 1125 THR A O   1 
ATOM 8602 C CB  . THR A 1 1128 ? 20.930  45.804 -7.559  1.00 69.86  ? 1125 THR A CB  1 
ATOM 8603 O OG1 . THR A 1 1128 ? 20.586  44.741 -8.464  1.00 69.86  ? 1125 THR A OG1 1 
ATOM 8604 C CG2 . THR A 1 1128 ? 20.377  47.151 -8.117  1.00 69.86  ? 1125 THR A CG2 1 
ATOM 8605 N N   . ALA A 1 1129 ? 22.128  47.876 -6.161  1.00 97.45  ? 1126 ALA A N   1 
ATOM 8606 C CA  . ALA A 1 1129 ? 22.438  49.241 -5.740  1.00 97.45  ? 1126 ALA A CA  1 
ATOM 8607 C C   . ALA A 1 1129 ? 21.303  49.830 -4.903  1.00 97.45  ? 1126 ALA A C   1 
ATOM 8608 O O   . ALA A 1 1129 ? 21.509  50.742 -4.099  1.00 97.45  ? 1126 ALA A O   1 
ATOM 8609 C CB  . ALA A 1 1129 ? 22.699  50.128 -6.971  1.00 125.96 ? 1126 ALA A CB  1 
ATOM 8610 N N   . ASP A 1 1130 ? 20.100  49.309 -5.128  1.00 92.89  ? 1127 ASP A N   1 
ATOM 8611 C CA  . ASP A 1 1130 ? 18.867  49.810 -4.507  1.00 92.89  ? 1127 ASP A CA  1 
ATOM 8612 C C   . ASP A 1 1130 ? 17.733  48.810 -4.733  1.00 92.89  ? 1127 ASP A C   1 
ATOM 8613 O O   . ASP A 1 1130 ? 16.568  49.088 -4.450  1.00 92.89  ? 1127 ASP A O   1 
ATOM 8614 C CB  . ASP A 1 1130 ? 18.487  51.217 -5.013  1.00 140.71 ? 1127 ASP A CB  1 
ATOM 8615 C CG  . ASP A 1 1130 ? 18.552  51.354 -6.537  1.00 140.71 ? 1127 ASP A CG  1 
ATOM 8616 O OD1 . ASP A 1 1130 ? 19.092  50.456 -7.230  1.00 140.71 ? 1127 ASP A OD1 1 
ATOM 8617 O OD2 . ASP A 1 1130 ? 18.066  52.392 -7.040  1.00 140.71 ? 1127 ASP A OD2 1 
ATOM 8618 N N   . ASP A 1 1131 ? 18.090  47.643 -5.258  1.00 128.53 ? 1128 ASP A N   1 
ATOM 8619 C CA  . ASP A 1 1131 ? 17.206  46.499 -5.205  1.00 128.53 ? 1128 ASP A CA  1 
ATOM 8620 C C   . ASP A 1 1131 ? 17.055  46.182 -3.725  1.00 128.53 ? 1128 ASP A C   1 
ATOM 8621 O O   . ASP A 1 1131 ? 16.071  45.574 -3.303  1.00 128.53 ? 1128 ASP A O   1 
ATOM 8622 C CB  . ASP A 1 1131 ? 17.820  45.305 -5.951  1.00 132.77 ? 1128 ASP A CB  1 
ATOM 8623 C CG  . ASP A 1 1131 ? 16.861  44.115 -6.081  1.00 132.77 ? 1128 ASP A CG  1 
ATOM 8624 O OD1 . ASP A 1 1131 ? 17.315  42.956 -5.920  1.00 132.77 ? 1128 ASP A OD1 1 
ATOM 8625 O OD2 . ASP A 1 1131 ? 15.655  44.334 -6.346  1.00 132.77 ? 1128 ASP A OD2 1 
ATOM 8626 N N   . LEU A 1 1132 ? 18.030  46.632 -2.936  1.00 66.16  ? 1129 LEU A N   1 
ATOM 8627 C CA  . LEU A 1 1132 ? 18.113  46.270 -1.508  1.00 66.16  ? 1129 LEU A CA  1 
ATOM 8628 C C   . LEU A 1 1132 ? 17.319  47.228 -0.652  1.00 66.16  ? 1129 LEU A C   1 
ATOM 8629 O O   . LEU A 1 1132 ? 16.583  46.800 0.265   1.00 66.16  ? 1129 LEU A O   1 
ATOM 8630 C CB  . LEU A 1 1132 ? 19.576  46.207 -1.028  1.00 75.59  ? 1129 LEU A CB  1 
ATOM 8631 C CG  . LEU A 1 1132 ? 20.303  44.894 -1.343  1.00 75.59  ? 1129 LEU A CG  1 
ATOM 8632 C CD1 . LEU A 1 1132 ? 20.029  43.911 -0.232  1.00 75.59  ? 1129 LEU A CD1 1 
ATOM 8633 C CD2 . LEU A 1 1132 ? 19.965  44.256 -2.734  1.00 75.59  ? 1129 LEU A CD2 1 
ATOM 8634 N N   . ILE A 1 1133 ? 17.479  48.515 -0.954  1.00 84.07  ? 1130 ILE A N   1 
ATOM 8635 C CA  . ILE A 1 1133 ? 16.590  49.541 -0.460  1.00 84.07  ? 1130 ILE A CA  1 
ATOM 8636 C C   . ILE A 1 1133 ? 15.143  49.010 -0.422  1.00 84.07  ? 1130 ILE A C   1 
ATOM 8637 O O   . ILE A 1 1133 ? 14.367  49.370 0.453   1.00 84.07  ? 1130 ILE A O   1 
ATOM 8638 C CB  . ILE A 1 1133 ? 16.727  50.824 -1.321  1.00 93.70  ? 1130 ILE A CB  1 
ATOM 8639 C CG1 . ILE A 1 1133 ? 16.732  52.075 -0.442  1.00 93.70  ? 1130 ILE A CG1 1 
ATOM 8640 C CG2 . ILE A 1 1133 ? 15.651  50.907 -2.415  1.00 93.70  ? 1130 ILE A CG2 1 
ATOM 8641 C CD1 . ILE A 1 1133 ? 17.611  53.182 -0.978  1.00 93.70  ? 1130 ILE A CD1 1 
ATOM 8642 N N   . LYS A 1 1134 ? 14.811  48.122 -1.355  1.00 87.22  ? 1131 LYS A N   1 
ATOM 8643 C CA  . LYS A 1 1134 ? 13.511  47.449 -1.390  1.00 87.22  ? 1131 LYS A CA  1 
ATOM 8644 C C   . LYS A 1 1134 ? 13.435  46.201 -0.485  1.00 87.22  ? 1131 LYS A C   1 
ATOM 8645 O O   . LYS A 1 1134 ? 12.393  45.933 0.119   1.00 87.22  ? 1131 LYS A O   1 
ATOM 8646 C CB  . LYS A 1 1134 ? 13.144  47.101 -2.849  1.00 146.67 ? 1131 LYS A CB  1 
ATOM 8647 C CG  . LYS A 1 1134 ? 12.303  45.830 -3.045  1.00 146.67 ? 1131 LYS A CG  1 
ATOM 8648 C CD  . LYS A 1 1134 ? 12.330  45.335 -4.489  1.00 146.67 ? 1131 LYS A CD  1 
ATOM 8649 C CE  . LYS A 1 1134 ? 11.117  45.804 -5.278  1.00 146.67 ? 1131 LYS A CE  1 
ATOM 8650 N NZ  . LYS A 1 1134 ? 11.067  47.282 -5.458  1.00 146.67 ? 1131 LYS A NZ  1 
ATOM 8651 N N   . VAL A 1 1135 ? 14.525  45.436 -0.419  1.00 77.76  ? 1132 VAL A N   1 
ATOM 8652 C CA  . VAL A 1 1135 ? 14.612  44.252 0.444   1.00 77.76  ? 1132 VAL A CA  1 
ATOM 8653 C C   . VAL A 1 1135 ? 14.490  44.647 1.907   1.00 77.76  ? 1132 VAL A C   1 
ATOM 8654 O O   . VAL A 1 1135 ? 13.849  43.967 2.709   1.00 77.76  ? 1132 VAL A O   1 
ATOM 8655 C CB  . VAL A 1 1135 ? 15.933  43.490 0.213   1.00 83.44  ? 1132 VAL A CB  1 
ATOM 8656 C CG1 . VAL A 1 1135 ? 16.425  42.807 1.494   1.00 83.44  ? 1132 VAL A CG1 1 
ATOM 8657 C CG2 . VAL A 1 1135 ? 15.761  42.492 -0.900  1.00 83.44  ? 1132 VAL A CG2 1 
ATOM 8658 N N   . VAL A 1 1136 ? 15.097  45.774 2.232   1.00 92.45  ? 1133 VAL A N   1 
ATOM 8659 C CA  . VAL A 1 1136 ? 15.130  46.237 3.589   1.00 92.45  ? 1133 VAL A CA  1 
ATOM 8660 C C   . VAL A 1 1136 ? 13.783  46.784 4.012   1.00 92.45  ? 1133 VAL A C   1 
ATOM 8661 O O   . VAL A 1 1136 ? 13.307  46.512 5.112   1.00 92.45  ? 1133 VAL A O   1 
ATOM 8662 C CB  . VAL A 1 1136 ? 16.252  47.226 3.751   1.00 57.46  ? 1133 VAL A CB  1 
ATOM 8663 C CG1 . VAL A 1 1136 ? 16.053  48.079 4.966   1.00 57.46  ? 1133 VAL A CG1 1 
ATOM 8664 C CG2 . VAL A 1 1136 ? 17.520  46.442 3.873   1.00 57.46  ? 1133 VAL A CG2 1 
ATOM 8665 N N   . GLU A 1 1137 ? 13.163  47.537 3.120   1.00 82.11  ? 1134 GLU A N   1 
ATOM 8666 C CA  . GLU A 1 1137 ? 11.786  47.932 3.299   1.00 82.11  ? 1134 GLU A CA  1 
ATOM 8667 C C   . GLU A 1 1137 ? 10.909  46.717 3.557   1.00 82.11  ? 1134 GLU A C   1 
ATOM 8668 O O   . GLU A 1 1137 ? 10.168  46.689 4.531   1.00 82.11  ? 1134 GLU A O   1 
ATOM 8669 C CB  . GLU A 1 1137 ? 11.281  48.637 2.055   1.00 102.99 ? 1134 GLU A CB  1 
ATOM 8670 C CG  . GLU A 1 1137 ? 11.739  50.067 1.889   1.00 102.99 ? 1134 GLU A CG  1 
ATOM 8671 C CD  . GLU A 1 1137 ? 11.148  50.696 0.635   1.00 102.99 ? 1134 GLU A CD  1 
ATOM 8672 O OE1 . GLU A 1 1137 ? 11.118  50.029 -0.427  1.00 102.99 ? 1134 GLU A OE1 1 
ATOM 8673 O OE2 . GLU A 1 1137 ? 10.702  51.861 0.710   1.00 102.99 ? 1134 GLU A OE2 1 
ATOM 8674 N N   . GLU A 1 1138 ? 10.996  45.707 2.697   1.00 101.07 ? 1135 GLU A N   1 
ATOM 8675 C CA  . GLU A 1 1138 ? 10.106  44.565 2.815   1.00 101.07 ? 1135 GLU A CA  1 
ATOM 8676 C C   . GLU A 1 1138 ? 10.157  43.971 4.227   1.00 101.07 ? 1135 GLU A C   1 
ATOM 8677 O O   . GLU A 1 1138 ? 9.240   43.273 4.649   1.00 101.07 ? 1135 GLU A O   1 
ATOM 8678 C CB  . GLU A 1 1138 ? 10.408  43.510 1.748   1.00 170.51 ? 1135 GLU A CB  1 
ATOM 8679 C CG  . GLU A 1 1138 ? 9.194   42.661 1.375   1.00 170.51 ? 1135 GLU A CG  1 
ATOM 8680 C CD  . GLU A 1 1138 ? 9.444   41.715 0.210   1.00 170.51 ? 1135 GLU A CD  1 
ATOM 8681 O OE1 . GLU A 1 1138 ? 8.534   40.914 -0.098  1.00 170.51 ? 1135 GLU A OE1 1 
ATOM 8682 O OE2 . GLU A 1 1138 ? 10.538  41.765 -0.400  1.00 170.51 ? 1135 GLU A OE2 1 
ATOM 8683 N N   . LEU A 1 1139 ? 11.216  44.279 4.966   1.00 80.74  ? 1136 LEU A N   1 
ATOM 8684 C CA  . LEU A 1 1139 ? 11.414  43.700 6.286   1.00 80.74  ? 1136 LEU A CA  1 
ATOM 8685 C C   . LEU A 1 1139 ? 10.832  44.578 7.353   1.00 80.74  ? 1136 LEU A C   1 
ATOM 8686 O O   . LEU A 1 1139 ? 10.055  44.108 8.174   1.00 80.74  ? 1136 LEU A O   1 
ATOM 8687 C CB  . LEU A 1 1139 ? 12.883  43.483 6.576   1.00 65.32  ? 1136 LEU A CB  1 
ATOM 8688 C CG  . LEU A 1 1139 ? 13.588  42.416 5.760   1.00 65.32  ? 1136 LEU A CG  1 
ATOM 8689 C CD1 . LEU A 1 1139 ? 15.065  42.728 5.799   1.00 65.32  ? 1136 LEU A CD1 1 
ATOM 8690 C CD2 . LEU A 1 1139 ? 13.320  41.027 6.290   1.00 65.32  ? 1136 LEU A CD2 1 
ATOM 8691 N N   . THR A 1 1140 ? 11.201  45.856 7.343   1.00 71.88  ? 1137 THR A N   1 
ATOM 8692 C CA  . THR A 1 1140 ? 10.577  46.825 8.232   1.00 71.88  ? 1137 THR A CA  1 
ATOM 8693 C C   . THR A 1 1140 ? 9.114   46.523 8.409   1.00 71.88  ? 1137 THR A C   1 
ATOM 8694 O O   . THR A 1 1140 ? 8.515   46.947 9.375   1.00 71.88  ? 1137 THR A O   1 
ATOM 8695 C CB  . THR A 1 1140 ? 10.614  48.213 7.656   1.00 54.50  ? 1137 THR A CB  1 
ATOM 8696 O OG1 . THR A 1 1140 ? 10.215  48.149 6.278   1.00 54.50  ? 1137 THR A OG1 1 
ATOM 8697 C CG2 . THR A 1 1140 ? 12.001  48.826 7.785   1.00 54.50  ? 1137 THR A CG2 1 
ATOM 8698 N N   . ARG A 1 1141 ? 8.536   45.799 7.466   1.00 70.13  ? 1138 ARG A N   1 
ATOM 8699 C CA  . ARG A 1 1141 ? 7.133   45.505 7.560   1.00 70.13  ? 1138 ARG A CA  1 
ATOM 8700 C C   . ARG A 1 1141 ? 6.751   44.201 8.295   1.00 70.13  ? 1138 ARG A C   1 
ATOM 8701 O O   . ARG A 1 1141 ? 5.574   43.794 8.235   1.00 70.13  ? 1138 ARG A O   1 
ATOM 8702 C CB  . ARG A 1 1141 ? 6.446   45.638 6.193   1.00 116.59 ? 1138 ARG A CB  1 
ATOM 8703 C CG  . ARG A 1 1141 ? 6.071   47.082 5.868   1.00 116.59 ? 1138 ARG A CG  1 
ATOM 8704 C CD  . ARG A 1 1141 ? 5.154   47.206 4.655   1.00 116.59 ? 1138 ARG A CD  1 
ATOM 8705 N NE  . ARG A 1 1141 ? 5.725   46.646 3.420   1.00 116.59 ? 1138 ARG A NE  1 
ATOM 8706 C CZ  . ARG A 1 1141 ? 6.637   47.246 2.648   1.00 116.59 ? 1138 ARG A CZ  1 
ATOM 8707 N NH1 . ARG A 1 1141 ? 7.127   48.436 2.974   1.00 116.59 ? 1138 ARG A NH1 1 
ATOM 8708 N NH2 . ARG A 1 1141 ? 7.071   46.641 1.549   1.00 116.59 ? 1138 ARG A NH2 1 
ATOM 8709 N N   . ILE A 1 1142 ? 7.694   43.561 8.999   1.00 62.29  ? 1139 ILE A N   1 
ATOM 8710 C CA  . ILE A 1 1142 ? 7.319   42.409 9.838   1.00 62.29  ? 1139 ILE A CA  1 
ATOM 8711 C C   . ILE A 1 1142 ? 6.831   42.823 11.223  1.00 62.29  ? 1139 ILE A C   1 
ATOM 8712 O O   . ILE A 1 1142 ? 6.355   41.991 12.002  1.00 62.29  ? 1139 ILE A O   1 
ATOM 8713 C CB  . ILE A 1 1142 ? 8.449   41.429 10.100  1.00 77.82  ? 1139 ILE A CB  1 
ATOM 8714 C CG1 . ILE A 1 1142 ? 9.337   41.233 8.889   1.00 77.82  ? 1139 ILE A CG1 1 
ATOM 8715 C CG2 . ILE A 1 1142 ? 7.861   40.065 10.541  1.00 77.82  ? 1139 ILE A CG2 1 
ATOM 8716 C CD1 . ILE A 1 1142 ? 10.699  40.703 9.314   1.00 77.82  ? 1139 ILE A CD1 1 
