data_3I7P
# 
_entry.id   3I7P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I7P         
RCSB  RCSB054068   
WWPDB D_1000054068 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7H 'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX'    unspecified 
PDB 3I7K 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX'    unspecified 
PDB 3I7L 'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2'   unspecified 
PDB 3I7N 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1'  unspecified 
PDB 3I7O 'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1'  unspecified 
PDB 3I89 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I8C 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' unspecified 
PDB 3I8E 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I7P 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I7P 
_cell.length_a           63.599 
_cell.length_b           132.522 
_cell.length_c           183.052 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I7P 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1'     127399.766 1 ? ? ?                ? 
2 polymer syn 'WD repeat-containing protein 40A' 1655.960   1 ? ? 'Residues 45-57' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
2 'Centrosome-related protein TCC52, Testis cancer centrosome-related protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no SLVYYLKNREVRL SLVYYLKNREVRL B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    SER n 
2 2    LEU n 
2 3    VAL n 
2 4    TYR n 
2 5    TYR n 
2 6    LEU n 
2 7    LYS n 
2 8    ASN n 
2 9    ARG n 
2 10   GLU n 
2 11   VAL n 
2 12   ARG n 
2 13   LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN  Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1  ? 
2 UNP WD40A_HUMAN Q5T6F0 2 SLVYYLKNREVRL 45 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I7P A 4 ? 1143 ? Q16531 1  ? 1140 ? 1  1140 
2 2 3I7P B 1 ? 13   ? Q5T6F0 45 ? 57   ? 45 57   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I7P GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1 
1 3I7P SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2 
1 3I7P HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3 
1 3I7P TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4 
1 3I7P ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5 
1 3I7P VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I7P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.99 
_exptl_crystal.density_percent_sol   58.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005M DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I7P 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             45.79 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   26351 
_reflns.number_all                   29177 
_reflns.percent_possible_obs         90.3 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.078 
_reflns_shell.percent_possible_all   89.5 
_reflns_shell.Rmerge_I_obs           0.401 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3I7P 
_refine.ls_number_reflns_obs                     26351 
_refine.ls_number_reflns_all                     29177 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.79 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    87.04 
_refine.ls_R_factor_obs                          0.24247 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23952 
_refine.ls_R_factor_R_free                       0.30119 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1336 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.908 
_refine.correlation_coeff_Fo_to_Fc_free          0.860 
_refine.B_iso_mean                               80.631 
_refine.aniso_B[1][1]                            -0.82 
_refine.aniso_B[2][2]                            1.12 
_refine.aniso_B[3][3]                            -0.30 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.557 
_refine.overall_SU_ML                            0.400 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             21.551 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8842 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8842 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        45.79 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 9003  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.933  1.966  ? 12192 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       8.304  5.000  ? 1122  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       41.265 24.694 ? 409   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       22.371 15.000 ? 1596  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.625 15.000 ? 50    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.116  0.200  ? 1405  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 6715  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.289  0.200  ? 4831  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.330  0.200  ? 6054  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.231  0.200  ? 352   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.204  0.200  ? 43    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.298  0.200  ? 4     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.000 
_refine_ls_shell.d_res_low                        3.078 
_refine_ls_shell.number_reflns_R_work             1765 
_refine_ls_shell.R_factor_R_work                  0.314 
_refine_ls_shell.percent_reflns_obs               80.77 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             87 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3I7P 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3I7P 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR40A' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, WD repeat-containing protein 40A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I7P 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;DDB1, WDR40A, DCAF12, H-Box Motif, Cytoplasm, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, WD repeat, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 253  ? GLN A 258  ? PRO A 250  GLN A 255  1 ? 6  
HELX_P HELX_P2  2  ALA A 384  ? GLU A 387  ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P3  3  SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P4  4  SER A 1067 ? ILE A 1071 ? SER A 1064 ILE A 1068 5 ? 5  
HELX_P HELX_P5  5  GLU A 1072 ? ARG A 1077 ? GLU A 1069 ARG A 1074 1 ? 6  
HELX_P HELX_P6  6  ASP A 1093 ? GLU A 1098 ? ASP A 1090 GLU A 1095 1 ? 6  
HELX_P HELX_P7  7  SER A 1099 ? ILE A 1103 ? SER A 1096 ILE A 1100 5 ? 5  
HELX_P HELX_P8  8  SER A 1104 ? GLU A 1110 ? SER A 1101 GLU A 1107 1 ? 7  
HELX_P HELX_P9  9  ASP A 1131 ? VAL A 1136 ? ASP A 1128 VAL A 1133 1 ? 6  
HELX_P HELX_P10 10 VAL A 1136 ? ARG A 1141 ? VAL A 1133 ARG A 1138 1 ? 6  
HELX_P HELX_P11 11 LEU B 2    ? ARG B 12   ? LEU B 46   ARG B 56   1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            21 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            316 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             18 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             313 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.047 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           931 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            928 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    932 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     929 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
K ? 2 ? 
L ? 2 ? 
M ? 3 ? 
N ? 3 ? 
O ? 4 ? 
P ? 3 ? 
Q ? 4 ? 
R ? 3 ? 
S ? 5 ? 
T ? 4 ? 
U ? 4 ? 
V ? 4 ? 
W ? 4 ? 
X ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
S 4 5 ? parallel      
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
X 1 2 ? anti-parallel 
X 2 3 ? anti-parallel 
X 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 7    ? GLN A 13   ? ASN A 4    GLN A 10   
A 2 ILE A 1040 ? SER A 1045 ? ILE A 1037 SER A 1042 
A 3 GLN A 1028 ? THR A 1035 ? GLN A 1025 THR A 1032 
A 4 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
B 1 GLY A 20   ? GLY A 24   ? GLY A 17   GLY A 21   
B 2 ASN A 33   ? ALA A 37   ? ASN A 30   ALA A 34   
B 3 ARG A 41   ? VAL A 47   ? ARG A 38   VAL A 44   
B 4 LEU A 52   ? GLY A 59   ? LEU A 49   GLY A 56   
C 1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C 2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C 3 ASN A 88   ? SER A 97   ? ASN A 85   SER A 94   
C 4 SER A 100  ? ASN A 110  ? SER A 97   ASN A 107  
D 1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D 2 MET A 133  ? ARG A 137  ? MET A 130  ARG A 134  
D 3 LEU A 142  ? PRO A 147  ? LEU A 139  PRO A 144  
D 4 PHE A 158  ? ARG A 161  ? PHE A 155  ARG A 158  
E 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
E 2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
E 3 GLY A 190  ? SER A 199  ? GLY A 187  SER A 196  
E 4 GLU A 204  ? LYS A 207  ? GLU A 201  LYS A 204  
F 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
F 2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
F 3 GLY A 190  ? SER A 199  ? GLY A 187  SER A 196  
F 4 GLU A 213  ? ASN A 214  ? GLU A 210  ASN A 211  
G 1 MET A 221  ? ILE A 223  ? MET A 218  ILE A 220  
G 2 ALA A 232  ? ILE A 235  ? ALA A 229  ILE A 232  
G 3 ILE A 240  ? ASN A 244  ? ILE A 237  ASN A 241  
G 4 LYS A 247  ? ILE A 251  ? LYS A 244  ILE A 248  
H 1 ILE A 261  ? ARG A 266  ? ILE A 258  ARG A 263  
H 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
H 3 ARG A 282  ? GLN A 293  ? ARG A 279  GLN A 290  
H 4 GLY A 296  ? GLU A 310  ? GLY A 293  GLU A 307  
I 1 CYS A 316  ? TYR A 319  ? CYS A 313  TYR A 316  
I 2 VAL A 324  ? GLY A 328  ? VAL A 321  GLY A 325  
I 3 SER A 334  ? ASN A 344  ? SER A 331  ASN A 341  
I 4 SER A 348  ? PHE A 356  ? SER A 345  PHE A 353  
J 1 ILE A 362  ? VAL A 368  ? ILE A 359  VAL A 365  
J 2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
J 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
J 4 LEU A 713  ? PRO A 719  ? LEU A 710  PRO A 716  
K 1 LEU A 430  ? SER A 431  ? LEU A 427  SER A 428  
K 2 THR A 436  ? ARG A 437  ? THR A 433  ARG A 434  
L 1 MET A 440  ? LEU A 441  ? MET A 437  LEU A 438  
L 2 VAL A 446  ? GLU A 447  ? VAL A 443  GLU A 444  
M 1 THR A 460  ? PHE A 462  ? THR A 457  PHE A 459  
M 2 GLN A 470  ? THR A 475  ? GLN A 467  THR A 472  
M 3 VAL A 479  ? SER A 483  ? VAL A 476  SER A 480  
N 1 GLN A 510  ? VAL A 511  ? GLN A 507  VAL A 508  
N 2 LEU A 522  ? HIS A 525  ? LEU A 519  HIS A 522  
N 3 GLU A 528  ? GLN A 531  ? GLU A 525  GLN A 528  
O 1 VAL A 541  ? ASP A 545  ? VAL A 538  ASP A 542  
O 2 CYS A 559  ? LEU A 563  ? CYS A 556  LEU A 560  
O 3 SER A 568  ? LEU A 572  ? SER A 565  LEU A 569  
O 4 LEU A 579  ? GLU A 583  ? LEU A 576  GLU A 580  
P 1 SER A 593  ? THR A 598  ? SER A 590  THR A 595  
P 2 HIS A 603  ? ALA A 608  ? HIS A 600  ALA A 605  
P 3 LEU A 614  ? GLY A 618  ? LEU A 611  GLY A 615  
Q 1 VAL A 640  ? THR A 643  ? VAL A 637  THR A 640  
Q 2 VAL A 652  ? CYS A 655  ? VAL A 649  CYS A 652  
Q 3 THR A 660  ? ILE A 662  ? THR A 657  ILE A 659  
Q 4 PHE A 671  ? ASN A 673  ? PHE A 668  ASN A 670  
R 1 TYR A 681  ? SER A 687  ? TYR A 678  SER A 684  
R 2 TYR A 690  ? ASN A 698  ? TYR A 687  ASN A 695  
R 3 THR A 701  ? ILE A 704  ? THR A 698  ILE A 701  
S 1 SER A 723  ? GLN A 730  ? SER A 720  GLN A 727  
S 2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
S 3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
S 4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
S 5 SER A 767  ? VAL A 768  ? SER A 764  VAL A 765  
T 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
T 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
T 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
T 4 LEU A 861  ? ALA A 865  ? LEU A 858  ALA A 862  
U 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
U 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
U 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
U 4 GLU A 868  ? VAL A 869  ? GLU A 865  VAL A 866  
V 1 SER A 875  ? GLU A 878  ? SER A 872  GLU A 875  
V 2 LEU A 883  ? ILE A 887  ? LEU A 880  ILE A 884  
V 3 THR A 890  ? TRP A 896  ? THR A 887  TRP A 893  
V 4 VAL A 902  ? HIS A 908  ? VAL A 899  HIS A 905  
W 1 THR A 919  ? LYS A 920  ? THR A 916  LYS A 917  
W 2 ILE A 924  ? VAL A 926  ? ILE A 921  VAL A 923  
W 3 LEU A 934  ? TYR A 938  ? LEU A 931  TYR A 935  
W 4 PHE A 945  ? ARG A 950  ? PHE A 942  ARG A 947  
X 1 MET A 957  ? ILE A 962  ? MET A 954  ILE A 959  
X 2 PHE A 968  ? GLU A 972  ? PHE A 965  GLU A 969  
X 3 ASN A 976  ? LYS A 982  ? ASN A 973  LYS A 979  
X 4 LEU A 995  ? HIS A 1002 ? LEU A 992  HIS A 999  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 12   ? N ALA A 9    O ILE A 1040 ? O ILE A 1037 
A 2 3 O VAL A 1043 ? O VAL A 1040 N VAL A 1031 ? N VAL A 1028 
A 3 4 O LEU A 1032 ? O LEU A 1029 N CYS A 1011 ? N CYS A 1008 
B 1 2 N VAL A 22   ? N VAL A 19   O LEU A 35   ? O LEU A 32   
B 2 3 N ILE A 36   ? N ILE A 33   O GLU A 43   ? O GLU A 40   
B 3 4 N VAL A 46   ? N VAL A 43   O ARG A 53   ? O ARG A 50   
C 1 2 N GLU A 68   ? N GLU A 65   O PHE A 81   ? O PHE A 78   
C 2 3 N LEU A 80   ? N LEU A 77   O LEU A 92   ? O LEU A 89   
C 3 4 N ILE A 91   ? N ILE A 88   O ALA A 107  ? O ALA A 104  
D 1 2 N ILE A 126  ? N ILE A 123  O GLY A 135  ? O GLY A 132  
D 2 3 N ILE A 134  ? N ILE A 131  O ILE A 146  ? O ILE A 143  
D 3 4 N VAL A 145  ? N VAL A 142  O PHE A 158  ? O PHE A 155  
E 1 2 N LYS A 171  ? N LYS A 168  O CYS A 182  ? O CYS A 179  
E 2 3 N ILE A 181  ? N ILE A 178  O TYR A 196  ? O TYR A 193  
E 3 4 N GLU A 197  ? N GLU A 194  O ASN A 206  ? O ASN A 203  
F 1 2 N LYS A 171  ? N LYS A 168  O CYS A 182  ? O CYS A 179  
F 2 3 N ILE A 181  ? N ILE A 178  O TYR A 196  ? O TYR A 193  
F 3 4 N VAL A 193  ? N VAL A 190  O GLU A 213  ? O GLU A 210  
G 1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
G 2 3 N ILE A 234  ? N ILE A 231  O THR A 241  ? O THR A 238  
G 3 4 N ILE A 240  ? N ILE A 237  O ILE A 251  ? O ILE A 248  
H 1 2 N CYS A 263  ? N CYS A 260  O GLY A 277  ? O GLY A 274  
H 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
H 3 4 N GLU A 289  ? N GLU A 286  O ASP A 302  ? O ASP A 299  
I 1 2 N THR A 318  ? N THR A 315  O PHE A 326  ? O PHE A 323  
I 2 3 N VAL A 325  ? N VAL A 322  O VAL A 337  ? O VAL A 334  
I 3 4 N SER A 334  ? N SER A 331  O PHE A 356  ? O PHE A 353  
J 1 2 N CYS A 366  ? N CYS A 363  O VAL A 379  ? O VAL A 376  
J 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
J 3 4 N ILE A 392  ? N ILE A 389  O ARG A 716  ? O ARG A 713  
K 1 2 N LEU A 430  ? N LEU A 427  O ARG A 437  ? O ARG A 434  
L 1 2 N MET A 440  ? N MET A 437  O GLU A 447  ? O GLU A 444  
M 1 2 N PHE A 461  ? N PHE A 458  O ILE A 474  ? O ILE A 471  
M 2 3 N LEU A 471  ? N LEU A 468  O VAL A 482  ? O VAL A 479  
N 1 2 N VAL A 511  ? N VAL A 508  O LEU A 522  ? O LEU A 519  
N 2 3 N HIS A 525  ? N HIS A 522  O GLU A 528  ? O GLU A 525  
O 1 2 N ALA A 542  ? N ALA A 539  O GLY A 562  ? O GLY A 559  
O 2 3 N CYS A 559  ? N CYS A 556  O LEU A 572  ? O LEU A 569  
O 3 4 N ILE A 571  ? N ILE A 568  O LEU A 580  ? O LEU A 577  
P 1 2 N THR A 597  ? N THR A 594  O TYR A 604  ? O TYR A 601  
P 2 3 N LEU A 605  ? N LEU A 602  O PHE A 617  ? O PHE A 614  
Q 1 2 N VAL A 640  ? N VAL A 637  O CYS A 655  ? O CYS A 652  
Q 2 3 N ALA A 654  ? N ALA A 651  O THR A 660  ? O THR A 657  
Q 3 4 N VAL A 661  ? N VAL A 658  O SER A 672  ? O SER A 669  
R 1 2 N CYS A 683  ? N CYS A 680  O ALA A 695  ? O ALA A 692  
R 2 3 N LEU A 696  ? N LEU A 693  O THR A 703  ? O THR A 700  
S 1 2 N CYS A 728  ? N CYS A 725  O GLY A 737  ? O GLY A 734  
S 2 3 N ARG A 742  ? N ARG A 739  O VAL A 791  ? O VAL A 788  
S 3 4 N ILE A 796  ? N ILE A 793  O LEU A 805  ? O LEU A 802  
S 4 5 O GLN A 809  ? O GLN A 806  N SER A 767  ? N SER A 764  
T 1 2 N TYR A 815  ? N TYR A 812  O ALA A 837  ? O ALA A 834  
T 2 3 N PHE A 832  ? N PHE A 829  O PHE A 854  ? O PHE A 851  
T 3 4 N GLN A 855  ? N GLN A 852  O GLN A 862  ? O GLN A 859  
U 1 2 N TYR A 815  ? N TYR A 812  O ALA A 837  ? O ALA A 834  
U 2 3 N PHE A 832  ? N PHE A 829  O PHE A 854  ? O PHE A 851  
U 3 4 N GLY A 849  ? N GLY A 846  O VAL A 869  ? O VAL A 866  
V 1 2 N VAL A 877  ? N VAL A 874  O LEU A 884  ? O LEU A 881  
V 2 3 N ILE A 887  ? N ILE A 884  O THR A 890  ? O THR A 887  
V 3 4 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
W 1 2 N LYS A 920  ? N LYS A 917  O ILE A 924  ? O ILE A 921  
W 2 3 N LEU A 925  ? N LEU A 922  O LEU A 936  ? O LEU A 933  
W 3 4 N LEU A 935  ? N LEU A 932  O ALA A 949  ? O ALA A 946  
X 1 2 N GLU A 961  ? N GLU A 958  O LEU A 969  ? O LEU A 966  
X 2 3 N GLY A 970  ? N GLY A 967  O PHE A 978  ? O PHE A 975  
X 3 4 N LEU A 977  ? N LEU A 974  O PHE A 1001 ? O PHE A 998  
# 
_database_PDB_matrix.entry_id          3I7P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I7P 
_atom_sites.fract_transf_matrix[1][1]   0.015724 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007546 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005463 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 4    ? 24.481  26.323 11.219  1.00 78.78  ? 1    MET A N   1 
ATOM 2    C CA  . MET A 1 4    ? 23.475  26.747 10.187  1.00 78.78  ? 1    MET A CA  1 
ATOM 3    C C   . MET A 1 4    ? 22.066  26.964 10.795  1.00 78.78  ? 1    MET A C   1 
ATOM 4    O O   . MET A 1 4    ? 21.096  26.248 10.457  1.00 78.78  ? 1    MET A O   1 
ATOM 5    C CB  . MET A 1 4    ? 23.425  25.761 8.994   1.00 129.12 ? 1    MET A CB  1 
ATOM 6    C CG  . MET A 1 4    ? 23.181  24.286 9.366   1.00 129.12 ? 1    MET A CG  1 
ATOM 7    S SD  . MET A 1 4    ? 22.204  23.321 8.178   1.00 129.12 ? 1    MET A SD  1 
ATOM 8    C CE  . MET A 1 4    ? 22.196  21.700 8.971   1.00 129.12 ? 1    MET A CE  1 
ATOM 9    N N   . SER A 1 5    ? 21.976  27.933 11.713  1.00 158.20 ? 2    SER A N   1 
ATOM 10   C CA  . SER A 1 5    ? 20.702  28.453 12.243  1.00 158.20 ? 2    SER A CA  1 
ATOM 11   C C   . SER A 1 5    ? 20.568  29.902 11.818  1.00 158.20 ? 2    SER A C   1 
ATOM 12   O O   . SER A 1 5    ? 21.514  30.668 11.956  1.00 158.20 ? 2    SER A O   1 
ATOM 13   C CB  . SER A 1 5    ? 20.677  28.376 13.767  1.00 117.07 ? 2    SER A CB  1 
ATOM 14   O OG  . SER A 1 5    ? 19.944  29.454 14.342  1.00 117.07 ? 2    SER A OG  1 
ATOM 15   N N   . TYR A 1 6    ? 19.405  30.294 11.313  1.00 68.25  ? 3    TYR A N   1 
ATOM 16   C CA  . TYR A 1 6    ? 19.290  31.631 10.713  1.00 68.25  ? 3    TYR A CA  1 
ATOM 17   C C   . TYR A 1 6    ? 18.115  32.473 11.200  1.00 68.25  ? 3    TYR A C   1 
ATOM 18   O O   . TYR A 1 6    ? 17.012  32.421 10.655  1.00 68.25  ? 3    TYR A O   1 
ATOM 19   C CB  . TYR A 1 6    ? 19.280  31.576 9.178   1.00 102.90 ? 3    TYR A CB  1 
ATOM 20   C CG  . TYR A 1 6    ? 20.249  30.609 8.530   1.00 102.90 ? 3    TYR A CG  1 
ATOM 21   C CD1 . TYR A 1 6    ? 21.634  30.792 8.612   1.00 102.90 ? 3    TYR A CD1 1 
ATOM 22   C CD2 . TYR A 1 6    ? 19.772  29.518 7.807   1.00 102.90 ? 3    TYR A CD2 1 
ATOM 23   C CE1 . TYR A 1 6    ? 22.516  29.896 7.999   1.00 102.90 ? 3    TYR A CE1 1 
ATOM 24   C CE2 . TYR A 1 6    ? 20.641  28.620 7.198   1.00 102.90 ? 3    TYR A CE2 1 
ATOM 25   C CZ  . TYR A 1 6    ? 22.008  28.811 7.286   1.00 102.90 ? 3    TYR A CZ  1 
ATOM 26   O OH  . TYR A 1 6    ? 22.846  27.906 6.658   1.00 102.90 ? 3    TYR A OH  1 
ATOM 27   N N   . ASN A 1 7    ? 18.383  33.284 12.212  1.00 59.61  ? 4    ASN A N   1 
ATOM 28   C CA  . ASN A 1 7    ? 17.376  34.148 12.794  1.00 59.61  ? 4    ASN A CA  1 
ATOM 29   C C   . ASN A 1 7    ? 17.663  35.596 12.642  1.00 59.61  ? 4    ASN A C   1 
ATOM 30   O O   . ASN A 1 7    ? 18.792  36.005 12.349  1.00 59.61  ? 4    ASN A O   1 
ATOM 31   C CB  . ASN A 1 7    ? 17.248  33.867 14.256  1.00 46.01  ? 4    ASN A CB  1 
ATOM 32   C CG  . ASN A 1 7    ? 16.902  32.462 14.507  1.00 46.01  ? 4    ASN A CG  1 
ATOM 33   O OD1 . ASN A 1 7    ? 15.796  32.006 14.137  1.00 46.01  ? 4    ASN A OD1 1 
ATOM 34   N ND2 . ASN A 1 7    ? 17.853  31.715 15.108  1.00 46.01  ? 4    ASN A ND2 1 
ATOM 35   N N   . TYR A 1 8    ? 16.620  36.367 12.892  1.00 51.32  ? 5    TYR A N   1 
ATOM 36   C CA  . TYR A 1 8    ? 16.617  37.773 12.632  1.00 51.32  ? 5    TYR A CA  1 
ATOM 37   C C   . TYR A 1 8    ? 16.003  38.397 13.897  1.00 51.32  ? 5    TYR A C   1 
ATOM 38   O O   . TYR A 1 8    ? 14.916  38.020 14.272  1.00 51.32  ? 5    TYR A O   1 
ATOM 39   C CB  . TYR A 1 8    ? 15.787  37.982 11.360  1.00 47.79  ? 5    TYR A CB  1 
ATOM 40   C CG  . TYR A 1 8    ? 15.645  39.401 10.922  1.00 47.79  ? 5    TYR A CG  1 
ATOM 41   C CD1 . TYR A 1 8    ? 16.528  39.974 10.035  1.00 47.79  ? 5    TYR A CD1 1 
ATOM 42   C CD2 . TYR A 1 8    ? 14.615  40.190 11.396  1.00 47.79  ? 5    TYR A CD2 1 
ATOM 43   C CE1 . TYR A 1 8    ? 16.390  41.310 9.640   1.00 47.79  ? 5    TYR A CE1 1 
ATOM 44   C CE2 . TYR A 1 8    ? 14.479  41.511 11.011  1.00 47.79  ? 5    TYR A CE2 1 
ATOM 45   C CZ  . TYR A 1 8    ? 15.357  42.061 10.138  1.00 47.79  ? 5    TYR A CZ  1 
ATOM 46   O OH  . TYR A 1 8    ? 15.193  43.382 9.782   1.00 47.79  ? 5    TYR A OH  1 
ATOM 47   N N   . VAL A 1 9    ? 16.695  39.290 14.599  1.00 45.15  ? 6    VAL A N   1 
ATOM 48   C CA  . VAL A 1 9    ? 16.064  39.971 15.750  1.00 45.15  ? 6    VAL A CA  1 
ATOM 49   C C   . VAL A 1 9    ? 15.820  41.433 15.456  1.00 45.15  ? 6    VAL A C   1 
ATOM 50   O O   . VAL A 1 9    ? 16.681  42.107 14.895  1.00 45.15  ? 6    VAL A O   1 
ATOM 51   C CB  . VAL A 1 9    ? 16.862  39.844 17.082  1.00 47.10  ? 6    VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 9    ? 16.822  38.452 17.586  1.00 47.10  ? 6    VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 9    ? 18.308  40.229 16.883  1.00 47.10  ? 6    VAL A CG2 1 
ATOM 54   N N   . VAL A 1 10   ? 14.635  41.922 15.804  1.00 34.50  ? 7    VAL A N   1 
ATOM 55   C CA  . VAL A 1 10   ? 14.341  43.362 15.636  1.00 34.50  ? 7    VAL A CA  1 
ATOM 56   C C   . VAL A 1 10   ? 13.616  43.942 16.807  1.00 34.50  ? 7    VAL A C   1 
ATOM 57   O O   . VAL A 1 10   ? 12.758  43.298 17.391  1.00 34.50  ? 7    VAL A O   1 
ATOM 58   C CB  . VAL A 1 10   ? 13.452  43.739 14.387  1.00 38.60  ? 7    VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 10   ? 13.920  45.089 13.811  1.00 38.60  ? 7    VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 10   ? 13.460  42.679 13.341  1.00 38.60  ? 7    VAL A CG2 1 
ATOM 61   N N   . THR A 1 11   ? 13.954  45.181 17.111  1.00 35.34  ? 8    THR A N   1 
ATOM 62   C CA  . THR A 1 11   ? 13.227  45.947 18.110  1.00 35.34  ? 8    THR A CA  1 
ATOM 63   C C   . THR A 1 11   ? 11.856  46.340 17.572  1.00 35.34  ? 8    THR A C   1 
ATOM 64   O O   . THR A 1 11   ? 11.741  46.897 16.467  1.00 35.34  ? 8    THR A O   1 
ATOM 65   C CB  . THR A 1 11   ? 14.000  47.196 18.500  1.00 51.83  ? 8    THR A CB  1 
ATOM 66   O OG1 . THR A 1 11   ? 15.256  46.799 19.051  1.00 51.83  ? 8    THR A OG1 1 
ATOM 67   C CG2 . THR A 1 11   ? 13.248  47.940 19.502  1.00 51.83  ? 8    THR A CG2 1 
ATOM 68   N N   . ALA A 1 12   ? 10.812  46.048 18.333  1.00 52.87  ? 9    ALA A N   1 
ATOM 69   C CA  . ALA A 1 12   ? 9.488   46.444 17.904  1.00 52.87  ? 9    ALA A CA  1 
ATOM 70   C C   . ALA A 1 12   ? 9.136   47.649 18.691  1.00 52.87  ? 9    ALA A C   1 
ATOM 71   O O   . ALA A 1 12   ? 8.290   48.430 18.292  1.00 52.87  ? 9    ALA A O   1 
ATOM 72   C CB  . ALA A 1 12   ? 8.506   45.361 18.177  1.00 18.69  ? 9    ALA A CB  1 
ATOM 73   N N   . GLN A 1 13   ? 9.799   47.792 19.828  1.00 39.84  ? 10   GLN A N   1 
ATOM 74   C CA  . GLN A 1 13   ? 9.503   48.853 20.759  1.00 39.84  ? 10   GLN A CA  1 
ATOM 75   C C   . GLN A 1 13   ? 10.771  49.107 21.558  1.00 39.84  ? 10   GLN A C   1 
ATOM 76   O O   . GLN A 1 13   ? 11.244  48.210 22.289  1.00 39.84  ? 10   GLN A O   1 
ATOM 77   C CB  . GLN A 1 13   ? 8.365   48.381 21.645  1.00 43.18  ? 10   GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13   ? 8.161   49.178 22.858  1.00 43.18  ? 10   GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13   ? 7.926   50.614 22.530  1.00 43.18  ? 10   GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13   ? 7.009   50.951 21.753  1.00 43.18  ? 10   GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13   ? 8.755   51.490 23.108  1.00 43.18  ? 10   GLN A NE2 1 
ATOM 82   N N   . LYS A 1 14   ? 11.370  50.281 21.393  1.00 40.79  ? 11   LYS A N   1 
ATOM 83   C CA  . LYS A 1 14   ? 12.598  50.534 22.125  1.00 40.79  ? 11   LYS A CA  1 
ATOM 84   C C   . LYS A 1 14   ? 12.335  50.452 23.652  1.00 40.79  ? 11   LYS A C   1 
ATOM 85   O O   . LYS A 1 14   ? 11.206  50.696 24.107  1.00 40.79  ? 11   LYS A O   1 
ATOM 86   C CB  . LYS A 1 14   ? 13.164  51.888 21.766  1.00 53.58  ? 11   LYS A CB  1 
ATOM 87   C CG  . LYS A 1 14   ? 13.554  52.042 20.336  1.00 53.58  ? 11   LYS A CG  1 
ATOM 88   C CD  . LYS A 1 14   ? 13.458  53.520 19.944  1.00 53.58  ? 11   LYS A CD  1 
ATOM 89   C CE  . LYS A 1 14   ? 14.637  54.023 19.086  1.00 53.58  ? 11   LYS A CE  1 
ATOM 90   N NZ  . LYS A 1 14   ? 14.673  55.560 18.927  1.00 53.58  ? 11   LYS A NZ  1 
ATOM 91   N N   . PRO A 1 15   ? 13.372  50.157 24.428  1.00 42.68  ? 12   PRO A N   1 
ATOM 92   C CA  . PRO A 1 15   ? 13.248  50.177 25.887  1.00 42.68  ? 12   PRO A CA  1 
ATOM 93   C C   . PRO A 1 15   ? 12.587  51.475 26.347  1.00 42.68  ? 12   PRO A C   1 
ATOM 94   O O   . PRO A 1 15   ? 12.835  52.526 25.756  1.00 42.68  ? 12   PRO A O   1 
ATOM 95   C CB  . PRO A 1 15   ? 14.710  50.142 26.330  1.00 42.44  ? 12   PRO A CB  1 
ATOM 96   C CG  . PRO A 1 15   ? 15.313  49.235 25.313  1.00 42.44  ? 12   PRO A CG  1 
ATOM 97   C CD  . PRO A 1 15   ? 14.757  49.840 24.039  1.00 42.44  ? 12   PRO A CD  1 
ATOM 98   N N   . THR A 1 16   ? 11.727  51.374 27.353  1.00 41.44  ? 13   THR A N   1 
ATOM 99   C CA  . THR A 1 16   ? 10.993  52.525 27.853  1.00 41.44  ? 13   THR A CA  1 
ATOM 100  C C   . THR A 1 16   ? 11.451  52.861 29.261  1.00 41.44  ? 13   THR A C   1 
ATOM 101  O O   . THR A 1 16   ? 11.235  53.974 29.742  1.00 41.44  ? 13   THR A O   1 
ATOM 102  C CB  . THR A 1 16   ? 9.476   52.267 27.862  1.00 36.25  ? 13   THR A CB  1 
ATOM 103  O OG1 . THR A 1 16   ? 9.182   51.155 28.717  1.00 36.25  ? 13   THR A OG1 1 
ATOM 104  C CG2 . THR A 1 16   ? 8.978   51.966 26.457  1.00 36.25  ? 13   THR A CG2 1 
ATOM 105  N N   . ALA A 1 17   ? 12.087  51.900 29.923  1.00 46.36  ? 14   ALA A N   1 
ATOM 106  C CA  . ALA A 1 17   ? 12.583  52.149 31.280  1.00 46.36  ? 14   ALA A CA  1 
ATOM 107  C C   . ALA A 1 17   ? 13.800  53.062 31.335  1.00 46.36  ? 14   ALA A C   1 
ATOM 108  O O   . ALA A 1 17   ? 14.558  53.203 30.379  1.00 46.36  ? 14   ALA A O   1 
ATOM 109  C CB  . ALA A 1 17   ? 12.891  50.862 31.966  1.00 26.73  ? 14   ALA A CB  1 
ATOM 110  N N   . VAL A 1 18   ? 14.003  53.670 32.482  1.00 31.26  ? 15   VAL A N   1 
ATOM 111  C CA  . VAL A 1 18   ? 14.985  54.739 32.575  1.00 31.26  ? 15   VAL A CA  1 
ATOM 112  C C   . VAL A 1 18   ? 16.001  54.369 33.613  1.00 31.26  ? 15   VAL A C   1 
ATOM 113  O O   . VAL A 1 18   ? 15.687  54.196 34.785  1.00 31.26  ? 15   VAL A O   1 
ATOM 114  C CB  . VAL A 1 18   ? 14.349  56.119 32.904  1.00 18.10  ? 15   VAL A CB  1 
ATOM 115  C CG1 . VAL A 1 18   ? 15.302  56.983 33.529  1.00 18.10  ? 15   VAL A CG1 1 
ATOM 116  C CG2 . VAL A 1 18   ? 13.897  56.816 31.643  1.00 18.10  ? 15   VAL A CG2 1 
ATOM 117  N N   . ASN A 1 19   ? 17.232  54.245 33.164  1.00 45.85  ? 16   ASN A N   1 
ATOM 118  C CA  . ASN A 1 19   ? 18.248  53.641 33.968  1.00 45.85  ? 16   ASN A CA  1 
ATOM 119  C C   . ASN A 1 19   ? 19.102  54.756 34.507  1.00 45.85  ? 16   ASN A C   1 
ATOM 120  O O   . ASN A 1 19   ? 19.769  54.634 35.547  1.00 45.85  ? 16   ASN A O   1 
ATOM 121  C CB  . ASN A 1 19   ? 18.994  52.639 33.097  1.00 43.09  ? 16   ASN A CB  1 
ATOM 122  C CG  . ASN A 1 19   ? 18.044  51.523 32.575  1.00 43.09  ? 16   ASN A CG  1 
ATOM 123  O OD1 . ASN A 1 19   ? 17.286  50.932 33.383  1.00 43.09  ? 16   ASN A OD1 1 
ATOM 124  N ND2 . ASN A 1 19   ? 18.046  51.248 31.239  1.00 43.09  ? 16   ASN A ND2 1 
ATOM 125  N N   . GLY A 1 20   ? 19.008  55.887 33.830  1.00 34.47  ? 17   GLY A N   1 
ATOM 126  C CA  . GLY A 1 20   ? 19.942  56.950 34.083  1.00 34.47  ? 17   GLY A CA  1 
ATOM 127  C C   . GLY A 1 20   ? 19.462  58.263 33.560  1.00 34.47  ? 17   GLY A C   1 
ATOM 128  O O   . GLY A 1 20   ? 18.849  58.328 32.526  1.00 34.47  ? 17   GLY A O   1 
ATOM 129  N N   . CYS A 1 21   ? 19.737  59.320 34.297  1.00 42.44  ? 18   CYS A N   1 
ATOM 130  C CA  . CYS A 1 21   ? 19.426  60.644 33.822  1.00 42.44  ? 18   CYS A CA  1 
ATOM 131  C C   . CYS A 1 21   ? 20.341  61.606 34.530  1.00 42.44  ? 18   CYS A C   1 
ATOM 132  O O   . CYS A 1 21   ? 20.626  61.440 35.700  1.00 42.44  ? 18   CYS A O   1 
ATOM 133  C CB  . CYS A 1 21   ? 17.953  60.986 34.024  1.00 54.44  ? 18   CYS A CB  1 
ATOM 134  S SG  . CYS A 1 21   ? 17.362  60.867 35.719  1.00 54.44  ? 18   CYS A SG  1 
ATOM 135  N N   . VAL A 1 22   ? 20.830  62.590 33.796  1.00 37.51  ? 19   VAL A N   1 
ATOM 136  C CA  . VAL A 1 22   ? 21.808  63.521 34.311  1.00 37.51  ? 19   VAL A CA  1 
ATOM 137  C C   . VAL A 1 22   ? 21.415  64.841 33.651  1.00 37.51  ? 19   VAL A C   1 
ATOM 138  O O   . VAL A 1 22   ? 20.732  64.826 32.585  1.00 37.51  ? 19   VAL A O   1 
ATOM 139  C CB  . VAL A 1 22   ? 23.235  63.061 33.897  1.00 38.70  ? 19   VAL A CB  1 
ATOM 140  C CG1 . VAL A 1 22   ? 23.649  63.601 32.500  1.00 38.70  ? 19   VAL A CG1 1 
ATOM 141  C CG2 . VAL A 1 22   ? 24.224  63.477 34.894  1.00 38.70  ? 19   VAL A CG2 1 
ATOM 142  N N   . THR A 1 23   ? 21.821  65.953 34.288  1.00 46.84  ? 20   THR A N   1 
ATOM 143  C CA  . THR A 1 23   ? 21.533  67.320 33.791  1.00 46.84  ? 20   THR A CA  1 
ATOM 144  C C   . THR A 1 23   ? 22.769  68.226 33.668  1.00 46.84  ? 20   THR A C   1 
ATOM 145  O O   . THR A 1 23   ? 23.793  68.011 34.319  1.00 46.84  ? 20   THR A O   1 
ATOM 146  C CB  . THR A 1 23   ? 20.442  68.041 34.626  1.00 61.19  ? 20   THR A CB  1 
ATOM 147  O OG1 . THR A 1 23   ? 19.950  69.136 33.865  1.00 61.19  ? 20   THR A OG1 1 
ATOM 148  C CG2 . THR A 1 23   ? 20.977  68.584 35.966  1.00 61.19  ? 20   THR A CG2 1 
ATOM 149  N N   . GLY A 1 24   ? 22.661  69.260 32.844  1.00 70.34  ? 21   GLY A N   1 
ATOM 150  C CA  . GLY A 1 24   ? 23.803  70.130 32.562  1.00 70.34  ? 21   GLY A CA  1 
ATOM 151  C C   . GLY A 1 24   ? 23.777  70.661 31.144  1.00 70.34  ? 21   GLY A C   1 
ATOM 152  O O   . GLY A 1 24   ? 22.874  70.347 30.356  1.00 70.34  ? 21   GLY A O   1 
ATOM 153  N N   . HIS A 1 25   ? 24.793  71.448 30.812  1.00 55.96  ? 22   HIS A N   1 
ATOM 154  C CA  . HIS A 1 25   ? 24.826  72.240 29.569  1.00 55.96  ? 22   HIS A CA  1 
ATOM 155  C C   . HIS A 1 25   ? 25.640  71.543 28.470  1.00 55.96  ? 22   HIS A C   1 
ATOM 156  O O   . HIS A 1 25   ? 26.741  71.972 28.142  1.00 55.96  ? 22   HIS A O   1 
ATOM 157  C CB  . HIS A 1 25   ? 25.333  73.648 29.890  1.00 61.48  ? 22   HIS A CB  1 
ATOM 158  C CG  . HIS A 1 25   ? 24.657  74.266 31.087  1.00 61.48  ? 22   HIS A CG  1 
ATOM 159  N ND1 . HIS A 1 25   ? 25.007  73.956 32.388  1.00 61.48  ? 22   HIS A ND1 1 
ATOM 160  C CD2 . HIS A 1 25   ? 23.638  75.158 31.179  1.00 61.48  ? 22   HIS A CD2 1 
ATOM 161  C CE1 . HIS A 1 25   ? 24.236  74.633 33.226  1.00 61.48  ? 22   HIS A CE1 1 
ATOM 162  N NE2 . HIS A 1 25   ? 23.403  75.374 32.518  1.00 61.48  ? 22   HIS A NE2 1 
ATOM 163  N N   . PHE A 1 26   ? 25.082  70.448 27.933  1.00 64.07  ? 23   PHE A N   1 
ATOM 164  C CA  . PHE A 1 26   ? 25.745  69.572 26.956  1.00 64.07  ? 23   PHE A CA  1 
ATOM 165  C C   . PHE A 1 26   ? 25.626  70.171 25.579  1.00 64.07  ? 23   PHE A C   1 
ATOM 166  O O   . PHE A 1 26   ? 26.506  70.035 24.739  1.00 64.07  ? 23   PHE A O   1 
ATOM 167  C CB  . PHE A 1 26   ? 25.117  68.140 26.974  1.00 32.92  ? 23   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 26   ? 25.795  67.125 26.006  1.00 32.92  ? 23   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 26   ? 27.151  66.759 26.153  1.00 32.92  ? 23   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 26   ? 25.099  66.574 24.961  1.00 32.92  ? 23   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 26   ? 27.787  65.896 25.264  1.00 32.92  ? 23   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 26   ? 25.740  65.693 24.073  1.00 32.92  ? 23   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 26   ? 27.084  65.356 24.231  1.00 32.92  ? 23   PHE A CZ  1 
ATOM 174  N N   . THR A 1 27   ? 24.515  70.853 25.379  1.00 66.06  ? 24   THR A N   1 
ATOM 175  C CA  . THR A 1 27   ? 24.120  71.369 24.092  1.00 66.06  ? 24   THR A CA  1 
ATOM 176  C C   . THR A 1 27   ? 24.739  72.740 23.752  1.00 66.06  ? 24   THR A C   1 
ATOM 177  O O   . THR A 1 27   ? 25.325  72.894 22.675  1.00 66.06  ? 24   THR A O   1 
ATOM 178  C CB  . THR A 1 27   ? 22.594  71.340 24.037  1.00 58.87  ? 24   THR A CB  1 
ATOM 179  O OG1 . THR A 1 27   ? 22.224  70.054 23.576  1.00 58.87  ? 24   THR A OG1 1 
ATOM 180  C CG2 . THR A 1 27   ? 22.012  72.361 23.101  1.00 58.87  ? 24   THR A CG2 1 
ATOM 181  N N   . SER A 1 28   ? 24.576  73.704 24.672  1.00 88.91  ? 25   SER A N   1 
ATOM 182  C CA  . SER A 1 28   ? 25.175  75.047 24.637  1.00 88.91  ? 25   SER A CA  1 
ATOM 183  C C   . SER A 1 28   ? 25.548  75.395 26.064  1.00 88.91  ? 25   SER A C   1 
ATOM 184  O O   . SER A 1 28   ? 24.945  74.886 26.996  1.00 88.91  ? 25   SER A O   1 
ATOM 185  C CB  . SER A 1 28   ? 24.180  76.104 24.162  1.00 92.53  ? 25   SER A CB  1 
ATOM 186  O OG  . SER A 1 28   ? 23.073  75.536 23.491  1.00 92.53  ? 25   SER A OG  1 
ATOM 187  N N   . ALA A 1 29   ? 26.524  76.280 26.240  1.00 69.74  ? 26   ALA A N   1 
ATOM 188  C CA  . ALA A 1 29   ? 26.996  76.673 27.577  1.00 69.74  ? 26   ALA A CA  1 
ATOM 189  C C   . ALA A 1 29   ? 25.867  77.400 28.273  1.00 69.74  ? 26   ALA A C   1 
ATOM 190  O O   . ALA A 1 29   ? 25.845  77.551 29.499  1.00 69.74  ? 26   ALA A O   1 
ATOM 191  C CB  . ALA A 1 29   ? 28.229  77.561 27.478  1.00 90.51  ? 26   ALA A CB  1 
ATOM 192  N N   . GLU A 1 30   ? 24.931  77.849 27.457  1.00 73.77  ? 27   GLU A N   1 
ATOM 193  C CA  . GLU A 1 30   ? 23.691  78.369 27.949  1.00 73.77  ? 27   GLU A CA  1 
ATOM 194  C C   . GLU A 1 30   ? 22.618  77.505 27.302  1.00 73.77  ? 27   GLU A C   1 
ATOM 195  O O   . GLU A 1 30   ? 22.207  77.709 26.139  1.00 73.77  ? 27   GLU A O   1 
ATOM 196  C CB  . GLU A 1 30   ? 23.508  79.864 27.608  1.00 104.87 ? 27   GLU A CB  1 
ATOM 197  C CG  . GLU A 1 30   ? 24.648  80.502 26.834  1.00 104.87 ? 27   GLU A CG  1 
ATOM 198  C CD  . GLU A 1 30   ? 24.671  80.003 25.409  1.00 104.87 ? 27   GLU A CD  1 
ATOM 199  O OE1 . GLU A 1 30   ? 25.510  79.127 25.116  1.00 104.87 ? 27   GLU A OE1 1 
ATOM 200  O OE2 . GLU A 1 30   ? 23.819  80.444 24.601  1.00 104.87 ? 27   GLU A OE2 1 
ATOM 201  N N   . ASP A 1 31   ? 22.212  76.503 28.067  1.00 67.55  ? 28   ASP A N   1 
ATOM 202  C CA  . ASP A 1 31   ? 21.139  75.605 27.716  1.00 67.55  ? 28   ASP A CA  1 
ATOM 203  C C   . ASP A 1 31   ? 21.088  74.678 28.887  1.00 67.55  ? 28   ASP A C   1 
ATOM 204  O O   . ASP A 1 31   ? 22.126  74.366 29.453  1.00 67.55  ? 28   ASP A O   1 
ATOM 205  C CB  . ASP A 1 31   ? 21.453  74.823 26.447  1.00 60.39  ? 28   ASP A CB  1 
ATOM 206  C CG  . ASP A 1 31   ? 20.584  75.246 25.262  1.00 60.39  ? 28   ASP A CG  1 
ATOM 207  O OD1 . ASP A 1 31   ? 19.678  76.103 25.449  1.00 60.39  ? 28   ASP A OD1 1 
ATOM 208  O OD2 . ASP A 1 31   ? 20.793  74.708 24.138  1.00 60.39  ? 28   ASP A OD2 1 
ATOM 209  N N   . LEU A 1 32   ? 19.885  74.289 29.296  1.00 62.17  ? 29   LEU A N   1 
ATOM 210  C CA  . LEU A 1 32   ? 19.746  73.249 30.300  1.00 62.17  ? 29   LEU A CA  1 
ATOM 211  C C   . LEU A 1 32   ? 19.295  72.012 29.562  1.00 62.17  ? 29   LEU A C   1 
ATOM 212  O O   . LEU A 1 32   ? 18.297  72.044 28.825  1.00 62.17  ? 29   LEU A O   1 
ATOM 213  C CB  . LEU A 1 32   ? 18.744  73.640 31.390  1.00 45.43  ? 29   LEU A CB  1 
ATOM 214  C CG  . LEU A 1 32   ? 18.766  72.897 32.727  1.00 45.43  ? 29   LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 32   ? 20.104  73.138 33.439  1.00 45.43  ? 29   LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 32   ? 17.589  73.293 33.610  1.00 45.43  ? 29   LEU A CD2 1 
ATOM 217  N N   . ASN A 1 33   ? 20.069  70.942 29.723  1.00 52.99  ? 30   ASN A N   1 
ATOM 218  C CA  . ASN A 1 33   ? 19.758  69.662 29.097  1.00 52.99  ? 30   ASN A CA  1 
ATOM 219  C C   . ASN A 1 33   ? 19.361  68.608 30.090  1.00 52.99  ? 30   ASN A C   1 
ATOM 220  O O   . ASN A 1 33   ? 19.943  68.477 31.172  1.00 52.99  ? 30   ASN A O   1 
ATOM 221  C CB  . ASN A 1 33   ? 20.961  69.112 28.313  1.00 54.41  ? 30   ASN A CB  1 
ATOM 222  C CG  . ASN A 1 33   ? 21.350  69.983 27.146  1.00 54.41  ? 30   ASN A CG  1 
ATOM 223  O OD1 . ASN A 1 33   ? 20.496  70.357 26.324  1.00 54.41  ? 30   ASN A OD1 1 
ATOM 224  N ND2 . ASN A 1 33   ? 22.641  70.317 27.058  1.00 54.41  ? 30   ASN A ND2 1 
ATOM 225  N N   . LEU A 1 34   ? 18.386  67.826 29.699  1.00 51.13  ? 31   LEU A N   1 
ATOM 226  C CA  . LEU A 1 34   ? 18.170  66.617 30.393  1.00 51.13  ? 31   LEU A CA  1 
ATOM 227  C C   . LEU A 1 34   ? 18.742  65.556 29.484  1.00 51.13  ? 31   LEU A C   1 
ATOM 228  O O   . LEU A 1 34   ? 18.296  65.388 28.339  1.00 51.13  ? 31   LEU A O   1 
ATOM 229  C CB  . LEU A 1 34   ? 16.687  66.395 30.630  1.00 54.16  ? 31   LEU A CB  1 
ATOM 230  C CG  . LEU A 1 34   ? 16.275  65.106 31.324  1.00 54.16  ? 31   LEU A CG  1 
ATOM 231  C CD1 . LEU A 1 34   ? 16.803  65.037 32.746  1.00 54.16  ? 31   LEU A CD1 1 
ATOM 232  C CD2 . LEU A 1 34   ? 14.801  65.063 31.339  1.00 54.16  ? 31   LEU A CD2 1 
ATOM 233  N N   . LEU A 1 35   ? 19.760  64.862 29.984  1.00 41.61  ? 32   LEU A N   1 
ATOM 234  C CA  . LEU A 1 35   ? 20.203  63.639 29.356  1.00 41.61  ? 32   LEU A CA  1 
ATOM 235  C C   . LEU A 1 35   ? 19.456  62.471 29.984  1.00 41.61  ? 32   LEU A C   1 
ATOM 236  O O   . LEU A 1 35   ? 19.459  62.313 31.211  1.00 41.61  ? 32   LEU A O   1 
ATOM 237  C CB  . LEU A 1 35   ? 21.709  63.498 29.503  1.00 63.09  ? 32   LEU A CB  1 
ATOM 238  C CG  . LEU A 1 35   ? 22.572  63.897 28.292  1.00 63.09  ? 32   LEU A CG  1 
ATOM 239  C CD1 . LEU A 1 35   ? 22.088  65.104 27.522  1.00 63.09  ? 32   LEU A CD1 1 
ATOM 240  C CD2 . LEU A 1 35   ? 23.986  64.134 28.750  1.00 63.09  ? 32   LEU A CD2 1 
ATOM 241  N N   . ILE A 1 36   ? 18.771  61.681 29.163  1.00 42.62  ? 33   ILE A N   1 
ATOM 242  C CA  . ILE A 1 36   ? 18.157  60.477 29.687  1.00 42.62  ? 33   ILE A CA  1 
ATOM 243  C C   . ILE A 1 36   ? 18.744  59.254 29.031  1.00 42.62  ? 33   ILE A C   1 
ATOM 244  O O   . ILE A 1 36   ? 18.751  59.145 27.811  1.00 42.62  ? 33   ILE A O   1 
ATOM 245  C CB  . ILE A 1 36   ? 16.640  60.464 29.502  1.00 32.47  ? 33   ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 36   ? 16.001  61.580 30.343  1.00 32.47  ? 33   ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 36   ? 16.068  59.104 29.911  1.00 32.47  ? 33   ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 36   ? 14.624  61.905 29.929  1.00 32.47  ? 33   ILE A CD1 1 
ATOM 249  N N   . ALA A 1 37   ? 19.232  58.344 29.878  1.00 55.48  ? 34   ALA A N   1 
ATOM 250  C CA  . ALA A 1 37   ? 19.715  57.009 29.512  1.00 55.48  ? 34   ALA A CA  1 
ATOM 251  C C   . ALA A 1 37   ? 18.596  55.967 29.559  1.00 55.48  ? 34   ALA A C   1 
ATOM 252  O O   . ALA A 1 37   ? 18.007  55.720 30.596  1.00 55.48  ? 34   ALA A O   1 
ATOM 253  C CB  . ALA A 1 37   ? 20.831  56.603 30.447  1.00 35.81  ? 34   ALA A CB  1 
ATOM 254  N N   . LYS A 1 38   ? 18.290  55.372 28.424  1.00 57.49  ? 35   LYS A N   1 
ATOM 255  C CA  . LYS A 1 38   ? 17.416  54.233 28.411  1.00 57.49  ? 35   LYS A CA  1 
ATOM 256  C C   . LYS A 1 38   ? 18.265  52.974 28.616  1.00 57.49  ? 35   LYS A C   1 
ATOM 257  O O   . LYS A 1 38   ? 18.745  52.714 29.711  1.00 57.49  ? 35   LYS A O   1 
ATOM 258  C CB  . LYS A 1 38   ? 16.628  54.194 27.118  1.00 39.28  ? 35   LYS A CB  1 
ATOM 259  C CG  . LYS A 1 38   ? 15.156  54.758 27.200  1.00 39.28  ? 35   LYS A CG  1 
ATOM 260  C CD  . LYS A 1 38   ? 15.024  56.096 27.958  1.00 39.28  ? 35   LYS A CD  1 
ATOM 261  C CE  . LYS A 1 38   ? 13.591  56.639 27.925  1.00 39.28  ? 35   LYS A CE  1 
ATOM 262  N NZ  . LYS A 1 38   ? 13.084  57.004 26.556  1.00 39.28  ? 35   LYS A NZ  1 
ATOM 263  N N   . ASN A 1 39   ? 18.503  52.158 27.621  1.00 44.14  ? 36   ASN A N   1 
ATOM 264  C CA  . ASN A 1 39   ? 19.446  51.114 27.953  1.00 44.14  ? 36   ASN A CA  1 
ATOM 265  C C   . ASN A 1 39   ? 20.627  51.355 27.063  1.00 44.14  ? 36   ASN A C   1 
ATOM 266  O O   . ASN A 1 39   ? 21.728  51.496 27.539  1.00 44.14  ? 36   ASN A O   1 
ATOM 267  C CB  . ASN A 1 39   ? 18.776  49.759 27.755  1.00 31.58  ? 36   ASN A CB  1 
ATOM 268  C CG  . ASN A 1 39   ? 19.672  48.571 28.045  1.00 31.58  ? 36   ASN A CG  1 
ATOM 269  O OD1 . ASN A 1 39   ? 20.623  48.618 28.821  1.00 31.58  ? 36   ASN A OD1 1 
ATOM 270  N ND2 . ASN A 1 39   ? 19.328  47.473 27.434  1.00 31.58  ? 36   ASN A ND2 1 
ATOM 271  N N   . THR A 1 40   ? 20.332  51.499 25.776  1.00 38.25  ? 37   THR A N   1 
ATOM 272  C CA  . THR A 1 40   ? 21.249  51.651 24.686  1.00 38.25  ? 37   THR A CA  1 
ATOM 273  C C   . THR A 1 40   ? 20.630  52.740 23.834  1.00 38.25  ? 37   THR A C   1 
ATOM 274  O O   . THR A 1 40   ? 20.663  52.721 22.584  1.00 38.25  ? 37   THR A O   1 
ATOM 275  C CB  . THR A 1 40   ? 21.198  50.422 23.829  1.00 44.08  ? 37   THR A CB  1 
ATOM 276  O OG1 . THR A 1 40   ? 19.817  50.125 23.525  1.00 44.08  ? 37   THR A OG1 1 
ATOM 277  C CG2 . THR A 1 40   ? 21.854  49.236 24.526  1.00 44.08  ? 37   THR A CG2 1 
ATOM 278  N N   . ARG A 1 41   ? 19.993  53.680 24.523  1.00 45.63  ? 38   ARG A N   1 
ATOM 279  C CA  . ARG A 1 41   ? 19.421  54.851 23.900  1.00 45.63  ? 38   ARG A CA  1 
ATOM 280  C C   . ARG A 1 41   ? 19.785  56.020 24.777  1.00 45.63  ? 38   ARG A C   1 
ATOM 281  O O   . ARG A 1 41   ? 19.737  55.958 26.011  1.00 45.63  ? 38   ARG A O   1 
ATOM 282  C CB  . ARG A 1 41   ? 17.927  54.687 23.777  1.00 70.13  ? 38   ARG A CB  1 
ATOM 283  C CG  . ARG A 1 41   ? 17.542  53.911 22.567  1.00 70.13  ? 38   ARG A CG  1 
ATOM 284  C CD  . ARG A 1 41   ? 17.439  54.843 21.394  1.00 70.13  ? 38   ARG A CD  1 
ATOM 285  N NE  . ARG A 1 41   ? 17.352  54.134 20.130  1.00 70.13  ? 38   ARG A NE  1 
ATOM 286  C CZ  . ARG A 1 41   ? 18.167  54.348 19.105  1.00 70.13  ? 38   ARG A CZ  1 
ATOM 287  N NH1 . ARG A 1 41   ? 19.109  55.271 19.185  1.00 70.13  ? 38   ARG A NH1 1 
ATOM 288  N NH2 . ARG A 1 41   ? 18.036  53.655 17.986  1.00 70.13  ? 38   ARG A NH2 1 
ATOM 289  N N   . LEU A 1 42   ? 20.222  57.081 24.140  1.00 42.65  ? 39   LEU A N   1 
ATOM 290  C CA  . LEU A 1 42   ? 20.518  58.256 24.878  1.00 42.65  ? 39   LEU A CA  1 
ATOM 291  C C   . LEU A 1 42   ? 19.609  59.305 24.287  1.00 42.65  ? 39   LEU A C   1 
ATOM 292  O O   . LEU A 1 42   ? 19.645  59.534 23.086  1.00 42.65  ? 39   LEU A O   1 
ATOM 293  C CB  . LEU A 1 42   ? 21.963  58.621 24.674  1.00 49.91  ? 39   LEU A CB  1 
ATOM 294  C CG  . LEU A 1 42   ? 22.460  59.762 25.534  1.00 49.91  ? 39   LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 42   ? 22.289  59.405 27.013  1.00 49.91  ? 39   LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 42   ? 23.887  60.041 25.208  1.00 49.91  ? 39   LEU A CD2 1 
ATOM 297  N N   . GLU A 1 43   ? 18.742  59.873 25.124  1.00 43.87  ? 40   GLU A N   1 
ATOM 298  C CA  . GLU A 1 43   ? 17.851  60.963 24.746  1.00 43.87  ? 40   GLU A CA  1 
ATOM 299  C C   . GLU A 1 43   ? 18.438  62.252 25.267  1.00 43.87  ? 40   GLU A C   1 
ATOM 300  O O   . GLU A 1 43   ? 18.870  62.330 26.434  1.00 43.87  ? 40   GLU A O   1 
ATOM 301  C CB  . GLU A 1 43   ? 16.455  60.765 25.334  1.00 40.25  ? 40   GLU A CB  1 
ATOM 302  C CG  . GLU A 1 43   ? 15.446  60.264 24.327  1.00 40.25  ? 40   GLU A CG  1 
ATOM 303  C CD  . GLU A 1 43   ? 14.468  59.210 24.908  1.00 40.25  ? 40   GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 43   ? 14.044  59.408 26.085  1.00 40.25  ? 40   GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 43   ? 14.125  58.193 24.196  1.00 40.25  ? 40   GLU A OE2 1 
ATOM 306  N N   . ILE A 1 44   ? 18.452  63.255 24.399  1.00 47.72  ? 41   ILE A N   1 
ATOM 307  C CA  . ILE A 1 44   ? 18.861  64.600 24.775  1.00 47.72  ? 41   ILE A CA  1 
ATOM 308  C C   . ILE A 1 44   ? 17.664  65.544 24.637  1.00 47.72  ? 41   ILE A C   1 
ATOM 309  O O   . ILE A 1 44   ? 16.923  65.522 23.633  1.00 47.72  ? 41   ILE A O   1 
ATOM 310  C CB  . ILE A 1 44   ? 20.005  65.092 23.883  1.00 42.66  ? 41   ILE A CB  1 
ATOM 311  C CG1 . ILE A 1 44   ? 21.224  64.211 24.053  1.00 42.66  ? 41   ILE A CG1 1 
ATOM 312  C CG2 . ILE A 1 44   ? 20.409  66.495 24.255  1.00 42.66  ? 41   ILE A CG2 1 
ATOM 313  C CD1 . ILE A 1 44   ? 22.213  64.348 22.943  1.00 42.66  ? 41   ILE A CD1 1 
ATOM 314  N N   . TYR A 1 45   ? 17.476  66.375 25.644  1.00 36.87  ? 42   TYR A N   1 
ATOM 315  C CA  . TYR A 1 45   ? 16.390  67.296 25.609  1.00 36.87  ? 42   TYR A CA  1 
ATOM 316  C C   . TYR A 1 45   ? 16.911  68.666 25.963  1.00 36.87  ? 42   TYR A C   1 
ATOM 317  O O   . TYR A 1 45   ? 17.958  68.793 26.609  1.00 36.87  ? 42   TYR A O   1 
ATOM 318  C CB  . TYR A 1 45   ? 15.349  66.893 26.648  1.00 44.43  ? 42   TYR A CB  1 
ATOM 319  C CG  . TYR A 1 45   ? 14.642  65.623 26.338  1.00 44.43  ? 42   TYR A CG  1 
ATOM 320  C CD1 . TYR A 1 45   ? 15.035  64.428 26.917  1.00 44.43  ? 42   TYR A CD1 1 
ATOM 321  C CD2 . TYR A 1 45   ? 13.574  65.610 25.469  1.00 44.43  ? 42   TYR A CD2 1 
ATOM 322  C CE1 . TYR A 1 45   ? 14.386  63.226 26.609  1.00 44.43  ? 42   TYR A CE1 1 
ATOM 323  C CE2 . TYR A 1 45   ? 12.902  64.410 25.159  1.00 44.43  ? 42   TYR A CE2 1 
ATOM 324  C CZ  . TYR A 1 45   ? 13.321  63.224 25.725  1.00 44.43  ? 42   TYR A CZ  1 
ATOM 325  O OH  . TYR A 1 45   ? 12.672  62.060 25.400  1.00 44.43  ? 42   TYR A OH  1 
ATOM 326  N N   . VAL A 1 46   ? 16.170  69.706 25.569  1.00 53.82  ? 43   VAL A N   1 
ATOM 327  C CA  . VAL A 1 46   ? 16.357  71.002 26.201  1.00 53.82  ? 43   VAL A CA  1 
ATOM 328  C C   . VAL A 1 46   ? 15.165  71.245 27.085  1.00 53.82  ? 43   VAL A C   1 
ATOM 329  O O   . VAL A 1 46   ? 14.031  70.968 26.711  1.00 53.82  ? 43   VAL A O   1 
ATOM 330  C CB  . VAL A 1 46   ? 16.592  72.168 25.211  1.00 71.08  ? 43   VAL A CB  1 
ATOM 331  C CG1 . VAL A 1 46   ? 17.014  73.413 25.959  1.00 71.08  ? 43   VAL A CG1 1 
ATOM 332  C CG2 . VAL A 1 46   ? 17.685  71.819 24.233  1.00 71.08  ? 43   VAL A CG2 1 
ATOM 333  N N   . VAL A 1 47   ? 15.470  71.712 28.288  1.00 56.11  ? 44   VAL A N   1 
ATOM 334  C CA  . VAL A 1 47   ? 14.487  72.155 29.278  1.00 56.11  ? 44   VAL A CA  1 
ATOM 335  C C   . VAL A 1 47   ? 13.983  73.556 28.890  1.00 56.11  ? 44   VAL A C   1 
ATOM 336  O O   . VAL A 1 47   ? 14.776  74.455 28.544  1.00 56.11  ? 44   VAL A O   1 
ATOM 337  C CB  . VAL A 1 47   ? 15.112  72.232 30.705  1.00 45.80  ? 44   VAL A CB  1 
ATOM 338  C CG1 . VAL A 1 47   ? 14.040  72.286 31.775  1.00 45.80  ? 44   VAL A CG1 1 
ATOM 339  C CG2 . VAL A 1 47   ? 16.042  71.068 30.944  1.00 45.80  ? 44   VAL A CG2 1 
ATOM 340  N N   . THR A 1 48   ? 12.666  73.723 28.964  1.00 86.90  ? 45   THR A N   1 
ATOM 341  C CA  . THR A 1 48   ? 11.993  74.938 28.539  1.00 86.90  ? 45   THR A CA  1 
ATOM 342  C C   . THR A 1 48   ? 10.833  75.209 29.482  1.00 86.90  ? 45   THR A C   1 
ATOM 343  O O   . THR A 1 48   ? 10.653  74.489 30.467  1.00 86.90  ? 45   THR A O   1 
ATOM 344  C CB  . THR A 1 48   ? 11.417  74.759 27.134  1.00 81.85  ? 45   THR A CB  1 
ATOM 345  O OG1 . THR A 1 48   ? 10.430  73.709 27.154  1.00 81.85  ? 45   THR A OG1 1 
ATOM 346  C CG2 . THR A 1 48   ? 12.530  74.425 26.135  1.00 81.85  ? 45   THR A CG2 1 
ATOM 347  N N   . ALA A 1 49   ? 10.044  76.235 29.165  1.00 96.86  ? 46   ALA A N   1 
ATOM 348  C CA  . ALA A 1 49   ? 8.818   76.550 29.897  1.00 96.86  ? 46   ALA A CA  1 
ATOM 349  C C   . ALA A 1 49   ? 7.808   75.405 29.826  1.00 96.86  ? 46   ALA A C   1 
ATOM 350  O O   . ALA A 1 49   ? 7.245   75.005 30.849  1.00 96.86  ? 46   ALA A O   1 
ATOM 351  C CB  . ALA A 1 49   ? 8.204   77.832 29.367  1.00 53.75  ? 46   ALA A CB  1 
ATOM 352  N N   . GLU A 1 50   ? 7.597   74.872 28.623  1.00 118.79 ? 47   GLU A N   1 
ATOM 353  C CA  . GLU A 1 50   ? 6.658   73.766 28.411  1.00 118.79 ? 47   GLU A CA  1 
ATOM 354  C C   . GLU A 1 50   ? 7.120   72.487 29.119  1.00 118.79 ? 47   GLU A C   1 
ATOM 355  O O   . GLU A 1 50   ? 6.307   71.618 29.452  1.00 118.79 ? 47   GLU A O   1 
ATOM 356  C CB  . GLU A 1 50   ? 6.464   73.512 26.907  1.00 142.88 ? 47   GLU A CB  1 
ATOM 357  C CG  . GLU A 1 50   ? 5.291   72.583 26.537  1.00 142.88 ? 47   GLU A CG  1 
ATOM 358  C CD  . GLU A 1 50   ? 5.672   71.096 26.474  1.00 142.88 ? 47   GLU A CD  1 
ATOM 359  O OE1 . GLU A 1 50   ? 4.766   70.240 26.602  1.00 142.88 ? 47   GLU A OE1 1 
ATOM 360  O OE2 . GLU A 1 50   ? 6.870   70.777 26.295  1.00 142.88 ? 47   GLU A OE2 1 
ATOM 361  N N   . GLY A 1 51   ? 8.424   72.404 29.375  1.00 70.29  ? 48   GLY A N   1 
ATOM 362  C CA  . GLY A 1 51   ? 9.063   71.156 29.775  1.00 70.29  ? 48   GLY A CA  1 
ATOM 363  C C   . GLY A 1 51   ? 10.246  70.812 28.873  1.00 70.29  ? 48   GLY A C   1 
ATOM 364  O O   . GLY A 1 51   ? 11.265  71.523 28.869  1.00 70.29  ? 48   GLY A O   1 
ATOM 365  N N   . LEU A 1 52   ? 10.116  69.742 28.089  1.00 53.46  ? 49   LEU A N   1 
ATOM 366  C CA  . LEU A 1 52   ? 11.280  69.175 27.389  1.00 53.46  ? 49   LEU A CA  1 
ATOM 367  C C   . LEU A 1 52   ? 11.263  69.294 25.853  1.00 53.46  ? 49   LEU A C   1 
ATOM 368  O O   . LEU A 1 52   ? 10.420  68.686 25.181  1.00 53.46  ? 49   LEU A O   1 
ATOM 369  C CB  . LEU A 1 52   ? 11.443  67.705 27.787  1.00 41.52  ? 49   LEU A CB  1 
ATOM 370  C CG  . LEU A 1 52   ? 12.168  67.186 29.037  1.00 41.52  ? 49   LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 52   ? 12.747  68.227 29.968  1.00 41.52  ? 49   LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 52   ? 11.230  66.259 29.766  1.00 41.52  ? 49   LEU A CD2 1 
ATOM 373  N N   . ARG A 1 53   ? 12.209  70.058 25.304  1.00 54.93  ? 50   ARG A N   1 
ATOM 374  C CA  . ARG A 1 53   ? 12.368  70.142 23.853  1.00 54.93  ? 50   ARG A CA  1 
ATOM 375  C C   . ARG A 1 53   ? 13.248  68.999 23.383  1.00 54.93  ? 50   ARG A C   1 
ATOM 376  O O   . ARG A 1 53   ? 14.446  69.023 23.624  1.00 54.93  ? 50   ARG A O   1 
ATOM 377  C CB  . ARG A 1 53   ? 12.962  71.491 23.427  1.00 135.22 ? 50   ARG A CB  1 
ATOM 378  C CG  . ARG A 1 53   ? 13.057  71.692 21.907  1.00 135.22 ? 50   ARG A CG  1 
ATOM 379  C CD  . ARG A 1 53   ? 13.694  73.037 21.532  1.00 135.22 ? 50   ARG A CD  1 
ATOM 380  N NE  . ARG A 1 53   ? 13.062  74.175 22.220  1.00 135.22 ? 50   ARG A NE  1 
ATOM 381  C CZ  . ARG A 1 53   ? 11.912  74.770 21.859  1.00 135.22 ? 50   ARG A CZ  1 
ATOM 382  N NH1 . ARG A 1 53   ? 11.220  74.353 20.794  1.00 135.22 ? 50   ARG A NH1 1 
ATOM 383  N NH2 . ARG A 1 53   ? 11.442  75.797 22.570  1.00 135.22 ? 50   ARG A NH2 1 
ATOM 384  N N   . PRO A 1 54   ? 12.655  67.991 22.722  1.00 51.42  ? 51   PRO A N   1 
ATOM 385  C CA  . PRO A 1 54   ? 13.440  66.886 22.132  1.00 51.42  ? 51   PRO A CA  1 
ATOM 386  C C   . PRO A 1 54   ? 14.484  67.324 21.082  1.00 51.42  ? 51   PRO A C   1 
ATOM 387  O O   . PRO A 1 54   ? 14.189  67.977 20.093  1.00 51.42  ? 51   PRO A O   1 
ATOM 388  C CB  . PRO A 1 54   ? 12.373  65.975 21.505  1.00 53.22  ? 51   PRO A CB  1 
ATOM 389  C CG  . PRO A 1 54   ? 11.107  66.338 22.188  1.00 53.22  ? 51   PRO A CG  1 
ATOM 390  C CD  . PRO A 1 54   ? 11.214  67.807 22.499  1.00 53.22  ? 51   PRO A CD  1 
ATOM 391  N N   . VAL A 1 55   ? 15.722  66.957 21.306  1.00 57.51  ? 52   VAL A N   1 
ATOM 392  C CA  . VAL A 1 55   ? 16.755  67.429 20.434  1.00 57.51  ? 52   VAL A CA  1 
ATOM 393  C C   . VAL A 1 55   ? 17.432  66.301 19.711  1.00 57.51  ? 52   VAL A C   1 
ATOM 394  O O   . VAL A 1 55   ? 17.518  66.324 18.496  1.00 57.51  ? 52   VAL A O   1 
ATOM 395  C CB  . VAL A 1 55   ? 17.779  68.222 21.219  1.00 40.23  ? 52   VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 55   ? 19.042  68.424 20.382  1.00 40.23  ? 52   VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 55   ? 17.150  69.549 21.675  1.00 40.23  ? 52   VAL A CG2 1 
ATOM 398  N N   . LYS A 1 56   ? 17.942  65.328 20.458  1.00 64.32  ? 53   LYS A N   1 
ATOM 399  C CA  . LYS A 1 56   ? 18.650  64.240 19.820  1.00 64.32  ? 53   LYS A CA  1 
ATOM 400  C C   . LYS A 1 56   ? 18.623  62.946 20.590  1.00 64.32  ? 53   LYS A C   1 
ATOM 401  O O   . LYS A 1 56   ? 18.878  62.874 21.795  1.00 64.32  ? 53   LYS A O   1 
ATOM 402  C CB  . LYS A 1 56   ? 20.080  64.637 19.459  1.00 64.45  ? 53   LYS A CB  1 
ATOM 403  C CG  . LYS A 1 56   ? 20.803  63.647 18.542  1.00 64.45  ? 53   LYS A CG  1 
ATOM 404  C CD  . LYS A 1 56   ? 20.221  63.491 17.124  1.00 64.45  ? 53   LYS A CD  1 
ATOM 405  C CE  . LYS A 1 56   ? 21.360  63.013 16.192  1.00 64.45  ? 53   LYS A CE  1 
ATOM 406  N NZ  . LYS A 1 56   ? 20.929  62.508 14.859  1.00 64.45  ? 53   LYS A NZ  1 
ATOM 407  N N   . GLU A 1 57   ? 18.313  61.921 19.819  1.00 52.69  ? 54   GLU A N   1 
ATOM 408  C CA  . GLU A 1 57   ? 18.081  60.595 20.292  1.00 52.69  ? 54   GLU A CA  1 
ATOM 409  C C   . GLU A 1 57   ? 19.072  59.793 19.506  1.00 52.69  ? 54   GLU A C   1 
ATOM 410  O O   . GLU A 1 57   ? 18.829  59.429 18.347  1.00 52.69  ? 54   GLU A O   1 
ATOM 411  C CB  . GLU A 1 57   ? 16.654  60.176 19.943  1.00 55.49  ? 54   GLU A CB  1 
ATOM 412  C CG  . GLU A 1 57   ? 16.056  59.151 20.858  1.00 55.49  ? 54   GLU A CG  1 
ATOM 413  C CD  . GLU A 1 57   ? 16.325  57.705 20.415  1.00 55.49  ? 54   GLU A CD  1 
ATOM 414  O OE1 . GLU A 1 57   ? 15.873  56.758 21.133  1.00 55.49  ? 54   GLU A OE1 1 
ATOM 415  O OE2 . GLU A 1 57   ? 16.969  57.499 19.356  1.00 55.49  ? 54   GLU A OE2 1 
ATOM 416  N N   . VAL A 1 58   ? 20.221  59.577 20.123  1.00 64.32  ? 55   VAL A N   1 
ATOM 417  C CA  . VAL A 1 58   ? 21.200  58.672 19.578  1.00 64.32  ? 55   VAL A CA  1 
ATOM 418  C C   . VAL A 1 58   ? 21.150  57.349 20.293  1.00 64.32  ? 55   VAL A C   1 
ATOM 419  O O   . VAL A 1 58   ? 20.731  57.273 21.456  1.00 64.32  ? 55   VAL A O   1 
ATOM 420  C CB  . VAL A 1 58   ? 22.588  59.217 19.710  1.00 58.36  ? 55   VAL A CB  1 
ATOM 421  C CG1 . VAL A 1 58   ? 22.916  60.003 18.487  1.00 58.36  ? 55   VAL A CG1 1 
ATOM 422  C CG2 . VAL A 1 58   ? 22.724  60.053 20.981  1.00 58.36  ? 55   VAL A CG2 1 
ATOM 423  N N   . GLY A 1 59   ? 21.564  56.305 19.584  1.00 51.47  ? 56   GLY A N   1 
ATOM 424  C CA  . GLY A 1 59   ? 21.647  54.974 20.167  1.00 51.47  ? 56   GLY A CA  1 
ATOM 425  C C   . GLY A 1 59   ? 23.089  54.545 20.291  1.00 51.47  ? 56   GLY A C   1 
ATOM 426  O O   . GLY A 1 59   ? 23.959  55.060 19.596  1.00 51.47  ? 56   GLY A O   1 
ATOM 427  N N   . MET A 1 60   ? 23.341  53.608 21.199  1.00 56.44  ? 57   MET A N   1 
ATOM 428  C CA  . MET A 1 60   ? 24.686  53.088 21.404  1.00 56.44  ? 57   MET A CA  1 
ATOM 429  C C   . MET A 1 60   ? 24.750  51.588 21.280  1.00 56.44  ? 57   MET A C   1 
ATOM 430  O O   . MET A 1 60   ? 23.695  50.911 21.277  1.00 56.44  ? 57   MET A O   1 
ATOM 431  C CB  . MET A 1 60   ? 25.219  53.534 22.737  1.00 54.27  ? 57   MET A CB  1 
ATOM 432  C CG  . MET A 1 60   ? 25.793  54.870 22.601  1.00 54.27  ? 57   MET A CG  1 
ATOM 433  S SD  . MET A 1 60   ? 26.652  55.330 24.069  1.00 54.27  ? 57   MET A SD  1 
ATOM 434  C CE  . MET A 1 60   ? 27.817  54.009 24.252  1.00 54.27  ? 57   MET A CE  1 
ATOM 435  N N   . TYR A 1 61   ? 25.982  51.086 21.149  1.00 47.17  ? 58   TYR A N   1 
ATOM 436  C CA  . TYR A 1 61   ? 26.253  49.660 21.024  1.00 47.17  ? 58   TYR A CA  1 
ATOM 437  C C   . TYR A 1 61   ? 26.707  49.093 22.343  1.00 47.17  ? 58   TYR A C   1 
ATOM 438  O O   . TYR A 1 61   ? 27.693  48.370 22.397  1.00 47.17  ? 58   TYR A O   1 
ATOM 439  C CB  . TYR A 1 61   ? 27.353  49.417 19.987  1.00 49.33  ? 58   TYR A CB  1 
ATOM 440  C CG  . TYR A 1 61   ? 26.918  49.537 18.547  1.00 49.33  ? 58   TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 61   ? 25.574  49.543 18.208  1.00 49.33  ? 58   TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 61   ? 27.860  49.618 17.521  1.00 49.33  ? 58   TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 61   ? 25.167  49.655 16.900  1.00 49.33  ? 58   TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 61   ? 27.465  49.729 16.195  1.00 49.33  ? 58   TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 61   ? 26.107  49.752 15.885  1.00 49.33  ? 58   TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 61   ? 25.664  49.862 14.565  1.00 49.33  ? 58   TYR A OH  1 
ATOM 447  N N   . GLY A 1 62   ? 26.012  49.440 23.411  1.00 39.91  ? 59   GLY A N   1 
ATOM 448  C CA  . GLY A 1 62   ? 26.396  49.000 24.749  1.00 39.91  ? 59   GLY A CA  1 
ATOM 449  C C   . GLY A 1 62   ? 25.299  49.407 25.697  1.00 39.91  ? 59   GLY A C   1 
ATOM 450  O O   . GLY A 1 62   ? 24.446  50.184 25.322  1.00 39.91  ? 59   GLY A O   1 
ATOM 451  N N   . LYS A 1 63   ? 25.302  48.883 26.918  1.00 39.88  ? 60   LYS A N   1 
ATOM 452  C CA  . LYS A 1 63   ? 24.363  49.343 27.939  1.00 39.88  ? 60   LYS A CA  1 
ATOM 453  C C   . LYS A 1 63   ? 25.040  50.432 28.747  1.00 39.88  ? 60   LYS A C   1 
ATOM 454  O O   . LYS A 1 63   ? 26.092  50.228 29.384  1.00 39.88  ? 60   LYS A O   1 
ATOM 455  C CB  . LYS A 1 63   ? 23.896  48.213 28.854  1.00 38.29  ? 60   LYS A CB  1 
ATOM 456  C CG  . LYS A 1 63   ? 23.265  47.069 28.111  1.00 38.29  ? 60   LYS A CG  1 
ATOM 457  C CD  . LYS A 1 63   ? 23.255  45.766 28.913  1.00 38.29  ? 60   LYS A CD  1 
ATOM 458  C CE  . LYS A 1 63   ? 22.183  45.802 30.038  1.00 38.29  ? 60   LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 63   ? 20.750  45.857 29.460  1.00 38.29  ? 60   LYS A NZ  1 
ATOM 460  N N   . ILE A 1 64   ? 24.440  51.604 28.726  1.00 36.06  ? 61   ILE A N   1 
ATOM 461  C CA  . ILE A 1 64   ? 24.943  52.681 29.539  1.00 36.06  ? 61   ILE A CA  1 
ATOM 462  C C   . ILE A 1 64   ? 24.964  52.347 31.048  1.00 36.06  ? 61   ILE A C   1 
ATOM 463  O O   . ILE A 1 64   ? 23.910  52.197 31.695  1.00 36.06  ? 61   ILE A O   1 
ATOM 464  C CB  . ILE A 1 64   ? 24.196  53.944 29.216  1.00 29.07  ? 61   ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 64   ? 24.269  54.155 27.688  1.00 29.07  ? 61   ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 64   ? 24.793  55.077 29.974  1.00 29.07  ? 61   ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 64   ? 23.381  55.210 27.079  1.00 29.07  ? 61   ILE A CD1 1 
ATOM 468  N N   . ALA A 1 65   ? 26.163  52.159 31.590  1.00 36.54  ? 62   ALA A N   1 
ATOM 469  C CA  . ALA A 1 65   ? 26.310  51.798 32.987  1.00 36.54  ? 62   ALA A CA  1 
ATOM 470  C C   . ALA A 1 65   ? 26.751  52.985 33.822  1.00 36.54  ? 62   ALA A C   1 
ATOM 471  O O   . ALA A 1 65   ? 26.636  52.963 35.049  1.00 36.54  ? 62   ALA A O   1 
ATOM 472  C CB  . ALA A 1 65   ? 27.287  50.657 33.123  1.00 17.63  ? 62   ALA A CB  1 
ATOM 473  N N   . VAL A 1 66   ? 27.291  54.002 33.155  1.00 43.91  ? 63   VAL A N   1 
ATOM 474  C CA  . VAL A 1 66   ? 27.735  55.233 33.786  1.00 43.91  ? 63   VAL A CA  1 
ATOM 475  C C   . VAL A 1 66   ? 27.436  56.325 32.779  1.00 43.91  ? 63   VAL A C   1 
ATOM 476  O O   . VAL A 1 66   ? 27.630  56.144 31.588  1.00 43.91  ? 63   VAL A O   1 
ATOM 477  C CB  . VAL A 1 66   ? 29.241  55.222 34.041  1.00 38.17  ? 63   VAL A CB  1 
ATOM 478  C CG1 . VAL A 1 66   ? 29.663  56.385 34.885  1.00 38.17  ? 63   VAL A CG1 1 
ATOM 479  C CG2 . VAL A 1 66   ? 29.652  53.959 34.692  1.00 38.17  ? 63   VAL A CG2 1 
ATOM 480  N N   . MET A 1 67   ? 26.933  57.453 33.250  1.00 46.60  ? 64   MET A N   1 
ATOM 481  C CA  . MET A 1 67   ? 26.633  58.584 32.370  1.00 46.60  ? 64   MET A CA  1 
ATOM 482  C C   . MET A 1 67   ? 26.894  59.900 33.119  1.00 46.60  ? 64   MET A C   1 
ATOM 483  O O   . MET A 1 67   ? 26.107  60.267 33.980  1.00 46.60  ? 64   MET A O   1 
ATOM 484  C CB  . MET A 1 67   ? 25.186  58.518 31.875  1.00 35.61  ? 64   MET A CB  1 
ATOM 485  C CG  . MET A 1 67   ? 24.811  59.682 30.974  1.00 35.61  ? 64   MET A CG  1 
ATOM 486  S SD  . MET A 1 67   ? 23.291  59.449 29.959  1.00 35.61  ? 64   MET A SD  1 
ATOM 487  C CE  . MET A 1 67   ? 22.069  59.295 31.291  1.00 35.61  ? 64   MET A CE  1 
ATOM 488  N N   . GLU A 1 68   ? 28.003  60.577 32.845  1.00 53.70  ? 65   GLU A N   1 
ATOM 489  C CA  . GLU A 1 68   ? 28.243  61.853 33.485  1.00 53.70  ? 65   GLU A CA  1 
ATOM 490  C C   . GLU A 1 68   ? 28.479  62.917 32.445  1.00 53.70  ? 65   GLU A C   1 
ATOM 491  O O   . GLU A 1 68   ? 29.003  62.637 31.364  1.00 53.70  ? 65   GLU A O   1 
ATOM 492  C CB  . GLU A 1 68   ? 29.423  61.809 34.448  1.00 64.30  ? 65   GLU A CB  1 
ATOM 493  C CG  . GLU A 1 68   ? 29.130  61.160 35.788  1.00 64.30  ? 65   GLU A CG  1 
ATOM 494  C CD  . GLU A 1 68   ? 27.851  61.689 36.435  1.00 64.30  ? 65   GLU A CD  1 
ATOM 495  O OE1 . GLU A 1 68   ? 27.098  60.876 37.043  1.00 64.30  ? 65   GLU A OE1 1 
ATOM 496  O OE2 . GLU A 1 68   ? 27.587  62.917 36.328  1.00 64.30  ? 65   GLU A OE2 1 
ATOM 497  N N   . LEU A 1 69   ? 28.034  64.127 32.749  1.00 71.07  ? 66   LEU A N   1 
ATOM 498  C CA  . LEU A 1 69   ? 28.444  65.291 32.017  1.00 71.07  ? 66   LEU A CA  1 
ATOM 499  C C   . LEU A 1 69   ? 29.538  65.887 32.876  1.00 71.07  ? 66   LEU A C   1 
ATOM 500  O O   . LEU A 1 69   ? 29.543  65.639 34.095  1.00 71.07  ? 66   LEU A O   1 
ATOM 501  C CB  . LEU A 1 69   ? 27.277  66.252 31.879  1.00 47.61  ? 66   LEU A CB  1 
ATOM 502  C CG  . LEU A 1 69   ? 26.432  66.127 30.606  1.00 47.61  ? 66   LEU A CG  1 
ATOM 503  C CD1 . LEU A 1 69   ? 25.219  67.014 30.698  1.00 47.61  ? 66   LEU A CD1 1 
ATOM 504  C CD2 . LEU A 1 69   ? 27.208  66.429 29.306  1.00 47.61  ? 66   LEU A CD2 1 
ATOM 505  N N   . PHE A 1 70   ? 30.479  66.623 32.267  1.00 53.69  ? 67   PHE A N   1 
ATOM 506  C CA  . PHE A 1 70   ? 31.633  67.201 33.012  1.00 53.69  ? 67   PHE A CA  1 
ATOM 507  C C   . PHE A 1 70   ? 32.343  68.182 32.133  1.00 53.69  ? 67   PHE A C   1 
ATOM 508  O O   . PHE A 1 70   ? 32.181  68.124 30.913  1.00 53.69  ? 67   PHE A O   1 
ATOM 509  C CB  . PHE A 1 70   ? 32.642  66.126 33.446  1.00 55.15  ? 67   PHE A CB  1 
ATOM 510  C CG  . PHE A 1 70   ? 33.427  65.562 32.309  1.00 55.15  ? 67   PHE A CG  1 
ATOM 511  C CD1 . PHE A 1 70   ? 34.669  66.076 31.985  1.00 55.15  ? 67   PHE A CD1 1 
ATOM 512  C CD2 . PHE A 1 70   ? 32.907  64.547 31.530  1.00 55.15  ? 67   PHE A CD2 1 
ATOM 513  C CE1 . PHE A 1 70   ? 35.387  65.567 30.915  1.00 55.15  ? 67   PHE A CE1 1 
ATOM 514  C CE2 . PHE A 1 70   ? 33.620  64.034 30.458  1.00 55.15  ? 67   PHE A CE2 1 
ATOM 515  C CZ  . PHE A 1 70   ? 34.853  64.542 30.149  1.00 55.15  ? 67   PHE A CZ  1 
ATOM 516  N N   . ARG A 1 71   ? 33.158  69.042 32.750  1.00 73.54  ? 68   ARG A N   1 
ATOM 517  C CA  . ARG A 1 71   ? 33.822  70.151 32.049  1.00 73.54  ? 68   ARG A CA  1 
ATOM 518  C C   . ARG A 1 71   ? 35.234  70.430 32.584  1.00 73.54  ? 68   ARG A C   1 
ATOM 519  O O   . ARG A 1 71   ? 35.386  70.935 33.704  1.00 73.54  ? 68   ARG A O   1 
ATOM 520  C CB  . ARG A 1 71   ? 32.942  71.417 32.118  1.00 95.17  ? 68   ARG A CB  1 
ATOM 521  C CG  . ARG A 1 71   ? 33.458  72.652 31.373  1.00 95.17  ? 68   ARG A CG  1 
ATOM 522  C CD  . ARG A 1 71   ? 32.376  73.312 30.471  1.00 95.17  ? 68   ARG A CD  1 
ATOM 523  N NE  . ARG A 1 71   ? 31.248  73.928 31.183  1.00 95.17  ? 68   ARG A NE  1 
ATOM 524  C CZ  . ARG A 1 71   ? 30.464  74.893 30.692  1.00 95.17  ? 68   ARG A CZ  1 
ATOM 525  N NH1 . ARG A 1 71   ? 30.669  75.390 29.482  1.00 95.17  ? 68   ARG A NH1 1 
ATOM 526  N NH2 . ARG A 1 71   ? 29.472  75.385 31.421  1.00 95.17  ? 68   ARG A NH2 1 
ATOM 527  N N   . PRO A 1 72   ? 36.269  70.096 31.787  1.00 108.93 ? 69   PRO A N   1 
ATOM 528  C CA  . PRO A 1 72   ? 37.640  70.485 32.127  1.00 108.93 ? 69   PRO A CA  1 
ATOM 529  C C   . PRO A 1 72   ? 37.915  71.921 31.696  1.00 108.93 ? 69   PRO A C   1 
ATOM 530  O O   . PRO A 1 72   ? 37.013  72.602 31.188  1.00 108.93 ? 69   PRO A O   1 
ATOM 531  C CB  . PRO A 1 72   ? 38.519  69.483 31.352  1.00 61.42  ? 69   PRO A CB  1 
ATOM 532  C CG  . PRO A 1 72   ? 37.605  68.800 30.362  1.00 61.42  ? 69   PRO A CG  1 
ATOM 533  C CD  . PRO A 1 72   ? 36.201  69.333 30.531  1.00 61.42  ? 69   PRO A CD  1 
ATOM 534  N N   . LYS A 1 73   ? 39.149  72.373 31.903  1.00 75.62  ? 70   LYS A N   1 
ATOM 535  C CA  . LYS A 1 73   ? 39.489  73.784 31.691  1.00 75.62  ? 70   LYS A CA  1 
ATOM 536  C C   . LYS A 1 73   ? 39.401  74.165 30.215  1.00 75.62  ? 70   LYS A C   1 
ATOM 537  O O   . LYS A 1 73   ? 39.571  73.309 29.332  1.00 75.62  ? 70   LYS A O   1 
ATOM 538  C CB  . LYS A 1 73   ? 40.872  74.121 32.270  1.00 168.36 ? 70   LYS A CB  1 
ATOM 539  C CG  . LYS A 1 73   ? 41.124  73.592 33.684  1.00 168.36 ? 70   LYS A CG  1 
ATOM 540  C CD  . LYS A 1 73   ? 40.106  74.102 34.694  1.00 168.36 ? 70   LYS A CD  1 
ATOM 541  C CE  . LYS A 1 73   ? 39.729  73.004 35.675  1.00 168.36 ? 70   LYS A CE  1 
ATOM 542  N NZ  . LYS A 1 73   ? 39.007  71.875 35.010  1.00 168.36 ? 70   LYS A NZ  1 
ATOM 543  N N   . GLY A 1 74   ? 39.094  75.437 29.960  1.00 142.45 ? 71   GLY A N   1 
ATOM 544  C CA  . GLY A 1 74   ? 39.056  75.990 28.604  1.00 142.45 ? 71   GLY A CA  1 
ATOM 545  C C   . GLY A 1 74   ? 38.147  75.254 27.635  1.00 142.45 ? 71   GLY A C   1 
ATOM 546  O O   . GLY A 1 74   ? 38.324  75.343 26.415  1.00 142.45 ? 71   GLY A O   1 
ATOM 547  N N   . GLU A 1 75   ? 37.180  74.521 28.184  1.00 77.38  ? 72   GLU A N   1 
ATOM 548  C CA  . GLU A 1 75   ? 36.198  73.826 27.381  1.00 77.38  ? 72   GLU A CA  1 
ATOM 549  C C   . GLU A 1 75   ? 34.963  74.688 27.189  1.00 77.38  ? 72   GLU A C   1 
ATOM 550  O O   . GLU A 1 75   ? 34.362  75.113 28.166  1.00 77.38  ? 72   GLU A O   1 
ATOM 551  C CB  . GLU A 1 75   ? 35.836  72.519 28.065  1.00 71.80  ? 72   GLU A CB  1 
ATOM 552  C CG  . GLU A 1 75   ? 36.727  71.357 27.657  1.00 71.80  ? 72   GLU A CG  1 
ATOM 553  C CD  . GLU A 1 75   ? 36.530  70.949 26.189  1.00 71.80  ? 72   GLU A CD  1 
ATOM 554  O OE1 . GLU A 1 75   ? 37.286  70.047 25.718  1.00 71.80  ? 72   GLU A OE1 1 
ATOM 555  O OE2 . GLU A 1 75   ? 35.631  71.539 25.519  1.00 71.80  ? 72   GLU A OE2 1 
ATOM 556  N N   . SER A 1 76   ? 34.592  74.959 25.938  1.00 83.44  ? 73   SER A N   1 
ATOM 557  C CA  . SER A 1 76   ? 33.444  75.836 25.649  1.00 83.44  ? 73   SER A CA  1 
ATOM 558  C C   . SER A 1 76   ? 32.195  75.498 26.478  1.00 83.44  ? 73   SER A C   1 
ATOM 559  O O   . SER A 1 76   ? 31.689  76.357 27.216  1.00 83.44  ? 73   SER A O   1 
ATOM 560  C CB  . SER A 1 76   ? 33.119  75.866 24.146  1.00 73.30  ? 73   SER A CB  1 
ATOM 561  O OG  . SER A 1 76   ? 33.406  74.627 23.506  1.00 73.30  ? 73   SER A OG  1 
ATOM 562  N N   . LYS A 1 77   ? 31.736  74.243 26.357  1.00 79.95  ? 74   LYS A N   1 
ATOM 563  C CA  . LYS A 1 77   ? 30.584  73.678 27.089  1.00 79.95  ? 74   LYS A CA  1 
ATOM 564  C C   . LYS A 1 77   ? 30.916  72.286 27.653  1.00 79.95  ? 74   LYS A C   1 
ATOM 565  O O   . LYS A 1 77   ? 32.068  71.868 27.619  1.00 79.95  ? 74   LYS A O   1 
ATOM 566  C CB  . LYS A 1 77   ? 29.365  73.599 26.171  1.00 51.86  ? 74   LYS A CB  1 
ATOM 567  C CG  . LYS A 1 77   ? 29.540  72.614 25.003  1.00 51.86  ? 74   LYS A CG  1 
ATOM 568  C CD  . LYS A 1 77   ? 28.624  72.966 23.829  1.00 51.86  ? 74   LYS A CD  1 
ATOM 569  C CE  . LYS A 1 77   ? 28.759  71.985 22.680  1.00 51.86  ? 74   LYS A CE  1 
ATOM 570  N NZ  . LYS A 1 77   ? 29.952  72.180 21.838  1.00 51.86  ? 74   LYS A NZ  1 
ATOM 571  N N   . ASP A 1 78   ? 29.901  71.572 28.150  1.00 59.28  ? 75   ASP A N   1 
ATOM 572  C CA  . ASP A 1 78   ? 30.062  70.230 28.767  1.00 59.28  ? 75   ASP A CA  1 
ATOM 573  C C   . ASP A 1 78   ? 30.284  69.052 27.816  1.00 59.28  ? 75   ASP A C   1 
ATOM 574  O O   . ASP A 1 78   ? 29.709  68.949 26.716  1.00 59.28  ? 75   ASP A O   1 
ATOM 575  C CB  . ASP A 1 78   ? 28.853  69.869 29.638  1.00 70.72  ? 75   ASP A CB  1 
ATOM 576  C CG  . ASP A 1 78   ? 28.856  70.552 30.981  1.00 70.72  ? 75   ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 78   ? 27.813  70.469 31.654  1.00 70.72  ? 75   ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 78   ? 29.870  71.161 31.381  1.00 70.72  ? 75   ASP A OD2 1 
ATOM 579  N N   . LEU A 1 79   ? 31.097  68.134 28.300  1.00 50.02  ? 76   LEU A N   1 
ATOM 580  C CA  . LEU A 1 79   ? 31.380  66.906 27.592  1.00 50.02  ? 76   LEU A CA  1 
ATOM 581  C C   . LEU A 1 79   ? 30.741  65.750 28.340  1.00 50.02  ? 76   LEU A C   1 
ATOM 582  O O   . LEU A 1 79   ? 30.521  65.838 29.563  1.00 50.02  ? 76   LEU A O   1 
ATOM 583  C CB  . LEU A 1 79   ? 32.896  66.688 27.492  1.00 48.19  ? 76   LEU A CB  1 
ATOM 584  C CG  . LEU A 1 79   ? 33.707  67.590 26.554  1.00 48.19  ? 76   LEU A CG  1 
ATOM 585  C CD1 . LEU A 1 79   ? 35.144  67.159 26.619  1.00 48.19  ? 76   LEU A CD1 1 
ATOM 586  C CD2 . LEU A 1 79   ? 33.156  67.475 25.142  1.00 48.19  ? 76   LEU A CD2 1 
ATOM 587  N N   . LEU A 1 80   ? 30.475  64.667 27.614  1.00 50.59  ? 77   LEU A N   1 
ATOM 588  C CA  . LEU A 1 80   ? 29.749  63.550 28.166  1.00 50.59  ? 77   LEU A CA  1 
ATOM 589  C C   . LEU A 1 80   ? 30.610  62.310 28.253  1.00 50.59  ? 77   LEU A C   1 
ATOM 590  O O   . LEU A 1 80   ? 31.170  61.863 27.250  1.00 50.59  ? 77   LEU A O   1 
ATOM 591  C CB  . LEU A 1 80   ? 28.535  63.281 27.300  1.00 50.51  ? 77   LEU A CB  1 
ATOM 592  C CG  . LEU A 1 80   ? 27.614  62.097 27.595  1.00 50.51  ? 77   LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 80   ? 27.171  62.046 29.062  1.00 50.51  ? 77   LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 80   ? 26.411  62.175 26.663  1.00 50.51  ? 77   LEU A CD2 1 
ATOM 595  N N   . PHE A 1 81   ? 30.720  61.758 29.457  1.00 53.66  ? 78   PHE A N   1 
ATOM 596  C CA  . PHE A 1 81   ? 31.505  60.554 29.666  1.00 53.66  ? 78   PHE A CA  1 
ATOM 597  C C   . PHE A 1 81   ? 30.611  59.334 29.754  1.00 53.66  ? 78   PHE A C   1 
ATOM 598  O O   . PHE A 1 81   ? 29.723  59.284 30.619  1.00 53.66  ? 78   PHE A O   1 
ATOM 599  C CB  . PHE A 1 81   ? 32.271  60.629 30.969  1.00 43.74  ? 78   PHE A CB  1 
ATOM 600  C CG  . PHE A 1 81   ? 32.783  59.300 31.404  1.00 43.74  ? 78   PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 81   ? 33.715  58.616 30.625  1.00 43.74  ? 78   PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 81   ? 32.290  58.693 32.548  1.00 43.74  ? 78   PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 81   ? 34.187  57.368 30.999  1.00 43.74  ? 78   PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 81   ? 32.750  57.431 32.935  1.00 43.74  ? 78   PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 81   ? 33.711  56.774 32.161  1.00 43.74  ? 78   PHE A CZ  1 
ATOM 606  N N   . ILE A 1 82   ? 30.841  58.331 28.913  1.00 58.17  ? 79   ILE A N   1 
ATOM 607  C CA  . ILE A 1 82   ? 29.962  57.173 28.967  1.00 58.17  ? 79   ILE A CA  1 
ATOM 608  C C   . ILE A 1 82   ? 30.678  55.870 29.134  1.00 58.17  ? 79   ILE A C   1 
ATOM 609  O O   . ILE A 1 82   ? 31.485  55.477 28.291  1.00 58.17  ? 79   ILE A O   1 
ATOM 610  C CB  . ILE A 1 82   ? 29.060  57.050 27.732  1.00 37.02  ? 79   ILE A CB  1 
ATOM 611  C CG1 . ILE A 1 82   ? 28.097  58.222 27.656  1.00 37.02  ? 79   ILE A CG1 1 
ATOM 612  C CG2 . ILE A 1 82   ? 28.283  55.711 27.755  1.00 37.02  ? 79   ILE A CG2 1 
ATOM 613  C CD1 . ILE A 1 82   ? 26.668  57.807 27.388  1.00 37.02  ? 79   ILE A CD1 1 
ATOM 614  N N   . LEU A 1 83   ? 30.351  55.181 30.210  1.00 38.34  ? 80   LEU A N   1 
ATOM 615  C CA  . LEU A 1 83   ? 30.805  53.832 30.337  1.00 38.34  ? 80   LEU A CA  1 
ATOM 616  C C   . LEU A 1 83   ? 29.721  52.804 30.062  1.00 38.34  ? 80   LEU A C   1 
ATOM 617  O O   . LEU A 1 83   ? 28.686  52.788 30.686  1.00 38.34  ? 80   LEU A O   1 
ATOM 618  C CB  . LEU A 1 83   ? 31.426  53.552 31.700  1.00 23.05  ? 80   LEU A CB  1 
ATOM 619  C CG  . LEU A 1 83   ? 31.847  52.088 31.632  1.00 23.05  ? 80   LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 83   ? 33.012  51.959 30.674  1.00 23.05  ? 80   LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 83   ? 32.211  51.600 32.959  1.00 23.05  ? 80   LEU A CD2 1 
ATOM 622  N N   . THR A 1 84   ? 30.007  51.917 29.139  1.00 39.17  ? 81   THR A N   1 
ATOM 623  C CA  . THR A 1 84   ? 29.204  50.767 28.875  1.00 39.17  ? 81   THR A CA  1 
ATOM 624  C C   . THR A 1 84   ? 29.486  49.622 29.841  1.00 39.17  ? 81   THR A C   1 
ATOM 625  O O   . THR A 1 84   ? 30.482  49.622 30.583  1.00 39.17  ? 81   THR A O   1 
ATOM 626  C CB  . THR A 1 84   ? 29.555  50.302 27.492  1.00 25.01  ? 81   THR A CB  1 
ATOM 627  O OG1 . THR A 1 84   ? 28.570  50.794 26.574  1.00 25.01  ? 81   THR A OG1 1 
ATOM 628  C CG2 . THR A 1 84   ? 29.590  48.820 27.414  1.00 25.01  ? 81   THR A CG2 1 
ATOM 629  N N   . ALA A 1 85   ? 28.619  48.619 29.795  1.00 35.99  ? 82   ALA A N   1 
ATOM 630  C CA  . ALA A 1 85   ? 28.705  47.474 30.670  1.00 35.99  ? 82   ALA A CA  1 
ATOM 631  C C   . ALA A 1 85   ? 29.670  46.400 30.161  1.00 35.99  ? 82   ALA A C   1 
ATOM 632  O O   . ALA A 1 85   ? 29.901  45.403 30.847  1.00 35.99  ? 82   ALA A O   1 
ATOM 633  C CB  . ALA A 1 85   ? 27.307  46.900 30.853  1.00 18.00  ? 82   ALA A CB  1 
ATOM 634  N N   . LYS A 1 86   ? 30.172  46.542 28.940  1.00 57.94  ? 83   LYS A N   1 
ATOM 635  C CA  . LYS A 1 86   ? 31.274  45.709 28.449  1.00 57.94  ? 83   LYS A CA  1 
ATOM 636  C C   . LYS A 1 86   ? 32.462  46.640 28.426  1.00 57.94  ? 83   LYS A C   1 
ATOM 637  O O   . LYS A 1 86   ? 33.333  46.592 27.554  1.00 57.94  ? 83   LYS A O   1 
ATOM 638  C CB  . LYS A 1 86   ? 31.013  45.137 27.067  1.00 27.48  ? 83   LYS A CB  1 
ATOM 639  C CG  . LYS A 1 86   ? 29.899  44.157 26.996  1.00 27.48  ? 83   LYS A CG  1 
ATOM 640  C CD  . LYS A 1 86   ? 29.465  43.908 25.563  1.00 27.48  ? 83   LYS A CD  1 
ATOM 641  C CE  . LYS A 1 86   ? 29.114  42.455 25.459  1.00 27.48  ? 83   LYS A CE  1 
ATOM 642  N NZ  . LYS A 1 86   ? 28.932  41.971 24.041  1.00 27.48  ? 83   LYS A NZ  1 
ATOM 643  N N   . TYR A 1 87   ? 32.435  47.535 29.394  1.00 39.02  ? 84   TYR A N   1 
ATOM 644  C CA  . TYR A 1 87   ? 33.570  48.297 29.744  1.00 39.02  ? 84   TYR A CA  1 
ATOM 645  C C   . TYR A 1 87   ? 34.041  49.159 28.594  1.00 39.02  ? 84   TYR A C   1 
ATOM 646  O O   . TYR A 1 87   ? 35.164  49.634 28.604  1.00 39.02  ? 84   TYR A O   1 
ATOM 647  C CB  . TYR A 1 87   ? 34.630  47.356 30.310  1.00 37.19  ? 84   TYR A CB  1 
ATOM 648  C CG  . TYR A 1 87   ? 34.106  46.559 31.485  1.00 37.19  ? 84   TYR A CG  1 
ATOM 649  C CD1 . TYR A 1 87   ? 33.597  45.288 31.323  1.00 37.19  ? 84   TYR A CD1 1 
ATOM 650  C CD2 . TYR A 1 87   ? 34.084  47.099 32.757  1.00 37.19  ? 84   TYR A CD2 1 
ATOM 651  C CE1 . TYR A 1 87   ? 33.096  44.574 32.388  1.00 37.19  ? 84   TYR A CE1 1 
ATOM 652  C CE2 . TYR A 1 87   ? 33.566  46.393 33.819  1.00 37.19  ? 84   TYR A CE2 1 
ATOM 653  C CZ  . TYR A 1 87   ? 33.086  45.140 33.622  1.00 37.19  ? 84   TYR A CZ  1 
ATOM 654  O OH  . TYR A 1 87   ? 32.584  44.457 34.694  1.00 37.19  ? 84   TYR A OH  1 
ATOM 655  N N   . ASN A 1 88   ? 33.153  49.396 27.621  1.00 44.92  ? 85   ASN A N   1 
ATOM 656  C CA  . ASN A 1 88   ? 33.335  50.467 26.593  1.00 44.92  ? 85   ASN A CA  1 
ATOM 657  C C   . ASN A 1 88   ? 33.273  51.881 27.157  1.00 44.92  ? 85   ASN A C   1 
ATOM 658  O O   . ASN A 1 88   ? 32.201  52.428 27.346  1.00 44.92  ? 85   ASN A O   1 
ATOM 659  C CB  . ASN A 1 88   ? 32.271  50.355 25.506  1.00 50.18  ? 85   ASN A CB  1 
ATOM 660  C CG  . ASN A 1 88   ? 32.365  49.064 24.730  1.00 50.18  ? 85   ASN A CG  1 
ATOM 661  O OD1 . ASN A 1 88   ? 31.436  48.275 24.715  1.00 50.18  ? 85   ASN A OD1 1 
ATOM 662  N ND2 . ASN A 1 88   ? 33.501  48.835 24.080  1.00 50.18  ? 85   ASN A ND2 1 
ATOM 663  N N   . ALA A 1 89   ? 34.413  52.475 27.453  1.00 39.61  ? 86   ALA A N   1 
ATOM 664  C CA  . ALA A 1 89   ? 34.426  53.874 27.900  1.00 39.61  ? 86   ALA A CA  1 
ATOM 665  C C   . ALA A 1 89   ? 34.510  54.713 26.664  1.00 39.61  ? 86   ALA A C   1 
ATOM 666  O O   . ALA A 1 89   ? 34.871  54.191 25.621  1.00 39.61  ? 86   ALA A O   1 
ATOM 667  C CB  . ALA A 1 89   ? 35.604  54.149 28.824  1.00 31.31  ? 86   ALA A CB  1 
ATOM 668  N N   . CYS A 1 90   ? 34.128  55.978 26.759  1.00 45.62  ? 87   CYS A N   1 
ATOM 669  C CA  . CYS A 1 90   ? 34.197  56.900 25.619  1.00 45.62  ? 87   CYS A CA  1 
ATOM 670  C C   . CYS A 1 90   ? 33.700  58.279 26.015  1.00 45.62  ? 87   CYS A C   1 
ATOM 671  O O   . CYS A 1 90   ? 32.910  58.399 26.950  1.00 45.62  ? 87   CYS A O   1 
ATOM 672  C CB  . CYS A 1 90   ? 33.349  56.380 24.468  1.00 46.95  ? 87   CYS A CB  1 
ATOM 673  S SG  . CYS A 1 90   ? 31.634  56.922 24.585  1.00 46.95  ? 87   CYS A SG  1 
ATOM 674  N N   . ILE A 1 91   ? 34.139  59.317 25.317  1.00 51.29  ? 88   ILE A N   1 
ATOM 675  C CA  . ILE A 1 91   ? 33.724  60.692 25.638  1.00 51.29  ? 88   ILE A CA  1 
ATOM 676  C C   . ILE A 1 91   ? 33.001  61.378 24.477  1.00 51.29  ? 88   ILE A C   1 
ATOM 677  O O   . ILE A 1 91   ? 33.439  61.318 23.325  1.00 51.29  ? 88   ILE A O   1 
ATOM 678  C CB  . ILE A 1 91   ? 34.913  61.566 25.999  1.00 40.07  ? 88   ILE A CB  1 
ATOM 679  C CG1 . ILE A 1 91   ? 35.400  61.270 27.417  1.00 40.07  ? 88   ILE A CG1 1 
ATOM 680  C CG2 . ILE A 1 91   ? 34.540  63.035 25.855  1.00 40.07  ? 88   ILE A CG2 1 
ATOM 681  C CD1 . ILE A 1 91   ? 36.682  62.037 27.756  1.00 40.07  ? 88   ILE A CD1 1 
ATOM 682  N N   . LEU A 1 92   ? 31.899  62.054 24.760  1.00 37.48  ? 89   LEU A N   1 
ATOM 683  C CA  . LEU A 1 92   ? 31.163  62.611 23.664  1.00 37.48  ? 89   LEU A CA  1 
ATOM 684  C C   . LEU A 1 92   ? 31.048  64.107 23.762  1.00 37.48  ? 89   LEU A C   1 
ATOM 685  O O   . LEU A 1 92   ? 31.142  64.689 24.862  1.00 37.48  ? 89   LEU A O   1 
ATOM 686  C CB  . LEU A 1 92   ? 29.824  61.937 23.556  1.00 32.21  ? 89   LEU A CB  1 
ATOM 687  C CG  . LEU A 1 92   ? 29.883  60.396 23.584  1.00 32.21  ? 89   LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 92   ? 28.488  59.791 23.422  1.00 32.21  ? 89   LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 92   ? 30.830  59.753 22.559  1.00 32.21  ? 89   LEU A CD2 1 
ATOM 690  N N   . GLU A 1 93   ? 30.899  64.722 22.589  1.00 60.16  ? 90   GLU A N   1 
ATOM 691  C CA  . GLU A 1 93   ? 30.706  66.154 22.430  1.00 60.16  ? 90   GLU A CA  1 
ATOM 692  C C   . GLU A 1 93   ? 29.482  66.392 21.559  1.00 60.16  ? 90   GLU A C   1 
ATOM 693  O O   . GLU A 1 93   ? 29.244  65.651 20.586  1.00 60.16  ? 90   GLU A O   1 
ATOM 694  C CB  . GLU A 1 93   ? 31.927  66.772 21.780  1.00 75.55  ? 90   GLU A CB  1 
ATOM 695  C CG  . GLU A 1 93   ? 32.014  68.253 21.964  1.00 75.55  ? 90   GLU A CG  1 
ATOM 696  C CD  . GLU A 1 93   ? 32.891  68.928 20.922  1.00 75.55  ? 90   GLU A CD  1 
ATOM 697  O OE1 . GLU A 1 93   ? 34.034  68.443 20.688  1.00 75.55  ? 90   GLU A OE1 1 
ATOM 698  O OE2 . GLU A 1 93   ? 32.428  69.952 20.343  1.00 75.55  ? 90   GLU A OE2 1 
ATOM 699  N N   . TYR A 1 94   ? 28.692  67.403 21.926  1.00 89.57  ? 91   TYR A N   1 
ATOM 700  C CA  . TYR A 1 94   ? 27.544  67.776 21.124  1.00 89.57  ? 91   TYR A CA  1 
ATOM 701  C C   . TYR A 1 94   ? 27.968  68.756 20.066  1.00 89.57  ? 91   TYR A C   1 
ATOM 702  O O   . TYR A 1 94   ? 28.626  69.742 20.369  1.00 89.57  ? 91   TYR A O   1 
ATOM 703  C CB  . TYR A 1 94   ? 26.405  68.352 21.952  1.00 81.43  ? 91   TYR A CB  1 
ATOM 704  C CG  . TYR A 1 94   ? 25.151  68.528 21.112  1.00 81.43  ? 91   TYR A CG  1 
ATOM 705  C CD1 . TYR A 1 94   ? 24.586  67.444 20.441  1.00 81.43  ? 91   TYR A CD1 1 
ATOM 706  C CD2 . TYR A 1 94   ? 24.547  69.777 20.968  1.00 81.43  ? 91   TYR A CD2 1 
ATOM 707  C CE1 . TYR A 1 94   ? 23.454  67.591 19.652  1.00 81.43  ? 91   TYR A CE1 1 
ATOM 708  C CE2 . TYR A 1 94   ? 23.410  69.932 20.188  1.00 81.43  ? 91   TYR A CE2 1 
ATOM 709  C CZ  . TYR A 1 94   ? 22.873  68.833 19.533  1.00 81.43  ? 91   TYR A CZ  1 
ATOM 710  O OH  . TYR A 1 94   ? 21.756  68.977 18.748  1.00 81.43  ? 91   TYR A OH  1 
ATOM 711  N N   . LYS A 1 95   ? 27.571  68.482 18.826  1.00 61.27  ? 92   LYS A N   1 
ATOM 712  C CA  . LYS A 1 95   ? 28.183  69.120 17.663  1.00 61.27  ? 92   LYS A CA  1 
ATOM 713  C C   . LYS A 1 95   ? 27.136  69.368 16.613  1.00 61.27  ? 92   LYS A C   1 
ATOM 714  O O   . LYS A 1 95   ? 26.716  68.445 15.924  1.00 61.27  ? 92   LYS A O   1 
ATOM 715  C CB  . LYS A 1 95   ? 29.292  68.206 17.093  1.00 76.63  ? 92   LYS A CB  1 
ATOM 716  C CG  . LYS A 1 95   ? 29.933  68.630 15.732  1.00 76.63  ? 92   LYS A CG  1 
ATOM 717  C CD  . LYS A 1 95   ? 31.294  69.381 15.895  1.00 76.63  ? 92   LYS A CD  1 
ATOM 718  C CE  . LYS A 1 95   ? 32.016  69.619 14.544  1.00 76.63  ? 92   LYS A CE  1 
ATOM 719  N NZ  . LYS A 1 95   ? 33.146  68.673 14.234  1.00 76.63  ? 92   LYS A NZ  1 
ATOM 720  N N   . GLN A 1 96   ? 26.708  70.609 16.479  1.00 72.99  ? 93   GLN A N   1 
ATOM 721  C CA  . GLN A 1 96   ? 25.723  70.900 15.451  1.00 72.99  ? 93   GLN A CA  1 
ATOM 722  C C   . GLN A 1 96   ? 26.299  71.683 14.289  1.00 72.99  ? 93   GLN A C   1 
ATOM 723  O O   . GLN A 1 96   ? 26.634  72.864 14.445  1.00 72.99  ? 93   GLN A O   1 
ATOM 724  C CB  . GLN A 1 96   ? 24.523  71.640 16.021  1.00 94.16  ? 93   GLN A CB  1 
ATOM 725  C CG  . GLN A 1 96   ? 23.486  71.962 14.973  1.00 94.16  ? 93   GLN A CG  1 
ATOM 726  C CD  . GLN A 1 96   ? 22.139  72.234 15.585  1.00 94.16  ? 93   GLN A CD  1 
ATOM 727  O OE1 . GLN A 1 96   ? 21.882  71.847 16.732  1.00 94.16  ? 93   GLN A OE1 1 
ATOM 728  N NE2 . GLN A 1 96   ? 21.258  72.895 14.829  1.00 94.16  ? 93   GLN A NE2 1 
ATOM 729  N N   . SER A 1 97   ? 26.403  71.036 13.130  1.00 148.67 ? 94   SER A N   1 
ATOM 730  C CA  . SER A 1 97   ? 26.786  71.722 11.901  1.00 148.67 ? 94   SER A CA  1 
ATOM 731  C C   . SER A 1 97   ? 25.578  72.469 11.329  1.00 148.67 ? 94   SER A C   1 
ATOM 732  O O   . SER A 1 97   ? 24.982  72.051 10.330  1.00 148.67 ? 94   SER A O   1 
ATOM 733  C CB  . SER A 1 97   ? 27.371  70.738 10.888  1.00 118.02 ? 94   SER A CB  1 
ATOM 734  O OG  . SER A 1 97   ? 28.462  70.033 11.449  1.00 118.02 ? 94   SER A OG  1 
ATOM 735  N N   . GLY A 1 98   ? 25.219  73.564 12.006  1.00 76.38  ? 95   GLY A N   1 
ATOM 736  C CA  . GLY A 1 98   ? 24.160  74.485 11.590  1.00 76.38  ? 95   GLY A CA  1 
ATOM 737  C C   . GLY A 1 98   ? 22.751  73.927 11.608  1.00 76.38  ? 95   GLY A C   1 
ATOM 738  O O   . GLY A 1 98   ? 21.841  74.514 12.192  1.00 76.38  ? 95   GLY A O   1 
ATOM 739  N N   . GLU A 1 99   ? 22.567  72.800 10.942  1.00 70.68  ? 96   GLU A N   1 
ATOM 740  C CA  . GLU A 1 99   ? 21.261  72.168 10.853  1.00 70.68  ? 96   GLU A CA  1 
ATOM 741  C C   . GLU A 1 99   ? 21.437  70.657 11.032  1.00 70.68  ? 96   GLU A C   1 
ATOM 742  O O   . GLU A 1 99   ? 20.500  69.952 11.432  1.00 70.68  ? 96   GLU A O   1 
ATOM 743  C CB  . GLU A 1 99   ? 20.587  72.510 9.510   1.00 136.30 ? 96   GLU A CB  1 
ATOM 744  C CG  . GLU A 1 99   ? 21.237  71.906 8.232   1.00 136.30 ? 96   GLU A CG  1 
ATOM 745  C CD  . GLU A 1 99   ? 22.740  72.178 8.095   1.00 136.30 ? 96   GLU A CD  1 
ATOM 746  O OE1 . GLU A 1 99   ? 23.177  73.316 8.371   1.00 136.30 ? 96   GLU A OE1 1 
ATOM 747  O OE2 . GLU A 1 99   ? 23.484  71.250 7.704   1.00 136.30 ? 96   GLU A OE2 1 
ATOM 748  N N   . SER A 1 100  ? 22.640  70.166 10.721  1.00 95.35  ? 97   SER A N   1 
ATOM 749  C CA  . SER A 1 100  ? 22.990  68.779 10.980  1.00 95.35  ? 97   SER A CA  1 
ATOM 750  C C   . SER A 1 100  ? 23.505  68.662 12.387  1.00 95.35  ? 97   SER A C   1 
ATOM 751  O O   . SER A 1 100  ? 24.246  69.517 12.863  1.00 95.35  ? 97   SER A O   1 
ATOM 752  C CB  . SER A 1 100  ? 24.034  68.265 10.000  1.00 82.81  ? 97   SER A CB  1 
ATOM 753  O OG  . SER A 1 100  ? 23.399  67.568 8.951   1.00 82.81  ? 97   SER A OG  1 
ATOM 754  N N   . ILE A 1 101  ? 23.080  67.599 13.050  1.00 71.75  ? 98   ILE A N   1 
ATOM 755  C CA  . ILE A 1 101  ? 23.489  67.320 14.412  1.00 71.75  ? 98   ILE A CA  1 
ATOM 756  C C   . ILE A 1 101  ? 24.297  66.046 14.466  1.00 71.75  ? 98   ILE A C   1 
ATOM 757  O O   . ILE A 1 101  ? 23.993  65.040 13.798  1.00 71.75  ? 98   ILE A O   1 
ATOM 758  C CB  . ILE A 1 101  ? 22.294  67.212 15.364  1.00 69.68  ? 98   ILE A CB  1 
ATOM 759  C CG1 . ILE A 1 101  ? 21.159  66.351 14.761  1.00 69.68  ? 98   ILE A CG1 1 
ATOM 760  C CG2 . ILE A 1 101  ? 21.805  68.581 15.760  1.00 69.68  ? 98   ILE A CG2 1 
ATOM 761  C CD1 . ILE A 1 101  ? 20.964  66.436 13.241  1.00 69.68  ? 98   ILE A CD1 1 
ATOM 762  N N   . ASP A 1 102  ? 25.356  66.116 15.258  1.00 69.52  ? 99   ASP A N   1 
ATOM 763  C CA  . ASP A 1 102  ? 26.225  64.973 15.489  1.00 69.52  ? 99   ASP A CA  1 
ATOM 764  C C   . ASP A 1 102  ? 26.650  64.931 16.944  1.00 69.52  ? 99   ASP A C   1 
ATOM 765  O O   . ASP A 1 102  ? 26.920  65.969 17.579  1.00 69.52  ? 99   ASP A O   1 
ATOM 766  C CB  . ASP A 1 102  ? 27.444  65.010 14.562  1.00 89.61  ? 99   ASP A CB  1 
ATOM 767  C CG  . ASP A 1 102  ? 27.078  64.722 13.117  1.00 89.61  ? 99   ASP A CG  1 
ATOM 768  O OD1 . ASP A 1 102  ? 26.973  63.530 12.750  1.00 89.61  ? 99   ASP A OD1 1 
ATOM 769  O OD2 . ASP A 1 102  ? 26.884  65.689 12.348  1.00 89.61  ? 99   ASP A OD2 1 
ATOM 770  N N   . ILE A 1 103  ? 26.663  63.721 17.482  1.00 70.70  ? 100  ILE A N   1 
ATOM 771  C CA  . ILE A 1 103  ? 27.366  63.496 18.719  1.00 70.70  ? 100  ILE A CA  1 
ATOM 772  C C   . ILE A 1 103  ? 28.697  62.859 18.316  1.00 70.70  ? 100  ILE A C   1 
ATOM 773  O O   . ILE A 1 103  ? 28.692  61.749 17.750  1.00 70.70  ? 100  ILE A O   1 
ATOM 774  C CB  . ILE A 1 103  ? 26.571  62.590 19.638  1.00 66.75  ? 100  ILE A CB  1 
ATOM 775  C CG1 . ILE A 1 103  ? 25.382  63.345 20.219  1.00 66.75  ? 100  ILE A CG1 1 
ATOM 776  C CG2 . ILE A 1 103  ? 27.422  62.147 20.766  1.00 66.75  ? 100  ILE A CG2 1 
ATOM 777  C CD1 . ILE A 1 103  ? 24.145  63.270 19.370  1.00 66.75  ? 100  ILE A CD1 1 
ATOM 778  N N   . ILE A 1 104  ? 29.816  63.570 18.554  1.00 58.39  ? 101  ILE A N   1 
ATOM 779  C CA  . ILE A 1 104  ? 31.164  63.086 18.122  1.00 58.39  ? 101  ILE A CA  1 
ATOM 780  C C   . ILE A 1 104  ? 31.988  62.498 19.279  1.00 58.39  ? 101  ILE A C   1 
ATOM 781  O O   . ILE A 1 104  ? 31.953  62.996 20.400  1.00 58.39  ? 101  ILE A O   1 
ATOM 782  C CB  . ILE A 1 104  ? 31.996  64.148 17.282  1.00 78.27  ? 101  ILE A CB  1 
ATOM 783  C CG1 . ILE A 1 104  ? 33.329  63.524 16.784  1.00 78.27  ? 101  ILE A CG1 1 
ATOM 784  C CG2 . ILE A 1 104  ? 32.241  65.432 18.075  1.00 78.27  ? 101  ILE A CG2 1 
ATOM 785  C CD1 . ILE A 1 104  ? 34.217  64.384 15.767  1.00 78.27  ? 101  ILE A CD1 1 
ATOM 786  N N   . THR A 1 105  ? 32.699  61.415 19.000  1.00 52.84  ? 102  THR A N   1 
ATOM 787  C CA  . THR A 1 105  ? 33.535  60.773 20.005  1.00 52.84  ? 102  THR A CA  1 
ATOM 788  C C   . THR A 1 105  ? 34.875  61.445 20.090  1.00 52.84  ? 102  THR A C   1 
ATOM 789  O O   . THR A 1 105  ? 35.725  61.199 19.251  1.00 52.84  ? 102  THR A O   1 
ATOM 790  C CB  . THR A 1 105  ? 33.818  59.338 19.631  1.00 49.80  ? 102  THR A CB  1 
ATOM 791  O OG1 . THR A 1 105  ? 32.581  58.641 19.484  1.00 49.80  ? 102  THR A OG1 1 
ATOM 792  C CG2 . THR A 1 105  ? 34.625  58.688 20.692  1.00 49.80  ? 102  THR A CG2 1 
ATOM 793  N N   . ARG A 1 106  ? 35.056  62.273 21.113  1.00 54.67  ? 103  ARG A N   1 
ATOM 794  C CA  . ARG A 1 106  ? 36.326  62.919 21.414  1.00 54.67  ? 103  ARG A CA  1 
ATOM 795  C C   . ARG A 1 106  ? 37.376  61.945 21.904  1.00 54.67  ? 103  ARG A C   1 
ATOM 796  O O   . ARG A 1 106  ? 38.553  62.199 21.741  1.00 54.67  ? 103  ARG A O   1 
ATOM 797  C CB  . ARG A 1 106  ? 36.135  64.019 22.443  1.00 46.53  ? 103  ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106  ? 35.345  65.163 21.883  1.00 46.53  ? 103  ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106  ? 36.232  66.136 21.098  1.00 46.53  ? 103  ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106  ? 36.472  67.367 21.863  1.00 46.53  ? 103  ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106  ? 37.252  67.475 22.947  1.00 46.53  ? 103  ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106  ? 37.899  66.404 23.428  1.00 46.53  ? 103  ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106  ? 37.352  68.656 23.569  1.00 46.53  ? 103  ARG A NH2 1 
ATOM 804  N N   . ALA A 1 107  ? 36.963  60.826 22.487  1.00 49.18  ? 104  ALA A N   1 
ATOM 805  C CA  . ALA A 1 107  ? 37.920  59.833 22.963  1.00 49.18  ? 104  ALA A CA  1 
ATOM 806  C C   . ALA A 1 107  ? 37.216  58.507 23.186  1.00 49.18  ? 104  ALA A C   1 
ATOM 807  O O   . ALA A 1 107  ? 36.006  58.505 23.310  1.00 49.18  ? 104  ALA A O   1 
ATOM 808  C CB  . ALA A 1 107  ? 38.523  60.292 24.248  1.00 17.16  ? 104  ALA A CB  1 
ATOM 809  N N   . HIS A 1 108  ? 37.957  57.398 23.275  1.00 47.92  ? 105  HIS A N   1 
ATOM 810  C CA  . HIS A 1 108  ? 37.341  56.124 23.575  1.00 47.92  ? 105  HIS A CA  1 
ATOM 811  C C   . HIS A 1 108  ? 38.319  55.007 23.780  1.00 47.92  ? 105  HIS A C   1 
ATOM 812  O O   . HIS A 1 108  ? 39.282  54.881 23.068  1.00 47.92  ? 105  HIS A O   1 
ATOM 813  C CB  . HIS A 1 108  ? 36.452  55.708 22.431  1.00 67.17  ? 105  HIS A CB  1 
ATOM 814  C CG  . HIS A 1 108  ? 37.213  55.260 21.238  1.00 67.17  ? 105  HIS A CG  1 
ATOM 815  N ND1 . HIS A 1 108  ? 37.884  56.140 20.420  1.00 67.17  ? 105  HIS A ND1 1 
ATOM 816  C CD2 . HIS A 1 108  ? 37.440  54.022 20.742  1.00 67.17  ? 105  HIS A CD2 1 
ATOM 817  C CE1 . HIS A 1 108  ? 38.470  55.460 19.453  1.00 67.17  ? 105  HIS A CE1 1 
ATOM 818  N NE2 . HIS A 1 108  ? 38.221  54.173 19.629  1.00 67.17  ? 105  HIS A NE2 1 
ATOM 819  N N   . GLY A 1 109  ? 38.037  54.127 24.715  1.00 46.04  ? 106  GLY A N   1 
ATOM 820  C CA  . GLY A 1 109  ? 38.824  52.909 24.820  1.00 46.04  ? 106  GLY A CA  1 
ATOM 821  C C   . GLY A 1 109  ? 38.114  51.887 25.660  1.00 46.04  ? 106  GLY A C   1 
ATOM 822  O O   . GLY A 1 109  ? 37.294  52.237 26.483  1.00 46.04  ? 106  GLY A O   1 
ATOM 823  N N   . ASN A 1 110  ? 38.417  50.615 25.468  1.00 45.70  ? 107  ASN A N   1 
ATOM 824  C CA  . ASN A 1 110  ? 37.830  49.628 26.343  1.00 45.70  ? 107  ASN A CA  1 
ATOM 825  C C   . ASN A 1 110  ? 38.614  49.458 27.635  1.00 45.70  ? 107  ASN A C   1 
ATOM 826  O O   . ASN A 1 110  ? 39.793  49.025 27.615  1.00 45.70  ? 107  ASN A O   1 
ATOM 827  C CB  . ASN A 1 110  ? 37.634  48.315 25.635  1.00 41.18  ? 107  ASN A CB  1 
ATOM 828  C CG  . ASN A 1 110  ? 36.802  47.397 26.422  1.00 41.18  ? 107  ASN A CG  1 
ATOM 829  O OD1 . ASN A 1 110  ? 37.230  46.900 27.442  1.00 41.18  ? 107  ASN A OD1 1 
ATOM 830  N ND2 . ASN A 1 110  ? 35.574  47.179 25.981  1.00 41.18  ? 107  ASN A ND2 1 
ATOM 831  N N   . VAL A 1 111  ? 37.941  49.779 28.748  1.00 43.95  ? 108  VAL A N   1 
ATOM 832  C CA  . VAL A 1 111  ? 38.561  49.764 30.085  1.00 43.95  ? 108  VAL A CA  1 
ATOM 833  C C   . VAL A 1 111  ? 38.525  48.495 30.951  1.00 43.95  ? 108  VAL A C   1 
ATOM 834  O O   . VAL A 1 111  ? 38.963  48.509 32.105  1.00 43.95  ? 108  VAL A O   1 
ATOM 835  C CB  . VAL A 1 111  ? 38.084  50.933 30.970  1.00 27.38  ? 108  VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 111  ? 38.535  52.253 30.405  1.00 27.38  ? 108  VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 111  ? 36.555  50.892 31.184  1.00 27.38  ? 108  VAL A CG2 1 
ATOM 838  N N   . GLN A 1 112  ? 38.036  47.394 30.421  1.00 50.96  ? 109  GLN A N   1 
ATOM 839  C CA  . GLN A 1 112  ? 37.984  46.195 31.238  1.00 50.96  ? 109  GLN A CA  1 
ATOM 840  C C   . GLN A 1 112  ? 39.367  45.650 31.474  1.00 50.96  ? 109  GLN A C   1 
ATOM 841  O O   . GLN A 1 112  ? 40.313  46.054 30.785  1.00 50.96  ? 109  GLN A O   1 
ATOM 842  C CB  . GLN A 1 112  ? 37.172  45.127 30.550  1.00 68.46  ? 109  GLN A CB  1 
ATOM 843  C CG  . GLN A 1 112  ? 37.474  45.052 29.107  1.00 68.46  ? 109  GLN A CG  1 
ATOM 844  C CD  . GLN A 1 112  ? 37.473  43.681 28.625  1.00 68.46  ? 109  GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 112  ? 37.452  43.456 27.426  1.00 68.46  ? 109  GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 112  ? 37.503  42.726 29.548  1.00 68.46  ? 109  GLN A NE2 1 
ATOM 847  N N   . ASP A 1 113  ? 39.459  44.730 32.438  1.00 66.01  ? 110  ASP A N   1 
ATOM 848  C CA  . ASP A 1 113  ? 40.684  44.058 32.834  1.00 66.01  ? 110  ASP A CA  1 
ATOM 849  C C   . ASP A 1 113  ? 40.350  42.589 32.905  1.00 66.01  ? 110  ASP A C   1 
ATOM 850  O O   . ASP A 1 113  ? 39.239  42.254 33.339  1.00 66.01  ? 110  ASP A O   1 
ATOM 851  C CB  . ASP A 1 113  ? 41.084  44.523 34.219  1.00 54.88  ? 110  ASP A CB  1 
ATOM 852  C CG  . ASP A 1 113  ? 41.253  46.030 34.296  1.00 54.88  ? 110  ASP A CG  1 
ATOM 853  O OD1 . ASP A 1 113  ? 41.302  46.689 33.230  1.00 54.88  ? 110  ASP A OD1 1 
ATOM 854  O OD2 . ASP A 1 113  ? 41.354  46.585 35.418  1.00 54.88  ? 110  ASP A OD2 1 
ATOM 855  N N   . ARG A 1 114  ? 41.290  41.713 32.502  1.00 73.10  ? 111  ARG A N   1 
ATOM 856  C CA  . ARG A 1 114  ? 41.069  40.253 32.469  1.00 73.10  ? 111  ARG A CA  1 
ATOM 857  C C   . ARG A 1 114  ? 40.963  39.721 33.889  1.00 73.10  ? 111  ARG A C   1 
ATOM 858  O O   . ARG A 1 114  ? 40.258  38.751 34.172  1.00 73.10  ? 111  ARG A O   1 
ATOM 859  C CB  . ARG A 1 114  ? 42.231  39.565 31.764  1.00 161.09 ? 111  ARG A CB  1 
ATOM 860  C CG  . ARG A 1 114  ? 41.886  38.210 31.175  1.00 161.09 ? 111  ARG A CG  1 
ATOM 861  C CD  . ARG A 1 114  ? 41.282  38.372 29.800  1.00 161.09 ? 111  ARG A CD  1 
ATOM 862  N NE  . ARG A 1 114  ? 42.124  39.221 28.965  1.00 161.09 ? 111  ARG A NE  1 
ATOM 863  C CZ  . ARG A 1 114  ? 41.666  40.059 28.043  1.00 161.09 ? 111  ARG A CZ  1 
ATOM 864  N NH1 . ARG A 1 114  ? 40.362  40.173 27.827  1.00 161.09 ? 111  ARG A NH1 1 
ATOM 865  N NH2 . ARG A 1 114  ? 42.517  40.792 27.343  1.00 161.09 ? 111  ARG A NH2 1 
ATOM 866  N N   . ILE A 1 115  ? 41.725  40.370 34.756  1.00 118.89 ? 112  ILE A N   1 
ATOM 867  C CA  . ILE A 1 115  ? 41.676  40.186 36.183  1.00 118.89 ? 112  ILE A CA  1 
ATOM 868  C C   . ILE A 1 115  ? 40.491  40.973 36.678  1.00 118.89 ? 112  ILE A C   1 
ATOM 869  O O   . ILE A 1 115  ? 40.173  42.036 36.155  1.00 118.89 ? 112  ILE A O   1 
ATOM 870  C CB  . ILE A 1 115  ? 42.947  40.781 36.819  1.00 64.43  ? 112  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 115  ? 44.128  39.844 36.621  1.00 64.43  ? 112  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 115  ? 42.737  41.149 38.290  1.00 64.43  ? 112  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 115  ? 44.584  39.832 35.194  1.00 64.43  ? 112  ILE A CD1 1 
ATOM 874  N N   . GLY A 1 116  ? 39.836  40.451 37.697  1.00 75.55  ? 113  GLY A N   1 
ATOM 875  C CA  . GLY A 1 116  ? 38.721  41.162 38.295  1.00 75.55  ? 113  GLY A CA  1 
ATOM 876  C C   . GLY A 1 116  ? 37.409  40.411 38.272  1.00 75.55  ? 113  GLY A C   1 
ATOM 877  O O   . GLY A 1 116  ? 36.942  39.977 37.209  1.00 75.55  ? 113  GLY A O   1 
ATOM 878  N N   . ARG A 1 117  ? 36.834  40.243 39.461  1.00 66.79  ? 114  ARG A N   1 
ATOM 879  C CA  . ARG A 1 117  ? 35.486  39.714 39.618  1.00 66.79  ? 114  ARG A CA  1 
ATOM 880  C C   . ARG A 1 117  ? 34.636  40.940 39.907  1.00 66.79  ? 114  ARG A C   1 
ATOM 881  O O   . ARG A 1 117  ? 34.908  41.645 40.896  1.00 66.79  ? 114  ARG A O   1 
ATOM 882  C CB  . ARG A 1 117  ? 35.415  38.708 40.778  1.00 107.45 ? 114  ARG A CB  1 
ATOM 883  C CG  . ARG A 1 117  ? 33.989  38.230 41.126  1.00 107.45 ? 114  ARG A CG  1 
ATOM 884  C CD  . ARG A 1 117  ? 33.856  37.724 42.561  1.00 107.45 ? 114  ARG A CD  1 
ATOM 885  N NE  . ARG A 1 117  ? 34.727  38.449 43.488  1.00 107.45 ? 114  ARG A NE  1 
ATOM 886  C CZ  . ARG A 1 117  ? 34.522  38.548 44.797  1.00 107.45 ? 114  ARG A CZ  1 
ATOM 887  N NH1 . ARG A 1 117  ? 33.454  37.985 45.349  1.00 107.45 ? 114  ARG A NH1 1 
ATOM 888  N NH2 . ARG A 1 117  ? 35.380  39.222 45.557  1.00 107.45 ? 114  ARG A NH2 1 
ATOM 889  N N   . PRO A 1 118  ? 33.598  41.194 39.067  1.00 64.44  ? 115  PRO A N   1 
ATOM 890  C CA  . PRO A 1 118  ? 32.937  42.502 39.092  1.00 64.44  ? 115  PRO A CA  1 
ATOM 891  C C   . PRO A 1 118  ? 32.141  42.591 40.380  1.00 64.44  ? 115  PRO A C   1 
ATOM 892  O O   . PRO A 1 118  ? 31.778  41.550 40.921  1.00 64.44  ? 115  PRO A O   1 
ATOM 893  C CB  . PRO A 1 118  ? 32.043  42.478 37.856  1.00 45.39  ? 115  PRO A CB  1 
ATOM 894  C CG  . PRO A 1 118  ? 32.429  41.227 37.090  1.00 45.39  ? 115  PRO A CG  1 
ATOM 895  C CD  . PRO A 1 118  ? 32.925  40.286 38.124  1.00 45.39  ? 115  PRO A CD  1 
ATOM 896  N N   . SER A 1 119  ? 31.894  43.794 40.882  1.00 55.50  ? 116  SER A N   1 
ATOM 897  C CA  . SER A 1 119  ? 31.807  43.934 42.327  1.00 55.50  ? 116  SER A CA  1 
ATOM 898  C C   . SER A 1 119  ? 30.415  44.003 42.967  1.00 55.50  ? 116  SER A C   1 
ATOM 899  O O   . SER A 1 119  ? 29.420  43.562 42.394  1.00 55.50  ? 116  SER A O   1 
ATOM 900  C CB  . SER A 1 119  ? 32.724  45.083 42.807  1.00 43.80  ? 116  SER A CB  1 
ATOM 901  O OG  . SER A 1 119  ? 32.187  46.360 42.521  1.00 43.80  ? 116  SER A OG  1 
ATOM 902  N N   . GLU A 1 120  ? 30.379  44.524 44.188  1.00 157.04 ? 117  GLU A N   1 
ATOM 903  C CA  . GLU A 1 120  ? 29.159  44.625 44.953  1.00 157.04 ? 117  GLU A CA  1 
ATOM 904  C C   . GLU A 1 120  ? 28.643  46.050 44.905  1.00 157.04 ? 117  GLU A C   1 
ATOM 905  O O   . GLU A 1 120  ? 29.244  46.948 45.502  1.00 157.04 ? 117  GLU A O   1 
ATOM 906  C CB  . GLU A 1 120  ? 29.413  44.184 46.394  1.00 114.35 ? 117  GLU A CB  1 
ATOM 907  C CG  . GLU A 1 120  ? 28.155  44.082 47.265  1.00 114.35 ? 117  GLU A CG  1 
ATOM 908  C CD  . GLU A 1 120  ? 26.963  43.411 46.570  1.00 114.35 ? 117  GLU A CD  1 
ATOM 909  O OE1 . GLU A 1 120  ? 26.826  43.517 45.316  1.00 114.35 ? 117  GLU A OE1 1 
ATOM 910  O OE2 . GLU A 1 120  ? 26.151  42.798 47.301  1.00 114.35 ? 117  GLU A OE2 1 
ATOM 911  N N   . THR A 1 121  ? 27.517  46.230 44.209  1.00 75.20  ? 118  THR A N   1 
ATOM 912  C CA  . THR A 1 121  ? 26.958  47.555 43.831  1.00 75.20  ? 118  THR A CA  1 
ATOM 913  C C   . THR A 1 121  ? 27.209  47.872 42.344  1.00 75.20  ? 118  THR A C   1 
ATOM 914  O O   . THR A 1 121  ? 26.852  48.967 41.850  1.00 75.20  ? 118  THR A O   1 
ATOM 915  C CB  . THR A 1 121  ? 27.436  48.745 44.737  1.00 103.02 ? 118  THR A CB  1 
ATOM 916  O OG1 . THR A 1 121  ? 27.377  48.363 46.118  1.00 103.02 ? 118  THR A OG1 1 
ATOM 917  C CG2 . THR A 1 121  ? 26.573  50.039 44.500  1.00 103.02 ? 118  THR A CG2 1 
ATOM 918  N N   . GLY A 1 122  ? 27.808  46.892 41.654  1.00 56.79  ? 119  GLY A N   1 
ATOM 919  C CA  . GLY A 1 122  ? 28.152  46.971 40.226  1.00 56.79  ? 119  GLY A CA  1 
ATOM 920  C C   . GLY A 1 122  ? 29.100  48.098 39.815  1.00 56.79  ? 119  GLY A C   1 
ATOM 921  O O   . GLY A 1 122  ? 29.857  48.646 40.642  1.00 56.79  ? 119  GLY A O   1 
ATOM 922  N N   . ILE A 1 123  ? 29.061  48.457 38.535  1.00 33.69  ? 120  ILE A N   1 
ATOM 923  C CA  . ILE A 1 123  ? 29.964  49.467 38.038  1.00 33.69  ? 120  ILE A CA  1 
ATOM 924  C C   . ILE A 1 123  ? 29.593  50.765 38.710  1.00 33.69  ? 120  ILE A C   1 
ATOM 925  O O   . ILE A 1 123  ? 28.424  50.988 38.982  1.00 33.69  ? 120  ILE A O   1 
ATOM 926  C CB  . ILE A 1 123  ? 29.856  49.668 36.504  1.00 30.05  ? 120  ILE A CB  1 
ATOM 927  C CG1 . ILE A 1 123  ? 30.608  48.563 35.767  1.00 30.05  ? 120  ILE A CG1 1 
ATOM 928  C CG2 . ILE A 1 123  ? 30.377  51.079 36.114  1.00 30.05  ? 120  ILE A CG2 1 
ATOM 929  C CD1 . ILE A 1 123  ? 29.891  48.024 34.542  1.00 30.05  ? 120  ILE A CD1 1 
ATOM 930  N N   . ILE A 1 124  ? 30.600  51.597 38.983  1.00 48.39  ? 121  ILE A N   1 
ATOM 931  C CA  . ILE A 1 124  ? 30.441  52.924 39.564  1.00 48.39  ? 121  ILE A CA  1 
ATOM 932  C C   . ILE A 1 124  ? 31.542  53.740 38.951  1.00 48.39  ? 121  ILE A C   1 
ATOM 933  O O   . ILE A 1 124  ? 32.705  53.400 39.134  1.00 48.39  ? 121  ILE A O   1 
ATOM 934  C CB  . ILE A 1 124  ? 30.745  52.938 41.081  1.00 47.45  ? 121  ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 124  ? 30.009  51.822 41.823  1.00 47.45  ? 121  ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 124  ? 30.501  54.316 41.680  1.00 47.45  ? 121  ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 124  ? 30.480  51.680 43.248  1.00 47.45  ? 121  ILE A CD1 1 
ATOM 938  N N   . GLY A 1 125  ? 31.199  54.818 38.254  1.00 46.28  ? 122  GLY A N   1 
ATOM 939  C CA  . GLY A 1 125  ? 32.202  55.675 37.632  1.00 46.28  ? 122  GLY A CA  1 
ATOM 940  C C   . GLY A 1 125  ? 31.999  57.103 38.085  1.00 46.28  ? 122  GLY A C   1 
ATOM 941  O O   . GLY A 1 125  ? 30.922  57.652 37.964  1.00 46.28  ? 122  GLY A O   1 
ATOM 942  N N   . ILE A 1 126  ? 33.031  57.735 38.606  1.00 39.99  ? 123  ILE A N   1 
ATOM 943  C CA  . ILE A 1 126  ? 32.831  59.051 39.197  1.00 39.99  ? 123  ILE A CA  1 
ATOM 944  C C   . ILE A 1 126  ? 33.897  59.969 38.629  1.00 39.99  ? 123  ILE A C   1 
ATOM 945  O O   . ILE A 1 126  ? 34.871  59.469 38.072  1.00 39.99  ? 123  ILE A O   1 
ATOM 946  C CB  . ILE A 1 126  ? 32.877  58.937 40.734  1.00 35.65  ? 123  ILE A CB  1 
ATOM 947  C CG1 . ILE A 1 126  ? 34.317  58.565 41.166  1.00 35.65  ? 123  ILE A CG1 1 
ATOM 948  C CG2 . ILE A 1 126  ? 31.755  57.883 41.231  1.00 35.65  ? 123  ILE A CG2 1 
ATOM 949  C CD1 . ILE A 1 126  ? 34.418  57.811 42.523  1.00 35.65  ? 123  ILE A CD1 1 
ATOM 950  N N   . ILE A 1 127  ? 33.708  61.284 38.743  1.00 50.00  ? 124  ILE A N   1 
ATOM 951  C CA  . ILE A 1 127  ? 34.605  62.259 38.118  1.00 50.00  ? 124  ILE A CA  1 
ATOM 952  C C   . ILE A 1 127  ? 34.929  63.414 39.090  1.00 50.00  ? 124  ILE A C   1 
ATOM 953  O O   . ILE A 1 127  ? 34.037  64.052 39.633  1.00 50.00  ? 124  ILE A O   1 
ATOM 954  C CB  . ILE A 1 127  ? 33.970  62.824 36.829  1.00 33.32  ? 124  ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127  ? 33.880  61.766 35.741  1.00 33.32  ? 124  ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127  ? 34.753  64.029 36.260  1.00 33.32  ? 124  ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127  ? 33.794  62.414 34.350  1.00 33.32  ? 124  ILE A CD1 1 
ATOM 958  N N   . ASP A 1 128  ? 36.210  63.691 39.303  1.00 61.66  ? 125  ASP A N   1 
ATOM 959  C CA  . ASP A 1 128  ? 36.627  64.674 40.314  1.00 61.66  ? 125  ASP A CA  1 
ATOM 960  C C   . ASP A 1 128  ? 36.102  66.044 39.929  1.00 61.66  ? 125  ASP A C   1 
ATOM 961  O O   . ASP A 1 128  ? 35.978  66.320 38.741  1.00 61.66  ? 125  ASP A O   1 
ATOM 962  C CB  . ASP A 1 128  ? 38.153  64.648 40.490  1.00 117.49 ? 125  ASP A CB  1 
ATOM 963  C CG  . ASP A 1 128  ? 38.780  66.022 40.394  1.00 117.49 ? 125  ASP A CG  1 
ATOM 964  O OD1 . ASP A 1 128  ? 39.158  66.590 41.440  1.00 117.49 ? 125  ASP A OD1 1 
ATOM 965  O OD2 . ASP A 1 128  ? 38.892  66.538 39.266  1.00 117.49 ? 125  ASP A OD2 1 
ATOM 966  N N   . PRO A 1 129  ? 35.773  66.899 40.929  1.00 57.78  ? 126  PRO A N   1 
ATOM 967  C CA  . PRO A 1 129  ? 35.359  68.285 40.683  1.00 57.78  ? 126  PRO A CA  1 
ATOM 968  C C   . PRO A 1 129  ? 36.271  69.039 39.702  1.00 57.78  ? 126  PRO A C   1 
ATOM 969  O O   . PRO A 1 129  ? 35.771  69.628 38.750  1.00 57.78  ? 126  PRO A O   1 
ATOM 970  C CB  . PRO A 1 129  ? 35.464  68.918 42.069  1.00 60.88  ? 126  PRO A CB  1 
ATOM 971  C CG  . PRO A 1 129  ? 35.166  67.798 43.002  1.00 60.88  ? 126  PRO A CG  1 
ATOM 972  C CD  . PRO A 1 129  ? 35.805  66.598 42.378  1.00 60.88  ? 126  PRO A CD  1 
ATOM 973  N N   . GLU A 1 130  ? 37.585  69.013 39.909  1.00 69.73  ? 127  GLU A N   1 
ATOM 974  C CA  . GLU A 1 130  ? 38.498  69.789 39.060  1.00 69.73  ? 127  GLU A CA  1 
ATOM 975  C C   . GLU A 1 130  ? 38.663  69.241 37.649  1.00 69.73  ? 127  GLU A C   1 