ATOM 8717 N N   . HIS A 1 1143 ? 6.977   44.101 11.547  1.00 57.31  ? 1140 HIS A N   1 
ATOM 8718 C CA  . HIS A 1 1143 ? 6.492   44.614 12.815  1.00 57.31  ? 1140 HIS A CA  1 
ATOM 8719 C C   . HIS A 1 1143 ? 5.992   46.031 12.612  1.00 57.31  ? 1140 HIS A C   1 
ATOM 8720 O O   . HIS A 1 1143 ? 6.549   46.789 11.824  1.00 57.31  ? 1140 HIS A O   1 
ATOM 8721 C CB  . HIS A 1 1143 ? 7.600   44.602 13.871  1.00 54.61  ? 1140 HIS A CB  1 
ATOM 8722 C CG  . HIS A 1 1143 ? 8.692   45.588 13.599  1.00 54.61  ? 1140 HIS A CG  1 
ATOM 8723 N ND1 . HIS A 1 1143 ? 9.764   45.304 12.779  1.00 54.61  ? 1140 HIS A ND1 1 
ATOM 8724 C CD2 . HIS A 1 1143 ? 8.848   46.872 13.997  1.00 54.61  ? 1140 HIS A CD2 1 
ATOM 8725 C CE1 . HIS A 1 1143 ? 10.538  46.367 12.691  1.00 54.61  ? 1140 HIS A CE1 1 
ATOM 8726 N NE2 . HIS A 1 1143 ? 10.006  47.330 13.423  1.00 54.61  ? 1140 HIS A NE2 1 
ATOM 8727 N N   . HIS B 2 1    ? 14.842  33.350 48.765  1.00 31.91  ? 9    HIS B N   1 
ATOM 8728 C CA  . HIS B 2 1    ? 14.570  32.161 47.927  1.00 31.91  ? 9    HIS B CA  1 
ATOM 8729 C C   . HIS B 2 1    ? 14.487  32.429 46.438  1.00 31.91  ? 9    HIS B C   1 
ATOM 8730 O O   . HIS B 2 1    ? 14.276  33.590 45.986  1.00 49.07  ? 9    HIS B O   1 
ATOM 8731 C CB  . HIS B 2 1    ? 13.311  31.481 48.402  1.00 31.91  ? 9    HIS B CB  1 
ATOM 8732 C CG  . HIS B 2 1    ? 13.047  31.786 49.826  1.00 31.91  ? 9    HIS B CG  1 
ATOM 8733 N ND1 . HIS B 2 1    ? 12.986  30.806 50.797  1.00 31.91  ? 9    HIS B ND1 1 
ATOM 8734 C CD2 . HIS B 2 1    ? 12.972  32.978 50.479  1.00 31.91  ? 9    HIS B CD2 1 
ATOM 8735 C CE1 . HIS B 2 1    ? 12.815  31.379 51.991  1.00 31.91  ? 9    HIS B CE1 1 
ATOM 8736 N NE2 . HIS B 2 1    ? 12.802  32.695 51.826  1.00 31.91  ? 9    HIS B NE2 1 
ATOM 8737 N N   . LEU B 2 2    ? 14.674  31.338 45.682  1.00 31.91  ? 10   LEU B N   1 
ATOM 8738 C CA  . LEU B 2 2    ? 14.861  31.511 44.282  1.00 31.91  ? 10   LEU B CA  1 
ATOM 8739 C C   . LEU B 2 2    ? 13.666  32.348 43.813  1.00 31.91  ? 10   LEU B C   1 
ATOM 8740 O O   . LEU B 2 2    ? 13.862  33.351 43.072  1.00 46.82  ? 10   LEU B O   1 
ATOM 8741 C CB  . LEU B 2 2    ? 14.933  30.168 43.613  1.00 31.91  ? 10   LEU B CB  1 
ATOM 8742 C CG  . LEU B 2 2    ? 16.208  29.415 44.006  1.00 31.91  ? 10   LEU B CG  1 
ATOM 8743 C CD1 . LEU B 2 2    ? 16.593  28.600 42.720  1.00 31.91  ? 10   LEU B CD1 1 
ATOM 8744 C CD2 . LEU B 2 2    ? 17.430  30.319 44.510  1.00 31.91  ? 10   LEU B CD2 1 
ATOM 8745 N N   . LEU B 2 3    ? 12.445  31.963 44.311  1.00 31.91  ? 11   LEU B N   1 
ATOM 8746 C CA  . LEU B 2 3    ? 11.198  32.634 43.878  1.00 31.91  ? 11   LEU B CA  1 
ATOM 8747 C C   . LEU B 2 3    ? 11.456  34.138 43.869  1.00 31.91  ? 11   LEU B C   1 
ATOM 8748 O O   . LEU B 2 3    ? 11.320  34.814 42.823  1.00 49.18  ? 11   LEU B O   1 
ATOM 8749 C CB  . LEU B 2 3    ? 9.967   32.220 44.730  1.00 31.91  ? 11   LEU B CB  1 
ATOM 8750 C CG  . LEU B 2 3    ? 9.666   30.740 44.399  1.00 31.91  ? 11   LEU B CG  1 
ATOM 8751 C CD1 . LEU B 2 3    ? 8.477   30.145 45.083  1.00 31.91  ? 11   LEU B CD1 1 
ATOM 8752 C CD2 . LEU B 2 3    ? 9.507   30.460 42.881  1.00 31.91  ? 11   LEU B CD2 1 
ATOM 8753 N N   . TRP B 2 4    ? 11.905  34.639 45.017  1.00 31.91  ? 12   TRP B N   1 
ATOM 8754 C CA  . TRP B 2 4    ? 12.034  36.076 45.131  1.00 31.91  ? 12   TRP B CA  1 
ATOM 8755 C C   . TRP B 2 4    ? 13.055  36.480 44.103  1.00 31.91  ? 12   TRP B C   1 
ATOM 8756 O O   . TRP B 2 4    ? 12.832  37.424 43.283  1.00 50.79  ? 12   TRP B O   1 
ATOM 8757 C CB  . TRP B 2 4    ? 12.427  36.518 46.535  1.00 31.91  ? 12   TRP B CB  1 
ATOM 8758 C CG  . TRP B 2 4    ? 11.329  36.283 47.467  1.00 31.91  ? 12   TRP B CG  1 
ATOM 8759 C CD1 . TRP B 2 4    ? 11.205  35.202 48.221  1.00 31.91  ? 12   TRP B CD1 1 
ATOM 8760 C CD2 . TRP B 2 4    ? 10.135  37.125 47.716  1.00 31.91  ? 12   TRP B CD2 1 
ATOM 8761 N NE1 . TRP B 2 4    ? 10.031  35.293 49.004  1.00 31.91  ? 12   TRP B NE1 1 
ATOM 8762 C CE2 . TRP B 2 4    ? 9.351   36.454 48.703  1.00 31.91  ? 12   TRP B CE2 1 
ATOM 8763 C CE3 . TRP B 2 4    ? 9.672   38.395 47.216  1.00 31.91  ? 12   TRP B CE3 1 
ATOM 8764 C CZ2 . TRP B 2 4    ? 8.121   36.980 49.241  1.00 31.91  ? 12   TRP B CZ2 1 
ATOM 8765 C CZ3 . TRP B 2 4    ? 8.413   38.958 47.770  1.00 31.91  ? 12   TRP B CZ3 1 
ATOM 8766 C CH2 . TRP B 2 4    ? 7.660   38.223 48.760  1.00 31.91  ? 12   TRP B CH2 1 
ATOM 8767 N N   . ASP B 2 5    ? 14.128  35.685 44.088  1.00 31.91  ? 13   ASP B N   1 
ATOM 8768 C CA  . ASP B 2 5    ? 15.272  35.923 43.206  1.00 31.91  ? 13   ASP B CA  1 
ATOM 8769 C C   . ASP B 2 5    ? 15.059  35.711 41.730  1.00 31.91  ? 13   ASP B C   1 
ATOM 8770 O O   . ASP B 2 5    ? 15.794  36.287 40.885  1.00 50.93  ? 13   ASP B O   1 
ATOM 8771 C CB  . ASP B 2 5    ? 16.328  34.925 43.552  1.00 31.91  ? 13   ASP B CB  1 
ATOM 8772 C CG  . ASP B 2 5    ? 17.565  35.581 43.739  1.00 31.91  ? 13   ASP B CG  1 
ATOM 8773 O OD1 . ASP B 2 5    ? 17.908  36.277 42.687  1.00 31.91  ? 13   ASP B OD1 1 
ATOM 8774 O OD2 . ASP B 2 5    ? 18.057  35.511 44.928  1.00 31.91  ? 13   ASP B OD2 1 
ATOM 8775 N N   . VAL B 2 6    ? 14.097  34.832 41.426  1.00 31.91  ? 14   VAL B N   1 
ATOM 8776 C CA  . VAL B 2 6    ? 13.535  34.854 40.095  1.00 31.91  ? 14   VAL B CA  1 
ATOM 8777 C C   . VAL B 2 6    ? 12.647  36.134 39.849  1.00 31.91  ? 14   VAL B C   1 
ATOM 8778 O O   . VAL B 2 6    ? 12.779  36.763 38.757  1.00 39.58  ? 14   VAL B O   1 
ATOM 8779 C CB  . VAL B 2 6    ? 12.975  33.527 39.723  1.00 31.91  ? 14   VAL B CB  1 
ATOM 8780 C CG1 . VAL B 2 6    ? 12.338  33.569 38.359  1.00 31.91  ? 14   VAL B CG1 1 
ATOM 8781 C CG2 . VAL B 2 6    ? 14.146  32.600 39.668  1.00 31.91  ? 14   VAL B CG2 1 
ATOM 8782 N N   . ARG B 2 7    ? 11.846  36.593 40.826  1.00 31.91  ? 15   ARG B N   1 
ATOM 8783 C CA  . ARG B 2 7    ? 11.155  37.859 40.508  1.00 31.91  ? 15   ARG B CA  1 
ATOM 8784 C C   . ARG B 2 7    ? 12.175  38.921 40.201  1.00 31.91  ? 15   ARG B C   1 
ATOM 8785 O O   . ARG B 2 7    ? 12.108  39.510 39.106  1.00 42.22  ? 15   ARG B O   1 
ATOM 8786 C CB  . ARG B 2 7    ? 10.231  38.422 41.593  1.00 31.91  ? 15   ARG B CB  1 
ATOM 8787 C CG  . ARG B 2 7    ? 8.875   37.806 41.603  1.00 31.91  ? 15   ARG B CG  1 
ATOM 8788 C CD  . ARG B 2 7    ? 8.581   37.210 43.093  1.00 31.91  ? 15   ARG B CD  1 
ATOM 8789 N NE  . ARG B 2 7    ? 8.025   35.844 42.982  1.00 31.91  ? 15   ARG B NE  1 
ATOM 8790 C CZ  . ARG B 2 7    ? 6.965   35.414 43.678  1.00 31.91  ? 15   ARG B CZ  1 
ATOM 8791 N NH1 . ARG B 2 7    ? 6.378   36.216 44.606  1.00 31.91  ? 15   ARG B NH1 1 
ATOM 8792 N NH2 . ARG B 2 7    ? 6.485   34.172 43.512  1.00 31.91  ? 15   ARG B NH2 1 
ATOM 8793 N N   . LYS B 2 8    ? 13.096  39.153 41.172  1.00 31.91  ? 16   LYS B N   1 
ATOM 8794 C CA  . LYS B 2 8    ? 13.855  40.404 41.222  1.00 31.91  ? 16   LYS B CA  1 
ATOM 8795 C C   . LYS B 2 8    ? 14.507  40.508 39.845  1.00 31.91  ? 16   LYS B C   1 
ATOM 8796 O O   . LYS B 2 8    ? 14.535  41.542 39.174  1.00 47.70  ? 16   LYS B O   1 
ATOM 8797 C CB  . LYS B 2 8    ? 14.804  40.438 42.439  1.00 31.91  ? 16   LYS B CB  1 
ATOM 8798 C CG  . LYS B 2 8    ? 13.984  40.323 43.780  1.00 31.91  ? 16   LYS B CG  1 
ATOM 8799 C CD  . LYS B 2 8    ? 14.623  40.779 45.143  1.00 31.91  ? 16   LYS B CD  1 
ATOM 8800 C CE  . LYS B 2 8    ? 13.788  40.063 46.347  1.00 31.91  ? 16   LYS B CE  1 
ATOM 8801 N NZ  . LYS B 2 8    ? 13.538  40.821 47.714  1.00 31.91  ? 16   LYS B NZ  1 
ATOM 8802 N N   . ARG B 2 9    ? 14.879  39.350 39.356  1.00 31.91  ? 17   ARG B N   1 
ATOM 8803 C CA  . ARG B 2 9    ? 15.459  39.332 38.057  1.00 31.91  ? 17   ARG B CA  1 
ATOM 8804 C C   . ARG B 2 9    ? 14.506  39.681 36.925  1.00 31.91  ? 17   ARG B C   1 
ATOM 8805 O O   . ARG B 2 9    ? 14.798  40.561 36.161  1.00 37.12  ? 17   ARG B O   1 
ATOM 8806 C CB  . ARG B 2 9    ? 16.236  38.039 37.843  1.00 31.91  ? 17   ARG B CB  1 
ATOM 8807 C CG  . ARG B 2 9    ? 17.606  38.180 38.448  1.00 31.91  ? 17   ARG B CG  1 
ATOM 8808 C CD  . ARG B 2 9    ? 18.475  37.508 37.477  1.00 31.91  ? 17   ARG B CD  1 
ATOM 8809 N NE  . ARG B 2 9    ? 18.010  36.129 37.303  1.00 31.91  ? 17   ARG B NE  1 
ATOM 8810 C CZ  . ARG B 2 9    ? 18.019  35.177 38.253  1.00 31.91  ? 17   ARG B CZ  1 
ATOM 8811 N NH1 . ARG B 2 9    ? 18.417  35.454 39.503  1.00 31.91  ? 17   ARG B NH1 1 
ATOM 8812 N NH2 . ARG B 2 9    ? 17.594  33.936 37.942  1.00 31.91  ? 17   ARG B NH2 1 
ATOM 8813 N N   . SER B 2 10   ? 13.388  38.997 36.802  1.00 31.91  ? 18   SER B N   1 
ATOM 8814 C CA  . SER B 2 10   ? 12.464  39.332 35.737  1.00 31.91  ? 18   SER B CA  1 
ATOM 8815 C C   . SER B 2 10   ? 12.265  40.832 35.761  1.00 31.91  ? 18   SER B C   1 
ATOM 8816 O O   . SER B 2 10   ? 11.834  41.430 34.770  1.00 41.64  ? 18   SER B O   1 
ATOM 8817 C CB  . SER B 2 10   ? 11.098  38.650 35.957  1.00 31.91  ? 18   SER B CB  1 
ATOM 8818 O OG  . SER B 2 10   ? 10.394  39.199 37.102  1.00 31.91  ? 18   SER B OG  1 
ATOM 8819 N N   . LEU B 2 11   ? 12.546  41.463 36.898  1.00 31.91  ? 19   LEU B N   1 
ATOM 8820 C CA  . LEU B 2 11   ? 12.281  42.864 36.893  1.00 31.91  ? 19   LEU B CA  1 
ATOM 8821 C C   . LEU B 2 11   ? 13.482  43.732 37.130  1.00 31.91  ? 19   LEU B C   1 
ATOM 8822 O O   . LEU B 2 11   ? 13.328  44.855 37.631  1.00 39.08  ? 19   LEU B O   1 
ATOM 8823 C CB  . LEU B 2 11   ? 11.090  43.218 37.782  1.00 31.91  ? 19   LEU B CB  1 
ATOM 8824 C CG  . LEU B 2 11   ? 11.165  42.824 39.230  1.00 31.91  ? 19   LEU B CG  1 
ATOM 8825 C CD1 . LEU B 2 11   ? 11.760  43.970 40.046  1.00 31.91  ? 19   LEU B CD1 1 
ATOM 8826 C CD2 . LEU B 2 11   ? 9.756   42.573 39.634  1.00 31.91  ? 19   LEU B CD2 1 
ATOM 8827 N N   . GLY B 2 12   ? 14.659  43.229 36.708  1.00 31.91  ? 20   GLY B N   1 
ATOM 8828 C CA  . GLY B 2 12   ? 15.898  43.977 36.723  1.00 31.91  ? 20   GLY B CA  1 
ATOM 8829 C C   . GLY B 2 12   ? 16.404  44.270 38.115  1.00 31.91  ? 20   GLY B C   1 
ATOM 8830 O O   . GLY B 2 12   ? 15.928  43.699 39.139  1.00 38.97  ? 20   GLY B O   1 
ATOM 8831 N N   . LEU B 2 13   ? 17.327  45.219 38.214  1.00 31.91  ? 21   LEU B N   1 
ATOM 8832 C CA  . LEU B 2 13   ? 18.368  45.081 39.313  1.00 31.91  ? 21   LEU B CA  1 
ATOM 8833 C C   . LEU B 2 13   ? 17.902  44.604 40.798  1.00 31.91  ? 21   LEU B C   1 
ATOM 8834 O O   . LEU B 2 13   ? 17.889  43.409 41.116  1.00 173.90 ? 21   LEU B O   1 
ATOM 8835 C CB  . LEU B 2 13   ? 19.479  46.219 39.211  1.00 31.91  ? 21   LEU B CB  1 
ATOM 8836 C CG  . LEU B 2 13   ? 19.679  46.519 37.663  1.00 31.91  ? 21   LEU B CG  1 
ATOM 8837 C CD1 . LEU B 2 13   ? 20.365  47.968 37.204  1.00 31.91  ? 21   LEU B CD1 1 
ATOM 8838 C CD2 . LEU B 2 13   ? 20.229  45.225 36.822  1.00 31.91  ? 21   LEU B CD2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    GLY 1    -2   ?    ?   ?   A . n 
A 1 2    SER 2    -1   ?    ?   ?   A . n 
A 1 3    HIS 3    0    ?    ?   ?   A . n 
A 1 4    MET 4    1    1    MET MET A . n 
A 1 5    SER 5    2    2    SER SER A . n 
A 1 6    TYR 6    3    3    TYR TYR A . n 
A 1 7    ASN 7    4    4    ASN ASN A . n 
A 1 8    TYR 8    5    5    TYR TYR A . n 
A 1 9    VAL 9    6    6    VAL VAL A . n 
A 1 10   VAL 10   7    7    VAL VAL A . n 
A 1 11   THR 11   8    8    THR THR A . n 
A 1 12   ALA 12   9    9    ALA ALA A . n 
A 1 13   GLN 13   10   10   GLN GLN A . n 
A 1 14   LYS 14   11   11   LYS LYS A . n 
A 1 15   PRO 15   12   12   PRO PRO A . n 
A 1 16   THR 16   13   13   THR THR A . n 
A 1 17   ALA 17   14   14   ALA ALA A . n 
A 1 18   VAL 18   15   15   VAL VAL A . n 
A 1 19   ASN 19   16   16   ASN ASN A . n 
A 1 20   GLY 20   17   17   GLY GLY A . n 
A 1 21   CYS 21   18   18   CYS CYS A . n 
A 1 22   VAL 22   19   19   VAL VAL A . n 
A 1 23   THR 23   20   20   THR THR A . n 
A 1 24   GLY 24   21   21   GLY GLY A . n 
A 1 25   HIS 25   22   22   HIS HIS A . n 
A 1 26   PHE 26   23   23   PHE PHE A . n 
A 1 27   THR 27   24   24   THR THR A . n 
A 1 28   SER 28   25   25   SER SER A . n 
A 1 29   ALA 29   26   26   ALA ALA A . n 
A 1 30   GLU 30   27   27   GLU GLU A . n 
A 1 31   ASP 31   28   28   ASP ASP A . n 
A 1 32   LEU 32   29   29   LEU LEU A . n 
A 1 33   ASN 33   30   30   ASN ASN A . n 
A 1 34   LEU 34   31   31   LEU LEU A . n 
A 1 35   LEU 35   32   32   LEU LEU A . n 
A 1 36   ILE 36   33   33   ILE ILE A . n 
A 1 37   ALA 37   34   34   ALA ALA A . n 
A 1 38   LYS 38   35   35   LYS LYS A . n 
A 1 39   ASN 39   36   36   ASN ASN A . n 
A 1 40   THR 40   37   37   THR THR A . n 
A 1 41   ARG 41   38   38   ARG ARG A . n 
A 1 42   LEU 42   39   39   LEU LEU A . n 
A 1 43   GLU 43   40   40   GLU GLU A . n 
A 1 44   ILE 44   41   41   ILE ILE A . n 
A 1 45   TYR 45   42   42   TYR TYR A . n 
A 1 46   VAL 46   43   43   VAL VAL A . n 
A 1 47   VAL 47   44   44   VAL VAL A . n 
A 1 48   THR 48   45   45   THR THR A . n 
A 1 49   ALA 49   46   46   ALA ALA A . n 
A 1 50   GLU 50   47   47   GLU GLU A . n 
A 1 51   GLY 51   48   48   GLY GLY A . n 
A 1 52   LEU 52   49   49   LEU LEU A . n 
A 1 53   ARG 53   50   50   ARG ARG A . n 
A 1 54   PRO 54   51   51   PRO PRO A . n 
A 1 55   VAL 55   52   52   VAL VAL A . n 
A 1 56   LYS 56   53   53   LYS LYS A . n 
A 1 57   GLU 57   54   54   GLU GLU A . n 
A 1 58   VAL 58   55   55   VAL VAL A . n 
A 1 59   GLY 59   56   56   GLY GLY A . n 
A 1 60   MET 60   57   57   MET MET A . n 
A 1 61   TYR 61   58   58   TYR TYR A . n 
A 1 62   GLY 62   59   59   GLY GLY A . n 
A 1 63   LYS 63   60   60   LYS LYS A . n 
A 1 64   ILE 64   61   61   ILE ILE A . n 
A 1 65   ALA 65   62   62   ALA ALA A . n 
A 1 66   VAL 66   63   63   VAL VAL A . n 
A 1 67   MET 67   64   64   MET MET A . n 
A 1 68   GLU 68   65   65   GLU GLU A . n 
A 1 69   LEU 69   66   66   LEU LEU A . n 
A 1 70   PHE 70   67   67   PHE PHE A . n 
A 1 71   ARG 71   68   68   ARG ARG A . n 
A 1 72   PRO 72   69   69   PRO PRO A . n 
A 1 73   LYS 73   70   70   LYS LYS A . n 
A 1 74   GLY 74   71   71   GLY GLY A . n 
A 1 75   GLU 75   72   72   GLU GLU A . n 
A 1 76   SER 76   73   73   SER SER A . n 
A 1 77   LYS 77   74   74   LYS LYS A . n 
A 1 78   ASP 78   75   75   ASP ASP A . n 
A 1 79   LEU 79   76   76   LEU LEU A . n 
A 1 80   LEU 80   77   77   LEU LEU A . n 
A 1 81   PHE 81   78   78   PHE PHE A . n 
A 1 82   ILE 82   79   79   ILE ILE A . n 
A 1 83   LEU 83   80   80   LEU LEU A . n 
A 1 84   THR 84   81   81   THR THR A . n 
A 1 85   ALA 85   82   82   ALA ALA A . n 
A 1 86   LYS 86   83   83   LYS LYS A . n 
A 1 87   TYR 87   84   84   TYR TYR A . n 
A 1 88   ASN 88   85   85   ASN ASN A . n 
A 1 89   ALA 89   86   86   ALA ALA A . n 
A 1 90   CYS 90   87   87   CYS CYS A . n 
A 1 91   ILE 91   88   88   ILE ILE A . n 
A 1 92   LEU 92   89   89   LEU LEU A . n 
A 1 93   GLU 93   90   90   GLU GLU A . n 
A 1 94   TYR 94   91   91   TYR TYR A . n 
A 1 95   LYS 95   92   92   LYS LYS A . n 
A 1 96   GLN 96   93   93   GLN GLN A . n 
A 1 97   SER 97   94   94   SER SER A . n 
A 1 98   GLY 98   95   95   GLY GLY A . n 
A 1 99   GLU 99   96   96   GLU GLU A . n 
A 1 100  SER 100  97   97   SER SER A . n 
A 1 101  ILE 101  98   98   ILE ILE A . n 
A 1 102  ASP 102  99   99   ASP ASP A . n 
A 1 103  ILE 103  100  100  ILE ILE A . n 
A 1 104  ILE 104  101  101  ILE ILE A . n 
A 1 105  THR 105  102  102  THR THR A . n 
A 1 106  ARG 106  103  103  ARG ARG A . n 
A 1 107  ALA 107  104  104  ALA ALA A . n 
A 1 108  HIS 108  105  105  HIS HIS A . n 
A 1 109  GLY 109  106  106  GLY GLY A . n 
A 1 110  ASN 110  107  107  ASN ASN A . n 
A 1 111  VAL 111  108  108  VAL VAL A . n 
A 1 112  GLN 112  109  109  GLN GLN A . n 
A 1 113  ASP 113  110  110  ASP ASP A . n 
A 1 114  ARG 114  111  111  ARG ARG A . n 
A 1 115  ILE 115  112  112  ILE ILE A . n 
A 1 116  GLY 116  113  113  GLY GLY A . n 
A 1 117  ARG 117  114  114  ARG ARG A . n 
A 1 118  PRO 118  115  115  PRO PRO A . n 
A 1 119  SER 119  116  116  SER SER A . n 
A 1 120  GLU 120  117  117  GLU GLU A . n 
A 1 121  THR 121  118  118  THR THR A . n 
A 1 122  GLY 122  119  119  GLY GLY A . n 
A 1 123  ILE 123  120  120  ILE ILE A . n 
A 1 124  ILE 124  121  121  ILE ILE A . n 
A 1 125  GLY 125  122  122  GLY GLY A . n 
A 1 126  ILE 126  123  123  ILE ILE A . n 
A 1 127  ILE 127  124  124  ILE ILE A . n 
A 1 128  ASP 128  125  125  ASP ASP A . n 
A 1 129  PRO 129  126  126  PRO PRO A . n 
A 1 130  GLU 130  127  127  GLU GLU A . n 
A 1 131  CYS 131  128  128  CYS CYS A . n 
A 1 132  ARG 132  129  129  ARG ARG A . n 
A 1 133  MET 133  130  130  MET MET A . n 
A 1 134  ILE 134  131  131  ILE ILE A . n 
A 1 135  GLY 135  132  132  GLY GLY A . n 
A 1 136  LEU 136  133  133  LEU LEU A . n 
A 1 137  ARG 137  134  134  ARG ARG A . n 
A 1 138  LEU 138  135  135  LEU LEU A . n 
A 1 139  TYR 139  136  136  TYR TYR A . n 
A 1 140  ASP 140  137  137  ASP ASP A . n 
A 1 141  GLY 141  138  138  GLY GLY A . n 
A 1 142  LEU 142  139  139  LEU LEU A . n 
A 1 143  PHE 143  140  140  PHE PHE A . n 
A 1 144  LYS 144  141  141  LYS LYS A . n 
A 1 145  VAL 145  142  142  VAL VAL A . n 
A 1 146  ILE 146  143  143  ILE ILE A . n 
A 1 147  PRO 147  144  144  PRO PRO A . n 
A 1 148  LEU 148  145  145  LEU LEU A . n 
A 1 149  ASP 149  146  146  ASP ASP A . n 
A 1 150  ARG 150  147  147  ARG ARG A . n 
A 1 151  ASP 151  148  148  ASP ASP A . n 
A 1 152  ASN 152  149  149  ASN ASN A . n 
A 1 153  LYS 153  150  150  LYS LYS A . n 
A 1 154  GLU 154  151  151  GLU GLU A . n 
A 1 155  LEU 155  152  152  LEU LEU A . n 
A 1 156  LYS 156  153  153  LYS LYS A . n 
A 1 157  ALA 157  154  154  ALA ALA A . n 
A 1 158  PHE 158  155  155  PHE PHE A . n 
A 1 159  ASN 159  156  156  ASN ASN A . n 
A 1 160  ILE 160  157  157  ILE ILE A . n 
A 1 161  ARG 161  158  158  ARG ARG A . n 
A 1 162  LEU 162  159  159  LEU LEU A . n 
A 1 163  GLU 163  160  160  GLU GLU A . n 
A 1 164  GLU 164  161  161  GLU GLU A . n 
A 1 165  LEU 165  162  162  LEU LEU A . n 
A 1 166  HIS 166  163  163  HIS HIS A . n 
A 1 167  VAL 167  164  164  VAL VAL A . n 
A 1 168  ILE 168  165  165  ILE ILE A . n 
A 1 169  ASP 169  166  166  ASP ASP A . n 
A 1 170  VAL 170  167  167  VAL VAL A . n 
A 1 171  LYS 171  168  168  LYS LYS A . n 
A 1 172  PHE 172  169  169  PHE PHE A . n 
A 1 173  LEU 173  170  170  LEU LEU A . n 
A 1 174  TYR 174  171  171  TYR TYR A . n 
A 1 175  GLY 175  172  172  GLY GLY A . n 
A 1 176  CYS 176  173  173  CYS CYS A . n 
A 1 177  GLN 177  174  174  GLN GLN A . n 
A 1 178  ALA 178  175  175  ALA ALA A . n 
A 1 179  PRO 179  176  176  PRO PRO A . n 
A 1 180  THR 180  177  177  THR THR A . n 
A 1 181  ILE 181  178  178  ILE ILE A . n 
A 1 182  CYS 182  179  179  CYS CYS A . n 
A 1 183  PHE 183  180  180  PHE PHE A . n 
A 1 184  VAL 184  181  181  VAL VAL A . n 
A 1 185  TYR 185  182  182  TYR TYR A . n 
A 1 186  GLN 186  183  183  GLN GLN A . n 
A 1 187  ASP 187  184  184  ASP ASP A . n 
A 1 188  PRO 188  185  185  PRO PRO A . n 
A 1 189  GLN 189  186  186  GLN GLN A . n 
A 1 190  GLY 190  187  187  GLY GLY A . n 
A 1 191  ARG 191  188  188  ARG ARG A . n 
A 1 192  HIS 192  189  189  HIS HIS A . n 
A 1 193  VAL 193  190  190  VAL VAL A . n 
A 1 194  LYS 194  191  191  LYS LYS A . n 
A 1 195  THR 195  192  192  THR THR A . n 
A 1 196  TYR 196  193  193  TYR TYR A . n 
A 1 197  GLU 197  194  194  GLU GLU A . n 
A 1 198  VAL 198  195  195  VAL VAL A . n 
A 1 199  SER 199  196  196  SER SER A . n 
A 1 200  LEU 200  197  197  LEU LEU A . n 
A 1 201  ARG 201  198  198  ARG ARG A . n 
A 1 202  GLU 202  199  199  GLU GLU A . n 
A 1 203  LYS 203  200  200  LYS LYS A . n 
A 1 204  GLU 204  201  201  GLU GLU A . n 
A 1 205  PHE 205  202  202  PHE PHE A . n 
A 1 206  ASN 206  203  203  ASN ASN A . n 
A 1 207  LYS 207  204  204  LYS LYS A . n 
A 1 208  GLY 208  205  205  GLY GLY A . n 
A 1 209  PRO 209  206  206  PRO PRO A . n 
A 1 210  TRP 210  207  207  TRP TRP A . n 
A 1 211  LYS 211  208  208  LYS LYS A . n 
A 1 212  GLN 212  209  209  GLN GLN A . n 
A 1 213  GLU 213  210  210  GLU GLU A . n 
A 1 214  ASN 214  211  211  ASN ASN A . n 
A 1 215  VAL 215  212  212  VAL VAL A . n 
A 1 216  GLU 216  213  213  GLU GLU A . n 
A 1 217  ALA 217  214  214  ALA ALA A . n 
A 1 218  GLU 218  215  215  GLU GLU A . n 
A 1 219  ALA 219  216  216  ALA ALA A . n 
A 1 220  SER 220  217  217  SER SER A . n 