ATOM 976  O O   . GLU A 1 130  ? 39.263  69.908 36.776  1.00 69.73  ? 127  GLU A O   1 
ATOM 977  C CB  . GLU A 1 130  ? 39.867  69.867 39.693  1.00 110.62 ? 127  GLU A CB  1 
ATOM 978  C CG  . GLU A 1 130  ? 39.975  70.923 40.730  1.00 110.62 ? 127  GLU A CG  1 
ATOM 979  C CD  . GLU A 1 130  ? 41.037  70.573 41.747  1.00 110.62 ? 127  GLU A CD  1 
ATOM 980  O OE1 . GLU A 1 130  ? 40.994  71.196 42.832  1.00 110.62 ? 127  GLU A OE1 1 
ATOM 981  O OE2 . GLU A 1 130  ? 41.898  69.683 41.481  1.00 110.62 ? 127  GLU A OE2 1 
ATOM 982  N N   . CYS A 1 131  ? 38.148  68.026 37.438  1.00 51.17  ? 128  CYS A N   1 
ATOM 983  C CA  . CYS A 1 131  ? 38.216  67.340 36.145  1.00 51.17  ? 128  CYS A CA  1 
ATOM 984  C C   . CYS A 1 131  ? 39.610  66.876 35.795  1.00 51.17  ? 128  CYS A C   1 
ATOM 985  O O   . CYS A 1 131  ? 39.970  66.736 34.619  1.00 51.17  ? 128  CYS A O   1 
ATOM 986  C CB  . CYS A 1 131  ? 37.620  68.175 35.019  1.00 66.63  ? 128  CYS A CB  1 
ATOM 987  S SG  . CYS A 1 131  ? 36.039  67.519 34.512  1.00 66.63  ? 128  CYS A SG  1 
ATOM 988  N N   . ARG A 1 132  ? 40.377  66.609 36.837  1.00 119.38 ? 129  ARG A N   1 
ATOM 989  C CA  . ARG A 1 132  ? 41.666  65.993 36.678  1.00 119.38 ? 129  ARG A CA  1 
ATOM 990  C C   . ARG A 1 132  ? 41.518  64.515 36.266  1.00 119.38 ? 129  ARG A C   1 
ATOM 991  O O   . ARG A 1 132  ? 42.458  63.935 35.718  1.00 119.38 ? 129  ARG A O   1 
ATOM 992  C CB  . ARG A 1 132  ? 42.494  66.165 37.963  1.00 136.16 ? 129  ARG A CB  1 
ATOM 993  C CG  . ARG A 1 132  ? 42.911  67.624 38.275  1.00 136.16 ? 129  ARG A CG  1 
ATOM 994  C CD  . ARG A 1 132  ? 44.310  67.963 37.738  1.00 136.16 ? 129  ARG A CD  1 
ATOM 995  N NE  . ARG A 1 132  ? 45.361  67.172 38.396  1.00 136.16 ? 129  ARG A NE  1 
ATOM 996  C CZ  . ARG A 1 132  ? 46.050  67.564 39.470  1.00 136.16 ? 129  ARG A CZ  1 
ATOM 997  N NH1 . ARG A 1 132  ? 45.822  68.757 40.026  1.00 136.16 ? 129  ARG A NH1 1 
ATOM 998  N NH2 . ARG A 1 132  ? 46.974  66.761 39.990  1.00 136.16 ? 129  ARG A NH2 1 
ATOM 999  N N   . MET A 1 133  ? 40.345  63.911 36.488  1.00 98.35  ? 130  MET A N   1 
ATOM 1000 C CA  . MET A 1 133  ? 40.188  62.479 36.197  1.00 98.35  ? 130  MET A CA  1 
ATOM 1001 C C   . MET A 1 133  ? 38.811  61.835 36.350  1.00 98.35  ? 130  MET A C   1 
ATOM 1002 O O   . MET A 1 133  ? 37.844  62.473 36.771  1.00 98.35  ? 130  MET A O   1 
ATOM 1003 C CB  . MET A 1 133  ? 41.139  61.687 37.067  1.00 63.16  ? 130  MET A CB  1 
ATOM 1004 C CG  . MET A 1 133  ? 41.064  62.081 38.517  1.00 63.16  ? 130  MET A CG  1 
ATOM 1005 S SD  . MET A 1 133  ? 41.217  60.597 39.501  1.00 63.16  ? 130  MET A SD  1 
ATOM 1006 C CE  . MET A 1 133  ? 42.271  61.235 40.780  1.00 63.16  ? 130  MET A CE  1 
ATOM 1007 N N   . ILE A 1 134  ? 38.774  60.541 36.012  1.00 43.87  ? 131  ILE A N   1 
ATOM 1008 C CA  . ILE A 1 134  ? 37.600  59.692 36.131  1.00 43.87  ? 131  ILE A CA  1 
ATOM 1009 C C   . ILE A 1 134  ? 38.042  58.460 36.911  1.00 43.87  ? 131  ILE A C   1 
ATOM 1010 O O   . ILE A 1 134  ? 39.110  57.893 36.639  1.00 43.87  ? 131  ILE A O   1 
ATOM 1011 C CB  . ILE A 1 134  ? 37.080  59.225 34.781  1.00 52.44  ? 131  ILE A CB  1 
ATOM 1012 C CG1 . ILE A 1 134  ? 36.709  60.414 33.915  1.00 52.44  ? 131  ILE A CG1 1 
ATOM 1013 C CG2 . ILE A 1 134  ? 35.904  58.281 34.965  1.00 52.44  ? 131  ILE A CG2 1 
ATOM 1014 C CD1 . ILE A 1 134  ? 36.142  60.023 32.592  1.00 52.44  ? 131  ILE A CD1 1 
ATOM 1015 N N   . GLY A 1 135  ? 37.236  58.061 37.893  1.00 40.72  ? 132  GLY A N   1 
ATOM 1016 C CA  . GLY A 1 135  ? 37.571  56.949 38.750  1.00 40.72  ? 132  GLY A CA  1 
ATOM 1017 C C   . GLY A 1 135  ? 36.519  55.870 38.569  1.00 40.72  ? 132  GLY A C   1 
ATOM 1018 O O   . GLY A 1 135  ? 35.325  56.170 38.423  1.00 40.72  ? 132  GLY A O   1 
ATOM 1019 N N   . LEU A 1 136  ? 36.952  54.620 38.592  1.00 53.01  ? 133  LEU A N   1 
ATOM 1020 C CA  . LEU A 1 136  ? 36.068  53.541 38.268  1.00 53.01  ? 133  LEU A CA  1 
ATOM 1021 C C   . LEU A 1 136  ? 36.180  52.418 39.279  1.00 53.01  ? 133  LEU A C   1 
ATOM 1022 O O   . LEU A 1 136  ? 37.256  52.137 39.833  1.00 53.01  ? 133  LEU A O   1 
ATOM 1023 C CB  . LEU A 1 136  ? 36.388  53.016 36.886  1.00 44.78  ? 133  LEU A CB  1 
ATOM 1024 C CG  . LEU A 1 136  ? 35.711  53.509 35.612  1.00 44.78  ? 133  LEU A CG  1 
ATOM 1025 C CD1 . LEU A 1 136  ? 35.331  54.996 35.570  1.00 44.78  ? 133  LEU A CD1 1 
ATOM 1026 C CD2 . LEU A 1 136  ? 36.650  53.134 34.452  1.00 44.78  ? 133  LEU A CD2 1 
ATOM 1027 N N   . ARG A 1 137  ? 35.045  51.796 39.542  1.00 52.11  ? 134  ARG A N   1 
ATOM 1028 C CA  . ARG A 1 137  ? 35.038  50.680 40.389  1.00 52.11  ? 134  ARG A CA  1 
ATOM 1029 C C   . ARG A 1 137  ? 34.361  49.645 39.533  1.00 52.11  ? 134  ARG A C   1 
ATOM 1030 O O   . ARG A 1 137  ? 33.150  49.532 39.503  1.00 52.11  ? 134  ARG A O   1 
ATOM 1031 C CB  . ARG A 1 137  ? 34.297  51.004 41.665  1.00 47.58  ? 134  ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 137  ? 34.776  50.229 42.874  1.00 47.58  ? 134  ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 137  ? 34.289  48.804 42.882  1.00 47.58  ? 134  ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 137  ? 32.874  48.732 42.561  1.00 47.58  ? 134  ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 137  ? 31.893  48.527 43.438  1.00 47.58  ? 134  ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 137  ? 32.154  48.333 44.733  1.00 47.58  ? 134  ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 137  ? 30.639  48.496 43.000  1.00 47.58  ? 134  ARG A NH2 1 
ATOM 1038 N N   . LEU A 1 138  ? 35.157  48.920 38.769  1.00 51.91  ? 135  LEU A N   1 
ATOM 1039 C CA  . LEU A 1 138  ? 34.609  47.863 37.988  1.00 51.91  ? 135  LEU A CA  1 
ATOM 1040 C C   . LEU A 1 138  ? 34.802  46.601 38.794  1.00 51.91  ? 135  LEU A C   1 
ATOM 1041 O O   . LEU A 1 138  ? 33.936  45.722 38.805  1.00 51.91  ? 135  LEU A O   1 
ATOM 1042 C CB  . LEU A 1 138  ? 35.274  47.785 36.619  1.00 42.49  ? 135  LEU A CB  1 
ATOM 1043 C CG  . LEU A 1 138  ? 35.371  49.023 35.693  1.00 42.49  ? 135  LEU A CG  1 
ATOM 1044 C CD1 . LEU A 1 138  ? 34.024  49.637 35.170  1.00 42.49  ? 135  LEU A CD1 1 
ATOM 1045 C CD2 . LEU A 1 138  ? 36.192  50.109 36.350  1.00 42.49  ? 135  LEU A CD2 1 
ATOM 1046 N N   . TYR A 1 139  ? 35.912  46.506 39.515  1.00 58.57  ? 136  TYR A N   1 
ATOM 1047 C CA  . TYR A 1 139  ? 36.177  45.261 40.228  1.00 58.57  ? 136  TYR A CA  1 
ATOM 1048 C C   . TYR A 1 139  ? 36.479  45.467 41.704  1.00 58.57  ? 136  TYR A C   1 
ATOM 1049 O O   . TYR A 1 139  ? 37.016  46.507 42.106  1.00 58.57  ? 136  TYR A O   1 
ATOM 1050 C CB  . TYR A 1 139  ? 37.323  44.513 39.540  1.00 50.30  ? 136  TYR A CB  1 
ATOM 1051 C CG  . TYR A 1 139  ? 37.170  44.398 38.035  1.00 50.30  ? 136  TYR A CG  1 
ATOM 1052 C CD1 . TYR A 1 139  ? 37.888  45.214 37.161  1.00 50.30  ? 136  TYR A CD1 1 
ATOM 1053 C CD2 . TYR A 1 139  ? 36.284  43.487 37.496  1.00 50.30  ? 136  TYR A CD2 1 
ATOM 1054 C CE1 . TYR A 1 139  ? 37.724  45.091 35.799  1.00 50.30  ? 136  TYR A CE1 1 
ATOM 1055 C CE2 . TYR A 1 139  ? 36.130  43.369 36.159  1.00 50.30  ? 136  TYR A CE2 1 
ATOM 1056 C CZ  . TYR A 1 139  ? 36.843  44.158 35.324  1.00 50.30  ? 136  TYR A CZ  1 
ATOM 1057 O OH  . TYR A 1 139  ? 36.623  43.960 34.000  1.00 50.30  ? 136  TYR A OH  1 
ATOM 1058 N N   . ASP A 1 140  ? 36.124  44.472 42.509  1.00 42.47  ? 137  ASP A N   1 
ATOM 1059 C CA  . ASP A 1 140  ? 36.583  44.393 43.909  1.00 42.47  ? 137  ASP A CA  1 
ATOM 1060 C C   . ASP A 1 140  ? 38.094  44.523 43.972  1.00 42.47  ? 137  ASP A C   1 
ATOM 1061 O O   . ASP A 1 140  ? 38.787  44.006 43.117  1.00 42.47  ? 137  ASP A O   1 
ATOM 1062 C CB  . ASP A 1 140  ? 36.146  43.067 44.541  1.00 60.37  ? 137  ASP A CB  1 
ATOM 1063 C CG  . ASP A 1 140  ? 34.672  43.058 44.865  1.00 60.37  ? 137  ASP A CG  1 
ATOM 1064 O OD1 . ASP A 1 140  ? 34.195  44.114 45.352  1.00 60.37  ? 137  ASP A OD1 1 
ATOM 1065 O OD2 . ASP A 1 140  ? 33.974  42.047 44.610  1.00 60.37  ? 137  ASP A OD2 1 
ATOM 1066 N N   . GLY A 1 141  ? 38.613  45.223 44.962  1.00 59.22  ? 138  GLY A N   1 
ATOM 1067 C CA  . GLY A 1 141  ? 40.050  45.252 45.124  1.00 59.22  ? 138  GLY A CA  1 
ATOM 1068 C C   . GLY A 1 141  ? 40.709  46.323 44.280  1.00 59.22  ? 138  GLY A C   1 
ATOM 1069 O O   . GLY A 1 141  ? 41.651  46.962 44.725  1.00 59.22  ? 138  GLY A O   1 
ATOM 1070 N N   . LEU A 1 142  ? 40.247  46.543 43.061  1.00 45.18  ? 139  LEU A N   1 
ATOM 1071 C CA  . LEU A 1 142  ? 40.935  47.540 42.258  1.00 45.18  ? 139  LEU A CA  1 
ATOM 1072 C C   . LEU A 1 142  ? 40.143  48.786 42.166  1.00 45.18  ? 139  LEU A C   1 
ATOM 1073 O O   . LEU A 1 142  ? 38.930  48.769 42.394  1.00 45.18  ? 139  LEU A O   1 
ATOM 1074 C CB  . LEU A 1 142  ? 41.171  47.068 40.843  1.00 38.98  ? 139  LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 142  ? 42.128  45.902 40.719  1.00 38.98  ? 139  LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 142  ? 41.730  45.126 39.449  1.00 38.98  ? 139  LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 142  ? 43.534  46.439 40.679  1.00 38.98  ? 139  LEU A CD2 1 
ATOM 1078 N N   . PHE A 1 143  ? 40.831  49.857 41.812  1.00 51.74  ? 140  PHE A N   1 
ATOM 1079 C CA  . PHE A 1 143  ? 40.200  51.097 41.542  1.00 51.74  ? 140  PHE A CA  1 
ATOM 1080 C C   . PHE A 1 143  ? 40.911  51.685 40.329  1.00 51.74  ? 140  PHE A C   1 
ATOM 1081 O O   . PHE A 1 143  ? 42.035  52.172 40.424  1.00 51.74  ? 140  PHE A O   1 
ATOM 1082 C CB  . PHE A 1 143  ? 40.297  52.010 42.755  1.00 48.99  ? 140  PHE A CB  1 
ATOM 1083 C CG  . PHE A 1 143  ? 39.701  53.359 42.524  1.00 48.99  ? 140  PHE A CG  1 
ATOM 1084 C CD1 . PHE A 1 143  ? 38.319  53.549 42.600  1.00 48.99  ? 140  PHE A CD1 1 
ATOM 1085 C CD2 . PHE A 1 143  ? 40.513  54.454 42.168  1.00 48.99  ? 140  PHE A CD2 1 
ATOM 1086 C CE1 . PHE A 1 143  ? 37.749  54.840 42.340  1.00 48.99  ? 140  PHE A CE1 1 
ATOM 1087 C CE2 . PHE A 1 143  ? 39.965  55.751 41.923  1.00 48.99  ? 140  PHE A CE2 1 
ATOM 1088 C CZ  . PHE A 1 143  ? 38.591  55.943 42.011  1.00 48.99  ? 140  PHE A CZ  1 
ATOM 1089 N N   . LYS A 1 144  ? 40.258  51.627 39.177  1.00 42.92  ? 141  LYS A N   1 
ATOM 1090 C CA  . LYS A 1 144  ? 40.761  52.187 37.909  1.00 42.92  ? 141  LYS A CA  1 
ATOM 1091 C C   . LYS A 1 144  ? 40.760  53.718 37.934  1.00 42.92  ? 141  LYS A C   1 
ATOM 1092 O O   . LYS A 1 144  ? 39.930  54.339 38.583  1.00 42.92  ? 141  LYS A O   1 
ATOM 1093 C CB  . LYS A 1 144  ? 39.869  51.648 36.755  1.00 38.33  ? 141  LYS A CB  1 
ATOM 1094 C CG  . LYS A 1 144  ? 40.262  51.980 35.293  1.00 38.33  ? 141  LYS A CG  1 
ATOM 1095 C CD  . LYS A 1 144  ? 41.392  51.064 34.764  1.00 38.33  ? 141  LYS A CD  1 
ATOM 1096 C CE  . LYS A 1 144  ? 40.990  49.614 34.751  1.00 38.33  ? 141  LYS A CE  1 
ATOM 1097 N NZ  . LYS A 1 144  ? 41.088  49.213 33.327  1.00 38.33  ? 141  LYS A NZ  1 
ATOM 1098 N N   . VAL A 1 145  ? 41.716  54.329 37.253  1.00 54.12  ? 142  VAL A N   1 
ATOM 1099 C CA  . VAL A 1 145  ? 41.744  55.779 37.141  1.00 54.12  ? 142  VAL A CA  1 
ATOM 1100 C C   . VAL A 1 145  ? 42.139  56.121 35.742  1.00 54.12  ? 142  VAL A C   1 
ATOM 1101 O O   . VAL A 1 145  ? 43.238  55.753 35.307  1.00 54.12  ? 142  VAL A O   1 
ATOM 1102 C CB  . VAL A 1 145  ? 42.785  56.436 38.036  1.00 48.35  ? 142  VAL A CB  1 
ATOM 1103 C CG1 . VAL A 1 145  ? 42.905  57.904 37.680  1.00 48.35  ? 142  VAL A CG1 1 
ATOM 1104 C CG2 . VAL A 1 145  ? 42.423  56.269 39.492  1.00 48.35  ? 142  VAL A CG2 1 
ATOM 1105 N N   . ILE A 1 146  ? 41.245  56.816 35.041  1.00 40.91  ? 143  ILE A N   1 
ATOM 1106 C CA  . ILE A 1 146  ? 41.573  57.369 33.746  1.00 40.91  ? 143  ILE A CA  1 
ATOM 1107 C C   . ILE A 1 146  ? 41.873  58.813 33.965  1.00 40.91  ? 143  ILE A C   1 
ATOM 1108 O O   . ILE A 1 146  ? 40.945  59.564 34.227  1.00 40.91  ? 143  ILE A O   1 
ATOM 1109 C CB  . ILE A 1 146  ? 40.404  57.318 32.767  1.00 41.07  ? 143  ILE A CB  1 
ATOM 1110 C CG1 . ILE A 1 146  ? 39.980  55.864 32.483  1.00 41.07  ? 143  ILE A CG1 1 
ATOM 1111 C CG2 . ILE A 1 146  ? 40.813  58.052 31.466  1.00 41.07  ? 143  ILE A CG2 1 
ATOM 1112 C CD1 . ILE A 1 146  ? 38.564  55.723 31.938  1.00 41.07  ? 143  ILE A CD1 1 
ATOM 1113 N N   . PRO A 1 147  ? 43.166  59.207 33.863  1.00 58.69  ? 144  PRO A N   1 
ATOM 1114 C CA  . PRO A 1 147  ? 43.590  60.603 33.953  1.00 58.69  ? 144  PRO A CA  1 
ATOM 1115 C C   . PRO A 1 147  ? 43.134  61.333 32.694  1.00 58.69  ? 144  PRO A C   1 
ATOM 1116 O O   . PRO A 1 147  ? 43.339  60.834 31.589  1.00 58.69  ? 144  PRO A O   1 
ATOM 1117 C CB  . PRO A 1 147  ? 45.108  60.506 33.959  1.00 78.83  ? 144  PRO A CB  1 
ATOM 1118 C CG  . PRO A 1 147  ? 45.417  59.092 34.224  1.00 78.83  ? 144  PRO A CG  1 
ATOM 1119 C CD  . PRO A 1 147  ? 44.318  58.327 33.622  1.00 78.83  ? 144  PRO A CD  1 
ATOM 1120 N N   . LEU A 1 148  ? 42.487  62.478 32.866  1.00 71.39  ? 145  LEU A N   1 
ATOM 1121 C CA  . LEU A 1 148  ? 42.090  63.300 31.734  1.00 71.39  ? 145  LEU A CA  1 
ATOM 1122 C C   . LEU A 1 148  ? 43.211  64.252 31.348  1.00 71.39  ? 145  LEU A C   1 
ATOM 1123 O O   . LEU A 1 148  ? 43.871  64.849 32.218  1.00 71.39  ? 145  LEU A O   1 
ATOM 1124 C CB  . LEU A 1 148  ? 40.782  64.034 32.019  1.00 65.48  ? 145  LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 148  ? 39.647  62.991 31.946  1.00 65.48  ? 145  LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 148  ? 38.771  63.000 33.191  1.00 65.48  ? 145  LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 148  ? 38.795  63.076 30.661  1.00 65.48  ? 145  LEU A CD2 1 
ATOM 1128 N N   . ASP A 1 149  ? 43.441  64.345 30.038  1.00 109.77 ? 146  ASP A N   1 
ATOM 1129 C CA  . ASP A 1 149  ? 44.486  65.173 29.438  1.00 109.77 ? 146  ASP A CA  1 
ATOM 1130 C C   . ASP A 1 149  ? 44.015  65.605 28.073  1.00 109.77 ? 146  ASP A C   1 
ATOM 1131 O O   . ASP A 1 149  ? 42.904  65.260 27.665  1.00 109.77 ? 146  ASP A O   1 
ATOM 1132 C CB  . ASP A 1 149  ? 45.792  64.398 29.295  1.00 112.40 ? 146  ASP A CB  1 
ATOM 1133 C CG  . ASP A 1 149  ? 46.565  64.335 30.580  1.00 112.40 ? 146  ASP A CG  1 
ATOM 1134 O OD1 . ASP A 1 149  ? 46.886  63.207 31.004  1.00 112.40 ? 146  ASP A OD1 1 
ATOM 1135 O OD2 . ASP A 1 149  ? 46.836  65.407 31.173  1.00 112.40 ? 146  ASP A OD2 1 
ATOM 1136 N N   . ARG A 1 150  ? 44.860  66.353 27.366  1.00 81.61  ? 147  ARG A N   1 
ATOM 1137 C CA  . ARG A 1 150  ? 44.505  66.853 26.046  1.00 81.61  ? 147  ARG A CA  1 
ATOM 1138 C C   . ARG A 1 150  ? 44.388  65.634 25.154  1.00 81.61  ? 147  ARG A C   1 
ATOM 1139 O O   . ARG A 1 150  ? 43.519  65.547 24.275  1.00 81.61  ? 147  ARG A O   1 
ATOM 1140 C CB  . ARG A 1 150  ? 45.590  67.799 25.522  1.00 171.52 ? 147  ARG A CB  1 
ATOM 1141 C CG  . ARG A 1 150  ? 45.060  69.081 24.892  1.00 171.52 ? 147  ARG A CG  1 
ATOM 1142 C CD  . ARG A 1 150  ? 44.158  68.796 23.706  1.00 171.52 ? 147  ARG A CD  1 
ATOM 1143 N NE  . ARG A 1 150  ? 43.520  70.006 23.194  1.00 171.52 ? 147  ARG A NE  1 
ATOM 1144 C CZ  . ARG A 1 150  ? 44.043  70.795 22.257  1.00 171.52 ? 147  ARG A CZ  1 
ATOM 1145 N NH1 . ARG A 1 150  ? 45.227  70.512 21.722  1.00 171.52 ? 147  ARG A NH1 1 
ATOM 1146 N NH2 . ARG A 1 150  ? 43.379  71.873 21.855  1.00 171.52 ? 147  ARG A NH2 1 
ATOM 1147 N N   . ASP A 1 151  ? 45.261  64.679 25.443  1.00 178.13 ? 148  ASP A N   1 
ATOM 1148 C CA  . ASP A 1 151  ? 45.430  63.470 24.679  1.00 178.13 ? 148  ASP A CA  1 
ATOM 1149 C C   . ASP A 1 151  ? 44.617  62.386 25.353  1.00 178.13 ? 148  ASP A C   1 
ATOM 1150 O O   . ASP A 1 151  ? 43.398  62.511 25.466  1.00 178.13 ? 148  ASP A O   1 
ATOM 1151 C CB  . ASP A 1 151  ? 46.906  63.121 24.701  1.00 177.52 ? 148  ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 151  ? 47.728  64.216 25.338  1.00 177.52 ? 148  ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 151  ? 48.391  64.966 24.597  1.00 177.52 ? 148  ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 151  ? 47.659  64.358 26.579  1.00 177.52 ? 148  ASP A OD2 1 
ATOM 1155 N N   . ASN A 1 152  ? 45.296  61.341 25.823  1.00 91.83  ? 149  ASN A N   1 
ATOM 1156 C CA  . ASN A 1 152  ? 44.643  60.154 26.391  1.00 91.83  ? 149  ASN A CA  1 
ATOM 1157 C C   . ASN A 1 152  ? 43.381  59.741 25.607  1.00 91.83  ? 149  ASN A C   1 
ATOM 1158 O O   . ASN A 1 152  ? 42.471  59.120 26.148  1.00 91.83  ? 149  ASN A O   1 
ATOM 1159 C CB  . ASN A 1 152  ? 44.352  60.358 27.889  1.00 74.75  ? 149  ASN A CB  1 
ATOM 1160 C CG  . ASN A 1 152  ? 44.376  59.042 28.689  1.00 74.75  ? 149  ASN A CG  1 
ATOM 1161 O OD1 . ASN A 1 152  ? 44.341  57.933 28.123  1.00 74.75  ? 149  ASN A OD1 1 
ATOM 1162 N ND2 . ASN A 1 152  ? 44.435  59.169 30.018  1.00 74.75  ? 149  ASN A ND2 1 
ATOM 1163 N N   . LYS A 1 153  ? 43.367  60.097 24.321  1.00 52.22  ? 150  LYS A N   1 
ATOM 1164 C CA  . LYS A 1 153  ? 42.244  59.887 23.391  1.00 52.22  ? 150  LYS A CA  1 
ATOM 1165 C C   . LYS A 1 153  ? 41.804  58.418 23.310  1.00 52.22  ? 150  LYS A C   1 
ATOM 1166 O O   . LYS A 1 153  ? 40.735  58.106 22.761  1.00 52.22  ? 150  LYS A O   1 
ATOM 1167 C CB  . LYS A 1 153  ? 42.607  60.385 21.983  1.00 88.34  ? 150  LYS A CB  1 
ATOM 1168 C CG  . LYS A 1 153  ? 42.699  61.883 21.816  1.00 88.34  ? 150  LYS A CG  1 
ATOM 1169 C CD  . LYS A 1 153  ? 42.578  62.251 20.336  1.00 88.34  ? 150  LYS A CD  1 
ATOM 1170 C CE  . LYS A 1 153  ? 42.020  63.661 20.132  1.00 88.34  ? 150  LYS A CE  1 
ATOM 1171 N NZ  . LYS A 1 153  ? 42.915  64.731 20.693  1.00 88.34  ? 150  LYS A NZ  1 
ATOM 1172 N N   . GLU A 1 154  ? 42.661  57.549 23.847  1.00 56.93  ? 151  GLU A N   1 
ATOM 1173 C CA  . GLU A 1 154  ? 42.370  56.136 23.981  1.00 56.93  ? 151  GLU A CA  1 
ATOM 1174 C C   . GLU A 1 154  ? 42.203  55.685 25.467  1.00 56.93  ? 151  GLU A C   1 
ATOM 1175 O O   . GLU A 1 154  ? 42.430  54.507 25.795  1.00 56.93  ? 151  GLU A O   1 
ATOM 1176 C CB  . GLU A 1 154  ? 43.462  55.300 23.298  1.00 86.46  ? 151  GLU A CB  1 
ATOM 1177 C CG  . GLU A 1 154  ? 44.048  55.842 21.979  1.00 86.46  ? 151  GLU A CG  1 
ATOM 1178 C CD  . GLU A 1 154  ? 45.227  54.981 21.460  1.00 86.46  ? 151  GLU A CD  1 
ATOM 1179 O OE1 . GLU A 1 154  ? 45.027  54.210 20.491  1.00 86.46  ? 151  GLU A OE1 1 
ATOM 1180 O OE2 . GLU A 1 154  ? 46.340  55.058 22.032  1.00 86.46  ? 151  GLU A OE2 1 
ATOM 1181 N N   . LEU A 1 155  ? 41.830  56.626 26.343  1.00 58.75  ? 152  LEU A N   1 
ATOM 1182 C CA  . LEU A 1 155  ? 41.539  56.397 27.783  1.00 58.75  ? 152  LEU A CA  1 
ATOM 1183 C C   . LEU A 1 155  ? 42.351  55.297 28.435  1.00 58.75  ? 152  LEU A C   1 
ATOM 1184 O O   . LEU A 1 155  ? 41.851  54.237 28.838  1.00 58.75  ? 152  LEU A O   1 
ATOM 1185 C CB  . LEU A 1 155  ? 40.032  56.262 28.031  1.00 48.56  ? 152  LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 155  ? 39.339  57.529 27.466  1.00 48.56  ? 152  LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 155  ? 38.000  57.293 26.765  1.00 48.56  ? 152  LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 155  ? 39.217  58.603 28.530  1.00 48.56  ? 152  LEU A CD2 1 
ATOM 1189 N N   . LYS A 1 156  ? 43.649  55.541 28.508  1.00 53.74  ? 153  LYS A N   1 
ATOM 1190 C CA  . LYS A 1 156  ? 44.526  54.576 29.160  1.00 53.74  ? 153  LYS A CA  1 
ATOM 1191 C C   . LYS A 1 156  ? 44.390  54.875 30.631  1.00 53.74  ? 153  LYS A C   1 
ATOM 1192 O O   . LYS A 1 156  ? 44.137  56.017 31.029  1.00 53.74  ? 153  LYS A O   1 
ATOM 1193 C CB  . LYS A 1 156  ? 45.972  54.679 28.658  1.00 78.81  ? 153  LYS A CB  1 
ATOM 1194 C CG  . LYS A 1 156  ? 46.109  54.648 27.117  1.00 78.81  ? 153  LYS A CG  1 
ATOM 1195 C CD  . LYS A 1 156  ? 46.089  53.238 26.519  1.00 78.81  ? 153  LYS A CD  1 
ATOM 1196 C CE  . LYS A 1 156  ? 46.001  53.295 24.978  1.00 78.81  ? 153  LYS A CE  1 
ATOM 1197 N NZ  . LYS A 1 156  ? 46.079  51.964 24.264  1.00 78.81  ? 153  LYS A NZ  1 
ATOM 1198 N N   . ALA A 1 157  ? 44.490  53.835 31.434  1.00 65.53  ? 154  ALA A N   1 
ATOM 1199 C CA  . ALA A 1 157  ? 44.182  53.953 32.836  1.00 65.53  ? 154  ALA A CA  1 
ATOM 1200 C C   . ALA A 1 157  ? 44.985  52.920 33.527  1.00 65.53  ? 154  ALA A C   1 
ATOM 1201 O O   . ALA A 1 157  ? 45.239  51.860 32.958  1.00 65.53  ? 154  ALA A O   1 
ATOM 1202 C CB  . ALA A 1 157  ? 42.696  53.661 33.065  1.00 43.58  ? 154  ALA A CB  1 
ATOM 1203 N N   . PHE A 1 158  ? 45.376  53.215 34.756  1.00 65.55  ? 155  PHE A N   1 
ATOM 1204 C CA  . PHE A 1 158  ? 45.929  52.181 35.619  1.00 65.55  ? 155  PHE A CA  1 
ATOM 1205 C C   . PHE A 1 158  ? 44.906  51.753 36.643  1.00 65.55  ? 155  PHE A C   1 
ATOM 1206 O O   . PHE A 1 158  ? 43.906  52.415 36.855  1.00 65.55  ? 155  PHE A O   1 
ATOM 1207 C CB  . PHE A 1 158  ? 47.172  52.684 36.342  1.00 65.73  ? 155  PHE A CB  1 
ATOM 1208 C CG  . PHE A 1 158  ? 46.961  53.979 37.062  1.00 65.73  ? 155  PHE A CG  1 
ATOM 1209 C CD1 . PHE A 1 158  ? 46.879  54.008 38.462  1.00 65.73  ? 155  PHE A CD1 1 
ATOM 1210 C CD2 . PHE A 1 158  ? 46.833  55.178 36.345  1.00 65.73  ? 155  PHE A CD2 1 
ATOM 1211 C CE1 . PHE A 1 158  ? 46.687  55.218 39.127  1.00 65.73  ? 155  PHE A CE1 1 
ATOM 1212 C CE2 . PHE A 1 158  ? 46.641  56.380 37.004  1.00 65.73  ? 155  PHE A CE2 1 
ATOM 1213 C CZ  . PHE A 1 158  ? 46.570  56.403 38.391  1.00 65.73  ? 155  PHE A CZ  1 
ATOM 1214 N N   . ASN A 1 159  ? 45.161  50.639 37.287  1.00 52.31  ? 156  ASN A N   1 
ATOM 1215 C CA  . ASN A 1 159  ? 44.445  50.336 38.500  1.00 52.31  ? 156  ASN A CA  1 
ATOM 1216 C C   . ASN A 1 159  ? 45.317  50.733 39.687  1.00 52.31  ? 156  ASN A C   1 
ATOM 1217 O O   . ASN A 1 159  ? 46.503  51.012 39.542  1.00 52.31  ? 156  ASN A O   1 
ATOM 1218 C CB  . ASN A 1 159  ? 44.078  48.851 38.561  1.00 74.92  ? 156  ASN A CB  1 
ATOM 1219 C CG  . ASN A 1 159  ? 42.922  48.516 37.681  1.00 74.92  ? 156  ASN A CG  1 
ATOM 1220 O OD1 . ASN A 1 159  ? 41.786  48.718 38.057  1.00 74.92  ? 156  ASN A OD1 1 
ATOM 1221 N ND2 . ASN A 1 159  ? 43.201  48.019 36.493  1.00 74.92  ? 156  ASN A ND2 1 
ATOM 1222 N N   . ILE A 1 160  ? 44.695  50.778 40.851  1.00 70.92  ? 157  ILE A N   1 
ATOM 1223 C CA  . ILE A 1 160  ? 45.366  50.933 42.106  1.00 70.92  ? 157  ILE A CA  1 
ATOM 1224 C C   . ILE A 1 160  ? 44.761  49.847 42.995  1.00 70.92  ? 157  ILE A C   1 
ATOM 1225 O O   . ILE A 1 160  ? 43.530  49.688 43.037  1.00 70.92  ? 157  ILE A O   1 
ATOM 1226 C CB  . ILE A 1 160  ? 45.049  52.277 42.688  1.00 40.93  ? 157  ILE A CB  1 
ATOM 1227 C CG1 . ILE A 1 160  ? 45.627  53.371 41.802  1.00 40.93  ? 157  ILE A CG1 1 
ATOM 1228 C CG2 . ILE A 1 160  ? 45.603  52.379 44.059  1.00 40.93  ? 157  ILE A CG2 1 
ATOM 1229 C CD1 . ILE A 1 160  ? 45.699  54.713 42.471  1.00 40.93  ? 157  ILE A CD1 1 
ATOM 1230 N N   . ARG A 1 161  ? 45.598  49.083 43.699  1.00 77.05  ? 158  ARG A N   1 
ATOM 1231 C CA  . ARG A 1 161  ? 45.044  48.099 44.611  1.00 77.05  ? 158  ARG A CA  1 
ATOM 1232 C C   . ARG A 1 161  ? 44.286  48.763 45.769  1.00 77.05  ? 158  ARG A C   1 
ATOM 1233 O O   . ARG A 1 161  ? 44.649  49.835 46.280  1.00 77.05  ? 158  ARG A O   1 
ATOM 1234 C CB  . ARG A 1 161  ? 46.094  47.111 45.097  1.00 112.43 ? 158  ARG A CB  1 
ATOM 1235 C CG  . ARG A 1 161  ? 45.537  45.708 45.226  1.00 112.43 ? 158  ARG A CG  1 
ATOM 1236 C CD  . ARG A 1 161  ? 45.960  45.075 46.529  1.00 112.43 ? 158  ARG A CD  1 
ATOM 1237 N NE  . ARG A 1 161  ? 47.414  44.967 46.636  1.00 112.43 ? 158  ARG A NE  1 
ATOM 1238 C CZ  . ARG A 1 161  ? 48.096  45.033 47.778  1.00 112.43 ? 158  ARG A CZ  1 
ATOM 1239 N NH1 . ARG A 1 161  ? 47.461  45.216 48.933  1.00 112.43 ? 158  ARG A NH1 1 
ATOM 1240 N NH2 . ARG A 1 161  ? 49.418  44.921 47.764  1.00 112.43 ? 158  ARG A NH2 1 
ATOM 1241 N N   . LEU A 1 162  ? 43.194  48.112 46.137  1.00 50.32  ? 159  LEU A N   1 
ATOM 1242 C CA  . LEU A 1 162  ? 42.253  48.638 47.123  1.00 50.32  ? 159  LEU A CA  1 
ATOM 1243 C C   . LEU A 1 162  ? 42.143  47.689 48.300  1.00 50.32  ? 159  LEU A C   1 
ATOM 1244 O O   . LEU A 1 162  ? 41.659  46.565 48.144  1.00 50.32  ? 159  LEU A O   1 
ATOM 1245 C CB  . LEU A 1 162  ? 40.878  48.841 46.484  1.00 54.84  ? 159  LEU A CB  1 
ATOM 1246 C CG  . LEU A 1 162  ? 40.118  49.994 47.111  1.00 54.84  ? 159  LEU A CG  1 
ATOM 1247 C CD1 . LEU A 1 162  ? 39.058  50.534 46.157  1.00 54.84  ? 159  LEU A CD1 1 
ATOM 1248 C CD2 . LEU A 1 162  ? 39.513  49.470 48.400  1.00 54.84  ? 159  LEU A CD2 1 
ATOM 1249 N N   . GLU A 1 163  ? 42.609  48.146 49.469  1.00 54.09  ? 160  GLU A N   1 
ATOM 1250 C CA  . GLU A 1 163  ? 42.636  47.295 50.668  1.00 54.09  ? 160  GLU A CA  1 
ATOM 1251 C C   . GLU A 1 163  ? 41.253  46.685 50.890  1.00 54.09  ? 160  GLU A C   1 
ATOM 1252 O O   . GLU A 1 163  ? 41.119  45.504 51.210  1.00 54.09  ? 160  GLU A O   1 
ATOM 1253 C CB  . GLU A 1 163  ? 43.053  48.113 51.893  1.00 141.07 ? 160  GLU A CB  1 
ATOM 1254 C CG  . GLU A 1 163  ? 44.518  48.535 51.896  1.00 141.07 ? 160  GLU A CG  1 
ATOM 1255 C CD  . GLU A 1 163  ? 45.463  47.339 51.902  1.00 141.07 ? 160  GLU A CD  1 
ATOM 1256 O OE1 . GLU A 1 163  ? 45.084  46.281 52.467  1.00 141.07 ? 160  GLU A OE1 1 
ATOM 1257 O OE2 . GLU A 1 163  ? 46.580  47.454 51.338  1.00 141.07 ? 160  GLU A OE2 1 
ATOM 1258 N N   . GLU A 1 164  ? 40.229  47.505 50.650  1.00 55.49  ? 161  GLU A N   1 
ATOM 1259 C CA  . GLU A 1 164  ? 38.853  47.126 50.919  1.00 55.49  ? 161  GLU A CA  1 
ATOM 1260 C C   . GLU A 1 164  ? 38.139  46.378 49.789  1.00 55.49  ? 161  GLU A C   1 
ATOM 1261 O O   . GLU A 1 164  ? 37.858  46.898 48.722  1.00 55.49  ? 161  GLU A O   1 
ATOM 1262 C CB  . GLU A 1 164  ? 38.078  48.331 51.422  1.00 71.38  ? 161  GLU A CB  1 
ATOM 1263 C CG  . GLU A 1 164  ? 38.649  48.853 52.736  1.00 71.38  ? 161  GLU A CG  1 
ATOM 1264 C CD  . GLU A 1 164  ? 39.999  49.541 52.595  1.00 71.38  ? 161  GLU A CD  1 
ATOM 1265 O OE1 . GLU A 1 164  ? 40.333  50.031 51.498  1.00 71.38  ? 161  GLU A OE1 1 
ATOM 1266 O OE2 . GLU A 1 164  ? 40.722  49.602 53.606  1.00 71.38  ? 161  GLU A OE2 1 
ATOM 1267 N N   . LEU A 1 165  ? 37.860  45.126 50.096  1.00 69.63  ? 162  LEU A N   1 
ATOM 1268 C CA  . LEU A 1 165  ? 37.372  44.129 49.177  1.00 69.63  ? 162  LEU A CA  1 
ATOM 1269 C C   . LEU A 1 165  ? 35.858  44.211 48.971  1.00 69.63  ? 162  LEU A C   1 
ATOM 1270 O O   . LEU A 1 165  ? 35.278  43.327 48.332  1.00 69.63  ? 162  LEU A O   1 
ATOM 1271 C CB  . LEU A 1 165  ? 37.740  42.740 49.764  1.00 39.36  ? 162  LEU A CB  1 
ATOM 1272 C CG  . LEU A 1 165  ? 38.884  41.847 49.236  1.00 39.36  ? 162  LEU A CG  1 
ATOM 1273 C CD1 . LEU A 1 165  ? 38.370  40.433 48.684  1.00 39.36  ? 162  LEU A CD1 1 
ATOM 1274 C CD2 . LEU A 1 165  ? 39.842  42.602 48.235  1.00 39.36  ? 162  LEU A CD2 1 
ATOM 1275 N N   . HIS A 1 166  ? 35.223  45.247 49.526  1.00 63.18  ? 163  HIS A N   1 
ATOM 1276 C CA  . HIS A 1 166  ? 33.741  45.336 49.544  1.00 63.18  ? 163  HIS A CA  1 
ATOM 1277 C C   . HIS A 1 166  ? 33.165  46.775 49.691  1.00 63.18  ? 163  HIS A C   1 
ATOM 1278 O O   . HIS A 1 166  ? 32.410  47.076 50.622  1.00 63.18  ? 163  HIS A O   1 
ATOM 1279 C CB  . HIS A 1 166  ? 33.163  44.376 50.607  1.00 71.18  ? 163  HIS A CB  1 
ATOM 1280 C CG  . HIS A 1 166  ? 31.685  44.116 50.477  1.00 71.18  ? 163  HIS A CG  1 
ATOM 1281 N ND1 . HIS A 1 166  ? 30.730  44.918 51.069  1.00 71.18  ? 163  HIS A ND1 1 
ATOM 1282 C CD2 . HIS A 1 166  ? 31.003  43.117 49.856  1.00 71.18  ? 163  HIS A CD2 1 
ATOM 1283 C CE1 . HIS A 1 166  ? 29.527  44.434 50.805  1.00 71.18  ? 163  HIS A CE1 1 
ATOM 1284 N NE2 . HIS A 1 166  ? 29.662  43.343 50.070  1.00 71.18  ? 163  HIS A NE2 1 
ATOM 1285 N N   . VAL A 1 167  ? 33.538  47.650 48.757  1.00 45.16  ? 164  VAL A N   1 
ATOM 1286 C CA  . VAL A 1 167  ? 32.998  48.991 48.702  1.00 45.16  ? 164  VAL A CA  1 
ATOM 1287 C C   . VAL A 1 167  ? 31.502  49.020 48.326  1.00 45.16  ? 164  VAL A C   1 
ATOM 1288 O O   . VAL A 1 167  ? 31.036  48.327 47.398  1.00 45.16  ? 164  VAL A O   1 
ATOM 1289 C CB  . VAL A 1 167  ? 33.807  49.898 47.754  1.00 33.70  ? 164  VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 167  ? 33.123  51.281 47.615  1.00 33.70  ? 164  VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 167  ? 35.189  50.112 48.306  1.00 33.70  ? 164  VAL A CG2 1 
ATOM 1292 N N   . ILE A 1 168  ? 30.772  49.835 49.086  1.00 45.74  ? 165  ILE A N   1 
ATOM 1293 C CA  . ILE A 1 168  ? 29.356  50.058 48.889  1.00 45.74  ? 165  ILE A CA  1 
ATOM 1294 C C   . ILE A 1 168  ? 29.118  51.231 47.907  1.00 45.74  ? 165  ILE A C   1 
ATOM 1295 O O   . ILE A 1 168  ? 28.354  51.095 46.950  1.00 45.74  ? 165  ILE A O   1 
ATOM 1296 C CB  . ILE A 1 168  ? 28.640  50.256 50.250  1.00 35.77  ? 165  ILE A CB  1 
ATOM 1297 C CG1 . ILE A 1 168  ? 28.946  49.100 51.224  1.00 35.77  ? 165  ILE A CG1 1 
ATOM 1298 C CG2 . ILE A 1 168  ? 27.152  50.377 50.057  1.00 35.77  ? 165  ILE A CG2 1 
ATOM 1299 C CD1 . ILE A 1 168  ? 28.511  47.763 50.763  1.00 35.77  ? 165  ILE A CD1 1 
ATOM 1300 N N   . ASP A 1 169  ? 29.792  52.361 48.103  1.00 35.61  ? 166  ASP A N   1 
ATOM 1301 C CA  . ASP A 1 169  ? 29.609  53.498 47.193  1.00 35.61  ? 166  ASP A CA  1 
ATOM 1302 C C   . ASP A 1 169  ? 30.770  54.511 47.368  1.00 35.61  ? 166  ASP A C   1 
ATOM 1303 O O   . ASP A 1 169  ? 31.352  54.586 48.449  1.00 35.61  ? 166  ASP A O   1 
ATOM 1304 C CB  . ASP A 1 169  ? 28.214  54.118 47.429  1.00 49.59  ? 166  ASP A CB  1 
ATOM 1305 C CG  . ASP A 1 169  ? 27.918  55.366 46.580  1.00 49.59  ? 166  ASP A CG  1 
ATOM 1306 O OD1 . ASP A 1 169  ? 28.583  55.637 45.536  1.00 49.59  ? 166  ASP A OD1 1 
ATOM 1307 O OD2 . ASP A 1 169  ? 26.959  56.085 46.982  1.00 49.59  ? 166  ASP A OD2 1 
ATOM 1308 N N   . VAL A 1 170  ? 31.118  55.246 46.305  1.00 55.09  ? 167  VAL A N   1 
ATOM 1309 C CA  . VAL A 1 170  ? 32.241  56.163 46.303  1.00 55.09  ? 167  VAL A CA  1 
ATOM 1310 C C   . VAL A 1 170  ? 31.832  57.429 45.593  1.00 55.09  ? 167  VAL A C   1 
ATOM 1311 O O   . VAL A 1 170  ? 30.925  57.403 44.762  1.00 55.09  ? 167  VAL A O   1 
ATOM 1312 C CB  . VAL A 1 170  ? 33.422  55.606 45.482  1.00 44.65  ? 167  VAL A CB  1 
ATOM 1313 C CG1 . VAL A 1 170  ? 34.759  56.213 45.928  1.00 44.65  ? 167  VAL A CG1 1 
ATOM 1314 C CG2 . VAL A 1 170  ? 33.501  54.132 45.582  1.00 44.65  ? 167  VAL A CG2 1 
ATOM 1315 N N   . LYS A 1 171  ? 32.487  58.534 45.949  1.00 46.95  ? 168  LYS A N   1 
ATOM 1316 C CA  . LYS A 1 171  ? 32.551  59.770 45.153  1.00 46.95  ? 168  LYS A CA  1 
ATOM 1317 C C   . LYS A 1 171  ? 33.828  60.448 45.582  1.00 46.95  ? 168  LYS A C   1 
ATOM 1318 O O   . LYS A 1 171  ? 34.442  60.019 46.565  1.00 46.95  ? 168  LYS A O   1 
ATOM 1319 C CB  . LYS A 1 171  ? 31.429  60.762 45.453  1.00 34.62  ? 168  LYS A CB  1 
ATOM 1320 C CG  . LYS A 1 171  ? 30.033  60.165 45.595  1.00 34.62  ? 168  LYS A CG  1 
ATOM 1321 C CD  . LYS A 1 171  ? 29.064  60.522 44.451  1.00 34.62  ? 168  LYS A CD  1 
ATOM 1322 C CE  . LYS A 1 171  ? 28.029  59.443 44.209  1.00 34.62  ? 168  LYS A CE  1 
ATOM 1323 N NZ  . LYS A 1 171  ? 27.736  58.633 45.410  1.00 34.62  ? 168  LYS A NZ  1 
ATOM 1324 N N   . PHE A 1 172  ? 34.221  61.471 44.812  1.00 47.50  ? 169  PHE A N   1 
ATOM 1325 C CA  . PHE A 1 172  ? 35.251  62.441 45.161  1.00 47.50  ? 169  PHE A CA  1 
ATOM 1326 C C   . PHE A 1 172  ? 34.601  63.487 46.005  1.00 47.50  ? 169  PHE A C   1 
ATOM 1327 O O   . PHE A 1 172  ? 33.395  63.684 45.899  1.00 47.50  ? 169  PHE A O   1 
ATOM 1328 C CB  . PHE A 1 172  ? 35.787  63.143 43.935  1.00 59.83  ? 169  PHE A CB  1 
ATOM 1329 C CG  . PHE A 1 172  ? 36.563  62.257 43.048  1.00 59.83  ? 169  PHE A CG  1 
ATOM 1330 C CD1 . PHE A 1 172  ? 36.019  61.789 41.860  1.00 59.83  ? 169  PHE A CD1 1 
ATOM 1331 C CD2 . PHE A 1 172  ? 37.832  61.853 43.395  1.00 59.83  ? 169  PHE A CD2 1 
ATOM 1332 C CE1 . PHE A 1 172  ? 36.756  60.965 41.015  1.00 59.83  ? 169  PHE A CE1 1 
ATOM 1333 C CE2 . PHE A 1 172  ? 38.540  61.021 42.558  1.00 59.83  ? 169  PHE A CE2 1 
ATOM 1334 C CZ  . PHE A 1 172  ? 37.994  60.578 41.370  1.00 59.83  ? 169  PHE A CZ  1 
ATOM 1335 N N   . LEU A 1 173  ? 35.408  64.154 46.831  1.00 51.07  ? 170  LEU A N   1 
ATOM 1336 C CA  . LEU A 1 173  ? 34.947  65.211 47.718  1.00 51.07  ? 170  LEU A CA  1 
ATOM 1337 C C   . LEU A 1 173  ? 35.259  66.532 47.085  1.00 51.07  ? 170  LEU A C   1 
ATOM 1338 O O   . LEU A 1 173  ? 36.252  66.662 46.385  1.00 51.07  ? 170  LEU A O   1 
ATOM 1339 C CB  . LEU A 1 173  ? 35.634  65.145 49.092  1.00 52.56  ? 170  LEU A CB  1 
ATOM 1340 C CG  . LEU A 1 173  ? 35.704  63.839 49.882  1.00 52.56  ? 170  LEU A CG  1 
ATOM 1341 C CD1 . LEU A 1 173  ? 36.865  63.959 50.822  1.00 52.56  ? 170  LEU A CD1 1 
ATOM 1342 C CD2 . LEU A 1 173  ? 34.438  63.566 50.662  1.00 52.56  ? 170  LEU A CD2 1 
ATOM 1343 N N   . TYR A 1 174  ? 34.403  67.507 47.337  1.00 68.08  ? 171  TYR A N   1 
ATOM 1344 C CA  . TYR A 1 174  ? 34.661  68.850 46.883  1.00 68.08  ? 171  TYR A CA  1 
ATOM 1345 C C   . TYR A 1 174  ? 35.603  69.531 47.853  1.00 68.08  ? 171  TYR A C   1 
ATOM 1346 O O   . TYR A 1 174  ? 35.675  69.180 49.050  1.00 68.08  ? 171  TYR A O   1 
ATOM 1347 C CB  . TYR A 1 174  ? 33.374  69.670 46.823  1.00 53.55  ? 171  TYR A CB  1 
ATOM 1348 C CG  . TYR A 1 174  ? 32.501  69.388 45.649  1.00 53.55  ? 171  TYR A CG  1 
ATOM 1349 C CD1 . TYR A 1 174  ? 31.554  68.361 45.693  1.00 53.55  ? 171  TYR A CD1 1 
ATOM 1350 C CD2 . TYR A 1 174  ? 32.599  70.154 44.498  1.00 53.55  ? 171  TYR A CD2 1 
ATOM 1351 C CE1 . TYR A 1 174  ? 30.721  68.104 44.610  1.00 53.55  ? 171  TYR A CE1 1 
ATOM 1352 C CE2 . TYR A 1 174  ? 31.776  69.914 43.405  1.00 53.55  ? 171  TYR A CE2 1 
ATOM 1353 C CZ  . TYR A 1 174  ? 30.834  68.887 43.465  1.00 53.55  ? 171  TYR A CZ  1 
ATOM 1354 O OH  . TYR A 1 174  ? 30.017  68.641 42.373  1.00 53.55  ? 171  TYR A OH  1 
ATOM 1355 N N   . GLY A 1 175  ? 36.283  70.542 47.306  1.00 85.91  ? 172  GLY A N   1 
ATOM 1356 C CA  . GLY A 1 175  ? 37.140  71.464 48.043  1.00 85.91  ? 172  GLY A CA  1 
ATOM 1357 C C   . GLY A 1 175  ? 38.340  70.703 48.528  1.00 85.91  ? 172  GLY A C   1 
ATOM 1358 O O   . GLY A 1 175  ? 38.554  70.590 49.730  1.00 85.91  ? 172  GLY A O   1 
ATOM 1359 N N   . CYS A 1 176  ? 39.121  70.161 47.607  1.00 126.73 ? 173  CYS A N   1 
ATOM 1360 C CA  . CYS A 1 176  ? 40.143  69.235 48.020  1.00 126.73 ? 173  CYS A CA  1 
ATOM 1361 C C   . CYS A 1 176  ? 41.420  69.412 47.229  1.00 126.73 ? 173  CYS A C   1 
ATOM 1362 O O   . CYS A 1 176  ? 41.432  69.264 45.999  1.00 126.73 ? 173  CYS A O   1 
ATOM 1363 C CB  . CYS A 1 176  ? 39.606  67.802 47.930  1.00 70.60  ? 173  CYS A CB  1 
ATOM 1364 S SG  . CYS A 1 176  ? 38.891  67.129 49.471  1.00 70.60  ? 173  CYS A SG  1 
ATOM 1365 N N   . GLN A 1 177  ? 42.491  69.731 47.953  1.00 78.95  ? 174  GLN A N   1 
ATOM 1366 C CA  . GLN A 1 177  ? 43.786  69.990 47.337  1.00 78.95  ? 174  GLN A CA  1 
ATOM 1367 C C   . GLN A 1 177  ? 44.172  68.857 46.403  1.00 78.95  ? 174  GLN A C   1 
ATOM 1368 O O   . GLN A 1 177  ? 44.400  69.058 45.209  1.00 78.95  ? 174  GLN A O   1 
ATOM 1369 C CB  . GLN A 1 177  ? 44.869  70.234 48.394  1.00 135.21 ? 174  GLN A CB  1 
ATOM 1370 C CG  . GLN A 1 177  ? 44.579  71.398 49.359  1.00 135.21 ? 174  GLN A CG  1 
ATOM 1371 C CD  . GLN A 1 177  ? 43.938  72.631 48.699  1.00 135.21 ? 174  GLN A CD  1 
ATOM 1372 O OE1 . GLN A 1 177  ? 44.123  72.907 47.504  1.00 135.21 ? 174  GLN A OE1 1 
ATOM 1373 N NE2 . GLN A 1 177  ? 43.182  73.380 49.493  1.00 135.21 ? 174  GLN A NE2 1 
ATOM 1374 N N   . ALA A 1 178  ? 44.211  67.652 46.934  1.00 78.36  ? 175  ALA A N   1 
ATOM 1375 C CA  . ALA A 1 178  ? 44.348  66.506 46.064  1.00 78.36  ? 175  ALA A CA  1 
ATOM 1376 C C   . ALA A 1 178  ? 42.968  65.966 45.727  1.00 78.36  ? 175  ALA A C   1 
ATOM 1377 O O   . ALA A 1 178  ? 42.054  66.091 46.541  1.00 78.36  ? 175  ALA A O   1 
ATOM 1378 C CB  . ALA A 1 178  ? 45.174  65.438 46.732  1.00 61.55  ? 175  ALA A CB  1 
ATOM 1379 N N   . PRO A 1 179  ? 42.800  65.406 44.509  1.00 60.24  ? 176  PRO A N   1 
ATOM 1380 C CA  . PRO A 1 179  ? 41.755  64.406 44.295  1.00 60.24  ? 176  PRO A CA  1 
ATOM 1381 C C   . PRO A 1 179  ? 41.620  63.522 45.537  1.00 60.24  ? 176  PRO A C   1 
ATOM 1382 O O   . PRO A 1 179  ? 42.647  63.090 46.086  1.00 60.24  ? 176  PRO A O   1 
ATOM 1383 C CB  . PRO A 1 179  ? 42.293  63.604 43.117  1.00 75.38  ? 176  PRO A CB  1 
ATOM 1384 C CG  . PRO A 1 179  ? 43.104  64.627 42.304  1.00 75.38  ? 176  PRO A CG  1 
ATOM 1385 C CD  . PRO A 1 179  ? 43.507  65.739 43.253  1.00 75.38  ? 176  PRO A CD  1 
ATOM 1386 N N   . THR A 1 180  ? 40.379  63.304 45.992  1.00 62.80  ? 177  THR A N   1 
ATOM 1387 C CA  . THR A 1 180  ? 40.114  62.540 47.215  1.00 62.80  ? 177  THR A CA  1 
ATOM 1388 C C   . THR A 1 180  ? 38.814  61.742 47.142  1.00 62.80  ? 177  THR A C   1 
ATOM 1389 O O   . THR A 1 180  ? 37.758  62.275 46.880  1.00 62.80  ? 177  THR A O   1 
ATOM 1390 C CB  . THR A 1 180  ? 40.025  63.449 48.451  1.00 52.09  ? 177  THR A CB  1 
ATOM 1391 O OG1 . THR A 1 180  ? 40.947  64.542 48.322  1.00 52.09  ? 177  THR A OG1 1 
ATOM 1392 C CG2 . THR A 1 180  ? 40.279  62.621 49.746  1.00 52.09  ? 177  THR A CG2 1 
ATOM 1393 N N   . ILE A 1 181  ? 38.887  60.451 47.383  1.00 69.17  ? 178  ILE A N   1 
ATOM 1394 C CA  . ILE A 1 181  ? 37.690  59.650 47.255  1.00 69.17  ? 178  ILE A CA  1 
ATOM 1395 C C   . ILE A 1 181  ? 37.157  59.410 48.653  1.00 69.17  ? 178  ILE A C   1 
ATOM 1396 O O   . ILE A 1 181  ? 37.921  59.539 49.635  1.00 69.17  ? 178  ILE A O   1 
ATOM 1397 C CB  . ILE A 1 181  ? 37.941  58.325 46.494  1.00 70.14  ? 178  ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 181  ? 39.063  57.514 47.138  1.00 70.14  ? 178  ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 181  ? 38.309  58.601 45.055  1.00 70.14  ? 178  ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 181  ? 38.911  56.035 46.890  1.00 70.14  ? 178  ILE A CD1 1 
ATOM 1401 N N   . CYS A 1 182  ? 35.858  59.088 48.733  1.00 69.56  ? 179  CYS A N   1 
ATOM 1402 C CA  . CYS A 1 182  ? 35.180  58.828 49.994  1.00 69.56  ? 179  CYS A CA  1 
ATOM 1403 C C   . CYS A 1 182  ? 34.186  57.699 49.826  1.00 69.56  ? 179  CYS A C   1 
ATOM 1404 O O   . CYS A 1 182  ? 33.347  57.753 48.936  1.00 69.56  ? 179  CYS A O   1 
ATOM 1405 C CB  . CYS A 1 182  ? 34.458  60.078 50.452  1.00 53.11  ? 179  CYS A CB  1 
ATOM 1406 S SG  . CYS A 1 182  ? 33.348  59.808 51.888  1.00 53.11  ? 179  CYS A SG  1 
ATOM 1407 N N   . PHE A 1 183  ? 34.267  56.692 50.690  1.00 53.91  ? 180  PHE A N   1 
ATOM 1408 C CA  . PHE A 1 183  ? 33.531  55.447 50.463  1.00 53.91  ? 180  PHE A CA  1 
ATOM 1409 C C   . PHE A 1 183  ? 33.155  54.653 51.725  1.00 53.91  ? 180  PHE A C   1 
ATOM 1410 O O   . PHE A 1 183  ? 33.988  54.307 52.553  1.00 53.91  ? 180  PHE A O   1 
ATOM 1411 C CB  . PHE A 1 183  ? 34.291  54.535 49.478  1.00 52.70  ? 180  PHE A CB  1 
ATOM 1412 C CG  . PHE A 1 183  ? 35.605  53.980 50.033  1.00 52.70  ? 180  PHE A CG  1 
ATOM 1413 C CD1 . PHE A 1 183  ? 35.678  52.667 50.512  1.00 52.70  ? 180  PHE A CD1 1 
ATOM 1414 C CD2 . PHE A 1 183  ? 36.773  54.788 50.092  1.00 52.70  ? 180  PHE A CD2 1 
ATOM 1415 C CE1 . PHE A 1 183  ? 36.885  52.179 51.029  1.00 52.70  ? 180  PHE A CE1 1 
ATOM 1416 C CE2 . PHE A 1 183  ? 37.967  54.303 50.607  1.00 52.70  ? 180  PHE A CE2 1 
ATOM 1417 C CZ  . PHE A 1 183  ? 38.028  52.997 51.068  1.00 52.70  ? 180  PHE A CZ  1 
ATOM 1418 N N   . VAL A 1 184  ? 31.877  54.374 51.860  1.00 61.27  ? 181  VAL A N   1 
ATOM 1419 C CA  . VAL A 1 184  ? 31.403  53.429 52.835  1.00 61.27  ? 181  VAL A CA  1 
ATOM 1420 C C   . VAL A 1 184  ? 31.856  52.089 52.263  1.00 61.27  ? 181  VAL A C   1 
ATOM 1421 O O   . VAL A 1 184  ? 31.930  51.955 51.034  1.00 61.27  ? 181  VAL A O   1 
ATOM 1422 C CB  . VAL A 1 184  ? 29.852  53.511 52.906  1.00 23.50  ? 181  VAL A CB  1 
ATOM 1423 C CG1 . VAL A 1 184  ? 29.260  52.667 54.060  1.00 23.50  ? 181  VAL A CG1 1 
ATOM 1424 C CG2 . VAL A 1 184  ? 29.418  54.955 52.958  1.00 23.50  ? 181  VAL A CG2 1 
ATOM 1425 N N   . TYR A 1 185  ? 32.198  51.125 53.123  1.00 55.49  ? 182  TYR A N   1 
ATOM 1426 C CA  . TYR A 1 185  ? 32.579  49.764 52.661  1.00 55.49  ? 182  TYR A CA  1 
ATOM 1427 C C   . TYR A 1 185  ? 32.313  48.788 53.786  1.00 55.49  ? 182  TYR A C   1 
ATOM 1428 O O   . TYR A 1 185  ? 32.297  49.205 54.938  1.00 55.49  ? 182  TYR A O   1 
ATOM 1429 C CB  . TYR A 1 185  ? 34.055  49.704 52.276  1.00 67.71  ? 182  TYR A CB  1 
ATOM 1430 C CG  . TYR A 1 185  ? 34.960  49.901 53.459  1.00 67.71  ? 182  TYR A CG  1 
ATOM 1431 C CD1 . TYR A 1 185  ? 35.415  48.794 54.222  1.00 67.71  ? 182  TYR A CD1 1 
ATOM 1432 C CD2 . TYR A 1 185  ? 35.339  51.169 53.844  1.00 67.71  ? 182  TYR A CD2 1 
ATOM 1433 C CE1 . TYR A 1 185  ? 36.228  48.963 55.327  1.00 67.71  ? 182  TYR A CE1 1 
ATOM 1434 C CE2 . TYR A 1 185  ? 36.151  51.346 54.924  1.00 67.71  ? 182  TYR A CE2 1 
ATOM 1435 C CZ  . TYR A 1 185  ? 36.598  50.247 55.669  1.00 67.71  ? 182  TYR A CZ  1 
ATOM 1436 O OH  . TYR A 1 185  ? 37.418  50.474 56.757  1.00 67.71  ? 182  TYR A OH  1 
ATOM 1437 N N   . GLN A 1 186  ? 32.112  47.509 53.480  1.00 65.61  ? 183  GLN A N   1 
ATOM 1438 C CA  . GLN A 1 186  ? 31.753  46.522 54.518  1.00 65.61  ? 183  GLN A CA  1 
ATOM 1439 C C   . GLN A 1 186  ? 32.777  45.391 54.720  1.00 65.61  ? 183  GLN A C   1 
ATOM 1440 O O   . GLN A 1 186  ? 33.132  44.665 53.787  1.00 65.61  ? 183  GLN A O   1 
ATOM 1441 C CB  . GLN A 1 186  ? 30.364  45.922 54.259  1.00 67.10  ? 183  GLN A CB  1 
ATOM 1442 C CG  . GLN A 1 186  ? 29.949  44.868 55.293  1.00 67.10  ? 183  GLN A CG  1 
ATOM 1443 C CD  . GLN A 1 186  ? 28.746  44.016 54.866  1.00 67.10  ? 183  GLN A CD  1 
ATOM 1444 O OE1 . GLN A 1 186  ? 27.959  44.408 53.998  1.00 67.10  ? 183  GLN A OE1 1 
ATOM 1445 N NE2 . GLN A 1 186  ? 28.597  42.849 55.498  1.00 67.10  ? 183  GLN A NE2 1 
ATOM 1446 N N   . ASP A 1 187  ? 33.245  45.254 55.954  1.00 76.11  ? 184  ASP A N   1 
ATOM 1447 C CA  . ASP A 1 187  ? 33.960  44.064 56.390  1.00 76.11  ? 184  ASP A CA  1 
ATOM 1448 C C   . ASP A 1 187  ? 33.202  43.580 57.615  1.00 76.11  ? 184  ASP A C   1 
ATOM 1449 O O   . ASP A 1 187  ? 32.188  44.198 57.992  1.00 76.11  ? 184  ASP A O   1 
ATOM 1450 C CB  . ASP A 1 187  ? 35.363  44.441 56.781  1.00 62.55  ? 184  ASP A CB  1 
ATOM 1451 C CG  . ASP A 1 187  ? 35.379  45.564 57.771  1.00 62.55  ? 184  ASP A CG  1 
ATOM 1452 O OD1 . ASP A 1 187  ? 34.922  45.324 58.906  1.00 62.55  ? 184  ASP A OD1 1 
ATOM 1453 O OD2 . ASP A 1 187  ? 35.820  46.688 57.406  1.00 62.55  ? 184  ASP A OD2 1 
ATOM 1454 N N   . PRO A 1 188  ? 33.689  42.510 58.271  1.00 100.64 ? 185  PRO A N   1 
ATOM 1455 C CA  . PRO A 1 188  ? 32.854  42.071 59.384  1.00 100.64 ? 185  PRO A CA  1 
ATOM 1456 C C   . PRO A 1 188  ? 32.081  42.919 60.379  1.00 100.64 ? 185  PRO A C   1 
ATOM 1457 O O   . PRO A 1 188  ? 30.875  42.759 60.474  1.00 100.64 ? 185  PRO A O   1 
ATOM 1458 C CB  . PRO A 1 188  ? 33.285  40.610 59.610  1.00 56.45  ? 185  PRO A CB  1 
ATOM 1459 C CG  . PRO A 1 188  ? 34.547  40.380 58.698  1.00 56.45  ? 185  PRO A CG  1 
ATOM 1460 C CD  . PRO A 1 188  ? 34.934  41.721 58.152  1.00 56.45  ? 185  PRO A CD  1 
ATOM 1461 N N   . GLN A 1 189  ? 32.777  43.774 61.126  1.00 119.91 ? 186  GLN A N   1 
ATOM 1462 C CA  . GLN A 1 189  ? 32.246  44.450 62.332  1.00 119.91 ? 186  GLN A CA  1 
ATOM 1463 C C   . GLN A 1 189  ? 31.158  45.474 62.056  1.00 119.91 ? 186  GLN A C   1 
ATOM 1464 O O   . GLN A 1 189  ? 30.679  46.157 62.969  1.00 119.91 ? 186  GLN A O   1 
ATOM 1465 C CB  . GLN A 1 189  ? 33.600  45.170 62.306  1.00 94.04  ? 186  GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 189  ? 34.651  44.552 63.226  1.00 94.04  ? 186  GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 189  ? 35.984  44.356 62.525  1.00 94.04  ? 186  GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 189  ? 36.699  45.318 62.233  1.00 94.04  ? 186  GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 189  ? 36.314  43.101 62.231  1.00 94.04  ? 186  GLN A NE2 1 
ATOM 1470 N N   . GLY A 1 190  ? 30.781  45.565 60.781  1.00 99.06  ? 187  GLY A N   1 
ATOM 1471 C CA  . GLY A 1 190  ? 29.849  46.572 60.287  1.00 99.06  ? 187  GLY A CA  1 
ATOM 1472 C C   . GLY A 1 190  ? 30.499  47.284 59.116  1.00 99.06  ? 187  GLY A C   1 
ATOM 1473 O O   . GLY A 1 190  ? 31.531  46.825 58.598  1.00 99.06  ? 187  GLY A O   1 
ATOM 1474 N N   . ARG A 1 191  ? 29.883  48.395 58.701  1.00 57.20  ? 188  ARG A N   1 
ATOM 1475 C CA  . ARG A 1 191  ? 30.433  49.249 57.647  1.00 57.20  ? 188  ARG A CA  1 
ATOM 1476 C C   . ARG A 1 191  ? 31.190  50.430 58.228  1.00 57.20  ? 188  ARG A C   1 
ATOM 1477 O O   . ARG A 1 191  ? 31.085  50.744 59.403  1.00 57.20  ? 188  ARG A O   1 
ATOM 1478 C CB  . ARG A 1 191  ? 29.341  49.747 56.711  1.00 64.25  ? 188  ARG A CB  1 
ATOM 1479 C CG  . ARG A 1 191  ? 28.791  48.731 55.757  1.00 64.25  ? 188  ARG A CG  1 
ATOM 1480 C CD  . ARG A 1 191  ? 27.415  49.218 55.364  1.00 64.25  ? 188  ARG A CD  1 
ATOM 1481 N NE  . ARG A 1 191  ? 26.855  48.654 54.138  1.00 64.25  ? 188  ARG A NE  1 
ATOM 1482 C CZ  . ARG A 1 191  ? 26.442  47.402 53.998  1.00 64.25  ? 188  ARG A CZ  1 
ATOM 1483 N NH1 . ARG A 1 191  ? 26.555  46.520 54.981  1.00 64.25  ? 188  ARG A NH1 1 
ATOM 1484 N NH2 . ARG A 1 191  ? 25.931  47.021 52.848  1.00 64.25  ? 188  ARG A NH2 1 
ATOM 1485 N N   . HIS A 1 192  ? 31.964  51.069 57.370  1.00 69.25  ? 189  HIS A N   1 
ATOM 1486 C CA  . HIS A 1 192  ? 32.885  52.108 57.766  1.00 69.25  ? 189  HIS A CA  1 
ATOM 1487 C C   . HIS A 1 192  ? 33.004  53.047 56.580  1.00 69.25  ? 189  HIS A C   1 
ATOM 1488 O O   . HIS A 1 192  ? 32.757  52.622 55.432  1.00 69.25  ? 189  HIS A O   1 
ATOM 1489 C CB  . HIS A 1 192  ? 34.269  51.510 58.087  1.00 71.78  ? 189  HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 192  ? 34.240  50.369 59.067  1.00 71.78  ? 189  HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 192  ? 34.068  49.055 58.682  1.00 71.78  ? 189  HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 192  ? 34.379  50.347 60.416  1.00 71.78  ? 189  HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 192  ? 34.095  48.275 59.750  1.00 71.78  ? 189  HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 192  ? 34.287  49.033 60.814  1.00 71.78  ? 189  HIS A NE2 1 
ATOM 1495 N N   . VAL A 1 193  ? 33.375  54.302 56.864  1.00 60.75  ? 190  VAL A N   1 
ATOM 1496 C CA  . VAL A 1 193  ? 33.608  55.327 55.845  1.00 60.75  ? 190  VAL A CA  1 
ATOM 1497 C C   . VAL A 1 193  ? 35.079  55.744 55.833  1.00 60.75  ? 190  VAL A C   1 
ATOM 1498 O O   . VAL A 1 193  ? 35.601  56.292 56.796  1.00 60.75  ? 190  VAL A O   1 
ATOM 1499 C CB  . VAL A 1 193  ? 32.669  56.579 56.001  1.00 51.27  ? 190  VAL A CB  1 
ATOM 1500 C CG1 . VAL A 1 193  ? 32.734  57.183 57.401  1.00 51.27  ? 190  VAL A CG1 1 
ATOM 1501 C CG2 . VAL A 1 193  ? 33.011  57.663 54.986  1.00 51.27  ? 190  VAL A CG2 1 
ATOM 1502 N N   . LYS A 1 194  ? 35.733  55.510 54.716  1.00 51.10  ? 191  LYS A N   1 
ATOM 1503 C CA  . LYS A 1 194  ? 37.123  55.819 54.617  1.00 51.10  ? 191  LYS A CA  1 
ATOM 1504 C C   . LYS A 1 194  ? 37.414  56.881 53.525  1.00 51.10  ? 191  LYS A C   1 
ATOM 1505 O O   . LYS A 1 194  ? 36.511  57.281 52.774  1.00 51.10  ? 191  LYS A O   1 
ATOM 1506 C CB  . LYS A 1 194  ? 37.862  54.505 54.371  1.00 68.27  ? 191  LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 194  ? 39.272  54.429 54.939  1.00 68.27  ? 191  LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 194  ? 39.489  53.099 55.669  1.00 68.27  ? 191  LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 194  ? 40.976  52.826 55.832  1.00 68.27  ? 191  LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 194  ? 41.645  52.974 54.481  1.00 68.27  ? 191  LYS A NZ  1 
ATOM 1511 N N   . THR A 1 195  ? 38.672  57.333 53.462  1.00 50.21  ? 192  THR A N   1 
ATOM 1512 C CA  . THR A 1 195  ? 39.144  58.302 52.466  1.00 50.21  ? 192  THR A CA  1 
ATOM 1513 C C   . THR A 1 195  ? 40.557  58.013 51.950  1.00 50.21  ? 192  THR A C   1 
ATOM 1514 O O   . THR A 1 195  ? 41.353  57.360 52.636  1.00 50.21  ? 192  THR A O   1 
ATOM 1515 C CB  . THR A 1 195  ? 39.235  59.647 53.098  1.00 45.16  ? 192  THR A CB  1 
ATOM 1516 O OG1 . THR A 1 195  ? 39.583  59.469 54.480  1.00 45.16  ? 192  THR A OG1 1 
ATOM 1517 C CG2 . THR A 1 195  ? 37.894  60.360 52.969  1.00 45.16  ? 192  THR A CG2 1 
ATOM 1518 N N   . TYR A 1 196  ? 40.871  58.473 50.739  1.00 53.53  ? 193  TYR A N   1 
ATOM 1519 C CA  . TYR A 1 196  ? 42.274  58.498 50.256  1.00 53.53  ? 193  TYR A CA  1 
ATOM 1520 C C   . TYR A 1 196  ? 42.373  59.663 49.323  1.00 53.53  ? 193  TYR A C   1 
ATOM 1521 O O   . TYR A 1 196  ? 41.371  60.001 48.663  1.00 53.53  ? 193  TYR A O   1 
ATOM 1522 C CB  . TYR A 1 196  ? 42.711  57.254 49.440  1.00 57.22  ? 193  TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 196  ? 42.545  55.903 50.089  1.00 57.22  ? 193  TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 196  ? 41.662  54.965 49.559  1.00 57.22  ? 193  TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 196  ? 43.273  55.551 51.211  1.00 57.22  ? 193  TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 196  ? 41.515  53.699 50.141  1.00 57.22  ? 193  TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 196  ? 43.120  54.295 51.808  1.00 57.22  ? 193  TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 196  ? 42.245  53.371 51.273  1.00 57.22  ? 193  TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 196  ? 42.078  52.138 51.882  1.00 57.22  ? 193  TYR A OH  1 
ATOM 1530 N N   . GLU A 1 197  ? 43.566  60.259 49.241  1.00 54.77  ? 194  GLU A N   1 
ATOM 1531 C CA  . GLU A 1 197  ? 43.860  61.210 48.162  1.00 54.77  ? 194  GLU A CA  1 
ATOM 1532 C C   . GLU A 1 197  ? 44.113  60.390 46.923  1.00 54.77  ? 194  GLU A C   1 
ATOM 1533 O O   . GLU A 1 197  ? 44.135  59.164 47.006  1.00 54.77  ? 194  GLU A O   1 
ATOM 1534 C CB  . GLU A 1 197  ? 45.088  62.065 48.478  1.00 96.05  ? 194  GLU A CB  1 
ATOM 1535 C CG  . GLU A 1 197  ? 44.758  63.387 49.162  1.00 96.05  ? 194  GLU A CG  1 
ATOM 1536 C CD  . GLU A 1 197  ? 45.924  63.930 49.974  1.00 96.05  ? 194  GLU A CD  1 
ATOM 1537 O OE1 . GLU A 1 197  ? 46.444  65.031 49.656  1.00 96.05  ? 194  GLU A OE1 1 
ATOM 1538 O OE2 . GLU A 1 197  ? 46.316  63.232 50.938  1.00 96.05  ? 194  GLU A OE2 1 
ATOM 1539 N N   . VAL A 1 198  ? 44.270  61.038 45.777  1.00 94.47  ? 195  VAL A N   1 
ATOM 1540 C CA  . VAL A 1 198  ? 44.816  60.317 44.643  1.00 94.47  ? 195  VAL A CA  1 
ATOM 1541 C C   . VAL A 1 198  ? 45.904  61.103 43.938  1.00 94.47  ? 195  VAL A C   1 
ATOM 1542 O O   . VAL A 1 198  ? 45.644  62.100 43.242  1.00 94.47  ? 195  VAL A O   1 
ATOM 1543 C CB  . VAL A 1 198  ? 43.752  59.694 43.684  1.00 63.60  ? 195  VAL A CB  1 
ATOM 1544 C CG1 . VAL A 1 198  ? 44.401  59.119 42.444  1.00 63.60  ? 195  VAL A CG1 1 
ATOM 1545 C CG2 . VAL A 1 198  ? 43.034  58.540 44.375  1.00 63.60  ? 195  VAL A CG2 1 
ATOM 1546 N N   . SER A 1 199  ? 47.120  60.604 44.130  1.00 85.02  ? 196  SER A N   1 
ATOM 1547 C CA  . SER A 1 199  ? 48.301  61.054 43.459  1.00 85.02  ? 196  SER A CA  1 
ATOM 1548 C C   . SER A 1 199  ? 48.458  60.133 42.316  1.00 85.02  ? 196  SER A C   1 
ATOM 1549 O O   . SER A 1 199  ? 48.689  58.956 42.497  1.00 85.02  ? 196  SER A O   1 
ATOM 1550 C CB  . SER A 1 199  ? 49.507  60.892 44.360  1.00 128.41 ? 196  SER A CB  1 
ATOM 1551 O OG  . SER A 1 199  ? 50.711  61.073 43.636  1.00 128.41 ? 196  SER A OG  1 
ATOM 1552 N N   . LEU A 1 200  ? 48.310  60.699 41.134  1.00 111.36 ? 197  LEU A N   1 
ATOM 1553 C CA  . LEU A 1 200  ? 48.370  59.984 39.866  1.00 111.36 ? 197  LEU A CA  1 
ATOM 1554 C C   . LEU A 1 200  ? 49.784  60.014 39.310  1.00 111.36 ? 197  LEU A C   1 
ATOM 1555 O O   . LEU A 1 200  ? 50.155  59.186 38.463  1.00 111.36 ? 197  LEU A O   1 
ATOM 1556 C CB  . LEU A 1 200  ? 47.360  60.572 38.861  1.00 61.57  ? 197  LEU A CB  1 
ATOM 1557 C CG  . LEU A 1 200  ? 47.216  62.064 38.526  1.00 61.57  ? 197  LEU A CG  1 
ATOM 1558 C CD1 . LEU A 1 200  ? 46.151  62.190 37.478  1.00 61.57  ? 197  LEU A CD1 1 
ATOM 1559 C CD2 . LEU A 1 200  ? 46.835  62.920 39.726  1.00 61.57  ? 197  LEU A CD2 1 
ATOM 1560 N N   . ARG A 1 201  ? 50.552  60.981 39.815  1.00 154.82 ? 198  ARG A N   1 
ATOM 1561 C CA  . ARG A 1 201  ? 51.988  61.070 39.617  1.00 154.82 ? 198  ARG A CA  1 
ATOM 1562 C C   . ARG A 1 201  ? 52.684  59.759 40.003  1.00 154.82 ? 198  ARG A C   1 
ATOM 1563 O O   . ARG A 1 201  ? 53.672  59.359 39.373  1.00 154.82 ? 198  ARG A O   1 
ATOM 1564 C CB  . ARG A 1 201  ? 52.540  62.247 40.434  1.00 139.20 ? 198  ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 201  ? 54.068  62.298 40.586  1.00 139.20 ? 198  ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 201  ? 54.591  63.722 40.510  1.00 139.20 ? 198  ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 201  ? 54.058  64.397 39.324  1.00 139.20 ? 198  ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 201  ? 54.566  64.300 38.096  1.00 139.20 ? 198  ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 201  ? 55.649  63.566 37.866  1.00 139.20 ? 198  ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 201  ? 53.990  64.945 37.092  1.00 139.20 ? 198  ARG A NH2 1 
ATOM 1571 N N   . GLU A 1 202  ? 52.154  59.079 41.017  1.00 74.47  ? 199  GLU A N   1 
ATOM 1572 C CA  . GLU A 1 202  ? 52.840  57.931 41.569  1.00 74.47  ? 199  GLU A CA  1 
ATOM 1573 C C   . GLU A 1 202  ? 52.021  56.669 41.558  1.00 74.47  ? 199  GLU A C   1 
ATOM 1574 O O   . GLU A 1 202  ? 52.482  55.643 42.090  1.00 74.47  ? 199  GLU A O   1 
ATOM 1575 C CB  . GLU A 1 202  ? 53.371  58.205 42.985  1.00 150.12 ? 199  GLU A CB  1 
ATOM 1576 C CG  . GLU A 1 202  ? 54.488  59.234 43.093  1.00 150.12 ? 199  GLU A CG  1 
ATOM 1577 C CD  . GLU A 1 202  ? 54.916  59.509 44.538  1.00 150.12 ? 199  GLU A CD  1 
ATOM 1578 O OE1 . GLU A 1 202  ? 54.215  59.040 45.457  1.00 150.12 ? 199  GLU A OE1 1 
ATOM 1579 O OE2 . GLU A 1 202  ? 55.946  60.190 44.771  1.00 150.12 ? 199  GLU A OE2 1 
ATOM 1580 N N   . LYS A 1 203  ? 50.830  56.734 40.947  1.00 83.13  ? 200  LYS A N   1 
ATOM 1581 C CA  . LYS A 1 203  ? 49.929  55.573 40.810  1.00 83.13  ? 200  LYS A CA  1 
ATOM 1582 C C   . LYS A 1 203  ? 49.684  54.867 42.156  1.00 83.13  ? 200  LYS A C   1 
ATOM 1583 O O   . LYS A 1 203  ? 49.852  53.647 42.270  1.00 83.13  ? 200  LYS A O   1 
ATOM 1584 C CB  . LYS A 1 203  ? 50.495  54.550 39.806  1.00 91.89  ? 200  LYS A CB  1 
ATOM 1585 C CG  . LYS A 1 203  ? 50.415  54.911 38.330  1.00 91.89  ? 200  LYS A CG  1 
ATOM 1586 C CD  . LYS A 1 203  ? 51.215  53.878 37.536  1.00 91.89  ? 200  LYS A CD  1 
ATOM 1587 C CE  . LYS A 1 203  ? 50.491  53.365 36.278  1.00 91.89  ? 200  LYS A CE  1 
ATOM 1588 N NZ  . LYS A 1 203  ? 50.166  54.419 35.266  1.00 91.89  ? 200  LYS A NZ  1 
ATOM 1589 N N   . GLU A 1 204  ? 49.311  55.632 43.177  1.00 87.69  ? 201  GLU A N   1 
ATOM 1590 C CA  . GLU A 1 204  ? 49.146  55.094 44.519  1.00 87.69  ? 201  GLU A CA  1 
ATOM 1591 C C   . GLU A 1 204  ? 48.174  55.979 45.266  1.00 87.69  ? 201  GLU A C   1 
ATOM 1592 O O   . GLU A 1 204  ? 47.800  57.062 44.794  1.00 87.69  ? 201  GLU A O   1 
ATOM 1593 C CB  . GLU A 1 204  ? 50.497  55.000 45.265  1.00 115.98 ? 201  GLU A CB  1 
ATOM 1594 C CG  . GLU A 1 204  ? 51.070  56.351 45.780  1.00 115.98 ? 201  GLU A CG  1 
ATOM 1595 C CD  . GLU A 1 204  ? 52.527  56.273 46.236  1.00 115.98 ? 201  GLU A CD  1 
ATOM 1596 O OE1 . GLU A 1 204  ? 52.815  56.575 47.421  1.00 115.98 ? 201  GLU A OE1 1 
ATOM 1597 O OE2 . GLU A 1 204  ? 53.387  55.920 45.400  1.00 115.98 ? 201  GLU A OE2 1 
ATOM 1598 N N   . PHE A 1 205  ? 47.781  55.537 46.452  1.00 95.97  ? 202  PHE A N   1 
ATOM 1599 C CA  . PHE A 1 205  ? 46.821  56.223 47.307  1.00 95.97  ? 202  PHE A CA  1 
ATOM 1600 C C   . PHE A 1 205  ? 47.495  57.011 48.425  1.00 95.97  ? 202  PHE A C   1 
ATOM 1601 O O   . PHE A 1 205  ? 48.570  56.668 48.857  1.00 95.97  ? 202  PHE A O   1 
ATOM 1602 C CB  . PHE A 1 205  ? 45.937  55.184 47.968  1.00 65.18  ? 202  PHE A CB  1 
ATOM 1603 C CG  . PHE A 1 205  ? 44.744  54.798 47.176  1.00 65.18  ? 202  PHE A CG  1 
ATOM 1604 C CD1 . PHE A 1 205  ? 44.314  53.506 47.159  1.00 65.18  ? 202  PHE A CD1 1 
ATOM 1605 C CD2 . PHE A 1 205  ? 44.037  55.722 46.471  1.00 65.18  ? 202  PHE A CD2 1 
ATOM 1606 C CE1 . PHE A 1 205  ? 43.220  53.156 46.462  1.00 65.18  ? 202  PHE A CE1 1 
ATOM 1607 C CE2 . PHE A 1 205  ? 42.949  55.361 45.763  1.00 65.18  ? 202  PHE A CE2 1 
ATOM 1608 C CZ  . PHE A 1 205  ? 42.545  54.085 45.760  1.00 65.18  ? 202  PHE A CZ  1 
ATOM 1609 N N   . ASN A 1 206  ? 46.839  58.041 48.927  1.00 67.99  ? 203  ASN A N   1 
ATOM 1610 C CA  . ASN A 1 206  ? 47.415  58.886 49.966  1.00 67.99  ? 203  ASN A CA  1 
ATOM 1611 C C   . ASN A 1 206  ? 46.450  59.111 51.125  1.00 67.99  ? 203  ASN A C   1 
ATOM 1612 O O   . ASN A 1 206  ? 45.338  59.602 50.933  1.00 67.99  ? 203  ASN A O   1 
ATOM 1613 C CB  . ASN A 1 206  ? 47.856  60.230 49.380  1.00 65.55  ? 203  ASN A CB  1 
ATOM 1614 C CG  . ASN A 1 206  ? 48.900  60.077 48.292  1.00 65.55  ? 203  ASN A CG  1 
ATOM 1615 O OD1 . ASN A 1 206  ? 49.311  58.964 47.961  1.00 65.55  ? 203  ASN A OD1 1 
ATOM 1616 N ND2 . ASN A 1 206  ? 49.335  61.197 47.727  1.00 65.55  ? 203  ASN A ND2 1 
ATOM 1617 N N   . LYS A 1 207  ? 46.884  58.749 52.328  1.00 87.21  ? 204  LYS A N   1 
ATOM 1618 C CA  . LYS A 1 207  ? 46.060  58.910 53.520  1.00 87.21  ? 204  LYS A CA  1 
ATOM 1619 C C   . LYS A 1 207  ? 45.053  60.042 53.344  1.00 87.21  ? 204  LYS A C   1 
ATOM 1620 O O   . LYS A 1 207  ? 45.430  61.203 53.190  1.00 87.21  ? 204  LYS A O   1 
ATOM 1621 C CB  . LYS A 1 207  ? 46.936  59.172 54.746  1.00 173.46 ? 204  LYS A CB  1 
ATOM 1622 C CG  . LYS A 1 207  ? 46.158  59.349 56.039  1.00 173.46 ? 204  LYS A CG  1 
ATOM 1623 C CD  . LYS A 1 207  ? 47.088  59.602 57.214  1.00 173.46 ? 204  LYS A CD  1 
ATOM 1624 C CE  . LYS A 1 207  ? 46.310  59.777 58.508  1.00 173.46 ? 204  LYS A CE  1 
ATOM 1625 N NZ  . LYS A 1 207  ? 47.209  60.025 59.668  1.00 173.46 ? 204  LYS A NZ  1 
ATOM 1626 N N   . GLY A 1 208  ? 43.770  59.695 53.369  1.00 88.57  ? 205  GLY A N   1 
ATOM 1627 C CA  . GLY A 1 208  ? 42.704  60.683 53.212  1.00 88.57  ? 205  GLY A CA  1 
ATOM 1628 C C   . GLY A 1 208  ? 42.687  61.700 54.343  1.00 88.57  ? 205  GLY A C   1 
ATOM 1629 O O   . GLY A 1 208  ? 43.187  61.419 55.437  1.00 88.57  ? 205  GLY A O   1 
ATOM 1630 N N   . PRO A 1 209  ? 42.083  62.882 54.091  1.00 75.33  ? 206  PRO A N   1 
ATOM 1631 C CA  . PRO A 1 209  ? 42.094  64.010 55.008  1.00 75.33  ? 206  PRO A CA  1 
ATOM 1632 C C   . PRO A 1 209  ? 41.486  63.686 56.369  1.00 75.33  ? 206  PRO A C   1 
ATOM 1633 O O   . PRO A 1 209  ? 41.563  64.509 57.290  1.00 75.33  ? 206  PRO A O   1 
ATOM 1634 C CB  . PRO A 1 209  ? 41.232  65.049 54.283  1.00 91.28  ? 206  PRO A CB  1 
ATOM 1635 C CG  . PRO A 1 209  ? 41.365  64.691 52.858  1.00 91.28  ? 206  PRO A CG  1 
ATOM 1636 C CD  . PRO A 1 209  ? 41.318  63.203 52.875  1.00 91.28  ? 206  PRO A CD  1 
ATOM 1637 N N   . TRP A 1 210  ? 40.894  62.503 56.511  1.00 62.96  ? 207  TRP A N   1 
ATOM 1638 C CA  . TRP A 1 210  ? 40.215  62.217 57.754  1.00 62.96  ? 207  TRP A CA  1 
ATOM 1639 C C   . TRP A 1 210  ? 39.853  60.779 58.065  1.00 62.96  ? 207  TRP A C   1 
ATOM 1640 O O   . TRP A 1 210  ? 39.331  60.037 57.218  1.00 62.96  ? 207  TRP A O   1 
ATOM 1641 C CB  . TRP A 1 210  ? 39.018  63.161 57.964  1.00 82.88  ? 207  TRP A CB  1 
ATOM 1642 C CG  . TRP A 1 210  ? 37.787  62.980 57.063  1.00 82.88  ? 207  TRP A CG  1 
ATOM 1643 C CD1 . TRP A 1 210  ? 36.877  61.940 57.087  1.00 82.88  ? 207  TRP A CD1 1 
ATOM 1644 C CD2 . TRP A 1 210  ? 37.295  63.916 56.088  1.00 82.88  ? 207  TRP A CD2 1 
ATOM 1645 N NE1 . TRP A 1 210  ? 35.875  62.163 56.168  1.00 82.88  ? 207  TRP A NE1 1 
ATOM 1646 C CE2 . TRP A 1 210  ? 36.102  63.360 55.537  1.00 82.88  ? 207  TRP A CE2 1 
ATOM 1647 C CE3 . TRP A 1 210  ? 37.751  65.163 55.618  1.00 82.88  ? 207  TRP A CE3 1 
ATOM 1648 C CZ2 . TRP A 1 210  ? 35.361  64.005 54.535  1.00 82.88  ? 207  TRP A CZ2 1 
ATOM 1649 C CZ3 . TRP A 1 210  ? 37.017  65.808 54.631  1.00 82.88  ? 207  TRP A CZ3 1 
ATOM 1650 C CH2 . TRP A 1 210  ? 35.827  65.224 54.096  1.00 82.88  ? 207  TRP A CH2 1 
ATOM 1651 N N   . LYS A 1 211  ? 40.117  60.437 59.330  1.00 59.63  ? 208  LYS A N   1 
ATOM 1652 C CA  . LYS A 1 211  ? 40.072  59.098 59.849  1.00 59.63  ? 208  LYS A CA  1 
ATOM 1653 C C   . LYS A 1 211  ? 38.847  58.375 59.372  1.00 59.63  ? 208  LYS A C   1 
ATOM 1654 O O   . LYS A 1 211  ? 37.784  58.968 59.216  1.00 59.63  ? 208  LYS A O   1 
ATOM 1655 C CB  . LYS A 1 211  ? 40.079  59.137 61.377  1.00 96.68  ? 208  LYS A CB  1 
ATOM 1656 C CG  . LYS A 1 211  ? 41.461  59.309 61.997  1.00 96.68  ? 208  LYS A CG  1 
ATOM 1657 C CD  . LYS A 1 211  ? 41.916  60.770 62.065  1.00 96.68  ? 208  LYS A CD  1 
ATOM 1658 C CE  . LYS A 1 211  ? 43.413  60.878 62.418  1.00 96.68  ? 208  LYS A CE  1 
ATOM 1659 N NZ  . LYS A 1 211  ? 43.796  62.244 62.881  1.00 96.68  ? 208  LYS A NZ  1 
ATOM 1660 N N   . GLN A 1 212  ? 39.007  57.087 59.113  1.00 77.71  ? 209  GLN A N   1 
ATOM 1661 C CA  . GLN A 1 212  ? 37.877  56.201 58.964  1.00 77.71  ? 209  GLN A CA  1 
ATOM 1662 C C   . GLN A 1 212  ? 37.054  56.247 60.256  1.00 77.71  ? 209  GLN A C   1 
ATOM 1663 O O   . GLN A 1 212  ? 37.596  56.210 61.368  1.00 77.71  ? 209  GLN A O   1 
ATOM 1664 C CB  . GLN A 1 212  ? 38.370  54.785 58.671  1.00 137.55 ? 209  GLN A CB  1 
ATOM 1665 C CG  . GLN A 1 212  ? 37.320  53.700 58.746  1.00 137.55 ? 209  GLN A CG  1 
ATOM 1666 C CD  . GLN A 1 212  ? 37.908  52.401 59.215  1.00 137.55 ? 209  GLN A CD  1 
ATOM 1667 O OE1 . GLN A 1 212  ? 38.775  51.827 58.557  1.00 137.55 ? 209  GLN A OE1 1 
ATOM 1668 N NE2 . GLN A 1 212  ? 37.454  51.932 60.369  1.00 137.55 ? 209  GLN A NE2 1 
ATOM 1669 N N   . GLU A 1 213  ? 35.744  56.368 60.107  1.00 86.88  ? 210  GLU A N   1 
ATOM 1670 C CA  . GLU A 1 213  ? 34.853  56.307 61.261  1.00 86.88  ? 210  GLU A CA  1 
ATOM 1671 C C   . GLU A 1 213  ? 33.972  55.095 61.058  1.00 86.88  ? 210  GLU A C   1 
ATOM 1672 O O   . GLU A 1 213  ? 34.319  54.209 60.285  1.00 86.88  ? 210  GLU A O   1 
ATOM 1673 C CB  . GLU A 1 213  ? 33.995  57.577 61.361  1.00 124.29 ? 210  GLU A CB  1 
ATOM 1674 C CG  . GLU A 1 213  ? 34.634  58.851 60.783  1.00 124.29 ? 210  GLU A CG  1 
ATOM 1675 C CD  . GLU A 1 213  ? 35.602  59.546 61.730  1.00 124.29 ? 210  GLU A CD  1 
ATOM 1676 O OE1 . GLU A 1 213  ? 36.100  58.893 62.675  1.00 124.29 ? 210  GLU A OE1 1 
ATOM 1677 O OE2 . GLU A 1 213  ? 35.863  60.755 61.518  1.00 124.29 ? 210  GLU A OE2 1 
ATOM 1678 N N   . ASN A 1 214  ? 32.836  55.060 61.739  1.00 110.25 ? 211  ASN A N   1 
ATOM 1679 C CA  . ASN A 1 214  ? 31.784  54.126 61.375  1.00 110.25 ? 211  ASN A CA  1 
ATOM 1680 C C   . ASN A 1 214  ? 30.619  54.829 60.706  1.00 110.25 ? 211  ASN A C   1 
ATOM 1681 O O   . ASN A 1 214  ? 30.425  56.033 60.853  1.00 110.25 ? 211  ASN A O   1 
ATOM 1682 C CB  . ASN A 1 214  ? 31.291  53.335 62.587  1.00 71.26  ? 211  ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 214  ? 32.362  52.435 63.161  1.00 71.26  ? 211  ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 214  ? 32.893  51.554 62.471  1.00 71.26  ? 211  ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 214  ? 32.685  52.645 64.438  1.00 71.26  ? 211  ASN A ND2 1 
ATOM 1686 N N   . VAL A 1 215  ? 29.876  54.055 59.934  1.00 46.27  ? 212  VAL A N   1 
ATOM 1687 C CA  . VAL A 1 215  ? 28.568  54.432 59.430  1.00 46.27  ? 212  VAL A CA  1 
ATOM 1688 C C   . VAL A 1 215  ? 27.754  53.169 59.645  1.00 46.27  ? 212  VAL A C   1 
ATOM 1689 O O   . VAL A 1 215  ? 28.332  52.143 59.999  1.00 46.27  ? 212  VAL A O   1 
ATOM 1690 C CB  . VAL A 1 215  ? 28.624  54.801 57.960  1.00 76.60  ? 212  VAL A CB  1 
ATOM 1691 C CG1 . VAL A 1 215  ? 29.364  56.120 57.776  1.00 76.60  ? 212  VAL A CG1 1 
ATOM 1692 C CG2 . VAL A 1 215  ? 29.297  53.692 57.174  1.00 76.60  ? 212  VAL A CG2 1 
ATOM 1693 N N   . GLU A 1 216  ? 26.437  53.228 59.451  1.00 49.39  ? 213  GLU A N   1 
ATOM 1694 C CA  . GLU A 1 216  ? 25.560  52.088 59.796  1.00 49.39  ? 213  GLU A CA  1 
ATOM 1695 C C   . GLU A 1 216  ? 25.566  50.849 58.884  1.00 49.39  ? 213  GLU A C   1 
ATOM 1696 O O   . GLU A 1 216  ? 25.797  50.914 57.678  1.00 49.39  ? 213  GLU A O   1 
ATOM 1697 C CB  . GLU A 1 216  ? 24.117  52.551 59.957  1.00 49.39  ? 213  GLU A CB  1 
ATOM 1698 C CG  . GLU A 1 216  ? 23.525  53.060 58.668  1.00 49.39  ? 213  GLU A CG  1 
ATOM 1699 C CD  . GLU A 1 216  ? 22.035  53.353 58.775  1.00 49.39  ? 213  GLU A CD  1 
ATOM 1700 O OE1 . GLU A 1 216  ? 21.676  54.566 58.909  1.00 49.39  ? 213  GLU A OE1 1 
ATOM 1701 O OE2 . GLU A 1 216  ? 21.239  52.361 58.698  1.00 49.39  ? 213  GLU A OE2 1 
ATOM 1702 N N   . ALA A 1 217  ? 25.285  49.726 59.534  1.00 58.74  ? 214  ALA A N   1 
ATOM 1703 C CA  . ALA A 1 217  ? 24.915  48.443 58.936  1.00 58.74  ? 214  ALA A CA  1 
ATOM 1704 C C   . ALA A 1 217  ? 24.274  48.480 57.592  1.00 58.74  ? 214  ALA A C   1 
ATOM 1705 O O   . ALA A 1 217  ? 24.404  47.525 56.863  1.00 58.74  ? 214  ALA A O   1 
ATOM 1706 C CB  . ALA A 1 217  ? 23.971  47.668 59.879  1.00 38.08  ? 214  ALA A CB  1 
ATOM 1707 N N   . GLU A 1 218  ? 23.515  49.524 57.289  1.00 64.69  ? 215  GLU A N   1 
ATOM 1708 C CA  . GLU A 1 218  ? 22.798  49.565 56.028  1.00 64.69  ? 215  GLU A CA  1 
ATOM 1709 C C   . GLU A 1 218  ? 23.077  50.802 55.205  1.00 64.69  ? 215  GLU A C   1 
ATOM 1710 O O   . GLU A 1 218  ? 22.322  51.107 54.282  1.00 64.69  ? 215  GLU A O   1 
ATOM 1711 C CB  . GLU A 1 218  ? 21.303  49.356 56.237  1.00 85.65  ? 215  GLU A CB  1 
ATOM 1712 C CG  . GLU A 1 218  ? 20.902  47.883 56.385  1.00 85.65  ? 215  GLU A CG  1 
ATOM 1713 C CD  . GLU A 1 218  ? 21.466  46.957 55.292  1.00 85.65  ? 215  GLU A CD  1 
ATOM 1714 O OE1 . GLU A 1 218  ? 21.751  47.405 54.160  1.00 85.65  ? 215  GLU A OE1 1 
ATOM 1715 O OE2 . GLU A 1 218  ? 21.619  45.754 55.569  1.00 85.65  ? 215  GLU A OE2 1 
ATOM 1716 N N   . ALA A 1 219  ? 24.167  51.494 55.536  1.00 66.64  ? 216  ALA A N   1 
ATOM 1717 C CA  . ALA A 1 219  ? 24.650  52.639 54.794  1.00 66.64  ? 216  ALA A CA  1 
ATOM 1718 C C   . ALA A 1 219  ? 24.918  52.287 53.321  1.00 66.64  ? 216  ALA A C   1 
ATOM 1719 O O   . ALA A 1 219  ? 25.540  51.256 53.061  1.00 66.64  ? 216  ALA A O   1 
ATOM 1720 C CB  . ALA A 1 219  ? 25.889  53.142 55.439  1.00 41.86  ? 216  ALA A CB  1 
ATOM 1721 N N   . SER A 1 220  ? 24.459  53.139 52.377  1.00 42.19  ? 217  SER A N   1 
ATOM 1722 C CA  . SER A 1 220  ? 24.462  52.796 50.960  1.00 42.19  ? 217  SER A CA  1 
ATOM 1723 C C   . SER A 1 220  ? 24.631  53.922 49.934  1.00 42.19  ? 217  SER A C   1 
ATOM 1724 O O   . SER A 1 220  ? 25.057  53.676 48.777  1.00 42.19  ? 217  SER A O   1 
ATOM 1725 C CB  . SER A 1 220  ? 23.206  52.031 50.597  1.00 35.34  ? 217  SER A CB  1 
ATOM 1726 O OG  . SER A 1 220  ? 22.181  52.957 50.223  1.00 35.34  ? 217  SER A OG  1 
ATOM 1727 N N   . MET A 1 221  ? 24.267  55.139 50.276  1.00 38.62  ? 218  MET A N   1 
ATOM 1728 C CA  . MET A 1 221  ? 24.561  56.198 49.334  1.00 38.62  ? 218  MET A CA  1 
ATOM 1729 C C   . MET A 1 221  ? 25.680  56.979 49.949  1.00 38.62  ? 218  MET A C   1 
ATOM 1730 O O   . MET A 1 221  ? 25.867  56.932 51.163  1.00 38.62  ? 218  MET A O   1 
ATOM 1731 C CB  . MET A 1 221  ? 23.337  57.077 49.095  1.00 91.53  ? 218  MET A CB  1 
ATOM 1732 C CG  . MET A 1 221  ? 22.053  56.277 48.887  1.00 91.53  ? 218  MET A CG  1 
ATOM 1733 S SD  . MET A 1 221  ? 21.202  56.630 47.342  1.00 91.53  ? 218  MET A SD  1 
ATOM 1734 C CE  . MET A 1 221  ? 22.524  56.360 46.152  1.00 91.53  ? 218  MET A CE  1 
ATOM 1735 N N   . VAL A 1 222  ? 26.453  57.671 49.134  1.00 52.61  ? 219  VAL A N   1 
ATOM 1736 C CA  . VAL A 1 222  ? 27.385  58.647 49.641  1.00 52.61  ? 219  VAL A CA  1 
ATOM 1737 C C   . VAL A 1 222  ? 27.075  59.850 48.814  1.00 52.61  ? 219  VAL A C   1 
ATOM 1738 O O   . VAL A 1 222  ? 27.075  59.758 47.597  1.00 52.61  ? 219  VAL A O   1 
ATOM 1739 C CB  . VAL A 1 222  ? 28.832  58.262 49.331  1.00 38.91  ? 219  VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 222  ? 29.819  59.346 49.828  1.00 38.91  ? 219  VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 222  ? 29.172  56.910 49.915  1.00 38.91  ? 219  VAL A CG2 1 
ATOM 1742 N N   . ILE A 1 223  ? 26.794  60.979 49.445  1.00 61.83  ? 220  ILE A N   1 
ATOM 1743 C CA  . ILE A 1 223  ? 26.706  62.238 48.704  1.00 61.83  ? 220  ILE A CA  1 
ATOM 1744 C C   . ILE A 1 223  ? 27.899  63.133 49.035  1.00 61.83  ? 220  ILE A C   1 
ATOM 1745 O O   . ILE A 1 223  ? 28.361  63.150 50.180  1.00 61.83  ? 220  ILE A O   1 
ATOM 1746 C CB  . ILE A 1 223  ? 25.443  62.997 49.019  1.00 49.77  ? 220  ILE A CB  1 
ATOM 1747 C CG1 . ILE A 1 223  ? 24.240  62.087 48.807  1.00 49.77  ? 220  ILE A CG1 1 
ATOM 1748 C CG2 . ILE A 1 223  ? 25.400  64.293 48.185  1.00 49.77  ? 220  ILE A CG2 1 
ATOM 1749 C CD1 . ILE A 1 223  ? 23.018  62.473 49.586  1.00 49.77  ? 220  ILE A CD1 1 
ATOM 1750 N N   . ALA A 1 224  ? 28.366  63.872 48.020  1.00 59.38  ? 221  ALA A N   1 
ATOM 1751 C CA  . ALA A 1 224  ? 29.495  64.794 48.141  1.00 59.38  ? 221  ALA A CA  1 
ATOM 1752 C C   . ALA A 1 224  ? 29.035  66.233 48.023  1.00 59.38  ? 221  ALA A C   1 
ATOM 1753 O O   . ALA A 1 224  ? 29.000  66.822 46.940  1.00 59.38  ? 221  ALA A O   1 
ATOM 1754 C CB  . ALA A 1 224  ? 30.524  64.497 47.096  1.00 39.02  ? 221  ALA A CB  1 
ATOM 1755 N N   . VAL A 1 225  ? 28.686  66.789 49.168  1.00 70.23  ? 222  VAL A N   1 
ATOM 1756 C CA  . VAL A 1 225  ? 28.218  68.151 49.289  1.00 70.23  ? 222  VAL A CA  1 
ATOM 1757 C C   . VAL A 1 225  ? 29.197  69.127 48.619  1.00 70.23  ? 222  VAL A C   1 
ATOM 1758 O O   . VAL A 1 225  ? 30.380  69.162 48.979  1.00 70.23  ? 222  VAL A O   1 
ATOM 1759 C CB  . VAL A 1 225  ? 28.075  68.478 50.771  1.00 81.42  ? 222  VAL A CB  1 
ATOM 1760 C CG1 . VAL A 1 225  ? 27.245  69.702 50.953  1.00 81.42  ? 222  VAL A CG1 1 
ATOM 1761 C CG2 . VAL A 1 225  ? 27.439  67.307 51.506  1.00 81.42  ? 222  VAL A CG2 1 
ATOM 1762 N N   . PRO A 1 226  ? 28.713  69.924 47.640  1.00 49.03  ? 223  PRO A N   1 
ATOM 1763 C CA  . PRO A 1 226  ? 29.578  70.831 46.806  1.00 49.03  ? 223  PRO A CA  1 
ATOM 1764 C C   . PRO A 1 226  ? 30.443  71.807 47.591  1.00 49.03  ? 223  PRO A C   1 
ATOM 1765 O O   . PRO A 1 226  ? 30.074  72.169 48.722  1.00 49.03  ? 223  PRO A O   1 
ATOM 1766 C CB  . PRO A 1 226  ? 28.566  71.617 45.953  1.00 73.25  ? 223  PRO A CB  1 
ATOM 1767 C CG  . PRO A 1 226  ? 27.245  71.396 46.608  1.00 73.25  ? 223  PRO A CG  1 
ATOM 1768 C CD  . PRO A 1 226  ? 27.298  70.039 47.253  1.00 73.25  ? 223  PRO A CD  1 
ATOM 1769 N N   . GLU A 1 227  ? 31.534  72.262 46.973  1.00 210.35 ? 224  GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227  ? 32.488  73.197 47.589  1.00 210.35 ? 224  GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227  ? 31.987  73.988 48.813  1.00 210.35 ? 224  GLU A C   1 
ATOM 1772 O O   . GLU A 1 227  ? 32.552  73.843 49.895  1.00 210.35 ? 224  GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227  ? 33.093  74.159 46.547  1.00 115.67 ? 224  GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227  ? 34.610  73.989 46.293  1.00 115.67 ? 224  GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227  ? 35.370  75.329 46.075  1.00 115.67 ? 224  GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227  ? 36.613  75.363 46.295  1.00 115.67 ? 224  GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227  ? 34.738  76.345 45.687  1.00 115.67 ? 224  GLU A OE2 1 
ATOM 1778 N N   . PRO A 1 228  ? 30.920  74.803 48.657  1.00 97.94  ? 225  PRO A N   1 
ATOM 1779 C CA  . PRO A 1 228  ? 30.561  75.752 49.724  1.00 97.94  ? 225  PRO A CA  1 
ATOM 1780 C C   . PRO A 1 228  ? 30.566  75.144 51.121  1.00 97.94  ? 225  PRO A C   1 
ATOM 1781 O O   . PRO A 1 228  ? 31.235  75.659 52.019  1.00 97.94  ? 225  PRO A O   1 
ATOM 1782 C CB  . PRO A 1 228  ? 29.142  76.174 49.353  1.00 110.12 ? 225  PRO A CB  1 
ATOM 1783 C CG  . PRO A 1 228  ? 29.065  75.979 47.872  1.00 110.12 ? 225  PRO A CG  1 
ATOM 1784 C CD  . PRO A 1 228  ? 29.990  74.874 47.510  1.00 110.12 ? 225  PRO A CD  1 
ATOM 1785 N N   . PHE A 1 229  ? 29.825  74.054 51.290  1.00 101.05 ? 226  PHE A N   1 
ATOM 1786 C CA  . PHE A 1 229  ? 29.832  73.303 52.537  1.00 101.05 ? 226  PHE A CA  1 
ATOM 1787 C C   . PHE A 1 229  ? 30.990  72.310 52.542  1.00 101.05 ? 226  PHE A C   1 
ATOM 1788 O O   . PHE A 1 229  ? 31.694  72.191 53.545  1.00 101.05 ? 226  PHE A O   1 
ATOM 1789 C CB  . PHE A 1 229  ? 28.542  72.497 52.720  1.00 143.87 ? 226  PHE A CB  1 
ATOM 1790 C CG  . PHE A 1 229  ? 27.263  73.284 52.554  1.00 143.87 ? 226  PHE A CG  1 
ATOM 1791 C CD1 . PHE A 1 229  ? 27.067  74.136 51.465  1.00 143.87 ? 226  PHE A CD1 1 
ATOM 1792 C CD2 . PHE A 1 229  ? 26.221  73.112 53.461  1.00 143.87 ? 226  PHE A CD2 1 
ATOM 1793 C CE1 . PHE A 1 229  ? 25.874  74.833 51.311  1.00 143.87 ? 226  PHE A CE1 1 
ATOM 1794 C CE2 . PHE A 1 229  ? 25.030  73.794 53.312  1.00 143.87 ? 226  PHE A CE2 1 
ATOM 1795 C CZ  . PHE A 1 229  ? 24.854  74.655 52.230  1.00 143.87 ? 226  PHE A CZ  1 
ATOM 1796 N N   . GLY A 1 230  ? 31.158  71.586 51.425  1.00 59.39  ? 227  GLY A N   1 
ATOM 1797 C CA  . GLY A 1 230  ? 32.080  70.462 51.336  1.00 59.39  ? 227  GLY A CA  1 
ATOM 1798 C C   . GLY A 1 230  ? 31.611  69.399 52.299  1.00 59.39  ? 227  GLY A C   1 
ATOM 1799 O O   . GLY A 1 230  ? 30.773  69.672 53.167  1.00 59.39  ? 227  GLY A O   1 
ATOM 1800 N N   . GLY A 1 231  ? 32.128  68.183 52.158  1.00 49.96  ? 228  GLY A N   1 
ATOM 1801 C CA  . GLY A 1 231  ? 31.820  67.099 53.121  1.00 49.96  ? 228  GLY A CA  1 
ATOM 1802 C C   . GLY A 1 231  ? 31.175  65.894 52.487  1.00 49.96  ? 228  GLY A C   1 
ATOM 1803 O O   . GLY A 1 231  ? 31.178  65.747 51.268  1.00 49.96  ? 228  GLY A O   1 
ATOM 1804 N N   . ALA A 1 232  ? 30.620  65.022 53.301  1.00 62.30  ? 229  ALA A N   1 
ATOM 1805 C CA  . ALA A 1 232  ? 29.960  63.873 52.736  1.00 62.30  ? 229  ALA A CA  1 
ATOM 1806 C C   . ALA A 1 232  ? 28.720  63.451 53.490  1.00 62.30  ? 229  ALA A C   1 
ATOM 1807 O O   . ALA A 1 232  ? 28.717  63.374 54.717  1.00 62.30  ? 229  ALA A O   1 
ATOM 1808 C CB  . ALA A 1 232  ? 30.937  62.708 52.596  1.00 43.67  ? 229  ALA A CB  1 
ATOM 1809 N N   . ILE A 1 233  ? 27.667  63.157 52.741  1.00 50.48  ? 230  ILE A N   1 
ATOM 1810 C CA  . ILE A 1 233  ? 26.463  62.696 53.366  1.00 50.48  ? 230  ILE A CA  1 
ATOM 1811 C C   . ILE A 1 233  ? 26.331  61.206 53.229  1.00 50.48  ? 230  ILE A C   1 
ATOM 1812 O O   . ILE A 1 233  ? 26.549  60.681 52.154  1.00 50.48  ? 230  ILE A O   1 
ATOM 1813 C CB  . ILE A 1 233  ? 25.266  63.378 52.768  1.00 69.97  ? 230  ILE A CB  1 
ATOM 1814 C CG1 . ILE A 1 233  ? 25.290  64.847 53.153  1.00 69.97  ? 230  ILE A CG1 1 
ATOM 1815 C CG2 . ILE A 1 233  ? 24.004  62.766 53.312  1.00 69.97  ? 230  ILE A CG2 1 
ATOM 1816 C CD1 . ILE A 1 233  ? 24.218  65.652 52.449  1.00 69.97  ? 230  ILE A CD1 1 
ATOM 1817 N N   . ILE A 1 234  ? 25.965  60.518 54.301  1.00 47.12  ? 231  ILE A N   1 
ATOM 1818 C CA  . ILE A 1 234  ? 25.739  59.080 54.222  1.00 47.12  ? 231  ILE A CA  1 
ATOM 1819 C C   . ILE A 1 234  ? 24.290  58.634 54.524  1.00 47.12  ? 231  ILE A C   1 
ATOM 1820 O O   . ILE A 1 234  ? 23.767  58.884 55.617  1.00 47.12  ? 231  ILE A O   1 
ATOM 1821 C CB  . ILE A 1 234  ? 26.704  58.312 55.151  1.00 38.63  ? 231  ILE A CB  1 
ATOM 1822 C CG1 . ILE A 1 234  ? 28.134  58.303 54.587  1.00 38.63  ? 231  ILE A CG1 1 
ATOM 1823 C CG2 . ILE A 1 234  ? 26.254  56.841 55.262  1.00 38.63  ? 231  ILE A CG2 1 
ATOM 1824 C CD1 . ILE A 1 234  ? 28.915  59.551 54.803  1.00 38.63  ? 231  ILE A CD1 1 
ATOM 1825 N N   . ILE A 1 235  ? 23.652  57.925 53.599  1.00 56.04  ? 232  ILE A N   1 
ATOM 1826 C CA  . ILE A 1 235  ? 22.286  57.488 53.872  1.00 56.04  ? 232  ILE A CA  1 
ATOM 1827 C C   . ILE A 1 235  ? 22.171  56.020 54.146  1.00 56.04  ? 232  ILE A C   1 
ATOM 1828 O O   . ILE A 1 235  ? 22.683  55.195 53.398  1.00 56.04  ? 232  ILE A O   1 
ATOM 1829 C CB  . ILE A 1 235  ? 21.339  57.829 52.716  1.00 55.25  ? 232  ILE A CB  1 
ATOM 1830 C CG1 . ILE A 1 235  ? 21.287  59.339 52.536  1.00 55.25  ? 232  ILE A CG1 1 
ATOM 1831 C CG2 . ILE A 1 235  ? 19.916  57.207 52.942  1.00 55.25  ? 232  ILE A CG2 1 
ATOM 1832 C CD1 . ILE A 1 235  ? 21.243  59.747 51.091  1.00 55.25  ? 232  ILE A CD1 1 
ATOM 1833 N N   . GLY A 1 236  ? 21.450  55.701 55.204  1.00 45.99  ? 233  GLY A N   1 
ATOM 1834 C CA  . GLY A 1 236  ? 21.128  54.313 55.529  1.00 45.99  ? 233  GLY A CA  1 
ATOM 1835 C C   . GLY A 1 236  ? 19.633  54.116 55.671  1.00 45.99  ? 233  GLY A C   1 
ATOM 1836 O O   . GLY A 1 236  ? 18.854  54.968 55.230  1.00 45.99  ? 233  GLY A O   1 
ATOM 1837 N N   . GLN A 1 237  ? 19.217  52.996 56.248  1.00 62.12  ? 234  GLN A N   1 
ATOM 1838 C CA  . GLN A 1 237  ? 17.840  52.885 56.687  1.00 62.12  ? 234  GLN A CA  1 
ATOM 1839 C C   . GLN A 1 237  ? 17.591  53.727 57.945  1.00 62.12  ? 234  GLN A C   1 
ATOM 1840 O O   . GLN A 1 237  ? 18.507  53.953 58.737  1.00 62.12  ? 234  GLN A O   1 
ATOM 1841 C CB  . GLN A 1 237  ? 17.440  51.430 56.891  1.00 78.32  ? 234  GLN A CB  1 
ATOM 1842 C CG  . GLN A 1 237  ? 16.647  50.873 55.718  1.00 78.32  ? 234  GLN A CG  1 
ATOM 1843 C CD  . GLN A 1 237  ? 15.405  51.738 55.354  1.00 78.32  ? 234  GLN A CD  1 
ATOM 1844 O OE1 . GLN A 1 237  ? 15.491  52.966 55.155  1.00 78.32  ? 234  GLN A OE1 1 
ATOM 1845 N NE2 . GLN A 1 237  ? 14.252  51.079 55.252  1.00 78.32  ? 234  GLN A NE2 1 
ATOM 1846 N N   . GLU A 1 238  ? 16.372  54.230 58.114  1.00 128.62 ? 235  GLU A N   1 
ATOM 1847 C CA  . GLU A 1 238  ? 16.016  55.091 59.271  1.00 128.62 ? 235  GLU A CA  1 
ATOM 1848 C C   . GLU A 1 238  ? 16.997  56.209 59.648  1.00 128.62 ? 235  GLU A C   1 
ATOM 1849 O O   . GLU A 1 238  ? 16.664  57.065 60.467  1.00 128.62 ? 235  GLU A O   1 
ATOM 1850 C CB  . GLU A 1 238  ? 15.670  54.262 60.530  1.00 115.56 ? 235  GLU A CB  1 
ATOM 1851 C CG  . GLU A 1 238  ? 16.517  52.997 60.790  1.00 115.56 ? 235  GLU A CG  1 
ATOM 1852 C CD  . GLU A 1 238  ? 17.728  53.227 61.684  1.00 115.56 ? 235  GLU A CD  1 
ATOM 1853 O OE1 . GLU A 1 238  ? 18.331  54.323 61.644  1.00 115.56 ? 235  GLU A OE1 1 
ATOM 1854 O OE2 . GLU A 1 238  ? 18.081  52.283 62.421  1.00 115.56 ? 235  GLU A OE2 1 
ATOM 1855 N N   . SER A 1 239  ? 18.185  56.212 59.052  1.00 82.39  ? 236  SER A N   1 
ATOM 1856 C CA  . SER A 1 239  ? 19.229  57.121 59.485  1.00 82.39  ? 236  SER A CA  1 
ATOM 1857 C C   . SER A 1 239  ? 20.010  57.796 58.384  1.00 82.39  ? 236  SER A C   1 
ATOM 1858 O O   . SER A 1 239  ? 20.346  57.188 57.377  1.00 82.39  ? 236  SER A O   1 
ATOM 1859 C CB  . SER A 1 239  ? 20.222  56.387 60.361  1.00 43.01  ? 236  SER A CB  1 
ATOM 1860 O OG  . SER A 1 239  ? 21.403  57.162 60.528  1.00 43.01  ? 236  SER A OG  1 
ATOM 1861 N N   . ILE A 1 240  ? 20.334  59.055 58.628  1.00 62.05  ? 237  ILE A N   1 
ATOM 1862 C CA  . ILE A 1 240  ? 21.129  59.838 57.734  1.00 62.05  ? 237  ILE A CA  1 
ATOM 1863 C C   . ILE A 1 240  ? 22.136  60.552 58.578  1.00 62.05  ? 237  ILE A C   1 
ATOM 1864 O O   . ILE A 1 240  ? 21.795  61.044 59.665  1.00 62.05  ? 237  ILE A O   1 
ATOM 1865 C CB  . ILE A 1 240  ? 20.306  60.890 57.051  1.00 49.14  ? 237  ILE A CB  1 
ATOM 1866 C CG1 . ILE A 1 240  ? 19.444  60.223 55.987  1.00 49.14  ? 237  ILE A CG1 1 
ATOM 1867 C CG2 . ILE A 1 240  ? 21.217  61.974 56.438  1.00 49.14  ? 237  ILE A CG2 1 
ATOM 1868 C CD1 . ILE A 1 240  ? 18.623  61.191 55.178  1.00 49.14  ? 237  ILE A CD1 1 
ATOM 1869 N N   . THR A 1 241  ? 23.370  60.628 58.072  1.00 95.10  ? 238  THR A N   1 
ATOM 1870 C CA  . THR A 1 241  ? 24.492  61.213 58.796  1.00 95.10  ? 238  THR A CA  1 
ATOM 1871 C C   . THR A 1 241  ? 25.397  61.955 57.839  1.00 95.10  ? 238  THR A C   1 
ATOM 1872 O O   . THR A 1 241  ? 25.426  61.681 56.652  1.00 95.10  ? 238  THR A O   1 
ATOM 1873 C CB  . THR A 1 241  ? 25.359  60.142 59.456  1.00 75.68  ? 238  THR A CB  1 
ATOM 1874 O OG1 . THR A 1 241  ? 26.128  59.498 58.438  1.00 75.68  ? 238  THR A OG1 1 
ATOM 1875 C CG2 . THR A 1 241  ? 24.516  59.093 60.219  1.00 75.68  ? 238  THR A CG2 1 
ATOM 1876 N N   . TYR A 1 242  ? 26.172  62.867 58.391  1.00 82.72  ? 239  TYR A N   1 
ATOM 1877 C CA  . TYR A 1 242  ? 27.066  63.713 57.634  1.00 82.72  ? 239  TYR A CA  1 
ATOM 1878 C C   . TYR A 1 242  ? 28.433  63.639 58.253  1.00 82.72  ? 239  TYR A C   1 
ATOM 1879 O O   . TYR A 1 242  ? 28.564  63.646 59.484  1.00 82.72  ? 239  TYR A O   1 
ATOM 1880 C CB  . TYR A 1 242  ? 26.608  65.149 57.756  1.00 61.56  ? 239  TYR A CB  1 
ATOM 1881 C CG  . TYR A 1 242  ? 27.535  66.196 57.158  1.00 61.56  ? 239  TYR A CG  1 
ATOM 1882 C CD1 . TYR A 1 242  ? 27.278  66.735 55.884  1.00 61.56  ? 239  TYR A CD1 1 
ATOM 1883 C CD2 . TYR A 1 242  ? 28.625  66.692 57.871  1.00 61.56  ? 239  TYR A CD2 1 
ATOM 1884 C CE1 . TYR A 1 242  ? 28.099  67.722 55.334  1.00 61.56  ? 239  TYR A CE1 1 
ATOM 1885 C CE2 . TYR A 1 242  ? 29.451  67.674 57.317  1.00 61.56  ? 239  TYR A CE2 1 
ATOM 1886 C CZ  . TYR A 1 242  ? 29.185  68.186 56.046  1.00 61.56  ? 239  TYR A CZ  1 
ATOM 1887 O OH  . TYR A 1 242  ? 29.994  69.164 55.482  1.00 61.56  ? 239  TYR A OH  1 
ATOM 1888 N N   . HIS A 1 243  ? 29.451  63.601 57.390  1.00 54.32  ? 240  HIS A N   1 
ATOM 1889 C CA  . HIS A 1 243  ? 30.833  63.600 57.833  1.00 54.32  ? 240  HIS A CA  1 
ATOM 1890 C C   . HIS A 1 243  ? 31.627  64.644 57.117  1.00 54.32  ? 240  HIS A C   1 
ATOM 1891 O O   . HIS A 1 243  ? 31.352  64.998 55.965  1.00 54.32  ? 240  HIS A O   1 
ATOM 1892 C CB  . HIS A 1 243  ? 31.460  62.234 57.651  1.00 66.16  ? 240  HIS A CB  1 
ATOM 1893 C CG  . HIS A 1 243  ? 30.608  61.127 58.175  1.00 66.16  ? 240  HIS A CG  1 
ATOM 1894 N ND1 . HIS A 1 243  ? 30.896  60.456 59.344  1.00 66.16  ? 240  HIS A ND1 1 
ATOM 1895 C CD2 . HIS A 1 243  ? 29.457  60.589 57.702  1.00 66.16  ? 240  HIS A CD2 1 
ATOM 1896 C CE1 . HIS A 1 243  ? 29.967  59.536 59.557  1.00 66.16  ? 240  HIS A CE1 1 
ATOM 1897 N NE2 . HIS A 1 243  ? 29.084  59.595 58.573  1.00 66.16  ? 240  HIS A NE2 1 
ATOM 1898 N N   . ASN A 1 244  ? 32.583  65.164 57.868  1.00 96.37  ? 241  ASN A N   1 
ATOM 1899 C CA  . ASN A 1 244  ? 33.673  65.960 57.377  1.00 96.37  ? 241  ASN A CA  1 
ATOM 1900 C C   . ASN A 1 244  ? 34.655  65.888 58.526  1.00 96.37  ? 241  ASN A C   1 
ATOM 1901 O O   . ASN A 1 244  ? 34.260  65.555 59.643  1.00 96.37  ? 241  ASN A O   1 
ATOM 1902 C CB  . ASN A 1 244  ? 33.226  67.389 57.091  1.00 83.02  ? 241  ASN A CB  1 
ATOM 1903 C CG  . ASN A 1 244  ? 34.296  68.207 56.403  1.00 83.02  ? 241  ASN A CG  1 
ATOM 1904 O OD1 . ASN A 1 244  ? 35.480  68.088 56.715  1.00 83.02  ? 241  ASN A OD1 1 
ATOM 1905 N ND2 . ASN A 1 244  ? 33.882  69.067 55.474  1.00 83.02  ? 241  ASN A ND2 1 
ATOM 1906 N N   . GLY A 1 245  ? 35.929  66.154 58.253  1.00 116.21 ? 242  GLY A N   1 
ATOM 1907 C CA  . GLY A 1 245  ? 36.980  66.013 59.249  1.00 116.21 ? 242  GLY A CA  1 
ATOM 1908 C C   . GLY A 1 245  ? 36.442  65.498 60.567  1.00 116.21 ? 242  GLY A C   1 
ATOM 1909 O O   . GLY A 1 245  ? 36.122  64.311 60.705  1.00 116.21 ? 242  GLY A O   1 
ATOM 1910 N N   . ASP A 1 246  ? 36.308  66.419 61.519  1.00 97.23  ? 243  ASP A N   1 
ATOM 1911 C CA  . ASP A 1 246  ? 35.878  66.111 62.885  1.00 97.23  ? 243  ASP A CA  1 
ATOM 1912 C C   . ASP A 1 246  ? 34.457  66.614 63.101  1.00 97.23  ? 243  ASP A C   1 
ATOM 1913 O O   . ASP A 1 246  ? 33.982  66.721 64.239  1.00 97.23  ? 243  ASP A O   1 
ATOM 1914 C CB  . ASP A 1 246  ? 36.825  66.768 63.890  1.00 185.37 ? 243  ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 246  ? 38.267  66.776 63.415  1.00 185.37 ? 243  ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 246  ? 38.806  67.881 63.178  1.00 185.37 ? 243  ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 246  ? 38.854  65.680 63.264  1.00 185.37 ? 243  ASP A OD2 1 
ATOM 1918 N N   . LYS A 1 247  ? 33.794  66.933 61.988  1.00 58.96  ? 244  LYS A N   1 
ATOM 1919 C CA  . LYS A 1 247  ? 32.396  67.331 61.985  1.00 58.96  ? 244  LYS A CA  1 
ATOM 1920 C C   . LYS A 1 247  ? 31.500  66.084 61.876  1.00 58.96  ? 244  LYS A C   1 
ATOM 1921 O O   . LYS A 1 247  ? 31.828  65.128 61.162  1.00 58.96  ? 244  LYS A O   1 
ATOM 1922 C CB  . LYS A 1 247  ? 32.159  68.306 60.838  1.00 55.81  ? 244  LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 247  ? 30.915  69.146 61.005  1.00 55.81  ? 244  LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 247  ? 31.093  70.347 61.967  1.00 55.81  ? 244  LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 247  ? 29.724  70.898 62.431  1.00 55.81  ? 244  LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 247  ? 28.900  69.915 63.290  1.00 55.81  ? 244  LYS A NZ  1 
ATOM 1927 N N   . TYR A 1 248  ? 30.399  66.075 62.616  1.00 53.71  ? 245  TYR A N   1 
ATOM 1928 C CA  . TYR A 1 248  ? 29.531  64.908 62.655  1.00 53.71  ? 245  TYR A CA  1 
ATOM 1929 C C   . TYR A 1 248  ? 28.117  65.265 63.126  1.00 53.71  ? 245  TYR A C   1 
ATOM 1930 O O   . TYR A 1 248  ? 27.858  65.336 64.339  1.00 53.71  ? 245  TYR A O   1 
ATOM 1931 C CB  . TYR A 1 248  ? 30.100  63.813 63.554  1.00 76.48  ? 245  TYR A CB  1 
ATOM 1932 C CG  . TYR A 1 248  ? 29.165  62.645 63.705  1.00 76.48  ? 245  TYR A CG  1 
ATOM 1933 C CD1 . TYR A 1 248  ? 29.065  61.682 62.708  1.00 76.48  ? 245  TYR A CD1 1 
ATOM 1934 C CD2 . TYR A 1 248  ? 28.370  62.501 64.832  1.00 76.48  ? 245  TYR A CD2 1 
ATOM 1935 C CE1 . TYR A 1 248  ? 28.190  60.576 62.827  1.00 76.48  ? 245  TYR A CE1 1 
ATOM 1936 C CE2 . TYR A 1 248  ? 27.488  61.400 64.975  1.00 76.48  ? 245  TYR A CE2 1 
ATOM 1937 C CZ  . TYR A 1 248  ? 27.406  60.447 63.964  1.00 76.48  ? 245  TYR A CZ  1 
ATOM 1938 O OH  . TYR A 1 248  ? 26.546  59.382 64.075  1.00 76.48  ? 245  TYR A OH  1 
ATOM 1939 N N   . LEU A 1 249  ? 27.212  65.484 62.168  1.00 63.71  ? 246  LEU A N   1 
ATOM 1940 C CA  . LEU A 1 249  ? 25.781  65.645 62.445  1.00 63.71  ? 246  LEU A CA  1 
ATOM 1941 C C   . LEU A 1 249  ? 25.034  64.360 62.096  1.00 63.71  ? 246  LEU A C   1 
ATOM 1942 O O   . LEU A 1 249  ? 25.551  63.565 61.337  1.00 63.71  ? 246  LEU A O   1 
ATOM 1943 C CB  . LEU A 1 249  ? 25.241  66.836 61.662  1.00 83.57  ? 246  LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 249  ? 25.754  68.168 62.231  1.00 83.57  ? 246  LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 249  ? 25.829  69.277 61.157  1.00 83.57  ? 246  LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 249  ? 24.923  68.606 63.470  1.00 83.57  ? 246  LEU A CD2 1 
ATOM 1947 N N   . ALA A 1 250  ? 23.836  64.134 62.638  1.00 67.17  ? 247  ALA A N   1 
ATOM 1948 C CA  . ALA A 1 250  ? 23.173  62.837 62.428  1.00 67.17  ? 247  ALA A CA  1 
ATOM 1949 C C   . ALA A 1 250  ? 21.734  62.758 62.952  1.00 67.17  ? 247  ALA A C   1 
ATOM 1950 O O   . ALA A 1 250  ? 21.463  63.143 64.086  1.00 67.17  ? 247  ALA A O   1 
ATOM 1951 C CB  . ALA A 1 250  ? 24.049  61.687 63.032  1.00 28.27  ? 247  ALA A CB  1 
ATOM 1952 N N   . ILE A 1 251  ? 20.829  62.218 62.140  1.00 82.41  ? 248  ILE A N   1 
ATOM 1953 C CA  . ILE A 1 251  ? 19.396  62.185 62.477  1.00 82.41  ? 248  ILE A CA  1 
ATOM 1954 C C   . ILE A 1 251  ? 18.744  60.838 62.246  1.00 82.41  ? 248  ILE A C   1 
ATOM 1955 O O   . ILE A 1 251  ? 19.135  60.107 61.337  1.00 82.41  ? 248  ILE A O   1 
ATOM 1956 C CB  . ILE A 1 251  ? 18.603  63.175 61.612  1.00 62.51  ? 248  ILE A CB  1 
ATOM 1957 C CG1 . ILE A 1 251  ? 18.752  62.801 60.130  1.00 62.51  ? 248  ILE A CG1 1 
ATOM 1958 C CG2 . ILE A 1 251  ? 19.067  64.620 61.873  1.00 62.51  ? 248  ILE A CG2 1 
ATOM 1959 C CD1 . ILE A 1 251  ? 18.031  63.746 59.192  1.00 62.51  ? 248  ILE A CD1 1 
ATOM 1960 N N   . ALA A 1 252  ? 17.711  60.534 63.025  1.00 68.32  ? 249  ALA A N   1 
ATOM 1961 C CA  . ALA A 1 252  ? 16.966  59.275 62.833  1.00 68.32  ? 249  ALA A CA  1 
ATOM 1962 C C   . ALA A 1 252  ? 15.473  59.506 62.655  1.00 68.32  ? 249  ALA A C   1 
ATOM 1963 O O   . ALA A 1 252  ? 14.702  59.100 63.525  1.00 68.32  ? 249  ALA A O   1 
ATOM 1964 C CB  . ALA A 1 252  ? 17.240  58.255 63.997  1.00 42.53  ? 249  ALA A CB  1 
ATOM 1965 N N   . PRO A 1 253  ? 15.057  60.114 61.509  1.00 53.41  ? 250  PRO A N   1 
ATOM 1966 C CA  . PRO A 1 253  ? 13.658  60.573 61.346  1.00 53.41  ? 250  PRO A CA  1 
ATOM 1967 C C   . PRO A 1 253  ? 12.741  59.384 61.089  1.00 53.41  ? 250  PRO A C   1 
ATOM 1968 O O   . PRO A 1 253  ? 12.829  58.745 60.038  1.00 53.41  ? 250  PRO A O   1 
ATOM 1969 C CB  . PRO A 1 253  ? 13.719  61.514 60.138  1.00 64.43  ? 250  PRO A CB  1 
ATOM 1970 C CG  . PRO A 1 253  ? 14.881  61.043 59.349  1.00 64.43  ? 250  PRO A CG  1 
ATOM 1971 C CD  . PRO A 1 253  ? 15.840  60.323 60.274  1.00 64.43  ? 250  PRO A CD  1 
ATOM 1972 N N   . PRO A 1 254  ? 11.887  59.056 62.061  1.00 87.78  ? 251  PRO A N   1 
ATOM 1973 C CA  . PRO A 1 254  ? 11.081  57.859 61.922  1.00 87.78  ? 251  PRO A CA  1 
ATOM 1974 C C   . PRO A 1 254  ? 10.573  57.692 60.477  1.00 87.78  ? 251  PRO A C   1 
ATOM 1975 O O   . PRO A 1 254  ? 10.522  56.563 59.950  1.00 87.78  ? 251  PRO A O   1 
ATOM 1976 C CB  . PRO A 1 254  ? 9.924   58.140 62.886  1.00 66.36  ? 251  PRO A CB  1 
ATOM 1977 C CG  . PRO A 1 254  ? 10.575  58.894 63.985  1.00 66.36  ? 251  PRO A CG  1 
ATOM 1978 C CD  . PRO A 1 254  ? 11.589  59.777 63.311  1.00 66.36  ? 251  PRO A CD  1 
ATOM 1979 N N   . ILE A 1 255  ? 10.252  58.836 59.860  1.00 79.39  ? 252  ILE A N   1 
ATOM 1980 C CA  . ILE A 1 255  ? 9.615   58.937 58.555  1.00 79.39  ? 252  ILE A CA  1 
ATOM 1981 C C   . ILE A 1 255  ? 10.318  58.154 57.437  1.00 79.39  ? 252  ILE A C   1 
ATOM 1982 O O   . ILE A 1 255  ? 9.655   57.558 56.576  1.00 79.39  ? 252  ILE A O   1 
ATOM 1983 C CB  . ILE A 1 255  ? 9.451   60.416 58.177  1.00 43.16  ? 252  ILE A CB  1 
ATOM 1984 C CG1 . ILE A 1 255  ? 8.243   60.654 57.275  1.00 43.16  ? 252  ILE A CG1 1 
ATOM 1985 C CG2 . ILE A 1 255  ? 10.741  61.042 57.532  1.00 43.16  ? 252  ILE A CG2 1 
ATOM 1986 C CD1 . ILE A 1 255  ? 8.187   62.160 56.852  1.00 43.16  ? 252  ILE A CD1 1 
ATOM 1987 N N   . ILE A 1 256  ? 11.649  58.143 57.446  1.00 53.39  ? 253  ILE A N   1 
ATOM 1988 C CA  . ILE A 1 256  ? 12.386  57.435 56.412  1.00 53.39  ? 253  ILE A CA  1 
ATOM 1989 C C   . ILE A 1 256  ? 12.560  55.962 56.721  1.00 53.39  ? 253  ILE A C   1 
ATOM 1990 O O   . ILE A 1 256  ? 12.868  55.195 55.842  1.00 53.39  ? 253  ILE A O   1 
ATOM 1991 C CB  . ILE A 1 256  ? 13.735  58.094 56.125  1.00 45.01  ? 253  ILE A CB  1 
ATOM 1992 C CG1 . ILE A 1 256  ? 14.652  58.043 57.364  1.00 45.01  ? 253  ILE A CG1 1 
ATOM 1993 C CG2 . ILE A 1 256  ? 13.519  59.533 55.602  1.00 45.01  ? 253  ILE A CG2 1 
ATOM 1994 C CD1 . ILE A 1 256  ? 16.149  58.273 57.041  1.00 45.01  ? 253  ILE A CD1 1 
ATOM 1995 N N   . LYS A 1 257  ? 12.335  55.546 57.955  1.00 63.24  ? 254  LYS A N   1 
ATOM 1996 C CA  . LYS A 1 257  ? 12.504  54.140 58.273  1.00 63.24  ? 254  LYS A CA  1 
ATOM 1997 C C   . LYS A 1 257  ? 11.595  53.263 57.417  1.00 63.24  ? 254  LYS A C   1 
ATOM 1998 O O   . LYS A 1 257  ? 11.993  52.156 57.018  1.00 63.24  ? 254  LYS A O   1 
ATOM 1999 C CB  . LYS A 1 257  ? 12.304  53.867 59.770  1.00 92.09  ? 254  LYS A CB  1 
ATOM 2000 C CG  . LYS A 1 257  ? 12.671  52.438 60.174  1.00 92.09  ? 254  LYS A CG  1 
ATOM 2001 C CD  . LYS A 1 257  ? 13.011  52.307 61.655  1.00 92.09  ? 254  LYS A CD  1 
ATOM 2002 C CE  . LYS A 1 257  ? 13.445  50.865 62.010  1.00 92.09  ? 254  LYS A CE  1 
ATOM 2003 N NZ  . LYS A 1 257  ? 14.811  50.466 61.512  1.00 92.09  ? 254  LYS A NZ  1 
ATOM 2004 N N   . GLN A 1 258  ? 10.386  53.771 57.127  1.00 57.01  ? 255  GLN A N   1 
ATOM 2005 C CA  . GLN A 1 258  ? 9.342   53.040 56.347  1.00 57.01  ? 255  GLN A CA  1 
ATOM 2006 C C   . GLN A 1 258  ? 9.831   52.295 55.096  1.00 57.01  ? 255  GLN A C   1 
ATOM 2007 O O   . GLN A 1 258  ? 9.261   51.301 54.712  1.00 57.01  ? 255  GLN A O   1 
ATOM 2008 C CB  . GLN A 1 258  ? 8.220   53.990 55.916  1.00 115.94 ? 255  GLN A CB  1 
ATOM 2009 C CG  . GLN A 1 258  ? 6.822   53.627 56.407  1.00 115.94 ? 255  GLN A CG  1 
ATOM 2010 C CD  . GLN A 1 258  ? 6.205   54.695 57.298  1.00 115.94 ? 255  GLN A CD  1 
ATOM 2011 O OE1 . GLN A 1 258  ? 6.830   55.736 57.577  1.00 115.94 ? 255  GLN A OE1 1 
ATOM 2012 N NE2 . GLN A 1 258  ? 4.963   54.444 57.745  1.00 115.94 ? 255  GLN A NE2 1 
ATOM 2013 N N   . SER A 1 259  ? 10.880  52.797 54.466  1.00 59.65  ? 256  SER A N   1 
ATOM 2014 C CA  . SER A 1 259  ? 11.389  52.206 53.262  1.00 59.65  ? 256  SER A CA  1 
ATOM 2015 C C   . SER A 1 259  ? 12.736  52.805 52.941  1.00 59.65  ? 256  SER A C   1 
ATOM 2016 O O   . SER A 1 259  ? 13.124  53.811 53.529  1.00 59.65  ? 256  SER A O   1 
ATOM 2017 C CB  . SER A 1 259  ? 10.426  52.460 52.117  1.00 57.91  ? 256  SER A CB  1 
ATOM 2018 O OG  . SER A 1 259  ? 10.750  51.657 50.997  1.00 57.91  ? 256  SER A OG  1 
ATOM 2019 N N   . THR A 1 260  ? 13.456  52.196 52.002  1.00 64.45  ? 257  THR A N   1 
ATOM 2020 C CA  . THR A 1 260  ? 14.856  52.580 51.797  1.00 64.45  ? 257  THR A CA  1 
ATOM 2021 C C   . THR A 1 260  ? 14.958  53.700 50.806  1.00 64.45  ? 257  THR A C   1 
ATOM 2022 O O   . THR A 1 260  ? 14.220  53.728 49.810  1.00 64.45  ? 257  THR A O   1 
ATOM 2023 C CB  . THR A 1 260  ? 15.732  51.422 51.300  1.00 60.72  ? 257  THR A CB  1 
ATOM 2024 O OG1 . THR A 1 260  ? 15.432  50.240 52.051  1.00 60.72  ? 257  THR A OG1 1 
ATOM 2025 C CG2 . THR A 1 260  ? 17.163  51.759 51.489  1.00 60.72  ? 257  THR A CG2 1 
ATOM 2026 N N   . ILE A 1 261  ? 15.874  54.621 51.097  1.00 46.05  ? 258  ILE A N   1 
ATOM 2027 C CA  . ILE A 1 261  ? 16.241  55.643 50.127  1.00 46.05  ? 258  ILE A CA  1 
ATOM 2028 C C   . ILE A 1 261  ? 17.098  55.001 49.062  1.00 46.05  ? 258  ILE A C   1 
ATOM 2029 O O   . ILE A 1 261  ? 17.714  53.999 49.286  1.00 46.05  ? 258  ILE A O   1 
ATOM 2030 C CB  . ILE A 1 261  ? 16.846  56.860 50.784  1.00 38.41  ? 258  ILE A CB  1 
ATOM 2031 C CG1 . ILE A 1 261  ? 15.690  57.606 51.480  1.00 38.41  ? 258  ILE A CG1 1 
ATOM 2032 C CG2 . ILE A 1 261  ? 17.425  57.783 49.757  1.00 38.41  ? 258  ILE A CG2 1 
ATOM 2033 C CD1 . ILE A 1 261  ? 16.008  58.185 52.902  1.00 38.41  ? 258  ILE A CD1 1 
ATOM 2034 N N   . VAL A 1 262  ? 17.111  55.548 47.871  1.00 43.51  ? 259  VAL A N   1 
ATOM 2035 C CA  . VAL A 1 262  ? 17.415  54.723 46.721  1.00 43.51  ? 259  VAL A CA  1 
ATOM 2036 C C   . VAL A 1 262  ? 18.011  55.524 45.571  1.00 43.51  ? 259  VAL A C   1 
ATOM 2037 O O   . VAL A 1 262  ? 18.716  54.989 44.766  1.00 43.51  ? 259  VAL A O   1 
ATOM 2038 C CB  . VAL A 1 262  ? 16.118  53.962 46.365  1.00 33.29  ? 259  VAL A CB  1 
ATOM 2039 C CG1 . VAL A 1 262  ? 15.460  54.400 45.015  1.00 33.29  ? 259  VAL A CG1 1 
ATOM 2040 C CG2 . VAL A 1 262  ? 16.377  52.492 46.490  1.00 33.29  ? 259  VAL A CG2 1 
ATOM 2041 N N   . CYS A 1 263  ? 17.712  56.818 45.515  1.00 57.22  ? 260  CYS A N   1 
ATOM 2042 C CA  . CYS A 1 263  ? 18.276  57.719 44.520  1.00 57.22  ? 260  CYS A CA  1 
ATOM 2043 C C   . CYS A 1 263  ? 18.097  59.093 45.064  1.00 57.22  ? 260  CYS A C   1 
ATOM 2044 O O   . CYS A 1 263  ? 17.099  59.358 45.708  1.00 57.22  ? 260  CYS A O   1 
ATOM 2045 C CB  . CYS A 1 263  ? 17.556  57.632 43.180  1.00 42.56  ? 260  CYS A CB  1 
ATOM 2046 S SG  . CYS A 1 263  ? 15.741  57.774 43.261  1.00 42.56  ? 260  CYS A SG  1 
ATOM 2047 N N   . HIS A 1 264  ? 19.071  59.952 44.799  1.00 40.08  ? 261  HIS A N   1 
ATOM 2048 C CA  . HIS A 1 264  ? 19.088  61.312 45.286  1.00 40.08  ? 261  HIS A CA  1 
ATOM 2049 C C   . HIS A 1 264  ? 19.443  62.318 44.195  1.00 40.08  ? 261  HIS A C   1 
ATOM 2050 O O   . HIS A 1 264  ? 19.812  61.945 43.103  1.00 40.08  ? 261  HIS A O   1 
ATOM 2051 C CB  . HIS A 1 264  ? 20.038  61.439 46.480  1.00 51.67  ? 261  HIS A CB  1 
ATOM 2052 C CG  . HIS A 1 264  ? 21.442  60.936 46.246  1.00 51.67  ? 261  HIS A CG  1 
ATOM 2053 N ND1 . HIS A 1 264  ? 22.438  61.722 45.695  1.00 51.67  ? 261  HIS A ND1 1 
ATOM 2054 C CD2 . HIS A 1 264  ? 22.032  59.760 46.592  1.00 51.67  ? 261  HIS A CD2 1 
ATOM 2055 C CE1 . HIS A 1 264  ? 23.566  61.030 45.672  1.00 51.67  ? 261  HIS A CE1 1 
ATOM 2056 N NE2 . HIS A 1 264  ? 23.345  59.840 46.209  1.00 51.67  ? 261  HIS A NE2 1 
ATOM 2057 N N   . ASN A 1 265  ? 19.329  63.605 44.466  1.00 41.30  ? 262  ASN A N   1 
ATOM 2058 C CA  . ASN A 1 265  ? 19.652  64.593 43.449  1.00 41.30  ? 262  ASN A CA  1 
ATOM 2059 C C   . ASN A 1 265  ? 19.913  65.851 44.180  1.00 41.30  ? 262  ASN A C   1 
ATOM 2060 O O   . ASN A 1 265  ? 19.250  66.077 45.192  1.00 41.30  ? 262  ASN A O   1 
ATOM 2061 C CB  . ASN A 1 265  ? 18.477  64.831 42.540  1.00 56.52  ? 262  ASN A CB  1 
ATOM 2062 C CG  . ASN A 1 265  ? 18.818  65.753 41.428  1.00 56.52  ? 262  ASN A CG  1 
ATOM 2063 O OD1 . ASN A 1 265  ? 19.445  65.342 40.451  1.00 56.52  ? 262  ASN A OD1 1 
ATOM 2064 N ND2 . ASN A 1 265  ? 18.446  67.020 41.562  1.00 56.52  ? 262  ASN A ND2 1 
ATOM 2065 N N   . ARG A 1 266  ? 20.890  66.640 43.709  1.00 45.20  ? 263  ARG A N   1 
ATOM 2066 C CA  . ARG A 1 266  ? 21.213  67.924 44.313  1.00 45.20  ? 263  ARG A CA  1 
ATOM 2067 C C   . ARG A 1 266  ? 20.284  68.909 43.700  1.00 45.20  ? 263  ARG A C   1 
ATOM 2068 O O   . ARG A 1 266  ? 20.264  69.038 42.491  1.00 45.20  ? 263  ARG A O   1 
ATOM 2069 C CB  . ARG A 1 266  ? 22.661  68.324 44.047  1.00 53.43  ? 263  ARG A CB  1 
ATOM 2070 C CG  . ARG A 1 266  ? 22.899  69.832 44.100  1.00 53.43  ? 263  ARG A CG  1 
ATOM 2071 C CD  . ARG A 1 266  ? 24.261  70.271 44.618  1.00 53.43  ? 263  ARG A CD  1 
ATOM 2072 N NE  . ARG A 1 266  ? 25.331  69.509 44.004  1.00 53.43  ? 263  ARG A NE  1 
ATOM 2073 C CZ  . ARG A 1 266  ? 25.780  69.660 42.754  1.00 53.43  ? 263  ARG A CZ  1 
ATOM 2074 N NH1 . ARG A 1 266  ? 25.258  70.581 41.935  1.00 53.43  ? 263  ARG A NH1 1 
ATOM 2075 N NH2 . ARG A 1 266  ? 26.752  68.853 42.312  1.00 53.43  ? 263  ARG A NH2 1 
ATOM 2076 N N   . VAL A 1 267  ? 19.491  69.578 44.527  1.00 46.26  ? 264  VAL A N   1 
ATOM 2077 C CA  . VAL A 1 267  ? 18.517  70.579 44.029  1.00 46.26  ? 264  VAL A CA  1 
ATOM 2078 C C   . VAL A 1 267  ? 19.227  71.918 43.833  1.00 46.26  ? 264  VAL A C   1 
ATOM 2079 O O   . VAL A 1 267  ? 19.221  72.491 42.738  1.00 46.26  ? 264  VAL A O   1 
ATOM 2080 C CB  . VAL A 1 267  ? 17.299  70.739 44.963  1.00 64.66  ? 264  VAL A CB  1 
ATOM 2081 C CG1 . VAL A 1 267  ? 16.302  71.675 44.367  1.00 64.66  ? 264  VAL A CG1 1 
ATOM 2082 C CG2 . VAL A 1 267  ? 16.642  69.413 45.172  1.00 64.66  ? 264  VAL A CG2 1 
ATOM 2083 N N   . ASP A 1 268  ? 19.881  72.379 44.882  1.00 68.10  ? 265  ASP A N   1 
ATOM 2084 C CA  . ASP A 1 268  ? 20.555  73.633 44.811  1.00 68.10  ? 265  ASP A CA  1 
ATOM 2085 C C   . ASP A 1 268  ? 22.051  73.471 44.655  1.00 68.10  ? 265  ASP A C   1 
ATOM 2086 O O   . ASP A 1 268  ? 22.694  72.773 45.445  1.00 68.10  ? 265  ASP A O   1 
ATOM 2087 C CB  . ASP A 1 268  ? 20.200  74.464 46.033  1.00 63.97  ? 265  ASP A CB  1 
ATOM 2088 C CG  . ASP A 1 268  ? 18.757  74.920 45.999  1.00 63.97  ? 265  ASP A CG  1 
ATOM 2089 O OD1 . ASP A 1 268  ? 18.361  75.505 44.957  1.00 63.97  ? 265  ASP A OD1 1 
ATOM 2090 O OD2 . ASP A 1 268  ? 18.025  74.673 46.993  1.00 63.97  ? 265  ASP A OD2 1 
ATOM 2091 N N   . PRO A 1 269  ? 22.610  74.133 43.628  1.00 61.74  ? 266  PRO A N   1 
ATOM 2092 C CA  . PRO A 1 269  ? 24.029  74.081 43.298  1.00 61.74  ? 266  PRO A CA  1 
ATOM 2093 C C   . PRO A 1 269  ? 24.909  74.148 44.544  1.00 61.74  ? 266  PRO A C   1 
ATOM 2094 O O   . PRO A 1 269  ? 26.012  73.597 44.544  1.00 61.74  ? 266  PRO A O   1 
ATOM 2095 C CB  . PRO A 1 269  ? 24.252  75.346 42.446  1.00 42.41  ? 266  PRO A CB  1 
ATOM 2096 C CG  . PRO A 1 269  ? 22.915  75.744 41.905  1.00 42.41  ? 266  PRO A CG  1 
ATOM 2097 C CD  . PRO A 1 269  ? 21.842  74.988 42.697  1.00 42.41  ? 266  PRO A CD  1 
ATOM 2098 N N   . ASN A 1 270  ? 24.438  74.834 45.584  1.00 50.82  ? 267  ASN A N   1 
ATOM 2099 C CA  . ASN A 1 270  ? 25.276  75.080 46.756  1.00 50.82  ? 267  ASN A CA  1 
ATOM 2100 C C   . ASN A 1 270  ? 25.149  73.916 47.699  1.00 50.82  ? 267  ASN A C   1 
ATOM 2101 O O   . ASN A 1 270  ? 26.040  73.665 48.519  1.00 50.82  ? 267  ASN A O   1 
ATOM 2102 C CB  . ASN A 1 270  ? 24.924  76.396 47.452  1.00 72.83  ? 267  ASN A CB  1 
ATOM 2103 C CG  . ASN A 1 270  ? 23.544  76.375 48.030  1.00 72.83  ? 267  ASN A CG  1 
ATOM 2104 O OD1 . ASN A 1 270  ? 22.552  76.657 47.343  1.00 72.83  ? 267  ASN A OD1 1 
ATOM 2105 N ND2 . ASN A 1 270  ? 23.458  76.006 49.295  1.00 72.83  ? 267  ASN A ND2 1 
ATOM 2106 N N   . GLY A 1 271  ? 24.040  73.193 47.572  1.00 52.25  ? 268  GLY A N   1 
ATOM 2107 C CA  . GLY A 1 271  ? 23.832  71.968 48.353  1.00 52.25  ? 268  GLY A CA  1 
ATOM 2108 C C   . GLY A 1 271  ? 23.040  72.159 49.626  1.00 52.25  ? 268  GLY A C   1 
ATOM 2109 O O   . GLY A 1 271  ? 23.126  71.349 50.544  1.00 52.25  ? 268  GLY A O   1 
ATOM 2110 N N   . SER A 1 272  ? 22.269  73.240 49.683  1.00 76.42  ? 269  SER A N   1 
ATOM 2111 C CA  . SER A 1 272  ? 21.345  73.450 50.768  1.00 76.42  ? 269  SER A CA  1 
ATOM 2112 C C   . SER A 1 272  ? 20.325  72.317 50.729  1.00 76.42  ? 269  SER A C   1 
ATOM 2113 O O   . SER A 1 272  ? 19.911  71.824 51.785  1.00 76.42  ? 269  SER A O   1 
ATOM 2114 C CB  . SER A 1 272  ? 20.658  74.785 50.581  1.00 87.18  ? 269  SER A CB  1 
ATOM 2115 O OG  . SER A 1 272  ? 20.316  74.940 49.214  1.00 87.18  ? 269  SER A OG  1 
ATOM 2116 N N   . ARG A 1 273  ? 19.958  71.892 49.509  1.00 64.22  ? 270  ARG A N   1 
ATOM 2117 C CA  . ARG A 1 273  ? 18.863  70.931 49.285  1.00 64.22  ? 270  ARG A CA  1 
ATOM 2118 C C   . ARG A 1 273  ? 19.169  69.768 48.369  1.00 64.22  ? 270  ARG A C   1 
ATOM 2119 O O   . ARG A 1 273  ? 19.974  69.871 47.447  1.00 64.22  ? 270  ARG A O   1 
ATOM 2120 C CB  . ARG A 1 273  ? 17.646  71.637 48.713  1.00 56.71  ? 270  ARG A CB  1 
ATOM 2121 C CG  . ARG A 1 273  ? 17.098  72.694 49.632  1.00 56.71  ? 270  ARG A CG  1 
ATOM 2122 C CD  . ARG A 1 273  ? 15.831  73.289 49.100  1.00 56.71  ? 270  ARG A CD  1 
ATOM 2123 N NE  . ARG A 1 273  ? 15.981  73.892 47.782  1.00 56.71  ? 270  ARG A NE  1 
ATOM 2124 C CZ  . ARG A 1 273  ? 14.989  74.508 47.150  1.00 56.71  ? 270  ARG A CZ  1 
ATOM 2125 N NH1 . ARG A 1 273  ? 13.787  74.603 47.716  1.00 56.71  ? 270  ARG A NH1 1 
ATOM 2126 N NH2 . ARG A 1 273  ? 15.187  75.018 45.951  1.00 56.71  ? 270  ARG A NH2 1 
ATOM 2127 N N   . TYR A 1 274  ? 18.475  68.664 48.614  1.00 43.51  ? 271  TYR A N   1 
ATOM 2128 C CA  . TYR A 1 274  ? 18.626  67.435 47.838  1.00 43.51  ? 271  TYR A CA  1 
ATOM 2129 C C   . TYR A 1 274  ? 17.293  66.713 47.823  1.00 43.51  ? 271  TYR A C   1 
ATOM 2130 O O   . TYR A 1 274  ? 16.565  66.726 48.830  1.00 43.51  ? 271  TYR A O   1 
ATOM 2131 C CB  . TYR A 1 274  ? 19.654  66.490 48.479  1.00 60.22  ? 271  TYR A CB  1 
ATOM 2132 C CG  . TYR A 1 274  ? 21.085  66.908 48.309  1.00 60.22  ? 271  TYR A CG  1 
ATOM 2133 C CD1 . TYR A 1 274  ? 21.772  67.529 49.344  1.00 60.22  ? 271  TYR A CD1 1 
ATOM 2134 C CD2 . TYR A 1 274  ? 21.762  66.681 47.121  1.00 60.22  ? 271  TYR A CD2 1 
ATOM 2135 C CE1 . TYR A 1 274  ? 23.099  67.917 49.188  1.00 60.22  ? 271  TYR A CE1 1 
ATOM 2136 C CE2 . TYR A 1 274  ? 23.067  67.064 46.960  1.00 60.22  ? 271  TYR A CE2 1 
ATOM 2137 C CZ  . TYR A 1 274  ? 23.728  67.682 47.988  1.00 60.22  ? 271  TYR A CZ  1 
ATOM 2138 O OH  . TYR A 1 274  ? 25.030  68.077 47.830  1.00 60.22  ? 271  TYR A OH  1 
ATOM 2139 N N   . LEU A 1 275  ? 16.997  66.053 46.705  1.00 43.50  ? 272  LEU A N   1 
ATOM 2140 C CA  . LEU A 1 275  ? 15.833  65.192 46.614  1.00 43.50  ? 272  LEU A CA  1 
ATOM 2141 C C   . LEU A 1 275  ? 16.187  63.807 47.106  1.00 43.50  ? 272  LEU A C   1 
ATOM 2142 O O   . LEU A 1 275  ? 17.332  63.447 47.052  1.00 43.50  ? 272  LEU A O   1 
ATOM 2143 C CB  . LEU A 1 275  ? 15.325  65.176 45.187  1.00 44.16  ? 272  LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 275  ? 14.669  66.539 44.898  1.00 44.16  ? 272  LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 275  ? 14.213  66.681 43.424  1.00 44.16  ? 272  LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 275  ? 13.510  66.847 45.866  1.00 44.16  ? 272  LEU A CD2 1 
ATOM 2147 N N   . LEU A 1 276  ? 15.248  63.034 47.635  1.00 47.14  ? 273  LEU A N   1 
ATOM 2148 C CA  . LEU A 1 276  ? 15.572  61.643 47.929  1.00 47.14  ? 273  LEU A CA  1 
ATOM 2149 C C   . LEU A 1 276  ? 14.435  60.725 47.480  1.00 47.14  ? 273  LEU A C   1 
ATOM 2150 O O   . LEU A 1 276  ? 13.254  60.982 47.748  1.00 47.14  ? 273  LEU A O   1 
ATOM 2151 C CB  . LEU A 1 276  ? 15.912  61.422 49.408  1.00 59.77  ? 273  LEU A CB  1 
ATOM 2152 C CG  . LEU A 1 276  ? 16.915  62.298 50.198  1.00 59.77  ? 273  LEU A CG  1 
ATOM 2153 C CD1 . LEU A 1 276  ? 17.090  61.785 51.636  1.00 59.77  ? 273  LEU A CD1 1 
ATOM 2154 C CD2 . LEU A 1 276  ? 18.273  62.411 49.543  1.00 59.77  ? 273  LEU A CD2 1 
ATOM 2155 N N   . GLY A 1 277  ? 14.793  59.655 46.779  1.00 47.53  ? 274  GLY A N   1 
ATOM 2156 C CA  . GLY A 1 277  ? 13.816  58.706 46.310  1.00 47.53  ? 274  GLY A CA  1 
ATOM 2157 C C   . GLY A 1 277  ? 13.694  57.537 47.240  1.00 47.53  ? 274  GLY A C   1 
ATOM 2158 O O   . GLY A 1 277  ? 14.686  57.033 47.720  1.00 47.53  ? 274  GLY A O   1 
ATOM 2159 N N   . ASP A 1 278  ? 12.458  57.096 47.451  1.00 42.81  ? 275  ASP A N   1 
ATOM 2160 C CA  . ASP A 1 278  ? 12.101  55.902 48.258  1.00 42.81  ? 275  ASP A CA  1 
ATOM 2161 C C   . ASP A 1 278  ? 11.758  54.721 47.323  1.00 42.81  ? 275  ASP A C   1 
ATOM 2162 O O   . ASP A 1 278  ? 11.319  54.940 46.187  1.00 42.81  ? 275  ASP A O   1 
ATOM 2163 C CB  . ASP A 1 278  ? 10.852  56.238 49.109  1.00 83.80  ? 275  ASP A CB  1 
ATOM 2164 C CG  . ASP A 1 278  ? 10.882  55.624 50.502  1.00 83.80  ? 275  ASP A CG  1 
ATOM 2165 O OD1 . ASP A 1 278  ? 10.361  56.260 51.442  1.00 83.80  ? 275  ASP A OD1 1 
ATOM 2166 O OD2 . ASP A 1 278  ? 11.417  54.513 50.665  1.00 83.80  ? 275  ASP A OD2 1 
ATOM 2167 N N   . MET A 1 279  ? 11.931  53.485 47.810  1.00 38.16  ? 276  MET A N   1 
ATOM 2168 C CA  . MET A 1 279  ? 11.440  52.305 47.110  1.00 38.16  ? 276  MET A CA  1 
ATOM 2169 C C   . MET A 1 279  ? 9.936   52.450 47.017  1.00 38.16  ? 276  MET A C   1 
ATOM 2170 O O   . MET A 1 279  ? 9.294   51.837 46.182  1.00 38.16  ? 276  MET A O   1 
ATOM 2171 C CB  . MET A 1 279  ? 11.817  51.025 47.860  1.00 98.16  ? 276  MET A CB  1 
ATOM 2172 C CG  . MET A 1 279  ? 11.766  49.740 47.022  1.00 98.16  ? 276  MET A CG  1 
ATOM 2173 S SD  . MET A 1 279  ? 10.234  49.432 46.067  1.00 98.16  ? 276  MET A SD  1 
ATOM 2174 C CE  . MET A 1 279  ? 9.057   48.789 47.307  1.00 98.16  ? 276  MET A CE  1 
ATOM 2175 N N   . GLU A 1 280  ? 9.384   53.303 47.880  1.00 51.63  ? 277  GLU A N   1 
ATOM 2176 C CA  . GLU A 1 280  ? 7.941   53.486 48.062  1.00 51.63  ? 277  GLU A CA  1 
ATOM 2177 C C   . GLU A 1 280  ? 7.340   54.436 47.049  1.00 51.63  ? 277  GLU A C   1 
ATOM 2178 O O   . GLU A 1 280  ? 6.109   54.545 46.968  1.00 51.63  ? 277  GLU A O   1 
ATOM 2179 C CB  . GLU A 1 280  ? 7.657   54.067 49.449  1.00 123.48 ? 277  GLU A CB  1 
ATOM 2180 C CG  . GLU A 1 280  ? 7.746   53.095 50.592  1.00 123.48 ? 277  GLU A CG  1 
ATOM 2181 C CD  . GLU A 1 280  ? 6.753   51.969 50.489  1.00 123.48 ? 277  GLU A CD  1 
ATOM 2182 O OE1 . GLU A 1 280  ? 6.360   51.611 49.360  1.00 123.48 ? 277  GLU A OE1 1 
ATOM 2183 O OE2 . GLU A 1 280  ? 6.375   51.434 51.547  1.00 123.48 ? 277  GLU A OE2 1 
ATOM 2184 N N   . GLY A 1 281  ? 8.185   55.146 46.300  1.00 46.26  ? 278  GLY A N   1 
ATOM 2185 C CA  . GLY A 1 281  ? 7.696   56.211 45.423  1.00 46.26  ? 278  GLY A CA  1 
ATOM 2186 C C   . GLY A 1 281  ? 7.632   57.573 46.109  1.00 46.26  ? 278  GLY A C   1 
ATOM 2187 O O   . GLY A 1 281  ? 7.344   58.580 45.465  1.00 46.26  ? 278  GLY A O   1 
ATOM 2188 N N   . ARG A 1 282  ? 7.950   57.602 47.408  1.00 33.52  ? 279  ARG A N   1 
ATOM 2189 C CA  . ARG A 1 282  ? 8.001   58.841 48.204  1.00 33.52  ? 279  ARG A CA  1 
ATOM 2190 C C   . ARG A 1 282  ? 9.192   59.744 47.900  1.00 33.52  ? 279  ARG A C   1 
ATOM 2191 O O   . ARG A 1 282  ? 10.283  59.272 47.551  1.00 33.52  ? 279  ARG A O   1 
ATOM 2192 C CB  . ARG A 1 282  ? 7.889   58.526 49.700  1.00 64.20  ? 279  ARG A CB  1 
ATOM 2193 C CG  . ARG A 1 282  ? 6.516   57.936 50.040  1.00 64.20  ? 279  ARG A CG  1 
ATOM 2194 C CD  . ARG A 1 282  ? 6.310   57.763 51.515  1.00 64.20  ? 279  ARG A CD  1 
ATOM 2195 N NE  . ARG A 1 282  ? 7.186   56.725 52.043  1.00 64.20  ? 279  ARG A NE  1 
ATOM 2196 C CZ  . ARG A 1 282  ? 7.823   56.793 53.205  1.00 64.20  ? 279  ARG A CZ  1 
ATOM 2197 N NH1 . ARG A 1 282  ? 7.707   57.869 53.987  1.00 64.20  ? 279  ARG A NH1 1 
ATOM 2198 N NH2 . ARG A 1 282  ? 8.606   55.788 53.567  1.00 64.20  ? 279  ARG A NH2 1 
ATOM 2199 N N   . LEU A 1 283  ? 8.965   61.050 48.014  1.00 47.09  ? 280  LEU A N   1 
ATOM 2200 C CA  . LEU A 1 283  ? 9.939   62.035 47.594  1.00 47.09  ? 280  LEU A CA  1 
ATOM 2201 C C   . LEU A 1 283  ? 10.318  62.771 48.810  1.00 47.09  ? 280  LEU A C   1 
ATOM 2202 O O   . LEU A 1 283  ? 9.445   63.215 49.492  1.00 47.09  ? 280  LEU A O   1 
ATOM 2203 C CB  . LEU A 1 283  ? 9.315   63.019 46.608  1.00 38.99  ? 280  LEU A CB  1 
ATOM 2204 C CG  . LEU A 1 283  ? 10.417  63.849 45.963  1.00 38.99  ? 280  LEU A CG  1 
ATOM 2205 C CD1 . LEU A 1 283  ? 11.504  62.881 45.458  1.00 38.99  ? 280  LEU A CD1 1 
ATOM 2206 C CD2 . LEU A 1 283  ? 9.989   64.734 44.818  1.00 38.99  ? 280  LEU A CD2 1 
ATOM 2207 N N   . PHE A 1 284  ? 11.594  62.919 49.113  1.00 57.46  ? 281  PHE A N   1 
ATOM 2208 C CA  . PHE A 1 284  ? 11.975  63.686 50.313  1.00 57.46  ? 281  PHE A CA  1 
ATOM 2209 C C   . PHE A 1 284  ? 12.849  64.836 49.946  1.00 57.46  ? 281  PHE A C   1 
ATOM 2210 O O   . PHE A 1 284  ? 13.647  64.741 49.027  1.00 57.46  ? 281  PHE A O   1 
ATOM 2211 C CB  . PHE A 1 284  ? 12.707  62.827 51.362  1.00 55.10  ? 281  PHE A CB  1 
ATOM 2212 C CG  . PHE A 1 284  ? 11.870  61.709 51.921  1.00 55.10  ? 281  PHE A CG  1 
ATOM 2213 C CD1 . PHE A 1 284  ? 11.999  60.420 51.434  1.00 55.10  ? 281  PHE A CD1 1 
ATOM 2214 C CD2 . PHE A 1 284  ? 10.937  61.953 52.908  1.00 55.10  ? 281  PHE A CD2 1 
ATOM 2215 C CE1 . PHE A 1 284  ? 11.218  59.392 51.926  1.00 55.10  ? 281  PHE A CE1 1 
ATOM 2216 C CE2 . PHE A 1 284  ? 10.161  60.942 53.420  1.00 55.10  ? 281  PHE A CE2 1 
ATOM 2217 C CZ  . PHE A 1 284  ? 10.301  59.647 52.930  1.00 55.10  ? 281  PHE A CZ  1 
ATOM 2218 N N   . MET A 1 285  ? 12.679  65.931 50.668  1.00 41.50  ? 282  MET A N   1 
ATOM 2219 C CA  . MET A 1 285  ? 13.663  66.998 50.686  1.00 41.50  ? 282  MET A CA  1 
ATOM 2220 C C   . MET A 1 285  ? 14.624  66.877 51.872  1.00 41.50  ? 282  MET A C   1 
ATOM 2221 O O   . MET A 1 285  ? 14.218  66.949 53.046  1.00 41.50  ? 282  MET A O   1 
ATOM 2222 C CB  . MET A 1 285  ? 12.999  68.337 50.767  1.00 60.70  ? 282  MET A CB  1 
ATOM 2223 C CG  . MET A 1 285  ? 13.989  69.440 50.594  1.00 60.70  ? 282  MET A CG  1 
ATOM 2224 S SD  . MET A 1 285  ? 14.580  69.425 48.900  1.00 60.70  ? 282  MET A SD  1 
ATOM 2225 C CE  . MET A 1 285  ? 13.036  69.556 47.963  1.00 60.70  ? 282  MET A CE  1 
ATOM 2226 N N   . LEU A 1 286  ? 15.898  66.688 51.555  1.00 54.96  ? 283  LEU A N   1 
ATOM 2227 C CA  . LEU A 1 286  ? 16.938  66.765 52.559  1.00 54.96  ? 283  LEU A CA  1 
ATOM 2228 C C   . LEU A 1 286  ? 17.490  68.165 52.524  1.00 54.96  ? 283  LEU A C   1 
ATOM 2229 O O   . LEU A 1 286  ? 17.958  68.629 51.470  1.00 54.96  ? 283  LEU A O   1 
ATOM 2230 C CB  . LEU A 1 286  ? 18.069  65.811 52.256  1.00 49.89  ? 283  LEU A CB  1 
ATOM 2231 C CG  . LEU A 1 286  ? 18.749  65.141 53.442  1.00 49.89  ? 283  LEU A CG  1 
ATOM 2232 C CD1 . LEU A 1 286  ? 20.067  64.580 52.963  1.00 49.89  ? 283  LEU A CD1 1 
ATOM 2233 C CD2 . LEU A 1 286  ? 18.953  66.058 54.640  1.00 49.89  ? 283  LEU A CD2 1 
ATOM 2234 N N   . LEU A 1 287  ? 17.430  68.820 53.686  1.00 55.06  ? 284  LEU A N   1 
ATOM 2235 C CA  . LEU A 1 287  ? 17.849  70.210 53.814  1.00 55.06  ? 284  LEU A CA  1 
ATOM 2236 C C   . LEU A 1 287  ? 18.982  70.361 54.795  1.00 55.06  ? 284  LEU A C   1 
ATOM 2237 O O   . LEU A 1 287  ? 18.965  69.825 55.912  1.00 55.06  ? 284  LEU A O   1 
ATOM 2238 C CB  . LEU A 1 287  ? 16.686  71.138 54.200  1.00 62.09  ? 284  LEU A CB  1 
ATOM 2239 C CG  . LEU A 1 287  ? 15.435  71.035 53.339  1.00 62.09  ? 284  LEU A CG  1 
ATOM 2240 C CD1 . LEU A 1 287  ? 14.343  70.426 54.157  1.00 62.09  ? 284  LEU A CD1 1 
ATOM 2241 C CD2 . LEU A 1 287  ? 15.019  72.379 52.857  1.00 62.09  ? 284  LEU A CD2 1 
ATOM 2242 N N   . LEU A 1 288  ? 19.971  71.113 54.361  1.00 67.84  ? 285  LEU A N   1 
ATOM 2243 C CA  . LEU A 1 288  ? 21.078  71.391 55.218  1.00 67.84  ? 285  LEU A CA  1 
ATOM 2244 C C   . LEU A 1 288  ? 20.966  72.827 55.681  1.00 67.84  ? 285  LEU A C   1 
ATOM 2245 O O   . LEU A 1 288  ? 20.857  73.764 54.875  1.00 67.84  ? 285  LEU A O   1 
ATOM 2246 C CB  . LEU A 1 288  ? 22.383  71.152 54.480  1.00 69.24  ? 285  LEU A CB  1 
ATOM 2247 C CG  . LEU A 1 288  ? 22.450  69.841 53.707  1.00 69.24  ? 285  LEU A CG  1 
ATOM 2248 C CD1 . LEU A 1 288  ? 23.798  69.773 53.050  1.00 69.24  ? 285  LEU A CD1 1 
ATOM 2249 C CD2 . LEU A 1 288  ? 22.193  68.605 54.589  1.00 69.24  ? 285  LEU A CD2 1 
ATOM 2250 N N   . GLU A 1 289  ? 20.990  72.996 56.994  1.00 71.87  ? 286  GLU A N   1 
ATOM 2251 C CA  . GLU A 1 289  ? 20.909  74.314 57.562  1.00 71.87  ? 286  GLU A CA  1 
ATOM 2252 C C   . GLU A 1 289  ? 22.295  74.948 57.669  1.00 71.87  ? 286  GLU A C   1 
ATOM 2253 O O   . GLU A 1 289  ? 23.057  74.611 58.579  1.00 71.87  ? 286  GLU A O   1 
ATOM 2254 C CB  . GLU A 1 289  ? 20.225  74.236 58.912  1.00 92.09  ? 286  GLU A CB  1 
ATOM 2255 C CG  . GLU A 1 289  ? 19.150  75.269 59.077  1.00 92.09  ? 286  GLU A CG  1 
ATOM 2256 C CD  . GLU A 1 289  ? 19.157  75.829 60.469  1.00 92.09  ? 286  GLU A CD  1 
ATOM 2257 O OE1 . GLU A 1 289  ? 19.695  76.953 60.634  1.00 92.09  ? 286  GLU A OE1 1 
ATOM 2258 O OE2 . GLU A 1 289  ? 18.669  75.132 61.394  1.00 92.09  ? 286  GLU A OE2 1 
ATOM 2259 N N   . LYS A 1 290  ? 22.604  75.851 56.726  1.00 75.37  ? 287  LYS A N   1 
ATOM 2260 C CA  . LYS A 1 290  ? 23.887  76.585 56.665  1.00 75.37  ? 287  LYS A CA  1 
ATOM 2261 C C   . LYS A 1 290  ? 24.125  77.442 57.903  1.00 75.37  ? 287  LYS A C   1 
ATOM 2262 O O   . LYS A 1 290  ? 23.233  77.598 58.726  1.00 75.37  ? 287  LYS A O   1 
ATOM 2263 C CB  . LYS A 1 290  ? 23.951  77.514 55.441  1.00 83.54  ? 287  LYS A CB  1 
ATOM 2264 C CG  . LYS A 1 290  ? 23.195  77.071 54.179  1.00 83.54  ? 287  LYS A CG  1 
ATOM 2265 C CD  . LYS A 1 290  ? 23.699  77.881 52.969  1.00 83.54  ? 287  LYS A CD  1 
ATOM 2266 C CE  . LYS A 1 290  ? 22.803  77.728 51.737  1.00 83.54  ? 287  LYS A CE  1 
ATOM 2267 N NZ  . LYS A 1 290  ? 23.228  78.609 50.581  1.00 83.54  ? 287  LYS A NZ  1 
ATOM 2268 N N   . GLU A 1 291  ? 25.321  78.015 58.020  1.00 170.08 ? 288  GLU A N   1 
ATOM 2269 C CA  . GLU A 1 291  ? 25.643  78.895 59.142  1.00 170.08 ? 288  GLU A CA  1 
ATOM 2270 C C   . GLU A 1 291  ? 26.882  79.722 58.860  1.00 170.08 ? 288  GLU A C   1 
ATOM 2271 O O   . GLU A 1 291  ? 27.932  79.185 58.511  1.00 170.08 ? 288  GLU A O   1 
ATOM 2272 C CB  . GLU A 1 291  ? 25.849  78.079 60.411  1.00 112.38 ? 288  GLU A CB  1 
ATOM 2273 C CG  . GLU A 1 291  ? 25.640  78.862 61.684  1.00 112.38 ? 288  GLU A CG  1 
ATOM 2274 C CD  . GLU A 1 291  ? 25.256  77.969 62.843  1.00 112.38 ? 288  GLU A CD  1 
ATOM 2275 O OE1 . GLU A 1 291  ? 25.944  76.942 63.063  1.00 112.38 ? 288  GLU A OE1 1 
ATOM 2276 O OE2 . GLU A 1 291  ? 24.265  78.299 63.530  1.00 112.38 ? 288  GLU A OE2 1 
ATOM 2277 N N   . GLU A 1 292  ? 26.754  81.034 59.021  1.00 198.70 ? 289  GLU A N   1 
ATOM 2278 C CA  . GLU A 1 292  ? 27.853  81.937 58.717  1.00 198.70 ? 289  GLU A CA  1 
ATOM 2279 C C   . GLU A 1 292  ? 28.443  82.587 59.967  1.00 198.70 ? 289  GLU A C   1 
ATOM 2280 O O   . GLU A 1 292  ? 27.722  82.864 60.947  1.00 198.70 ? 289  GLU A O   1 
ATOM 2281 C CB  . GLU A 1 292  ? 27.410  83.013 57.715  1.00 196.82 ? 289  GLU A CB  1 
ATOM 2282 C CG  . GLU A 1 292  ? 28.565  83.615 56.919  1.00 196.82 ? 289  GLU A CG  1 
ATOM 2283 C CD  . GLU A 1 292  ? 28.148  84.822 56.087  1.00 196.82 ? 289  GLU A CD  1 
ATOM 2284 O OE1 . GLU A 1 292  ? 27.480  85.745 56.638  1.00 196.82 ? 289  GLU A OE1 1 
ATOM 2285 O OE2 . GLU A 1 292  ? 28.508  84.853 54.880  1.00 196.82 ? 289  GLU A OE2 1 
ATOM 2286 N N   . GLN A 1 293  ? 29.766  82.798 59.924  1.00 204.38 ? 290  GLN A N   1 
ATOM 2287 C CA  . GLN A 1 293  ? 30.432  83.719 60.839  1.00 204.38 ? 290  GLN A CA  1 
ATOM 2288 C C   . GLN A 1 293  ? 31.116  84.826 60.006  1.00 204.38 ? 290  GLN A C   1 
ATOM 2289 O O   . GLN A 1 293  ? 31.550  84.569 58.878  1.00 204.38 ? 290  GLN A O   1 
ATOM 2290 C CB  . GLN A 1 293  ? 31.392  82.976 61.786  1.00 103.65 ? 290  GLN A CB  1 
ATOM 2291 C CG  . GLN A 1 293  ? 32.825  82.763 61.290  1.00 103.65 ? 290  GLN A CG  1 
ATOM 2292 C CD  . GLN A 1 293  ? 33.866  83.008 62.391  1.00 103.65 ? 290  GLN A CD  1 
ATOM 2293 O OE1 . GLN A 1 293  ? 33.701  83.894 63.244  1.00 103.65 ? 290  GLN A OE1 1 
ATOM 2294 N NE2 . GLN A 1 293  ? 34.944  82.225 62.370  1.00 103.65 ? 290  GLN A NE2 1 
ATOM 2295 N N   . MET A 1 294  ? 31.194  86.042 60.563  1.00 210.35 ? 291  MET A N   1 
ATOM 2296 C CA  . MET A 1 294  ? 31.538  87.288 59.821  1.00 210.35 ? 291  MET A CA  1 
ATOM 2297 C C   . MET A 1 294  ? 32.619  87.195 58.719  1.00 210.35 ? 291  MET A C   1 
ATOM 2298 O O   . MET A 1 294  ? 32.273  87.215 57.536  1.00 210.35 ? 291  MET A O   1 
ATOM 2299 C CB  . MET A 1 294  ? 31.805  88.451 60.790  1.00 167.04 ? 291  MET A CB  1 
ATOM 2300 C CG  . MET A 1 294  ? 30.530  89.081 61.368  1.00 167.04 ? 291  MET A CG  1 
ATOM 2301 S SD  . MET A 1 294  ? 30.794  90.019 62.897  1.00 167.04 ? 291  MET A SD  1 
ATOM 2302 C CE  . MET A 1 294  ? 31.906  91.356 62.338  1.00 167.04 ? 291  MET A CE  1 
ATOM 2303 N N   . ASP A 1 295  ? 33.905  87.129 59.086  1.00 165.28 ? 292  ASP A N   1 
ATOM 2304 C CA  . ASP A 1 295  ? 34.949  86.751 58.109  1.00 165.28 ? 292  ASP A CA  1 
ATOM 2305 C C   . ASP A 1 295  ? 35.409  85.291 58.281  1.00 165.28 ? 292  ASP A C   1 
ATOM 2306 O O   . ASP A 1 295  ? 36.521  85.005 58.745  1.00 165.28 ? 292  ASP A O   1 
ATOM 2307 C CB  . ASP A 1 295  ? 36.120  87.766 58.000  1.00 210.35 ? 292  ASP A CB  1 
ATOM 2308 C CG  . ASP A 1 295  ? 36.862  87.990 59.310  1.00 210.35 ? 292  ASP A CG  1 
ATOM 2309 O OD1 . ASP A 1 295  ? 36.347  88.732 60.168  1.00 210.35 ? 292  ASP A OD1 1 
ATOM 2310 O OD2 . ASP A 1 295  ? 37.986  87.467 59.458  1.00 210.35 ? 292  ASP A OD2 1 
ATOM 2311 N N   . GLY A 1 296  ? 34.510  84.382 57.896  1.00 186.17 ? 293  GLY A N   1 
ATOM 2312 C CA  . GLY A 1 296  ? 34.725  82.937 57.959  1.00 186.17 ? 293  GLY A CA  1 
ATOM 2313 C C   . GLY A 1 296  ? 33.772  82.192 57.036  1.00 186.17 ? 293  GLY A C   1 
ATOM 2314 O O   . GLY A 1 296  ? 32.584  82.526 56.963  1.00 186.17 ? 293  GLY A O   1 
ATOM 2315 N N   . THR A 1 297  ? 34.300  81.185 56.335  1.00 210.35 ? 294  THR A N   1 
ATOM 2316 C CA  . THR A 1 297  ? 33.532  80.376 55.369  1.00 210.35 ? 294  THR A CA  1 
ATOM 2317 C C   . THR A 1 297  ? 32.426  79.570 56.071  1.00 210.35 ? 294  THR A C   1 
ATOM 2318 O O   . THR A 1 297  ? 32.557  79.187 57.240  1.00 210.35 ? 294  THR A O   1 
ATOM 2319 C CB  . THR A 1 297  ? 34.452  79.446 54.481  1.00 128.09 ? 294  THR A CB  1 
ATOM 2320 O OG1 . THR A 1 297  ? 35.582  80.180 53.990  1.00 128.09 ? 294  THR A OG1 1 
ATOM 2321 C CG2 . THR A 1 297  ? 33.689  78.878 53.276  1.00 128.09 ? 294  THR A CG2 1 
ATOM 2322 N N   . VAL A 1 298  ? 31.347  79.325 55.330  1.00 159.94 ? 295  VAL A N   1 
ATOM 2323 C CA  . VAL A 1 298  ? 30.096  78.763 55.851  1.00 159.94 ? 295  VAL A CA  1 
ATOM 2324 C C   . VAL A 1 298  ? 30.197  77.366 56.484  1.00 159.94 ? 295  VAL A C   1 
ATOM 2325 O O   . VAL A 1 298  ? 30.606  76.401 55.831  1.00 159.94 ? 295  VAL A O   1 
ATOM 2326 C CB  . VAL A 1 298  ? 28.986  78.772 54.754  1.00 140.23 ? 295  VAL A CB  1 
ATOM 2327 C CG1 . VAL A 1 298  ? 28.401  80.178 54.594  1.00 140.23 ? 295  VAL A CG1 1 
ATOM 2328 C CG2 . VAL A 1 298  ? 29.538  78.263 53.404  1.00 140.23 ? 295  VAL A CG2 1 
ATOM 2329 N N   . THR A 1 299  ? 29.816  77.276 57.759  1.00 110.21 ? 296  THR A N   1 
ATOM 2330 C CA  . THR A 1 299  ? 29.706  75.985 58.459  1.00 110.21 ? 296  THR A CA  1 
ATOM 2331 C C   . THR A 1 299  ? 28.350  75.282 58.189  1.00 110.21 ? 296  THR A C   1 
ATOM 2332 O O   . THR A 1 299  ? 27.739  75.496 57.138  1.00 110.21 ? 296  THR A O   1 
ATOM 2333 C CB  . THR A 1 299  ? 30.031  76.107 59.992  1.00 115.20 ? 296  THR A CB  1 
ATOM 2334 O OG1 . THR A 1 299  ? 29.667  74.899 60.682  1.00 115.20 ? 296  THR A OG1 1 
ATOM 2335 C CG2 . THR A 1 299  ? 29.313  77.285 60.630  1.00 115.20 ? 296  THR A CG2 1 
ATOM 2336 N N   . LEU A 1 300  ? 27.913  74.430 59.120  1.00 123.58 ? 297  LEU A N   1 
ATOM 2337 C CA  . LEU A 1 300  ? 26.650  73.684 59.012  1.00 123.58 ? 297  LEU A CA  1 
ATOM 2338 C C   . LEU A 1 300  ? 25.988  73.467 60.386  1.00 123.58 ? 297  LEU A C   1 
ATOM 2339 O O   . LEU A 1 300  ? 26.621  72.968 61.331  1.00 123.58 ? 297  LEU A O   1 
ATOM 2340 C CB  . LEU A 1 300  ? 26.875  72.331 58.333  1.00 210.35 ? 297  LEU A CB  1 
ATOM 2341 C CG  . LEU A 1 300  ? 27.059  72.261 56.816  1.00 210.35 ? 297  LEU A CG  1 
ATOM 2342 C CD1 . LEU A 1 300  ? 28.529  72.349 56.410  1.00 210.35 ? 297  LEU A CD1 1 
ATOM 2343 C CD2 . LEU A 1 300  ? 26.470  70.958 56.333  1.00 210.35 ? 297  LEU A CD2 1 
ATOM 2344 N N   . LYS A 1 301  ? 24.712  73.828 60.494  1.00 84.43  ? 298  LYS A N   1 
ATOM 2345 C CA  . LYS A 1 301  ? 24.054  73.782 61.782  1.00 84.43  ? 298  LYS A CA  1 
ATOM 2346 C C   . LYS A 1 301  ? 23.316  72.472 61.959  1.00 84.43  ? 298  LYS A C   1 
ATOM 2347 O O   . LYS A 1 301  ? 23.542  71.768 62.938  1.00 84.43  ? 298  LYS A O   1 
ATOM 2348 C CB  . LYS A 1 301  ? 23.144  75.011 61.980  1.00 137.34 ? 298  LYS A CB  1 
ATOM 2349 C CG  . LYS A 1 301  ? 22.515  75.218 63.388  1.00 137.34 ? 298  LYS A CG  1 
ATOM 2350 C CD  . LYS A 1 301  ? 23.276  74.577 64.583  1.00 137.34 ? 298  LYS A CD  1 
ATOM 2351 C CE  . LYS A 1 301  ? 24.561  75.305 65.014  1.00 137.34 ? 298  LYS A CE  1 
ATOM 2352 N NZ  . LYS A 1 301  ? 24.308  76.576 65.755  1.00 137.34 ? 298  LYS A NZ  1 
ATOM 2353 N N   . ASP A 1 302  ? 22.449  72.127 61.013  1.00 70.60  ? 299  ASP A N   1 
ATOM 2354 C CA  . ASP A 1 302  ? 21.587  70.949 61.172  1.00 70.60  ? 299  ASP A CA  1 
ATOM 2355 C C   . ASP A 1 302  ? 21.148  70.438 59.819  1.00 70.60  ? 299  ASP A C   1 
ATOM 2356 O O   . ASP A 1 302  ? 21.197  71.175 58.835  1.00 70.60  ? 299  ASP A O   1 
ATOM 2357 C CB  . ASP A 1 302  ? 20.357  71.312 62.022  1.00 75.64  ? 299  ASP A CB  1 
ATOM 2358 C CG  . ASP A 1 302  ? 19.520  70.090 62.420  1.00 75.64  ? 299  ASP A CG  1 
ATOM 2359 O OD1 . ASP A 1 302  ? 20.108  69.004 62.675  1.00 75.64  ? 299  ASP A OD1 1 
ATOM 2360 O OD2 . ASP A 1 302  ? 18.262  70.228 62.490  1.00 75.64  ? 299  ASP A OD2 1 
ATOM 2361 N N   . LEU A 1 303  ? 20.716  69.184 59.765  1.00 68.53  ? 300  LEU A N   1 
ATOM 2362 C CA  . LEU A 1 303  ? 20.080  68.649 58.555  1.00 68.53  ? 300  LEU A CA  1 
ATOM 2363 C C   . LEU A 1 303  ? 18.712  68.000 58.843  1.00 68.53  ? 300  LEU A C   1 
ATOM 2364 O O   . LEU A 1 303  ? 18.569  67.234 59.797  1.00 68.53  ? 300  LEU A O   1 
ATOM 2365 C CB  . LEU A 1 303  ? 21.043  67.709 57.798  1.00 81.24  ? 300  LEU A CB  1 
ATOM 2366 C CG  . LEU A 1 303  ? 21.524  66.303 58.221  1.00 81.24  ? 300  LEU A CG  1 
ATOM 2367 C CD1 . LEU A 1 303  ? 22.669  65.920 57.324  1.00 81.24  ? 300  LEU A CD1 1 
ATOM 2368 C CD2 . LEU A 1 303  ? 21.962  66.144 59.681  1.00 81.24  ? 300  LEU A CD2 1 
ATOM 2369 N N   . ARG A 1 304  ? 17.696  68.315 58.046  1.00 63.75  ? 301  ARG A N   1 
ATOM 2370 C CA  . ARG A 1 304  ? 16.391  67.676 58.249  1.00 63.75  ? 301  ARG A CA  1 
ATOM 2371 C C   . ARG A 1 304  ? 15.767  67.161 56.959  1.00 63.75  ? 301  ARG A C   1 
ATOM 2372 O O   . ARG A 1 304  ? 16.142  67.559 55.852  1.00 63.75  ? 301  ARG A O   1 
ATOM 2373 C CB  . ARG A 1 304  ? 15.407  68.624 58.930  1.00 60.74  ? 301  ARG A CB  1 
ATOM 2374 C CG  . ARG A 1 304  ? 14.663  69.522 57.941  1.00 60.74  ? 301  ARG A CG  1 
ATOM 2375 C CD  . ARG A 1 304  ? 14.228  70.769 58.590  1.00 60.74  ? 301  ARG A CD  1 
ATOM 2376 N NE  . ARG A 1 304  ? 14.438  71.891 57.695  1.00 60.74  ? 301  ARG A NE  1 
ATOM 2377 C CZ  . ARG A 1 304  ? 13.465  72.525 57.038  1.00 60.74  ? 301  ARG A CZ  1 
ATOM 2378 N NH1 . ARG A 1 304  ? 12.194  72.135 57.180  1.00 60.74  ? 301  ARG A NH1 1 
ATOM 2379 N NH2 . ARG A 1 304  ? 13.755  73.561 56.232  1.00 60.74  ? 301  ARG A NH2 1 
ATOM 2380 N N   . VAL A 1 305  ? 14.778  66.297 57.140  1.00 51.83  ? 302  VAL A N   1 
ATOM 2381 C CA  . VAL A 1 305  ? 14.096  65.659 56.055  1.00 51.83  ? 302  VAL A CA  1 
ATOM 2382 C C   . VAL A 1 305  ? 12.637  66.055 56.051  1.00 51.83  ? 302  VAL A C   1 
ATOM 2383 O O   . VAL A 1 305  ? 11.924  65.882 57.050  1.00 51.83  ? 302  VAL A O   1 
ATOM 2384 C CB  . VAL A 1 305  ? 14.184  64.167 56.232  1.00 41.07  ? 302  VAL A CB  1 
ATOM 2385 C CG1 . VAL A 1 305  ? 13.047  63.479 55.515  1.00 41.07  ? 302  VAL A CG1 1 
ATOM 2386 C CG2 . VAL A 1 305  ? 15.577  63.647 55.731  1.00 41.07  ? 302  VAL A CG2 1 
ATOM 2387 N N   . GLU A 1 306  ? 12.191  66.591 54.922  1.00 48.55  ? 303  GLU A N   1 
ATOM 2388 C CA  . GLU A 1 306  ? 10.807  66.981 54.764  1.00 48.55  ? 303  GLU A CA  1 
ATOM 2389 C C   . GLU A 1 306  ? 10.191  66.030 53.744  1.00 48.55  ? 303  GLU A C   1 
ATOM 2390 O O   . GLU A 1 306  ? 10.635  66.023 52.606  1.00 48.55  ? 303  GLU A O   1 
ATOM 2391 C CB  . GLU A 1 306  ? 10.754  68.438 54.272  1.00 79.18  ? 303  GLU A CB  1 
ATOM 2392 C CG  . GLU A 1 306  ? 9.632   69.312 54.866  1.00 79.18  ? 303  GLU A CG  1 
ATOM 2393 C CD  . GLU A 1 306  ? 10.054  70.796 55.053  1.00 79.18  ? 303  GLU A CD  1 
ATOM 2394 O OE1 . GLU A 1 306  ? 10.448  71.459 54.058  1.00 79.18  ? 303  GLU A OE1 1 
ATOM 2395 O OE2 . GLU A 1 306  ? 9.988   71.309 56.202  1.00 79.18  ? 303  GLU A OE2 1 
ATOM 2396 N N   . LEU A 1 307  ? 9.191   65.228 54.131  1.00 63.97  ? 304  LEU A N   1 
ATOM 2397 C CA  . LEU A 1 307  ? 8.401   64.448 53.158  1.00 63.97  ? 304  LEU A CA  1 
ATOM 2398 C C   . LEU A 1 307  ? 7.675   65.355 52.220  1.00 63.97  ? 304  LEU A C   1 
ATOM 2399 O O   . LEU A 1 307  ? 6.957   66.210 52.649  1.00 63.97  ? 304  LEU A O   1 
ATOM 2400 C CB  . LEU A 1 307  ? 7.362   63.569 53.846  1.00 47.79  ? 304  LEU A CB  1 
ATOM 2401 C CG  . LEU A 1 307  ? 6.220   62.887 53.059  1.00 47.79  ? 304  LEU A CG  1 
ATOM 2402 C CD1 . LEU A 1 307  ? 6.673   62.321 51.750  1.00 47.79  ? 304  LEU A CD1 1 
ATOM 2403 C CD2 . LEU A 1 307  ? 5.585   61.783 53.873  1.00 47.79  ? 304  LEU A CD2 1 
ATOM 2404 N N   . LEU A 1 308  ? 7.833   65.144 50.937  1.00 51.77  ? 305  LEU A N   1 
ATOM 2405 C CA  . LEU A 1 308  ? 7.235   66.025 49.980  1.00 51.77  ? 305  LEU A CA  1 
ATOM 2406 C C   . LEU A 1 308  ? 6.047   65.443 49.285  1.00 51.77  ? 305  LEU A C   1 
ATOM 2407 O O   . LEU A 1 308  ? 5.153   66.199 48.874  1.00 51.77  ? 305  LEU A O   1 
ATOM 2408 C CB  . LEU A 1 308  ? 8.199   66.349 48.888  1.00 41.97  ? 305  LEU A CB  1 
ATOM 2409 C CG  . LEU A 1 308  ? 9.240   67.368 49.161  1.00 41.97  ? 305  LEU A CG  1 
ATOM 2410 C CD1 . LEU A 1 308  ? 9.588   67.937 47.782  1.00 41.97  ? 305  LEU A CD1 1 
ATOM 2411 C CD2 . LEU A 1 308  ? 8.655   68.402 50.089  1.00 41.97  ? 305  LEU A CD2 1 
ATOM 2412 N N   . GLY A 1 309  ? 6.035   64.130 49.083  1.00 42.92  ? 306  GLY A N   1 
ATOM 2413 C CA  . GLY A 1 309  ? 4.896   63.543 48.390  1.00 42.92  ? 306  GLY A CA  1 
ATOM 2414 C C   . GLY A 1 309  ? 5.167   62.228 47.716  1.00 42.92  ? 306  GLY A C   1 
ATOM 2415 O O   . GLY A 1 309  ? 5.727   61.329 48.297  1.00 42.92  ? 306  GLY A O   1 
ATOM 2416 N N   . GLU A 1 310  ? 4.784   62.103 46.470  1.00 59.31  ? 307  GLU A N   1 
ATOM 2417 C CA  . GLU A 1 310  ? 4.769   60.802 45.926  1.00 59.31  ? 307  GLU A CA  1 
ATOM 2418 C C   . GLU A 1 310  ? 5.035   60.897 44.458  1.00 59.31  ? 307  GLU A C   1 
ATOM 2419 O O   . GLU A 1 310  ? 4.417   61.665 43.766  1.00 59.31  ? 307  GLU A O   1 
ATOM 2420 C CB  . GLU A 1 310  ? 3.419   60.188 46.236  1.00 59.29  ? 307  GLU A CB  1 
ATOM 2421 C CG  . GLU A 1 310  ? 2.988   59.052 45.364  1.00 59.29  ? 307  GLU A CG  1 
ATOM 2422 C CD  . GLU A 1 310  ? 2.238   57.997 46.176  1.00 59.29  ? 307  GLU A CD  1 
ATOM 2423 O OE1 . GLU A 1 310  ? 2.565   57.891 47.403  1.00 59.29  ? 307  GLU A OE1 1 
ATOM 2424 O OE2 . GLU A 1 310  ? 1.351   57.289 45.598  1.00 59.29  ? 307  GLU A OE2 1 
ATOM 2425 N N   . THR A 1 311  ? 5.987   60.118 43.992  1.00 39.48  ? 308  THR A N   1 
ATOM 2426 C CA  . THR A 1 311  ? 6.309   60.052 42.608  1.00 39.48  ? 308  THR A CA  1 
ATOM 2427 C C   . THR A 1 311  ? 6.199   58.581 42.232  1.00 39.48  ? 308  THR A C   1 
ATOM 2428 O O   . THR A 1 311  ? 5.669   57.790 43.011  1.00 39.48  ? 308  THR A O   1 
ATOM 2429 C CB  . THR A 1 311  ? 7.715   60.531 42.395  1.00 34.77  ? 308  THR A CB  1 
ATOM 2430 O OG1 . THR A 1 311  ? 8.598   59.742 43.205  1.00 34.77  ? 308  THR A OG1 1 
ATOM 2431 C CG2 . THR A 1 311  ? 7.843   61.972 42.814  1.00 34.77  ? 308  THR A CG2 1 
ATOM 2432 N N   . SER A 1 312  ? 6.669   58.205 41.040  1.00 43.30  ? 309  SER A N   1 
ATOM 2433 C CA  . SER A 1 312  ? 6.643   56.811 40.703  1.00 43.30  ? 309  SER A CA  1 
ATOM 2434 C C   . SER A 1 312  ? 7.871   56.341 41.402  1.00 43.30  ? 309  SER A C   1 
ATOM 2435 O O   . SER A 1 312  ? 8.691   57.159 41.852  1.00 43.30  ? 309  SER A O   1 
ATOM 2436 C CB  . SER A 1 312  ? 6.813   56.569 39.215  1.00 32.81  ? 309  SER A CB  1 
ATOM 2437 O OG  . SER A 1 312  ? 6.367   57.652 38.437  1.00 32.81  ? 309  SER A OG  1 
ATOM 2438 N N   . ILE A 1 313  ? 8.021   55.029 41.496  1.00 48.93  ? 310  ILE A N   1 
ATOM 2439 C CA  . ILE A 1 313  ? 9.214   54.491 42.094  1.00 48.93  ? 310  ILE A CA  1 
ATOM 2440 C C   . ILE A 1 313  ? 10.359  54.975 41.237  1.00 48.93  ? 310  ILE A C   1 
ATOM 2441 O O   . ILE A 1 313  ? 10.462  54.709 40.041  1.00 48.93  ? 310  ILE A O   1 
ATOM 2442 C CB  . ILE A 1 313  ? 9.193   52.988 42.181  1.00 44.01  ? 310  ILE A CB  1 
ATOM 2443 C CG1 . ILE A 1 313  ? 7.805   52.456 42.557  1.00 44.01  ? 310  ILE A CG1 1 
ATOM 2444 C CG2 . ILE A 1 313  ? 10.175  52.574 43.177  1.00 44.01  ? 310  ILE A CG2 1 
ATOM 2445 C CD1 . ILE A 1 313  ? 7.243   52.960 43.864  1.00 44.01  ? 310  ILE A CD1 1 
ATOM 2446 N N   . ALA A 1 314  ? 11.187  55.773 41.859  1.00 29.05  ? 311  ALA A N   1 
ATOM 2447 C CA  . ALA A 1 314  ? 12.214  56.490 41.125  1.00 29.05  ? 311  ALA A CA  1 
ATOM 2448 C C   . ALA A 1 314  ? 13.488  55.709 41.169  1.00 29.05  ? 311  ALA A C   1 
ATOM 2449 O O   . ALA A 1 314  ? 13.863  55.155 42.217  1.00 29.05  ? 311  ALA A O   1 
ATOM 2450 C CB  . ALA A 1 314  ? 12.450  57.954 41.705  1.00 11.35  ? 311  ALA A CB  1 
ATOM 2451 N N   . GLU A 1 315  ? 14.135  55.653 40.010  1.00 47.21  ? 312  GLU A N   1 
ATOM 2452 C CA  . GLU A 1 315  ? 15.485  55.155 39.898  1.00 47.21  ? 312  GLU A CA  1 
ATOM 2453 C C   . GLU A 1 315  ? 16.397  56.327 39.955  1.00 47.21  ? 312  GLU A C   1 
ATOM 2454 O O   . GLU A 1 315  ? 17.433  56.242 40.577  1.00 47.21  ? 312  GLU A O   1 
ATOM 2455 C CB  . GLU A 1 315  ? 15.673  54.425 38.593  1.00 54.72  ? 312  GLU A CB  1 
ATOM 2456 C CG  . GLU A 1 315  ? 15.838  52.981 38.803  1.00 54.72  ? 312  GLU A CG  1 
ATOM 2457 C CD  . GLU A 1 315  ? 17.290  52.592 38.713  1.00 54.72  ? 312  GLU A CD  1 
ATOM 2458 O OE1 . GLU A 1 315  ? 18.079  53.535 38.419  1.00 54.72  ? 312  GLU A OE1 1 
ATOM 2459 O OE2 . GLU A 1 315  ? 17.632  51.374 38.924  1.00 54.72  ? 312  GLU A OE2 1 
ATOM 2460 N N   . CYS A 1 316  ? 15.925  57.430 39.366  1.00 47.92  ? 313  CYS A N   1 
ATOM 2461 C CA  . CYS A 1 316  ? 16.694  58.539 38.798  1.00 47.92  ? 313  CYS A CA  1 
ATOM 2462 C C   . CYS A 1 316  ? 15.903  59.822 39.175  1.00 47.92  ? 313  CYS A C   1 
ATOM 2463 O O   . CYS A 1 316  ? 14.697  59.952 38.881  1.00 47.92  ? 313  CYS A O   1 
ATOM 2464 C CB  . CYS A 1 316  ? 16.685  58.365 37.284  1.00 182.23 ? 313  CYS A CB  1 
ATOM 2465 S SG  . CYS A 1 316  ? 18.041  59.059 36.396  1.00 182.23 ? 313  CYS A SG  1 
ATOM 2466 N N   . LEU A 1 317  ? 16.543  60.769 39.842  1.00 56.09  ? 314  LEU A N   1 
ATOM 2467 C CA  . LEU A 1 317  ? 15.911  62.070 40.056  1.00 56.09  ? 314  LEU A CA  1 
ATOM 2468 C C   . LEU A 1 317  ? 16.802  63.177 39.501  1.00 56.09  ? 314  LEU A C   1 
ATOM 2469 O O   . LEU A 1 317  ? 18.026  63.135 39.634  1.00 56.09  ? 314  LEU A O   1 
ATOM 2470 C CB  . LEU A 1 317  ? 15.673  62.306 41.544  1.00 37.31  ? 314  LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 317  ? 14.385  62.068 42.319  1.00 37.31  ? 314  LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 317  ? 13.425  61.263 41.537  1.00 37.31  ? 314  LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 317  ? 14.664  61.346 43.640  1.00 37.31  ? 314  LEU A CD2 1 
ATOM 2474 N N   . THR A 1 318  ? 16.194  64.170 38.873  1.00 42.83  ? 315  THR A N   1 
ATOM 2475 C CA  . THR A 1 318  ? 16.947  65.310 38.399  1.00 42.83  ? 315  THR A CA  1 
ATOM 2476 C C   . THR A 1 318  ? 16.086  66.523 38.531  1.00 42.83  ? 315  THR A C   1 
ATOM 2477 O O   . THR A 1 318  ? 15.050  66.615 37.860  1.00 42.83  ? 315  THR A O   1 
ATOM 2478 C CB  . THR A 1 318  ? 17.355  65.179 36.909  1.00 52.69  ? 315  THR A CB  1 
ATOM 2479 O OG1 . THR A 1 318  ? 17.963  63.896 36.663  1.00 52.69  ? 315  THR A OG1 1 
ATOM 2480 C CG2 . THR A 1 318  ? 18.337  66.286 36.524  1.00 52.69  ? 315  THR A CG2 1 
ATOM 2481 N N   . TYR A 1 319  ? 16.519  67.444 39.397  1.00 34.87  ? 316  TYR A N   1 
ATOM 2482 C CA  . TYR A 1 319  ? 15.860  68.731 39.555  1.00 34.87  ? 316  TYR A CA  1 
ATOM 2483 C C   . TYR A 1 319  ? 16.105  69.537 38.263  1.00 34.87  ? 316  TYR A C   1 
ATOM 2484 O O   . TYR A 1 319  ? 17.237  69.529 37.727  1.00 34.87  ? 316  TYR A O   1 
ATOM 2485 C CB  . TYR A 1 319  ? 16.386  69.464 40.792  1.00 60.53  ? 316  TYR A CB  1 
ATOM 2486 C CG  . TYR A 1 319  ? 15.732  70.795 40.938  1.00 60.53  ? 316  TYR A CG  1 
ATOM 2487 C CD1 . TYR A 1 319  ? 14.411  70.898 41.390  1.00 60.53  ? 316  TYR A CD1 1 
ATOM 2488 C CD2 . TYR A 1 319  ? 16.401  71.963 40.577  1.00 60.53  ? 316  TYR A CD2 1 
ATOM 2489 C CE1 . TYR A 1 319  ? 13.777  72.146 41.492  1.00 60.53  ? 316  TYR A CE1 1 
ATOM 2490 C CE2 . TYR A 1 319  ? 15.778  73.221 40.681  1.00 60.53  ? 316  TYR A CE2 1 
ATOM 2491 C CZ  . TYR A 1 319  ? 14.469  73.301 41.134  1.00 60.53  ? 316  TYR A CZ  1 
ATOM 2492 O OH  . TYR A 1 319  ? 13.849  74.529 41.213  1.00 60.53  ? 316  TYR A OH  1 
ATOM 2493 N N   . LEU A 1 320  ? 15.073  70.183 37.719  1.00 50.93  ? 317  LEU A N   1 
ATOM 2494 C CA  . LEU A 1 320  ? 15.273  70.964 36.493  1.00 50.93  ? 317  LEU A CA  1 
ATOM 2495 C C   . LEU A 1 320  ? 15.234  72.461 36.742  1.00 50.93  ? 317  LEU A C   1 
ATOM 2496 O O   . LEU A 1 320  ? 15.981  72.963 37.584  1.00 50.93  ? 317  LEU A O   1 
ATOM 2497 C CB  . LEU A 1 320  ? 14.305  70.557 35.398  1.00 52.66  ? 317  LEU A CB  1 
ATOM 2498 C CG  . LEU A 1 320  ? 14.458  69.133 34.904  1.00 52.66  ? 317  LEU A CG  1 
ATOM 2499 C CD1 . LEU A 1 320  ? 13.605  68.928 33.674  1.00 52.66  ? 317  LEU A CD1 1 
ATOM 2500 C CD2 . LEU A 1 320  ? 15.925  68.831 34.608  1.00 52.66  ? 317  LEU A CD2 1 
ATOM 2501 N N   . ASP A 1 321  ? 14.384  73.176 36.006  1.00 92.87  ? 318  ASP A N   1 
ATOM 2502 C CA  . ASP A 1 321  ? 14.216  74.619 36.170  1.00 92.87  ? 318  ASP A CA  1 
ATOM 2503 C C   . ASP A 1 321  ? 13.652  74.949 37.557  1.00 92.87  ? 318  ASP A C   1 
ATOM 2504 O O   . ASP A 1 321  ? 14.368  74.933 38.552  1.00 92.87  ? 318  ASP A O   1 
ATOM 2505 C CB  . ASP A 1 321  ? 13.321  75.198 35.053  1.00 151.90 ? 318  ASP A CB  1 
ATOM 2506 C CG  . ASP A 1 321  ? 14.105  75.979 33.983  1.00 151.90 ? 318  ASP A CG  1 
ATOM 2507 O OD1 . ASP A 1 321  ? 13.619  76.052 32.829  1.00 151.90 ? 318  ASP A OD1 1 
ATOM 2508 O OD2 . ASP A 1 321  ? 15.185  76.535 34.287  1.00 151.90 ? 318  ASP A OD2 1 
ATOM 2509 N N   . ASN A 1 322  ? 12.364  75.240 37.621  1.00 49.57  ? 319  ASN A N   1 
ATOM 2510 C CA  . ASN A 1 322  ? 11.816  75.880 38.797  1.00 49.57  ? 319  ASN A CA  1 
ATOM 2511 C C   . ASN A 1 322  ? 10.675  75.066 39.334  1.00 49.57  ? 319  ASN A C   1 
ATOM 2512 O O   . ASN A 1 322  ? 9.546   75.114 38.813  1.00 49.57  ? 319  ASN A O   1 
ATOM 2513 C CB  . ASN A 1 322  ? 11.381  77.308 38.484  1.00 94.86  ? 319  ASN A CB  1 
ATOM 2514 C CG  . ASN A 1 322  ? 12.348  78.020 37.564  1.00 94.86  ? 319  ASN A CG  1 
ATOM 2515 O OD1 . ASN A 1 322  ? 13.239  78.739 38.012  1.00 94.86  ? 319  ASN A OD1 1 
ATOM 2516 N ND2 . ASN A 1 322  ? 12.189  77.804 36.268  1.00 94.86  ? 319  ASN A ND2 1 
ATOM 2517 N N   . GLY A 1 323  ? 11.016  74.260 40.343  1.00 70.33  ? 320  GLY A N   1 
ATOM 2518 C CA  . GLY A 1 323  ? 10.100  73.290 40.933  1.00 70.33  ? 320  GLY A CA  1 
ATOM 2519 C C   . GLY A 1 323  ? 9.791   72.075 40.078  1.00 70.33  ? 320  GLY A C   1 
ATOM 2520 O O   . GLY A 1 323  ? 9.195   71.125 40.571  1.00 70.33  ? 320  GLY A O   1 
ATOM 2521 N N   . VAL A 1 324  ? 10.159  72.104 38.796  1.00 52.06  ? 321  VAL A N   1 
ATOM 2522 C CA  . VAL A 1 324  ? 10.188  70.875 37.977  1.00 52.06  ? 321  VAL A CA  1 
ATOM 2523 C C   . VAL A 1 324  ? 11.285  69.875 38.402  1.00 52.06  ? 321  VAL A C   1 
ATOM 2524 O O   . VAL A 1 324  ? 12.402  70.233 38.802  1.00 52.06  ? 321  VAL A O   1 
ATOM 2525 C CB  . VAL A 1 324  ? 10.256  71.113 36.449  1.00 63.62  ? 321  VAL A CB  1 
ATOM 2526 C CG1 . VAL A 1 324  ? 8.892   71.319 35.894  1.00 63.62  ? 321  VAL A CG1 1 
ATOM 2527 C CG2 . VAL A 1 324  ? 11.156  72.293 36.104  1.00 63.62  ? 321  VAL A CG2 1 
ATOM 2528 N N   . VAL A 1 325  ? 10.917  68.608 38.328  1.00 36.64  ? 322  VAL A N   1 
ATOM 2529 C CA  . VAL A 1 325  ? 11.756  67.519 38.727  1.00 36.64  ? 322  VAL A CA  1 
ATOM 2530 C C   . VAL A 1 325  ? 11.445  66.487 37.677  1.00 36.64  ? 322  VAL A C   1 
ATOM 2531 O O   . VAL A 1 325  ? 10.257  66.191 37.453  1.00 36.64  ? 322  VAL A O   1 
ATOM 2532 C CB  . VAL A 1 325  ? 11.351  66.994 40.126  1.00 39.38  ? 322  VAL A CB  1 
ATOM 2533 C CG1 . VAL A 1 325  ? 12.202  65.821 40.542  1.00 39.38  ? 322  VAL A CG1 1 
ATOM 2534 C CG2 . VAL A 1 325  ? 11.494  68.082 41.156  1.00 39.38  ? 322  VAL A CG2 1 
ATOM 2535 N N   . PHE A 1 326  ? 12.489  65.986 37.003  1.00 43.41  ? 323  PHE A N   1 
ATOM 2536 C CA  . PHE A 1 326  ? 12.337  64.795 36.184  1.00 43.41  ? 323  PHE A CA  1 
ATOM 2537 C C   . PHE A 1 326  ? 12.436  63.546 37.012  1.00 43.41  ? 323  PHE A C   1 
ATOM 2538 O O   . PHE A 1 326  ? 13.310  63.404 37.842  1.00 43.41  ? 323  PHE A O   1 
ATOM 2539 C CB  . PHE A 1 326  ? 13.358  64.673 35.092  1.00 39.14  ? 323  PHE A CB  1 
ATOM 2540 C CG  . PHE A 1 326  ? 13.164  63.441 34.275  1.00 39.14  ? 323  PHE A CG  1 
ATOM 2541 C CD1 . PHE A 1 326  ? 12.022  63.294 33.487  1.00 39.14  ? 323  PHE A CD1 1 
ATOM 2542 C CD2 . PHE A 1 326  ? 14.081  62.408 34.319  1.00 39.14  ? 323  PHE A CD2 1 
ATOM 2543 C CE1 . PHE A 1 326  ? 11.824  62.159 32.737  1.00 39.14  ? 323  PHE A CE1 1 
ATOM 2544 C CE2 . PHE A 1 326  ? 13.903  61.271 33.569  1.00 39.14  ? 323  PHE A CE2 1 
ATOM 2545 C CZ  . PHE A 1 326  ? 12.777  61.141 32.771  1.00 39.14  ? 323  PHE A CZ  1 
ATOM 2546 N N   . VAL A 1 327  ? 11.548  62.607 36.761  1.00 39.29  ? 324  VAL A N   1 
ATOM 2547 C CA  . VAL A 1 327  ? 11.471  61.429 37.607  1.00 39.29  ? 324  VAL A CA  1 
ATOM 2548 C C   . VAL A 1 327  ? 11.601  60.139 36.797  1.00 39.29  ? 324  VAL A C   1 
ATOM 2549 O O   . VAL A 1 327  ? 10.601  59.602 36.297  1.00 39.29  ? 324  VAL A O   1 
ATOM 2550 C CB  . VAL A 1 327  ? 10.197  61.438 38.407  1.00 38.21  ? 324  VAL A CB  1 
ATOM 2551 C CG1 . VAL A 1 327  ? 9.718   59.978 38.693  1.00 38.21  ? 324  VAL A CG1 1 
ATOM 2552 C CG2 . VAL A 1 327  ? 10.444  62.255 39.659  1.00 38.21  ? 324  VAL A CG2 1 
ATOM 2553 N N   . GLY A 1 328  ? 12.842  59.656 36.682  1.00 38.84  ? 325  GLY A N   1 
ATOM 2554 C CA  . GLY A 1 328  ? 13.114  58.442 35.964  1.00 38.84  ? 325  GLY A CA  1 
ATOM 2555 C C   . GLY A 1 328  ? 12.753  57.203 36.737  1.00 38.84  ? 325  GLY A C   1 
ATOM 2556 O O   . GLY A 1 328  ? 13.252  56.971 37.829  1.00 38.84  ? 325  GLY A O   1 
ATOM 2557 N N   . SER A 1 329  ? 11.912  56.386 36.134  1.00 36.73  ? 326  SER A N   1 
ATOM 2558 C CA  . SER A 1 329  ? 11.371  55.234 36.796  1.00 36.73  ? 326  SER A CA  1 
ATOM 2559 C C   . SER A 1 329  ? 11.667  53.992 35.932  1.00 36.73  ? 326  SER A C   1 
ATOM 2560 O O   . SER A 1 329  ? 11.607  54.107 34.706  1.00 36.73  ? 326  SER A O   1 
ATOM 2561 C CB  . SER A 1 329  ? 9.876   55.467 36.947  1.00 38.11  ? 326  SER A CB  1 
ATOM 2562 O OG  . SER A 1 329  ? 9.252   54.401 37.589  1.00 38.11  ? 326  SER A OG  1 
ATOM 2563 N N   . ARG A 1 330  ? 12.010  52.837 36.537  1.00 39.08  ? 327  ARG A N   1 
ATOM 2564 C CA  . ARG A 1 330  ? 11.931  51.555 35.809  1.00 39.08  ? 327  ARG A CA  1 
ATOM 2565 C C   . ARG A 1 330  ? 10.797  50.648 36.238  1.00 39.08  ? 327  ARG A C   1 
ATOM 2566 O O   . ARG A 1 330  ? 10.214  49.928 35.410  1.00 39.08  ? 327  ARG A O   1 
ATOM 2567 C CB  . ARG A 1 330  ? 13.246  50.770 35.721  1.00 49.34  ? 327  ARG A CB  1 
ATOM 2568 C CG  . ARG A 1 330  ? 14.416  51.228 36.574  1.00 49.34  ? 327  ARG A CG  1 
ATOM 2569 C CD  . ARG A 1 330  ? 15.501  50.081 36.793  1.00 49.34  ? 327  ARG A CD  1 
ATOM 2570 N NE  . ARG A 1 330  ? 15.484  49.828 38.243  1.00 49.34  ? 327  ARG A NE  1 
ATOM 2571 C CZ  . ARG A 1 330  ? 14.814  48.835 38.879  1.00 49.34  ? 327  ARG A CZ  1 
ATOM 2572 N NH1 . ARG A 1 330  ? 14.149  47.840 38.227  1.00 49.34  ? 327  ARG A NH1 1 
ATOM 2573 N NH2 . ARG A 1 330  ? 14.865  48.814 40.218  1.00 49.34  ? 327  ARG A NH2 1 
ATOM 2574 N N   . LEU A 1 331  ? 10.454  50.680 37.518  1.00 34.26  ? 328  LEU A N   1 
ATOM 2575 C CA  . LEU A 1 331  ? 9.293   49.910 37.964  1.00 34.26  ? 328  LEU A CA  1 
ATOM 2576 C C   . LEU A 1 331  ? 7.990   50.511 37.439  1.00 34.26  ? 328  LEU A C   1 
ATOM 2577 O O   . LEU A 1 331  ? 6.969   49.832 37.463  1.00 34.26  ? 328  LEU A O   1 
ATOM 2578 C CB  . LEU A 1 331  ? 9.262   49.763 39.494  1.00 29.49  ? 328  LEU A CB  1 
ATOM 2579 C CG  . LEU A 1 331  ? 10.454  49.019 40.090  1.00 29.49  ? 328  LEU A CG  1 
ATOM 2580 C CD1 . LEU A 1 331  ? 10.300  48.709 41.525  1.00 29.49  ? 328  LEU A CD1 1 
ATOM 2581 C CD2 . LEU A 1 331  ? 10.665  47.746 39.291  1.00 29.49  ? 328  LEU A CD2 1 
ATOM 2582 N N   . GLY A 1 332  ? 8.019   51.767 36.969  1.00 27.10  ? 329  GLY A N   1 
ATOM 2583 C CA  . GLY A 1 332  ? 6.809   52.404 36.430  1.00 27.10  ? 329  GLY A CA  1 
ATOM 2584 C C   . GLY A 1 332  ? 6.975   53.482 35.366  1.00 27.10  ? 329  GLY A C   1 
ATOM 2585 O O   . GLY A 1 332  ? 8.056   53.603 34.781  1.00 27.10  ? 329  GLY A O   1 
ATOM 2586 N N   . ASP A 1 333  ? 5.922   54.288 35.139  1.00 38.06  ? 330  ASP A N   1 
ATOM 2587 C CA  . ASP A 1 333  ? 6.012   55.414 34.196  1.00 38.06  ? 330  ASP A CA  1 
ATOM 2588 C C   . ASP A 1 333  ? 6.913   56.542 34.735  1.00 38.06  ? 330  ASP A C   1 
ATOM 2589 O O   . ASP A 1 333  ? 6.811   56.982 35.897  1.00 38.06  ? 330  ASP A O   1 
ATOM 2590 C CB  . ASP A 1 333  ? 4.626   55.957 33.810  1.00 25.66  ? 330  ASP A CB  1 
ATOM 2591 C CG  . ASP A 1 333  ? 3.794   54.974 32.877  1.00 25.66  ? 330  ASP A CG  1 
ATOM 2592 O OD1 . ASP A 1 333  ? 4.275   54.000 32.236  1.00 25.66  ? 330  ASP A OD1 1 
ATOM 2593 O OD2 . ASP A 1 333  ? 2.570   55.208 32.748  1.00 25.66  ? 330  ASP A OD2 1 
ATOM 2594 N N   . SER A 1 334  ? 7.830   56.986 33.881  1.00 42.31  ? 331  SER A N   1 
ATOM 2595 C CA  . SER A 1 334  ? 8.668   58.134 34.196  1.00 42.31  ? 331  SER A CA  1 
ATOM 2596 C C   . SER A 1 334  ? 7.825   59.343 34.052  1.00 42.31  ? 331  SER A C   1 
ATOM 2597 O O   . SER A 1 334  ? 6.889   59.377 33.232  1.00 42.31  ? 331  SER A O   1 
ATOM 2598 C CB  . SER A 1 334  ? 9.854   58.239 33.269  1.00 48.38  ? 331  SER A CB  1 
ATOM 2599 O OG  . SER A 1 334  ? 10.987  57.633 33.867  1.00 48.38  ? 331  SER A OG  1 
ATOM 2600 N N   . GLN A 1 335  ? 8.123   60.359 34.836  1.00 43.16  ? 332  GLN A N   1 
ATOM 2601 C CA  . GLN A 1 335  ? 7.223   61.473 34.837  1.00 43.16  ? 332  GLN A CA  1 
ATOM 2602 C C   . GLN A 1 335  ? 7.879   62.827 35.070  1.00 43.16  ? 332  GLN A C   1 
ATOM 2603 O O   . GLN A 1 335  ? 9.001   62.901 35.556  1.00 43.16  ? 332  GLN A O   1 
ATOM 2604 C CB  . GLN A 1 335  ? 6.108   61.184 35.833  1.00 35.92  ? 332  GLN A CB  1 
ATOM 2605 C CG  . GLN A 1 335  ? 6.506   61.397 37.251  1.00 35.92  ? 332  GLN A CG  1 
ATOM 2606 C CD  . GLN A 1 335  ? 5.549   60.762 38.187  1.00 35.92  ? 332  GLN A CD  1 
ATOM 2607 O OE1 . GLN A 1 335  ? 4.460   60.359 37.791  1.00 35.92  ? 332  GLN A OE1 1 
ATOM 2608 N NE2 . GLN A 1 335  ? 5.948   60.644 39.442  1.00 35.92  ? 332  GLN A NE2 1 
ATOM 2609 N N   . LEU A 1 336  ? 7.154   63.885 34.696  1.00 48.65  ? 333  LEU A N   1 
ATOM 2610 C CA  . LEU A 1 336  ? 7.580   65.259 34.920  1.00 48.65  ? 333  LEU A CA  1 
ATOM 2611 C C   . LEU A 1 336  ? 6.806   65.794 36.061  1.00 48.65  ? 333  LEU A C   1 
ATOM 2612 O O   . LEU A 1 336  ? 5.619   65.634 36.086  1.00 48.65  ? 333  LEU A O   1 
ATOM 2613 C CB  . LEU A 1 336  ? 7.306   66.109 33.703  1.00 59.41  ? 333  LEU A CB  1 
ATOM 2614 C CG  . LEU A 1 336  ? 8.453   67.067 33.437  1.00 59.41  ? 333  LEU A CG  1 
ATOM 2615 C CD1 . LEU A 1 336  ? 9.706   66.588 34.098  1.00 59.41  ? 333  LEU A CD1 1 
ATOM 2616 C CD2 . LEU A 1 336  ? 8.642   67.121 31.963  1.00 59.41  ? 333  LEU A CD2 1 
ATOM 2617 N N   . VAL A 1 337  ? 7.477   66.426 37.009  1.00 40.68  ? 334  VAL A N   1 
ATOM 2618 C CA  . VAL A 1 337  ? 6.848   66.695 38.286  1.00 40.68  ? 334  VAL A CA  1 
ATOM 2619 C C   . VAL A 1 337  ? 7.064   68.090 38.851  1.00 40.68  ? 334  VAL A C   1 
ATOM 2620 O O   . VAL A 1 337  ? 8.142   68.659 38.704  1.00 40.68  ? 334  VAL A O   1 
ATOM 2621 C CB  . VAL A 1 337  ? 7.247   65.642 39.290  1.00 38.34  ? 334  VAL A CB  1 
ATOM 2622 C CG1 . VAL A 1 337  ? 7.588   66.236 40.649  1.00 38.34  ? 334  VAL A CG1 1 
ATOM 2623 C CG2 . VAL A 1 337  ? 6.135   64.694 39.393  1.00 38.34  ? 334  VAL A CG2 1 
ATOM 2624 N N   . LYS A 1 338  ? 6.043   68.639 39.507  1.00 56.00  ? 335  LYS A N   1 
ATOM 2625 C CA  . LYS A 1 338  ? 6.150   69.979 40.025  1.00 56.00  ? 335  LYS A CA  1 
ATOM 2626 C C   . LYS A 1 338  ? 6.054   70.049 41.539  1.00 56.00  ? 335  LYS A C   1 
ATOM 2627 O O   . LYS A 1 338  ? 5.068   69.579 42.140  1.00 56.00  ? 335  LYS A O   1 
ATOM 2628 C CB  . LYS A 1 338  ? 5.104   70.882 39.394  1.00 53.37  ? 335  LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 338  ? 5.126   72.285 39.899  1.00 53.37  ? 335  LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 338  ? 6.071   73.144 39.119  1.00 53.37  ? 335  LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 338  ? 6.566   74.254 40.015  1.00 53.37  ? 335  LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 338  ? 6.582   75.585 39.331  1.00 53.37  ? 335  LYS A NZ  1 
ATOM 2633 N N   . LEU A 1 339  ? 7.101   70.637 42.126  1.00 55.83  ? 336  LEU A N   1 
ATOM 2634 C CA  . LEU A 1 339  ? 7.122   71.043 43.513  1.00 55.83  ? 336  LEU A CA  1 
ATOM 2635 C C   . LEU A 1 339  ? 6.618   72.459 43.657  1.00 55.83  ? 336  LEU A C   1 
ATOM 2636 O O   . LEU A 1 339  ? 6.958   73.382 42.884  1.00 55.83  ? 336  LEU A O   1 
ATOM 2637 C CB  . LEU A 1 339  ? 8.520   70.992 44.071  1.00 30.62  ? 336  LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 339  ? 9.385   69.733 43.940  1.00 30.62  ? 336  LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 339  ? 10.769  70.049 44.430  1.00 30.62  ? 336  LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 339  ? 8.829   68.546 44.708  1.00 30.62  ? 336  LEU A CD2 1 
ATOM 2641 N N   . ASN A 1 340  ? 5.787   72.642 44.665  1.00 41.87  ? 337  ASN A N   1 
ATOM 2642 C CA  . ASN A 1 340  ? 5.297   73.953 44.945  1.00 41.87  ? 337  ASN A CA  1 
ATOM 2643 C C   . ASN A 1 340  ? 5.544   74.205 46.401  1.00 41.87  ? 337  ASN A C   1 
ATOM 2644 O O   . ASN A 1 340  ? 5.610   73.272 47.221  1.00 41.87  ? 337  ASN A O   1 
ATOM 2645 C CB  . ASN A 1 340  ? 3.816   74.050 44.656  1.00 39.26  ? 337  ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 340  ? 3.459   73.520 43.318  1.00 39.26  ? 337  ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 340  ? 2.830   72.478 43.217  1.00 39.26  ? 337  ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 340  ? 3.856   74.226 42.275  1.00 39.26  ? 337  ASN A ND2 1 
ATOM 2649 N N   . VAL A 1 341  ? 5.667   75.491 46.707  1.00 63.71  ? 338  VAL A N   1 
ATOM 2650 C CA  . VAL A 1 341  ? 5.818   75.965 48.067  1.00 63.71  ? 338  VAL A CA  1 
ATOM 2651 C C   . VAL A 1 341  ? 4.723   75.428 49.014  1.00 63.71  ? 338  VAL A C   1 
ATOM 2652 O O   . VAL A 1 341  ? 4.982   75.241 50.203  1.00 63.71  ? 338  VAL A O   1 
ATOM 2653 C CB  . VAL A 1 341  ? 5.845   77.497 48.067  1.00 91.80  ? 338  VAL A CB  1 
ATOM 2654 C CG1 . VAL A 1 341  ? 6.512   78.028 49.333  1.00 91.80  ? 338  VAL A CG1 1 
ATOM 2655 C CG2 . VAL A 1 341  ? 6.565   77.989 46.810  1.00 91.80  ? 338  VAL A CG2 1 
ATOM 2656 N N   . ASP A 1 342  ? 3.516   75.220 48.499  1.00 59.54  ? 339  ASP A N   1 
ATOM 2657 C CA  . ASP A 1 342  ? 2.412   74.768 49.342  1.00 59.54  ? 339  ASP A CA  1 
ATOM 2658 C C   . ASP A 1 342  ? 1.956   73.337 49.075  1.00 59.54  ? 339  ASP A C   1 
ATOM 2659 O O   . ASP A 1 342  ? 2.304   72.735 48.060  1.00 59.54  ? 339  ASP A O   1 
ATOM 2660 C CB  . ASP A 1 342  ? 1.222   75.723 49.213  1.00 78.09  ? 339  ASP A CB  1 
ATOM 2661 C CG  . ASP A 1 342  ? 1.562   77.137 49.642  1.00 78.09  ? 339  ASP A CG  1 
ATOM 2662 O OD1 . ASP A 1 342  ? 2.717   77.374 50.054  1.00 78.09  ? 339  ASP A OD1 1 
ATOM 2663 O OD2 . ASP A 1 342  ? 0.674   78.012 49.566  1.00 78.09  ? 339  ASP A OD2 1 
ATOM 2664 N N   . SER A 1 343  ? 1.176   72.795 50.004  1.00 67.31  ? 340  SER A N   1 
ATOM 2665 C CA  . SER A 1 343  ? 0.670   71.434 49.881  1.00 67.31  ? 340  SER A CA  1 
ATOM 2666 C C   . SER A 1 343  ? -0.844  71.430 49.714  1.00 67.31  ? 340  SER A C   1 
ATOM 2667 O O   . SER A 1 343  ? -1.583  71.745 50.647  1.00 67.31  ? 340  SER A O   1 
ATOM 2668 C CB  . SER A 1 343  ? 1.067   70.602 51.102  1.00 69.77  ? 340  SER A CB  1 
ATOM 2669 O OG  . SER A 1 343  ? 0.542   71.162 52.294  1.00 69.77  ? 340  SER A OG  1 
ATOM 2670 N N   . ASN A 1 344  ? -1.301  71.068 48.520  1.00 77.52  ? 341  ASN A N   1 
ATOM 2671 C CA  . ASN A 1 344  ? -2.729  71.019 48.229  1.00 77.52  ? 341  ASN A CA  1 
ATOM 2672 C C   . ASN A 1 344  ? -3.413  69.840 48.913  1.00 77.52  ? 341  ASN A C   1 
ATOM 2673 O O   . ASN A 1 344  ? -2.797  69.129 49.707  1.00 77.52  ? 341  ASN A O   1 
ATOM 2674 C CB  . ASN A 1 344  ? -2.968  70.963 46.719  1.00 49.52  ? 341  ASN A CB  1 
ATOM 2675 C CG  . ASN A 1 344  ? -2.334  69.746 46.075  1.00 49.52  ? 341  ASN A CG  1 
ATOM 2676 O OD1 . ASN A 1 344  ? -1.707  68.928 46.748  1.00 49.52  ? 341  ASN A OD1 1 
ATOM 2677 N ND2 . ASN A 1 344  ? -2.494  69.620 44.762  1.00 49.52  ? 341  ASN A ND2 1 
ATOM 2678 N N   . GLU A 1 345  ? -4.688  69.638 48.600  1.00 96.16  ? 342  GLU A N   1 
ATOM 2679 C CA  . GLU A 1 345  ? -5.456  68.545 49.183  1.00 96.16  ? 342  GLU A CA  1 
ATOM 2680 C C   . GLU A 1 345  ? -4.573  67.330 49.447  1.00 96.16  ? 342  GLU A C   1 
ATOM 2681 O O   . GLU A 1 345  ? -3.923  66.815 48.538  1.00 96.16  ? 342  GLU A O   1 
ATOM 2682 C CB  . GLU A 1 345  ? -6.622  68.160 48.270  1.00 135.69 ? 342  GLU A CB  1 
ATOM 2683 C CG  . GLU A 1 345  ? -6.201  67.696 46.885  1.00 135.69 ? 342  GLU A CG  1 
ATOM 2684 C CD  . GLU A 1 345  ? -5.539  68.795 46.077  1.00 135.69 ? 342  GLU A CD  1 
ATOM 2685 O OE1 . GLU A 1 345  ? -5.589  69.965 46.509  1.00 135.69 ? 342  GLU A OE1 1 
ATOM 2686 O OE2 . GLU A 1 345  ? -4.971  68.488 45.007  1.00 135.69 ? 342  GLU A OE2 1 
ATOM 2687 N N   . GLN A 1 346  ? -4.555  66.877 50.696  1.00 81.84  ? 343  GLN A N   1 
ATOM 2688 C CA  . GLN A 1 346  ? -3.752  65.722 51.081  1.00 81.84  ? 343  GLN A CA  1 
ATOM 2689 C C   . GLN A 1 346  ? -2.458  66.154 51.762  1.00 81.84  ? 343  GLN A C   1 
ATOM 2690 O O   . GLN A 1 346  ? -1.896  65.417 52.573  1.00 81.84  ? 343  GLN A O   1 
ATOM 2691 C CB  . GLN A 1 346  ? -3.441  64.855 49.860  1.00 178.17 ? 343  GLN A CB  1 
ATOM 2692 C CG  . GLN A 1 346  ? -2.600  63.627 50.169  1.00 178.17 ? 343  GLN A CG  1 
ATOM 2693 C CD  . GLN A 1 346  ? -2.308  62.796 48.935  1.00 178.17 ? 343  GLN A CD  1 
ATOM 2694 O OE1 . GLN A 1 346  ? -2.736  63.131 47.831  1.00 178.17 ? 343  GLN A OE1 1 
ATOM 2695 N NE2 . GLN A 1 346  ? -1.574  61.704 49.118  1.00 178.17 ? 343  GLN A NE2 1 
ATOM 2696 N N   . GLY A 1 347  ? -1.990  67.351 51.427  1.00 53.07  ? 344  GLY A N   1 
ATOM 2697 C CA  . GLY A 1 347  ? -0.767  67.881 52.002  1.00 53.07  ? 344  GLY A CA  1 
ATOM 2698 C C   . GLY A 1 347  ? 0.467   67.454 51.232  1.00 53.07  ? 344  GLY A C   1 
ATOM 2699 O O   . GLY A 1 347  ? 1.557   67.348 51.796  1.00 53.07  ? 344  GLY A O   1 
ATOM 2700 N N   . SER A 1 348  ? 0.296   67.207 49.938  1.00 51.46  ? 345  SER A N   1 
ATOM 2701 C CA  . SER A 1 348  ? 1.401   66.789 49.084  1.00 51.46  ? 345  SER A CA  1 
ATOM 2702 C C   . SER A 1 348  ? 1.915   67.949 48.238  1.00 51.46  ? 345  SER A C   1 
ATOM 2703 O O   . SER A 1 348  ? 1.161   68.558 47.479  1.00 51.46  ? 345  SER A O   1 
ATOM 2704 C CB  . SER A 1 348  ? 0.973   65.629 48.183  1.00 44.00  ? 345  SER A CB  1 
ATOM 2705 O OG  . SER A 1 348  ? 2.039   65.212 47.347  1.00 44.00  ? 345  SER A OG  1 
ATOM 2706 N N   . TYR A 1 349  ? 3.203   68.249 48.374  1.00 53.43  ? 346  TYR A N   1 
ATOM 2707 C CA  . TYR A 1 349  ? 3.820   69.335 47.623  1.00 53.43  ? 346  TYR A CA  1 
ATOM 2708 C C   . TYR A 1 349  ? 4.220   68.880 46.224  1.00 53.43  ? 346  TYR A C   1 
ATOM 2709 O O   . TYR A 1 349  ? 4.929   69.588 45.509  1.00 53.43  ? 346  TYR A O   1 
ATOM 2710 C CB  . TYR A 1 349  ? 5.041   69.876 48.369  1.00 63.49  ? 346  TYR A CB  1 
ATOM 2711 C CG  . TYR A 1 349  ? 4.730   70.409 49.749  1.00 63.49  ? 346  TYR A CG  1 
ATOM 2712 C CD1 . TYR A 1 349  ? 4.778   69.580 50.862  1.00 63.49  ? 346  TYR A CD1 1 
ATOM 2713 C CD2 . TYR A 1 349  ? 4.390   71.742 49.940  1.00 63.49  ? 346  TYR A CD2 1 
ATOM 2714 C CE1 . TYR A 1 349  ? 4.494   70.062 52.125  1.00 63.49  ? 346  TYR A CE1 1 
ATOM 2715 C CE2 . TYR A 1 349  ? 4.105   72.233 51.199  1.00 63.49  ? 346  TYR A CE2 1 
ATOM 2716 C CZ  . TYR A 1 349  ? 4.159   71.390 52.288  1.00 63.49  ? 346  TYR A CZ  1 
ATOM 2717 O OH  . TYR A 1 349  ? 3.876   71.875 53.545  1.00 63.49  ? 346  TYR A OH  1 
ATOM 2718 N N   . VAL A 1 350  ? 3.761   67.693 45.840  1.00 62.14  ? 347  VAL A N   1 
ATOM 2719 C CA  . VAL A 1 350  ? 4.071   67.141 44.526  1.00 62.14  ? 347  VAL A CA  1 
ATOM 2720 C C   . VAL A 1 350  ? 2.860   67.199 43.601  1.00 62.14  ? 347  VAL A C   1 
ATOM 2721 O O   . VAL A 1 350  ? 1.734   66.928 44.019  1.00 62.14  ? 347  VAL A O   1 
ATOM 2722 C CB  . VAL A 1 350  ? 4.558   65.683 44.628  1.00 68.15  ? 347  VAL A CB  1 
ATOM 2723 C CG1 . VAL A 1 350  ? 4.806   65.109 43.241  1.00 68.15  ? 347  VAL A CG1 1 
ATOM 2724 C CG2 . VAL A 1 350  ? 5.816   65.602 45.479  1.00 68.15  ? 347  VAL A CG2 1 
ATOM 2725 N N   . VAL A 1 351  ? 3.100   67.553 42.343  1.00 50.95  ? 348  VAL A N   1 
ATOM 2726 C CA  . VAL A 1 351  ? 2.041   67.646 41.364  1.00 50.95  ? 348  VAL A CA  1 
ATOM 2727 C C   . VAL A 1 351  ? 2.575   67.131 40.021  1.00 50.95  ? 348  VAL A C   1 
ATOM 2728 O O   . VAL A 1 351  ? 3.523   67.719 39.462  1.00 50.95  ? 348  VAL A O   1 
ATOM 2729 C CB  . VAL A 1 351  ? 1.588   69.128 41.160  1.00 41.99  ? 348  VAL A CB  1 
ATOM 2730 C CG1 . VAL A 1 351  ? 0.730   69.258 39.890  1.00 41.99  ? 348  VAL A CG1 1 
ATOM 2731 C CG2 . VAL A 1 351  ? 0.889   69.735 42.412  1.00 41.99  ? 348  VAL A CG2 1 
ATOM 2732 N N   . ALA A 1 352  ? 1.982   66.059 39.487  1.00 32.71  ? 349  ALA A N   1 
ATOM 2733 C CA  . ALA A 1 352  ? 2.436   65.541 38.189  1.00 32.71  ? 349  ALA A CA  1 
ATOM 2734 C C   . ALA A 1 352  ? 2.119   66.500 37.079  1.00 32.71  ? 349  ALA A C   1 
ATOM 2735 O O   . ALA A 1 352  ? 1.012   67.016 37.051  1.00 32.71  ? 349  ALA A O   1 
ATOM 2736 C CB  . ALA A 1 352  ? 1.772   64.267 37.880  1.00 11.35  ? 349  ALA A CB  1 
ATOM 2737 N N   . MET A 1 353  ? 3.059   66.716 36.171  1.00 61.25  ? 350  MET A N   1 
ATOM 2738 C CA  . MET A 1 353  ? 2.810   67.487 34.981  1.00 61.25  ? 350  MET A CA  1 
ATOM 2739 C C   . MET A 1 353  ? 2.710   66.571 33.809  1.00 61.25  ? 350  MET A C   1 
ATOM 2740 O O   . MET A 1 353  ? 1.866   66.747 32.950  1.00 61.25  ? 350  MET A O   1 
ATOM 2741 C CB  . MET A 1 353  ? 3.928   68.461 34.740  1.00 57.18  ? 350  MET A CB  1 
ATOM 2742 C CG  . MET A 1 353  ? 3.961   69.551 35.770  1.00 57.18  ? 350  MET A CG  1 
ATOM 2743 S SD  . MET A 1 353  ? 5.625   70.196 36.069  1.00 57.18  ? 350  MET A SD  1 
ATOM 2744 C CE  . MET A 1 353  ? 6.020   70.945 34.472  1.00 57.18  ? 350  MET A CE  1 
ATOM 2745 N N   . GLU A 1 354  ? 3.583   65.585 33.749  1.00 61.87  ? 351  GLU A N   1 
ATOM 2746 C CA  . GLU A 1 354  ? 3.586   64.717 32.592  1.00 61.87  ? 351  GLU A CA  1 
ATOM 2747 C C   . GLU A 1 354  ? 3.982   63.319 32.961  1.00 61.87  ? 351  GLU A C   1 
ATOM 2748 O O   . GLU A 1 354  ? 4.614   63.081 33.974  1.00 61.87  ? 351  GLU A O   1 
ATOM 2749 C CB  . GLU A 1 354  ? 4.499   65.260 31.506  1.00 75.88  ? 351  GLU A CB  1 
ATOM 2750 C CG  . GLU A 1 354  ? 3.803   65.413 30.189  1.00 75.88  ? 351  GLU A CG  1 
ATOM 2751 C CD  . GLU A 1 354  ? 4.785   65.553 29.067  1.00 75.88  ? 351  GLU A CD  1 
ATOM 2752 O OE1 . GLU A 1 354  ? 5.535   66.559 29.056  1.00 75.88  ? 351  GLU A OE1 1 
ATOM 2753 O OE2 . GLU A 1 354  ? 4.816   64.642 28.205  1.00 75.88  ? 351  GLU A OE2 1 
ATOM 2754 N N   . THR A 1 355  ? 3.592   62.400 32.103  1.00 35.39  ? 352  THR A N   1 
ATOM 2755 C CA  . THR A 1 355  ? 3.649   60.991 32.367  1.00 35.39  ? 352  THR A CA  1 
ATOM 2756 C C   . THR A 1 355  ? 4.137   60.319 31.094  1.00 35.39  ? 352  THR A C   1 
ATOM 2757 O O   . THR A 1 355  ? 3.538   60.425 30.003  1.00 35.39  ? 352  THR A O   1 
ATOM 2758 C CB  . THR A 1 355  ? 2.254   60.519 32.731  1.00 38.13  ? 352  THR A CB  1 
ATOM 2759 O OG1 . THR A 1 355  ? 2.094   60.697 34.136  1.00 38.13  ? 352  THR A OG1 1 
ATOM 2760 C CG2 . THR A 1 355  ? 2.008   59.059 32.354  1.00 38.13  ? 352  THR A CG2 1 
ATOM 2761 N N   . PHE A 1 356  ? 5.248   59.629 31.196  1.00 46.16  ? 353  PHE A N   1 
ATOM 2762 C CA  . PHE A 1 356  ? 5.657   58.971 30.001  1.00 46.16  ? 353  PHE A CA  1 
ATOM 2763 C C   . PHE A 1 356  ? 5.549   57.495 30.222  1.00 46.16  ? 353  PHE A C   1 
ATOM 2764 O O   . PHE A 1 356  ? 5.841   57.000 31.308  1.00 46.16  ? 353  PHE A O   1 
ATOM 2765 C CB  . PHE A 1 356  ? 7.047   59.398 29.599  1.00 39.46  ? 353  PHE A CB  1 
ATOM 2766 C CG  . PHE A 1 356  ? 7.361   60.823 29.905  1.00 39.46  ? 353  PHE A CG  1 
ATOM 2767 C CD1 . PHE A 1 356  ? 7.878   61.180 31.146  1.00 39.46  ? 353  PHE A CD1 1 
ATOM 2768 C CD2 . PHE A 1 356  ? 7.203   61.794 28.941  1.00 39.46  ? 353  PHE A CD2 1 
ATOM 2769 C CE1 . PHE A 1 356  ? 8.216   62.488 31.438  1.00 39.46  ? 353  PHE A CE1 1 
ATOM 2770 C CE2 . PHE A 1 356  ? 7.521   63.107 29.216  1.00 39.46  ? 353  PHE A CE2 1 
ATOM 2771 C CZ  . PHE A 1 356  ? 8.045   63.456 30.471  1.00 39.46  ? 353  PHE A CZ  1 
ATOM 2772 N N   . THR A 1 357  ? 5.092   56.808 29.186  1.00 42.93  ? 354  THR A N   1 
ATOM 2773 C CA  . THR A 1 357  ? 4.706   55.420 29.323  1.00 42.93  ? 354  THR A CA  1 
ATOM 2774 C C   . THR A 1 357  ? 5.967   54.595 29.323  1.00 42.93  ? 354  THR A C   1 
ATOM 2775 O O   . THR A 1 357  ? 6.827   54.776 28.489  1.00 42.93  ? 354  THR A O   1 
ATOM 2776 C CB  . THR A 1 357  ? 3.725   54.978 28.232  1.00 47.05  ? 354  THR A CB  1 
ATOM 2777 O OG1 . THR A 1 357  ? 4.055   55.652 27.026  1.00 47.05  ? 354  THR A OG1 1 
ATOM 2778 C CG2 . THR A 1 357  ? 2.306   55.402 28.584  1.00 47.05  ? 354  THR A CG2 1 
ATOM 2779 N N   . ASN A 1 358  ? 6.098   53.781 30.359  1.00 31.87  ? 355  ASN A N   1 
ATOM 2780 C CA  . ASN A 1 358  ? 7.105   52.783 30.487  1.00 31.87  ? 355  ASN A CA  1 
ATOM 2781 C C   . ASN A 1 358  ? 6.359   51.460 30.618  1.00 31.87  ? 355  ASN A C   1 
ATOM 2782 O O   . ASN A 1 358  ? 5.648   51.243 31.638  1.00 31.87  ? 355  ASN A O   1 
ATOM 2783 C CB  . ASN A 1 358  ? 7.918   53.033 31.748  1.00 31.54  ? 355  ASN A CB  1 
ATOM 2784 C CG  . ASN A 1 358  ? 8.975   51.933 32.003  1.00 31.54  ? 355  ASN A CG  1 
ATOM 2785 O OD1 . ASN A 1 358  ? 9.230   51.094 31.145  1.00 31.54  ? 355  ASN A OD1 1 
ATOM 2786 N ND2 . ASN A 1 358  ? 9.567   51.928 33.198  1.00 31.54  ? 355  ASN A ND2 1 
ATOM 2787 N N   . LEU A 1 359  ? 6.509   50.578 29.610  1.00 33.74  ? 356  LEU A N   1 
ATOM 2788 C CA  . LEU A 1 359  ? 6.098   49.150 29.700  1.00 33.74  ? 356  LEU A CA  1 
ATOM 2789 C C   . LEU A 1 359  ? 6.979   48.451 30.721  1.00 33.74  ? 356  LEU A C   1 
ATOM 2790 O O   . LEU A 1 359  ? 6.765   47.269 31.038  1.00 33.74  ? 356  LEU A O   1 
ATOM 2791 C CB  . LEU A 1 359  ? 6.141   48.450 28.352  1.00 23.29  ? 356  LEU A CB  1 
ATOM 2792 C CG  . LEU A 1 359  ? 5.586   49.341 27.213  1.00 23.29  ? 356  LEU A CG  1 
ATOM 2793 C CD1 . LEU A 1 359  ? 5.886   48.839 25.793  1.00 23.29  ? 356  LEU A CD1 1 
ATOM 2794 C CD2 . LEU A 1 359  ? 4.094   49.673 27.362  1.00 23.29  ? 356  LEU A CD2 1 
ATOM 2795 N N   . GLY A 1 360  ? 7.944   49.223 31.241  1.00 74.73  ? 357  GLY A N   1 
ATOM 2796 C CA  . GLY A 1 360  ? 8.506   49.062 32.577  1.00 74.73  ? 357  GLY A CA  1 
ATOM 2797 C C   . GLY A 1 360  ? 9.002   47.683 32.583  1.00 74.73  ? 357  GLY A C   1 
ATOM 2798 O O   . GLY A 1 360  ? 9.489   47.229 31.560  1.00 74.73  ? 357  GLY A O   1 
ATOM 2799 N N   . PRO A 1 361  ? 8.886   46.992 33.717  1.00 39.73  ? 358  PRO A N   1 
ATOM 2800 C CA  . PRO A 1 361  ? 9.138   45.526 33.612  1.00 39.73  ? 358  PRO A CA  1 
ATOM 2801 C C   . PRO A 1 361  ? 7.993   44.760 32.875  1.00 39.73  ? 358  PRO A C   1 
ATOM 2802 O O   . PRO A 1 361  ? 6.922   44.601 33.410  1.00 39.73  ? 358  PRO A O   1 
ATOM 2803 C CB  . PRO A 1 361  ? 9.350   45.077 35.093  1.00 26.68  ? 358  PRO A CB  1 
ATOM 2804 C CG  . PRO A 1 361  ? 9.319   46.297 35.890  1.00 26.68  ? 358  PRO A CG  1 
ATOM 2805 C CD  . PRO A 1 361  ? 8.634   47.419 35.096  1.00 26.68  ? 358  PRO A CD  1 
ATOM 2806 N N   . ILE A 1 362  ? 8.182   44.339 31.648  1.00 29.28  ? 359  ILE A N   1 
ATOM 2807 C CA  . ILE A 1 362  ? 7.236   43.390 31.076  1.00 29.28  ? 359  ILE A CA  1 
ATOM 2808 C C   . ILE A 1 362  ? 7.564   42.005 31.629  1.00 29.28  ? 359  ILE A C   1 
ATOM 2809 O O   . ILE A 1 362  ? 8.682   41.513 31.455  1.00 29.28  ? 359  ILE A O   1 
ATOM 2810 C CB  . ILE A 1 362  ? 7.354   43.280 29.581  1.00 24.55  ? 359  ILE A CB  1 
ATOM 2811 C CG1 . ILE A 1 362  ? 7.160   44.643 28.967  1.00 24.55  ? 359  ILE A CG1 1 
ATOM 2812 C CG2 . ILE A 1 362  ? 6.339   42.261 29.061  1.00 24.55  ? 359  ILE A CG2 1 
ATOM 2813 C CD1 . ILE A 1 362  ? 7.197   44.627 27.501  1.00 24.55  ? 359  ILE A CD1 1 
ATOM 2814 N N   . VAL A 1 363  ? 6.606   41.376 32.291  1.00 39.30  ? 360  VAL A N   1 
ATOM 2815 C CA  . VAL A 1 363  ? 6.930   40.341 33.278  1.00 39.30  ? 360  VAL A CA  1 
ATOM 2816 C C   . VAL A 1 363  ? 6.338   39.080 32.756  1.00 39.30  ? 360  VAL A C   1 
ATOM 2817 O O   . VAL A 1 363  ? 6.950   38.037 32.846  1.00 39.30  ? 360  VAL A O   1 
ATOM 2818 C CB  . VAL A 1 363  ? 6.336   40.727 34.640  1.00 44.38  ? 360  VAL A CB  1 
ATOM 2819 C CG1 . VAL A 1 363  ? 5.602   39.579 35.307  1.00 44.38  ? 360  VAL A CG1 1 
ATOM 2820 C CG2 . VAL A 1 363  ? 7.390   41.328 35.531  1.00 44.38  ? 360  VAL A CG2 1 
ATOM 2821 N N   . ASP A 1 364  ? 5.130   39.216 32.213  1.00 30.50  ? 361  ASP A N   1 
ATOM 2822 C CA  . ASP A 1 364  ? 4.505   38.243 31.345  1.00 30.50  ? 361  ASP A CA  1 
ATOM 2823 C C   . ASP A 1 364  ? 3.764   38.997 30.235  1.00 30.50  ? 361  ASP A C   1 
ATOM 2824 O O   . ASP A 1 364  ? 3.524   40.185 30.348  1.00 30.50  ? 361  ASP A O   1 
ATOM 2825 C CB  . ASP A 1 364  ? 3.523   37.397 32.136  1.00 51.21  ? 361  ASP A CB  1 
ATOM 2826 C CG  . ASP A 1 364  ? 3.112   36.149 31.380  1.00 51.21  ? 361  ASP A CG  1 
ATOM 2827 O OD1 . ASP A 1 364  ? 2.372   35.288 31.944  1.00 51.21  ? 361  ASP A OD1 1 
ATOM 2828 O OD2 . ASP A 1 364  ? 3.561   36.028 30.212  1.00 51.21  ? 361  ASP A OD2 1 
ATOM 2829 N N   . MET A 1 365  ? 3.375   38.335 29.170  1.00 29.97  ? 362  MET A N   1 
ATOM 2830 C CA  . MET A 1 365  ? 2.496   38.975 28.217  1.00 29.97  ? 362  MET A CA  1 
ATOM 2831 C C   . MET A 1 365  ? 1.744   37.966 27.300  1.00 29.97  ? 362  MET A C   1 
ATOM 2832 O O   . MET A 1 365  ? 2.118   36.802 27.216  1.00 29.97  ? 362  MET A O   1 
ATOM 2833 C CB  . MET A 1 365  ? 3.322   39.955 27.427  1.00 41.92  ? 362  MET A CB  1 
ATOM 2834 C CG  . MET A 1 365  ? 4.272   39.305 26.472  1.00 41.92  ? 362  MET A CG  1 
ATOM 2835 S SD  . MET A 1 365  ? 5.478   40.474 25.816  1.00 41.92  ? 362  MET A SD  1 
ATOM 2836 C CE  . MET A 1 365  ? 5.685   39.671 24.216  1.00 41.92  ? 362  MET A CE  1 
ATOM 2837 N N   . CYS A 1 366  ? 0.679   38.374 26.624  1.00 42.35  ? 363  CYS A N   1 
ATOM 2838 C CA  . CYS A 1 366  ? 0.107   37.497 25.577  1.00 42.35  ? 363  CYS A CA  1 
ATOM 2839 C C   . CYS A 1 366  ? -0.489  38.259 24.420  1.00 42.35  ? 363  CYS A C   1 
ATOM 2840 O O   . CYS A 1 366  ? -0.707  39.467 24.544  1.00 42.35  ? 363  CYS A O   1 
ATOM 2841 C CB  . CYS A 1 366  ? -0.923  36.533 26.144  1.00 42.75  ? 363  CYS A CB  1 
ATOM 2842 S SG  . CYS A 1 366  ? -2.434  37.349 26.671  1.00 42.75  ? 363  CYS A SG  1 
ATOM 2843 N N   . VAL A 1 367  ? -0.741  37.569 23.303  1.00 51.02  ? 364  VAL A N   1 
ATOM 2844 C CA  . VAL A 1 367  ? -1.296  38.208 22.078  1.00 51.02  ? 364  VAL A CA  1 
ATOM 2845 C C   . VAL A 1 367  ? -2.761  37.873 21.889  1.00 51.02  ? 364  VAL A C   1 
ATOM 2846 O O   . VAL A 1 367  ? -3.155  36.732 21.979  1.00 51.02  ? 364  VAL A O   1 
ATOM 2847 C CB  . VAL A 1 367  ? -0.539  37.813 20.774  1.00 42.24  ? 364  VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 367  ? -1.078  38.598 19.609  1.00 42.24  ? 364  VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 367  ? 0.953   38.097 20.895  1.00 42.24  ? 364  VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 368  ? -3.567  38.896 21.624  1.00 74.45  ? 365  VAL A N   1 
ATOM 2851 C CA  . VAL A 1 368  ? -4.998  38.709 21.421  1.00 74.45  ? 365  VAL A CA  1 
ATOM 2852 C C   . VAL A 1 368  ? -5.541  39.672 20.371  1.00 74.45  ? 365  VAL A C   1 
ATOM 2853 O O   . VAL A 1 368  ? -5.213  40.859 20.375  1.00 74.45  ? 365  VAL A O   1 
ATOM 2854 C CB  . VAL A 1 368  ? -5.783  38.899 22.732  1.00 40.85  ? 365  VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 368  ? -7.277  38.768 22.480  1.00 40.85  ? 365  VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 368  ? -5.322  37.895 23.777  1.00 40.85  ? 365  VAL A CG2 1 
ATOM 2857 N N   . ASP A 1 369  ? -6.359  39.210 19.431  1.00 122.85 ? 366  ASP A N   1 
ATOM 2858 C CA  . ASP A 1 369  ? -6.993  40.116 18.454  1.00 122.85 ? 366  ASP A CA  1 
ATOM 2859 C C   . ASP A 1 369  ? -8.390  40.214 18.988  1.00 122.85 ? 366  ASP A C   1 
ATOM 2860 O O   . ASP A 1 369  ? -9.266  39.440 18.658  1.00 122.85 ? 366  ASP A O   1 
ATOM 2861 C CB  . ASP A 1 369  ? -6.965  39.585 17.046  1.00 76.19  ? 366  ASP A CB  1 
ATOM 2862 C CG  . ASP A 1 369  ? -7.022  38.128 16.997  1.00 76.19  ? 366  ASP A CG  1 
ATOM 2863 O OD1 . ASP A 1 369  ? -7.040  37.504 18.060  1.00 76.19  ? 366  ASP A OD1 1 
ATOM 2864 O OD2 . ASP A 1 369  ? -7.038  37.597 15.887  1.00 76.19  ? 366  ASP A OD2 1 
ATOM 2865 N N   . LEU A 1 370  ? -8.545  41.231 19.810  1.00 120.43 ? 367  LEU A N   1 
ATOM 2866 C CA  . LEU A 1 370  ? -9.524  41.447 20.869  1.00 120.43 ? 367  LEU A CA  1 
ATOM 2867 C C   . LEU A 1 370  ? -10.829 41.730 20.129  1.00 120.43 ? 367  LEU A C   1 
ATOM 2868 O O   . LEU A 1 370  ? -11.888 41.231 20.508  1.00 120.43 ? 367  LEU A O   1 
ATOM 2869 C CB  . LEU A 1 370  ? -8.825  42.763 21.216  1.00 85.74  ? 367  LEU A CB  1 
ATOM 2870 C CG  . LEU A 1 370  ? -7.568  42.656 22.082  1.00 85.74  ? 367  LEU A CG  1 
ATOM 2871 C CD1 . LEU A 1 370  ? -6.935  44.024 22.283  1.00 85.74  ? 367  LEU A CD1 1 
ATOM 2872 C CD2 . LEU A 1 370  ? -7.891  42.008 23.420  1.00 85.74  ? 367  LEU A CD2 1 
ATOM 2873 N N   . GLU A 1 371  ? -10.745 42.538 19.078  1.00 142.09 ? 368  GLU A N   1 
ATOM 2874 C CA  . GLU A 1 371  ? -11.913 42.909 18.309  1.00 142.09 ? 368  GLU A CA  1 
ATOM 2875 C C   . GLU A 1 371  ? -12.162 41.762 17.345  1.00 142.09 ? 368  GLU A C   1 
ATOM 2876 O O   . GLU A 1 371  ? -13.205 41.696 16.694  1.00 142.09 ? 368  GLU A O   1 
ATOM 2877 C CB  . GLU A 1 371  ? -11.668 44.208 17.541  1.00 143.21 ? 368  GLU A CB  1 
ATOM 2878 C CG  . GLU A 1 371  ? -11.369 45.408 18.426  1.00 143.21 ? 368  GLU A CG  1 
ATOM 2879 C CD  . GLU A 1 371  ? -10.070 45.259 19.192  1.00 143.21 ? 368  GLU A CD  1 
ATOM 2880 O OE1 . GLU A 1 371  ? -9.303  44.320 18.891  1.00 143.21 ? 368  GLU A OE1 1 
ATOM 2881 O OE2 . GLU A 1 371  ? -9.813  46.083 20.095  1.00 143.21 ? 368  GLU A OE2 1 
ATOM 2882 N N   . ARG A 1 372  ? -11.191 40.854 17.261  1.00 182.73 ? 369  ARG A N   1 
ATOM 2883 C CA  . ARG A 1 372  ? -11.322 39.691 16.374  1.00 182.73 ? 369  ARG A CA  1 
ATOM 2884 C C   . ARG A 1 372  ? -11.100 40.046 14.901  1.00 182.73 ? 369  ARG A C   1 
ATOM 2885 O O   . ARG A 1 372  ? -11.954 39.781 14.052  1.00 182.73 ? 369  ARG A O   1 
ATOM 2886 C CB  . ARG A 1 372  ? -12.700 39.036 16.576  1.00 127.55 ? 369  ARG A CB  1 
ATOM 2887 C CG  . ARG A 1 372  ? -12.875 37.650 15.951  1.00 127.55 ? 369  ARG A CG  1 
ATOM 2888 C CD  . ARG A 1 372  ? -14.352 37.335 15.661  1.00 127.55 ? 369  ARG A CD  1 
ATOM 2889 N NE  . ARG A 1 372  ? -15.122 37.032 16.877  1.00 127.55 ? 369  ARG A NE  1 
ATOM 2890 C CZ  . ARG A 1 372  ? -16.435 36.775 16.910  1.00 127.55 ? 369  ARG A CZ  1 
ATOM 2891 N NH1 . ARG A 1 372  ? -17.154 36.781 15.787  1.00 127.55 ? 369  ARG A NH1 1 
ATOM 2892 N NH2 . ARG A 1 372  ? -17.035 36.514 18.072  1.00 127.55 ? 369  ARG A NH2 1 
ATOM 2893 N N   . GLN A 1 373  ? -9.954  40.654 14.607  1.00 125.09 ? 370  GLN A N   1 
ATOM 2894 C CA  . GLN A 1 373  ? -9.648  41.087 13.243  1.00 125.09 ? 370  GLN A CA  1 
ATOM 2895 C C   . GLN A 1 373  ? -8.697  40.149 12.519  1.00 125.09 ? 370  GLN A C   1 
ATOM 2896 O O   . GLN A 1 373  ? -9.075  39.448 11.586  1.00 125.09 ? 370  GLN A O   1 
ATOM 2897 C CB  . GLN A 1 373  ? -9.005  42.462 13.249  1.00 100.47 ? 370  GLN A CB  1 
ATOM 2898 C CG  . GLN A 1 373  ? -9.711  43.504 14.040  1.00 100.47 ? 370  GLN A CG  1 
ATOM 2899 C CD  . GLN A 1 373  ? -8.998  44.822 13.917  1.00 100.47 ? 370  GLN A CD  1 
ATOM 2900 O OE1 . GLN A 1 373  ? -8.639  45.248 12.815  1.00 100.47 ? 370  GLN A OE1 1 
ATOM 2901 N NE2 . GLN A 1 373  ? -8.755  45.469 15.046  1.00 100.47 ? 370  GLN A NE2 1 
ATOM 2902 N N   . GLY A 1 374  ? -7.448  40.171 12.962  1.00 65.49  ? 371  GLY A N   1 
ATOM 2903 C CA  . GLY A 1 374  ? -6.353  39.467 12.318  1.00 65.49  ? 371  GLY A CA  1 
ATOM 2904 C C   . GLY A 1 374  ? -5.045  40.169 12.667  1.00 65.49  ? 371  GLY A C   1 
ATOM 2905 O O   . GLY A 1 374  ? -3.949  39.666 12.375  1.00 65.49  ? 371  GLY A O   1 
ATOM 2906 N N   . GLN A 1 375  ? -5.161  41.353 13.265  1.00 84.14  ? 372  GLN A N   1 
ATOM 2907 C CA  . GLN A 1 375  ? -4.023  41.935 13.936  1.00 84.14  ? 372  GLN A CA  1 
ATOM 2908 C C   . GLN A 1 375  ? -4.073  41.510 15.393  1.00 84.14  ? 372  GLN A C   1 
ATOM 2909 O O   . GLN A 1 375  ? -5.147  41.397 15.992  1.00 84.14  ? 372  GLN A O   1 
ATOM 2910 C CB  . GLN A 1 375  ? -3.936  43.462 13.773  1.00 115.27 ? 372  GLN A CB  1 
ATOM 2911 C CG  . GLN A 1 375  ? -5.252  44.198 13.762  1.00 115.27 ? 372  GLN A CG  1 
ATOM 2912 C CD  . GLN A 1 375  ? -5.912  44.276 15.127  1.00 115.27 ? 372  GLN A CD  1 
ATOM 2913 O OE1 . GLN A 1 375  ? -5.869  45.315 15.785  1.00 115.27 ? 372  GLN A OE1 1 
ATOM 2914 N NE2 . GLN A 1 375  ? -6.548  43.188 15.549  1.00 115.27 ? 372  GLN A NE2 1 
ATOM 2915 N N   . GLY A 1 376  ? -2.897  41.209 15.930  1.00 86.15  ? 373  GLY A N   1 
ATOM 2916 C CA  . GLY A 1 376  ? -2.743  40.952 17.340  1.00 86.15  ? 373  GLY A CA  1 
ATOM 2917 C C   . GLY A 1 376  ? -2.614  42.293 17.994  1.00 86.15  ? 373  GLY A C   1 
ATOM 2918 O O   . GLY A 1 376  ? -2.061  43.221 17.433  1.00 86.15  ? 373  GLY A O   1 
ATOM 2919 N N   . GLN A 1 377  ? -3.212  42.407 19.154  1.00 42.40  ? 374  GLN A N   1 
ATOM 2920 C CA  . GLN A 1 377  ? -2.899  43.451 20.081  1.00 42.40  ? 374  GLN A CA  1 
ATOM 2921 C C   . GLN A 1 377  ? -2.058  42.639 21.012  1.00 42.40  ? 374  GLN A C   1 
ATOM 2922 O O   . GLN A 1 377  ? -2.032  41.405 20.933  1.00 42.40  ? 374  GLN A O   1 
ATOM 2923 C CB  . GLN A 1 377  ? -4.114  43.897 20.889  1.00 86.87  ? 374  GLN A CB  1 
ATOM 2924 C CG  . GLN A 1 377  ? -5.325  44.301 20.117  1.00 86.87  ? 374  GLN A CG  1 
ATOM 2925 C CD  . GLN A 1 377  ? -5.566  45.784 20.135  1.00 86.87  ? 374  GLN A CD  1 
ATOM 2926 O OE1 . GLN A 1 377  ? -6.100  46.334 19.177  1.00 86.87  ? 374  GLN A OE1 1 
ATOM 2927 N NE2 . GLN A 1 377  ? -5.192  46.447 21.226  1.00 86.87  ? 374  GLN A NE2 1 
ATOM 2928 N N   . LEU A 1 378  ? -1.408  43.305 21.942  1.00 52.01  ? 375  LEU A N   1 
ATOM 2929 C CA  . LEU A 1 378  ? -0.579  42.596 22.873  1.00 52.01  ? 375  LEU A CA  1 
ATOM 2930 C C   . LEU A 1 378  ? -0.829  43.134 24.259  1.00 52.01  ? 375  LEU A C   1 
ATOM 2931 O O   . LEU A 1 378  ? -0.955  44.349 24.447  1.00 52.01  ? 375  LEU A O   1 
ATOM 2932 C CB  . LEU A 1 378  ? 0.877   42.825 22.491  1.00 39.00  ? 375  LEU A CB  1 
ATOM 2933 C CG  . LEU A 1 378  ? 1.875   41.923 23.176  1.00 39.00  ? 375  LEU A CG  1 
ATOM 2934 C CD1 . LEU A 1 378  ? 1.868   40.687 22.278  1.00 39.00  ? 375  LEU A CD1 1 
ATOM 2935 C CD2 . LEU A 1 378  ? 3.207   42.653 23.277  1.00 39.00  ? 375  LEU A CD2 1 
ATOM 2936 N N   . VAL A 1 379  ? -0.838  42.238 25.234  1.00 45.67  ? 376  VAL A N   1 
ATOM 2937 C CA  . VAL A 1 379  ? -1.320  42.598 26.553  1.00 45.67  ? 376  VAL A CA  1 
ATOM 2938 C C   . VAL A 1 379  ? -0.282  42.174 27.555  1.00 45.67  ? 376  VAL A C   1 
ATOM 2939 O O   . VAL A 1 379  ? -0.023  40.997 27.674  1.00 45.67  ? 376  VAL A O   1 
ATOM 2940 C CB  . VAL A 1 379  ? -2.690  41.903 26.792  1.00 30.48  ? 376  VAL A CB  1 
ATOM 2941 C CG1 . VAL A 1 379  ? -3.182  42.073 28.191  1.00 30.48  ? 376  VAL A CG1 1 
ATOM 2942 C CG2 . VAL A 1 379  ? -3.726  42.440 25.794  1.00 30.48  ? 376  VAL A CG2 1 
ATOM 2943 N N   . THR A 1 380  ? 0.315   43.115 28.276  1.00 40.75  ? 377  THR A N   1 
ATOM 2944 C CA  . THR A 1 380  ? 1.496   42.797 29.080  1.00 40.75  ? 377  THR A CA  1 
ATOM 2945 C C   . THR A 1 380  ? 1.267   43.078 30.526  1.00 40.75  ? 377  THR A C   1 
ATOM 2946 O O   . THR A 1 380  ? 0.731   44.101 30.844  1.00 40.75  ? 377  THR A O   1 
ATOM 2947 C CB  . THR A 1 380  ? 2.674   43.742 28.765  1.00 21.22  ? 377  THR A CB  1 
ATOM 2948 O OG1 . THR A 1 380  ? 2.306   45.072 29.186  1.00 21.22  ? 377  THR A OG1 1 
ATOM 2949 C CG2 . THR A 1 380  ? 3.098   43.736 27.297  1.00 21.22  ? 377  THR A CG2 1 
ATOM 2950 N N   . CYS A 1 381  ? 1.752   42.223 31.409  1.00 25.49  ? 378  CYS A N   1 
ATOM 2951 C CA  . CYS A 1 381  ? 1.721   42.560 32.831  1.00 25.49  ? 378  CYS A CA  1 
ATOM 2952 C C   . CYS A 1 381  ? 2.952   43.425 33.035  1.00 25.49  ? 378  CYS A C   1 
ATOM 2953 O O   . CYS A 1 381  ? 4.030   42.989 32.638  1.00 25.49  ? 378  CYS A O   1 
ATOM 2954 C CB  . CYS A 1 381  ? 1.768   41.305 33.716  1.00 35.39  ? 378  CYS A CB  1 
ATOM 2955 S SG  . CYS A 1 381  ? 0.605   39.953 33.209  1.00 35.39  ? 378  CYS A SG  1 
ATOM 2956 N N   . SER A 1 382  ? 2.808   44.615 33.630  1.00 34.70  ? 379  SER A N   1 
ATOM 2957 C CA  . SER A 1 382  ? 3.889   45.579 33.723  1.00 34.70  ? 379  SER A CA  1 
ATOM 2958 C C   . SER A 1 382  ? 3.999   46.226 35.067  1.00 34.70  ? 379  SER A C   1 
ATOM 2959 O O   . SER A 1 382  ? 3.007   46.307 35.839  1.00 34.70  ? 379  SER A O   1 
ATOM 2960 C CB  . SER A 1 382  ? 3.689   46.699 32.732  1.00 36.50  ? 379  SER A CB  1 
ATOM 2961 O OG  . SER A 1 382  ? 3.783   46.211 31.424  1.00 36.50  ? 379  SER A OG  1 
ATOM 2962 N N   . GLY A 1 383  ? 5.204   46.718 35.352  1.00 28.69  ? 380  GLY A N   1 
ATOM 2963 C CA  . GLY A 1 383  ? 5.420   47.447 36.567  1.00 28.69  ? 380  GLY A CA  1 
ATOM 2964 C C   . GLY A 1 383  ? 5.482   46.472 37.704  1.00 28.69  ? 380  GLY A C   1 
ATOM 2965 O O   . GLY A 1 383  ? 5.401   45.253 37.531  1.00 28.69  ? 380  GLY A O   1 
ATOM 2966 N N   . ALA A 1 384  ? 5.627   47.009 38.896  1.00 39.60  ? 381  ALA A N   1 
ATOM 2967 C CA  . ALA A 1 384  ? 5.741   46.211 40.081  1.00 39.60  ? 381  ALA A CA  1 
ATOM 2968 C C   . ALA A 1 384  ? 5.088   47.076 41.106  1.00 39.60  ? 381  ALA A C   1 
ATOM 2969 O O   . ALA A 1 384  ? 5.068   48.298 40.949  1.00 39.60  ? 381  ALA A O   1 
ATOM 2970 C CB  . ALA A 1 384  ? 7.165   46.068 40.392  1.00 40.79  ? 381  ALA A CB  1 
ATOM 2971 N N   . PHE A 1 385  ? 4.549   46.473 42.156  1.00 42.78  ? 382  PHE A N   1 
ATOM 2972 C CA  . PHE A 1 385  ? 3.905   47.266 43.226  1.00 42.78  ? 382  PHE A CA  1 
ATOM 2973 C C   . PHE A 1 385  ? 2.909   48.316 42.686  1.00 42.78  ? 382  PHE A C   1 
ATOM 2974 O O   . PHE A 1 385  ? 2.163   48.025 41.763  1.00 42.78  ? 382  PHE A O   1 
ATOM 2975 C CB  . PHE A 1 385  ? 4.959   47.881 44.128  1.00 21.06  ? 382  PHE A CB  1 
ATOM 2976 C CG  . PHE A 1 385  ? 6.172   46.989 44.315  1.00 21.06  ? 382  PHE A CG  1 
ATOM 2977 C CD1 . PHE A 1 385  ? 7.429   47.375 43.815  1.00 21.06  ? 382  PHE A CD1 1 
ATOM 2978 C CD2 . PHE A 1 385  ? 6.057   45.750 44.961  1.00 21.06  ? 382  PHE A CD2 1 
ATOM 2979 C CE1 . PHE A 1 385  ? 8.555   46.543 43.977  1.00 21.06  ? 382  PHE A CE1 1 
ATOM 2980 C CE2 . PHE A 1 385  ? 7.164   44.896 45.136  1.00 21.06  ? 382  PHE A CE2 1 
ATOM 2981 C CZ  . PHE A 1 385  ? 8.396   45.283 44.648  1.00 21.06  ? 382  PHE A CZ  1 
ATOM 2982 N N   . LYS A 1 386  ? 2.868   49.512 43.241  1.00 45.69  ? 383  LYS A N   1 
ATOM 2983 C CA  . LYS A 1 386  ? 1.756   50.388 42.871  1.00 45.69  ? 383  LYS A CA  1 
ATOM 2984 C C   . LYS A 1 386  ? 1.736   50.753 41.357  1.00 45.69  ? 383  LYS A C   1 
ATOM 2985 O O   . LYS A 1 386  ? 0.639   51.010 40.771  1.00 45.69  ? 383  LYS A O   1 
ATOM 2986 C CB  . LYS A 1 386  ? 1.698   51.620 43.785  1.00 27.09  ? 383  LYS A CB  1 
ATOM 2987 C CG  . LYS A 1 386  ? 2.728   52.709 43.478  1.00 27.09  ? 383  LYS A CG  1 
ATOM 2988 C CD  . LYS A 1 386  ? 3.332   53.288 44.757  1.00 27.09  ? 383  LYS A CD  1 
ATOM 2989 C CE  . LYS A 1 386  ? 3.647   54.792 44.652  1.00 27.09  ? 383  LYS A CE  1 
ATOM 2990 N NZ  . LYS A 1 386  ? 4.272   55.190 43.380  1.00 27.09  ? 383  LYS A NZ  1 
ATOM 2991 N N   . GLU A 1 387  ? 2.927   50.721 40.728  1.00 33.90  ? 384  GLU A N   1 
ATOM 2992 C CA  . GLU A 1 387  ? 3.077   51.026 39.325  1.00 33.90  ? 384  GLU A CA  1 
ATOM 2993 C C   . GLU A 1 387  ? 2.501   49.921 38.503  1.00 33.90  ? 384  GLU A C   1 
ATOM 2994 O O   . GLU A 1 387  ? 2.354   50.046 37.281  1.00 33.90  ? 384  GLU A O   1 
ATOM 2995 C CB  . GLU A 1 387  ? 4.531   51.152 38.970  1.00 37.65  ? 384  GLU A CB  1 
ATOM 2996 C CG  . GLU A 1 387  ? 5.295   52.066 39.838  1.00 37.65  ? 384  GLU A CG  1 
ATOM 2997 C CD  . GLU A 1 387  ? 4.643   53.420 39.963  1.00 37.65  ? 384  GLU A CD  1 
ATOM 2998 O OE1 . GLU A 1 387  ? 4.074   53.920 38.913  1.00 37.65  ? 384  GLU A OE1 1 
ATOM 2999 O OE2 . GLU A 1 387  ? 4.709   53.994 41.096  1.00 37.65  ? 384  GLU A OE2 1 
ATOM 3000 N N   . GLY A 1 388  ? 2.225   48.796 39.141  1.00 18.14  ? 385  GLY A N   1 
ATOM 3001 C CA  . GLY A 1 388  ? 1.755   47.607 38.399  1.00 18.14  ? 385  GLY A CA  1 
ATOM 3002 C C   . GLY A 1 388  ? 0.621   48.005 37.458  1.00 18.14  ? 385  GLY A C   1 
ATOM 3003 O O   . GLY A 1 388  ? -0.069  49.005 37.727  1.00 18.14  ? 385  GLY A O   1 
ATOM 3004 N N   . SER A 1 389  ? 0.455   47.253 36.365  1.00 31.13  ? 386  SER A N   1 
ATOM 3005 C CA  . SER A 1 389  ? -0.520  47.564 35.338  1.00 31.13  ? 386  SER A CA  1 
ATOM 3006 C C   . SER A 1 389  ? -0.598  46.513 34.229  1.00 31.13  ? 386  SER A C   1 
ATOM 3007 O O   . SER A 1 389  ? 0.216   45.604 34.183  1.00 31.13  ? 386  SER A O   1 
ATOM 3008 C CB  . SER A 1 389  ? -0.250  48.934 34.737  1.00 36.42  ? 386  SER A CB  1 
ATOM 3009 O OG  . SER A 1 389  ? 0.742   48.884 33.741  1.00 36.42  ? 386  SER A OG  1 
ATOM 3010 N N   . LEU A 1 390  ? -1.633  46.599 33.390  1.00 34.45  ? 387  LEU A N   1 
ATOM 3011 C CA  . LEU A 1 390  ? -1.663  45.905 32.122  1.00 34.45  ? 387  LEU A CA  1 
ATOM 3012 C C   . LEU A 1 390  ? -1.510  46.981 31.114  1.00 34.45  ? 387  LEU A C   1 
ATOM 3013 O O   . LEU A 1 390  ? -1.956  48.089 31.325  1.00 34.45  ? 387  LEU A O   1 
ATOM 3014 C CB  . LEU A 1 390  ? -2.982  45.226 31.818  1.00 20.81  ? 387  LEU A CB  1 
ATOM 3015 C CG  . LEU A 1 390  ? -3.523  44.077 32.668  1.00 20.81  ? 387  LEU A CG  1 
ATOM 3016 C CD1 . LEU A 1 390  ? -4.710  43.398 31.937  1.00 20.81  ? 387  LEU A CD1 1 
ATOM 3017 C CD2 . LEU A 1 390  ? -2.402  43.066 32.990  1.00 20.81  ? 387  LEU A CD2 1 
ATOM 3018 N N   . ARG A 1 391  ? -0.845  46.649 30.027  1.00 40.85  ? 388  ARG A N   1 
ATOM 3019 C CA  . ARG A 1 391  ? -0.680  47.560 28.944  1.00 40.85  ? 388  ARG A CA  1 
ATOM 3020 C C   . ARG A 1 391  ? -1.139  46.826 27.742  1.00 40.85  ? 388  ARG A C   1 
ATOM 3021 O O   . ARG A 1 391  ? -0.735  45.678 27.503  1.00 40.85  ? 388  ARG A O   1 
ATOM 3022 C CB  . ARG A 1 391  ? 0.776   47.955 28.774  1.00 32.35  ? 388  ARG A CB  1 
ATOM 3023 C CG  . ARG A 1 391  ? 1.368   48.633 30.000  1.00 32.35  ? 388  ARG A CG  1 
ATOM 3024 C CD  . ARG A 1 391  ? 1.087   50.114 30.116  1.00 32.35  ? 388  ARG A CD  1 
ATOM 3025 N NE  . ARG A 1 391  ? 1.580   50.495 31.430  1.00 32.35  ? 388  ARG A NE  1 
ATOM 3026 C CZ  . ARG A 1 391  ? 2.143   51.665 31.728  1.00 32.35  ? 388  ARG A CZ  1 
ATOM 3027 N NH1 . ARG A 1 391  ? 2.279   52.602 30.808  1.00 32.35  ? 388  ARG A NH1 1 
ATOM 3028 N NH2 . ARG A 1 391  ? 2.550   51.917 32.959  1.00 32.35  ? 388  ARG A NH2 1 
ATOM 3029 N N   . ILE A 1 392  ? -2.029  47.486 27.009  1.00 51.28  ? 389  ILE A N   1 
ATOM 3030 C CA  . ILE A 1 392  ? -2.564  46.922 25.786  1.00 51.28  ? 389  ILE A CA  1 
ATOM 3031 C C   . ILE A 1 392  ? -1.869  47.669 24.651  1.00 51.28  ? 389  ILE A C   1 
ATOM 3032 O O   . ILE A 1 392  ? -1.954  48.883 24.566  1.00 51.28  ? 389  ILE A O   1 
ATOM 3033 C CB  . ILE A 1 392  ? -4.149  46.946 25.716  1.00 37.44  ? 389  ILE A CB  1 
ATOM 3034 C CG1 . ILE A 1 392  ? -4.797  46.299 26.929  1.00 37.44  ? 389  ILE A CG1 1 
ATOM 3035 C CG2 . ILE A 1 392  ? -4.663  46.047 24.634  1.00 37.44  ? 389  ILE A CG2 1 
ATOM 3036 C CD1 . ILE A 1 392  ? -5.100  47.236 28.093  1.00 37.44  ? 389  ILE A CD1 1 
ATOM 3037 N N   . ILE A 1 393  ? -1.151  46.919 23.815  1.00 54.99  ? 390  ILE A N   1 
ATOM 3038 C CA  . ILE A 1 393  ? -0.328  47.472 22.749  1.00 54.99  ? 390  ILE A CA  1 
ATOM 3039 C C   . ILE A 1 393  ? -0.861  47.099 21.369  1.00 54.99  ? 390  ILE A C   1 
ATOM 3040 O O   . ILE A 1 393  ? -0.980  45.921 21.007  1.00 54.99  ? 390  ILE A O   1 
ATOM 3041 C CB  . ILE A 1 393  ? 1.104   46.935 22.808  1.00 42.78  ? 390  ILE A CB  1 
ATOM 3042 C CG1 . ILE A 1 393  ? 1.496   46.472 24.213  1.00 42.78  ? 390  ILE A CG1 1 
ATOM 3043 C CG2 . ILE A 1 393  ? 2.039   47.951 22.269  1.00 42.78  ? 390  ILE A CG2 1 
ATOM 3044 C CD1 . ILE A 1 393  ? 2.419   47.419 24.981  1.00 42.78  ? 390  ILE A CD1 1 
ATOM 3045 N N   . ARG A 1 394  ? -1.133  48.117 20.576  1.00 45.72  ? 391  ARG A N   1 
ATOM 3046 C CA  . ARG A 1 394  ? -1.793  47.924 19.291  1.00 45.72  ? 391  ARG A CA  1 
ATOM 3047 C C   . ARG A 1 394  ? -1.044  48.677 18.190  1.00 45.72  ? 391  ARG A C   1 
ATOM 3048 O O   . ARG A 1 394  ? -0.792  49.888 18.292  1.00 45.72  ? 391  ARG A O   1 
ATOM 3049 C CB  . ARG A 1 394  ? -3.238  48.442 19.413  1.00 80.48  ? 391  ARG A CB  1 
ATOM 3050 C CG  . ARG A 1 394  ? -4.172  48.136 18.247  1.00 80.48  ? 391  ARG A CG  1 
ATOM 3051 C CD  . ARG A 1 394  ? -4.433  49.338 17.314  1.00 80.48  ? 391  ARG A CD  1 
ATOM 3052 N NE  . ARG A 1 394  ? -4.736  50.613 17.973  1.00 80.48  ? 391  ARG A NE  1 
ATOM 3053 C CZ  . ARG A 1 394  ? -5.872  50.887 18.608  1.00 80.48  ? 391  ARG A CZ  1 
ATOM 3054 N NH1 . ARG A 1 394  ? -6.823  49.970 18.724  1.00 80.48  ? 391  ARG A NH1 1 
ATOM 3055 N NH2 . ARG A 1 394  ? -6.044  52.075 19.159  1.00 80.48  ? 391  ARG A NH2 1 
ATOM 3056 N N   . ASN A 1 395  ? -0.701  47.961 17.131  1.00 60.39  ? 392  ASN A N   1 
ATOM 3057 C CA  . ASN A 1 395  ? -0.065  48.601 15.986  1.00 60.39  ? 392  ASN A CA  1 
ATOM 3058 C C   . ASN A 1 395  ? -1.040  49.515 15.246  1.00 60.39  ? 392  ASN A C   1 
ATOM 3059 O O   . ASN A 1 395  ? -2.241  49.257 15.191  1.00 60.39  ? 392  ASN A O   1 
ATOM 3060 C CB  . ASN A 1 395  ? 0.499   47.548 15.034  1.00 149.69 ? 392  ASN A CB  1 
ATOM 3061 C CG  . ASN A 1 395  ? 1.580   48.100 14.133  1.00 149.69 ? 392  ASN A CG  1 
ATOM 3062 O OD1 . ASN A 1 395  ? 2.761   47.997 14.447  1.00 149.69 ? 392  ASN A OD1 1 
ATOM 3063 N ND2 . ASN A 1 395  ? 1.183   48.698 13.013  1.00 149.69 ? 392  ASN A ND2 1 
ATOM 3064 N N   . GLY A 1 396  ? -0.520  50.593 14.682  1.00 47.31  ? 393  GLY A N   1 
ATOM 3065 C CA  . GLY A 1 396  ? -1.301  51.372 13.745  1.00 47.31  ? 393  GLY A CA  1 
ATOM 3066 C C   . GLY A 1 396  ? -2.226  52.367 14.394  1.00 47.31  ? 393  GLY A C   1 
ATOM 3067 O O   . GLY A 1 396  ? -2.331  52.473 15.629  1.00 47.31  ? 393  GLY A O   1 
ATOM 3068 N N   . ILE A 1 397  ? -2.858  53.127 13.521  1.00 73.54  ? 394  ILE A N   1 
ATOM 3069 C CA  . ILE A 1 397  ? -3.772  54.165 13.892  1.00 73.54  ? 394  ILE A CA  1 
ATOM 3070 C C   . ILE A 1 397  ? -5.088  53.720 13.260  1.00 73.54  ? 394  ILE A C   1 
ATOM 3071 O O   . ILE A 1 397  ? -5.211  53.646 12.035  1.00 73.54  ? 394  ILE A O   1 
ATOM 3072 C CB  . ILE A 1 397  ? -3.310  55.549 13.295  1.00 42.83  ? 394  ILE A CB  1 
ATOM 3073 C CG1 . ILE A 1 397  ? -1.799  55.794 13.449  1.00 42.83  ? 394  ILE A CG1 1 
ATOM 3074 C CG2 . ILE A 1 397  ? -4.153  56.734 13.844  1.00 42.83  ? 394  ILE A CG2 1 
ATOM 3075 C CD1 . ILE A 1 397  ? -1.206  56.519 12.244  1.00 42.83  ? 394  ILE A CD1 1 
ATOM 3076 N N   . GLY A 1 398  ? -6.062  53.387 14.090  1.00 58.51  ? 395  GLY A N   1 
ATOM 3077 C CA  . GLY A 1 398  ? -7.356  52.929 13.582  1.00 58.51  ? 395  GLY A CA  1 
ATOM 3078 C C   . GLY A 1 398  ? -8.355  54.046 13.674  1.00 58.51  ? 395  GLY A C   1 
ATOM 3079 O O   . GLY A 1 398  ? -8.069  55.084 14.286  1.00 58.51  ? 395  GLY A O   1 
ATOM 3080 N N   . ILE A 1 399  ? -9.516  53.848 13.051  1.00 56.27  ? 396  ILE A N   1 
ATOM 3081 C CA  . ILE A 1 399  ? -10.596 54.858 13.055  1.00 56.27  ? 396  ILE A CA  1 
ATOM 3082 C C   . ILE A 1 399  ? -12.004 54.223 13.243  1.00 56.27  ? 396  ILE A C   1 
ATOM 3083 O O   . ILE A 1 399  ? -12.221 53.074 12.788  1.00 56.27  ? 396  ILE A O   1 
ATOM 3084 C CB  . ILE A 1 399  ? -10.524 55.867 11.801  1.00 73.49  ? 396  ILE A CB  1 
ATOM 3085 C CG1 . ILE A 1 399  ? -11.776 55.827 10.913  1.00 73.49  ? 396  ILE A CG1 1 
ATOM 3086 C CG2 . ILE A 1 399  ? -9.209  55.759 10.995  1.00 73.49  ? 396  ILE A CG2 1 
ATOM 3087 C CD1 . ILE A 1 399  ? -11.955 54.565 10.087  1.00 73.49  ? 396  ILE A CD1 1 
ATOM 3088 N N   . HIS A 1 400  ? -12.942 54.966 13.880  1.00 82.41  ? 397  HIS A N   1 
ATOM 3089 C CA  . HIS A 1 400  ? -14.326 54.470 14.204  1.00 82.41  ? 397  HIS A CA  1 
ATOM 3090 C C   . HIS A 1 400  ? -15.442 54.673 13.121  1.00 82.41  ? 397  HIS A C   1 
ATOM 3091 O O   . HIS A 1 400  ? -15.836 55.802 12.859  1.00 82.41  ? 397  HIS A O   1 
ATOM 3092 C CB  . HIS A 1 400  ? -14.806 55.039 15.552  1.00 133.34 ? 397  HIS A CB  1 
ATOM 3093 C CG  . HIS A 1 400  ? -13.715 55.251 16.562  1.00 133.34 ? 397  HIS A CG  1 
ATOM 3094 N ND1 . HIS A 1 400  ? -12.855 54.248 16.962  1.00 133.34 ? 397  HIS A ND1 1 
ATOM 3095 C CD2 . HIS A 1 400  ? -13.370 56.349 17.281  1.00 133.34 ? 397  HIS A CD2 1 
ATOM 3096 C CE1 . HIS A 1 400  ? -12.018 54.723 17.868  1.00 133.34 ? 397  HIS A CE1 1 
ATOM 3097 N NE2 . HIS A 1 400  ? -12.311 55.995 18.083  1.00 133.34 ? 397  HIS A NE2 1 
ATOM 3098 N N   . GLU A 1 401  ? -15.975 53.577 12.551  1.00 94.51  ? 398  GLU A N   1 
ATOM 3099 C CA  . GLU A 1 401  ? -16.847 53.617 11.327  1.00 94.51  ? 398  GLU A CA  1 
ATOM 3100 C C   . GLU A 1 401  ? -18.378 53.872 11.478  1.00 94.51  ? 398  GLU A C   1 
ATOM 3101 O O   . GLU A 1 401  ? -19.169 52.935 11.667  1.00 94.51  ? 398  GLU A O   1 
ATOM 3102 C CB  . GLU A 1 401  ? -16.590 52.403 10.408  1.00 109.47 ? 398  GLU A CB  1 
ATOM 3103 C CG  . GLU A 1 401  ? -17.070 51.046 10.932  1.00 109.47 ? 398  GLU A CG  1 
ATOM 3104 C CD  . GLU A 1 401  ? -17.298 50.020 9.813   1.00 109.47 ? 398  GLU A CD  1 
ATOM 3105 O OE1 . GLU A 1 401  ? -17.655 50.426 8.683   1.00 109.47 ? 398  GLU A OE1 1 
ATOM 3106 O OE2 . GLU A 1 401  ? -17.130 48.802 10.062  1.00 109.47 ? 398  GLU A OE2 1 
ATOM 3107 N N   . HIS A 1 402  ? -18.787 55.132 11.313  1.00 196.51 ? 399  HIS A N   1 
ATOM 3108 C CA  . HIS A 1 402  ? -20.157 55.566 11.636  1.00 196.51 ? 399  HIS A CA  1 
ATOM 3109 C C   . HIS A 1 402  ? -21.269 55.143 10.650  1.00 196.51 ? 399  HIS A C   1 
ATOM 3110 O O   . HIS A 1 402  ? -22.195 54.447 11.060  1.00 196.51 ? 399  HIS A O   1 
ATOM 3111 C CB  . HIS A 1 402  ? -20.191 57.071 11.940  1.00 95.85  ? 399  HIS A CB  1 
ATOM 3112 C CG  . HIS A 1 402  ? -19.407 57.467 13.160  1.00 95.85  ? 399  HIS A CG  1 
ATOM 3113 N ND1 . HIS A 1 402  ? -19.664 58.623 13.869  1.00 95.85  ? 399  HIS A ND1 1 
ATOM 3114 C CD2 . HIS A 1 402  ? -18.381 56.857 13.803  1.00 95.85  ? 399  HIS A CD2 1 
ATOM 3115 C CE1 . HIS A 1 402  ? -18.821 58.717 14.883  1.00 95.85  ? 399  HIS A CE1 1 
ATOM 3116 N NE2 . HIS A 1 402  ? -18.034 57.657 14.865  1.00 95.85  ? 399  HIS A NE2 1 
ATOM 3117 N N   . ALA A 1 403  ? -21.201 55.549 9.379   1.00 77.77  ? 400  ALA A N   1 
ATOM 3118 C CA  . ALA A 1 403  ? -22.160 55.042 8.368   1.00 77.77  ? 400  ALA A CA  1 
ATOM 3119 C C   . ALA A 1 403  ? -21.491 54.100 7.361   1.00 77.77  ? 400  ALA A C   1 
ATOM 3120 O O   . ALA A 1 403  ? -20.315 53.776 7.500   1.00 77.77  ? 400  ALA A O   1 
ATOM 3121 C CB  . ALA A 1 403  ? -22.908 56.189 7.649   1.00 40.23  ? 400  ALA A CB  1 
ATOM 3122 N N   . SER A 1 404  ? -22.244 53.647 6.365   1.00 107.96 ? 401  SER A N   1 
ATOM 3123 C CA  . SER A 1 404  ? -21.706 52.719 5.373   1.00 107.96 ? 401  SER A CA  1 
ATOM 3124 C C   . SER A 1 404  ? -22.557 52.694 4.107   1.00 107.96 ? 401  SER A C   1 
ATOM 3125 O O   . SER A 1 404  ? -23.547 51.971 4.012   1.00 107.96 ? 401  SER A O   1 
ATOM 3126 C CB  . SER A 1 404  ? -21.570 51.315 5.969   1.00 71.07  ? 401  SER A CB  1 
ATOM 3127 O OG  . SER A 1 404  ? -20.389 50.674 5.505   1.00 71.07  ? 401  SER A OG  1 
ATOM 3128 N N   . ILE A 1 405  ? -22.152 53.499 3.136   1.00 201.12 ? 402  ILE A N   1 
ATOM 3129 C CA  . ILE A 1 405  ? -22.921 53.680 1.923   1.00 201.12 ? 402  ILE A CA  1 
ATOM 3130 C C   . ILE A 1 405  ? -22.099 53.179 0.738   1.00 201.12 ? 402  ILE A C   1 
ATOM 3131 O O   . ILE A 1 405  ? -21.169 53.855 0.291   1.00 201.12 ? 402  ILE A O   1 
ATOM 3132 C CB  . ILE A 1 405  ? -23.306 55.169 1.738   1.00 73.05  ? 402  ILE A CB  1 
ATOM 3133 C CG1 . ILE A 1 405  ? -24.103 55.706 2.942   1.00 73.05  ? 402  ILE A CG1 1 
ATOM 3134 C CG2 . ILE A 1 405  ? -24.082 55.387 0.452   1.00 73.05  ? 402  ILE A CG2 1 
ATOM 3135 C CD1 . ILE A 1 405  ? -23.260 56.543 3.954   1.00 73.05  ? 402  ILE A CD1 1 
ATOM 3136 N N   . ASP A 1 406  ? -22.449 51.990 0.243   1.00 150.70 ? 403  ASP A N   1 
ATOM 3137 C CA  . ASP A 1 406  ? -21.701 51.312 -0.826  1.00 150.70 ? 403  ASP A CA  1 
ATOM 3138 C C   . ASP A 1 406  ? -21.836 52.033 -2.159  1.00 150.70 ? 403  ASP A C   1 
ATOM 3139 O O   . ASP A 1 406  ? -22.886 51.976 -2.799  1.00 150.70 ? 403  ASP A O   1 
ATOM 3140 C CB  . ASP A 1 406  ? -22.171 49.865 -1.014  1.00 139.15 ? 403  ASP A CB  1 
ATOM 3141 C CG  . ASP A 1 406  ? -21.764 48.957 0.125   1.00 139.15 ? 403  ASP A CG  1 
ATOM 3142 O OD1 . ASP A 1 406  ? -20.886 49.368 0.913   1.00 139.15 ? 403  ASP A OD1 1 
ATOM 3143 O OD2 . ASP A 1 406  ? -22.306 47.836 0.235   1.00 139.15 ? 403  ASP A OD2 1 
ATOM 3144 N N   . LEU A 1 407  ? -20.763 52.700 -2.578  1.00 196.40 ? 404  LEU A N   1 
ATOM 3145 C CA  . LEU A 1 407  ? -20.760 53.452 -3.832  1.00 196.40 ? 404  LEU A CA  1 
ATOM 3146 C C   . LEU A 1 407  ? -19.560 53.084 -4.708  1.00 196.40 ? 404  LEU A C   1 
ATOM 3147 O O   . LEU A 1 407  ? -18.505 53.717 -4.609  1.00 196.40 ? 404  LEU A O   1 
ATOM 3148 C CB  . LEU A 1 407  ? -20.812 54.961 -3.552  1.00 68.14  ? 404  LEU A CB  1 
ATOM 3149 C CG  . LEU A 1 407  ? -21.942 55.395 -2.622  1.00 68.14  ? 404  LEU A CG  1 
ATOM 3150 C CD1 . LEU A 1 407  ? -21.809 56.845 -2.138  1.00 68.14  ? 404  LEU A CD1 1 
ATOM 3151 C CD2 . LEU A 1 407  ? -23.241 55.177 -3.346  1.00 68.14  ? 404  LEU A CD2 1 
ATOM 3152 N N   . PRO A 1 408  ? -19.716 52.045 -5.560  1.00 177.03 ? 405  PRO A N   1 
ATOM 3153 C CA  . PRO A 1 408  ? -18.661 51.598 -6.478  1.00 177.03 ? 405  PRO A CA  1 
ATOM 3154 C C   . PRO A 1 408  ? -18.303 52.651 -7.533  1.00 177.03 ? 405  PRO A C   1 
ATOM 3155 O O   . PRO A 1 408  ? -18.664 52.521 -8.705  1.00 177.03 ? 405  PRO A O   1 
ATOM 3156 C CB  . PRO A 1 408  ? -19.261 50.338 -7.126  1.00 155.61 ? 405  PRO A CB  1 
ATOM 3157 C CG  . PRO A 1 408  ? -20.378 49.920 -6.211  1.00 155.61 ? 405  PRO A CG  1 
ATOM 3158 C CD  . PRO A 1 408  ? -20.922 51.203 -5.680  1.00 155.61 ? 405  PRO A CD  1 
ATOM 3159 N N   . GLY A 1 409  ? -17.593 53.687 -7.093  1.00 132.37 ? 406  GLY A N   1 
ATOM 3160 C CA  . GLY A 1 409  ? -17.134 54.753 -7.969  1.00 132.37 ? 406  GLY A CA  1 
ATOM 3161 C C   . GLY A 1 409  ? -16.348 55.842 -7.263  1.00 132.37 ? 406  GLY A C   1 
ATOM 3162 O O   . GLY A 1 409  ? -15.136 55.947 -7.447  1.00 132.37 ? 406  GLY A O   1 
ATOM 3163 N N   . ILE A 1 410  ? -17.047 56.634 -6.448  1.00 126.71 ? 407  ILE A N   1 
ATOM 3164 C CA  . ILE A 1 410  ? -16.528 57.861 -5.819  1.00 126.71 ? 407  ILE A CA  1 
ATOM 3165 C C   . ILE A 1 410  ? -15.092 58.225 -6.153  1.00 126.71 ? 407  ILE A C   1 
ATOM 3166 O O   . ILE A 1 410  ? -14.152 57.620 -5.638  1.00 126.71 ? 407  ILE A O   1 
ATOM 3167 C CB  . ILE A 1 410  ? -16.637 57.828 -4.296  1.00 70.44  ? 407  ILE A CB  1 
ATOM 3168 C CG1 . ILE A 1 410  ? -17.939 57.134 -3.854  1.00 70.44  ? 407  ILE A CG1 1 
ATOM 3169 C CG2 . ILE A 1 410  ? -16.472 59.259 -3.743  1.00 70.44  ? 407  ILE A CG2 1 
ATOM 3170 C CD1 . ILE A 1 410  ? -18.110 56.973 -2.335  1.00 70.44  ? 407  ILE A CD1 1 
ATOM 3171 N N   . LYS A 1 411  ? -14.934 59.239 -6.993  1.00 96.78  ? 408  LYS A N   1 
ATOM 3172 C CA  . LYS A 1 411  ? -13.625 59.613 -7.493  1.00 96.78  ? 408  LYS A CA  1 
ATOM 3173 C C   . LYS A 1 411  ? -13.153 60.917 -6.895  1.00 96.78  ? 408  LYS A C   1 
ATOM 3174 O O   . LYS A 1 411  ? -12.245 61.564 -7.415  1.00 96.78  ? 408  LYS A O   1 
ATOM 3175 C CB  . LYS A 1 411  ? -13.636 59.710 -9.008  1.00 61.19  ? 408  LYS A CB  1 
ATOM 3176 C CG  . LYS A 1 411  ? -13.978 58.400 -9.750  1.00 61.19  ? 408  LYS A CG  1 
ATOM 3177 C CD  . LYS A 1 411  ? -12.811 57.368 -9.899  1.00 61.19  ? 408  LYS A CD  1 
ATOM 3178 C CE  . LYS A 1 411  ? -13.260 56.258 -10.908 1.00 61.19  ? 408  LYS A CE  1 
ATOM 3179 N NZ  . LYS A 1 411  ? -12.711 54.857 -10.836 1.00 61.19  ? 408  LYS A NZ  1 
ATOM 3180 N N   . GLY A 1 412  ? -13.769 61.293 -5.784  1.00 64.19  ? 409  GLY A N   1 
ATOM 3181 C CA  . GLY A 1 412  ? -13.351 62.466 -5.016  1.00 64.19  ? 409  GLY A CA  1 
ATOM 3182 C C   . GLY A 1 412  ? -14.385 62.660 -3.924  1.00 64.19  ? 409  GLY A C   1 
ATOM 3183 O O   . GLY A 1 412  ? -15.438 61.979 -3.925  1.00 64.19  ? 409  GLY A O   1 
ATOM 3184 N N   . LEU A 1 413  ? -14.052 63.524 -2.959  1.00 65.76  ? 410  LEU A N   1 
ATOM 3185 C CA  . LEU A 1 413  ? -15.053 64.162 -2.110  1.00 65.76  ? 410  LEU A CA  1 
ATOM 3186 C C   . LEU A 1 413  ? -14.488 65.360 -1.383  1.00 65.76  ? 410  LEU A C   1 
ATOM 3187 O O   . LEU A 1 413  ? -13.308 65.380 -1.029  1.00 65.76  ? 410  LEU A O   1 
ATOM 3188 C CB  . LEU A 1 413  ? -15.789 63.192 -1.170  1.00 108.36 ? 410  LEU A CB  1 
ATOM 3189 C CG  . LEU A 1 413  ? -15.140 62.066 -0.376  1.00 108.36 ? 410  LEU A CG  1 
ATOM 3190 C CD1 . LEU A 1 413  ? -14.913 62.510 1.035   1.00 108.36 ? 410  LEU A CD1 1 
ATOM 3191 C CD2 . LEU A 1 413  ? -16.046 60.838 -0.393  1.00 108.36 ? 410  LEU A CD2 1 
ATOM 3192 N N   . TRP A 1 414  ? -15.320 66.393 -1.246  1.00 113.90 ? 411  TRP A N   1 
ATOM 3193 C CA  . TRP A 1 414  ? -14.988 67.577 -0.448  1.00 113.90 ? 411  TRP A CA  1 
ATOM 3194 C C   . TRP A 1 414  ? -16.181 67.937 0.425   1.00 113.90 ? 411  TRP A C   1 
ATOM 3195 O O   . TRP A 1 414  ? -17.325 67.551 0.114   1.00 113.90 ? 411  TRP A O   1 
ATOM 3196 C CB  . TRP A 1 414  ? -14.616 68.810 -1.300  1.00 68.43  ? 411  TRP A CB  1 
ATOM 3197 C CG  . TRP A 1 414  ? -13.576 68.596 -2.341  1.00 68.43  ? 411  TRP A CG  1 
ATOM 3198 C CD1 . TRP A 1 414  ? -12.310 69.130 -2.367  1.00 68.43  ? 411  TRP A CD1 1 
ATOM 3199 C CD2 . TRP A 1 414  ? -13.717 67.824 -3.533  1.00 68.43  ? 411  TRP A CD2 1 
ATOM 3200 N NE1 . TRP A 1 414  ? -11.654 68.713 -3.502  1.00 68.43  ? 411  TRP A NE1 1 
ATOM 3201 C CE2 . TRP A 1 414  ? -12.490 67.904 -4.228  1.00 68.43  ? 411  TRP A CE2 1 
ATOM 3202 C CE3 . TRP A 1 414  ? -14.754 67.063 -4.073  1.00 68.43  ? 411  TRP A CE3 1 
ATOM 3203 C CZ2 . TRP A 1 414  ? -12.273 67.247 -5.445  1.00 68.43  ? 411  TRP A CZ2 1 
ATOM 3204 C CZ3 . TRP A 1 414  ? -14.540 66.396 -5.277  1.00 68.43  ? 411  TRP A CZ3 1 
ATOM 3205 C CH2 . TRP A 1 414  ? -13.307 66.500 -5.956  1.00 68.43  ? 411  TRP A CH2 1 
ATOM 3206 N N   . PRO A 1 415  ? -15.936 68.645 1.526   1.00 106.45 ? 412  PRO A N   1 
ATOM 3207 C CA  . PRO A 1 415  ? -17.000 69.023 2.467   1.00 106.45 ? 412  PRO A CA  1 
ATOM 3208 C C   . PRO A 1 415  ? -17.957 70.076 1.911   1.00 106.45 ? 412  PRO A C   1 
ATOM 3209 O O   . PRO A 1 415  ? -17.781 70.497 0.768   1.00 106.45 ? 412  PRO A O   1 
ATOM 3210 C CB  . PRO A 1 415  ? -16.199 69.606 3.633   1.00 98.92  ? 412  PRO A CB  1 
ATOM 3211 C CG  . PRO A 1 415  ? -15.003 68.715 3.654   1.00 98.92  ? 412  PRO A CG  1 
ATOM 3212 C CD  . PRO A 1 415  ? -14.621 68.724 2.186   1.00 98.92  ? 412  PRO A CD  1 
ATOM 3213 N N   . LEU A 1 416  ? -18.952 70.496 2.694   1.00 163.60 ? 413  LEU A N   1 
ATOM 3214 C CA  . LEU A 1 416  ? -19.890 71.503 2.195   1.00 163.60 ? 413  LEU A CA  1 
ATOM 3215 C C   . LEU A 1 416  ? -21.037 71.984 3.102   1.00 163.60 ? 413  LEU A C   1 
ATOM 3216 O O   . LEU A 1 416  ? -22.140 71.438 3.067   1.00 163.60 ? 413  LEU A O   1 
ATOM 3217 C CB  . LEU A 1 416  ? -20.468 71.050 0.849   1.00 156.49 ? 413  LEU A CB  1 
ATOM 3218 C CG  . LEU A 1 416  ? -21.477 71.995 0.193   1.00 156.49 ? 413  LEU A CG  1 
ATOM 3219 C CD1 . LEU A 1 416  ? -20.869 73.375 -0.009  1.00 156.49 ? 413  LEU A CD1 1 
ATOM 3220 C CD2 . LEU A 1 416  ? -21.968 71.423 -1.128  1.00 156.49 ? 413  LEU A CD2 1 
ATOM 3221 N N   . ARG A 1 417  ? -20.769 73.025 3.888   1.00 146.24 ? 414  ARG A N   1 
ATOM 3222 C CA  . ARG A 1 417  ? -21.778 73.701 4.706   1.00 146.24 ? 414  ARG A CA  1 
ATOM 3223 C C   . ARG A 1 417  ? -22.809 74.337 3.767   1.00 146.24 ? 414  ARG A C   1 
ATOM 3224 O O   . ARG A 1 417  ? -22.471 75.211 2.971   1.00 146.24 ? 414  ARG A O   1 
ATOM 3225 C CB  . ARG A 1 417  ? -21.141 74.753 5.655   1.00 69.54  ? 414  ARG A CB  1 
ATOM 3226 C CG  . ARG A 1 417  ? -20.008 75.596 5.026   1.00 69.54  ? 414  ARG A CG  1 
ATOM 3227 C CD  . ARG A 1 417  ? -19.723 76.967 5.692   1.00 69.54  ? 414  ARG A CD  1 
ATOM 3228 N NE  . ARG A 1 417  ? -18.569 77.001 6.609   1.00 69.54  ? 414  ARG A NE  1 
ATOM 3229 C CZ  . ARG A 1 417  ? -17.446 76.267 6.529   1.00 69.54  ? 414  ARG A CZ  1 
ATOM 3230 N NH1 . ARG A 1 417  ? -17.239 75.410 5.530   1.00 69.54  ? 414  ARG A NH1 1 
ATOM 3231 N NH2 . ARG A 1 417  ? -16.500 76.410 7.458   1.00 69.54  ? 414  ARG A NH2 1 
ATOM 3232 N N   . SER A 1 418  ? -24.056 73.877 3.830   1.00 126.43 ? 415  SER A N   1 
ATOM 3233 C CA  . SER A 1 418  ? -25.129 74.515 3.060   1.00 126.43 ? 415  SER A CA  1 
ATOM 3234 C C   . SER A 1 418  ? -25.690 75.744 3.792   1.00 126.43 ? 415  SER A C   1 
ATOM 3235 O O   . SER A 1 418  ? -26.621 76.396 3.310   1.00 126.43 ? 415  SER A O   1 
ATOM 3236 C CB  . SER A 1 418  ? -26.242 73.526 2.703   1.00 109.89 ? 415  SER A CB  1 
ATOM 3237 O OG  . SER A 1 418  ? -27.111 74.071 1.721   1.00 109.89 ? 415  SER A OG  1 
ATOM 3238 N N   . ASP A 1 419  ? -25.109 76.054 4.951   1.00 210.01 ? 416  ASP A N   1 
ATOM 3239 C CA  . ASP A 1 419  ? -25.403 77.296 5.657   1.00 210.01 ? 416  ASP A CA  1 
ATOM 3240 C C   . ASP A 1 419  ? -24.110 78.057 5.989   1.00 210.01 ? 416  ASP A C   1 
ATOM 3241 O O   . ASP A 1 419  ? -23.209 77.504 6.632   1.00 210.01 ? 416  ASP A O   1 
ATOM 3242 C CB  . ASP A 1 419  ? -26.230 77.032 6.915   1.00 178.35 ? 416  ASP A CB  1 
ATOM 3243 C CG  . ASP A 1 419  ? -27.136 78.201 7.275   1.00 178.35 ? 416  ASP A CG  1 
ATOM 3244 O OD1 . ASP A 1 419  ? -27.185 78.570 8.474   1.00 178.35 ? 416  ASP A OD1 1 
ATOM 3245 O OD2 . ASP A 1 419  ? -27.800 78.753 6.362   1.00 178.35 ? 416  ASP A OD2 1 
ATOM 3246 N N   . PRO A 1 420  ? -24.021 79.329 5.539   1.00 166.07 ? 417  PRO A N   1 
ATOM 3247 C CA  . PRO A 1 420  ? -22.845 80.223 5.628   1.00 166.07 ? 417  PRO A CA  1 
ATOM 3248 C C   . PRO A 1 420  ? -22.183 80.397 7.008   1.00 166.07 ? 417  PRO A C   1 
ATOM 3249 O O   . PRO A 1 420  ? -21.066 80.922 7.086   1.00 166.07 ? 417  PRO A O   1 
ATOM 3250 C CB  . PRO A 1 420  ? -23.400 81.572 5.149   1.00 136.36 ? 417  PRO A CB  1 
ATOM 3251 C CG  . PRO A 1 420  ? -24.536 81.212 4.250   1.00 136.36 ? 417  PRO A CG  1 
ATOM 3252 C CD  . PRO A 1 420  ? -25.156 79.985 4.846   1.00 136.36 ? 417  PRO A CD  1 
ATOM 3253 N N   . ASN A 1 421  ? -22.858 79.971 8.075   1.00 209.77 ? 418  ASN A N   1 
ATOM 3254 C CA  . ASN A 1 421  ? -22.362 80.197 9.439   1.00 209.77 ? 418  ASN A CA  1 
ATOM 3255 C C   . ASN A 1 421  ? -21.696 79.003 10.133  1.00 209.77 ? 418  ASN A C   1 
ATOM 3256 O O   . ASN A 1 421  ? -20.479 79.014 10.339  1.00 209.77 ? 418  ASN A O   1 
ATOM 3257 C CB  . ASN A 1 421  ? -23.432 80.858 10.340  1.00 125.35 ? 418  ASN A CB  1 
ATOM 3258 C CG  . ASN A 1 421  ? -24.861 80.419 10.005  1.00 125.35 ? 418  ASN A CG  1 
ATOM 3259 O OD1 . ASN A 1 421  ? -25.696 81.245 9.651   1.00 125.35 ? 418  ASN A OD1 1 
ATOM 3260 N ND2 . ASN A 1 421  ? -25.143 79.124 10.127  1.00 125.35 ? 418  ASN A ND2 1 
ATOM 3261 N N   . ARG A 1 422  ? -22.491 77.983 10.475  1.00 210.35 ? 419  ARG A N   1 
ATOM 3262 C CA  . ARG A 1 422  ? -22.030 76.822 11.259  1.00 210.35 ? 419  ARG A CA  1 
ATOM 3263 C C   . ARG A 1 422  ? -20.786 76.147 10.678  1.00 210.35 ? 419  ARG A C   1 
ATOM 3264 O O   . ARG A 1 422  ? -20.636 76.069 9.455   1.00 210.35 ? 419  ARG A O   1 
ATOM 3265 C CB  . ARG A 1 422  ? -23.158 75.788 11.486  1.00 136.27 ? 419  ARG A CB  1 
ATOM 3266 C CG  . ARG A 1 422  ? -24.251 75.731 10.410  1.00 136.27 ? 419  ARG A CG  1 
ATOM 3267 C CD  . ARG A 1 422  ? -25.064 74.401 10.400  1.00 136.27 ? 419  ARG A CD  1 
ATOM 3268 N NE  . ARG A 1 422  ? -25.836 74.111 11.624  1.00 136.27 ? 419  ARG A NE  1 
ATOM 3269 C CZ  . ARG A 1 422  ? -26.798 73.180 11.734  1.00 136.27 ? 419  ARG A CZ  1 
ATOM 3270 N NH1 . ARG A 1 422  ? -27.141 72.422 10.701  1.00 136.27 ? 419  ARG A NH1 1 
ATOM 3271 N NH2 . ARG A 1 422  ? -27.434 72.998 12.887  1.00 136.27 ? 419  ARG A NH2 1 
ATOM 3272 N N   . GLU A 1 423  ? -19.899 75.675 11.563  1.00 128.82 ? 420  GLU A N   1 
ATOM 3273 C CA  . GLU A 1 423  ? -18.704 74.921 11.158  1.00 128.82 ? 420  GLU A CA  1 
ATOM 3274 C C   . GLU A 1 423  ? -19.125 73.623 10.500  1.00 128.82 ? 420  GLU A C   1 
ATOM 3275 O O   . GLU A 1 423  ? -18.336 72.993 9.793   1.00 128.82 ? 420  GLU A O   1 
ATOM 3276 C CB  . GLU A 1 423  ? -17.785 74.607 12.350  1.00 127.17 ? 420  GLU A CB  1 
ATOM 3277 C CG  . GLU A 1 423  ? -17.229 75.821 13.106  1.00 127.17 ? 420  GLU A CG  1 
ATOM 3278 C CD  . GLU A 1 423  ? -16.571 76.870 12.204  1.00 127.17 ? 420  GLU A CD  1 
ATOM 3279 O OE1 . GLU A 1 423  ? -16.234 76.558 11.040  1.00 127.17 ? 420  GLU A OE1 1 
ATOM 3280 O OE2 . GLU A 1 423  ? -16.391 78.018 12.670  1.00 127.17 ? 420  GLU A OE2 1 
ATOM 3281 N N   . THR A 1 424  ? -20.384 73.249 10.743  1.00 149.60 ? 421  THR A N   1 
ATOM 3282 C CA  . THR A 1 424  ? -20.975 72.016 10.224  1.00 149.60 ? 421  THR A CA  1 
ATOM 3283 C C   . THR A 1 424  ? -21.406 72.111 8.752   1.00 149.60 ? 421  THR A C   1 
ATOM 3284 O O   . THR A 1 424  ? -22.037 73.080 8.317   1.00 149.60 ? 421  THR A O   1 
ATOM 3285 C CB  . THR A 1 424  ? -22.151 71.466 11.118  1.00 131.08 ? 421  THR A CB  1 
ATOM 3286 O OG1 . THR A 1 424  ? -23.285 72.336 11.054  1.00 131.08 ? 421  THR A OG1 1 
ATOM 3287 C CG2 . THR A 1 424  ? -21.721 71.293 12.581  1.00 131.08 ? 421  THR A CG2 1 
ATOM 3288 N N   . TYR A 1 425  ? -21.023 71.077 8.010   1.00 117.49 ? 422  TYR A N   1 
ATOM 3289 C CA  . TYR A 1 425  ? -21.357 70.886 6.609   1.00 117.49 ? 422  TYR A CA  1 
ATOM 3290 C C   . TYR A 1 425  ? -22.432 69.793 6.592   1.00 117.49 ? 422  TYR A C   1 
ATOM 3291 O O   . TYR A 1 425  ? -22.317 68.814 7.336   1.00 117.49 ? 422  TYR A O   1 
ATOM 3292 C CB  . TYR A 1 425  ? -20.112 70.400 5.839   1.00 149.28 ? 422  TYR A CB  1 
ATOM 3293 C CG  . TYR A 1 425  ? -18.787 71.055 6.230   1.00 149.28 ? 422  TYR A CG  1 
ATOM 3294 C CD1 . TYR A 1 425  ? -18.074 70.623 7.353   1.00 149.28 ? 422  TYR A CD1 1 
ATOM 3295 C CD2 . TYR A 1 425  ? -18.236 72.088 5.471   1.00 149.28 ? 422  TYR A CD2 1 
ATOM 3296 C CE1 . TYR A 1 425  ? -16.857 71.214 7.720   1.00 149.28 ? 422  TYR A CE1 1 
ATOM 3297 C CE2 . TYR A 1 425  ? -17.014 72.678 5.825   1.00 149.28 ? 422  TYR A CE2 1 
ATOM 3298 C CZ  . TYR A 1 425  ? -16.337 72.238 6.954   1.00 149.28 ? 422  TYR A CZ  1 
ATOM 3299 O OH  . TYR A 1 425  ? -15.137 72.809 7.318   1.00 149.28 ? 422  TYR A OH  1 
ATOM 3300 N N   . ASP A 1 426  ? -23.484 69.956 5.787   1.00 134.41 ? 423  ASP A N   1 
ATOM 3301 C CA  . ASP A 1 426  ? -24.521 68.914 5.702   1.00 134.41 ? 423  ASP A CA  1 
ATOM 3302 C C   . ASP A 1 426  ? -24.558 68.260 4.332   1.00 134.41 ? 423  ASP A C   1 
ATOM 3303 O O   . ASP A 1 426  ? -25.546 67.616 3.967   1.00 134.41 ? 423  ASP A O   1 
ATOM 3304 C CB  . ASP A 1 426  ? -25.912 69.449 6.081   1.00 118.21 ? 423  ASP A CB  1 
ATOM 3305 C CG  . ASP A 1 426  ? -26.505 70.363 5.015   1.00 118.21 ? 423  ASP A CG  1 
ATOM 3306 O OD1 . ASP A 1 426  ? -27.748 70.333 4.818   1.00 118.21 ? 423  ASP A OD1 1 
ATOM 3307 O OD2 . ASP A 1 426  ? -25.721 71.109 4.376   1.00 118.21 ? 423  ASP A OD2 1 
ATOM 3308 N N   . THR A 1 427  ? -23.475 68.426 3.581   1.00 95.44  ? 424  THR A N   1 
ATOM 3309 C CA  . THR A 1 427  ? -23.385 67.871 2.243   1.00 95.44  ? 424  THR A CA  1 
ATOM 3310 C C   . THR A 1 427  ? -21.990 67.341 1.933   1.00 95.44  ? 424  THR A C   1 
ATOM 3311 O O   . THR A 1 427  ? -20.975 67.844 2.438   1.00 95.44  ? 424  THR A O   1 
ATOM 3312 C CB  . THR A 1 427  ? -23.738 68.931 1.177   1.00 136.29 ? 424  THR A CB  1 
ATOM 3313 O OG1 . THR A 1 427  ? -24.681 69.865 1.712   1.00 136.29 ? 424  THR A OG1 1 
ATOM 3314 C CG2 . THR A 1 427  ? -24.321 68.285 -0.060  1.00 136.29 ? 424  THR A CG2 1 
ATOM 3315 N N   . LEU A 1 428  ? -21.938 66.330 1.079   1.00 170.98 ? 425  LEU A N   1 
ATOM 3316 C CA  . LEU A 1 428  ? -20.671 65.890 0.542   1.00 170.98 ? 425  LEU A CA  1 
ATOM 3317 C C   . LEU A 1 428  ? -20.801 65.628 -0.951  1.00 170.98 ? 425  LEU A C   1 
ATOM 3318 O O   . LEU A 1 428  ? -21.160 64.523 -1.372  1.00 170.98 ? 425  LEU A O   1 
ATOM 3319 C CB  . LEU A 1 428  ? -20.188 64.649 1.280   1.00 167.19 ? 425  LEU A CB  1 