A 1 221  MET 221  218  218  MET MET A . n 
A 1 222  VAL 222  219  219  VAL VAL A . n 
A 1 223  ILE 223  220  220  ILE ILE A . n 
A 1 224  ALA 224  221  221  ALA ALA A . n 
A 1 225  VAL 225  222  222  VAL VAL A . n 
A 1 226  PRO 226  223  223  PRO PRO A . n 
A 1 227  GLU 227  224  224  GLU GLU A . n 
A 1 228  PRO 228  225  225  PRO PRO A . n 
A 1 229  PHE 229  226  226  PHE PHE A . n 
A 1 230  GLY 230  227  227  GLY GLY A . n 
A 1 231  GLY 231  228  228  GLY GLY A . n 
A 1 232  ALA 232  229  229  ALA ALA A . n 
A 1 233  ILE 233  230  230  ILE ILE A . n 
A 1 234  ILE 234  231  231  ILE ILE A . n 
A 1 235  ILE 235  232  232  ILE ILE A . n 
A 1 236  GLY 236  233  233  GLY GLY A . n 
A 1 237  GLN 237  234  234  GLN GLN A . n 
A 1 238  GLU 238  235  235  GLU GLU A . n 
A 1 239  SER 239  236  236  SER SER A . n 
A 1 240  ILE 240  237  237  ILE ILE A . n 
A 1 241  THR 241  238  238  THR THR A . n 
A 1 242  TYR 242  239  239  TYR TYR A . n 
A 1 243  HIS 243  240  240  HIS HIS A . n 
A 1 244  ASN 244  241  241  ASN ASN A . n 
A 1 245  GLY 245  242  242  GLY GLY A . n 
A 1 246  ASP 246  243  243  ASP ASP A . n 
A 1 247  LYS 247  244  244  LYS LYS A . n 
A 1 248  TYR 248  245  245  TYR TYR A . n 
A 1 249  LEU 249  246  246  LEU LEU A . n 
A 1 250  ALA 250  247  247  ALA ALA A . n 
A 1 251  ILE 251  248  248  ILE ILE A . n 
A 1 252  ALA 252  249  249  ALA ALA A . n 
A 1 253  PRO 253  250  250  PRO PRO A . n 
A 1 254  PRO 254  251  251  PRO PRO A . n 
A 1 255  ILE 255  252  252  ILE ILE A . n 
A 1 256  ILE 256  253  253  ILE ILE A . n 
A 1 257  LYS 257  254  254  LYS LYS A . n 
A 1 258  GLN 258  255  255  GLN GLN A . n 
A 1 259  SER 259  256  256  SER SER A . n 
A 1 260  THR 260  257  257  THR THR A . n 
A 1 261  ILE 261  258  258  ILE ILE A . n 
A 1 262  VAL 262  259  259  VAL VAL A . n 
A 1 263  CYS 263  260  260  CYS CYS A . n 
A 1 264  HIS 264  261  261  HIS HIS A . n 
A 1 265  ASN 265  262  262  ASN ASN A . n 
A 1 266  ARG 266  263  263  ARG ARG A . n 
A 1 267  VAL 267  264  264  VAL VAL A . n 
A 1 268  ASP 268  265  265  ASP ASP A . n 
A 1 269  PRO 269  266  266  PRO PRO A . n 
A 1 270  ASN 270  267  267  ASN ASN A . n 
A 1 271  GLY 271  268  268  GLY GLY A . n 
A 1 272  SER 272  269  269  SER SER A . n 
A 1 273  ARG 273  270  270  ARG ARG A . n 
A 1 274  TYR 274  271  271  TYR TYR A . n 
A 1 275  LEU 275  272  272  LEU LEU A . n 
A 1 276  LEU 276  273  273  LEU LEU A . n 
A 1 277  GLY 277  274  274  GLY GLY A . n 
A 1 278  ASP 278  275  275  ASP ASP A . n 
A 1 279  MET 279  276  276  MET MET A . n 
A 1 280  GLU 280  277  277  GLU GLU A . n 
A 1 281  GLY 281  278  278  GLY GLY A . n 
A 1 282  ARG 282  279  279  ARG ARG A . n 
A 1 283  LEU 283  280  280  LEU LEU A . n 
A 1 284  PHE 284  281  281  PHE PHE A . n 
A 1 285  MET 285  282  282  MET MET A . n 
A 1 286  LEU 286  283  283  LEU LEU A . n 
A 1 287  LEU 287  284  284  LEU LEU A . n 
A 1 288  LEU 288  285  285  LEU LEU A . n 
A 1 289  GLU 289  286  286  GLU GLU A . n 
A 1 290  LYS 290  287  287  LYS LYS A . n 
A 1 291  GLU 291  288  288  GLU GLU A . n 
A 1 292  GLU 292  289  289  GLU GLU A . n 
A 1 293  GLN 293  290  290  GLN GLN A . n 
A 1 294  MET 294  291  291  MET MET A . n 
A 1 295  ASP 295  292  292  ASP ASP A . n 
A 1 296  GLY 296  293  293  GLY GLY A . n 
A 1 297  THR 297  294  294  THR THR A . n 
A 1 298  VAL 298  295  295  VAL VAL A . n 
A 1 299  THR 299  296  296  THR THR A . n 
A 1 300  LEU 300  297  297  LEU LEU A . n 
A 1 301  LYS 301  298  298  LYS LYS A . n 
A 1 302  ASP 302  299  299  ASP ASP A . n 
A 1 303  LEU 303  300  300  LEU LEU A . n 
A 1 304  ARG 304  301  301  ARG ARG A . n 
A 1 305  VAL 305  302  302  VAL VAL A . n 
A 1 306  GLU 306  303  303  GLU GLU A . n 
A 1 307  LEU 307  304  304  LEU LEU A . n 
A 1 308  LEU 308  305  305  LEU LEU A . n 
A 1 309  GLY 309  306  306  GLY GLY A . n 
A 1 310  GLU 310  307  307  GLU GLU A . n 
A 1 311  THR 311  308  308  THR THR A . n 
A 1 312  SER 312  309  309  SER SER A . n 
A 1 313  ILE 313  310  310  ILE ILE A . n 
A 1 314  ALA 314  311  311  ALA ALA A . n 
A 1 315  GLU 315  312  312  GLU GLU A . n 
A 1 316  CYS 316  313  313  CYS CYS A . n 
A 1 317  LEU 317  314  314  LEU LEU A . n 
A 1 318  THR 318  315  315  THR THR A . n 
A 1 319  TYR 319  316  316  TYR TYR A . n 
A 1 320  LEU 320  317  317  LEU LEU A . n 
A 1 321  ASP 321  318  318  ASP ASP A . n 
A 1 322  ASN 322  319  319  ASN ASN A . n 
A 1 323  GLY 323  320  320  GLY GLY A . n 
A 1 324  VAL 324  321  321  VAL VAL A . n 
A 1 325  VAL 325  322  322  VAL VAL A . n 
A 1 326  PHE 326  323  323  PHE PHE A . n 
A 1 327  VAL 327  324  324  VAL VAL A . n 
A 1 328  GLY 328  325  325  GLY GLY A . n 
A 1 329  SER 329  326  326  SER SER A . n 
A 1 330  ARG 330  327  327  ARG ARG A . n 
A 1 331  LEU 331  328  328  LEU LEU A . n 
A 1 332  GLY 332  329  329  GLY GLY A . n 
A 1 333  ASP 333  330  330  ASP ASP A . n 
A 1 334  SER 334  331  331  SER SER A . n 
A 1 335  GLN 335  332  332  GLN GLN A . n 
A 1 336  LEU 336  333  333  LEU LEU A . n 
A 1 337  VAL 337  334  334  VAL VAL A . n 
A 1 338  LYS 338  335  335  LYS LYS A . n 
A 1 339  LEU 339  336  336  LEU LEU A . n 
A 1 340  ASN 340  337  337  ASN ASN A . n 
A 1 341  VAL 341  338  338  VAL VAL A . n 
A 1 342  ASP 342  339  339  ASP ASP A . n 
A 1 343  SER 343  340  340  SER SER A . n 
A 1 344  ASN 344  341  341  ASN ASN A . n 
A 1 345  GLU 345  342  342  GLU GLU A . n 
A 1 346  GLN 346  343  343  GLN GLN A . n 
A 1 347  GLY 347  344  344  GLY GLY A . n 
A 1 348  SER 348  345  345  SER SER A . n 
A 1 349  TYR 349  346  346  TYR TYR A . n 
A 1 350  VAL 350  347  347  VAL VAL A . n 
A 1 351  VAL 351  348  348  VAL VAL A . n 
A 1 352  ALA 352  349  349  ALA ALA A . n 
A 1 353  MET 353  350  350  MET MET A . n 
A 1 354  GLU 354  351  351  GLU GLU A . n 
A 1 355  THR 355  352  352  THR THR A . n 
A 1 356  PHE 356  353  353  PHE PHE A . n 
A 1 357  THR 357  354  354  THR THR A . n 
A 1 358  ASN 358  355  355  ASN ASN A . n 
A 1 359  LEU 359  356  356  LEU LEU A . n 
A 1 360  GLY 360  357  357  GLY GLY A . n 
A 1 361  PRO 361  358  358  PRO PRO A . n 
A 1 362  ILE 362  359  359  ILE ILE A . n 
A 1 363  VAL 363  360  360  VAL VAL A . n 
A 1 364  ASP 364  361  361  ASP ASP A . n 
A 1 365  MET 365  362  362  MET MET A . n 
A 1 366  CYS 366  363  363  CYS CYS A . n 
A 1 367  VAL 367  364  364  VAL VAL A . n 
A 1 368  VAL 368  365  365  VAL VAL A . n 
A 1 369  ASP 369  366  366  ASP ASP A . n 
A 1 370  LEU 370  367  367  LEU LEU A . n 
A 1 371  GLU 371  368  368  GLU GLU A . n 
A 1 372  ARG 372  369  369  ARG ARG A . n 
A 1 373  GLN 373  370  370  GLN GLN A . n 
A 1 374  GLY 374  371  371  GLY GLY A . n 
A 1 375  GLN 375  372  372  GLN GLN A . n 
A 1 376  GLY 376  373  373  GLY GLY A . n 
A 1 377  GLN 377  374  374  GLN GLN A . n 
A 1 378  LEU 378  375  375  LEU LEU A . n 
A 1 379  VAL 379  376  376  VAL VAL A . n 
A 1 380  THR 380  377  377  THR THR A . n 
A 1 381  CYS 381  378  378  CYS CYS A . n 
A 1 382  SER 382  379  379  SER SER A . n 
A 1 383  GLY 383  380  380  GLY GLY A . n 
A 1 384  ALA 384  381  381  ALA ALA A . n 
A 1 385  PHE 385  382  382  PHE PHE A . n 
A 1 386  LYS 386  383  383  LYS LYS A . n 
A 1 387  GLU 387  384  384  GLU GLU A . n 
A 1 388  GLY 388  385  385  GLY GLY A . n 
A 1 389  SER 389  386  386  SER SER A . n 
A 1 390  LEU 390  387  387  LEU LEU A . n 
A 1 391  ARG 391  388  388  ARG ARG A . n 
A 1 392  ILE 392  389  389  ILE ILE A . n 
A 1 393  ILE 393  390  390  ILE ILE A . n 
A 1 394  ARG 394  391  391  ARG ARG A . n 
A 1 395  ASN 395  392  392  ASN ASN A . n 
A 1 396  GLY 396  393  393  GLY GLY A . n 
A 1 397  ILE 397  394  394  ILE ILE A . n 
A 1 398  GLY 398  395  395  GLY GLY A . n 
A 1 399  ILE 399  396  396  ILE ILE A . n 
A 1 400  HIS 400  397  397  HIS HIS A . n 
A 1 401  GLU 401  398  398  GLU GLU A . n 
A 1 402  HIS 402  399  399  HIS HIS A . n 
A 1 403  ALA 403  400  400  ALA ALA A . n 
A 1 404  SER 404  401  401  SER SER A . n 
A 1 405  ILE 405  402  402  ILE ILE A . n 
A 1 406  ASP 406  403  403  ASP ASP A . n 
A 1 407  LEU 407  404  404  LEU LEU A . n 
A 1 408  PRO 408  405  405  PRO PRO A . n 
A 1 409  GLY 409  406  406  GLY GLY A . n 
A 1 410  ILE 410  407  407  ILE ILE A . n 
A 1 411  LYS 411  408  408  LYS LYS A . n 
A 1 412  GLY 412  409  409  GLY GLY A . n 
A 1 413  LEU 413  410  410  LEU LEU A . n 
A 1 414  TRP 414  411  411  TRP TRP A . n 
A 1 415  PRO 415  412  412  PRO PRO A . n 
A 1 416  LEU 416  413  413  LEU LEU A . n 
A 1 417  ARG 417  414  414  ARG ARG A . n 
A 1 418  SER 418  415  415  SER SER A . n 
A 1 419  ASP 419  416  416  ASP ASP A . n 
A 1 420  PRO 420  417  417  PRO PRO A . n 
A 1 421  ASN 421  418  418  ASN ASN A . n 
A 1 422  ARG 422  419  419  ARG ARG A . n 
A 1 423  GLU 423  420  420  GLU GLU A . n 
A 1 424  THR 424  421  421  THR THR A . n 
A 1 425  TYR 425  422  422  TYR TYR A . n 
A 1 426  ASP 426  423  423  ASP ASP A . n 
A 1 427  THR 427  424  424  THR THR A . n 
A 1 428  LEU 428  425  425  LEU LEU A . n 
A 1 429  VAL 429  426  426  VAL VAL A . n 
A 1 430  LEU 430  427  427  LEU LEU A . n 
A 1 431  SER 431  428  428  SER SER A . n 
A 1 432  PHE 432  429  429  PHE PHE A . n 
A 1 433  VAL 433  430  430  VAL VAL A . n 
A 1 434  GLY 434  431  431  GLY GLY A . n 
A 1 435  GLN 435  432  432  GLN GLN A . n 
A 1 436  THR 436  433  433  THR THR A . n 
A 1 437  ARG 437  434  434  ARG ARG A . n 
A 1 438  VAL 438  435  435  VAL VAL A . n 
A 1 439  LEU 439  436  436  LEU LEU A . n 
A 1 440  MET 440  437  437  MET MET A . n 
A 1 441  LEU 441  438  438  LEU LEU A . n 
A 1 442  ASN 442  439  439  ASN ASN A . n 
A 1 443  GLY 443  440  440  GLY GLY A . n 
A 1 444  GLU 444  441  441  GLU GLU A . n 
A 1 445  GLU 445  442  442  GLU GLU A . n 
A 1 446  VAL 446  443  443  VAL VAL A . n 
A 1 447  GLU 447  444  444  GLU GLU A . n 
A 1 448  GLU 448  445  445  GLU GLU A . n 
A 1 449  THR 449  446  446  THR THR A . n 
A 1 450  GLU 450  447  447  GLU GLU A . n 
A 1 451  LEU 451  448  448  LEU LEU A . n 
A 1 452  MET 452  449  449  MET MET A . n 
A 1 453  GLY 453  450  450  GLY GLY A . n 
A 1 454  PHE 454  451  451  PHE PHE A . n 
A 1 455  VAL 455  452  452  VAL VAL A . n 
A 1 456  ASP 456  453  453  ASP ASP A . n 
A 1 457  ASP 457  454  454  ASP ASP A . n 
A 1 458  GLN 458  455  455  GLN GLN A . n 
A 1 459  GLN 459  456  456  GLN GLN A . n 
A 1 460  THR 460  457  457  THR THR A . n 
A 1 461  PHE 461  458  458  PHE PHE A . n 
A 1 462  PHE 462  459  459  PHE PHE A . n 
A 1 463  CYS 463  460  460  CYS CYS A . n 
A 1 464  GLY 464  461  461  GLY GLY A . n 
A 1 465  ASN 465  462  462  ASN ASN A . n 
A 1 466  VAL 466  463  463  VAL VAL A . n 
A 1 467  ALA 467  464  464  ALA ALA A . n 
A 1 468  HIS 468  465  465  HIS HIS A . n 
A 1 469  GLN 469  466  466  GLN GLN A . n 
A 1 470  GLN 470  467  467  GLN GLN A . n 
A 1 471  LEU 471  468  468  LEU LEU A . n 
A 1 472  ILE 472  469  469  ILE ILE A . n 
A 1 473  GLN 473  470  470  GLN GLN A . n 
A 1 474  ILE 474  471  471  ILE ILE A . n 
A 1 475  THR 475  472  472  THR THR A . n 
A 1 476  SER 476  473  473  SER SER A . n 
A 1 477  ALA 477  474  474  ALA ALA A . n 
A 1 478  SER 478  475  475  SER SER A . n 
A 1 479  VAL 479  476  476  VAL VAL A . n 
A 1 480  ARG 480  477  477  ARG ARG A . n 
A 1 481  LEU 481  478  478  LEU LEU A . n 
A 1 482  VAL 482  479  479  VAL VAL A . n 
A 1 483  SER 483  480  480  SER SER A . n 
A 1 484  GLN 484  481  481  GLN GLN A . n 
A 1 485  GLU 485  482  482  GLU GLU A . n 
A 1 486  PRO 486  483  483  PRO PRO A . n 
A 1 487  LYS 487  484  484  LYS LYS A . n 
A 1 488  ALA 488  485  485  ALA ALA A . n 
A 1 489  LEU 489  486  486  LEU LEU A . n 
A 1 490  VAL 490  487  487  VAL VAL A . n 
A 1 491  SER 491  488  488  SER SER A . n 
A 1 492  GLU 492  489  489  GLU GLU A . n 
A 1 493  TRP 493  490  490  TRP TRP A . n 
A 1 494  LYS 494  491  491  LYS LYS A . n 
A 1 495  GLU 495  492  492  GLU GLU A . n 
A 1 496  PRO 496  493  493  PRO PRO A . n 
A 1 497  GLN 497  494  494  GLN GLN A . n 
A 1 498  ALA 498  495  495  ALA ALA A . n 
A 1 499  LYS 499  496  496  LYS LYS A . n 
A 1 500  ASN 500  497  497  ASN ASN A . n 
A 1 501  ILE 501  498  498  ILE ILE A . n 
A 1 502  SER 502  499  499  SER SER A . n 
A 1 503  VAL 503  500  500  VAL VAL A . n 
A 1 504  ALA 504  501  501  ALA ALA A . n 
A 1 505  SER 505  502  502  SER SER A . n 
A 1 506  CYS 506  503  503  CYS CYS A . n 
A 1 507  ASN 507  504  504  ASN ASN A . n 
A 1 508  SER 508  505  505  SER SER A . n 
A 1 509  SER 509  506  506  SER SER A . n 
A 1 510  GLN 510  507  507  GLN GLN A . n 
A 1 511  VAL 511  508  508  VAL VAL A . n 
A 1 512  VAL 512  509  509  VAL VAL A . n 
A 1 513  VAL 513  510  510  VAL VAL A . n 
A 1 514  ALA 514  511  511  ALA ALA A . n 
A 1 515  VAL 515  512  512  VAL VAL A . n 
A 1 516  GLY 516  513  513  GLY GLY A . n 
A 1 517  ARG 517  514  514  ARG ARG A . n 
A 1 518  ALA 518  515  515  ALA ALA A . n 
A 1 519  LEU 519  516  516  LEU LEU A . n 
A 1 520  TYR 520  517  517  TYR TYR A . n 
A 1 521  TYR 521  518  518  TYR TYR A . n 
A 1 522  LEU 522  519  519  LEU LEU A . n 
A 1 523  GLN 523  520  520  GLN GLN A . n 
A 1 524  ILE 524  521  521  ILE ILE A . n 
A 1 525  HIS 525  522  522  HIS HIS A . n 
A 1 526  PRO 526  523  523  PRO PRO A . n 
A 1 527  GLN 527  524  524  GLN GLN A . n 
A 1 528  GLU 528  525  525  GLU GLU A . n 
A 1 529  LEU 529  526  526  LEU LEU A . n 
A 1 530  ARG 530  527  527  ARG ARG A . n 
A 1 531  GLN 531  528  528  GLN GLN A . n 
A 1 532  ILE 532  529  529  ILE ILE A . n 
A 1 533  SER 533  530  530  SER SER A . n 
A 1 534  HIS 534  531  531  HIS HIS A . n 
A 1 535  THR 535  532  532  THR THR A . n 
A 1 536  GLU 536  533  533  GLU GLU A . n 
A 1 537  MET 537  534  534  MET MET A . n 
A 1 538  GLU 538  535  535  GLU GLU A . n 
A 1 539  HIS 539  536  536  HIS HIS A . n 
A 1 540  GLU 540  537  537  GLU GLU A . n 
A 1 541  VAL 541  538  538  VAL VAL A . n 
A 1 542  ALA 542  539  539  ALA ALA A . n 
A 1 543  CYS 543  540  540  CYS CYS A . n 
A 1 544  LEU 544  541  541  LEU LEU A . n 
A 1 545  ASP 545  542  542  ASP ASP A . n 
A 1 546  ILE 546  543  543  ILE ILE A . n 
A 1 547  THR 547  544  544  THR THR A . n 
A 1 548  PRO 548  545  545  PRO PRO A . n 
A 1 549  LEU 549  546  546  LEU LEU A . n 
A 1 550  GLY 550  547  547  GLY GLY A . n 
A 1 551  ASP 551  548  548  ASP ASP A . n 
A 1 552  SER 552  549  549  SER SER A . n 
A 1 553  ASN 553  550  550  ASN ASN A . n 
A 1 554  GLY 554  551  551  GLY GLY A . n 
A 1 555  LEU 555  552  552  LEU LEU A . n 
A 1 556  SER 556  553  553  SER SER A . n 
A 1 557  PRO 557  554  554  PRO PRO A . n 
A 1 558  LEU 558  555  555  LEU LEU A . n 
A 1 559  CYS 559  556  556  CYS CYS A . n 
A 1 560  ALA 560  557  557  ALA ALA A . n 
A 1 561  ILE 561  558  558  ILE ILE A . n 
A 1 562  GLY 562  559  559  GLY GLY A . n 
A 1 563  LEU 563  560  560  LEU LEU A . n 
A 1 564  TRP 564  561  561  TRP TRP A . n 
A 1 565  THR 565  562  562  THR THR A . n 
A 1 566  ASP 566  563  563  ASP ASP A . n 
A 1 567  ILE 567  564  564  ILE ILE A . n 
A 1 568  SER 568  565  565  SER SER A . n 
A 1 569  ALA 569  566  566  ALA ALA A . n 
A 1 570  ARG 570  567  567  ARG ARG A . n 
A 1 571  ILE 571  568  568  ILE ILE A . n 
A 1 572  LEU 572  569  569  LEU LEU A . n 
A 1 573  LYS 573  570  570  LYS LYS A . n 
A 1 574  LEU 574  571  571  LEU LEU A . n 
A 1 575  PRO 575  572  572  PRO PRO A . n 
A 1 576  SER 576  573  573  SER SER A . n 
A 1 577  PHE 577  574  574  PHE PHE A . n 
A 1 578  GLU 578  575  575  GLU GLU A . n 
A 1 579  LEU 579  576  576  LEU LEU A . n 
A 1 580  LEU 580  577  577  LEU LEU A . n 
A 1 581  HIS 581  578  578  HIS HIS A . n 
A 1 582  LYS 582  579  579  LYS LYS A . n 
A 1 583  GLU 583  580  580  GLU GLU A . n 
A 1 584  MET 584  581  581  MET MET A . n 
A 1 585  LEU 585  582  582  LEU LEU A . n 
A 1 586  GLY 586  583  583  GLY GLY A . n 
A 1 587  GLY 587  584  584  GLY GLY A . n 
A 1 588  GLU 588  585  585  GLU GLU A . n 
A 1 589  ILE 589  586  586  ILE ILE A . n 
A 1 590  ILE 590  587  587  ILE ILE A . n 
A 1 591  PRO 591  588  588  PRO PRO A . n 
A 1 592  ARG 592  589  589  ARG ARG A . n 
A 1 593  SER 593  590  590  SER SER A . n 
A 1 594  ILE 594  591  591  ILE ILE A . n 
A 1 595  LEU 595  592  592  LEU LEU A . n 
A 1 596  MET 596  593  593  MET MET A . n 
A 1 597  THR 597  594  594  THR THR A . n 
A 1 598  THR 598  595  595  THR THR A . n 
A 1 599  PHE 599  596  596  PHE PHE A . n 
A 1 600  GLU 600  597  597  GLU GLU A . n 
A 1 601  SER 601  598  598  SER SER A . n 
A 1 602  SER 602  599  599  SER SER A . n 
A 1 603  HIS 603  600  600  HIS HIS A . n 
A 1 604  TYR 604  601  601  TYR TYR A . n 
A 1 605  LEU 605  602  602  LEU LEU A . n 
A 1 606  LEU 606  603  603  LEU LEU A . n 
A 1 607  CYS 607  604  604  CYS CYS A . n 
A 1 608  ALA 608  605  605  ALA ALA A . n 
A 1 609  LEU 609  606  606  LEU LEU A . n 
A 1 610  GLY 610  607  607  GLY GLY A . n 
A 1 611  ASP 611  608  608  ASP ASP A . n 
A 1 612  GLY 612  609  609  GLY GLY A . n 
A 1 613  ALA 613  610  610  ALA ALA A . n 
A 1 614  LEU 614  611  611  LEU LEU A . n 
A 1 615  PHE 615  612  612  PHE PHE A . n 
A 1 616  TYR 616  613  613  TYR TYR A . n 
A 1 617  PHE 617  614  614  PHE PHE A . n 
A 1 618  GLY 618  615  615  GLY GLY A . n 
A 1 619  LEU 619  616  616  LEU LEU A . n 
A 1 620  ASN 620  617  617  ASN ASN A . n 
A 1 621  ILE 621  618  618  ILE ILE A . n 
A 1 622  GLU 622  619  619  GLU GLU A . n 
A 1 623  THR 623  620  620  THR THR A . n 
A 1 624  GLY 624  621  621  GLY GLY A . n 
A 1 625  LEU 625  622  622  LEU LEU A . n 
A 1 626  LEU 626  623  623  LEU LEU A . n 
A 1 627  SER 627  624  624  SER SER A . n 
A 1 628  ASP 628  625  625  ASP ASP A . n 
A 1 629  ARG 629  626  626  ARG ARG A . n 
A 1 630  LYS 630  627  627  LYS LYS A . n 
A 1 631  LYS 631  628  628  LYS LYS A . n 
A 1 632  VAL 632  629  629  VAL VAL A . n 
A 1 633  THR 633  630  630  THR THR A . n 
A 1 634  LEU 634  631  631  LEU LEU A . n 
A 1 635  GLY 635  632  632  GLY GLY A . n 
A 1 636  THR 636  633  633  THR THR A . n 
A 1 637  GLN 637  634  634  GLN GLN A . n 
A 1 638  PRO 638  635  635  PRO PRO A . n 
A 1 639  THR 639  636  636  THR THR A . n 
A 1 640  VAL 640  637  637  VAL VAL A . n 
A 1 641  LEU 641  638  638  LEU LEU A . n 
A 1 642  ARG 642  639  639  ARG ARG A . n 
A 1 643  THR 643  640  640  THR THR A . n 
A 1 644  PHE 644  641  641  PHE PHE A . n 
A 1 645  ARG 645  642  642  ARG ARG A . n 
A 1 646  SER 646  643  643  SER SER A . n 
A 1 647  LEU 647  644  644  LEU LEU A . n 
A 1 648  SER 648  645  645  SER SER A . n 
A 1 649  THR 649  646  646  THR THR A . n 
A 1 650  THR 650  647  647  THR THR A . n 
A 1 651  ASN 651  648  648  ASN ASN A . n 
A 1 652  VAL 652  649  649  VAL VAL A . n 
A 1 653  PHE 653  650  650  PHE PHE A . n 
A 1 654  ALA 654  651  651  ALA ALA A . n 
A 1 655  CYS 655  652  652  CYS CYS A . n 
A 1 656  SER 656  653  653  SER SER A . n 
A 1 657  ASP 657  654  654  ASP ASP A . n 
A 1 658  ARG 658  655  655  ARG ARG A . n 
A 1 659  PRO 659  656  656  PRO PRO A . n 
A 1 660  THR 660  657  657  THR THR A . n 
A 1 661  VAL 661  658  658  VAL VAL A . n 
A 1 662  ILE 662  659  659  ILE ILE A . n 
A 1 663  TYR 663  660  660  TYR TYR A . n 
A 1 664  SER 664  661  661  SER SER A . n 
A 1 665  SER 665  662  662  SER SER A . n 
A 1 666  ASN 666  663  663  ASN ASN A . n 
A 1 667  HIS 667  664  664  HIS HIS A . n 
A 1 668  LYS 668  665  665  LYS LYS A . n 
A 1 669  LEU 669  666  666  LEU LEU A . n 
A 1 670  VAL 670  667  667  VAL VAL A . n 
A 1 671  PHE 671  668  668  PHE PHE A . n 
A 1 672  SER 672  669  669  SER SER A . n 
A 1 673  ASN 673  670  670  ASN ASN A . n 
A 1 674  VAL 674  671  671  VAL VAL A . n 
A 1 675  ASN 675  672  672  ASN ASN A . n 
A 1 676  LEU 676  673  673  LEU LEU A . n 
A 1 677  LYS 677  674  674  LYS LYS A . n 
A 1 678  GLU 678  675  675  GLU GLU A . n 
A 1 679  VAL 679  676  676  VAL VAL A . n 
A 1 680  ASN 680  677  677  ASN ASN A . n 
A 1 681  TYR 681  678  678  TYR TYR A . n 
A 1 682  MET 682  679  679  MET MET A . n 
A 1 683  CYS 683  680  680  CYS CYS A . n 
A 1 684  PRO 684  681  681  PRO PRO A . n 
A 1 685  LEU 685  682  682  LEU LEU A . n 
A 1 686  ASN 686  683  683  ASN ASN A . n 
A 1 687  SER 687  684  684  SER SER A . n 
A 1 688  ASP 688  685  685  ASP ASP A . n 
A 1 689  GLY 689  686  686  GLY GLY A . n 
A 1 690  TYR 690  687  687  TYR TYR A . n 
A 1 691  PRO 691  688  688  PRO PRO A . n 