ATOM 3320 C CG  . LEU A 1 428  ? -18.728 64.286 1.039   1.00 167.19 ? 425  LEU A CG  1 
ATOM 3321 C CD1 . LEU A 1 428  ? -17.828 65.121 1.925   1.00 167.19 ? 425  LEU A CD1 1 
ATOM 3322 C CD2 . LEU A 1 428  ? -18.538 62.817 1.319   1.00 167.19 ? 425  LEU A CD2 1 
ATOM 3323 N N   . VAL A 1 429  ? -20.522 66.655 -1.750  1.00 178.31 ? 426  VAL A N   1 
ATOM 3324 C CA  . VAL A 1 429  ? -20.581 66.512 -3.197  1.00 178.31 ? 426  VAL A CA  1 
ATOM 3325 C C   . VAL A 1 429  ? -19.367 65.703 -3.639  1.00 178.31 ? 426  VAL A C   1 
ATOM 3326 O O   . VAL A 1 429  ? -18.212 66.107 -3.468  1.00 178.31 ? 426  VAL A O   1 
ATOM 3327 C CB  . VAL A 1 429  ? -20.695 67.860 -3.932  1.00 184.09 ? 426  VAL A CB  1 
ATOM 3328 C CG1 . VAL A 1 429  ? -21.131 67.641 -5.364  1.00 184.09 ? 426  VAL A CG1 1 
ATOM 3329 C CG2 . VAL A 1 429  ? -21.695 68.754 -3.237  1.00 184.09 ? 426  VAL A CG2 1 
ATOM 3330 N N   . LEU A 1 430  ? -19.666 64.534 -4.182  1.00 104.65 ? 427  LEU A N   1 
ATOM 3331 C CA  . LEU A 1 430  ? -18.672 63.519 -4.445  1.00 104.65 ? 427  LEU A CA  1 
ATOM 3332 C C   . LEU A 1 430  ? -18.407 63.364 -5.938  1.00 104.65 ? 427  LEU A C   1 
ATOM 3333 O O   . LEU A 1 430  ? -19.315 63.002 -6.692  1.00 104.65 ? 427  LEU A O   1 
ATOM 3334 C CB  . LEU A 1 430  ? -19.155 62.184 -3.851  1.00 116.40 ? 427  LEU A CB  1 
ATOM 3335 C CG  . LEU A 1 430  ? -20.619 61.734 -4.031  1.00 116.40 ? 427  LEU A CG  1 
ATOM 3336 C CD1 . LEU A 1 430  ? -20.890 61.103 -5.388  1.00 116.40 ? 427  LEU A CD1 1 
ATOM 3337 C CD2 . LEU A 1 430  ? -21.009 60.757 -2.946  1.00 116.40 ? 427  LEU A CD2 1 
ATOM 3338 N N   . SER A 1 431  ? -17.177 63.622 -6.377  1.00 106.92 ? 428  SER A N   1 
ATOM 3339 C CA  . SER A 1 431  ? -16.823 63.244 -7.746  1.00 106.92 ? 428  SER A CA  1 
ATOM 3340 C C   . SER A 1 431  ? -17.094 61.757 -7.949  1.00 106.92 ? 428  SER A C   1 
ATOM 3341 O O   . SER A 1 431  ? -16.960 60.961 -7.029  1.00 106.92 ? 428  SER A O   1 
ATOM 3342 C CB  . SER A 1 431  ? -15.366 63.541 -8.059  1.00 155.65 ? 428  SER A CB  1 
ATOM 3343 O OG  . SER A 1 431  ? -15.082 63.183 -9.405  1.00 155.65 ? 428  SER A OG  1 
ATOM 3344 N N   . PHE A 1 432  ? -17.468 61.373 -9.156  1.00 97.10  ? 429  PHE A N   1 
ATOM 3345 C CA  . PHE A 1 432  ? -17.924 60.005 -9.366  1.00 97.10  ? 429  PHE A CA  1 
ATOM 3346 C C   . PHE A 1 432  ? -17.529 59.541 -10.774 1.00 97.10  ? 429  PHE A C   1 
ATOM 3347 O O   . PHE A 1 432  ? -16.988 60.334 -11.571 1.00 97.10  ? 429  PHE A O   1 
ATOM 3348 C CB  . PHE A 1 432  ? -19.443 59.987 -9.195  1.00 135.13 ? 429  PHE A CB  1 
ATOM 3349 C CG  . PHE A 1 432  ? -19.985 58.773 -8.499  1.00 135.13 ? 429  PHE A CG  1 
ATOM 3350 C CD1 . PHE A 1 432  ? -20.508 57.708 -9.232  1.00 135.13 ? 429  PHE A CD1 1 
ATOM 3351 C CD2 . PHE A 1 432  ? -20.035 58.720 -7.108  1.00 135.13 ? 429  PHE A CD2 1 
ATOM 3352 C CE1 . PHE A 1 432  ? -21.044 56.593 -8.592  1.00 135.13 ? 429  PHE A CE1 1 
ATOM 3353 C CE2 . PHE A 1 432  ? -20.568 57.609 -6.451  1.00 135.13 ? 429  PHE A CE2 1 
ATOM 3354 C CZ  . PHE A 1 432  ? -21.074 56.541 -7.195  1.00 135.13 ? 429  PHE A CZ  1 
ATOM 3355 N N   . VAL A 1 433  ? -17.826 58.271 -11.072 1.00 171.23 ? 430  VAL A N   1 
ATOM 3356 C CA  . VAL A 1 433  ? -17.501 57.609 -12.355 1.00 171.23 ? 430  VAL A CA  1 
ATOM 3357 C C   . VAL A 1 433  ? -18.045 58.356 -13.590 1.00 171.23 ? 430  VAL A C   1 
ATOM 3358 O O   . VAL A 1 433  ? -18.739 57.771 -14.427 1.00 171.23 ? 430  VAL A O   1 
ATOM 3359 C CB  . VAL A 1 433  ? -18.016 56.123 -12.401 1.00 143.50 ? 430  VAL A CB  1 
ATOM 3360 C CG1 . VAL A 1 433  ? -17.026 55.236 -13.175 1.00 143.50 ? 430  VAL A CG1 1 
ATOM 3361 C CG2 . VAL A 1 433  ? -18.232 55.561 -10.994 1.00 143.50 ? 430  VAL A CG2 1 
ATOM 3362 N N   . GLY A 1 434  ? -17.713 59.642 -13.702 1.00 93.81  ? 431  GLY A N   1 
ATOM 3363 C CA  . GLY A 1 434  ? -18.231 60.497 -14.771 1.00 93.81  ? 431  GLY A CA  1 
ATOM 3364 C C   . GLY A 1 434  ? -19.559 61.217 -14.507 1.00 93.81  ? 431  GLY A C   1 
ATOM 3365 O O   . GLY A 1 434  ? -20.226 61.658 -15.454 1.00 93.81  ? 431  GLY A O   1 
ATOM 3366 N N   . GLN A 1 435  ? -19.947 61.333 -13.233 1.00 117.22 ? 432  GLN A N   1 
ATOM 3367 C CA  . GLN A 1 435  ? -21.141 62.088 -12.816 1.00 117.22 ? 432  GLN A CA  1 
ATOM 3368 C C   . GLN A 1 435  ? -20.840 62.894 -11.556 1.00 117.22 ? 432  GLN A C   1 
ATOM 3369 O O   . GLN A 1 435  ? -19.680 63.019 -11.154 1.00 117.22 ? 432  GLN A O   1 
ATOM 3370 C CB  . GLN A 1 435  ? -22.333 61.147 -12.567 1.00 124.09 ? 432  GLN A CB  1 
ATOM 3371 C CG  . GLN A 1 435  ? -23.138 60.756 -13.822 1.00 124.09 ? 432  GLN A CG  1 
ATOM 3372 C CD  . GLN A 1 435  ? -24.356 59.868 -13.530 1.00 124.09 ? 432  GLN A CD  1 
ATOM 3373 O OE1 . GLN A 1 435  ? -24.422 58.724 -13.986 1.00 124.09 ? 432  GLN A OE1 1 
ATOM 3374 N NE2 . GLN A 1 435  ? -25.321 60.397 -12.778 1.00 124.09 ? 432  GLN A NE2 1 
ATOM 3375 N N   . THR A 1 436  ? -21.884 63.452 -10.949 1.00 206.26 ? 433  THR A N   1 
ATOM 3376 C CA  . THR A 1 436  ? -21.788 64.060 -9.625  1.00 206.26 ? 433  THR A CA  1 
ATOM 3377 C C   . THR A 1 436  ? -23.138 63.970 -8.918  1.00 206.26 ? 433  THR A C   1 
ATOM 3378 O O   . THR A 1 436  ? -24.103 64.638 -9.303  1.00 206.26 ? 433  THR A O   1 
ATOM 3379 C CB  . THR A 1 436  ? -21.312 65.546 -9.671  1.00 70.43  ? 433  THR A CB  1 
ATOM 3380 O OG1 . THR A 1 436  ? -20.100 65.653 -10.413 1.00 70.43  ? 433  THR A OG1 1 
ATOM 3381 C CG2 . THR A 1 436  ? -21.075 66.107 -8.268  1.00 70.43  ? 433  THR A CG2 1 
ATOM 3382 N N   . ARG A 1 437  ? -23.201 63.115 -7.901  1.00 115.96 ? 434  ARG A N   1 
ATOM 3383 C CA  . ARG A 1 437  ? -24.310 63.120 -6.951  1.00 115.96 ? 434  ARG A CA  1 
ATOM 3384 C C   . ARG A 1 437  ? -23.977 63.993 -5.727  1.00 115.96 ? 434  ARG A C   1 
ATOM 3385 O O   . ARG A 1 437  ? -22.830 64.058 -5.277  1.00 115.96 ? 434  ARG A O   1 
ATOM 3386 C CB  . ARG A 1 437  ? -24.696 61.689 -6.547  1.00 169.16 ? 434  ARG A CB  1 
ATOM 3387 C CG  . ARG A 1 437  ? -25.453 60.928 -7.639  1.00 169.16 ? 434  ARG A CG  1 
ATOM 3388 C CD  . ARG A 1 437  ? -26.976 61.101 -7.529  1.00 169.16 ? 434  ARG A CD  1 
ATOM 3389 N NE  . ARG A 1 437  ? -27.588 61.681 -8.732  1.00 169.16 ? 434  ARG A NE  1 
ATOM 3390 C CZ  . ARG A 1 437  ? -27.804 61.035 -9.877  1.00 169.16 ? 434  ARG A CZ  1 
ATOM 3391 N NH1 . ARG A 1 437  ? -27.448 59.763 -10.021 1.00 169.16 ? 434  ARG A NH1 1 
ATOM 3392 N NH2 . ARG A 1 437  ? -28.371 61.672 -10.890 1.00 169.16 ? 434  ARG A NH2 1 
ATOM 3393 N N   . VAL A 1 438  ? -24.987 64.682 -5.215  1.00 120.66 ? 435  VAL A N   1 
ATOM 3394 C CA  . VAL A 1 438  ? -24.834 65.549 -4.060  1.00 120.66 ? 435  VAL A CA  1 
ATOM 3395 C C   . VAL A 1 438  ? -25.322 64.759 -2.844  1.00 120.66 ? 435  VAL A C   1 
ATOM 3396 O O   . VAL A 1 438  ? -26.040 63.773 -3.002  1.00 120.66 ? 435  VAL A O   1 
ATOM 3397 C CB  . VAL A 1 438  ? -25.662 66.832 -4.249  1.00 126.37 ? 435  VAL A CB  1 
ATOM 3398 C CG1 . VAL A 1 438  ? -25.234 67.897 -3.271  1.00 126.37 ? 435  VAL A CG1 1 
ATOM 3399 C CG2 . VAL A 1 438  ? -25.540 67.353 -5.690  1.00 126.37 ? 435  VAL A CG2 1 
ATOM 3400 N N   . LEU A 1 439  ? -24.934 65.168 -1.637  1.00 210.35 ? 436  LEU A N   1 
ATOM 3401 C CA  . LEU A 1 439  ? -25.380 64.449 -0.442  1.00 210.35 ? 436  LEU A CA  1 
ATOM 3402 C C   . LEU A 1 439  ? -25.868 65.302 0.718   1.00 210.35 ? 436  LEU A C   1 
ATOM 3403 O O   . LEU A 1 439  ? -25.168 65.470 1.718   1.00 210.35 ? 436  LEU A O   1 
ATOM 3404 C CB  . LEU A 1 439  ? -24.334 63.427 0.027   1.00 113.38 ? 436  LEU A CB  1 
ATOM 3405 C CG  . LEU A 1 439  ? -24.490 62.008 -0.553  1.00 113.38 ? 436  LEU A CG  1 
ATOM 3406 C CD1 . LEU A 1 439  ? -23.398 61.057 -0.044  1.00 113.38 ? 436  LEU A CD1 1 
ATOM 3407 C CD2 . LEU A 1 439  ? -25.880 61.415 -0.291  1.00 113.38 ? 436  LEU A CD2 1 
ATOM 3408 N N   . MET A 1 440  ? -27.081 65.833 0.569   1.00 136.73 ? 437  MET A N   1 
ATOM 3409 C CA  . MET A 1 440  ? -27.747 66.568 1.638   1.00 136.73 ? 437  MET A CA  1 
ATOM 3410 C C   . MET A 1 440  ? -27.970 65.635 2.819   1.00 136.73 ? 437  MET A C   1 
ATOM 3411 O O   . MET A 1 440  ? -28.301 64.467 2.641   1.00 136.73 ? 437  MET A O   1 
ATOM 3412 C CB  . MET A 1 440  ? -29.077 67.150 1.150   1.00 187.93 ? 437  MET A CB  1 
ATOM 3413 C CG  . MET A 1 440  ? -28.937 68.371 0.240   1.00 187.93 ? 437  MET A CG  1 
ATOM 3414 S SD  . MET A 1 440  ? -28.950 69.955 1.113   1.00 187.93 ? 437  MET A SD  1 
ATOM 3415 C CE  . MET A 1 440  ? -30.722 70.162 1.424   1.00 187.93 ? 437  MET A CE  1 
ATOM 3416 N N   . LEU A 1 441  ? -27.762 66.145 4.023   1.00 209.96 ? 438  LEU A N   1 
ATOM 3417 C CA  . LEU A 1 441  ? -27.958 65.332 5.206   1.00 209.96 ? 438  LEU A CA  1 
ATOM 3418 C C   . LEU A 1 441  ? -29.021 65.910 6.112   1.00 209.96 ? 438  LEU A C   1 
ATOM 3419 O O   . LEU A 1 441  ? -28.995 67.096 6.441   1.00 209.96 ? 438  LEU A O   1 
ATOM 3420 C CB  . LEU A 1 441  ? -26.649 65.148 5.967   1.00 74.59  ? 438  LEU A CB  1 
ATOM 3421 C CG  . LEU A 1 441  ? -25.696 64.068 5.424   1.00 74.59  ? 438  LEU A CG  1 
ATOM 3422 C CD1 . LEU A 1 441  ? -24.222 64.393 5.723   1.00 74.59  ? 438  LEU A CD1 1 
ATOM 3423 C CD2 . LEU A 1 441  ? -26.045 62.687 5.967   1.00 74.59  ? 438  LEU A CD2 1 
ATOM 3424 N N   . ASN A 1 442  ? -29.958 65.053 6.505   1.00 199.79 ? 439  ASN A N   1 
ATOM 3425 C CA  . ASN A 1 442  ? -30.982 65.395 7.479   1.00 199.79 ? 439  ASN A CA  1 
ATOM 3426 C C   . ASN A 1 442  ? -30.361 65.485 8.881   1.00 199.79 ? 439  ASN A C   1 
ATOM 3427 O O   . ASN A 1 442  ? -31.069 65.615 9.883   1.00 199.79 ? 439  ASN A O   1 
ATOM 3428 C CB  . ASN A 1 442  ? -32.080 64.331 7.441   1.00 157.62 ? 439  ASN A CB  1 
ATOM 3429 C CG  . ASN A 1 442  ? -33.457 64.913 7.152   1.00 157.62 ? 439  ASN A CG  1 
ATOM 3430 O OD1 . ASN A 1 442  ? -34.160 64.448 6.244   1.00 157.62 ? 439  ASN A OD1 1 
ATOM 3431 N ND2 . ASN A 1 442  ? -33.852 65.927 7.920   1.00 157.62 ? 439  ASN A ND2 1 
ATOM 3432 N N   . GLY A 1 443  ? -29.027 65.423 8.926   1.00 102.62 ? 440  GLY A N   1 
ATOM 3433 C CA  . GLY A 1 443  ? -28.244 65.443 10.161  1.00 102.62 ? 440  GLY A CA  1 
ATOM 3434 C C   . GLY A 1 443  ? -27.251 64.296 10.169  1.00 102.62 ? 440  GLY A C   1 
ATOM 3435 O O   . GLY A 1 443  ? -26.094 64.449 9.754   1.00 102.62 ? 440  GLY A O   1 
ATOM 3436 N N   . GLU A 1 444  ? -27.728 63.147 10.645  1.00 92.06  ? 441  GLU A N   1 
ATOM 3437 C CA  . GLU A 1 444  ? -26.995 61.886 10.595  1.00 92.06  ? 441  GLU A CA  1 
ATOM 3438 C C   . GLU A 1 444  ? -27.626 60.945 9.562   1.00 92.06  ? 441  GLU A C   1 
ATOM 3439 O O   . GLU A 1 444  ? -27.310 59.754 9.509   1.00 92.06  ? 441  GLU A O   1 
ATOM 3440 C CB  . GLU A 1 444  ? -26.962 61.232 11.983  1.00 210.35 ? 441  GLU A CB  1 
ATOM 3441 C CG  . GLU A 1 444  ? -28.300 61.228 12.737  1.00 210.35 ? 441  GLU A CG  1 
ATOM 3442 C CD  . GLU A 1 444  ? -29.228 60.075 12.345  1.00 210.35 ? 441  GLU A CD  1 
ATOM 3443 O OE1 . GLU A 1 444  ? -30.480 60.189 12.605  1.00 210.35 ? 441  GLU A OE1 1 
ATOM 3444 O OE2 . GLU A 1 444  ? -28.724 59.055 11.783  1.00 210.35 ? 441  GLU A OE2 1 
ATOM 3445 N N   . GLU A 1 445  ? -28.511 61.504 8.738   1.00 160.30 ? 442  GLU A N   1 
ATOM 3446 C CA  . GLU A 1 445  ? -29.265 60.744 7.744   1.00 160.30 ? 442  GLU A CA  1 
ATOM 3447 C C   . GLU A 1 445  ? -28.881 61.126 6.303   1.00 160.30 ? 442  GLU A C   1 
ATOM 3448 O O   . GLU A 1 445  ? -28.824 62.310 5.958   1.00 160.30 ? 442  GLU A O   1 
ATOM 3449 C CB  . GLU A 1 445  ? -30.761 60.959 7.967   1.00 123.71 ? 442  GLU A CB  1 
ATOM 3450 C CG  . GLU A 1 445  ? -31.653 60.061 7.139   1.00 123.71 ? 442  GLU A CG  1 
ATOM 3451 C CD  . GLU A 1 445  ? -32.863 60.788 6.576   1.00 123.71 ? 442  GLU A CD  1 
ATOM 3452 O OE1 . GLU A 1 445  ? -32.689 61.753 5.792   1.00 123.71 ? 442  GLU A OE1 1 
ATOM 3453 O OE2 . GLU A 1 445  ? -33.994 60.376 6.908   1.00 123.71 ? 442  GLU A OE2 1 
ATOM 3454 N N   . VAL A 1 446  ? -28.651 60.106 5.472   1.00 190.19 ? 443  VAL A N   1 
ATOM 3455 C CA  . VAL A 1 446  ? -28.141 60.250 4.094   1.00 190.19 ? 443  VAL A CA  1 
ATOM 3456 C C   . VAL A 1 446  ? -29.220 60.552 3.046   1.00 190.19 ? 443  VAL A C   1 
ATOM 3457 O O   . VAL A 1 446  ? -30.275 59.912 3.034   1.00 190.19 ? 443  VAL A O   1 
ATOM 3458 C CB  . VAL A 1 446  ? -27.363 58.971 3.682   1.00 113.60 ? 443  VAL A CB  1 
ATOM 3459 C CG1 . VAL A 1 446  ? -27.246 58.829 2.156   1.00 113.60 ? 443  VAL A CG1 1 
ATOM 3460 C CG2 . VAL A 1 446  ? -25.993 58.952 4.342   1.00 113.60 ? 443  VAL A CG2 1 
ATOM 3461 N N   . GLU A 1 447  ? -28.940 61.514 2.163   1.00 209.19 ? 444  GLU A N   1 
ATOM 3462 C CA  . GLU A 1 447  ? -29.870 61.883 1.088   1.00 209.19 ? 444  GLU A CA  1 
ATOM 3463 C C   . GLU A 1 447  ? -29.182 62.537 -0.112  1.00 209.19 ? 444  GLU A C   1 
ATOM 3464 O O   . GLU A 1 447  ? -28.439 63.508 0.040   1.00 209.19 ? 444  GLU A O   1 
ATOM 3465 C CB  . GLU A 1 447  ? -30.960 62.816 1.624   1.00 126.76 ? 444  GLU A CB  1 
ATOM 3466 C CG  . GLU A 1 447  ? -32.053 63.179 0.614   1.00 126.76 ? 444  GLU A CG  1 
ATOM 3467 C CD  . GLU A 1 447  ? -32.900 64.366 1.061   1.00 126.76 ? 444  GLU A CD  1 
ATOM 3468 O OE1 . GLU A 1 447  ? -32.443 65.140 1.934   1.00 126.76 ? 444  GLU A OE1 1 
ATOM 3469 O OE2 . GLU A 1 447  ? -34.022 64.524 0.531   1.00 126.76 ? 444  GLU A OE2 1 
ATOM 3470 N N   . GLU A 1 448  ? -29.457 62.008 -1.304  1.00 130.56 ? 445  GLU A N   1 
ATOM 3471 C CA  . GLU A 1 448  ? -28.936 62.580 -2.545  1.00 130.56 ? 445  GLU A CA  1 
ATOM 3472 C C   . GLU A 1 448  ? -29.986 63.381 -3.328  1.00 130.56 ? 445  GLU A C   1 
ATOM 3473 O O   . GLU A 1 448  ? -30.893 62.814 -3.963  1.00 130.56 ? 445  GLU A O   1 
ATOM 3474 C CB  . GLU A 1 448  ? -28.275 61.512 -3.422  1.00 199.73 ? 445  GLU A CB  1 
ATOM 3475 C CG  . GLU A 1 448  ? -29.122 60.287 -3.695  1.00 199.73 ? 445  GLU A CG  1 
ATOM 3476 C CD  . GLU A 1 448  ? -28.508 59.395 -4.744  1.00 199.73 ? 445  GLU A CD  1 
ATOM 3477 O OE1 . GLU A 1 448  ? -29.269 58.786 -5.522  1.00 199.73 ? 445  GLU A OE1 1 
ATOM 3478 O OE2 . GLU A 1 448  ? -27.264 59.307 -4.797  1.00 199.73 ? 445  GLU A OE2 1 
ATOM 3479 N N   . THR A 1 449  ? -29.858 64.705 -3.260  1.00 193.78 ? 446  THR A N   1 
ATOM 3480 C CA  . THR A 1 449  ? -30.737 65.616 -3.993  1.00 193.78 ? 446  THR A CA  1 
ATOM 3481 C C   . THR A 1 449  ? -29.949 66.468 -4.995  1.00 193.78 ? 446  THR A C   1 
ATOM 3482 O O   . THR A 1 449  ? -28.724 66.375 -5.071  1.00 193.78 ? 446  THR A O   1 
ATOM 3483 C CB  . THR A 1 449  ? -31.572 66.534 -3.040  1.00 89.44  ? 446  THR A CB  1 
ATOM 3484 O OG1 . THR A 1 449  ? -30.705 67.233 -2.138  1.00 89.44  ? 446  THR A OG1 1 
ATOM 3485 C CG2 . THR A 1 449  ? -32.593 65.718 -2.248  1.00 89.44  ? 446  THR A CG2 1 
ATOM 3486 N N   . GLU A 1 450  ? -30.673 67.279 -5.768  1.00 102.71 ? 447  GLU A N   1 
ATOM 3487 C CA  . GLU A 1 450  ? -30.106 68.267 -6.699  1.00 102.71 ? 447  GLU A CA  1 
ATOM 3488 C C   . GLU A 1 450  ? -29.333 69.397 -5.990  1.00 102.71 ? 447  GLU A C   1 
ATOM 3489 O O   . GLU A 1 450  ? -29.237 69.427 -4.754  1.00 102.71 ? 447  GLU A O   1 
ATOM 3490 C CB  . GLU A 1 450  ? -31.227 68.864 -7.585  1.00 170.17 ? 447  GLU A CB  1 
ATOM 3491 C CG  . GLU A 1 450  ? -32.607 69.007 -6.897  1.00 170.17 ? 447  GLU A CG  1 
ATOM 3492 C CD  . GLU A 1 450  ? -33.568 69.963 -7.614  1.00 170.17 ? 447  GLU A CD  1 
ATOM 3493 O OE1 . GLU A 1 450  ? -34.544 69.486 -8.239  1.00 170.17 ? 447  GLU A OE1 1 
ATOM 3494 O OE2 . GLU A 1 450  ? -33.357 71.196 -7.542  1.00 170.17 ? 447  GLU A OE2 1 
ATOM 3495 N N   . LEU A 1 451  ? -28.775 70.308 -6.788  1.00 205.04 ? 448  LEU A N   1 
ATOM 3496 C CA  . LEU A 1 451  ? -28.281 71.596 -6.300  1.00 205.04 ? 448  LEU A CA  1 
ATOM 3497 C C   . LEU A 1 451  ? -28.037 72.534 -7.475  1.00 205.04 ? 448  LEU A C   1 
ATOM 3498 O O   . LEU A 1 451  ? -27.474 72.124 -8.496  1.00 205.04 ? 448  LEU A O   1 
ATOM 3499 C CB  . LEU A 1 451  ? -27.009 71.437 -5.470  1.00 97.94  ? 448  LEU A CB  1 
ATOM 3500 C CG  . LEU A 1 451  ? -26.942 72.319 -4.221  1.00 97.94  ? 448  LEU A CG  1 
ATOM 3501 C CD1 . LEU A 1 451  ? -27.814 71.759 -3.095  1.00 97.94  ? 448  LEU A CD1 1 
ATOM 3502 C CD2 . LEU A 1 451  ? -25.506 72.486 -3.755  1.00 97.94  ? 448  LEU A CD2 1 
ATOM 3503 N N   . MET A 1 452  ? -28.465 73.788 -7.317  1.00 197.85 ? 449  MET A N   1 
ATOM 3504 C CA  . MET A 1 452  ? -28.430 74.791 -8.387  1.00 197.85 ? 449  MET A CA  1 
ATOM 3505 C C   . MET A 1 452  ? -27.020 74.964 -8.921  1.00 197.85 ? 449  MET A C   1 
ATOM 3506 O O   . MET A 1 452  ? -26.057 74.820 -8.170  1.00 197.85 ? 449  MET A O   1 
ATOM 3507 C CB  . MET A 1 452  ? -28.934 76.148 -7.885  1.00 158.89 ? 449  MET A CB  1 
ATOM 3508 C CG  . MET A 1 452  ? -29.785 76.085 -6.639  1.00 158.89 ? 449  MET A CG  1 
ATOM 3509 S SD  . MET A 1 452  ? -31.481 75.589 -6.933  1.00 158.89 ? 449  MET A SD  1 
ATOM 3510 C CE  . MET A 1 452  ? -31.762 74.575 -5.475  1.00 158.89 ? 449  MET A CE  1 
ATOM 3511 N N   . GLY A 1 453  ? -26.908 75.250 -10.218 1.00 200.43 ? 450  GLY A N   1 
ATOM 3512 C CA  . GLY A 1 453  ? -25.622 75.524 -10.867 1.00 200.43 ? 450  GLY A CA  1 
ATOM 3513 C C   . GLY A 1 453  ? -24.506 74.514 -10.636 1.00 200.43 ? 450  GLY A C   1 
ATOM 3514 O O   . GLY A 1 453  ? -23.332 74.820 -10.865 1.00 200.43 ? 450  GLY A O   1 
ATOM 3515 N N   . PHE A 1 454  ? -24.875 73.317 -10.178 1.00 155.29 ? 451  PHE A N   1 
ATOM 3516 C CA  . PHE A 1 454  ? -23.933 72.231 -9.912  1.00 155.29 ? 451  PHE A CA  1 
ATOM 3517 C C   . PHE A 1 454  ? -24.361 71.009 -10.710 1.00 155.29 ? 451  PHE A C   1 
ATOM 3518 O O   . PHE A 1 454  ? -25.496 70.546 -10.564 1.00 155.29 ? 451  PHE A O   1 
ATOM 3519 C CB  . PHE A 1 454  ? -23.913 71.899 -8.418  1.00 152.54 ? 451  PHE A CB  1 
ATOM 3520 C CG  . PHE A 1 454  ? -23.005 72.780 -7.598  1.00 152.54 ? 451  PHE A CG  1 
ATOM 3521 C CD1 . PHE A 1 454  ? -22.568 74.011 -8.070  1.00 152.54 ? 451  PHE A CD1 1 
ATOM 3522 C CD2 . PHE A 1 454  ? -22.607 72.380 -6.332  1.00 152.54 ? 451  PHE A CD2 1 
ATOM 3523 C CE1 . PHE A 1 454  ? -21.739 74.817 -7.304  1.00 152.54 ? 451  PHE A CE1 1 
ATOM 3524 C CE2 . PHE A 1 454  ? -21.778 73.184 -5.557  1.00 152.54 ? 451  PHE A CE2 1 
ATOM 3525 C CZ  . PHE A 1 454  ? -21.348 74.403 -6.046  1.00 152.54 ? 451  PHE A CZ  1 
ATOM 3526 N N   . VAL A 1 455  ? -23.463 70.490 -11.551 1.00 95.35  ? 452  VAL A N   1 
ATOM 3527 C CA  . VAL A 1 455  ? -23.843 69.413 -12.477 1.00 95.35  ? 452  VAL A CA  1 
ATOM 3528 C C   . VAL A 1 455  ? -24.092 68.064 -11.833 1.00 95.35  ? 452  VAL A C   1 
ATOM 3529 O O   . VAL A 1 455  ? -23.563 67.759 -10.767 1.00 95.35  ? 452  VAL A O   1 
ATOM 3530 C CB  . VAL A 1 455  ? -22.936 69.271 -13.725 1.00 100.79 ? 452  VAL A CB  1 
ATOM 3531 C CG1 . VAL A 1 455  ? -23.733 69.614 -14.994 1.00 100.79 ? 452  VAL A CG1 1 
ATOM 3532 C CG2 . VAL A 1 455  ? -21.676 70.108 -13.604 1.00 100.79 ? 452  VAL A CG2 1 
ATOM 3533 N N   . ASP A 1 456  ? -24.938 67.296 -12.517 1.00 90.49  ? 453  ASP A N   1 
ATOM 3534 C CA  . ASP A 1 456  ? -25.467 66.004 -12.082 1.00 90.49  ? 453  ASP A CA  1 
ATOM 3535 C C   . ASP A 1 456  ? -25.151 64.944 -13.142 1.00 90.49  ? 453  ASP A C   1 
ATOM 3536 O O   . ASP A 1 456  ? -25.249 63.732 -12.889 1.00 90.49  ? 453  ASP A O   1 
ATOM 3537 C CB  . ASP A 1 456  ? -26.988 66.105 -11.870 1.00 198.25 ? 453  ASP A CB  1 
ATOM 3538 C CG  . ASP A 1 456  ? -27.728 66.657 -13.095 1.00 198.25 ? 453  ASP A CG  1 
ATOM 3539 O OD1 . ASP A 1 456  ? -28.055 65.868 -14.007 1.00 198.25 ? 453  ASP A OD1 1 
ATOM 3540 O OD2 . ASP A 1 456  ? -28.000 67.878 -13.135 1.00 198.25 ? 453  ASP A OD2 1 
ATOM 3541 N N   . ASP A 1 457  ? -24.790 65.428 -14.331 1.00 193.22 ? 454  ASP A N   1 
ATOM 3542 C CA  . ASP A 1 457  ? -24.418 64.589 -15.462 1.00 193.22 ? 454  ASP A CA  1 
ATOM 3543 C C   . ASP A 1 457  ? -22.976 64.874 -15.865 1.00 193.22 ? 454  ASP A C   1 
ATOM 3544 O O   . ASP A 1 457  ? -22.460 64.285 -16.812 1.00 193.22 ? 454  ASP A O   1 
ATOM 3545 C CB  . ASP A 1 457  ? -25.355 64.846 -16.648 1.00 169.96 ? 454  ASP A CB  1 
ATOM 3546 C CG  . ASP A 1 457  ? -25.064 66.160 -17.352 1.00 169.96 ? 454  ASP A CG  1 
ATOM 3547 O OD1 . ASP A 1 457  ? -24.948 66.151 -18.594 1.00 169.96 ? 454  ASP A OD1 1 
ATOM 3548 O OD2 . ASP A 1 457  ? -24.942 67.198 -16.670 1.00 169.96 ? 454  ASP A OD2 1 
ATOM 3549 N N   . GLN A 1 458  ? -22.335 65.787 -15.146 1.00 186.96 ? 455  GLN A N   1 
ATOM 3550 C CA  . GLN A 1 458  ? -20.958 66.147 -15.437 1.00 186.96 ? 455  GLN A CA  1 
ATOM 3551 C C   . GLN A 1 458  ? -20.064 66.026 -14.206 1.00 186.96 ? 455  GLN A C   1 
ATOM 3552 O O   . GLN A 1 458  ? -20.258 66.720 -13.206 1.00 186.96 ? 455  GLN A O   1 
ATOM 3553 C CB  . GLN A 1 458  ? -20.890 67.549 -16.034 1.00 131.06 ? 455  GLN A CB  1 
ATOM 3554 C CG  . GLN A 1 458  ? -21.088 67.602 -17.525 1.00 131.06 ? 455  GLN A CG  1 
ATOM 3555 C CD  . GLN A 1 458  ? -19.786 67.419 -18.271 1.00 131.06 ? 455  GLN A CD  1 
ATOM 3556 O OE1 . GLN A 1 458  ? -19.070 68.389 -18.540 1.00 131.06 ? 455  GLN A OE1 1 
ATOM 3557 N NE2 . GLN A 1 458  ? -19.456 66.169 -18.589 1.00 131.06 ? 455  GLN A NE2 1 
ATOM 3558 N N   . GLN A 1 459  ? -19.081 65.134 -14.310 1.00 132.88 ? 456  GLN A N   1 
ATOM 3559 C CA  . GLN A 1 459  ? -18.129 64.810 -13.242 1.00 132.88 ? 456  GLN A CA  1 
ATOM 3560 C C   . GLN A 1 459  ? -17.407 66.006 -12.603 1.00 132.88 ? 456  GLN A C   1 
ATOM 3561 O O   . GLN A 1 459  ? -16.654 66.724 -13.266 1.00 132.88 ? 456  GLN A O   1 
ATOM 3562 C CB  . GLN A 1 459  ? -17.097 63.817 -13.782 1.00 123.98 ? 456  GLN A CB  1 
ATOM 3563 C CG  . GLN A 1 459  ? -15.977 63.480 -12.825 1.00 123.98 ? 456  GLN A CG  1 
ATOM 3564 C CD  . GLN A 1 459  ? -14.916 62.614 -13.460 1.00 123.98 ? 456  GLN A CD  1 
ATOM 3565 O OE1 . GLN A 1 459  ? -13.995 62.177 -12.784 1.00 123.98 ? 456  GLN A OE1 1 
ATOM 3566 N NE2 . GLN A 1 459  ? -15.034 62.358 -14.762 1.00 123.98 ? 456  GLN A NE2 1 
ATOM 3567 N N   . THR A 1 460  ? -17.632 66.190 -11.303 1.00 117.49 ? 457  THR A N   1 
ATOM 3568 C CA  . THR A 1 460  ? -16.993 67.252 -10.538 1.00 117.49 ? 457  THR A CA  1 
ATOM 3569 C C   . THR A 1 460  ? -15.556 66.854 -10.195 1.00 117.49 ? 457  THR A C   1 
ATOM 3570 O O   . THR A 1 460  ? -15.278 65.696 -9.919  1.00 117.49 ? 457  THR A O   1 
ATOM 3571 C CB  . THR A 1 460  ? -17.818 67.559 -9.252  1.00 91.50  ? 457  THR A CB  1 
ATOM 3572 O OG1 . THR A 1 460  ? -19.129 68.016 -9.614  1.00 91.50  ? 457  THR A OG1 1 
ATOM 3573 C CG2 . THR A 1 460  ? -17.147 68.601 -8.389  1.00 91.50  ? 457  THR A CG2 1 
ATOM 3574 N N   . PHE A 1 461  ? -14.652 67.828 -10.240 1.00 86.53  ? 458  PHE A N   1 
ATOM 3575 C CA  . PHE A 1 461  ? -13.233 67.640 -9.891  1.00 86.53  ? 458  PHE A CA  1 
ATOM 3576 C C   . PHE A 1 461  ? -12.844 68.450 -8.659  1.00 86.53  ? 458  PHE A C   1 
ATOM 3577 O O   . PHE A 1 461  ? -11.651 68.581 -8.333  1.00 86.53  ? 458  PHE A O   1 
ATOM 3578 C CB  . PHE A 1 461  ? -12.309 68.123 -11.031 1.00 169.79 ? 458  PHE A CB  1 
ATOM 3579 C CG  . PHE A 1 461  ? -12.283 67.240 -12.258 1.00 169.79 ? 458  PHE A CG  1 
ATOM 3580 C CD1 . PHE A 1 461  ? -12.531 65.870 -12.182 1.00 169.79 ? 458  PHE A CD1 1 
ATOM 3581 C CD2 . PHE A 1 461  ? -11.958 67.791 -13.495 1.00 169.79 ? 458  PHE A CD2 1 
ATOM 3582 C CE1 . PHE A 1 461  ? -12.490 65.073 -13.327 1.00 169.79 ? 458  PHE A CE1 1 
ATOM 3583 C CE2 . PHE A 1 461  ? -11.913 67.003 -14.641 1.00 169.79 ? 458  PHE A CE2 1 
ATOM 3584 C CZ  . PHE A 1 461  ? -12.179 65.641 -14.558 1.00 169.79 ? 458  PHE A CZ  1 
ATOM 3585 N N   . PHE A 1 462  ? -13.842 69.026 -7.999  1.00 62.39  ? 459  PHE A N   1 
ATOM 3586 C CA  . PHE A 1 462  ? -13.585 69.994 -6.931  1.00 62.39  ? 459  PHE A CA  1 
ATOM 3587 C C   . PHE A 1 462  ? -14.836 70.697 -6.420  1.00 62.39  ? 459  PHE A C   1 
ATOM 3588 O O   . PHE A 1 462  ? -15.793 70.856 -7.152  1.00 62.39  ? 459  PHE A O   1 
ATOM 3589 C CB  . PHE A 1 462  ? -12.548 71.050 -7.364  1.00 83.94  ? 459  PHE A CB  1 
ATOM 3590 C CG  . PHE A 1 462  ? -11.700 71.553 -6.241  1.00 83.94  ? 459  PHE A CG  1 
ATOM 3591 C CD1 . PHE A 1 462  ? -10.387 71.124 -6.111  1.00 83.94  ? 459  PHE A CD1 1 
ATOM 3592 C CD2 . PHE A 1 462  ? -12.215 72.443 -5.310  1.00 83.94  ? 459  PHE A CD2 1 
ATOM 3593 C CE1 . PHE A 1 462  ? -9.591  71.587 -5.068  1.00 83.94  ? 459  PHE A CE1 1 
ATOM 3594 C CE2 . PHE A 1 462  ? -11.440 72.905 -4.264  1.00 83.94  ? 459  PHE A CE2 1 
ATOM 3595 C CZ  . PHE A 1 462  ? -10.126 72.484 -4.137  1.00 83.94  ? 459  PHE A CZ  1 
ATOM 3596 N N   . CYS A 1 463  ? -14.772 71.139 -5.166  1.00 99.94  ? 460  CYS A N   1 
ATOM 3597 C CA  . CYS A 1 463  ? -15.890 71.739 -4.454  1.00 99.94  ? 460  CYS A CA  1 
ATOM 3598 C C   . CYS A 1 463  ? -15.407 72.721 -3.400  1.00 99.94  ? 460  CYS A C   1 
ATOM 3599 O O   . CYS A 1 463  ? -16.242 73.350 -2.753  1.00 99.94  ? 460  CYS A O   1 
ATOM 3600 C CB  . CYS A 1 463  ? -16.734 70.667 -3.747  1.00 123.11 ? 460  CYS A CB  1 
ATOM 3601 S SG  . CYS A 1 463  ? -17.948 69.783 -4.743  1.00 123.11 ? 460  CYS A SG  1 
ATOM 3602 N N   . GLY A 1 464  ? -14.081 72.817 -3.219  1.00 87.49  ? 461  GLY A N   1 
ATOM 3603 C CA  . GLY A 1 464  ? -13.419 73.707 -2.250  1.00 87.49  ? 461  GLY A CA  1 
ATOM 3604 C C   . GLY A 1 464  ? -14.345 74.299 -1.203  1.00 87.49  ? 461  GLY A C   1 
ATOM 3605 O O   . GLY A 1 464  ? -15.285 73.630 -0.751  1.00 87.49  ? 461  GLY A O   1 
ATOM 3606 N N   . ASN A 1 465  ? -14.070 75.540 -0.792  1.00 210.35 ? 462  ASN A N   1 
ATOM 3607 C CA  . ASN A 1 465  ? -14.998 76.346 0.028   1.00 210.35 ? 462  ASN A CA  1 
ATOM 3608 C C   . ASN A 1 465  ? -14.777 77.847 -0.224  1.00 210.35 ? 462  ASN A C   1 
ATOM 3609 O O   . ASN A 1 465  ? -14.355 78.589 0.667   1.00 210.35 ? 462  ASN A O   1 
ATOM 3610 C CB  . ASN A 1 465  ? -14.919 75.994 1.537   1.00 202.48 ? 462  ASN A CB  1 
ATOM 3611 C CG  . ASN A 1 465  ? -16.097 75.114 2.022   1.00 202.48 ? 462  ASN A CG  1 
ATOM 3612 O OD1 . ASN A 1 465  ? -15.970 74.386 3.035   1.00 202.48 ? 462  ASN A OD1 1 
ATOM 3613 N ND2 . ASN A 1 465  ? -17.242 75.201 1.310   1.00 202.48 ? 462  ASN A ND2 1 
ATOM 3614 N N   . VAL A 1 466  ? -15.076 78.276 -1.451  1.00 115.29 ? 463  VAL A N   1 
ATOM 3615 C CA  . VAL A 1 466  ? -14.807 79.646 -1.910  1.00 115.29 ? 463  VAL A CA  1 
ATOM 3616 C C   . VAL A 1 466  ? -15.629 80.710 -1.182  1.00 115.29 ? 463  VAL A C   1 
ATOM 3617 O O   . VAL A 1 466  ? -16.838 80.580 -1.012  1.00 115.29 ? 463  VAL A O   1 
ATOM 3618 C CB  . VAL A 1 466  ? -14.954 79.776 -3.440  1.00 125.18 ? 463  VAL A CB  1 
ATOM 3619 C CG1 . VAL A 1 466  ? -13.865 78.971 -4.145  1.00 125.18 ? 463  VAL A CG1 1 
ATOM 3620 C CG2 . VAL A 1 466  ? -16.337 79.333 -3.889  1.00 125.18 ? 463  VAL A CG2 1 
ATOM 3621 N N   . ALA A 1 467  ? -14.932 81.756 -0.752  1.00 96.24  ? 464  ALA A N   1 
ATOM 3622 C CA  . ALA A 1 467  ? -15.507 82.818 0.077   1.00 96.24  ? 464  ALA A CA  1 
ATOM 3623 C C   . ALA A 1 467  ? -16.422 83.825 -0.669  1.00 96.24  ? 464  ALA A C   1 
ATOM 3624 O O   . ALA A 1 467  ? -16.674 83.690 -1.878  1.00 96.24  ? 464  ALA A O   1 
ATOM 3625 C CB  . ALA A 1 467  ? -14.384 83.546 0.839   1.00 119.87 ? 464  ALA A CB  1 
ATOM 3626 N N   . HIS A 1 468  ? -16.909 84.830 0.067   1.00 104.69 ? 465  HIS A N   1 
ATOM 3627 C CA  . HIS A 1 468  ? -17.864 85.826 -0.452  1.00 104.69 ? 465  HIS A CA  1 
ATOM 3628 C C   . HIS A 1 468  ? -19.274 85.216 -0.650  1.00 104.69 ? 465  HIS A C   1 
ATOM 3629 O O   . HIS A 1 468  ? -19.965 85.507 -1.644  1.00 104.69 ? 465  HIS A O   1 
ATOM 3630 C CB  . HIS A 1 468  ? -17.358 86.487 -1.761  1.00 137.16 ? 465  HIS A CB  1 
ATOM 3631 C CG  . HIS A 1 468  ? -15.984 87.095 -1.672  1.00 137.16 ? 465  HIS A CG  1 
ATOM 3632 N ND1 . HIS A 1 468  ? -14.830 86.335 -1.556  1.00 137.16 ? 465  HIS A ND1 1 
ATOM 3633 C CD2 . HIS A 1 468  ? -15.581 88.393 -1.728  1.00 137.16 ? 465  HIS A CD2 1 
ATOM 3634 C CE1 . HIS A 1 468  ? -13.781 87.137 -1.520  1.00 137.16 ? 465  HIS A CE1 1 
ATOM 3635 N NE2 . HIS A 1 468  ? -14.209 88.390 -1.625  1.00 137.16 ? 465  HIS A NE2 1 
ATOM 3636 N N   . GLN A 1 469  ? -19.687 84.377 0.305   1.00 93.14  ? 466  GLN A N   1 
ATOM 3637 C CA  . GLN A 1 469  ? -20.992 83.721 0.279   1.00 93.14  ? 466  GLN A CA  1 
ATOM 3638 C C   . GLN A 1 469  ? -21.265 82.898 -0.996  1.00 93.14  ? 466  GLN A C   1 
ATOM 3639 O O   . GLN A 1 469  ? -22.313 83.073 -1.614  1.00 93.14  ? 466  GLN A O   1 
ATOM 3640 C CB  . GLN A 1 469  ? -22.121 84.762 0.412   1.00 109.99 ? 466  GLN A CB  1 
ATOM 3641 C CG  . GLN A 1 469  ? -22.354 85.411 1.770   1.00 109.99 ? 466  GLN A CG  1 
ATOM 3642 C CD  . GLN A 1 469  ? -23.516 86.424 1.723   1.00 109.99 ? 466  GLN A CD  1 
ATOM 3643 O OE1 . GLN A 1 469  ? -24.515 86.273 2.431   1.00 109.99 ? 466  GLN A OE1 1 
ATOM 3644 N NE2 . GLN A 1 469  ? -23.390 87.446 0.870   1.00 109.99 ? 466  GLN A NE2 1 
ATOM 3645 N N   . GLN A 1 470  ? -20.369 82.002 -1.400  1.00 169.05 ? 467  GLN A N   1 
ATOM 3646 C CA  . GLN A 1 470  ? -20.662 81.159 -2.582  1.00 169.05 ? 467  GLN A CA  1 
ATOM 3647 C C   . GLN A 1 470  ? -20.039 79.744 -2.597  1.00 169.05 ? 467  GLN A C   1 
ATOM 3648 O O   . GLN A 1 470  ? -19.106 79.456 -1.845  1.00 169.05 ? 467  GLN A O   1 
ATOM 3649 C CB  . GLN A 1 470  ? -20.403 81.918 -3.904  1.00 115.65 ? 467  GLN A CB  1 
ATOM 3650 C CG  . GLN A 1 470  ? -19.137 82.774 -3.952  1.00 115.65 ? 467  GLN A CG  1 
ATOM 3651 C CD  . GLN A 1 470  ? -19.256 83.923 -4.931  1.00 115.65 ? 467  GLN A CD  1 
ATOM 3652 O OE1 . GLN A 1 470  ? -18.348 84.166 -5.725  1.00 115.65 ? 467  GLN A OE1 1 
ATOM 3653 N NE2 . GLN A 1 470  ? -20.385 84.636 -4.882  1.00 115.65 ? 467  GLN A NE2 1 
ATOM 3654 N N   . LEU A 1 471  ? -20.580 78.869 -3.449  1.00 172.64 ? 468  LEU A N   1 
ATOM 3655 C CA  . LEU A 1 471  ? -20.104 77.486 -3.573  1.00 172.64 ? 468  LEU A CA  1 
ATOM 3656 C C   . LEU A 1 471  ? -19.631 77.189 -4.998  1.00 172.64 ? 468  LEU A C   1 
ATOM 3657 O O   . LEU A 1 471  ? -20.340 77.477 -5.963  1.00 172.64 ? 468  LEU A O   1 
ATOM 3658 C CB  . LEU A 1 471  ? -21.202 76.482 -3.192  1.00 107.38 ? 468  LEU A CB  1 
ATOM 3659 C CG  . LEU A 1 471  ? -22.415 76.834 -2.307  1.00 107.38 ? 468  LEU A CG  1 
ATOM 3660 C CD1 . LEU A 1 471  ? -23.516 75.768 -2.437  1.00 107.38 ? 468  LEU A CD1 1 
ATOM 3661 C CD2 . LEU A 1 471  ? -22.062 77.071 -0.831  1.00 107.38 ? 468  LEU A CD2 1 
ATOM 3662 N N   . ILE A 1 472  ? -18.443 76.594 -5.116  1.00 127.14 ? 469  ILE A N   1 
ATOM 3663 C CA  . ILE A 1 472  ? -17.814 76.283 -6.413  1.00 127.14 ? 469  ILE A CA  1 
ATOM 3664 C C   . ILE A 1 472  ? -18.034 74.831 -6.843  1.00 127.14 ? 469  ILE A C   1 
ATOM 3665 O O   . ILE A 1 472  ? -18.252 73.959 -6.014  1.00 127.14 ? 469  ILE A O   1 
ATOM 3666 C CB  . ILE A 1 472  ? -16.279 76.628 -6.395  1.00 65.61  ? 469  ILE A CB  1 
ATOM 3667 C CG1 . ILE A 1 472  ? -15.625 76.471 -7.786  1.00 65.61  ? 469  ILE A CG1 1 
ATOM 3668 C CG2 . ILE A 1 472  ? -15.544 75.842 -5.285  1.00 65.61  ? 469  ILE A CG2 1 
ATOM 3669 C CD1 . ILE A 1 472  ? -14.833 75.191 -7.955  1.00 65.61  ? 469  ILE A CD1 1 
ATOM 3670 N N   . GLN A 1 473  ? -18.003 74.598 -8.151  1.00 93.93  ? 470  GLN A N   1 
ATOM 3671 C CA  . GLN A 1 473  ? -17.930 73.258 -8.719  1.00 93.93  ? 470  GLN A CA  1 
ATOM 3672 C C   . GLN A 1 473  ? -17.082 73.271 -10.001 1.00 93.93  ? 470  GLN A C   1 
ATOM 3673 O O   . GLN A 1 473  ? -17.564 73.662 -11.059 1.00 93.93  ? 470  GLN A O   1 
ATOM 3674 C CB  . GLN A 1 473  ? -19.327 72.699 -9.009  1.00 104.48 ? 470  GLN A CB  1 
ATOM 3675 C CG  . GLN A 1 473  ? -19.347 71.208 -9.386  1.00 104.48 ? 470  GLN A CG  1 
ATOM 3676 C CD  . GLN A 1 473  ? -20.522 70.817 -10.280 1.00 104.48 ? 470  GLN A CD  1 
ATOM 3677 O OE1 . GLN A 1 473  ? -21.151 71.672 -10.911 1.00 104.48 ? 470  GLN A OE1 1 
ATOM 3678 N NE2 . GLN A 1 473  ? -20.815 69.516 -10.346 1.00 104.48 ? 470  GLN A NE2 1 
ATOM 3679 N N   . ILE A 1 474  ? -15.819 72.857 -9.905  1.00 87.90  ? 471  ILE A N   1 
ATOM 3680 C CA  . ILE A 1 474  ? -15.014 72.662 -11.101 1.00 87.90  ? 471  ILE A CA  1 
ATOM 3681 C C   . ILE A 1 474  ? -15.356 71.306 -11.708 1.00 87.90  ? 471  ILE A C   1 
ATOM 3682 O O   . ILE A 1 474  ? -15.205 70.262 -11.074 1.00 87.90  ? 471  ILE A O   1 
ATOM 3683 C CB  . ILE A 1 474  ? -13.502 72.780 -10.841 1.00 58.20  ? 471  ILE A CB  1 
ATOM 3684 C CG1 . ILE A 1 474  ? -13.180 74.165 -10.261 1.00 58.20  ? 471  ILE A CG1 1 
ATOM 3685 C CG2 . ILE A 1 474  ? -12.752 72.510 -12.149 1.00 58.20  ? 471  ILE A CG2 1 
ATOM 3686 C CD1 . ILE A 1 474  ? -11.805 74.346 -9.697  1.00 58.20  ? 471  ILE A CD1 1 
ATOM 3687 N N   . THR A 1 475  ? -15.849 71.337 -12.937 1.00 82.23  ? 472  THR A N   1 
ATOM 3688 C CA  . THR A 1 475  ? -16.283 70.119 -13.617 1.00 82.23  ? 472  THR A CA  1 
ATOM 3689 C C   . THR A 1 475  ? -15.303 69.813 -14.778 1.00 82.23  ? 472  THR A C   1 
ATOM 3690 O O   . THR A 1 475  ? -14.376 70.620 -15.049 1.00 82.23  ? 472  THR A O   1 
ATOM 3691 C CB  . THR A 1 475  ? -17.827 70.194 -14.001 1.00 114.54 ? 472  THR A CB  1 
ATOM 3692 O OG1 . THR A 1 475  ? -18.337 68.895 -14.314 1.00 114.54 ? 472  THR A OG1 1 
ATOM 3693 C CG2 . THR A 1 475  ? -18.110 71.139 -15.150 1.00 114.54 ? 472  THR A CG2 1 
ATOM 3694 N N   . SER A 1 476  ? -15.462 68.645 -15.413 1.00 97.44  ? 473  SER A N   1 
ATOM 3695 C CA  . SER A 1 476  ? -14.695 68.292 -16.612 1.00 97.44  ? 473  SER A CA  1 
ATOM 3696 C C   . SER A 1 476  ? -14.643 69.543 -17.455 1.00 97.44  ? 473  SER A C   1 
ATOM 3697 O O   . SER A 1 476  ? -13.579 70.031 -17.830 1.00 97.44  ? 473  SER A O   1 
ATOM 3698 C CB  . SER A 1 476  ? -15.401 67.194 -17.425 1.00 113.44 ? 473  SER A CB  1 
ATOM 3699 O OG  . SER A 1 476  ? -15.874 66.121 -16.623 1.00 113.44 ? 473  SER A OG  1 
ATOM 3700 N N   . ALA A 1 477  ? -15.834 70.067 -17.710 1.00 127.19 ? 474  ALA A N   1 
ATOM 3701 C CA  . ALA A 1 477  ? -16.033 71.277 -18.471 1.00 127.19 ? 474  ALA A CA  1 
ATOM 3702 C C   . ALA A 1 477  ? -15.556 72.534 -17.726 1.00 127.19 ? 474  ALA A C   1 
ATOM 3703 O O   . ALA A 1 477  ? -14.369 72.859 -17.739 1.00 127.19 ? 474  ALA A O   1 
ATOM 3704 C CB  . ALA A 1 477  ? -17.499 71.385 -18.835 1.00 50.82  ? 474  ALA A CB  1 
ATOM 3705 N N   . SER A 1 478  ? -16.487 73.205 -17.054 1.00 93.09  ? 475  SER A N   1 
ATOM 3706 C CA  . SER A 1 478  ? -16.313 74.576 -16.603 1.00 93.09  ? 475  SER A CA  1 
ATOM 3707 C C   . SER A 1 478  ? -16.212 74.688 -15.096 1.00 93.09  ? 475  SER A C   1 
ATOM 3708 O O   . SER A 1 478  ? -16.884 73.959 -14.378 1.00 93.09  ? 475  SER A O   1 
ATOM 3709 C CB  . SER A 1 478  ? -17.532 75.378 -17.062 1.00 162.34 ? 475  SER A CB  1 
ATOM 3710 O OG  . SER A 1 478  ? -18.738 74.782 -16.603 1.00 162.34 ? 475  SER A OG  1 
ATOM 3711 N N   . VAL A 1 479  ? -15.389 75.613 -14.614 1.00 90.32  ? 476  VAL A N   1 
ATOM 3712 C CA  . VAL A 1 479  ? -15.455 76.013 -13.208 1.00 90.32  ? 476  VAL A CA  1 
ATOM 3713 C C   . VAL A 1 479  ? -16.782 76.788 -12.990 1.00 90.32  ? 476  VAL A C   1 
ATOM 3714 O O   . VAL A 1 479  ? -16.890 77.947 -13.391 1.00 90.32  ? 476  VAL A O   1 
ATOM 3715 C CB  . VAL A 1 479  ? -14.124 76.749 -12.732 1.00 97.21  ? 476  VAL A CB  1 
ATOM 3716 C CG1 . VAL A 1 479  ? -13.231 77.056 -13.893 1.00 97.21  ? 476  VAL A CG1 1 
ATOM 3717 C CG2 . VAL A 1 479  ? -14.371 78.014 -11.891 1.00 97.21  ? 476  VAL A CG2 1 
ATOM 3718 N N   . ARG A 1 480  ? -17.789 76.112 -12.404 1.00 95.21  ? 477  ARG A N   1 
ATOM 3719 C CA  . ARG A 1 480  ? -19.167 76.644 -12.182 1.00 95.21  ? 477  ARG A CA  1 
ATOM 3720 C C   . ARG A 1 480  ? -19.307 77.505 -10.918 1.00 95.21  ? 477  ARG A C   1 
ATOM 3721 O O   . ARG A 1 480  ? -18.344 77.673 -10.179 1.00 95.21  ? 477  ARG A O   1 
ATOM 3722 C CB  . ARG A 1 480  ? -20.200 75.510 -12.147 1.00 172.15 ? 477  ARG A CB  1 
ATOM 3723 C CG  . ARG A 1 480  ? -20.348 74.745 -13.447 1.00 172.15 ? 477  ARG A CG  1 
ATOM 3724 C CD  . ARG A 1 480  ? -21.561 73.826 -13.410 1.00 172.15 ? 477  ARG A CD  1 
ATOM 3725 N NE  . ARG A 1 480  ? -22.821 74.554 -13.580 1.00 172.15 ? 477  ARG A NE  1 
ATOM 3726 C CZ  . ARG A 1 480  ? -24.015 73.982 -13.742 1.00 172.15 ? 477  ARG A CZ  1 
ATOM 3727 N NH1 . ARG A 1 480  ? -24.138 72.662 -13.745 1.00 172.15 ? 477  ARG A NH1 1 
ATOM 3728 N NH2 . ARG A 1 480  ? -25.096 74.737 -13.891 1.00 172.15 ? 477  ARG A NH2 1 
ATOM 3729 N N   . LEU A 1 481  ? -20.497 78.064 -10.679 1.00 125.84 ? 478  LEU A N   1 
ATOM 3730 C CA  . LEU A 1 481  ? -20.703 78.969 -9.530  1.00 125.84 ? 478  LEU A CA  1 
ATOM 3731 C C   . LEU A 1 481  ? -22.139 79.015 -9.007  1.00 125.84 ? 478  LEU A C   1 
ATOM 3732 O O   . LEU A 1 481  ? -23.091 79.126 -9.787  1.00 125.84 ? 478  LEU A O   1 
ATOM 3733 C CB  . LEU A 1 481  ? -20.204 80.400 -9.836  1.00 86.09  ? 478  LEU A CB  1 
ATOM 3734 C CG  . LEU A 1 481  ? -19.951 81.404 -8.693  1.00 86.09  ? 478  LEU A CG  1 
ATOM 3735 C CD1 . LEU A 1 481  ? -18.823 81.019 -7.725  1.00 86.09  ? 478  LEU A CD1 1 
ATOM 3736 C CD2 . LEU A 1 481  ? -19.651 82.763 -9.256  1.00 86.09  ? 478  LEU A CD2 1 
ATOM 3737 N N   . VAL A 1 482  ? -22.257 78.925 -7.677  1.00 146.21 ? 479  VAL A N   1 
ATOM 3738 C CA  . VAL A 1 482  ? -23.522 79.021 -6.927  1.00 146.21 ? 479  VAL A CA  1 
ATOM 3739 C C   . VAL A 1 482  ? -23.296 79.866 -5.681  1.00 146.21 ? 479  VAL A C   1 
ATOM 3740 O O   . VAL A 1 482  ? -22.219 79.832 -5.093  1.00 146.21 ? 479  VAL A O   1 
ATOM 3741 C CB  . VAL A 1 482  ? -24.054 77.627 -6.501  1.00 103.76 ? 479  VAL A CB  1 
ATOM 3742 C CG1 . VAL A 1 482  ? -25.239 77.731 -5.516  1.00 103.76 ? 479  VAL A CG1 1 
ATOM 3743 C CG2 . VAL A 1 482  ? -24.459 76.845 -7.711  1.00 103.76 ? 479  VAL A CG2 1 
ATOM 3744 N N   . SER A 1 483  ? -24.319 80.610 -5.275  1.00 145.24 ? 480  SER A N   1 
ATOM 3745 C CA  . SER A 1 483  ? -24.183 81.525 -4.154  1.00 145.24 ? 480  SER A CA  1 
ATOM 3746 C C   . SER A 1 483  ? -24.830 81.022 -2.878  1.00 145.24 ? 480  SER A C   1 
ATOM 3747 O O   . SER A 1 483  ? -25.441 79.952 -2.847  1.00 145.24 ? 480  SER A O   1 
ATOM 3748 C CB  . SER A 1 483  ? -24.755 82.897 -4.505  1.00 91.67  ? 480  SER A CB  1 
ATOM 3749 O OG  . SER A 1 483  ? -23.849 83.683 -5.268  1.00 91.67  ? 480  SER A OG  1 
ATOM 3750 N N   . GLN A 1 484  ? -24.662 81.817 -1.826  1.00 210.35 ? 481  GLN A N   1 
ATOM 3751 C CA  . GLN A 1 484  ? -25.339 81.619 -0.554  1.00 210.35 ? 481  GLN A CA  1 
ATOM 3752 C C   . GLN A 1 484  ? -26.565 82.524 -0.506  1.00 210.35 ? 481  GLN A C   1 
ATOM 3753 O O   . GLN A 1 484  ? -27.642 82.110 -0.055  1.00 210.35 ? 481  GLN A O   1 
ATOM 3754 C CB  . GLN A 1 484  ? -24.392 81.939 0.604   1.00 114.16 ? 481  GLN A CB  1 
ATOM 3755 C CG  . GLN A 1 484  ? -23.151 81.072 0.653   1.00 114.16 ? 481  GLN A CG  1 
ATOM 3756 C CD  . GLN A 1 484  ? -23.421 79.669 1.129   1.00 114.16 ? 481  GLN A CD  1 
ATOM 3757 O OE1 . GLN A 1 484  ? -24.325 78.985 0.645   1.00 114.16 ? 481  GLN A OE1 1 
ATOM 3758 N NE2 . GLN A 1 484  ? -22.618 79.219 2.078   1.00 114.16 ? 481  GLN A NE2 1 
ATOM 3759 N N   . GLU A 1 485  ? -26.389 83.761 -0.975  1.00 185.55 ? 482  GLU A N   1 
ATOM 3760 C CA  . GLU A 1 485  ? -27.517 84.654 -1.206  1.00 185.55 ? 482  GLU A CA  1 
ATOM 3761 C C   . GLU A 1 485  ? -28.289 84.221 -2.476  1.00 185.55 ? 482  GLU A C   1 
ATOM 3762 O O   . GLU A 1 485  ? -29.372 83.638 -2.346  1.00 185.55 ? 482  GLU A O   1 
ATOM 3763 C CB  . GLU A 1 485  ? -27.079 86.129 -1.237  1.00 189.72 ? 482  GLU A CB  1 
ATOM 3764 C CG  . GLU A 1 485  ? -26.615 86.696 0.123   1.00 189.72 ? 482  GLU A CG  1 
ATOM 3765 C CD  . GLU A 1 485  ? -27.750 86.854 1.164   1.00 189.72 ? 482  GLU A CD  1 
ATOM 3766 O OE1 . GLU A 1 485  ? -28.974 86.749 0.781   1.00 189.72 ? 482  GLU A OE1 1 
ATOM 3767 O OE2 . GLU A 1 485  ? -27.529 87.089 2.398   1.00 189.72 ? 482  GLU A OE2 1 
ATOM 3768 N N   . PRO A 1 486  ? -27.745 84.492 -3.697  1.00 210.35 ? 483  PRO A N   1 
ATOM 3769 C CA  . PRO A 1 486  ? -28.389 83.966 -4.916  1.00 210.35 ? 483  PRO A CA  1 
ATOM 3770 C C   . PRO A 1 486  ? -28.663 82.459 -4.895  1.00 210.35 ? 483  PRO A C   1 
ATOM 3771 O O   . PRO A 1 486  ? -29.833 82.064 -4.903  1.00 210.35 ? 483  PRO A O   1 
ATOM 3772 C CB  . PRO A 1 486  ? -27.397 84.328 -6.031  1.00 179.91 ? 483  PRO A CB  1 
ATOM 3773 C CG  . PRO A 1 486  ? -26.718 85.545 -5.530  1.00 179.91 ? 483  PRO A CG  1 
ATOM 3774 C CD  . PRO A 1 486  ? -26.574 85.329 -4.037  1.00 179.91 ? 483  PRO A CD  1 
ATOM 3775 N N   . LYS A 1 487  ? -27.611 81.634 -4.853  1.00 135.31 ? 484  LYS A N   1 
ATOM 3776 C CA  . LYS A 1 487  ? -27.767 80.179 -4.912  1.00 135.31 ? 484  LYS A CA  1 
ATOM 3777 C C   . LYS A 1 487  ? -28.403 79.782 -6.255  1.00 135.31 ? 484  LYS A C   1 
ATOM 3778 O O   . LYS A 1 487  ? -29.532 79.292 -6.312  1.00 135.31 ? 484  LYS A O   1 
ATOM 3779 C CB  . LYS A 1 487  ? -28.547 79.661 -3.672  1.00 107.83 ? 484  LYS A CB  1 
ATOM 3780 C CG  . LYS A 1 487  ? -29.271 78.296 -3.794  1.00 107.83 ? 484  LYS A CG  1 
ATOM 3781 C CD  . LYS A 1 487  ? -28.325 77.095 -3.840  1.00 107.83 ? 484  LYS A CD  1 
ATOM 3782 C CE  . LYS A 1 487  ? -28.328 76.330 -2.537  1.00 107.83 ? 484  LYS A CE  1 
ATOM 3783 N NZ  . LYS A 1 487  ? -27.359 75.207 -2.600  1.00 107.83 ? 484  LYS A NZ  1 
ATOM 3784 N N   . ALA A 1 488  ? -27.674 80.033 -7.340  1.00 203.21 ? 485  ALA A N   1 
ATOM 3785 C CA  . ALA A 1 488  ? -28.173 79.727 -8.678  1.00 203.21 ? 485  ALA A CA  1 
ATOM 3786 C C   . ALA A 1 488  ? -27.492 80.533 -9.788  1.00 203.21 ? 485  ALA A C   1 
ATOM 3787 O O   . ALA A 1 488  ? -27.687 81.742 -9.908  1.00 203.21 ? 485  ALA A O   1 
ATOM 3788 C CB  . ALA A 1 488  ? -29.684 79.920 -8.734  1.00 140.96 ? 485  ALA A CB  1 
ATOM 3789 N N   . LEU A 1 489  ? -26.700 79.838 -10.599 1.00 163.95 ? 486  LEU A N   1 
ATOM 3790 C CA  . LEU A 1 489  ? -26.070 80.404 -11.792 1.00 163.95 ? 486  LEU A CA  1 
ATOM 3791 C C   . LEU A 1 489  ? -25.027 81.541 -11.731 1.00 163.95 ? 486  LEU A C   1 
ATOM 3792 O O   . LEU A 1 489  ? -24.385 81.856 -12.739 1.00 163.95 ? 486  LEU A O   1 
ATOM 3793 C CB  . LEU A 1 489  ? -26.854 80.391 -13.132 1.00 115.38 ? 486  LEU A CB  1 
ATOM 3794 C CG  . LEU A 1 489  ? -26.247 79.929 -14.476 1.00 115.38 ? 486  LEU A CG  1 
ATOM 3795 C CD1 . LEU A 1 489  ? -25.328 78.700 -14.357 1.00 115.38 ? 486  LEU A CD1 1 
ATOM 3796 C CD2 . LEU A 1 489  ? -27.306 79.717 -15.558 1.00 115.38 ? 486  LEU A CD2 1 
ATOM 3797 N N   . VAL A 1 490  ? -24.852 82.118 -10.534 1.00 140.18 ? 487  VAL A N   1 
ATOM 3798 C CA  . VAL A 1 490  ? -24.013 83.323 -10.270 1.00 140.18 ? 487  VAL A CA  1 
ATOM 3799 C C   . VAL A 1 490  ? -23.003 83.676 -11.370 1.00 140.18 ? 487  VAL A C   1 
ATOM 3800 O O   . VAL A 1 490  ? -23.029 84.785 -11.911 1.00 140.18 ? 487  VAL A O   1 
ATOM 3801 C CB  . VAL A 1 490  ? -23.285 83.235 -8.885  1.00 76.60  ? 487  VAL A CB  1 
ATOM 3802 C CG1 . VAL A 1 490  ? -22.672 84.572 -8.484  1.00 76.60  ? 487  VAL A CG1 1 
ATOM 3803 C CG2 . VAL A 1 490  ? -24.250 82.769 -7.828  1.00 76.60  ? 487  VAL A CG2 1 
ATOM 3804 N N   . SER A 1 491  ? -22.117 82.730 -11.679 1.00 168.16 ? 488  SER A N   1 
ATOM 3805 C CA  . SER A 1 491  ? -21.169 82.858 -12.786 1.00 168.16 ? 488  SER A CA  1 
ATOM 3806 C C   . SER A 1 491  ? -20.806 81.471 -13.345 1.00 168.16 ? 488  SER A C   1 
ATOM 3807 O O   . SER A 1 491  ? -21.422 80.459 -12.974 1.00 168.16 ? 488  SER A O   1 
ATOM 3808 C CB  . SER A 1 491  ? -19.920 83.648 -12.353 1.00 175.80 ? 488  SER A CB  1 
ATOM 3809 O OG  . SER A 1 491  ? -19.113 84.032 -13.456 1.00 175.80 ? 488  SER A OG  1 
ATOM 3810 N N   . GLU A 1 492  ? -19.817 81.447 -14.242 1.00 119.77 ? 489  GLU A N   1 
ATOM 3811 C CA  . GLU A 1 492  ? -19.381 80.242 -14.953 1.00 119.77 ? 489  GLU A CA  1 
ATOM 3812 C C   . GLU A 1 492  ? -18.185 80.545 -15.869 1.00 119.77 ? 489  GLU A C   1 
ATOM 3813 O O   . GLU A 1 492  ? -18.248 81.437 -16.724 1.00 119.77 ? 489  GLU A O   1 
ATOM 3814 C CB  . GLU A 1 492  ? -20.529 79.658 -15.772 1.00 113.44 ? 489  GLU A CB  1 
ATOM 3815 C CG  . GLU A 1 492  ? -20.207 78.347 -16.424 1.00 113.44 ? 489  GLU A CG  1 
ATOM 3816 C CD  . GLU A 1 492  ? -21.449 77.568 -16.749 1.00 113.44 ? 489  GLU A CD  1 
ATOM 3817 O OE1 . GLU A 1 492  ? -22.563 78.094 -16.514 1.00 113.44 ? 489  GLU A OE1 1 
ATOM 3818 O OE2 . GLU A 1 492  ? -21.309 76.424 -17.236 1.00 113.44 ? 489  GLU A OE2 1 
ATOM 3819 N N   . TRP A 1 493  ? -17.096 79.808 -15.670 1.00 210.35 ? 490  TRP A N   1 
ATOM 3820 C CA  . TRP A 1 493  ? -15.923 79.909 -16.528 1.00 210.35 ? 490  TRP A CA  1 
ATOM 3821 C C   . TRP A 1 493  ? -16.003 78.747 -17.502 1.00 210.35 ? 490  TRP A C   1 
ATOM 3822 O O   . TRP A 1 493  ? -16.644 77.741 -17.219 1.00 210.35 ? 490  TRP A O   1 
ATOM 3823 C CB  . TRP A 1 493  ? -14.646 79.823 -15.691 1.00 109.94 ? 490  TRP A CB  1 
ATOM 3824 C CG  . TRP A 1 493  ? -13.428 80.495 -16.275 1.00 109.94 ? 490  TRP A CG  1 
ATOM 3825 C CD1 . TRP A 1 493  ? -13.005 81.765 -16.031 1.00 109.94 ? 490  TRP A CD1 1 
ATOM 3826 C CD2 . TRP A 1 493  ? -12.453 79.910 -17.153 1.00 109.94 ? 490  TRP A CD2 1 
ATOM 3827 N NE1 . TRP A 1 493  ? -11.842 82.017 -16.714 1.00 109.94 ? 490  TRP A NE1 1 
ATOM 3828 C CE2 . TRP A 1 493  ? -11.480 80.896 -17.411 1.00 109.94 ? 490  TRP A CE2 1 
ATOM 3829 C CE3 . TRP A 1 493  ? -12.311 78.646 -17.752 1.00 109.94 ? 490  TRP A CE3 1 
ATOM 3830 C CZ2 . TRP A 1 493  ? -10.379 80.665 -18.241 1.00 109.94 ? 490  TRP A CZ2 1 
ATOM 3831 C CZ3 . TRP A 1 493  ? -11.215 78.416 -18.579 1.00 109.94 ? 490  TRP A CZ3 1 
ATOM 3832 C CH2 . TRP A 1 493  ? -10.267 79.424 -18.817 1.00 109.94 ? 490  TRP A CH2 1 
ATOM 3833 N N   . LYS A 1 494  ? -15.362 78.902 -18.653 1.00 185.07 ? 491  LYS A N   1 
ATOM 3834 C CA  . LYS A 1 494  ? -15.426 77.921 -19.723 1.00 185.07 ? 491  LYS A CA  1 
ATOM 3835 C C   . LYS A 1 494  ? -14.232 78.210 -20.617 1.00 185.07 ? 491  LYS A C   1 
ATOM 3836 O O   . LYS A 1 494  ? -13.951 79.369 -20.919 1.00 185.07 ? 491  LYS A O   1 
ATOM 3837 C CB  . LYS A 1 494  ? -16.736 78.096 -20.494 1.00 103.02 ? 491  LYS A CB  1 
ATOM 3838 C CG  . LYS A 1 494  ? -17.040 77.047 -21.539 1.00 103.02 ? 491  LYS A CG  1 
ATOM 3839 C CD  . LYS A 1 494  ? -17.906 75.941 -20.972 1.00 103.02 ? 491  LYS A CD  1 
ATOM 3840 C CE  . LYS A 1 494  ? -18.107 74.859 -22.018 1.00 103.02 ? 491  LYS A CE  1 
ATOM 3841 N NZ  . LYS A 1 494  ? -18.418 73.530 -21.412 1.00 103.02 ? 491  LYS A NZ  1 
ATOM 3842 N N   . GLU A 1 495  ? -13.520 77.166 -21.028 1.00 109.05 ? 492  GLU A N   1 
ATOM 3843 C CA  . GLU A 1 495  ? -12.268 77.345 -21.768 1.00 109.05 ? 492  GLU A CA  1 
ATOM 3844 C C   . GLU A 1 495  ? -12.473 77.824 -23.215 1.00 109.05 ? 492  GLU A C   1 
ATOM 3845 O O   . GLU A 1 495  ? -13.205 77.177 -23.980 1.00 109.05 ? 492  GLU A O   1 
ATOM 3846 C CB  . GLU A 1 495  ? -11.418 76.069 -21.715 1.00 137.28 ? 492  GLU A CB  1 
ATOM 3847 C CG  . GLU A 1 495  ? -9.931  76.272 -22.039 1.00 137.28 ? 492  GLU A CG  1 
ATOM 3848 C CD  . GLU A 1 495  ? -9.550  75.862 -23.460 1.00 137.28 ? 492  GLU A CD  1 
ATOM 3849 O OE1 . GLU A 1 495  ? -10.271 76.243 -24.409 1.00 137.28 ? 492  GLU A OE1 1 
ATOM 3850 O OE2 . GLU A 1 495  ? -8.519  75.156 -23.632 1.00 137.28 ? 492  GLU A OE2 1 
ATOM 3851 N N   . PRO A 1 496  ? -11.819 78.956 -23.588 1.00 164.66 ? 493  PRO A N   1 
ATOM 3852 C CA  . PRO A 1 496  ? -11.912 79.526 -24.935 1.00 164.66 ? 493  PRO A CA  1 
ATOM 3853 C C   . PRO A 1 496  ? -11.382 78.587 -26.015 1.00 164.66 ? 493  PRO A C   1 
ATOM 3854 O O   . PRO A 1 496  ? -10.275 78.799 -26.523 1.00 164.66 ? 493  PRO A O   1 
ATOM 3855 C CB  . PRO A 1 496  ? -11.041 80.794 -24.850 1.00 80.51  ? 493  PRO A CB  1 
ATOM 3856 C CG  . PRO A 1 496  ? -10.142 80.587 -23.697 1.00 80.51  ? 493  PRO A CG  1 
ATOM 3857 C CD  . PRO A 1 496  ? -10.954 79.779 -22.719 1.00 80.51  ? 493  PRO A CD  1 
ATOM 3858 N N   . GLN A 1 497  ? -12.172 77.553 -26.329 1.00 80.50  ? 494  GLN A N   1 
ATOM 3859 C CA  . GLN A 1 497  ? -11.893 76.573 -27.400 1.00 80.50  ? 494  GLN A CA  1 
ATOM 3860 C C   . GLN A 1 497  ? -12.864 75.386 -27.399 1.00 80.50  ? 494  GLN A C   1 
ATOM 3861 O O   . GLN A 1 497  ? -12.828 74.554 -28.323 1.00 80.50  ? 494  GLN A O   1 
ATOM 3862 C CB  . GLN A 1 497  ? -10.449 76.034 -27.341 1.00 110.78 ? 494  GLN A CB  1 
ATOM 3863 C CG  . GLN A 1 497  ? -9.436  76.771 -28.211 1.00 110.78 ? 494  GLN A CG  1 
ATOM 3864 C CD  . GLN A 1 497  ? -9.647  76.560 -29.706 1.00 110.78 ? 494  GLN A CD  1 
ATOM 3865 O OE1 . GLN A 1 497  ? -10.753 76.260 -30.174 1.00 110.78 ? 494  GLN A OE1 1 
ATOM 3866 N NE2 . GLN A 1 497  ? -8.574  76.722 -30.464 1.00 110.78 ? 494  GLN A NE2 1 
ATOM 3867 N N   . ALA A 1 498  ? -13.716 75.319 -26.368 1.00 176.54 ? 495  ALA A N   1 
ATOM 3868 C CA  . ALA A 1 498  ? -14.498 74.121 -26.025 1.00 176.54 ? 495  ALA A CA  1 
ATOM 3869 C C   . ALA A 1 498  ? -13.563 72.958 -25.683 1.00 176.54 ? 495  ALA A C   1 
ATOM 3870 O O   . ALA A 1 498  ? -13.493 71.966 -26.416 1.00 176.54 ? 495  ALA A O   1 
ATOM 3871 C CB  . ALA A 1 498  ? -15.454 73.744 -27.146 1.00 70.55  ? 495  ALA A CB  1 
ATOM 3872 N N   . LYS A 1 499  ? -12.848 73.100 -24.564 1.00 101.09 ? 496  LYS A N   1 
ATOM 3873 C CA  . LYS A 1 499  ? -11.752 72.184 -24.168 1.00 101.09 ? 496  LYS A CA  1 
ATOM 3874 C C   . LYS A 1 499  ? -11.614 72.061 -22.649 1.00 101.09 ? 496  LYS A C   1 
ATOM 3875 O O   . LYS A 1 499  ? -11.595 73.060 -21.933 1.00 101.09 ? 496  LYS A O   1 
ATOM 3876 C CB  . LYS A 1 499  ? -10.393 72.626 -24.767 1.00 80.63  ? 496  LYS A CB  1 
ATOM 3877 C CG  . LYS A 1 499  ? -9.762  71.697 -25.855 1.00 80.63  ? 496  LYS A CG  1 
ATOM 3878 C CD  . LYS A 1 499  ? -8.247  71.942 -25.994 1.00 80.63  ? 496  LYS A CD  1 
ATOM 3879 C CE  . LYS A 1 499  ? -7.896  73.438 -26.214 1.00 80.63  ? 496  LYS A CE  1 
ATOM 3880 N NZ  . LYS A 1 499  ? -6.709  73.888 -25.436 1.00 80.63  ? 496  LYS A NZ  1 
ATOM 3881 N N   . ASN A 1 500  ? -11.464 70.829 -22.179 1.00 97.59  ? 497  ASN A N   1 
ATOM 3882 C CA  . ASN A 1 500  ? -11.585 70.524 -20.762 1.00 97.59  ? 497  ASN A CA  1 
ATOM 3883 C C   . ASN A 1 500  ? -10.499 71.063 -19.844 1.00 97.59  ? 497  ASN A C   1 
ATOM 3884 O O   . ASN A 1 500  ? -9.378  71.375 -20.273 1.00 97.59  ? 497  ASN A O   1 
ATOM 3885 C CB  . ASN A 1 500  ? -11.729 69.016 -20.562 1.00 103.88 ? 497  ASN A CB  1 
ATOM 3886 C CG  . ASN A 1 500  ? -13.096 68.503 -20.979 1.00 103.88 ? 497  ASN A CG  1 
ATOM 3887 O OD1 . ASN A 1 500  ? -14.125 69.101 -20.662 1.00 103.88 ? 497  ASN A OD1 1 
ATOM 3888 N ND2 . ASN A 1 500  ? -13.114 67.381 -21.689 1.00 103.88 ? 497  ASN A ND2 1 
ATOM 3889 N N   . ILE A 1 501  ? -10.882 71.203 -18.576 1.00 167.34 ? 498  ILE A N   1 
ATOM 3890 C CA  . ILE A 1 501  ? -9.948  71.338 -17.469 1.00 167.34 ? 498  ILE A CA  1 
ATOM 3891 C C   . ILE A 1 501  ? -9.462  69.926 -17.133 1.00 167.34 ? 498  ILE A C   1 
ATOM 3892 O O   . ILE A 1 501  ? -10.269 68.998 -16.985 1.00 167.34 ? 498  ILE A O   1 
ATOM 3893 C CB  . ILE A 1 501  ? -10.622 71.937 -16.209 1.00 123.56 ? 498  ILE A CB  1 
ATOM 3894 C CG1 . ILE A 1 501  ? -11.280 73.286 -16.517 1.00 123.56 ? 498  ILE A CG1 1 
ATOM 3895 C CG2 . ILE A 1 501  ? -9.600  72.064 -15.080 1.00 123.56 ? 498  ILE A CG2 1 
ATOM 3896 C CD1 . ILE A 1 501  ? -12.456 73.611 -15.604 1.00 123.56 ? 498  ILE A CD1 1 
ATOM 3897 N N   . SER A 1 502  ? -8.147  69.765 -17.025 1.00 75.05  ? 499  SER A N   1 
ATOM 3898 C CA  . SER A 1 502  ? -7.571  68.473 -16.682 1.00 75.05  ? 499  SER A CA  1 
ATOM 3899 C C   . SER A 1 502  ? -7.263  68.339 -15.172 1.00 75.05  ? 499  SER A C   1 
ATOM 3900 O O   . SER A 1 502  ? -7.686  67.373 -14.554 1.00 75.05  ? 499  SER A O   1 
ATOM 3901 C CB  . SER A 1 502  ? -6.364  68.156 -17.575 1.00 69.30  ? 499  SER A CB  1 
ATOM 3902 O OG  . SER A 1 502  ? -5.383  69.167 -17.488 1.00 69.30  ? 499  SER A OG  1 
ATOM 3903 N N   . VAL A 1 503  ? -6.570  69.317 -14.592 1.00 83.15  ? 500  VAL A N   1 
ATOM 3904 C CA  . VAL A 1 503  ? -6.167  69.282 -13.188 1.00 83.15  ? 500  VAL A CA  1 
ATOM 3905 C C   . VAL A 1 503  ? -6.890  70.410 -12.467 1.00 83.15  ? 500  VAL A C   1 
ATOM 3906 O O   . VAL A 1 503  ? -6.706  71.575 -12.820 1.00 83.15  ? 500  VAL A O   1 
ATOM 3907 C CB  . VAL A 1 503  ? -4.590  69.434 -13.015 1.00 57.70  ? 500  VAL A CB  1 
ATOM 3908 C CG1 . VAL A 1 503  ? -4.186  69.920 -11.623 1.00 57.70  ? 500  VAL A CG1 1 
ATOM 3909 C CG2 . VAL A 1 503  ? -3.889  68.156 -13.317 1.00 57.70  ? 500  VAL A CG2 1 
ATOM 3910 N N   . ALA A 1 504  ? -7.677  70.056 -11.444 1.00 129.26 ? 501  ALA A N   1 
ATOM 3911 C CA  . ALA A 1 504  ? -8.437  71.018 -10.612 1.00 129.26 ? 501  ALA A CA  1 
ATOM 3912 C C   . ALA A 1 504  ? -7.738  71.455 -9.297  1.00 129.26 ? 501  ALA A C   1 
ATOM 3913 O O   . ALA A 1 504  ? -7.226  70.616 -8.553  1.00 129.26 ? 501  ALA A O   1 
ATOM 3914 C CB  . ALA A 1 504  ? -9.849  70.458 -10.316 1.00 100.52 ? 501  ALA A CB  1 
ATOM 3915 N N   . SER A 1 505  ? -7.728  72.765 -9.024  1.00 166.64 ? 502  SER A N   1 
ATOM 3916 C CA  . SER A 1 505  ? -7.234  73.319 -7.743  1.00 166.64 ? 502  SER A CA  1 
ATOM 3917 C C   . SER A 1 505  ? -8.116  74.460 -7.204  1.00 166.64 ? 502  SER A C   1 
ATOM 3918 O O   . SER A 1 505  ? -8.910  75.045 -7.950  1.00 166.64 ? 502  SER A O   1 
ATOM 3919 C CB  . SER A 1 505  ? -5.790  73.826 -7.864  1.00 62.70  ? 502  SER A CB  1 
ATOM 3920 O OG  . SER A 1 505  ? -4.916  72.850 -8.409  1.00 62.70  ? 502  SER A OG  1 
ATOM 3921 N N   . CYS A 1 506  ? -7.955  74.760 -5.906  1.00 152.88 ? 503  CYS A N   1 
ATOM 3922 C CA  . CYS A 1 506  ? -8.645  75.857 -5.181  1.00 152.88 ? 503  CYS A CA  1 
ATOM 3923 C C   . CYS A 1 506  ? -8.404  75.766 -3.667  1.00 152.88 ? 503  CYS A C   1 
ATOM 3924 O O   . CYS A 1 506  ? -8.321  74.669 -3.109  1.00 152.88 ? 503  CYS A O   1 
ATOM 3925 C CB  . CYS A 1 506  ? -10.154 75.880 -5.483  1.00 135.23 ? 503  CYS A CB  1 
ATOM 3926 S SG  . CYS A 1 506  ? -11.223 76.563 -4.186  1.00 135.23 ? 503  CYS A SG  1 
ATOM 3927 N N   . ASN A 1 507  ? -8.293  76.911 -2.999  1.00 210.35 ? 504  ASN A N   1 
ATOM 3928 C CA  . ASN A 1 507  ? -8.249  76.892 -1.535  1.00 210.35 ? 504  ASN A CA  1 
ATOM 3929 C C   . ASN A 1 507  ? -9.554  77.357 -0.842  1.00 210.35 ? 504  ASN A C   1 
ATOM 3930 O O   . ASN A 1 507  ? -10.199 76.565 -0.147  1.00 210.35 ? 504  ASN A O   1 
ATOM 3931 C CB  . ASN A 1 507  ? -6.936  77.493 -0.959  1.00 85.77  ? 504  ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 507  ? -6.694  78.951 -1.356  1.00 85.77  ? 504  ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 507  ? -7.325  79.874 -0.831  1.00 85.77  ? 504  ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 507  ? -5.716  79.161 -2.225  1.00 85.77  ? 504  ASN A ND2 1 
ATOM 3935 N N   . SER A 1 508  ? -9.945  78.615 -1.071  1.00 170.71 ? 505  SER A N   1 
ATOM 3936 C CA  . SER A 1 508  ? -11.179 79.233 -0.539  1.00 170.71 ? 505  SER A CA  1 
ATOM 3937 C C   . SER A 1 508  ? -11.219 80.662 -1.086  1.00 170.71 ? 505  SER A C   1 
ATOM 3938 O O   . SER A 1 508  ? -12.166 81.421 -0.853  1.00 170.71 ? 505  SER A O   1 
ATOM 3939 C CB  . SER A 1 508  ? -11.177 79.254 0.999   1.00 115.81 ? 505  SER A CB  1 
ATOM 3940 O OG  . SER A 1 508  ? -10.136 80.065 1.528   1.00 115.81 ? 505  SER A OG  1 
ATOM 3941 N N   . SER A 1 509  ? -10.152 80.995 -1.814  1.00 146.40 ? 506  SER A N   1 
ATOM 3942 C CA  . SER A 1 509  ? -9.905  82.308 -2.417  1.00 146.40 ? 506  SER A CA  1 
ATOM 3943 C C   . SER A 1 509  ? -9.342  82.139 -3.849  1.00 146.40 ? 506  SER A C   1 
ATOM 3944 O O   . SER A 1 509  ? -9.906  82.680 -4.801  1.00 146.40 ? 506  SER A O   1 
ATOM 3945 C CB  . SER A 1 509  ? -8.927  83.125 -1.553  1.00 119.21 ? 506  SER A CB  1 
ATOM 3946 O OG  . SER A 1 509  ? -9.083  82.842 -0.170  1.00 119.21 ? 506  SER A OG  1 
ATOM 3947 N N   . GLN A 1 510  ? -8.240  81.386 -3.985  1.00 210.35 ? 507  GLN A N   1 
ATOM 3948 C CA  . GLN A 1 510  ? -7.612  81.072 -5.292  1.00 210.35 ? 507  GLN A CA  1 
ATOM 3949 C C   . GLN A 1 510  ? -8.358  80.020 -6.110  1.00 210.35 ? 507  GLN A C   1 
ATOM 3950 O O   . GLN A 1 510  ? -9.038  79.150 -5.562  1.00 210.35 ? 507  GLN A O   1 
ATOM 3951 C CB  . GLN A 1 510  ? -6.161  80.577 -5.124  1.00 94.81  ? 507  GLN A CB  1 
ATOM 3952 C CG  . GLN A 1 510  ? -5.092  81.446 -5.746  1.00 94.81  ? 507  GLN A CG  1 
ATOM 3953 C CD  . GLN A 1 510  ? -4.390  82.336 -4.733  1.00 94.81  ? 507  GLN A CD  1 
ATOM 3954 O OE1 . GLN A 1 510  ? -3.160  82.314 -4.618  1.00 94.81  ? 507  GLN A OE1 1 
ATOM 3955 N NE2 . GLN A 1 510  ? -5.166  83.123 -3.992  1.00 94.81  ? 507  GLN A NE2 1 
ATOM 3956 N N   . VAL A 1 511  ? -8.211  80.121 -7.429  1.00 210.35 ? 508  VAL A N   1 
ATOM 3957 C CA  . VAL A 1 511  ? -8.537  79.045 -8.365  1.00 210.35 ? 508  VAL A CA  1 
ATOM 3958 C C   . VAL A 1 511  ? -7.397  78.985 -9.389  1.00 210.35 ? 508  VAL A C   1 
ATOM 3959 O O   . VAL A 1 511  ? -7.008  80.004 -9.968  1.00 210.35 ? 508  VAL A O   1 
ATOM 3960 C CB  . VAL A 1 511  ? -9.938  79.229 -9.057  1.00 129.27 ? 508  VAL A CB  1 
ATOM 3961 C CG1 . VAL A 1 511  ? -10.137 78.248 -10.230 1.00 129.27 ? 508  VAL A CG1 1 
ATOM 3962 C CG2 . VAL A 1 511  ? -11.071 79.059 -8.053  1.00 129.27 ? 508  VAL A CG2 1 
ATOM 3963 N N   . VAL A 1 512  ? -6.839  77.791 -9.565  1.00 116.39 ? 509  VAL A N   1 
ATOM 3964 C CA  . VAL A 1 512  ? -5.828  77.523 -10.584 1.00 116.39 ? 509  VAL A CA  1 
ATOM 3965 C C   . VAL A 1 512  ? -6.175  76.228 -11.289 1.00 116.39 ? 509  VAL A C   1 
ATOM 3966 O O   . VAL A 1 512  ? -6.226  75.172 -10.659 1.00 116.39 ? 509  VAL A O   1 
ATOM 3967 C CB  . VAL A 1 512  ? -4.424  77.416 -9.969  1.00 54.52  ? 509  VAL A CB  1 
ATOM 3968 C CG1 . VAL A 1 512  ? -3.498  76.639 -10.879 1.00 54.52  ? 509  VAL A CG1 1 
ATOM 3969 C CG2 . VAL A 1 512  ? -3.898  78.826 -9.669  1.00 54.52  ? 509  VAL A CG2 1 
ATOM 3970 N N   . VAL A 1 513  ? -6.442  76.307 -12.588 1.00 87.93  ? 510  VAL A N   1 
ATOM 3971 C CA  . VAL A 1 513  ? -6.689  75.080 -13.349 1.00 87.93  ? 510  VAL A CA  1 
ATOM 3972 C C   . VAL A 1 513  ? -5.530  74.726 -14.295 1.00 87.93  ? 510  VAL A C   1 
ATOM 3973 O O   . VAL A 1 513  ? -4.399  75.262 -14.177 1.00 87.93  ? 510  VAL A O   1 
ATOM 3974 C CB  . VAL A 1 513  ? -8.095  75.026 -14.070 1.00 136.06 ? 510  VAL A CB  1 
ATOM 3975 C CG1 . VAL A 1 513  ? -9.232  74.942 -13.056 1.00 136.06 ? 510  VAL A CG1 1 
ATOM 3976 C CG2 . VAL A 1 513  ? -8.293  76.200 -15.009 1.00 136.06 ? 510  VAL A CG2 1 
ATOM 3977 N N   . ALA A 1 514  ? -5.815  73.791 -15.200 1.00 60.50  ? 511  ALA A N   1 
ATOM 3978 C CA  . ALA A 1 514  ? -4.842  73.343 -16.186 1.00 60.50  ? 511  ALA A CA  1 
ATOM 3979 C C   . ALA A 1 514  ? -5.612  72.635 -17.276 1.00 60.50  ? 511  ALA A C   1 
ATOM 3980 O O   . ALA A 1 514  ? -6.432  71.748 -16.973 1.00 60.50  ? 511  ALA A O   1 
ATOM 3981 C CB  . ALA A 1 514  ? -3.771  72.400 -15.547 1.00 67.53  ? 511  ALA A CB  1 
ATOM 3982 N N   . VAL A 1 515  ? -5.363  73.045 -18.527 1.00 84.85  ? 512  VAL A N   1 
ATOM 3983 C CA  . VAL A 1 515  ? -5.933  72.365 -19.705 1.00 84.85  ? 512  VAL A CA  1 
ATOM 3984 C C   . VAL A 1 515  ? -4.989  71.275 -20.201 1.00 84.85  ? 512  VAL A C   1 
ATOM 3985 O O   . VAL A 1 515  ? -5.419  70.294 -20.843 1.00 84.85  ? 512  VAL A O   1 
ATOM 3986 C CB  . VAL A 1 515  ? -6.285  73.365 -20.830 1.00 101.10 ? 512  VAL A CB  1 
ATOM 3987 C CG1 . VAL A 1 515  ? -6.511  72.660 -22.195 1.00 101.10 ? 512  VAL A CG1 1 
ATOM 3988 C CG2 . VAL A 1 515  ? -7.519  74.168 -20.419 1.00 101.10 ? 512  VAL A CG2 1 
ATOM 3989 N N   . GLY A 1 516  ? -3.710  71.454 -19.859 1.00 71.30  ? 513  GLY A N   1 
ATOM 3990 C CA  . GLY A 1 516  ? -2.639  70.488 -20.155 1.00 71.30  ? 513  GLY A CA  1 
ATOM 3991 C C   . GLY A 1 516  ? -1.310  71.045 -19.694 1.00 71.30  ? 513  GLY A C   1 
ATOM 3992 O O   . GLY A 1 516  ? -0.809  70.666 -18.630 1.00 71.30  ? 513  GLY A O   1 
ATOM 3993 N N   . ARG A 1 517  ? -0.730  71.823 -20.585 1.00 93.33  ? 514  ARG A N   1 
ATOM 3994 C CA  . ARG A 1 517  ? 0.503   72.467 -20.306 1.00 93.33  ? 514  ARG A CA  1 
ATOM 3995 C C   . ARG A 1 517  ? 0.011   73.786 -19.902 1.00 93.33  ? 514  ARG A C   1 
ATOM 3996 O O   . ARG A 1 517  ? 0.649   74.521 -19.181 1.00 93.33  ? 514  ARG A O   1 
ATOM 3997 C CB  . ARG A 1 517  ? 1.277   72.595 -21.579 1.00 84.77  ? 514  ARG A CB  1 
ATOM 3998 C CG  . ARG A 1 517  ? 1.170   71.383 -22.439 1.00 84.77  ? 514  ARG A CG  1 
ATOM 3999 C CD  . ARG A 1 517  ? 2.180   71.447 -23.541 1.00 84.77  ? 514  ARG A CD  1 
ATOM 4000 N NE  . ARG A 1 517  ? 1.796   72.398 -24.551 1.00 84.77  ? 514  ARG A NE  1 
ATOM 4001 C CZ  . ARG A 1 517  ? 1.005   72.084 -25.559 1.00 84.77  ? 514  ARG A CZ  1 
ATOM 4002 N NH1 . ARG A 1 517  ? 0.544   70.853 -25.666 1.00 84.77  ? 514  ARG A NH1 1 
ATOM 4003 N NH2 . ARG A 1 517  ? 0.677   72.996 -26.453 1.00 84.77  ? 514  ARG A NH2 1 
ATOM 4004 N N   . ALA A 1 518  ? -1.178  74.069 -20.380 1.00 80.88  ? 515  ALA A N   1 
ATOM 4005 C CA  . ALA A 1 518  ? -1.789  75.342 -20.150 1.00 80.88  ? 515  ALA A CA  1 
ATOM 4006 C C   . ALA A 1 518  ? -2.052  75.483 -18.689 1.00 80.88  ? 515  ALA A C   1 
ATOM 4007 O O   . ALA A 1 518  ? -2.685  74.643 -18.079 1.00 80.88  ? 515  ALA A O   1 
ATOM 4008 C CB  . ALA A 1 518  ? -3.061  75.452 -20.921 1.00 129.49 ? 515  ALA A CB  1 
ATOM 4009 N N   . LEU A 1 519  ? -1.551  76.568 -18.138 1.00 142.64 ? 516  LEU A N   1 
ATOM 4010 C CA  . LEU A 1 519  ? -1.828  76.953 -16.769 1.00 142.64 ? 516  LEU A CA  1 
ATOM 4011 C C   . LEU A 1 519  ? -2.464  78.328 -16.774 1.00 142.64 ? 516  LEU A C   1 
ATOM 4012 O O   . LEU A 1 519  ? -1.770  79.347 -16.823 1.00 142.64 ? 516  LEU A O   1 
ATOM 4013 C CB  . LEU A 1 519  ? -0.556  76.973 -15.925 1.00 82.19  ? 516  LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 519  ? 0.652   76.093 -16.269 1.00 82.19  ? 516  LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 519  ? 1.845   76.449 -15.378 1.00 82.19  ? 516  LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 519  ? 0.310   74.628 -16.129 1.00 82.19  ? 516  LEU A CD2 1 
ATOM 4017 N N   . TYR A 1 520  ? -3.792  78.348 -16.746 1.00 96.89  ? 517  TYR A N   1 
ATOM 4018 C CA  . TYR A 1 520  ? -4.529  79.582 -16.554 1.00 96.89  ? 517  TYR A CA  1 
ATOM 4019 C C   . TYR A 1 520  ? -4.329  80.083 -15.114 1.00 96.89  ? 517  TYR A C   1 
ATOM 4020 O O   . TYR A 1 520  ? -3.265  79.852 -14.492 1.00 96.89  ? 517  TYR A O   1 
ATOM 4021 C CB  . TYR A 1 520  ? -6.027  79.375 -16.814 1.00 130.95 ? 517  TYR A CB  1 
ATOM 4022 C CG  . TYR A 1 520  ? -6.452  79.252 -18.262 1.00 130.95 ? 517  TYR A CG  1 
ATOM 4023 C CD1 . TYR A 1 520  ? -6.992  78.059 -18.742 1.00 130.95 ? 517  TYR A CD1 1 
ATOM 4024 C CD2 . TYR A 1 520  ? -6.348  80.331 -19.148 1.00 130.95 ? 517  TYR A CD2 1 
ATOM 4025 C CE1 . TYR A 1 520  ? -7.411  77.931 -20.077 1.00 130.95 ? 517  TYR A CE1 1 
ATOM 4026 C CE2 . TYR A 1 520  ? -6.762  80.212 -20.489 1.00 130.95 ? 517  TYR A CE2 1 
ATOM 4027 C CZ  . TYR A 1 520  ? -7.295  79.008 -20.942 1.00 130.95 ? 517  TYR A CZ  1 
ATOM 4028 O OH  . TYR A 1 520  ? -7.714  78.860 -22.247 1.00 130.95 ? 517  TYR A OH  1 
ATOM 4029 N N   . TYR A 1 521  ? -5.369  80.779 -14.628 1.00 210.35 ? 518  TYR A N   1 
ATOM 4030 C CA  . TYR A 1 521  ? -5.551  81.285 -13.253 1.00 210.35 ? 518  TYR A CA  1 
ATOM 4031 C C   . TYR A 1 521  ? -6.829  82.142 -13.249 1.00 210.35 ? 518  TYR A C   1 
ATOM 4032 O O   . TYR A 1 521  ? -7.002  82.995 -14.125 1.00 210.35 ? 518  TYR A O   1 
ATOM 4033 C CB  . TYR A 1 521  ? -4.348  82.123 -12.766 1.00 104.29 ? 518  TYR A CB  1 
ATOM 4034 C CG  . TYR A 1 521  ? -4.537  82.820 -11.427 1.00 104.29 ? 518  TYR A CG  1 
ATOM 4035 C CD1 . TYR A 1 521  ? -3.442  83.238 -10.677 1.00 104.29 ? 518  TYR A CD1 1 
ATOM 4036 C CD2 . TYR A 1 521  ? -5.813  83.060 -10.916 1.00 104.29 ? 518  TYR A CD2 1 
ATOM 4037 C CE1 . TYR A 1 521  ? -3.634  83.890 -9.454  1.00 104.29 ? 518  TYR A CE1 1 
ATOM 4038 C CE2 . TYR A 1 521  ? -6.013  83.690 -9.720  1.00 104.29 ? 518  TYR A CE2 1 
ATOM 4039 C CZ  . TYR A 1 521  ? -4.933  84.105 -8.988  1.00 104.29 ? 518  TYR A CZ  1 
ATOM 4040 O OH  . TYR A 1 521  ? -5.165  84.746 -7.798  1.00 104.29 ? 518  TYR A OH  1 
ATOM 4041 N N   . LEU A 1 522  ? -7.720  81.906 -12.280 1.00 207.84 ? 519  LEU A N   1 
ATOM 4042 C CA  . LEU A 1 522  ? -8.928  82.738 -12.086 1.00 207.84 ? 519  LEU A CA  1 
ATOM 4043 C C   . LEU A 1 522  ? -9.245  82.966 -10.591 1.00 207.84 ? 519  LEU A C   1 
ATOM 4044 O O   . LEU A 1 522  ? -8.663  82.314 -9.724  1.00 207.84 ? 519  LEU A O   1 
ATOM 4045 C CB  . LEU A 1 522  ? -10.150 82.135 -12.797 1.00 136.46 ? 519  LEU A CB  1 
ATOM 4046 C CG  . LEU A 1 522  ? -10.072 80.815 -13.563 1.00 136.46 ? 519  LEU A CG  1 
ATOM 4047 C CD1 . LEU A 1 522  ? -11.463 80.230 -13.605 1.00 136.46 ? 519  LEU A CD1 1 
ATOM 4048 C CD2 . LEU A 1 522  ? -9.462  80.940 -14.953 1.00 136.46 ? 519  LEU A CD2 1 
ATOM 4049 N N   . GLN A 1 523  ? -10.160 83.893 -10.296 1.00 171.26 ? 520  GLN A N   1 
ATOM 4050 C CA  . GLN A 1 523  ? -10.534 84.221 -8.911  1.00 171.26 ? 520  GLN A CA  1 
ATOM 4051 C C   . GLN A 1 523  ? -12.049 84.226 -8.772  1.00 171.26 ? 520  GLN A C   1 
ATOM 4052 O O   . GLN A 1 523  ? -12.749 84.583 -9.719  1.00 171.26 ? 520  GLN A O   1 
ATOM 4053 C CB  . GLN A 1 523  ? -10.014 85.606 -8.521  1.00 124.71 ? 520  GLN A CB  1 
ATOM 4054 C CG  . GLN A 1 523  ? -8.708  86.018 -9.170  1.00 124.71 ? 520  GLN A CG  1 
ATOM 4055 C CD  . GLN A 1 523  ? -8.818  87.358 -9.867  1.00 124.71 ? 520  GLN A CD  1 
ATOM 4056 O OE1 . GLN A 1 523  ? -9.347  87.456 -10.976 1.00 124.71 ? 520  GLN A OE1 1 
ATOM 4057 N NE2 . GLN A 1 523  ? -8.305  88.399 -9.225  1.00 124.71 ? 520  GLN A NE2 1 
ATOM 4058 N N   . ILE A 1 524  ? -12.556 83.851 -7.596  1.00 176.21 ? 521  ILE A N   1 
ATOM 4059 C CA  . ILE A 1 524  ? -14.002 83.912 -7.330  1.00 176.21 ? 521  ILE A CA  1 
ATOM 4060 C C   . ILE A 1 524  ? -14.353 85.257 -6.678  1.00 176.21 ? 521  ILE A C   1 
ATOM 4061 O O   . ILE A 1 524  ? -14.718 85.320 -5.500  1.00 176.21 ? 521  ILE A O   1 
ATOM 4062 C CB  . ILE A 1 524  ? -14.537 82.720 -6.446  1.00 119.09 ? 521  ILE A CB  1 
ATOM 4063 C CG1 . ILE A 1 524  ? -13.727 81.415 -6.661  1.00 119.09 ? 521  ILE A CG1 1 
ATOM 4064 C CG2 . ILE A 1 524  ? -16.060 82.551 -6.639  1.00 119.09 ? 521  ILE A CG2 1 
ATOM 4065 C CD1 . ILE A 1 524  ? -14.334 80.371 -7.630  1.00 119.09 ? 521  ILE A CD1 1 
ATOM 4066 N N   . HIS A 1 525  ? -14.241 86.332 -7.454  1.00 186.26 ? 522  HIS A N   1 
ATOM 4067 C CA  . HIS A 1 525  ? -14.489 87.674 -6.938  1.00 186.26 ? 522  HIS A CA  1 
ATOM 4068 C C   . HIS A 1 525  ? -15.960 87.994 -6.732  1.00 186.26 ? 522  HIS A C   1 
ATOM 4069 O O   . HIS A 1 525  ? -16.800 87.485 -7.471  1.00 186.26 ? 522  HIS A O   1 
ATOM 4070 C CB  . HIS A 1 525  ? -13.794 88.710 -7.797  1.00 111.98 ? 522  HIS A CB  1 
ATOM 4071 C CG  . HIS A 1 525  ? -12.408 88.987 -7.338  1.00 111.98 ? 522  HIS A CG  1 
ATOM 4072 N ND1 . HIS A 1 525  ? -12.141 89.728 -6.206  1.00 111.98 ? 522  HIS A ND1 1 
ATOM 4073 C CD2 . HIS A 1 525  ? -11.211 88.570 -7.810  1.00 111.98 ? 522  HIS A CD2 1 
ATOM 4074 C CE1 . HIS A 1 525  ? -10.834 89.781 -6.021  1.00 111.98 ? 522  HIS A CE1 1 
ATOM 4075 N NE2 . HIS A 1 525  ? -10.247 89.086 -6.979  1.00 111.98 ? 522  HIS A NE2 1 
ATOM 4076 N N   . PRO A 1 526  ? -16.271 88.858 -5.739  1.00 173.04 ? 523  PRO A N   1 
ATOM 4077 C CA  . PRO A 1 526  ? -17.629 88.921 -5.160  1.00 173.04 ? 523  PRO A CA  1 
ATOM 4078 C C   . PRO A 1 526  ? -18.782 88.648 -6.146  1.00 173.04 ? 523  PRO A C   1 
ATOM 4079 O O   . PRO A 1 526  ? -19.448 89.593 -6.579  1.00 173.04 ? 523  PRO A O   1 
ATOM 4080 C CB  . PRO A 1 526  ? -17.722 90.353 -4.629  1.00 68.99  ? 523  PRO A CB  1 
ATOM 4081 C CG  . PRO A 1 526  ? -16.272 90.787 -4.372  1.00 68.99  ? 523  PRO A CG  1 
ATOM 4082 C CD  . PRO A 1 526  ? -15.352 89.853 -5.138  1.00 68.99  ? 523  PRO A CD  1 
ATOM 4083 N N   . GLN A 1 527  ? -19.001 87.370 -6.487  1.00 111.18 ? 524  GLN A N   1 
ATOM 4084 C CA  . GLN A 1 527  ? -20.123 86.913 -7.336  1.00 111.18 ? 524  GLN A CA  1 
ATOM 4085 C C   . GLN A 1 527  ? -19.762 86.592 -8.785  1.00 111.18 ? 524  GLN A C   1 
ATOM 4086 O O   . GLN A 1 527  ? -20.653 86.394 -9.626  1.00 111.18 ? 524  GLN A O   1 
ATOM 4087 C CB  . GLN A 1 527  ? -21.299 87.904 -7.329  1.00 118.38 ? 524  GLN A CB  1 
ATOM 4088 C CG  . GLN A 1 527  ? -22.248 87.774 -6.155  1.00 118.38 ? 524  GLN A CG  1 
ATOM 4089 C CD  . GLN A 1 527  ? -23.672 88.176 -6.518  1.00 118.38 ? 524  GLN A CD  1 
ATOM 4090 O OE1 . GLN A 1 527  ? -24.382 87.443 -7.230  1.00 118.38 ? 524  GLN A OE1 1 
ATOM 4091 N NE2 . GLN A 1 527  ? -24.104 89.341 -6.024  1.00 118.38 ? 524  GLN A NE2 1 
ATOM 4092 N N   . GLU A 1 528  ? -18.471 86.555 -9.087  1.00 96.64  ? 525  GLU A N   1 
ATOM 4093 C CA  . GLU A 1 528  ? -18.027 86.299 -10.464 1.00 96.64  ? 525  GLU A CA  1 
ATOM 4094 C C   . GLU A 1 528  ? -16.584 85.808 -10.585 1.00 96.64  ? 525  GLU A C   1 
ATOM 4095 O O   . GLU A 1 528  ? -15.693 86.276 -9.875  1.00 96.64  ? 525  GLU A O   1 
ATOM 4096 C CB  . GLU A 1 528  ? -18.250 87.535 -11.356 1.00 174.67 ? 525  GLU A CB  1 
ATOM 4097 C CG  . GLU A 1 528  ? -17.983 88.894 -10.690 1.00 174.67 ? 525  GLU A CG  1 
ATOM 4098 C CD  . GLU A 1 528  ? -16.510 89.262 -10.619 1.00 174.67 ? 525  GLU A CD  1 
ATOM 4099 O OE1 . GLU A 1 528  ? -16.053 89.657 -9.529  1.00 174.67 ? 525  GLU A OE1 1 
ATOM 4100 O OE2 . GLU A 1 528  ? -15.808 89.165 -11.648 1.00 174.67 ? 525  GLU A OE2 1 
ATOM 4101 N N   . LEU A 1 529  ? -16.360 84.895 -11.520 1.00 95.55  ? 526  LEU A N   1 
ATOM 4102 C CA  . LEU A 1 529  ? -15.024 84.345 -11.764 1.00 95.55  ? 526  LEU A CA  1 
ATOM 4103 C C   . LEU A 1 529  ? -14.201 85.127 -12.815 1.00 95.55  ? 526  LEU A C   1 
ATOM 4104 O O   . LEU A 1 529  ? -14.339 84.888 -14.026 1.00 95.55  ? 526  LEU A O   1 
ATOM 4105 C CB  . LEU A 1 529  ? -15.147 82.882 -12.190 1.00 87.84  ? 526  LEU A CB  1 
ATOM 4106 C CG  . LEU A 1 529  ? -16.426 82.172 -11.743 1.00 87.84  ? 526  LEU A CG  1 
ATOM 4107 C CD1 . LEU A 1 529  ? -16.807 81.166 -12.776 1.00 87.84  ? 526  LEU A CD1 1 
ATOM 4108 C CD2 . LEU A 1 529  ? -16.288 81.518 -10.353 1.00 87.84  ? 526  LEU A CD2 1 
ATOM 4109 N N   . ARG A 1 530  ? -13.344 86.041 -12.358 1.00 159.85 ? 527  ARG A N   1 
ATOM 4110 C CA  . ARG A 1 530  ? -12.519 86.856 -13.261 1.00 159.85 ? 527  ARG A CA  1 
ATOM 4111 C C   . ARG A 1 530  ? -11.200 86.170 -13.557 1.00 159.85 ? 527  ARG A C   1 
ATOM 4112 O O   . ARG A 1 530  ? -10.604 85.582 -12.659 1.00 159.85 ? 527  ARG A O   1 
ATOM 4113 C CB  . ARG A 1 530  ? -12.229 88.217 -12.641 1.00 106.33 ? 527  ARG A CB  1 
ATOM 4114 C CG  . ARG A 1 530  ? -11.877 89.291 -13.648 1.00 106.33 ? 527  ARG A CG  1 
ATOM 4115 C CD  . ARG A 1 530  ? -11.569 90.598 -12.948 1.00 106.33 ? 527  ARG A CD  1 
ATOM 4116 N NE  . ARG A 1 530  ? -12.757 91.315 -12.457 1.00 106.33 ? 527  ARG A NE  1 
ATOM 4117 C CZ  . ARG A 1 530  ? -13.160 91.365 -11.181 1.00 106.33 ? 527  ARG A CZ  1 
ATOM 4118 N NH1 . ARG A 1 530  ? -12.491 90.719 -10.230 1.00 106.33 ? 527  ARG A NH1 1 
ATOM 4119 N NH2 . ARG A 1 530  ? -14.245 92.063 -10.849 1.00 106.33 ? 527  ARG A NH2 1 
ATOM 4120 N N   . GLN A 1 531  ? -10.740 86.269 -14.806 1.00 137.66 ? 528  GLN A N   1 
ATOM 4121 C CA  . GLN A 1 531  ? -9.493  85.614 -15.256 1.00 137.66 ? 528  GLN A CA  1 
ATOM 4122 C C   . GLN A 1 531  ? -8.250  86.439 -14.894 1.00 137.66 ? 528  GLN A C   1 
ATOM 4123 O O   . GLN A 1 531  ? -8.378  87.591 -14.485 1.00 137.66 ? 528  GLN A O   1 
ATOM 4124 C CB  . GLN A 1 531  ? -9.542  85.357 -16.775 1.00 129.66 ? 528  GLN A CB  1 
ATOM 4125 C CG  . GLN A 1 531  ? -8.974  84.001 -17.235 1.00 129.66 ? 528  GLN A CG  1 
ATOM 4126 C CD  . GLN A 1 531  ? -8.801  83.916 -18.746 1.00 129.66 ? 528  GLN A CD  1 
ATOM 4127 O OE1 . GLN A 1 531  ? -9.628  83.330 -19.450 1.00 129.66 ? 528  GLN A OE1 1 
ATOM 4128 N NE2 . GLN A 1 531  ? -7.723  84.515 -19.251 1.00 129.66 ? 528  GLN A NE2 1 
ATOM 4129 N N   . ILE A 1 532  ? -7.062  85.834 -15.014 1.00 104.56 ? 529  ILE A N   1 
ATOM 4130 C CA  . ILE A 1 532  ? -5.782  86.550 -14.879 1.00 104.56 ? 529  ILE A CA  1 
ATOM 4131 C C   . ILE A 1 532  ? -4.682  85.992 -15.785 1.00 104.56 ? 529  ILE A C   1 
ATOM 4132 O O   . ILE A 1 532  ? -4.629  86.333 -16.971 1.00 104.56 ? 529  ILE A O   1 
ATOM 4133 C CB  . ILE A 1 532  ? -5.235  86.614 -13.422 1.00 49.04  ? 529  ILE A CB  1 
ATOM 4134 C CG1 . ILE A 1 532  ? -6.370  86.889 -12.396 1.00 49.04  ? 529  ILE A CG1 1 
ATOM 4135 C CG2 . ILE A 1 532  ? -4.000  87.591 -13.329 1.00 49.04  ? 529  ILE A CG2 1 
ATOM 4136 C CD1 . ILE A 1 532  ? -5.961  87.776 -11.158 1.00 49.04  ? 529  ILE A CD1 1 
ATOM 4137 N N   . SER A 1 533  ? -3.802  85.154 -15.227 1.00 100.64 ? 530  SER A N   1 
ATOM 4138 C CA  . SER A 1 533  ? -2.561  84.757 -15.913 1.00 100.64 ? 530  SER A CA  1 
ATOM 4139 C C   . SER A 1 533  ? -2.751  83.586 -16.887 1.00 100.64 ? 530  SER A C   1 
ATOM 4140 O O   . SER A 1 533  ? -3.864  83.079 -17.062 1.00 100.64 ? 530  SER A O   1 
ATOM 4141 C CB  . SER A 1 533  ? -1.419  84.477 -14.911 1.00 65.36  ? 530  SER A CB  1 
ATOM 4142 O OG  . SER A 1 533  ? -0.949  85.664 -14.274 1.00 65.36  ? 530  SER A OG  1 
ATOM 4143 N N   . HIS A 1 534  ? -1.652  83.203 -17.539 1.00 117.00 ? 531  HIS A N   1 
ATOM 4144 C CA  . HIS A 1 534  ? -1.596  82.089 -18.489 1.00 117.00 ? 531  HIS A CA  1 
ATOM 4145 C C   . HIS A 1 534  ? -0.138  81.805 -18.858 1.00 117.00 ? 531  HIS A C   1 
ATOM 4146 O O   . HIS A 1 534  ? 0.665   82.728 -19.073 1.00 117.00 ? 531  HIS A O   1 
ATOM 4147 C CB  . HIS A 1 534  ? -2.419  82.359 -19.758 1.00 146.68 ? 531  HIS A CB  1 
ATOM 4148 C CG  . HIS A 1 534  ? -2.388  81.234 -20.747 1.00 146.68 ? 531  HIS A CG  1 
ATOM 4149 N ND1 . HIS A 1 534  ? -3.050  80.042 -20.541 1.00 146.68 ? 531  HIS A ND1 1 
ATOM 4150 C CD2 . HIS A 1 534  ? -1.767  81.117 -21.945 1.00 146.68 ? 531  HIS A CD2 1 
ATOM 4151 C CE1 . HIS A 1 534  ? -2.841  79.241 -21.570 1.00 146.68 ? 531  HIS A CE1 1 
ATOM 4152 N NE2 . HIS A 1 534  ? -2.066  79.869 -22.437 1.00 146.68 ? 531  HIS A NE2 1 
ATOM 4153 N N   . THR A 1 535  ? 0.188   80.515 -18.900 1.00 124.62 ? 532  THR A N   1 
ATOM 4154 C CA  . THR A 1 535  ? 1.489   80.029 -19.335 1.00 124.62 ? 532  THR A CA  1 
ATOM 4155 C C   . THR A 1 535  ? 1.276   78.592 -19.807 1.00 124.62 ? 532  THR A C   1 
ATOM 4156 O O   . THR A 1 535  ? 0.207   78.013 -19.598 1.00 124.62 ? 532  THR A O   1 
ATOM 4157 C CB  . THR A 1 535  ? 2.581   80.202 -18.219 1.00 72.71  ? 532  THR A CB  1 
ATOM 4158 O OG1 . THR A 1 535  ? 2.740   81.602 -17.947 1.00 72.71  ? 532  THR A OG1 1 
ATOM 4159 C CG2 . THR A 1 535  ? 3.964   79.647 -18.617 1.00 72.71  ? 532  THR A CG2 1 
ATOM 4160 N N   . GLU A 1 536  ? 2.290   78.062 -20.482 1.00 72.61  ? 533  GLU A N   1 
ATOM 4161 C CA  . GLU A 1 536  ? 2.310   76.753 -21.113 1.00 72.61  ? 533  GLU A CA  1 
ATOM 4162 C C   . GLU A 1 536  ? 3.657   76.145 -20.686 1.00 72.61  ? 533  GLU A C   1 
ATOM 4163 O O   . GLU A 1 536  ? 4.676   76.848 -20.665 1.00 72.61  ? 533  GLU A O   1 
ATOM 4164 C CB  . GLU A 1 536  ? 2.270   76.954 -22.631 1.00 160.89 ? 533  GLU A CB  1 
ATOM 4165 C CG  . GLU A 1 536  ? 1.827   75.757 -23.468 1.00 160.89 ? 533  GLU A CG  1 
ATOM 4166 C CD  . GLU A 1 536  ? 2.000   76.003 -24.967 1.00 160.89 ? 533  GLU A CD  1 
ATOM 4167 O OE1 . GLU A 1 536  ? 2.226   75.014 -25.706 1.00 160.89 ? 533  GLU A OE1 1 
ATOM 4168 O OE2 . GLU A 1 536  ? 1.919   77.180 -25.408 1.00 160.89 ? 533  GLU A OE2 1 
ATOM 4169 N N   . MET A 1 537  ? 3.689   74.867 -20.319 1.00 62.70  ? 534  MET A N   1 
ATOM 4170 C CA  . MET A 1 537  ? 4.953   74.283 -19.843 1.00 62.70  ? 534  MET A CA  1 
ATOM 4171 C C   . MET A 1 537  ? 5.434   73.214 -20.791 1.00 62.70  ? 534  MET A C   1 
ATOM 4172 O O   . MET A 1 537  ? 4.629   72.612 -21.503 1.00 62.70  ? 534  MET A O   1 
ATOM 4173 C CB  . MET A 1 537  ? 4.804   73.657 -18.459 1.00 86.20  ? 534  MET A CB  1 
ATOM 4174 C CG  . MET A 1 537  ? 3.792   74.305 -17.540 1.00 86.20  ? 534  MET A CG  1 
ATOM 4175 S SD  . MET A 1 537  ? 4.553   75.357 -16.311 1.00 86.20  ? 534  MET A SD  1 
ATOM 4176 C CE  . MET A 1 537  ? 6.025   74.415 -15.869 1.00 86.20  ? 534  MET A CE  1 
ATOM 4177 N N   . GLU A 1 538  ? 6.741   72.962 -20.778 1.00 77.52  ? 535  GLU A N   1 
ATOM 4178 C CA  . GLU A 1 538  ? 7.305   71.844 -21.500 1.00 77.52  ? 535  GLU A CA  1 
ATOM 4179 C C   . GLU A 1 538  ? 6.229   70.784 -21.832 1.00 77.52  ? 535  GLU A C   1 
ATOM 4180 O O   . GLU A 1 538  ? 5.943   70.524 -23.008 1.00 77.52  ? 535  GLU A O   1 
ATOM 4181 C CB  . GLU A 1 538  ? 8.422   71.224 -20.661 1.00 129.64 ? 535  GLU A CB  1 
ATOM 4182 C CG  . GLU A 1 538  ? 9.690   72.049 -20.572 1.00 129.64 ? 535  GLU A CG  1 
ATOM 4183 C CD  . GLU A 1 538  ? 10.657  71.743 -21.701 1.00 129.64 ? 535  GLU A CD  1 
ATOM 4184 O OE1 . GLU A 1 538  ? 10.872  72.636 -22.551 1.00 129.64 ? 535  GLU A OE1 1 
ATOM 4185 O OE2 . GLU A 1 538  ? 11.192  70.609 -21.745 1.00 129.64 ? 535  GLU A OE2 1 
ATOM 4186 N N   . HIS A 1 539  ? 5.602   70.240 -20.777 1.00 67.95  ? 536  HIS A N   1 
ATOM 4187 C CA  . HIS A 1 539  ? 4.783   69.009 -20.826 1.00 67.95  ? 536  HIS A CA  1 
ATOM 4188 C C   . HIS A 1 539  ? 3.388   69.082 -20.168 1.00 67.95  ? 536  HIS A C   1 
ATOM 4189 O O   . HIS A 1 539  ? 3.034   70.087 -19.554 1.00 67.95  ? 536  HIS A O   1 
ATOM 4190 C CB  . HIS A 1 539  ? 5.562   67.852 -20.195 1.00 99.52  ? 536  HIS A CB  1 
ATOM 4191 C CG  . HIS A 1 539  ? 7.007   67.824 -20.572 1.00 99.52  ? 536  HIS A CG  1 
ATOM 4192 N ND1 . HIS A 1 539  ? 7.454   67.294 -21.762 1.00 99.52  ? 536  HIS A ND1 1 
ATOM 4193 C CD2 . HIS A 1 539  ? 8.104   68.269 -19.918 1.00 99.52  ? 536  HIS A CD2 1 
ATOM 4194 C CE1 . HIS A 1 539  ? 8.766   67.413 -21.825 1.00 99.52  ? 536  HIS A CE1 1 
ATOM 4195 N NE2 . HIS A 1 539  ? 9.185   68.005 -20.721 1.00 99.52  ? 536  HIS A NE2 1 
ATOM 4196 N N   . GLU A 1 540  ? 2.608   68.001 -20.321 1.00 66.92  ? 537  GLU A N   1 
ATOM 4197 C CA  . GLU A 1 540  ? 1.270   67.867 -19.731 1.00 66.92  ? 537  GLU A CA  1 
ATOM 4198 C C   . GLU A 1 540  ? 1.337   68.041 -18.218 1.00 66.92  ? 537  GLU A C   1 
ATOM 4199 O O   . GLU A 1 540  ? 2.058   67.296 -17.531 1.00 66.92  ? 537  GLU A O   1 
ATOM 4200 C CB  . GLU A 1 540  ? 0.713   66.469 -20.019 1.00 76.86  ? 537  GLU A CB  1 
ATOM 4201 C CG  . GLU A 1 540  ? -0.435  66.336 -21.011 1.00 76.86  ? 537  GLU A CG  1 
ATOM 4202 C CD  . GLU A 1 540  ? -0.792  64.853 -21.282 1.00 76.86  ? 537  GLU A CD  1 
ATOM 4203 O OE1 . GLU A 1 540  ? 0.083   64.047 -21.711 1.00 76.86  ? 537  GLU A OE1 1 
ATOM 4204 O OE2 . GLU A 1 540  ? -1.960  64.486 -21.066 1.00 76.86  ? 537  GLU A OE2 1 
ATOM 4205 N N   . VAL A 1 541  ? 0.582   69.000 -17.686 1.00 61.82  ? 538  VAL A N   1 
ATOM 4206 C CA  . VAL A 1 541  ? 0.483   69.153 -16.225 1.00 61.82  ? 538  VAL A CA  1 
ATOM 4207 C C   . VAL A 1 541  ? -0.181  67.918 -15.601 1.00 61.82  ? 538  VAL A C   1 
ATOM 4208 O O   . VAL A 1 541  ? -1.363  67.633 -15.877 1.00 61.82  ? 538  VAL A O   1 
ATOM 4209 C CB  . VAL A 1 541  ? -0.345  70.376 -15.825 1.00 78.77  ? 538  VAL A CB  1 
ATOM 4210 C CG1 . VAL A 1 541  ? -0.415  70.482 -14.308 1.00 78.77  ? 538  VAL A CG1 1 
ATOM 4211 C CG2 . VAL A 1 541  ? 0.232   71.624 -16.420 1.00 78.77  ? 538  VAL A CG2 1 
ATOM 4212 N N   . ALA A 1 542  ? 0.571   67.197 -14.763 1.00 62.33  ? 539  ALA A N   1 
ATOM 4213 C CA  . ALA A 1 542  ? 0.036   66.016 -14.074 1.00 62.33  ? 539  ALA A CA  1 
ATOM 4214 C C   . ALA A 1 542  ? -0.848  66.329 -12.875 1.00 62.33  ? 539  ALA A C   1 
ATOM 4215 O O   . ALA A 1 542  ? -1.888  65.688 -12.750 1.00 62.33  ? 539  ALA A O   1 
ATOM 4216 C CB  . ALA A 1 542  ? 1.139   65.057 -13.681 1.00 49.36  ? 539  ALA A CB  1 
ATOM 4217 N N   . CYS A 1 543  ? -0.448  67.311 -12.043 1.00 68.37  ? 540  CYS A N   1 
ATOM 4218 C CA  . CYS A 1 543  ? -1.102  67.651 -10.745 1.00 68.37  ? 540  CYS A CA  1 
ATOM 4219 C C   . CYS A 1 543  ? -0.530  68.926 -10.076 1.00 68.37  ? 540  CYS A C   1 
ATOM 4220 O O   . CYS A 1 543  ? 0.647   69.248 -10.259 1.00 68.37  ? 540  CYS A O   1 
ATOM 4221 C CB  . CYS A 1 543  ? -0.880  66.510 -9.775  1.00 56.33  ? 540  CYS A CB  1 
ATOM 4222 S SG  . CYS A 1 543  ? 0.925   66.225 -9.610  1.00 56.33  ? 540  CYS A SG  1 
ATOM 4223 N N   . LEU A 1 544  ? -1.340  69.605 -9.256  1.00 104.33 ? 541  LEU A N   1 
ATOM 4224 C CA  . LEU A 1 544  ? -0.995  70.944 -8.717  1.00 104.33 ? 541  LEU A CA  1 
ATOM 4225 C C   . LEU A 1 544  ? -1.456  71.191 -7.282  1.00 104.33 ? 541  LEU A C   1 
ATOM 4226 O O   . LEU A 1 544  ? -2.597  70.874 -6.947  1.00 104.33 ? 541  LEU A O   1 
ATOM 4227 C CB  . LEU A 1 544  ? -1.694  72.009 -9.557  1.00 56.04  ? 541  LEU A CB  1 
ATOM 4228 C CG  . LEU A 1 544  ? -1.248  72.442 -10.947 1.00 56.04  ? 541  LEU A CG  1 
ATOM 4229 C CD1 . LEU A 1 544  ? -2.543  72.739 -11.699 1.00 56.04  ? 541  LEU A CD1 1 
ATOM 4230 C CD2 . LEU A 1 544  ? -0.313  73.690 -10.888 1.00 56.04  ? 541  LEU A CD2 1 
ATOM 4231 N N   . ASP A 1 545  ? -0.619  71.812 -6.451  1.00 206.10 ? 542  ASP A N   1 
ATOM 4232 C CA  . ASP A 1 545  ? -1.088  72.208 -5.111  1.00 206.10 ? 542  ASP A CA  1 
ATOM 4233 C C   . ASP A 1 545  ? -0.955  73.689 -4.769  1.00 206.10 ? 542  ASP A C   1 
ATOM 4234 O O   . ASP A 1 545  ? 0.093   74.286 -4.983  1.00 206.10 ? 542  ASP A O   1 
ATOM 4235 C CB  . ASP A 1 545  ? -0.440  71.369 -4.003  1.00 154.88 ? 542  ASP A CB  1 
ATOM 4236 C CG  . ASP A 1 545  ? -1.103  71.590 -2.636  1.00 154.88 ? 542  ASP A CG  1 
ATOM 4237 O OD1 . ASP A 1 545  ? -2.344  71.748 -2.582  1.00 154.88 ? 542  ASP A OD1 1 
ATOM 4238 O OD2 . ASP A 1 545  ? -0.387  71.605 -1.612  1.00 154.88 ? 542  ASP A OD2 1 
ATOM 4239 N N   . ILE A 1 546  ? -2.034  74.257 -4.223  1.00 185.75 ? 543  ILE A N   1 
ATOM 4240 C CA  . ILE A 1 546  ? -2.041  75.620 -3.678  1.00 185.75 ? 543  ILE A CA  1 
ATOM 4241 C C   . ILE A 1 546  ? -2.868  75.773 -2.422  1.00 185.75 ? 543  ILE A C   1 
ATOM 4242 O O   . ILE A 1 546  ? -4.005  75.309 -2.349  1.00 185.75 ? 543  ILE A O   1 
ATOM 4243 C CB  . ILE A 1 546  ? -2.567  76.680 -4.667  1.00 92.08  ? 543  ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 546  ? -3.627  76.104 -5.621  1.00 92.08  ? 543  ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 546  ? -1.405  77.305 -5.405  1.00 92.08  ? 543  ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 546  ? -5.045  76.254 -5.150  1.00 92.08  ? 543  ILE A CD1 1 
ATOM 4247 N N   . THR A 1 547  ? -2.284  76.448 -1.440  1.00 142.32 ? 544  THR A N   1 
ATOM 4248 C CA  . THR A 1 547  ? -2.989  76.819 -0.225  1.00 142.32 ? 544  THR A CA  1 
ATOM 4249 C C   . THR A 1 547  ? -2.263  78.014 0.375   1.00 142.32 ? 544  THR A C   1 
ATOM 4250 O O   . THR A 1 547  ? -1.027  78.058 0.358   1.00 142.32 ? 544  THR A O   1 
ATOM 4251 C CB  . THR A 1 547  ? -3.032  75.665 0.829   1.00 116.77 ? 544  THR A CB  1 
ATOM 4252 O OG1 . THR A 1 547  ? -2.856  74.391 0.191   1.00 116.77 ? 544  THR A OG1 1 
ATOM 4253 C CG2 . THR A 1 547  ? -4.360  75.673 1.591   1.00 116.77 ? 544  THR A CG2 1 
ATOM 4254 N N   . PRO A 1 548  ? -3.025  79.006 0.871   1.00 210.35 ? 545  PRO A N   1 
ATOM 4255 C CA  . PRO A 1 548  ? -2.457  80.053 1.707   1.00 210.35 ? 545  PRO A CA  1 
ATOM 4256 C C   . PRO A 1 548  ? -1.842  79.426 2.962   1.00 210.35 ? 545  PRO A C   1 
ATOM 4257 O O   . PRO A 1 548  ? -2.564  78.874 3.801   1.00 210.35 ? 545  PRO A O   1 
ATOM 4258 C CB  . PRO A 1 548  ? -3.675  80.927 2.054   1.00 165.83 ? 545  PRO A CB  1 
ATOM 4259 C CG  . PRO A 1 548  ? -4.866  80.076 1.783   1.00 165.83 ? 545  PRO A CG  1 
ATOM 4260 C CD  . PRO A 1 548  ? -4.464  79.213 0.647   1.00 165.83 ? 545  PRO A CD  1 
ATOM 4261 N N   . LEU A 1 549  ? -0.515  79.488 3.066   1.00 131.20 ? 546  LEU A N   1 
ATOM 4262 C CA  . LEU A 1 549  ? 0.196   78.842 4.170   1.00 131.20 ? 546  LEU A CA  1 
ATOM 4263 C C   . LEU A 1 549  ? 0.342   79.752 5.406   1.00 131.20 ? 546  LEU A C   1 
ATOM 4264 O O   . LEU A 1 549  ? -0.629  79.977 6.132   1.00 131.20 ? 546  LEU A O   1 
ATOM 4265 C CB  . LEU A 1 549  ? 1.544   78.251 3.701   1.00 76.97  ? 546  LEU A CB  1 
ATOM 4266 C CG  . LEU A 1 549  ? 1.532   77.187 2.601   1.00 76.97  ? 546  LEU A CG  1 
ATOM 4267 C CD1 . LEU A 1 549  ? 2.037   77.799 1.328   1.00 76.97  ? 546  LEU A CD1 1 
ATOM 4268 C CD2 . LEU A 1 549  ? 2.408   76.035 2.988   1.00 76.97  ? 546  LEU A CD2 1 
ATOM 4269 N N   . GLY A 1 550  ? 1.542   80.278 5.637   1.00 160.87 ? 547  GLY A N   1 
ATOM 4270 C CA  . GLY A 1 550  ? 1.814   81.074 6.831   1.00 160.87 ? 547  GLY A CA  1 
ATOM 4271 C C   . GLY A 1 550  ? 1.319   82.507 6.757   1.00 160.87 ? 547  GLY A C   1 
ATOM 4272 O O   . GLY A 1 550  ? 0.222   82.826 7.229   1.00 160.87 ? 547  GLY A O   1 
ATOM 4273 N N   . ASP A 1 551  ? 2.139   83.364 6.151   1.00 203.83 ? 548  ASP A N   1 
ATOM 4274 C CA  . ASP A 1 551  ? 1.917   84.812 6.133   1.00 203.83 ? 548  ASP A CA  1 
ATOM 4275 C C   . ASP A 1 551  ? 1.018   85.285 4.989   1.00 203.83 ? 548  ASP A C   1 
ATOM 4276 O O   . ASP A 1 551  ? 1.270   86.340 4.379   1.00 203.83 ? 548  ASP A O   1 
ATOM 4277 C CB  . ASP A 1 551  ? 3.264   85.538 6.070   1.00 149.30 ? 548  ASP A CB  1 
ATOM 4278 C CG  . ASP A 1 551  ? 4.165   84.995 4.975   1.00 149.30 ? 548  ASP A CG  1 
ATOM 4279 O OD1 . ASP A 1 551  ? 5.185   84.352 5.322   1.00 149.30 ? 548  ASP A OD1 1 
ATOM 4280 O OD2 . ASP A 1 551  ? 3.846   85.190 3.775   1.00 149.30 ? 548  ASP A OD2 1 
ATOM 4281 N N   . SER A 1 552  ? -0.031  84.508 4.705   1.00 149.85 ? 549  SER A N   1 
ATOM 4282 C CA  . SER A 1 552  ? -0.986  84.876 3.669   1.00 149.85 ? 549  SER A CA  1 
ATOM 4283 C C   . SER A 1 552  ? -2.365  84.315 3.964   1.00 149.85 ? 549  SER A C   1 
ATOM 4284 O O   . SER A 1 552  ? -2.572  83.107 3.972   1.00 149.85 ? 549  SER A O   1 
ATOM 4285 C CB  . SER A 1 552  ? -0.494  84.426 2.290   1.00 143.82 ? 549  SER A CB  1 
ATOM 4286 O OG  . SER A 1 552  ? 0.090   83.129 2.355   1.00 143.82 ? 549  SER A OG  1 
ATOM 4287 N N   . ASN A 1 553  ? -3.304  85.205 4.234   1.00 139.22 ? 550  ASN A N   1 
ATOM 4288 C CA  . ASN A 1 553  ? -4.685  84.799 4.366   1.00 139.22 ? 550  ASN A CA  1 
ATOM 4289 C C   . ASN A 1 553  ? -5.293  84.728 2.973   1.00 139.22 ? 550  ASN A C   1 
ATOM 4290 O O   . ASN A 1 553  ? -5.290  85.724 2.242   1.00 139.22 ? 550  ASN A O   1 
ATOM 4291 C CB  . ASN A 1 553  ? -5.466  85.782 5.248   1.00 186.50 ? 550  ASN A CB  1 
ATOM 4292 C CG  . ASN A 1 553  ? -4.964  85.819 6.685   1.00 186.50 ? 550  ASN A CG  1 
ATOM 4293 O OD1 . ASN A 1 553  ? -5.643  85.349 7.602   1.00 186.50 ? 550  ASN A OD1 1 
ATOM 4294 N ND2 . ASN A 1 553  ? -3.777  86.388 6.888   1.00 186.50 ? 550  ASN A ND2 1 
ATOM 4295 N N   . GLY A 1 554  ? -5.772  83.542 2.594   1.00 167.79 ? 551  GLY A N   1 
ATOM 4296 C CA  . GLY A 1 554  ? -6.504  83.348 1.338   1.00 167.79 ? 551  GLY A CA  1 
ATOM 4297 C C   . GLY A 1 554  ? -5.683  83.290 0.059   1.00 167.79 ? 551  GLY A C   1 
ATOM 4298 O O   . GLY A 1 554  ? -5.554  82.227 -0.549  1.00 167.79 ? 551  GLY A O   1 
ATOM 4299 N N   . LEU A 1 555  ? -5.152  84.443 -0.354  1.00 133.17 ? 552  LEU A N   1 
ATOM 4300 C CA  . LEU A 1 555  ? -4.332  84.571 -1.565  1.00 133.17 ? 552  LEU A CA  1 
ATOM 4301 C C   . LEU A 1 555  ? -2.961  83.913 -1.345  1.00 133.17 ? 552  LEU A C   1 
ATOM 4302 O O   . LEU A 1 555  ? -2.302  84.181 -0.331  1.00 133.17 ? 552  LEU A O   1 
ATOM 4303 C CB  . LEU A 1 555  ? -4.171  86.056 -1.941  1.00 104.92 ? 552  LEU A CB  1 
ATOM 4304 C CG  . LEU A 1 555  ? -4.090  86.492 -3.418  1.00 104.92 ? 552  LEU A CG  1 
ATOM 4305 C CD1 . LEU A 1 555  ? -5.491  86.610 -4.039  1.00 104.92 ? 552  LEU A CD1 1 
ATOM 4306 C CD2 . LEU A 1 555  ? -3.312  87.813 -3.594  1.00 104.92 ? 552  LEU A CD2 1 
ATOM 4307 N N   . SER A 1 556  ? -2.533  83.065 -2.289  1.00 118.58 ? 553  SER A N   1 
ATOM 4308 C CA  . SER A 1 556  ? -1.373  82.176 -2.074  1.00 118.58 ? 553  SER A CA  1 
ATOM 4309 C C   . SER A 1 556  ? -0.090  82.529 -2.874  1.00 118.58 ? 553  SER A C   1 
ATOM 4310 O O   . SER A 1 556  ? -0.150  82.692 -4.093  1.00 118.58 ? 553  SER A O   1 
ATOM 4311 C CB  . SER A 1 556  ? -1.792  80.717 -2.314  1.00 105.61 ? 553  SER A CB  1 
ATOM 4312 O OG  . SER A 1 556  ? -0.878  79.806 -1.730  1.00 105.61 ? 553  SER A OG  1 
ATOM 4313 N N   . PRO A 1 557  ? 1.061   82.684 -2.168  1.00 184.03 ? 554  PRO A N   1 
ATOM 4314 C CA  . PRO A 1 557  ? 2.444   82.841 -2.689  1.00 184.03 ? 554  PRO A CA  1 
ATOM 4315 C C   . PRO A 1 557  ? 2.930   81.778 -3.705  1.00 184.03 ? 554  PRO A C   1 
ATOM 4316 O O   . PRO A 1 557  ? 2.188   81.451 -4.628  1.00 184.03 ? 554  PRO A O   1 
ATOM 4317 C CB  . PRO A 1 557  ? 3.296   82.828 -1.415  1.00 116.22 ? 554  PRO A CB  1 
ATOM 4318 C CG  . PRO A 1 557  ? 2.380   83.397 -0.373  1.00 116.22 ? 554  PRO A CG  1 
ATOM 4319 C CD  . PRO A 1 557  ? 1.036   82.802 -0.696  1.00 116.22 ? 554  PRO A CD  1 
ATOM 4320 N N   . LEU A 1 558  ? 4.156   81.260 -3.548  1.00 147.37 ? 555  LEU A N   1 
ATOM 4321 C CA  . LEU A 1 558  ? 4.807   80.403 -4.585  1.00 147.37 ? 555  LEU A CA  1 
ATOM 4322 C C   . LEU A 1 558  ? 4.188   79.012 -4.787  1.00 147.37 ? 555  LEU A C   1 
ATOM 4323 O O   . LEU A 1 558  ? 3.187   78.696 -4.152  1.00 147.37 ? 555  LEU A O   1 
ATOM 4324 C CB  . LEU A 1 558  ? 6.310   80.266 -4.331  1.00 114.33 ? 555  LEU A CB  1 
ATOM 4325 C CG  . LEU A 1 558  ? 6.712   79.461 -3.103  1.00 114.33 ? 555  LEU A CG  1 
ATOM 4326 C CD1 . LEU A 1 558  ? 7.978   78.641 -3.374  1.00 114.33 ? 555  LEU A CD1 1 
ATOM 4327 C CD2 . LEU A 1 558  ? 6.861   80.408 -1.898  1.00 114.33 ? 555  LEU A CD2 1 
ATOM 4328 N N   . CYS A 1 559  ? 4.780   78.187 -5.664  1.00 134.92 ? 556  CYS A N   1 
ATOM 4329 C CA  . CYS A 1 559  ? 4.213   76.850 -5.960  1.00 134.92 ? 556  CYS A CA  1 
ATOM 4330 C C   . CYS A 1 559  ? 5.095   75.771 -6.642  1.00 134.92 ? 556  CYS A C   1 
ATOM 4331 O O   . CYS A 1 559  ? 6.269   75.988 -6.948  1.00 134.92 ? 556  CYS A O   1 
ATOM 4332 C CB  . CYS A 1 559  ? 2.891   76.981 -6.730  1.00 155.23 ? 556  CYS A CB  1 
ATOM 4333 S SG  . CYS A 1 559  ? 1.849   75.505 -6.600  1.00 155.23 ? 556  CYS A SG  1 
ATOM 4334 N N   . ALA A 1 560  ? 4.474   74.604 -6.852  1.00 109.77 ? 557  ALA A N   1 
ATOM 4335 C CA  . ALA A 1 560  ? 5.081   73.426 -7.456  1.00 109.77 ? 557  ALA A CA  1 
ATOM 4336 C C   . ALA A 1 560  ? 4.041   72.537 -8.181  1.00 109.77 ? 557  ALA A C   1 
ATOM 4337 O O   . ALA A 1 560  ? 2.816   72.637 -7.960  1.00 109.77 ? 557  ALA A O   1 
ATOM 4338 C CB  . ALA A 1 560  ? 5.839   72.631 -6.412  1.00 206.54 ? 557  ALA A CB  1 
ATOM 4339 N N   . ILE A 1 561  ? 4.552   71.646 -9.030  1.00 67.49  ? 558  ILE A N   1 
ATOM 4340 C CA  . ILE A 1 561  ? 3.753   70.961 -10.039 1.00 67.49  ? 558  ILE A CA  1 
ATOM 4341 C C   . ILE A 1 561  ? 4.501   69.728 -10.552 1.00 67.49  ? 558  ILE A C   1 
ATOM 4342 O O   . ILE A 1 561  ? 5.741   69.675 -10.552 1.00 67.49  ? 558  ILE A O   1 
ATOM 4343 C CB  . ILE A 1 561  ? 3.503   71.937 -11.234 1.00 93.25  ? 558  ILE A CB  1 
ATOM 4344 C CG1 . ILE A 1 561  ? 2.288   71.540 -12.065 1.00 93.25  ? 558  ILE A CG1 1 
ATOM 4345 C CG2 . ILE A 1 561  ? 4.753   72.072 -12.120 1.00 93.25  ? 558  ILE A CG2 1 
ATOM 4346 C CD1 . ILE A 1 561  ? 1.946   72.568 -13.122 1.00 93.25  ? 558  ILE A CD1 1 
ATOM 4347 N N   . GLY A 1 562  ? 3.755   68.735 -11.006 1.00 53.74  ? 559  GLY A N   1 
ATOM 4348 C CA  . GLY A 1 562  ? 4.385   67.575 -11.636 1.00 53.74  ? 559  GLY A CA  1 
ATOM 4349 C C   . GLY A 1 562  ? 3.816   67.354 -13.025 1.00 53.74  ? 559  GLY A C   1 
ATOM 4350 O O   . GLY A 1 562  ? 2.585   67.277 -13.185 1.00 53.74  ? 559  GLY A O   1 
ATOM 4351 N N   . LEU A 1 563  ? 4.678   67.252 -14.021 1.00 70.90  ? 560  LEU A N   1 
ATOM 4352 C CA  . LEU A 1 563  ? 4.248   67.150 -15.394 1.00 70.90  ? 560  LEU A CA  1 
ATOM 4353 C C   . LEU A 1 563  ? 4.531   65.780 -15.871 1.00 70.90  ? 560  LEU A C   1 
ATOM 4354 O O   . LEU A 1 563  ? 5.126   65.026 -15.172 1.00 70.90  ? 560  LEU A O   1 
ATOM 4355 C CB  . LEU A 1 563  ? 5.063   68.077 -16.256 1.00 82.97  ? 560  LEU A CB  1 
ATOM 4356 C CG  . LEU A 1 563  ? 5.211   69.522 -15.840 1.00 82.97  ? 560  LEU A CG  1 
ATOM 4357 C CD1 . LEU A 1 563  ? 5.466   70.299 -17.071 1.00 82.97  ? 560  LEU A CD1 1 
ATOM 4358 C CD2 . LEU A 1 563  ? 3.959   69.986 -15.198 1.00 82.97  ? 560  LEU A CD2 1 
ATOM 4359 N N   . TRP A 1 564  ? 4.264   65.466 -17.125 1.00 78.29  ? 561  TRP A N   1 
ATOM 4360 C CA  . TRP A 1 564  ? 4.303   64.073 -17.600 1.00 78.29  ? 561  TRP A CA  1 
ATOM 4361 C C   . TRP A 1 564  ? 5.568   63.262 -18.010 1.00 78.29  ? 561  TRP A C   1 
ATOM 4362 O O   . TRP A 1 564  ? 5.814   62.202 -17.477 1.00 78.29  ? 561  TRP A O   1 
ATOM 4363 C CB  . TRP A 1 564  ? 3.268   63.906 -18.701 1.00 72.93  ? 561  TRP A CB  1 
ATOM 4364 C CG  . TRP A 1 564  ? 1.924   63.630 -18.202 1.00 72.93  ? 561  TRP A CG  1 
ATOM 4365 C CD1 . TRP A 1 564  ? 1.148   64.447 -17.482 1.00 72.93  ? 561  TRP A CD1 1 
ATOM 4366 C CD2 . TRP A 1 564  ? 1.185   62.446 -18.401 1.00 72.93  ? 561  TRP A CD2 1 
ATOM 4367 N NE1 . TRP A 1 564  ? -0.038  63.848 -17.205 1.00 72.93  ? 561  TRP A NE1 1 
ATOM 4368 C CE2 . TRP A 1 564  ? -0.036  62.610 -17.770 1.00 72.93  ? 561  TRP A CE2 1 
ATOM 4369 C CE3 . TRP A 1 564  ? 1.440   61.257 -19.064 1.00 72.93  ? 561  TRP A CE3 1 
ATOM 4370 C CZ2 . TRP A 1 564  ? -0.999  61.633 -17.768 1.00 72.93  ? 561  TRP A CZ2 1 
ATOM 4371 C CZ3 . TRP A 1 564  ? 0.484   60.288 -19.060 1.00 72.93  ? 561  TRP A CZ3 1 
ATOM 4372 C CH2 . TRP A 1 564  ? -0.717  60.477 -18.417 1.00 72.93  ? 561  TRP A CH2 1 
ATOM 4373 N N   . THR A 1 565  ? 6.317   63.727 -18.978 1.00 89.05  ? 562  THR A N   1 
ATOM 4374 C CA  . THR A 1 565  ? 7.169   62.997 -19.852 1.00 89.05  ? 562  THR A CA  1 
ATOM 4375 C C   . THR A 1 565  ? 8.548   63.071 -19.269 1.00 89.05  ? 562  THR A C   1 
ATOM 4376 O O   . THR A 1 565  ? 9.402   62.265 -19.582 1.00 89.05  ? 562  THR A O   1 
ATOM 4377 C CB  . THR A 1 565  ? 7.177   63.633 -21.202 1.00 79.79  ? 562  THR A CB  1 
ATOM 4378 O OG1 . THR A 1 565  ? 6.070   64.524 -21.290 1.00 79.79  ? 562  THR A OG1 1 
ATOM 4379 C CG2 . THR A 1 565  ? 7.037   62.592 -22.259 1.00 79.79  ? 562  THR A CG2 1 
ATOM 4380 N N   . ASP A 1 566  ? 8.773   64.042 -18.406 1.00 86.01  ? 563  ASP A N   1 
ATOM 4381 C CA  . ASP A 1 566  ? 10.063  64.140 -17.783 1.00 86.01  ? 563  ASP A CA  1 
ATOM 4382 C C   . ASP A 1 566  ? 9.907   63.548 -16.441 1.00 86.01  ? 563  ASP A C   1 
ATOM 4383 O O   . ASP A 1 566  ? 10.853  63.443 -15.704 1.00 86.01  ? 563  ASP A O   1 
ATOM 4384 C CB  . ASP A 1 566  ? 10.438  65.576 -17.593 1.00 79.33  ? 563  ASP A CB  1 
ATOM 4385 C CG  . ASP A 1 566  ? 9.490   66.264 -16.733 1.00 79.33  ? 563  ASP A CG  1 
ATOM 4386 O OD1 . ASP A 1 566  ? 8.517   65.609 -16.368 1.00 79.33  ? 563  ASP A OD1 1 
ATOM 4387 O OD2 . ASP A 1 566  ? 9.714   67.431 -16.397 1.00 79.33  ? 563  ASP A OD2 1 
ATOM 4388 N N   . ILE A 1 567  ? 8.689   63.168 -16.110 1.00 129.31 ? 564  ILE A N   1 
ATOM 4389 C CA  . ILE A 1 567  ? 8.416   62.669 -14.787 1.00 129.31 ? 564  ILE A CA  1 
ATOM 4390 C C   . ILE A 1 567  ? 9.114   63.639 -13.881 1.00 129.31 ? 564  ILE A C   1 
ATOM 4391 O O   . ILE A 1 567  ? 10.245  63.432 -13.491 1.00 129.31 ? 564  ILE A O   1 
ATOM 4392 C CB  . ILE A 1 567  ? 9.007   61.293 -14.590 1.00 65.86  ? 564  ILE A CB  1 
ATOM 4393 C CG1 . ILE A 1 567  ? 8.123   60.247 -15.227 1.00 65.86  ? 564  ILE A CG1 1 
ATOM 4394 C CG2 . ILE A 1 567  ? 9.074   60.977 -13.141 1.00 65.86  ? 564  ILE A CG2 1 
ATOM 4395 C CD1 . ILE A 1 567  ? 7.418   60.736 -16.382 1.00 65.86  ? 564  ILE A CD1 1 
ATOM 4396 N N   . SER A 1 568  ? 8.461   64.731 -13.561 1.00 56.08  ? 565  SER A N   1 
ATOM 4397 C CA  . SER A 1 568  ? 9.182   65.736 -12.819 1.00 56.08  ? 565  SER A CA  1 
ATOM 4398 C C   . SER A 1 568  ? 8.296   66.611 -11.948 1.00 56.08  ? 565  SER A C   1 
ATOM 4399 O O   . SER A 1 568  ? 7.075   66.706 -12.173 1.00 56.08  ? 565  SER A O   1 
ATOM 4400 C CB  . SER A 1 568  ? 9.889   66.658 -13.792 1.00 75.81  ? 565  SER A CB  1 
ATOM 4401 O OG  . SER A 1 568  ? 8.995   67.689 -14.202 1.00 75.81  ? 565  SER A OG  1 
ATOM 4402 N N   . ALA A 1 569  ? 8.933   67.268 -10.974 1.00 68.43  ? 566  ALA A N   1 
ATOM 4403 C CA  . ALA A 1 569  ? 8.306   68.255 -10.124 1.00 68.43  ? 566  ALA A CA  1 
ATOM 4404 C C   . ALA A 1 569  ? 9.265   69.434 -9.962  1.00 68.43  ? 566  ALA A C   1 
ATOM 4405 O O   . ALA A 1 569  ? 10.486  69.274 -9.730  1.00 68.43  ? 566  ALA A O   1 
ATOM 4406 C CB  . ALA A 1 569  ? 7.941   67.659 -8.794  1.00 102.38 ? 566  ALA A CB  1 
ATOM 4407 N N   . ARG A 1 570  ? 8.691   70.625 -10.095 1.00 81.49  ? 567  ARG A N   1 
ATOM 4408 C CA  . ARG A 1 570  ? 9.455   71.865 -10.259 1.00 81.49  ? 567  ARG A CA  1 
ATOM 4409 C C   . ARG A 1 570  ? 8.805   73.021 -9.486  1.00 81.49  ? 567  ARG A C   1 
ATOM 4410 O O   . ARG A 1 570  ? 7.577   73.025 -9.293  1.00 81.49  ? 567  ARG A O   1 
ATOM 4411 C CB  . ARG A 1 570  ? 9.608   72.200 -11.754 1.00 109.80 ? 567  ARG A CB  1 
ATOM 4412 C CG  . ARG A 1 570  ? 8.453   71.722 -12.645 1.00 109.80 ? 567  ARG A CG  1 
ATOM 4413 C CD  . ARG A 1 570  ? 8.952   70.832 -13.799 1.00 109.80 ? 567  ARG A CD  1 
ATOM 4414 N NE  . ARG A 1 570  ? 9.291   71.582 -15.017 1.00 109.80 ? 567  ARG A NE  1 
ATOM 4415 C CZ  . ARG A 1 570  ? 9.965   71.086 -16.056 1.00 109.80 ? 567  ARG A CZ  1 
ATOM 4416 N NH1 . ARG A 1 570  ? 10.397  69.833 -16.052 1.00 109.80 ? 567  ARG A NH1 1 
ATOM 4417 N NH2 . ARG A 1 570  ? 10.213  71.852 -17.108 1.00 109.80 ? 567  ARG A NH2 1 
ATOM 4418 N N   . ILE A 1 571  ? 9.627   73.988 -9.055  1.00 133.73 ? 568  ILE A N   1 
ATOM 4419 C CA  . ILE A 1 571  ? 9.187   75.114 -8.202  1.00 133.73 ? 568  ILE A CA  1 
ATOM 4420 C C   . ILE A 1 571  ? 8.949   76.403 -9.013  1.00 133.73 ? 568  ILE A C   1 
ATOM 4421 O O   . ILE A 1 571  ? 9.835   76.849 -9.737  1.00 133.73 ? 568  ILE A O   1 
ATOM 4422 C CB  . ILE A 1 571  ? 10.210  75.405 -7.050  1.00 196.89 ? 568  ILE A CB  1 
ATOM 4423 C CG1 . ILE A 1 571  ? 10.882  74.120 -6.517  1.00 196.89 ? 568  ILE A CG1 1 
ATOM 4424 C CG2 . ILE A 1 571  ? 9.572   76.264 -5.943  1.00 196.89 ? 568  ILE A CG2 1 
ATOM 4425 C CD1 . ILE A 1 571  ? 9.955   73.091 -5.875  1.00 196.89 ? 568  ILE A CD1 1 
ATOM 4426 N N   . LEU A 1 572  ? 7.756   76.994 -8.885  1.00 200.92 ? 569  LEU A N   1 
ATOM 4427 C CA  . LEU A 1 572  ? 7.337   78.141 -9.720  1.00 200.92 ? 569  LEU A CA  1 
ATOM 4428 C C   . LEU A 1 572  ? 6.381   79.108 -8.995  1.00 200.92 ? 569  LEU A C   1 
ATOM 4429 O O   . LEU A 1 572  ? 5.704   78.703 -8.053  1.00 200.92 ? 569  LEU A O   1 
ATOM 4430 C CB  . LEU A 1 572  ? 6.693   77.649 -11.030 1.00 164.82 ? 569  LEU A CB  1 
ATOM 4431 C CG  . LEU A 1 572  ? 7.508   76.789 -12.014 1.00 164.82 ? 569  LEU A CG  1 
ATOM 4432 C CD1 . LEU A 1 572  ? 7.268   75.302 -11.806 1.00 164.82 ? 569  LEU A CD1 1 
ATOM 4433 C CD2 . LEU A 1 572  ? 7.210   77.150 -13.458 1.00 164.82 ? 569  LEU A CD2 1 
ATOM 4434 N N   . LYS A 1 573  ? 6.311   80.369 -9.446  1.00 146.96 ? 570  LYS A N   1 
ATOM 4435 C CA  . LYS A 1 573  ? 5.511   81.423 -8.764  1.00 146.96 ? 570  LYS A CA  1 
ATOM 4436 C C   . LYS A 1 573  ? 4.026   81.484 -9.188  1.00 146.96 ? 570  LYS A C   1 
ATOM 4437 O O   . LYS A 1 573  ? 3.492   80.475 -9.648  1.00 146.96 ? 570  LYS A O   1 
ATOM 4438 C CB  . LYS A 1 573  ? 6.182   82.795 -8.902  1.00 75.11  ? 570  LYS A CB  1 
ATOM 4439 C CG  . LYS A 1 573  ? 6.204   83.616 -7.611  1.00 75.11  ? 570  LYS A CG  1 
ATOM 4440 C CD  . LYS A 1 573  ? 6.254   85.141 -7.872  1.00 75.11  ? 570  LYS A CD  1 
ATOM 4441 C CE  . LYS A 1 573  ? 4.843   85.802 -8.042  1.00 75.11  ? 570  LYS A CE  1 
ATOM 4442 N NZ  . LYS A 1 573  ? 4.375   85.906 -9.473  1.00 75.11  ? 570  LYS A NZ  1 
ATOM 4443 N N   . LEU A 1 574  ? 3.375   82.651 -9.033  1.00 210.35 ? 571  LEU A N   1 
ATOM 4444 C CA  . LEU A 1 574  ? 1.901   82.791 -9.222  1.00 210.35 ? 571  LEU A CA  1 
ATOM 4445 C C   . LEU A 1 574  ? 1.378   83.480 -10.519 1.00 210.35 ? 571  LEU A C   1 
ATOM 4446 O O   . LEU A 1 574  ? 1.049   82.772 -11.476 1.00 210.35 ? 571  LEU A O   1 
ATOM 4447 C CB  . LEU A 1 574  ? 1.205   83.346 -7.959  1.00 111.64 ? 571  LEU A CB  1 
ATOM 4448 C CG  . LEU A 1 574  ? -0.330  83.490 -8.012  1.00 111.64 ? 571  LEU A CG  1 
ATOM 4449 C CD1 . LEU A 1 574  ? -1.076  82.135 -7.942  1.00 111.64 ? 571  LEU A CD1 1 
ATOM 4450 C CD2 . LEU A 1 574  ? -0.818  84.473 -6.940  1.00 111.64 ? 571  LEU A CD2 1 
ATOM 4451 N N   . PRO A 1 575  ? 1.245   84.835 -10.553 1.00 199.35 ? 572  PRO A N   1 
ATOM 4452 C CA  . PRO A 1 575  ? 0.790   85.354 -11.847 1.00 199.35 ? 572  PRO A CA  1 
ATOM 4453 C C   . PRO A 1 575  ? 1.879   85.261 -12.920 1.00 199.35 ? 572  PRO A C   1 
ATOM 4454 O O   . PRO A 1 575  ? 1.567   85.211 -14.112 1.00 199.35 ? 572  PRO A O   1 
ATOM 4455 C CB  . PRO A 1 575  ? 0.436   86.822 -11.544 1.00 188.29 ? 572  PRO A CB  1 
ATOM 4456 C CG  . PRO A 1 575  ? 0.409   86.932 -10.051 1.00 188.29 ? 572  PRO A CG  1 
ATOM 4457 C CD  . PRO A 1 575  ? 1.415   85.931 -9.581  1.00 188.29 ? 572  PRO A CD  1 
ATOM 4458 N N   . SER A 1 576  ? 3.139   85.212 -12.484 1.00 149.87 ? 573  SER A N   1 
ATOM 4459 C CA  . SER A 1 576  ? 4.294   85.132 -13.384 1.00 149.87 ? 573  SER A CA  1 
ATOM 4460 C C   . SER A 1 576  ? 4.580   83.709 -13.888 1.00 149.87 ? 573  SER A C   1 
ATOM 4461 O O   . SER A 1 576  ? 4.864   83.518 -15.081 1.00 149.87 ? 573  SER A O   1 
ATOM 4462 C CB  . SER A 1 576  ? 5.541   85.711 -12.710 1.00 138.23 ? 573  SER A CB  1 
ATOM 4463 O OG  . SER A 1 576  ? 5.896   84.952 -11.570 1.00 138.23 ? 573  SER A OG  1 
ATOM 4464 N N   . PHE A 1 577  ? 4.490   82.729 -12.979 1.00 128.60 ? 574  PHE A N   1 
ATOM 4465 C CA  . PHE A 1 577  ? 4.793   81.307 -13.251 1.00 128.60 ? 574  PHE A CA  1 
ATOM 4466 C C   . PHE A 1 577  ? 6.302   81.071 -13.492 1.00 128.60 ? 574  PHE A C   1 
ATOM 4467 O O   . PHE A 1 577  ? 6.691   80.203 -14.274 1.00 128.60 ? 574  PHE A O   1 
ATOM 4468 C CB  . PHE A 1 577  ? 3.965   80.751 -14.430 1.00 106.92 ? 574  PHE A CB  1 
ATOM 4469 C CG  . PHE A 1 577  ? 2.458   80.904 -14.280 1.00 106.92 ? 574  PHE A CG  1 
ATOM 4470 C CD1 . PHE A 1 577  ? 1.794   82.023 -14.812 1.00 106.92 ? 574  PHE A CD1 1 
ATOM 4471 C CD2 . PHE A 1 577  ? 1.691   79.906 -13.655 1.00 106.92 ? 574  PHE A CD2 1 
ATOM 4472 C CE1 . PHE A 1 577  ? 0.395   82.154 -14.701 1.00 106.92 ? 574  PHE A CE1 1 
ATOM 4473 C CE2 . PHE A 1 577  ? 0.287   80.032 -13.539 1.00 106.92 ? 574  PHE A CE2 1 
ATOM 4474 C CZ  . PHE A 1 577  ? -0.360  81.155 -14.061 1.00 106.92 ? 574  PHE A CZ  1 
ATOM 4475 N N   . GLU A 1 578  ? 7.146   81.839 -12.809 1.00 143.82 ? 575  GLU A N   1 
ATOM 4476 C CA  . GLU A 1 578  ? 8.587   81.781 -13.028 1.00 143.82 ? 575  GLU A CA  1 
ATOM 4477 C C   . GLU A 1 578  ? 9.261   80.565 -12.374 1.00 143.82 ? 575  GLU A C   1 
ATOM 4478 O O   . GLU A 1 578  ? 9.205   80.383 -11.155 1.00 143.82 ? 575  GLU A O   1 
ATOM 4479 C CB  . GLU A 1 578  ? 9.223   83.085 -12.561 1.00 146.42 ? 575  GLU A CB  1 
ATOM 4480 C CG  . GLU A 1 578  ? 8.825   83.476 -11.155 1.00 146.42 ? 575  GLU A CG  1 
ATOM 4481 C CD  . GLU A 1 578  ? 8.830   84.963 -10.933 1.00 146.42 ? 575  GLU A CD  1 
ATOM 4482 O OE1 . GLU A 1 578  ? 8.217   85.687 -11.742 1.00 146.42 ? 575  GLU A OE1 1 
ATOM 4483 O OE2 . GLU A 1 578  ? 9.435   85.405 -9.939  1.00 146.42 ? 575  GLU A OE2 1 
ATOM 4484 N N   . LEU A 1 579  ? 9.899   79.747 -13.207 1.00 93.42  ? 576  LEU A N   1 
ATOM 4485 C CA  . LEU A 1 579  ? 10.582  78.505 -12.798 1.00 93.42  ? 576  LEU A CA  1 
ATOM 4486 C C   . LEU A 1 579  ? 11.863  78.720 -11.972 1.00 93.42  ? 576  LEU A C   1 
ATOM 4487 O O   . LEU A 1 579  ? 12.785  79.402 -12.414 1.00 93.42  ? 576  LEU A O   1 
ATOM 4488 C CB  . LEU A 1 579  ? 10.873  77.642 -14.055 1.00 109.76 ? 576  LEU A CB  1 
ATOM 4489 C CG  . LEU A 1 579  ? 11.696  76.330 -14.185 1.00 109.76 ? 576  LEU A CG  1 
ATOM 4490 C CD1 . LEU A 1 579  ? 13.227  76.546 -14.143 1.00 109.76 ? 576  LEU A CD1 1 
ATOM 4491 C CD2 . LEU A 1 579  ? 11.276  75.202 -13.221 1.00 109.76 ? 576  LEU A CD2 1 
ATOM 4492 N N   . LEU A 1 580  ? 11.923  78.106 -10.788 1.00 204.25 ? 577  LEU A N   1 
ATOM 4493 C CA  . LEU A 1 580  ? 13.091  78.204 -9.894  1.00 204.25 ? 577  LEU A CA  1 
ATOM 4494 C C   . LEU A 1 580  ? 14.035  76.997 -10.033 1.00 204.25 ? 577  LEU A C   1 
ATOM 4495 O O   . LEU A 1 580  ? 14.665  76.804 -11.076 1.00 204.25 ? 577  LEU A O   1 
ATOM 4496 C CB  . LEU A 1 580  ? 12.642  78.367 -8.428  1.00 112.04 ? 577  LEU A CB  1 
ATOM 4497 C CG  . LEU A 1 580  ? 11.880  79.623 -7.990  1.00 112.04 ? 577  LEU A CG  1 
ATOM 4498 C CD1 . LEU A 1 580  ? 10.365  79.456 -8.068  1.00 112.04 ? 577  LEU A CD1 1 