A 1 692  ASP 692  689  689  ASP ASP A . n 
A 1 693  SER 693  690  690  SER SER A . n 
A 1 694  LEU 694  691  691  LEU LEU A . n 
A 1 695  ALA 695  692  692  ALA ALA A . n 
A 1 696  LEU 696  693  693  LEU LEU A . n 
A 1 697  ALA 697  694  694  ALA ALA A . n 
A 1 698  ASN 698  695  695  ASN ASN A . n 
A 1 699  ASN 699  696  696  ASN ASN A . n 
A 1 700  SER 700  697  697  SER SER A . n 
A 1 701  THR 701  698  698  THR THR A . n 
A 1 702  LEU 702  699  699  LEU LEU A . n 
A 1 703  THR 703  700  700  THR THR A . n 
A 1 704  ILE 704  701  701  ILE ILE A . n 
A 1 705  GLY 705  702  702  GLY GLY A . n 
A 1 706  THR 706  703  703  THR THR A . n 
A 1 707  ILE 707  704  704  ILE ILE A . n 
A 1 708  ASP 708  705  705  ASP ASP A . n 
A 1 709  GLU 709  706  706  GLU GLU A . n 
A 1 710  ILE 710  707  707  ILE ILE A . n 
A 1 711  GLN 711  708  708  GLN GLN A . n 
A 1 712  LYS 712  709  709  LYS LYS A . n 
A 1 713  LEU 713  710  710  LEU LEU A . n 
A 1 714  HIS 714  711  711  HIS HIS A . n 
A 1 715  ILE 715  712  712  ILE ILE A . n 
A 1 716  ARG 716  713  713  ARG ARG A . n 
A 1 717  THR 717  714  714  THR THR A . n 
A 1 718  VAL 718  715  715  VAL VAL A . n 
A 1 719  PRO 719  716  716  PRO PRO A . n 
A 1 720  LEU 720  717  717  LEU LEU A . n 
A 1 721  TYR 721  718  718  TYR TYR A . n 
A 1 722  GLU 722  719  719  GLU GLU A . n 
A 1 723  SER 723  720  720  SER SER A . n 
A 1 724  PRO 724  721  721  PRO PRO A . n 
A 1 725  ARG 725  722  722  ARG ARG A . n 
A 1 726  LYS 726  723  723  LYS LYS A . n 
A 1 727  ILE 727  724  724  ILE ILE A . n 
A 1 728  CYS 728  725  725  CYS CYS A . n 
A 1 729  TYR 729  726  726  TYR TYR A . n 
A 1 730  GLN 730  727  727  GLN GLN A . n 
A 1 731  GLU 731  728  728  GLU GLU A . n 
A 1 732  VAL 732  729  729  VAL VAL A . n 
A 1 733  SER 733  730  730  SER SER A . n 
A 1 734  GLN 734  731  731  GLN GLN A . n 
A 1 735  CYS 735  732  732  CYS CYS A . n 
A 1 736  PHE 736  733  733  PHE PHE A . n 
A 1 737  GLY 737  734  734  GLY GLY A . n 
A 1 738  VAL 738  735  735  VAL VAL A . n 
A 1 739  LEU 739  736  736  LEU LEU A . n 
A 1 740  SER 740  737  737  SER SER A . n 
A 1 741  SER 741  738  738  SER SER A . n 
A 1 742  ARG 742  739  739  ARG ARG A . n 
A 1 743  ILE 743  740  740  ILE ILE A . n 
A 1 744  GLU 744  741  741  GLU GLU A . n 
A 1 745  VAL 745  742  742  VAL VAL A . n 
A 1 746  GLN 746  743  743  GLN GLN A . n 
A 1 747  ASP 747  744  744  ASP ASP A . n 
A 1 748  THR 748  745  745  THR THR A . n 
A 1 749  SER 749  746  746  SER SER A . n 
A 1 750  GLY 750  747  747  GLY GLY A . n 
A 1 751  GLY 751  748  748  GLY GLY A . n 
A 1 752  THR 752  749  749  THR THR A . n 
A 1 753  THR 753  750  750  THR THR A . n 
A 1 754  ALA 754  751  751  ALA ALA A . n 
A 1 755  LEU 755  752  752  LEU LEU A . n 
A 1 756  ARG 756  753  753  ARG ARG A . n 
A 1 757  PRO 757  754  754  PRO PRO A . n 
A 1 758  SER 758  755  755  SER SER A . n 
A 1 759  ALA 759  756  756  ALA ALA A . n 
A 1 760  SER 760  757  757  SER SER A . n 
A 1 761  THR 761  758  758  THR THR A . n 
A 1 762  GLN 762  759  759  GLN GLN A . n 
A 1 763  ALA 763  760  760  ALA ALA A . n 
A 1 764  LEU 764  761  761  LEU LEU A . n 
A 1 765  SER 765  762  762  SER SER A . n 
A 1 766  SER 766  763  763  SER SER A . n 
A 1 767  SER 767  764  764  SER SER A . n 
A 1 768  VAL 768  765  765  VAL VAL A . n 
A 1 769  SER 769  766  766  SER SER A . n 
A 1 770  SER 770  767  767  SER SER A . n 
A 1 771  SER 771  768  768  SER SER A . n 
A 1 772  LYS 772  769  769  LYS LYS A . n 
A 1 773  LEU 773  770  770  LEU LEU A . n 
A 1 774  PHE 774  771  771  PHE PHE A . n 
A 1 775  SER 775  772  772  SER SER A . n 
A 1 776  SER 776  773  773  SER SER A . n 
A 1 777  SER 777  774  ?    ?   ?   A . n 
A 1 778  THR 778  775  ?    ?   ?   A . n 
A 1 779  ALA 779  776  ?    ?   ?   A . n 
A 1 780  PRO 780  777  ?    ?   ?   A . n 
A 1 781  HIS 781  778  ?    ?   ?   A . n 
A 1 782  GLU 782  779  ?    ?   ?   A . n 
A 1 783  THR 783  780  ?    ?   ?   A . n 
A 1 784  SER 784  781  ?    ?   ?   A . n 
A 1 785  PHE 785  782  ?    ?   ?   A . n 
A 1 786  GLY 786  783  783  GLY GLY A . n 
A 1 787  GLU 787  784  784  GLU GLU A . n 
A 1 788  GLU 788  785  785  GLU GLU A . n 
A 1 789  VAL 789  786  786  VAL VAL A . n 
A 1 790  GLU 790  787  787  GLU GLU A . n 
A 1 791  VAL 791  788  788  VAL VAL A . n 
A 1 792  HIS 792  789  789  HIS HIS A . n 
A 1 793  ASN 793  790  790  ASN ASN A . n 
A 1 794  LEU 794  791  791  LEU LEU A . n 
A 1 795  LEU 795  792  792  LEU LEU A . n 
A 1 796  ILE 796  793  793  ILE ILE A . n 
A 1 797  ILE 797  794  794  ILE ILE A . n 
A 1 798  ASP 798  795  795  ASP ASP A . n 
A 1 799  GLN 799  796  796  GLN GLN A . n 
A 1 800  HIS 800  797  797  HIS HIS A . n 
A 1 801  THR 801  798  798  THR THR A . n 
A 1 802  PHE 802  799  799  PHE PHE A . n 
A 1 803  GLU 803  800  800  GLU GLU A . n 
A 1 804  VAL 804  801  801  VAL VAL A . n 
A 1 805  LEU 805  802  802  LEU LEU A . n 
A 1 806  HIS 806  803  803  HIS HIS A . n 
A 1 807  ALA 807  804  804  ALA ALA A . n 
A 1 808  HIS 808  805  805  HIS HIS A . n 
A 1 809  GLN 809  806  806  GLN GLN A . n 
A 1 810  PHE 810  807  807  PHE PHE A . n 
A 1 811  LEU 811  808  808  LEU LEU A . n 
A 1 812  GLN 812  809  809  GLN GLN A . n 
A 1 813  ASN 813  810  810  ASN ASN A . n 
A 1 814  GLU 814  811  811  GLU GLU A . n 
A 1 815  TYR 815  812  812  TYR TYR A . n 
A 1 816  ALA 816  813  813  ALA ALA A . n 
A 1 817  LEU 817  814  814  LEU LEU A . n 
A 1 818  SER 818  815  815  SER SER A . n 
A 1 819  LEU 819  816  816  LEU LEU A . n 
A 1 820  VAL 820  817  817  VAL VAL A . n 
A 1 821  SER 821  818  818  SER SER A . n 
A 1 822  CYS 822  819  819  CYS CYS A . n 
A 1 823  LYS 823  820  820  LYS LYS A . n 
A 1 824  LEU 824  821  821  LEU LEU A . n 
A 1 825  GLY 825  822  822  GLY GLY A . n 
A 1 826  LYS 826  823  823  LYS LYS A . n 
A 1 827  ASP 827  824  824  ASP ASP A . n 
A 1 828  PRO 828  825  825  PRO PRO A . n 
A 1 829  ASN 829  826  826  ASN ASN A . n 
A 1 830  THR 830  827  827  THR THR A . n 
A 1 831  TYR 831  828  828  TYR TYR A . n 
A 1 832  PHE 832  829  829  PHE PHE A . n 
A 1 833  ILE 833  830  830  ILE ILE A . n 
A 1 834  VAL 834  831  831  VAL VAL A . n 
A 1 835  GLY 835  832  832  GLY GLY A . n 
A 1 836  THR 836  833  833  THR THR A . n 
A 1 837  ALA 837  834  834  ALA ALA A . n 
A 1 838  MET 838  835  835  MET MET A . n 
A 1 839  VAL 839  836  836  VAL VAL A . n 
A 1 840  TYR 840  837  837  TYR TYR A . n 
A 1 841  PRO 841  838  838  PRO PRO A . n 
A 1 842  GLU 842  839  839  GLU GLU A . n 
A 1 843  GLU 843  840  840  GLU GLU A . n 
A 1 844  ALA 844  841  841  ALA ALA A . n 
A 1 845  GLU 845  842  842  GLU GLU A . n 
A 1 846  PRO 846  843  843  PRO PRO A . n 
A 1 847  LYS 847  844  844  LYS LYS A . n 
A 1 848  GLN 848  845  845  GLN GLN A . n 
A 1 849  GLY 849  846  846  GLY GLY A . n 
A 1 850  ARG 850  847  847  ARG ARG A . n 
A 1 851  ILE 851  848  848  ILE ILE A . n 
A 1 852  VAL 852  849  849  VAL VAL A . n 
A 1 853  VAL 853  850  850  VAL VAL A . n 
A 1 854  PHE 854  851  851  PHE PHE A . n 
A 1 855  GLN 855  852  852  GLN GLN A . n 
A 1 856  TYR 856  853  853  TYR TYR A . n 
A 1 857  SER 857  854  854  SER SER A . n 
A 1 858  ASP 858  855  855  ASP ASP A . n 
A 1 859  GLY 859  856  856  GLY GLY A . n 
A 1 860  LYS 860  857  857  LYS LYS A . n 
A 1 861  LEU 861  858  858  LEU LEU A . n 
A 1 862  GLN 862  859  859  GLN GLN A . n 
A 1 863  THR 863  860  860  THR THR A . n 
A 1 864  VAL 864  861  861  VAL VAL A . n 
A 1 865  ALA 865  862  862  ALA ALA A . n 
A 1 866  GLU 866  863  863  GLU GLU A . n 
A 1 867  LYS 867  864  864  LYS LYS A . n 
A 1 868  GLU 868  865  865  GLU GLU A . n 
A 1 869  VAL 869  866  866  VAL VAL A . n 
A 1 870  LYS 870  867  867  LYS LYS A . n 
A 1 871  GLY 871  868  868  GLY GLY A . n 
A 1 872  ALA 872  869  869  ALA ALA A . n 
A 1 873  VAL 873  870  870  VAL VAL A . n 
A 1 874  TYR 874  871  871  TYR TYR A . n 
A 1 875  SER 875  872  872  SER SER A . n 
A 1 876  MET 876  873  873  MET MET A . n 
A 1 877  VAL 877  874  874  VAL VAL A . n 
A 1 878  GLU 878  875  875  GLU GLU A . n 
A 1 879  PHE 879  876  876  PHE PHE A . n 
A 1 880  ASN 880  877  877  ASN ASN A . n 
A 1 881  GLY 881  878  878  GLY GLY A . n 
A 1 882  LYS 882  879  879  LYS LYS A . n 
A 1 883  LEU 883  880  880  LEU LEU A . n 
A 1 884  LEU 884  881  881  LEU LEU A . n 
A 1 885  ALA 885  882  882  ALA ALA A . n 
A 1 886  SER 886  883  883  SER SER A . n 
A 1 887  ILE 887  884  884  ILE ILE A . n 
A 1 888  ASN 888  885  885  ASN ASN A . n 
A 1 889  SER 889  886  886  SER SER A . n 
A 1 890  THR 890  887  887  THR THR A . n 
A 1 891  VAL 891  888  888  VAL VAL A . n 
A 1 892  ARG 892  889  889  ARG ARG A . n 
A 1 893  LEU 893  890  890  LEU LEU A . n 
A 1 894  TYR 894  891  891  TYR TYR A . n 
A 1 895  GLU 895  892  892  GLU GLU A . n 
A 1 896  TRP 896  893  893  TRP TRP A . n 
A 1 897  THR 897  894  894  THR THR A . n 
A 1 898  THR 898  895  895  THR THR A . n 
A 1 899  GLU 899  896  896  GLU GLU A . n 
A 1 900  LYS 900  897  897  LYS LYS A . n 
A 1 901  ASP 901  898  898  ASP ASP A . n 
A 1 902  VAL 902  899  899  VAL VAL A . n 
A 1 903  ARG 903  900  900  ARG ARG A . n 
A 1 904  THR 904  901  901  THR THR A . n 
A 1 905  GLU 905  902  902  GLU GLU A . n 
A 1 906  CYS 906  903  903  CYS CYS A . n 
A 1 907  ASN 907  904  904  ASN ASN A . n 
A 1 908  HIS 908  905  905  HIS HIS A . n 
A 1 909  TYR 909  906  906  TYR TYR A . n 
A 1 910  ASN 910  907  907  ASN ASN A . n 
A 1 911  ASN 911  908  908  ASN ASN A . n 
A 1 912  ILE 912  909  909  ILE ILE A . n 
A 1 913  MET 913  910  910  MET MET A . n 
A 1 914  ALA 914  911  911  ALA ALA A . n 
A 1 915  LEU 915  912  912  LEU LEU A . n 
A 1 916  TYR 916  913  913  TYR TYR A . n 
A 1 917  LEU 917  914  914  LEU LEU A . n 
A 1 918  LYS 918  915  915  LYS LYS A . n 
A 1 919  THR 919  916  916  THR THR A . n 
A 1 920  LYS 920  917  917  LYS LYS A . n 
A 1 921  GLY 921  918  918  GLY GLY A . n 
A 1 922  ASP 922  919  919  ASP ASP A . n 
A 1 923  PHE 923  920  920  PHE PHE A . n 
A 1 924  ILE 924  921  921  ILE ILE A . n 
A 1 925  LEU 925  922  922  LEU LEU A . n 
A 1 926  VAL 926  923  923  VAL VAL A . n 
A 1 927  GLY 927  924  924  GLY GLY A . n 