ATOM 4499 C CD2 . LEU A 1 580  ? 12.283  79.983 -6.586  1.00 112.04 ? 577  LEU A CD2 1 
ATOM 4500 N N   . HIS A 1 581  ? 14.140  76.219 -8.956  1.00 106.95 ? 578  HIS A N   1 
ATOM 4501 C CA  . HIS A 1 581  ? 14.797  74.902 -8.932  1.00 106.95 ? 578  HIS A CA  1 
ATOM 4502 C C   . HIS A 1 581  ? 13.779  73.794 -9.249  1.00 106.95 ? 578  HIS A C   1 
ATOM 4503 O O   . HIS A 1 581  ? 12.566  74.038 -9.325  1.00 106.95 ? 578  HIS A O   1 
ATOM 4504 C CB  . HIS A 1 581  ? 15.466  74.675 -7.554  1.00 137.53 ? 578  HIS A CB  1 
ATOM 4505 C CG  . HIS A 1 581  ? 15.746  73.234 -7.212  1.00 137.53 ? 578  HIS A CG  1 
ATOM 4506 N ND1 . HIS A 1 581  ? 16.847  72.551 -7.687  1.00 137.53 ? 578  HIS A ND1 1 
ATOM 4507 C CD2 . HIS A 1 581  ? 15.085  72.362 -6.412  1.00 137.53 ? 578  HIS A CD2 1 
ATOM 4508 C CE1 . HIS A 1 581  ? 16.846  71.321 -7.205  1.00 137.53 ? 578  HIS A CE1 1 
ATOM 4509 N NE2 . HIS A 1 581  ? 15.783  71.178 -6.436  1.00 137.53 ? 578  HIS A NE2 1 
ATOM 4510 N N   . LYS A 1 582  ? 14.283  72.582 -9.447  1.00 108.88 ? 579  LYS A N   1 
ATOM 4511 C CA  . LYS A 1 582  ? 13.433  71.423 -9.682  1.00 108.88 ? 579  LYS A CA  1 
ATOM 4512 C C   . LYS A 1 582  ? 14.103  70.095 -9.266  1.00 108.88 ? 579  LYS A C   1 
ATOM 4513 O O   . LYS A 1 582  ? 15.290  70.055 -8.893  1.00 108.88 ? 579  LYS A O   1 
ATOM 4514 C CB  . LYS A 1 582  ? 12.994  71.378 -11.154 1.00 78.91  ? 579  LYS A CB  1 
ATOM 4515 C CG  . LYS A 1 582  ? 14.129  71.497 -12.197 1.00 78.91  ? 579  LYS A CG  1 
ATOM 4516 C CD  . LYS A 1 582  ? 13.803  70.752 -13.508 1.00 78.91  ? 579  LYS A CD  1 
ATOM 4517 C CE  . LYS A 1 582  ? 13.982  69.236 -13.330 1.00 78.91  ? 579  LYS A CE  1 
ATOM 4518 N NZ  . LYS A 1 582  ? 13.159  68.413 -14.270 1.00 78.91  ? 579  LYS A NZ  1 
ATOM 4519 N N   . GLU A 1 583  ? 13.328  69.014 -9.308  1.00 112.98 ? 580  GLU A N   1 
ATOM 4520 C CA  . GLU A 1 583  ? 13.899  67.680 -9.219  1.00 112.98 ? 580  GLU A CA  1 
ATOM 4521 C C   . GLU A 1 583  ? 13.617  66.976 -10.541 1.00 112.98 ? 580  GLU A C   1 
ATOM 4522 O O   . GLU A 1 583  ? 12.762  67.420 -11.309 1.00 112.98 ? 580  GLU A O   1 
ATOM 4523 C CB  . GLU A 1 583  ? 13.311  66.922 -8.026  1.00 127.78 ? 580  GLU A CB  1 
ATOM 4524 C CG  . GLU A 1 583  ? 13.953  65.561 -7.736  1.00 127.78 ? 580  GLU A CG  1 
ATOM 4525 C CD  . GLU A 1 583  ? 15.417  65.642 -7.373  1.00 127.78 ? 580  GLU A CD  1 
ATOM 4526 O OE1 . GLU A 1 583  ? 15.800  66.542 -6.586  1.00 127.78 ? 580  GLU A OE1 1 
ATOM 4527 O OE2 . GLU A 1 583  ? 16.183  64.792 -7.875  1.00 127.78 ? 580  GLU A OE2 1 
ATOM 4528 N N   . MET A 1 584  ? 14.347  65.899 -10.814 1.00 145.11 ? 581  MET A N   1 
ATOM 4529 C CA  . MET A 1 584  ? 14.147  65.130 -12.037 1.00 145.11 ? 581  MET A CA  1 
ATOM 4530 C C   . MET A 1 584  ? 14.004  63.631 -11.718 1.00 145.11 ? 581  MET A C   1 
ATOM 4531 O O   . MET A 1 584  ? 14.821  62.814 -12.141 1.00 145.11 ? 581  MET A O   1 
ATOM 4532 C CB  . MET A 1 584  ? 15.298  65.405 -13.030 1.00 98.73  ? 581  MET A CB  1 
ATOM 4533 C CG  . MET A 1 584  ? 15.062  64.921 -14.488 1.00 98.73  ? 581  MET A CG  1 
ATOM 4534 S SD  . MET A 1 584  ? 14.172  66.100 -15.550 1.00 98.73  ? 581  MET A SD  1 
ATOM 4535 C CE  . MET A 1 584  ? 15.524  66.967 -16.402 1.00 98.73  ? 581  MET A CE  1 
ATOM 4536 N N   . LEU A 1 585  ? 12.959  63.280 -10.970 1.00 75.44  ? 582  LEU A N   1 
ATOM 4537 C CA  . LEU A 1 585  ? 12.684  61.883 -10.577 1.00 75.44  ? 582  LEU A CA  1 
ATOM 4538 C C   . LEU A 1 585  ? 12.568  60.986 -11.801 1.00 75.44  ? 582  LEU A C   1 
ATOM 4539 O O   . LEU A 1 585  ? 12.307  61.469 -12.900 1.00 75.44  ? 582  LEU A O   1 
ATOM 4540 C CB  . LEU A 1 585  ? 11.380  61.800 -9.786  1.00 47.11  ? 582  LEU A CB  1 
ATOM 4541 C CG  . LEU A 1 585  ? 10.678  63.113 -9.360  1.00 47.11  ? 582  LEU A CG  1 
ATOM 4542 C CD1 . LEU A 1 585  ? 9.165   62.853 -9.201  1.00 47.11  ? 582  LEU A CD1 1 
ATOM 4543 C CD2 . LEU A 1 585  ? 11.241  63.758 -8.121  1.00 47.11  ? 582  LEU A CD2 1 
ATOM 4544 N N   . GLY A 1 586  ? 12.757  59.688 -11.621 1.00 78.55  ? 583  GLY A N   1 
ATOM 4545 C CA  . GLY A 1 586  ? 12.840  58.787 -12.769 1.00 78.55  ? 583  GLY A CA  1 
ATOM 4546 C C   . GLY A 1 586  ? 11.631  57.897 -13.026 1.00 78.55  ? 583  GLY A C   1 
ATOM 4547 O O   . GLY A 1 586  ? 10.498  58.242 -12.665 1.00 78.55  ? 583  GLY A O   1 
ATOM 4548 N N   . GLY A 1 587  ? 11.881  56.743 -13.650 1.00 98.32  ? 584  GLY A N   1 
ATOM 4549 C CA  . GLY A 1 587  ? 10.830  55.803 -14.042 1.00 98.32  ? 584  GLY A CA  1 
ATOM 4550 C C   . GLY A 1 587  ? 9.934   56.385 -15.121 1.00 98.32  ? 584  GLY A C   1 
ATOM 4551 O O   . GLY A 1 587  ? 10.000  57.590 -15.419 1.00 98.32  ? 584  GLY A O   1 
ATOM 4552 N N   . GLU A 1 588  ? 9.088   55.541 -15.703 1.00 162.64 ? 585  GLU A N   1 
ATOM 4553 C CA  . GLU A 1 588  ? 8.187   55.987 -16.766 1.00 162.64 ? 585  GLU A CA  1 
ATOM 4554 C C   . GLU A 1 588  ? 6.795   56.376 -16.225 1.00 162.64 ? 585  GLU A C   1 
ATOM 4555 O O   . GLU A 1 588  ? 5.914   56.733 -17.003 1.00 162.64 ? 585  GLU A O   1 
ATOM 4556 C CB  . GLU A 1 588  ? 8.087   54.937 -17.896 1.00 108.25 ? 585  GLU A CB  1 
ATOM 4557 C CG  . GLU A 1 588  ? 9.424   54.237 -18.319 1.00 108.25 ? 585  GLU A CG  1 
ATOM 4558 C CD  . GLU A 1 588  ? 10.202  54.944 -19.458 1.00 108.25 ? 585  GLU A CD  1 
ATOM 4559 O OE1 . GLU A 1 588  ? 10.603  56.120 -19.297 1.00 108.25 ? 585  GLU A OE1 1 
ATOM 4560 O OE2 . GLU A 1 588  ? 10.447  54.312 -20.514 1.00 108.25 ? 585  GLU A OE2 1 
ATOM 4561 N N   . ILE A 1 589  ? 6.621   56.332 -14.898 1.00 86.29  ? 586  ILE A N   1 
ATOM 4562 C CA  . ILE A 1 589  ? 5.320   56.609 -14.231 1.00 86.29  ? 586  ILE A CA  1 
ATOM 4563 C C   . ILE A 1 589  ? 5.249   58.026 -13.597 1.00 86.29  ? 586  ILE A C   1 
ATOM 4564 O O   . ILE A 1 589  ? 6.195   58.452 -12.919 1.00 86.29  ? 586  ILE A O   1 
ATOM 4565 C CB  . ILE A 1 589  ? 4.951   55.470 -13.172 1.00 84.77  ? 586  ILE A CB  1 
ATOM 4566 C CG1 . ILE A 1 589  ? 4.475   54.167 -13.854 1.00 84.77  ? 586  ILE A CG1 1 
ATOM 4567 C CG2 . ILE A 1 589  ? 3.913   55.950 -12.149 1.00 84.77  ? 586  ILE A CG2 1 
ATOM 4568 C CD1 . ILE A 1 589  ? 3.272   54.304 -14.842 1.00 84.77  ? 586  ILE A CD1 1 
ATOM 4569 N N   . ILE A 1 590  ? 4.135   58.740 -13.798 1.00 86.94  ? 587  ILE A N   1 
ATOM 4570 C CA  . ILE A 1 590  ? 4.058   60.155 -13.350 1.00 86.94  ? 587  ILE A CA  1 
ATOM 4571 C C   . ILE A 1 590  ? 3.591   60.428 -11.917 1.00 86.94  ? 587  ILE A C   1 
ATOM 4572 O O   . ILE A 1 590  ? 2.986   59.578 -11.277 1.00 86.94  ? 587  ILE A O   1 
ATOM 4573 C CB  . ILE A 1 590  ? 3.237   61.107 -14.308 1.00 59.95  ? 587  ILE A CB  1 
ATOM 4574 C CG1 . ILE A 1 590  ? 1.724   61.027 -14.054 1.00 59.95  ? 587  ILE A CG1 1 
ATOM 4575 C CG2 . ILE A 1 590  ? 3.681   60.960 -15.795 1.00 59.95  ? 587  ILE A CG2 1 
ATOM 4576 C CD1 . ILE A 1 590  ? 1.040   59.851 -14.729 1.00 59.95  ? 587  ILE A CD1 1 
ATOM 4577 N N   . PRO A 1 591  ? 3.872   61.640 -11.423 1.00 61.32  ? 588  PRO A N   1 
ATOM 4578 C CA  . PRO A 1 591  ? 3.410   62.062 -10.108 1.00 61.32  ? 588  PRO A CA  1 
ATOM 4579 C C   . PRO A 1 591  ? 1.913   62.291 -10.098 1.00 61.32  ? 588  PRO A C   1 
ATOM 4580 O O   . PRO A 1 591  ? 1.428   63.294 -10.623 1.00 61.32  ? 588  PRO A O   1 
ATOM 4581 C CB  . PRO A 1 591  ? 4.148   63.387 -9.872  1.00 60.48  ? 588  PRO A CB  1 
ATOM 4582 C CG  . PRO A 1 591  ? 4.494   63.891 -11.237 1.00 60.48  ? 588  PRO A CG  1 
ATOM 4583 C CD  . PRO A 1 591  ? 4.682   62.676 -12.094 1.00 60.48  ? 588  PRO A CD  1 
ATOM 4584 N N   . ARG A 1 592  ? 1.192   61.345 -9.517  1.00 69.63  ? 589  ARG A N   1 
ATOM 4585 C CA  . ARG A 1 592  ? -0.241  61.450 -9.327  1.00 69.63  ? 589  ARG A CA  1 
ATOM 4586 C C   . ARG A 1 592  ? -0.602  62.648 -8.381  1.00 69.63  ? 589  ARG A C   1 
ATOM 4587 O O   . ARG A 1 592  ? -1.572  63.380 -8.612  1.00 69.63  ? 589  ARG A O   1 
ATOM 4588 C CB  . ARG A 1 592  ? -0.751  60.106 -8.807  1.00 123.42 ? 589  ARG A CB  1 
ATOM 4589 C CG  . ARG A 1 592  ? -2.086  59.680 -9.353  1.00 123.42 ? 589  ARG A CG  1 
ATOM 4590 C CD  . ARG A 1 592  ? -3.160  60.077 -8.371  1.00 123.42 ? 589  ARG A CD  1 
ATOM 4591 N NE  . ARG A 1 592  ? -4.507  59.785 -8.843  1.00 123.42 ? 589  ARG A NE  1 
ATOM 4592 C CZ  . ARG A 1 592  ? -5.594  60.445 -8.449  1.00 123.42 ? 589  ARG A CZ  1 
ATOM 4593 N NH1 . ARG A 1 592  ? -5.502  61.454 -7.586  1.00 123.42 ? 589  ARG A NH1 1 
ATOM 4594 N NH2 . ARG A 1 592  ? -6.781  60.099 -8.929  1.00 123.42 ? 589  ARG A NH2 1 
ATOM 4595 N N   . SER A 1 593  ? 0.208   62.883 -7.346  1.00 57.00  ? 590  SER A N   1 
ATOM 4596 C CA  . SER A 1 593  ? -0.123  63.932 -6.360  1.00 57.00  ? 590  SER A CA  1 
ATOM 4597 C C   . SER A 1 593  ? 1.089   64.711 -5.777  1.00 57.00  ? 590  SER A C   1 
ATOM 4598 O O   . SER A 1 593  ? 2.136   64.134 -5.427  1.00 57.00  ? 590  SER A O   1 
ATOM 4599 C CB  . SER A 1 593  ? -1.009  63.358 -5.239  1.00 85.19  ? 590  SER A CB  1 
ATOM 4600 O OG  . SER A 1 593  ? -1.694  64.389 -4.552  1.00 85.19  ? 590  SER A OG  1 
ATOM 4601 N N   . ILE A 1 594  ? 0.926   66.030 -5.705  1.00 81.92  ? 591  ILE A N   1 
ATOM 4602 C CA  . ILE A 1 594  ? 1.935   66.923 -5.140  1.00 81.92  ? 591  ILE A CA  1 
ATOM 4603 C C   . ILE A 1 594  ? 1.239   67.741 -4.063  1.00 81.92  ? 591  ILE A C   1 
ATOM 4604 O O   . ILE A 1 594  ? 0.038   68.034 -4.180  1.00 81.92  ? 591  ILE A O   1 
ATOM 4605 C CB  . ILE A 1 594  ? 2.582   67.842 -6.240  1.00 89.33  ? 591  ILE A CB  1 
ATOM 4606 C CG1 . ILE A 1 594  ? 3.830   68.563 -5.715  1.00 89.33  ? 591  ILE A CG1 1 
ATOM 4607 C CG2 . ILE A 1 594  ? 1.555   68.806 -6.870  1.00 89.33  ? 591  ILE A CG2 1 
ATOM 4608 C CD1 . ILE A 1 594  ? 5.116   67.789 -5.887  1.00 89.33  ? 591  ILE A CD1 1 
ATOM 4609 N N   . LEU A 1 595  ? 1.951   68.078 -2.997  1.00 84.09  ? 592  LEU A N   1 
ATOM 4610 C CA  . LEU A 1 595  ? 1.288   68.822 -1.952  1.00 84.09  ? 592  LEU A CA  1 
ATOM 4611 C C   . LEU A 1 595  ? 2.251   69.628 -1.151  1.00 84.09  ? 592  LEU A C   1 
ATOM 4612 O O   . LEU A 1 595  ? 3.338   69.127 -0.810  1.00 84.09  ? 592  LEU A O   1 
ATOM 4613 C CB  . LEU A 1 595  ? 0.497   67.893 -1.014  1.00 143.57 ? 592  LEU A CB  1 
ATOM 4614 C CG  . LEU A 1 595  ? -0.645  68.473 -0.155  1.00 143.57 ? 592  LEU A CG  1 
ATOM 4615 C CD1 . LEU A 1 595  ? -1.951  68.671 -0.940  1.00 143.57 ? 592  LEU A CD1 1 
ATOM 4616 C CD2 . LEU A 1 595  ? -0.899  67.582 1.052   1.00 143.57 ? 592  LEU A CD2 1 
ATOM 4617 N N   . MET A 1 596  ? 1.818   70.868 -0.864  1.00 132.40 ? 593  MET A N   1 
ATOM 4618 C CA  . MET A 1 596  ? 2.450   71.820 0.065   1.00 132.40 ? 593  MET A CA  1 
ATOM 4619 C C   . MET A 1 596  ? 1.686   71.891 1.393   1.00 132.40 ? 593  MET A C   1 
ATOM 4620 O O   . MET A 1 596  ? 0.470   72.111 1.400   1.00 132.40 ? 593  MET A O   1 
ATOM 4621 C CB  . MET A 1 596  ? 2.556   73.229 -0.562  1.00 114.47 ? 593  MET A CB  1 
ATOM 4622 C CG  . MET A 1 596  ? 1.255   74.075 -0.606  1.00 114.47 ? 593  MET A CG  1 
ATOM 4623 S SD  . MET A 1 596  ? 1.391   75.736 -1.351  1.00 114.47 ? 593  MET A SD  1 
ATOM 4624 C CE  . MET A 1 596  ? 1.844   75.338 -3.027  1.00 114.47 ? 593  MET A CE  1 
ATOM 4625 N N   . THR A 1 597  ? 2.403   71.700 2.504   1.00 181.53 ? 594  THR A N   1 
ATOM 4626 C CA  . THR A 1 597  ? 1.819   71.784 3.854   1.00 181.53 ? 594  THR A CA  1 
ATOM 4627 C C   . THR A 1 597  ? 2.688   72.511 4.873   1.00 181.53 ? 594  THR A C   1 
ATOM 4628 O O   . THR A 1 597  ? 3.822   72.894 4.588   1.00 181.53 ? 594  THR A O   1 
ATOM 4629 C CB  . THR A 1 597  ? 1.507   70.401 4.456   1.00 80.25  ? 594  THR A CB  1 
ATOM 4630 O OG1 . THR A 1 597  ? 2.642   69.524 4.304   1.00 80.25  ? 594  THR A OG1 1 
ATOM 4631 C CG2 . THR A 1 597  ? 0.256   69.793 3.812   1.00 80.25  ? 594  THR A CG2 1 
ATOM 4632 N N   . THR A 1 598  ? 2.136   72.687 6.072   1.00 97.30  ? 595  THR A N   1 
ATOM 4633 C CA  . THR A 1 598  ? 2.858   73.312 7.183   1.00 97.30  ? 595  THR A CA  1 
ATOM 4634 C C   . THR A 1 598  ? 2.388   72.722 8.513   1.00 97.30  ? 595  THR A C   1 
ATOM 4635 O O   . THR A 1 598  ? 1.256   72.236 8.624   1.00 97.30  ? 595  THR A O   1 
ATOM 4636 C CB  . THR A 1 598  ? 2.729   74.878 7.174   1.00 184.20 ? 595  THR A CB  1 
ATOM 4637 O OG1 . THR A 1 598  ? 3.286   75.402 5.960   1.00 184.20 ? 595  THR A OG1 1 
ATOM 4638 C CG2 . THR A 1 598  ? 3.468   75.521 8.356   1.00 184.20 ? 595  THR A CG2 1 
ATOM 4639 N N   . PHE A 1 599  ? 3.270   72.765 9.511   1.00 161.85 ? 596  PHE A N   1 
ATOM 4640 C CA  . PHE A 1 599  ? 3.017   72.148 10.806  1.00 161.85 ? 596  PHE A CA  1 
ATOM 4641 C C   . PHE A 1 599  ? 3.539   72.981 11.963  1.00 161.85 ? 596  PHE A C   1 
ATOM 4642 O O   . PHE A 1 599  ? 2.789   73.371 12.865  1.00 161.85 ? 596  PHE A O   1 
ATOM 4643 C CB  . PHE A 1 599  ? 3.659   70.763 10.830  1.00 116.85 ? 596  PHE A CB  1 
ATOM 4644 C CG  . PHE A 1 599  ? 2.837   69.714 10.143  1.00 116.85 ? 596  PHE A CG  1 
ATOM 4645 C CD1 . PHE A 1 599  ? 3.101   69.359 8.823   1.00 116.85 ? 596  PHE A CD1 1 
ATOM 4646 C CD2 . PHE A 1 599  ? 1.782   69.091 10.811  1.00 116.85 ? 596  PHE A CD2 1 
ATOM 4647 C CE1 . PHE A 1 599  ? 2.336   68.383 8.177   1.00 116.85 ? 596  PHE A CE1 1 
ATOM 4648 C CE2 . PHE A 1 599  ? 1.019   68.122 10.179  1.00 116.85 ? 596  PHE A CE2 1 
ATOM 4649 C CZ  . PHE A 1 599  ? 1.294   67.763 8.860   1.00 116.85 ? 596  PHE A CZ  1 
ATOM 4650 N N   . GLU A 1 600  ? 4.843   73.228 11.927  1.00 181.87 ? 597  GLU A N   1 
ATOM 4651 C CA  . GLU A 1 600  ? 5.516   74.010 12.938  1.00 181.87 ? 597  GLU A CA  1 
ATOM 4652 C C   . GLU A 1 600  ? 6.338   75.071 12.226  1.00 181.87 ? 597  GLU A C   1 
ATOM 4653 O O   . GLU A 1 600  ? 5.790   75.973 11.585  1.00 181.87 ? 597  GLU A O   1 
ATOM 4654 C CB  . GLU A 1 600  ? 6.423   73.114 13.799  1.00 153.98 ? 597  GLU A CB  1 
ATOM 4655 C CG  . GLU A 1 600  ? 5.691   72.213 14.792  1.00 153.98 ? 597  GLU A CG  1 
ATOM 4656 C CD  . GLU A 1 600  ? 5.203   70.913 14.158  1.00 153.98 ? 597  GLU A CD  1 
ATOM 4657 O OE1 . GLU A 1 600  ? 6.055   70.043 13.828  1.00 153.98 ? 597  GLU A OE1 1 
ATOM 4658 O OE2 . GLU A 1 600  ? 3.962   70.762 14.013  1.00 153.98 ? 597  GLU A OE2 1 
ATOM 4659 N N   . SER A 1 601  ? 7.657   74.931 12.333  1.00 190.80 ? 598  SER A N   1 
ATOM 4660 C CA  . SER A 1 601  ? 8.602   75.832 11.700  1.00 190.80 ? 598  SER A CA  1 
ATOM 4661 C C   . SER A 1 601  ? 9.285   75.130 10.529  1.00 190.80 ? 598  SER A C   1 
ATOM 4662 O O   . SER A 1 601  ? 10.434  74.689 10.627  1.00 190.80 ? 598  SER A O   1 
ATOM 4663 C CB  . SER A 1 601  ? 9.626   76.344 12.722  1.00 145.27 ? 598  SER A CB  1 
ATOM 4664 O OG  . SER A 1 601  ? 9.007   77.190 13.680  1.00 145.27 ? 598  SER A OG  1 
ATOM 4665 N N   . SER A 1 602  ? 8.535   75.005 9.438   1.00 209.18 ? 599  SER A N   1 
ATOM 4666 C CA  . SER A 1 602  ? 9.031   74.528 8.146   1.00 209.18 ? 599  SER A CA  1 
ATOM 4667 C C   . SER A 1 602  ? 7.811   74.317 7.263   1.00 209.18 ? 599  SER A C   1 
ATOM 4668 O O   . SER A 1 602  ? 6.791   73.783 7.713   1.00 209.18 ? 599  SER A O   1 
ATOM 4669 C CB  . SER A 1 602  ? 9.849   73.224 8.269   1.00 132.57 ? 599  SER A CB  1 
ATOM 4670 O OG  . SER A 1 602  ? 10.556  72.917 7.068   1.00 132.57 ? 599  SER A OG  1 
ATOM 4671 N N   . HIS A 1 603  ? 7.907   74.782 6.021   1.00 209.17 ? 600  HIS A N   1 
ATOM 4672 C CA  . HIS A 1 603  ? 6.887   74.507 5.015   1.00 209.17 ? 600  HIS A CA  1 
ATOM 4673 C C   . HIS A 1 603  ? 7.287   73.233 4.258   1.00 209.17 ? 600  HIS A C   1 
ATOM 4674 O O   . HIS A 1 603  ? 8.482   72.930 4.138   1.00 209.17 ? 600  HIS A O   1 
ATOM 4675 C CB  . HIS A 1 603  ? 6.697   75.718 4.091   1.00 95.15  ? 600  HIS A CB  1 
ATOM 4676 C CG  . HIS A 1 603  ? 6.122   76.916 4.787   1.00 95.15  ? 600  HIS A CG  1 
ATOM 4677 N ND1 . HIS A 1 603  ? 4.848   77.385 4.538   1.00 95.15  ? 600  HIS A ND1 1 
ATOM 4678 C CD2 . HIS A 1 603  ? 6.639   77.729 5.741   1.00 95.15  ? 600  HIS A CD2 1 
ATOM 4679 C CE1 . HIS A 1 603  ? 4.611   78.440 5.298   1.00 95.15  ? 600  HIS A CE1 1 
ATOM 4680 N NE2 . HIS A 1 603  ? 5.681   78.671 6.037   1.00 95.15  ? 600  HIS A NE2 1 
ATOM 4681 N N   . TYR A 1 604  ? 6.292   72.486 3.771   1.00 108.23 ? 601  TYR A N   1 
ATOM 4682 C CA  . TYR A 1 604  ? 6.507   71.120 3.276   1.00 108.23 ? 601  TYR A CA  1 
ATOM 4683 C C   . TYR A 1 604  ? 6.040   70.849 1.830   1.00 108.23 ? 601  TYR A C   1 
ATOM 4684 O O   . TYR A 1 604  ? 4.977   71.319 1.396   1.00 108.23 ? 601  TYR A O   1 
ATOM 4685 C CB  . TYR A 1 604  ? 5.831   70.126 4.223   1.00 127.09 ? 601  TYR A CB  1 
ATOM 4686 C CG  . TYR A 1 604  ? 6.398   70.064 5.636   1.00 127.09 ? 601  TYR A CG  1 
ATOM 4687 C CD1 . TYR A 1 604  ? 5.779   70.743 6.697   1.00 127.09 ? 601  TYR A CD1 1 
ATOM 4688 C CD2 . TYR A 1 604  ? 7.536   69.297 5.920   1.00 127.09 ? 601  TYR A CD2 1 
ATOM 4689 C CE1 . TYR A 1 604  ? 6.288   70.663 8.004   1.00 127.09 ? 601  TYR A CE1 1 
ATOM 4690 C CE2 . TYR A 1 604  ? 8.051   69.215 7.217   1.00 127.09 ? 601  TYR A CE2 1 
ATOM 4691 C CZ  . TYR A 1 604  ? 7.423   69.895 8.250   1.00 127.09 ? 601  TYR A CZ  1 
ATOM 4692 O OH  . TYR A 1 604  ? 7.939   69.803 9.522   1.00 127.09 ? 601  TYR A OH  1 
ATOM 4693 N N   . LEU A 1 605  ? 6.852   70.084 1.100   1.00 139.20 ? 602  LEU A N   1 
ATOM 4694 C CA  . LEU A 1 605  ? 6.445   69.528 -0.195  1.00 139.20 ? 602  LEU A CA  1 
ATOM 4695 C C   . LEU A 1 605  ? 6.632   68.017 -0.265  1.00 139.20 ? 602  LEU A C   1 
ATOM 4696 O O   . LEU A 1 605  ? 7.712   67.479 0.015   1.00 139.20 ? 602  LEU A O   1 
ATOM 4697 C CB  . LEU A 1 605  ? 7.152   70.205 -1.379  1.00 117.92 ? 602  LEU A CB  1 
ATOM 4698 C CG  . LEU A 1 605  ? 7.259   69.409 -2.696  1.00 117.92 ? 602  LEU A CG  1 
ATOM 4699 C CD1 . LEU A 1 605  ? 6.912   70.256 -3.894  1.00 117.92 ? 602  LEU A CD1 1 
ATOM 4700 C CD2 . LEU A 1 605  ? 8.629   68.722 -2.870  1.00 117.92 ? 602  LEU A CD2 1 
ATOM 4701 N N   . LEU A 1 606  ? 5.565   67.342 -0.669  1.00 114.18 ? 603  LEU A N   1 
ATOM 4702 C CA  . LEU A 1 606  ? 5.601   65.906 -0.847  1.00 114.18 ? 603  LEU A CA  1 
ATOM 4703 C C   . LEU A 1 606  ? 5.066   65.578 -2.239  1.00 114.18 ? 603  LEU A C   1 
ATOM 4704 O O   . LEU A 1 606  ? 4.223   66.312 -2.792  1.00 114.18 ? 603  LEU A O   1 
ATOM 4705 C CB  . LEU A 1 606  ? 4.775   65.218 0.247   1.00 108.19 ? 603  LEU A CB  1 
ATOM 4706 C CG  . LEU A 1 606  ? 4.766   65.796 1.672   1.00 108.19 ? 603  LEU A CG  1 
ATOM 4707 C CD1 . LEU A 1 606  ? 3.831   67.000 1.825   1.00 108.19 ? 603  LEU A CD1 1 
ATOM 4708 C CD2 . LEU A 1 606  ? 4.358   64.713 2.621   1.00 108.19 ? 603  LEU A CD2 1 
ATOM 4709 N N   . CYS A 1 607  ? 5.573   64.489 -2.813  1.00 49.06  ? 604  CYS A N   1 
ATOM 4710 C CA  . CYS A 1 607  ? 5.147   64.112 -4.148  1.00 49.06  ? 604  CYS A CA  1 
ATOM 4711 C C   . CYS A 1 607  ? 4.932   62.609 -4.392  1.00 49.06  ? 604  CYS A C   1 
ATOM 4712 O O   . CYS A 1 607  ? 5.880   61.832 -4.520  1.00 49.06  ? 604  CYS A O   1 
ATOM 4713 C CB  . CYS A 1 607  ? 6.064   64.684 -5.220  1.00 79.18  ? 604  CYS A CB  1 
ATOM 4714 S SG  . CYS A 1 607  ? 5.423   64.270 -6.862  1.00 79.18  ? 604  CYS A SG  1 
ATOM 4715 N N   . ALA A 1 608  ? 3.660   62.243 -4.519  1.00 68.79  ? 605  ALA A N   1 
ATOM 4716 C CA  . ALA A 1 608  ? 3.242   60.880 -4.781  1.00 68.79  ? 605  ALA A CA  1 
ATOM 4717 C C   . ALA A 1 608  ? 3.321   60.513 -6.248  1.00 68.79  ? 605  ALA A C   1 
ATOM 4718 O O   . ALA A 1 608  ? 2.884   61.287 -7.109  1.00 68.79  ? 605  ALA A O   1 
ATOM 4719 C CB  . ALA A 1 608  ? 1.832   60.727 -4.322  1.00 57.89  ? 605  ALA A CB  1 
ATOM 4720 N N   . LEU A 1 609  ? 3.851   59.323 -6.513  1.00 65.04  ? 606  LEU A N   1 
ATOM 4721 C CA  . LEU A 1 609  ? 3.818   58.722 -7.841  1.00 65.04  ? 606  LEU A CA  1 
ATOM 4722 C C   . LEU A 1 609  ? 2.854   57.542 -7.895  1.00 65.04  ? 606  LEU A C   1 
ATOM 4723 O O   . LEU A 1 609  ? 2.313   57.112 -6.876  1.00 65.04  ? 606  LEU A O   1 
ATOM 4724 C CB  . LEU A 1 609  ? 5.182   58.202 -8.243  1.00 61.59  ? 606  LEU A CB  1 
ATOM 4725 C CG  . LEU A 1 609  ? 6.471   58.933 -7.951  1.00 61.59  ? 606  LEU A CG  1 
ATOM 4726 C CD1 . LEU A 1 609  ? 7.518   58.160 -8.725  1.00 61.59  ? 606  LEU A CD1 1 
ATOM 4727 C CD2 . LEU A 1 609  ? 6.406   60.400 -8.380  1.00 61.59  ? 606  LEU A CD2 1 
ATOM 4728 N N   . GLY A 1 610  ? 2.664   56.987 -9.084  1.00 52.46  ? 607  GLY A N   1 
ATOM 4729 C CA  . GLY A 1 610  ? 1.639   55.987 -9.267  1.00 52.46  ? 607  GLY A CA  1 
ATOM 4730 C C   . GLY A 1 610  ? 2.095   54.592 -8.904  1.00 52.46  ? 607  GLY A C   1 
ATOM 4731 O O   . GLY A 1 610  ? 1.294   53.637 -8.950  1.00 52.46  ? 607  GLY A O   1 
ATOM 4732 N N   . ASP A 1 611  ? 3.371   54.460 -8.556  1.00 100.99 ? 608  ASP A N   1 
ATOM 4733 C CA  . ASP A 1 611  ? 3.957   53.178 -8.161  1.00 100.99 ? 608  ASP A CA  1 
ATOM 4734 C C   . ASP A 1 611  ? 3.829   52.941 -6.652  1.00 100.99 ? 608  ASP A C   1 
ATOM 4735 O O   . ASP A 1 611  ? 4.504   52.081 -6.082  1.00 100.99 ? 608  ASP A O   1 
ATOM 4736 C CB  . ASP A 1 611  ? 5.426   53.189 -8.537  1.00 98.75  ? 608  ASP A CB  1 
ATOM 4737 C CG  . ASP A 1 611  ? 6.106   54.474 -8.114  1.00 98.75  ? 608  ASP A CG  1 
ATOM 4738 O OD1 . ASP A 1 611  ? 7.274   54.682 -8.508  1.00 98.75  ? 608  ASP A OD1 1 
ATOM 4739 O OD2 . ASP A 1 611  ? 5.469   55.282 -7.394  1.00 98.75  ? 608  ASP A OD2 1 
ATOM 4740 N N   . GLY A 1 612  ? 2.968   53.723 -6.011  1.00 88.17  ? 609  GLY A N   1 
ATOM 4741 C CA  . GLY A 1 612  ? 2.775   53.664 -4.564  1.00 88.17  ? 609  GLY A CA  1 
ATOM 4742 C C   . GLY A 1 612  ? 3.745   54.539 -3.780  1.00 88.17  ? 609  GLY A C   1 
ATOM 4743 O O   . GLY A 1 612  ? 3.505   54.904 -2.621  1.00 88.17  ? 609  GLY A O   1 
ATOM 4744 N N   . ALA A 1 613  ? 4.837   54.903 -4.430  1.00 62.54  ? 610  ALA A N   1 
ATOM 4745 C CA  . ALA A 1 613  ? 5.991   55.395 -3.713  1.00 62.54  ? 610  ALA A CA  1 
ATOM 4746 C C   . ALA A 1 613  ? 6.002   56.888 -3.706  1.00 62.54  ? 610  ALA A C   1 
ATOM 4747 O O   . ALA A 1 613  ? 5.412   57.523 -4.564  1.00 62.54  ? 610  ALA A O   1 
ATOM 4748 C CB  . ALA A 1 613  ? 7.281   54.840 -4.342  1.00 103.25 ? 610  ALA A CB  1 
ATOM 4749 N N   . LEU A 1 614  ? 6.703   57.451 -2.748  1.00 89.60  ? 611  LEU A N   1 
ATOM 4750 C CA  . LEU A 1 614  ? 6.626   58.864 -2.563  1.00 89.60  ? 611  LEU A CA  1 
ATOM 4751 C C   . LEU A 1 614  ? 8.022   59.441 -2.435  1.00 89.60  ? 611  LEU A C   1 
ATOM 4752 O O   . LEU A 1 614  ? 8.899   58.835 -1.818  1.00 89.60  ? 611  LEU A O   1 
ATOM 4753 C CB  . LEU A 1 614  ? 5.794   59.128 -1.317  1.00 61.90  ? 611  LEU A CB  1 
ATOM 4754 C CG  . LEU A 1 614  ? 5.547   60.557 -0.897  1.00 61.90  ? 611  LEU A CG  1 
ATOM 4755 C CD1 . LEU A 1 614  ? 4.379   60.557 0.057   1.00 61.90  ? 611  LEU A CD1 1 
ATOM 4756 C CD2 . LEU A 1 614  ? 6.775   61.147 -0.235  1.00 61.90  ? 611  LEU A CD2 1 
ATOM 4757 N N   . PHE A 1 615  ? 8.226   60.608 -3.032  1.00 86.88  ? 612  PHE A N   1 
ATOM 4758 C CA  . PHE A 1 615  ? 9.465   61.362 -2.863  1.00 86.88  ? 612  PHE A CA  1 
ATOM 4759 C C   . PHE A 1 615  ? 9.137   62.543 -1.953  1.00 86.88  ? 612  PHE A C   1 
ATOM 4760 O O   . PHE A 1 615  ? 8.079   63.166 -2.113  1.00 86.88  ? 612  PHE A O   1 
ATOM 4761 C CB  . PHE A 1 615  ? 10.014  61.794 -4.233  1.00 84.38  ? 612  PHE A CB  1 
ATOM 4762 C CG  . PHE A 1 615  ? 10.538  60.640 -5.078  1.00 84.38  ? 612  PHE A CG  1 
ATOM 4763 C CD1 . PHE A 1 615  ? 9.692   59.627 -5.525  1.00 84.38  ? 612  PHE A CD1 1 
ATOM 4764 C CD2 . PHE A 1 615  ? 11.884  60.574 -5.435  1.00 84.38  ? 612  PHE A CD2 1 
ATOM 4765 C CE1 . PHE A 1 615  ? 10.191  58.556 -6.305  1.00 84.38  ? 612  PHE A CE1 1 
ATOM 4766 C CE2 . PHE A 1 615  ? 12.382  59.513 -6.212  1.00 84.38  ? 612  PHE A CE2 1 
ATOM 4767 C CZ  . PHE A 1 615  ? 11.530  58.507 -6.647  1.00 84.38  ? 612  PHE A CZ  1 
ATOM 4768 N N   . TYR A 1 616  ? 9.998   62.822 -0.972  1.00 146.42 ? 613  TYR A N   1 
ATOM 4769 C CA  . TYR A 1 616  ? 9.664   63.834 0.048   1.00 146.42 ? 613  TYR A CA  1 
ATOM 4770 C C   . TYR A 1 616  ? 10.700  64.917 0.306   1.00 146.42 ? 613  TYR A C   1 
ATOM 4771 O O   . TYR A 1 616  ? 11.886  64.616 0.463   1.00 146.42 ? 613  TYR A O   1 
ATOM 4772 C CB  . TYR A 1 616  ? 9.235   63.195 1.371   1.00 152.86 ? 613  TYR A CB  1 
ATOM 4773 C CG  . TYR A 1 616  ? 10.043  62.008 1.851   1.00 152.86 ? 613  TYR A CG  1 
ATOM 4774 C CD1 . TYR A 1 616  ? 9.744   60.716 1.412   1.00 152.86 ? 613  TYR A CD1 1 
ATOM 4775 C CD2 . TYR A 1 616  ? 11.060  62.165 2.790   1.00 152.86 ? 613  TYR A CD2 1 
ATOM 4776 C CE1 . TYR A 1 616  ? 10.451  59.622 1.866   1.00 152.86 ? 613  TYR A CE1 1 
ATOM 4777 C CE2 . TYR A 1 616  ? 11.773  61.073 3.252   1.00 152.86 ? 613  TYR A CE2 1 
ATOM 4778 C CZ  . TYR A 1 616  ? 11.458  59.808 2.784   1.00 152.86 ? 613  TYR A CZ  1 
ATOM 4779 O OH  . TYR A 1 616  ? 12.155  58.720 3.232   1.00 152.86 ? 613  TYR A OH  1 
ATOM 4780 N N   . PHE A 1 617  ? 10.208  66.165 0.383   1.00 104.33 ? 614  PHE A N   1 
ATOM 4781 C CA  . PHE A 1 617  ? 11.031  67.404 0.386   1.00 104.33 ? 614  PHE A CA  1 
ATOM 4782 C C   . PHE A 1 617  ? 10.486  68.572 1.295   1.00 104.33 ? 614  PHE A C   1 
ATOM 4783 O O   . PHE A 1 617  ? 9.302   68.619 1.661   1.00 104.33 ? 614  PHE A O   1 
ATOM 4784 C CB  . PHE A 1 617  ? 11.297  67.899 -1.077  1.00 100.66 ? 614  PHE A CB  1 
ATOM 4785 C CG  . PHE A 1 617  ? 12.138  66.937 -1.935  1.00 100.66 ? 614  PHE A CG  1 
ATOM 4786 C CD1 . PHE A 1 617  ? 11.533  65.920 -2.688  1.00 100.66 ? 614  PHE A CD1 1 
ATOM 4787 C CD2 . PHE A 1 617  ? 13.522  67.058 -2.002  1.00 100.66 ? 614  PHE A CD2 1 
ATOM 4788 C CE1 . PHE A 1 617  ? 12.294  65.022 -3.478  1.00 100.66 ? 614  PHE A CE1 1 
ATOM 4789 C CE2 . PHE A 1 617  ? 14.291  66.170 -2.794  1.00 100.66 ? 614  PHE A CE2 1 
ATOM 4790 C CZ  . PHE A 1 617  ? 13.672  65.153 -3.530  1.00 100.66 ? 614  PHE A CZ  1 
ATOM 4791 N N   . GLY A 1 618  ? 11.380  69.501 1.650   1.00 119.82 ? 615  GLY A N   1 
ATOM 4792 C CA  . GLY A 1 618  ? 11.057  70.674 2.475   1.00 119.82 ? 615  GLY A CA  1 
ATOM 4793 C C   . GLY A 1 618  ? 11.291  72.005 1.766   1.00 119.82 ? 615  GLY A C   1 
ATOM 4794 O O   . GLY A 1 618  ? 12.419  72.354 1.406   1.00 119.82 ? 615  GLY A O   1 
ATOM 4795 N N   . LEU A 1 619  ? 10.210  72.763 1.593   1.00 210.35 ? 616  LEU A N   1 
ATOM 4796 C CA  . LEU A 1 619  ? 10.217  74.023 0.833   1.00 210.35 ? 616  LEU A CA  1 
ATOM 4797 C C   . LEU A 1 619  ? 10.527  75.269 1.685   1.00 210.35 ? 616  LEU A C   1 
ATOM 4798 O O   . LEU A 1 619  ? 11.070  75.169 2.791   1.00 210.35 ? 616  LEU A O   1 
ATOM 4799 C CB  . LEU A 1 619  ? 8.882   74.185 0.068   1.00 181.43 ? 616  LEU A CB  1 
ATOM 4800 C CG  . LEU A 1 619  ? 8.551   75.360 -0.873  1.00 181.43 ? 616  LEU A CG  1 
ATOM 4801 C CD1 . LEU A 1 619  ? 9.471   75.411 -2.099  1.00 181.43 ? 616  LEU A CD1 1 
ATOM 4802 C CD2 . LEU A 1 619  ? 7.078   75.322 -1.300  1.00 181.43 ? 616  LEU A CD2 1 
ATOM 4803 N N   . ASN A 1 620  ? 10.159  76.433 1.147   1.00 126.49 ? 617  ASN A N   1 
ATOM 4804 C CA  . ASN A 1 620  ? 10.620  77.728 1.604   1.00 126.49 ? 617  ASN A CA  1 
ATOM 4805 C C   . ASN A 1 620  ? 9.622   78.790 1.216   1.00 126.49 ? 617  ASN A C   1 
ATOM 4806 O O   . ASN A 1 620  ? 9.604   79.215 0.056   1.00 126.49 ? 617  ASN A O   1 
ATOM 4807 C CB  . ASN A 1 620  ? 11.927  78.058 0.903   1.00 94.63  ? 617  ASN A CB  1 
ATOM 4808 C CG  . ASN A 1 620  ? 12.915  76.930 0.982   1.00 94.63  ? 617  ASN A CG  1 
ATOM 4809 O OD1 . ASN A 1 620  ? 13.473  76.683 2.048   1.00 94.63  ? 617  ASN A OD1 1 
ATOM 4810 N ND2 . ASN A 1 620  ? 13.126  76.212 -0.135  1.00 94.63  ? 617  ASN A ND2 1 
ATOM 4811 N N   . ILE A 1 621  ? 8.798   79.220 2.173   1.00 206.13 ? 618  ILE A N   1 
ATOM 4812 C CA  . ILE A 1 621  ? 7.866   80.340 1.961   1.00 206.13 ? 618  ILE A CA  1 
ATOM 4813 C C   . ILE A 1 621  ? 8.540   81.522 1.267   1.00 206.13 ? 618  ILE A C   1 
ATOM 4814 O O   . ILE A 1 621  ? 7.905   82.259 0.505   1.00 206.13 ? 618  ILE A O   1 
ATOM 4815 C CB  . ILE A 1 621  ? 7.213   80.845 3.284   1.00 157.61 ? 618  ILE A CB  1 
ATOM 4816 C CG1 . ILE A 1 621  ? 8.020   80.400 4.522   1.00 157.61 ? 618  ILE A CG1 1 
ATOM 4817 C CG2 . ILE A 1 621  ? 5.744   80.443 3.330   1.00 157.61 ? 618  ILE A CG2 1 
ATOM 4818 C CD1 . ILE A 1 621  ? 7.688   81.151 5.824   1.00 157.61 ? 618  ILE A CD1 1 
ATOM 4819 N N   . GLU A 1 622  ? 9.836   81.675 1.534   1.00 190.26 ? 619  GLU A N   1 
ATOM 4820 C CA  . GLU A 1 622  ? 10.640  82.771 1.018   1.00 190.26 ? 619  GLU A CA  1 
ATOM 4821 C C   . GLU A 1 622  ? 11.312  82.372 -0.290  1.00 190.26 ? 619  GLU A C   1 
ATOM 4822 O O   . GLU A 1 622  ? 10.862  82.743 -1.380  1.00 190.26 ? 619  GLU A O   1 
ATOM 4823 C CB  . GLU A 1 622  ? 11.724  83.148 2.038   1.00 177.04 ? 619  GLU A CB  1 
ATOM 4824 C CG  . GLU A 1 622  ? 11.406  82.811 3.495   1.00 177.04 ? 619  GLU A CG  1 
ATOM 4825 C CD  . GLU A 1 622  ? 10.374  83.745 4.105   1.00 177.04 ? 619  GLU A CD  1 
ATOM 4826 O OE1 . GLU A 1 622  ? 9.162   83.548 3.864   1.00 177.04 ? 619  GLU A OE1 1 
ATOM 4827 O OE2 . GLU A 1 622  ? 10.778  84.677 4.837   1.00 177.04 ? 619  GLU A OE2 1 
ATOM 4828 N N   . THR A 1 623  ? 12.409  81.634 -0.168  1.00 196.79 ? 620  THR A N   1 
ATOM 4829 C CA  . THR A 1 623  ? 13.278  81.331 -1.298  1.00 196.79 ? 620  THR A CA  1 
ATOM 4830 C C   . THR A 1 623  ? 12.642  80.466 -2.382  1.00 196.79 ? 620  THR A C   1 
ATOM 4831 O O   . THR A 1 623  ? 12.180  80.974 -3.404  1.00 196.79 ? 620  THR A O   1 
ATOM 4832 C CB  . THR A 1 623  ? 14.584  80.654 -0.832  1.00 91.27  ? 620  THR A CB  1 
ATOM 4833 O OG1 . THR A 1 623  ? 15.416  80.382 -1.967  1.00 91.27  ? 620  THR A OG1 1 
ATOM 4834 C CG2 . THR A 1 623  ? 14.281  79.352 -0.107  1.00 91.27  ? 620  THR A CG2 1 
ATOM 4835 N N   . GLY A 1 624  ? 12.639  79.156 -2.160  1.00 208.27 ? 621  GLY A N   1 
ATOM 4836 C CA  . GLY A 1 624  ? 12.289  78.202 -3.207  1.00 208.27 ? 621  GLY A CA  1 
ATOM 4837 C C   . GLY A 1 624  ? 13.541  77.488 -3.685  1.00 208.27 ? 621  GLY A C   1 
ATOM 4838 O O   . GLY A 1 624  ? 14.211  77.948 -4.613  1.00 208.27 ? 621  GLY A O   1 
ATOM 4839 N N   . LEU A 1 625  ? 13.856  76.363 -3.051  1.00 164.74 ? 622  LEU A N   1 
ATOM 4840 C CA  . LEU A 1 625  ? 15.033  75.584 -3.414  1.00 164.74 ? 622  LEU A CA  1 
ATOM 4841 C C   . LEU A 1 625  ? 14.726  74.090 -3.417  1.00 164.74 ? 622  LEU A C   1 
ATOM 4842 O O   . LEU A 1 625  ? 13.591  73.681 -3.661  1.00 164.74 ? 622  LEU A O   1 
ATOM 4843 C CB  . LEU A 1 625  ? 16.189  75.881 -2.456  1.00 92.44  ? 622  LEU A CB  1 
ATOM 4844 C CG  . LEU A 1 625  ? 16.745  77.306 -2.486  1.00 92.44  ? 622  LEU A CG  1 
ATOM 4845 C CD1 . LEU A 1 625  ? 17.781  77.502 -1.390  1.00 92.44  ? 622  LEU A CD1 1 
ATOM 4846 C CD2 . LEU A 1 625  ? 17.336  77.623 -3.851  1.00 92.44  ? 622  LEU A CD2 1 
ATOM 4847 N N   . LEU A 1 626  ? 15.744  73.281 -3.144  1.00 121.84 ? 623  LEU A N   1 
ATOM 4848 C CA  . LEU A 1 626  ? 15.585  71.832 -3.115  1.00 121.84 ? 623  LEU A CA  1 
ATOM 4849 C C   . LEU A 1 626  ? 16.081  71.248 -1.797  1.00 121.84 ? 623  LEU A C   1 
ATOM 4850 O O   . LEU A 1 626  ? 17.255  71.380 -1.451  1.00 121.84 ? 623  LEU A O   1 
ATOM 4851 C CB  . LEU A 1 626  ? 16.328  71.188 -4.288  1.00 159.95 ? 623  LEU A CB  1 
ATOM 4852 C CG  . LEU A 1 626  ? 16.252  69.662 -4.383  1.00 159.95 ? 623  LEU A CG  1 
ATOM 4853 C CD1 . LEU A 1 626  ? 16.963  69.166 -5.632  1.00 159.95 ? 623  LEU A CD1 1 
ATOM 4854 C CD2 . LEU A 1 626  ? 16.836  69.016 -3.136  1.00 159.95 ? 623  LEU A CD2 1 
ATOM 4855 N N   . SER A 1 627  ? 15.179  70.602 -1.065  1.00 172.25 ? 624  SER A N   1 
ATOM 4856 C CA  . SER A 1 627  ? 15.523  69.997 0.216   1.00 172.25 ? 624  SER A CA  1 
ATOM 4857 C C   . SER A 1 627  ? 16.535  68.869 0.039   1.00 172.25 ? 624  SER A C   1 
ATOM 4858 O O   . SER A 1 627  ? 17.685  69.107 -0.329  1.00 172.25 ? 624  SER A O   1 
ATOM 4859 C CB  . SER A 1 627  ? 14.267  69.472 0.915   1.00 83.90  ? 624  SER A CB  1 
ATOM 4860 O OG  . SER A 1 627  ? 13.667  68.428 0.168   1.00 83.90  ? 624  SER A OG  1 
ATOM 4861 N N   . ASP A 1 628  ? 16.098  67.642 0.303   1.00 127.73 ? 625  ASP A N   1 
ATOM 4862 C CA  . ASP A 1 628  ? 16.965  66.475 0.173   1.00 127.73 ? 625  ASP A CA  1 
ATOM 4863 C C   . ASP A 1 628  ? 16.465  65.471 -0.863  1.00 127.73 ? 625  ASP A C   1 
ATOM 4864 O O   . ASP A 1 628  ? 16.409  65.769 -2.056  1.00 127.73 ? 625  ASP A O   1 
ATOM 4865 C CB  . ASP A 1 628  ? 17.136  65.785 1.528   1.00 181.88 ? 625  ASP A CB  1 
ATOM 4866 C CG  . ASP A 1 628  ? 17.742  66.699 2.575   1.00 181.88 ? 625  ASP A CG  1 
ATOM 4867 O OD1 . ASP A 1 628  ? 18.028  67.870 2.250   1.00 181.88 ? 625  ASP A OD1 1 
ATOM 4868 O OD2 . ASP A 1 628  ? 17.934  66.245 3.723   1.00 181.88 ? 625  ASP A OD2 1 
ATOM 4869 N N   . ARG A 1 629  ? 16.109  64.277 -0.397  1.00 152.43 ? 626  ARG A N   1 
ATOM 4870 C CA  . ARG A 1 629  ? 15.632  63.197 -1.293  1.00 152.43 ? 626  ARG A CA  1 
ATOM 4871 C C   . ARG A 1 629  ? 15.586  61.815 -0.680  1.00 152.43 ? 626  ARG A C   1 
ATOM 4872 O O   . ARG A 1 629  ? 16.620  61.282 -0.272  1.00 152.43 ? 626  ARG A O   1 
ATOM 4873 C CB  . ARG A 1 629  ? 16.399  63.107 -2.622  1.00 134.48 ? 626  ARG A CB  1 
ATOM 4874 C CG  . ARG A 1 629  ? 15.737  62.129 -3.646  1.00 134.48 ? 626  ARG A CG  1 
ATOM 4875 C CD  . ARG A 1 629  ? 16.749  61.517 -4.622  1.00 134.48 ? 626  ARG A CD  1 
ATOM 4876 N NE  . ARG A 1 629  ? 16.164  60.597 -5.608  1.00 134.48 ? 626  ARG A NE  1 
ATOM 4877 C CZ  . ARG A 1 629  ? 15.705  60.952 -6.811  1.00 134.48 ? 626  ARG A CZ  1 
ATOM 4878 N NH1 . ARG A 1 629  ? 15.728  62.218 -7.201  1.00 134.48 ? 626  ARG A NH1 1 
ATOM 4879 N NH2 . ARG A 1 629  ? 15.212  60.037 -7.629  1.00 134.48 ? 626  ARG A NH2 1 
ATOM 4880 N N   . LYS A 1 630  ? 14.378  61.243 -0.652  1.00 79.77  ? 627  LYS A N   1 
ATOM 4881 C CA  . LYS A 1 630  ? 14.170  59.816 -0.372  1.00 79.77  ? 627  LYS A CA  1 
ATOM 4882 C C   . LYS A 1 630  ? 12.929  59.232 -1.096  1.00 79.77  ? 627  LYS A C   1 
ATOM 4883 O O   . LYS A 1 630  ? 12.195  59.941 -1.794  1.00 79.77  ? 627  LYS A O   1 
ATOM 4884 C CB  . LYS A 1 630  ? 14.162  59.517 1.142   1.00 92.08  ? 627  LYS A CB  1 
ATOM 4885 C CG  . LYS A 1 630  ? 15.391  60.012 1.936   1.00 92.08  ? 627  LYS A CG  1 
ATOM 4886 C CD  . LYS A 1 630  ? 15.413  59.519 3.373   1.00 92.08  ? 627  LYS A CD  1 
ATOM 4887 C CE  . LYS A 1 630  ? 16.003  58.107 3.474   1.00 92.08  ? 627  LYS A CE  1 
ATOM 4888 N NZ  . LYS A 1 630  ? 17.496  58.082 3.260   1.00 92.08  ? 627  LYS A NZ  1 
ATOM 4889 N N   . LYS A 1 631  ? 12.732  57.928 -0.937  1.00 78.24  ? 628  LYS A N   1 
ATOM 4890 C CA  . LYS A 1 631  ? 11.742  57.203 -1.703  1.00 78.24  ? 628  LYS A CA  1 
ATOM 4891 C C   . LYS A 1 631  ? 11.146  56.073 -0.873  1.00 78.24  ? 628  LYS A C   1 
ATOM 4892 O O   . LYS A 1 631  ? 11.809  55.073 -0.610  1.00 78.24  ? 628  LYS A O   1 
ATOM 4893 C CB  . LYS A 1 631  ? 12.365  56.643 -2.993  1.00 72.89  ? 628  LYS A CB  1 
ATOM 4894 C CG  . LYS A 1 631  ? 11.445  55.731 -3.819  1.00 72.89  ? 628  LYS A CG  1 
ATOM 4895 C CD  . LYS A 1 631  ? 12.061  55.446 -5.178  1.00 72.89  ? 628  LYS A CD  1 
ATOM 4896 C CE  . LYS A 1 631  ? 11.007  54.961 -6.169  1.00 72.89  ? 628  LYS A CE  1 
ATOM 4897 N NZ  . LYS A 1 631  ? 11.627  54.379 -7.399  1.00 72.89  ? 628  LYS A NZ  1 
ATOM 4898 N N   . VAL A 1 632  ? 9.886   56.234 -0.472  1.00 103.01 ? 629  VAL A N   1 
ATOM 4899 C CA  . VAL A 1 632  ? 9.195   55.209 0.294   1.00 103.01 ? 629  VAL A CA  1 
ATOM 4900 C C   . VAL A 1 632  ? 8.428   54.284 -0.625  1.00 103.01 ? 629  VAL A C   1 
ATOM 4901 O O   . VAL A 1 632  ? 8.770   54.152 -1.800  1.00 103.01 ? 629  VAL A O   1 
ATOM 4902 C CB  . VAL A 1 632  ? 8.253   55.817 1.296   1.00 69.25  ? 629  VAL A CB  1 
ATOM 4903 C CG1 . VAL A 1 632  ? 8.968   56.036 2.612   1.00 69.25  ? 629  VAL A CG1 1 
ATOM 4904 C CG2 . VAL A 1 632  ? 7.731   57.105 0.756   1.00 69.25  ? 629  VAL A CG2 1 
ATOM 4905 N N   . THR A 1 633  ? 7.390   53.666 -0.104  1.00 86.99  ? 630  THR A N   1 
ATOM 4906 C CA  . THR A 1 633  ? 6.639   52.759 -0.916  1.00 86.99  ? 630  THR A CA  1 
ATOM 4907 C C   . THR A 1 633  ? 5.375   52.383 -0.214  1.00 86.99  ? 630  THR A C   1 
ATOM 4908 O O   . THR A 1 633  ? 5.170   51.240 0.107   1.00 86.99  ? 630  THR A O   1 
ATOM 4909 C CB  . THR A 1 633  ? 7.439   51.533 -1.132  1.00 91.08  ? 630  THR A CB  1 
ATOM 4910 O OG1 . THR A 1 633  ? 6.582   50.457 -1.522  1.00 91.08  ? 630  THR A OG1 1 
ATOM 4911 C CG2 . THR A 1 633  ? 8.130   51.195 0.146   1.00 91.08  ? 630  THR A CG2 1 
ATOM 4912 N N   . LEU A 1 634  ? 4.521   53.350 0.044   1.00 68.78  ? 631  LEU A N   1 
ATOM 4913 C CA  . LEU A 1 634  ? 3.263   53.040 0.636   1.00 68.78  ? 631  LEU A CA  1 
ATOM 4914 C C   . LEU A 1 634  ? 2.580   52.157 -0.348  1.00 68.78  ? 631  LEU A C   1 
ATOM 4915 O O   . LEU A 1 634  ? 3.190   51.376 -1.038  1.00 68.78  ? 631  LEU A O   1 
ATOM 4916 C CB  . LEU A 1 634  ? 2.484   54.311 0.826   1.00 62.13  ? 631  LEU A CB  1 
ATOM 4917 C CG  . LEU A 1 634  ? 3.487   55.376 1.201   1.00 62.13  ? 631  LEU A CG  1 
ATOM 4918 C CD1 . LEU A 1 634  ? 2.869   56.518 1.913   1.00 62.13  ? 631  LEU A CD1 1 
ATOM 4919 C CD2 . LEU A 1 634  ? 4.486   54.718 2.061   1.00 62.13  ? 631  LEU A CD2 1 
ATOM 4920 N N   . GLY A 1 635  ? 1.291   52.307 -0.464  1.00 77.19  ? 632  GLY A N   1 
ATOM 4921 C CA  . GLY A 1 635  ? 0.549   51.367 -1.291  1.00 77.19  ? 632  GLY A CA  1 
ATOM 4922 C C   . GLY A 1 635  ? 0.885   51.371 -2.768  1.00 77.19  ? 632  GLY A C   1 
ATOM 4923 O O   . GLY A 1 635  ? 0.906   52.426 -3.406  1.00 77.19  ? 632  GLY A O   1 
ATOM 4924 N N   . THR A 1 636  ? 1.138   50.185 -3.317  1.00 85.23  ? 633  THR A N   1 
ATOM 4925 C CA  . THR A 1 636  ? 1.470   50.066 -4.732  1.00 85.23  ? 633  THR A CA  1 
ATOM 4926 C C   . THR A 1 636  ? 0.715   51.127 -5.513  1.00 85.23  ? 633  THR A C   1 
ATOM 4927 O O   . THR A 1 636  ? 1.323   51.970 -6.176  1.00 85.23  ? 633  THR A O   1 
ATOM 4928 C CB  . THR A 1 636  ? 1.116   48.689 -5.289  1.00 103.59 ? 633  THR A CB  1 
ATOM 4929 O OG1 . THR A 1 636  ? -0.191  48.734 -5.875  1.00 103.59 ? 633  THR A OG1 1 
ATOM 4930 C CG2 . THR A 1 636  ? 1.150   47.653 -4.183  1.00 103.59 ? 633  THR A CG2 1 
ATOM 4931 N N   . GLN A 1 637  ? -0.612  51.083 -5.427  1.00 89.87  ? 634  GLN A N   1 
ATOM 4932 C CA  . GLN A 1 637  ? -1.452  52.089 -6.081  1.00 89.87  ? 634  GLN A CA  1 
ATOM 4933 C C   . GLN A 1 637  ? -1.018  53.519 -5.756  1.00 89.87  ? 634  GLN A C   1 
ATOM 4934 O O   . GLN A 1 637  ? -0.485  53.769 -4.667  1.00 89.87  ? 634  GLN A O   1 
ATOM 4935 C CB  . GLN A 1 637  ? -2.913  51.907 -5.663  1.00 97.17  ? 634  GLN A CB  1 
ATOM 4936 C CG  . GLN A 1 637  ? -3.509  50.599 -6.109  1.00 97.17  ? 634  GLN A CG  1 
ATOM 4937 C CD  . GLN A 1 637  ? -3.282  50.344 -7.586  1.00 97.17  ? 634  GLN A CD  1 
ATOM 4938 O OE1 . GLN A 1 637  ? -3.426  51.252 -8.418  1.00 97.17  ? 634  GLN A OE1 1 
ATOM 4939 N NE2 . GLN A 1 637  ? -2.919  49.101 -7.921  1.00 97.17  ? 634  GLN A NE2 1 
ATOM 4940 N N   . PRO A 1 638  ? -1.243  54.459 -6.706  1.00 84.68  ? 635  PRO A N   1 
ATOM 4941 C CA  . PRO A 1 638  ? -0.969  55.884 -6.515  1.00 84.68  ? 635  PRO A CA  1 
ATOM 4942 C C   . PRO A 1 638  ? -1.578  56.423 -5.233  1.00 84.68  ? 635  PRO A C   1 
ATOM 4943 O O   . PRO A 1 638  ? -2.634  55.976 -4.826  1.00 84.68  ? 635  PRO A O   1 
ATOM 4944 C CB  . PRO A 1 638  ? -1.630  56.549 -7.735  1.00 101.01 ? 635  PRO A CB  1 
ATOM 4945 C CG  . PRO A 1 638  ? -2.354  55.486 -8.462  1.00 101.01 ? 635  PRO A CG  1 
ATOM 4946 C CD  . PRO A 1 638  ? -1.745  54.193 -8.067  1.00 101.01 ? 635  PRO A CD  1 
ATOM 4947 N N   . THR A 1 639  ? -0.913  57.388 -4.622  1.00 62.19  ? 636  THR A N   1 
ATOM 4948 C CA  . THR A 1 639  ? -1.301  57.882 -3.337  1.00 62.19  ? 636  THR A CA  1 
ATOM 4949 C C   . THR A 1 639  ? -1.909  59.288 -3.420  1.00 62.19  ? 636  THR A C   1 
ATOM 4950 O O   . THR A 1 639  ? -1.327  60.191 -4.033  1.00 62.19  ? 636  THR A O   1 
ATOM 4951 C CB  . THR A 1 639  ? -0.078  57.859 -2.472  1.00 67.46  ? 636  THR A CB  1 
ATOM 4952 O OG1 . THR A 1 639  ? 0.356   56.495 -2.356  1.00 67.46  ? 636  THR A OG1 1 
ATOM 4953 C CG2 . THR A 1 639  ? -0.355  58.427 -1.095  1.00 67.46  ? 636  THR A CG2 1 
ATOM 4954 N N   . VAL A 1 640  ? -3.085  59.482 -2.816  1.00 52.12  ? 637  VAL A N   1 
ATOM 4955 C CA  . VAL A 1 640  ? -3.751  60.802 -2.825  1.00 52.12  ? 637  VAL A CA  1 
ATOM 4956 C C   . VAL A 1 640  ? -3.503  61.485 -1.498  1.00 52.12  ? 637  VAL A C   1 
ATOM 4957 O O   . VAL A 1 640  ? -4.063  61.059 -0.481  1.00 52.12  ? 637  VAL A O   1 
ATOM 4958 C CB  . VAL A 1 640  ? -5.291  60.671 -3.029  1.00 52.85  ? 637  VAL A CB  1 
ATOM 4959 C CG1 . VAL A 1 640  ? -5.936  62.017 -3.359  1.00 52.85  ? 637  VAL A CG1 1 
ATOM 4960 C CG2 . VAL A 1 640  ? -5.619  59.592 -4.073  1.00 52.85  ? 637  VAL A CG2 1 
ATOM 4961 N N   . LEU A 1 641  ? -2.658  62.515 -1.509  1.00 72.02  ? 638  LEU A N   1 
ATOM 4962 C CA  . LEU A 1 641  ? -2.269  63.235 -0.291  1.00 72.02  ? 638  LEU A CA  1 
ATOM 4963 C C   . LEU A 1 641  ? -3.316  64.256 0.050   1.00 72.02  ? 638  LEU A C   1 
ATOM 4964 O O   . LEU A 1 641  ? -3.912  64.837 -0.845  1.00 72.02  ? 638  LEU A O   1 
ATOM 4965 C CB  . LEU A 1 641  ? -0.943  63.951 -0.491  1.00 63.50  ? 638  LEU A CB  1 
ATOM 4966 C CG  . LEU A 1 641  ? 0.239   63.036 -0.850  1.00 63.50  ? 638  LEU A CG  1 
ATOM 4967 C CD1 . LEU A 1 641  ? 1.260   63.707 -1.786  1.00 63.50  ? 638  LEU A CD1 1 
ATOM 4968 C CD2 . LEU A 1 641  ? 0.918   62.436 0.421   1.00 63.50  ? 638  LEU A CD2 1 
ATOM 4969 N N   . ARG A 1 642  ? -3.550  64.466 1.343   1.00 72.47  ? 639  ARG A N   1 
ATOM 4970 C CA  . ARG A 1 642  ? -4.608  65.374 1.841   1.00 72.47  ? 639  ARG A CA  1 
ATOM 4971 C C   . ARG A 1 642  ? -4.305  65.724 3.287   1.00 72.47  ? 639  ARG A C   1 
ATOM 4972 O O   . ARG A 1 642  ? -3.390  65.138 3.893   1.00 72.47  ? 639  ARG A O   1 
ATOM 4973 C CB  . ARG A 1 642  ? -6.019  64.763 1.693   1.00 177.62 ? 639  ARG A CB  1 
ATOM 4974 C CG  . ARG A 1 642  ? -7.169  65.571 2.333   1.00 177.62 ? 639  ARG A CG  1 
ATOM 4975 C CD  . ARG A 1 642  ? -7.467  66.891 1.617   1.00 177.62 ? 639  ARG A CD  1 
ATOM 4976 N NE  . ARG A 1 642  ? -8.686  66.833 0.809   1.00 177.62 ? 639  ARG A NE  1 
ATOM 4977 C CZ  . ARG A 1 642  ? -9.865  67.329 1.182   1.00 177.62 ? 639  ARG A CZ  1 
ATOM 4978 N NH1 . ARG A 1 642  ? -9.999  67.925 2.358   1.00 177.62 ? 639  ARG A NH1 1 
ATOM 4979 N NH2 . ARG A 1 642  ? -10.917 67.229 0.379   1.00 177.62 ? 639  ARG A NH2 1 
ATOM 4980 N N   . THR A 1 643  ? -5.044  66.695 3.826   1.00 119.52 ? 640  THR A N   1 
ATOM 4981 C CA  . THR A 1 643  ? -4.871  67.142 5.210   1.00 119.52 ? 640  THR A CA  1 
ATOM 4982 C C   . THR A 1 643  ? -6.191  67.127 5.991   1.00 119.52 ? 640  THR A C   1 
ATOM 4983 O O   . THR A 1 643  ? -7.238  67.535 5.485   1.00 119.52 ? 640  THR A O   1 
ATOM 4984 C CB  . THR A 1 643  ? -4.100  68.502 5.292   1.00 71.37  ? 640  THR A CB  1 
ATOM 4985 O OG1 . THR A 1 643  ? -2.677  68.251 5.249   1.00 71.37  ? 640  THR A OG1 1 
ATOM 4986 C CG2 . THR A 1 643  ? -4.467  69.309 6.557   1.00 71.37  ? 640  THR A CG2 1 
ATOM 4987 N N   . PHE A 1 644  ? -6.107  66.616 7.219   1.00 139.63 ? 641  PHE A N   1 
ATOM 4988 C CA  . PHE A 1 644  ? -7.265  66.367 8.078   1.00 139.63 ? 641  PHE A CA  1 
ATOM 4989 C C   . PHE A 1 644  ? -7.295  67.305 9.295   1.00 139.63 ? 641  PHE A C   1 
ATOM 4990 O O   . PHE A 1 644  ? -6.284  67.944 9.626   1.00 139.63 ? 641  PHE A O   1 
ATOM 4991 C CB  . PHE A 1 644  ? -7.376  64.854 8.486   1.00 82.55  ? 641  PHE A CB  1 
ATOM 4992 C CG  . PHE A 1 644  ? -6.095  64.238 9.088   1.00 82.55  ? 641  PHE A CG  1 
ATOM 4993 C CD1 . PHE A 1 644  ? -5.949  64.106 10.475  1.00 82.55  ? 641  PHE A CD1 1 
ATOM 4994 C CD2 . PHE A 1 644  ? -5.055  63.773 8.264   1.00 82.55  ? 641  PHE A CD2 1 
ATOM 4995 C CE1 . PHE A 1 644  ? -4.775  63.555 11.034  1.00 82.55  ? 641  PHE A CE1 1 
ATOM 4996 C CE2 . PHE A 1 644  ? -3.891  63.212 8.812   1.00 82.55  ? 641  PHE A CE2 1 
ATOM 4997 C CZ  . PHE A 1 644  ? -3.753  63.099 10.199  1.00 82.55  ? 641  PHE A CZ  1 
ATOM 4998 N N   . ARG A 1 645  ? -8.465  67.400 9.931   1.00 193.84 ? 642  ARG A N   1 
ATOM 4999 C CA  . ARG A 1 645  ? -8.603  68.077 11.222  1.00 193.84 ? 642  ARG A CA  1 
ATOM 5000 C C   . ARG A 1 645  ? -8.396  67.084 12.377  1.00 193.84 ? 642  ARG A C   1 
ATOM 5001 O O   . ARG A 1 645  ? -9.133  66.094 12.494  1.00 193.84 ? 642  ARG A O   1 
ATOM 5002 C CB  . ARG A 1 645  ? -9.969  68.780 11.340  1.00 113.99 ? 642  ARG A CB  1 
ATOM 5003 C CG  . ARG A 1 645  ? -10.302 69.244 12.785  1.00 113.99 ? 642  ARG A CG  1 
ATOM 5004 C CD  . ARG A 1 645  ? -11.447 70.259 12.908  1.00 113.99 ? 642  ARG A CD  1 
ATOM 5005 N NE  . ARG A 1 645  ? -12.708 69.775 12.348  1.00 113.99 ? 642  ARG A NE  1 
ATOM 5006 C CZ  . ARG A 1 645  ? -13.899 70.281 12.632  1.00 113.99 ? 642  ARG A CZ  1 
ATOM 5007 N NH1 . ARG A 1 645  ? -14.024 71.277 13.494  1.00 113.99 ? 642  ARG A NH1 1 
ATOM 5008 N NH2 . ARG A 1 645  ? -14.964 69.779 12.051  1.00 113.99 ? 642  ARG A NH2 1 
ATOM 5009 N N   . SER A 1 646  ? -7.397  67.362 13.222  1.00 210.35 ? 643  SER A N   1 
ATOM 5010 C CA  . SER A 1 646  ? -7.051  66.487 14.356  1.00 210.35 ? 643  SER A CA  1 
ATOM 5011 C C   . SER A 1 646  ? -6.872  67.213 15.705  1.00 210.35 ? 643  SER A C   1 
ATOM 5012 O O   . SER A 1 646  ? -7.804  67.259 16.511  1.00 210.35 ? 643  SER A O   1 
ATOM 5013 C CB  . SER A 1 646  ? -5.826  65.614 14.024  1.00 99.91  ? 643  SER A CB  1 
ATOM 5014 O OG  . SER A 1 646  ? -4.736  66.394 13.549  1.00 99.91  ? 643  SER A OG  1 
ATOM 5015 N N   . LEU A 1 647  ? -5.682  67.769 15.946  1.00 153.52 ? 644  LEU A N   1 
ATOM 5016 C CA  . LEU A 1 647  ? -5.393  68.503 17.185  1.00 153.52 ? 644  LEU A CA  1 
ATOM 5017 C C   . LEU A 1 647  ? -4.783  69.889 16.881  1.00 153.52 ? 644  LEU A C   1 
ATOM 5018 O O   . LEU A 1 647  ? -5.400  70.687 16.172  1.00 153.52 ? 644  LEU A O   1 
ATOM 5019 C CB  . LEU A 1 647  ? -4.557  67.641 18.169  1.00 94.86  ? 644  LEU A CB  1 
ATOM 5020 C CG  . LEU A 1 647  ? -3.009  67.583 18.282  1.00 94.86  ? 644  LEU A CG  1 
ATOM 5021 C CD1 . LEU A 1 647  ? -2.548  66.743 19.504  1.00 94.86  ? 644  LEU A CD1 1 
ATOM 5022 C CD2 . LEU A 1 647  ? -2.277  67.137 16.990  1.00 94.86  ? 644  LEU A CD2 1 
ATOM 5023 N N   . SER A 1 648  ? -3.591  70.170 17.409  1.00 166.10 ? 645  SER A N   1 
ATOM 5024 C CA  . SER A 1 648  ? -2.923  71.462 17.218  1.00 166.10 ? 645  SER A CA  1 
ATOM 5025 C C   . SER A 1 648  ? -1.823  71.419 16.151  1.00 166.10 ? 645  SER A C   1 
ATOM 5026 O O   . SER A 1 648  ? -1.241  72.456 15.806  1.00 166.10 ? 645  SER A O   1 
ATOM 5027 C CB  . SER A 1 648  ? -2.358  71.982 18.546  1.00 161.67 ? 645  SER A CB  1 
ATOM 5028 O OG  . SER A 1 648  ? -1.281  71.180 18.997  1.00 161.67 ? 645  SER A OG  1 
ATOM 5029 N N   . THR A 1 649  ? -1.529  70.220 15.650  1.00 210.35 ? 646  THR A N   1 
ATOM 5030 C CA  . THR A 1 649  ? -0.600  70.056 14.531  1.00 210.35 ? 646  THR A CA  1 
ATOM 5031 C C   . THR A 1 649  ? -1.280  69.309 13.373  1.00 210.35 ? 646  THR A C   1 
ATOM 5032 O O   . THR A 1 649  ? -0.672  68.436 12.763  1.00 210.35 ? 646  THR A O   1 
ATOM 5033 C CB  . THR A 1 649  ? 0.771   69.390 14.958  1.00 99.23  ? 646  THR A CB  1 
ATOM 5034 O OG1 . THR A 1 649  ? 0.621   67.979 15.154  1.00 99.23  ? 646  THR A OG1 1 
ATOM 5035 C CG2 . THR A 1 649  ? 1.322   70.018 16.238  1.00 99.23  ? 646  THR A CG2 1 
ATOM 5036 N N   . THR A 1 650  ? -2.533  69.682 13.078  1.00 163.22 ? 647  THR A N   1 
ATOM 5037 C CA  . THR A 1 650  ? -3.411  69.008 12.086  1.00 163.22 ? 647  THR A CA  1 
ATOM 5038 C C   . THR A 1 650  ? -2.653  68.488 10.855  1.00 163.22 ? 647  THR A C   1 
ATOM 5039 O O   . THR A 1 650  ? -1.899  69.243 10.246  1.00 163.22 ? 647  THR A O   1 
ATOM 5040 C CB  . THR A 1 650  ? -4.560  69.934 11.629  1.00 90.22  ? 647  THR A CB  1 
ATOM 5041 O OG1 . THR A 1 650  ? -4.064  70.880 10.676  1.00 90.22  ? 647  THR A OG1 1 
ATOM 5042 C CG2 . THR A 1 650  ? -5.170  70.678 12.808  1.00 90.22  ? 647  THR A CG2 1 
ATOM 5043 N N   . ASN A 1 651  ? -2.876  67.225 10.476  1.00 141.29 ? 648  ASN A N   1 
ATOM 5044 C CA  . ASN A 1 651  ? -1.846  66.469 9.730   1.00 141.29 ? 648  ASN A CA  1 
ATOM 5045 C C   . ASN A 1 651  ? -2.121  66.018 8.291   1.00 141.29 ? 648  ASN A C   1 
ATOM 5046 O O   . ASN A 1 651  ? -3.117  66.426 7.697   1.00 141.29 ? 648  ASN A O   1 
ATOM 5047 C CB  . ASN A 1 651  ? -1.352  65.279 10.563  1.00 177.94 ? 648  ASN A CB  1 
ATOM 5048 C CG  . ASN A 1 651  ? -0.806  65.692 11.911  1.00 177.94 ? 648  ASN A CG  1 
ATOM 5049 O OD1 . ASN A 1 651  ? 0.407   65.783 12.099  1.00 177.94 ? 648  ASN A OD1 1 
ATOM 5050 N ND2 . ASN A 1 651  ? -1.701  65.940 12.865  1.00 177.94 ? 648  ASN A ND2 1 
ATOM 5051 N N   . VAL A 1 652  ? -1.215  65.172 7.763   1.00 95.27  ? 649  VAL A N   1 
ATOM 5052 C CA  . VAL A 1 652  ? -1.279  64.611 6.386   1.00 95.27  ? 649  VAL A CA  1 
ATOM 5053 C C   . VAL A 1 652  ? -1.677  63.111 6.242   1.00 95.27  ? 649  VAL A C   1 
ATOM 5054 O O   . VAL A 1 652  ? -0.906  62.201 6.586   1.00 95.27  ? 649  VAL A O   1 
ATOM 5055 C CB  . VAL A 1 652  ? 0.044   64.858 5.615   1.00 114.23 ? 649  VAL A CB  1 
ATOM 5056 C CG1 . VAL A 1 652  ? -0.035  64.310 4.191   1.00 114.23 ? 649  VAL A CG1 1 
ATOM 5057 C CG2 . VAL A 1 652  ? 0.356   66.340 5.575   1.00 114.23 ? 649  VAL A CG2 1 
ATOM 5058 N N   . PHE A 1 653  ? -2.873  62.882 5.692   1.00 58.54  ? 650  PHE A N   1 
ATOM 5059 C CA  . PHE A 1 653  ? -3.418  61.543 5.469   1.00 58.54  ? 650  PHE A CA  1 
ATOM 5060 C C   . PHE A 1 653  ? -3.133  61.120 4.049   1.00 58.54  ? 650  PHE A C   1 
ATOM 5061 O O   . PHE A 1 653  ? -3.445  61.849 3.124   1.00 58.54  ? 650  PHE A O   1 
ATOM 5062 C CB  . PHE A 1 653  ? -4.933  61.571 5.641   1.00 80.37  ? 650  PHE A CB  1 
ATOM 5063 C CG  . PHE A 1 653  ? -5.569  60.208 5.652   1.00 80.37  ? 650  PHE A CG  1 
ATOM 5064 C CD1 . PHE A 1 653  ? -6.223  59.741 6.793   1.00 80.37  ? 650  PHE A CD1 1 
ATOM 5065 C CD2 . PHE A 1 653  ? -5.518  59.383 4.532   1.00 80.37  ? 650  PHE A CD2 1 
ATOM 5066 C CE1 . PHE A 1 653  ? -6.808  58.493 6.816   1.00 80.37  ? 650  PHE A CE1 1 
ATOM 5067 C CE2 . PHE A 1 653  ? -6.109  58.118 4.558   1.00 80.37  ? 650  PHE A CE2 1 
ATOM 5068 C CZ  . PHE A 1 653  ? -6.751  57.682 5.700   1.00 80.37  ? 650  PHE A CZ  1 
ATOM 5069 N N   . ALA A 1 654  ? -2.577  59.932 3.868   1.00 53.24  ? 651  ALA A N   1 
ATOM 5070 C CA  . ALA A 1 654  ? -2.179  59.483 2.540   1.00 53.24  ? 651  ALA A CA  1 
ATOM 5071 C C   . ALA A 1 654  ? -2.979  58.250 2.084   1.00 53.24  ? 651  ALA A C   1 
ATOM 5072 O O   . ALA A 1 654  ? -2.959  57.219 2.753   1.00 53.24  ? 651  ALA A O   1 
ATOM 5073 C CB  . ALA A 1 654  ? -0.700  59.202 2.528   1.00 68.60  ? 651  ALA A CB  1 
ATOM 5074 N N   . CYS A 1 655  ? -3.665  58.363 0.942   1.00 59.61  ? 652  CYS A N   1 
ATOM 5075 C CA  . CYS A 1 655  ? -4.592  57.310 0.500   1.00 59.61  ? 652  CYS A CA  1 
ATOM 5076 C C   . CYS A 1 655  ? -3.981  56.410 -0.537  1.00 59.61  ? 652  CYS A C   1 
ATOM 5077 O O   . CYS A 1 655  ? -3.867  56.793 -1.689  1.00 59.61  ? 652  CYS A O   1 
ATOM 5078 C CB  . CYS A 1 655  ? -5.877  57.886 -0.090  1.00 73.05  ? 652  CYS A CB  1 
ATOM 5079 S SG  . CYS A 1 655  ? -6.756  59.048 0.955   1.00 73.05  ? 652  CYS A SG  1 
ATOM 5080 N N   . SER A 1 656  ? -3.595  55.218 -0.103  1.00 56.17  ? 653  SER A N   1 
ATOM 5081 C CA  . SER A 1 656  ? -3.047  54.179 -0.941  1.00 56.17  ? 653  SER A CA  1 
ATOM 5082 C C   . SER A 1 656  ? -3.954  52.963 -0.813  1.00 56.17  ? 653  SER A C   1 
ATOM 5083 O O   . SER A 1 656  ? -5.071  53.022 -0.239  1.00 56.17  ? 653  SER A O   1 
ATOM 5084 C CB  . SER A 1 656  ? -1.669  53.787 -0.417  1.00 61.45  ? 653  SER A CB  1 
ATOM 5085 O OG  . SER A 1 656  ? -0.614  54.249 -1.250  1.00 61.45  ? 653  SER A OG  1 
ATOM 5086 N N   . ASP A 1 657  ? -3.467  51.845 -1.332  1.00 74.12  ? 654  ASP A N   1 
ATOM 5087 C CA  . ASP A 1 657  ? -3.990  50.548 -0.924  1.00 74.12  ? 654  ASP A CA  1 
ATOM 5088 C C   . ASP A 1 657  ? -3.589  50.285 0.536   1.00 74.12  ? 654  ASP A C   1 
ATOM 5089 O O   . ASP A 1 657  ? -4.219  49.482 1.223   1.00 74.12  ? 654  ASP A O   1 
ATOM 5090 C CB  . ASP A 1 657  ? -3.495  49.435 -1.860  1.00 106.98 ? 654  ASP A CB  1 
ATOM 5091 C CG  . ASP A 1 657  ? -2.094  49.705 -2.400  1.00 106.98 ? 654  ASP A CG  1 
ATOM 5092 O OD1 . ASP A 1 657  ? -1.920  50.730 -3.101  1.00 106.98 ? 654  ASP A OD1 1 
ATOM 5093 O OD2 . ASP A 1 657  ? -1.168  48.903 -2.121  1.00 106.98 ? 654  ASP A OD2 1 
ATOM 5094 N N   . ARG A 1 658  ? -2.547  50.981 0.996   1.00 57.35  ? 655  ARG A N   1 
ATOM 5095 C CA  . ARG A 1 658  ? -2.077  50.913 2.380   1.00 57.35  ? 655  ARG A CA  1 
ATOM 5096 C C   . ARG A 1 658  ? -2.153  52.312 3.042   1.00 57.35  ? 655  ARG A C   1 
ATOM 5097 O O   . ARG A 1 658  ? -1.124  52.992 3.199   1.00 57.35  ? 655  ARG A O   1 
ATOM 5098 C CB  . ARG A 1 658  ? -0.646  50.367 2.427   1.00 116.31 ? 655  ARG A CB  1 
ATOM 5099 C CG  . ARG A 1 658  ? -0.232  49.783 3.770   1.00 116.31 ? 655  ARG A CG  1 
ATOM 5100 C CD  . ARG A 1 658  ? 1.230   50.121 4.120   1.00 116.31 ? 655  ARG A CD  1 
ATOM 5101 N NE  . ARG A 1 658  ? 2.156   49.856 3.018   1.00 116.31 ? 655  ARG A NE  1 
ATOM 5102 C CZ  . ARG A 1 658  ? 2.694   48.667 2.746   1.00 116.31 ? 655  ARG A CZ  1 
ATOM 5103 N NH1 . ARG A 1 658  ? 2.406   47.610 3.497   1.00 116.31 ? 655  ARG A NH1 1 
ATOM 5104 N NH2 . ARG A 1 658  ? 3.525   48.533 1.717   1.00 116.31 ? 655  ARG A NH2 1 
ATOM 5105 N N   . PRO A 1 659  ? -3.373  52.732 3.454   1.00 48.23  ? 656  PRO A N   1 
ATOM 5106 C CA  . PRO A 1 659  ? -3.662  54.072 3.966   1.00 48.23  ? 656  PRO A CA  1 
ATOM 5107 C C   . PRO A 1 659  ? -2.704  54.376 5.065   1.00 48.23  ? 656  PRO A C   1 
ATOM 5108 O O   . PRO A 1 659  ? -2.312  53.481 5.797   1.00 48.23  ? 656  PRO A O   1 
ATOM 5109 C CB  . PRO A 1 659  ? -5.060  53.938 4.542   1.00 59.66  ? 656  PRO A CB  1 
ATOM 5110 C CG  . PRO A 1 659  ? -5.291  52.454 4.658   1.00 59.66  ? 656  PRO A CG  1 
ATOM 5111 C CD  . PRO A 1 659  ? -4.565  51.878 3.508   1.00 59.66  ? 656  PRO A CD  1 
ATOM 5112 N N   . THR A 1 660  ? -2.304  55.629 5.167   1.00 47.12  ? 657  THR A N   1 
ATOM 5113 C CA  . THR A 1 660  ? -1.126  55.981 5.945   1.00 47.12  ? 657  THR A CA  1 
ATOM 5114 C C   . THR A 1 660  ? -1.285  57.386 6.436   1.00 47.12  ? 657  THR A C   1 
ATOM 5115 O O   . THR A 1 660  ? -1.653  58.271 5.677   1.00 47.12  ? 657  THR A O   1 
ATOM 5116 C CB  . THR A 1 660  ? 0.183   55.921 5.068   1.00 53.55  ? 657  THR A CB  1 
ATOM 5117 O OG1 . THR A 1 660  ? 0.370   54.610 4.515   1.00 53.55  ? 657  THR A OG1 1 
ATOM 5118 C CG2 . THR A 1 660  ? 1.409   56.278 5.877   1.00 53.55  ? 657  THR A CG2 1 
ATOM 5119 N N   . VAL A 1 661  ? -1.010  57.592 7.712   1.00 54.53  ? 658  VAL A N   1 
ATOM 5120 C CA  . VAL A 1 661  ? -0.871  58.945 8.203   1.00 54.53  ? 658  VAL A CA  1 
ATOM 5121 C C   . VAL A 1 661  ? 0.553   59.394 8.219   1.00 54.53  ? 658  VAL A C   1 
ATOM 5122 O O   . VAL A 1 661  ? 1.464   58.616 8.527   1.00 54.53  ? 658  VAL A O   1 
ATOM 5123 C CB  . VAL A 1 661  ? -1.359  59.135 9.591   1.00 40.10  ? 658  VAL A CB  1 
ATOM 5124 C CG1 . VAL A 1 661  ? -0.814  60.421 10.081  1.00 40.10  ? 658  VAL A CG1 1 
ATOM 5125 C CG2 . VAL A 1 661  ? -2.853  59.214 9.583   1.00 40.10  ? 658  VAL A CG2 1 
ATOM 5126 N N   . ILE A 1 662  ? 0.704   60.672 7.870   1.00 131.58 ? 659  ILE A N   1 
ATOM 5127 C CA  . ILE A 1 662  ? 1.934   61.429 8.024   1.00 131.58 ? 659  ILE A CA  1 
ATOM 5128 C C   . ILE A 1 662  ? 1.732   62.560 9.073   1.00 131.58 ? 659  ILE A C   1 
ATOM 5129 O O   . ILE A 1 662  ? 1.094   63.592 8.789   1.00 131.58 ? 659  ILE A O   1 
ATOM 5130 C CB  . ILE A 1 662  ? 2.443   61.946 6.653   1.00 104.05 ? 659  ILE A CB  1 
ATOM 5131 C CG1 . ILE A 1 662  ? 2.350   60.832 5.590   1.00 104.05 ? 659  ILE A CG1 1 
ATOM 5132 C CG2 . ILE A 1 662  ? 3.858   62.427 6.794   1.00 104.05 ? 659  ILE A CG2 1 
ATOM 5133 C CD1 . ILE A 1 662  ? 2.949   61.151 4.229   1.00 104.05 ? 659  ILE A CD1 1 
ATOM 5134 N N   . TYR A 1 663  ? 2.261   62.315 10.286  1.00 155.12 ? 660  TYR A N   1 
ATOM 5135 C CA  . TYR A 1 663  ? 2.156   63.207 11.472  1.00 155.12 ? 660  TYR A CA  1 
ATOM 5136 C C   . TYR A 1 663  ? 3.430   64.062 11.639  1.00 155.12 ? 660  TYR A C   1 
ATOM 5137 O O   . TYR A 1 663  ? 3.995   64.524 10.650  1.00 155.12 ? 660  TYR A O   1 
ATOM 5138 C CB  . TYR A 1 663  ? 1.906   62.399 12.774  1.00 155.19 ? 660  TYR A CB  1 
ATOM 5139 C CG  . TYR A 1 663  ? 0.458   62.035 13.124  1.00 155.19 ? 660  TYR A CG  1 
ATOM 5140 C CD1 . TYR A 1 663  ? 0.021   60.703 13.110  1.00 155.19 ? 660  TYR A CD1 1 
ATOM 5141 C CD2 . TYR A 1 663  ? -0.461  63.014 13.513  1.00 155.19 ? 660  TYR A CD2 1 
ATOM 5142 C CE1 . TYR A 1 663  ? -1.310  60.360 13.445  1.00 155.19 ? 660  TYR A CE1 1 
ATOM 5143 C CE2 . TYR A 1 663  ? -1.796  62.679 13.846  1.00 155.19 ? 660  TYR A CE2 1 
ATOM 5144 C CZ  . TYR A 1 663  ? -2.208  61.351 13.810  1.00 155.19 ? 660  TYR A CZ  1 
ATOM 5145 O OH  . TYR A 1 663  ? -3.508  61.024 14.138  1.00 155.19 ? 660  TYR A OH  1 
ATOM 5146 N N   . SER A 1 664  ? 3.878   64.259 12.884  1.00 210.35 ? 661  SER A N   1 
ATOM 5147 C CA  . SER A 1 664  ? 5.104   65.033 13.181  1.00 210.35 ? 661  SER A CA  1 
ATOM 5148 C C   . SER A 1 664  ? 5.971   64.462 14.322  1.00 210.35 ? 661  SER A C   1 
ATOM 5149 O O   . SER A 1 664  ? 5.515   64.350 15.465  1.00 210.35 ? 661  SER A O   1 
ATOM 5150 C CB  . SER A 1 664  ? 4.769   66.503 13.470  1.00 105.01 ? 661  SER A CB  1 
ATOM 5151 O OG  . SER A 1 664  ? 4.138   67.118 12.364  1.00 105.01 ? 661  SER A OG  1 
ATOM 5152 N N   . SER A 1 665  ? 7.223   64.123 14.004  1.00 159.09 ? 662  SER A N   1 
ATOM 5153 C CA  . SER A 1 665  ? 8.164   63.548 14.977  1.00 159.09 ? 662  SER A CA  1 
ATOM 5154 C C   . SER A 1 665  ? 8.828   64.645 15.849  1.00 159.09 ? 662  SER A C   1 
ATOM 5155 O O   . SER A 1 665  ? 8.138   65.310 16.634  1.00 159.09 ? 662  SER A O   1 
ATOM 5156 C CB  . SER A 1 665  ? 9.178   62.614 14.269  1.00 78.50  ? 662  SER A CB  1 
ATOM 5157 O OG  . SER A 1 665  ? 9.912   61.803 15.178  1.00 78.50  ? 662  SER A OG  1 
ATOM 5158 N N   . ASN A 1 666  ? 10.143  64.804 15.758  1.00 191.27 ? 663  ASN A N   1 
ATOM 5159 C CA  . ASN A 1 666  ? 10.808  65.837 16.545  1.00 191.27 ? 663  ASN A CA  1 
ATOM 5160 C C   . ASN A 1 666  ? 10.170  67.178 16.216  1.00 191.27 ? 663  ASN A C   1 
ATOM 5161 O O   . ASN A 1 666  ? 9.647   67.877 17.084  1.00 191.27 ? 663  ASN A O   1 
ATOM 5162 C CB  . ASN A 1 666  ? 12.305  65.870 16.240  1.00 162.73 ? 663  ASN A CB  1 
ATOM 5163 C CG  . ASN A 1 666  ? 12.992  64.554 16.549  1.00 162.73 ? 663  ASN A CG  1 
ATOM 5164 O OD1 . ASN A 1 666  ? 12.358  63.602 17.005  1.00 162.73 ? 663  ASN A OD1 1 
ATOM 5165 N ND2 . ASN A 1 666  ? 14.295  64.494 16.302  1.00 162.73 ? 663  ASN A ND2 1 
ATOM 5166 N N   . HIS A 1 667  ? 10.270  67.495 14.932  1.00 90.12  ? 664  HIS A N   1 
ATOM 5167 C CA  . HIS A 1 667  ? 9.513   68.511 14.240  1.00 90.12  ? 664  HIS A CA  1 
ATOM 5168 C C   . HIS A 1 667  ? 9.415   67.883 12.861  1.00 90.12  ? 664  HIS A C   1 
ATOM 5169 O O   . HIS A 1 667  ? 8.979   68.504 11.892  1.00 90.12  ? 664  HIS A O   1 
ATOM 5170 C CB  . HIS A 1 667  ? 10.290  69.823 14.180  1.00 129.55 ? 664  HIS A CB  1 
ATOM 5171 C CG  . HIS A 1 667  ? 9.579   70.913 13.439  1.00 129.55 ? 664  HIS A CG  1 
ATOM 5172 N ND1 . HIS A 1 667  ? 9.731   71.113 12.083  1.00 129.55 ? 664  HIS A ND1 1 
ATOM 5173 C CD2 . HIS A 1 667  ? 8.711   71.861 13.864  1.00 129.55 ? 664  HIS A CD2 1 
ATOM 5174 C CE1 . HIS A 1 667  ? 8.988   72.137 11.705  1.00 129.55 ? 664  HIS A CE1 1 
ATOM 5175 N NE2 . HIS A 1 667  ? 8.359   72.610 12.767  1.00 129.55 ? 664  HIS A NE2 1 
ATOM 5176 N N   . LYS A 1 668  ? 9.844   66.623 12.806  1.00 210.35 ? 665  LYS A N   1 
ATOM 5177 C CA  . LYS A 1 668  ? 9.930   65.847 11.574  1.00 210.35 ? 665  LYS A CA  1 
ATOM 5178 C C   . LYS A 1 668  ? 8.564   65.467 11.019  1.00 210.35 ? 665  LYS A C   1 
ATOM 5179 O O   . LYS A 1 668  ? 7.844   66.323 10.505  1.00 210.35 ? 665  LYS A O   1 
ATOM 5180 C CB  . LYS A 1 668  ? 10.772  64.588 11.795  1.00 87.25  ? 665  LYS A CB  1 
ATOM 5181 C CG  . LYS A 1 668  ? 12.200  64.866 12.235  1.00 87.25  ? 665  LYS A CG  1 
ATOM 5182 C CD  . LYS A 1 668  ? 12.977  63.575 12.437  1.00 87.25  ? 665  LYS A CD  1 
ATOM 5183 C CE  . LYS A 1 668  ? 14.404  63.852 12.878  1.00 87.25  ? 665  LYS A CE  1 
ATOM 5184 N NZ  . LYS A 1 668  ? 15.178  62.596 13.080  1.00 87.25  ? 665  LYS A NZ  1 
ATOM 5185 N N   . LEU A 1 669  ? 8.205   64.188 11.108  1.00 89.38  ? 666  LEU A N   1 
ATOM 5186 C CA  . LEU A 1 669  ? 6.933   63.752 10.481  1.00 89.38  ? 666  LEU A CA  1 
ATOM 5187 C C   . LEU A 1 669  ? 6.683   62.255 10.583  1.00 89.38  ? 666  LEU A C   1 
ATOM 5188 O O   . LEU A 1 669  ? 7.451   61.506 9.990   1.00 89.38  ? 666  LEU A O   1 
ATOM 5189 C CB  . LEU A 1 669  ? 6.948   64.084 8.973   1.00 112.48 ? 666  LEU A CB  1 
ATOM 5190 C CG  . LEU A 1 669  ? 7.085   65.469 8.320   1.00 112.48 ? 666  LEU A CG  1 
ATOM 5191 C CD1 . LEU A 1 669  ? 7.839   65.313 7.016   1.00 112.48 ? 666  LEU A CD1 1 
ATOM 5192 C CD2 . LEU A 1 669  ? 5.741   66.150 8.095   1.00 112.48 ? 666  LEU A CD2 1 
ATOM 5193 N N   . VAL A 1 670  ? 5.617   61.800 11.255  1.00 142.29 ? 667  VAL A N   1 
ATOM 5194 C CA  . VAL A 1 670  ? 5.413   60.335 11.442  1.00 142.29 ? 667  VAL A CA  1 
ATOM 5195 C C   . VAL A 1 670  ? 4.904   59.645 10.177  1.00 142.29 ? 667  VAL A C   1 
ATOM 5196 O O   . VAL A 1 670  ? 4.281   60.282 9.332   1.00 142.29 ? 667  VAL A O   1 
ATOM 5197 C CB  . VAL A 1 670  ? 4.519   59.954 12.684  1.00 82.58  ? 667  VAL A CB  1 
ATOM 5198 C CG1 . VAL A 1 670  ? 4.588   58.464 12.999  1.00 82.58  ? 667  VAL A CG1 1 
ATOM 5199 C CG2 . VAL A 1 670  ? 4.972   60.688 13.907  1.00 82.58  ? 667  VAL A CG2 1 
ATOM 5200 N N   . PHE A 1 671  ? 5.201   58.343 10.074  1.00 148.48 ? 668  PHE A N   1 
ATOM 5201 C CA  . PHE A 1 671  ? 4.815   57.468 8.952   1.00 148.48 ? 668  PHE A CA  1 
ATOM 5202 C C   . PHE A 1 671  ? 4.139   56.151 9.394   1.00 148.48 ? 668  PHE A C   1 
ATOM 5203 O O   . PHE A 1 671  ? 4.541   55.066 8.957   1.00 148.48 ? 668  PHE A O   1 
ATOM 5204 C CB  . PHE A 1 671  ? 6.053   57.147 8.108   1.00 140.54 ? 668  PHE A CB  1 
ATOM 5205 C CG  . PHE A 1 671  ? 6.135   57.920 6.826   1.00 140.54 ? 668  PHE A CG  1 
ATOM 5206 C CD1 . PHE A 1 671  ? 5.740   59.254 6.765   1.00 140.54 ? 668  PHE A CD1 1 
ATOM 5207 C CD2 . PHE A 1 671  ? 6.629   57.318 5.677   1.00 140.54 ? 668  PHE A CD2 1 
ATOM 5208 C CE1 . PHE A 1 671  ? 5.823   59.969 5.578   1.00 140.54 ? 668  PHE A CE1 1 
ATOM 5209 C CE2 . PHE A 1 671  ? 6.717   58.030 4.483   1.00 140.54 ? 668  PHE A CE2 1 
ATOM 5210 C CZ  . PHE A 1 671  ? 6.309   59.358 4.436   1.00 140.54 ? 668  PHE A CZ  1 
ATOM 5211 N N   . SER A 1 672  ? 3.112   56.255 10.242  1.00 59.13  ? 669  SER A N   1 
ATOM 5212 C CA  . SER A 1 672  ? 2.452   55.087 10.843  1.00 59.13  ? 669  SER A CA  1 
ATOM 5213 C C   . SER A 1 672  ? 1.336   54.608 9.933   1.00 59.13  ? 669  SER A C   1 
ATOM 5214 O O   . SER A 1 672  ? 0.772   55.411 9.184   1.00 59.13  ? 669  SER A O   1 
ATOM 5215 C CB  . SER A 1 672  ? 1.858   55.422 12.212  1.00 191.57 ? 669  SER A CB  1 
ATOM 5216 O OG  . SER A 1 672  ? 2.224   56.716 12.649  1.00 191.57 ? 669  SER A OG  1 
ATOM 5217 N N   . ASN A 1 673  ? 1.039   53.307 9.979   1.00 46.69  ? 670  ASN A N   1 
ATOM 5218 C CA  . ASN A 1 673  ? -0.112  52.765 9.280   1.00 46.69  ? 670  ASN A CA  1 
ATOM 5219 C C   . ASN A 1 673  ? -1.456  53.257 9.821   1.00 46.69  ? 670  ASN A C   1 
ATOM 5220 O O   . ASN A 1 673  ? -1.639  53.531 11.032  1.00 46.69  ? 670  ASN A O   1 
ATOM 5221 C CB  . ASN A 1 673  ? -0.117  51.267 9.387   1.00 69.99  ? 670  ASN A CB  1 
ATOM 5222 C CG  . ASN A 1 673  ? 1.059   50.647 8.734   1.00 69.99  ? 670  ASN A CG  1 
ATOM 5223 O OD1 . ASN A 1 673  ? 1.231   50.748 7.511   1.00 69.99  ? 670  ASN A OD1 1 
ATOM 5224 N ND2 . ASN A 1 673  ? 1.883   49.960 9.535   1.00 69.99  ? 670  ASN A ND2 1 
ATOM 5225 N N   . VAL A 1 674  ? -2.401  53.357 8.904   1.00 56.68  ? 671  VAL A N   1 
ATOM 5226 C CA  . VAL A 1 674  ? -3.769  53.506 9.299   1.00 56.68  ? 671  VAL A CA  1 
ATOM 5227 C C   . VAL A 1 674  ? -4.498  52.172 9.145   1.00 56.68  ? 671  VAL A C   1 
ATOM 5228 O O   . VAL A 1 674  ? -4.390  51.492 8.135   1.00 56.68  ? 671  VAL A O   1 
ATOM 5229 C CB  . VAL A 1 674  ? -4.463  54.643 8.541   1.00 43.69  ? 671  VAL A CB  1 
ATOM 5230 C CG1 . VAL A 1 674  ? -5.939  54.711 8.919   1.00 43.69  ? 671  VAL A CG1 1 
ATOM 5231 C CG2 . VAL A 1 674  ? -3.801  55.954 8.852   1.00 43.69  ? 671  VAL A CG2 1 
ATOM 5232 N N   . ASN A 1 675  ? -5.235  51.822 10.178  1.00 66.10  ? 672  ASN A N   1 
ATOM 5233 C CA  . ASN A 1 675  ? -5.848  50.536 10.261  1.00 66.10  ? 672  ASN A CA  1 
ATOM 5234 C C   . ASN A 1 675  ? -7.136  50.414 9.484   1.00 66.10  ? 672  ASN A C   1 
ATOM 5235 O O   . ASN A 1 675  ? -8.215  50.335 10.071  1.00 66.10  ? 672  ASN A O   1 
ATOM 5236 C CB  . ASN A 1 675  ? -6.078  50.179 11.721  1.00 44.85  ? 672  ASN A CB  1 
ATOM 5237 C CG  . ASN A 1 675  ? -4.801  49.808 12.418  1.00 44.85  ? 672  ASN A CG  1 
ATOM 5238 O OD1 . ASN A 1 675  ? -3.840  49.346 11.778  1.00 44.85  ? 672  ASN A OD1 1 
ATOM 5239 N ND2 . ASN A 1 675  ? -4.761  50.013 13.736  1.00 44.85  ? 672  ASN A ND2 1 
ATOM 5240 N N   . LEU A 1 676  ? -7.022  50.388 8.162   1.00 62.79  ? 673  LEU A N   1 
ATOM 5241 C CA  . LEU A 1 676  ? -8.190  50.297 7.307   1.00 62.79  ? 673  LEU A CA  1 
ATOM 5242 C C   . LEU A 1 676  ? -7.859  49.522 6.080   1.00 62.79  ? 673  LEU A C   1 
ATOM 5243 O O   . LEU A 1 676  ? -6.706  49.424 5.676   1.00 62.79  ? 673  LEU A O   1 
ATOM 5244 C CB  . LEU A 1 676  ? -8.717  51.669 6.907   1.00 53.57  ? 673  LEU A CB  1 
ATOM 5245 C CG  . LEU A 1 676  ? -9.225  52.548 8.040   1.00 53.57  ? 673  LEU A CG  1 
ATOM 5246 C CD1 . LEU A 1 676  ? -9.210  53.973 7.622   1.00 53.57  ? 673  LEU A CD1 1 
ATOM 5247 C CD2 . LEU A 1 676  ? -10.610 52.129 8.455   1.00 53.57  ? 673  LEU A CD2 1 
ATOM 5248 N N   . LYS A 1 677  ? -8.924  48.980 5.509   1.00 87.58  ? 674  LYS A N   1 
ATOM 5249 C CA  . LYS A 1 677  ? -8.912  48.053 4.386   1.00 87.58  ? 674  LYS A CA  1 
ATOM 5250 C C   . LYS A 1 677  ? -8.072  48.659 3.250   1.00 87.58  ? 674  LYS A C   1 
ATOM 5251 O O   . LYS A 1 677  ? -6.983  48.158 2.936   1.00 87.58  ? 674  LYS A O   1 
ATOM 5252 C CB  . LYS A 1 677  ? -10.395 47.770 3.990   1.00 91.25  ? 674  LYS A CB  1 
ATOM 5253 C CG  . LYS A 1 677  ? -10.681 46.926 2.734   1.00 91.25  ? 674  LYS A CG  1 
ATOM 5254 C CD  . LYS A 1 677  ? -11.295 45.571 3.045   1.00 91.25  ? 674  LYS A CD  1 
ATOM 5255 C CE  . LYS A 1 677  ? -11.885 44.984 1.772   1.00 91.25  ? 674  LYS A CE  1 
ATOM 5256 N NZ  . LYS A 1 677  ? -12.250 43.551 1.908   1.00 91.25  ? 674  LYS A NZ  1 
ATOM 5257 N N   . GLU A 1 678  ? -8.584  49.753 2.679   1.00 71.74  ? 675  GLU A N   1 
ATOM 5258 C CA  . GLU A 1 678  ? -7.985  50.470 1.564   1.00 71.74  ? 675  GLU A CA  1 
ATOM 5259 C C   . GLU A 1 678  ? -8.766  51.749 1.521   1.00 71.74  ? 675  GLU A C   1 
ATOM 5260 O O   . GLU A 1 678  ? -9.965  51.726 1.649   1.00 71.74  ? 675  GLU A O   1 
ATOM 5261 C CB  . GLU A 1 678  ? -8.172  49.718 0.250   1.00 138.36 ? 675  GLU A CB  1 
ATOM 5262 C CG  . GLU A 1 678  ? -7.104  50.051 -0.768  1.00 138.36 ? 675  GLU A CG  1 
ATOM 5263 C CD  . GLU A 1 678  ? -7.575  49.954 -2.208  1.00 138.36 ? 675  GLU A CD  1 
ATOM 5264 O OE1 . GLU A 1 678  ? -8.779  49.664 -2.423  1.00 138.36 ? 675  GLU A OE1 1 
ATOM 5265 O OE2 . GLU A 1 678  ? -6.737  50.180 -3.123  1.00 138.36 ? 675  GLU A OE2 1 
ATOM 5266 N N   . VAL A 1 679  ? -8.098  52.876 1.378   1.00 73.37  ? 676  VAL A N   1 
ATOM 5267 C CA  . VAL A 1 679  ? -8.801  54.136 1.326   1.00 73.37  ? 676  VAL A CA  1 
ATOM 5268 C C   . VAL A 1 679  ? -8.488  54.806 0.003   1.00 73.37  ? 676  VAL A C   1 
ATOM 5269 O O   . VAL A 1 679  ? -7.332  54.836 -0.420  1.00 73.37  ? 676  VAL A O   1 
ATOM 5270 C CB  . VAL A 1 679  ? -8.367  55.018 2.460   1.00 59.50  ? 676  VAL A CB  1 
ATOM 5271 C CG1 . VAL A 1 679  ? -9.078  56.317 2.391   1.00 59.50  ? 676  VAL A CG1 1 
ATOM 5272 C CG2 . VAL A 1 679  ? -8.642  54.342 3.780   1.00 59.50  ? 676  VAL A CG2 1 
ATOM 5273 N N   . ASN A 1 680  ? -9.518  55.331 -0.657  1.00 75.10  ? 677  ASN A N   1 
ATOM 5274 C CA  . ASN A 1 680  ? -9.377  55.936 -1.983  1.00 75.10  ? 677  ASN A CA  1 
ATOM 5275 C C   . ASN A 1 680  ? -9.140  57.425 -1.951  1.00 75.10  ? 677  ASN A C   1 
ATOM 5276 O O   . ASN A 1 680  ? -8.124  57.915 -2.460  1.00 75.10  ? 677  ASN A O   1 
ATOM 5277 C CB  . ASN A 1 680  ? -10.591 55.626 -2.838  1.00 109.77 ? 677  ASN A CB  1 
ATOM 5278 C CG  . ASN A 1 680  ? -10.368 54.451 -3.727  1.00 109.77 ? 677  ASN A CG  1 
ATOM 5279 O OD1 . ASN A 1 680  ? -9.378  54.394 -4.458  1.00 109.77 ? 677  ASN A OD1 1 
ATOM 5280 N ND2 . ASN A 1 680  ? -11.288 53.501 -3.688  1.00 109.77 ? 677  ASN A ND2 1 
ATOM 5281 N N   . TYR A 1 681  ? -10.107 58.133 -1.374  1.00 58.65  ? 678  TYR A N   1 
ATOM 5282 C CA  . TYR A 1 681  ? -10.013 59.588 -1.132  1.00 58.65  ? 678  TYR A CA  1 
ATOM 5283 C C   . TYR A 1 681  ? -10.544 59.785 0.261   1.00 58.65  ? 678  TYR A C   1 
ATOM 5284 O O   . TYR A 1 681  ? -11.215 58.886 0.791   1.00 58.65  ? 678  TYR A O   1 
ATOM 5285 C CB  . TYR A 1 681  ? -10.815 60.420 -2.170  1.00 72.42  ? 678  TYR A CB  1 
ATOM 5286 C CG  . TYR A 1 681  ? -10.582 59.951 -3.588  1.00 72.42  ? 678  TYR A CG  1 
ATOM 5287 C CD1 . TYR A 1 681  ? -11.295 58.877 -4.100  1.00 72.42  ? 678  TYR A CD1 1 
ATOM 5288 C CD2 . TYR A 1 681  ? -9.593  60.530 -4.391  1.00 72.42  ? 678  TYR A CD2 1 
ATOM 5289 C CE1 . TYR A 1 681  ? -11.048 58.400 -5.381  1.00 72.42  ? 678  TYR A CE1 1 
ATOM 5290 C CE2 . TYR A 1 681  ? -9.342  60.070 -5.685  1.00 72.42  ? 678  TYR A CE2 1 
ATOM 5291 C CZ  . TYR A 1 681  ? -10.081 59.006 -6.171  1.00 72.42  ? 678  TYR A CZ  1 
ATOM 5292 O OH  . TYR A 1 681  ? -9.884  58.529 -7.446  1.00 72.42  ? 678  TYR A OH  1 
ATOM 5293 N N   . MET A 1 682  ? -10.239 60.929 0.855   1.00 78.54  ? 679  MET A N   1 
ATOM 5294 C CA  . MET A 1 682  ? -10.558 61.175 2.239   1.00 78.54  ? 679  MET A CA  1 
ATOM 5295 C C   . MET A 1 682  ? -10.569 62.678 2.480   1.00 78.54  ? 679  MET A C   1 
ATOM 5296 O O   . MET A 1 682  ? -9.766  63.393 1.878   1.00 78.54  ? 679  MET A O   1 
ATOM 5297 C CB  . MET A 1 682  ? -9.520  60.493 3.120   1.00 92.05  ? 679  MET A CB  1 
ATOM 5298 C CG  . MET A 1 682  ? -9.325  61.121 4.467   1.00 92.05  ? 679  MET A CG  1 
ATOM 5299 S SD  . MET A 1 682  ? -8.365  62.632 4.342   1.00 92.05  ? 679  MET A SD  1 
ATOM 5300 C CE  . MET A 1 682  ? -8.933  63.550 5.756   1.00 92.05  ? 679  MET A CE  1 
ATOM 5301 N N   . CYS A 1 683  ? -11.476 63.152 3.345   1.00 133.14 ? 680  CYS A N   1 
ATOM 5302 C CA  . CYS A 1 683  ? -11.547 64.575 3.753   1.00 133.14 ? 680  CYS A CA  1 
ATOM 5303 C C   . CYS A 1 683  ? -12.097 64.778 5.170   1.00 133.14 ? 680  CYS A C   1 
ATOM 5304 O O   . CYS A 1 683  ? -12.948 64.004 5.614   1.00 133.14 ? 680  CYS A O   1 
ATOM 5305 C CB  . CYS A 1 683  ? -12.371 65.404 2.757   1.00 106.88 ? 680  CYS A CB  1 
ATOM 5306 S SG  . CYS A 1 683  ? -13.997 64.745 2.340   1.00 106.88 ? 680  CYS A SG  1 
ATOM 5307 N N   . PRO A 1 684  ? -11.593 65.806 5.890   1.00 117.11 ? 681  PRO A N   1 
ATOM 5308 C CA  . PRO A 1 684  ? -12.153 66.248 7.170   1.00 117.11 ? 681  PRO A CA  1 
ATOM 5309 C C   . PRO A 1 684  ? -13.602 66.695 7.023   1.00 117.11 ? 681  PRO A C   1 
ATOM 5310 O O   . PRO A 1 684  ? -13.949 67.322 6.018   1.00 117.11 ? 681  PRO A O   1 
ATOM 5311 C CB  . PRO A 1 684  ? -11.283 67.451 7.534   1.00 86.31  ? 681  PRO A CB  1 
ATOM 5312 C CG  . PRO A 1 684  ? -10.025 67.198 6.850   1.00 86.31  ? 681  PRO A CG  1 
ATOM 5313 C CD  . PRO A 1 684  ? -10.404 66.594 5.542   1.00 86.31  ? 681  PRO A CD  1 
ATOM 5314 N N   . LEU A 1 685  ? -14.427 66.372 8.022   1.00 209.68 ? 682  LEU A N   1 
ATOM 5315 C CA  . LEU A 1 685  ? -15.872 66.649 8.011   1.00 209.68 ? 682  LEU A CA  1 
ATOM 5316 C C   . LEU A 1 685  ? -16.353 66.968 9.436   1.00 209.68 ? 682  LEU A C   1 
ATOM 5317 O O   . LEU A 1 685  ? -15.525 67.007 10.351  1.00 209.68 ? 682  LEU A O   1 
ATOM 5318 C CB  . LEU A 1 685  ? -16.630 65.453 7.429   1.00 83.21  ? 682  LEU A CB  1 
ATOM 5319 C CG  . LEU A 1 685  ? -17.986 65.678 6.736   1.00 83.21  ? 682  LEU A CG  1 
ATOM 5320 C CD1 . LEU A 1 685  ? -17.828 66.224 5.308   1.00 83.21  ? 682  LEU A CD1 1 
ATOM 5321 C CD2 . LEU A 1 685  ? -18.825 64.393 6.726   1.00 83.21  ? 682  LEU A CD2 1 
ATOM 5322 N N   . ASN A 1 686  ? -17.663 67.188 9.634   1.00 156.98 ? 683  ASN A N   1 
ATOM 5323 C CA  . ASN A 1 686  ? -18.162 67.735 10.919  1.00 156.98 ? 683  ASN A CA  1 
ATOM 5324 C C   . ASN A 1 686  ? -19.669 68.101 11.071  1.00 156.98 ? 683  ASN A C   1 
ATOM 5325 O O   . ASN A 1 686  ? -19.986 69.076 11.749  1.00 156.98 ? 683  ASN A O   1 
ATOM 5326 C CB  . ASN A 1 686  ? -17.281 68.954 11.283  1.00 114.05 ? 683  ASN A CB  1 
ATOM 5327 C CG  . ASN A 1 686  ? -17.707 69.668 12.558  1.00 114.05 ? 683  ASN A CG  1 
ATOM 5328 O OD1 . ASN A 1 686  ? -18.052 69.053 13.566  1.00 114.05 ? 683  ASN A OD1 1 
ATOM 5329 N ND2 . ASN A 1 686  ? -17.651 70.992 12.516  1.00 114.05 ? 683  ASN A ND2 1 
ATOM 5330 N N   . SER A 1 687  ? -20.598 67.328 10.500  1.00 160.49 ? 684  SER A N   1 
ATOM 5331 C CA  . SER A 1 687  ? -22.043 67.686 10.593  1.00 160.49 ? 684  SER A CA  1 
ATOM 5332 C C   . SER A 1 687  ? -22.642 67.592 12.013  1.00 160.49 ? 684  SER A C   1 
ATOM 5333 O O   . SER A 1 687  ? -21.998 67.098 12.944  1.00 160.49 ? 684  SER A O   1 
ATOM 5334 C CB  . SER A 1 687  ? -22.897 66.868 9.606   1.00 127.83 ? 684  SER A CB  1 
ATOM 5335 O OG  . SER A 1 687  ? -24.154 67.496 9.371   1.00 127.83 ? 684  SER A OG  1 
ATOM 5336 N N   . ASP A 1 688  ? -23.867 68.089 12.177  1.00 176.87 ? 685  ASP A N   1 
ATOM 5337 C CA  . ASP A 1 688  ? -24.617 67.824 13.401  1.00 176.87 ? 685  ASP A CA  1 
ATOM 5338 C C   . ASP A 1 688  ? -25.265 66.443 13.271  1.00 176.87 ? 685  ASP A C   1 
ATOM 5339 O O   . ASP A 1 688  ? -26.406 66.289 12.830  1.00 176.87 ? 685  ASP A O   1 
ATOM 5340 C CB  . ASP A 1 688  ? -25.610 68.955 13.743  1.00 91.70  ? 685  ASP A CB  1 
ATOM 5341 C CG  . ASP A 1 688  ? -26.604 69.253 12.621  1.00 91.70  ? 685  ASP A CG  1 
ATOM 5342 O OD1 . ASP A 1 688  ? -26.669 68.483 11.628  1.00 91.70  ? 685  ASP A OD1 1 
ATOM 5343 O OD2 . ASP A 1 688  ? -27.330 70.274 12.759  1.00 91.70  ? 685  ASP A OD2 1 
ATOM 5344 N N   . GLY A 1 689  ? -24.491 65.437 13.656  1.00 82.56  ? 686  GLY A N   1 
ATOM 5345 C CA  . GLY A 1 689  ? -24.773 64.046 13.329  1.00 82.56  ? 686  GLY A CA  1 
ATOM 5346 C C   . GLY A 1 689  ? -23.497 63.260 12.992  1.00 82.56  ? 686  GLY A C   1 
ATOM 5347 O O   . GLY A 1 689  ? -23.543 62.025 12.913  1.00 82.56  ? 686  GLY A O   1 
ATOM 5348 N N   . TYR A 1 690  ? -22.372 63.974 12.776  1.00 75.09  ? 687  TYR A N   1 
ATOM 5349 C CA  . TYR A 1 690  ? -21.029 63.394 12.561  1.00 75.09  ? 687  TYR A CA  1 
ATOM 5350 C C   . TYR A 1 690  ? -19.846 64.379 12.794  1.00 75.09  ? 687  TYR A C   1 
ATOM 5351 O O   . TYR A 1 690  ? -19.039 64.557 11.893  1.00 75.09  ? 687  TYR A O   1 
ATOM 5352 C CB  . TYR A 1 690  ? -20.914 62.828 11.141  1.00 96.63  ? 687  TYR A CB  1 
ATOM 5353 C CG  . TYR A 1 690  ? -21.841 61.684 10.797  1.00 96.63  ? 687  TYR A CG  1 
ATOM 5354 C CD1 . TYR A 1 690  ? -21.688 60.417 11.377  1.00 96.63  ? 687  TYR A CD1 1 
ATOM 5355 C CD2 . TYR A 1 690  ? -22.855 61.850 9.858   1.00 96.63  ? 687  TYR A CD2 1 
ATOM 5356 C CE1 . TYR A 1 690  ? -22.548 59.340 11.041  1.00 96.63  ? 687  TYR A CE1 1 
ATOM 5357 C CE2 . TYR A 1 690  ? -23.721 60.785 9.511   1.00 96.63  ? 687  TYR A CE2 1 
ATOM 5358 C CZ  . TYR A 1 690  ? -23.564 59.533 10.104  1.00 96.63  ? 687  TYR A CZ  1 
ATOM 5359 O OH  . TYR A 1 690  ? -24.418 58.493 9.753   1.00 96.63  ? 687  TYR A OH  1 
ATOM 5360 N N   . PRO A 1 691  ? -19.732 65.016 13.984  1.00 117.04 ? 688  PRO A N   1 
ATOM 5361 C CA  . PRO A 1 691  ? -18.651 66.007 14.238  1.00 117.04 ? 688  PRO A CA  1 
ATOM 5362 C C   . PRO A 1 691  ? -17.224 65.437 14.223  1.00 117.04 ? 688  PRO A C   1 
ATOM 5363 O O   . PRO A 1 691  ? -17.084 64.228 14.054  1.00 117.04 ? 688  PRO A O   1 
ATOM 5364 C CB  . PRO A 1 691  ? -19.007 66.577 15.620  1.00 91.68  ? 688  PRO A CB  1 
ATOM 5365 C CG  . PRO A 1 691  ? -20.464 66.274 15.789  1.00 91.68  ? 688  PRO A CG  1 
ATOM 5366 C CD  . PRO A 1 691  ? -20.612 64.908 15.156  1.00 91.68  ? 688  PRO A CD  1 
ATOM 5367 N N   . ASP A 1 692  ? -16.211 66.302 14.312  1.00 106.54 ? 689  ASP A N   1 
ATOM 5368 C CA  . ASP A 1 692  ? -14.810 65.888 14.177  1.00 106.54 ? 689  ASP A CA  1 
ATOM 5369 C C   . ASP A 1 692  ? -14.709 64.584 13.368  1.00 106.54 ? 689  ASP A C   1 
ATOM 5370 O O   . ASP A 1 692  ? -14.071 63.618 13.785  1.00 106.54 ? 689  ASP A O   1 
ATOM 5371 C CB  . ASP A 1 692  ? -14.108 65.778 15.539  1.00 104.24 ? 689  ASP A CB  1 
ATOM 5372 C CG  . ASP A 1 692  ? -12.584 65.844 15.427  1.00 104.24 ? 689  ASP A CG  1 
ATOM 5373 O OD1 . ASP A 1 692  ? -11.969 66.718 16.077  1.00 104.24 ? 689  ASP A OD1 1 
ATOM 5374 O OD2 . ASP A 1 692  ? -12.001 65.018 14.690  1.00 104.24 ? 689  ASP A OD2 1 
ATOM 5375 N N   . SER A 1 693  ? -15.344 64.580 12.200  1.00 199.50 ? 690  SER A N   1 
ATOM 5376 C CA  . SER A 1 693  ? -15.398 63.410 11.359  1.00 199.50 ? 690  SER A CA  1 
ATOM 5377 C C   . SER A 1 693  ? -14.307 63.522 10.311  1.00 199.50 ? 690  SER A C   1 
ATOM 5378 O O   . SER A 1 693  ? -13.855 64.623 9.984   1.00 199.50 ? 690  SER A O   1 
ATOM 5379 C CB  . SER A 1 693  ? -16.772 63.333 10.691  1.00 93.34  ? 690  SER A CB  1 
ATOM 5380 O OG  . SER A 1 693  ? -17.142 61.999 10.379  1.00 93.34  ? 690  SER A OG  1 
ATOM 5381 N N   . LEU A 1 694  ? -13.860 62.371 9.820   1.00 60.90  ? 691  LEU A N   1 
ATOM 5382 C CA  . LEU A 1 694  ? -13.065 62.305 8.615   1.00 60.90  ? 691  LEU A CA  1 
ATOM 5383 C C   . LEU A 1 694  ? -13.867 61.403 7.676   1.00 60.90  ? 691  LEU A C   1 
ATOM 5384 O O   . LEU A 1 694  ? -14.549 60.477 8.125   1.00 60.90  ? 691  LEU A O   1 
ATOM 5385 C CB  . LEU A 1 694  ? -11.660 61.767 8.897   1.00 62.42  ? 691  LEU A CB  1 
ATOM 5386 C CG  . LEU A 1 694  ? -10.804 62.298 10.067  1.00 62.42  ? 691  LEU A CG  1 
ATOM 5387 C CD1 . LEU A 1 694  ? -9.328  61.949 9.827   1.00 62.42  ? 691  LEU A CD1 1 
ATOM 5388 C CD2 . LEU A 1 694  ? -10.960 63.814 10.357  1.00 62.42  ? 691  LEU A CD2 1 
ATOM 5389 N N   . ALA A 1 695  ? -13.849 61.717 6.385   1.00 96.78  ? 692  ALA A N   1 
ATOM 5390 C CA  . ALA A 1 695  ? -14.680 60.989 5.437   1.00 96.78  ? 692  ALA A CA  1 
ATOM 5391 C C   . ALA A 1 695  ? -13.807 60.309 4.421   1.00 96.78  ? 692  ALA A C   1 
ATOM 5392 O O   . ALA A 1 695  ? -12.880 60.902 3.882   1.00 96.78  ? 692  ALA A O   1 
ATOM 5393 C CB  . ALA A 1 695  ? -15.667 61.901 4.762   1.00 122.55 ? 692  ALA A CB  1 
ATOM 5394 N N   . LEU A 1 696  ? -14.112 59.054 4.157   1.00 75.72  ? 693  LEU A N   1 
ATOM 5395 C CA  . LEU A 1 696  ? -13.177 58.215 3.473   1.00 75.72  ? 693  LEU A CA  1 
ATOM 5396 C C   . LEU A 1 696  ? -13.924 57.274 2.554   1.00 75.72  ? 693  LEU A C   1 
ATOM 5397 O O   . LEU A 1 696  ? -14.701 56.420 3.016   1.00 75.72  ? 693  LEU A O   1 
ATOM 5398 C CB  . LEU A 1 696  ? -12.367 57.413 4.500   1.00 66.78  ? 693  LEU A CB  1 
ATOM 5399 C CG  . LEU A 1 696  ? -11.177 57.977 5.307   1.00 66.78  ? 693  LEU A CG  1 
ATOM 5400 C CD1 . LEU A 1 696  ? -11.538 59.025 6.379   1.00 66.78  ? 693  LEU A CD1 1 
ATOM 5401 C CD2 . LEU A 1 696  ? -10.476 56.782 5.965   1.00 66.78  ? 693  LEU A CD2 1 
ATOM 5402 N N   . ALA A 1 697  ? -13.692 57.432 1.251   1.00 69.75  ? 694  ALA A N   1 
ATOM 5403 C CA  . ALA A 1 697  ? -14.345 56.590 0.251   1.00 69.75  ? 694  ALA A CA  1 
ATOM 5404 C C   . ALA A 1 697  ? -13.458 55.410 -0.007  1.00 69.75  ? 694  ALA A C   1 
ATOM 5405 O O   . ALA A 1 697  ? -12.249 55.576 0.011   1.00 69.75  ? 694  ALA A O   1 
ATOM 5406 C CB  . ALA A 1 697  ? -14.565 57.368 -1.038  1.00 162.97 ? 694  ALA A CB  1 
ATOM 5407 N N   . ASN A 1 698  ? -14.023 54.227 -0.228  1.00 100.00 ? 695  ASN A N   1 
ATOM 5408 C CA  . ASN A 1 698  ? -13.209 53.118 -0.736  1.00 100.00 ? 695  ASN A CA  1 
ATOM 5409 C C   . ASN A 1 698  ? -13.758 52.518 -2.027  1.00 100.00 ? 695  ASN A C   1 
ATOM 5410 O O   . ASN A 1 698  ? -14.600 53.135 -2.700  1.00 100.00 ? 695  ASN A O   1 
ATOM 5411 C CB  . ASN A 1 698  ? -12.917 52.055 0.334   1.00 135.38 ? 695  ASN A CB  1 
ATOM 5412 C CG  . ASN A 1 698  ? -14.139 51.268 0.742   1.00 135.38 ? 695  ASN A CG  1 
ATOM 5413 O OD1 . ASN A 1 698  ? -15.025 51.782 1.424   1.00 135.38 ? 695  ASN A OD1 1 
ATOM 5414 N ND2 . ASN A 1 698  ? -14.176 49.996 0.355   1.00 135.38 ? 695  ASN A ND2 1 
ATOM 5415 N N   . ASN A 1 699  ? -13.257 51.335 -2.382  1.00 104.90 ? 696  ASN A N   1 
ATOM 5416 C CA  . ASN A 1 699  ? -13.697 50.638 -3.588  1.00 104.90 ? 696  ASN A CA  1 
ATOM 5417 C C   . ASN A 1 699  ? -15.218 50.673 -3.726  1.00 104.90 ? 696  ASN A C   1 
ATOM 5418 O O   . ASN A 1 699  ? -15.748 50.628 -4.838  1.00 104.90 ? 696  ASN A O   1 
ATOM 5419 C CB  . ASN A 1 699  ? -13.197 49.193 -3.592  1.00 175.07 ? 696  ASN A CB  1 
ATOM 5420 C CG  . ASN A 1 699  ? -13.268 48.559 -4.966  1.00 175.07 ? 696  ASN A CG  1 
ATOM 5421 O OD1 . ASN A 1 699  ? -12.628 49.028 -5.910  1.00 175.07 ? 696  ASN A OD1 1 
ATOM 5422 N ND2 . ASN A 1 699  ? -14.047 47.488 -5.086  1.00 175.07 ? 696  ASN A ND2 1 
ATOM 5423 N N   . SER A 1 700  ? -15.896 50.738 -2.574  1.00 93.05  ? 697  SER A N   1 
ATOM 5424 C CA  . SER A 1 700  ? -17.321 51.066 -2.453  1.00 93.05  ? 697  SER A CA  1 
ATOM 5425 C C   . SER A 1 700  ? -17.669 51.242 -0.980  1.00 93.05  ? 697  SER A C   1 
ATOM 5426 O O   . SER A 1 700  ? -17.709 50.264 -0.240  1.00 93.05  ? 697  SER A O   1 
ATOM 5427 C CB  . SER A 1 700  ? -18.214 49.981 -3.078  1.00 140.71 ? 697  SER A CB  1 
ATOM 5428 O OG  . SER A 1 700  ? -18.178 48.776 -2.332  1.00 140.71 ? 697  SER A OG  1 
ATOM 5429 N N   . THR A 1 701  ? -17.897 52.486 -0.564  1.00 92.70  ? 698  THR A N   1 
ATOM 5430 C CA  . THR A 1 701  ? -18.379 52.820 0.780   1.00 92.70  ? 698  THR A CA  1 
ATOM 5431 C C   . THR A 1 701  ? -17.932 54.213 1.175   1.00 92.70  ? 698  THR A C   1 
ATOM 5432 O O   . THR A 1 701  ? -16.742 54.533 1.133   1.00 92.70  ? 698  THR A O   1 
ATOM 5433 C CB  . THR A 1 701  ? -17.910 51.807 1.874   1.00 150.10 ? 698  THR A CB  1 
ATOM 5434 O OG1 . THR A 1 701  ? -18.661 50.595 1.764   1.00 150.10 ? 698  THR A OG1 1 
ATOM 5435 C CG2 . THR A 1 701  ? -18.106 52.353 3.268   1.00 150.10 ? 698  THR A CG2 1 
ATOM 5436 N N   . LEU A 1 702  ? -18.884 55.052 1.552   1.00 92.95  ? 699  LEU A N   1 
ATOM 5437 C CA  . LEU A 1 702  ? -18.508 56.218 2.323   1.00 92.95  ? 699  LEU A CA  1 
ATOM 5438 C C   . LEU A 1 702  ? -18.469 55.789 3.787   1.00 92.95  ? 699  LEU A C   1 
ATOM 5439 O O   . LEU A 1 702  ? -19.296 54.973 4.218   1.00 92.95  ? 699  LEU A O   1 
ATOM 5440 C CB  . LEU A 1 702  ? -19.447 57.420 2.118   1.00 60.64  ? 699  LEU A CB  1 
ATOM 5441 C CG  . LEU A 1 702  ? -18.982 58.653 2.923   1.00 60.64  ? 699  LEU A CG  1 
ATOM 5442 C CD1 . LEU A 1 702  ? -17.768 59.364 2.312   1.00 60.64  ? 699  LEU A CD1 1 
ATOM 5443 C CD2 . LEU A 1 702  ? -20.094 59.634 3.179   1.00 60.64  ? 699  LEU A CD2 1 
ATOM 5444 N N   . THR A 1 703  ? -17.482 56.327 4.512   1.00 108.68 ? 700  THR A N   1 
ATOM 5445 C CA  . THR A 1 703  ? -17.299 56.144 5.955   1.00 108.68 ? 700  THR A CA  1 
ATOM 5446 C C   . THR A 1 703  ? -16.890 57.479 6.624   1.00 108.68 ? 700  THR A C   1 
ATOM 5447 O O   . THR A 1 703  ? -16.542 58.442 5.942   1.00 108.68 ? 700  THR A O   1 
ATOM 5448 C CB  . THR A 1 703  ? -16.261 55.019 6.277   1.00 97.78  ? 700  THR A CB  1 
ATOM 5449 O OG1 . THR A 1 703  ? -15.133 55.128 5.401   1.00 97.78  ? 700  THR A OG1 1 
ATOM 5450 C CG2 . THR A 1 703  ? -16.861 53.634 6.108   1.00 97.78  ? 700  THR A CG2 1 
ATOM 5451 N N   . ILE A 1 704  ? -16.934 57.514 7.958   1.00 87.68  ? 701  ILE A N   1 
ATOM 5452 C CA  . ILE A 1 704  ? -16.721 58.727 8.772   1.00 87.68  ? 701  ILE A CA  1 
ATOM 5453 C C   . ILE A 1 704  ? -16.380 58.373 10.244  1.00 87.68  ? 701  ILE A C   1 
ATOM 5454 O O   . ILE A 1 704  ? -17.026 57.492 10.814  1.00 87.68  ? 701  ILE A O   1 
ATOM 5455 C CB  . ILE A 1 704  ? -17.988 59.622 8.776   1.00 100.53 ? 701  ILE A CB  1 
ATOM 5456 C CG1 . ILE A 1 704  ? -19.249 58.818 9.160   1.00 100.53 ? 701  ILE A CG1 1 
ATOM 5457 C CG2 . ILE A 1 704  ? -18.164 60.366 7.461   1.00 100.53 ? 701  ILE A CG2 1 
ATOM 5458 C CD1 . ILE A 1 704  ? -19.621 57.639 8.259   1.00 100.53 ? 701  ILE A CD1 1 
ATOM 5459 N N   . GLY A 1 705  ? -15.407 59.060 10.857  1.00 56.22  ? 702  GLY A N   1 
ATOM 5460 C CA  . GLY A 1 705  ? -14.954 58.745 12.232  1.00 56.22  ? 702  GLY A CA  1 
ATOM 5461 C C   . GLY A 1 705  ? -13.808 59.571 12.860  1.00 56.22  ? 702  GLY A C   1 
ATOM 5462 O O   . GLY A 1 705  ? -13.173 60.419 12.197  1.00 56.22  ? 702  GLY A O   1 
ATOM 5463 N N   . THR A 1 706  ? -13.518 59.374 14.147  1.00 70.32  ? 703  THR A N   1 
ATOM 5464 C CA  . THR A 1 706  ? -12.309 60.046 14.683  1.00 70.32  ? 703  THR A CA  1 
ATOM 5465 C C   . THR A 1 706  ? -11.095 59.083 14.633  1.00 70.32  ? 703  THR A C   1 
ATOM 5466 O O   . THR A 1 706  ? -11.216 57.942 14.144  1.00 70.32  ? 703  THR A O   1 
ATOM 5467 C CB  . THR A 1 706  ? -12.493 60.781 16.075  1.00 112.49 ? 703  THR A CB  1 
ATOM 5468 O OG1 . THR A 1 706  ? -12.041 59.947 17.152  1.00 112.49 ? 703  THR A OG1 1 
ATOM 5469 C CG2 . THR A 1 706  ? -13.946 61.222 16.305  1.00 112.49 ? 703  THR A CG2 1 
ATOM 5470 N N   . ILE A 1 707  ? -9.949  59.553 15.126  1.00 78.60  ? 704  ILE A N   1 
ATOM 5471 C CA  . ILE A 1 707  ? -8.667  58.932 14.850  1.00 78.60  ? 704  ILE A CA  1 
ATOM 5472 C C   . ILE A 1 707  ? -7.918  58.858 16.153  1.00 78.60  ? 704  ILE A C   1 
ATOM 5473 O O   . ILE A 1 707  ? -7.877  59.859 16.869  1.00 78.60  ? 704  ILE A O   1 
ATOM 5474 C CB  . ILE A 1 707  ? -7.834  59.813 13.863  1.00 83.13  ? 704  ILE A CB  1 
ATOM 5475 C CG1 . ILE A 1 707  ? -8.704  60.356 12.733  1.00 83.13  ? 704  ILE A CG1 1 
ATOM 5476 C CG2 . ILE A 1 707  ? -6.654  59.047 13.259  1.00 83.13  ? 704  ILE A CG2 1 
ATOM 5477 C CD1 . ILE A 1 707  ? -9.217  59.290 11.774  1.00 83.13  ? 704  ILE A CD1 1 
ATOM 5478 N N   . ASP A 1 708  ? -7.310  57.700 16.454  1.00 55.84  ? 705  ASP A N   1 
ATOM 5479 C CA  . ASP A 1 708  ? -6.510  57.521 17.701  1.00 55.84  ? 705  ASP A CA  1 
ATOM 5480 C C   . ASP A 1 708  ? -5.205  58.320 17.679  1.00 55.84  ? 705  ASP A C   1 
ATOM 5481 O O   . ASP A 1 708  ? -4.963  59.097 16.769  1.00 55.84  ? 705  ASP A O   1 
ATOM 5482 C CB  . ASP A 1 708  ? -6.175  56.043 17.967  1.00 120.22 ? 705  ASP A CB  1 
ATOM 5483 C CG  . ASP A 1 708  ? -7.230  55.094 17.440  1.00 120.22 ? 705  ASP A CG  1 
ATOM 5484 O OD1 . ASP A 1 708  ? -8.434  55.321 17.691  1.00 120.22 ? 705  ASP A OD1 1 
ATOM 5485 O OD2 . ASP A 1 708  ? -6.841  54.106 16.779  1.00 120.22 ? 705  ASP A OD2 1 
ATOM 5486 N N   . GLU A 1 709  ? -4.359  58.091 18.681  1.00 124.51 ? 706  GLU A N   1 
ATOM 5487 C CA  . GLU A 1 709  ? -3.070  58.780 18.815  1.00 124.51 ? 706  GLU A CA  1 
ATOM 5488 C C   . GLU A 1 709  ? -2.349  58.979 17.472  1.00 124.51 ? 706  GLU A C   1 
ATOM 5489 O O   . GLU A 1 709  ? -2.844  59.684 16.596  1.00 124.51 ? 706  GLU A O   1 
ATOM 5490 C CB  . GLU A 1 709  ? -2.166  58.046 19.823  1.00 144.26 ? 706  GLU A CB  1 
ATOM 5491 C CG  . GLU A 1 709  ? -1.131  58.924 20.528  1.00 144.26 ? 706  GLU A CG  1 
ATOM 5492 C CD  . GLU A 1 709  ? -1.569  59.375 21.912  1.00 144.26 ? 706  GLU A CD  1 
ATOM 5493 O OE1 . GLU A 1 709  ? -0.885  59.016 22.894  1.00 144.26 ? 706  GLU A OE1 1 
ATOM 5494 O OE2 . GLU A 1 709  ? -2.591  60.083 22.026  1.00 144.26 ? 706  GLU A OE2 1 
ATOM 5495 N N   . ILE A 1 710  ? -1.193  58.345 17.311  1.00 54.89  ? 707  ILE A N   1 
ATOM 5496 C CA  . ILE A 1 710  ? -0.218  58.717 16.270  1.00 54.89  ? 707  ILE A CA  1 
ATOM 5497 C C   . ILE A 1 710  ? 0.774   57.554 16.105  1.00 54.89  ? 707  ILE A C   1 
ATOM 5498 O O   . ILE A 1 710  ? 0.630   56.704 15.220  1.00 54.89  ? 707  ILE A O   1 
ATOM 5499 C CB  . ILE A 1 710  ? 0.582   60.040 16.662  1.00 91.13  ? 707  ILE A CB  1 
ATOM 5500 C CG1 . ILE A 1 710  ? -0.319  61.298 16.640  1.00 91.13  ? 707  ILE A CG1 1 
ATOM 5501 C CG2 . ILE A 1 710  ? 1.874   60.214 15.807  1.00 91.13  ? 707  ILE A CG2 1 
ATOM 5502 C CD1 . ILE A 1 710  ? 0.219   62.562 17.420  1.00 91.13  ? 707  ILE A CD1 1 
ATOM 5503 N N   . GLN A 1 711  ? 1.785   57.572 16.966  1.00 52.87  ? 708  GLN A N   1 
ATOM 5504 C CA  . GLN A 1 711  ? 2.779   56.537 17.156  1.00 52.87  ? 708  GLN A CA  1 
ATOM 5505 C C   . GLN A 1 711  ? 2.566   55.301 16.309  1.00 52.87  ? 708  GLN A C   1 
ATOM 5506 O O   . GLN A 1 711  ? 1.450   54.846 16.160  1.00 52.87  ? 708  GLN A O   1 
ATOM 5507 C CB  . GLN A 1 711  ? 2.757   56.171 18.640  1.00 149.62 ? 708  GLN A CB  1 
ATOM 5508 C CG  . GLN A 1 711  ? 1.390   56.469 19.312  1.00 149.62 ? 708  GLN A CG  1 
ATOM 5509 C CD  . GLN A 1 711  ? 1.342   56.131 20.796  1.00 149.62 ? 708  GLN A CD  1 
ATOM 5510 O OE1 . GLN A 1 711  ? 0.269   55.891 21.356  1.00 149.62 ? 708  GLN A OE1 1 
ATOM 5511 N NE2 . GLN A 1 711  ? 2.507   56.098 21.437  1.00 149.62 ? 708  GLN A NE2 1 
ATOM 5512 N N   . LYS A 1 712  ? 3.636   54.748 15.750  1.00 75.11  ? 709  LYS A N   1 
ATOM 5513 C CA  . LYS A 1 712  ? 3.545   53.439 15.096  1.00 75.11  ? 709  LYS A CA  1 
ATOM 5514 C C   . LYS A 1 712  ? 2.687   52.478 15.950  1.00 75.11  ? 709  LYS A C   1 
ATOM 5515 O O   . LYS A 1 712  ? 1.982   51.620 15.402  1.00 75.11  ? 709  LYS A O   1 
ATOM 5516 C CB  . LYS A 1 712  ? 4.949   52.868 14.819  1.00 128.17 ? 709  LYS A CB  1 
ATOM 5517 C CG  . LYS A 1 712  ? 4.977   51.571 14.000  1.00 128.17 ? 709  LYS A CG  1 
ATOM 5518 C CD  . LYS A 1 712  ? 6.188   51.515 13.063  1.00 128.17 ? 709  LYS A CD  1 
ATOM 5519 C CE  . LYS A 1 712  ? 6.420   50.108 12.493  1.00 128.17 ? 709  LYS A CE  1 
ATOM 5520 N NZ  . LYS A 1 712  ? 5.332   49.596 11.599  1.00 128.17 ? 709  LYS A NZ  1 
ATOM 5521 N N   . LEU A 1 713  ? 2.735   52.680 17.282  1.00 57.24  ? 710  LEU A N   1 
ATOM 5522 C CA  . LEU A 1 713  ? 2.010   51.894 18.295  1.00 57.24  ? 710  LEU A CA  1 
ATOM 5523 C C   . LEU A 1 713  ? 1.082   52.726 19.161  1.00 57.24  ? 710  LEU A C   1 
ATOM 5524 O O   . LEU A 1 713  ? 1.483   53.742 19.695  1.00 57.24  ? 710  LEU A O   1 
ATOM 5525 C CB  . LEU A 1 713  ? 2.991   51.195 19.244  1.00 56.11  ? 710  LEU A CB  1 
ATOM 5526 C CG  . LEU A 1 713  ? 3.821   50.049 18.668  1.00 56.11  ? 710  LEU A CG  1 
ATOM 5527 C CD1 . LEU A 1 713  ? 4.756   49.512 19.745  1.00 56.11  ? 710  LEU A CD1 1 
ATOM 5528 C CD2 . LEU A 1 713  ? 2.982   48.926 18.075  1.00 56.11  ? 710  LEU A CD2 1 
ATOM 5529 N N   . HIS A 1 714  ? -0.142  52.260 19.349  1.00 73.47  ? 711  HIS A N   1 
ATOM 5530 C CA  . HIS A 1 714  ? -0.959  52.801 20.404  1.00 73.47  ? 711  HIS A CA  1 
ATOM 5531 C C   . HIS A 1 714  ? -0.920  51.872 21.611  1.00 73.47  ? 711  HIS A C   1 
ATOM 5532 O O   . HIS A 1 714  ? -1.065  50.658 21.480  1.00 73.47  ? 711  HIS A O   1 
ATOM 5533 C CB  . HIS A 1 714  ? -2.384  53.019 19.923  1.00 88.34  ? 711  HIS A CB  1 
ATOM 5534 C CG  . HIS A 1 714  ? -3.306  53.454 21.011  1.00 88.34  ? 711  HIS A CG  1 
ATOM 5535 N ND1 . HIS A 1 714  ? -3.265  54.721 21.556  1.00 88.34  ? 711  HIS A ND1 1 
ATOM 5536 C CD2 . HIS A 1 714  ? -4.261  52.777 21.697  1.00 88.34  ? 711  HIS A CD2 1 
ATOM 5537 C CE1 . HIS A 1 714  ? -4.172  54.813 22.515  1.00 88.34  ? 711  HIS A CE1 1 
ATOM 5538 N NE2 . HIS A 1 714  ? -4.790  53.648 22.619  1.00 88.34  ? 711  HIS A NE2 1 
ATOM 5539 N N   . ILE A 1 715  ? -0.716  52.458 22.784  1.00 60.32  ? 712  ILE A N   1 
ATOM 5540 C CA  . ILE A 1 715  ? -0.693  51.722 24.042  1.00 60.32  ? 712  ILE A CA  1 
ATOM 5541 C C   . ILE A 1 715  ? -1.833  52.116 24.952  1.00 60.32  ? 712  ILE A C   1 
ATOM 5542 O O   . ILE A 1 715  ? -1.931  53.274 25.299  1.00 60.32  ? 712  ILE A O   1 
ATOM 5543 C CB  . ILE A 1 715  ? 0.521   52.119 24.884  1.00 59.95  ? 712  ILE A CB  1 
ATOM 5544 C CG1 . ILE A 1 715  ? 1.827   51.871 24.178  1.00 59.95  ? 712  ILE A CG1 1 
ATOM 5545 C CG2 . ILE A 1 715  ? 0.539   51.378 26.202  1.00 59.95  ? 712  ILE A CG2 1 
ATOM 5546 C CD1 . ILE A 1 715  ? 2.906   52.542 24.910  1.00 59.95  ? 712  ILE A CD1 1 
ATOM 5547 N N   . ARG A 1 716  ? -2.659  51.148 25.338  1.00 69.76  ? 713  ARG A N   1 
ATOM 5548 C CA  . ARG A 1 716  ? -3.768  51.382 26.254  1.00 69.76  ? 713  ARG A CA  1 
ATOM 5549 C C   . ARG A 1 716  ? -3.422  50.701 27.573  1.00 69.76  ? 713  ARG A C   1 
ATOM 5550 O O   . ARG A 1 716  ? -3.209  49.489 27.613  1.00 69.76  ? 713  ARG A O   1 
ATOM 5551 C CB  . ARG A 1 716  ? -5.068  50.814 25.685  1.00 56.45  ? 713  ARG A CB  1 
ATOM 5552 C CG  . ARG A 1 716  ? -6.284  51.043 26.569  1.00 56.45  ? 713  ARG A CG  1 
ATOM 5553 C CD  . ARG A 1 716  ? -7.540  50.464 25.940  1.00 56.45  ? 713  ARG A CD  1 
ATOM 5554 N NE  . ARG A 1 716  ? -8.721  50.692 26.768  1.00 56.45  ? 713  ARG A NE  1 
ATOM 5555 C CZ  . ARG A 1 716  ? -9.145  49.857 27.711  1.00 56.45  ? 713  ARG A CZ  1 
ATOM 5556 N NH1 . ARG A 1 716  ? -8.485  48.733 27.949  1.00 56.45  ? 713  ARG A NH1 1 
ATOM 5557 N NH2 . ARG A 1 716  ? -10.231 50.146 28.416  1.00 56.45  ? 713  ARG A NH2 1 
ATOM 5558 N N   . THR A 1 717  ? -3.355  51.479 28.648  1.00 38.09  ? 714  THR A N   1 
ATOM 5559 C CA  . THR A 1 717  ? -2.984  50.935 29.952  1.00 38.09  ? 714  THR A CA  1 
ATOM 5560 C C   . THR A 1 717  ? -4.143  50.706 30.921  1.00 38.09  ? 714  THR A C   1 
ATOM 5561 O O   . THR A 1 717  ? -5.229  51.266 30.769  1.00 38.09  ? 714  THR A O   1 
ATOM 5562 C CB  . THR A 1 717  ? -1.932  51.825 30.647  1.00 29.13  ? 714  THR A CB  1 
ATOM 5563 O OG1 . THR A 1 717  ? -0.759  51.913 29.828  1.00 29.13  ? 714  THR A OG1 1 
ATOM 5564 C CG2 . THR A 1 717  ? -1.556  51.247 32.002  1.00 29.13  ? 714  THR A CG2 1 
ATOM 5565 N N   . VAL A 1 718  ? -3.879  49.871 31.921  1.00 38.39  ? 715  VAL A N   1 
ATOM 5566 C CA  . VAL A 1 718  ? -4.837  49.534 32.967  1.00 38.39  ? 715  VAL A CA  1 
ATOM 5567 C C   . VAL A 1 718  ? -4.143  49.493 34.324  1.00 38.39  ? 715  VAL A C   1 
ATOM 5568 O O   . VAL A 1 718  ? -3.554  48.479 34.700  1.00 38.39  ? 715  VAL A O   1 
ATOM 5569 C CB  . VAL A 1 718  ? -5.510  48.175 32.701  1.00 50.92  ? 715  VAL A CB  1 
ATOM 5570 C CG1 . VAL A 1 718  ? -6.455  47.820 33.839  1.00 50.92  ? 715  VAL A CG1 1 
ATOM 5571 C CG2 . VAL A 1 718  ? -6.251  48.201 31.373  1.00 50.92  ? 715  VAL A CG2 1 
ATOM 5572 N N   . PRO A 1 719  ? -4.214  50.601 35.054  1.00 29.01  ? 716  PRO A N   1 
ATOM 5573 C CA  . PRO A 1 719  ? -3.576  50.696 36.370  1.00 29.01  ? 716  PRO A CA  1 
ATOM 5574 C C   . PRO A 1 719  ? -4.002  49.600 37.326  1.00 29.01  ? 716  PRO A C   1 
ATOM 5575 O O   . PRO A 1 719  ? -5.165  49.544 37.695  1.00 29.01  ? 716  PRO A O   1 
ATOM 5576 C CB  . PRO A 1 719  ? -4.119  51.996 36.905  1.00 20.16  ? 716  PRO A CB  1 
ATOM 5577 C CG  . PRO A 1 719  ? -4.462  52.771 35.714  1.00 20.16  ? 716  PRO A CG  1 
ATOM 5578 C CD  . PRO A 1 719  ? -4.754  51.870 34.592  1.00 20.16  ? 716  PRO A CD  1 
ATOM 5579 N N   . LEU A 1 720  ? -3.110  48.730 37.770  1.00 37.60  ? 717  LEU A N   1 
ATOM 5580 C CA  . LEU A 1 720  ? -3.548  47.697 38.735  1.00 37.60  ? 717  LEU A CA  1 
ATOM 5581 C C   . LEU A 1 720  ? -3.255  48.009 40.213  1.00 37.60  ? 717  LEU A C   1 
ATOM 5582 O O   . LEU A 1 720  ? -3.938  47.503 41.096  1.00 37.60  ? 717  LEU A O   1 
ATOM 5583 C CB  . LEU A 1 720  ? -3.006  46.336 38.341  1.00 34.48  ? 717  LEU A CB  1 
ATOM 5584 C CG  . LEU A 1 720  ? -3.606  45.801 37.050  1.00 34.48  ? 717  LEU A CG  1 
ATOM 5585 C CD1 . LEU A 1 720  ? -2.681  44.746 36.443  1.00 34.48  ? 717  LEU A CD1 1 
ATOM 5586 C CD2 . LEU A 1 720  ? -4.957  45.213 37.378  1.00 34.48  ? 717  LEU A CD2 1 
ATOM 5587 N N   . TYR A 1 721  ? -2.277  48.879 40.470  1.00 38.49  ? 718  TYR A N   1 
ATOM 5588 C CA  . TYR A 1 721  ? -1.965  49.311 41.839  1.00 38.49  ? 718  TYR A CA  1 
ATOM 5589 C C   . TYR A 1 721  ? -1.350  48.186 42.670  1.00 38.49  ? 718  TYR A C   1 
ATOM 5590 O O   . TYR A 1 721  ? -1.043  48.354 43.858  1.00 38.49  ? 718  TYR A O   1 
ATOM 5591 C CB  . TYR A 1 721  ? -3.186  49.981 42.551  1.00 28.07  ? 718  TYR A CB  1 
ATOM 5592 C CG  . TYR A 1 721  ? -3.654  51.156 41.767  1.00 28.07  ? 718  TYR A CG  1 
ATOM 5593 C CD1 . TYR A 1 721  ? -4.808  51.104 41.023  1.00 28.07  ? 718  TYR A CD1 1 
ATOM 5594 C CD2 . TYR A 1 721  ? -2.867  52.269 41.681  1.00 28.07  ? 718  TYR A CD2 1 
ATOM 5595 C CE1 . TYR A 1 721  ? -5.169  52.113 40.265  1.00 28.07  ? 718  TYR A CE1 1 
ATOM 5596 C CE2 . TYR A 1 721  ? -3.213  53.291 40.934  1.00 28.07  ? 718  TYR A CE2 1 
ATOM 5597 C CZ  . TYR A 1 721  ? -4.373  53.217 40.225  1.00 28.07  ? 718  TYR A CZ  1 
ATOM 5598 O OH  . TYR A 1 721  ? -4.717  54.330 39.474  1.00 28.07  ? 718  TYR A OH  1 
ATOM 5599 N N   . GLU A 1 722  ? -1.162  47.036 42.059  1.00 79.50  ? 719  GLU A N   1 
ATOM 5600 C CA  . GLU A 1 722  ? -0.357  46.014 42.668  1.00 79.50  ? 719  GLU A CA  1 
ATOM 5601 C C   . GLU A 1 722  ? 0.416   45.497 41.456  1.00 79.50  ? 719  GLU A C   1 
ATOM 5602 O O   . GLU A 1 722  ? 0.341   46.094 40.392  1.00 79.50  ? 719  GLU A O   1 
ATOM 5603 C CB  . GLU A 1 722  ? -1.257  44.995 43.366  1.00 42.23  ? 719  GLU A CB  1 
ATOM 5604 C CG  . GLU A 1 722  ? -2.441  44.705 42.512  1.00 42.23  ? 719  GLU A CG  1 
ATOM 5605 C CD  . GLU A 1 722  ? -3.441  43.709 43.093  1.00 42.23  ? 719  GLU A CD  1 
ATOM 5606 O OE1 . GLU A 1 722  ? -3.517  42.573 42.520  1.00 42.23  ? 719  GLU A OE1 1 
ATOM 5607 O OE2 . GLU A 1 722  ? -4.189  44.075 44.074  1.00 42.23  ? 719  GLU A OE2 1 
ATOM 5608 N N   . SER A 1 723  ? 1.161   44.416 41.606  1.00 27.23  ? 720  SER A N   1 
ATOM 5609 C CA  . SER A 1 723  ? 2.104   44.008 40.615  1.00 27.23  ? 720  SER A CA  1 
ATOM 5610 C C   . SER A 1 723  ? 1.656   42.754 39.911  1.00 27.23  ? 720  SER A C   1 
ATOM 5611 O O   . SER A 1 723  ? 1.654   41.719 40.520  1.00 27.23  ? 720  SER A O   1 
ATOM 5612 C CB  . SER A 1 723  ? 3.402   43.760 41.339  1.00 38.25  ? 720  SER A CB  1 
ATOM 5613 O OG  . SER A 1 723  ? 3.078   43.148 42.567  1.00 38.25  ? 720  SER A OG  1 
ATOM 5614 N N   . PRO A 1 724  ? 1.318   42.828 38.621  1.00 21.66  ? 721  PRO A N   1 
ATOM 5615 C CA  . PRO A 1 724  ? 0.818   41.673 37.909  1.00 21.66  ? 721  PRO A CA  1 
ATOM 5616 C C   . PRO A 1 724  ? 1.937   40.670 37.701  1.00 21.66  ? 721  PRO A C   1 
ATOM 5617 O O   . PRO A 1 724  ? 3.121   41.048 37.654  1.00 21.66  ? 721  PRO A O   1 
ATOM 5618 C CB  . PRO A 1 724  ? 0.464   42.235 36.541  1.00 25.39  ? 721  PRO A CB  1 
ATOM 5619 C CG  . PRO A 1 724  ? 1.260   43.434 36.390  1.00 25.39  ? 721  PRO A CG  1 
ATOM 5620 C CD  . PRO A 1 724  ? 1.467   43.990 37.740  1.00 25.39  ? 721  PRO A CD  1 
ATOM 5621 N N   . ARG A 1 725  ? 1.610   39.402 37.544  1.00 45.79  ? 722  ARG A N   1 
ATOM 5622 C CA  . ARG A 1 725  ? 2.666   38.412 37.444  1.00 45.79  ? 722  ARG A CA  1 
ATOM 5623 C C   . ARG A 1 725  ? 2.451   37.525 36.218  1.00 45.79  ? 722  ARG A C   1 
ATOM 5624 O O   . ARG A 1 725  ? 3.365   37.343 35.438  1.00 45.79  ? 722  ARG A O   1 
ATOM 5625 C CB  . ARG A 1 725  ? 2.816   37.610 38.758  1.00 30.18  ? 722  ARG A CB  1 
ATOM 5626 C CG  . ARG A 1 725  ? 3.274   38.396 40.013  1.00 30.18  ? 722  ARG A CG  1 
ATOM 5627 C CD  . ARG A 1 725  ? 4.826   38.303 40.329  1.00 30.18  ? 722  ARG A CD  1 
ATOM 5628 N NE  . ARG A 1 725  ? 5.256   39.207 41.442  1.00 30.18  ? 722  ARG A NE  1 
ATOM 5629 C CZ  . ARG A 1 725  ? 5.281   38.880 42.759  1.00 30.18  ? 722  ARG A CZ  1 
ATOM 5630 N NH1 . ARG A 1 725  ? 4.940   37.664 43.217  1.00 30.18  ? 722  ARG A NH1 1 
ATOM 5631 N NH2 . ARG A 1 725  ? 5.675   39.786 43.646  1.00 30.18  ? 722  ARG A NH2 1 
ATOM 5632 N N   . LYS A 1 726  ? 1.250   37.000 36.012  1.00 29.35  ? 723  LYS A N   1 
ATOM 5633 C CA  . LYS A 1 726  ? 0.978   36.174 34.799  1.00 29.35  ? 723  LYS A CA  1 
ATOM 5634 C C   . LYS A 1 726  ? -0.239  36.577 33.984  1.00 29.35  ? 723  LYS A C   1 
ATOM 5635 O O   . LYS A 1 726  ? -1.082  37.306 34.471  1.00 29.35  ? 723  LYS A O   1 
ATOM 5636 C CB  . LYS A 1 726  ? 0.866   34.699 35.161  1.00 39.20  ? 723  LYS A CB  1 
ATOM 5637 C CG  . LYS A 1 726  ? 2.150   34.193 35.722  1.00 39.20  ? 723  LYS A CG  1 
ATOM 5638 C CD  . LYS A 1 726  ? 3.314   34.454 34.788  1.00 39.20  ? 723  LYS A CD  1 
ATOM 5639 C CE  . LYS A 1 726  ? 3.801   33.183 34.229  1.00 39.20  ? 723  LYS A CE  1 
ATOM 5640 N NZ  . LYS A 1 726  ? 4.926   32.700 35.077  1.00 39.20  ? 723  LYS A NZ  1 
ATOM 5641 N N   . ILE A 1 727  ? -0.367  36.109 32.754  1.00 28.03  ? 724  ILE A N   1 
ATOM 5642 C CA  . ILE A 1 727  ? -1.544  36.500 32.027  1.00 28.03  ? 724  ILE A CA  1 
ATOM 5643 C C   . ILE A 1 727  ? -2.024  35.493 30.999  1.00 28.03  ? 724  ILE A C   1 
ATOM 5644 O O   . ILE A 1 727  ? -1.274  35.125 30.127  1.00 28.03  ? 724  ILE A O   1 
ATOM 5645 C CB  . ILE A 1 727  ? -1.418  37.919 31.474  1.00 24.47  ? 724  ILE A CB  1 
ATOM 5646 C CG1 . ILE A 1 727  ? -2.781  38.397 31.032  1.00 24.47  ? 724  ILE A CG1 1 
ATOM 5647 C CG2 . ILE A 1 727  ? -0.455  37.991 30.330  1.00 24.47  ? 724  ILE A CG2 1 
ATOM 5648 C CD1 . ILE A 1 727  ? -2.941  39.902 31.140  1.00 24.47  ? 724  ILE A CD1 1 
ATOM 5649 N N   . CYS A 1 728  ? -3.287  35.059 31.146  1.00 42.38  ? 725  CYS A N   1 
ATOM 5650 C CA  . CYS A 1 728  ? -4.030  34.191 30.204  1.00 42.38  ? 725  CYS A CA  1 
ATOM 5651 C C   . CYS A 1 728  ? -5.282  34.798 29.605  1.00 42.38  ? 725  CYS A C   1 
ATOM 5652 O O   . CYS A 1 728  ? -6.037  35.508 30.296  1.00 42.38  ? 725  CYS A O   1 
ATOM 5653 C CB  . CYS A 1 728  ? -4.480  32.981 30.927  1.00 72.34  ? 725  CYS A CB  1 
ATOM 5654 S SG  . CYS A 1 728  ? -3.124  32.054 30.914  1.00 72.34  ? 725  CYS A SG  1 
ATOM 5655 N N   . TYR A 1 729  ? -5.511  34.491 28.331  1.00 59.69  ? 726  TYR A N   1 
ATOM 5656 C CA  . TYR A 1 729  ? -6.733  34.890 27.674  1.00 59.69  ? 726  TYR A CA  1 
ATOM 5657 C C   . TYR A 1 729  ? -7.625  33.648 27.525  1.00 59.69  ? 726  TYR A C   1 
ATOM 5658 O O   . TYR A 1 729  ? -7.366  32.799 26.677  1.00 59.69  ? 726  TYR A O   1 
ATOM 5659 C CB  . TYR A 1 729  ? -6.445  35.611 26.327  1.00 49.75  ? 726  TYR A CB  1 
ATOM 5660 C CG  . TYR A 1 729  ? -7.691  35.983 25.542  1.00 49.75  ? 726  TYR A CG  1 
ATOM 5661 C CD1 . TYR A 1 729  ? -8.628  36.870 26.071  1.00 49.75  ? 726  TYR A CD1 1 
ATOM 5662 C CD2 . TYR A 1 729  ? -7.962  35.424 24.293  1.00 49.75  ? 726  TYR A CD2 1 
ATOM 5663 C CE1 . TYR A 1 729  ? -9.808  37.211 25.378  1.00 49.75  ? 726  TYR A CE1 1 
ATOM 5664 C CE2 . TYR A 1 729  ? -9.135  35.755 23.586  1.00 49.75  ? 726  TYR A CE2 1 
ATOM 5665 C CZ  . TYR A 1 729  ? -10.067 36.654 24.141  1.00 49.75  ? 726  TYR A CZ  1 
ATOM 5666 O OH  . TYR A 1 729  ? -11.243 37.019 23.491  1.00 49.75  ? 726  TYR A OH  1 
ATOM 5667 N N   . GLN A 1 730  ? -8.648  33.524 28.377  1.00 37.98  ? 727  GLN A N   1 
ATOM 5668 C CA  . GLN A 1 730  ? -9.694  32.483 28.225  1.00 37.98  ? 727  GLN A CA  1 
ATOM 5669 C C   . GLN A 1 730  ? -10.848 33.060 27.393  1.00 37.98  ? 727  GLN A C   1 
ATOM 5670 O O   . GLN A 1 730  ? -11.617 33.946 27.853  1.00 37.98  ? 727  GLN A O   1 
ATOM 5671 C CB  . GLN A 1 730  ? -10.187 32.048 29.585  1.00 54.71  ? 727  GLN A CB  1 
ATOM 5672 C CG  . GLN A 1 730  ? -11.187 30.923 29.628  1.00 54.71  ? 727  GLN A CG  1 
ATOM 5673 C CD  . GLN A 1 730  ? -11.360 30.422 31.072  1.00 54.71  ? 727  GLN A CD  1 
ATOM 5674 O OE1 . GLN A 1 730  ? -10.453 29.773 31.629  1.00 54.71  ? 727  GLN A OE1 1 
ATOM 5675 N NE2 . GLN A 1 730  ? -12.503 30.758 31.700  1.00 54.71  ? 727  GLN A NE2 1 
ATOM 5676 N N   . GLU A 1 731  ? -10.954 32.578 26.161  1.00 63.82  ? 728  GLU A N   1 
ATOM 5677 C CA  . GLU A 1 731  ? -11.699 33.299 25.146  1.00 63.82  ? 728  GLU A CA  1 
ATOM 5678 C C   . GLU A 1 731  ? -13.194 33.198 25.355  1.00 63.82  ? 728  GLU A C   1 