A 1 928  ASP 928  925  925  ASP ASP A . n 
A 1 929  LEU 929  926  926  LEU LEU A . n 
A 1 930  MET 930  927  927  MET MET A . n 
A 1 931  ARG 931  928  928  ARG ARG A . n 
A 1 932  SER 932  929  929  SER SER A . n 
A 1 933  VAL 933  930  930  VAL VAL A . n 
A 1 934  LEU 934  931  931  LEU LEU A . n 
A 1 935  LEU 935  932  932  LEU LEU A . n 
A 1 936  LEU 936  933  933  LEU LEU A . n 
A 1 937  ALA 937  934  934  ALA ALA A . n 
A 1 938  TYR 938  935  935  TYR TYR A . n 
A 1 939  LYS 939  936  936  LYS LYS A . n 
A 1 940  PRO 940  937  937  PRO PRO A . n 
A 1 941  MET 941  938  938  MET MET A . n 
A 1 942  GLU 942  939  939  GLU GLU A . n 
A 1 943  GLY 943  940  940  GLY GLY A . n 
A 1 944  ASN 944  941  941  ASN ASN A . n 
A 1 945  PHE 945  942  942  PHE PHE A . n 
A 1 946  GLU 946  943  943  GLU GLU A . n 
A 1 947  GLU 947  944  944  GLU GLU A . n 
A 1 948  ILE 948  945  945  ILE ILE A . n 
A 1 949  ALA 949  946  946  ALA ALA A . n 
A 1 950  ARG 950  947  947  ARG ARG A . n 
A 1 951  ASP 951  948  948  ASP ASP A . n 
A 1 952  PHE 952  949  949  PHE PHE A . n 
A 1 953  ASN 953  950  950  ASN ASN A . n 
A 1 954  PRO 954  951  951  PRO PRO A . n 
A 1 955  ASN 955  952  952  ASN ASN A . n 
A 1 956  TRP 956  953  953  TRP TRP A . n 
A 1 957  MET 957  954  954  MET MET A . n 
A 1 958  SER 958  955  955  SER SER A . n 
A 1 959  ALA 959  956  956  ALA ALA A . n 
A 1 960  VAL 960  957  957  VAL VAL A . n 
A 1 961  GLU 961  958  958  GLU GLU A . n 
A 1 962  ILE 962  959  959  ILE ILE A . n 
A 1 963  LEU 963  960  960  LEU LEU A . n 
A 1 964  ASP 964  961  961  ASP ASP A . n 
A 1 965  ASP 965  962  962  ASP ASP A . n 
A 1 966  ASP 966  963  963  ASP ASP A . n 
A 1 967  ASN 967  964  964  ASN ASN A . n 
A 1 968  PHE 968  965  965  PHE PHE A . n 
A 1 969  LEU 969  966  966  LEU LEU A . n 
A 1 970  GLY 970  967  967  GLY GLY A . n 
A 1 971  ALA 971  968  968  ALA ALA A . n 
A 1 972  GLU 972  969  969  GLU GLU A . n 
A 1 973  ASN 973  970  970  ASN ASN A . n 
A 1 974  ALA 974  971  971  ALA ALA A . n 
A 1 975  PHE 975  972  972  PHE PHE A . n 
A 1 976  ASN 976  973  973  ASN ASN A . n 
A 1 977  LEU 977  974  974  LEU LEU A . n 
A 1 978  PHE 978  975  975  PHE PHE A . n 
A 1 979  VAL 979  976  976  VAL VAL A . n 
A 1 980  CYS 980  977  977  CYS CYS A . n 
A 1 981  GLN 981  978  978  GLN GLN A . n 
A 1 982  LYS 982  979  979  LYS LYS A . n 
A 1 983  ASP 983  980  980  ASP ASP A . n 
A 1 984  SER 984  981  981  SER SER A . n 
A 1 985  ALA 985  982  982  ALA ALA A . n 
A 1 986  ALA 986  983  983  ALA ALA A . n 
A 1 987  THR 987  984  984  THR THR A . n 
A 1 988  THR 988  985  985  THR THR A . n 
A 1 989  ASP 989  986  986  ASP ASP A . n 
A 1 990  GLU 990  987  987  GLU GLU A . n 
A 1 991  GLU 991  988  988  GLU GLU A . n 
A 1 992  ARG 992  989  989  ARG ARG A . n 
A 1 993  GLN 993  990  990  GLN GLN A . n 
A 1 994  HIS 994  991  991  HIS HIS A . n 
A 1 995  LEU 995  992  992  LEU LEU A . n 
A 1 996  GLN 996  993  993  GLN GLN A . n 
A 1 997  GLU 997  994  994  GLU GLU A . n 
A 1 998  VAL 998  995  995  VAL VAL A . n 
A 1 999  GLY 999  996  996  GLY GLY A . n 
A 1 1000 LEU 1000 997  997  LEU LEU A . n 
A 1 1001 PHE 1001 998  998  PHE PHE A . n 
A 1 1002 HIS 1002 999  999  HIS HIS A . n 
A 1 1003 LEU 1003 1000 1000 LEU LEU A . n 
A 1 1004 GLY 1004 1001 1001 GLY GLY A . n 
A 1 1005 GLU 1005 1002 1002 GLU GLU A . n 
A 1 1006 PHE 1006 1003 1003 PHE PHE A . n 
A 1 1007 VAL 1007 1004 1004 VAL VAL A . n 
A 1 1008 ASN 1008 1005 1005 ASN ASN A . n 
A 1 1009 VAL 1009 1006 1006 VAL VAL A . n 
A 1 1010 PHE 1010 1007 1007 PHE PHE A . n 
A 1 1011 CYS 1011 1008 1008 CYS CYS A . n 
A 1 1012 HIS 1012 1009 1009 HIS HIS A . n 
A 1 1013 GLY 1013 1010 1010 GLY GLY A . n 
A 1 1014 SER 1014 1011 1011 SER SER A . n 
A 1 1015 LEU 1015 1012 1012 LEU LEU A . n 
A 1 1016 VAL 1016 1013 1013 VAL VAL A . n 
A 1 1017 MET 1017 1014 1014 MET MET A . n 
A 1 1018 GLN 1018 1015 1015 GLN GLN A . n 
A 1 1019 ASN 1019 1016 ?    ?   ?   A . n 
A 1 1020 LEU 1020 1017 ?    ?   ?   A . n 
A 1 1021 GLY 1021 1018 ?    ?   ?   A . n 
A 1 1022 GLU 1022 1019 ?    ?   ?   A . n 
A 1 1023 THR 1023 1020 ?    ?   ?   A . n 
A 1 1024 SER 1024 1021 ?    ?   ?   A . n 
A 1 1025 THR 1025 1022 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1023 1023 PRO PRO A . n 
A 1 1027 THR 1027 1024 1024 THR THR A . n 
A 1 1028 GLN 1028 1025 1025 GLN GLN A . n 
A 1 1029 GLY 1029 1026 1026 GLY GLY A . n 
A 1 1030 SER 1030 1027 1027 SER SER A . n 
A 1 1031 VAL 1031 1028 1028 VAL VAL A . n 
A 1 1032 LEU 1032 1029 1029 LEU LEU A . n 
A 1 1033 PHE 1033 1030 1030 PHE PHE A . n 
A 1 1034 GLY 1034 1031 1031 GLY GLY A . n 
A 1 1035 THR 1035 1032 1032 THR THR A . n 
A 1 1036 VAL 1036 1033 1033 VAL VAL A . n 
A 1 1037 ASN 1037 1034 1034 ASN ASN A . n 
A 1 1038 GLY 1038 1035 1035 GLY GLY A . n 
A 1 1039 MET 1039 1036 1036 MET MET A . n 
A 1 1040 ILE 1040 1037 1037 ILE ILE A . n 
A 1 1041 GLY 1041 1038 1038 GLY GLY A . n 
A 1 1042 LEU 1042 1039 1039 LEU LEU A . n 
A 1 1043 VAL 1043 1040 1040 VAL VAL A . n 
A 1 1044 THR 1044 1041 1041 THR THR A . n 
A 1 1045 SER 1045 1042 1042 SER SER A . n 
A 1 1046 LEU 1046 1043 1043 LEU LEU A . n 
A 1 1047 SER 1047 1044 1044 SER SER A . n 
A 1 1048 GLU 1048 1045 1045 GLU GLU A . n 
A 1 1049 SER 1049 1046 1046 SER SER A . n 
A 1 1050 TRP 1050 1047 1047 TRP TRP A . n 
A 1 1051 TYR 1051 1048 1048 TYR TYR A . n 
A 1 1052 ASN 1052 1049 1049 ASN ASN A . n 
A 1 1053 LEU 1053 1050 1050 LEU LEU A . n 
A 1 1054 LEU 1054 1051 1051 LEU LEU A . n 
A 1 1055 LEU 1055 1052 1052 LEU LEU A . n 
A 1 1056 ASP 1056 1053 1053 ASP ASP A . n 
A 1 1057 MET 1057 1054 1054 MET MET A . n 
A 1 1058 GLN 1058 1055 1055 GLN GLN A . n 
A 1 1059 ASN 1059 1056 1056 ASN ASN A . n 
A 1 1060 ARG 1060 1057 1057 ARG ARG A . n 
A 1 1061 LEU 1061 1058 1058 LEU LEU A . n 
A 1 1062 ASN 1062 1059 1059 ASN ASN A . n 
A 1 1063 LYS 1063 1060 1060 LYS LYS A . n 
A 1 1064 VAL 1064 1061 1061 VAL VAL A . n 
A 1 1065 ILE 1065 1062 1062 ILE ILE A . n 
A 1 1066 LYS 1066 1063 1063 LYS LYS A . n 
A 1 1067 SER 1067 1064 1064 SER SER A . n 
A 1 1068 VAL 1068 1065 1065 VAL VAL A . n 
A 1 1069 GLY 1069 1066 1066 GLY GLY A . n 
A 1 1070 LYS 1070 1067 1067 LYS LYS A . n 
A 1 1071 ILE 1071 1068 1068 ILE ILE A . n 
A 1 1072 GLU 1072 1069 1069 GLU GLU A . n 
A 1 1073 HIS 1073 1070 1070 HIS HIS A . n 
A 1 1074 SER 1074 1071 1071 SER SER A . n 
A 1 1075 PHE 1075 1072 1072 PHE PHE A . n 
A 1 1076 TRP 1076 1073 1073 TRP TRP A . n 
A 1 1077 ARG 1077 1074 1074 ARG ARG A . n 
A 1 1078 SER 1078 1075 1075 SER SER A . n 
A 1 1079 PHE 1079 1076 1076 PHE PHE A . n 
A 1 1080 HIS 1080 1077 1077 HIS HIS A . n 
A 1 1081 THR 1081 1078 1078 THR THR A . n 
A 1 1082 GLU 1082 1079 1079 GLU GLU A . n 
A 1 1083 ARG 1083 1080 1080 ARG ARG A . n 
A 1 1084 LYS 1084 1081 1081 LYS LYS A . n 
A 1 1085 THR 1085 1082 1082 THR THR A . n 
A 1 1086 GLU 1086 1083 1083 GLU GLU A . n 
A 1 1087 PRO 1087 1084 1084 PRO PRO A . n 
A 1 1088 ALA 1088 1085 1085 ALA ALA A . n 
A 1 1089 THR 1089 1086 1086 THR THR A . n 
A 1 1090 GLY 1090 1087 1087 GLY GLY A . n 
A 1 1091 PHE 1091 1088 1088 PHE PHE A . n 
A 1 1092 ILE 1092 1089 1089 ILE ILE A . n 
A 1 1093 ASP 1093 1090 1090 ASP ASP A . n 
A 1 1094 GLY 1094 1091 1091 GLY GLY A . n 
A 1 1095 ASP 1095 1092 1092 ASP ASP A . n 
A 1 1096 LEU 1096 1093 1093 LEU LEU A . n 
A 1 1097 ILE 1097 1094 1094 ILE ILE A . n 
A 1 1098 GLU 1098 1095 1095 GLU GLU A . n 
A 1 1099 SER 1099 1096 1096 SER SER A . n 
A 1 1100 PHE 1100 1097 1097 PHE PHE A . n 
A 1 1101 LEU 1101 1098 1098 LEU LEU A . n 
A 1 1102 ASP 1102 1099 1099 ASP ASP A . n 
A 1 1103 ILE 1103 1100 1100 ILE ILE A . n 
A 1 1104 SER 1104 1101 1101 SER SER A . n 
A 1 1105 ARG 1105 1102 1102 ARG ARG A . n 
A 1 1106 PRO 1106 1103 1103 PRO PRO A . n 
A 1 1107 LYS 1107 1104 1104 LYS LYS A . n 
A 1 1108 MET 1108 1105 1105 MET MET A . n 
A 1 1109 GLN 1109 1106 1106 GLN GLN A . n 
A 1 1110 GLU 1110 1107 1107 GLU GLU A . n 
A 1 1111 VAL 1111 1108 1108 VAL VAL A . n 
A 1 1112 VAL 1112 1109 1109 VAL VAL A . n 
A 1 1113 ALA 1113 1110 1110 ALA ALA A . n 
A 1 1114 ASN 1114 1111 1111 ASN ASN A . n 
A 1 1115 LEU 1115 1112 ?    ?   ?   A . n 
A 1 1116 GLN 1116 1113 ?    ?   ?   A . n 
A 1 1117 TYR 1117 1114 ?    ?   ?   A . n 
A 1 1118 ASP 1118 1115 ?    ?   ?   A . n 
A 1 1119 ASP 1119 1116 ?    ?   ?   A . n 
A 1 1120 GLY 1120 1117 ?    ?   ?   A . n 
A 1 1121 SER 1121 1118 ?    ?   ?   A . n 
A 1 1122 GLY 1122 1119 ?    ?   ?   A . n 
A 1 1123 MET 1123 1120 ?    ?   ?   A . n 
A 1 1124 LYS 1124 1121 ?    ?   ?   A . n 
A 1 1125 ARG 1125 1122 1122 ARG ARG A . n 
A 1 1126 GLU 1126 1123 1123 GLU GLU A . n 
A 1 1127 ALA 1127 1124 1124 ALA ALA A . n 
A 1 1128 THR 1128 1125 1125 THR THR A . n 
A 1 1129 ALA 1129 1126 1126 ALA ALA A . n 
A 1 1130 ASP 1130 1127 1127 ASP ASP A . n 
A 1 1131 ASP 1131 1128 1128 ASP ASP A . n 
A 1 1132 LEU 1132 1129 1129 LEU LEU A . n 
A 1 1133 ILE 1133 1130 1130 ILE ILE A . n 
A 1 1134 LYS 1134 1131 1131 LYS LYS A . n 
A 1 1135 VAL 1135 1132 1132 VAL VAL A . n 
A 1 1136 VAL 1136 1133 1133 VAL VAL A . n 
A 1 1137 GLU 1137 1134 1134 GLU GLU A . n 
A 1 1138 GLU 1138 1135 1135 GLU GLU A . n 
A 1 1139 LEU 1139 1136 1136 LEU LEU A . n 
A 1 1140 THR 1140 1137 1137 THR THR A . n 
A 1 1141 ARG 1141 1138 1138 ARG ARG A . n 
A 1 1142 ILE 1142 1139 1139 ILE ILE A . n 
A 1 1143 HIS 1143 1140 1140 HIS HIS A . n 
B 2 1    HIS 1    9    9    HIS HIS B . n 
B 2 2    LEU 2    10   10   LEU LEU B . n 
B 2 3    LEU 3    11   11   LEU LEU B . n 
B 2 4    TRP 4    12   12   TRP TRP B . n 
B 2 5    ASP 5    13   13   ASP ASP B . n 
B 2 6    VAL 6    14   14   VAL VAL B . n 
B 2 7    ARG 7    15   15   ARG ARG B . n 
B 2 8    LYS 8    16   16   LYS LYS B . n 
B 2 9    ARG 9    17   17   ARG ARG B . n 
B 2 10   SER 10   18   18   SER SER B . n 
B 2 11   LEU 11   19   19   LEU LEU B . n 
B 2 12   GLY 12   20   20   GLY GLY B . n 
B 2 13   LEU 13   21   21   LEU LEU B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1540  ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  47380 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3I7O 