ATOM 5679 O O   . GLU A 1 731  ? -13.851 34.197 25.649  1.00 63.82  ? 728  GLU A O   1 
ATOM 5680 C CB  . GLU A 1 731  ? -11.325 32.807 23.770  1.00 95.00  ? 728  GLU A CB  1 
ATOM 5681 C CG  . GLU A 1 731  ? -11.927 33.639 22.696  1.00 95.00  ? 728  GLU A CG  1 
ATOM 5682 C CD  . GLU A 1 731  ? -12.709 32.788 21.776  1.00 95.00  ? 728  GLU A CD  1 
ATOM 5683 O OE1 . GLU A 1 731  ? -13.080 33.291 20.698  1.00 95.00  ? 728  GLU A OE1 1 
ATOM 5684 O OE2 . GLU A 1 731  ? -12.948 31.607 22.138  1.00 95.00  ? 728  GLU A OE2 1 
ATOM 5685 N N   . VAL A 1 732  ? -13.727 31.993 25.205  1.00 61.24  ? 729  VAL A N   1 
ATOM 5686 C CA  . VAL A 1 732  ? -15.109 31.702 25.590  1.00 61.24  ? 729  VAL A CA  1 
ATOM 5687 C C   . VAL A 1 732  ? -15.668 32.546 26.757  1.00 61.24  ? 729  VAL A C   1 
ATOM 5688 O O   . VAL A 1 732  ? -16.853 32.899 26.737  1.00 61.24  ? 729  VAL A O   1 
ATOM 5689 C CB  . VAL A 1 732  ? -15.279 30.219 25.919  1.00 49.60  ? 729  VAL A CB  1 
ATOM 5690 C CG1 . VAL A 1 732  ? -14.193 29.428 25.194  1.00 49.60  ? 729  VAL A CG1 1 
ATOM 5691 C CG2 . VAL A 1 732  ? -15.189 29.991 27.427  1.00 49.60  ? 729  VAL A CG2 1 
ATOM 5692 N N   . SER A 1 733  ? -14.851 32.879 27.758  1.00 47.77  ? 730  SER A N   1 
ATOM 5693 C CA  . SER A 1 733  ? -15.330 33.748 28.833  1.00 47.77  ? 730  SER A CA  1 
ATOM 5694 C C   . SER A 1 733  ? -15.015 35.222 28.597  1.00 47.77  ? 730  SER A C   1 
ATOM 5695 O O   . SER A 1 733  ? -15.217 36.063 29.493  1.00 47.77  ? 730  SER A O   1 
ATOM 5696 C CB  . SER A 1 733  ? -14.741 33.320 30.150  1.00 58.85  ? 730  SER A CB  1 
ATOM 5697 O OG  . SER A 1 733  ? -14.339 31.990 30.034  1.00 58.85  ? 730  SER A OG  1 
ATOM 5698 N N   . GLN A 1 734  ? -14.507 35.535 27.406  1.00 61.33  ? 731  GLN A N   1 
ATOM 5699 C CA  . GLN A 1 734  ? -14.197 36.909 27.032  1.00 61.33  ? 731  GLN A CA  1 
ATOM 5700 C C   . GLN A 1 734  ? -13.448 37.671 28.142  1.00 61.33  ? 731  GLN A C   1 
ATOM 5701 O O   . GLN A 1 734  ? -13.700 38.844 28.431  1.00 61.33  ? 731  GLN A O   1 
ATOM 5702 C CB  . GLN A 1 734  ? -15.476 37.632 26.615  1.00 62.16  ? 731  GLN A CB  1 
ATOM 5703 C CG  . GLN A 1 734  ? -16.189 36.981 25.476  1.00 62.16  ? 731  GLN A CG  1 
ATOM 5704 C CD  . GLN A 1 734  ? -15.520 37.254 24.147  1.00 62.16  ? 731  GLN A CD  1 
ATOM 5705 O OE1 . GLN A 1 734  ? -15.691 38.325 23.546  1.00 62.16  ? 731  GLN A OE1 1 
ATOM 5706 N NE2 . GLN A 1 734  ? -14.760 36.278 23.667  1.00 62.16  ? 731  GLN A NE2 1 
ATOM 5707 N N   . CYS A 1 735  ? -12.506 36.999 28.769  1.00 45.07  ? 732  CYS A N   1 
ATOM 5708 C CA  . CYS A 1 735  ? -11.750 37.670 29.811  1.00 45.07  ? 732  CYS A CA  1 
ATOM 5709 C C   . CYS A 1 735  ? -10.297 37.196 29.949  1.00 45.07  ? 732  CYS A C   1 
ATOM 5710 O O   . CYS A 1 735  ? -9.797  36.311 29.225  1.00 45.07  ? 732  CYS A O   1 
ATOM 5711 C CB  . CYS A 1 735  ? -12.462 37.507 31.137  1.00 76.88  ? 732  CYS A CB  1 
ATOM 5712 S SG  . CYS A 1 735  ? -12.635 35.796 31.540  1.00 76.88  ? 732  CYS A SG  1 
ATOM 5713 N N   . PHE A 1 736  ? -9.639  37.797 30.915  1.00 49.43  ? 733  PHE A N   1 
ATOM 5714 C CA  . PHE A 1 736  ? -8.256  37.520 31.122  1.00 49.43  ? 733  PHE A CA  1 
ATOM 5715 C C   . PHE A 1 736  ? -8.056  36.957 32.519  1.00 49.43  ? 733  PHE A C   1 
ATOM 5716 O O   . PHE A 1 736  ? -8.742  37.346 33.455  1.00 49.43  ? 733  PHE A O   1 
ATOM 5717 C CB  . PHE A 1 736  ? -7.436  38.812 30.939  1.00 37.20  ? 733  PHE A CB  1 
ATOM 5718 C CG  . PHE A 1 736  ? -7.169  39.185 29.493  1.00 37.20  ? 733  PHE A CG  1 
ATOM 5719 C CD1 . PHE A 1 736  ? -7.558  40.428 28.993  1.00 37.20  ? 733  PHE A CD1 1 
ATOM 5720 C CD2 . PHE A 1 736  ? -6.501  38.325 28.641  1.00 37.20  ? 733  PHE A CD2 1 
ATOM 5721 C CE1 . PHE A 1 736  ? -7.292  40.786 27.643  1.00 37.20  ? 733  PHE A CE1 1 
ATOM 5722 C CE2 . PHE A 1 736  ? -6.250  38.685 27.303  1.00 37.20  ? 733  PHE A CE2 1 
ATOM 5723 C CZ  . PHE A 1 736  ? -6.646  39.908 26.818  1.00 37.20  ? 733  PHE A CZ  1 
ATOM 5724 N N   . GLY A 1 737  ? -7.123  36.039 32.670  1.00 35.24  ? 734  GLY A N   1 
ATOM 5725 C CA  . GLY A 1 737  ? -6.690  35.724 34.014  1.00 35.24  ? 734  GLY A CA  1 
ATOM 5726 C C   . GLY A 1 737  ? -5.373  36.389 34.364  1.00 35.24  ? 734  GLY A C   1 
ATOM 5727 O O   . GLY A 1 737  ? -4.418  36.414 33.590  1.00 35.24  ? 734  GLY A O   1 
ATOM 5728 N N   . VAL A 1 738  ? -5.280  36.921 35.552  1.00 29.87  ? 735  VAL A N   1 
ATOM 5729 C CA  . VAL A 1 738  ? -4.066  37.603 35.848  1.00 29.87  ? 735  VAL A CA  1 
ATOM 5730 C C   . VAL A 1 738  ? -3.594  37.323 37.266  1.00 29.87  ? 735  VAL A C   1 
ATOM 5731 O O   . VAL A 1 738  ? -4.296  37.604 38.233  1.00 29.87  ? 735  VAL A O   1 
ATOM 5732 C CB  . VAL A 1 738  ? -4.254  39.055 35.505  1.00 22.77  ? 735  VAL A CB  1 
ATOM 5733 C CG1 . VAL A 1 738  ? -3.263  39.971 36.219  1.00 22.77  ? 735  VAL A CG1 1 
ATOM 5734 C CG2 . VAL A 1 738  ? -4.109  39.163 34.025  1.00 22.77  ? 735  VAL A CG2 1 
ATOM 5735 N N   . LEU A 1 739  ? -2.427  36.716 37.401  1.00 33.00  ? 736  LEU A N   1 
ATOM 5736 C CA  . LEU A 1 739  ? -1.962  36.472 38.713  1.00 33.00  ? 736  LEU A CA  1 
ATOM 5737 C C   . LEU A 1 739  ? -1.444  37.800 39.165  1.00 33.00  ? 736  LEU A C   1 
ATOM 5738 O O   . LEU A 1 739  ? -1.048  38.597 38.348  1.00 33.00  ? 736  LEU A O   1 
ATOM 5739 C CB  . LEU A 1 739  ? -0.924  35.386 38.685  1.00 46.33  ? 736  LEU A CB  1 
ATOM 5740 C CG  . LEU A 1 739  ? -1.593  34.070 38.291  1.00 46.33  ? 736  LEU A CG  1 
ATOM 5741 C CD1 . LEU A 1 739  ? -0.597  32.942 38.301  1.00 46.33  ? 736  LEU A CD1 1 
ATOM 5742 C CD2 . LEU A 1 739  ? -2.727  33.786 39.219  1.00 46.33  ? 736  LEU A CD2 1 
ATOM 5743 N N   . SER A 1 740  ? -1.510  38.085 40.450  1.00 32.22  ? 737  SER A N   1 
ATOM 5744 C CA  . SER A 1 740  ? -1.239  39.429 40.937  1.00 32.22  ? 737  SER A CA  1 
ATOM 5745 C C   . SER A 1 740  ? -0.805  39.321 42.370  1.00 32.22  ? 737  SER A C   1 
ATOM 5746 O O   . SER A 1 740  ? -1.043  38.335 43.030  1.00 32.22  ? 737  SER A O   1 
ATOM 5747 C CB  . SER A 1 740  ? -2.496  40.301 40.839  1.00 67.83  ? 737  SER A CB  1 
ATOM 5748 O OG  . SER A 1 740  ? -3.385  40.124 41.931  1.00 67.83  ? 737  SER A OG  1 
ATOM 5749 N N   . SER A 1 741  ? -0.155  40.331 42.870  1.00 32.05  ? 738  SER A N   1 
ATOM 5750 C CA  . SER A 1 741  ? 0.545   40.136 44.103  1.00 32.05  ? 738  SER A CA  1 
ATOM 5751 C C   . SER A 1 741  ? 0.489   41.468 44.781  1.00 32.05  ? 738  SER A C   1 
ATOM 5752 O O   . SER A 1 741  ? 0.810   42.510 44.172  1.00 32.05  ? 738  SER A O   1 
ATOM 5753 C CB  . SER A 1 741  ? 2.000   39.755 43.827  1.00 44.21  ? 738  SER A CB  1 
ATOM 5754 O OG  . SER A 1 741  ? 2.829   40.077 44.937  1.00 44.21  ? 738  SER A OG  1 
ATOM 5755 N N   . ARG A 1 742  ? 0.074   41.481 46.031  1.00 26.72  ? 739  ARG A N   1 
ATOM 5756 C CA  . ARG A 1 742  ? -0.018  42.758 46.651  1.00 26.72  ? 739  ARG A CA  1 
ATOM 5757 C C   . ARG A 1 742  ? 0.714   42.625 47.959  1.00 26.72  ? 739  ARG A C   1 
ATOM 5758 O O   . ARG A 1 742  ? 0.824   41.525 48.472  1.00 26.72  ? 739  ARG A O   1 
ATOM 5759 C CB  . ARG A 1 742  ? -1.482  43.223 46.749  1.00 53.95  ? 739  ARG A CB  1 
ATOM 5760 C CG  . ARG A 1 742  ? -2.316  42.549 47.794  1.00 53.95  ? 739  ARG A CG  1 
ATOM 5761 C CD  . ARG A 1 742  ? -3.582  43.348 48.034  1.00 53.95  ? 739  ARG A CD  1 
ATOM 5762 N NE  . ARG A 1 742  ? -4.327  42.833 49.181  1.00 53.95  ? 739  ARG A NE  1 
ATOM 5763 C CZ  . ARG A 1 742  ? -5.036  41.701 49.173  1.00 53.95  ? 739  ARG A CZ  1 
ATOM 5764 N NH1 . ARG A 1 742  ? -5.110  40.963 48.066  1.00 53.95  ? 739  ARG A NH1 1 
ATOM 5765 N NH2 . ARG A 1 742  ? -5.669  41.299 50.276  1.00 53.95  ? 739  ARG A NH2 1 
ATOM 5766 N N   . ILE A 1 743  ? 1.257   43.723 48.452  1.00 47.65  ? 740  ILE A N   1 
ATOM 5767 C CA  . ILE A 1 743  ? 1.933   43.704 49.714  1.00 47.65  ? 740  ILE A CA  1 
ATOM 5768 C C   . ILE A 1 743  ? 1.037   44.221 50.861  1.00 47.65  ? 740  ILE A C   1 
ATOM 5769 O O   . ILE A 1 743  ? 0.111   45.040 50.661  1.00 47.65  ? 740  ILE A O   1 
ATOM 5770 C CB  . ILE A 1 743  ? 3.247   44.465 49.655  1.00 37.59  ? 740  ILE A CB  1 
ATOM 5771 C CG1 . ILE A 1 743  ? 4.241   43.743 48.737  1.00 37.59  ? 740  ILE A CG1 1 
ATOM 5772 C CG2 . ILE A 1 743  ? 3.808   44.575 51.029  1.00 37.59  ? 740  ILE A CG2 1 
ATOM 5773 C CD1 . ILE A 1 743  ? 5.440   44.548 48.375  1.00 37.59  ? 740  ILE A CD1 1 
ATOM 5774 N N   . GLU A 1 744  ? 1.302   43.685 52.058  1.00 58.52  ? 741  GLU A N   1 
ATOM 5775 C CA  . GLU A 1 744  ? 0.596   44.043 53.286  1.00 58.52  ? 741  GLU A CA  1 
ATOM 5776 C C   . GLU A 1 744  ? 1.630   44.138 54.374  1.00 58.52  ? 741  GLU A C   1 
ATOM 5777 O O   . GLU A 1 744  ? 2.719   43.578 54.237  1.00 58.52  ? 741  GLU A O   1 
ATOM 5778 C CB  . GLU A 1 744  ? -0.476  43.011 53.623  1.00 61.38  ? 741  GLU A CB  1 
ATOM 5779 C CG  . GLU A 1 744  ? -1.826  43.396 53.019  1.00 61.38  ? 741  GLU A CG  1 
ATOM 5780 C CD  . GLU A 1 744  ? -2.862  42.267 52.948  1.00 61.38  ? 741  GLU A CD  1 
ATOM 5781 O OE1 . GLU A 1 744  ? -2.789  41.277 53.722  1.00 61.38  ? 741  GLU A OE1 1 
ATOM 5782 O OE2 . GLU A 1 744  ? -3.778  42.391 52.103  1.00 61.38  ? 741  GLU A OE2 1 
ATOM 5783 N N   . VAL A 1 745  ? 1.314   44.876 55.435  1.00 62.24  ? 742  VAL A N   1 
ATOM 5784 C CA  . VAL A 1 745  ? 2.212   44.975 56.589  1.00 62.24  ? 742  VAL A CA  1 
ATOM 5785 C C   . VAL A 1 745  ? 1.545   44.310 57.787  1.00 62.24  ? 742  VAL A C   1 
ATOM 5786 O O   . VAL A 1 745  ? 0.304   44.237 57.838  1.00 62.24  ? 742  VAL A O   1 
ATOM 5787 C CB  . VAL A 1 745  ? 2.563   46.448 56.919  1.00 64.18  ? 742  VAL A CB  1 
ATOM 5788 C CG1 . VAL A 1 745  ? 3.444   47.056 55.826  1.00 64.18  ? 742  VAL A CG1 1 
ATOM 5789 C CG2 . VAL A 1 745  ? 1.281   47.270 57.136  1.00 64.18  ? 742  VAL A CG2 1 
ATOM 5790 N N   . GLN A 1 746  ? 2.375   43.816 58.714  1.00 99.34  ? 743  GLN A N   1 
ATOM 5791 C CA  . GLN A 1 746  ? 1.947   43.247 60.014  1.00 99.34  ? 743  GLN A CA  1 
ATOM 5792 C C   . GLN A 1 746  ? 1.107   44.252 60.814  1.00 99.34  ? 743  GLN A C   1 
ATOM 5793 O O   . GLN A 1 746  ? 1.387   45.456 60.791  1.00 99.34  ? 743  GLN A O   1 
ATOM 5794 C CB  . GLN A 1 746  ? 3.176   42.851 60.862  1.00 88.38  ? 743  GLN A CB  1 
ATOM 5795 C CG  . GLN A 1 746  ? 3.860   44.047 61.587  1.00 88.38  ? 743  GLN A CG  1 
ATOM 5796 C CD  . GLN A 1 746  ? 5.003   43.642 62.490  1.00 88.38  ? 743  GLN A CD  1 
ATOM 5797 O OE1 . GLN A 1 746  ? 6.164   43.876 62.174  1.00 88.38  ? 743  GLN A OE1 1 
ATOM 5798 N NE2 . GLN A 1 746  ? 4.677   43.033 63.627  1.00 88.38  ? 743  GLN A NE2 1 
ATOM 5799 N N   . ASP A 1 747  ? 0.105   43.763 61.539  1.00 144.09 ? 744  ASP A N   1 
ATOM 5800 C CA  . ASP A 1 747  ? -0.763  44.659 62.295  1.00 144.09 ? 744  ASP A CA  1 
ATOM 5801 C C   . ASP A 1 747  ? -0.283  44.830 63.737  1.00 144.09 ? 744  ASP A C   1 
ATOM 5802 O O   . ASP A 1 747  ? 0.889   44.570 64.048  1.00 144.09 ? 744  ASP A O   1 
ATOM 5803 C CB  . ASP A 1 747  ? -2.221  44.185 62.243  1.00 103.78 ? 744  ASP A CB  1 
ATOM 5804 C CG  . ASP A 1 747  ? -3.156  45.248 61.675  1.00 103.78 ? 744  ASP A CG  1 
ATOM 5805 O OD1 . ASP A 1 747  ? -2.644  46.252 61.131  1.00 103.78 ? 744  ASP A OD1 1 
ATOM 5806 O OD2 . ASP A 1 747  ? -4.396  45.083 61.755  1.00 103.78 ? 744  ASP A OD2 1 
ATOM 5807 N N   . THR A 1 748  ? -1.184  45.307 64.596  1.00 95.93  ? 745  THR A N   1 
ATOM 5808 C CA  . THR A 1 748  ? -0.976  45.299 66.048  1.00 95.93  ? 745  THR A CA  1 
ATOM 5809 C C   . THR A 1 748  ? -1.846  44.179 66.631  1.00 95.93  ? 745  THR A C   1 
ATOM 5810 O O   . THR A 1 748  ? -1.556  43.637 67.705  1.00 95.93  ? 745  THR A O   1 
ATOM 5811 C CB  . THR A 1 748  ? -1.307  46.658 66.692  1.00 83.96  ? 745  THR A CB  1 
ATOM 5812 O OG1 . THR A 1 748  ? -2.584  47.103 66.212  1.00 83.96  ? 745  THR A OG1 1 
ATOM 5813 C CG2 . THR A 1 748  ? -0.219  47.708 66.361  1.00 83.96  ? 745  THR A CG2 1 
ATOM 5814 N N   . SER A 1 749  ? -2.907  43.831 65.902  1.00 92.60  ? 746  SER A N   1 
ATOM 5815 C CA  . SER A 1 749  ? -3.509  42.499 66.038  1.00 92.60  ? 746  SER A CA  1 
ATOM 5816 C C   . SER A 1 749  ? -2.705  41.497 65.177  1.00 92.60  ? 746  SER A C   1 
ATOM 5817 O O   . SER A 1 749  ? -3.174  40.387 64.875  1.00 92.60  ? 746  SER A O   1 
ATOM 5818 C CB  . SER A 1 749  ? -4.995  42.502 65.656  1.00 133.48 ? 746  SER A CB  1 
ATOM 5819 O OG  . SER A 1 749  ? -5.175  42.161 64.290  1.00 133.48 ? 746  SER A OG  1 
ATOM 5820 N N   . GLY A 1 750  ? -1.501  41.922 64.780  1.00 90.06  ? 747  GLY A N   1 
ATOM 5821 C CA  . GLY A 1 750  ? -0.489  41.056 64.186  1.00 90.06  ? 747  GLY A CA  1 
ATOM 5822 C C   . GLY A 1 750  ? -0.758  40.626 62.757  1.00 90.06  ? 747  GLY A C   1 
ATOM 5823 O O   . GLY A 1 750  ? 0.190   40.440 61.980  1.00 90.06  ? 747  GLY A O   1 
ATOM 5824 N N   . GLY A 1 751  ? -2.042  40.463 62.416  1.00 122.80 ? 748  GLY A N   1 
ATOM 5825 C CA  . GLY A 1 751  ? -2.481  40.069 61.069  1.00 122.80 ? 748  GLY A CA  1 
ATOM 5826 C C   . GLY A 1 751  ? -2.041  41.061 60.006  1.00 122.80 ? 748  GLY A C   1 
ATOM 5827 O O   . GLY A 1 751  ? -1.167  41.901 60.252  1.00 122.80 ? 748  GLY A O   1 
ATOM 5828 N N   . THR A 1 752  ? -2.621  40.975 58.811  1.00 76.46  ? 749  THR A N   1 
ATOM 5829 C CA  . THR A 1 752  ? -2.218  41.922 57.754  1.00 76.46  ? 749  THR A CA  1 
ATOM 5830 C C   . THR A 1 752  ? -3.321  42.754 57.115  1.00 76.46  ? 749  THR A C   1 
ATOM 5831 O O   . THR A 1 752  ? -4.447  42.292 56.891  1.00 76.46  ? 749  THR A O   1 
ATOM 5832 C CB  . THR A 1 752  ? -1.272  41.315 56.659  1.00 46.38  ? 749  THR A CB  1 
ATOM 5833 O OG1 . THR A 1 752  ? -1.785  40.052 56.161  1.00 46.38  ? 749  THR A OG1 1 
ATOM 5834 C CG2 . THR A 1 752  ? 0.229   41.238 57.170  1.00 46.38  ? 749  THR A CG2 1 
ATOM 5835 N N   . THR A 1 753  ? -2.939  43.979 56.797  1.00 117.10 ? 750  THR A N   1 
ATOM 5836 C CA  . THR A 1 753  ? -3.869  44.997 56.410  1.00 117.10 ? 750  THR A CA  1 
ATOM 5837 C C   . THR A 1 753  ? -3.766  45.321 54.926  1.00 117.10 ? 750  THR A C   1 
ATOM 5838 O O   . THR A 1 753  ? -4.618  44.887 54.162  1.00 117.10 ? 750  THR A O   1 
ATOM 5839 C CB  . THR A 1 753  ? -3.666  46.226 57.281  1.00 109.88 ? 750  THR A CB  1 
ATOM 5840 O OG1 . THR A 1 753  ? -2.320  46.219 57.768  1.00 109.88 ? 750  THR A OG1 1 
ATOM 5841 C CG2 . THR A 1 753  ? -4.602  46.168 58.471  1.00 109.88 ? 750  THR A CG2 1 
ATOM 5842 N N   . ALA A 1 754  ? -2.714  46.034 54.514  1.00 89.64  ? 751  ALA A N   1 
ATOM 5843 C CA  . ALA A 1 754  ? -2.606  46.614 53.160  1.00 89.64  ? 751  ALA A CA  1 
ATOM 5844 C C   . ALA A 1 754  ? -2.205  48.089 53.237  1.00 89.64  ? 751  ALA A C   1 
ATOM 5845 O O   . ALA A 1 754  ? -2.495  48.763 54.234  1.00 89.64  ? 751  ALA A O   1 
ATOM 5846 C CB  . ALA A 1 754  ? -3.922  46.488 52.404  1.00 46.51  ? 751  ALA A CB  1 
ATOM 5847 N N   . LEU A 1 755  ? -1.575  48.605 52.178  1.00 51.93  ? 752  LEU A N   1 
ATOM 5848 C CA  . LEU A 1 755  ? -1.021  49.967 52.220  1.00 51.93  ? 752  LEU A CA  1 
ATOM 5849 C C   . LEU A 1 755  ? -1.801  50.996 51.377  1.00 51.93  ? 752  LEU A C   1 
ATOM 5850 O O   . LEU A 1 755  ? -1.636  52.210 51.552  1.00 51.93  ? 752  LEU A O   1 
ATOM 5851 C CB  . LEU A 1 755  ? 0.485   49.921 51.892  1.00 69.16  ? 752  LEU A CB  1 
ATOM 5852 C CG  . LEU A 1 755  ? 1.316   48.850 52.658  1.00 69.16  ? 752  LEU A CG  1 
ATOM 5853 C CD1 . LEU A 1 755  ? 2.850   48.923 52.417  1.00 69.16  ? 752  LEU A CD1 1 
ATOM 5854 C CD2 . LEU A 1 755  ? 1.019   48.855 54.178  1.00 69.16  ? 752  LEU A CD2 1 
ATOM 5855 N N   . ARG A 1 756  ? -2.693  50.476 50.527  1.00 38.65  ? 753  ARG A N   1 
ATOM 5856 C CA  . ARG A 1 756  ? -3.474  51.206 49.520  1.00 38.65  ? 753  ARG A CA  1 
ATOM 5857 C C   . ARG A 1 756  ? -4.512  50.244 48.870  1.00 38.65  ? 753  ARG A C   1 
ATOM 5858 O O   . ARG A 1 756  ? -4.241  49.049 48.692  1.00 38.65  ? 753  ARG A O   1 
ATOM 5859 C CB  . ARG A 1 756  ? -2.552  51.680 48.395  1.00 58.98  ? 753  ARG A CB  1 
ATOM 5860 C CG  . ARG A 1 756  ? -2.181  50.538 47.398  1.00 58.98  ? 753  ARG A CG  1 
ATOM 5861 C CD  . ARG A 1 756  ? -1.389  50.985 46.152  1.00 58.98  ? 753  ARG A CD  1 
ATOM 5862 N NE  . ARG A 1 756  ? -0.404  52.017 46.490  1.00 58.98  ? 753  ARG A NE  1 
ATOM 5863 C CZ  . ARG A 1 756  ? 0.645   51.830 47.297  1.00 58.98  ? 753  ARG A CZ  1 
ATOM 5864 N NH1 . ARG A 1 756  ? 0.855   50.629 47.860  1.00 58.98  ? 753  ARG A NH1 1 
ATOM 5865 N NH2 . ARG A 1 756  ? 1.468   52.857 47.557  1.00 58.98  ? 753  ARG A NH2 1 
ATOM 5866 N N   . PRO A 1 757  ? -5.668  50.763 48.432  1.00 50.90  ? 754  PRO A N   1 
ATOM 5867 C CA  . PRO A 1 757  ? -6.527  49.808 47.754  1.00 50.90  ? 754  PRO A CA  1 
ATOM 5868 C C   . PRO A 1 757  ? -5.837  49.381 46.479  1.00 50.90  ? 754  PRO A C   1 
ATOM 5869 O O   . PRO A 1 757  ? -5.248  50.204 45.801  1.00 50.90  ? 754  PRO A O   1 
ATOM 5870 C CB  . PRO A 1 757  ? -7.781  50.618 47.428  1.00 38.03  ? 754  PRO A CB  1 
ATOM 5871 C CG  . PRO A 1 757  ? -7.289  52.024 47.309  1.00 38.03  ? 754  PRO A CG  1 
ATOM 5872 C CD  . PRO A 1 757  ? -6.221  52.127 48.409  1.00 38.03  ? 754  PRO A CD  1 
ATOM 5873 N N   . SER A 1 758  ? -5.884  48.091 46.190  1.00 50.42  ? 755  SER A N   1 
ATOM 5874 C CA  . SER A 1 758  ? -5.271  47.502 45.007  1.00 50.42  ? 755  SER A CA  1 
ATOM 5875 C C   . SER A 1 758  ? -6.370  47.140 44.062  1.00 50.42  ? 755  SER A C   1 
ATOM 5876 O O   . SER A 1 758  ? -7.489  47.590 44.217  1.00 50.42  ? 755  SER A O   1 
ATOM 5877 C CB  . SER A 1 758  ? -4.561  46.229 45.410  1.00 39.27  ? 755  SER A CB  1 
ATOM 5878 O OG  . SER A 1 758  ? -3.911  46.421 46.650  1.00 39.27  ? 755  SER A OG  1 
ATOM 5879 N N   . ALA A 1 759  ? -6.064  46.317 43.089  1.00 44.35  ? 756  ALA A N   1 
ATOM 5880 C CA  . ALA A 1 759  ? -7.072  45.845 42.176  1.00 44.35  ? 756  ALA A CA  1 
ATOM 5881 C C   . ALA A 1 759  ? -7.674  44.569 42.670  1.00 44.35  ? 756  ALA A C   1 
ATOM 5882 O O   . ALA A 1 759  ? -8.671  44.102 42.105  1.00 44.35  ? 756  ALA A O   1 
ATOM 5883 C CB  . ALA A 1 759  ? -6.470  45.588 40.848  1.00 11.35  ? 756  ALA A CB  1 
ATOM 5884 N N   . SER A 1 760  ? -7.044  43.964 43.672  1.00 47.68  ? 757  SER A N   1 
ATOM 5885 C CA  . SER A 1 760  ? -7.588  42.751 44.272  1.00 47.68  ? 757  SER A CA  1 
ATOM 5886 C C   . SER A 1 760  ? -8.495  43.096 45.489  1.00 47.68  ? 757  SER A C   1 
ATOM 5887 O O   . SER A 1 760  ? -9.332  42.315 45.939  1.00 47.68  ? 757  SER A O   1 
ATOM 5888 C CB  . SER A 1 760  ? -6.453  41.810 44.662  1.00 39.18  ? 757  SER A CB  1 
ATOM 5889 O OG  . SER A 1 760  ? -5.664  42.322 45.725  1.00 39.18  ? 757  SER A OG  1 
ATOM 5890 N N   . THR A 1 761  ? -8.329  44.287 46.017  1.00 42.31  ? 758  THR A N   1 
ATOM 5891 C CA  . THR A 1 761  ? -9.168  44.665 47.089  1.00 42.31  ? 758  THR A CA  1 
ATOM 5892 C C   . THR A 1 761  ? -10.413 45.398 46.536  1.00 42.31  ? 758  THR A C   1 
ATOM 5893 O O   . THR A 1 761  ? -11.506 45.221 47.056  1.00 42.31  ? 758  THR A O   1 
ATOM 5894 C CB  . THR A 1 761  ? -8.397  45.510 48.115  1.00 41.39  ? 758  THR A CB  1 
ATOM 5895 O OG1 . THR A 1 761  ? -8.292  46.856 47.646  1.00 41.39  ? 758  THR A OG1 1 
ATOM 5896 C CG2 . THR A 1 761  ? -7.031  44.926 48.383  1.00 41.39  ? 758  THR A CG2 1 
ATOM 5897 N N   . GLN A 1 762  ? -10.250 46.215 45.500  1.00 42.75  ? 759  GLN A N   1 
ATOM 5898 C CA  . GLN A 1 762  ? -11.392 46.816 44.790  1.00 42.75  ? 759  GLN A CA  1 
ATOM 5899 C C   . GLN A 1 762  ? -12.038 45.891 43.743  1.00 42.75  ? 759  GLN A C   1 
ATOM 5900 O O   . GLN A 1 762  ? -12.761 46.386 42.875  1.00 42.75  ? 759  GLN A O   1 
ATOM 5901 C CB  . GLN A 1 762  ? -11.024 48.144 44.104  1.00 80.69  ? 759  GLN A CB  1 
ATOM 5902 C CG  . GLN A 1 762  ? -10.296 49.150 44.959  1.00 80.69  ? 759  GLN A CG  1 
ATOM 5903 C CD  . GLN A 1 762  ? -10.818 49.201 46.389  1.00 80.69  ? 759  GLN A CD  1 
ATOM 5904 O OE1 . GLN A 1 762  ? -10.519 48.320 47.218  1.00 80.69  ? 759  GLN A OE1 1 
ATOM 5905 N NE2 . GLN A 1 762  ? -11.588 50.251 46.695  1.00 80.69  ? 759  GLN A NE2 1 
ATOM 5906 N N   . ALA A 1 763  ? -11.800 44.580 43.795  1.00 45.57  ? 760  ALA A N   1 
ATOM 5907 C CA  . ALA A 1 763  ? -12.570 43.618 42.956  1.00 45.57  ? 760  ALA A CA  1 
ATOM 5908 C C   . ALA A 1 763  ? -14.117 43.870 42.920  1.00 45.57  ? 760  ALA A C   1 
ATOM 5909 O O   . ALA A 1 763  ? -14.669 44.372 43.895  1.00 45.57  ? 760  ALA A O   1 
ATOM 5910 C CB  . ALA A 1 763  ? -12.303 42.190 43.461  1.00 51.58  ? 760  ALA A CB  1 
ATOM 5911 N N   . LEU A 1 764  ? -14.831 43.493 41.859  1.00 74.00  ? 761  LEU A N   1 
ATOM 5912 C CA  . LEU A 1 764  ? -16.309 43.629 41.895  1.00 74.00  ? 761  LEU A CA  1 
ATOM 5913 C C   . LEU A 1 764  ? -16.997 42.558 42.776  1.00 74.00  ? 761  LEU A C   1 
ATOM 5914 O O   . LEU A 1 764  ? -17.747 42.897 43.695  1.00 74.00  ? 761  LEU A O   1 
ATOM 5915 C CB  . LEU A 1 764  ? -16.934 43.736 40.488  1.00 56.69  ? 761  LEU A CB  1 
ATOM 5916 C CG  . LEU A 1 764  ? -16.310 44.789 39.547  1.00 56.69  ? 761  LEU A CG  1 
ATOM 5917 C CD1 . LEU A 1 764  ? -16.887 44.714 38.184  1.00 56.69  ? 761  LEU A CD1 1 
ATOM 5918 C CD2 . LEU A 1 764  ? -16.387 46.206 40.051  1.00 56.69  ? 761  LEU A CD2 1 
ATOM 5919 N N   . SER A 1 765  ? -16.745 41.281 42.485  1.00 78.77  ? 762  SER A N   1 
ATOM 5920 C CA  . SER A 1 765  ? -17.004 40.186 43.419  1.00 78.77  ? 762  SER A CA  1 
ATOM 5921 C C   . SER A 1 765  ? -15.650 39.712 43.960  1.00 78.77  ? 762  SER A C   1 
ATOM 5922 O O   . SER A 1 765  ? -14.663 40.450 43.830  1.00 78.77  ? 762  SER A O   1 
ATOM 5923 C CB  . SER A 1 765  ? -17.746 39.058 42.734  1.00 60.87  ? 762  SER A CB  1 
ATOM 5924 O OG  . SER A 1 765  ? -16.878 38.235 42.008  1.00 60.87  ? 762  SER A OG  1 
ATOM 5925 N N   . SER A 1 766  ? -15.595 38.513 44.566  1.00 66.73  ? 763  SER A N   1 
ATOM 5926 C CA  . SER A 1 766  ? -14.383 38.027 45.253  1.00 66.73  ? 763  SER A CA  1 
ATOM 5927 C C   . SER A 1 766  ? -14.508 36.710 46.053  1.00 66.73  ? 763  SER A C   1 
ATOM 5928 O O   . SER A 1 766  ? -15.604 36.202 46.244  1.00 66.73  ? 763  SER A O   1 
ATOM 5929 C CB  . SER A 1 766  ? -13.819 39.110 46.159  1.00 39.77  ? 763  SER A CB  1 
ATOM 5930 O OG  . SER A 1 766  ? -14.254 38.922 47.468  1.00 39.77  ? 763  SER A OG  1 
ATOM 5931 N N   . SER A 1 767  ? -13.365 36.197 46.536  1.00 41.04  ? 764  SER A N   1 
ATOM 5932 C CA  . SER A 1 767  ? -13.218 34.841 47.077  1.00 41.04  ? 764  SER A CA  1 
ATOM 5933 C C   . SER A 1 767  ? -12.022 34.782 47.943  1.00 41.04  ? 764  SER A C   1 
ATOM 5934 O O   . SER A 1 767  ? -11.105 35.540 47.737  1.00 41.04  ? 764  SER A O   1 
ATOM 5935 C CB  . SER A 1 767  ? -12.925 33.854 45.977  1.00 39.43  ? 764  SER A CB  1 
ATOM 5936 O OG  . SER A 1 767  ? -14.062 33.668 45.188  1.00 39.43  ? 764  SER A OG  1 
ATOM 5937 N N   . VAL A 1 768  ? -12.001 33.885 48.910  1.00 54.71  ? 765  VAL A N   1 
ATOM 5938 C CA  . VAL A 1 768  ? -10.726 33.507 49.439  1.00 54.71  ? 765  VAL A CA  1 
ATOM 5939 C C   . VAL A 1 768  ? -10.580 32.014 49.220  1.00 54.71  ? 765  VAL A C   1 
ATOM 5940 O O   . VAL A 1 768  ? -11.565 31.323 48.888  1.00 54.71  ? 765  VAL A O   1 
ATOM 5941 C CB  . VAL A 1 768  ? -10.570 33.799 50.902  1.00 40.61  ? 765  VAL A CB  1 
ATOM 5942 C CG1 . VAL A 1 768  ? -11.127 32.607 51.741  1.00 40.61  ? 765  VAL A CG1 1 
ATOM 5943 C CG2 . VAL A 1 768  ? -9.069  33.992 51.232  1.00 40.61  ? 765  VAL A CG2 1 
ATOM 5944 N N   . SER A 1 769  ? -9.349  31.519 49.386  1.00 60.26  ? 766  SER A N   1 
ATOM 5945 C CA  . SER A 1 769  ? -9.142  30.084 49.401  1.00 60.26  ? 766  SER A CA  1 
ATOM 5946 C C   . SER A 1 769  ? -9.613  29.605 50.785  1.00 60.26  ? 766  SER A C   1 
ATOM 5947 O O   . SER A 1 769  ? -9.326  30.229 51.835  1.00 60.26  ? 766  SER A O   1 
ATOM 5948 C CB  . SER A 1 769  ? -7.695  29.666 49.028  1.00 53.41  ? 766  SER A CB  1 
ATOM 5949 O OG  . SER A 1 769  ? -7.702  28.600 48.057  1.00 53.41  ? 766  SER A OG  1 
ATOM 5950 N N   . SER A 1 770  ? -10.413 28.546 50.747  1.00 66.79  ? 767  SER A N   1 
ATOM 5951 C CA  . SER A 1 770  ? -10.996 28.000 51.938  1.00 66.79  ? 767  SER A CA  1 
ATOM 5952 C C   . SER A 1 770  ? -10.153 26.794 52.299  1.00 66.79  ? 767  SER A C   1 
ATOM 5953 O O   . SER A 1 770  ? -9.697  26.697 53.441  1.00 66.79  ? 767  SER A O   1 
ATOM 5954 C CB  . SER A 1 770  ? -12.438 27.597 51.674  1.00 54.25  ? 767  SER A CB  1 
ATOM 5955 O OG  . SER A 1 770  ? -12.408 26.393 50.937  1.00 54.25  ? 767  SER A OG  1 
ATOM 5956 N N   . SER A 1 771  ? -9.948  25.899 51.321  1.00 66.10  ? 768  SER A N   1 
ATOM 5957 C CA  . SER A 1 771  ? -9.023  24.731 51.414  1.00 66.10  ? 768  SER A CA  1 
ATOM 5958 C C   . SER A 1 771  ? -8.095  24.588 52.667  1.00 66.10  ? 768  SER A C   1 
ATOM 5959 O O   . SER A 1 771  ? -7.519  25.554 53.177  1.00 66.10  ? 768  SER A O   1 
ATOM 5960 C CB  . SER A 1 771  ? -8.183  24.613 50.128  1.00 60.60  ? 768  SER A CB  1 
ATOM 5961 O OG  . SER A 1 771  ? -6.902  24.029 50.416  1.00 60.60  ? 768  SER A OG  1 
ATOM 5962 N N   . LYS A 1 772  ? -7.925  23.361 53.133  1.00 82.82  ? 769  LYS A N   1 
ATOM 5963 C CA  . LYS A 1 772  ? -7.299  23.166 54.433  1.00 82.82  ? 769  LYS A CA  1 
ATOM 5964 C C   . LYS A 1 772  ? -6.047  22.278 54.380  1.00 82.82  ? 769  LYS A C   1 
ATOM 5965 O O   . LYS A 1 772  ? -5.660  21.679 55.398  1.00 82.82  ? 769  LYS A O   1 
ATOM 5966 C CB  . LYS A 1 772  ? -8.343  22.628 55.433  1.00 104.32 ? 769  LYS A CB  1 
ATOM 5967 C CG  . LYS A 1 772  ? -9.476  23.613 55.789  1.00 104.32 ? 769  LYS A CG  1 
ATOM 5968 C CD  . LYS A 1 772  ? -9.053  24.617 56.874  1.00 104.32 ? 769  LYS A CD  1 
ATOM 5969 C CE  . LYS A 1 772  ? -10.015 25.806 56.964  1.00 104.32 ? 769  LYS A CE  1 
ATOM 5970 N NZ  . LYS A 1 772  ? -9.659  26.946 56.060  1.00 104.32 ? 769  LYS A NZ  1 
ATOM 5971 N N   . LEU A 1 773  ? -5.388  22.261 53.215  1.00 85.84  ? 770  LEU A N   1 
ATOM 5972 C CA  . LEU A 1 773  ? -4.356  21.252 52.890  1.00 85.84  ? 770  LEU A CA  1 
ATOM 5973 C C   . LEU A 1 773  ? -3.071  21.270 53.706  1.00 85.84  ? 770  LEU A C   1 
ATOM 5974 O O   . LEU A 1 773  ? -2.271  20.335 53.628  1.00 85.84  ? 770  LEU A O   1 
ATOM 5975 C CB  . LEU A 1 773  ? -4.038  21.239 51.393  1.00 78.01  ? 770  LEU A CB  1 
ATOM 5976 C CG  . LEU A 1 773  ? -5.208  20.742 50.539  1.00 78.01  ? 770  LEU A CG  1 
ATOM 5977 C CD1 . LEU A 1 773  ? -4.721  19.859 49.382  1.00 78.01  ? 770  LEU A CD1 1 
ATOM 5978 C CD2 . LEU A 1 773  ? -6.278  20.000 51.392  1.00 78.01  ? 770  LEU A CD2 1 
ATOM 5979 N N   . PHE A 1 774  ? -2.890  22.310 54.506  1.00 89.59  ? 771  PHE A N   1 
ATOM 5980 C CA  . PHE A 1 774  ? -1.698  22.432 55.334  1.00 89.59  ? 771  PHE A CA  1 
ATOM 5981 C C   . PHE A 1 774  ? -2.076  22.780 56.804  1.00 89.59  ? 771  PHE A C   1 
ATOM 5982 O O   . PHE A 1 774  ? -3.273  22.846 57.134  1.00 89.59  ? 771  PHE A O   1 
ATOM 5983 C CB  . PHE A 1 774  ? -0.719  23.425 54.669  1.00 76.95  ? 771  PHE A CB  1 
ATOM 5984 C CG  . PHE A 1 774  ? -0.538  23.203 53.151  1.00 76.95  ? 771  PHE A CG  1 
ATOM 5985 C CD1 . PHE A 1 774  ? -1.140  24.061 52.220  1.00 76.95  ? 771  PHE A CD1 1 
ATOM 5986 C CD2 . PHE A 1 774  ? 0.218   22.122 52.659  1.00 76.95  ? 771  PHE A CD2 1 
ATOM 5987 C CE1 . PHE A 1 774  ? -0.989  23.856 50.830  1.00 76.95  ? 771  PHE A CE1 1 
ATOM 5988 C CE2 . PHE A 1 774  ? 0.374   21.917 51.269  1.00 76.95  ? 771  PHE A CE2 1 
ATOM 5989 C CZ  . PHE A 1 774  ? -0.236  22.788 50.359  1.00 76.95  ? 771  PHE A CZ  1 
ATOM 5990 N N   . SER A 1 775  ? -1.080  22.954 57.684  1.00 210.35 ? 772  SER A N   1 
ATOM 5991 C CA  . SER A 1 775  ? -1.321  23.213 59.126  1.00 210.35 ? 772  SER A CA  1 
ATOM 5992 C C   . SER A 1 775  ? -0.418  24.256 59.769  1.00 210.35 ? 772  SER A C   1 
ATOM 5993 O O   . SER A 1 775  ? -0.904  25.236 60.339  1.00 210.35 ? 772  SER A O   1 
ATOM 5994 C CB  . SER A 1 775  ? -1.187  21.933 59.954  1.00 73.10  ? 772  SER A CB  1 
ATOM 5995 O OG  . SER A 1 775  ? -2.296  21.096 59.752  1.00 73.10  ? 772  SER A OG  1 
ATOM 5996 N N   . SER A 1 776  ? 0.893   24.015 59.700  1.00 198.27 ? 773  SER A N   1 
ATOM 5997 C CA  . SER A 1 776  ? 1.890   24.798 60.438  1.00 198.27 ? 773  SER A CA  1 
ATOM 5998 C C   . SER A 1 776  ? 2.453   25.957 59.601  1.00 198.27 ? 773  SER A C   1 
ATOM 5999 O O   . SER A 1 776  ? 2.319   25.901 58.332  1.00 198.27 ? 773  SER A O   1 
ATOM 6000 C CB  . SER A 1 776  ? 3.033   23.868 60.850  1.00 91.84  ? 773  SER A CB  1 
ATOM 6001 O OG  . SER A 1 776  ? 3.511   23.149 59.717  1.00 91.84  ? 773  SER A OG  1 
ATOM 6002 N N   . GLY A 1 786  ? 4.811   46.922 60.305  1.00 121.09 ? 783  GLY A N   1 
ATOM 6003 C CA  . GLY A 1 786  ? 6.148   46.339 60.234  1.00 121.09 ? 783  GLY A CA  1 
ATOM 6004 C C   . GLY A 1 786  ? 6.298   45.270 59.161  1.00 121.09 ? 783  GLY A C   1 
ATOM 6005 O O   . GLY A 1 786  ? 6.092   45.549 57.980  1.00 121.09 ? 783  GLY A O   1 
ATOM 6006 N N   . GLU A 1 787  ? 6.657   44.053 59.588  1.00 80.17  ? 784  GLU A N   1 
ATOM 6007 C CA  . GLU A 1 787  ? 6.932   42.883 58.712  1.00 80.17  ? 784  GLU A CA  1 
ATOM 6008 C C   . GLU A 1 787  ? 6.122   42.861 57.419  1.00 80.17  ? 784  GLU A C   1 
ATOM 6009 O O   . GLU A 1 787  ? 4.899   43.125 57.417  1.00 80.17  ? 784  GLU A O   1 
ATOM 6010 C CB  . GLU A 1 787  ? 6.685   41.567 59.470  1.00 121.08 ? 784  GLU A CB  1 
ATOM 6011 C CG  . GLU A 1 787  ? 7.558   41.348 60.710  1.00 121.08 ? 784  GLU A CG  1 
ATOM 6012 C CD  . GLU A 1 787  ? 6.776   40.775 61.900  1.00 121.08 ? 784  GLU A CD  1 
ATOM 6013 O OE1 . GLU A 1 787  ? 7.404   40.514 62.953  1.00 121.08 ? 784  GLU A OE1 1 
ATOM 6014 O OE2 . GLU A 1 787  ? 5.536   40.598 61.791  1.00 121.08 ? 784  GLU A OE2 1 
ATOM 6015 N N   . GLU A 1 788  ? 6.791   42.546 56.317  1.00 74.98  ? 785  GLU A N   1 
ATOM 6016 C CA  . GLU A 1 788  ? 6.084   42.580 55.045  1.00 74.98  ? 785  GLU A CA  1 
ATOM 6017 C C   . GLU A 1 788  ? 5.673   41.196 54.566  1.00 74.98  ? 785  GLU A C   1 
ATOM 6018 O O   . GLU A 1 788  ? 6.345   40.209 54.846  1.00 74.98  ? 785  GLU A O   1 
ATOM 6019 C CB  . GLU A 1 788  ? 6.849   43.383 53.979  1.00 72.13  ? 785  GLU A CB  1 
ATOM 6020 C CG  . GLU A 1 788  ? 6.612   44.898 54.129  1.00 72.13  ? 785  GLU A CG  1 
ATOM 6021 C CD  . GLU A 1 788  ? 7.279   45.776 53.059  1.00 72.13  ? 785  GLU A CD  1 
ATOM 6022 O OE1 . GLU A 1 788  ? 8.189   45.300 52.326  1.00 72.13  ? 785  GLU A OE1 1 
ATOM 6023 O OE2 . GLU A 1 788  ? 6.871   46.963 52.974  1.00 72.13  ? 785  GLU A OE2 1 
ATOM 6024 N N   . VAL A 1 789  ? 4.542   41.137 53.877  1.00 52.09  ? 786  VAL A N   1 
ATOM 6025 C CA  . VAL A 1 789  ? 4.112   39.924 53.243  1.00 52.09  ? 786  VAL A CA  1 
ATOM 6026 C C   . VAL A 1 789  ? 3.416   40.254 51.890  1.00 52.09  ? 786  VAL A C   1 
ATOM 6027 O O   . VAL A 1 789  ? 3.144   41.421 51.550  1.00 52.09  ? 786  VAL A O   1 
ATOM 6028 C CB  . VAL A 1 789  ? 3.235   39.076 54.206  1.00 67.13  ? 786  VAL A CB  1 
ATOM 6029 C CG1 . VAL A 1 789  ? 1.805   39.598 54.248  1.00 67.13  ? 786  VAL A CG1 1 
ATOM 6030 C CG2 . VAL A 1 789  ? 3.270   37.587 53.838  1.00 67.13  ? 786  VAL A CG2 1 
ATOM 6031 N N   . GLU A 1 790  ? 3.173   39.201 51.127  1.00 35.70  ? 787  GLU A N   1 
ATOM 6032 C CA  . GLU A 1 790  ? 2.707   39.282 49.800  1.00 35.70  ? 787  GLU A CA  1 
ATOM 6033 C C   . GLU A 1 790  ? 1.420   38.502 49.794  1.00 35.70  ? 787  GLU A C   1 
ATOM 6034 O O   . GLU A 1 790  ? 1.327   37.477 50.452  1.00 35.70  ? 787  GLU A O   1 
ATOM 6035 C CB  . GLU A 1 790  ? 3.738   38.628 48.865  1.00 33.16  ? 787  GLU A CB  1 
ATOM 6036 C CG  . GLU A 1 790  ? 4.418   39.650 47.955  1.00 33.16  ? 787  GLU A CG  1 
ATOM 6037 C CD  . GLU A 1 790  ? 5.576   39.080 47.167  1.00 33.16  ? 787  GLU A CD  1 
ATOM 6038 O OE1 . GLU A 1 790  ? 6.736   39.528 47.501  1.00 33.16  ? 787  GLU A OE1 1 
ATOM 6039 O OE2 . GLU A 1 790  ? 5.339   38.212 46.240  1.00 33.16  ? 787  GLU A OE2 1 
ATOM 6040 N N   . VAL A 1 791  ? 0.415   38.972 49.067  1.00 48.92  ? 788  VAL A N   1 
ATOM 6041 C CA  . VAL A 1 791  ? -0.870  38.323 49.103  1.00 48.92  ? 788  VAL A CA  1 
ATOM 6042 C C   . VAL A 1 791  ? -1.241  38.137 47.659  1.00 48.92  ? 788  VAL A C   1 
ATOM 6043 O O   . VAL A 1 791  ? -1.299  39.099 46.919  1.00 48.92  ? 788  VAL A O   1 
ATOM 6044 C CB  . VAL A 1 791  ? -1.944  39.179 49.880  1.00 36.61  ? 788  VAL A CB  1 
ATOM 6045 C CG1 . VAL A 1 791  ? -3.233  38.444 49.946  1.00 36.61  ? 788  VAL A CG1 1 
ATOM 6046 C CG2 . VAL A 1 791  ? -1.546  39.410 51.280  1.00 36.61  ? 788  VAL A CG2 1 
ATOM 6047 N N   . HIS A 1 792  ? -1.505  36.911 47.255  1.00 52.00  ? 789  HIS A N   1 
ATOM 6048 C CA  . HIS A 1 792  ? -1.660  36.616 45.851  1.00 52.00  ? 789  HIS A CA  1 
ATOM 6049 C C   . HIS A 1 792  ? -3.088  36.348 45.386  1.00 52.00  ? 789  HIS A C   1 
ATOM 6050 O O   . HIS A 1 792  ? -3.863  35.732 46.101  1.00 52.00  ? 789  HIS A O   1 
ATOM 6051 C CB  . HIS A 1 792  ? -0.784  35.422 45.508  1.00 42.23  ? 789  HIS A CB  1 
ATOM 6052 C CG  . HIS A 1 792  ? 0.669   35.741 45.479  1.00 42.23  ? 789  HIS A CG  1 
ATOM 6053 N ND1 . HIS A 1 792  ? 1.461   35.465 44.391  1.00 42.23  ? 789  HIS A ND1 1 
ATOM 6054 C CD2 . HIS A 1 792  ? 1.469   36.333 46.397  1.00 42.23  ? 789  HIS A CD2 1 
ATOM 6055 C CE1 . HIS A 1 792  ? 2.691   35.875 44.642  1.00 42.23  ? 789  HIS A CE1 1 
ATOM 6056 N NE2 . HIS A 1 792  ? 2.723   36.406 45.852  1.00 42.23  ? 789  HIS A NE2 1 
ATOM 6057 N N   . ASN A 1 793  ? -3.412  36.765 44.163  1.00 42.43  ? 790  ASN A N   1 
ATOM 6058 C CA  . ASN A 1 793  ? -4.745  36.607 43.603  1.00 42.43  ? 790  ASN A CA  1 
ATOM 6059 C C   . ASN A 1 793  ? -4.726  36.069 42.194  1.00 42.43  ? 790  ASN A C   1 
ATOM 6060 O O   . ASN A 1 793  ? -3.746  36.197 41.467  1.00 42.43  ? 790  ASN A O   1 
ATOM 6061 C CB  . ASN A 1 793  ? -5.472  37.941 43.558  1.00 53.47  ? 790  ASN A CB  1 
ATOM 6062 C CG  . ASN A 1 793  ? -5.555  38.605 44.910  1.00 53.47  ? 790  ASN A CG  1 
ATOM 6063 O OD1 . ASN A 1 793  ? -6.505  38.371 45.681  1.00 53.47  ? 790  ASN A OD1 1 
ATOM 6064 N ND2 . ASN A 1 793  ? -4.571  39.466 45.207  1.00 53.47  ? 790  ASN A ND2 1 
ATOM 6065 N N   . LEU A 1 794  ? -5.826  35.449 41.815  1.00 45.62  ? 791  LEU A N   1 
ATOM 6066 C CA  . LEU A 1 794  ? -6.175  35.322 40.432  1.00 45.62  ? 791  LEU A CA  1 
ATOM 6067 C C   . LEU A 1 794  ? -7.159  36.466 40.184  1.00 45.62  ? 791  LEU A C   1 
ATOM 6068 O O   . LEU A 1 794  ? -8.075  36.663 40.961  1.00 45.62  ? 791  LEU A O   1 
ATOM 6069 C CB  . LEU A 1 794  ? -6.841  33.971 40.226  1.00 31.33  ? 791  LEU A CB  1 
ATOM 6070 C CG  . LEU A 1 794  ? -7.521  33.764 38.879  1.00 31.33  ? 791  LEU A CG  1 
ATOM 6071 C CD1 . LEU A 1 794  ? -6.569  34.116 37.688  1.00 31.33  ? 791  LEU A CD1 1 
ATOM 6072 C CD2 . LEU A 1 794  ? -8.062  32.359 38.786  1.00 31.33  ? 791  LEU A CD2 1 
ATOM 6073 N N   . LEU A 1 795  ? -6.962  37.255 39.137  1.00 36.86  ? 792  LEU A N   1 
ATOM 6074 C CA  . LEU A 1 795  ? -7.905  38.354 38.839  1.00 36.86  ? 792  LEU A CA  1 
ATOM 6075 C C   . LEU A 1 795  ? -8.716  37.913 37.677  1.00 36.86  ? 792  LEU A C   1 
ATOM 6076 O O   . LEU A 1 795  ? -8.247  37.055 36.895  1.00 36.86  ? 792  LEU A O   1 
ATOM 6077 C CB  . LEU A 1 795  ? -7.189  39.642 38.503  1.00 31.09  ? 792  LEU A CB  1 
ATOM 6078 C CG  . LEU A 1 795  ? -6.443  40.083 39.757  1.00 31.09  ? 792  LEU A CG  1 
ATOM 6079 C CD1 . LEU A 1 795  ? -5.668  41.382 39.602  1.00 31.09  ? 792  LEU A CD1 1 
ATOM 6080 C CD2 . LEU A 1 795  ? -7.406  40.148 40.908  1.00 31.09  ? 792  LEU A CD2 1 
ATOM 6081 N N   . ILE A 1 796  ? -9.940  38.423 37.566  1.00 36.29  ? 793  ILE A N   1 
ATOM 6082 C CA  . ILE A 1 796  ? -10.719 38.113 36.374  1.00 36.29  ? 793  ILE A CA  1 
ATOM 6083 C C   . ILE A 1 796  ? -11.059 39.384 35.624  1.00 36.29  ? 793  ILE A C   1 
ATOM 6084 O O   . ILE A 1 796  ? -11.736 40.265 36.155  1.00 36.29  ? 793  ILE A O   1 
ATOM 6085 C CB  . ILE A 1 796  ? -11.921 37.251 36.676  1.00 47.68  ? 793  ILE A CB  1 
ATOM 6086 C CG1 . ILE A 1 796  ? -11.454 35.827 36.989  1.00 47.68  ? 793  ILE A CG1 1 
ATOM 6087 C CG2 . ILE A 1 796  ? -12.853 37.205 35.478  1.00 47.68  ? 793  ILE A CG2 1 
ATOM 6088 C CD1 . ILE A 1 796  ? -10.958 35.035 35.794  1.00 47.68  ? 793  ILE A CD1 1 
ATOM 6089 N N   . ILE A 1 797  ? -10.564 39.503 34.402  1.00 38.61  ? 794  ILE A N   1 
ATOM 6090 C CA  . ILE A 1 797  ? -10.559 40.798 33.762  1.00 38.61  ? 794  ILE A CA  1 
ATOM 6091 C C   . ILE A 1 797  ? -11.377 40.788 32.503  1.00 38.61  ? 794  ILE A C   1 
ATOM 6092 O O   . ILE A 1 797  ? -11.187 39.950 31.587  1.00 38.61  ? 794  ILE A O   1 
ATOM 6093 C CB  . ILE A 1 797  ? -9.119  41.340 33.555  1.00 40.60  ? 794  ILE A CB  1 
ATOM 6094 C CG1 . ILE A 1 797  ? -8.720  42.120 34.782  1.00 40.60  ? 794  ILE A CG1 1 
ATOM 6095 C CG2 . ILE A 1 797  ? -9.031  42.278 32.401  1.00 40.60  ? 794  ILE A CG2 1 
ATOM 6096 C CD1 . ILE A 1 797  ? -7.555  41.574 35.444  1.00 40.60  ? 794  ILE A CD1 1 
ATOM 6097 N N   . ASP A 1 798  ? -12.309 41.724 32.462  1.00 35.26  ? 795  ASP A N   1 
ATOM 6098 C CA  . ASP A 1 798  ? -13.134 41.821 31.300  1.00 35.26  ? 795  ASP A CA  1 
ATOM 6099 C C   . ASP A 1 798  ? -12.332 42.324 30.100  1.00 35.26  ? 795  ASP A C   1 
ATOM 6100 O O   . ASP A 1 798  ? -11.711 43.423 30.137  1.00 35.26  ? 795  ASP A O   1 
ATOM 6101 C CB  . ASP A 1 798  ? -14.304 42.735 31.584  1.00 51.19  ? 795  ASP A CB  1 
ATOM 6102 C CG  . ASP A 1 798  ? -15.230 42.838 30.412  1.00 51.19  ? 795  ASP A CG  1 
ATOM 6103 O OD1 . ASP A 1 798  ? -15.316 43.959 29.837  1.00 51.19  ? 795  ASP A OD1 1 
ATOM 6104 O OD2 . ASP A 1 798  ? -15.826 41.790 30.051  1.00 51.19  ? 795  ASP A OD2 1 
ATOM 6105 N N   . GLN A 1 799  ? -12.346 41.548 29.018  1.00 48.92  ? 796  GLN A N   1 
ATOM 6106 C CA  . GLN A 1 799  ? -11.554 41.973 27.857  1.00 48.92  ? 796  GLN A CA  1 
ATOM 6107 C C   . GLN A 1 799  ? -11.996 43.288 27.279  1.00 48.92  ? 796  GLN A C   1 
ATOM 6108 O O   . GLN A 1 799  ? -11.184 44.007 26.761  1.00 48.92  ? 796  GLN A O   1 
ATOM 6109 C CB  . GLN A 1 799  ? -11.448 40.928 26.766  1.00 59.44  ? 796  GLN A CB  1 
ATOM 6110 C CG  . GLN A 1 799  ? -12.735 40.364 26.311  1.00 59.44  ? 796  GLN A CG  1 
ATOM 6111 C CD  . GLN A 1 799  ? -12.597 39.746 24.954  1.00 59.44  ? 796  GLN A CD  1 
ATOM 6112 O OE1 . GLN A 1 799  ? -12.673 40.449 23.944  1.00 59.44  ? 796  GLN A OE1 1 
ATOM 6113 N NE2 . GLN A 1 799  ? -12.382 38.432 24.905  1.00 59.44  ? 796  GLN A NE2 1 
ATOM 6114 N N   . HIS A 1 800  ? -13.275 43.610 27.373  1.00 50.88  ? 797  HIS A N   1 
ATOM 6115 C CA  . HIS A 1 800  ? -13.747 44.875 26.818  1.00 50.88  ? 797  HIS A CA  1 
ATOM 6116 C C   . HIS A 1 800  ? -13.519 46.038 27.756  1.00 50.88  ? 797  HIS A C   1 
ATOM 6117 O O   . HIS A 1 800  ? -12.956 47.044 27.361  1.00 50.88  ? 797  HIS A O   1 
ATOM 6118 C CB  . HIS A 1 800  ? -15.194 44.777 26.356  1.00 53.23  ? 797  HIS A CB  1 
ATOM 6119 C CG  . HIS A 1 800  ? -15.398 43.709 25.342  1.00 53.23  ? 797  HIS A CG  1 
ATOM 6120 N ND1 . HIS A 1 800  ? -15.023 43.860 24.032  1.00 53.23  ? 797  HIS A ND1 1 
ATOM 6121 C CD2 . HIS A 1 800  ? -15.861 42.441 25.457  1.00 53.23  ? 797  HIS A CD2 1 
ATOM 6122 C CE1 . HIS A 1 800  ? -15.264 42.741 23.371  1.00 53.23  ? 797  HIS A CE1 1 
ATOM 6123 N NE2 . HIS A 1 800  ? -15.779 41.863 24.213  1.00 53.23  ? 797  HIS A NE2 1 
ATOM 6124 N N   . THR A 1 801  ? -13.911 45.899 29.003  1.00 48.54  ? 798  THR A N   1 
ATOM 6125 C CA  . THR A 1 801  ? -13.848 47.027 29.902  1.00 48.54  ? 798  THR A CA  1 
ATOM 6126 C C   . THR A 1 801  ? -12.587 47.140 30.750  1.00 48.54  ? 798  THR A C   1 
ATOM 6127 O O   . THR A 1 801  ? -12.380 48.164 31.395  1.00 48.54  ? 798  THR A O   1 
ATOM 6128 C CB  . THR A 1 801  ? -15.030 46.967 30.841  1.00 46.63  ? 798  THR A CB  1 
ATOM 6129 O OG1 . THR A 1 801  ? -15.017 45.710 31.544  1.00 46.63  ? 798  THR A OG1 1 
ATOM 6130 C CG2 . THR A 1 801  ? -16.313 47.106 30.038  1.00 46.63  ? 798  THR A CG2 1 
ATOM 6131 N N   . PHE A 1 802  ? -11.783 46.067 30.778  1.00 49.53  ? 799  PHE A N   1 
ATOM 6132 C CA  . PHE A 1 802  ? -10.629 45.915 31.686  1.00 49.53  ? 799  PHE A CA  1 
ATOM 6133 C C   . PHE A 1 802  ? -10.947 46.199 33.179  1.00 49.53  ? 799  PHE A C   1 
ATOM 6134 O O   . PHE A 1 802  ? -10.272 46.974 33.890  1.00 49.53  ? 799  PHE A O   1 
ATOM 6135 C CB  . PHE A 1 802  ? -9.406  46.625 31.095  1.00 46.30  ? 799  PHE A CB  1 
ATOM 6136 C CG  . PHE A 1 802  ? -8.834  45.875 29.895  1.00 46.30  ? 799  PHE A CG  1 
ATOM 6137 C CD1 . PHE A 1 802  ? -9.212  46.200 28.597  1.00 46.30  ? 799  PHE A CD1 1 
ATOM 6138 C CD2 . PHE A 1 802  ? -7.974  44.797 30.072  1.00 46.30  ? 799  PHE A CD2 1 
ATOM 6139 C CE1 . PHE A 1 802  ? -8.740  45.488 27.537  1.00 46.30  ? 799  PHE A CE1 1 
ATOM 6140 C CE2 . PHE A 1 802  ? -7.499  44.082 29.001  1.00 46.30  ? 799  PHE A CE2 1 
ATOM 6141 C CZ  . PHE A 1 802  ? -7.878  44.421 27.742  1.00 46.30  ? 799  PHE A CZ  1 
ATOM 6142 N N   . GLU A 1 803  ? -12.041 45.575 33.621  1.00 57.06  ? 800  GLU A N   1 
ATOM 6143 C CA  . GLU A 1 803  ? -12.494 45.611 35.002  1.00 57.06  ? 800  GLU A CA  1 
ATOM 6144 C C   . GLU A 1 803  ? -12.165 44.257 35.624  1.00 57.06  ? 800  GLU A C   1 
ATOM 6145 O O   . GLU A 1 803  ? -12.422 43.180 35.027  1.00 57.06  ? 800  GLU A O   1 
ATOM 6146 C CB  . GLU A 1 803  ? -14.005 45.871 35.090  1.00 104.22 ? 800  GLU A CB  1 
ATOM 6147 C CG  . GLU A 1 803  ? -14.382 47.353 35.242  1.00 104.22 ? 800  GLU A CG  1 
ATOM 6148 C CD  . GLU A 1 803  ? -15.871 47.616 35.601  1.00 104.22 ? 800  GLU A CD  1 
ATOM 6149 O OE1 . GLU A 1 803  ? -16.180 48.744 36.068  1.00 104.22 ? 800  GLU A OE1 1 
ATOM 6150 O OE2 . GLU A 1 803  ? -16.731 46.717 35.408  1.00 104.22 ? 800  GLU A OE2 1 
ATOM 6151 N N   . VAL A 1 804  ? -11.573 44.317 36.813  1.00 41.95  ? 801  VAL A N   1 
ATOM 6152 C CA  . VAL A 1 804  ? -11.583 43.168 37.703  1.00 41.95  ? 801  VAL A CA  1 
ATOM 6153 C C   . VAL A 1 804  ? -13.019 42.725 37.948  1.00 41.95  ? 801  VAL A C   1 
ATOM 6154 O O   . VAL A 1 804  ? -13.632 43.156 38.900  1.00 41.95  ? 801  VAL A O   1 
ATOM 6155 C CB  . VAL A 1 804  ? -11.039 43.526 39.100  1.00 38.04  ? 801  VAL A CB  1 
ATOM 6156 C CG1 . VAL A 1 804  ? -10.486 42.267 39.798  1.00 38.04  ? 801  VAL A CG1 1 
ATOM 6157 C CG2 . VAL A 1 804  ? -10.001 44.629 39.000  1.00 38.04  ? 801  VAL A CG2 1 
ATOM 6158 N N   . LEU A 1 805  ? -13.565 41.887 37.091  1.00 49.57  ? 802  LEU A N   1 
ATOM 6159 C CA  . LEU A 1 805  ? -14.777 41.192 37.463  1.00 49.57  ? 802  LEU A CA  1 
ATOM 6160 C C   . LEU A 1 805  ? -14.577 40.510 38.842  1.00 49.57  ? 802  LEU A C   1 
ATOM 6161 O O   . LEU A 1 805  ? -14.901 41.103 39.883  1.00 49.57  ? 802  LEU A O   1 
ATOM 6162 C CB  . LEU A 1 805  ? -15.190 40.189 36.391  1.00 48.29  ? 802  LEU A CB  1 
ATOM 6163 C CG  . LEU A 1 805  ? -15.267 40.766 34.982  1.00 48.29  ? 802  LEU A CG  1 
ATOM 6164 C CD1 . LEU A 1 805  ? -15.548 39.676 33.968  1.00 48.29  ? 802  LEU A CD1 1 
ATOM 6165 C CD2 . LEU A 1 805  ? -16.247 41.942 34.838  1.00 48.29  ? 802  LEU A CD2 1 
ATOM 6166 N N   . HIS A 1 806  ? -14.003 39.312 38.867  1.00 59.93  ? 803  HIS A N   1 
ATOM 6167 C CA  . HIS A 1 806  ? -13.812 38.600 40.124  1.00 59.93  ? 803  HIS A CA  1 
ATOM 6168 C C   . HIS A 1 806  ? -12.342 38.591 40.654  1.00 59.93  ? 803  HIS A C   1 
ATOM 6169 O O   . HIS A 1 806  ? -11.383 38.670 39.870  1.00 59.93  ? 803  HIS A O   1 
ATOM 6170 C CB  . HIS A 1 806  ? -14.409 37.190 39.980  1.00 51.47  ? 803  HIS A CB  1 
ATOM 6171 C CG  . HIS A 1 806  ? -14.262 36.344 41.205  1.00 51.47  ? 803  HIS A CG  1 
ATOM 6172 N ND1 . HIS A 1 806  ? -14.812 36.691 42.424  1.00 51.47  ? 803  HIS A ND1 1 
ATOM 6173 C CD2 . HIS A 1 806  ? -13.582 35.191 41.415  1.00 51.47  ? 803  HIS A CD2 1 
ATOM 6174 C CE1 . HIS A 1 806  ? -14.485 35.784 43.326  1.00 51.47  ? 803  HIS A CE1 1 
ATOM 6175 N NE2 . HIS A 1 806  ? -13.732 34.868 42.743  1.00 51.47  ? 803  HIS A NE2 1 
ATOM 6176 N N   . ALA A 1 807  ? -12.179 38.513 41.976  1.00 63.13  ? 804  ALA A N   1 
ATOM 6177 C CA  . ALA A 1 807  ? -10.862 38.259 42.587  1.00 63.13  ? 804  ALA A CA  1 
ATOM 6178 C C   . ALA A 1 807  ? -10.815 37.067 43.523  1.00 63.13  ? 804  ALA A C   1 
ATOM 6179 O O   . ALA A 1 807  ? -11.506 37.047 44.519  1.00 63.13  ? 804  ALA A O   1 
ATOM 6180 C CB  . ALA A 1 807  ? -10.357 39.466 43.347  1.00 38.25  ? 804  ALA A CB  1 
ATOM 6181 N N   . HIS A 1 808  ? -9.953  36.100 43.232  1.00 43.50  ? 805  HIS A N   1 
ATOM 6182 C CA  . HIS A 1 808  ? -9.683  35.020 44.166  1.00 43.50  ? 805  HIS A CA  1 
ATOM 6183 C C   . HIS A 1 808  ? -8.390  35.183 44.965  1.00 43.50  ? 805  HIS A C   1 
ATOM 6184 O O   . HIS A 1 808  ? -7.340  35.293 44.388  1.00 43.50  ? 805  HIS A O   1 
ATOM 6185 C CB  . HIS A 1 808  ? -9.680  33.695 43.437  1.00 74.79  ? 805  HIS A CB  1 
ATOM 6186 C CG  . HIS A 1 808  ? -9.525  32.545 44.361  1.00 74.79  ? 805  HIS A CG  1 
ATOM 6187 N ND1 . HIS A 1 808  ? -10.601 31.960 44.993  1.00 74.79  ? 805  HIS A ND1 1 
ATOM 6188 C CD2 . HIS A 1 808  ? -8.414  31.925 44.832  1.00 74.79  ? 805  HIS A CD2 1 
ATOM 6189 C CE1 . HIS A 1 808  ? -10.161 30.999 45.786  1.00 74.79  ? 805  HIS A CE1 1 
ATOM 6190 N NE2 . HIS A 1 808  ? -8.838  30.957 45.708  1.00 74.79  ? 805  HIS A NE2 1 
ATOM 6191 N N   . GLN A 1 809  ? -8.467  35.199 46.291  1.00 57.70  ? 806  GLN A N   1 
ATOM 6192 C CA  . GLN A 1 809  ? -7.256  35.348 47.131  1.00 57.70  ? 806  GLN A CA  1 
ATOM 6193 C C   . GLN A 1 809  ? -6.750  33.991 47.634  1.00 57.70  ? 806  GLN A C   1 
ATOM 6194 O O   . GLN A 1 809  ? -7.529  33.162 48.125  1.00 57.70  ? 806  GLN A O   1 
ATOM 6195 C CB  . GLN A 1 809  ? -7.471  36.312 48.302  1.00 43.74  ? 806  GLN A CB  1 
ATOM 6196 C CG  . GLN A 1 809  ? -6.436  36.188 49.401  1.00 43.74  ? 806  GLN A CG  1 
ATOM 6197 C CD  . GLN A 1 809  ? -6.583  37.249 50.520  1.00 43.74  ? 806  GLN A CD  1 
ATOM 6198 O OE1 . GLN A 1 809  ? -6.939  38.397 50.267  1.00 43.74  ? 806  GLN A OE1 1 
ATOM 6199 N NE2 . GLN A 1 809  ? -6.264  36.862 51.750  1.00 43.74  ? 806  GLN A NE2 1 
ATOM 6200 N N   . PHE A 1 810  ? -5.447  33.758 47.506  1.00 45.01  ? 807  PHE A N   1 
ATOM 6201 C CA  . PHE A 1 810  ? -4.882  32.463 47.880  1.00 45.01  ? 807  PHE A CA  1 
ATOM 6202 C C   . PHE A 1 810  ? -4.577  32.445 49.371  1.00 45.01  ? 807  PHE A C   1 
ATOM 6203 O O   . PHE A 1 810  ? -4.835  33.463 50.062  1.00 45.01  ? 807  PHE A O   1 
ATOM 6204 C CB  . PHE A 1 810  ? -3.647  32.134 47.020  1.00 31.32  ? 807  PHE A CB  1 
ATOM 6205 C CG  . PHE A 1 810  ? -3.980  31.895 45.599  1.00 31.32  ? 807  PHE A CG  1 
ATOM 6206 C CD1 . PHE A 1 810  ? -3.910  32.920 44.683  1.00 31.32  ? 807  PHE A CD1 1 
ATOM 6207 C CD2 . PHE A 1 810  ? -4.415  30.667 45.190  1.00 31.32  ? 807  PHE A CD2 1 
ATOM 6208 C CE1 . PHE A 1 810  ? -4.261  32.722 43.372  1.00 31.32  ? 807  PHE A CE1 1 
ATOM 6209 C CE2 . PHE A 1 810  ? -4.765  30.437 43.849  1.00 31.32  ? 807  PHE A CE2 1 
ATOM 6210 C CZ  . PHE A 1 810  ? -4.693  31.474 42.940  1.00 31.32  ? 807  PHE A CZ  1 
ATOM 6211 N N   . LEU A 1 811  ? -4.027  31.310 49.843  1.00 38.43  ? 808  LEU A N   1 
ATOM 6212 C CA  . LEU A 1 811  ? -3.780  31.065 51.259  1.00 38.43  ? 808  LEU A CA  1 
ATOM 6213 C C   . LEU A 1 811  ? -2.859  32.081 51.896  1.00 38.43  ? 808  LEU A C   1 
ATOM 6214 O O   . LEU A 1 811  ? -2.596  33.140 51.321  1.00 38.43  ? 808  LEU A O   1 
ATOM 6215 C CB  . LEU A 1 811  ? -3.261  29.661 51.471  1.00 68.31  ? 808  LEU A CB  1 
ATOM 6216 C CG  . LEU A 1 811  ? -4.402  28.685 51.221  1.00 68.31  ? 808  LEU A CG  1 
ATOM 6217 C CD1 . LEU A 1 811  ? -3.889  27.258 51.155  1.00 68.31  ? 808  LEU A CD1 1 
ATOM 6218 C CD2 . LEU A 1 811  ? -5.487  28.852 52.279  1.00 68.31  ? 808  LEU A CD2 1 
ATOM 6219 N N   . GLN A 1 812  ? -2.398  31.802 53.103  1.00 63.39  ? 809  GLN A N   1 
ATOM 6220 C CA  . GLN A 1 812  ? -1.541  32.739 53.750  1.00 63.39  ? 809  GLN A CA  1 
ATOM 6221 C C   . GLN A 1 812  ? -0.139  32.257 53.573  1.00 63.39  ? 809  GLN A C   1 
ATOM 6222 O O   . GLN A 1 812  ? 0.258   31.287 54.182  1.00 63.39  ? 809  GLN A O   1 
ATOM 6223 C CB  . GLN A 1 812  ? -1.882  32.874 55.208  1.00 77.85  ? 809  GLN A CB  1 
ATOM 6224 C CG  . GLN A 1 812  ? -1.136  34.015 55.845  1.00 77.85  ? 809  GLN A CG  1 
ATOM 6225 C CD  . GLN A 1 812  ? -1.559  34.256 57.268  1.00 77.85  ? 809  GLN A CD  1 
ATOM 6226 O OE1 . GLN A 1 812  ? -0.984  35.108 57.945  1.00 77.85  ? 809  GLN A OE1 1 
ATOM 6227 N NE2 . GLN A 1 812  ? -2.576  33.509 57.736  1.00 77.85  ? 809  GLN A NE2 1 
ATOM 6228 N N   . ASN A 1 813  ? 0.588   32.964 52.715  1.00 57.51  ? 810  ASN A N   1 
ATOM 6229 C CA  . ASN A 1 813  ? 1.963   32.671 52.316  1.00 57.51  ? 810  ASN A CA  1 
ATOM 6230 C C   . ASN A 1 813  ? 2.028   31.700 51.151  1.00 57.51  ? 810  ASN A C   1 
ATOM 6231 O O   . ASN A 1 813  ? 2.978   30.970 50.993  1.00 57.51  ? 810  ASN A O   1 
ATOM 6232 C CB  . ASN A 1 813  ? 2.827   32.257 53.511  1.00 52.78  ? 810  ASN A CB  1 
ATOM 6233 C CG  . ASN A 1 813  ? 2.998   33.409 54.545  1.00 52.78  ? 810  ASN A CG  1 
ATOM 6234 O OD1 . ASN A 1 813  ? 3.446   34.530 54.195  1.00 52.78  ? 810  ASN A OD1 1 
ATOM 6235 N ND2 . ASN A 1 813  ? 2.645   33.137 55.822  1.00 52.78  ? 810  ASN A ND2 1 
ATOM 6236 N N   . GLU A 1 814  ? 0.994   31.726 50.329  1.00 56.01  ? 811  GLU A N   1 
ATOM 6237 C CA  . GLU A 1 814  ? 0.935   30.959 49.101  1.00 56.01  ? 811  GLU A CA  1 
ATOM 6238 C C   . GLU A 1 814  ? 1.137   31.880 47.885  1.00 56.01  ? 811  GLU A C   1 
ATOM 6239 O O   . GLU A 1 814  ? 0.372   32.821 47.704  1.00 56.01  ? 811  GLU A O   1 
ATOM 6240 C CB  . GLU A 1 814  ? -0.430  30.325 49.008  1.00 35.32  ? 811  GLU A CB  1 
ATOM 6241 C CG  . GLU A 1 814  ? -0.701  29.715 47.702  1.00 35.32  ? 811  GLU A CG  1 
ATOM 6242 C CD  . GLU A 1 814  ? -1.913  28.794 47.768  1.00 35.32  ? 811  GLU A CD  1 
ATOM 6243 O OE1 . GLU A 1 814  ? -2.973  29.294 48.272  1.00 35.32  ? 811  GLU A OE1 1 
ATOM 6244 O OE2 . GLU A 1 814  ? -1.819  27.588 47.342  1.00 35.32  ? 811  GLU A OE2 1 
ATOM 6245 N N   . TYR A 1 815  ? 2.136   31.626 47.042  1.00 57.28  ? 812  TYR A N   1 
ATOM 6246 C CA  . TYR A 1 815  ? 2.387   32.484 45.876  1.00 57.28  ? 812  TYR A CA  1 
ATOM 6247 C C   . TYR A 1 815  ? 1.957   31.745 44.633  1.00 57.28  ? 812  TYR A C   1 
ATOM 6248 O O   . TYR A 1 815  ? 2.374   30.625 44.409  1.00 57.28  ? 812  TYR A O   1 
ATOM 6249 C CB  . TYR A 1 815  ? 3.868   32.795 45.755  1.00 31.96  ? 812  TYR A CB  1 
ATOM 6250 C CG  . TYR A 1 815  ? 4.461   33.686 46.819  1.00 31.96  ? 812  TYR A CG  1 
ATOM 6251 C CD1 . TYR A 1 815  ? 5.595   34.413 46.550  1.00 31.96  ? 812  TYR A CD1 1 
ATOM 6252 C CD2 . TYR A 1 815  ? 3.887   33.813 48.083  1.00 31.96  ? 812  TYR A CD2 1 
ATOM 6253 C CE1 . TYR A 1 815  ? 6.159   35.270 47.489  1.00 31.96  ? 812  TYR A CE1 1 
ATOM 6254 C CE2 . TYR A 1 815  ? 4.456   34.637 49.060  1.00 31.96  ? 812  TYR A CE2 1 
ATOM 6255 C CZ  . TYR A 1 815  ? 5.597   35.385 48.759  1.00 31.96  ? 812  TYR A CZ  1 
ATOM 6256 O OH  . TYR A 1 815  ? 6.177   36.260 49.701  1.00 31.96  ? 812  TYR A OH  1 
ATOM 6257 N N   . ALA A 1 816  ? 1.113   32.351 43.818  1.00 38.40  ? 813  ALA A N   1 
ATOM 6258 C CA  . ALA A 1 816  ? 0.705   31.695 42.562  1.00 38.40  ? 813  ALA A CA  1 
ATOM 6259 C C   . ALA A 1 816  ? 1.713   32.040 41.486  1.00 38.40  ? 813  ALA A C   1 
ATOM 6260 O O   . ALA A 1 816  ? 1.936   33.192 41.238  1.00 38.40  ? 813  ALA A O   1 
ATOM 6261 C CB  . ALA A 1 816  ? -0.728  32.149 42.121  1.00 33.39  ? 813  ALA A CB  1 
ATOM 6262 N N   . LEU A 1 817  ? 2.292   31.051 40.825  1.00 39.10  ? 814  LEU A N   1 
ATOM 6263 C CA  . LEU A 1 817  ? 3.430   31.304 39.931  1.00 39.10  ? 814  LEU A CA  1 
ATOM 6264 C C   . LEU A 1 817  ? 3.148   30.894 38.457  1.00 39.10  ? 814  LEU A C   1 
ATOM 6265 O O   . LEU A 1 817  ? 3.882   31.242 37.550  1.00 39.10  ? 814  LEU A O   1 
ATOM 6266 C CB  . LEU A 1 817  ? 4.714   30.635 40.503  1.00 25.84  ? 814  LEU A CB  1 
ATOM 6267 C CG  . LEU A 1 817  ? 5.014   30.679 42.033  1.00 25.84  ? 814  LEU A CG  1 
ATOM 6268 C CD1 . LEU A 1 817  ? 5.476   29.280 42.390  1.00 25.84  ? 814  LEU A CD1 1 
ATOM 6269 C CD2 . LEU A 1 817  ? 5.989   31.740 42.633  1.00 25.84  ? 814  LEU A CD2 1 
ATOM 6270 N N   . SER A 1 818  ? 2.080   30.167 38.212  1.00 42.57  ? 815  SER A N   1 
ATOM 6271 C CA  . SER A 1 818  ? 1.776   29.801 36.843  1.00 42.57  ? 815  SER A CA  1 
ATOM 6272 C C   . SER A 1 818  ? 0.288   29.865 36.511  1.00 42.57  ? 815  SER A C   1 
ATOM 6273 O O   . SER A 1 818  ? -0.570  29.581 37.346  1.00 42.57  ? 815  SER A O   1 
ATOM 6274 C CB  . SER A 1 818  ? 2.341   28.422 36.519  1.00 32.81  ? 815  SER A CB  1 
ATOM 6275 O OG  . SER A 1 818  ? 2.413   27.600 37.664  1.00 32.81  ? 815  SER A OG  1 
ATOM 6276 N N   . LEU A 1 819  ? -0.012  30.234 35.282  1.00 28.18  ? 816  LEU A N   1 
ATOM 6277 C CA  . LEU A 1 819  ? -1.391  30.289 34.868  1.00 28.18  ? 816  LEU A CA  1 
ATOM 6278 C C   . LEU A 1 819  ? -1.665  29.729 33.458  1.00 28.18  ? 816  LEU A C   1 
ATOM 6279 O O   . LEU A 1 819  ? -1.096  30.199 32.476  1.00 28.18  ? 816  LEU A O   1 
ATOM 6280 C CB  . LEU A 1 819  ? -1.896  31.713 34.977  1.00 38.14  ? 816  LEU A CB  1 
ATOM 6281 C CG  . LEU A 1 819  ? -3.299  31.946 34.470  1.00 38.14  ? 816  LEU A CG  1 
ATOM 6282 C CD1 . LEU A 1 819  ? -4.210  31.557 35.579  1.00 38.14  ? 816  LEU A CD1 1 
ATOM 6283 C CD2 . LEU A 1 819  ? -3.476  33.386 34.132  1.00 38.14  ? 816  LEU A CD2 1 
ATOM 6284 N N   . VAL A 1 820  ? -2.528  28.731 33.334  1.00 49.76  ? 817  VAL A N   1 
ATOM 6285 C CA  . VAL A 1 820  ? -2.994  28.366 32.010  1.00 49.76  ? 817  VAL A CA  1 
ATOM 6286 C C   . VAL A 1 820  ? -4.508  28.512 31.886  1.00 49.76  ? 817  VAL A C   1 
ATOM 6287 O O   . VAL A 1 820  ? -5.265  28.502 32.873  1.00 49.76  ? 817  VAL A O   1 
ATOM 6288 C CB  . VAL A 1 820  ? -2.590  26.968 31.677  1.00 54.27  ? 817  VAL A CB  1 
ATOM 6289 C CG1 . VAL A 1 820  ? -1.285  26.684 32.324  1.00 54.27  ? 817  VAL A CG1 1 
ATOM 6290 C CG2 . VAL A 1 820  ? -3.614  26.006 32.219  1.00 54.27  ? 817  VAL A CG2 1 
ATOM 6291 N N   . SER A 1 821  ? -4.953  28.644 30.655  1.00 43.09  ? 818  SER A N   1 
ATOM 6292 C CA  . SER A 1 821  ? -6.357  28.609 30.406  1.00 43.09  ? 818  SER A CA  1 
ATOM 6293 C C   . SER A 1 821  ? -6.703  27.521 29.391  1.00 43.09  ? 818  SER A C   1 
ATOM 6294 O O   . SER A 1 821  ? -6.600  27.721 28.182  1.00 43.09  ? 818  SER A O   1 
ATOM 6295 C CB  . SER A 1 821  ? -6.768  29.956 29.908  1.00 39.01  ? 818  SER A CB  1 
ATOM 6296 O OG  . SER A 1 821  ? -8.084  29.869 29.473  1.00 39.01  ? 818  SER A OG  1 
ATOM 6297 N N   . CYS A 1 822  ? -7.125  26.364 29.869  1.00 64.39  ? 819  CYS A N   1 
ATOM 6298 C CA  . CYS A 1 822  ? -7.339  25.260 28.949  1.00 64.39  ? 819  CYS A CA  1 
ATOM 6299 C C   . CYS A 1 822  ? -8.536  24.368 29.256  1.00 64.39  ? 819  CYS A C   1 
ATOM 6300 O O   . CYS A 1 822  ? -8.960  24.274 30.415  1.00 64.39  ? 819  CYS A O   1 
ATOM 6301 C CB  . CYS A 1 822  ? -6.096  24.392 28.950  1.00 46.86  ? 819  CYS A CB  1 
ATOM 6302 S SG  . CYS A 1 822  ? -5.796  23.685 30.579  1.00 46.86  ? 819  CYS A SG  1 
ATOM 6303 N N   . LYS A 1 823  ? -9.050  23.721 28.199  1.00 61.79  ? 820  LYS A N   1 
ATOM 6304 C CA  . LYS A 1 823  ? -9.895  22.512 28.288  1.00 61.79  ? 820  LYS A CA  1 
ATOM 6305 C C   . LYS A 1 823  ? -8.971  21.366 28.631  1.00 61.79  ? 820  LYS A C   1 
ATOM 6306 O O   . LYS A 1 823  ? -7.818  21.372 28.199  1.00 61.79  ? 820  LYS A O   1 
ATOM 6307 C CB  . LYS A 1 823  ? -10.562 22.200 26.939  1.00 58.41  ? 820  LYS A CB  1 
ATOM 6308 C CG  . LYS A 1 823  ? -11.783 23.072 26.637  1.00 58.41  ? 820  LYS A CG  1 
ATOM 6309 C CD  . LYS A 1 823  ? -12.010 23.329 25.141  1.00 58.41  ? 820  LYS A CD  1 
ATOM 6310 C CE  . LYS A 1 823  ? -13.089 22.409 24.537  1.00 58.41  ? 820  LYS A CE  1 
ATOM 6311 N NZ  . LYS A 1 823  ? -14.010 23.166 23.607  1.00 58.41  ? 820  LYS A NZ  1 
ATOM 6312 N N   . LEU A 1 824  ? -9.438  20.387 29.392  1.00 73.32  ? 821  LEU A N   1 
ATOM 6313 C CA  . LEU A 1 824  ? -8.595  19.218 29.649  1.00 73.32  ? 821  LEU A CA  1 
ATOM 6314 C C   . LEU A 1 824  ? -9.345  17.910 29.456  1.00 73.32  ? 821  LEU A C   1 
ATOM 6315 O O   . LEU A 1 824  ? -10.573 17.872 29.626  1.00 73.32  ? 821  LEU A O   1 
ATOM 6316 C CB  . LEU A 1 824  ? -8.047  19.265 31.060  1.00 62.04  ? 821  LEU A CB  1 
ATOM 6317 C CG  . LEU A 1 824  ? -6.882  20.183 31.399  1.00 62.04  ? 821  LEU A CG  1 
ATOM 6318 C CD1 . LEU A 1 824  ? -6.637  20.078 32.892  1.00 62.04  ? 821  LEU A CD1 1 
ATOM 6319 C CD2 . LEU A 1 824  ? -5.618  19.786 30.603  1.00 62.04  ? 821  LEU A CD2 1 
ATOM 6320 N N   . GLY A 1 825  ? -8.614  16.846 29.108  1.00 71.77  ? 822  GLY A N   1 
ATOM 6321 C CA  . GLY A 1 825  ? -9.193  15.500 28.891  1.00 71.77  ? 822  GLY A CA  1 
ATOM 6322 C C   . GLY A 1 825  ? -10.481 15.486 28.081  1.00 71.77  ? 822  GLY A C   1 
ATOM 6323 O O   . GLY A 1 825  ? -10.639 16.287 27.154  1.00 71.77  ? 822  GLY A O   1 
ATOM 6324 N N   . LYS A 1 826  ? -11.409 14.591 28.435  1.00 79.70  ? 823  LYS A N   1 
ATOM 6325 C CA  . LYS A 1 826  ? -12.721 14.524 27.759  1.00 79.70  ? 823  LYS A CA  1 
ATOM 6326 C C   . LYS A 1 826  ? -13.545 15.801 28.013  1.00 79.70  ? 823  LYS A C   1 
ATOM 6327 O O   . LYS A 1 826  ? -14.214 16.313 27.117  1.00 79.70  ? 823  LYS A O   1 
ATOM 6328 C CB  . LYS A 1 826  ? -13.498 13.262 28.190  1.00 100.26 ? 823  LYS A CB  1 
ATOM 6329 C CG  . LYS A 1 826  ? -13.474 12.056 27.193  1.00 100.26 ? 823  LYS A CG  1 
ATOM 6330 C CD  . LYS A 1 826  ? -12.209 11.138 27.284  1.00 100.26 ? 823  LYS A CD  1 
ATOM 6331 C CE  . LYS A 1 826  ? -12.425 9.858  28.123  1.00 100.26 ? 823  LYS A CE  1 
ATOM 6332 N NZ  . LYS A 1 826  ? -11.548 8.712  27.705  1.00 100.26 ? 823  LYS A NZ  1 
ATOM 6333 N N   . ASP A 1 827  ? -13.455 16.282 29.255  1.00 63.46  ? 824  ASP A N   1 
ATOM 6334 C CA  . ASP A 1 827  ? -14.042 17.530 29.798  1.00 63.46  ? 824  ASP A CA  1 
ATOM 6335 C C   . ASP A 1 827  ? -14.195 18.744 28.850  1.00 63.46  ? 824  ASP A C   1 
ATOM 6336 O O   . ASP A 1 827  ? -13.190 19.388 28.478  1.00 63.46  ? 824  ASP A O   1 
ATOM 6337 C CB  . ASP A 1 827  ? -13.202 17.946 31.017  1.00 59.87  ? 824  ASP A CB  1 
ATOM 6338 C CG  . ASP A 1 827  ? -14.021 18.598 32.114  1.00 59.87  ? 824  ASP A CG  1 
ATOM 6339 O OD1 . ASP A 1 827  ? -14.939 19.438 31.828  1.00 59.87  ? 824  ASP A OD1 1 
ATOM 6340 O OD2 . ASP A 1 827  ? -13.718 18.263 33.287  1.00 59.87  ? 824  ASP A OD2 1 
ATOM 6341 N N   . PRO A 1 828  ? -15.458 19.105 28.522  1.00 79.24  ? 825  PRO A N   1 
ATOM 6342 C CA  . PRO A 1 828  ? -15.728 20.140 27.530  1.00 79.24  ? 825  PRO A CA  1 
ATOM 6343 C C   . PRO A 1 828  ? -15.610 21.531 28.130  1.00 79.24  ? 825  PRO A C   1 
ATOM 6344 O O   . PRO A 1 828  ? -15.784 22.517 27.424  1.00 79.24  ? 825  PRO A O   1 
ATOM 6345 C CB  . PRO A 1 828  ? -17.178 19.864 27.142  1.00 119.25 ? 825  PRO A CB  1 
ATOM 6346 C CG  . PRO A 1 828  ? -17.788 19.350 28.391  1.00 119.25 ? 825  PRO A CG  1 
ATOM 6347 C CD  . PRO A 1 828  ? -16.708 18.579 29.108  1.00 119.25 ? 825  PRO A CD  1 
ATOM 6348 N N   . ASN A 1 829  ? -15.340 21.596 29.427  1.00 96.53  ? 826  ASN A N   1 
ATOM 6349 C CA  . ASN A 1 829  ? -15.173 22.849 30.130  1.00 96.53  ? 826  ASN A CA  1 
ATOM 6350 C C   . ASN A 1 829  ? -13.849 23.503 29.837  1.00 96.53  ? 826  ASN A C   1 
ATOM 6351 O O   . ASN A 1 829  ? -12.891 22.801 29.514  1.00 96.53  ? 826  ASN A O   1 
ATOM 6352 C CB  . ASN A 1 829  ? -15.230 22.586 31.613  1.00 62.46  ? 826  ASN A CB  1 
ATOM 6353 C CG  . ASN A 1 829  ? -16.567 22.876 32.181  1.00 62.46  ? 826  ASN A CG  1 
ATOM 6354 O OD1 . ASN A 1 829  ? -17.573 22.772 31.484  1.00 62.46  ? 826  ASN A OD1 1 
ATOM 6355 N ND2 . ASN A 1 829  ? -16.607 23.267 33.452  1.00 62.46  ? 826  ASN A ND2 1 
ATOM 6356 N N   . THR A 1 830  ? -13.782 24.832 29.973  1.00 64.71  ? 827  THR A N   1 
ATOM 6357 C CA  . THR A 1 830  ? -12.520 25.557 29.822  1.00 64.71  ? 827  THR A CA  1 
ATOM 6358 C C   . THR A 1 830  ? -12.080 26.144 31.151  1.00 64.71  ? 827  THR A C   1 
ATOM 6359 O O   . THR A 1 830  ? -12.681 27.086 31.662  1.00 64.71  ? 827  THR A O   1 
ATOM 6360 C CB  . THR A 1 830  ? -12.586 26.639 28.727  1.00 62.30  ? 827  THR A CB  1 
ATOM 6361 O OG1 . THR A 1 830  ? -12.573 26.012 27.443  1.00 62.30  ? 827  THR A OG1 1 
ATOM 6362 C CG2 . THR A 1 830  ? -11.369 27.535 28.789  1.00 62.30  ? 827  THR A CG2 1 
ATOM 6363 N N   . TYR A 1 831  ? -11.018 25.568 31.700  1.00 44.27  ? 828  TYR A N   1 
ATOM 6364 C CA  . TYR A 1 831  ? -10.559 25.905 33.038  1.00 44.27  ? 828  TYR A CA  1 
ATOM 6365 C C   . TYR A 1 831  ? -9.463  26.976 33.042  1.00 44.27  ? 828  TYR A C   1 
ATOM 6366 O O   . TYR A 1 831  ? -8.867  27.277 31.998  1.00 44.27  ? 828  TYR A O   1 
ATOM 6367 C CB  . TYR A 1 831  ? -10.126 24.642 33.816  1.00 72.31  ? 828  TYR A CB  1 
ATOM 6368 C CG  . TYR A 1 831  ? -11.250 23.658 33.989  1.00 72.31  ? 828  TYR A CG  1 
ATOM 6369 C CD1 . TYR A 1 831  ? -11.462 22.668 33.050  1.00 72.31  ? 828  TYR A CD1 1 
ATOM 6370 C CD2 . TYR A 1 831  ? -12.134 23.742 35.063  1.00 72.31  ? 828  TYR A CD2 1 
ATOM 6371 C CE1 . TYR A 1 831  ? -12.515 21.760 33.162  1.00 72.31  ? 828  TYR A CE1 1 
ATOM 6372 C CE2 . TYR A 1 831  ? -13.200 22.830 35.198  1.00 72.31  ? 828  TYR A CE2 1 
ATOM 6373 C CZ  . TYR A 1 831  ? -13.384 21.835 34.231  1.00 72.31  ? 828  TYR A CZ  1 
ATOM 6374 O OH  . TYR A 1 831  ? -14.415 20.911 34.298  1.00 72.31  ? 828  TYR A OH  1 
ATOM 6375 N N   . PHE A 1 832  ? -9.281  27.594 34.214  1.00 41.42  ? 829  PHE A N   1 
ATOM 6376 C CA  . PHE A 1 832  ? -8.117  28.402 34.541  1.00 41.42  ? 829  PHE A CA  1 
ATOM 6377 C C   . PHE A 1 832  ? -7.336  27.598 35.545  1.00 41.42  ? 829  PHE A C   1 
ATOM 6378 O O   . PHE A 1 832  ? -7.772  27.480 36.717  1.00 41.42  ? 829  PHE A O   1 
ATOM 6379 C CB  . PHE A 1 832  ? -8.492  29.689 35.274  1.00 43.14  ? 829  PHE A CB  1 
ATOM 6380 C CG  . PHE A 1 832  ? -8.843  30.799 34.390  1.00 43.14  ? 829  PHE A CG  1 
ATOM 6381 C CD1 . PHE A 1 832  ? -8.094  31.070 33.275  1.00 43.14  ? 829  PHE A CD1 1 
ATOM 6382 C CD2 . PHE A 1 832  ? -9.905  31.602 34.682  1.00 43.14  ? 829  PHE A CD2 1 
ATOM 6383 C CE1 . PHE A 1 832  ? -8.440  32.127 32.446  1.00 43.14  ? 829  PHE A CE1 1 
ATOM 6384 C CE2 . PHE A 1 832  ? -10.259 32.647 33.854  1.00 43.14  ? 829  PHE A CE2 1 
ATOM 6385 C CZ  . PHE A 1 832  ? -9.534  32.912 32.753  1.00 43.14  ? 829  PHE A CZ  1 
ATOM 6386 N N   . ILE A 1 833  ? -6.168  27.087 35.146  1.00 59.99  ? 830  ILE A N   1 
ATOM 6387 C CA  . ILE A 1 833  ? -5.336  26.420 36.129  1.00 59.99  ? 830  ILE A CA  1 
ATOM 6388 C C   . ILE A 1 833  ? -4.222  27.311 36.623  1.00 59.99  ? 830  ILE A C   1 
ATOM 6389 O O   . ILE A 1 833  ? -3.592  27.978 35.828  1.00 59.99  ? 830  ILE A O   1 
ATOM 6390 C CB  . ILE A 1 833  ? -4.786  25.137 35.604  1.00 40.38  ? 830  ILE A CB  1 
ATOM 6391 C CG1 . ILE A 1 833  ? -5.934  24.140 35.367  1.00 40.38  ? 830  ILE A CG1 1 
ATOM 6392 C CG2 . ILE A 1 833  ? -3.823  24.561 36.631  1.00 40.38  ? 830  ILE A CG2 1 
ATOM 6393 C CD1 . ILE A 1 833  ? -5.709  23.235 34.178  1.00 40.38  ? 830  ILE A CD1 1 
ATOM 6394 N N   . VAL A 1 834  ? -4.019  27.318 37.944  1.00 44.50  ? 831  VAL A N   1 
ATOM 6395 C CA  . VAL A 1 834  ? -3.007  28.123 38.629  1.00 44.50  ? 831  VAL A CA  1 
ATOM 6396 C C   . VAL A 1 834  ? -2.127  27.248 39.522  1.00 44.50  ? 831  VAL A C   1 
ATOM 6397 O O   . VAL A 1 834  ? -2.600  26.716 40.516  1.00 44.50  ? 831  VAL A O   1 
ATOM 6398 C CB  . VAL A 1 834  ? -3.697  29.134 39.512  1.00 32.41  ? 831  VAL A CB  1 
ATOM 6399 C CG1 . VAL A 1 834  ? -2.738  29.799 40.468  1.00 32.41  ? 831  VAL A CG1 1 
ATOM 6400 C CG2 . VAL A 1 834  ? -4.317  30.158 38.674  1.00 32.41  ? 831  VAL A CG2 1 
ATOM 6401 N N   . GLY A 1 835  ? -0.854  27.081 39.184  1.00 62.06  ? 832  GLY A N   1 
ATOM 6402 C CA  . GLY A 1 835  ? 0.057   26.373 40.078  1.00 62.06  ? 832  GLY A CA  1 
ATOM 6403 C C   . GLY A 1 835  ? 0.589   27.336 41.119  1.00 62.06  ? 832  GLY A C   1 
ATOM 6404 O O   . GLY A 1 835  ? 0.785   28.513 40.829  1.00 62.06  ? 832  GLY A O   1 
ATOM 6405 N N   . THR A 1 836  ? 0.845   26.843 42.327  1.00 43.01  ? 833  THR A N   1 
ATOM 6406 C CA  . THR A 1 836  ? 1.148   27.725 43.481  1.00 43.01  ? 833  THR A CA  1 
ATOM 6407 C C   . THR A 1 836  ? 2.331   27.231 44.305  1.00 43.01  ? 833  THR A C   1 
ATOM 6408 O O   . THR A 1 836  ? 2.943   26.244 43.918  1.00 43.01  ? 833  THR A O   1 
ATOM 6409 C CB  . THR A 1 836  ? -0.071  27.856 44.430  1.00 48.66  ? 833  THR A CB  1 
ATOM 6410 O OG1 . THR A 1 836  ? -0.325  26.591 45.063  1.00 48.66  ? 833  THR A OG1 1 
ATOM 6411 C CG2 . THR A 1 836  ? -1.323  28.320 43.661  1.00 48.66  ? 833  THR A CG2 1 
ATOM 6412 N N   . ALA A 1 837  ? 2.619   27.876 45.439  1.00 43.58  ? 834  ALA A N   1 
ATOM 6413 C CA  . ALA A 1 837  ? 3.812   27.549 46.211  1.00 43.58  ? 834  ALA A CA  1 
ATOM 6414 C C   . ALA A 1 837  ? 3.820   28.195 47.607  1.00 43.58  ? 834  ALA A C   1 
ATOM 6415 O O   . ALA A 1 837  ? 3.503   29.373 47.754  1.00 43.58  ? 834  ALA A O   1 
ATOM 6416 C CB  . ALA A 1 837  ? 5.026   27.977 45.446  1.00 28.10  ? 834  ALA A CB  1 
ATOM 6417 N N   . MET A 1 838  ? 4.158   27.448 48.649  1.00 43.26  ? 835  MET A N   1 
ATOM 6418 C CA  . MET A 1 838  ? 4.093   28.056 49.958  1.00 43.26  ? 835  MET A CA  1 
ATOM 6419 C C   . MET A 1 838  ? 5.461   28.571 50.221  1.00 43.26  ? 835  MET A C   1 
ATOM 6420 O O   . MET A 1 838  ? 6.438   27.937 49.855  1.00 43.26  ? 835  MET A O   1 
ATOM 6421 C CB  . MET A 1 838  ? 3.683   27.065 51.028  1.00 40.93  ? 835  MET A CB  1 
ATOM 6422 C CG  . MET A 1 838  ? 2.396   26.304 50.738  1.00 40.93  ? 835  MET A CG  1 
ATOM 6423 S SD  . MET A 1 838  ? 0.895   27.326 50.651  1.00 40.93  ? 835  MET A SD  1 
ATOM 6424 C CE  . MET A 1 838  ? 1.123   28.480 52.022  1.00 40.93  ? 835  MET A CE  1 
ATOM 6425 N N   . VAL A 1 839  ? 5.587   29.725 50.820  1.00 49.19  ? 836  VAL A N   1 
ATOM 6426 C CA  . VAL A 1 839  ? 6.885   30.301 50.778  1.00 49.19  ? 836  VAL A CA  1 
ATOM 6427 C C   . VAL A 1 839  ? 7.124   30.952 52.092  1.00 49.19  ? 836  VAL A C   1 
ATOM 6428 O O   . VAL A 1 839  ? 6.279   31.715 52.535  1.00 49.19  ? 836  VAL A O   1 
ATOM 6429 C CB  . VAL A 1 839  ? 7.010   31.332 49.625  1.00 35.26  ? 836  VAL A CB  1 
ATOM 6430 C CG1 . VAL A 1 839  ? 8.341   32.033 49.678  1.00 35.26  ? 836  VAL A CG1 1 
ATOM 6431 C CG2 . VAL A 1 839  ? 6.823   30.643 48.258  1.00 35.26  ? 836  VAL A CG2 1 
ATOM 6432 N N   . TYR A 1 840  ? 8.270   30.654 52.714  1.00 66.23  ? 837  TYR A N   1 
ATOM 6433 C CA  . TYR A 1 840  ? 8.655   31.251 53.981  1.00 66.23  ? 837  TYR A CA  1 
ATOM 6434 C C   . TYR A 1 840  ? 10.099  31.669 53.903  1.00 66.23  ? 837  TYR A C   1 
ATOM 6435 O O   . TYR A 1 840  ? 10.955  30.857 53.553  1.00 66.23  ? 837  TYR A O   1 
ATOM 6436 C CB  . TYR A 1 840  ? 8.463   30.238 55.076  1.00 34.06  ? 837  TYR A CB  1 
ATOM 6437 C CG  . TYR A 1 840  ? 7.083   29.622 55.051  1.00 34.06  ? 837  TYR A CG  1 
ATOM 6438 C CD1 . TYR A 1 840  ? 6.876   28.336 54.580  1.00 34.06  ? 837  TYR A CD1 1 
ATOM 6439 C CD2 . TYR A 1 840  ? 5.961   30.361 55.482  1.00 34.06  ? 837  TYR A CD2 1 
ATOM 6440 C CE1 . TYR A 1 840  ? 5.577   27.786 54.543  1.00 34.06  ? 837  TYR A CE1 1 
ATOM 6441 C CE2 . TYR A 1 840  ? 4.673   29.827 55.451  1.00 34.06  ? 837  TYR A CE2 1 
ATOM 6442 C CZ  . TYR A 1 840  ? 4.484   28.552 54.999  1.00 34.06  ? 837  TYR A CZ  1 
ATOM 6443 O OH  . TYR A 1 840  ? 3.182   28.054 54.973  1.00 34.06  ? 837  TYR A OH  1 
ATOM 6444 N N   . PRO A 1 841  ? 10.379  32.956 54.192  1.00 87.42  ? 838  PRO A N   1 
ATOM 6445 C CA  . PRO A 1 841  ? 11.703  33.602 54.076  1.00 87.42  ? 838  PRO A CA  1 
ATOM 6446 C C   . PRO A 1 841  ? 12.852  32.771 54.605  1.00 87.42  ? 838  PRO A C   1 
ATOM 6447 O O   . PRO A 1 841  ? 13.961  32.864 54.078  1.00 87.42  ? 838  PRO A O   1 
ATOM 6448 C CB  . PRO A 1 841  ? 11.540  34.868 54.915  1.00 81.86  ? 838  PRO A CB  1 
ATOM 6449 C CG  . PRO A 1 841  ? 10.116  35.243 54.671  1.00 81.86  ? 838  PRO A CG  1 
ATOM 6450 C CD  . PRO A 1 841  ? 9.350   33.923 54.624  1.00 81.86  ? 838  PRO A CD  1 
ATOM 6451 N N   . GLU A 1 842  ? 12.569  31.985 55.645  1.00 81.45  ? 839  GLU A N   1 
ATOM 6452 C CA  . GLU A 1 842  ? 13.516  31.052 56.243  1.00 81.45  ? 839  GLU A CA  1 
ATOM 6453 C C   . GLU A 1 842  ? 13.895  29.994 55.217  1.00 81.45  ? 839  GLU A C   1 
ATOM 6454 O O   . GLU A 1 842  ? 15.006  30.036 54.671  1.00 81.45  ? 839  GLU A O   1 
ATOM 6455 C CB  . GLU A 1 842  ? 12.936  30.410 57.515  1.00 97.64  ? 839  GLU A CB  1 
ATOM 6456 C CG  . GLU A 1 842  ? 11.423  30.079 57.482  1.00 97.64  ? 839  GLU A CG  1 
ATOM 6457 C CD  . GLU A 1 842  ? 10.535  31.295 57.787  1.00 97.64  ? 839  GLU A CD  1 
ATOM 6458 O OE1 . GLU A 1 842  ? 10.062  31.433 58.943  1.00 97.64  ? 839  GLU A OE1 1 
ATOM 6459 O OE2 . GLU A 1 842  ? 10.315  32.123 56.875  1.00 97.64  ? 839  GLU A OE2 1 
ATOM 6460 N N   . GLU A 1 843  ? 12.956  29.087 54.932  1.00 72.67  ? 840  GLU A N   1 
ATOM 6461 C CA  . GLU A 1 843  ? 13.140  28.023 53.946  1.00 72.67  ? 840  GLU A CA  1 
ATOM 6462 C C   . GLU A 1 843  ? 13.793  28.506 52.668  1.00 72.67  ? 840  GLU A C   1 
ATOM 6463 O O   . GLU A 1 843  ? 13.440  29.552 52.151  1.00 72.67  ? 840  GLU A O   1 
ATOM 6464 C CB  . GLU A 1 843  ? 11.819  27.380 53.599  1.00 71.83  ? 840  GLU A CB  1 
ATOM 6465 C CG  . GLU A 1 843  ? 10.986  27.089 54.795  1.00 71.83  ? 840  GLU A CG  1 
ATOM 6466 C CD  . GLU A 1 843  ? 9.904   26.098 54.481  1.00 71.83  ? 840  GLU A CD  1 
ATOM 6467 O OE1 . GLU A 1 843  ? 9.163   25.691 55.415  1.00 71.83  ? 840  GLU A OE1 1 
ATOM 6468 O OE2 . GLU A 1 843  ? 9.792   25.720 53.291  1.00 71.83  ? 840  GLU A OE2 1 
ATOM 6469 N N   . ALA A 1 844  ? 14.748  27.726 52.172  1.00 69.73  ? 841  ALA A N   1 
ATOM 6470 C CA  . ALA A 1 844  ? 15.589  28.116 51.050  1.00 69.73  ? 841  ALA A CA  1 
ATOM 6471 C C   . ALA A 1 844  ? 14.795  28.044 49.754  1.00 69.73  ? 841  ALA A C   1 
ATOM 6472 O O   . ALA A 1 844  ? 15.186  28.588 48.716  1.00 69.73  ? 841  ALA A O   1 
ATOM 6473 C CB  . ALA A 1 844  ? 16.779  27.197 50.979  1.00 55.25  ? 841  ALA A CB  1 
ATOM 6474 N N   . GLU A 1 845  ? 13.657  27.382 49.835  1.00 56.85  ? 842  GLU A N   1 
ATOM 6475 C CA  . GLU A 1 845  ? 13.008  26.890 48.652  1.00 56.85  ? 842  GLU A CA  1 
ATOM 6476 C C   . GLU A 1 845  ? 11.799  26.079 49.149  1.00 56.85  ? 842  GLU A C   1 
ATOM 6477 O O   . GLU A 1 845  ? 11.944  25.205 50.030  1.00 56.85  ? 842  GLU A O   1 
ATOM 6478 C CB  . GLU A 1 845  ? 13.994  26.043 47.849  1.00 57.53  ? 842  GLU A CB  1 
ATOM 6479 C CG  . GLU A 1 845  ? 13.418  25.345 46.659  1.00 57.53  ? 842  GLU A CG  1 
ATOM 6480 C CD  . GLU A 1 845  ? 14.422  24.345 46.016  1.00 57.53  ? 842  GLU A CD  1 
ATOM 6481 O OE1 . GLU A 1 845  ? 15.327  23.803 46.733  1.00 57.53  ? 842  GLU A OE1 1 
ATOM 6482 O OE2 . GLU A 1 845  ? 14.282  24.107 44.775  1.00 57.53  ? 842  GLU A OE2 1 
ATOM 6483 N N   . PRO A 1 846  ? 10.588  26.417 48.648  1.00 79.63  ? 843  PRO A N   1 
ATOM 6484 C CA  . PRO A 1 846  ? 9.414   25.734 49.141  1.00 79.63  ? 843  PRO A CA  1 
ATOM 6485 C C   . PRO A 1 846  ? 9.472   24.241 48.866  1.00 79.63  ? 843  PRO A C   1 
ATOM 6486 O O   . PRO A 1 846  ? 10.004  23.814 47.835  1.00 79.63  ? 843  PRO A O   1 
ATOM 6487 C CB  . PRO A 1 846  ? 8.275   26.393 48.351  1.00 37.95  ? 843  PRO A CB  1 
ATOM 6488 C CG  . PRO A 1 846  ? 8.920   26.917 47.142  1.00 37.95  ? 843  PRO A CG  1 
ATOM 6489 C CD  . PRO A 1 846  ? 10.216  27.436 47.649  1.00 37.95  ? 843  PRO A CD  1 
ATOM 6490 N N   . LYS A 1 847  ? 8.945   23.486 49.828  1.00 72.67  ? 844  LYS A N   1 
ATOM 6491 C CA  . LYS A 1 847  ? 8.740   22.055 49.729  1.00 72.67  ? 844  LYS A CA  1 
ATOM 6492 C C   . LYS A 1 847  ? 7.251   21.740 49.544  1.00 72.67  ? 844  LYS A C   1 
ATOM 6493 O O   . LYS A 1 847  ? 6.854   20.580 49.618  1.00 72.67  ? 844  LYS A O   1 
ATOM 6494 C CB  . LYS A 1 847  ? 9.308   21.333 50.972  1.00 179.48 ? 844  LYS A CB  1 
ATOM 6495 C CG  . LYS A 1 847  ? 8.484   21.458 52.273  1.00 179.48 ? 844  LYS A CG  1 
ATOM 6496 C CD  . LYS A 1 847  ? 8.650   22.827 52.921  1.00 179.48 ? 844  LYS A CD  1 
ATOM 6497 C CE  . LYS A 1 847  ? 7.421   23.228 53.741  1.00 179.48 ? 844  LYS A CE  1 
ATOM 6498 N NZ  . LYS A 1 847  ? 7.080   24.687 53.582  1.00 179.48 ? 844  LYS A NZ  1 
ATOM 6499 N N   . GLN A 1 848  ? 6.422   22.755 49.300  1.00 66.35  ? 845  GLN A N   1 
ATOM 6500 C CA  . GLN A 1 848  ? 4.999   22.505 49.055  1.00 66.35  ? 845  GLN A CA  1 
ATOM 6501 C C   . GLN A 1 848  ? 4.233   23.614 48.344  1.00 66.35  ? 845  GLN A C   1 
ATOM 6502 O O   . GLN A 1 848  ? 4.457   24.806 48.576  1.00 66.35  ? 845  GLN A O   1 
ATOM 6503 C CB  . GLN A 1 848  ? 4.307   22.210 50.360  1.00 76.38  ? 845  GLN A CB  1 
ATOM 6504 C CG  . GLN A 1 848  ? 4.755   23.133 51.425  1.00 76.38  ? 845  GLN A CG  1 
ATOM 6505 C CD  . GLN A 1 848  ? 3.912   23.016 52.638  1.00 76.38  ? 845  GLN A CD  1 
ATOM 6506 O OE1 . GLN A 1 848  ? 3.867   23.929 53.461  1.00 76.38  ? 845  GLN A OE1 1 
ATOM 6507 N NE2 . GLN A 1 848  ? 3.221   21.891 52.769  1.00 76.38  ? 845  GLN A NE2 1 
ATOM 6508 N N   . GLY A 1 849  ? 3.313   23.196 47.484  1.00 44.76  ? 846  GLY A N   1 
ATOM 6509 C CA  . GLY A 1 849  ? 2.394   24.102 46.807  1.00 44.76  ? 846  GLY A CA  1 
ATOM 6510 C C   . GLY A 1 849  ? 1.275   23.263 46.200  1.00 44.76  ? 846  GLY A C   1 
ATOM 6511 O O   . GLY A 1 849  ? 1.181   22.063 46.444  1.00 44.76  ? 846  GLY A O   1 
ATOM 6512 N N   . ARG A 1 850  ? 0.420   23.873 45.400  1.00 52.76  ? 847  ARG A N   1 
ATOM 6513 C CA  . ARG A 1 850  ? -0.707  23.131 44.875  1.00 52.76  ? 847  ARG A CA  1 
ATOM 6514 C C   . ARG A 1 850  ? -1.123  23.644 43.518  1.00 52.76  ? 847  ARG A C   1 
ATOM 6515 O O   . ARG A 1 850  ? -1.083  24.837 43.261  1.00 52.76  ? 847  ARG A O   1 
ATOM 6516 C CB  . ARG A 1 850  ? -1.903  23.130 45.863  1.00 67.24  ? 847  ARG A CB  1 
ATOM 6517 C CG  . ARG A 1 850  ? -2.270  24.485 46.436  1.00 67.24  ? 847  ARG A CG  1 
ATOM 6518 C CD  . ARG A 1 850  ? -3.334  24.437 47.546  1.00 67.24  ? 847  ARG A CD  1 
ATOM 6519 N NE  . ARG A 1 850  ? -3.752  25.799 47.948  1.00 67.24  ? 847  ARG A NE  1 
ATOM 6520 C CZ  . ARG A 1 850  ? -4.934  26.361 47.657  1.00 67.24  ? 847  ARG A CZ  1 
ATOM 6521 N NH1 . ARG A 1 850  ? -5.855  25.679 46.976  1.00 67.24  ? 847  ARG A NH1 1 
ATOM 6522 N NH2 . ARG A 1 850  ? -5.199  27.604 48.059  1.00 67.24  ? 847  ARG A NH2 1 
ATOM 6523 N N   . ILE A 1 851  ? -1.493  22.727 42.651  1.00 49.57  ? 848  ILE A N   1 
ATOM 6524 C CA  . ILE A 1 851  ? -2.176  23.073 41.450  1.00 49.57  ? 848  ILE A CA  1 
ATOM 6525 C C   . ILE A 1 851  ? -3.689  23.181 41.721  1.00 49.57  ? 848  ILE A C   1 
ATOM 6526 O O   . ILE A 1 851  ? -4.254  22.287 42.329  1.00 49.57  ? 848  ILE A O   1 
ATOM 6527 C CB  . ILE A 1 851  ? -1.953  21.973 40.491  1.00 32.06  ? 848  ILE A CB  1 
ATOM 6528 C CG1 . ILE A 1 851  ? -0.472  21.843 40.207  1.00 32.06  ? 848  ILE A CG1 1 
ATOM 6529 C CG2 . ILE A 1 851  ? -2.759  22.160 39.190  1.00 32.06  ? 848  ILE A CG2 1 
ATOM 6530 C CD1 . ILE A 1 851  ? -0.188  20.512 39.552  1.00 32.06  ? 848  ILE A CD1 1 
ATOM 6531 N N   . VAL A 1 852  ? -4.340  24.253 41.254  1.00 50.56  ? 849  VAL A N   1 
ATOM 6532 C CA  . VAL A 1 852  ? -5.764  24.498 41.499  1.00 50.56  ? 849  VAL A CA  1 
ATOM 6533 C C   . VAL A 1 852  ? -6.495  24.712 40.183  1.00 50.56  ? 849  VAL A C   1 
ATOM 6534 O O   . VAL A 1 852  ? -6.005  25.434 39.307  1.00 50.56  ? 849  VAL A O   1 
ATOM 6535 C CB  . VAL A 1 852  ? -5.987  25.768 42.314  1.00 34.05  ? 849  VAL A CB  1 
ATOM 6536 C CG1 . VAL A 1 852  ? -7.437  25.877 42.733  1.00 34.05  ? 849  VAL A CG1 1 
ATOM 6537 C CG2 . VAL A 1 852  ? -5.021  25.865 43.562  1.00 34.05  ? 849  VAL A CG2 1 
ATOM 6538 N N   . VAL A 1 853  ? -7.666  24.102 40.045  1.00 71.53  ? 850  VAL A N   1 
ATOM 6539 C CA  . VAL A 1 853  ? -8.413  24.168 38.804  1.00 71.53  ? 850  VAL A CA  1 
ATOM 6540 C C   . VAL A 1 853  ? -9.710  24.887 39.042  1.00 71.53  ? 850  VAL A C   1 
ATOM 6541 O O   . VAL A 1 853  ? -10.523 24.450 39.813  1.00 71.53  ? 850  VAL A O   1 
ATOM 6542 C CB  . VAL A 1 853  ? -8.688  22.773 38.250  1.00 35.16  ? 850  VAL A CB  1 
ATOM 6543 C CG1 . VAL A 1 853  ? -9.115  22.821 36.754  1.00 35.16  ? 850  VAL A CG1 1 
ATOM 6544 C CG2 . VAL A 1 853  ? -7.459  21.948 38.383  1.00 35.16  ? 850  VAL A CG2 1 
ATOM 6545 N N   . PHE A 1 854  ? -9.880  26.003 38.363  1.00 54.17  ? 851  PHE A N   1 
ATOM 6546 C CA  . PHE A 1 854  ? -10.985 26.885 38.565  1.00 54.17  ? 851  PHE A CA  1 
ATOM 6547 C C   . PHE A 1 854  ? -11.764 27.012 37.280  1.00 54.17  ? 851  PHE A C   1 
ATOM 6548 O O   . PHE A 1 854  ? -11.265 26.770 36.171  1.00 54.17  ? 851  PHE A O   1 
ATOM 6549 C CB  . PHE A 1 854  ? -10.501 28.287 38.779  1.00 49.93  ? 851  PHE A CB  1 
ATOM 6550 C CG  . PHE A 1 854  ? -9.702  28.535 40.021  1.00 49.93  ? 851  PHE A CG  1 
ATOM 6551 C CD1 . PHE A 1 854  ? -8.333  28.659 39.950  1.00 49.93  ? 851  PHE A CD1 1 
ATOM 6552 C CD2 . PHE A 1 854  ? -10.326 28.841 41.213  1.00 49.93  ? 851  PHE A CD2 1 
ATOM 6553 C CE1 . PHE A 1 854  ? -7.598  28.995 41.085  1.00 49.93  ? 851  PHE A CE1 1 
ATOM 6554 C CE2 . PHE A 1 854  ? -9.606  29.180 42.339  1.00 49.93  ? 851  PHE A CE2 1 
ATOM 6555 C CZ  . PHE A 1 854  ? -8.249  29.254 42.281  1.00 49.93  ? 851  PHE A CZ  1 
ATOM 6556 N N   . GLN A 1 855  ? -12.995 27.465 37.447  1.00 76.12  ? 852  GLN A N   1 
ATOM 6557 C CA  . GLN A 1 855  ? -13.838 27.835 36.338  1.00 76.12  ? 852  GLN A CA  1 
ATOM 6558 C C   . GLN A 1 855  ? -14.630 29.087 36.688  1.00 76.12  ? 852  GLN A C   1 
ATOM 6559 O O   . GLN A 1 855  ? -15.112 29.283 37.822  1.00 76.12  ? 852  GLN A O   1 
ATOM 6560 C CB  . GLN A 1 855  ? -14.758 26.694 35.939  1.00 60.58  ? 852  GLN A CB  1 
ATOM 6561 C CG  . GLN A 1 855  ? -15.807 27.080 34.931  1.00 60.58  ? 852  GLN A CG  1 
ATOM 6562 C CD  . GLN A 1 855  ? -16.717 25.927 34.600  1.00 60.58  ? 852  GLN A CD  1 
ATOM 6563 O OE1 . GLN A 1 855  ? -17.108 25.145 35.482  1.00 60.58  ? 852  GLN A OE1 1 
ATOM 6564 N NE2 . GLN A 1 855  ? -17.059 25.799 33.322  1.00 60.58  ? 852  GLN A NE2 1 
ATOM 6565 N N   . TYR A 1 856  ? -14.710 29.938 35.675  1.00 50.40  ? 853  TYR A N   1 
ATOM 6566 C CA  . TYR A 1 856  ? -15.470 31.181 35.706  1.00 50.40  ? 853  TYR A CA  1 
ATOM 6567 C C   . TYR A 1 856  ? -16.758 31.026 34.851  1.00 50.40  ? 853  TYR A C   1 
ATOM 6568 O O   . TYR A 1 856  ? -16.704 30.521 33.712  1.00 50.40  ? 853  TYR A O   1 
ATOM 6569 C CB  . TYR A 1 856  ? -14.564 32.345 35.251  1.00 55.41  ? 853  TYR A CB  1 
ATOM 6570 C CG  . TYR A 1 856  ? -15.150 33.732 35.427  1.00 55.41  ? 853  TYR A CG  1 
ATOM 6571 C CD1 . TYR A 1 856  ? -15.322 34.301 36.706  1.00 55.41  ? 853  TYR A CD1 1 
ATOM 6572 C CD2 . TYR A 1 856  ? -15.524 34.497 34.307  1.00 55.41  ? 853  TYR A CD2 1 
ATOM 6573 C CE1 . TYR A 1 856  ? -15.872 35.598 36.860  1.00 55.41  ? 853  TYR A CE1 1 
ATOM 6574 C CE2 . TYR A 1 856  ? -16.072 35.796 34.456  1.00 55.41  ? 853  TYR A CE2 1 
ATOM 6575 C CZ  . TYR A 1 856  ? -16.238 36.331 35.729  1.00 55.41  ? 853  TYR A CZ  1 
ATOM 6576 O OH  . TYR A 1 856  ? -16.774 37.584 35.841  1.00 55.41  ? 853  TYR A OH  1 
ATOM 6577 N N   . SER A 1 857  ? -17.883 31.477 35.415  1.00 134.44 ? 854  SER A N   1 
ATOM 6578 C CA  . SER A 1 857  ? -19.234 31.162 34.930  1.00 134.44 ? 854  SER A CA  1 
ATOM 6579 C C   . SER A 1 857  ? -19.954 32.306 34.222  1.00 134.44 ? 854  SER A C   1 
ATOM 6580 O O   . SER A 1 857  ? -19.408 32.971 33.332  1.00 134.44 ? 854  SER A O   1 
ATOM 6581 C CB  . SER A 1 857  ? -20.099 30.749 36.121  1.00 81.58  ? 854  SER A CB  1 
ATOM 6582 O OG  . SER A 1 857  ? -19.476 29.724 36.877  1.00 81.58  ? 854  SER A OG  1 
ATOM 6583 N N   . ASP A 1 858  ? -21.210 32.492 34.627  1.00 136.46 ? 855  ASP A N   1 
ATOM 6584 C CA  . ASP A 1 858  ? -21.991 33.673 34.299  1.00 136.46 ? 855  ASP A CA  1 
ATOM 6585 C C   . ASP A 1 858  ? -21.344 34.883 34.976  1.00 136.46 ? 855  ASP A C   1 
ATOM 6586 O O   . ASP A 1 858  ? -21.503 36.019 34.522  1.00 136.46 ? 855  ASP A O   1 
ATOM 6587 C CB  . ASP A 1 858  ? -23.442 33.521 34.796  1.00 121.33 ? 855  ASP A CB  1 
ATOM 6588 C CG  . ASP A 1 858  ? -24.378 32.827 33.775  1.00 121.33 ? 855  ASP A CG  1 
ATOM 6589 O OD1 . ASP A 1 858  ? -24.049 31.727 33.280  1.00 121.33 ? 855  ASP A OD1 1 
ATOM 6590 O OD2 . ASP A 1 858  ? -25.473 33.370 33.492  1.00 121.33 ? 855  ASP A OD2 1 
ATOM 6591 N N   . GLY A 1 859  ? -20.616 34.622 36.063  1.00 78.67  ? 856  GLY A N   1 
ATOM 6592 C CA  . GLY A 1 859  ? -19.949 35.655 36.859  1.00 78.67  ? 856  GLY A CA  1 
ATOM 6593 C C   . GLY A 1 859  ? -19.283 35.044 38.084  1.00 78.67  ? 856  GLY A C   1 
ATOM 6594 O O   . GLY A 1 859  ? -18.742 35.755 38.954  1.00 78.67  ? 856  GLY A O   1 
ATOM 6595 N N   . LYS A 1 860  ? -19.309 33.714 38.138  1.00 60.63  ? 857  LYS A N   1 
ATOM 6596 C CA  . LYS A 1 860  ? -18.786 32.989 39.292  1.00 60.63  ? 857  LYS A CA  1 
ATOM 6597 C C   . LYS A 1 860  ? -17.365 32.425 39.061  1.00 60.63  ? 857  LYS A C   1 
ATOM 6598 O O   . LYS A 1 860  ? -17.002 32.081 37.932  1.00 60.63  ? 857  LYS A O   1 
ATOM 6599 C CB  . LYS A 1 860  ? -19.746 31.847 39.694  1.00 154.07 ? 857  LYS A CB  1 
ATOM 6600 C CG  . LYS A 1 860  ? -21.125 31.829 39.009  1.00 154.07 ? 857  LYS A CG  1 
ATOM 6601 C CD  . LYS A 1 860  ? -22.134 32.756 39.644  1.00 154.07 ? 857  LYS A CD  1 
ATOM 6602 C CE  . LYS A 1 860  ? -23.357 32.851 38.768  1.00 154.07 ? 857  LYS A CE  1 
ATOM 6603 N NZ  . LYS A 1 860  ? -24.090 34.113 39.004  1.00 154.07 ? 857  LYS A NZ  1 
ATOM 6604 N N   . LEU A 1 861  ? -16.581 32.322 40.135  1.00 69.53  ? 858  LEU A N   1 
ATOM 6605 C CA  . LEU A 1 861  ? -15.317 31.585 40.099  1.00 69.53  ? 858  LEU A CA  1 
ATOM 6606 C C   . LEU A 1 861  ? -15.387 30.434 41.114  1.00 69.53  ? 858  LEU A C   1 
ATOM 6607 O O   . LEU A 1 861  ? -15.414 30.649 42.321  1.00 69.53  ? 858  LEU A O   1 
ATOM 6608 C CB  . LEU A 1 861  ? -14.118 32.529 40.371  1.00 44.45  ? 858  LEU A CB  1 
ATOM 6609 C CG  . LEU A 1 861  ? -12.715 32.448 39.700  1.00 44.45  ? 858  LEU A CG  1 
ATOM 6610 C CD1 . LEU A 1 861  ? -11.566 32.108 40.664  1.00 44.45  ? 858  LEU A CD1 1 
ATOM 6611 C CD2 . LEU A 1 861  ? -12.682 31.557 38.414  1.00 44.45  ? 858  LEU A CD2 1 
ATOM 6612 N N   . GLN A 1 862  ? -15.431 29.205 40.623  1.00 48.40  ? 859  GLN A N   1 
ATOM 6613 C CA  . GLN A 1 862  ? -15.531 28.063 41.521  1.00 48.40  ? 859  GLN A CA  1 
ATOM 6614 C C   . GLN A 1 862  ? -14.211 27.237 41.555  1.00 48.40  ? 859  GLN A C   1 
ATOM 6615 O O   . GLN A 1 862  ? -13.694 26.822 40.499  1.00 48.40  ? 859  GLN A O   1 
ATOM 6616 C CB  . GLN A 1 862  ? -16.709 27.202 41.083  1.00 113.97 ? 859  GLN A CB  1 
ATOM 6617 C CG  . GLN A 1 862  ? -17.292 26.288 42.146  1.00 113.97 ? 859  GLN A CG  1 
ATOM 6618 C CD  . GLN A 1 862  ? -18.233 25.246 41.539  1.00 113.97 ? 859  GLN A CD  1 
ATOM 6619 O OE1 . GLN A 1 862  ? -18.452 25.222 40.322  1.00 113.97 ? 859  GLN A OE1 1 
ATOM 6620 N NE2 . GLN A 1 862  ? -18.790 24.381 42.382  1.00 113.97 ? 859  GLN A NE2 1 
ATOM 6621 N N   . THR A 1 863  ? -13.670 27.019 42.759  1.00 59.68  ? 860  THR A N   1 
ATOM 6622 C CA  . THR A 1 863  ? -12.592 26.048 42.964  1.00 59.68  ? 860  THR A CA  1 
ATOM 6623 C C   . THR A 1 863  ? -13.055 24.627 42.493  1.00 59.68  ? 860  THR A C   1 
ATOM 6624 O O   . THR A 1 863  ? -13.549 23.832 43.310  1.00 59.68  ? 860  THR A O   1 
ATOM 6625 C CB  . THR A 1 863  ? -12.132 26.014 44.477  1.00 51.56  ? 860  THR A CB  1 
ATOM 6626 O OG1 . THR A 1 863  ? -11.921 27.338 44.991  1.00 51.56  ? 860  THR A OG1 1 
ATOM 6627 C CG2 . THR A 1 863  ? -10.863 25.181 44.650  1.00 51.56  ? 860  THR A CG2 1 
ATOM 6628 N N   . VAL A 1 864  ? -12.915 24.323 41.193  1.00 53.03  ? 861  VAL A N   1 
ATOM 6629 C CA  . VAL A 1 864  ? -13.386 23.059 40.596  1.00 53.03  ? 861  VAL A CA  1 
ATOM 6630 C C   . VAL A 1 864  ? -12.683 21.805 41.100  1.00 53.03  ? 861  VAL A C   1 
ATOM 6631 O O   . VAL A 1 864  ? -13.192 20.715 40.895  1.00 53.03  ? 861  VAL A O   1 
ATOM 6632 C CB  . VAL A 1 864  ? -13.256 23.053 39.022  1.00 47.27  ? 861  VAL A CB  1 
ATOM 6633 C CG1 . VAL A 1 864  ? -13.621 21.685 38.385  1.00 47.27  ? 861  VAL A CG1 1 
ATOM 6634 C CG2 . VAL A 1 864  ? -14.085 24.130 38.394  1.00 47.27  ? 861  VAL A CG2 1 
ATOM 6635 N N   . ALA A 1 865  ? -11.518 21.945 41.731  1.00 58.39  ? 862  ALA A N   1 
ATOM 6636 C CA  . ALA A 1 865  ? -10.648 20.807 42.098  1.00 58.39  ? 862  ALA A CA  1 
ATOM 6637 C C   . ALA A 1 865  ? -9.319  21.323 42.592  1.00 58.39  ? 862  ALA A C   1 
ATOM 6638 O O   . ALA A 1 865  ? -8.844  22.314 42.070  1.00 58.39  ? 862  ALA A O   1 
ATOM 6639 C CB  . ALA A 1 865  ? -10.390 19.961 40.904  1.00 47.79  ? 862  ALA A CB  1 
ATOM 6640 N N   . GLU A 1 866  ? -8.704  20.671 43.573  1.00 77.52  ? 863  GLU A N   1 
ATOM 6641 C CA  . GLU A 1 866  ? -7.344  21.053 43.951  1.00 77.52  ? 863  GLU A CA  1 
ATOM 6642 C C   . GLU A 1 866  ? -6.360  19.881 43.810  1.00 77.52  ? 863  GLU A C   1 
ATOM 6643 O O   . GLU A 1 866  ? -6.727  18.868 43.187  1.00 77.52  ? 863  GLU A O   1 
ATOM 6644 C CB  . GLU A 1 866  ? -7.287  21.804 45.296  1.00 69.84  ? 863  GLU A CB  1 
ATOM 6645 C CG  . GLU A 1 866  ? -7.592  21.036 46.583  1.00 69.84  ? 863  GLU A CG  1 
ATOM 6646 C CD  . GLU A 1 866  ? -7.323  21.887 47.863  1.00 69.84  ? 863  GLU A CD  1 
ATOM 6647 O OE1 . GLU A 1 866  ? -6.399  22.740 47.839  1.00 69.84  ? 863  GLU A OE1 1 
ATOM 6648 O OE2 . GLU A 1 866  ? -8.015  21.714 48.903  1.00 69.84  ? 863  GLU A OE2 1 
ATOM 6649 N N   . LYS A 1 867  ? -5.125  20.023 44.323  1.00 53.92  ? 864  LYS A N   1 
ATOM 6650 C CA  . LYS A 1 867  ? -4.094  18.982 44.179  1.00 53.92  ? 864  LYS A CA  1 
ATOM 6651 C C   . LYS A 1 867  ? -2.789  19.378 44.840  1.00 53.92  ? 864  LYS A C   1 
ATOM 6652 O O   . LYS A 1 867  ? -2.120  20.255 44.348  1.00 53.92  ? 864  LYS A O   1 
ATOM 6653 C CB  . LYS A 1 867  ? -3.810  18.690 42.710  1.00 79.58  ? 864  LYS A CB  1 
ATOM 6654 C CG  . LYS A 1 867  ? -2.813  17.568 42.489  1.00 79.58  ? 864  LYS A CG  1 
ATOM 6655 C CD  . LYS A 1 867  ? -3.513  16.244 42.315  1.00 79.58  ? 864  LYS A CD  1 
ATOM 6656 C CE  . LYS A 1 867  ? -2.511  15.124 42.137  1.00 79.58  ? 864  LYS A CE  1 
ATOM 6657 N NZ  . LYS A 1 867  ? -3.186  13.846 41.790  1.00 79.58  ? 864  LYS A NZ  1 
ATOM 6658 N N   . GLU A 1 868  ? -2.401  18.720 45.927  1.00 57.05  ? 865  GLU A N   1 
ATOM 6659 C CA  . GLU A 1 868  ? -1.199  19.108 46.625  1.00 57.05  ? 865  GLU A CA  1 
ATOM 6660 C C   . GLU A 1 868  ? -0.014  18.763 45.749  1.00 57.05  ? 865  GLU A C   1 
ATOM 6661 O O   . GLU A 1 868  ? -0.140  17.949 44.824  1.00 57.05  ? 865  GLU A O   1 
ATOM 6662 C CB  . GLU A 1 868  ? -1.085  18.363 47.946  1.00 65.41  ? 865  GLU A CB  1 
ATOM 6663 C CG  . GLU A 1 868  ? -0.190  19.063 48.991  1.00 65.41  ? 865  GLU A CG  1 
ATOM 6664 C CD  . GLU A 1 868  ? -0.072  18.311 50.338  1.00 65.41  ? 865  GLU A CD  1 
ATOM 6665 O OE1 . GLU A 1 868  ? 0.933   18.516 51.065  1.00 65.41  ? 865  GLU A OE1 1 
ATOM 6666 O OE2 . GLU A 1 868  ? -0.980  17.514 50.674  1.00 65.41  ? 865  GLU A OE2 1 
ATOM 6667 N N   . VAL A 1 869  ? 1.121   19.412 46.014  1.00 52.01  ? 866  VAL A N   1 
ATOM 6668 C CA  . VAL A 1 869  ? 2.441   19.010 45.488  1.00 52.01  ? 866  VAL A CA  1 
ATOM 6669 C C   . VAL A 1 869  ? 3.531   19.504 46.429  1.00 52.01  ? 866  VAL A C   1 
ATOM 6670 O O   . VAL A 1 869  ? 3.342   20.478 47.196  1.00 52.01  ? 866  VAL A O   1 
ATOM 6671 C CB  . VAL A 1 869  ? 2.774   19.502 44.037  1.00 63.25  ? 866  VAL A CB  1 
ATOM 6672 C CG1 . VAL A 1 869  ? 1.960   18.760 42.993  1.00 63.25  ? 866  VAL A CG1 1 
ATOM 6673 C CG2 . VAL A 1 869  ? 2.631   21.026 43.913  1.00 63.25  ? 866  VAL A CG2 1 
ATOM 6674 N N   . LYS A 1 870  ? 4.681   18.836 46.331  1.00 71.19  ? 867  LYS A N   1 
ATOM 6675 C CA  . LYS A 1 870  ? 5.741   18.950 47.311  1.00 71.19  ? 867  LYS A CA  1 
ATOM 6676 C C   . LYS A 1 870  ? 6.805   19.961 46.872  1.00 71.19  ? 867  LYS A C   1 
ATOM 6677 O O   . LYS A 1 870  ? 7.943   19.926 47.321  1.00 71.19  ? 867  LYS A O   1 
ATOM 6678 C CB  . LYS A 1 870  ? 6.306   17.555 47.568  1.00 72.46  ? 867  LYS A CB  1 
ATOM 6679 C CG  . LYS A 1 870  ? 5.208   16.516 47.828  1.00 72.46  ? 867  LYS A CG  1 
ATOM 6680 C CD  . LYS A 1 870  ? 5.736   15.081 47.945  1.00 72.46  ? 867  LYS A CD  1 
ATOM 6681 C CE  . LYS A 1 870  ? 5.301   14.164 46.774  1.00 72.46  ? 867  LYS A CE  1 
ATOM 6682 N NZ  . LYS A 1 870  ? 6.034   12.827 46.756  1.00 72.46  ? 867  LYS A NZ  1 
ATOM 6683 N N   . GLY A 1 871  ? 6.413   20.893 46.012  1.00 73.23  ? 868  GLY A N   1 
ATOM 6684 C CA  . GLY A 1 871  ? 7.326   21.911 45.518  1.00 73.23  ? 868  GLY A CA  1 
ATOM 6685 C C   . GLY A 1 871  ? 6.601   23.166 45.071  1.00 73.23  ? 868  GLY A C   1 
ATOM 6686 O O   . GLY A 1 871  ? 5.454   23.392 45.445  1.00 73.23  ? 868  GLY A O   1 
ATOM 6687 N N   . ALA A 1 872  ? 7.304   23.979 44.284  1.00 45.25  ? 869  ALA A N   1 
ATOM 6688 C CA  . ALA A 1 872  ? 6.806   25.175 43.600  1.00 45.25  ? 869  ALA A CA  1 
ATOM 6689 C C   . ALA A 1 872  ? 6.437   24.879 42.142  1.00 45.25  ? 869  ALA A C   1 
ATOM 6690 O O   . ALA A 1 872  ? 7.294   24.427 41.367  1.00 45.25  ? 869  ALA A O   1 
ATOM 6691 C CB  . ALA A 1 872  ? 7.881   26.244 43.647  1.00 35.44  ? 869  ALA A CB  1 
ATOM 6692 N N   . VAL A 1 873  ? 5.189   25.132 41.752  1.00 53.94  ? 870  VAL A N   1 
ATOM 6693 C CA  . VAL A 1 873  ? 4.796   24.896 40.356  1.00 53.94  ? 870  VAL A CA  1 
ATOM 6694 C C   . VAL A 1 873  ? 5.166   26.054 39.433  1.00 53.94  ? 870  VAL A C   1 
ATOM 6695 O O   . VAL A 1 873  ? 4.376   26.979 39.240  1.00 53.94  ? 870  VAL A O   1 
ATOM 6696 C CB  . VAL A 1 873  ? 3.323   24.583 40.193  1.00 44.21  ? 870  VAL A CB  1 
ATOM 6697 C CG1 . VAL A 1 873  ? 3.086   24.172 38.792  1.00 44.21  ? 870  VAL A CG1 1 
ATOM 6698 C CG2 . VAL A 1 873  ? 2.923   23.460 41.072  1.00 44.21  ? 870  VAL A CG2 1 
ATOM 6699 N N   . TYR A 1 874  ? 6.369   25.986 38.859  1.00 54.88  ? 871  TYR A N   1 
ATOM 6700 C CA  . TYR A 1 874  ? 7.010   27.147 38.262  1.00 54.88  ? 871  TYR A CA  1 
ATOM 6701 C C   . TYR A 1 874  ? 6.404   27.515 36.961  1.00 54.88  ? 871  TYR A C   1 
ATOM 6702 O O   . TYR A 1 874  ? 6.468   28.653 36.528  1.00 54.88  ? 871  TYR A O   1 
ATOM 6703 C CB  . TYR A 1 874  ? 8.468   26.883 38.043  1.00 43.80  ? 871  TYR A CB  1 
ATOM 6704 C CG  . TYR A 1 874  ? 9.238   27.020 39.284  1.00 43.80  ? 871  TYR A CG  1 
ATOM 6705 C CD1 . TYR A 1 874  ? 9.810   25.914 39.873  1.00 43.80  ? 871  TYR A CD1 1 
ATOM 6706 C CD2 . TYR A 1 874  ? 9.382   28.256 39.899  1.00 43.80  ? 871  TYR A CD2 1 
ATOM 6707 C CE1 . TYR A 1 874  ? 10.519  26.028 41.040  1.00 43.80  ? 871  TYR A CE1 1 
ATOM 6708 C CE2 . TYR A 1 874  ? 10.085  28.391 41.079  1.00 43.80  ? 871  TYR A CE2 1 
ATOM 6709 C CZ  . TYR A 1 874  ? 10.653  27.271 41.639  1.00 43.80  ? 871  TYR A CZ  1 
ATOM 6710 O OH  . TYR A 1 874  ? 11.357  27.357 42.813  1.00 43.80  ? 871  TYR A OH  1 
ATOM 6711 N N   . SER A 1 875  ? 5.808   26.534 36.333  1.00 50.30  ? 872  SER A N   1 
ATOM 6712 C CA  . SER A 1 875  ? 5.229   26.774 35.066  1.00 50.30  ? 872  SER A CA  1 
ATOM 6713 C C   . SER A 1 875  ? 4.426   25.542 34.699  1.00 50.30  ? 872  SER A C   1 
ATOM 6714 O O   . SER A 1 875  ? 4.731   24.456 35.183  1.00 50.30  ? 872  SER A O   1 
ATOM 6715 C CB  . SER A 1 875  ? 6.351   27.049 34.057  1.00 37.43  ? 872  SER A CB  1 
ATOM 6716 O OG  . SER A 1 875  ? 6.730   25.863 33.367  1.00 37.43  ? 872  SER A OG  1 
ATOM 6717 N N   . MET A 1 876  ? 3.401   25.721 33.866  1.00 44.17  ? 873  MET A N   1 
ATOM 6718 C CA  . MET A 1 876  ? 2.668   24.596 33.265  1.00 44.17  ? 873  MET A CA  1 
ATOM 6719 C C   . MET A 1 876  ? 2.116   24.887 31.882  1.00 44.17  ? 873  MET A C   1 
ATOM 6720 O O   . MET A 1 876  ? 1.567   25.932 31.655  1.00 44.17  ? 873  MET A O   1 
ATOM 6721 C CB  . MET A 1 876  ? 1.519   24.139 34.163  1.00 47.25  ? 873  MET A CB  1 
ATOM 6722 C CG  . MET A 1 876  ? 0.707   25.245 34.721  1.00 47.25  ? 873  MET A CG  1 
ATOM 6723 S SD  . MET A 1 876  ? -0.211  24.884 36.218  1.00 47.25  ? 873  MET A SD  1 
ATOM 6724 C CE  . MET A 1 876  ? 0.961   23.980 37.198  1.00 47.25  ? 873  MET A CE  1 
ATOM 6725 N N   . VAL A 1 877  ? 2.255   23.977 30.942  1.00 54.21  ? 874  VAL A N   1 
ATOM 6726 C CA  . VAL A 1 877  ? 1.534   24.190 29.703  1.00 54.21  ? 874  VAL A CA  1 
ATOM 6727 C C   . VAL A 1 877  ? 0.416   23.165 29.551  1.00 54.21  ? 874  VAL A C   1 
ATOM 6728 O O   . VAL A 1 877  ? 0.319   22.192 30.293  1.00 54.21  ? 874  VAL A O   1 
ATOM 6729 C CB  . VAL A 1 877  ? 2.449   24.205 28.445  1.00 46.73  ? 874  VAL A CB  1 
ATOM 6730 C CG1 . VAL A 1 877  ? 3.337   22.965 28.375  1.00 46.73  ? 874  VAL A CG1 1 
ATOM 6731 C CG2 . VAL A 1 877  ? 1.590   24.337 27.146  1.00 46.73  ? 874  VAL A CG2 1 
ATOM 6732 N N   . GLU A 1 878  ? -0.444  23.407 28.585  1.00 68.01  ? 875  GLU A N   1 
ATOM 6733 C CA  . GLU A 1 878  ? -1.446  22.442 28.242  1.00 68.01  ? 875  GLU A CA  1 
ATOM 6734 C C   . GLU A 1 878  ? -0.754  21.583 27.194  1.00 68.01  ? 875  GLU A C   1 
ATOM 6735 O O   . GLU A 1 878  ? -0.343  22.074 26.122  1.00 68.01  ? 875  GLU A O   1 
ATOM 6736 C CB  . GLU A 1 878  ? -2.705  23.171 27.736  1.00 79.88  ? 875  GLU A CB  1 
ATOM 6737 C CG  . GLU A 1 878  ? -3.736  22.322 27.055  1.00 79.88  ? 875  GLU A CG  1 
ATOM 6738 C CD  . GLU A 1 878  ? -3.322  21.976 25.643  1.00 79.88  ? 875  GLU A CD  1 
ATOM 6739 O OE1 . GLU A 1 878  ? -2.819  22.882 24.918  1.00 79.88  ? 875  GLU A OE1 1 
ATOM 6740 O OE2 . GLU A 1 878  ? -3.480  20.791 25.272  1.00 79.88  ? 875  GLU A OE2 1 
ATOM 6741 N N   . PHE A 1 879  ? -0.578  20.310 27.523  1.00 98.83  ? 876  PHE A N   1 
ATOM 6742 C CA  . PHE A 1 879  ? 0.114   19.430 26.610  1.00 98.83  ? 876  PHE A CA  1 
ATOM 6743 C C   . PHE A 1 879  ? -0.834  18.978 25.516  1.00 98.83  ? 876  PHE A C   1 
ATOM 6744 O O   . PHE A 1 879  ? -0.927  19.642 24.476  1.00 98.83  ? 876  PHE A O   1 
ATOM 6745 C CB  . PHE A 1 879  ? 0.811   18.274 27.327  1.00 63.24  ? 876  PHE A CB  1 
ATOM 6746 C CG  . PHE A 1 879  ? 1.880   17.630 26.498  1.00 63.24  ? 876  PHE A CG  1 
ATOM 6747 C CD1 . PHE A 1 879  ? 2.620   18.388 25.587  1.00 63.24  ? 876  PHE A CD1 1 
ATOM 6748 C CD2 . PHE A 1 879  ? 2.149   16.271 26.613  1.00 63.24  ? 876  PHE A CD2 1 
ATOM 6749 C CE1 . PHE A 1 879  ? 3.582   17.810 24.804  1.00 63.24  ? 876  PHE A CE1 1 
ATOM 6750 C CE2 . PHE A 1 879  ? 3.126   15.686 25.836  1.00 63.24  ? 876  PHE A CE2 1 
ATOM 6751 C CZ  . PHE A 1 879  ? 3.840   16.462 24.932  1.00 63.24  ? 876  PHE A CZ  1 
ATOM 6752 N N   . ASN A 1 880  ? -1.538  17.871 25.736  1.00 65.29  ? 877  ASN A N   1 
ATOM 6753 C CA  . ASN A 1 880  ? -2.607  17.498 24.832  1.00 65.29  ? 877  ASN A CA  1 
ATOM 6754 C C   . ASN A 1 880  ? -3.771  17.023 25.632  1.00 65.29  ? 877  ASN A C   1 
ATOM 6755 O O   . ASN A 1 880  ? -3.886  15.845 25.909  1.00 65.29  ? 877  ASN A O   1 
ATOM 6756 C CB  . ASN A 1 880  ? -2.166  16.372 23.946  1.00 56.98  ? 877  ASN A CB  1 
ATOM 6757 C CG  . ASN A 1 880  ? -1.039  16.755 23.055  1.00 56.98  ? 877  ASN A CG  1 
ATOM 6758 O OD1 . ASN A 1 880  ? -1.232  17.523 22.098  1.00 56.98  ? 877  ASN A OD1 1 
ATOM 6759 N ND2 . ASN A 1 880  ? 0.168   16.206 23.339  1.00 56.98  ? 877  ASN A ND2 1 
ATOM 6760 N N   . GLY A 1 881  ? -4.633  17.939 26.033  1.00 59.48  ? 878  GLY A N   1 
ATOM 6761 C CA  . GLY A 1 881  ? -5.693  17.584 26.940  1.00 59.48  ? 878  GLY A CA  1 
ATOM 6762 C C   . GLY A 1 881  ? -5.111  16.991 28.210  1.00 59.48  ? 878  GLY A C   1 
ATOM 6763 O O   . GLY A 1 881  ? -5.875  16.505 29.059  1.00 59.48  ? 878  GLY A O   1 
ATOM 6764 N N   . LYS A 1 882  ? -3.771  16.993 28.334  1.00 50.45  ? 879  LYS A N   1 
ATOM 6765 C CA  . LYS A 1 882  ? -3.088  16.657 29.591  1.00 50.45  ? 879  LYS A CA  1 
ATOM 6766 C C   . LYS A 1 882  ? -2.522  17.957 30.119  1.00 50.45  ? 879  LYS A C   1 
ATOM 6767 O O   . LYS A 1 882  ? -2.392  18.928 29.357  1.00 50.45  ? 879  LYS A O   1 
ATOM 6768 C CB  . LYS A 1 882  ? -1.962  15.665 29.366  1.00 72.08  ? 879  LYS A CB  1 
ATOM 6769 C CG  . LYS A 1 882  ? -2.328  14.497 28.488  1.00 72.08  ? 879  LYS A CG  1 
ATOM 6770 C CD  . LYS A 1 882  ? -1.682  13.214 28.985  1.00 72.08  ? 879  LYS A CD  1 
ATOM 6771 C CE  . LYS A 1 882  ? -2.174  11.985 28.232  1.00 72.08  ? 879  LYS A CE  1 
ATOM 6772 N NZ  . LYS A 1 882  ? -1.832  12.070 26.793  1.00 72.08  ? 879  LYS A NZ  1 
ATOM 6773 N N   . LEU A 1 883  ? -2.205  17.988 31.416  1.00 56.75  ? 880  LEU A N   1 
ATOM 6774 C CA  . LEU A 1 883  ? -1.554  19.158 32.024  1.00 56.75  ? 880  LEU A CA  1 
ATOM 6775 C C   . LEU A 1 883  ? -0.133  18.885 32.461  1.00 56.75  ? 880  LEU A C   1 
ATOM 6776 O O   . LEU A 1 883  ? 0.115   18.414 33.583  1.00 56.75  ? 880  LEU A O   1 
ATOM 6777 C CB  . LEU A 1 883  ? -2.340  19.715 33.219  1.00 42.39  ? 880  LEU A CB  1 
ATOM 6778 C CG  . LEU A 1 883  ? -1.880  21.111 33.725  1.00 42.39  ? 880  LEU A CG  1 
ATOM 6779 C CD1 . LEU A 1 883  ? -2.248  22.275 32.748  1.00 42.39  ? 880  LEU A CD1 1 
ATOM 6780 C CD2 . LEU A 1 883  ? -2.388  21.455 35.155  1.00 42.39  ? 880  LEU A CD2 1 
ATOM 6781 N N   . LEU A 1 884  ? 0.798   19.206 31.566  1.00 46.06  ? 881  LEU A N   1 
ATOM 6782 C CA  . LEU A 1 884  ? 2.244   19.187 31.870  1.00 46.06  ? 881  LEU A CA  1 
ATOM 6783 C C   . LEU A 1 884  ? 2.663   20.377 32.760  1.00 46.06  ? 881  LEU A C   1 
ATOM 6784 O O   . LEU A 1 884  ? 2.235   21.508 32.517  1.00 46.06  ? 881  LEU A O   1 
ATOM 6785 C CB  . LEU A 1 884  ? 3.020   19.174 30.554  1.00 64.55  ? 881  LEU A CB  1 
ATOM 6786 C CG  . LEU A 1 884  ? 4.519   19.453 30.543  1.00 64.55  ? 881  LEU A CG  1 
ATOM 6787 C CD1 . LEU A 1 884  ? 5.261   18.383 31.309  1.00 64.55  ? 881  LEU A CD1 1 
ATOM 6788 C CD2 . LEU A 1 884  ? 4.945   19.491 29.103  1.00 64.55  ? 881  LEU A CD2 1 
ATOM 6789 N N   . ALA A 1 885  ? 3.508   20.116 33.759  1.00 47.90  ? 882  ALA A N   1 
ATOM 6790 C CA  . ALA A 1 885  ? 3.753   21.096 34.820  1.00 47.90  ? 882  ALA A CA  1 
ATOM 6791 C C   . ALA A 1 885  ? 5.055   20.979 35.645  1.00 47.90  ? 882  ALA A C   1 
ATOM 6792 O O   . ALA A 1 885  ? 5.161   20.141 36.547  1.00 47.90  ? 882  ALA A O   1 
ATOM 6793 C CB  . ALA A 1 885  ? 2.590   21.088 35.752  1.00 37.28  ? 882  ALA A CB  1 
ATOM 6794 N N   . SER A 1 886  ? 6.031   21.846 35.377  1.00 49.06  ? 883  SER A N   1 
ATOM 6795 C CA  . SER A 1 886  ? 7.259   21.892 36.189  1.00 49.06  ? 883  SER A CA  1 
ATOM 6796 C C   . SER A 1 886  ? 6.901   21.977 37.693  1.00 49.06  ? 883  SER A C   1 
ATOM 6797 O O   . SER A 1 886  ? 6.097   22.823 38.078  1.00 49.06  ? 883  SER A O   1 
ATOM 6798 C CB  . SER A 1 886  ? 8.112   23.086 35.780  1.00 94.48  ? 883  SER A CB  1 
ATOM 6799 O OG  . SER A 1 886  ? 7.423   24.294 36.060  1.00 94.48  ? 883  SER A OG  1 
ATOM 6800 N N   . ILE A 1 887  ? 7.441   21.065 38.507  1.00 53.91  ? 884  ILE A N   1 
ATOM 6801 C CA  . ILE A 1 887  ? 7.369   21.155 39.966  1.00 53.91  ? 884  ILE A CA  1 
ATOM 6802 C C   . ILE A 1 887  ? 8.786   21.003 40.506  1.00 53.91  ? 884  ILE A C   1 
ATOM 6803 O O   . ILE A 1 887  ? 9.304   19.884 40.605  1.00 53.91  ? 884  ILE A O   1 
ATOM 6804 C CB  . ILE A 1 887  ? 6.482   20.040 40.623  1.00 47.00  ? 884  ILE A CB  1 
ATOM 6805 C CG1 . ILE A 1 887  ? 5.100   19.924 39.958  1.00 47.00  ? 884  ILE A CG1 1 
ATOM 6806 C CG2 . ILE A 1 887  ? 6.380   20.239 42.152  1.00 47.00  ? 884  ILE A CG2 1 
ATOM 6807 C CD1 . ILE A 1 887  ? 4.666   18.492 39.696  1.00 47.00  ? 884  ILE A CD1 1 
ATOM 6808 N N   . ASN A 1 888  ? 9.421   22.143 40.776  1.00 61.13  ? 885  ASN A N   1 
ATOM 6809 C CA  . ASN A 1 888  ? 10.571  22.265 41.661  1.00 61.13  ? 885  ASN A CA  1 
ATOM 6810 C C   . ASN A 1 888  ? 11.910  21.689 41.240  1.00 61.13  ? 885  ASN A C   1 
ATOM 6811 O O   . ASN A 1 888  ? 12.907  21.999 41.887  1.00 61.13  ? 885  ASN A O   1 
ATOM 6812 C CB  . ASN A 1 888  ? 10.201  21.700 43.021  1.00 60.07  ? 885  ASN A CB  1 
ATOM 6813 C CG  . ASN A 1 888  ? 10.702  22.547 44.169  1.00 60.07  ? 885  ASN A CG  1 
ATOM 6814 O OD1 . ASN A 1 888  ? 10.940  22.016 45.250  1.00 60.07  ? 885  ASN A OD1 1 
ATOM 6815 N ND2 . ASN A 1 888  ? 10.846  23.874 43.963  1.00 60.07  ? 885  ASN A ND2 1 
ATOM 6816 N N   . SER A 1 889  ? 11.945  20.898 40.158  1.00 47.88  ? 886  SER A N   1 
ATOM 6817 C CA  . SER A 1 889  ? 12.999  19.843 39.890  1.00 47.88  ? 886  SER A CA  1 
ATOM 6818 C C   . SER A 1 889  ? 12.435  18.700 39.028  1.00 47.88  ? 886  SER A C   1 
ATOM 6819 O O   . SER A 1 889  ? 13.072  18.186 38.107  1.00 47.88  ? 886  SER A O   1 
ATOM 6820 C CB  . SER A 1 889  ? 13.478  19.195 41.190  1.00 48.00  ? 886  SER A CB  1 
ATOM 6821 O OG  . SER A 1 889  ? 14.884  19.271 41.285  1.00 48.00  ? 886  SER A OG  1 
ATOM 6822 N N   . THR A 1 890  ? 11.221  18.305 39.375  1.00 67.78  ? 887  THR A N   1 
ATOM 6823 C CA  . THR A 1 890  ? 10.445  17.351 38.617  1.00 67.78  ? 887  THR A CA  1 
ATOM 6824 C C   . THR A 1 890  ? 9.660   18.013 37.489  1.00 67.78  ? 887  THR A C   1 
ATOM 6825 O O   . THR A 1 890  ? 9.201   19.144 37.624  1.00 67.78  ? 887  THR A O   1 
ATOM 6826 C CB  . THR A 1 890  ? 9.439   16.783 39.551  1.00 48.24  ? 887  THR A CB  1 
ATOM 6827 O OG1 . THR A 1 890  ? 10.063  16.657 40.831  1.00 48.24  ? 887  THR A OG1 1 
ATOM 6828 C CG2 . THR A 1 890  ? 8.899   15.450 39.043  1.00 48.24  ? 887  THR A CG2 1 
ATOM 6829 N N   . VAL A 1 891  ? 9.476   17.298 36.388  1.00 62.31  ? 888  VAL A N   1 
ATOM 6830 C CA  . VAL A 1 891  ? 8.612   17.768 35.322  1.00 62.31  ? 888  VAL A CA  1 
ATOM 6831 C C   . VAL A 1 891  ? 7.501   16.749 35.174  1.00 62.31  ? 888  VAL A C   1 
ATOM 6832 O O   . VAL A 1 891  ? 7.736   15.675 34.654  1.00 62.31  ? 888  VAL A O   1 
ATOM 6833 C CB  . VAL A 1 891  ? 9.417   17.966 34.028  1.00 36.59  ? 888  VAL A CB  1 
ATOM 6834 C CG1 . VAL A 1 891  ? 8.549   17.932 32.786  1.00 36.59  ? 888  VAL A CG1 1 
ATOM 6835 C CG2 . VAL A 1 891  ? 10.117  19.284 34.093  1.00 36.59  ? 888  VAL A CG2 1 
ATOM 6836 N N   . ARG A 1 892  ? 6.293   17.079 35.639  1.00 47.59  ? 889  ARG A N   1 
ATOM 6837 C CA  . ARG A 1 892  ? 5.239   16.085 35.723  1.00 47.59  ? 889  ARG A CA  1 
ATOM 6838 C C   . ARG A 1 892  ? 4.173   16.279 34.695  1.00 47.59  ? 889  ARG A C   1 
ATOM 6839 O O   . ARG A 1 892  ? 3.888   17.429 34.319  1.00 47.59  ? 889  ARG A O   1 
ATOM 6840 C CB  . ARG A 1 892  ? 4.610   16.102 37.090  1.00 48.00  ? 889  ARG A CB  1 
ATOM 6841 C CG  . ARG A 1 892  ? 4.415   14.698 37.608  1.00 48.00  ? 889  ARG A CG  1 
ATOM 6842 C CD  . ARG A 1 892  ? 3.482   14.597 38.772  1.00 48.00  ? 889  ARG A CD  1 
ATOM 6843 N NE  . ARG A 1 892  ? 3.862   15.324 39.986  1.00 48.00  ? 889  ARG A NE  1 
ATOM 6844 C CZ  . ARG A 1 892  ? 4.930   15.075 40.746  1.00 48.00  ? 889  ARG A CZ  1 
ATOM 6845 N NH1 . ARG A 1 892  ? 5.836   14.127 40.417  1.00 48.00  ? 889  ARG A NH1 1 
ATOM 6846 N NH2 . ARG A 1 892  ? 5.095   15.805 41.851  1.00 48.00  ? 889  ARG A NH2 1 
ATOM 6847 N N   . LEU A 1 893  ? 3.568   15.165 34.247  1.00 62.92  ? 890  LEU A N   1 
ATOM 6848 C CA  . LEU A 1 893  ? 2.507   15.212 33.207  1.00 62.92  ? 890  LEU A CA  1 
ATOM 6849 C C   . LEU A 1 893  ? 1.147   14.722 33.660  1.00 62.92  ? 890  LEU A C   1 
ATOM 6850 O O   . LEU A 1 893  ? 0.923   13.531 33.606  1.00 62.92  ? 890  LEU A O   1 
ATOM 6851 C CB  . LEU A 1 893  ? 2.880   14.399 31.975  1.00 61.15  ? 890  LEU A CB  1 
ATOM 6852 C CG  . LEU A 1 893  ? 1.683   14.286 31.030  1.00 61.15  ? 890  LEU A CG  1 
ATOM 6853 C CD1 . LEU A 1 893  ? 1.244   15.664 30.515  1.00 61.15  ? 890  LEU A CD1 1 
ATOM 6854 C CD2 . LEU A 1 893  ? 1.990   13.354 29.875  1.00 61.15  ? 890  LEU A CD2 1 
ATOM 6855 N N   . TYR A 1 894  ? 0.223   15.621 34.007  1.00 60.06  ? 891  TYR A N   1 
ATOM 6856 C CA  . TYR A 1 894  ? -1.040  15.218 34.640  1.00 60.06  ? 891  TYR A CA  1 
ATOM 6857 C C   . TYR A 1 894  ? -2.158  14.845 33.714  1.00 60.06  ? 891  TYR A C   1 
ATOM 6858 O O   . TYR A 1 894  ? -2.184  15.219 32.548  1.00 60.06  ? 891  TYR A O   1 
ATOM 6859 C CB  . TYR A 1 894  ? -1.554  16.315 35.539  1.00 53.48  ? 891  TYR A CB  1 
ATOM 6860 C CG  . TYR A 1 894  ? -0.756  16.519 36.790  1.00 53.48  ? 891  TYR A CG  1 
ATOM 6861 C CD1 . TYR A 1 894  ? 0.354   17.363 36.817  1.00 53.48  ? 891  TYR A CD1 1 
ATOM 6862 C CD2 . TYR A 1 894  ? -1.108  15.883 37.956  1.00 53.48  ? 891  TYR A CD2 1 
ATOM 6863 C CE1 . TYR A 1 894  ? 1.082   17.565 37.988  1.00 53.48  ? 891  TYR A CE1 1 
ATOM 6864 C CE2 . TYR A 1 894  ? -0.385  16.071 39.119  1.00 53.48  ? 891  TYR A CE2 1 
ATOM 6865 C CZ  . TYR A 1 894  ? 0.693   16.911 39.130  1.00 53.48  ? 891  TYR A CZ  1 
ATOM 6866 O OH  . TYR A 1 894  ? 1.381   17.065 40.304  1.00 53.48  ? 891  TYR A OH  1 
ATOM 6867 N N   . GLU A 1 895  ? -3.109  14.107 34.274  1.00 72.54  ? 892  GLU A N   1 
ATOM 6868 C CA  . GLU A 1 895  ? -4.361  13.798 33.586  1.00 72.54  ? 892  GLU A CA  1 
ATOM 6869 C C   . GLU A 1 895  ? -5.620  14.080 34.382  1.00 72.54  ? 892  GLU A C   1 
ATOM 6870 O O   . GLU A 1 895  ? -5.700  13.849 35.584  1.00 72.54  ? 892  GLU A O   1 
ATOM 6871 C CB  . GLU A 1 895  ? -4.386  12.360 33.153  1.00 66.02  ? 892  GLU A CB  1 
ATOM 6872 C CG  . GLU A 1 895  ? -3.977  12.164 31.740  1.00 66.02  ? 892  GLU A CG  1 
ATOM 6873 C CD  . GLU A 1 895  ? -3.682  10.702 31.443  1.00 66.02  ? 892  GLU A CD  1 
ATOM 6874 O OE1 . GLU A 1 895  ? -3.392  9.948  32.423  1.00 66.02  ? 892  GLU A OE1 1 
ATOM 6875 O OE2 . GLU A 1 895  ? -3.729  10.318 30.238  1.00 66.02  ? 892  GLU A OE2 1 
ATOM 6876 N N   . TRP A 1 896  ? -6.611  14.558 33.656  1.00 50.74  ? 893  TRP A N   1 
ATOM 6877 C CA  . TRP A 1 896  ? -7.912  14.850 34.192  1.00 50.74  ? 893  TRP A CA  1 
ATOM 6878 C C   . TRP A 1 896  ? -8.744  13.558 34.224  1.00 50.74  ? 893  TRP A C   1 
ATOM 6879 O O   . TRP A 1 896  ? -9.213  13.074 33.172  1.00 50.74  ? 893  TRP A O   1 
ATOM 6880 C CB  . TRP A 1 896  ? -8.575  15.817 33.239  1.00 48.54  ? 893  TRP A CB  1 
ATOM 6881 C CG  . TRP A 1 896  ? -9.563  16.766 33.777  1.00 48.54  ? 893  TRP A CG  1 
ATOM 6882 C CD1 . TRP A 1 896  ? -10.612 17.288 33.085  1.00 48.54  ? 893  TRP A CD1 1 
ATOM 6883 C CD2 . TRP A 1 896  ? -9.592  17.386 35.076  1.00 48.54  ? 893  TRP A CD2 1 
ATOM 6884 N NE1 . TRP A 1 896  ? -11.293 18.198 33.859  1.00 48.54  ? 893  TRP A NE1 1 
ATOM 6885 C CE2 . TRP A 1 896  ? -10.698 18.274 35.089  1.00 48.54  ? 893  TRP A CE2 1 
ATOM 6886 C CE3 . TRP A 1 896  ? -8.795  17.292 36.221  1.00 48.54  ? 893  TRP A CE3 1 
ATOM 6887 C CZ2 . TRP A 1 896  ? -11.043 19.051 36.215  1.00 48.54  ? 893  TRP A CZ2 1 
ATOM 6888 C CZ3 . TRP A 1 896  ? -9.123  18.098 37.344  1.00 48.54  ? 893  TRP A CZ3 1 
ATOM 6889 C CH2 . TRP A 1 896  ? -10.250 18.949 37.327  1.00 48.54  ? 893  TRP A CH2 1 
ATOM 6890 N N   . THR A 1 897  ? -8.956  13.011 35.413  1.00 94.51  ? 894  THR A N   1 
ATOM 6891 C CA  . THR A 1 897  ? -9.980  12.000 35.573  1.00 94.51  ? 894  THR A CA  1 
ATOM 6892 C C   . THR A 1 897  ? -11.322 12.507 35.005  1.00 94.51  ? 894  THR A C   1 
ATOM 6893 O O   . THR A 1 897  ? -11.550 13.713 34.866  1.00 94.51  ? 894  THR A O   1 
ATOM 6894 C CB  . THR A 1 897  ? -10.155 11.612 37.052  1.00 60.08  ? 894  THR A CB  1 
ATOM 6895 O OG1 . THR A 1 897  ? -10.735 12.691 37.783  1.00 60.08  ? 894  THR A OG1 1 
ATOM 6896 C CG2 . THR A 1 897  ? -8.842  11.282 37.680  1.00 60.08  ? 894  THR A CG2 1 
ATOM 6897 N N   . THR A 1 898  ? -12.198 11.579 34.649  1.00 110.98 ? 895  THR A N   1 
ATOM 6898 C CA  . THR A 1 898  ? -13.562 11.927 34.272  1.00 110.98 ? 895  THR A CA  1 
ATOM 6899 C C   . THR A 1 898  ? -14.332 12.261 35.537  1.00 110.98 ? 895  THR A C   1 
ATOM 6900 O O   . THR A 1 898  ? -15.355 12.947 35.489  1.00 110.98 ? 895  THR A O   1 
ATOM 6901 C CB  . THR A 1 898  ? -14.267 10.749 33.653  1.00 95.96  ? 895  THR A CB  1 
ATOM 6902 O OG1 . THR A 1 898  ? -14.095 9.620  34.526  1.00 95.96  ? 895  THR A OG1 1 
ATOM 6903 C CG2 . THR A 1 898  ? -13.722 10.446 32.239  1.00 95.96  ? 895  THR A CG2 1 
ATOM 6904 N N   . GLU A 1 899  ? -13.846 11.736 36.662  1.00 79.75  ? 896  GLU A N   1 
ATOM 6905 C CA  . GLU A 1 899  ? -14.289 12.148 37.978  1.00 79.75  ? 896  GLU A CA  1 
ATOM 6906 C C   . GLU A 1 899  ? -13.975 13.622 38.179  1.00 79.75  ? 896  GLU A C   1 
ATOM 6907 O O   . GLU A 1 899  ? -14.430 14.217 39.170  1.00 79.75  ? 896  GLU A O   1 
ATOM 6908 C CB  . GLU A 1 899  ? -13.573 11.343 39.050  1.00 91.22  ? 896  GLU A CB  1 
ATOM 6909 C CG  . GLU A 1 899  ? -13.580 9.846  38.786  1.00 91.22  ? 896  GLU A CG  1 
ATOM 6910 C CD  . GLU A 1 899  ? -12.173 9.247  38.763  1.00 91.22  ? 896  GLU A CD  1 
ATOM 6911 O OE1 . GLU A 1 899  ? -11.212 9.932  39.196  1.00 91.22  ? 896  GLU A OE1 1 
ATOM 6912 O OE2 . GLU A 1 899  ? -12.029 8.091  38.303  1.00 91.22  ? 896  GLU A OE2 1 
ATOM 6913 N N   . LYS A 1 900  ? -13.205 14.197 37.230  1.00 68.23  ? 897  LYS A N   1 
ATOM 6914 C CA  . LYS A 1 900  ? -12.736 15.604 37.243  1.00 68.23  ? 897  LYS A CA  1 
ATOM 6915 C C   . LYS A 1 900  ? -11.727 15.881 38.364  1.00 68.23  ? 897  LYS A C   1 
ATOM 6916 O O   . LYS A 1 900  ? -11.953 16.746 39.208  1.00 68.23  ? 897  LYS A O   1 
ATOM 6917 C CB  . LYS A 1 900  ? -13.900 16.604 37.338  1.00 63.17  ? 897  LYS A CB  1 
ATOM 6918 C CG  . LYS A 1 900  ? -14.746 16.837 36.090  1.00 63.17  ? 897  LYS A CG  1 
ATOM 6919 C CD  . LYS A 1 900  ? -15.501 18.184 36.274  1.00 63.17  ? 897  LYS A CD  1 
ATOM 6920 C CE  . LYS A 1 900  ? -17.016 18.124 36.026  1.00 63.17  ? 897  LYS A CE  1 
ATOM 6921 N NZ  . LYS A 1 900  ? -17.403 18.193 34.576  1.00 63.17  ? 897  LYS A NZ  1 
ATOM 6922 N N   . ASP A 1 901  ? -10.628 15.132 38.369  1.00 52.87  ? 898  ASP A N   1 
ATOM 6923 C CA  . ASP A 1 901  ? -9.506  15.380 39.295  1.00 52.87  ? 898  ASP A CA  1 
ATOM 6924 C C   . ASP A 1 901  ? -8.141  15.303 38.539  1.00 52.87  ? 898  ASP A C   1 
ATOM 6925 O O   . ASP A 1 901  ? -8.053  14.562 37.546  1.00 52.87  ? 898  ASP A O   1 
ATOM 6926 C CB  . ASP A 1 901  ? -9.571  14.403 40.469  1.00 98.15  ? 898  ASP A CB  1 
ATOM 6927 C CG  . ASP A 1 901  ? -9.193  15.050 41.792  1.00 98.15  ? 898  ASP A CG  1 
ATOM 6928 O OD1 . ASP A 1 901  ? -9.334  14.374 42.838  1.00 98.15  ? 898  ASP A OD1 1 
ATOM 6929 O OD2 . ASP A 1 901  ? -8.753  16.231 41.792  1.00 98.15  ? 898  ASP A OD2 1 
ATOM 6930 N N   . VAL A 1 902  ? -7.112  16.079 38.931  1.00 59.46  ? 899  VAL A N   1 
ATOM 6931 C CA  . VAL A 1 902  ? -5.770  15.878 38.270  1.00 59.46  ? 899  VAL A CA  1 
ATOM 6932 C C   . VAL A 1 902  ? -5.014  14.677 38.865  1.00 59.46  ? 899  VAL A C   1 
ATOM 6933 O O   . VAL A 1 902  ? -4.727  14.677 40.055  1.00 59.46  ? 899  VAL A O   1 
ATOM 6934 C CB  . VAL A 1 902  ? -4.778  17.183 38.129  1.00 45.68  ? 899  VAL A CB  1 
ATOM 6935 C CG1 . VAL A 1 902  ? -5.025  18.008 36.847  1.00 45.68  ? 899  VAL A CG1 1 
ATOM 6936 C CG2 . VAL A 1 902  ? -4.828  18.085 39.304  1.00 45.68  ? 899  VAL A CG2 1 
ATOM 6937 N N   . ARG A 1 903  ? -4.709  13.670 38.038  1.00 54.37  ? 900  ARG A N   1 
ATOM 6938 C CA  . ARG A 1 903  ? -3.871  12.524 38.460  1.00 54.37  ? 900  ARG A CA  1 
ATOM 6939 C C   . ARG A 1 903  ? -2.593  12.187 37.612  1.00 54.37  ? 900  ARG A C   1 
ATOM 6940 O O   . ARG A 1 903  ? -2.641  12.022 36.375  1.00 54.37  ? 900  ARG A O   1 
ATOM 6941 C CB  . ARG A 1 903  ? -4.751  11.290 38.674  1.00 68.95  ? 900  ARG A CB  1 
ATOM 6942 C CG  . ARG A 1 903  ? -5.262  10.613 37.416  1.00 68.95  ? 900  ARG A CG  1 
ATOM 6943 C CD  . ARG A 1 903  ? -4.729  9.193  37.307  1.00 68.95  ? 900  ARG A CD  1 
ATOM 6944 N NE  . ARG A 1 903  ? -4.911  8.684  35.951  1.00 68.95  ? 900  ARG A NE  1 
ATOM 6945 C CZ  . ARG A 1 903  ? -6.064  8.245  35.450  1.00 68.95  ? 900  ARG A CZ  1 
ATOM 6946 N NH1 . ARG A 1 903  ? -7.168  8.249  36.200  1.00 68.95  ? 900  ARG A NH1 1 
ATOM 6947 N NH2 . ARG A 1 903  ? -6.115  7.807  34.195  1.00 68.95  ? 900  ARG A NH2 1 
ATOM 6948 N N   . THR A 1 904  ? -1.466  12.085 38.318  1.00 63.26  ? 901  THR A N   1 
ATOM 6949 C CA  . THR A 1 904  ? -0.139  11.807 37.741  1.00 63.26  ? 901  THR A CA  1 
ATOM 6950 C C   . THR A 1 904  ? -0.126  10.696 36.683  1.00 63.26  ? 901  THR A C   1 
ATOM 6951 O O   . THR A 1 904  ? -0.820  9.694  36.816  1.00 63.26  ? 901  THR A O   1 
ATOM 6952 C CB  . THR A 1 904  ? 0.883   11.406 38.836  1.00 75.97  ? 901  THR A CB  1 
ATOM 6953 O OG1 . THR A 1 904  ? 0.789   12.283 39.966  1.00 75.97  ? 901  THR A OG1 1 
ATOM 6954 C CG2 . THR A 1 904  ? 2.291   11.450 38.279  1.00 75.97  ? 901  THR A CG2 1 
ATOM 6955 N N   . GLU A 1 905  ? 0.667   10.889 35.639  1.00 206.35 ? 902  GLU A N   1 
ATOM 6956 C CA  . GLU A 1 905  ? 0.900   9.842  34.661  1.00 206.35 ? 902  GLU A CA  1 
ATOM 6957 C C   . GLU A 1 905  ? 2.378   9.471  34.611  1.00 206.35 ? 902  GLU A C   1 
ATOM 6958 O O   . GLU A 1 905  ? 2.728   8.287  34.597  1.00 206.35 ? 902  GLU A O   1 
ATOM 6959 C CB  . GLU A 1 905  ? 0.410   10.278 33.289  1.00 137.42 ? 902  GLU A CB  1 
ATOM 6960 C CG  . GLU A 1 905  ? 0.554   9.211  32.232  1.00 137.42 ? 902  GLU A CG  1 
ATOM 6961 C CD  . GLU A 1 905  ? 0.022   9.636  30.888  1.00 137.42 ? 902  GLU A CD  1 
ATOM 6962 O OE1 . GLU A 1 905  ? -0.436  10.785 30.745  1.00 137.42 ? 902  GLU A OE1 1 
ATOM 6963 O OE2 . GLU A 1 905  ? 0.062   8.807  29.962  1.00 137.42 ? 902  GLU A OE2 1 
ATOM 6964 N N   . CYS A 1 906  ? 3.234   10.490 34.577  1.00 177.82 ? 903  CYS A N   1 
ATOM 6965 C CA  . CYS A 1 906  ? 4.682   10.302 34.556  1.00 177.82 ? 903  CYS A CA  1 
ATOM 6966 C C   . CYS A 1 906  ? 5.402   11.537 35.006  1.00 177.82 ? 903  CYS A C   1 
ATOM 6967 O O   . CYS A 1 906  ? 4.809   12.607 35.134  1.00 177.82 ? 903  CYS A O   1 
ATOM 6968 C CB  . CYS A 1 906  ? 5.174   10.006 33.150  1.00 69.32  ? 903  CYS A CB  1 
ATOM 6969 S SG  . CYS A 1 906  ? 4.597   11.155 31.934  1.00 69.32  ? 903  CYS A SG  1 
ATOM 6970 N N   . ASN A 1 907  ? 6.700   11.371 35.225  1.00 66.09  ? 904  ASN A N   1 
ATOM 6971 C CA  . ASN A 1 907  ? 7.601   12.491 35.454  1.00 66.09  ? 904  ASN A CA  1 
ATOM 6972 C C   . ASN A 1 907  ? 9.101   12.295 35.140  1.00 66.09  ? 904  ASN A C   1 
ATOM 6973 O O   . ASN A 1 907  ? 9.646   11.208 35.246  1.00 66.09  ? 904  ASN A O   1 
ATOM 6974 C CB  . ASN A 1 907  ? 7.400   13.163 36.831  1.00 87.78  ? 904  ASN A CB  1 
ATOM 6975 C CG  . ASN A 1 907  ? 7.106   12.189 37.929  1.00 87.78  ? 904  ASN A CG  1 
ATOM 6976 O OD1 . ASN A 1 907  ? 7.949   11.942 38.780  1.00 87.78  ? 904  ASN A OD1 1 
ATOM 6977 N ND2 . ASN A 1 907  ? 5.897   11.645 37.938  1.00 87.78  ? 904  ASN A ND2 1 
ATOM 6978 N N   . HIS A 1 908  ? 9.727   13.397 34.740  1.00 65.81  ? 905  HIS A N   1 
ATOM 6979 C CA  . HIS A 1 908  ? 11.116  13.488 34.426  1.00 65.81  ? 905  HIS A CA  1 
ATOM 6980 C C   . HIS A 1 908  ? 11.774  14.119 35.629  1.00 65.81  ? 905  HIS A C   1 
ATOM 6981 O O   . HIS A 1 908  ? 11.208  15.025 36.211  1.00 65.81  ? 905  HIS A O   1 
ATOM 6982 C CB  . HIS A 1 908  ? 11.264  14.376 33.211  1.00 63.98  ? 905  HIS A CB  1 
ATOM 6983 C CG  . HIS A 1 908  ? 12.652  14.868 32.999  1.00 63.98  ? 905  HIS A CG  1 
ATOM 6984 N ND1 . HIS A 1 908  ? 13.584  14.169 32.263  1.00 63.98  ? 905  HIS A ND1 1 
ATOM 6985 C CD2 . HIS A 1 908  ? 13.273  15.992 33.427  1.00 63.98  ? 905  HIS A CD2 1 
ATOM 6986 C CE1 . HIS A 1 908  ? 14.723  14.838 32.248  1.00 63.98  ? 905  HIS A CE1 1 
ATOM 6987 N NE2 . HIS A 1 908  ? 14.561  15.948 32.946  1.00 63.98  ? 905  HIS A NE2 1 
ATOM 6988 N N   . TYR A 1 909  ? 12.959  13.645 36.014  1.00 56.71  ? 906  TYR A N   1 
ATOM 6989 C CA  . TYR A 1 909  ? 13.566  14.091 37.269  1.00 56.71  ? 906  TYR A CA  1 
ATOM 6990 C C   . TYR A 1 909  ? 14.850  14.862 37.099  1.00 56.71  ? 906  TYR A C   1 
ATOM 6991 O O   . TYR A 1 909  ? 15.262  15.590 38.010  1.00 56.71  ? 906  TYR A O   1 
ATOM 6992 C CB  . TYR A 1 909  ? 13.831  12.910 38.194  1.00 85.96  ? 906  TYR A CB  1 
ATOM 6993 C CG  . TYR A 1 909  ? 12.620  12.432 38.952  1.00 85.96  ? 906  TYR A CG  1 
ATOM 6994 C CD1 . TYR A 1 909  ? 12.046  11.196 38.664  1.00 85.96  ? 906  TYR A CD1 1 
ATOM 6995 C CD2 . TYR A 1 909  ? 12.046  13.213 39.964  1.00 85.96  ? 906  TYR A CD2 1 
ATOM 6996 C CE1 . TYR A 1 909  ? 10.944  10.747 39.350  1.00 85.96  ? 906  TYR A CE1 1 
ATOM 6997 C CE2 . TYR A 1 909  ? 10.936  12.768 40.655  1.00 85.96  ? 906  TYR A CE2 1 
ATOM 6998 C CZ  . TYR A 1 909  ? 10.399  11.527 40.341  1.00 85.96  ? 906  TYR A CZ  1 
ATOM 6999 O OH  . TYR A 1 909  ? 9.289   11.062 41.008  1.00 85.96  ? 906  TYR A OH  1 
ATOM 7000 N N   . ASN A 1 910  ? 15.478  14.695 35.938  1.00 70.36  ? 907  ASN A N   1 
ATOM 7001 C CA  . ASN A 1 910  ? 16.828  15.202 35.696  1.00 70.36  ? 907  ASN A CA  1 
ATOM 7002 C C   . ASN A 1 910  ? 16.919  16.722 35.424  1.00 70.36  ? 907  ASN A C   1 
ATOM 7003 O O   . ASN A 1 910  ? 17.306  17.153 34.339  1.00 70.36  ? 907  ASN A O   1 
ATOM 7004 C CB  . ASN A 1 910  ? 17.507  14.375 34.582  1.00 79.52  ? 907  ASN A CB  1 
ATOM 7005 C CG  . ASN A 1 910  ? 19.030  14.572 34.533  1.00 79.52  ? 907  ASN A CG  1 
ATOM 7006 O OD1 . ASN A 1 910  ? 19.590  14.844 33.470  1.00 79.52  ? 907  ASN A OD1 1 
ATOM 7007 N ND2 . ASN A 1 910  ? 19.698  14.443 35.682  1.00 79.52  ? 907  ASN A ND2 1 
ATOM 7008 N N   . ASN A 1 911  ? 16.558  17.538 36.402  1.00 78.13  ? 908  ASN A N   1 
ATOM 7009 C CA  . ASN A 1 911  ? 16.665  18.975 36.239  1.00 78.13  ? 908  ASN A CA  1 
ATOM 7010 C C   . ASN A 1 911  ? 17.149  19.489 37.544  1.00 78.13  ? 908  ASN A C   1 
ATOM 7011 O O   . ASN A 1 911  ? 16.705  19.035 38.578  1.00 78.13  ? 908  ASN A O   1 
ATOM 7012 C CB  . ASN A 1 911  ? 15.307  19.646 35.970  1.00 55.64  ? 908  ASN A CB  1 
ATOM 7013 C CG  . ASN A 1 911  ? 14.434  18.876 34.996  1.00 55.64  ? 908  ASN A CG  1 
ATOM 7014 O OD1 . ASN A 1 911  ? 14.535  19.049 33.776  1.00 55.64  ? 908  ASN A OD1 1 
ATOM 7015 N ND2 . ASN A 1 911  ? 13.548  18.037 35.535  1.00 55.64  ? 908  ASN A ND2 1 
ATOM 7016 N N   . ILE A 1 912  ? 18.038  20.461 37.523  1.00 80.48  ? 909  ILE A N   1 
ATOM 7017 C CA  . ILE A 1 912  ? 18.403  21.106 38.751  1.00 80.48  ? 909  ILE A CA  1 
ATOM 7018 C C   . ILE A 1 912  ? 17.175  21.804 39.362  1.00 80.48  ? 909  ILE A C   1 
ATOM 7019 O O   . ILE A 1 912  ? 16.950  21.695 40.565  1.00 80.48  ? 909  ILE A O   1 
ATOM 7020 C CB  . ILE A 1 912  ? 19.555  22.054 38.509  1.00 74.72  ? 909  ILE A CB  1 
ATOM 7021 C CG1 . ILE A 1 912  ? 20.612  21.875 39.588  1.00 74.72  ? 909  ILE A CG1 1 
ATOM 7022 C CG2 . ILE A 1 912  ? 19.067  23.475 38.396  1.00 74.72  ? 909  ILE A CG2 1 
ATOM 7023 C CD1 . ILE A 1 912  ? 21.416  20.614 39.432  1.00 74.72  ? 909  ILE A CD1 1 
ATOM 7024 N N   . MET A 1 913  ? 16.379  22.470 38.507  1.00 72.15  ? 910  MET A N   1 
ATOM 7025 C CA  . MET A 1 913  ? 15.131  23.203 38.862  1.00 72.15  ? 910  MET A CA  1 
ATOM 7026 C C   . MET A 1 913  ? 14.417  23.763 37.622  1.00 72.15  ? 910  MET A C   1 
ATOM 7027 O O   . MET A 1 913  ? 14.777  24.818 37.121  1.00 72.15  ? 910  MET A O   1 
ATOM 7028 C CB  . MET A 1 913  ? 15.443  24.334 39.836  1.00 62.50  ? 910  MET A CB  1 
ATOM 7029 C CG  . MET A 1 913  ? 14.300  25.206 40.244  1.00 62.50  ? 910  MET A CG  1 
ATOM 7030 S SD  . MET A 1 913  ? 15.020  26.262 41.484  1.00 62.50  ? 910  MET A SD  1 
ATOM 7031 C CE  . MET A 1 913  ? 14.447  27.891 41.053  1.00 62.50  ? 910  MET A CE  1 
ATOM 7032 N N   . ALA A 1 914  ? 13.392  23.049 37.146  1.00 49.91  ? 911  ALA A N   1 
ATOM 7033 C CA  . ALA A 1 914  ? 12.648  23.415 35.894  1.00 49.91  ? 911  ALA A CA  1 
ATOM 7034 C C   . ALA A 1 914  ? 11.812  24.701 36.008  1.00 49.91  ? 911  ALA A C   1 
ATOM 7035 O O   . ALA A 1 914  ? 10.777  24.745 36.679  1.00 49.91  ? 911  ALA A O   1 
ATOM 7036 C CB  . ALA A 1 914  ? 11.788  22.260 35.412  1.00 44.83  ? 911  ALA A CB  1 
ATOM 7037 N N   . LEU A 1 915  ? 12.289  25.754 35.366  1.00 52.27  ? 912  LEU A N   1 
ATOM 7038 C CA  . LEU A 1 915  ? 11.671  27.059 35.520  1.00 52.27  ? 912  LEU A CA  1 
ATOM 7039 C C   . LEU A 1 915  ? 10.693  27.369 34.435  1.00 52.27  ? 912  LEU A C   1 
ATOM 7040 O O   . LEU A 1 915  ? 9.889   28.279 34.578  1.00 52.27  ? 912  LEU A O   1 
ATOM 7041 C CB  . LEU A 1 915  ? 12.724  28.155 35.494  1.00 27.98  ? 912  LEU A CB  1 
ATOM 7042 C CG  . LEU A 1 915  ? 13.540  28.213 36.755  1.00 27.98  ? 912  LEU A CG  1 
ATOM 7043 C CD1 . LEU A 1 915  ? 14.146  29.617 36.900  1.00 27.98  ? 912  LEU A CD1 1 
ATOM 7044 C CD2 . LEU A 1 915  ? 12.629  27.793 37.934  1.00 27.98  ? 912  LEU A CD2 1 
ATOM 7045 N N   . TYR A 1 916  ? 10.788  26.649 33.338  1.00 35.75  ? 913  TYR A N   1 
ATOM 7046 C CA  . TYR A 1 916  ? 10.109  27.035 32.146  1.00 35.75  ? 913  TYR A CA  1 
ATOM 7047 C C   . TYR A 1 916  ? 9.790   25.785 31.351  1.00 35.75  ? 913  TYR A C   1 
ATOM 7048 O O   . TYR A 1 916  ? 10.561  24.827 31.377  1.00 35.75  ? 913  TYR A O   1 
ATOM 7049 C CB  . TYR A 1 916  ? 11.049  27.915 31.334  1.00 23.97  ? 913  TYR A CB  1 
ATOM 7050 C CG  . TYR A 1 916  ? 11.621  29.058 32.129  1.00 23.97  ? 913  TYR A CG  1 
ATOM 7051 C CD1 . TYR A 1 916  ? 12.984  29.154 32.429  1.00 23.97  ? 913  TYR A CD1 1 
ATOM 7052 C CD2 . TYR A 1 916  ? 10.776  30.049 32.606  1.00 23.97  ? 913  TYR A CD2 1 
ATOM 7053 C CE1 . TYR A 1 916  ? 13.456  30.232 33.214  1.00 23.97  ? 913  TYR A CE1 1 
ATOM 7054 C CE2 . TYR A 1 916  ? 11.218  31.085 33.365  1.00 23.97  ? 913  TYR A CE2 1 
ATOM 7055 C CZ  . TYR A 1 916  ? 12.512  31.187 33.668  1.00 23.97  ? 913  TYR A CZ  1 
ATOM 7056 O OH  . TYR A 1 916  ? 12.799  32.272 34.416  1.00 23.97  ? 913  TYR A OH  1 
ATOM 7057 N N   . LEU A 1 917  ? 8.656   25.773 30.662  1.00 33.30  ? 914  LEU A N   1 
ATOM 7058 C CA  . LEU A 1 917  ? 8.440   24.767 29.660  1.00 33.30  ? 914  LEU A CA  1 
ATOM 7059 C C   . LEU A 1 917  ? 7.625   25.307 28.503  1.00 33.30  ? 914  LEU A C   1 
ATOM 7060 O O   . LEU A 1 917  ? 6.939   26.305 28.640  1.00 33.30  ? 914  LEU A O   1 
ATOM 7061 C CB  . LEU A 1 917  ? 7.685   23.607 30.249  1.00 29.18  ? 914  LEU A CB  1 
ATOM 7062 C CG  . LEU A 1 917  ? 7.776   23.248 31.704  1.00 29.18  ? 914  LEU A CG  1 
ATOM 7063 C CD1 . LEU A 1 917  ? 6.354   22.854 32.174  1.00 29.18  ? 914  LEU A CD1 1 
ATOM 7064 C CD2 . LEU A 1 917  ? 8.757   22.094 31.812  1.00 29.18  ? 914  LEU A CD2 1 
ATOM 7065 N N   . LYS A 1 918  ? 7.679   24.627 27.368  1.00 48.79  ? 915  LYS A N   1 
ATOM 7066 C CA  . LYS A 1 918  ? 6.940   25.015 26.179  1.00 48.79  ? 915  LYS A CA  1 
ATOM 7067 C C   . LYS A 1 918  ? 6.832   23.717 25.430  1.00 48.79  ? 915  LYS A C   1 
ATOM 7068 O O   . LYS A 1 918  ? 7.485   22.750 25.782  1.00 48.79  ? 915  LYS A O   1 
ATOM 7069 C CB  . LYS A 1 918  ? 7.739   26.033 25.358  1.00 34.14  ? 915  LYS A CB  1 
ATOM 7070 C CG  . LYS A 1 918  ? 7.909   27.462 25.946  1.00 34.14  ? 915  LYS A CG  1 
ATOM 7071 C CD  . LYS A 1 918  ? 6.829   28.328 25.408  1.00 34.14  ? 915  LYS A CD  1 
ATOM 7072 C CE  . LYS A 1 918  ? 6.738   29.496 26.251  1.00 34.14  ? 915  LYS A CE  1 
ATOM 7073 N NZ  . LYS A 1 918  ? 7.518   30.643 25.643  1.00 34.14  ? 915  LYS A NZ  1 
ATOM 7074 N N   . THR A 1 919  ? 6.023   23.671 24.391  1.00 43.92  ? 916  THR A N   1 
ATOM 7075 C CA  . THR A 1 919  ? 5.513   22.373 23.928  1.00 43.92  ? 916  THR A CA  1 
ATOM 7076 C C   . THR A 1 919  ? 5.310   22.441 22.449  1.00 43.92  ? 916  THR A C   1 
ATOM 7077 O O   . THR A 1 919  ? 4.538   23.249 21.973  1.00 43.92  ? 916  THR A O   1 
ATOM 7078 C CB  . THR A 1 919  ? 4.151   22.050 24.635  1.00 57.51  ? 916  THR A CB  1 
ATOM 7079 O OG1 . THR A 1 919  ? 4.382   21.278 25.829  1.00 57.51  ? 916  THR A OG1 1 
ATOM 7080 C CG2 . THR A 1 919  ? 3.153   21.332 23.682  1.00 57.51  ? 916  THR A CG2 1 
ATOM 7081 N N   . LYS A 1 920  ? 6.020   21.633 21.686  1.00 81.40  ? 917  LYS A N   1 
ATOM 7082 C CA  . LYS A 1 920  ? 5.794   21.725 20.256  1.00 81.40  ? 917  LYS A CA  1 
ATOM 7083 C C   . LYS A 1 920  ? 4.706   20.736 19.909  1.00 81.40  ? 917  LYS A C   1 
ATOM 7084 O O   . LYS A 1 920  ? 4.871   19.520 20.126  1.00 81.40  ? 917  LYS A O   1 
ATOM 7085 C CB  . LYS A 1 920  ? 7.069   21.533 19.434  1.00 204.30 ? 917  LYS A CB  1 
ATOM 7086 C CG  . LYS A 1 920  ? 7.273   22.633 18.376  1.00 204.30 ? 917  LYS A CG  1 
ATOM 7087 C CD  . LYS A 1 920  ? 6.187   22.637 17.287  1.00 204.30 ? 917  LYS A CD  1 
ATOM 7088 C CE  . LYS A 1 920  ? 6.505   21.642 16.164  1.00 204.30 ? 917  LYS A CE  1 
ATOM 7089 N NZ  . LYS A 1 920  ? 6.711   20.224 16.619  1.00 204.30 ? 917  LYS A NZ  1 
ATOM 7090 N N   . GLY A 1 921  ? 3.595   21.308 19.421  1.00 180.27 ? 918  GLY A N   1 
ATOM 7091 C CA  . GLY A 1 921  ? 2.331   20.638 19.082  1.00 180.27 ? 918  GLY A CA  1 
ATOM 7092 C C   . GLY A 1 921  ? 2.295   19.158 19.359  1.00 180.27 ? 918  GLY A C   1 
ATOM 7093 O O   . GLY A 1 921  ? 1.455   18.672 20.119  1.00 180.27 ? 918  GLY A O   1 
ATOM 7094 N N   . ASP A 1 922  ? 3.224   18.453 18.722  1.00 98.56  ? 919  ASP A N   1 
ATOM 7095 C CA  . ASP A 1 922  ? 3.494   17.053 18.983  1.00 98.56  ? 919  ASP A CA  1 
ATOM 7096 C C   . ASP A 1 922  ? 3.882   16.841 20.454  1.00 98.56  ? 919  ASP A C   1 
ATOM 7097 O O   . ASP A 1 922  ? 3.506   17.626 21.341  1.00 98.56  ? 919  ASP A O   1 
ATOM 7098 C CB  . ASP A 1 922  ? 4.604   16.561 18.043  1.00 210.35 ? 919  ASP A CB  1 
ATOM 7099 C CG  . ASP A 1 922  ? 4.584   15.057 17.846  1.00 210.35 ? 919  ASP A CG  1 
ATOM 7100 O OD1 . ASP A 1 922  ? 3.493   14.491 17.626  1.00 210.35 ? 919  ASP A OD1 1 
ATOM 7101 O OD2 . ASP A 1 922  ? 5.668   14.440 17.906  1.00 210.35 ? 919  ASP A OD2 1 
ATOM 7102 N N   . PHE A 1 923  ? 4.639   15.781 20.705  1.00 83.49  ? 920  PHE A N   1 
ATOM 7103 C CA  . PHE A 1 923  ? 4.839   15.316 22.050  1.00 83.49  ? 920  PHE A CA  1 
ATOM 7104 C C   . PHE A 1 923  ? 6.219   15.724 22.551  1.00 83.49  ? 920  PHE A C   1 
ATOM 7105 O O   . PHE A 1 923  ? 6.922   14.931 23.162  1.00 83.49  ? 920  PHE A O   1 
ATOM 7106 C CB  . PHE A 1 923  ? 4.614   13.796 22.116  1.00 124.46 ? 920  PHE A CB  1 
ATOM 7107 C CG  . PHE A 1 923  ? 3.236   13.340 21.639  1.00 124.46 ? 920  PHE A CG  1 
ATOM 7108 C CD1 . PHE A 1 923  ? 2.107   13.474 22.461  1.00 124.46 ? 920  PHE A CD1 1 
ATOM 7109 C CD2 . PHE A 1 923  ? 3.077   12.742 20.383  1.00 124.46 ? 920  PHE A CD2 1 
ATOM 7110 C CE1 . PHE A 1 923  ? 0.834   13.035 22.032  1.00 124.46 ? 920  PHE A CE1 1 
ATOM 7111 C CE2 . PHE A 1 923  ? 1.807   12.302 19.940  1.00 124.46 ? 920  PHE A CE2 1 
ATOM 7112 C CZ  . PHE A 1 923  ? 0.686   12.450 20.767  1.00 124.46 ? 920  PHE A CZ  1 
ATOM 7113 N N   . ILE A 1 924  ? 6.576   16.988 22.309  1.00 49.56  ? 921  ILE A N   1 
ATOM 7114 C CA  . ILE A 1 924  ? 7.927   17.522 22.576  1.00 49.56  ? 921  ILE A CA  1 
ATOM 7115 C C   . ILE A 1 924  ? 7.899   18.725 23.572  1.00 49.56  ? 921  ILE A C   1 
ATOM 7116 O O   . ILE A 1 924  ? 6.964   19.531 23.507  1.00 49.56  ? 921  ILE A O   1 
ATOM 7117 C CB  . ILE A 1 924  ? 8.606   17.870 21.225  1.00 49.01  ? 921  ILE A CB  1 
ATOM 7118 C CG1 . ILE A 1 924  ? 8.559   16.656 20.245  1.00 49.01  ? 921  ILE A CG1 1 
ATOM 7119 C CG2 . ILE A 1 924  ? 9.967   18.401 21.459  1.00 49.01  ? 921  ILE A CG2 1 
ATOM 7120 C CD1 . ILE A 1 924  ? 9.810   16.356 19.328  1.00 49.01  ? 921  ILE A CD1 1 
ATOM 7121 N N   . LEU A 1 925  ? 8.885   18.824 24.489  1.00 49.31  ? 922  LEU A N   1 
ATOM 7122 C CA  . LEU A 1 925  ? 8.977   19.852 25.588  1.00 49.31  ? 922  LEU A CA  1 
ATOM 7123 C C   . LEU A 1 925  ? 10.419  20.392 25.751  1.00 49.31  ? 922  LEU A C   1 
ATOM 7124 O O   . LEU A 1 925  ? 11.281  19.933 25.020  1.00 49.31  ? 922  LEU A O   1 
ATOM 7125 C CB  . LEU A 1 925  ? 8.607   19.238 26.924  1.00 52.25  ? 922  LEU A CB  1 
ATOM 7126 C CG  . LEU A 1 925  ? 7.275   18.551 27.200  1.00 52.25  ? 922  LEU A CG  1 
ATOM 7127 C CD1 . LEU A 1 925  ? 6.817   17.524 26.138  1.00 52.25  ? 922  LEU A CD1 1 
ATOM 7128 C CD2 . LEU A 1 925  ? 7.325   17.861 28.584  1.00 52.25  ? 922  LEU A CD2 1 
ATOM 7129 N N   . VAL A 1 926  ? 10.711  21.267 26.742  1.00 52.75  ? 923  VAL A N   1 
ATOM 7130 C CA  . VAL A 1 926  ? 12.007  21.980 26.856  1.00 52.75  ? 923  VAL A CA  1 
ATOM 7131 C C   . VAL A 1 926  ? 12.171  22.759 28.206  1.00 52.75  ? 923  VAL A C   1 
ATOM 7132 O O   . VAL A 1 926  ? 11.159  23.208 28.689  1.00 52.75  ? 923  VAL A O   1 
ATOM 7133 C CB  . VAL A 1 926  ? 12.077  22.904 25.588  1.00 46.03  ? 923  VAL A CB  1 
ATOM 7134 C CG1 . VAL A 1 926  ? 10.851  23.667 25.465  1.00 46.03  ? 923  VAL A CG1 1 
ATOM 7135 C CG2 . VAL A 1 926  ? 13.300  23.780 25.474  1.00 46.03  ? 923  VAL A CG2 1 
ATOM 7136 N N   . GLY A 1 927  ? 13.373  22.912 28.823  1.00 76.72  ? 924  GLY A N   1 
ATOM 7137 C CA  . GLY A 1 927  ? 13.657  24.027 29.844  1.00 76.72  ? 924  GLY A CA  1 
ATOM 7138 C C   . GLY A 1 927  ? 14.486  23.824 31.142  1.00 76.72  ? 924  GLY A C   1 
ATOM 7139 O O   . GLY A 1 927  ? 14.601  22.652 31.560  1.00 76.72  ? 924  GLY A O   1 
ATOM 7140 N N   . ASP A 1 928  ? 15.055  24.898 31.782  1.00 97.18  ? 925  ASP A N   1 
ATOM 7141 C CA  . ASP A 1 928  ? 15.857  24.817 33.113  1.00 97.18  ? 925  ASP A CA  1 
ATOM 7142 C C   . ASP A 1 928  ? 16.600  26.042 33.710  1.00 97.18  ? 925  ASP A C   1 
ATOM 7143 O O   . ASP A 1 928  ? 17.165  26.815 32.991  1.00 97.18  ? 925  ASP A O   1 
ATOM 7144 C CB  . ASP A 1 928  ? 16.902  23.672 33.109  1.00 74.39  ? 925  ASP A CB  1 
ATOM 7145 C CG  . ASP A 1 928  ? 17.507  23.368 34.536  1.00 74.39  ? 925  ASP A CG  1 
ATOM 7146 O OD1 . ASP A 1 928  ? 17.154  22.329 35.120  1.00 74.39  ? 925  ASP A OD1 1 
ATOM 7147 O OD2 . ASP A 1 928  ? 18.340  24.130 35.076  1.00 74.39  ? 925  ASP A OD2 1 
ATOM 7148 N N   . LEU A 1 929  ? 16.699  26.129 35.037  1.00 61.61  ? 926  LEU A N   1 
ATOM 7149 C CA  . LEU A 1 929  ? 17.267  27.297 35.766  1.00 61.61  ? 926  LEU A CA  1 
ATOM 7150 C C   . LEU A 1 929  ? 18.726  27.612 35.507  1.00 61.61  ? 926  LEU A C   1 
ATOM 7151 O O   . LEU A 1 929  ? 19.064  28.699 35.129  1.00 61.61  ? 926  LEU A O   1 
ATOM 7152 C CB  . LEU A 1 929  ? 17.042  27.223 37.312  1.00 51.73  ? 926  LEU A CB  1 
ATOM 7153 C CG  . LEU A 1 929  ? 17.973  27.962 38.333  1.00 51.73  ? 926  LEU A CG  1 
ATOM 7154 C CD1 . LEU A 1 929  ? 17.679  29.469 38.674  1.00 51.73  ? 926  LEU A CD1 1 
ATOM 7155 C CD2 . LEU A 1 929  ? 18.058  27.247 39.631  1.00 51.73  ? 926  LEU A CD2 1 
ATOM 7156 N N   . MET A 1 930  ? 19.585  26.608 35.665  1.00 56.89  ? 927  MET A N   1 
ATOM 7157 C CA  . MET A 1 930  ? 21.015  26.793 35.428  1.00 56.89  ? 927  MET A CA  1 
ATOM 7158 C C   . MET A 1 930  ? 21.698  25.661 34.649  1.00 56.89  ? 927  MET A C   1 
ATOM 7159 O O   . MET A 1 930  ? 22.344  24.796 35.242  1.00 56.89  ? 927  MET A O   1 
ATOM 7160 C CB  . MET A 1 930  ? 21.746  27.023 36.754  1.00 66.11  ? 927  MET A CB  1 
ATOM 7161 C CG  . MET A 1 930  ? 21.610  25.878 37.744  1.00 66.11  ? 927  MET A CG  1 
ATOM 7162 S SD  . MET A 1 930  ? 22.819  25.966 39.079  1.00 66.11  ? 927  MET A SD  1 
ATOM 7163 C CE  . MET A 1 930  ? 21.826  25.433 40.471  1.00 66.11  ? 927  MET A CE  1 
ATOM 7164 N N   . ARG A 1 931  ? 21.566  25.678 33.324  1.00 45.67  ? 928  ARG A N   1 
ATOM 7165 C CA  . ARG A 1 931  ? 22.238  24.697 32.465  1.00 45.67  ? 928  ARG A CA  1 
ATOM 7166 C C   . ARG A 1 931  ? 21.395  23.496 32.016  1.00 45.67  ? 928  ARG A C   1 
ATOM 7167 O O   . ARG A 1 931  ? 21.402  22.447 32.659  1.00 45.67  ? 928  ARG A O   1 
ATOM 7168 C CB  . ARG A 1 931  ? 23.528  24.207 33.132  1.00 72.68  ? 928  ARG A CB  1 
ATOM 7169 C CG  . ARG A 1 931  ? 23.500  22.746 33.553  1.00 72.68  ? 928  ARG A CG  1 
ATOM 7170 C CD  . ARG A 1 931  ? 22.847  22.576 34.915  1.00 72.68  ? 928  ARG A CD  1 
ATOM 7171 N NE  . ARG A 1 931  ? 21.635  21.765 34.844  1.00 72.68  ? 928  ARG A NE  1 
ATOM 7172 C CZ  . ARG A 1 931  ? 21.606  20.448 35.016  1.00 72.68  ? 928  ARG A CZ  1 
ATOM 7173 N NH1 . ARG A 1 931  ? 22.727  19.786 35.272  1.00 72.68  ? 928  ARG A NH1 1 
ATOM 7174 N NH2 . ARG A 1 931  ? 20.457  19.791 34.934  1.00 72.68  ? 928  ARG A NH2 1 
ATOM 7175 N N   . SER A 1 932  ? 20.583  23.685 31.007  1.00 52.69  ? 929  SER A N   1 
ATOM 7176 C CA  . SER A 1 932  ? 20.473  24.907 30.292  1.00 52.69  ? 929  SER A CA  1 
ATOM 7177 C C   . SER A 1 932  ? 19.164  24.660 29.601  1.00 52.69  ? 929  SER A C   1 
ATOM 7178 O O   . SER A 1 932  ? 18.164  25.186 29.992  1.00 52.69  ? 929  SER A O   1 
ATOM 7179 C CB  . SER A 1 932  ? 21.597  24.996 29.314  1.00 59.87  ? 929  SER A CB  1 
ATOM 7180 O OG  . SER A 1 932  ? 21.224  25.793 28.244  1.00 59.87  ? 929  SER A OG  1 
ATOM 7181 N N   . VAL A 1 933  ? 19.132  23.764 28.637  1.00 37.70  ? 930  VAL A N   1 
ATOM 7182 C CA  . VAL A 1 933  ? 17.860  23.276 28.174  1.00 37.70  ? 930  VAL A CA  1 
ATOM 7183 C C   . VAL A 1 933  ? 17.891  21.804 27.872  1.00 37.70  ? 930  VAL A C   1 
ATOM 7184 O O   . VAL A 1 933  ? 18.886  21.313 27.457  1.00 37.70  ? 930  VAL A O   1 
ATOM 7185 C CB  . VAL A 1 933  ? 17.374  24.037 27.001  1.00 42.40  ? 930  VAL A CB  1 
ATOM 7186 C CG1 . VAL A 1 933  ? 17.269  25.450 27.339  1.00 42.40  ? 930  VAL A CG1 1 
ATOM 7187 C CG2 . VAL A 1 933  ? 18.261  23.858 25.884  1.00 42.40  ? 930  VAL A CG2 1 
ATOM 7188 N N   . LEU A 1 934  ? 16.792  21.117 28.158  1.00 60.97  ? 931  LEU A N   1 
ATOM 7189 C CA  . LEU A 1 934  ? 16.562  19.708 27.884  1.00 60.97  ? 931  LEU A CA  1 
ATOM 7190 C C   . LEU A 1 934  ? 15.387  19.662 26.916  1.00 60.97  ? 931  LEU A C   1 
ATOM 7191 O O   . LEU A 1 934  ? 14.513  20.527 26.959  1.00 60.97  ? 931  LEU A O   1 
ATOM 7192 C CB  . LEU A 1 934  ? 16.226  18.953 29.169  1.00 63.80  ? 931  LEU A CB  1 
ATOM 7193 C CG  . LEU A 1 934  ? 17.121  19.238 30.377  1.00 63.80  ? 931  LEU A CG  1 
ATOM 7194 C CD1 . LEU A 1 934  ? 17.187  20.732 30.656  1.00 63.80  ? 931  LEU A CD1 1 
ATOM 7195 C CD2 . LEU A 1 934  ? 16.631  18.481 31.601  1.00 63.80  ? 931  LEU A CD2 1 
ATOM 7196 N N   . LEU A 1 935  ? 15.376  18.689 26.040  1.00 64.04  ? 932  LEU A N   1 
ATOM 7197 C CA  . LEU A 1 935  ? 14.332  18.566 25.082  1.00 64.04  ? 932  LEU A CA  1 
ATOM 7198 C C   . LEU A 1 935  ? 13.723  17.248 25.404  1.00 64.04  ? 932  LEU A C   1 
ATOM 7199 O O   . LEU A 1 935  ? 14.420  16.378 25.816  1.00 64.04  ? 932  LEU A O   1 
ATOM 7200 C CB  . LEU A 1 935  ? 14.941  18.533 23.715  1.00 46.56  ? 932  LEU A CB  1 
ATOM 7201 C CG  . LEU A 1 935  ? 13.817  18.330 22.766  1.00 46.56  ? 932  LEU A CG  1 
ATOM 7202 C CD1 . LEU A 1 935  ? 13.017  19.535 22.965  1.00 46.56  ? 932  LEU A CD1 1 
ATOM 7203 C CD2 . LEU A 1 935  ? 14.310  18.210 21.387  1.00 46.56  ? 932  LEU A CD2 1 
ATOM 7204 N N   . LEU A 1 936  ? 12.419  17.090 25.263  1.00 80.10  ? 933  LEU A N   1 
ATOM 7205 C CA  . LEU A 1 936  ? 11.774  15.880 25.749  1.00 80.10  ? 933  LEU A CA  1 
ATOM 7206 C C   . LEU A 1 936  ? 10.709  15.394 24.784  1.00 80.10  ? 933  LEU A C   1 
ATOM 7207 O O   . LEU A 1 936  ? 10.276  16.128 23.908  1.00 80.10  ? 933  LEU A O   1 
ATOM 7208 C CB  . LEU A 1 936  ? 11.170  16.117 27.140  1.00 62.49  ? 933  LEU A CB  1 
ATOM 7209 C CG  . LEU A 1 936  ? 11.982  15.652 28.363  1.00 62.49  ? 933  LEU A CG  1 
ATOM 7210 C CD1 . LEU A 1 936  ? 13.203  16.530 28.668  1.00 62.49  ? 933  LEU A CD1 1 
ATOM 7211 C CD2 . LEU A 1 936  ? 11.094  15.525 29.597  1.00 62.49  ? 933  LEU A CD2 1 
ATOM 7212 N N   . ALA A 1 937  ? 10.314  14.137 24.926  1.00 67.67  ? 934  ALA A N   1 
ATOM 7213 C CA  . ALA A 1 937  ? 9.120   13.629 24.239  1.00 67.67  ? 934  ALA A CA  1 
ATOM 7214 C C   . ALA A 1 937  ? 8.167   12.957 25.209  1.00 67.67  ? 934  ALA A C   1 
ATOM 7215 O O   . ALA A 1 937  ? 8.531   12.571 26.328  1.00 67.67  ? 934  ALA A O   1 
ATOM 7216 C CB  . ALA A 1 937  ? 9.464   12.680 23.065  1.00 29.48  ? 934  ALA A CB  1 
ATOM 7217 N N   . TYR A 1 938  ? 6.929   12.862 24.786  1.00 90.12  ? 935  TYR A N   1 
ATOM 7218 C CA  . TYR A 1 938  ? 6.026   12.039 25.494  1.00 90.12  ? 935  TYR A CA  1 
ATOM 7219 C C   . TYR A 1 938  ? 5.952   10.793 24.652  1.00 90.12  ? 935  TYR A C   1 
ATOM 7220 O O   . TYR A 1 938  ? 5.955   10.886 23.419  1.00 90.12  ? 935  TYR A O   1 
ATOM 7221 C CB  . TYR A 1 938  ? 4.675   12.707 25.587  1.00 62.07  ? 935  TYR A CB  1 
ATOM 7222 C CG  . TYR A 1 938  ? 3.640   11.818 26.189  1.00 62.07  ? 935  TYR A CG  1 
ATOM 7223 C CD1 . TYR A 1 938  ? 3.760   11.380 27.507  1.00 62.07  ? 935  TYR A CD1 1 
ATOM 7224 C CD2 . TYR A 1 938  ? 2.546   11.390 25.432  1.00 62.07  ? 935  TYR A CD2 1 
ATOM 7225 C CE1 . TYR A 1 938  ? 2.798   10.559 28.067  1.00 62.07  ? 935  TYR A CE1 1 
ATOM 7226 C CE2 . TYR A 1 938  ? 1.577   10.564 25.974  1.00 62.07  ? 935  TYR A CE2 1 
ATOM 7227 C CZ  . TYR A 1 938  ? 1.704   10.151 27.295  1.00 62.07  ? 935  TYR A CZ  1 
ATOM 7228 O OH  . TYR A 1 938  ? 0.741   9.327  27.842  1.00 62.07  ? 935  TYR A OH  1 
ATOM 7229 N N   . LYS A 1 939  ? 5.920   9.629  25.299  1.00 82.22  ? 936  LYS A N   1 
ATOM 7230 C CA  . LYS A 1 939  ? 5.749   8.380  24.563  1.00 82.22  ? 936  LYS A CA  1 
ATOM 7231 C C   . LYS A 1 939  ? 4.416   7.682  24.890  1.00 82.22  ? 936  LYS A C   1 
ATOM 7232 O O   . LYS A 1 939  ? 4.256   7.069  25.969  1.00 82.22  ? 936  LYS A O   1 
ATOM 7233 C CB  . LYS A 1 939  ? 6.942   7.448  24.781  1.00 61.98  ? 936  LYS A CB  1 
ATOM 7234 C CG  . LYS A 1 939  ? 8.278   8.150  24.996  1.00 61.98  ? 936  LYS A CG  1 
ATOM 7235 C CD  . LYS A 1 939  ? 8.685   9.068  23.833  1.00 61.98  ? 936  LYS A CD  1 
ATOM 7236 C CE  . LYS A 1 939  ? 8.984   8.314  22.560  1.00 61.98  ? 936  LYS A CE  1 
ATOM 7237 N NZ  . LYS A 1 939  ? 10.089  7.369  22.806  1.00 61.98  ? 936  LYS A NZ  1 
ATOM 7238 N N   . PRO A 1 940  ? 3.453   7.755  23.951  1.00 69.77  ? 937  PRO A N   1 
ATOM 7239 C CA  . PRO A 1 940  ? 2.236   6.941  24.091  1.00 69.77  ? 937  PRO A CA  1 
ATOM 7240 C C   . PRO A 1 940  ? 2.651   5.439  24.070  1.00 69.77  ? 937  PRO A C   1 
ATOM 7241 O O   . PRO A 1 940  ? 2.189   4.605  23.264  1.00 69.77  ? 937  PRO A O   1 
ATOM 7242 C CB  . PRO A 1 940  ? 1.382   7.360  22.882  1.00 63.37  ? 937  PRO A CB  1 
ATOM 7243 C CG  . PRO A 1 940  ? 2.031   8.646  22.348  1.00 63.37  ? 937  PRO A CG  1 
ATOM 7244 C CD  . PRO A 1 940  ? 3.475   8.535  22.701  1.00 63.37  ? 937  PRO A CD  1 
ATOM 7245 N N   . MET A 1 941  ? 3.589   5.143  24.953  1.00 107.41 ? 938  MET A N   1 
ATOM 7246 C CA  . MET A 1 941  ? 4.097   3.831  25.139  1.00 107.41 ? 938  MET A CA  1 
ATOM 7247 C C   . MET A 1 941  ? 3.486   3.552  26.476  1.00 107.41 ? 938  MET A C   1 
ATOM 7248 O O   . MET A 1 941  ? 2.264   3.438  26.585  1.00 107.41 ? 938  MET A O   1 
ATOM 7249 C CB  . MET A 1 941  ? 5.611   3.914  25.236  1.00 139.13 ? 938  MET A CB  1 
ATOM 7250 C CG  . MET A 1 941  ? 6.306   2.636  25.652  1.00 139.13 ? 938  MET A CG  1 
ATOM 7251 S SD  . MET A 1 941  ? 7.719   3.011  26.705  1.00 139.13 ? 938  MET A SD  1 
ATOM 7252 C CE  . MET A 1 941  ? 8.858   3.781  25.539  1.00 139.13 ? 938  MET A CE  1 
ATOM 7253 N N   . GLU A 1 942  ? 4.322   3.496  27.507  1.00 151.34 ? 939  GLU A N   1 
ATOM 7254 C CA  . GLU A 1 942  ? 3.839   3.416  28.875  1.00 151.34 ? 939  GLU A CA  1 
ATOM 7255 C C   . GLU A 1 942  ? 3.462   4.823  29.350  1.00 151.34 ? 939  GLU A C   1 
ATOM 7256 O O   . GLU A 1 942  ? 3.354   5.091  30.556  1.00 151.34 ? 939  GLU A O   1 
ATOM 7257 C CB  . GLU A 1 942  ? 4.878   2.751  29.795  1.00 167.01 ? 939  GLU A CB  1 
ATOM 7258 C CG  . GLU A 1 942  ? 6.172   3.537  29.997  1.00 167.01 ? 939  GLU A CG  1 
ATOM 7259 C CD  . GLU A 1 942  ? 6.879   3.183  31.293  1.00 167.01 ? 939  GLU A CD  1 
ATOM 7260 O OE1 . GLU A 1 942  ? 7.278   4.112  32.031  1.00 167.01 ? 939  GLU A OE1 1 
ATOM 7261 O OE2 . GLU A 1 942  ? 7.026   1.976  31.577  1.00 167.01 ? 939  GLU A OE2 1 
ATOM 7262 N N   . GLY A 1 943  ? 3.247   5.718  28.388  1.00 150.17 ? 940  GLY A N   1 
ATOM 7263 C CA  . GLY A 1 943  ? 2.983   7.099  28.715  1.00 150.17 ? 940  GLY A CA  1 
ATOM 7264 C C   . GLY A 1 943  ? 4.129   7.538  29.586  1.00 150.17 ? 940  GLY A C   1 
ATOM 7265 O O   . GLY A 1 943  ? 3.930   8.014  30.700  1.00 150.17 ? 940  GLY A O   1 
ATOM 7266 N N   . ASN A 1 944  ? 5.334   7.305  29.080  1.00 79.77  ? 941  ASN A N   1 
ATOM 7267 C CA  . ASN A 1 944  ? 6.560   7.735  29.742  1.00 79.77  ? 941  ASN A CA  1 
ATOM 7268 C C   . ASN A 1 944  ? 7.125   9.063  29.182  1.00 79.77  ? 941  ASN A C   1 
ATOM 7269 O O   . ASN A 1 944  ? 6.692   9.560  28.120  1.00 79.77  ? 941  ASN A O   1 
ATOM 7270 C CB  . ASN A 1 944  ? 7.619   6.633  29.646  1.00 168.97 ? 941  ASN A CB  1 
ATOM 7271 C CG  . ASN A 1 944  ? 8.644   6.708  30.759  1.00 168.97 ? 941  ASN A CG  1 
ATOM 7272 O OD1 . ASN A 1 944  ? 9.821   6.968  30.518  1.00 168.97 ? 941  ASN A OD1 1 
ATOM 7273 N ND2 . ASN A 1 944  ? 8.198   6.486  31.990  1.00 168.97 ? 941  ASN A ND2 1 
ATOM 7274 N N   . PHE A 1 945  ? 8.069   9.643  29.926  1.00 47.06  ? 942  PHE A N   1 
ATOM 7275 C CA  . PHE A 1 945  ? 8.976   10.641 29.375  1.00 47.06  ? 942  PHE A CA  1 
ATOM 7276 C C   . PHE A 1 945  ? 10.309  10.016 29.005  1.00 47.06  ? 942  PHE A C   1 
ATOM 7277 O O   . PHE A 1 945  ? 11.016  9.460  29.871  1.00 47.06  ? 942  PHE A O   1 
ATOM 7278 C CB  . PHE A 1 945  ? 9.260   11.766 30.364  1.00 45.33  ? 942  PHE A CB  1 
ATOM 7279 C CG  . PHE A 1 945  ? 8.170   12.742 30.475  1.00 45.33  ? 942  PHE A CG  1 
ATOM 7280 C CD1 . PHE A 1 945  ? 7.899   13.344 31.679  1.00 45.33  ? 942  PHE A CD1 1 
ATOM 7281 C CD2 . PHE A 1 945  ? 7.394   13.049 29.382  1.00 45.33  ? 942  PHE A CD2 1 
ATOM 7282 C CE1 . PHE A 1 945  ? 6.899   14.259 31.785  1.00 45.33  ? 942  PHE A CE1 1 
ATOM 7283 C CE2 . PHE A 1 945  ? 6.380   13.955 29.493  1.00 45.33  ? 942  PHE A CE2 1 
ATOM 7284 C CZ  . PHE A 1 945  ? 6.142   14.567 30.696  1.00 45.33  ? 942  PHE A CZ  1 
ATOM 7285 N N   . GLU A 1 946  ? 10.631  10.133 27.718  1.00 94.28  ? 943  GLU A N   1 
ATOM 7286 C CA  . GLU A 1 946  ? 11.976  9.950  27.212  1.00 94.28  ? 943  GLU A CA  1 
ATOM 7287 C C   . GLU A 1 946  ? 12.629  11.321 27.038  1.00 94.28  ? 943  GLU A C   1 
ATOM 7288 O O   . GLU A 1 946  ? 12.088  12.182 26.341  1.00 94.28  ? 943  GLU A O   1 
ATOM 7289 C CB  . GLU A 1 946  ? 11.938  9.249  25.862  1.00 90.73  ? 943  GLU A CB  1 
ATOM 7290 C CG  . GLU A 1 946  ? 13.329  9.089  25.244  1.00 90.73  ? 943  GLU A CG  1 
ATOM 7291 C CD  . GLU A 1 946  ? 13.305  8.736  23.764  1.00 90.73  ? 943  GLU A CD  1 
ATOM 7292 O OE1 . GLU A 1 946  ? 14.412  8.533  23.194  1.00 90.73  ? 943  GLU A OE1 1 
ATOM 7293 O OE2 . GLU A 1 946  ? 12.194  8.673  23.178  1.00 90.73  ? 943  GLU A OE2 1 
ATOM 7294 N N   . GLU A 1 947  ? 13.790  11.507 27.668  1.00 47.14  ? 944  GLU A N   1 
ATOM 7295 C CA  . GLU A 1 947  ? 14.587  12.747 27.567  1.00 47.14  ? 944  GLU A CA  1 
ATOM 7296 C C   . GLU A 1 947  ? 15.446  12.779 26.298  1.00 47.14  ? 944  GLU A C   1 
ATOM 7297 O O   . GLU A 1 947  ? 16.554  12.239 26.328  1.00 47.14  ? 944  GLU A O   1 
ATOM 7298 C CB  . GLU A 1 947  ? 15.484  12.854 28.803  1.00 80.08  ? 944  GLU A CB  1 
ATOM 7299 C CG  . GLU A 1 947  ? 16.476  13.981 28.781  1.00 80.08  ? 944  GLU A CG  1 
ATOM 7300 C CD  . GLU A 1 947  ? 17.253  14.075 30.076  1.00 80.08  ? 944  GLU A CD  1 
ATOM 7301 O OE1 . GLU A 1 947  ? 18.134  14.959 30.156  1.00 80.08  ? 944  GLU A OE1 1 
ATOM 7302 O OE2 . GLU A 1 947  ? 16.992  13.279 31.015  1.00 80.08  ? 944  GLU A OE2 1 
ATOM 7303 N N   . ILE A 1 948  ? 14.957  13.415 25.218  1.00 56.41  ? 945  ILE A N   1 
ATOM 7304 C CA  . ILE A 1 948  ? 15.623  13.362 23.889  1.00 56.41  ? 945  ILE A CA  1 
ATOM 7305 C C   . ILE A 1 948  ? 17.069  13.865 23.770  1.00 56.41  ? 945  ILE A C   1 
ATOM 7306 O O   . ILE A 1 948  ? 17.908  13.198 23.149  1.00 56.41  ? 945  ILE A O   1 
ATOM 7307 C CB  . ILE A 1 948  ? 14.822  14.022 22.767  1.00 60.39  ? 945  ILE A CB  1 
ATOM 7308 C CG1 . ILE A 1 948  ? 13.919  13.000 22.086  1.00 60.39  ? 945  ILE A CG1 1 
ATOM 7309 C CG2 . ILE A 1 948  ? 15.764  14.573 21.702  1.00 60.39  ? 945  ILE A CG2 1 
ATOM 7310 C CD1 . ILE A 1 948  ? 12.471  13.154 22.438  1.00 60.39  ? 945  ILE A CD1 1 
ATOM 7311 N N   . ALA A 1 949  ? 17.337  15.055 24.306  1.00 61.72  ? 946  ALA A N   1 
ATOM 7312 C CA  . ALA A 1 949  ? 18.677  15.655 24.284  1.00 61.72  ? 946  ALA A CA  1 
ATOM 7313 C C   . ALA A 1 949  ? 18.733  16.801 25.270  1.00 61.72  ? 946  ALA A C   1 
ATOM 7314 O O   . ALA A 1 949  ? 17.706  17.214 25.804  1.00 61.72  ? 946  ALA A O   1 
ATOM 7315 C CB  . ALA A 1 949  ? 19.052  16.166 22.862  1.00 45.39  ? 946  ALA A CB  1 
ATOM 7316 N N   . ARG A 1 950  ? 19.939  17.304 25.506  1.00 52.88  ? 947  ARG A N   1 
ATOM 7317 C CA  . ARG A 1 950  ? 20.103  18.578 26.189  1.00 52.88  ? 947  ARG A CA  1 
ATOM 7318 C C   . ARG A 1 950  ? 21.312  19.397 25.732  1.00 52.88  ? 947  ARG A C   1 
ATOM 7319 O O   . ARG A 1 950  ? 22.156  18.922 24.978  1.00 52.88  ? 947  ARG A O   1 
ATOM 7320 C CB  . ARG A 1 950  ? 20.075  18.433 27.710  1.00 66.21  ? 947  ARG A CB  1 
ATOM 7321 C CG  . ARG A 1 950  ? 21.309  17.969 28.346  1.00 66.21  ? 947  ARG A CG  1 
ATOM 7322 C CD  . ARG A 1 950  ? 20.968  17.682 29.756  1.00 66.21  ? 947  ARG A CD  1 
ATOM 7323 N NE  . ARG A 1 950  ? 21.610  18.639 30.627  1.00 66.21  ? 947  ARG A NE  1 
ATOM 7324 C CZ  . ARG A 1 950  ? 22.441  18.291 31.605  1.00 66.21  ? 947  ARG A CZ  1 
ATOM 7325 N NH1 . ARG A 1 950  ? 22.685  17.002 31.843  1.00 66.21  ? 947  ARG A NH1 1 
ATOM 7326 N NH2 . ARG A 1 950  ? 23.018  19.229 32.359  1.00 66.21  ? 947  ARG A NH2 1 
ATOM 7327 N N   . ASP A 1 951  ? 21.327  20.655 26.147  1.00 49.30  ? 948  ASP A N   1 
ATOM 7328 C CA  . ASP A 1 951  ? 22.397  21.537 25.865  1.00 49.30  ? 948  ASP A CA  1 
ATOM 7329 C C   . ASP A 1 951  ? 23.180  21.478 27.147  1.00 49.30  ? 948  ASP A C   1 
ATOM 7330 O O   . ASP A 1 951  ? 22.610  21.378 28.221  1.00 49.30  ? 948  ASP A O   1 
ATOM 7331 C CB  . ASP A 1 951  ? 21.865  22.928 25.561  1.00 58.82  ? 948  ASP A CB  1 
ATOM 7332 C CG  . ASP A 1 951  ? 22.965  23.930 25.218  1.00 58.82  ? 948  ASP A CG  1 
ATOM 7333 O OD1 . ASP A 1 951  ? 24.128  23.829 25.687  1.00 58.82  ? 948  ASP A OD1 1 
ATOM 7334 O OD2 . ASP A 1 951  ? 22.642  24.867 24.480  1.00 58.82  ? 948  ASP A OD2 1 
ATOM 7335 N N   . PHE A 1 952  ? 24.496  21.487 27.009  1.00 55.57  ? 949  PHE A N   1 
ATOM 7336 C CA  . PHE A 1 952  ? 25.402  21.192 28.096  1.00 55.57  ? 949  PHE A CA  1 
ATOM 7337 C C   . PHE A 1 952  ? 26.184  22.441 28.414  1.00 55.57  ? 949  PHE A C   1 
ATOM 7338 O O   . PHE A 1 952  ? 27.362  22.381 28.759  1.00 55.57  ? 949  PHE A O   1 
ATOM 7339 C CB  . PHE A 1 952  ? 26.332  20.025 27.729  1.00 62.74  ? 949  PHE A CB  1 
ATOM 7340 C CG  . PHE A 1 952  ? 25.726  18.654 27.973  1.00 62.74  ? 949  PHE A CG  1 
ATOM 7341 C CD1 . PHE A 1 952  ? 24.897  18.052 27.023  1.00 62.74  ? 949  PHE A CD1 1 
ATOM 7342 C CD2 . PHE A 1 952  ? 25.988  17.954 29.159  1.00 62.74  ? 949  PHE A CD2 1 
ATOM 7343 C CE1 . PHE A 1 952  ? 24.333  16.773 27.260  1.00 62.74  ? 949  PHE A CE1 1 
ATOM 7344 C CE2 . PHE A 1 952  ? 25.437  16.687 29.389  1.00 62.74  ? 949  PHE A CE2 1 
ATOM 7345 C CZ  . PHE A 1 952  ? 24.604  16.105 28.448  1.00 62.74  ? 949  PHE A CZ  1 
ATOM 7346 N N   . ASN A 1 953  ? 25.518  23.580 28.302  1.00 48.38  ? 950  ASN A N   1 
ATOM 7347 C CA  . ASN A 1 953  ? 26.133  24.828 28.737  1.00 48.38  ? 950  ASN A CA  1 
ATOM 7348 C C   . ASN A 1 953  ? 25.528  25.420 30.034  1.00 48.38  ? 950  ASN A C   1 
ATOM 7349 O O   . ASN A 1 953  ? 24.376  25.149 30.437  1.00 48.38  ? 950  ASN A O   1 
ATOM 7350 C CB  . ASN A 1 953  ? 26.139  25.855 27.595  1.00 61.25  ? 950  ASN A CB  1 
ATOM 7351 C CG  . ASN A 1 953  ? 27.214  25.563 26.540  1.00 61.25  ? 950  ASN A CG  1 
ATOM 7352 O OD1 . ASN A 1 953  ? 26.906  25.139 25.403  1.00 61.25  ? 950  ASN A OD1 1 
ATOM 7353 N ND2 . ASN A 1 953  ? 28.480  25.800 26.912  1.00 61.25  ? 950  ASN A ND2 1 
ATOM 7354 N N   . PRO A 1 954  ? 26.309  26.231 30.715  1.00 57.18  ? 951  PRO A N   1 
ATOM 7355 C CA  . PRO A 1 954  ? 25.960  26.705 32.050  1.00 57.18  ? 951  PRO A CA  1 
ATOM 7356 C C   . PRO A 1 954  ? 25.031  27.932 32.079  1.00 57.18  ? 951  PRO A C   1 
ATOM 7357 O O   . PRO A 1 954  ? 25.183  28.812 32.953  1.00 57.18  ? 951  PRO A O   1 
ATOM 7358 C CB  . PRO A 1 954  ? 27.330  27.046 32.649  1.00 43.22  ? 951  PRO A CB  1 
ATOM 7359 C CG  . PRO A 1 954  ? 28.343  26.666 31.565  1.00 43.22  ? 951  PRO A CG  1 
ATOM 7360 C CD  . PRO A 1 954  ? 27.613  26.715 30.286  1.00 43.22  ? 951  PRO A CD  1 
ATOM 7361 N N   . ASN A 1 955  ? 24.071  27.965 31.151  1.00 37.69  ? 952  ASN A N   1 
ATOM 7362 C CA  . ASN A 1 955  ? 23.165  29.088 30.994  1.00 37.69  ? 952  ASN A CA  1 
ATOM 7363 C C   . ASN A 1 955  ? 22.083  29.186 32.068  1.00 37.69  ? 952  ASN A C   1 
ATOM 7364 O O   . ASN A 1 955  ? 21.180  28.353 32.073  1.00 37.69  ? 952  ASN A O   1 
ATOM 7365 C CB  . ASN A 1 955  ? 22.478  28.952 29.657  1.00 44.89  ? 952  ASN A CB  1 
ATOM 7366 C CG  . ASN A 1 955  ? 23.431  29.104 28.496  1.00 44.89  ? 952  ASN A CG  1 
ATOM 7367 O OD1 . ASN A 1 955  ? 24.392  29.878 28.574  1.00 44.89  ? 952  ASN A OD1 1 
ATOM 7368 N ND2 . ASN A 1 955  ? 23.144  28.401 27.384  1.00 44.89  ? 952  ASN A ND2 1 
ATOM 7369 N N   . TRP A 1 956  ? 22.150  30.189 32.965  1.00 40.65  ? 953  TRP A N   1 
ATOM 7370 C CA  . TRP A 1 956  ? 20.998  30.503 33.834  1.00 40.65  ? 953  TRP A CA  1 
ATOM 7371 C C   . TRP A 1 956  ? 19.800  31.087 33.060  1.00 40.65  ? 953  TRP A C   1 
ATOM 7372 O O   . TRP A 1 956  ? 19.714  32.267 32.808  1.00 40.65  ? 953  TRP A O   1 
ATOM 7373 C CB  . TRP A 1 956  ? 21.378  31.421 34.958  1.00 63.51  ? 953  TRP A CB  1 
ATOM 7374 C CG  . TRP A 1 956  ? 22.382  30.870 35.830  1.00 63.51  ? 953  TRP A CG  1 
ATOM 7375 C CD1 . TRP A 1 956  ? 23.576  30.345 35.461  1.00 63.51  ? 953  TRP A CD1 1 
ATOM 7376 C CD2 . TRP A 1 956  ? 22.332  30.810 37.262  1.00 63.51  ? 953  TRP A CD2 1 
ATOM 7377 N NE1 . TRP A 1 956  ? 24.265  29.944 36.569  1.00 63.51  ? 953  TRP A NE1 1 
ATOM 7378 C CE2 . TRP A 1 956  ? 23.530  30.224 37.691  1.00 63.51  ? 953  TRP A CE2 1 
ATOM 7379 C CE3 . TRP A 1 956  ? 21.383  31.193 38.225  1.00 63.51  ? 953  TRP A CE3 1 
ATOM 7380 C CZ2 . TRP A 1 956  ? 23.810  29.993 39.045  1.00 63.51  ? 953  TRP A CZ2 1 
ATOM 7381 C CZ3 . TRP A 1 956  ? 21.665  30.973 39.580  1.00 63.51  ? 953  TRP A CZ3 1 
ATOM 7382 C CH2 . TRP A 1 956  ? 22.863  30.376 39.970  1.00 63.51  ? 953  TRP A CH2 1 
ATOM 7383 N N   . MET A 1 957  ? 18.868  30.242 32.674  1.00 39.19  ? 954  MET A N   1 
ATOM 7384 C CA  . MET A 1 957  ? 17.758  30.703 31.887  1.00 39.19  ? 954  MET A CA  1 
ATOM 7385 C C   . MET A 1 957  ? 16.835  31.711 32.584  1.00 39.19  ? 954  MET A C   1 
ATOM 7386 O O   . MET A 1 957  ? 16.691  31.755 33.835  1.00 39.19  ? 954  MET A O   1 
ATOM 7387 C CB  . MET A 1 957  ? 16.936  29.513 31.422  1.00 37.58  ? 954  MET A CB  1 
ATOM 7388 C CG  . MET A 1 957  ? 17.760  28.401 30.857  1.00 37.58  ? 954  MET A CG  1 
ATOM 7389 S SD  . MET A 1 957  ? 18.779  28.906 29.464  1.00 37.58  ? 954  MET A SD  1 
ATOM 7390 C CE  . MET A 1 957  ? 17.535  28.983 28.176  1.00 37.58  ? 954  MET A CE  1 
ATOM 7391 N N   . SER A 1 958  ? 16.188  32.491 31.728  1.00 39.33  ? 955  SER A N   1 
ATOM 7392 C CA  . SER A 1 958  ? 15.121  33.347 32.135  1.00 39.33  ? 955  SER A CA  1 
ATOM 7393 C C   . SER A 1 958  ? 13.906  33.176 31.227  1.00 39.33  ? 955  SER A C   1 
ATOM 7394 O O   . SER A 1 958  ? 12.768  33.453 31.639  1.00 39.33  ? 955  SER A O   1 
ATOM 7395 C CB  . SER A 1 958  ? 15.607  34.775 32.054  1.00 41.58  ? 955  SER A CB  1 
ATOM 7396 O OG  . SER A 1 958  ? 15.844  35.110 30.703  1.00 41.58  ? 955  SER A OG  1 
ATOM 7397 N N   . ALA A 1 959  ? 14.143  32.758 29.982  1.00 31.54  ? 956  ALA A N   1 
ATOM 7398 C CA  . ALA A 1 959  ? 13.058  32.582 29.012  1.00 31.54  ? 956  ALA A CA  1 
ATOM 7399 C C   . ALA A 1 959  ? 13.471  31.587 27.943  1.00 31.54  ? 956  ALA A C   1 
ATOM 7400 O O   . ALA A 1 959  ? 14.632  31.532 27.597  1.00 31.54  ? 956  ALA A O   1 
ATOM 7401 C CB  . ALA A 1 959  ? 12.687  33.894 28.402  1.00 49.77  ? 956  ALA A CB  1 
ATOM 7402 N N   . VAL A 1 960  ? 12.516  30.798 27.442  1.00 39.55  ? 957  VAL A N   1 
ATOM 7403 C CA  . VAL A 1 960  ? 12.760  29.643 26.577  1.00 39.55  ? 957  VAL A CA  1 
ATOM 7404 C C   . VAL A 1 960  ? 11.625  29.646 25.575  1.00 39.55  ? 957  VAL A C   1 
ATOM 7405 O O   . VAL A 1 960  ? 10.532  30.023 25.921  1.00 39.55  ? 957  VAL A O   1 
ATOM 7406 C CB  . VAL A 1 960  ? 12.651  28.342 27.400  1.00 43.25  ? 957  VAL A CB  1 
ATOM 7407 C CG1 . VAL A 1 960  ? 12.444  27.138 26.526  1.00 43.25  ? 957  VAL A CG1 1 
ATOM 7408 C CG2 . VAL A 1 960  ? 13.864  28.131 28.236  1.00 43.25  ? 957  VAL A CG2 1 
ATOM 7409 N N   . GLU A 1 961  ? 11.866  29.265 24.332  1.00 54.03  ? 958  GLU A N   1 
ATOM 7410 C CA  . GLU A 1 961  ? 10.780  29.151 23.366  1.00 54.03  ? 958  GLU A CA  1 
ATOM 7411 C C   . GLU A 1 961  ? 11.140  28.177 22.272  1.00 54.03  ? 958  GLU A C   1 
ATOM 7412 O O   . GLU A 1 961  ? 12.319  27.912 22.015  1.00 54.03  ? 958  GLU A O   1 
ATOM 7413 C CB  . GLU A 1 961  ? 10.446  30.488 22.739  1.00 50.82  ? 958  GLU A CB  1 
ATOM 7414 C CG  . GLU A 1 961  ? 9.338   30.445 21.737  1.00 50.82  ? 958  GLU A CG  1 
ATOM 7415 C CD  . GLU A 1 961  ? 8.034   30.036 22.384  1.00 50.82  ? 958  GLU A CD  1 
ATOM 7416 O OE1 . GLU A 1 961  ? 7.737   28.809 22.369  1.00 50.82  ? 958  GLU A OE1 1 
ATOM 7417 O OE2 . GLU A 1 961  ? 7.322   30.930 22.932  1.00 50.82  ? 958  GLU A OE2 1 
ATOM 7418 N N   . ILE A 1 962  ? 10.130  27.637 21.614  1.00 46.25  ? 959  ILE A N   1 
ATOM 7419 C CA  . ILE A 1 962  ? 10.383  26.673 20.584  1.00 46.25  ? 959  ILE A CA  1 
ATOM 7420 C C   . ILE A 1 962  ? 10.084  27.368 19.264  1.00 46.25  ? 959  ILE A C   1 
ATOM 7421 O O   . ILE A 1 962  ? 8.970   27.848 19.054  1.00 46.25  ? 959  ILE A O   1 
ATOM 7422 C CB  . ILE A 1 962  ? 9.483   25.440 20.817  1.00 41.99  ? 959  ILE A CB  1 
ATOM 7423 C CG1 . ILE A 1 962  ? 9.840   24.756 22.152  1.00 41.99  ? 959  ILE A CG1 1 
ATOM 7424 C CG2 . ILE A 1 962  ? 9.509   24.503 19.592  1.00 41.99  ? 959  ILE A CG2 1 
ATOM 7425 C CD1 . ILE A 1 962  ? 9.001   23.530 22.501  1.00 41.99  ? 959  ILE A CD1 1 
ATOM 7426 N N   . LEU A 1 963  ? 11.069  27.460 18.381  1.00 60.23  ? 960  LEU A N   1 
ATOM 7427 C CA  . LEU A 1 963  ? 10.829  28.109 17.081  1.00 60.23  ? 960  LEU A CA  1 
ATOM 7428 C C   . LEU A 1 963  ? 10.209  27.168 16.063  1.00 60.23  ? 960  LEU A C   1 
ATOM 7429 O O   . LEU A 1 963  ? 9.329   27.559 15.306  1.00 60.23  ? 960  LEU A O   1 
ATOM 7430 C CB  . LEU A 1 963  ? 12.097  28.725 16.493  1.00 39.03  ? 960  LEU A CB  1 
ATOM 7431 C CG  . LEU A 1 963  ? 12.985  29.630 17.334  1.00 39.03  ? 960  LEU A CG  1 
ATOM 7432 C CD1 . LEU A 1 963  ? 13.898  30.296 16.385  1.00 39.03  ? 960  LEU A CD1 1 
ATOM 7433 C CD2 . LEU A 1 963  ? 12.205  30.686 18.029  1.00 39.03  ? 960  LEU A CD2 1 
ATOM 7434 N N   . ASP A 1 964  ? 10.705  25.941 16.033  1.00 66.86  ? 961  ASP A N   1 
ATOM 7435 C CA  . ASP A 1 964  ? 10.163  24.899 15.189  1.00 66.86  ? 961  ASP A CA  1 
ATOM 7436 C C   . ASP A 1 964  ? 10.679  23.554 15.670  1.00 66.86  ? 961  ASP A C   1 
ATOM 7437 O O   . ASP A 1 964  ? 11.519  23.491 16.582  1.00 66.86  ? 961  ASP A O   1 
ATOM 7438 C CB  . ASP A 1 964  ? 10.528  25.131 13.722  1.00 77.47  ? 961  ASP A CB  1 
ATOM 7439 C CG  . ASP A 1 964  ? 12.015  25.109 13.485  1.00 77.47  ? 961  ASP A CG  1 
ATOM 7440 O OD1 . ASP A 1 964  ? 12.469  25.825 12.559  1.00 77.47  ? 961  ASP A OD1 1 
ATOM 7441 O OD2 . ASP A 1 964  ? 12.725  24.376 14.220  1.00 77.47  ? 961  ASP A OD2 1 
ATOM 7442 N N   . ASP A 1 965  ? 10.183  22.483 15.054  1.00 59.49  ? 962  ASP A N   1 
ATOM 7443 C CA  . ASP A 1 965  ? 10.517  21.129 15.500  1.00 59.49  ? 962  ASP A CA  1 
ATOM 7444 C C   . ASP A 1 965  ? 11.980  20.905 15.947  1.00 59.49  ? 962  ASP A C   1 
ATOM 7445 O O   . ASP A 1 965  ? 12.250  19.974 16.712  1.00 59.49  ? 962  ASP A O   1 
ATOM 7446 C CB  . ASP A 1 965  ? 10.144  20.106 14.431  1.00 115.27 ? 962  ASP A CB  1 
ATOM 7447 C CG  . ASP A 1 965  ? 8.662   20.031 14.210  1.00 115.27 ? 962  ASP A CG  1 
ATOM 7448 O OD1 . ASP A 1 965  ? 8.099   21.042 13.726  1.00 115.27 ? 962  ASP A OD1 1 
ATOM 7449 O OD2 . ASP A 1 965  ? 8.063   18.977 14.537  1.00 115.27 ? 962  ASP A OD2 1 
ATOM 7450 N N   . ASP A 1 966  ? 12.905  21.741 15.472  1.00 92.59  ? 963  ASP A N   1 
ATOM 7451 C CA  . ASP A 1 966  ? 14.324  21.516 15.709  1.00 92.59  ? 963  ASP A CA  1 
ATOM 7452 C C   . ASP A 1 966  ? 14.980  22.675 16.454  1.00 92.59  ? 963  ASP A C   1 
ATOM 7453 O O   . ASP A 1 966  ? 15.823  22.445 17.335  1.00 92.59  ? 963  ASP A O   1 
ATOM 7454 C CB  . ASP A 1 966  ? 15.043  21.216 14.387  1.00 121.02 ? 963  ASP A CB  1 
ATOM 7455 C CG  . ASP A 1 966  ? 14.613  19.879 13.775  1.00 121.02 ? 963  ASP A CG  1 
ATOM 7456 O OD1 . ASP A 1 966  ? 15.351  18.866 13.950  1.00 121.02 ? 963  ASP A OD1 1 
ATOM 7457 O OD2 . ASP A 1 966  ? 13.539  19.833 13.104  1.00 121.02 ? 963  ASP A OD2 1 
ATOM 7458 N N   . ASN A 1 967  ? 14.566  23.903 16.116  1.00 72.88  ? 964  ASN A N   1 
ATOM 7459 C CA  . ASN A 1 967  ? 15.136  25.142 16.683  1.00 72.88  ? 964  ASN A CA  1 
ATOM 7460 C C   . ASN A 1 967  ? 14.517  25.611 17.975  1.00 72.88  ? 964  ASN A C   1 
ATOM 7461 O O   . ASN A 1 967  ? 13.311  25.680 18.098  1.00 72.88  ? 964  ASN A O   1 
ATOM 7462 C CB  . ASN A 1 967  ? 15.097  26.274 15.669  1.00 80.18  ? 964  ASN A CB  1 
ATOM 7463 C CG  . ASN A 1 967  ? 16.118  26.088 14.553  1.00 80.18  ? 964  ASN A CG  1 
ATOM 7464 O OD1 . ASN A 1 967  ? 17.099  25.333 14.687  1.00 80.18  ? 964  ASN A OD1 1 
ATOM 7465 N ND2 . ASN A 1 967  ? 15.895  26.787 13.439  1.00 80.18  ? 964  ASN A ND2 1 
ATOM 7466 N N   . PHE A 1 968  ? 15.380  25.928 18.931  1.00 39.00  ? 965  PHE A N   1 
ATOM 7467 C CA  . PHE A 1 968  ? 15.002  26.327 20.273  1.00 39.00  ? 965  PHE A CA  1 
ATOM 7468 C C   . PHE A 1 968  ? 15.668  27.627 20.699  1.00 39.00  ? 965  PHE A C   1 
ATOM 7469 O O   . PHE A 1 968  ? 16.899  27.682 20.895  1.00 39.00  ? 965  PHE A O   1 
ATOM 7470 C CB  . PHE A 1 968  ? 15.327  25.224 21.255  1.00 38.12  ? 965  PHE A CB  1 
ATOM 7471 C CG  . PHE A 1 968  ? 14.671  23.932 20.922  1.00 38.12  ? 965  PHE A CG  1 
ATOM 7472 C CD1 . PHE A 1 968  ? 15.402  22.732 20.939  1.00 38.12  ? 965  PHE A CD1 1 
ATOM 7473 C CD2 . PHE A 1 968  ? 13.313  23.897 20.561  1.00 38.12  ? 965  PHE A CD2 1 
ATOM 7474 C CE1 . PHE A 1 968  ? 14.813  21.506 20.624  1.00 38.12  ? 965  PHE A CE1 1 
ATOM 7475 C CE2 . PHE A 1 968  ? 12.678  22.678 20.229  1.00 38.12  ? 965  PHE A CE2 1 
ATOM 7476 C CZ  . PHE A 1 968  ? 13.436  21.470 20.274  1.00 38.12  ? 965  PHE A CZ  1 
ATOM 7477 N N   . LEU A 1 969  ? 14.832  28.667 20.834  1.00 41.54  ? 966  LEU A N   1 
ATOM 7478 C CA  . LEU A 1 969  ? 15.220  29.972 21.389  1.00 41.54  ? 966  LEU A CA  1 
ATOM 7479 C C   . LEU A 1 969  ? 15.365  29.922 22.879  1.00 41.54  ? 966  LEU A C   1 
ATOM 7480 O O   . LEU A 1 969  ? 14.691  29.180 23.564  1.00 41.54  ? 966  LEU A O   1 
ATOM 7481 C CB  . LEU A 1 969  ? 14.159  31.019 21.071  1.00 39.72  ? 966  LEU A CB  1 
ATOM 7482 C CG  . LEU A 1 969  ? 14.617  32.303 20.356  1.00 39.72  ? 966  LEU A CG  1 
ATOM 7483 C CD1 . LEU A 1 969  ? 13.579  33.375 20.610  1.00 39.72  ? 966  LEU A CD1 1 
ATOM 7484 C CD2 . LEU A 1 969  ? 16.002  32.719 20.820  1.00 39.72  ? 966  LEU A CD2 1 
ATOM 7485 N N   . GLY A 1 970  ? 16.246  30.745 23.389  1.00 43.42  ? 967  GLY A N   1 
ATOM 7486 C CA  . GLY A 1 970  ? 16.591  30.643 24.778  1.00 43.42  ? 967  GLY A CA  1 
ATOM 7487 C C   . GLY A 1 970  ? 17.278  31.930 25.043  1.00 43.42  ? 967  GLY A C   1 
ATOM 7488 O O   . GLY A 1 970  ? 17.964  32.428 24.169  1.00 43.42  ? 967  GLY A O   1 
ATOM 7489 N N   . ALA A 1 971  ? 17.051  32.464 26.236  1.00 37.21  ? 968  ALA A N   1 
ATOM 7490 C CA  . ALA A 1 971  ? 17.477  33.769 26.657  1.00 37.21  ? 968  ALA A CA  1 
ATOM 7491 C C   . ALA A 1 971  ? 17.994  33.540 28.016  1.00 37.21  ? 968  ALA A C   1 
ATOM 7492 O O   . ALA A 1 971  ? 17.478  32.667 28.722  1.00 37.21  ? 968  ALA A O   1 
ATOM 7493 C CB  . ALA A 1 971  ? 16.287  34.690 26.749  1.00 43.62  ? 968  ALA A CB  1 
ATOM 7494 N N   . GLU A 1 972  ? 18.960  34.332 28.450  1.00 27.59  ? 969  GLU A N   1 
ATOM 7495 C CA  . GLU A 1 972  ? 19.492  34.041 29.748  1.00 27.59  ? 969  GLU A CA  1 
ATOM 7496 C C   . GLU A 1 972  ? 20.071  35.159 30.601  1.00 27.59  ? 969  GLU A C   1 
ATOM 7497 O O   . GLU A 1 972  ? 20.414  36.197 30.101  1.00 27.59  ? 969  GLU A O   1 
ATOM 7498 C CB  . GLU A 1 972  ? 20.477  32.862 29.590  1.00 54.50  ? 969  GLU A CB  1 
ATOM 7499 C CG  . GLU A 1 972  ? 21.959  33.151 29.825  1.00 54.50  ? 969  GLU A CG  1 
ATOM 7500 C CD  . GLU A 1 972  ? 22.517  34.193 28.900  1.00 54.50  ? 969  GLU A CD  1 
ATOM 7501 O OE1 . GLU A 1 972  ? 22.686  33.889 27.715  1.00 54.50  ? 969  GLU A OE1 1 
ATOM 7502 O OE2 . GLU A 1 972  ? 22.809  35.309 29.354  1.00 54.50  ? 969  GLU A OE2 1 
ATOM 7503 N N   . ASN A 1 973  ? 20.087  34.930 31.913  1.00 46.07  ? 970  ASN A N   1 
ATOM 7504 C CA  . ASN A 1 973  ? 20.986  35.525 32.893  1.00 46.07  ? 970  ASN A CA  1 
ATOM 7505 C C   . ASN A 1 973  ? 21.747  36.770 32.521  1.00 46.07  ? 970  ASN A C   1 
ATOM 7506 O O   . ASN A 1 973  ? 21.920  37.667 33.338  1.00 46.07  ? 970  ASN A O   1 
ATOM 7507 C CB  . ASN A 1 973  ? 22.030  34.479 33.260  1.00 101.74 ? 970  ASN A CB  1 
ATOM 7508 C CG  . ASN A 1 973  ? 22.523  34.630 34.657  1.00 101.74 ? 970  ASN A CG  1 
ATOM 7509 O OD1 . ASN A 1 973  ? 21.780  35.045 35.538  1.00 101.74 ? 970  ASN A OD1 1 
ATOM 7510 N ND2 . ASN A 1 973  ? 23.779  34.270 34.885  1.00 101.74 ? 970  ASN A ND2 1 
ATOM 7511 N N   . ALA A 1 974  ? 22.228  36.822 31.293  1.00 46.27  ? 971  ALA A N   1 
ATOM 7512 C CA  . ALA A 1 974  ? 23.290  37.742 30.927  1.00 46.27  ? 971  ALA A CA  1 
ATOM 7513 C C   . ALA A 1 974  ? 23.013  38.450 29.611  1.00 46.27  ? 971  ALA A C   1 
ATOM 7514 O O   . ALA A 1 974  ? 23.932  38.853 28.888  1.00 46.27  ? 971  ALA A O   1 
ATOM 7515 C CB  . ALA A 1 974  ? 24.567  36.952 30.825  1.00 25.68  ? 971  ALA A CB  1 
ATOM 7516 N N   . PHE A 1 975  ? 21.737  38.560 29.294  1.00 40.35  ? 972  PHE A N   1 
ATOM 7517 C CA  . PHE A 1 975  ? 21.286  39.288 28.125  1.00 40.35  ? 972  PHE A CA  1 
ATOM 7518 C C   . PHE A 1 975  ? 21.762  38.681 26.838  1.00 40.35  ? 972  PHE A C   1 
ATOM 7519 O O   . PHE A 1 975  ? 22.027  39.407 25.883  1.00 40.35  ? 972  PHE A O   1 
ATOM 7520 C CB  . PHE A 1 975  ? 21.677  40.765 28.251  1.00 26.51  ? 972  PHE A CB  1 
ATOM 7521 C CG  . PHE A 1 975  ? 21.738  41.199 29.682  1.00 26.51  ? 972  PHE A CG  1 
ATOM 7522 C CD1 . PHE A 1 975  ? 22.911  41.682 30.228  1.00 26.51  ? 972  PHE A CD1 1 
ATOM 7523 C CD2 . PHE A 1 975  ? 20.635  40.982 30.516  1.00 26.51  ? 972  PHE A CD2 1 
ATOM 7524 C CE1 . PHE A 1 975  ? 22.979  42.004 31.587  1.00 26.51  ? 972  PHE A CE1 1 
ATOM 7525 C CE2 . PHE A 1 975  ? 20.675  41.303 31.852  1.00 26.51  ? 972  PHE A CE2 1 
ATOM 7526 C CZ  . PHE A 1 975  ? 21.862  41.816 32.399  1.00 26.51  ? 972  PHE A CZ  1 
ATOM 7527 N N   . ASN A 1 976  ? 21.856  37.354 26.797  1.00 46.38  ? 973  ASN A N   1 
ATOM 7528 C CA  . ASN A 1 976  ? 22.193  36.714 25.538  1.00 46.38  ? 973  ASN A CA  1 
ATOM 7529 C C   . ASN A 1 976  ? 21.026  35.905 25.072  1.00 46.38  ? 973  ASN A C   1 
ATOM 7530 O O   . ASN A 1 976  ? 20.228  35.452 25.852  1.00 46.38  ? 973  ASN A O   1 
ATOM 7531 C CB  . ASN A 1 976  ? 23.495  35.859 25.587  1.00 31.52  ? 973  ASN A CB  1 
ATOM 7532 C CG  . ASN A 1 976  ? 24.719  36.618 26.192  1.00 31.52  ? 973  ASN A CG  1 
ATOM 7533 O OD1 . ASN A 1 976  ? 25.106  37.717 25.712  1.00 31.52  ? 973  ASN A OD1 1 
ATOM 7534 N ND2 . ASN A 1 976  ? 25.329  36.020 27.244  1.00 31.52  ? 973  ASN A ND2 1 
ATOM 7535 N N   . LEU A 1 977  ? 20.935  35.754 23.774  1.00 41.63  ? 974  LEU A N   1 
ATOM 7536 C CA  . LEU A 1 977  ? 20.014  34.856 23.172  1.00 41.63  ? 974  LEU A CA  1 
ATOM 7537 C C   . LEU A 1 977  ? 20.835  33.740 22.560  1.00 41.63  ? 974  LEU A C   1 
ATOM 7538 O O   . LEU A 1 977  ? 21.976  33.956 22.144  1.00 41.63  ? 974  LEU A O   1 
ATOM 7539 C CB  . LEU A 1 977  ? 19.295  35.580 22.051  1.00 53.47  ? 974  LEU A CB  1 
ATOM 7540 C CG  . LEU A 1 977  ? 18.316  36.634 22.526  1.00 53.47  ? 974  LEU A CG  1 
ATOM 7541 C CD1 . LEU A 1 977  ? 17.588  37.212 21.357  1.00 53.47  ? 974  LEU A CD1 1 
ATOM 7542 C CD2 . LEU A 1 977  ? 17.359  35.962 23.491  1.00 53.47  ? 974  LEU A CD2 1 
ATOM 7543 N N   . PHE A 1 978  ? 20.271  32.543 22.498  1.00 41.13  ? 975  PHE A N   1 
ATOM 7544 C CA  . PHE A 1 978  ? 20.948  31.444 21.863  1.00 41.13  ? 975  PHE A CA  1 
ATOM 7545 C C   . PHE A 1 978  ? 19.960  30.490 21.318  1.00 41.13  ? 975  PHE A C   1 
ATOM 7546 O O   . PHE A 1 978  ? 18.867  30.361 21.840  1.00 41.13  ? 975  PHE A O   1 
ATOM 7547 C CB  . PHE A 1 978  ? 21.880  30.729 22.818  1.00 40.76  ? 975  PHE A CB  1 
ATOM 7548 C CG  . PHE A 1 978  ? 21.197  29.975 23.903  1.00 40.76  ? 975  PHE A CG  1 
ATOM 7549 C CD1 . PHE A 1 978  ? 20.843  28.659 23.728  1.00 40.76  ? 975  PHE A CD1 1 
ATOM 7550 C CD2 . PHE A 1 978  ? 20.973  30.568 25.145  1.00 40.76  ? 975  PHE A CD2 1 
ATOM 7551 C CE1 . PHE A 1 978  ? 20.245  27.947 24.768  1.00 40.76  ? 975  PHE A CE1 1 
ATOM 7552 C CE2 . PHE A 1 978  ? 20.365  29.853 26.189  1.00 40.76  ? 975  PHE A CE2 1 
ATOM 7553 C CZ  . PHE A 1 978  ? 20.014  28.546 25.995  1.00 40.76  ? 975  PHE A CZ  1 
ATOM 7554 N N   . VAL A 1 979  ? 20.335  29.812 20.256  1.00 45.15  ? 976  VAL A N   1 
ATOM 7555 C CA  . VAL A 1 979  ? 19.419  28.901 19.649  1.00 45.15  ? 976  VAL A CA  1 
ATOM 7556 C C   . VAL A 1 979  ? 20.081  27.554 19.660  1.00 45.15  ? 976  VAL A C   1 
ATOM 7557 O O   . VAL A 1 979  ? 21.283  27.452 19.518  1.00 45.15  ? 976  VAL A O   1 
ATOM 7558 C CB  . VAL A 1 979  ? 19.035  29.394 18.257  1.00 31.92  ? 976  VAL A CB  1 
ATOM 7559 C CG1 . VAL A 1 979  ? 18.235  28.362 17.480  1.00 31.92  ? 976  VAL A CG1 1 
ATOM 7560 C CG2 . VAL A 1 979  ? 18.238  30.577 18.445  1.00 31.92  ? 976  VAL A CG2 1 
ATOM 7561 N N   . CYS A 1 980  ? 19.283  26.523 19.860  1.00 48.21  ? 977  CYS A N   1 
ATOM 7562 C CA  . CYS A 1 980  ? 19.786  25.179 19.812  1.00 48.21  ? 977  CYS A CA  1 
ATOM 7563 C C   . CYS A 1 980  ? 18.992  24.353 18.862  1.00 48.21  ? 977  CYS A C   1 
ATOM 7564 O O   . CYS A 1 980  ? 17.779  24.501 18.769  1.00 48.21  ? 977  CYS A O   1 
ATOM 7565 C CB  . CYS A 1 980  ? 19.734  24.557 21.200  1.00 56.99  ? 977  CYS A CB  1 
ATOM 7566 S SG  . CYS A 1 980  ? 20.914  25.378 22.260  1.00 56.99  ? 977  CYS A SG  1 
ATOM 7567 N N   . GLN A 1 981  ? 19.698  23.492 18.133  1.00 66.88  ? 978  GLN A N   1 
ATOM 7568 C CA  . GLN A 1 981  ? 19.057  22.370 17.431  1.00 66.88  ? 978  GLN A CA  1 
ATOM 7569 C C   . GLN A 1 981  ? 19.748  21.032 17.744  1.00 66.88  ? 978  GLN A C   1 
ATOM 7570 O O   . GLN A 1 981  ? 20.875  21.018 18.249  1.00 66.88  ? 978  GLN A O   1 
ATOM 7571 C CB  . GLN A 1 981  ? 18.992  22.634 15.937  1.00 55.63  ? 978  GLN A CB  1 
ATOM 7572 C CG  . GLN A 1 981  ? 20.310  22.891 15.311  1.00 55.63  ? 978  GLN A CG  1 
ATOM 7573 C CD  . GLN A 1 981  ? 20.145  23.614 14.013  1.00 55.63  ? 978  GLN A CD  1 
ATOM 7574 O OE1 . GLN A 1 981  ? 19.467  23.136 13.083  1.00 55.63  ? 978  GLN A OE1 1 
ATOM 7575 N NE2 . GLN A 1 981  ? 20.759  24.793 13.928  1.00 55.63  ? 978  GLN A NE2 1 
ATOM 7576 N N   . LYS A 1 982  ? 19.070  19.918 17.471  1.00 65.83  ? 979  LYS A N   1 
ATOM 7577 C CA  . LYS A 1 982  ? 19.661  18.591 17.738  1.00 65.83  ? 979  LYS A CA  1 
ATOM 7578 C C   . LYS A 1 982  ? 20.705  18.182 16.695  1.00 65.83  ? 979  LYS A C   1 
ATOM 7579 O O   . LYS A 1 982  ? 20.502  18.355 15.494  1.00 65.83  ? 979  LYS A O   1 
ATOM 7580 C CB  . LYS A 1 982  ? 18.595  17.483 17.934  1.00 98.64  ? 979  LYS A CB  1 
ATOM 7581 C CG  . LYS A 1 982  ? 17.474  17.381 16.888  1.00 98.64  ? 979  LYS A CG  1 
ATOM 7582 C CD  . LYS A 1 982  ? 16.239  18.162 17.316  1.00 98.64  ? 979  LYS A CD  1 
ATOM 7583 C CE  . LYS A 1 982  ? 14.949  17.498 16.817  1.00 98.64  ? 979  LYS A CE  1 
ATOM 7584 N NZ  . LYS A 1 982  ? 14.258  16.682 17.854  1.00 98.64  ? 979  LYS A NZ  1 
ATOM 7585 N N   . ASP A 1 983  ? 21.816  17.641 17.168  1.00 161.95 ? 980  ASP A N   1 
ATOM 7586 C CA  . ASP A 1 983  ? 22.923  17.316 16.294  1.00 161.95 ? 980  ASP A CA  1 
ATOM 7587 C C   . ASP A 1 983  ? 22.581  16.171 15.335  1.00 161.95 ? 980  ASP A C   1 
ATOM 7588 O O   . ASP A 1 983  ? 22.645  15.004 15.719  1.00 161.95 ? 980  ASP A O   1 
ATOM 7589 C CB  . ASP A 1 983  ? 24.140  16.974 17.147  1.00 107.71 ? 980  ASP A CB  1 
ATOM 7590 C CG  . ASP A 1 983  ? 25.368  16.695 16.331  1.00 107.71 ? 980  ASP A CG  1 
ATOM 7591 O OD1 . ASP A 1 983  ? 25.466  17.211 15.197  1.00 107.71 ? 980  ASP A OD1 1 
ATOM 7592 O OD2 . ASP A 1 983  ? 26.246  15.967 16.836  1.00 107.71 ? 980  ASP A OD2 1 
ATOM 7593 N N   . SER A 1 984  ? 22.201  16.511 14.100  1.00 103.15 ? 981  SER A N   1 
ATOM 7594 C CA  . SER A 1 984  ? 22.064  15.511 13.029  1.00 103.15 ? 981  SER A CA  1 
ATOM 7595 C C   . SER A 1 984  ? 23.444  14.884 12.763  1.00 103.15 ? 981  SER A C   1 
ATOM 7596 O O   . SER A 1 984  ? 24.270  15.460 12.037  1.00 103.15 ? 981  SER A O   1 
ATOM 7597 C CB  . SER A 1 984  ? 21.500  16.139 11.745  1.00 123.26 ? 981  SER A CB  1 
ATOM 7598 O OG  . SER A 1 984  ? 20.093  16.276 11.803  1.00 123.26 ? 981  SER A OG  1 
ATOM 7599 N N   . ALA A 1 985  ? 23.694  13.720 13.376  1.00 78.81  ? 982  ALA A N   1 
ATOM 7600 C CA  . ALA A 1 985  ? 25.020  13.087 13.340  1.00 78.81  ? 982  ALA A CA  1 
ATOM 7601 C C   . ALA A 1 985  ? 24.969  11.563 13.431  1.00 78.81  ? 982  ALA A C   1 
ATOM 7602 O O   . ALA A 1 985  ? 24.021  10.998 13.971  1.00 78.81  ? 982  ALA A O   1 
ATOM 7603 C CB  . ALA A 1 985  ? 25.917  13.654 14.464  1.00 82.62  ? 982  ALA A CB  1 
ATOM 7604 N N   . ALA A 1 986  ? 26.007  10.905 12.925  1.00 171.66 ? 983  ALA A N   1 
ATOM 7605 C CA  . ALA A 1 986  ? 26.187  9.472  13.127  1.00 171.66 ? 983  ALA A CA  1 
ATOM 7606 C C   . ALA A 1 986  ? 26.465  9.189  14.609  1.00 171.66 ? 983  ALA A C   1 
ATOM 7607 O O   . ALA A 1 986  ? 26.662  10.129 15.388  1.00 171.66 ? 983  ALA A O   1 
ATOM 7608 C CB  . ALA A 1 986  ? 27.326  8.995  12.279  1.00 53.69  ? 983  ALA A CB  1 
ATOM 7609 N N   . THR A 1 987  ? 26.482  7.906  14.994  1.00 85.41  ? 984  THR A N   1 
ATOM 7610 C CA  . THR A 1 987  ? 26.826  7.475  16.384  1.00 85.41  ? 984  THR A CA  1 
ATOM 7611 C C   . THR A 1 987  ? 25.773  7.933  17.411  1.00 85.41  ? 984  THR A C   1 
ATOM 7612 O O   . THR A 1 987  ? 26.091  8.322  18.556  1.00 85.41  ? 984  THR A O   1 
ATOM 7613 C CB  . THR A 1 987  ? 28.261  7.931  16.841  1.00 167.89 ? 984  THR A CB  1 
ATOM 7614 O OG1 . THR A 1 987  ? 28.238  9.304  17.260  1.00 167.89 ? 984  THR A OG1 1 
ATOM 7615 C CG2 . THR A 1 987  ? 29.298  7.742  15.730  1.00 167.89 ? 984  THR A CG2 1 
ATOM 7616 N N   . THR A 1 988  ? 24.520  7.847  16.972  1.00 165.19 ? 985  THR A N   1 
ATOM 7617 C CA  . THR A 1 988  ? 23.392  8.540  17.580  1.00 165.19 ? 985  THR A CA  1 
ATOM 7618 C C   . THR A 1 988  ? 23.058  8.038  18.988  1.00 165.19 ? 985  THR A C   1 
ATOM 7619 O O   . THR A 1 988  ? 22.004  7.450  19.220  1.00 165.19 ? 985  THR A O   1 
ATOM 7620 C CB  . THR A 1 988  ? 22.142  8.501  16.637  1.00 137.35 ? 985  THR A CB  1 
ATOM 7621 O OG1 . THR A 1 988  ? 21.510  7.214  16.711  1.00 137.35 ? 985  THR A OG1 1 
ATOM 7622 C CG2 . THR A 1 988  ? 22.554  8.746  15.188  1.00 137.35 ? 985  THR A CG2 1 
ATOM 7623 N N   . ASP A 1 989  ? 23.973  8.277  19.921  1.00 153.16 ? 986  ASP A N   1 
ATOM 7624 C CA  . ASP A 1 989  ? 23.761  7.959  21.333  1.00 153.16 ? 986  ASP A CA  1 
ATOM 7625 C C   . ASP A 1 989  ? 24.615  8.820  22.246  1.00 153.16 ? 986  ASP A C   1 
ATOM 7626 O O   . ASP A 1 989  ? 24.541  8.719  23.473  1.00 153.16 ? 986  ASP A O   1 
ATOM 7627 C CB  . ASP A 1 989  ? 24.005  6.475  21.618  1.00 108.20 ? 986  ASP A CB  1 
ATOM 7628 C CG  . ASP A 1 989  ? 22.763  5.772  22.114  1.00 108.20 ? 986  ASP A CG  1 
ATOM 7629 O OD1 . ASP A 1 989  ? 21.658  6.159  21.693  1.00 108.20 ? 986  ASP A OD1 1 
ATOM 7630 O OD2 . ASP A 1 989  ? 22.888  4.837  22.934  1.00 108.20 ? 986  ASP A OD2 1 
ATOM 7631 N N   . GLU A 1 990  ? 25.438  9.660  21.636  1.00 82.75  ? 987  GLU A N   1 
ATOM 7632 C CA  . GLU A 1 990  ? 26.127  10.697 22.364  1.00 82.75  ? 987  GLU A CA  1 
ATOM 7633 C C   . GLU A 1 990  ? 25.913  11.982 21.585  1.00 82.75  ? 987  GLU A C   1 
ATOM 7634 O O   . GLU A 1 990  ? 25.334  12.926 22.101  1.00 82.75  ? 987  GLU A O   1 
ATOM 7635 C CB  . GLU A 1 990  ? 27.611  10.364 22.528  1.00 192.98 ? 987  GLU A CB  1 
ATOM 7636 C CG  . GLU A 1 990  ? 28.245  10.964 23.784  1.00 192.98 ? 987  GLU A CG  1 
ATOM 7637 C CD  . GLU A 1 990  ? 27.674  10.398 25.082  1.00 192.98 ? 987  GLU A CD  1 
ATOM 7638 O OE1 . GLU A 1 990  ? 27.189  9.245  25.084  1.00 192.98 ? 987  GLU A OE1 1 
ATOM 7639 O OE2 . GLU A 1 990  ? 27.717  11.110 26.108  1.00 192.98 ? 987  GLU A OE2 1 
ATOM 7640 N N   . GLU A 1 991  ? 26.339  11.992 20.325  1.00 106.48 ? 988  GLU A N   1 
ATOM 7641 C CA  . GLU A 1 991  ? 26.127  13.130 19.437  1.00 106.48 ? 988  GLU A CA  1 
ATOM 7642 C C   . GLU A 1 991  ? 24.652  13.338 19.153  1.00 106.48 ? 988  GLU A C   1 
ATOM 7643 O O   . GLU A 1 991  ? 24.298  14.098 18.253  1.00 106.48 ? 988  GLU A O   1 
ATOM 7644 C CB  . GLU A 1 991  ? 26.857  12.920 18.114  1.00 114.45 ? 988  GLU A CB  1 
ATOM 7645 C CG  . GLU A 1 991  ? 28.348  13.161 18.166  1.00 114.45 ? 988  GLU A CG  1 
ATOM 7646 C CD  . GLU A 1 991  ? 29.066  12.465 17.037  1.00 114.45 ? 988  GLU A CD  1 
ATOM 7647 O OE1 . GLU A 1 991  ? 28.537  12.458 15.899  1.00 114.45 ? 988  GLU A OE1 1 
ATOM 7648 O OE2 . GLU A 1 991  ? 30.156  11.919 17.297  1.00 114.45 ? 988  GLU A OE2 1 
ATOM 7649 N N   . ARG A 1 992  ? 23.799  12.649 19.908  1.00 106.72 ? 989  ARG A N   1 
ATOM 7650 C CA  . ARG A 1 992  ? 22.359  12.811 19.781  1.00 106.72 ? 989  ARG A CA  1 
ATOM 7651 C C   . ARG A 1 992  ? 21.745  13.264 21.102  1.00 106.72 ? 989  ARG A C   1 
ATOM 7652 O O   . ARG A 1 992  ? 20.736  13.969 21.119  1.00 106.72 ? 989  ARG A O   1 
ATOM 7653 C CB  . ARG A 1 992  ? 21.712  11.510 19.302  1.00 157.00 ? 989  ARG A CB  1 
ATOM 7654 C CG  . ARG A 1 992  ? 20.276  11.667 18.827  1.00 157.00 ? 989  ARG A CG  1 
ATOM 7655 C CD  . ARG A 1 992  ? 20.207  12.349 17.476  1.00 157.00 ? 989  ARG A CD  1 
ATOM 7656 N NE  . ARG A 1 992  ? 20.459  11.416 16.380  1.00 157.00 ? 989  ARG A NE  1 
ATOM 7657 C CZ  . ARG A 1 992  ? 20.169  11.660 15.102  1.00 157.00 ? 989  ARG A CZ  1 
ATOM 7658 N NH1 . ARG A 1 992  ? 19.615  12.815 14.743  1.00 157.00 ? 989  ARG A NH1 1 
ATOM 7659 N NH2 . ARG A 1 992  ? 20.428  10.748 14.176  1.00 157.00 ? 989  ARG A NH2 1 
ATOM 7660 N N   . GLN A 1 993  ? 22.367  12.845 22.200  1.00 91.93  ? 990  GLN A N   1 
ATOM 7661 C CA  . GLN A 1 993  ? 21.971  13.248 23.541  1.00 91.93  ? 990  GLN A CA  1 
ATOM 7662 C C   . GLN A 1 993  ? 22.444  14.685 23.840  1.00 91.93  ? 990  GLN A C   1 
ATOM 7663 O O   . GLN A 1 993  ? 22.251  15.208 24.951  1.00 91.93  ? 990  GLN A O   1 
ATOM 7664 C CB  . GLN A 1 993  ? 22.569  12.271 24.553  1.00 132.39 ? 990  GLN A CB  1 
ATOM 7665 C CG  . GLN A 1 993  ? 21.737  12.077 25.806  1.00 132.39 ? 990  GLN A CG  1 
ATOM 7666 C CD  . GLN A 1 993  ? 20.481  11.253 25.566  1.00 132.39 ? 990  GLN A CD  1 
ATOM 7667 O OE1 . GLN A 1 993  ? 19.413  11.567 26.091  1.00 132.39 ? 990  GLN A OE1 1 
ATOM 7668 N NE2 . GLN A 1 993  ? 20.604  10.196 24.772  1.00 132.39 ? 990  GLN A NE2 1 
ATOM 7669 N N   . HIS A 1 994  ? 23.084  15.300 22.842  1.00 86.87  ? 991  HIS A N   1 
ATOM 7670 C CA  . HIS A 1 994  ? 23.674  16.639 22.949  1.00 86.87  ? 991  HIS A CA  1 
ATOM 7671 C C   . HIS A 1 994  ? 23.116  17.468 21.799  1.00 86.87  ? 991  HIS A C   1 
ATOM 7672 O O   . HIS A 1 994  ? 22.972  16.953 20.685  1.00 86.87  ? 991  HIS A O   1 
ATOM 7673 C CB  . HIS A 1 994  ? 25.210  16.566 22.881  1.00 103.47 ? 991  HIS A CB  1 
ATOM 7674 C CG  . HIS A 1 994  ? 25.853  15.927 24.085  1.00 103.47 ? 991  HIS A CG  1 
ATOM 7675 N ND1 . HIS A 1 994  ? 26.885  16.522 24.782  1.00 103.47 ? 991  HIS A ND1 1 
ATOM 7676 C CD2 . HIS A 1 994  ? 25.614  14.747 24.711  1.00 103.47 ? 991  HIS A CD2 1 
ATOM 7677 C CE1 . HIS A 1 994  ? 27.253  15.740 25.782  1.00 103.47 ? 991  HIS A CE1 1 
ATOM 7678 N NE2 . HIS A 1 994  ? 26.496  14.657 25.762  1.00 103.47 ? 991  HIS A NE2 1 
ATOM 7679 N N   . LEU A 1 995  ? 22.746  18.722 22.068  1.00 72.15  ? 992  LEU A N   1 
ATOM 7680 C CA  . LEU A 1 995  ? 22.201  19.597 21.005  1.00 72.15  ? 992  LEU A CA  1 
ATOM 7681 C C   . LEU A 1 995  ? 22.991  20.885 20.992  1.00 72.15  ? 992  LEU A C   1 
ATOM 7682 O O   . LEU A 1 995  ? 23.265  21.454 22.036  1.00 72.15  ? 992  LEU A O   1 
ATOM 7683 C CB  . LEU A 1 995  ? 20.669  19.822 21.105  1.00 61.37  ? 992  LEU A CB  1 
ATOM 7684 C CG  . LEU A 1 995  ? 19.885  20.002 22.423  1.00 61.37  ? 992  LEU A CG  1 
ATOM 7685 C CD1 . LEU A 1 995  ? 20.179  21.342 23.107  1.00 61.37  ? 992  LEU A CD1 1 
ATOM 7686 C CD2 . LEU A 1 995  ? 18.379  19.890 22.181  1.00 61.37  ? 992  LEU A CD2 1 
ATOM 7687 N N   . GLN A 1 996  ? 23.422  21.325 19.827  1.00 53.32  ? 993  GLN A N   1 
ATOM 7688 C CA  . GLN A 1 996  ? 24.491  22.290 19.854  1.00 53.32  ? 993  GLN A CA  1 
ATOM 7689 C C   . GLN A 1 996  ? 23.994  23.711 19.846  1.00 53.32  ? 993  GLN A C   1 
ATOM 7690 O O   . GLN A 1 996  ? 22.914  23.974 19.290  1.00 53.32  ? 993  GLN A O   1 
ATOM 7691 C CB  . GLN A 1 996  ? 25.496  22.052 18.721  1.00 142.32 ? 993  GLN A CB  1 
ATOM 7692 C CG  . GLN A 1 996  ? 26.707  21.226 19.134  1.00 142.32 ? 993  GLN A CG  1 
ATOM 7693 C CD  . GLN A 1 996  ? 26.428  19.735 19.127  1.00 142.32 ? 993  GLN A CD  1 
ATOM 7694 O OE1 . GLN A 1 996  ? 26.026  19.177 18.106  1.00 142.32 ? 993  GLN A OE1 1 
ATOM 7695 N NE2 . GLN A 1 996  ? 26.646  19.079 20.267  1.00 142.32 ? 993  GLN A NE2 1 
ATOM 7696 N N   . GLU A 1 997  ? 24.783  24.623 20.426  1.00 66.62  ? 994  GLU A N   1 
ATOM 7697 C CA  . GLU A 1 997  ? 24.434  26.042 20.446  1.00 66.62  ? 994  GLU A CA  1 
ATOM 7698 C C   . GLU A 1 997  ? 24.748  26.758 19.135  1.00 66.62  ? 994  GLU A C   1 
ATOM 7699 O O   . GLU A 1 997  ? 25.758  27.443 19.022  1.00 66.62  ? 994  GLU A O   1 
ATOM 7700 C CB  . GLU A 1 997  ? 25.092  26.758 21.627  1.00 58.26  ? 994  GLU A CB  1 
ATOM 7701 C CG  . GLU A 1 997  ? 24.588  26.279 22.998  1.00 58.26  ? 994  GLU A CG  1 
ATOM 7702 C CD  . GLU A 1 997  ? 24.666  27.327 24.121  1.00 58.26  ? 994  GLU A CD  1 
ATOM 7703 O OE1 . GLU A 1 997  ? 25.410  28.328 23.972  1.00 58.26  ? 994  GLU A OE1 1 
ATOM 7704 O OE2 . GLU A 1 997  ? 23.983  27.124 25.157  1.00 58.26  ? 994  GLU A OE2 1 
ATOM 7705 N N   . VAL A 1 998  ? 23.839  26.636 18.170  1.00 46.29  ? 995  VAL A N   1 
ATOM 7706 C CA  . VAL A 1 998  ? 24.031  27.124 16.789  1.00 46.29  ? 995  VAL A CA  1 
ATOM 7707 C C   . VAL A 1 998  ? 23.790  28.602 16.489  1.00 46.29  ? 995  VAL A C   1 
ATOM 7708 O O   . VAL A 1 998  ? 24.100  29.052 15.408  1.00 46.29  ? 995  VAL A O   1 
ATOM 7709 C CB  . VAL A 1 998  ? 23.142  26.351 15.797  1.00 34.58  ? 995  VAL A CB  1 
ATOM 7710 C CG1 . VAL A 1 998  ? 23.394  24.843 15.913  1.00 34.58  ? 995  VAL A CG1 1 
ATOM 7711 C CG2 . VAL A 1 998  ? 21.702  26.648 16.078  1.00 34.58  ? 995  VAL A CG2 1 
ATOM 7712 N N   . GLY A 1 999  ? 23.173  29.329 17.409  1.00 46.13  ? 996  GLY A N   1 
ATOM 7713 C CA  . GLY A 1 999  ? 22.882  30.773 17.237  1.00 46.13  ? 996  GLY A CA  1 
ATOM 7714 C C   . GLY A 1 999  ? 23.264  31.461 18.536  1.00 46.13  ? 996  GLY A C   1 
ATOM 7715 O O   . GLY A 1 999  ? 22.901  31.008 19.614  1.00 46.13  ? 996  GLY A O   1 
ATOM 7716 N N   . LEU A 1 1000 ? 24.049  32.511 18.447  1.00 48.09  ? 997  LEU A N   1 
ATOM 7717 C CA  . LEU A 1 1000 ? 24.545  33.147 19.631  1.00 48.09  ? 997  LEU A CA  1 
ATOM 7718 C C   . LEU A 1 1000 ? 24.394  34.603 19.327  1.00 48.09  ? 997  LEU A C   1 
ATOM 7719 O O   . LEU A 1 1000 ? 24.587  35.001 18.183  1.00 48.09  ? 997  LEU A O   1 
ATOM 7720 C CB  . LEU A 1 1000 ? 26.026  32.801 19.855  1.00 30.95  ? 997  LEU A CB  1 
ATOM 7721 C CG  . LEU A 1 1000 ? 26.417  31.375 20.231  1.00 30.95  ? 997  LEU A CG  1 
ATOM 7722 C CD1 . LEU A 1 1000 ? 27.880  31.218 20.530  1.00 30.95  ? 997  LEU A CD1 1 
ATOM 7723 C CD2 . LEU A 1 1000 ? 25.651  31.006 21.458  1.00 30.95  ? 997  LEU A CD2 1 
ATOM 7724 N N   . PHE A 1 1001 ? 24.067  35.396 20.343  1.00 48.39  ? 998  PHE A N   1 
ATOM 7725 C CA  . PHE A 1 1001 ? 23.751  36.805 20.140  1.00 48.39  ? 998  PHE A CA  1 
ATOM 7726 C C   . PHE A 1 1001 ? 23.560  37.516 21.444  1.00 48.39  ? 998  PHE A C   1 
ATOM 7727 O O   . PHE A 1 1001 ? 22.838  37.049 22.311  1.00 48.39  ? 998  PHE A O   1 
ATOM 7728 C CB  . PHE A 1 1001 ? 22.466  36.925 19.347  1.00 46.55  ? 998  PHE A CB  1 
ATOM 7729 C CG  . PHE A 1 1001 ? 22.188  38.301 18.834  1.00 46.55  ? 998  PHE A CG  1 
ATOM 7730 C CD1 . PHE A 1 1001 ? 22.830  38.778 17.713  1.00 46.55  ? 998  PHE A CD1 1 
ATOM 7731 C CD2 . PHE A 1 1001 ? 21.230  39.110 19.452  1.00 46.55  ? 998  PHE A CD2 1 
ATOM 7732 C CE1 . PHE A 1 1001 ? 22.533  40.030 17.249  1.00 46.55  ? 998  PHE A CE1 1 
ATOM 7733 C CE2 . PHE A 1 1001 ? 20.939  40.373 18.980  1.00 46.55  ? 998  PHE A CE2 1 
ATOM 7734 C CZ  . PHE A 1 1001 ? 21.578  40.827 17.894  1.00 46.55  ? 998  PHE A CZ  1 
ATOM 7735 N N   . HIS A 1 1002 ? 24.194  38.662 21.586  1.00 33.29  ? 999  HIS A N   1 
ATOM 7736 C CA  . HIS A 1 1002 ? 23.981  39.452 22.765  1.00 33.29  ? 999  HIS A CA  1 
ATOM 7737 C C   . HIS A 1 1002 ? 22.917  40.489 22.490  1.00 33.29  ? 999  HIS A C   1 
ATOM 7738 O O   . HIS A 1 1002 ? 23.150  41.455 21.771  1.00 33.29  ? 999  HIS A O   1 
ATOM 7739 C CB  . HIS A 1 1002 ? 25.254  40.125 23.166  1.00 46.12  ? 999  HIS A CB  1 
ATOM 7740 C CG  . HIS A 1 1002 ? 25.150  40.861 24.451  1.00 46.12  ? 999  HIS A CG  1 
ATOM 7741 N ND1 . HIS A 1 1002 ? 25.287  40.240 25.669  1.00 46.12  ? 999  HIS A ND1 1 
ATOM 7742 C CD2 . HIS A 1 1002 ? 24.943  42.173 24.711  1.00 46.12  ? 999  HIS A CD2 1 
ATOM 7743 C CE1 . HIS A 1 1002 ? 25.182  41.144 26.623  1.00 46.12  ? 999  HIS A CE1 1 
ATOM 7744 N NE2 . HIS A 1 1002 ? 24.981  42.325 26.068  1.00 46.12  ? 999  HIS A NE2 1 
ATOM 7745 N N   . LEU A 1 1003 ? 21.733  40.274 23.050  1.00 51.58  ? 1000 LEU A N   1 
ATOM 7746 C CA  . LEU A 1 1003 ? 20.606  41.190 22.882  1.00 51.58  ? 1000 LEU A CA  1 
ATOM 7747 C C   . LEU A 1 1003 ? 20.866  42.434 23.669  1.00 51.58  ? 1000 LEU A C   1 
ATOM 7748 O O   . LEU A 1 1003 ? 20.845  43.518 23.119  1.00 51.58  ? 1000 LEU A O   1 
ATOM 7749 C CB  . LEU A 1 1003 ? 19.341  40.572 23.418  1.00 29.78  ? 1000 LEU A CB  1 
ATOM 7750 C CG  . LEU A 1 1003 ? 17.994  40.703 22.739  1.00 29.78  ? 1000 LEU A CG  1 
ATOM 7751 C CD1 . LEU A 1 1003 ? 16.946  40.830 23.825  1.00 29.78  ? 1000 LEU A CD1 1 
ATOM 7752 C CD2 . LEU A 1 1003 ? 17.932  41.903 21.890  1.00 29.78  ? 1000 LEU A CD2 1 
ATOM 7753 N N   . GLY A 1 1004 ? 21.116  42.274 24.963  1.00 38.89  ? 1001 GLY A N   1 
ATOM 7754 C CA  . GLY A 1 1004 ? 21.483  43.388 25.784  1.00 38.89  ? 1001 GLY A CA  1 
ATOM 7755 C C   . GLY A 1 1004 ? 20.265  43.839 26.524  1.00 38.89  ? 1001 GLY A C   1 
ATOM 7756 O O   . GLY A 1 1004 ? 20.215  44.958 27.024  1.00 38.89  ? 1001 GLY A O   1 
ATOM 7757 N N   . GLU A 1 1005 ? 19.289  42.942 26.590  1.00 40.78  ? 1002 GLU A N   1 
ATOM 7758 C CA  . GLU A 1 1005 ? 18.119  43.086 27.413  1.00 40.78  ? 1002 GLU A CA  1 
ATOM 7759 C C   . GLU A 1 1005 ? 17.929  41.808 28.221  1.00 40.78  ? 1002 GLU A C   1 
ATOM 7760 O O   . GLU A 1 1005 ? 18.408  40.780 27.837  1.00 40.78  ? 1002 GLU A O   1 
ATOM 7761 C CB  . GLU A 1 1005 ? 16.911  43.296 26.532  1.00 42.62  ? 1002 GLU A CB  1 
ATOM 7762 C CG  . GLU A 1 1005 ? 16.833  44.650 25.900  1.00 42.62  ? 1002 GLU A CG  1 
ATOM 7763 C CD  . GLU A 1 1005 ? 16.600  45.742 26.898  1.00 42.62  ? 1002 GLU A CD  1 
ATOM 7764 O OE1 . GLU A 1 1005 ? 16.764  46.920 26.511  1.00 42.62  ? 1002 GLU A OE1 1 
ATOM 7765 O OE2 . GLU A 1 1005 ? 16.267  45.420 28.073  1.00 42.62  ? 1002 GLU A OE2 1 
ATOM 7766 N N   . PHE A 1 1006 ? 17.222  41.870 29.341  1.00 31.18  ? 1003 PHE A N   1 
ATOM 7767 C CA  . PHE A 1 1006 ? 16.893  40.668 30.098  1.00 31.18  ? 1003 PHE A CA  1 
ATOM 7768 C C   . PHE A 1 1006 ? 15.502  40.153 29.687  1.00 31.18  ? 1003 PHE A C   1 
ATOM 7769 O O   . PHE A 1 1006 ? 14.554  40.853 29.836  1.00 31.18  ? 1003 PHE A O   1 
ATOM 7770 C CB  . PHE A 1 1006 ? 16.937  40.980 31.587  1.00 30.13  ? 1003 PHE A CB  1 
ATOM 7771 C CG  . PHE A 1 1006 ? 16.674  39.819 32.431  1.00 30.13  ? 1003 PHE A CG  1 
ATOM 7772 C CD1 . PHE A 1 1006 ? 17.715  39.157 33.045  1.00 30.13  ? 1003 PHE A CD1 1 
ATOM 7773 C CD2 . PHE A 1 1006 ? 15.378  39.343 32.605  1.00 30.13  ? 1003 PHE A CD2 1 
ATOM 7774 C CE1 . PHE A 1 1006 ? 17.465  38.005 33.878  1.00 30.13  ? 1003 PHE A CE1 1 
ATOM 7775 C CE2 . PHE A 1 1006 ? 15.125  38.220 33.427  1.00 30.13  ? 1003 PHE A CE2 1 
ATOM 7776 C CZ  . PHE A 1 1006 ? 16.174  37.550 34.057  1.00 30.13  ? 1003 PHE A CZ  1 
ATOM 7777 N N   . VAL A 1 1007 ? 15.348  38.957 29.174  1.00 32.29  ? 1004 VAL A N   1 
ATOM 7778 C CA  . VAL A 1 1007 ? 14.068  38.626 28.574  1.00 32.29  ? 1004 VAL A CA  1 
ATOM 7779 C C   . VAL A 1 1007 ? 13.140  37.861 29.548  1.00 32.29  ? 1004 VAL A C   1 
ATOM 7780 O O   . VAL A 1 1007 ? 13.485  36.777 29.979  1.00 32.29  ? 1004 VAL A O   1 
ATOM 7781 C CB  . VAL A 1 1007 ? 14.278  37.889 27.178  1.00 23.40  ? 1004 VAL A CB  1 
ATOM 7782 C CG1 . VAL A 1 1007 ? 13.050  37.192 26.712  1.00 23.40  ? 1004 VAL A CG1 1 
ATOM 7783 C CG2 . VAL A 1 1007 ? 14.668  38.856 26.114  1.00 23.40  ? 1004 VAL A CG2 1 
ATOM 7784 N N   . ASN A 1 1008 ? 11.965  38.396 29.880  1.00 28.76  ? 1005 ASN A N   1 
ATOM 7785 C CA  . ASN A 1 1008 ? 10.975  37.605 30.648  1.00 28.76  ? 1005 ASN A CA  1 
ATOM 7786 C C   . ASN A 1 1008 ? 10.060  36.672 29.878  1.00 28.76  ? 1005 ASN A C   1 
ATOM 7787 O O   . ASN A 1 1008 ? 9.741   35.610 30.365  1.00 28.76  ? 1005 ASN A O   1 
ATOM 7788 C CB  . ASN A 1 1008 ? 10.122  38.481 31.523  1.00 27.01  ? 1005 ASN A CB  1 
ATOM 7789 C CG  . ASN A 1 1008 ? 10.880  39.012 32.619  1.00 27.01  ? 1005 ASN A CG  1 
ATOM 7790 O OD1 . ASN A 1 1008 ? 11.750  38.297 33.079  1.00 27.01  ? 1005 ASN A OD1 1 
ATOM 7791 N ND2 . ASN A 1 1008 ? 10.597  40.254 33.088  1.00 27.01  ? 1005 ASN A ND2 1 
ATOM 7792 N N   . VAL A 1 1009 ? 9.628   37.020 28.688  1.00 29.91  ? 1006 VAL A N   1 
ATOM 7793 C CA  . VAL A 1 1009 ? 8.640   36.153 28.090  1.00 29.91  ? 1006 VAL A CA  1 
ATOM 7794 C C   . VAL A 1 1009 ? 8.804   36.084 26.591  1.00 29.91  ? 1006 VAL A C   1 
ATOM 7795 O O   . VAL A 1 1009 ? 8.980   37.086 25.903  1.00 29.91  ? 1006 VAL A O   1 
ATOM 7796 C CB  . VAL A 1 1009 ? 7.188   36.598 28.512  1.00 30.32  ? 1006 VAL A CB  1 
ATOM 7797 C CG1 . VAL A 1 1009 ? 7.147   38.098 28.726  1.00 30.32  ? 1006 VAL A CG1 1 
ATOM 7798 C CG2 . VAL A 1 1009 ? 6.146   36.255 27.501  1.00 30.32  ? 1006 VAL A CG2 1 
ATOM 7799 N N   . PHE A 1 1010 ? 8.757   34.903 26.056  1.00 40.43  ? 1007 PHE A N   1 
ATOM 7800 C CA  . PHE A 1 1010 ? 8.618   34.862 24.649  1.00 40.43  ? 1007 PHE A CA  1 
ATOM 7801 C C   . PHE A 1 1010 ? 7.158   34.529 24.401  1.00 40.43  ? 1007 PHE A C   1 
ATOM 7802 O O   . PHE A 1 1010 ? 6.500   33.908 25.235  1.00 40.43  ? 1007 PHE A O   1 
ATOM 7803 C CB  . PHE A 1 1010 ? 9.506   33.741 24.051  1.00 29.68  ? 1007 PHE A CB  1 
ATOM 7804 C CG  . PHE A 1 1010 ? 10.999  33.962 24.183  1.00 29.68  ? 1007 PHE A CG  1 
ATOM 7805 C CD1 . PHE A 1 1010 ? 11.745  33.211 25.080  1.00 29.68  ? 1007 PHE A CD1 1 
ATOM 7806 C CD2 . PHE A 1 1010 ? 11.666  34.886 23.354  1.00 29.68  ? 1007 PHE A CD2 1 
ATOM 7807 C CE1 . PHE A 1 1010 ? 13.136  33.382 25.145  1.00 29.68  ? 1007 PHE A CE1 1 
ATOM 7808 C CE2 . PHE A 1 1010 ? 13.045  35.082 23.430  1.00 29.68  ? 1007 PHE A CE2 1 
ATOM 7809 C CZ  . PHE A 1 1010 ? 13.792  34.338 24.312  1.00 29.68  ? 1007 PHE A CZ  1 
ATOM 7810 N N   . CYS A 1 1011 ? 6.651   34.879 23.233  1.00 51.51  ? 1008 CYS A N   1 
ATOM 7811 C CA  . CYS A 1 1011 ? 5.519   34.129 22.742  1.00 51.51  ? 1008 CYS A CA  1 
ATOM 7812 C C   . CYS A 1 1011 ? 5.314   34.281 21.265  1.00 51.51  ? 1008 CYS A C   1 
ATOM 7813 O O   . CYS A 1 1011 ? 5.816   35.191 20.660  1.00 51.51  ? 1008 CYS A O   1 
ATOM 7814 C CB  . CYS A 1 1011 ? 4.273   34.513 23.479  1.00 57.83  ? 1008 CYS A CB  1 
ATOM 7815 S SG  . CYS A 1 1011 ? 3.868   36.078 23.045  1.00 57.83  ? 1008 CYS A SG  1 
ATOM 7816 N N   . HIS A 1 1012 ? 4.600   33.340 20.683  1.00 53.43  ? 1009 HIS A N   1 
ATOM 7817 C CA  . HIS A 1 1012 ? 4.246   33.419 19.303  1.00 53.43  ? 1009 HIS A CA  1 
ATOM 7818 C C   . HIS A 1 1012 ? 3.114   34.386 19.224  1.00 53.43  ? 1009 HIS A C   1 
ATOM 7819 O O   . HIS A 1 1012 ? 2.293   34.443 20.114  1.00 53.43  ? 1009 HIS A O   1 
ATOM 7820 C CB  . HIS A 1 1012 ? 3.833   32.051 18.812  1.00 46.45  ? 1009 HIS A CB  1 
ATOM 7821 C CG  . HIS A 1 1012 ? 4.941   31.066 18.884  1.00 46.45  ? 1009 HIS A CG  1 
ATOM 7822 N ND1 . HIS A 1 1012 ? 5.768   30.806 17.811  1.00 46.45  ? 1009 HIS A ND1 1 
ATOM 7823 C CD2 . HIS A 1 1012 ? 5.431   30.351 19.926  1.00 46.45  ? 1009 HIS A CD2 1 
ATOM 7824 C CE1 . HIS A 1 1012 ? 6.696   29.932 18.177  1.00 46.45  ? 1009 HIS A CE1 1 
ATOM 7825 N NE2 . HIS A 1 1012 ? 6.519   29.646 19.458  1.00 46.45  ? 1009 HIS A NE2 1 
ATOM 7826 N N   . GLY A 1 1013 ? 3.091   35.158 18.153  1.00 37.69  ? 1010 GLY A N   1 
ATOM 7827 C CA  . GLY A 1 1013 ? 2.156   36.260 17.978  1.00 37.69  ? 1010 GLY A CA  1 
ATOM 7828 C C   . GLY A 1 1013 ? 2.773   37.221 16.957  1.00 37.69  ? 1010 GLY A C   1 
ATOM 7829 O O   . GLY A 1 1013 ? 3.927   37.053 16.553  1.00 37.69  ? 1010 GLY A O   1 
ATOM 7830 N N   . SER A 1 1014 ? 1.996   38.207 16.526  1.00 57.58  ? 1011 SER A N   1 
ATOM 7831 C CA  . SER A 1 1014 ? 2.495   39.244 15.647  1.00 57.58  ? 1011 SER A CA  1 
ATOM 7832 C C   . SER A 1 1014 ? 1.567   40.415 15.692  1.00 57.58  ? 1011 SER A C   1 
ATOM 7833 O O   . SER A 1 1014 ? 0.363   40.250 15.852  1.00 57.58  ? 1011 SER A O   1 
ATOM 7834 C CB  . SER A 1 1014 ? 2.595   38.793 14.192  1.00 46.23  ? 1011 SER A CB  1 
ATOM 7835 O OG  . SER A 1 1014 ? 2.991   39.928 13.410  1.00 46.23  ? 1011 SER A OG  1 
ATOM 7836 N N   . LEU A 1 1015 ? 2.114   41.599 15.501  1.00 41.86  ? 1012 LEU A N   1 
ATOM 7837 C CA  . LEU A 1 1015 ? 1.305   42.759 15.668  1.00 41.86  ? 1012 LEU A CA  1 
ATOM 7838 C C   . LEU A 1 1015 ? 0.810   43.327 14.344  1.00 41.86  ? 1012 LEU A C   1 
ATOM 7839 O O   . LEU A 1 1015 ? 0.292   44.451 14.311  1.00 41.86  ? 1012 LEU A O   1 
ATOM 7840 C CB  . LEU A 1 1015 ? 2.027   43.832 16.485  1.00 70.27  ? 1012 LEU A CB  1 
ATOM 7841 C CG  . LEU A 1 1015 ? 2.623   43.492 17.848  1.00 70.27  ? 1012 LEU A CG  1 
ATOM 7842 C CD1 . LEU A 1 1015 ? 2.687   44.757 18.668  1.00 70.27  ? 1012 LEU A CD1 1 
ATOM 7843 C CD2 . LEU A 1 1015 ? 1.844   42.440 18.581  1.00 70.27  ? 1012 LEU A CD2 1 
ATOM 7844 N N   . VAL A 1 1016 ? 0.905   42.575 13.260  1.00 69.68  ? 1013 VAL A N   1 
ATOM 7845 C CA  . VAL A 1 1016 ? 0.567   43.199 12.000  1.00 69.68  ? 1013 VAL A CA  1 
ATOM 7846 C C   . VAL A 1 1016 ? -0.424  42.447 11.128  1.00 69.68  ? 1013 VAL A C   1 
ATOM 7847 O O   . VAL A 1 1016 ? -0.957  41.410 11.534  1.00 69.68  ? 1013 VAL A O   1 
ATOM 7848 C CB  . VAL A 1 1016 ? 1.838   43.533 11.210  1.00 65.84  ? 1013 VAL A CB  1 
ATOM 7849 C CG1 . VAL A 1 1016 ? 2.433   44.844 11.714  1.00 65.84  ? 1013 VAL A CG1 1 
ATOM 7850 C CG2 . VAL A 1 1016 ? 2.852   42.388 11.291  1.00 65.84  ? 1013 VAL A CG2 1 
ATOM 7851 N N   . MET A 1 1017 ? -0.653  42.983 9.926   1.00 88.11  ? 1014 MET A N   1 
ATOM 7852 C CA  . MET A 1 1017 ? -1.454  42.344 8.865   1.00 88.11  ? 1014 MET A CA  1 
ATOM 7853 C C   . MET A 1 1017 ? -2.952  42.350 9.186   1.00 88.11  ? 1014 MET A C   1 
ATOM 7854 O O   . MET A 1 1017 ? -3.376  42.821 10.253  1.00 88.11  ? 1014 MET A O   1 
ATOM 7855 C CB  . MET A 1 1017 ? -0.907  40.962 8.434   1.00 120.34 ? 1014 MET A CB  1 
ATOM 7856 C CG  . MET A 1 1017 ? -1.362  39.766 9.254   1.00 120.34 ? 1014 MET A CG  1 
ATOM 7857 S SD  . MET A 1 1017 ? -2.810  38.976 8.551   1.00 120.34 ? 1014 MET A SD  1 
ATOM 7858 C CE  . MET A 1 1017 ? -3.334  37.903 9.886   1.00 120.34 ? 1014 MET A CE  1 
ATOM 7859 N N   . GLN A 1 1018 ? -3.734  41.835 8.236   1.00 90.81  ? 1015 GLN A N   1 
ATOM 7860 C CA  . GLN A 1 1018 ? -5.203  41.909 8.232   1.00 90.81  ? 1015 GLN A CA  1 
ATOM 7861 C C   . GLN A 1 1018 ? -5.814  41.913 9.635   1.00 90.81  ? 1015 GLN A C   1 
ATOM 7862 O O   . GLN A 1 1018 ? -6.360  42.925 10.083  1.00 90.81  ? 1015 GLN A O   1 
ATOM 7863 C CB  . GLN A 1 1018 ? -5.818  40.762 7.396   1.00 152.83 ? 1015 GLN A CB  1 
ATOM 7864 C CG  . GLN A 1 1018 ? -4.833  39.877 6.585   1.00 152.83 ? 1015 GLN A CG  1 
ATOM 7865 C CD  . GLN A 1 1018 ? -4.206  40.565 5.369   1.00 152.83 ? 1015 GLN A CD  1 
ATOM 7866 O OE1 . GLN A 1 1018 ? -4.891  40.858 4.376   1.00 152.83 ? 1015 GLN A OE1 1 
ATOM 7867 N NE2 . GLN A 1 1018 ? -2.890  40.795 5.435   1.00 152.83 ? 1015 GLN A NE2 1 
ATOM 7868 N N   . PRO A 1 1026 ? 9.836   35.565 2.806   1.00 94.96  ? 1023 PRO A N   1 
ATOM 7869 C CA  . PRO A 1 1026 ? 10.959  36.500 3.120   1.00 94.96  ? 1023 PRO A CA  1 
ATOM 7870 C C   . PRO A 1 1026 ? 11.479  36.189 4.507   1.00 94.96  ? 1023 PRO A C   1 
ATOM 7871 O O   . PRO A 1 1026 ? 12.684  36.275 4.771   1.00 94.96  ? 1023 PRO A O   1 
ATOM 7872 C CB  . PRO A 1 1026 ? 10.313  37.902 3.089   1.00 58.96  ? 1023 PRO A CB  1 
ATOM 7873 C CG  . PRO A 1 1026 ? 8.985   37.688 2.284   1.00 58.96  ? 1023 PRO A CG  1 
ATOM 7874 C CD  . PRO A 1 1026 ? 8.548   36.249 2.589   1.00 58.96  ? 1023 PRO A CD  1 
ATOM 7875 N N   . THR A 1 1027 ? 10.530  35.825 5.368   1.00 68.69  ? 1024 THR A N   1 
ATOM 7876 C CA  . THR A 1 1027 ? 10.773  35.367 6.726   1.00 68.69  ? 1024 THR A CA  1 
ATOM 7877 C C   . THR A 1 1027 ? 9.685   34.352 7.096   1.00 68.69  ? 1024 THR A C   1 
ATOM 7878 O O   . THR A 1 1027 ? 8.665   34.207 6.381   1.00 68.69  ? 1024 THR A O   1 
ATOM 7879 C CB  . THR A 1 1027 ? 10.743  36.521 7.745   1.00 89.63  ? 1024 THR A CB  1 
ATOM 7880 O OG1 . THR A 1 1027 ? 9.589   37.341 7.502   1.00 89.63  ? 1024 THR A OG1 1 
ATOM 7881 C CG2 . THR A 1 1027 ? 12.050  37.357 7.692   1.00 89.63  ? 1024 THR A CG2 1 
ATOM 7882 N N   . GLN A 1 1028 ? 9.934   33.648 8.199   1.00 58.96  ? 1025 GLN A N   1 
ATOM 7883 C CA  . GLN A 1 1028 ? 9.042   32.636 8.691   1.00 58.96  ? 1025 GLN A CA  1 
ATOM 7884 C C   . GLN A 1 1028 ? 8.803   32.919 10.176  1.00 58.96  ? 1025 GLN A C   1 
ATOM 7885 O O   . GLN A 1 1028 ? 9.670   33.469 10.868  1.00 58.96  ? 1025 GLN A O   1 
ATOM 7886 C CB  . GLN A 1 1028 ? 9.624   31.233 8.486   1.00 198.61 ? 1025 GLN A CB  1 
ATOM 7887 C CG  . GLN A 1 1028 ? 8.590   30.116 8.627   1.00 198.61 ? 1025 GLN A CG  1 
ATOM 7888 C CD  . GLN A 1 1028 ? 9.162   28.732 8.358   1.00 198.61 ? 1025 GLN A CD  1 
ATOM 7889 O OE1 . GLN A 1 1028 ? 9.962   28.206 9.143   1.00 198.61 ? 1025 GLN A OE1 1 
ATOM 7890 N NE2 . GLN A 1 1028 ? 8.739   28.126 7.250   1.00 198.61 ? 1025 GLN A NE2 1 
ATOM 7891 N N   . GLY A 1 1029 ? 7.606   32.563 10.647  1.00 66.50  ? 1026 GLY A N   1 
ATOM 7892 C CA  . GLY A 1 1029 ? 7.257   32.664 12.049  1.00 66.50  ? 1026 GLY A CA  1 
ATOM 7893 C C   . GLY A 1 1029 ? 7.309   34.079 12.573  1.00 66.50  ? 1026 GLY A C   1 
ATOM 7894 O O   . GLY A 1 1029 ? 7.551   35.031 11.824  1.00 66.50  ? 1026 GLY A O   1 
ATOM 7895 N N   . SER A 1 1030 ? 7.068   34.200 13.878  1.00 47.46  ? 1027 SER A N   1 
ATOM 7896 C CA  . SER A 1 1030 ? 7.139   35.470 14.577  1.00 47.46  ? 1027 SER A CA  1 
ATOM 7897 C C   . SER A 1 1030 ? 6.975   35.205 16.054  1.00 47.46  ? 1027 SER A C   1 
ATOM 7898 O O   . SER A 1 1030 ? 5.908   34.786 16.499  1.00 47.46  ? 1027 SER A O   1 
ATOM 7899 C CB  . SER A 1 1030 ? 6.054   36.421 14.080  1.00 50.78  ? 1027 SER A CB  1 
ATOM 7900 O OG  . SER A 1 1030 ? 6.256   37.731 14.576  1.00 50.78  ? 1027 SER A OG  1 
ATOM 7901 N N   . VAL A 1 1031 ? 8.050   35.438 16.800  1.00 44.65  ? 1028 VAL A N   1 
ATOM 7902 C CA  . VAL A 1 1031 ? 8.080   35.248 18.246  1.00 44.65  ? 1028 VAL A CA  1 
ATOM 7903 C C   . VAL A 1 1031 ? 8.419   36.571 18.898  1.00 44.65  ? 1028 VAL A C   1 
ATOM 7904 O O   . VAL A 1 1031 ? 9.439   37.168 18.585  1.00 44.65  ? 1028 VAL A O   1 
ATOM 7905 C CB  . VAL A 1 1031 ? 9.172   34.276 18.634  1.00 25.25  ? 1028 VAL A CB  1 
ATOM 7906 C CG1 . VAL A 1 1031 ? 9.496   34.446 20.081  1.00 25.25  ? 1028 VAL A CG1 1 
ATOM 7907 C CG2 . VAL A 1 1031 ? 8.729   32.842 18.356  1.00 25.25  ? 1028 VAL A CG2 1 
ATOM 7908 N N   . LEU A 1 1032 ? 7.580   37.035 19.802  1.00 49.49  ? 1029 LEU A N   1 
ATOM 7909 C CA  . LEU A 1 1032 ? 7.820   38.308 20.395  1.00 49.49  ? 1029 LEU A CA  1 
ATOM 7910 C C   . LEU A 1 1032 ? 8.309   37.998 21.755  1.00 49.49  ? 1029 LEU A C   1 
ATOM 7911 O O   . LEU A 1 1032 ? 7.993   36.942 22.280  1.00 49.49  ? 1029 LEU A O   1 
ATOM 7912 C CB  . LEU A 1 1032 ? 6.539   39.116 20.462  1.00 35.31  ? 1029 LEU A CB  1 
ATOM 7913 C CG  . LEU A 1 1032 ? 5.842   39.447 19.125  1.00 35.31  ? 1029 LEU A CG  1 
ATOM 7914 C CD1 . LEU A 1 1032 ? 4.346   39.543 19.368  1.00 35.31  ? 1029 LEU A CD1 1 
ATOM 7915 C CD2 . LEU A 1 1032 ? 6.348   40.706 18.434  1.00 35.31  ? 1029 LEU A CD2 1 
ATOM 7916 N N   . PHE A 1 1033 ? 9.118   38.910 22.302  1.00 38.08  ? 1030 PHE A N   1 
ATOM 7917 C CA  . PHE A 1 1033 ? 9.615   38.815 23.666  1.00 38.08  ? 1030 PHE A CA  1 
ATOM 7918 C C   . PHE A 1 1033 ? 9.476   40.113 24.370  1.00 38.08  ? 1030 PHE A C   1 
ATOM 7919 O O   . PHE A 1 1033 ? 9.368   41.153 23.739  1.00 38.08  ? 1030 PHE A O   1 
ATOM 7920 C CB  . PHE A 1 1033 ? 11.061  38.367 23.711  1.00 30.36  ? 1030 PHE A CB  1 
ATOM 7921 C CG  . PHE A 1 1033 ? 12.006  39.203 22.898  1.00 30.36  ? 1030 PHE A CG  1 
ATOM 7922 C CD1 . PHE A 1 1033 ? 12.580  40.347 23.439  1.00 30.36  ? 1030 PHE A CD1 1 
ATOM 7923 C CD2 . PHE A 1 1033 ? 12.389  38.788 21.615  1.00 30.36  ? 1030 PHE A CD2 1 
ATOM 7924 C CE1 . PHE A 1 1033 ? 13.477  41.123 22.659  1.00 30.36  ? 1030 PHE A CE1 1 
ATOM 7925 C CE2 . PHE A 1 1033 ? 13.277  39.529 20.833  1.00 30.36  ? 1030 PHE A CE2 1 
ATOM 7926 C CZ  . PHE A 1 1033 ? 13.836  40.688 21.351  1.00 30.36  ? 1030 PHE A CZ  1 
ATOM 7927 N N   . GLY A 1 1034 ? 9.462   40.065 25.691  1.00 34.79  ? 1031 GLY A N   1 
ATOM 7928 C CA  . GLY A 1 1034 ? 9.299   41.288 26.460  1.00 34.79  ? 1031 GLY A CA  1 
ATOM 7929 C C   . GLY A 1 1034 ? 10.324  41.246 27.545  1.00 34.79  ? 1031 GLY A C   1 
ATOM 7930 O O   . GLY A 1 1034 ? 10.610  40.186 28.102  1.00 34.79  ? 1031 GLY A O   1 
ATOM 7931 N N   . THR A 1 1035 ? 10.879  42.407 27.829  1.00 27.97  ? 1032 THR A N   1 
ATOM 7932 C CA  . THR A 1 1035 ? 12.078  42.529 28.623  1.00 27.97  ? 1032 THR A CA  1 
ATOM 7933 C C   . THR A 1 1035 ? 11.844  43.367 29.867  1.00 27.97  ? 1032 THR A C   1 
ATOM 7934 O O   . THR A 1 1035 ? 10.895  44.145 29.961  1.00 27.97  ? 1032 THR A O   1 
ATOM 7935 C CB  . THR A 1 1035 ? 13.181  43.225 27.805  1.00 34.54  ? 1032 THR A CB  1 
ATOM 7936 O OG1 . THR A 1 1035 ? 12.785  44.567 27.505  1.00 34.54  ? 1032 THR A OG1 1 
ATOM 7937 C CG2 . THR A 1 1035 ? 13.397  42.526 26.507  1.00 34.54  ? 1032 THR A CG2 1 
ATOM 7938 N N   . VAL A 1 1036 ? 12.761  43.269 30.805  1.00 30.94  ? 1033 VAL A N   1 
ATOM 7939 C CA  . VAL A 1 1036 ? 12.727  44.035 32.040  1.00 30.94  ? 1033 VAL A CA  1 
ATOM 7940 C C   . VAL A 1 1036 ? 12.665  45.536 31.832  1.00 30.94  ? 1033 VAL A C   1 
ATOM 7941 O O   . VAL A 1 1036 ? 12.301  46.282 32.700  1.00 30.94  ? 1033 VAL A O   1 
ATOM 7942 C CB  . VAL A 1 1036 ? 13.950  43.639 32.849  1.00 23.41  ? 1033 VAL A CB  1 
ATOM 7943 C CG1 . VAL A 1 1036 ? 14.392  44.709 33.801  1.00 23.41  ? 1033 VAL A CG1 1 
ATOM 7944 C CG2 . VAL A 1 1036 ? 13.706  42.349 33.494  1.00 23.41  ? 1033 VAL A CG2 1 
ATOM 7945 N N   . ASN A 1 1037 ? 12.981  45.977 30.647  1.00 37.70  ? 1034 ASN A N   1 
ATOM 7946 C CA  . ASN A 1 1037 ? 13.243  47.367 30.382  1.00 37.70  ? 1034 ASN A CA  1 
ATOM 7947 C C   . ASN A 1 1037 ? 12.126  48.019 29.585  1.00 37.70  ? 1034 ASN A C   1 
ATOM 7948 O O   . ASN A 1 1037 ? 12.066  49.240 29.401  1.00 37.70  ? 1034 ASN A O   1 
ATOM 7949 C CB  . ASN A 1 1037 ? 14.478  47.382 29.530  1.00 29.35  ? 1034 ASN A CB  1 
ATOM 7950 C CG  . ASN A 1 1037 ? 15.735  47.786 30.280  1.00 29.35  ? 1034 ASN A CG  1 
ATOM 7951 O OD1 . ASN A 1 1037 ? 15.721  48.233 31.462  1.00 29.35  ? 1034 ASN A OD1 1 
ATOM 7952 N ND2 . ASN A 1 1037 ? 16.863  47.690 29.544  1.00 29.35  ? 1034 ASN A ND2 1 
ATOM 7953 N N   . GLY A 1 1038 ? 11.245  47.171 29.090  1.00 45.53  ? 1035 GLY A N   1 
ATOM 7954 C CA  . GLY A 1 1038 ? 10.117  47.630 28.325  1.00 45.53  ? 1035 GLY A CA  1 
ATOM 7955 C C   . GLY A 1 1038 ? 10.337  47.475 26.853  1.00 45.53  ? 1035 GLY A C   1 
ATOM 7956 O O   . GLY A 1 1038 ? 9.545   47.963 26.055  1.00 45.53  ? 1035 GLY A O   1 
ATOM 7957 N N   . MET A 1 1039 ? 11.414  46.789 26.493  1.00 38.06  ? 1036 MET A N   1 
ATOM 7958 C CA  . MET A 1 1039 ? 11.683  46.534 25.107  1.00 38.06  ? 1036 MET A CA  1 
ATOM 7959 C C   . MET A 1 1039 ? 10.732  45.424 24.661  1.00 38.06  ? 1036 MET A C   1 
ATOM 7960 O O   . MET A 1 1039 ? 10.510  44.432 25.368  1.00 38.06  ? 1036 MET A O   1 
ATOM 7961 C CB  . MET A 1 1039 ? 13.155  46.173 24.957  1.00 41.79  ? 1036 MET A CB  1 
ATOM 7962 C CG  . MET A 1 1039 ? 13.705  46.192 23.561  1.00 41.79  ? 1036 MET A CG  1 
ATOM 7963 S SD  . MET A 1 1039 ? 13.971  44.477 23.095  1.00 41.79  ? 1036 MET A SD  1 
ATOM 7964 C CE  . MET A 1 1039 ? 14.590  44.627 21.376  1.00 41.79  ? 1036 MET A CE  1 
ATOM 7965 N N   . ILE A 1 1040 ? 10.110  45.609 23.515  1.00 44.44  ? 1037 ILE A N   1 
ATOM 7966 C CA  . ILE A 1 1040 ? 9.465   44.487 22.880  1.00 44.44  ? 1037 ILE A CA  1 
ATOM 7967 C C   . ILE A 1 1040 ? 10.252  44.235 21.623  1.00 44.44  ? 1037 ILE A C   1 
ATOM 7968 O O   . ILE A 1 1040 ? 10.315  45.106 20.756  1.00 44.44  ? 1037 ILE A O   1 
ATOM 7969 C CB  . ILE A 1 1040 ? 7.996   44.778 22.561  1.00 32.87  ? 1037 ILE A CB  1 
ATOM 7970 C CG1 . ILE A 1 1040 ? 7.275   45.148 23.850  1.00 32.87  ? 1037 ILE A CG1 1 
ATOM 7971 C CG2 . ILE A 1 1040 ? 7.320   43.598 21.896  1.00 32.87  ? 1037 ILE A CG2 1 
ATOM 7972 C CD1 . ILE A 1 1040 ? 5.783   45.430 23.652  1.00 32.87  ? 1037 ILE A CD1 1 
ATOM 7973 N N   . GLY A 1 1041 ? 10.894  43.078 21.541  1.00 68.81  ? 1038 GLY A N   1 
ATOM 7974 C CA  . GLY A 1 1041 ? 11.534  42.668 20.304  1.00 68.81  ? 1038 GLY A CA  1 
ATOM 7975 C C   . GLY A 1 1041 ? 10.725  41.626 19.552  1.00 68.81  ? 1038 GLY A C   1 
ATOM 7976 O O   . GLY A 1 1041 ? 9.574   41.374 19.886  1.00 68.81  ? 1038 GLY A O   1 
ATOM 7977 N N   . LEU A 1 1042 ? 11.348  41.021 18.544  1.00 34.62  ? 1039 LEU A N   1 
ATOM 7978 C CA  . LEU A 1 1042 ? 10.742  39.991 17.721  1.00 34.62  ? 1039 LEU A CA  1 
ATOM 7979 C C   . LEU A 1 1042 ? 11.786  39.055 17.098  1.00 34.62  ? 1039 LEU A C   1 
ATOM 7980 O O   . LEU A 1 1042 ? 12.737  39.522 16.532  1.00 34.62  ? 1039 LEU A O   1 
ATOM 7981 C CB  . LEU A 1 1042 ? 9.919   40.680 16.625  1.00 58.01  ? 1039 LEU A CB  1 
ATOM 7982 C CG  . LEU A 1 1042 ? 9.655   40.120 15.223  1.00 58.01  ? 1039 LEU A CG  1 
ATOM 7983 C CD1 . LEU A 1 1042 ? 9.233   38.676 15.177  1.00 58.01  ? 1039 LEU A CD1 1 
ATOM 7984 C CD2 . LEU A 1 1042 ? 8.574   40.954 14.651  1.00 58.01  ? 1039 LEU A CD2 1 
ATOM 7985 N N   . VAL A 1 1043 ? 11.627  37.748 17.157  1.00 59.39  ? 1040 VAL A N   1 
ATOM 7986 C CA  . VAL A 1 1043 ? 12.545  36.912 16.402  1.00 59.39  ? 1040 VAL A CA  1 
ATOM 7987 C C   . VAL A 1 1043 ? 11.860  36.143 15.282  1.00 59.39  ? 1040 VAL A C   1 
ATOM 7988 O O   . VAL A 1 1043 ? 10.855  35.453 15.494  1.00 59.39  ? 1040 VAL A O   1 
ATOM 7989 C CB  . VAL A 1 1043 ? 13.282  35.910 17.276  1.00 34.40  ? 1040 VAL A CB  1 
ATOM 7990 C CG1 . VAL A 1 1043 ? 14.253  35.158 16.452  1.00 34.40  ? 1040 VAL A CG1 1 
ATOM 7991 C CG2 . VAL A 1 1043 ? 13.999  36.585 18.388  1.00 34.40  ? 1040 VAL A CG2 1 
ATOM 7992 N N   . THR A 1 1044 ? 12.443  36.231 14.093  1.00 66.61  ? 1041 THR A N   1 
ATOM 7993 C CA  . THR A 1 1044 ? 11.956  35.530 12.912  1.00 66.61  ? 1041 THR A CA  1 
ATOM 7994 C C   . THR A 1 1044 ? 13.045  34.651 12.374  1.00 66.61  ? 1041 THR A C   1 
ATOM 7995 O O   . THR A 1 1044 ? 14.211  34.896 12.638  1.00 66.61  ? 1041 THR A O   1 
ATOM 7996 C CB  . THR A 1 1044 ? 11.584  36.537 11.829  1.00 52.62  ? 1041 THR A CB  1 
ATOM 7997 O OG1 . THR A 1 1044 ? 10.383  37.219 12.222  1.00 52.62  ? 1041 THR A OG1 1 
ATOM 7998 C CG2 . THR A 1 1044 ? 11.341  35.856 10.525  1.00 52.62  ? 1041 THR A CG2 1 
ATOM 7999 N N   . SER A 1 1045 ? 12.652  33.631 11.619  1.00 58.55  ? 1042 SER A N   1 
ATOM 8000 C CA  . SER A 1 1045 ? 13.579  32.741 10.886  1.00 58.55  ? 1042 SER A CA  1 
ATOM 8001 C C   . SER A 1 1045 ? 13.945  33.266 9.477   1.00 58.55  ? 1042 SER A C   1 
ATOM 8002 O O   . SER A 1 1045 ? 13.369  34.242 8.989   1.00 58.55  ? 1042 SER A O   1 
ATOM 8003 C CB  . SER A 1 1045 ? 12.996  31.324 10.809  1.00 75.02  ? 1042 SER A CB  1 
ATOM 8004 O OG  . SER A 1 1045 ? 12.966  30.722 12.099  1.00 75.02  ? 1042 SER A OG  1 
ATOM 8005 N N   . LEU A 1 1046 ? 14.910  32.636 8.818   1.00 77.49  ? 1043 LEU A N   1 
ATOM 8006 C CA  . LEU A 1 1046 ? 15.319  33.100 7.498   1.00 77.49  ? 1043 LEU A CA  1 
ATOM 8007 C C   . LEU A 1 1046 ? 15.682  31.953 6.589   1.00 77.49  ? 1043 LEU A C   1 
ATOM 8008 O O   . LEU A 1 1046 ? 15.904  30.835 7.054   1.00 77.49  ? 1043 LEU A O   1 
ATOM 8009 C CB  . LEU A 1 1046 ? 16.541  33.991 7.626   1.00 40.26  ? 1043 LEU A CB  1 
ATOM 8010 C CG  . LEU A 1 1046 ? 16.459  35.295 8.393   1.00 40.26  ? 1043 LEU A CG  1 
ATOM 8011 C CD1 . LEU A 1 1046 ? 17.779  35.514 9.126   1.00 40.26  ? 1043 LEU A CD1 1 
ATOM 8012 C CD2 . LEU A 1 1046 ? 16.158  36.426 7.437   1.00 40.26  ? 1043 LEU A CD2 1 
ATOM 8013 N N   . SER A 1 1047 ? 15.755  32.244 5.293   1.00 75.40  ? 1044 SER A N   1 
ATOM 8014 C CA  . SER A 1 1047 ? 16.423  31.369 4.336   1.00 75.40  ? 1044 SER A CA  1 
ATOM 8015 C C   . SER A 1 1047 ? 17.941  31.566 4.438   1.00 75.40  ? 1044 SER A C   1 
ATOM 8016 O O   . SER A 1 1047 ? 18.417  32.695 4.606   1.00 75.40  ? 1044 SER A O   1 
ATOM 8017 C CB  . SER A 1 1047 ? 15.997  31.745 2.928   1.00 88.94  ? 1044 SER A CB  1 
ATOM 8018 O OG  . SER A 1 1047 ? 16.635  32.949 2.539   1.00 88.94  ? 1044 SER A OG  1 
ATOM 8019 N N   . GLU A 1 1048 ? 18.700  30.478 4.318   1.00 61.11  ? 1045 GLU A N   1 
ATOM 8020 C CA  . GLU A 1 1048 ? 20.177  30.549 4.257   1.00 61.11  ? 1045 GLU A CA  1 
ATOM 8021 C C   . GLU A 1 1048 ? 20.653  31.647 3.321   1.00 61.11  ? 1045 GLU A C   1 
ATOM 8022 O O   . GLU A 1 1048 ? 21.596  32.363 3.618   1.00 61.11  ? 1045 GLU A O   1 
ATOM 8023 C CB  . GLU A 1 1048 ? 20.785  29.188 3.851   1.00 120.53 ? 1045 GLU A CB  1 
ATOM 8024 C CG  . GLU A 1 1048 ? 20.703  28.822 2.352   1.00 120.53 ? 1045 GLU A CG  1 
ATOM 8025 C CD  . GLU A 1 1048 ? 19.298  28.443 1.875   1.00 120.53 ? 1045 GLU A CD  1 
ATOM 8026 O OE1 . GLU A 1 1048 ? 18.884  27.283 2.098   1.00 120.53 ? 1045 GLU A OE1 1 
ATOM 8027 O OE2 . GLU A 1 1048 ? 18.622  29.298 1.254   1.00 120.53 ? 1045 GLU A OE2 1 
ATOM 8028 N N   . SER A 1 1049 ? 19.979  31.780 2.191   1.00 56.16  ? 1046 SER A N   1 
ATOM 8029 C CA  . SER A 1 1049 ? 20.325  32.798 1.218   1.00 56.16  ? 1046 SER A CA  1 
ATOM 8030 C C   . SER A 1 1049 ? 20.052  34.211 1.753   1.00 56.16  ? 1046 SER A C   1 
ATOM 8031 O O   . SER A 1 1049 ? 20.920  35.120 1.666   1.00 56.16  ? 1046 SER A O   1 
ATOM 8032 C CB  . SER A 1 1049 ? 19.557  32.565 -0.082  1.00 68.40  ? 1046 SER A CB  1 
ATOM 8033 O OG  . SER A 1 1049 ? 18.191  32.317 0.197   1.00 68.40  ? 1046 SER A OG  1 
ATOM 8034 N N   . TRP A 1 1050 ? 18.845  34.379 2.294   1.00 71.27  ? 1047 TRP A N   1 
ATOM 8035 C CA  . TRP A 1 1050 ? 18.473  35.602 2.975   1.00 71.27  ? 1047 TRP A CA  1 
ATOM 8036 C C   . TRP A 1 1050 ? 19.365  35.914 4.167   1.00 71.27  ? 1047 TRP A C   1 
ATOM 8037 O O   . TRP A 1 1050 ? 19.779  37.072 4.342   1.00 71.27  ? 1047 TRP A O   1 
ATOM 8038 C CB  . TRP A 1 1050 ? 17.015  35.543 3.361   1.00 90.81  ? 1047 TRP A CB  1 