_pdbx_entry_details.sequence_details     'MUTATIONS OCCURRED DURING THE CLONING OF DDB1' 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   N 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    744 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   GLY 
_pdbx_validate_close_contact.auth_seq_id_2    748 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB  A CYS 725 ? ? SG  A CYS 725 ? ? 1.698 1.812 -0.114 0.016 N 
2 1 C   A SER 773 ? ? O   A SER 773 ? ? 1.818 1.229 0.589  0.019 N 
3 1 CE3 B TRP 12  ? ? CZ3 B TRP 12  ? ? 1.486 1.380 0.106  0.017 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N  A LEU 29  ? ? CA A LEU 29  ? ? CB  A LEU 29  ? ? 80.92  110.40 -29.48 2.00 N 
2  1 CA A LEU 162 ? ? CB A LEU 162 ? ? CG  A LEU 162 ? ? 130.06 115.30 14.76  2.30 N 
3  1 CB A ASP 330 ? ? CG A ASP 330 ? ? OD1 A ASP 330 ? ? 128.55 118.30 10.25  0.90 N 
4  1 CB A ASP 330 ? ? CG A ASP 330 ? ? OD2 A ASP 330 ? ? 111.09 118.30 -7.21  0.90 N 
5  1 N  A PRO 412 ? ? CA A PRO 412 ? ? C   A PRO 412 ? ? 129.58 112.10 17.48  2.60 N 
6  1 N  A LEU 413 ? ? CA A LEU 413 ? ? CB  A LEU 413 ? ? 79.85  110.40 -30.55 2.00 N 
7  1 N  A LEU 413 ? ? CA A LEU 413 ? ? C   A LEU 413 ? ? 135.20 111.00 24.20  2.70 N 
8  1 N  A ARG 514 ? ? CA A ARG 514 ? ? CB  A ARG 514 ? ? 98.88  110.60 -11.72 1.80 N 
9  1 N  A ARG 514 ? ? CA A ARG 514 ? ? C   A ARG 514 ? ? 94.16  111.00 -16.84 2.70 N 
10 1 N  A TRP 561 ? ? CA A TRP 561 ? ? C   A TRP 561 ? ? 132.02 111.00 21.02  2.70 N 
11 1 CA A LEU 710 ? ? CB A LEU 710 ? ? CG  A LEU 710 ? ? 129.31 115.30 14.01  2.30 N 
12 1 N  A SER 773 ? ? CA A SER 773 ? ? C   A SER 773 ? ? 94.50  111.00 -16.50 2.70 N 
13 1 CA A SER 773 ? ? C  A SER 773 ? ? O   A SER 773 ? ? 105.09 120.10 -15.01 2.10 N 
14 1 C  A GLU 842 ? ? N  A PRO 843 ? ? CD  A PRO 843 ? ? 114.16 128.40 -14.24 2.10 Y 
15 1 N  A SER 929 ? ? CA A SER 929 ? ? C   A SER 929 ? ? 128.99 111.00 17.99  2.70 N 
16 1 N  A VAL 930 ? ? CA A VAL 930 ? ? C   A VAL 930 ? ? 135.44 111.00 24.44  2.70 N 
17 1 N  A MET 938 ? ? CA A MET 938 ? ? C   A MET 938 ? ? 93.62  111.00 -17.38 2.70 N 
18 1 CA A LEU 992 ? ? CB A LEU 992 ? ? CG  A LEU 992 ? ? 129.99 115.30 14.69  2.30 N 
19 1 CB B ASP 13  ? ? CG B ASP 13  ? ? OD1 B ASP 13  ? ? 111.75 118.30 -6.55  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 GLU A 27   ? ? -113.19 59.49   
2   1 ASP A 28   ? ? -161.76 117.41  
3   1 LYS A 35   ? ? -81.76  -117.83 
4   1 ASN A 36   ? ? -106.76 -64.44  
5   1 TYR A 58   ? ? -92.07  57.79   
6   1 TYR A 84   ? ? 83.64   14.58   
7   1 THR A 118  ? ? 98.05   3.92    
8   1 ASP A 148  ? ? -65.25  -127.61 
9   1 ASN A 149  ? ? 34.58   39.21   
10  1 PRO A 176  ? ? -35.16  110.97  
11  1 GLN A 186  ? ? 157.98  -34.39  
12  1 ARG A 198  ? ? -33.52  -38.92  
13  1 GLU A 199  ? ? -145.63 27.39   
14  1 LYS A 200  ? ? 47.09   28.12   
15  1 ASN A 203  ? ? 80.07   -171.95 
16  1 LYS A 208  ? ? -29.99  135.18  
17  1 GLU A 210  ? ? -101.04 -152.61 
18  1 ALA A 214  ? ? -33.65  -36.24  
19  1 SER A 217  ? ? -167.21 -9.61   
20  1 GLU A 224  ? ? -21.41  -47.94  
21  1 GLU A 235  ? ? 37.51   13.27   
22  1 VAL A 259  ? ? -153.19 -20.15  
23  1 GLU A 288  ? ? 159.53  156.45  
24  1 GLN A 290  ? ? -160.34 76.52   
25  1 MET A 291  ? ? 42.85   -143.95 
26  1 ASP A 292  ? ? -54.21  95.30   
27  1 LEU A 317  ? ? -113.89 -125.31 
28  1 ASP A 318  ? ? -69.36  -143.69 
29  1 ASN A 341  ? ? -65.65  -162.71 
30  1 GLU A 342  ? ? -34.55  154.70  
31  1 GLN A 343  ? ? 63.45   -19.45  
32  1 LEU A 356  ? ? -63.10  0.17    
33  1 ASP A 366  ? ? 98.67   28.11   
34  1 LEU A 367  ? ? -119.21 -84.15  
35  1 GLU A 368  ? ? -80.43  35.09   
36  1 ARG A 369  ? ? 25.98   63.06   
37  1 GLN A 370  ? ? -101.62 -82.04  
38  1 PHE A 382  ? ? 53.81   -133.89 
39  1 HIS A 399  ? ? -104.72 -63.99  
40  1 SER A 401  ? ? -168.17 76.59   
41  1 PRO A 405  ? ? -65.00  19.63   
42  1 ILE A 407  ? ? -16.27  118.21  
43  1 PRO A 417  ? ? -39.63  -39.42  
44  1 VAL A 430  ? ? -55.27  73.51   
45  1 LEU A 448  ? ? -169.16 108.01  
46  1 CYS A 460  ? ? -179.89 27.68   
47  1 ASN A 462  ? ? -114.73 69.29   
48  1 ALA A 474  ? ? -73.22  -106.03 
49  1 ARG A 477  ? ? -59.04  172.75  
50  1 GLU A 482  ? ? -69.79  -72.27  
51  1 LYS A 484  ? ? 71.92   62.12   
52  1 ALA A 485  ? ? -150.75 -138.94 
53  1 LEU A 486  ? ? -101.32 73.28   
54  1 SER A 488  ? ? -143.24 -96.62  
55  1 GLU A 489  ? ? 89.09   110.30  
56  1 TRP A 490  ? ? -79.49  -168.50 
57  1 LYS A 491  ? ? 170.29  126.93  
58  1 PRO A 493  ? ? -68.35  74.55   
59  1 GLN A 494  ? ? 165.15  -7.10   
60  1 ALA A 495  ? ? 78.91   33.37   
61  1 ALA A 501  ? ? -74.01  -164.95 
62  1 SER A 502  ? ? 154.77  148.62  
63  1 CYS A 503  ? ? 165.10  160.74  
64  1 ASN A 504  ? ? -121.29 -82.99  
65  1 SER A 505  ? ? -155.03 1.23    
66  1 SER A 506  ? ? -146.93 -40.61  
67  1 TYR A 517  ? ? -122.83 -137.93 
68  1 TYR A 518  ? ? 154.61  114.12  
69  1 PRO A 523  ? ? -34.82  102.64  
70  1 GLN A 524  ? ? 84.97   26.70   
71  1 ILE A 529  ? ? -135.86 -76.54  
72  1 GLU A 535  ? ? -29.56  -57.38  
73  1 PRO A 545  ? ? -54.38  97.76   
74  1 LEU A 546  ? ? -63.61  -98.34  
75  1 PRO A 554  ? ? -52.98  -131.81 
76  1 LEU A 555  ? ? -68.41  -170.34 
77  1 ILE A 564  ? ? 49.18   70.22   
78  1 LYS A 570  ? ? -105.07 -136.43 
79  1 LEU A 571  ? ? -126.47 -105.67 
80  1 PHE A 574  ? ? 82.65   45.01   
81  1 LEU A 577  ? ? -97.95  -117.66 
82  1 MET A 581  ? ? -102.28 63.86   
83  1 PRO A 588  ? ? -57.99  109.61  
84  1 SER A 590  ? ? -175.34 129.33  
85  1 PHE A 596  ? ? -136.20 -93.74  
86  1 GLU A 597  ? ? -91.73  -67.28  
87  1 LEU A 623  ? ? -53.98  -178.26 
88  1 SER A 624  ? ? -159.79 -84.91  
89  1 LYS A 627  ? ? -176.57 107.25  
90  1 LEU A 631  ? ? -156.70 -99.07  
91  1 PRO A 635  ? ? -25.65  135.29  
92  1 SER A 643  ? ? -138.93 -73.98  
93  1 LEU A 644  ? ? -149.75 -90.66  
94  1 SER A 645  ? ? -121.64 -57.64  
95  1 THR A 646  ? ? -67.21  7.03    
96  1 THR A 647  ? ? -6.60   125.49  
97  1 ARG A 655  ? ? -107.09 79.16   
98  1 TYR A 660  ? ? -74.50  -132.38 
99  1 SER A 661  ? ? -172.70 82.43   
100 1 SER A 662  ? ? -58.03  -132.85 
101 1 LYS A 665  ? ? -104.39 -159.02 
102 1 PRO A 681  ? ? -61.57  -175.96 
103 1 ASN A 683  ? ? -175.60 20.18   
104 1 TYR A 687  ? ? -150.86 62.73   
105 1 PRO A 688  ? ? -51.83  171.24  
106 1 ASP A 689  ? ? -9.91   104.43  
107 1 ASN A 695  ? ? -119.30 -161.69 
108 1 THR A 698  ? ? 158.33  128.26  
109 1 ASP A 705  ? ? -54.69  -153.20 
110 1 GLU A 706  ? ? -73.70  -101.45 
111 1 ILE A 707  ? ? -171.29 -82.74  
112 1 GLN A 708  ? ? -1.82   117.15  
113 1 LYS A 709  ? ? -12.57  -61.53  
114 1 TYR A 718  ? ? 66.61   -17.65  
115 1 ASP A 744  ? ? -86.62  -154.72 
116 1 SER A 746  ? ? -145.57 -26.51  
117 1 THR A 750  ? ? -90.77  -126.83 
118 1 ALA A 751  ? ? -179.09 75.85   
119 1 LEU A 752  ? ? -22.85  -87.92  
120 1 SER A 762  ? ? -111.44 -156.69 
121 1 SER A 763  ? ? 171.98  177.35  
122 1 SER A 768  ? ? -3.48   129.50  
123 1 LEU A 770  ? ? -48.54  -8.69   
124 1 SER A 772  ? ? 158.26  104.08  
125 1 ASP A 824  ? ? -39.67  111.04  
126 1 PRO A 838  ? ? -49.97  -1.96   
127 1 GLU A 840  ? ? -94.17  -144.74 
128 1 ALA A 841  ? ? 179.81  45.81   
129 1 GLU A 842  ? ? 178.65  54.53   
130 1 PRO A 843  ? ? -9.56   132.78  
131 1 SER A 854  ? ? -90.41  -141.77 
132 1 THR A 860  ? ? -62.01  98.39   
133 1 LYS A 867  ? ? -102.54 46.99   
134 1 PHE A 876  ? ? -83.74  -91.88  
135 1 ILE A 884  ? ? -116.98 61.89   
136 1 ASN A 885  ? ? 61.39   88.27   
137 1 SER A 886  ? ? 81.87   -27.80  
138 1 GLU A 896  ? ? -69.17  26.49   
139 1 GLU A 902  ? ? -126.78 -56.53  
140 1 PHE A 920  ? ? -73.57  48.80   
141 1 ASP A 925  ? ? 161.23  165.44  
142 1 SER A 929  ? ? -34.17  100.05  
143 1 VAL A 930  ? ? 63.02   106.90  
144 1 PRO A 937  ? ? -61.53  47.04   
145 1 MET A 938  ? ? -118.80 -128.24 
146 1 GLU A 939  ? ? -63.50  42.20   
147 1 ALA A 946  ? ? -174.92 146.26  
148 1 ARG A 947  ? ? -119.08 -162.67 
149 1 PRO A 951  ? ? -95.19  48.94   
150 1 SER A 955  ? ? -131.01 -30.41  
151 1 GLU A 969  ? ? -140.62 -106.90 
152 1 PHE A 972  ? ? 88.77   36.40   
153 1 SER A 981  ? ? -67.03  90.10   
154 1 THR A 985  ? ? -71.34  40.80   
155 1 ASP A 986  ? ? -140.58 25.11   
156 1 GLU A 987  ? ? -155.03 -76.10  
157 1 GLU A 994  ? ? -55.73  98.60   
158 1 PHE A 998  ? ? 176.33  134.76  
159 1 VAL A 1013 ? ? -121.05 -159.50 
160 1 MET A 1014 ? ? 56.44   -175.19 
161 1 VAL A 1065 ? ? -36.96  -80.18  
162 1 ARG A 1080 ? ? 169.34  13.39   
163 1 LYS A 1081 ? ? 177.92  139.03  
164 1 PHE A 1097 ? ? -40.25  -73.96  
165 1 ASP A 1099 ? ? -75.92  24.59   
166 1 THR A 1125 ? ? -105.22 -113.17 
167 1 ALA A 1126 ? ? -172.60 -25.58  
168 1 ASP A 1127 ? ? -167.56 8.70    
169 1 ILE A 1130 ? ? -37.05  -32.02  
170 1 THR A 1137 ? ? -36.12  -22.07  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    20 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LEU 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    21 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -147.95 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             GLU 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              194 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   10.37 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2   ? A GLY 1    
2  1 Y 1 A SER -1   ? A SER 2    
3  1 Y 1 A HIS 0    ? A HIS 3    
4  1 Y 1 A SER 774  ? A SER 777  
5  1 Y 1 A THR 775  ? A THR 778  
6  1 Y 1 A ALA 776  ? A ALA 779  
7  1 Y 1 A PRO 777  ? A PRO 780  
8  1 Y 1 A HIS 778  ? A HIS 781  
9  1 Y 1 A GLU 779  ? A GLU 782  
10 1 Y 1 A THR 780  ? A THR 783  
11 1 Y 1 A SER 781  ? A SER 784  
12 1 Y 1 A PHE 782  ? A PHE 785  
13 1 Y 1 A ASN 1016 ? A ASN 1019 
14 1 Y 1 A LEU 1017 ? A LEU 1020 
15 1 Y 1 A GLY 1018 ? A GLY 1021 
16 1 Y 1 A GLU 1019 ? A GLU 1022 
17 1 Y 1 A THR 1020 ? A THR 1023 
18 1 Y 1 A SER 1021 ? A SER 1024 
19 1 Y 1 A THR 1022 ? A THR 1025 
20 1 Y 1 A LEU 1112 ? A LEU 1115 
21 1 Y 1 A GLN 1113 ? A GLN 1116 
22 1 Y 1 A TYR 1114 ? A TYR 1117 
23 1 Y 1 A ASP 1115 ? A ASP 1118 
24 1 Y 1 A ASP 1116 ? A ASP 1119 
25 1 Y 1 A GLY 1117 ? A GLY 1120 
26 1 Y 1 A SER 1118 ? A SER 1121 
27 1 Y 1 A GLY 1119 ? A GLY 1122 
28 1 Y 1 A MET 1120 ? A MET 1123 
29 1 Y 1 A LYS 1121 ? A LYS 1124 
#