ATOM 8039 C CG  . TRP A 1 1050 ? 16.246  36.099 2.283   1.00 90.81  ? 1047 TRP A CG  1 
ATOM 8040 C CD1 . TRP A 1 1050 ? 16.147  35.616 1.014   1.00 90.81  ? 1047 TRP A CD1 1 
ATOM 8041 C CD2 . TRP A 1 1050 ? 15.511  37.308 2.319   1.00 90.81  ? 1047 TRP A CD2 1 
ATOM 8042 N NE1 . TRP A 1 1050 ? 15.362  36.442 0.264   1.00 90.81  ? 1047 TRP A NE1 1 
ATOM 8043 C CE2 . TRP A 1 1050 ? 14.960  37.494 1.044   1.00 90.81  ? 1047 TRP A CE2 1 
ATOM 8044 C CE3 . TRP A 1 1050 ? 15.240  38.247 3.317   1.00 90.81  ? 1047 TRP A CE3 1 
ATOM 8045 C CZ2 . TRP A 1 1050 ? 14.155  38.581 0.740   1.00 90.81  ? 1047 TRP A CZ2 1 
ATOM 8046 C CZ3 . TRP A 1 1050 ? 14.443  39.320 3.017   1.00 90.81  ? 1047 TRP A CZ3 1 
ATOM 8047 C CH2 . TRP A 1 1050 ? 13.906  39.482 1.742   1.00 90.81  ? 1047 TRP A CH2 1 
ATOM 8048 N N   . TYR A 1 1051 ? 19.687  34.888 4.965   1.00 58.83  ? 1048 TYR A N   1 
ATOM 8049 C CA  . TYR A 1 1051 ? 20.671  35.055 6.020   1.00 58.83  ? 1048 TYR A CA  1 
ATOM 8050 C C   . TYR A 1 1051 ? 21.860  35.702 5.370   1.00 58.83  ? 1048 TYR A C   1 
ATOM 8051 O O   . TYR A 1 1051 ? 22.186  36.843 5.671   1.00 58.83  ? 1048 TYR A O   1 
ATOM 8052 C CB  . TYR A 1 1051 ? 21.052  33.732 6.656   1.00 72.19  ? 1048 TYR A CB  1 
ATOM 8053 C CG  . TYR A 1 1051 ? 22.070  33.875 7.749   1.00 72.19  ? 1048 TYR A CG  1 
ATOM 8054 C CD1 . TYR A 1 1051 ? 21.687  34.179 9.053   1.00 72.19  ? 1048 TYR A CD1 1 
ATOM 8055 C CD2 . TYR A 1 1051 ? 23.419  33.705 7.486   1.00 72.19  ? 1048 TYR A CD2 1 
ATOM 8056 C CE1 . TYR A 1 1051 ? 22.638  34.316 10.078  1.00 72.19  ? 1048 TYR A CE1 1 
ATOM 8057 C CE2 . TYR A 1 1051 ? 24.375  33.829 8.495   1.00 72.19  ? 1048 TYR A CE2 1 
ATOM 8058 C CZ  . TYR A 1 1051 ? 23.983  34.140 9.788   1.00 72.19  ? 1048 TYR A CZ  1 
ATOM 8059 O OH  . TYR A 1 1051 ? 24.934  34.269 10.777  1.00 72.19  ? 1048 TYR A OH  1 
ATOM 8060 N N   . ASN A 1 1052 ? 22.434  34.996 4.401   1.00 41.42  ? 1049 ASN A N   1 
ATOM 8061 C CA  . ASN A 1 1052 ? 23.689  35.419 3.736   1.00 41.42  ? 1049 ASN A CA  1 
ATOM 8062 C C   . ASN A 1 1052 ? 23.720  36.845 3.184   1.00 41.42  ? 1049 ASN A C   1 
ATOM 8063 O O   . ASN A 1 1052 ? 24.554  37.648 3.608   1.00 41.42  ? 1049 ASN A O   1 
ATOM 8064 C CB  . ASN A 1 1052 ? 24.135  34.393 2.691   1.00 67.05  ? 1049 ASN A CB  1 
ATOM 8065 C CG  . ASN A 1 1052 ? 24.597  33.100 3.330   1.00 67.05  ? 1049 ASN A CG  1 
ATOM 8066 O OD1 . ASN A 1 1052 ? 25.165  33.099 4.425   1.00 67.05  ? 1049 ASN A OD1 1 
ATOM 8067 N ND2 . ASN A 1 1052 ? 24.349  31.991 2.658   1.00 67.05  ? 1049 ASN A ND2 1 
ATOM 8068 N N   . LEU A 1 1053 ? 22.802  37.156 2.275   1.00 56.55  ? 1050 LEU A N   1 
ATOM 8069 C CA  . LEU A 1 1053 ? 22.699  38.499 1.772   1.00 56.55  ? 1050 LEU A CA  1 
ATOM 8070 C C   . LEU A 1 1053 ? 22.851  39.467 2.943   1.00 56.55  ? 1050 LEU A C   1 
ATOM 8071 O O   . LEU A 1 1053 ? 23.758  40.315 2.955   1.00 56.55  ? 1050 LEU A O   1 
ATOM 8072 C CB  . LEU A 1 1053 ? 21.364  38.692 1.086   1.00 51.89  ? 1050 LEU A CB  1 
ATOM 8073 C CG  . LEU A 1 1053 ? 21.312  39.883 0.124   1.00 51.89  ? 1050 LEU A CG  1 
ATOM 8074 C CD1 . LEU A 1 1053 ? 19.876  40.095 -0.402  1.00 51.89  ? 1050 LEU A CD1 1 
ATOM 8075 C CD2 . LEU A 1 1053 ? 21.841  41.182 0.729   1.00 51.89  ? 1050 LEU A CD2 1 
ATOM 8076 N N   . LEU A 1 1054 ? 21.993  39.294 3.946   1.00 68.36  ? 1051 LEU A N   1 
ATOM 8077 C CA  . LEU A 1 1054 ? 21.944  40.156 5.140   1.00 68.36  ? 1051 LEU A CA  1 
ATOM 8078 C C   . LEU A 1 1054 ? 23.216  40.176 6.003   1.00 68.36  ? 1051 LEU A C   1 
ATOM 8079 O O   . LEU A 1 1054 ? 23.547  41.195 6.598   1.00 68.36  ? 1051 LEU A O   1 
ATOM 8080 C CB  . LEU A 1 1054 ? 20.763  39.735 6.026   1.00 38.36  ? 1051 LEU A CB  1 
ATOM 8081 C CG  . LEU A 1 1054 ? 19.347  39.826 5.487   1.00 38.36  ? 1051 LEU A CG  1 
ATOM 8082 C CD1 . LEU A 1 1054 ? 18.459  39.135 6.494   1.00 38.36  ? 1051 LEU A CD1 1 
ATOM 8083 C CD2 . LEU A 1 1054 ? 18.992  41.282 5.324   1.00 38.36  ? 1051 LEU A CD2 1 
ATOM 8084 N N   . LEU A 1 1055 ? 23.888  39.034 6.102   1.00 54.06  ? 1052 LEU A N   1 
ATOM 8085 C CA  . LEU A 1 1055 ? 25.089  38.935 6.918   1.00 54.06  ? 1052 LEU A CA  1 
ATOM 8086 C C   . LEU A 1 1055 ? 26.198  39.751 6.243   1.00 54.06  ? 1052 LEU A C   1 
ATOM 8087 O O   . LEU A 1 1055 ? 26.978  40.454 6.894   1.00 54.06  ? 1052 LEU A O   1 
ATOM 8088 C CB  . LEU A 1 1055 ? 25.521  37.469 7.123   1.00 43.43  ? 1052 LEU A CB  1 
ATOM 8089 C CG  . LEU A 1 1055 ? 26.463  37.234 8.322   1.00 43.43  ? 1052 LEU A CG  1 
ATOM 8090 C CD1 . LEU A 1 1055 ? 26.933  35.774 8.438   1.00 43.43  ? 1052 LEU A CD1 1 
ATOM 8091 C CD2 . LEU A 1 1055 ? 27.653  38.116 8.314   1.00 43.43  ? 1052 LEU A CD2 1 
ATOM 8092 N N   . ASP A 1 1056 ? 26.257  39.641 4.922   1.00 71.80  ? 1053 ASP A N   1 
ATOM 8093 C CA  . ASP A 1 1056 ? 27.178  40.442 4.168   1.00 71.80  ? 1053 ASP A CA  1 
ATOM 8094 C C   . ASP A 1 1056 ? 26.753  41.881 4.427   1.00 71.80  ? 1053 ASP A C   1 
ATOM 8095 O O   . ASP A 1 1056 ? 27.498  42.661 5.022   1.00 71.80  ? 1053 ASP A O   1 
ATOM 8096 C CB  . ASP A 1 1056 ? 27.101  40.086 2.678   1.00 99.30  ? 1053 ASP A CB  1 
ATOM 8097 C CG  . ASP A 1 1056 ? 28.293  40.623 1.880   1.00 99.30  ? 1053 ASP A CG  1 
ATOM 8098 O OD1 . ASP A 1 1056 ? 29.377  39.981 1.933   1.00 99.30  ? 1053 ASP A OD1 1 
ATOM 8099 O OD2 . ASP A 1 1056 ? 28.140  41.676 1.199   1.00 99.30  ? 1053 ASP A OD2 1 
ATOM 8100 N N   . MET A 1 1057 ? 25.518  42.189 4.035   1.00 73.14  ? 1054 MET A N   1 
ATOM 8101 C CA  . MET A 1 1057 ? 24.960  43.527 4.140   1.00 73.14  ? 1054 MET A CA  1 
ATOM 8102 C C   . MET A 1 1057 ? 25.261  44.179 5.488   1.00 73.14  ? 1054 MET A C   1 
ATOM 8103 O O   . MET A 1 1057 ? 25.420  45.385 5.587   1.00 73.14  ? 1054 MET A O   1 
ATOM 8104 C CB  . MET A 1 1057 ? 23.469  43.464 3.870   1.00 85.68  ? 1054 MET A CB  1 
ATOM 8105 C CG  . MET A 1 1057 ? 22.724  44.725 4.193   1.00 85.68  ? 1054 MET A CG  1 
ATOM 8106 S SD  . MET A 1 1057 ? 21.378  45.060 3.037   1.00 85.68  ? 1054 MET A SD  1 
ATOM 8107 C CE  . MET A 1 1057 ? 20.534  43.481 2.966   1.00 85.68  ? 1054 MET A CE  1 
ATOM 8108 N N   . GLN A 1 1058 ? 25.369  43.352 6.517   1.00 66.62  ? 1055 GLN A N   1 
ATOM 8109 C CA  . GLN A 1 1058 ? 25.685  43.803 7.860   1.00 66.62  ? 1055 GLN A CA  1 
ATOM 8110 C C   . GLN A 1 1058 ? 27.116  44.244 7.951   1.00 66.62  ? 1055 GLN A C   1 
ATOM 8111 O O   . GLN A 1 1058 ? 27.389  45.334 8.421   1.00 66.62  ? 1055 GLN A O   1 
ATOM 8112 C CB  . GLN A 1 1058 ? 25.521  42.654 8.818   1.00 66.99  ? 1055 GLN A CB  1 
ATOM 8113 C CG  . GLN A 1 1058 ? 24.302  42.649 9.654   1.00 66.99  ? 1055 GLN A CG  1 
ATOM 8114 C CD  . GLN A 1 1058 ? 24.571  41.818 10.858  1.00 66.99  ? 1055 GLN A CD  1 
ATOM 8115 O OE1 . GLN A 1 1058 ? 23.694  41.155 11.391  1.00 66.99  ? 1055 GLN A OE1 1 
ATOM 8116 N NE2 . GLN A 1 1058 ? 25.826  41.810 11.278  1.00 66.99  ? 1055 GLN A NE2 1 
ATOM 8117 N N   . ASN A 1 1059 ? 28.020  43.367 7.513   1.00 49.09  ? 1056 ASN A N   1 
ATOM 8118 C CA  . ASN A 1 1059 ? 29.453  43.599 7.582   1.00 49.09  ? 1056 ASN A CA  1 
ATOM 8119 C C   . ASN A 1 1059 ? 29.791  44.843 6.779   1.00 49.09  ? 1056 ASN A C   1 
ATOM 8120 O O   . ASN A 1 1059 ? 30.490  45.734 7.285   1.00 49.09  ? 1056 ASN A O   1 
ATOM 8121 C CB  . ASN A 1 1059 ? 30.231  42.376 7.082   1.00 69.87  ? 1056 ASN A CB  1 
ATOM 8122 C CG  . ASN A 1 1059 ? 30.159  41.157 8.049   1.00 69.87  ? 1056 ASN A CG  1 
ATOM 8123 O OD1 . ASN A 1 1059 ? 30.199  40.012 7.611   1.00 69.87  ? 1056 ASN A OD1 1 
ATOM 8124 N ND2 . ASN A 1 1059 ? 30.082  41.411 9.352   1.00 69.87  ? 1056 ASN A ND2 1 
ATOM 8125 N N   . ARG A 1 1060 ? 29.241  44.930 5.562   1.00 57.72  ? 1057 ARG A N   1 
ATOM 8126 C CA  . ARG A 1 1060 ? 29.380  46.110 4.715   1.00 57.72  ? 1057 ARG A CA  1 
ATOM 8127 C C   . ARG A 1 1060 ? 28.850  47.318 5.436   1.00 57.72  ? 1057 ARG A C   1 
ATOM 8128 O O   . ARG A 1 1060 ? 29.531  48.337 5.533   1.00 57.72  ? 1057 ARG A O   1 
ATOM 8129 C CB  . ARG A 1 1060 ? 28.608  45.964 3.413   1.00 81.19  ? 1057 ARG A CB  1 
ATOM 8130 C CG  . ARG A 1 1060 ? 28.970  44.768 2.582   1.00 81.19  ? 1057 ARG A CG  1 
ATOM 8131 C CD  . ARG A 1 1060 ? 29.322  45.244 1.206   1.00 81.19  ? 1057 ARG A CD  1 
ATOM 8132 N NE  . ARG A 1 1060 ? 28.965  44.274 0.179   1.00 81.19  ? 1057 ARG A NE  1 
ATOM 8133 C CZ  . ARG A 1 1060 ? 29.201  44.439 -1.121  1.00 81.19  ? 1057 ARG A CZ  1 
ATOM 8134 N NH1 . ARG A 1 1060 ? 29.804  45.538 -1.564  1.00 81.19  ? 1057 ARG A NH1 1 
ATOM 8135 N NH2 . ARG A 1 1060 ? 28.834  43.504 -1.980  1.00 81.19  ? 1057 ARG A NH2 1 
ATOM 8136 N N   . LEU A 1 1061 ? 27.629  47.187 5.959   1.00 75.27  ? 1058 LEU A N   1 
ATOM 8137 C CA  . LEU A 1 1061 ? 26.936  48.279 6.646   1.00 75.27  ? 1058 LEU A CA  1 
ATOM 8138 C C   . LEU A 1 1061 ? 27.690  48.839 7.809   1.00 75.27  ? 1058 LEU A C   1 
ATOM 8139 O O   . LEU A 1 1061 ? 27.453  49.969 8.215   1.00 75.27  ? 1058 LEU A O   1 
ATOM 8140 C CB  . LEU A 1 1061 ? 25.574  47.846 7.162   1.00 54.77  ? 1058 LEU A CB  1 
ATOM 8141 C CG  . LEU A 1 1061 ? 24.352  48.439 6.438   1.00 54.77  ? 1058 LEU A CG  1 
ATOM 8142 C CD1 . LEU A 1 1061 ? 23.057  47.778 6.988   1.00 54.77  ? 1058 LEU A CD1 1 
ATOM 8143 C CD2 . LEU A 1 1061 ? 24.280  49.984 6.484   1.00 54.77  ? 1058 LEU A CD2 1 
ATOM 8144 N N   . ASN A 1 1062 ? 28.587  48.047 8.368   1.00 69.96  ? 1059 ASN A N   1 
ATOM 8145 C CA  . ASN A 1 1062 ? 29.330  48.538 9.493   1.00 69.96  ? 1059 ASN A CA  1 
ATOM 8146 C C   . ASN A 1 1062 ? 30.414  49.528 9.097   1.00 69.96  ? 1059 ASN A C   1 
ATOM 8147 O O   . ASN A 1 1062 ? 30.314  50.703 9.471   1.00 69.96  ? 1059 ASN A O   1 
ATOM 8148 C CB  . ASN A 1 1062 ? 29.785  47.394 10.373  1.00 63.59  ? 1059 ASN A CB  1 
ATOM 8149 C CG  . ASN A 1 1062 ? 28.624  46.815 11.166  1.00 63.59  ? 1059 ASN A CG  1 
ATOM 8150 O OD1 . ASN A 1 1062 ? 27.937  47.532 11.896  1.00 63.59  ? 1059 ASN A OD1 1 
ATOM 8151 N ND2 . ASN A 1 1062 ? 28.373  45.533 10.991  1.00 63.59  ? 1059 ASN A ND2 1 
ATOM 8152 N N   . LYS A 1 1063 ? 31.395  49.092 8.301   1.00 67.10  ? 1060 LYS A N   1 
ATOM 8153 C CA  . LYS A 1 1063 ? 32.412  49.992 7.723   1.00 67.10  ? 1060 LYS A CA  1 
ATOM 8154 C C   . LYS A 1 1063 ? 31.841  51.394 7.422   1.00 67.10  ? 1060 LYS A C   1 
ATOM 8155 O O   . LYS A 1 1063 ? 32.359  52.407 7.889   1.00 67.10  ? 1060 LYS A O   1 
ATOM 8156 C CB  . LYS A 1 1063 ? 33.016  49.365 6.453   1.00 79.68  ? 1060 LYS A CB  1 
ATOM 8157 C CG  . LYS A 1 1063 ? 33.963  48.176 6.686   1.00 79.68  ? 1060 LYS A CG  1 
ATOM 8158 C CD  . LYS A 1 1063 ? 35.038  48.090 5.598   1.00 79.68  ? 1060 LYS A CD  1 
ATOM 8159 C CE  . LYS A 1 1063 ? 36.006  46.942 5.845   1.00 79.68  ? 1060 LYS A CE  1 
ATOM 8160 N NZ  . LYS A 1 1063 ? 35.318  45.611 5.779   1.00 79.68  ? 1060 LYS A NZ  1 
ATOM 8161 N N   . VAL A 1 1064 ? 30.752  51.443 6.662   1.00 78.58  ? 1061 VAL A N   1 
ATOM 8162 C CA  . VAL A 1 1064 ? 30.055  52.701 6.344   1.00 78.58  ? 1061 VAL A CA  1 
ATOM 8163 C C   . VAL A 1 1064 ? 29.587  53.503 7.573   1.00 78.58  ? 1061 VAL A C   1 
ATOM 8164 O O   . VAL A 1 1064 ? 29.853  54.709 7.660   1.00 78.58  ? 1061 VAL A O   1 
ATOM 8165 C CB  . VAL A 1 1064 ? 28.852  52.429 5.423   1.00 91.56  ? 1061 VAL A CB  1 
ATOM 8166 C CG1 . VAL A 1 1064 ? 28.052  53.685 5.202   1.00 91.56  ? 1061 VAL A CG1 1 
ATOM 8167 C CG2 . VAL A 1 1064 ? 29.322  51.849 4.105   1.00 91.56  ? 1061 VAL A CG2 1 
ATOM 8168 N N   . ILE A 1 1065 ? 28.900  52.828 8.506   1.00 84.95  ? 1062 ILE A N   1 
ATOM 8169 C CA  . ILE A 1 1065 ? 28.376  53.457 9.739   1.00 84.95  ? 1062 ILE A CA  1 
ATOM 8170 C C   . ILE A 1 1065 ? 29.416  53.735 10.840  1.00 84.95  ? 1062 ILE A C   1 
ATOM 8171 O O   . ILE A 1 1065 ? 30.045  52.833 11.403  1.00 84.95  ? 1062 ILE A O   1 
ATOM 8172 C CB  . ILE A 1 1065 ? 27.172  52.673 10.348  1.00 49.08  ? 1062 ILE A CB  1 
ATOM 8173 C CG1 . ILE A 1 1065 ? 25.993  52.688 9.405   1.00 49.08  ? 1062 ILE A CG1 1 
ATOM 8174 C CG2 . ILE A 1 1065 ? 26.732  53.259 11.707  1.00 49.08  ? 1062 ILE A CG2 1 
ATOM 8175 C CD1 . ILE A 1 1065 ? 25.059  51.523 9.650   1.00 49.08  ? 1062 ILE A CD1 1 
ATOM 8176 N N   . LYS A 1 1066 ? 29.556  55.018 11.129  1.00 82.10  ? 1063 LYS A N   1 
ATOM 8177 C CA  . LYS A 1 1066 ? 30.237  55.502 12.321  1.00 82.10  ? 1063 LYS A CA  1 
ATOM 8178 C C   . LYS A 1 1066 ? 29.360  55.276 13.565  1.00 82.10  ? 1063 LYS A C   1 
ATOM 8179 O O   . LYS A 1 1066 ? 28.302  55.906 13.724  1.00 82.10  ? 1063 LYS A O   1 
ATOM 8180 C CB  . LYS A 1 1066 ? 30.587  56.994 12.159  1.00 125.97 ? 1063 LYS A CB  1 
ATOM 8181 C CG  . LYS A 1 1066 ? 29.385  57.923 11.860  1.00 125.97 ? 1063 LYS A CG  1 
ATOM 8182 C CD  . LYS A 1 1066 ? 28.903  57.832 10.408  1.00 125.97 ? 1063 LYS A CD  1 
ATOM 8183 C CE  . LYS A 1 1066 ? 27.387  57.975 10.319  1.00 125.97 ? 1063 LYS A CE  1 
ATOM 8184 N NZ  . LYS A 1 1066 ? 26.964  58.545 9.009   1.00 125.97 ? 1063 LYS A NZ  1 
ATOM 8185 N N   . SER A 1 1067 ? 29.802  54.370 14.435  1.00 40.72  ? 1064 SER A N   1 
ATOM 8186 C CA  . SER A 1 1067 ? 29.103  54.106 15.687  1.00 40.72  ? 1064 SER A CA  1 
ATOM 8187 C C   . SER A 1 1067 ? 29.422  55.266 16.588  1.00 40.72  ? 1064 SER A C   1 
ATOM 8188 O O   . SER A 1 1067 ? 30.368  55.988 16.293  1.00 40.72  ? 1064 SER A O   1 
ATOM 8189 C CB  . SER A 1 1067 ? 29.580  52.813 16.329  1.00 60.34  ? 1064 SER A CB  1 
ATOM 8190 O OG  . SER A 1 1067 ? 30.874  52.980 16.848  1.00 60.34  ? 1064 SER A OG  1 
ATOM 8191 N N   . VAL A 1 1068 ? 28.736  55.389 17.699  1.00 72.59  ? 1065 VAL A N   1 
ATOM 8192 C CA  . VAL A 1 1068 ? 29.015  56.431 18.651  1.00 72.59  ? 1065 VAL A CA  1 
ATOM 8193 C C   . VAL A 1 1068 ? 29.852  55.873 19.768  1.00 72.59  ? 1065 VAL A C   1 
ATOM 8194 O O   . VAL A 1 1068 ? 29.483  54.908 20.366  1.00 72.59  ? 1065 VAL A O   1 
ATOM 8195 C CB  . VAL A 1 1068 ? 27.734  56.910 19.270  1.00 48.65  ? 1065 VAL A CB  1 
ATOM 8196 C CG1 . VAL A 1 1068 ? 27.991  58.011 20.205  1.00 48.65  ? 1065 VAL A CG1 1 
ATOM 8197 C CG2 . VAL A 1 1068 ? 26.797  57.320 18.222  1.00 48.65  ? 1065 VAL A CG2 1 
ATOM 8198 N N   . GLY A 1 1069 ? 30.976  56.481 20.060  1.00 46.70  ? 1066 GLY A N   1 
ATOM 8199 C CA  . GLY A 1 1069 ? 31.800  55.998 21.127  1.00 46.70  ? 1066 GLY A CA  1 
ATOM 8200 C C   . GLY A 1 1069 ? 32.712  55.046 20.448  1.00 46.70  ? 1066 GLY A C   1 
ATOM 8201 O O   . GLY A 1 1069 ? 33.488  54.351 21.061  1.00 46.70  ? 1066 GLY A O   1 
ATOM 8202 N N   . LYS A 1 1070 ? 32.589  55.036 19.139  1.00 61.10  ? 1067 LYS A N   1 
ATOM 8203 C CA  . LYS A 1 1070 ? 33.426  54.234 18.294  1.00 61.10  ? 1067 LYS A CA  1 
ATOM 8204 C C   . LYS A 1 1070 ? 33.450  52.847 18.828  1.00 61.10  ? 1067 LYS A C   1 
ATOM 8205 O O   . LYS A 1 1070 ? 34.460  52.183 18.794  1.00 61.10  ? 1067 LYS A O   1 
ATOM 8206 C CB  . LYS A 1 1070 ? 34.830  54.785 18.244  1.00 77.60  ? 1067 LYS A CB  1 
ATOM 8207 C CG  . LYS A 1 1070 ? 34.913  56.259 17.993  1.00 77.60  ? 1067 LYS A CG  1 
ATOM 8208 C CD  . LYS A 1 1070 ? 34.818  56.570 16.543  1.00 77.60  ? 1067 LYS A CD  1 
ATOM 8209 C CE  . LYS A 1 1070 ? 35.282  57.967 16.236  1.00 77.60  ? 1067 LYS A CE  1 
ATOM 8210 N NZ  . LYS A 1 1070 ? 36.746  58.118 16.352  1.00 77.60  ? 1067 LYS A NZ  1 
ATOM 8211 N N   . ILE A 1 1071 ? 32.311  52.410 19.318  1.00 39.41  ? 1068 ILE A N   1 
ATOM 8212 C CA  . ILE A 1 1071 ? 32.080  50.984 19.664  1.00 39.41  ? 1068 ILE A CA  1 
ATOM 8213 C C   . ILE A 1 1071 ? 31.840  50.098 18.436  1.00 39.41  ? 1068 ILE A C   1 
ATOM 8214 O O   . ILE A 1 1071 ? 31.089  50.428 17.532  1.00 39.41  ? 1068 ILE A O   1 
ATOM 8215 C CB  . ILE A 1 1071 ? 30.974  50.755 20.780  1.00 37.15  ? 1068 ILE A CB  1 
ATOM 8216 C CG1 . ILE A 1 1071 ? 31.311  51.517 22.061  1.00 37.15  ? 1068 ILE A CG1 1 
ATOM 8217 C CG2 . ILE A 1 1071 ? 30.888  49.316 21.199  1.00 37.15  ? 1068 ILE A CG2 1 
ATOM 8218 C CD1 . ILE A 1 1071 ? 30.136  51.599 23.024  1.00 37.15  ? 1068 ILE A CD1 1 
ATOM 8219 N N   . GLU A 1 1072 ? 32.525  48.962 18.443  1.00 47.78  ? 1069 GLU A N   1 
ATOM 8220 C CA  . GLU A 1 1072 ? 32.494  47.954 17.377  1.00 47.78  ? 1069 GLU A CA  1 
ATOM 8221 C C   . GLU A 1 1072 ? 31.180  47.144 17.433  1.00 47.78  ? 1069 GLU A C   1 
ATOM 8222 O O   . GLU A 1 1072 ? 30.942  46.388 18.394  1.00 47.78  ? 1069 GLU A O   1 
ATOM 8223 C CB  . GLU A 1 1072 ? 33.722  47.044 17.569  1.00 157.72 ? 1069 GLU A CB  1 
ATOM 8224 C CG  . GLU A 1 1072 ? 33.777  45.795 16.719  1.00 157.72 ? 1069 GLU A CG  1 
ATOM 8225 C CD  . GLU A 1 1072 ? 34.215  46.077 15.302  1.00 157.72 ? 1069 GLU A CD  1 
ATOM 8226 O OE1 . GLU A 1 1072 ? 33.700  45.403 14.380  1.00 157.72 ? 1069 GLU A OE1 1 
ATOM 8227 O OE2 . GLU A 1 1072 ? 35.069  46.975 15.113  1.00 157.72 ? 1069 GLU A OE2 1 
ATOM 8228 N N   . HIS A 1 1073 ? 30.343  47.281 16.403  1.00 40.89  ? 1070 HIS A N   1 
ATOM 8229 C CA  . HIS A 1 1073 ? 29.062  46.544 16.347  1.00 40.89  ? 1070 HIS A CA  1 
ATOM 8230 C C   . HIS A 1 1073 ? 29.143  45.100 16.774  1.00 40.89  ? 1070 HIS A C   1 
ATOM 8231 O O   . HIS A 1 1073 ? 28.305  44.621 17.501  1.00 40.89  ? 1070 HIS A O   1 
ATOM 8232 C CB  . HIS A 1 1073 ? 28.434  46.606 14.961  1.00 38.14  ? 1070 HIS A CB  1 
ATOM 8233 C CG  . HIS A 1 1073 ? 27.198  45.773 14.839  1.00 38.14  ? 1070 HIS A CG  1 
ATOM 8234 N ND1 . HIS A 1 1073 ? 25.934  46.272 15.087  1.00 38.14  ? 1070 HIS A ND1 1 
ATOM 8235 C CD2 . HIS A 1 1073 ? 27.032  44.465 14.528  1.00 38.14  ? 1070 HIS A CD2 1 
ATOM 8236 C CE1 . HIS A 1 1073 ? 25.045  45.306 14.943  1.00 38.14  ? 1070 HIS A CE1 1 
ATOM 8237 N NE2 . HIS A 1 1073 ? 25.684  44.204 14.594  1.00 38.14  ? 1070 HIS A NE2 1 
ATOM 8238 N N   . SER A 1 1074 ? 30.165  44.414 16.303  1.00 47.53  ? 1071 SER A N   1 
ATOM 8239 C CA  . SER A 1 1074 ? 30.352  43.001 16.585  1.00 47.53  ? 1071 SER A CA  1 
ATOM 8240 C C   . SER A 1 1074 ? 30.875  42.778 17.985  1.00 47.53  ? 1071 SER A C   1 
ATOM 8241 O O   . SER A 1 1074 ? 30.661  41.729 18.559  1.00 47.53  ? 1071 SER A O   1 
ATOM 8242 C CB  . SER A 1 1074 ? 31.246  42.342 15.535  1.00 62.51  ? 1071 SER A CB  1 
ATOM 8243 O OG  . SER A 1 1074 ? 32.404  43.114 15.332  1.00 62.51  ? 1071 SER A OG  1 
ATOM 8244 N N   . PHE A 1 1075 ? 31.537  43.755 18.571  1.00 52.01  ? 1072 PHE A N   1 
ATOM 8245 C CA  . PHE A 1 1075 ? 31.945  43.571 19.951  1.00 52.01  ? 1072 PHE A CA  1 
ATOM 8246 C C   . PHE A 1 1075 ? 30.710  43.559 20.857  1.00 52.01  ? 1072 PHE A C   1 
ATOM 8247 O O   . PHE A 1 1075 ? 30.562  42.720 21.765  1.00 52.01  ? 1072 PHE A O   1 
ATOM 8248 C CB  . PHE A 1 1075 ? 32.878  44.676 20.348  1.00 34.55  ? 1072 PHE A CB  1 
ATOM 8249 C CG  . PHE A 1 1075 ? 33.236  44.666 21.770  1.00 34.55  ? 1072 PHE A CG  1 
ATOM 8250 C CD1 . PHE A 1 1075 ? 34.139  43.735 22.257  1.00 34.55  ? 1072 PHE A CD1 1 
ATOM 8251 C CD2 . PHE A 1 1075 ? 32.671  45.618 22.653  1.00 34.55  ? 1072 PHE A CD2 1 
ATOM 8252 C CE1 . PHE A 1 1075 ? 34.495  43.752 23.629  1.00 34.55  ? 1072 PHE A CE1 1 
ATOM 8253 C CE2 . PHE A 1 1075 ? 33.002  45.650 24.030  1.00 34.55  ? 1072 PHE A CE2 1 
ATOM 8254 C CZ  . PHE A 1 1075 ? 33.905  44.718 24.530  1.00 34.55  ? 1072 PHE A CZ  1 
ATOM 8255 N N   . TRP A 1 1076 ? 29.839  44.520 20.573  1.00 48.50  ? 1073 TRP A N   1 
ATOM 8256 C CA  . TRP A 1 1076 ? 28.532  44.648 21.146  1.00 48.50  ? 1073 TRP A CA  1 
ATOM 8257 C C   . TRP A 1 1076 ? 27.787  43.353 20.962  1.00 48.50  ? 1073 TRP A C   1 
ATOM 8258 O O   . TRP A 1 1076 ? 27.444  42.730 21.963  1.00 48.50  ? 1073 TRP A O   1 
ATOM 8259 C CB  . TRP A 1 1076 ? 27.823  45.846 20.497  1.00 43.48  ? 1073 TRP A CB  1 
ATOM 8260 C CG  . TRP A 1 1076 ? 26.324  46.033 20.741  1.00 43.48  ? 1073 TRP A CG  1 
ATOM 8261 C CD1 . TRP A 1 1076 ? 25.379  46.321 19.801  1.00 43.48  ? 1073 TRP A CD1 1 
ATOM 8262 C CD2 . TRP A 1 1076 ? 25.634  45.974 21.991  1.00 43.48  ? 1073 TRP A CD2 1 
ATOM 8263 N NE1 . TRP A 1 1076 ? 24.150  46.434 20.387  1.00 43.48  ? 1073 TRP A NE1 1 
ATOM 8264 C CE2 . TRP A 1 1076 ? 24.280  46.212 21.728  1.00 43.48  ? 1073 TRP A CE2 1 
ATOM 8265 C CE3 . TRP A 1 1076 ? 26.030  45.718 23.305  1.00 43.48  ? 1073 TRP A CE3 1 
ATOM 8266 C CZ2 . TRP A 1 1076 ? 23.329  46.212 22.722  1.00 43.48  ? 1073 TRP A CZ2 1 
ATOM 8267 C CZ3 . TRP A 1 1076 ? 25.094  45.742 24.290  1.00 43.48  ? 1073 TRP A CZ3 1 
ATOM 8268 C CH2 . TRP A 1 1076 ? 23.763  45.983 24.002  1.00 43.48  ? 1073 TRP A CH2 1 
ATOM 8269 N N   . ARG A 1 1077 ? 27.578  42.902 19.722  1.00 37.99  ? 1074 ARG A N   1 
ATOM 8270 C CA  . ARG A 1 1077 ? 26.689  41.741 19.508  1.00 37.99  ? 1074 ARG A CA  1 
ATOM 8271 C C   . ARG A 1 1077 ? 27.233  40.406 19.988  1.00 37.99  ? 1074 ARG A C   1 
ATOM 8272 O O   . ARG A 1 1077 ? 26.668  39.342 19.722  1.00 37.99  ? 1074 ARG A O   1 
ATOM 8273 C CB  . ARG A 1 1077 ? 26.283  41.595 18.054  1.00 43.01  ? 1074 ARG A CB  1 
ATOM 8274 C CG  . ARG A 1 1077 ? 25.177  42.488 17.658  1.00 43.01  ? 1074 ARG A CG  1 
ATOM 8275 C CD  . ARG A 1 1077 ? 24.230  42.661 18.817  1.00 43.01  ? 1074 ARG A CD  1 
ATOM 8276 N NE  . ARG A 1 1077 ? 23.101  43.522 18.464  1.00 43.01  ? 1074 ARG A NE  1 
ATOM 8277 C CZ  . ARG A 1 1077 ? 22.122  43.838 19.296  1.00 43.01  ? 1074 ARG A CZ  1 
ATOM 8278 N NH1 . ARG A 1 1077 ? 22.085  43.396 20.555  1.00 43.01  ? 1074 ARG A NH1 1 
ATOM 8279 N NH2 . ARG A 1 1077 ? 21.181  44.618 18.851  1.00 43.01  ? 1074 ARG A NH2 1 
ATOM 8280 N N   . SER A 1 1078 ? 28.339  40.436 20.698  1.00 36.50  ? 1075 SER A N   1 
ATOM 8281 C CA  . SER A 1 1078 ? 28.982  39.180 20.934  1.00 36.50  ? 1075 SER A CA  1 
ATOM 8282 C C   . SER A 1 1078 ? 28.548  38.548 22.212  1.00 36.50  ? 1075 SER A C   1 
ATOM 8283 O O   . SER A 1 1078 ? 28.487  39.207 23.264  1.00 36.50  ? 1075 SER A O   1 
ATOM 8284 C CB  . SER A 1 1078 ? 30.498  39.290 20.794  1.00 48.55  ? 1075 SER A CB  1 
ATOM 8285 O OG  . SER A 1 1078 ? 30.841  38.806 19.493  1.00 48.55  ? 1075 SER A OG  1 
ATOM 8286 N N   . PHE A 1 1079 ? 28.214  37.274 22.076  1.00 48.77  ? 1076 PHE A N   1 
ATOM 8287 C CA  . PHE A 1 1079 ? 27.832  36.433 23.179  1.00 48.77  ? 1076 PHE A CA  1 
ATOM 8288 C C   . PHE A 1 1079 ? 28.804  36.614 24.269  1.00 48.77  ? 1076 PHE A C   1 
ATOM 8289 O O   . PHE A 1 1079 ? 29.997  36.673 24.032  1.00 48.77  ? 1076 PHE A O   1 
ATOM 8290 C CB  . PHE A 1 1079 ? 27.855  34.975 22.769  1.00 53.05  ? 1076 PHE A CB  1 
ATOM 8291 C CG  . PHE A 1 1079 ? 27.142  34.077 23.727  1.00 53.05  ? 1076 PHE A CG  1 
ATOM 8292 C CD1 . PHE A 1 1079 ? 25.813  33.696 23.481  1.00 53.05  ? 1076 PHE A CD1 1 
ATOM 8293 C CD2 . PHE A 1 1079 ? 27.788  33.612 24.879  1.00 53.05  ? 1076 PHE A CD2 1 
ATOM 8294 C CE1 . PHE A 1 1079 ? 25.158  32.860 24.382  1.00 53.05  ? 1076 PHE A CE1 1 
ATOM 8295 C CE2 . PHE A 1 1079 ? 27.137  32.779 25.780  1.00 53.05  ? 1076 PHE A CE2 1 
ATOM 8296 C CZ  . PHE A 1 1079 ? 25.837  32.403 25.544  1.00 53.05  ? 1076 PHE A CZ  1 
ATOM 8297 N N   . HIS A 1 1080 ? 28.338  36.699 25.484  1.00 40.50  ? 1077 HIS A N   1 
ATOM 8298 C CA  . HIS A 1 1080 ? 29.197  37.036 26.558  1.00 40.50  ? 1077 HIS A CA  1 
ATOM 8299 C C   . HIS A 1 1080 ? 28.622  36.775 27.906  1.00 40.50  ? 1077 HIS A C   1 
ATOM 8300 O O   . HIS A 1 1080 ? 27.620  37.307 28.274  1.00 40.50  ? 1077 HIS A O   1 
ATOM 8301 C CB  . HIS A 1 1080 ? 29.497  38.495 26.490  1.00 56.75  ? 1077 HIS A CB  1 
ATOM 8302 C CG  . HIS A 1 1080 ? 30.204  38.996 27.693  1.00 56.75  ? 1077 HIS A CG  1 
ATOM 8303 N ND1 . HIS A 1 1080 ? 31.496  39.454 27.658  1.00 56.75  ? 1077 HIS A ND1 1 
ATOM 8304 C CD2 . HIS A 1 1080 ? 29.812  39.071 28.979  1.00 56.75  ? 1077 HIS A CD2 1 
ATOM 8305 C CE1 . HIS A 1 1080 ? 31.865  39.807 28.870  1.00 56.75  ? 1077 HIS A CE1 1 
ATOM 8306 N NE2 . HIS A 1 1080 ? 30.861  39.587 29.690  1.00 56.75  ? 1077 HIS A NE2 1 
ATOM 8307 N N   . THR A 1 1081 ? 29.252  35.865 28.612  1.00 60.83  ? 1078 THR A N   1 
ATOM 8308 C CA  . THR A 1 1081 ? 28.920  35.562 29.973  1.00 60.83  ? 1078 THR A CA  1 
ATOM 8309 C C   . THR A 1 1081 ? 30.255  35.749 30.521  1.00 60.83  ? 1078 THR A C   1 
ATOM 8310 O O   . THR A 1 1081 ? 31.194  35.380 29.876  1.00 60.83  ? 1078 THR A O   1 
ATOM 8311 C CB  . THR A 1 1081 ? 28.745  34.108 30.179  1.00 53.45  ? 1078 THR A CB  1 
ATOM 8312 O OG1 . THR A 1 1081 ? 29.913  33.468 29.688  1.00 53.45  ? 1078 THR A OG1 1 
ATOM 8313 C CG2 . THR A 1 1081 ? 27.566  33.593 29.433  1.00 53.45  ? 1078 THR A CG2 1 
ATOM 8314 N N   . GLU A 1 1082 ? 30.355  36.289 31.713  1.00 90.78  ? 1079 GLU A N   1 
ATOM 8315 C CA  . GLU A 1 1082 ? 31.646  36.597 32.249  1.00 90.78  ? 1079 GLU A CA  1 
ATOM 8316 C C   . GLU A 1 1082 ? 32.608  35.618 31.673  1.00 90.78  ? 1079 GLU A C   1 
ATOM 8317 O O   . GLU A 1 1082 ? 33.272  35.886 30.690  1.00 90.78  ? 1079 GLU A O   1 
ATOM 8318 C CB  . GLU A 1 1082 ? 31.650  36.498 33.755  1.00 210.35 ? 1079 GLU A CB  1 
ATOM 8319 C CG  . GLU A 1 1082 ? 32.349  37.671 34.370  1.00 210.35 ? 1079 GLU A CG  1 
ATOM 8320 C CD  . GLU A 1 1082 ? 33.434  38.238 33.465  1.00 210.35 ? 1079 GLU A CD  1 
ATOM 8321 O OE1 . GLU A 1 1082 ? 34.294  37.463 32.999  1.00 210.35 ? 1079 GLU A OE1 1 
ATOM 8322 O OE2 . GLU A 1 1082 ? 33.436  39.465 33.226  1.00 210.35 ? 1079 GLU A OE2 1 
ATOM 8323 N N   . ARG A 1 1083 ? 32.709  34.463 32.278  1.00 59.20  ? 1080 ARG A N   1 
ATOM 8324 C CA  . ARG A 1 1083 ? 33.495  33.468 31.633  1.00 59.20  ? 1080 ARG A CA  1 
ATOM 8325 C C   . ARG A 1 1083 ? 33.578  32.987 30.255  1.00 59.20  ? 1080 ARG A C   1 
ATOM 8326 O O   . ARG A 1 1083 ? 33.978  31.892 30.007  1.00 59.20  ? 1080 ARG A O   1 
ATOM 8327 C CB  . ARG A 1 1083 ? 32.457  32.615 32.279  1.00 126.45 ? 1080 ARG A CB  1 
ATOM 8328 C CG  . ARG A 1 1083 ? 31.712  31.812 31.248  1.00 126.45 ? 1080 ARG A CG  1 
ATOM 8329 C CD  . ARG A 1 1083 ? 31.101  30.603 31.902  1.00 126.45 ? 1080 ARG A CD  1 
ATOM 8330 N NE  . ARG A 1 1083 ? 31.720  30.397 33.211  1.00 126.45 ? 1080 ARG A NE  1 
ATOM 8331 C CZ  . ARG A 1 1083 ? 32.661  29.500 33.476  1.00 126.45 ? 1080 ARG A CZ  1 
ATOM 8332 N NH1 . ARG A 1 1083 ? 33.094  28.690 32.528  1.00 126.45 ? 1080 ARG A NH1 1 
ATOM 8333 N NH2 . ARG A 1 1083 ? 33.158  29.410 34.697  1.00 126.45 ? 1080 ARG A NH2 1 
ATOM 8334 N N   . LYS A 1 1084 ? 33.134  33.794 29.332  1.00 69.61  ? 1081 LYS A N   1 
ATOM 8335 C CA  . LYS A 1 1084 ? 33.198  33.322 27.956  1.00 69.61  ? 1081 LYS A CA  1 
ATOM 8336 C C   . LYS A 1 1084 ? 32.753  34.419 27.019  1.00 69.61  ? 1081 LYS A C   1 
ATOM 8337 O O   . LYS A 1 1084 ? 31.831  35.173 27.343  1.00 69.61  ? 1081 LYS A O   1 
ATOM 8338 C CB  . LYS A 1 1084 ? 32.341  32.044 27.770  1.00 52.85  ? 1081 LYS A CB  1 
ATOM 8339 C CG  . LYS A 1 1084 ? 31.920  31.691 26.340  1.00 52.85  ? 1081 LYS A CG  1 
ATOM 8340 C CD  . LYS A 1 1084 ? 31.067  30.404 26.309  1.00 52.85  ? 1081 LYS A CD  1 
ATOM 8341 C CE  . LYS A 1 1084 ? 30.254  30.248 24.996  1.00 52.85  ? 1081 LYS A CE  1 
ATOM 8342 N NZ  . LYS A 1 1084 ? 30.033  28.866 24.446  1.00 52.85  ? 1081 LYS A NZ  1 
ATOM 8343 N N   . THR A 1 1085 ? 33.419  34.515 25.867  1.00 49.27  ? 1082 THR A N   1 
ATOM 8344 C CA  . THR A 1 1085 ? 33.003  35.449 24.819  1.00 49.27  ? 1082 THR A CA  1 
ATOM 8345 C C   . THR A 1 1085 ? 33.270  34.929 23.403  1.00 49.27  ? 1082 THR A C   1 
ATOM 8346 O O   . THR A 1 1085 ? 34.409  35.003 22.939  1.00 49.27  ? 1082 THR A O   1 
ATOM 8347 C CB  . THR A 1 1085 ? 33.664  36.848 24.968  1.00 46.09  ? 1082 THR A CB  1 
ATOM 8348 O OG1 . THR A 1 1085 ? 33.455  37.373 26.296  1.00 46.09  ? 1082 THR A OG1 1 
ATOM 8349 C CG2 . THR A 1 1085 ? 33.086  37.769 23.915  1.00 46.09  ? 1082 THR A CG2 1 
ATOM 8350 N N   . GLU A 1 1086 ? 32.224  34.412 22.746  1.00 52.03  ? 1083 GLU A N   1 
ATOM 8351 C CA  . GLU A 1 1086 ? 32.229  34.138 21.312  1.00 52.03  ? 1083 GLU A CA  1 
ATOM 8352 C C   . GLU A 1 1086 ? 31.556  35.261 20.497  1.00 52.03  ? 1083 GLU A C   1 
ATOM 8353 O O   . GLU A 1 1086 ? 30.828  36.080 21.031  1.00 52.03  ? 1083 GLU A O   1 
ATOM 8354 C CB  . GLU A 1 1086 ? 31.519  32.818 21.029  1.00 90.58  ? 1083 GLU A CB  1 
ATOM 8355 C CG  . GLU A 1 1086 ? 31.864  31.695 21.983  1.00 90.58  ? 1083 GLU A CG  1 
ATOM 8356 C CD  . GLU A 1 1086 ? 33.371  31.489 22.199  1.00 90.58  ? 1083 GLU A CD  1 
ATOM 8357 O OE1 . GLU A 1 1086 ? 33.736  30.792 23.179  1.00 90.58  ? 1083 GLU A OE1 1 
ATOM 8358 O OE2 . GLU A 1 1086 ? 34.194  32.002 21.397  1.00 90.58  ? 1083 GLU A OE2 1 
ATOM 8359 N N   . PRO A 1 1087 ? 31.793  35.316 19.179  1.00 52.47  ? 1084 PRO A N   1 
ATOM 8360 C CA  . PRO A 1 1087 ? 31.019  36.334 18.493  1.00 52.47  ? 1084 PRO A CA  1 
ATOM 8361 C C   . PRO A 1 1087 ? 29.681  35.759 18.111  1.00 52.47  ? 1084 PRO A C   1 
ATOM 8362 O O   . PRO A 1 1087 ? 29.449  34.562 18.314  1.00 52.47  ? 1084 PRO A O   1 
ATOM 8363 C CB  . PRO A 1 1087 ? 31.850  36.616 17.232  1.00 41.21  ? 1084 PRO A CB  1 
ATOM 8364 C CG  . PRO A 1 1087 ? 33.077  35.686 17.326  1.00 41.21  ? 1084 PRO A CG  1 
ATOM 8365 C CD  . PRO A 1 1087 ? 32.673  34.601 18.234  1.00 41.21  ? 1084 PRO A CD  1 
ATOM 8366 N N   . ALA A 1 1088 ? 28.810  36.610 17.573  1.00 46.93  ? 1085 ALA A N   1 
ATOM 8367 C CA  . ALA A 1 1088 ? 27.432  36.223 17.240  1.00 46.93  ? 1085 ALA A CA  1 
ATOM 8368 C C   . ALA A 1 1088 ? 27.409  35.369 16.003  1.00 46.93  ? 1085 ALA A C   1 
ATOM 8369 O O   . ALA A 1 1088 ? 28.013  35.726 15.001  1.00 46.93  ? 1085 ALA A O   1 
ATOM 8370 C CB  . ALA A 1 1088 ? 26.585  37.452 17.002  1.00 16.22  ? 1085 ALA A CB  1 
ATOM 8371 N N   . THR A 1 1089 ? 26.727  34.238 16.059  1.00 34.52  ? 1086 THR A N   1 
ATOM 8372 C CA  . THR A 1 1089 ? 26.386  33.581 14.820  1.00 34.52  ? 1086 THR A CA  1 
ATOM 8373 C C   . THR A 1 1089 ? 24.894  33.378 14.805  1.00 34.52  ? 1086 THR A C   1 
ATOM 8374 O O   . THR A 1 1089 ? 24.269  33.300 15.852  1.00 34.52  ? 1086 THR A O   1 
ATOM 8375 C CB  . THR A 1 1089 ? 27.075  32.247 14.675  1.00 51.24  ? 1086 THR A CB  1 
ATOM 8376 O OG1 . THR A 1 1089 ? 26.417  31.273 15.498  1.00 51.24  ? 1086 THR A OG1 1 
ATOM 8377 C CG2 . THR A 1 1089 ? 28.508  32.374 15.102  1.00 51.24  ? 1086 THR A CG2 1 
ATOM 8378 N N   . GLY A 1 1090 ? 24.330  33.293 13.608  1.00 51.35  ? 1087 GLY A N   1 
ATOM 8379 C CA  . GLY A 1 1090 ? 22.936  32.857 13.426  1.00 51.35  ? 1087 GLY A CA  1 
ATOM 8380 C C   . GLY A 1 1090 ? 21.892  33.887 13.781  1.00 51.35  ? 1087 GLY A C   1 
ATOM 8381 O O   . GLY A 1 1090 ? 20.702  33.609 13.747  1.00 51.35  ? 1087 GLY A O   1 
ATOM 8382 N N   . PHE A 1 1091 ? 22.360  35.076 14.125  1.00 49.92  ? 1088 PHE A N   1 
ATOM 8383 C CA  . PHE A 1 1091 ? 21.479  36.173 14.439  1.00 49.92  ? 1088 PHE A CA  1 
ATOM 8384 C C   . PHE A 1 1091 ? 21.741  37.425 13.618  1.00 49.92  ? 1088 PHE A C   1 
ATOM 8385 O O   . PHE A 1 1091 ? 22.832  37.620 13.103  1.00 49.92  ? 1088 PHE A O   1 
ATOM 8386 C CB  . PHE A 1 1091 ? 21.520  36.445 15.945  1.00 49.60  ? 1088 PHE A CB  1 
ATOM 8387 C CG  . PHE A 1 1091 ? 20.590  35.556 16.723  1.00 49.60  ? 1088 PHE A CG  1 
ATOM 8388 C CD1 . PHE A 1 1091 ? 21.062  34.434 17.379  1.00 49.60  ? 1088 PHE A CD1 1 
ATOM 8389 C CD2 . PHE A 1 1091 ? 19.221  35.809 16.741  1.00 49.60  ? 1088 PHE A CD2 1 
ATOM 8390 C CE1 . PHE A 1 1091 ? 20.189  33.605 18.073  1.00 49.60  ? 1088 PHE A CE1 1 
ATOM 8391 C CE2 . PHE A 1 1091 ? 18.367  34.985 17.420  1.00 49.60  ? 1088 PHE A CE2 1 
ATOM 8392 C CZ  . PHE A 1 1091 ? 18.848  33.891 18.090  1.00 49.60  ? 1088 PHE A CZ  1 
ATOM 8393 N N   . ILE A 1 1092 ? 20.736  38.277 13.508  1.00 61.56  ? 1089 ILE A N   1 
ATOM 8394 C CA  . ILE A 1 1092 ? 20.821  39.449 12.654  1.00 61.56  ? 1089 ILE A CA  1 
ATOM 8395 C C   . ILE A 1 1092 ? 20.093  40.644 13.302  1.00 61.56  ? 1089 ILE A C   1 
ATOM 8396 O O   . ILE A 1 1092 ? 18.879  40.526 13.549  1.00 61.56  ? 1089 ILE A O   1 
ATOM 8397 C CB  . ILE A 1 1092 ? 20.163  39.107 11.296  1.00 69.75  ? 1089 ILE A CB  1 
ATOM 8398 C CG1 . ILE A 1 1092 ? 20.914  37.950 10.632  1.00 69.75  ? 1089 ILE A CG1 1 
ATOM 8399 C CG2 . ILE A 1 1092 ? 20.057  40.330 10.390  1.00 69.75  ? 1089 ILE A CG2 1 
ATOM 8400 C CD1 . ILE A 1 1092 ? 20.632  37.781 9.147   1.00 69.75  ? 1089 ILE A CD1 1 
ATOM 8401 N N   . ASP A 1 1093 ? 20.741  41.784 13.596  1.00 41.32  ? 1090 ASP A N   1 
ATOM 8402 C CA  . ASP A 1 1093 ? 19.813  42.884 13.880  1.00 41.32  ? 1090 ASP A CA  1 
ATOM 8403 C C   . ASP A 1 1093 ? 19.389  43.592 12.663  1.00 41.32  ? 1090 ASP A C   1 
ATOM 8404 O O   . ASP A 1 1093 ? 20.160  44.308 12.030  1.00 41.32  ? 1090 ASP A O   1 
ATOM 8405 C CB  . ASP A 1 1093 ? 20.053  43.833 15.098  1.00 44.54  ? 1090 ASP A CB  1 
ATOM 8406 C CG  . ASP A 1 1093 ? 21.427  44.203 15.244  1.00 44.54  ? 1090 ASP A CG  1 
ATOM 8407 O OD1 . ASP A 1 1093 ? 21.759  44.996 16.134  1.00 44.54  ? 1090 ASP A OD1 1 
ATOM 8408 O OD2 . ASP A 1 1093 ? 22.170  43.642 14.450  1.00 44.54  ? 1090 ASP A OD2 1 
ATOM 8409 N N   . GLY A 1 1094 ? 18.138  43.316 12.329  1.00 47.15  ? 1091 GLY A N   1 
ATOM 8410 C CA  . GLY A 1 1094 ? 17.371  44.183 11.469  1.00 47.15  ? 1091 GLY A CA  1 
ATOM 8411 C C   . GLY A 1 1094 ? 17.423  45.593 12.009  1.00 47.15  ? 1091 GLY A C   1 
ATOM 8412 O O   . GLY A 1 1094 ? 17.284  46.527 11.258  1.00 47.15  ? 1091 GLY A O   1 
ATOM 8413 N N   . ASP A 1 1095 ? 17.641  45.738 13.311  1.00 48.02  ? 1092 ASP A N   1 
ATOM 8414 C CA  . ASP A 1 1095 ? 17.840  47.032 13.913  1.00 48.02  ? 1092 ASP A CA  1 
ATOM 8415 C C   . ASP A 1 1095 ? 18.944  47.727 13.177  1.00 48.02  ? 1092 ASP A C   1 
ATOM 8416 O O   . ASP A 1 1095 ? 18.890  48.934 12.998  1.00 48.02  ? 1092 ASP A O   1 
ATOM 8417 C CB  . ASP A 1 1095 ? 18.290  46.860 15.359  1.00 40.77  ? 1092 ASP A CB  1 
ATOM 8418 C CG  . ASP A 1 1095 ? 17.144  46.995 16.369  1.00 40.77  ? 1092 ASP A CG  1 
ATOM 8419 O OD1 . ASP A 1 1095 ? 15.979  46.684 15.971  1.00 40.77  ? 1092 ASP A OD1 1 
ATOM 8420 O OD2 . ASP A 1 1095 ? 17.439  47.393 17.548  1.00 40.77  ? 1092 ASP A OD2 1 
ATOM 8421 N N   . LEU A 1 1096 ? 19.955  46.945 12.788  1.00 65.90  ? 1093 LEU A N   1 
ATOM 8422 C CA  . LEU A 1 1096 ? 21.146  47.427 12.099  1.00 65.90  ? 1093 LEU A CA  1 
ATOM 8423 C C   . LEU A 1 1096 ? 20.903  47.390 10.622  1.00 65.90  ? 1093 LEU A C   1 
ATOM 8424 O O   . LEU A 1 1096 ? 21.282  48.311 9.902   1.00 65.90  ? 1093 LEU A O   1 
ATOM 8425 C CB  . LEU A 1 1096 ? 22.367  46.564 12.430  1.00 38.75  ? 1093 LEU A CB  1 
ATOM 8426 C CG  . LEU A 1 1096 ? 23.778  46.828 11.866  1.00 38.75  ? 1093 LEU A CG  1 
ATOM 8427 C CD1 . LEU A 1 1096 ? 24.072  45.919 10.709  1.00 38.75  ? 1093 LEU A CD1 1 
ATOM 8428 C CD2 . LEU A 1 1096 ? 24.028  48.279 11.466  1.00 38.75  ? 1093 LEU A CD2 1 
ATOM 8429 N N   . ILE A 1 1097 ? 20.301  46.309 10.151  1.00 47.94  ? 1094 ILE A N   1 
ATOM 8430 C CA  . ILE A 1 1097 ? 19.859  46.302 8.772   1.00 47.94  ? 1094 ILE A CA  1 
ATOM 8431 C C   . ILE A 1 1097 ? 19.027  47.553 8.523   1.00 47.94  ? 1094 ILE A C   1 
ATOM 8432 O O   . ILE A 1 1097 ? 19.405  48.362 7.707   1.00 47.94  ? 1094 ILE A O   1 
ATOM 8433 C CB  . ILE A 1 1097 ? 19.061  45.069 8.442   1.00 39.01  ? 1094 ILE A CB  1 
ATOM 8434 C CG1 . ILE A 1 1097 ? 19.895  43.840 8.771   1.00 39.01  ? 1094 ILE A CG1 1 
ATOM 8435 C CG2 . ILE A 1 1097 ? 18.677  45.078 6.972   1.00 39.01  ? 1094 ILE A CG2 1 
ATOM 8436 C CD1 . ILE A 1 1097 ? 20.925  43.501 7.703   1.00 39.01  ? 1094 ILE A CD1 1 
ATOM 8437 N N   . GLU A 1 1098 ? 17.941  47.737 9.267   1.00 79.31  ? 1095 GLU A N   1 
ATOM 8438 C CA  . GLU A 1 1098 ? 17.099  48.931 9.153   1.00 79.31  ? 1095 GLU A CA  1 
ATOM 8439 C C   . GLU A 1 1098 ? 17.877  50.236 9.175   1.00 79.31  ? 1095 GLU A C   1 
ATOM 8440 O O   . GLU A 1 1098 ? 17.393  51.246 8.674   1.00 79.31  ? 1095 GLU A O   1 
ATOM 8441 C CB  . GLU A 1 1098 ? 16.024  48.954 10.254  1.00 66.35  ? 1095 GLU A CB  1 
ATOM 8442 C CG  . GLU A 1 1098 ? 14.868  47.908 10.052  1.00 66.35  ? 1095 GLU A CG  1 
ATOM 8443 C CD  . GLU A 1 1098 ? 13.786  47.951 11.148  1.00 66.35  ? 1095 GLU A CD  1 
ATOM 8444 O OE1 . GLU A 1 1098 ? 13.777  48.917 11.967  1.00 66.35  ? 1095 GLU A OE1 1 
ATOM 8445 O OE2 . GLU A 1 1098 ? 12.943  47.006 11.176  1.00 66.35  ? 1095 GLU A OE2 1 
ATOM 8446 N N   . SER A 1 1099 ? 19.076  50.221 9.750   1.00 64.71  ? 1096 SER A N   1 
ATOM 8447 C CA  . SER A 1 1099 ? 19.938  51.403 9.725   1.00 64.71  ? 1096 SER A CA  1 
ATOM 8448 C C   . SER A 1 1099 ? 20.154  51.893 8.285   1.00 64.71  ? 1096 SER A C   1 
ATOM 8449 O O   . SER A 1 1099 ? 20.071  53.091 8.019   1.00 64.71  ? 1096 SER A O   1 
ATOM 8450 C CB  . SER A 1 1099 ? 21.279  51.129 10.406  1.00 151.22 ? 1096 SER A CB  1 
ATOM 8451 O OG  . SER A 1 1099 ? 21.100  50.562 11.691  1.00 151.22 ? 1096 SER A OG  1 
ATOM 8452 N N   . PHE A 1 1100 ? 20.426  50.961 7.374   1.00 72.19  ? 1097 PHE A N   1 
ATOM 8453 C CA  . PHE A 1 1100 ? 20.531  51.229 5.946   1.00 72.19  ? 1097 PHE A CA  1 
ATOM 8454 C C   . PHE A 1 1100 ? 19.697  52.434 5.472   1.00 72.19  ? 1097 PHE A C   1 
ATOM 8455 O O   . PHE A 1 1100 ? 20.248  53.404 4.975   1.00 72.19  ? 1097 PHE A O   1 
ATOM 8456 C CB  . PHE A 1 1100 ? 20.110  49.982 5.209   1.00 82.58  ? 1097 PHE A CB  1 
ATOM 8457 C CG  . PHE A 1 1100 ? 20.509  49.934 3.771   1.00 82.58  ? 1097 PHE A CG  1 
ATOM 8458 C CD1 . PHE A 1 1100 ? 21.713  49.362 3.396   1.00 82.58  ? 1097 PHE A CD1 1 
ATOM 8459 C CD2 . PHE A 1 1100 ? 19.635  50.359 2.782   1.00 82.58  ? 1097 PHE A CD2 1 
ATOM 8460 C CE1 . PHE A 1 1100 ? 22.056  49.261 2.061   1.00 82.58  ? 1097 PHE A CE1 1 
ATOM 8461 C CE2 . PHE A 1 1100 ? 19.971  50.256 1.445   1.00 82.58  ? 1097 PHE A CE2 1 
ATOM 8462 C CZ  . PHE A 1 1100 ? 21.174  49.711 1.081   1.00 82.58  ? 1097 PHE A CZ  1 
ATOM 8463 N N   . LEU A 1 1101 ? 18.382  52.400 5.655   1.00 52.84  ? 1098 LEU A N   1 
ATOM 8464 C CA  . LEU A 1 1101 ? 17.493  53.468 5.172   1.00 52.84  ? 1098 LEU A CA  1 
ATOM 8465 C C   . LEU A 1 1101 ? 17.901  54.848 5.602   1.00 52.84  ? 1098 LEU A C   1 
ATOM 8466 O O   . LEU A 1 1101 ? 17.553  55.829 4.938   1.00 52.84  ? 1098 LEU A O   1 
ATOM 8467 C CB  . LEU A 1 1101 ? 16.068  53.268 5.679   1.00 52.59  ? 1098 LEU A CB  1 
ATOM 8468 C CG  . LEU A 1 1101 ? 15.400  51.923 5.405   1.00 52.59  ? 1098 LEU A CG  1 
ATOM 8469 C CD1 . LEU A 1 1101 ? 14.196  51.799 6.307   1.00 52.59  ? 1098 LEU A CD1 1 
ATOM 8470 C CD2 . LEU A 1 1101 ? 15.022  51.779 3.924   1.00 52.59  ? 1098 LEU A CD2 1 
ATOM 8471 N N   . ASP A 1 1102 ? 18.597  54.944 6.728   1.00 71.96  ? 1099 ASP A N   1 
ATOM 8472 C CA  . ASP A 1 1102 ? 18.936  56.245 7.289   1.00 71.96  ? 1099 ASP A CA  1 
ATOM 8473 C C   . ASP A 1 1102 ? 20.333  56.647 6.822   1.00 71.96  ? 1099 ASP A C   1 
ATOM 8474 O O   . ASP A 1 1102 ? 21.003  57.518 7.400   1.00 71.96  ? 1099 ASP A O   1 
ATOM 8475 C CB  . ASP A 1 1102 ? 18.800  56.214 8.815   1.00 108.24 ? 1099 ASP A CB  1 
ATOM 8476 C CG  . ASP A 1 1102 ? 17.433  55.698 9.271   1.00 108.24 ? 1099 ASP A CG  1 
ATOM 8477 O OD1 . ASP A 1 1102 ? 16.398  56.255 8.824   1.00 108.24 ? 1099 ASP A OD1 1 
ATOM 8478 O OD2 . ASP A 1 1102 ? 17.399  54.728 10.072  1.00 108.24 ? 1099 ASP A OD2 1 
ATOM 8479 N N   . ILE A 1 1103 ? 20.755  56.003 5.744   1.00 94.63  ? 1100 ILE A N   1 
ATOM 8480 C CA  . ILE A 1 1103 ? 22.011  56.307 5.110   1.00 94.63  ? 1100 ILE A CA  1 
ATOM 8481 C C   . ILE A 1 1103 ? 21.777  57.037 3.783   1.00 94.63  ? 1100 ILE A C   1 
ATOM 8482 O O   . ILE A 1 1103 ? 20.882  56.695 2.998   1.00 94.63  ? 1100 ILE A O   1 
ATOM 8483 C CB  . ILE A 1 1103 ? 22.824  55.025 4.970   1.00 100.14 ? 1100 ILE A CB  1 
ATOM 8484 C CG1 . ILE A 1 1103 ? 23.796  54.935 6.128   1.00 100.14 ? 1100 ILE A CG1 1 
ATOM 8485 C CG2 . ILE A 1 1103 ? 23.574  54.979 3.688   1.00 100.14 ? 1100 ILE A CG2 1 
ATOM 8486 C CD1 . ILE A 1 1103 ? 24.217  53.549 6.405   1.00 100.14 ? 1100 ILE A CD1 1 
ATOM 8487 N N   . SER A 1 1104 ? 22.571  58.075 3.567   1.00 118.54 ? 1101 SER A N   1 
ATOM 8488 C CA  . SER A 1 1104 ? 22.561  58.825 2.322   1.00 118.54 ? 1101 SER A CA  1 
ATOM 8489 C C   . SER A 1 1104 ? 22.885  57.903 1.142   1.00 118.54 ? 1101 SER A C   1 
ATOM 8490 O O   . SER A 1 1104 ? 23.662  56.965 1.292   1.00 118.54 ? 1101 SER A O   1 
ATOM 8491 C CB  . SER A 1 1104 ? 23.621  59.904 2.421   1.00 56.25  ? 1101 SER A CB  1 
ATOM 8492 O OG  . SER A 1 1104 ? 24.871  59.269 2.627   1.00 56.25  ? 1101 SER A OG  1 
ATOM 8493 N N   . ARG A 1 1105 ? 22.317  58.186 -0.031  1.00 180.60 ? 1102 ARG A N   1 
ATOM 8494 C CA  . ARG A 1 1105 ? 22.492  57.316 -1.210  1.00 180.60 ? 1102 ARG A CA  1 
ATOM 8495 C C   . ARG A 1 1105 ? 23.953  56.955 -1.609  1.00 180.60 ? 1102 ARG A C   1 
ATOM 8496 O O   . ARG A 1 1105 ? 24.205  55.833 -2.036  1.00 180.60 ? 1102 ARG A O   1 
ATOM 8497 C CB  . ARG A 1 1105 ? 21.657  57.803 -2.410  1.00 131.35 ? 1102 ARG A CB  1 
ATOM 8498 C CG  . ARG A 1 1105 ? 21.734  56.883 -3.623  1.00 131.35 ? 1102 ARG A CG  1 
ATOM 8499 C CD  . ARG A 1 1105 ? 20.474  56.888 -4.458  1.00 131.35 ? 1102 ARG A CD  1 
ATOM 8500 N NE  . ARG A 1 1105 ? 20.658  56.048 -5.647  1.00 131.35 ? 1102 ARG A NE  1 
ATOM 8501 C CZ  . ARG A 1 1105 ? 19.695  55.337 -6.238  1.00 131.35 ? 1102 ARG A CZ  1 
ATOM 8502 N NH1 . ARG A 1 1105 ? 18.451  55.340 -5.764  1.00 131.35 ? 1102 ARG A NH1 1 
ATOM 8503 N NH2 . ARG A 1 1105 ? 19.980  54.609 -7.310  1.00 131.35 ? 1102 ARG A NH2 1 
ATOM 8504 N N   . PRO A 1 1106 ? 24.904  57.905 -1.489  1.00 100.43 ? 1103 PRO A N   1 
ATOM 8505 C CA  . PRO A 1 1106 ? 26.365  57.627 -1.634  1.00 100.43 ? 1103 PRO A CA  1 
ATOM 8506 C C   . PRO A 1 1106 ? 26.941  56.538 -0.701  1.00 100.43 ? 1103 PRO A C   1 
ATOM 8507 O O   . PRO A 1 1106 ? 27.431  55.503 -1.172  1.00 100.43 ? 1103 PRO A O   1 
ATOM 8508 C CB  . PRO A 1 1106 ? 27.018  58.975 -1.291  1.00 87.49  ? 1103 PRO A CB  1 
ATOM 8509 C CG  . PRO A 1 1106 ? 25.903  59.801 -0.607  1.00 87.49  ? 1103 PRO A CG  1 
ATOM 8510 C CD  . PRO A 1 1106 ? 24.645  59.341 -1.263  1.00 87.49  ? 1103 PRO A CD  1 
ATOM 8511 N N   . LYS A 1 1107 ? 26.899  56.812 0.606   1.00 99.95  ? 1104 LYS A N   1 
ATOM 8512 C CA  . LYS A 1 1107 ? 27.223  55.862 1.672   1.00 99.95  ? 1104 LYS A CA  1 
ATOM 8513 C C   . LYS A 1 1107 ? 26.453  54.554 1.506   1.00 99.95  ? 1104 LYS A C   1 
ATOM 8514 O O   . LYS A 1 1107 ? 26.812  53.533 2.066   1.00 99.95  ? 1104 LYS A O   1 
ATOM 8515 C CB  . LYS A 1 1107 ? 26.902  56.495 3.031   1.00 174.49 ? 1104 LYS A CB  1 
ATOM 8516 C CG  . LYS A 1 1107 ? 27.914  57.529 3.517   1.00 174.49 ? 1104 LYS A CG  1 
ATOM 8517 C CD  . LYS A 1 1107 ? 29.115  56.843 4.166   1.00 174.49 ? 1104 LYS A CD  1 
ATOM 8518 C CE  . LYS A 1 1107 ? 30.042  57.815 4.867   1.00 174.49 ? 1104 LYS A CE  1 
ATOM 8519 N NZ  . LYS A 1 1107 ? 30.941  58.524 3.915   1.00 174.49 ? 1104 LYS A NZ  1 
ATOM 8520 N N   . MET A 1 1108 ? 25.399  54.608 0.707   1.00 66.16  ? 1105 MET A N   1 
ATOM 8521 C CA  . MET A 1 1108 ? 24.498  53.505 0.488   1.00 66.16  ? 1105 MET A CA  1 
ATOM 8522 C C   . MET A 1 1108 ? 25.015  52.715 -0.688  1.00 66.16  ? 1105 MET A C   1 
ATOM 8523 O O   . MET A 1 1108 ? 25.099  51.481 -0.627  1.00 66.16  ? 1105 MET A O   1 
ATOM 8524 C CB  . MET A 1 1108 ? 23.104  54.056 0.186   1.00 78.86  ? 1105 MET A CB  1 
ATOM 8525 C CG  . MET A 1 1108 ? 21.963  53.054 0.227   1.00 78.86  ? 1105 MET A CG  1 
ATOM 8526 S SD  . MET A 1 1108 ? 20.335  53.733 -0.199  1.00 78.86  ? 1105 MET A SD  1 
ATOM 8527 C CE  . MET A 1 1108 ? 20.215  55.176 0.882   1.00 78.86  ? 1105 MET A CE  1 
ATOM 8528 N N   . GLN A 1 1109 ? 25.359  53.437 -1.766  1.00 93.22  ? 1106 GLN A N   1 
ATOM 8529 C CA  . GLN A 1 1109 ? 26.021  52.869 -2.953  1.00 93.22  ? 1106 GLN A CA  1 
ATOM 8530 C C   . GLN A 1 1109 ? 27.157  51.990 -2.486  1.00 93.22  ? 1106 GLN A C   1 
ATOM 8531 O O   . GLN A 1 1109 ? 27.097  50.773 -2.639  1.00 93.22  ? 1106 GLN A O   1 
ATOM 8532 C CB  . GLN A 1 1109 ? 26.567  53.976 -3.865  1.00 90.41  ? 1106 GLN A CB  1 
ATOM 8533 C CG  . GLN A 1 1109 ? 25.529  54.672 -4.753  1.00 90.41  ? 1106 GLN A CG  1 
ATOM 8534 C CD  . GLN A 1 1109 ? 24.784  53.713 -5.683  1.00 90.41  ? 1106 GLN A CD  1 
ATOM 8535 O OE1 . GLN A 1 1109 ? 25.339  52.707 -6.156  1.00 90.41  ? 1106 GLN A OE1 1 
ATOM 8536 N NE2 . GLN A 1 1109 ? 23.517  54.028 -5.950  1.00 90.41  ? 1106 GLN A NE2 1 
ATOM 8537 N N   . GLU A 1 1110 ? 28.160  52.637 -1.883  1.00 79.93  ? 1107 GLU A N   1 
ATOM 8538 C CA  . GLU A 1 1110 ? 29.298  51.991 -1.215  1.00 79.93  ? 1107 GLU A CA  1 
ATOM 8539 C C   . GLU A 1 1110 ? 29.028  50.575 -0.748  1.00 79.93  ? 1107 GLU A C   1 
ATOM 8540 O O   . GLU A 1 1110 ? 29.820  49.664 -1.018  1.00 79.93  ? 1107 GLU A O   1 
ATOM 8541 C CB  . GLU A 1 1110 ? 29.720  52.794 0.007   1.00 80.12  ? 1107 GLU A CB  1 
ATOM 8542 C CG  . GLU A 1 1110 ? 30.206  54.200 -0.267  1.00 80.12  ? 1107 GLU A CG  1 
ATOM 8543 C CD  . GLU A 1 1110 ? 31.020  54.734 0.901   1.00 80.12  ? 1107 GLU A CD  1 
ATOM 8544 O OE1 . GLU A 1 1110 ? 31.825  53.938 1.458   1.00 80.12  ? 1107 GLU A OE1 1 
ATOM 8545 O OE2 . GLU A 1 1110 ? 30.844  55.926 1.266   1.00 80.12  ? 1107 GLU A OE2 1 
ATOM 8546 N N   . VAL A 1 1111 ? 27.908  50.418 -0.045  1.00 106.91 ? 1108 VAL A N   1 
ATOM 8547 C CA  . VAL A 1 1111 ? 27.478  49.154 0.535   1.00 106.91 ? 1108 VAL A CA  1 
ATOM 8548 C C   . VAL A 1 1111 ? 27.377  48.061 -0.538  1.00 106.91 ? 1108 VAL A C   1 
ATOM 8549 O O   . VAL A 1 1111 ? 27.307  46.866 -0.242  1.00 106.91 ? 1108 VAL A O   1 
ATOM 8550 C CB  . VAL A 1 1111 ? 26.146  49.349 1.296   1.00 95.45  ? 1108 VAL A CB  1 
ATOM 8551 C CG1 . VAL A 1 1111 ? 25.721  48.082 2.011   1.00 95.45  ? 1108 VAL A CG1 1 
ATOM 8552 C CG2 . VAL A 1 1111 ? 26.281  50.470 2.303   1.00 95.45  ? 1108 VAL A CG2 1 
ATOM 8553 N N   . VAL A 1 1112 ? 27.393  48.485 -1.796  1.00 122.50 ? 1109 VAL A N   1 
ATOM 8554 C CA  . VAL A 1 1112 ? 27.531  47.543 -2.897  1.00 122.50 ? 1109 VAL A CA  1 
ATOM 8555 C C   . VAL A 1 1112 ? 28.794  47.738 -3.747  1.00 122.50 ? 1109 VAL A C   1 
ATOM 8556 O O   . VAL A 1 1112 ? 29.417  48.796 -3.764  1.00 122.50 ? 1109 VAL A O   1 
ATOM 8557 C CB  . VAL A 1 1112 ? 26.304  47.501 -3.802  1.00 53.76  ? 1109 VAL A CB  1 
ATOM 8558 C CG1 . VAL A 1 1112 ? 26.217  46.082 -4.461  1.00 53.76  ? 1109 VAL A CG1 1 
ATOM 8559 C CG2 . VAL A 1 1112 ? 25.023  47.857 -3.012  1.00 53.76  ? 1109 VAL A CG2 1 
ATOM 8560 N N   . ALA A 1 1113 ? 29.131  46.677 -4.456  1.00 148.27 ? 1110 ALA A N   1 
ATOM 8561 C CA  . ALA A 1 1113 ? 30.352  46.527 -5.193  1.00 148.27 ? 1110 ALA A CA  1 
ATOM 8562 C C   . ALA A 1 1113 ? 30.111  45.132 -5.693  1.00 148.27 ? 1110 ALA A C   1 
ATOM 8563 O O   . ALA A 1 1113 ? 30.721  44.680 -6.659  1.00 148.27 ? 1110 ALA A O   1 
ATOM 8564 C CB  . ALA A 1 1113 ? 31.524  46.551 -4.259  1.00 47.76  ? 1110 ALA A CB  1 
ATOM 8565 N N   . ASN A 1 1114 ? 29.208  44.463 -4.972  1.00 83.22  ? 1111 ASN A N   1 
ATOM 8566 C CA  . ASN A 1 1114 ? 28.582  43.176 -5.337  1.00 83.22  ? 1111 ASN A CA  1 
ATOM 8567 C C   . ASN A 1 1114 ? 27.471  42.779 -4.341  1.00 83.22  ? 1111 ASN A C   1 
ATOM 8568 O O   . ASN A 1 1114 ? 27.051  41.619 -4.265  1.00 83.22  ? 1111 ASN A O   1 
ATOM 8569 C CB  . ASN A 1 1114 ? 29.612  42.044 -5.513  1.00 117.74 ? 1111 ASN A CB  1 
ATOM 8570 C CG  . ASN A 1 1114 ? 30.693  42.036 -4.431  1.00 117.74 ? 1111 ASN A CG  1 
ATOM 8571 O OD1 . ASN A 1 1114 ? 31.080  43.085 -3.894  1.00 117.74 ? 1111 ASN A OD1 1 
ATOM 8572 N ND2 . ASN A 1 1114 ? 31.202  40.844 -4.125  1.00 117.74 ? 1111 ASN A ND2 1 
ATOM 8573 N N   . ARG A 1 1125 ? 22.115  34.945 -9.825  1.00 91.47  ? 1122 ARG A N   1 
ATOM 8574 C CA  . ARG A 1 1125 ? 22.678  35.837 -8.802  1.00 91.47  ? 1122 ARG A CA  1 
ATOM 8575 C C   . ARG A 1 1125 ? 23.146  37.209 -9.329  1.00 91.47  ? 1122 ARG A C   1 
ATOM 8576 O O   . ARG A 1 1125 ? 23.830  37.293 -10.359 1.00 91.47  ? 1122 ARG A O   1 
ATOM 8577 C CB  . ARG A 1 1125 ? 23.799  35.134 -8.030  1.00 129.10 ? 1122 ARG A CB  1 
ATOM 8578 C CG  . ARG A 1 1125 ? 25.116  35.038 -8.764  1.00 129.10 ? 1122 ARG A CG  1 
ATOM 8579 C CD  . ARG A 1 1125 ? 26.209  34.757 -7.771  1.00 129.10 ? 1122 ARG A CD  1 
ATOM 8580 N NE  . ARG A 1 1125 ? 27.556  34.990 -8.296  1.00 129.10 ? 1122 ARG A NE  1 
ATOM 8581 C CZ  . ARG A 1 1125 ? 28.238  36.128 -8.167  1.00 129.10 ? 1122 ARG A CZ  1 
ATOM 8582 N NH1 . ARG A 1 1125 ? 27.707  37.178 -7.549  1.00 129.10 ? 1122 ARG A NH1 1 
ATOM 8583 N NH2 . ARG A 1 1125 ? 29.459  36.216 -8.668  1.00 129.10 ? 1122 ARG A NH2 1 
ATOM 8584 N N   . GLU A 1 1126 ? 22.778  38.268 -8.590  1.00 156.00 ? 1123 GLU A N   1 
ATOM 8585 C CA  . GLU A 1 1126 ? 23.033  39.669 -8.976  1.00 156.00 ? 1123 GLU A CA  1 
ATOM 8586 C C   . GLU A 1 1126 ? 23.482  40.587 -7.822  1.00 156.00 ? 1123 GLU A C   1 
ATOM 8587 O O   . GLU A 1 1126 ? 23.586  40.162 -6.670  1.00 156.00 ? 1123 GLU A O   1 
ATOM 8588 C CB  . GLU A 1 1126 ? 21.791  40.260 -9.659  1.00 142.43 ? 1123 GLU A CB  1 
ATOM 8589 C CG  . GLU A 1 1126 ? 22.092  41.444 -10.591 1.00 142.43 ? 1123 GLU A CG  1 
ATOM 8590 C CD  . GLU A 1 1126 ? 20.856  41.940 -11.341 1.00 142.43 ? 1123 GLU A CD  1 
ATOM 8591 O OE1 . GLU A 1 1126 ? 19.726  41.803 -10.811 1.00 142.43 ? 1123 GLU A OE1 1 
ATOM 8592 O OE2 . GLU A 1 1126 ? 21.021  42.473 -12.471 1.00 142.43 ? 1123 GLU A OE2 1 
ATOM 8593 N N   . ALA A 1 1127 ? 23.740  41.849 -8.163  1.00 154.34 ? 1124 ALA A N   1 
ATOM 8594 C CA  . ALA A 1 1127 ? 24.197  42.867 -7.225  1.00 154.34 ? 1124 ALA A CA  1 
ATOM 8595 C C   . ALA A 1 1127 ? 23.737  44.249 -7.692  1.00 154.34 ? 1124 ALA A C   1 
ATOM 8596 O O   . ALA A 1 1127 ? 24.208  44.731 -8.727  1.00 154.34 ? 1124 ALA A O   1 
ATOM 8597 C CB  . ALA A 1 1127 ? 25.705  42.831 -7.135  1.00 118.17 ? 1124 ALA A CB  1 
ATOM 8598 N N   . THR A 1 1128 ? 22.829  44.881 -6.937  1.00 114.35 ? 1125 THR A N   1 
ATOM 8599 C CA  . THR A 1 1128 ? 22.278  46.207 -7.313  1.00 114.35 ? 1125 THR A CA  1 
ATOM 8600 C C   . THR A 1 1128 ? 22.636  47.324 -6.342  1.00 114.35 ? 1125 THR A C   1 
ATOM 8601 O O   . THR A 1 1128 ? 23.559  47.188 -5.557  1.00 114.35 ? 1125 THR A O   1 
ATOM 8602 C CB  . THR A 1 1128 ? 20.733  46.196 -7.494  1.00 67.30  ? 1125 THR A CB  1 
ATOM 8603 O OG1 . THR A 1 1128 ? 20.345  45.079 -8.310  1.00 67.30  ? 1125 THR A OG1 1 
ATOM 8604 C CG2 . THR A 1 1128 ? 20.240  47.510 -8.170  1.00 67.30  ? 1125 THR A CG2 1 
ATOM 8605 N N   . ALA A 1 1129 ? 21.879  48.419 -6.411  1.00 94.89  ? 1126 ALA A N   1 
ATOM 8606 C CA  . ALA A 1 1129 ? 22.139  49.649 -5.662  1.00 94.89  ? 1126 ALA A CA  1 
ATOM 8607 C C   . ALA A 1 1129 ? 20.900  50.082 -4.889  1.00 94.89  ? 1126 ALA A C   1 
ATOM 8608 O O   . ALA A 1 1129 ? 20.990  50.628 -3.784  1.00 94.89  ? 1126 ALA A O   1 
ATOM 8609 C CB  . ALA A 1 1129 ? 22.578  50.757 -6.618  1.00 123.40 ? 1126 ALA A CB  1 
ATOM 8610 N N   . ASP A 1 1130 ? 19.737  49.832 -5.483  1.00 90.33  ? 1127 ASP A N   1 
ATOM 8611 C CA  . ASP A 1 1130 ? 18.463  50.226 -4.877  1.00 90.33  ? 1127 ASP A CA  1 
ATOM 8612 C C   . ASP A 1 1130 ? 17.455  49.075 -4.810  1.00 90.33  ? 1127 ASP A C   1 
ATOM 8613 O O   . ASP A 1 1130 ? 16.277  49.278 -4.504  1.00 90.33  ? 1127 ASP A O   1 
ATOM 8614 C CB  . ASP A 1 1130 ? 17.865  51.477 -5.559  1.00 138.15 ? 1127 ASP A CB  1 
ATOM 8615 C CG  . ASP A 1 1130 ? 18.471  51.762 -6.943  1.00 138.15 ? 1127 ASP A CG  1 
ATOM 8616 O OD1 . ASP A 1 1130 ? 19.226  50.923 -7.501  1.00 138.15 ? 1127 ASP A OD1 1 
ATOM 8617 O OD2 . ASP A 1 1130 ? 18.186  52.859 -7.473  1.00 138.15 ? 1127 ASP A OD2 1 
ATOM 8618 N N   . ASP A 1 1131 ? 17.932  47.869 -5.099  1.00 125.97 ? 1128 ASP A N   1 
ATOM 8619 C CA  . ASP A 1 1131 ? 17.152  46.679 -4.824  1.00 125.97 ? 1128 ASP A CA  1 
ATOM 8620 C C   . ASP A 1 1131 ? 17.061  46.584 -3.312  1.00 125.97 ? 1128 ASP A C   1 
ATOM 8621 O O   . ASP A 1 1131 ? 15.978  46.497 -2.744  1.00 125.97 ? 1128 ASP A O   1 
ATOM 8622 C CB  . ASP A 1 1131 ? 17.821  45.416 -5.403  1.00 130.21 ? 1128 ASP A CB  1 
ATOM 8623 C CG  . ASP A 1 1131 ? 17.199  44.951 -6.727  1.00 130.21 ? 1128 ASP A CG  1 
ATOM 8624 O OD1 . ASP A 1 1131 ? 17.706  43.966 -7.308  1.00 130.21 ? 1128 ASP A OD1 1 
ATOM 8625 O OD2 . ASP A 1 1131 ? 16.205  45.550 -7.188  1.00 130.21 ? 1128 ASP A OD2 1 
ATOM 8626 N N   . LEU A 1 1132 ? 18.219  46.659 -2.673  1.00 63.60  ? 1129 LEU A N   1 
ATOM 8627 C CA  . LEU A 1 1132 ? 18.360  46.355 -1.250  1.00 63.60  ? 1129 LEU A CA  1 
ATOM 8628 C C   . LEU A 1 1132 ? 17.585  47.338 -0.388  1.00 63.60  ? 1129 LEU A C   1 
ATOM 8629 O O   . LEU A 1 1132 ? 16.869  46.944 0.533   1.00 63.60  ? 1129 LEU A O   1 
ATOM 8630 C CB  . LEU A 1 1132 ? 19.846  46.338 -0.876  1.00 73.03  ? 1129 LEU A CB  1 
ATOM 8631 C CG  . LEU A 1 1132 ? 20.562  45.048 -1.290  1.00 73.03  ? 1129 LEU A CG  1 
ATOM 8632 C CD1 . LEU A 1 1132 ? 20.147  43.982 -0.339  1.00 73.03  ? 1129 LEU A CD1 1 
ATOM 8633 C CD2 . LEU A 1 1132 ? 20.301  44.562 -2.739  1.00 73.03  ? 1129 LEU A CD2 1 
ATOM 8634 N N   . ILE A 1 1133 ? 17.719  48.616 -0.731  1.00 81.51  ? 1130 ILE A N   1 
ATOM 8635 C CA  . ILE A 1 1133 ? 16.913  49.685 -0.164  1.00 81.51  ? 1130 ILE A CA  1 
ATOM 8636 C C   . ILE A 1 1133 ? 15.389  49.435 -0.285  1.00 81.51  ? 1130 ILE A C   1 
ATOM 8637 O O   . ILE A 1 1133 ? 14.590  50.258 0.156   1.00 81.51  ? 1130 ILE A O   1 
ATOM 8638 C CB  . ILE A 1 1133 ? 17.314  51.048 -0.786  1.00 91.14  ? 1130 ILE A CB  1 
ATOM 8639 C CG1 . ILE A 1 1133 ? 16.746  52.210 0.033   1.00 91.14  ? 1130 ILE A CG1 1 
ATOM 8640 C CG2 . ILE A 1 1133 ? 16.863  51.133 -2.207  1.00 91.14  ? 1130 ILE A CG2 1 
ATOM 8641 C CD1 . ILE A 1 1133 ? 17.134  53.574 -0.477  1.00 91.14  ? 1130 ILE A CD1 1 
ATOM 8642 N N   . LYS A 1 1134 ? 15.010  48.296 -0.866  1.00 84.66  ? 1131 LYS A N   1 
ATOM 8643 C CA  . LYS A 1 1134 ? 13.619  47.874 -0.988  1.00 84.66  ? 1131 LYS A CA  1 
ATOM 8644 C C   . LYS A 1 1134 ? 13.454  46.441 -0.472  1.00 84.66  ? 1131 LYS A C   1 
ATOM 8645 O O   . LYS A 1 1134 ? 12.339  45.976 -0.242  1.00 84.66  ? 1131 LYS A O   1 
ATOM 8646 C CB  . LYS A 1 1134 ? 13.178  47.966 -2.449  1.00 144.11 ? 1131 LYS A CB  1 
ATOM 8647 C CG  . LYS A 1 1134 ? 11.782  47.428 -2.736  1.00 144.11 ? 1131 LYS A CG  1 
ATOM 8648 C CD  . LYS A 1 1134 ? 11.662  46.869 -4.148  1.00 144.11 ? 1131 LYS A CD  1 
ATOM 8649 C CE  . LYS A 1 1134 ? 11.282  47.946 -5.165  1.00 144.11 ? 1131 LYS A CE  1 
ATOM 8650 N NZ  . LYS A 1 1134 ? 12.362  48.941 -5.443  1.00 144.11 ? 1131 LYS A NZ  1 
ATOM 8651 N N   . VAL A 1 1135 ? 14.566  45.728 -0.319  1.00 75.20  ? 1132 VAL A N   1 
ATOM 8652 C CA  . VAL A 1 1135 ? 14.570  44.472 0.418   1.00 75.20  ? 1132 VAL A CA  1 
ATOM 8653 C C   . VAL A 1 1135 ? 14.409  44.824 1.906   1.00 75.20  ? 1132 VAL A C   1 
ATOM 8654 O O   . VAL A 1 1135 ? 13.701  44.130 2.635   1.00 75.20  ? 1132 VAL A O   1 
ATOM 8655 C CB  . VAL A 1 1135 ? 15.874  43.679 0.188   1.00 80.88  ? 1132 VAL A CB  1 
ATOM 8656 C CG1 . VAL A 1 1135 ? 15.800  42.315 0.839   1.00 80.88  ? 1132 VAL A CG1 1 
ATOM 8657 C CG2 . VAL A 1 1135 ? 16.151  43.512 -1.292  1.00 80.88  ? 1132 VAL A CG2 1 
ATOM 8658 N N   . VAL A 1 1136 ? 15.048  45.919 2.339   1.00 89.89  ? 1133 VAL A N   1 
ATOM 8659 C CA  . VAL A 1 1136 ? 14.953  46.410 3.727   1.00 89.89  ? 1133 VAL A CA  1 
ATOM 8660 C C   . VAL A 1 1136 ? 13.525  46.841 4.086   1.00 89.89  ? 1133 VAL A C   1 
ATOM 8661 O O   . VAL A 1 1136 ? 12.994  46.455 5.137   1.00 89.89  ? 1133 VAL A O   1 
ATOM 8662 C CB  . VAL A 1 1136 ? 15.967  47.551 4.016   1.00 54.90  ? 1133 VAL A CB  1 
ATOM 8663 C CG1 . VAL A 1 1136 ? 15.596  48.327 5.280   1.00 54.90  ? 1133 VAL A CG1 1 
ATOM 8664 C CG2 . VAL A 1 1136 ? 17.361  47.001 4.151   1.00 54.90  ? 1133 VAL A CG2 1 
ATOM 8665 N N   . GLU A 1 1137 ? 12.906  47.636 3.211   1.00 79.55  ? 1134 GLU A N   1 
ATOM 8666 C CA  . GLU A 1 1137 ? 11.501  48.035 3.376   1.00 79.55  ? 1134 GLU A CA  1 
ATOM 8667 C C   . GLU A 1 1137 ? 10.652  46.814 3.697   1.00 79.55  ? 1134 GLU A C   1 
ATOM 8668 O O   . GLU A 1 1137 ? 10.014  46.738 4.745   1.00 79.55  ? 1134 GLU A O   1 
ATOM 8669 C CB  . GLU A 1 1137 ? 10.965  48.669 2.084   1.00 100.43 ? 1134 GLU A CB  1 
ATOM 8670 C CG  . GLU A 1 1137 ? 11.574  50.014 1.682   1.00 100.43 ? 1134 GLU A CG  1 
ATOM 8671 C CD  . GLU A 1 1137 ? 11.030  50.534 0.341   1.00 100.43 ? 1134 GLU A CD  1 
ATOM 8672 O OE1 . GLU A 1 1137 ? 10.324  49.782 -0.382  1.00 100.43 ? 1134 GLU A OE1 1 
ATOM 8673 O OE2 . GLU A 1 1137 ? 11.319  51.702 0.005   1.00 100.43 ? 1134 GLU A OE2 1 
ATOM 8674 N N   . GLU A 1 1138 ? 10.692  45.848 2.782   1.00 98.51  ? 1135 GLU A N   1 
ATOM 8675 C CA  . GLU A 1 1138 ? 9.846   44.679 2.847   1.00 98.51  ? 1135 GLU A CA  1 
ATOM 8676 C C   . GLU A 1 1138 ? 10.083  43.912 4.127   1.00 98.51  ? 1135 GLU A C   1 
ATOM 8677 O O   . GLU A 1 1138 ? 9.406   42.926 4.372   1.00 98.51  ? 1135 GLU A O   1 
ATOM 8678 C CB  . GLU A 1 1138 ? 10.041  43.760 1.635   1.00 167.95 ? 1135 GLU A CB  1 
ATOM 8679 C CG  . GLU A 1 1138 ? 8.746   43.052 1.205   1.00 167.95 ? 1135 GLU A CG  1 
ATOM 8680 C CD  . GLU A 1 1138 ? 8.939   41.594 0.818   1.00 167.95 ? 1135 GLU A CD  1 
ATOM 8681 O OE1 . GLU A 1 1138 ? 8.091   40.769 1.214   1.00 167.95 ? 1135 GLU A OE1 1 
ATOM 8682 O OE2 . GLU A 1 1138 ? 9.926   41.269 0.124   1.00 167.95 ? 1135 GLU A OE2 1 
ATOM 8683 N N   . LEU A 1 1139 ? 11.036  44.354 4.943   1.00 78.18  ? 1136 LEU A N   1 
ATOM 8684 C CA  . LEU A 1 1139 ? 11.239  43.745 6.245   1.00 78.18  ? 1136 LEU A CA  1 
ATOM 8685 C C   . LEU A 1 1139 ? 10.594  44.603 7.287   1.00 78.18  ? 1136 LEU A C   1 
ATOM 8686 O O   . LEU A 1 1139 ? 9.854   44.083 8.097   1.00 78.18  ? 1136 LEU A O   1 
ATOM 8687 C CB  . LEU A 1 1139 ? 12.709  43.558 6.580   1.00 62.76  ? 1136 LEU A CB  1 
ATOM 8688 C CG  . LEU A 1 1139 ? 13.487  42.453 5.871   1.00 62.76  ? 1136 LEU A CG  1 
ATOM 8689 C CD1 . LEU A 1 1139 ? 14.969  42.784 5.957   1.00 62.76  ? 1136 LEU A CD1 1 
ATOM 8690 C CD2 . LEU A 1 1139 ? 13.205  41.071 6.458   1.00 62.76  ? 1136 LEU A CD2 1 
ATOM 8691 N N   . THR A 1 1140 ? 10.844  45.914 7.262   1.00 69.32  ? 1137 THR A N   1 
ATOM 8692 C CA  . THR A 1 1140 ? 10.285  46.808 8.288   1.00 69.32  ? 1137 THR A CA  1 
ATOM 8693 C C   . THR A 1 1140 ? 8.832   46.500 8.626   1.00 69.32  ? 1137 THR A C   1 
ATOM 8694 O O   . THR A 1 1140 ? 8.381   46.771 9.744   1.00 69.32  ? 1137 THR A O   1 
ATOM 8695 C CB  . THR A 1 1140 ? 10.241  48.264 7.848   1.00 51.94  ? 1137 THR A CB  1 
ATOM 8696 O OG1 . THR A 1 1140 ? 9.646   48.309 6.532   1.00 51.94  ? 1137 THR A OG1 1 
ATOM 8697 C CG2 . THR A 1 1140 ? 11.658  48.980 7.934   1.00 51.94  ? 1137 THR A CG2 1 
ATOM 8698 N N   . ARG A 1 1141 ? 8.090   45.967 7.659   1.00 67.57  ? 1138 ARG A N   1 
ATOM 8699 C CA  . ARG A 1 1141 ? 6.679   45.697 7.865   1.00 67.57  ? 1138 ARG A CA  1 
ATOM 8700 C C   . ARG A 1 1141 ? 6.416   44.313 8.481   1.00 67.57  ? 1138 ARG A C   1 
ATOM 8701 O O   . ARG A 1 1141 ? 5.277   43.865 8.535   1.00 67.57  ? 1138 ARG A O   1 
ATOM 8702 C CB  . ARG A 1 1141 ? 5.928   45.914 6.560   1.00 114.03 ? 1138 ARG A CB  1 
ATOM 8703 C CG  . ARG A 1 1141 ? 6.289   47.250 5.896   1.00 114.03 ? 1138 ARG A CG  1 
ATOM 8704 C CD  . ARG A 1 1141 ? 5.415   47.495 4.649   1.00 114.03 ? 1138 ARG A CD  1 
ATOM 8705 N NE  . ARG A 1 1141 ? 5.489   46.378 3.693   1.00 114.03 ? 1138 ARG A NE  1 
ATOM 8706 C CZ  . ARG A 1 1141 ? 6.131   46.467 2.494   1.00 114.03 ? 1138 ARG A CZ  1 
ATOM 8707 N NH1 . ARG A 1 1141 ? 6.757   47.628 2.079   1.00 114.03 ? 1138 ARG A NH1 1 
ATOM 8708 N NH2 . ARG A 1 1141 ? 6.144   45.385 1.707   1.00 114.03 ? 1138 ARG A NH2 1 
ATOM 8709 N N   . ILE A 1 1142 ? 7.472   43.643 8.948   1.00 59.73  ? 1139 ILE A N   1 
ATOM 8710 C CA  . ILE A 1 1142 ? 7.366   42.418 9.763   1.00 59.73  ? 1139 ILE A CA  1 
ATOM 8711 C C   . ILE A 1 1142 ? 6.774   42.741 11.143  1.00 59.73  ? 1139 ILE A C   1 
ATOM 8712 O O   . ILE A 1 1142 ? 6.211   41.876 11.811  1.00 59.73  ? 1139 ILE A O   1 
ATOM 8713 C CB  . ILE A 1 1142 ? 8.740   41.763 9.939   1.00 75.26  ? 1139 ILE A CB  1 
ATOM 8714 C CG1 . ILE A 1 1142 ? 9.032   40.820 8.791   1.00 75.26  ? 1139 ILE A CG1 1 
ATOM 8715 C CG2 . ILE A 1 1142 ? 8.842   41.003 11.241  1.00 75.26  ? 1139 ILE A CG2 1 
ATOM 8716 C CD1 . ILE A 1 1142 ? 10.316  40.071 9.008   1.00 75.26  ? 1139 ILE A CD1 1 
ATOM 8717 N N   . HIS A 1 1143 ? 6.928   43.989 11.570  1.00 54.75  ? 1140 HIS A N   1 
ATOM 8718 C CA  . HIS A 1 1143 ? 6.160   44.526 12.684  1.00 54.75  ? 1140 HIS A CA  1 
ATOM 8719 C C   . HIS A 1 1143 ? 5.579   45.903 12.298  1.00 54.75  ? 1140 HIS A C   1 
ATOM 8720 O O   . HIS A 1 1143 ? 6.020   46.967 12.758  1.00 54.75  ? 1140 HIS A O   1 
ATOM 8721 C CB  . HIS A 1 1143 ? 7.041   44.625 13.917  1.00 52.05  ? 1140 HIS A CB  1 
ATOM 8722 C CG  . HIS A 1 1143 ? 8.200   45.555 13.754  1.00 52.05  ? 1140 HIS A CG  1 
ATOM 8723 N ND1 . HIS A 1 1143 ? 9.061   45.485 12.683  1.00 52.05  ? 1140 HIS A ND1 1 
ATOM 8724 C CD2 . HIS A 1 1143 ? 8.628   46.587 14.515  1.00 52.05  ? 1140 HIS A CD2 1 
ATOM 8725 C CE1 . HIS A 1 1143 ? 9.982   46.426 12.792  1.00 52.05  ? 1140 HIS A CE1 1 
ATOM 8726 N NE2 . HIS A 1 1143 ? 9.747   47.102 13.902  1.00 52.05  ? 1140 HIS A NE2 1 
ATOM 8727 N N   . SER B 2 1    ? 13.722  32.491 49.848  1.00 29.35  ? 45   SER B N   1 
ATOM 8728 C CA  . SER B 2 1    ? 13.605  31.419 48.909  1.00 29.35  ? 45   SER B CA  1 
ATOM 8729 C C   . SER B 2 1    ? 14.287  31.891 47.699  1.00 29.35  ? 45   SER B C   1 
ATOM 8730 O O   . SER B 2 1    ? 14.893  32.929 47.725  1.00 46.51  ? 45   SER B O   1 
ATOM 8731 C CB  . SER B 2 1    ? 12.170  31.222 48.618  1.00 29.35  ? 45   SER B CB  1 
ATOM 8732 O OG  . SER B 2 1    ? 11.526  31.730 49.727  1.00 29.35  ? 45   SER B OG  1 
ATOM 8733 N N   . LEU B 2 2    ? 14.201  31.110 46.628  1.00 29.35  ? 46   LEU B N   1 
ATOM 8734 C CA  . LEU B 2 2    ? 14.694  31.530 45.328  1.00 29.35  ? 46   LEU B CA  1 
ATOM 8735 C C   . LEU B 2 2    ? 13.530  32.198 44.617  1.00 29.35  ? 46   LEU B C   1 
ATOM 8736 O O   . LEU B 2 2    ? 13.687  32.797 43.554  1.00 44.26  ? 46   LEU B O   1 
ATOM 8737 C CB  . LEU B 2 2    ? 15.192  30.330 44.524  1.00 29.35  ? 46   LEU B CB  1 
ATOM 8738 C CG  . LEU B 2 2    ? 16.341  29.531 45.141  1.00 29.35  ? 46   LEU B CG  1 
ATOM 8739 C CD1 . LEU B 2 2    ? 16.683  28.325 44.279  1.00 29.35  ? 46   LEU B CD1 1 
ATOM 8740 C CD2 . LEU B 2 2    ? 17.563  30.415 45.342  1.00 29.35  ? 46   LEU B CD2 1 
ATOM 8741 N N   . VAL B 2 3    ? 12.355  32.084 45.229  1.00 29.35  ? 47   VAL B N   1 
ATOM 8742 C CA  . VAL B 2 3    ? 11.145  32.699 44.707  1.00 29.35  ? 47   VAL B CA  1 
ATOM 8743 C C   . VAL B 2 3    ? 11.202  34.210 44.883  1.00 29.35  ? 47   VAL B C   1 
ATOM 8744 O O   . VAL B 2 3    ? 10.820  34.959 43.984  1.00 46.62  ? 47   VAL B O   1 
ATOM 8745 C CB  . VAL B 2 3    ? 9.886   32.155 45.408  1.00 29.35  ? 47   VAL B CB  1 
ATOM 8746 C CG1 . VAL B 2 3    ? 9.736   30.665 45.147  1.00 29.35  ? 47   VAL B CG1 1 
ATOM 8747 C CG2 . VAL B 2 3    ? 9.948   32.438 46.902  1.00 29.35  ? 47   VAL B CG2 1 
ATOM 8748 N N   . TYR B 2 4    ? 11.682  34.658 46.040  1.00 29.35  ? 48   TYR B N   1 
ATOM 8749 C CA  . TYR B 2 4    ? 11.808  36.089 46.278  1.00 29.35  ? 48   TYR B CA  1 
ATOM 8750 C C   . TYR B 2 4    ? 12.816  36.693 45.308  1.00 29.35  ? 48   TYR B C   1 
ATOM 8751 O O   . TYR B 2 4    ? 12.809  37.898 45.057  1.00 48.23  ? 48   TYR B O   1 
ATOM 8752 C CB  . TYR B 2 4    ? 12.235  36.360 47.721  1.00 29.35  ? 48   TYR B CB  1 
ATOM 8753 C CG  . TYR B 2 4    ? 11.246  35.871 48.755  1.00 29.35  ? 48   TYR B CG  1 
ATOM 8754 C CD1 . TYR B 2 4    ? 10.225  36.694 49.210  1.00 29.35  ? 48   TYR B CD1 1 
ATOM 8755 C CD2 . TYR B 2 4    ? 11.333  34.586 49.275  1.00 29.35  ? 48   TYR B CD2 1 
ATOM 8756 C CE1 . TYR B 2 4    ? 9.318   36.252 50.155  1.00 29.35  ? 48   TYR B CE1 1 
ATOM 8757 C CE2 . TYR B 2 4    ? 10.431  34.135 50.219  1.00 29.35  ? 48   TYR B CE2 1 
ATOM 8758 C CZ  . TYR B 2 4    ? 9.426   34.972 50.656  1.00 29.35  ? 48   TYR B CZ  1 
ATOM 8759 O OH  . TYR B 2 4    ? 8.525   34.527 51.596  1.00 29.35  ? 48   TYR B OH  1 
ATOM 8760 N N   . TYR B 2 5    ? 13.511  35.746 44.709  1.00 29.35  ? 49   TYR B N   1 
ATOM 8761 C CA  . TYR B 2 5    ? 14.665  35.931 43.885  1.00 29.35  ? 49   TYR B CA  1 
ATOM 8762 C C   . TYR B 2 5    ? 14.355  35.799 42.457  1.00 29.35  ? 49   TYR B C   1 
ATOM 8763 O O   . TYR B 2 5    ? 14.925  36.475 41.646  1.00 48.37  ? 49   TYR B O   1 
ATOM 8764 C CB  . TYR B 2 5    ? 15.695  34.872 44.173  1.00 29.35  ? 49   TYR B CB  1 
ATOM 8765 C CG  . TYR B 2 5    ? 16.852  35.436 44.891  1.00 29.35  ? 49   TYR B CG  1 
ATOM 8766 C CD1 . TYR B 2 5    ? 17.000  36.796 44.993  1.00 29.35  ? 49   TYR B CD1 1 
ATOM 8767 C CD2 . TYR B 2 5    ? 17.804  34.631 45.459  1.00 29.35  ? 49   TYR B CD2 1 
ATOM 8768 C CE1 . TYR B 2 5    ? 18.047  37.345 45.658  1.00 29.35  ? 49   TYR B CE1 1 
ATOM 8769 C CE2 . TYR B 2 5    ? 18.870  35.174 46.126  1.00 29.35  ? 49   TYR B CE2 1 
ATOM 8770 C CZ  . TYR B 2 5    ? 18.983  36.534 46.220  1.00 29.35  ? 49   TYR B CZ  1 
ATOM 8771 O OH  . TYR B 2 5    ? 20.037  37.089 46.882  1.00 29.35  ? 49   TYR B OH  1 
ATOM 8772 N N   . LEU B 2 6    ? 13.497  34.892 42.092  1.00 29.35  ? 50   LEU B N   1 
ATOM 8773 C CA  . LEU B 2 6    ? 13.192  34.870 40.711  1.00 29.35  ? 50   LEU B CA  1 
ATOM 8774 C C   . LEU B 2 6    ? 12.369  36.100 40.498  1.00 29.35  ? 50   LEU B C   1 
ATOM 8775 O O   . LEU B 2 6    ? 12.588  36.857 39.582  1.00 37.02  ? 50   LEU B O   1 
ATOM 8776 C CB  . LEU B 2 6    ? 12.444  33.620 40.369  1.00 29.35  ? 50   LEU B CB  1 
ATOM 8777 C CG  . LEU B 2 6    ? 13.349  32.429 40.503  1.00 29.35  ? 50   LEU B CG  1 
ATOM 8778 C CD1 . LEU B 2 6    ? 12.719  31.243 39.977  1.00 29.35  ? 50   LEU B CD1 1 
ATOM 8779 C CD2 . LEU B 2 6    ? 14.549  32.707 39.748  1.00 29.35  ? 50   LEU B CD2 1 
ATOM 8780 N N   . LYS B 2 7    ? 11.440  36.324 41.402  1.00 29.35  ? 51   LYS B N   1 
ATOM 8781 C CA  . LYS B 2 7    ? 10.481  37.391 41.281  1.00 29.35  ? 51   LYS B CA  1 
ATOM 8782 C C   . LYS B 2 7    ? 11.159  38.675 41.265  1.00 29.35  ? 51   LYS B C   1 
ATOM 8783 O O   . LYS B 2 7    ? 10.597  39.661 40.910  1.00 39.66  ? 51   LYS B O   1 
ATOM 8784 C CB  . LYS B 2 7    ? 9.562   37.383 42.469  1.00 29.35  ? 51   LYS B CB  1 
ATOM 8785 C CG  . LYS B 2 7    ? 9.102   36.021 42.772  1.00 29.35  ? 51   LYS B CG  1 
ATOM 8786 C CD  . LYS B 2 7    ? 7.829   36.018 43.514  1.00 29.35  ? 51   LYS B CD  1 
ATOM 8787 C CE  . LYS B 2 7    ? 7.001   34.888 43.022  1.00 29.35  ? 51   LYS B CE  1 
ATOM 8788 N NZ  . LYS B 2 7    ? 6.228   34.299 44.102  1.00 29.35  ? 51   LYS B NZ  1 
ATOM 8789 N N   . ASN B 2 8    ? 12.382  38.662 41.703  1.00 29.35  ? 52   ASN B N   1 
ATOM 8790 C CA  . ASN B 2 8    ? 13.119  39.864 41.923  1.00 29.35  ? 52   ASN B CA  1 
ATOM 8791 C C   . ASN B 2 8    ? 13.867  40.137 40.631  1.00 29.35  ? 52   ASN B C   1 
ATOM 8792 O O   . ASN B 2 8    ? 13.601  41.049 39.921  1.00 45.14  ? 52   ASN B O   1 
ATOM 8793 C CB  . ASN B 2 8    ? 14.054  39.599 43.094  1.00 29.35  ? 52   ASN B CB  1 
ATOM 8794 C CG  . ASN B 2 8    ? 14.231  40.776 44.006  1.00 29.35  ? 52   ASN B CG  1 
ATOM 8795 O OD1 . ASN B 2 8    ? 13.466  41.709 43.998  1.00 29.35  ? 52   ASN B OD1 1 
ATOM 8796 N ND2 . ASN B 2 8    ? 15.261  40.727 44.814  1.00 29.35  ? 52   ASN B ND2 1 
ATOM 8797 N N   . ARG B 2 9    ? 14.783  39.270 40.317  1.00 29.35  ? 53   ARG B N   1 
ATOM 8798 C CA  . ARG B 2 9    ? 15.411  39.355 39.072  1.00 29.35  ? 53   ARG B CA  1 
ATOM 8799 C C   . ARG B 2 9    ? 14.326  39.616 38.095  1.00 29.35  ? 53   ARG B C   1 
ATOM 8800 O O   . ARG B 2 9    ? 14.549  40.195 37.085  1.00 34.56  ? 53   ARG B O   1 
ATOM 8801 C CB  . ARG B 2 9    ? 16.057  38.031 38.772  1.00 29.35  ? 53   ARG B CB  1 
ATOM 8802 C CG  . ARG B 2 9    ? 16.555  37.369 39.990  1.00 29.35  ? 53   ARG B CG  1 
ATOM 8803 C CD  . ARG B 2 9    ? 17.551  36.263 39.665  1.00 29.35  ? 53   ARG B CD  1 
ATOM 8804 N NE  . ARG B 2 9    ? 18.377  35.904 40.826  1.00 29.35  ? 53   ARG B NE  1 
ATOM 8805 C CZ  . ARG B 2 9    ? 18.378  34.729 41.428  1.00 29.35  ? 53   ARG B CZ  1 
ATOM 8806 N NH1 . ARG B 2 9    ? 17.637  33.747 41.006  1.00 29.35  ? 53   ARG B NH1 1 
ATOM 8807 N NH2 . ARG B 2 9    ? 19.142  34.546 42.451  1.00 29.35  ? 53   ARG B NH2 1 
ATOM 8808 N N   . GLU B 2 10   ? 13.059  39.305 38.469  1.00 29.35  ? 54   GLU B N   1 
ATOM 8809 C CA  . GLU B 2 10   ? 11.875  39.494 37.641  1.00 29.35  ? 54   GLU B CA  1 
ATOM 8810 C C   . GLU B 2 10   ? 11.797  40.938 37.161  1.00 29.35  ? 54   GLU B C   1 
ATOM 8811 O O   . GLU B 2 10   ? 11.899  41.212 35.965  1.00 39.08  ? 54   GLU B O   1 
ATOM 8812 C CB  . GLU B 2 10   ? 10.610  39.127 38.419  1.00 29.35  ? 54   GLU B CB  1 
ATOM 8813 C CG  . GLU B 2 10   ? 10.567  37.681 38.886  1.00 29.35  ? 54   GLU B CG  1 
ATOM 8814 C CD  . GLU B 2 10   ? 10.624  36.695 37.736  1.00 29.35  ? 54   GLU B CD  1 
ATOM 8815 O OE1 . GLU B 2 10   ? 10.699  37.141 36.572  1.00 29.35  ? 54   GLU B OE1 1 
ATOM 8816 O OE2 . GLU B 2 10   ? 10.594  35.474 37.997  1.00 29.35  ? 54   GLU B OE2 1 
ATOM 8817 N N   . VAL B 2 11   ? 11.620  41.860 38.102  1.00 29.35  ? 55   VAL B N   1 
ATOM 8818 C CA  . VAL B 2 11   ? 11.545  43.278 37.777  1.00 29.35  ? 55   VAL B CA  1 
ATOM 8819 C C   . VAL B 2 11   ? 12.897  43.761 37.268  1.00 29.35  ? 55   VAL B C   1 
ATOM 8820 O O   . VAL B 2 11   ? 12.987  44.400 36.220  1.00 36.52  ? 55   VAL B O   1 
ATOM 8821 C CB  . VAL B 2 11   ? 11.133  44.119 38.999  1.00 29.35  ? 55   VAL B CB  1 
ATOM 8822 C CG1 . VAL B 2 11   ? 9.737   43.730 39.463  1.00 29.35  ? 55   VAL B CG1 1 
ATOM 8823 C CG2 . VAL B 2 11   ? 12.143  43.949 40.123  1.00 29.35  ? 55   VAL B CG2 1 
ATOM 8824 N N   . ARG B 2 12   ? 13.947  43.445 38.019  1.00 29.35  ? 56   ARG B N   1 
ATOM 8825 C CA  . ARG B 2 12   ? 15.304  43.826 37.644  1.00 29.35  ? 56   ARG B CA  1 
ATOM 8826 C C   . ARG B 2 12   ? 16.049  44.442 38.823  1.00 29.35  ? 56   ARG B C   1 
ATOM 8827 O O   . ARG B 2 12   ? 15.478  45.208 39.600  1.00 36.41  ? 56   ARG B O   1 
ATOM 8828 C CB  . ARG B 2 12   ? 15.281  44.803 36.467  1.00 29.35  ? 56   ARG B CB  1 
ATOM 8829 C CG  . ARG B 2 12   ? 16.653  45.310 36.055  1.00 29.35  ? 56   ARG B CG  1 
ATOM 8830 C CD  . ARG B 2 12   ? 17.528  44.178 35.542  1.00 29.35  ? 56   ARG B CD  1 
ATOM 8831 N NE  . ARG B 2 12   ? 18.851  44.646 35.141  1.00 29.35  ? 56   ARG B NE  1 
ATOM 8832 C CZ  . ARG B 2 12   ? 19.878  44.783 35.973  1.00 29.35  ? 56   ARG B CZ  1 
ATOM 8833 N NH1 . ARG B 2 12   ? 19.739  44.485 37.257  1.00 29.35  ? 56   ARG B NH1 1 
ATOM 8834 N NH2 . ARG B 2 12   ? 21.047  45.217 35.521  1.00 29.35  ? 56   ARG B NH2 1 
ATOM 8835 N N   . LEU B 2 13   ? 17.328  44.103 38.951  1.00 29.35  ? 57   LEU B N   1 
ATOM 8836 C CA  . LEU B 2 13   ? 18.154  44.622 40.034  1.00 29.35  ? 57   LEU B CA  1 
ATOM 8837 C C   . LEU B 2 13   ? 17.297  45.084 41.208  1.00 29.35  ? 57   LEU B C   1 
ATOM 8838 O O   . LEU B 2 13   ? 17.663  44.896 42.368  1.00 171.34 ? 57   LEU B O   1 
ATOM 8839 C CB  . LEU B 2 13   ? 19.029  45.774 39.537  1.00 29.35  ? 57   LEU B CB  1 
ATOM 8840 C CG  . LEU B 2 13   ? 19.955  46.418 40.571  1.00 29.35  ? 57   LEU B CG  1 
ATOM 8841 C CD1 . LEU B 2 13   ? 20.820  47.489 39.925  1.00 29.35  ? 57   LEU B CD1 1 
ATOM 8842 C CD2 . LEU B 2 13   ? 19.151  46.996 41.725  1.00 29.35  ? 57   LEU B CD2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    GLY 1    -2   ?    ?   ?   A . n 
A 1 2    SER 2    -1   ?    ?   ?   A . n 
A 1 3    HIS 3    0    ?    ?   ?   A . n 
A 1 4    MET 4    1    1    MET MET A . n 
A 1 5    SER 5    2    2    SER SER A . n 
A 1 6    TYR 6    3    3    TYR TYR A . n 
A 1 7    ASN 7    4    4    ASN ASN A . n 
A 1 8    TYR 8    5    5    TYR TYR A . n 
A 1 9    VAL 9    6    6    VAL VAL A . n 
A 1 10   VAL 10   7    7    VAL VAL A . n 
A 1 11   THR 11   8    8    THR THR A . n 
A 1 12   ALA 12   9    9    ALA ALA A . n 
A 1 13   GLN 13   10   10   GLN GLN A . n 
A 1 14   LYS 14   11   11   LYS LYS A . n 
A 1 15   PRO 15   12   12   PRO PRO A . n 
A 1 16   THR 16   13   13   THR THR A . n 
A 1 17   ALA 17   14   14   ALA ALA A . n 
A 1 18   VAL 18   15   15   VAL VAL A . n 
A 1 19   ASN 19   16   16   ASN ASN A . n 
A 1 20   GLY 20   17   17   GLY GLY A . n 
A 1 21   CYS 21   18   18   CYS CYS A . n 
A 1 22   VAL 22   19   19   VAL VAL A . n 
A 1 23   THR 23   20   20   THR THR A . n 
A 1 24   GLY 24   21   21   GLY GLY A . n 
A 1 25   HIS 25   22   22   HIS HIS A . n 
A 1 26   PHE 26   23   23   PHE PHE A . n 
A 1 27   THR 27   24   24   THR THR A . n 
A 1 28   SER 28   25   25   SER SER A . n 
A 1 29   ALA 29   26   26   ALA ALA A . n 
A 1 30   GLU 30   27   27   GLU GLU A . n 
A 1 31   ASP 31   28   28   ASP ASP A . n 
A 1 32   LEU 32   29   29   LEU LEU A . n 
A 1 33   ASN 33   30   30   ASN ASN A . n 
A 1 34   LEU 34   31   31   LEU LEU A . n 
A 1 35   LEU 35   32   32   LEU LEU A . n 
A 1 36   ILE 36   33   33   ILE ILE A . n 
A 1 37   ALA 37   34   34   ALA ALA A . n 
A 1 38   LYS 38   35   35   LYS LYS A . n 
A 1 39   ASN 39   36   36   ASN ASN A . n 
A 1 40   THR 40   37   37   THR THR A . n 
A 1 41   ARG 41   38   38   ARG ARG A . n 
A 1 42   LEU 42   39   39   LEU LEU A . n 
A 1 43   GLU 43   40   40   GLU GLU A . n 
A 1 44   ILE 44   41   41   ILE ILE A . n 
A 1 45   TYR 45   42   42   TYR TYR A . n 
A 1 46   VAL 46   43   43   VAL VAL A . n 
A 1 47   VAL 47   44   44   VAL VAL A . n 
A 1 48   THR 48   45   45   THR THR A . n 
A 1 49   ALA 49   46   46   ALA ALA A . n 
A 1 50   GLU 50   47   47   GLU GLU A . n 
A 1 51   GLY 51   48   48   GLY GLY A . n 
A 1 52   LEU 52   49   49   LEU LEU A . n 
A 1 53   ARG 53   50   50   ARG ARG A . n 
A 1 54   PRO 54   51   51   PRO PRO A . n 
A 1 55   VAL 55   52   52   VAL VAL A . n 
A 1 56   LYS 56   53   53   LYS LYS A . n 
A 1 57   GLU 57   54   54   GLU GLU A . n 
A 1 58   VAL 58   55   55   VAL VAL A . n 
A 1 59   GLY 59   56   56   GLY GLY A . n 
A 1 60   MET 60   57   57   MET MET A . n 
A 1 61   TYR 61   58   58   TYR TYR A . n 
A 1 62   GLY 62   59   59   GLY GLY A . n 
A 1 63   LYS 63   60   60   LYS LYS A . n 
A 1 64   ILE 64   61   61   ILE ILE A . n 
A 1 65   ALA 65   62   62   ALA ALA A . n 
A 1 66   VAL 66   63   63   VAL VAL A . n 
A 1 67   MET 67   64   64   MET MET A . n 
A 1 68   GLU 68   65   65   GLU GLU A . n 
A 1 69   LEU 69   66   66   LEU LEU A . n 
A 1 70   PHE 70   67   67   PHE PHE A . n 
A 1 71   ARG 71   68   68   ARG ARG A . n 
A 1 72   PRO 72   69   69   PRO PRO A . n 
A 1 73   LYS 73   70   70   LYS LYS A . n 
A 1 74   GLY 74   71   71   GLY GLY A . n 
A 1 75   GLU 75   72   72   GLU GLU A . n 
A 1 76   SER 76   73   73   SER SER A . n 
A 1 77   LYS 77   74   74   LYS LYS A . n 
A 1 78   ASP 78   75   75   ASP ASP A . n 
A 1 79   LEU 79   76   76   LEU LEU A . n 
A 1 80   LEU 80   77   77   LEU LEU A . n 
A 1 81   PHE 81   78   78   PHE PHE A . n 
A 1 82   ILE 82   79   79   ILE ILE A . n 
A 1 83   LEU 83   80   80   LEU LEU A . n 
A 1 84   THR 84   81   81   THR THR A . n 
A 1 85   ALA 85   82   82   ALA ALA A . n 
A 1 86   LYS 86   83   83   LYS LYS A . n 
A 1 87   TYR 87   84   84   TYR TYR A . n 
A 1 88   ASN 88   85   85   ASN ASN A . n 
A 1 89   ALA 89   86   86   ALA ALA A . n 
A 1 90   CYS 90   87   87   CYS CYS A . n 
A 1 91   ILE 91   88   88   ILE ILE A . n 
A 1 92   LEU 92   89   89   LEU LEU A . n 
A 1 93   GLU 93   90   90   GLU GLU A . n 
A 1 94   TYR 94   91   91   TYR TYR A . n 
A 1 95   LYS 95   92   92   LYS LYS A . n 
A 1 96   GLN 96   93   93   GLN GLN A . n 
A 1 97   SER 97   94   94   SER SER A . n 
A 1 98   GLY 98   95   95   GLY GLY A . n 
A 1 99   GLU 99   96   96   GLU GLU A . n 
A 1 100  SER 100  97   97   SER SER A . n 
A 1 101  ILE 101  98   98   ILE ILE A . n 
A 1 102  ASP 102  99   99   ASP ASP A . n 
A 1 103  ILE 103  100  100  ILE ILE A . n 
A 1 104  ILE 104  101  101  ILE ILE A . n 
A 1 105  THR 105  102  102  THR THR A . n 
A 1 106  ARG 106  103  103  ARG ARG A . n 
A 1 107  ALA 107  104  104  ALA ALA A . n 
A 1 108  HIS 108  105  105  HIS HIS A . n 
A 1 109  GLY 109  106  106  GLY GLY A . n 
A 1 110  ASN 110  107  107  ASN ASN A . n 
A 1 111  VAL 111  108  108  VAL VAL A . n 
A 1 112  GLN 112  109  109  GLN GLN A . n 
A 1 113  ASP 113  110  110  ASP ASP A . n 
A 1 114  ARG 114  111  111  ARG ARG A . n 
A 1 115  ILE 115  112  112  ILE ILE A . n 
A 1 116  GLY 116  113  113  GLY GLY A . n 
A 1 117  ARG 117  114  114  ARG ARG A . n 
A 1 118  PRO 118  115  115  PRO PRO A . n 
A 1 119  SER 119  116  116  SER SER A . n 
A 1 120  GLU 120  117  117  GLU GLU A . n 
A 1 121  THR 121  118  118  THR THR A . n 
A 1 122  GLY 122  119  119  GLY GLY A . n 
A 1 123  ILE 123  120  120  ILE ILE A . n 
A 1 124  ILE 124  121  121  ILE ILE A . n 
A 1 125  GLY 125  122  122  GLY GLY A . n 
A 1 126  ILE 126  123  123  ILE ILE A . n 
A 1 127  ILE 127  124  124  ILE ILE A . n 
A 1 128  ASP 128  125  125  ASP ASP A . n 
A 1 129  PRO 129  126  126  PRO PRO A . n 
A 1 130  GLU 130  127  127  GLU GLU A . n 
A 1 131  CYS 131  128  128  CYS CYS A . n 
A 1 132  ARG 132  129  129  ARG ARG A . n 
A 1 133  MET 133  130  130  MET MET A . n 
A 1 134  ILE 134  131  131  ILE ILE A . n 
A 1 135  GLY 135  132  132  GLY GLY A . n 
A 1 136  LEU 136  133  133  LEU LEU A . n 
A 1 137  ARG 137  134  134  ARG ARG A . n 
A 1 138  LEU 138  135  135  LEU LEU A . n 
A 1 139  TYR 139  136  136  TYR TYR A . n 
A 1 140  ASP 140  137  137  ASP ASP A . n 
A 1 141  GLY 141  138  138  GLY GLY A . n 
A 1 142  LEU 142  139  139  LEU LEU A . n 
A 1 143  PHE 143  140  140  PHE PHE A . n 
A 1 144  LYS 144  141  141  LYS LYS A . n 
A 1 145  VAL 145  142  142  VAL VAL A . n 
A 1 146  ILE 146  143  143  ILE ILE A . n 
A 1 147  PRO 147  144  144  PRO PRO A . n 
A 1 148  LEU 148  145  145  LEU LEU A . n 
A 1 149  ASP 149  146  146  ASP ASP A . n 
A 1 150  ARG 150  147  147  ARG ARG A . n 
A 1 151  ASP 151  148  148  ASP ASP A . n 
A 1 152  ASN 152  149  149  ASN ASN A . n 
A 1 153  LYS 153  150  150  LYS LYS A . n 
A 1 154  GLU 154  151  151  GLU GLU A . n 
A 1 155  LEU 155  152  152  LEU LEU A . n 
A 1 156  LYS 156  153  153  LYS LYS A . n 
A 1 157  ALA 157  154  154  ALA ALA A . n 
A 1 158  PHE 158  155  155  PHE PHE A . n 
A 1 159  ASN 159  156  156  ASN ASN A . n 
A 1 160  ILE 160  157  157  ILE ILE A . n 
A 1 161  ARG 161  158  158  ARG ARG A . n 
A 1 162  LEU 162  159  159  LEU LEU A . n 
A 1 163  GLU 163  160  160  GLU GLU A . n 
A 1 164  GLU 164  161  161  GLU GLU A . n 
A 1 165  LEU 165  162  162  LEU LEU A . n 
A 1 166  HIS 166  163  163  HIS HIS A . n 
A 1 167  VAL 167  164  164  VAL VAL A . n 
A 1 168  ILE 168  165  165  ILE ILE A . n 
A 1 169  ASP 169  166  166  ASP ASP A . n 
A 1 170  VAL 170  167  167  VAL VAL A . n 
A 1 171  LYS 171  168  168  LYS LYS A . n 
A 1 172  PHE 172  169  169  PHE PHE A . n 
A 1 173  LEU 173  170  170  LEU LEU A . n 
A 1 174  TYR 174  171  171  TYR TYR A . n 
A 1 175  GLY 175  172  172  GLY GLY A . n 
A 1 176  CYS 176  173  173  CYS CYS A . n 
A 1 177  GLN 177  174  174  GLN GLN A . n 
A 1 178  ALA 178  175  175  ALA ALA A . n 
A 1 179  PRO 179  176  176  PRO PRO A . n 
A 1 180  THR 180  177  177  THR THR A . n 
A 1 181  ILE 181  178  178  ILE ILE A . n 
A 1 182  CYS 182  179  179  CYS CYS A . n 
A 1 183  PHE 183  180  180  PHE PHE A . n 
A 1 184  VAL 184  181  181  VAL VAL A . n 
A 1 185  TYR 185  182  182  TYR TYR A . n 
A 1 186  GLN 186  183  183  GLN GLN A . n 
A 1 187  ASP 187  184  184  ASP ASP A . n 
A 1 188  PRO 188  185  185  PRO PRO A . n 
A 1 189  GLN 189  186  186  GLN GLN A . n 
A 1 190  GLY 190  187  187  GLY GLY A . n 
A 1 191  ARG 191  188  188  ARG ARG A . n 
A 1 192  HIS 192  189  189  HIS HIS A . n 
A 1 193  VAL 193  190  190  VAL VAL A . n 
A 1 194  LYS 194  191  191  LYS LYS A . n 
A 1 195  THR 195  192  192  THR THR A . n 
A 1 196  TYR 196  193  193  TYR TYR A . n 
A 1 197  GLU 197  194  194  GLU GLU A . n 
A 1 198  VAL 198  195  195  VAL VAL A . n 
A 1 199  SER 199  196  196  SER SER A . n 
A 1 200  LEU 200  197  197  LEU LEU A . n 
A 1 201  ARG 201  198  198  ARG ARG A . n 
A 1 202  GLU 202  199  199  GLU GLU A . n 
A 1 203  LYS 203  200  200  LYS LYS A . n 
A 1 204  GLU 204  201  201  GLU GLU A . n 
A 1 205  PHE 205  202  202  PHE PHE A . n 
A 1 206  ASN 206  203  203  ASN ASN A . n 
A 1 207  LYS 207  204  204  LYS LYS A . n 
A 1 208  GLY 208  205  205  GLY GLY A . n 
A 1 209  PRO 209  206  206  PRO PRO A . n 
A 1 210  TRP 210  207  207  TRP TRP A . n 
A 1 211  LYS 211  208  208  LYS LYS A . n 
A 1 212  GLN 212  209  209  GLN GLN A . n 
A 1 213  GLU 213  210  210  GLU GLU A . n 
A 1 214  ASN 214  211  211  ASN ASN A . n 
A 1 215  VAL 215  212  212  VAL VAL A . n 
A 1 216  GLU 216  213  213  GLU GLU A . n 
A 1 217  ALA 217  214  214  ALA ALA A . n 
A 1 218  GLU 218  215  215  GLU GLU A . n 
A 1 219  ALA 219  216  216  ALA ALA A . n 
A 1 220  SER 220  217  217  SER SER A . n 
A 1 221  MET 221  218  218  MET MET A . n 
A 1 222  VAL 222  219  219  VAL VAL A . n 
A 1 223  ILE 223  220  220  ILE ILE A . n 
A 1 224  ALA 224  221  221  ALA ALA A . n 
A 1 225  VAL 225  222  222  VAL VAL A . n 
A 1 226  PRO 226  223  223  PRO PRO A . n 
A 1 227  GLU 227  224  224  GLU GLU A . n 
A 1 228  PRO 228  225  225  PRO PRO A . n 
A 1 229  PHE 229  226  226  PHE PHE A . n 
A 1 230  GLY 230  227  227  GLY GLY A . n 
A 1 231  GLY 231  228  228  GLY GLY A . n 
A 1 232  ALA 232  229  229  ALA ALA A . n 
A 1 233  ILE 233  230  230  ILE ILE A . n 
A 1 234  ILE 234  231  231  ILE ILE A . n 
A 1 235  ILE 235  232  232  ILE ILE A . n 
A 1 236  GLY 236  233  233  GLY GLY A . n 
A 1 237  GLN 237  234  234  GLN GLN A . n 
A 1 238  GLU 238  235  235  GLU GLU A . n 
A 1 239  SER 239  236  236  SER SER A . n 
A 1 240  ILE 240  237  237  ILE ILE A . n 
A 1 241  THR 241  238  238  THR THR A . n 
A 1 242  TYR 242  239  239  TYR TYR A . n 
A 1 243  HIS 243  240  240  HIS HIS A . n 
A 1 244  ASN 244  241  241  ASN ASN A . n 
A 1 245  GLY 245  242  242  GLY GLY A . n 
A 1 246  ASP 246  243  243  ASP ASP A . n 
A 1 247  LYS 247  244  244  LYS LYS A . n 
A 1 248  TYR 248  245  245  TYR TYR A . n 
A 1 249  LEU 249  246  246  LEU LEU A . n 
A 1 250  ALA 250  247  247  ALA ALA A . n 
A 1 251  ILE 251  248  248  ILE ILE A . n 
A 1 252  ALA 252  249  249  ALA ALA A . n 
A 1 253  PRO 253  250  250  PRO PRO A . n 
A 1 254  PRO 254  251  251  PRO PRO A . n 
A 1 255  ILE 255  252  252  ILE ILE A . n 
A 1 256  ILE 256  253  253  ILE ILE A . n 
A 1 257  LYS 257  254  254  LYS LYS A . n 
A 1 258  GLN 258  255  255  GLN GLN A . n 
A 1 259  SER 259  256  256  SER SER A . n 
A 1 260  THR 260  257  257  THR THR A . n 
A 1 261  ILE 261  258  258  ILE ILE A . n 
A 1 262  VAL 262  259  259  VAL VAL A . n 
A 1 263  CYS 263  260  260  CYS CYS A . n 
A 1 264  HIS 264  261  261  HIS HIS A . n 
A 1 265  ASN 265  262  262  ASN ASN A . n 
A 1 266  ARG 266  263  263  ARG ARG A . n 
A 1 267  VAL 267  264  264  VAL VAL A . n 
A 1 268  ASP 268  265  265  ASP ASP A . n 
A 1 269  PRO 269  266  266  PRO PRO A . n 
A 1 270  ASN 270  267  267  ASN ASN A . n 
A 1 271  GLY 271  268  268  GLY GLY A . n 
A 1 272  SER 272  269  269  SER SER A . n 
A 1 273  ARG 273  270  270  ARG ARG A . n 
A 1 274  TYR 274  271  271  TYR TYR A . n 
A 1 275  LEU 275  272  272  LEU LEU A . n 
A 1 276  LEU 276  273  273  LEU LEU A . n 
A 1 277  GLY 277  274  274  GLY GLY A . n 
A 1 278  ASP 278  275  275  ASP ASP A . n 
A 1 279  MET 279  276  276  MET MET A . n 
A 1 280  GLU 280  277  277  GLU GLU A . n 
A 1 281  GLY 281  278  278  GLY GLY A . n 
A 1 282  ARG 282  279  279  ARG ARG A . n 
A 1 283  LEU 283  280  280  LEU LEU A . n 
A 1 284  PHE 284  281  281  PHE PHE A . n 
A 1 285  MET 285  282  282  MET MET A . n 
A 1 286  LEU 286  283  283  LEU LEU A . n 
A 1 287  LEU 287  284  284  LEU LEU A . n 
A 1 288  LEU 288  285  285  LEU LEU A . n 
A 1 289  GLU 289  286  286  GLU GLU A . n 
A 1 290  LYS 290  287  287  LYS LYS A . n 
A 1 291  GLU 291  288  288  GLU GLU A . n 
A 1 292  GLU 292  289  289  GLU GLU A . n 
A 1 293  GLN 293  290  290  GLN GLN A . n 
A 1 294  MET 294  291  291  MET MET A . n 
A 1 295  ASP 295  292  292  ASP ASP A . n 
A 1 296  GLY 296  293  293  GLY GLY A . n 
A 1 297  THR 297  294  294  THR THR A . n 
A 1 298  VAL 298  295  295  VAL VAL A . n 
A 1 299  THR 299  296  296  THR THR A . n 
A 1 300  LEU 300  297  297  LEU LEU A . n 
A 1 301  LYS 301  298  298  LYS LYS A . n 
A 1 302  ASP 302  299  299  ASP ASP A . n 
A 1 303  LEU 303  300  300  LEU LEU A . n 
A 1 304  ARG 304  301  301  ARG ARG A . n 
A 1 305  VAL 305  302  302  VAL VAL A . n 
A 1 306  GLU 306  303  303  GLU GLU A . n 
A 1 307  LEU 307  304  304  LEU LEU A . n 
A 1 308  LEU 308  305  305  LEU LEU A . n 
A 1 309  GLY 309  306  306  GLY GLY A . n 
A 1 310  GLU 310  307  307  GLU GLU A . n 
A 1 311  THR 311  308  308  THR THR A . n 
A 1 312  SER 312  309  309  SER SER A . n 
A 1 313  ILE 313  310  310  ILE ILE A . n 
A 1 314  ALA 314  311  311  ALA ALA A . n 
A 1 315  GLU 315  312  312  GLU GLU A . n 
A 1 316  CYS 316  313  313  CYS CYS A . n 
A 1 317  LEU 317  314  314  LEU LEU A . n 
A 1 318  THR 318  315  315  THR THR A . n 
A 1 319  TYR 319  316  316  TYR TYR A . n 
A 1 320  LEU 320  317  317  LEU LEU A . n 
A 1 321  ASP 321  318  318  ASP ASP A . n 
A 1 322  ASN 322  319  319  ASN ASN A . n 
A 1 323  GLY 323  320  320  GLY GLY A . n 
A 1 324  VAL 324  321  321  VAL VAL A . n 
A 1 325  VAL 325  322  322  VAL VAL A . n 
A 1 326  PHE 326  323  323  PHE PHE A . n 
A 1 327  VAL 327  324  324  VAL VAL A . n 
A 1 328  GLY 328  325  325  GLY GLY A . n 
A 1 329  SER 329  326  326  SER SER A . n 
A 1 330  ARG 330  327  327  ARG ARG A . n 
A 1 331  LEU 331  328  328  LEU LEU A . n 
A 1 332  GLY 332  329  329  GLY GLY A . n 
A 1 333  ASP 333  330  330  ASP ASP A . n 
A 1 334  SER 334  331  331  SER SER A . n 
A 1 335  GLN 335  332  332  GLN GLN A . n 
A 1 336  LEU 336  333  333  LEU LEU A . n 
A 1 337  VAL 337  334  334  VAL VAL A . n 
A 1 338  LYS 338  335  335  LYS LYS A . n 
A 1 339  LEU 339  336  336  LEU LEU A . n 
A 1 340  ASN 340  337  337  ASN ASN A . n 
A 1 341  VAL 341  338  338  VAL VAL A . n 
A 1 342  ASP 342  339  339  ASP ASP A . n 
A 1 343  SER 343  340  340  SER SER A . n 
A 1 344  ASN 344  341  341  ASN ASN A . n 
A 1 345  GLU 345  342  342  GLU GLU A . n 
A 1 346  GLN 346  343  343  GLN GLN A . n 
A 1 347  GLY 347  344  344  GLY GLY A . n 
A 1 348  SER 348  345  345  SER SER A . n 
A 1 349  TYR 349  346  346  TYR TYR A . n 
A 1 350  VAL 350  347  347  VAL VAL A . n 
A 1 351  VAL 351  348  348  VAL VAL A . n 
A 1 352  ALA 352  349  349  ALA ALA A . n 
A 1 353  MET 353  350  350  MET MET A . n 
A 1 354  GLU 354  351  351  GLU GLU A . n 
A 1 355  THR 355  352  352  THR THR A . n 
A 1 356  PHE 356  353  353  PHE PHE A . n 
A 1 357  THR 357  354  354  THR THR A . n 
A 1 358  ASN 358  355  355  ASN ASN A . n 
A 1 359  LEU 359  356  356  LEU LEU A . n 
A 1 360  GLY 360  357  357  GLY GLY A . n 
A 1 361  PRO 361  358  358  PRO PRO A . n 
A 1 362  ILE 362  359  359  ILE ILE A . n 
A 1 363  VAL 363  360  360  VAL VAL A . n 
A 1 364  ASP 364  361  361  ASP ASP A . n 
A 1 365  MET 365  362  362  MET MET A . n 
A 1 366  CYS 366  363  363  CYS CYS A . n 
A 1 367  VAL 367  364  364  VAL VAL A . n 
A 1 368  VAL 368  365  365  VAL VAL A . n 
A 1 369  ASP 369  366  366  ASP ASP A . n 
A 1 370  LEU 370  367  367  LEU LEU A . n 
A 1 371  GLU 371  368  368  GLU GLU A . n 
A 1 372  ARG 372  369  369  ARG ARG A . n 
A 1 373  GLN 373  370  370  GLN GLN A . n 
A 1 374  GLY 374  371  371  GLY GLY A . n 
A 1 375  GLN 375  372  372  GLN GLN A . n 
A 1 376  GLY 376  373  373  GLY GLY A . n 
A 1 377  GLN 377  374  374  GLN GLN A . n 
A 1 378  LEU 378  375  375  LEU LEU A . n 
A 1 379  VAL 379  376  376  VAL VAL A . n 
A 1 380  THR 380  377  377  THR THR A . n 
A 1 381  CYS 381  378  378  CYS CYS A . n 
A 1 382  SER 382  379  379  SER SER A . n 
A 1 383  GLY 383  380  380  GLY GLY A . n 
A 1 384  ALA 384  381  381  ALA ALA A . n 
A 1 385  PHE 385  382  382  PHE PHE A . n 
A 1 386  LYS 386  383  383  LYS LYS A . n 
A 1 387  GLU 387  384  384  GLU GLU A . n 
A 1 388  GLY 388  385  385  GLY GLY A . n 
A 1 389  SER 389  386  386  SER SER A . n 
A 1 390  LEU 390  387  387  LEU LEU A . n 
A 1 391  ARG 391  388  388  ARG ARG A . n 
A 1 392  ILE 392  389  389  ILE ILE A . n 
A 1 393  ILE 393  390  390  ILE ILE A . n 
A 1 394  ARG 394  391  391  ARG ARG A . n 
A 1 395  ASN 395  392  392  ASN ASN A . n 
A 1 396  GLY 396  393  393  GLY GLY A . n 
A 1 397  ILE 397  394  394  ILE ILE A . n 
A 1 398  GLY 398  395  395  GLY GLY A . n 
A 1 399  ILE 399  396  396  ILE ILE A . n 
A 1 400  HIS 400  397  397  HIS HIS A . n 
A 1 401  GLU 401  398  398  GLU GLU A . n 
A 1 402  HIS 402  399  399  HIS HIS A . n 
A 1 403  ALA 403  400  400  ALA ALA A . n 
A 1 404  SER 404  401  401  SER SER A . n 
A 1 405  ILE 405  402  402  ILE ILE A . n 
A 1 406  ASP 406  403  403  ASP ASP A . n 
A 1 407  LEU 407  404  404  LEU LEU A . n 
A 1 408  PRO 408  405  405  PRO PRO A . n 
A 1 409  GLY 409  406  406  GLY GLY A . n 
A 1 410  ILE 410  407  407  ILE ILE A . n 
A 1 411  LYS 411  408  408  LYS LYS A . n 
A 1 412  GLY 412  409  409  GLY GLY A . n 
A 1 413  LEU 413  410  410  LEU LEU A . n 
A 1 414  TRP 414  411  411  TRP TRP A . n 
A 1 415  PRO 415  412  412  PRO PRO A . n 
A 1 416  LEU 416  413  413  LEU LEU A . n 
A 1 417  ARG 417  414  414  ARG ARG A . n 
A 1 418  SER 418  415  415  SER SER A . n 
A 1 419  ASP 419  416  416  ASP ASP A . n 
A 1 420  PRO 420  417  417  PRO PRO A . n 
A 1 421  ASN 421  418  418  ASN ASN A . n 
A 1 422  ARG 422  419  419  ARG ARG A . n 
A 1 423  GLU 423  420  420  GLU GLU A . n 
A 1 424  THR 424  421  421  THR THR A . n 
A 1 425  TYR 425  422  422  TYR TYR A . n 
A 1 426  ASP 426  423  423  ASP ASP A . n 
A 1 427  THR 427  424  424  THR THR A . n 
A 1 428  LEU 428  425  425  LEU LEU A . n 
A 1 429  VAL 429  426  426  VAL VAL A . n 
A 1 430  LEU 430  427  427  LEU LEU A . n 
A 1 431  SER 431  428  428  SER SER A . n 
A 1 432  PHE 432  429  429  PHE PHE A . n 
A 1 433  VAL 433  430  430  VAL VAL A . n 
A 1 434  GLY 434  431  431  GLY GLY A . n 
A 1 435  GLN 435  432  432  GLN GLN A . n 
A 1 436  THR 436  433  433  THR THR A . n 
A 1 437  ARG 437  434  434  ARG ARG A . n 
A 1 438  VAL 438  435  435  VAL VAL A . n 
A 1 439  LEU 439  436  436  LEU LEU A . n 
A 1 440  MET 440  437  437  MET MET A . n 
A 1 441  LEU 441  438  438  LEU LEU A . n 
A 1 442  ASN 442  439  439  ASN ASN A . n 
A 1 443  GLY 443  440  440  GLY GLY A . n 
A 1 444  GLU 444  441  441  GLU GLU A . n 
A 1 445  GLU 445  442  442  GLU GLU A . n 
A 1 446  VAL 446  443  443  VAL VAL A . n 
A 1 447  GLU 447  444  444  GLU GLU A . n 
A 1 448  GLU 448  445  445  GLU GLU A . n 
A 1 449  THR 449  446  446  THR THR A . n 
A 1 450  GLU 450  447  447  GLU GLU A . n 
A 1 451  LEU 451  448  448  LEU LEU A . n 
A 1 452  MET 452  449  449  MET MET A . n 
A 1 453  GLY 453  450  450  GLY GLY A . n 
A 1 454  PHE 454  451  451  PHE PHE A . n 
A 1 455  VAL 455  452  452  VAL VAL A . n 
A 1 456  ASP 456  453  453  ASP ASP A . n 
A 1 457  ASP 457  454  454  ASP ASP A . n 
A 1 458  GLN 458  455  455  GLN GLN A . n 
A 1 459  GLN 459  456  456  GLN GLN A . n 
A 1 460  THR 460  457  457  THR THR A . n 
A 1 461  PHE 461  458  458  PHE PHE A . n 
A 1 462  PHE 462  459  459  PHE PHE A . n 
A 1 463  CYS 463  460  460  CYS CYS A . n 
A 1 464  GLY 464  461  461  GLY GLY A . n 
A 1 465  ASN 465  462  462  ASN ASN A . n 
A 1 466  VAL 466  463  463  VAL VAL A . n 
A 1 467  ALA 467  464  464  ALA ALA A . n 
A 1 468  HIS 468  465  465  HIS HIS A . n 
A 1 469  GLN 469  466  466  GLN GLN A . n 
A 1 470  GLN 470  467  467  GLN GLN A . n 
A 1 471  LEU 471  468  468  LEU LEU A . n 
A 1 472  ILE 472  469  469  ILE ILE A . n 
A 1 473  GLN 473  470  470  GLN GLN A . n 
A 1 474  ILE 474  471  471  ILE ILE A . n 
A 1 475  THR 475  472  472  THR THR A . n 
A 1 476  SER 476  473  473  SER SER A . n 
A 1 477  ALA 477  474  474  ALA ALA A . n 
A 1 478  SER 478  475  475  SER SER A . n 
A 1 479  VAL 479  476  476  VAL VAL A . n 
A 1 480  ARG 480  477  477  ARG ARG A . n 
A 1 481  LEU 481  478  478  LEU LEU A . n 
A 1 482  VAL 482  479  479  VAL VAL A . n 
A 1 483  SER 483  480  480  SER SER A . n 
A 1 484  GLN 484  481  481  GLN GLN A . n 
A 1 485  GLU 485  482  482  GLU GLU A . n 
A 1 486  PRO 486  483  483  PRO PRO A . n 
A 1 487  LYS 487  484  484  LYS LYS A . n 
A 1 488  ALA 488  485  485  ALA ALA A . n 
A 1 489  LEU 489  486  486  LEU LEU A . n 
A 1 490  VAL 490  487  487  VAL VAL A . n 
A 1 491  SER 491  488  488  SER SER A . n 
A 1 492  GLU 492  489  489  GLU GLU A . n 
A 1 493  TRP 493  490  490  TRP TRP A . n 
A 1 494  LYS 494  491  491  LYS LYS A . n 
A 1 495  GLU 495  492  492  GLU GLU A . n 
A 1 496  PRO 496  493  493  PRO PRO A . n 
A 1 497  GLN 497  494  494  GLN GLN A . n 
A 1 498  ALA 498  495  495  ALA ALA A . n 
A 1 499  LYS 499  496  496  LYS LYS A . n 
A 1 500  ASN 500  497  497  ASN ASN A . n 
A 1 501  ILE 501  498  498  ILE ILE A . n 
A 1 502  SER 502  499  499  SER SER A . n 
A 1 503  VAL 503  500  500  VAL VAL A . n 
A 1 504  ALA 504  501  501  ALA ALA A . n 
A 1 505  SER 505  502  502  SER SER A . n 
A 1 506  CYS 506  503  503  CYS CYS A . n 
A 1 507  ASN 507  504  504  ASN ASN A . n 
A 1 508  SER 508  505  505  SER SER A . n 
A 1 509  SER 509  506  506  SER SER A . n 
A 1 510  GLN 510  507  507  GLN GLN A . n 
A 1 511  VAL 511  508  508  VAL VAL A . n 
A 1 512  VAL 512  509  509  VAL VAL A . n 
A 1 513  VAL 513  510  510  VAL VAL A . n 
A 1 514  ALA 514  511  511  ALA ALA A . n 
A 1 515  VAL 515  512  512  VAL VAL A . n 
A 1 516  GLY 516  513  513  GLY GLY A . n 
A 1 517  ARG 517  514  514  ARG ARG A . n 
A 1 518  ALA 518  515  515  ALA ALA A . n 
A 1 519  LEU 519  516  516  LEU LEU A . n 
A 1 520  TYR 520  517  517  TYR TYR A . n 
A 1 521  TYR 521  518  518  TYR TYR A . n 
A 1 522  LEU 522  519  519  LEU LEU A . n 
A 1 523  GLN 523  520  520  GLN GLN A . n 
A 1 524  ILE 524  521  521  ILE ILE A . n 
A 1 525  HIS 525  522  522  HIS HIS A . n 
A 1 526  PRO 526  523  523  PRO PRO A . n 
A 1 527  GLN 527  524  524  GLN GLN A . n 
A 1 528  GLU 528  525  525  GLU GLU A . n 
A 1 529  LEU 529  526  526  LEU LEU A . n 
A 1 530  ARG 530  527  527  ARG ARG A . n 
A 1 531  GLN 531  528  528  GLN GLN A . n 
A 1 532  ILE 532  529  529  ILE ILE A . n 
A 1 533  SER 533  530  530  SER SER A . n 
A 1 534  HIS 534  531  531  HIS HIS A . n 
A 1 535  THR 535  532  532  THR THR A . n 
A 1 536  GLU 536  533  533  GLU GLU A . n 
A 1 537  MET 537  534  534  MET MET A . n 
A 1 538  GLU 538  535  535  GLU GLU A . n 
A 1 539  HIS 539  536  536  HIS HIS A . n 
A 1 540  GLU 540  537  537  GLU GLU A . n 
A 1 541  VAL 541  538  538  VAL VAL A . n 
A 1 542  ALA 542  539  539  ALA ALA A . n 
A 1 543  CYS 543  540  540  CYS CYS A . n 
A 1 544  LEU 544  541  541  LEU LEU A . n 
A 1 545  ASP 545  542  542  ASP ASP A . n 
A 1 546  ILE 546  543  543  ILE ILE A . n 
A 1 547  THR 547  544  544  THR THR A . n 
A 1 548  PRO 548  545  545  PRO PRO A . n 
A 1 549  LEU 549  546  546  LEU LEU A . n 
A 1 550  GLY 550  547  547  GLY GLY A . n 
A 1 551  ASP 551  548  548  ASP ASP A . n 
A 1 552  SER 552  549  549  SER SER A . n 
A 1 553  ASN 553  550  550  ASN ASN A . n 
A 1 554  GLY 554  551  551  GLY GLY A . n 
A 1 555  LEU 555  552  552  LEU LEU A . n 
A 1 556  SER 556  553  553  SER SER A . n 
A 1 557  PRO 557  554  554  PRO PRO A . n 
A 1 558  LEU 558  555  555  LEU LEU A . n 
A 1 559  CYS 559  556  556  CYS CYS A . n 
A 1 560  ALA 560  557  557  ALA ALA A . n 
A 1 561  ILE 561  558  558  ILE ILE A . n 
A 1 562  GLY 562  559  559  GLY GLY A . n 
A 1 563  LEU 563  560  560  LEU LEU A . n 
A 1 564  TRP 564  561  561  TRP TRP A . n 
A 1 565  THR 565  562  562  THR THR A . n 
A 1 566  ASP 566  563  563  ASP ASP A . n 
A 1 567  ILE 567  564  564  ILE ILE A . n 
A 1 568  SER 568  565  565  SER SER A . n 
A 1 569  ALA 569  566  566  ALA ALA A . n 
A 1 570  ARG 570  567  567  ARG ARG A . n 
A 1 571  ILE 571  568  568  ILE ILE A . n 
A 1 572  LEU 572  569  569  LEU LEU A . n 
A 1 573  LYS 573  570  570  LYS LYS A . n 
A 1 574  LEU 574  571  571  LEU LEU A . n 
A 1 575  PRO 575  572  572  PRO PRO A . n 
A 1 576  SER 576  573  573  SER SER A . n 
A 1 577  PHE 577  574  574  PHE PHE A . n 
A 1 578  GLU 578  575  575  GLU GLU A . n 
A 1 579  LEU 579  576  576  LEU LEU A . n 
A 1 580  LEU 580  577  577  LEU LEU A . n 
A 1 581  HIS 581  578  578  HIS HIS A . n 
A 1 582  LYS 582  579  579  LYS LYS A . n 
A 1 583  GLU 583  580  580  GLU GLU A . n 
A 1 584  MET 584  581  581  MET MET A . n 
A 1 585  LEU 585  582  582  LEU LEU A . n 
A 1 586  GLY 586  583  583  GLY GLY A . n 
A 1 587  GLY 587  584  584  GLY GLY A . n 
A 1 588  GLU 588  585  585  GLU GLU A . n 
A 1 589  ILE 589  586  586  ILE ILE A . n 
A 1 590  ILE 590  587  587  ILE ILE A . n 
A 1 591  PRO 591  588  588  PRO PRO A . n 
A 1 592  ARG 592  589  589  ARG ARG A . n 
A 1 593  SER 593  590  590  SER SER A . n 
A 1 594  ILE 594  591  591  ILE ILE A . n 
A 1 595  LEU 595  592  592  LEU LEU A . n 
A 1 596  MET 596  593  593  MET MET A . n 
A 1 597  THR 597  594  594  THR THR A . n 
A 1 598  THR 598  595  595  THR THR A . n 
A 1 599  PHE 599  596  596  PHE PHE A . n 
A 1 600  GLU 600  597  597  GLU GLU A . n 
A 1 601  SER 601  598  598  SER SER A . n 
A 1 602  SER 602  599  599  SER SER A . n 
A 1 603  HIS 603  600  600  HIS HIS A . n 
A 1 604  TYR 604  601  601  TYR TYR A . n 
A 1 605  LEU 605  602  602  LEU LEU A . n 
A 1 606  LEU 606  603  603  LEU LEU A . n 
A 1 607  CYS 607  604  604  CYS CYS A . n 
A 1 608  ALA 608  605  605  ALA ALA A . n 
A 1 609  LEU 609  606  606  LEU LEU A . n 
A 1 610  GLY 610  607  607  GLY GLY A . n 
A 1 611  ASP 611  608  608  ASP ASP A . n 
A 1 612  GLY 612  609  609  GLY GLY A . n 
A 1 613  ALA 613  610  610  ALA ALA A . n 
A 1 614  LEU 614  611  611  LEU LEU A . n 
A 1 615  PHE 615  612  612  PHE PHE A . n 
A 1 616  TYR 616  613  613  TYR TYR A . n 
A 1 617  PHE 617  614  614  PHE PHE A . n 
A 1 618  GLY 618  615  615  GLY GLY A . n 
A 1 619  LEU 619  616  616  LEU LEU A . n 
A 1 620  ASN 620  617  617  ASN ASN A . n 
A 1 621  ILE 621  618  618  ILE ILE A . n 
A 1 622  GLU 622  619  619  GLU GLU A . n 
A 1 623  THR 623  620  620  THR THR A . n 
A 1 624  GLY 624  621  621  GLY GLY A . n 
A 1 625  LEU 625  622  622  LEU LEU A . n 
A 1 626  LEU 626  623  623  LEU LEU A . n 
A 1 627  SER 627  624  624  SER SER A . n 
A 1 628  ASP 628  625  625  ASP ASP A . n 
A 1 629  ARG 629  626  626  ARG ARG A . n 
A 1 630  LYS 630  627  627  LYS LYS A . n 
A 1 631  LYS 631  628  628  LYS LYS A . n 
A 1 632  VAL 632  629  629  VAL VAL A . n 
A 1 633  THR 633  630  630  THR THR A . n 
A 1 634  LEU 634  631  631  LEU LEU A . n 
A 1 635  GLY 635  632  632  GLY GLY A . n 
A 1 636  THR 636  633  633  THR THR A . n 
A 1 637  GLN 637  634  634  GLN GLN A . n 
A 1 638  PRO 638  635  635  PRO PRO A . n 
A 1 639  THR 639  636  636  THR THR A . n 
A 1 640  VAL 640  637  637  VAL VAL A . n 
A 1 641  LEU 641  638  638  LEU LEU A . n 
A 1 642  ARG 642  639  639  ARG ARG A . n 
A 1 643  THR 643  640  640  THR THR A . n 
A 1 644  PHE 644  641  641  PHE PHE A . n 
A 1 645  ARG 645  642  642  ARG ARG A . n 
A 1 646  SER 646  643  643  SER SER A . n 
A 1 647  LEU 647  644  644  LEU LEU A . n 
A 1 648  SER 648  645  645  SER SER A . n 
A 1 649  THR 649  646  646  THR THR A . n 
A 1 650  THR 650  647  647  THR THR A . n 
A 1 651  ASN 651  648  648  ASN ASN A . n 
A 1 652  VAL 652  649  649  VAL VAL A . n 
A 1 653  PHE 653  650  650  PHE PHE A . n 
A 1 654  ALA 654  651  651  ALA ALA A . n 
A 1 655  CYS 655  652  652  CYS CYS A . n 
A 1 656  SER 656  653  653  SER SER A . n 
A 1 657  ASP 657  654  654  ASP ASP A . n 
A 1 658  ARG 658  655  655  ARG ARG A . n 
A 1 659  PRO 659  656  656  PRO PRO A . n 
A 1 660  THR 660  657  657  THR THR A . n 
A 1 661  VAL 661  658  658  VAL VAL A . n 
A 1 662  ILE 662  659  659  ILE ILE A . n 
A 1 663  TYR 663  660  660  TYR TYR A . n 
A 1 664  SER 664  661  661  SER SER A . n 
A 1 665  SER 665  662  662  SER SER A . n 
A 1 666  ASN 666  663  663  ASN ASN A . n 
A 1 667  HIS 667  664  664  HIS HIS A . n 
A 1 668  LYS 668  665  665  LYS LYS A . n 
A 1 669  LEU 669  666  666  LEU LEU A . n 
A 1 670  VAL 670  667  667  VAL VAL A . n 
A 1 671  PHE 671  668  668  PHE PHE A . n 
A 1 672  SER 672  669  669  SER SER A . n 
A 1 673  ASN 673  670  670  ASN ASN A . n 
A 1 674  VAL 674  671  671  VAL VAL A . n 
A 1 675  ASN 675  672  672  ASN ASN A . n 
A 1 676  LEU 676  673  673  LEU LEU A . n 
A 1 677  LYS 677  674  674  LYS LYS A . n 
A 1 678  GLU 678  675  675  GLU GLU A . n 
A 1 679  VAL 679  676  676  VAL VAL A . n 
A 1 680  ASN 680  677  677  ASN ASN A . n 
A 1 681  TYR 681  678  678  TYR TYR A . n 
A 1 682  MET 682  679  679  MET MET A . n 
A 1 683  CYS 683  680  680  CYS CYS A . n 
A 1 684  PRO 684  681  681  PRO PRO A . n 
A 1 685  LEU 685  682  682  LEU LEU A . n 
A 1 686  ASN 686  683  683  ASN ASN A . n 
A 1 687  SER 687  684  684  SER SER A . n 
A 1 688  ASP 688  685  685  ASP ASP A . n 
A 1 689  GLY 689  686  686  GLY GLY A . n 
A 1 690  TYR 690  687  687  TYR TYR A . n 
A 1 691  PRO 691  688  688  PRO PRO A . n 
A 1 692  ASP 692  689  689  ASP ASP A . n 
A 1 693  SER 693  690  690  SER SER A . n 
A 1 694  LEU 694  691  691  LEU LEU A . n 
A 1 695  ALA 695  692  692  ALA ALA A . n 
A 1 696  LEU 696  693  693  LEU LEU A . n 
A 1 697  ALA 697  694  694  ALA ALA A . n 
A 1 698  ASN 698  695  695  ASN ASN A . n 
A 1 699  ASN 699  696  696  ASN ASN A . n 
A 1 700  SER 700  697  697  SER SER A . n 
A 1 701  THR 701  698  698  THR THR A . n 
A 1 702  LEU 702  699  699  LEU LEU A . n 
A 1 703  THR 703  700  700  THR THR A . n 
A 1 704  ILE 704  701  701  ILE ILE A . n 
A 1 705  GLY 705  702  702  GLY GLY A . n 
A 1 706  THR 706  703  703  THR THR A . n 
A 1 707  ILE 707  704  704  ILE ILE A . n 
A 1 708  ASP 708  705  705  ASP ASP A . n 
A 1 709  GLU 709  706  706  GLU GLU A . n 
A 1 710  ILE 710  707  707  ILE ILE A . n 
A 1 711  GLN 711  708  708  GLN GLN A . n 
A 1 712  LYS 712  709  709  LYS LYS A . n 
A 1 713  LEU 713  710  710  LEU LEU A . n 
A 1 714  HIS 714  711  711  HIS HIS A . n 
A 1 715  ILE 715  712  712  ILE ILE A . n 
A 1 716  ARG 716  713  713  ARG ARG A . n 
A 1 717  THR 717  714  714  THR THR A . n 
A 1 718  VAL 718  715  715  VAL VAL A . n 
A 1 719  PRO 719  716  716  PRO PRO A . n 
A 1 720  LEU 720  717  717  LEU LEU A . n 
A 1 721  TYR 721  718  718  TYR TYR A . n 
A 1 722  GLU 722  719  719  GLU GLU A . n 
A 1 723  SER 723  720  720  SER SER A . n 
A 1 724  PRO 724  721  721  PRO PRO A . n 
A 1 725  ARG 725  722  722  ARG ARG A . n 
A 1 726  LYS 726  723  723  LYS LYS A . n 
A 1 727  ILE 727  724  724  ILE ILE A . n 
A 1 728  CYS 728  725  725  CYS CYS A . n 
A 1 729  TYR 729  726  726  TYR TYR A . n 
A 1 730  GLN 730  727  727  GLN GLN A . n 
A 1 731  GLU 731  728  728  GLU GLU A . n 
A 1 732  VAL 732  729  729  VAL VAL A . n 
A 1 733  SER 733  730  730  SER SER A . n 
A 1 734  GLN 734  731  731  GLN GLN A . n 
A 1 735  CYS 735  732  732  CYS CYS A . n 
A 1 736  PHE 736  733  733  PHE PHE A . n 
A 1 737  GLY 737  734  734  GLY GLY A . n 
A 1 738  VAL 738  735  735  VAL VAL A . n 
A 1 739  LEU 739  736  736  LEU LEU A . n 
A 1 740  SER 740  737  737  SER SER A . n 
A 1 741  SER 741  738  738  SER SER A . n 
A 1 742  ARG 742  739  739  ARG ARG A . n 
A 1 743  ILE 743  740  740  ILE ILE A . n 
A 1 744  GLU 744  741  741  GLU GLU A . n 
A 1 745  VAL 745  742  742  VAL VAL A . n 
A 1 746  GLN 746  743  743  GLN GLN A . n 
A 1 747  ASP 747  744  744  ASP ASP A . n 
A 1 748  THR 748  745  745  THR THR A . n 
A 1 749  SER 749  746  746  SER SER A . n 
A 1 750  GLY 750  747  747  GLY GLY A . n 
A 1 751  GLY 751  748  748  GLY GLY A . n 
A 1 752  THR 752  749  749  THR THR A . n 
A 1 753  THR 753  750  750  THR THR A . n 
A 1 754  ALA 754  751  751  ALA ALA A . n 
A 1 755  LEU 755  752  752  LEU LEU A . n 
A 1 756  ARG 756  753  753  ARG ARG A . n 
A 1 757  PRO 757  754  754  PRO PRO A . n 
A 1 758  SER 758  755  755  SER SER A . n 
A 1 759  ALA 759  756  756  ALA ALA A . n 
A 1 760  SER 760  757  757  SER SER A . n 
A 1 761  THR 761  758  758  THR THR A . n 
A 1 762  GLN 762  759  759  GLN GLN A . n 
A 1 763  ALA 763  760  760  ALA ALA A . n 
A 1 764  LEU 764  761  761  LEU LEU A . n 
A 1 765  SER 765  762  762  SER SER A . n 
A 1 766  SER 766  763  763  SER SER A . n 
A 1 767  SER 767  764  764  SER SER A . n 
A 1 768  VAL 768  765  765  VAL VAL A . n 
A 1 769  SER 769  766  766  SER SER A . n 
A 1 770  SER 770  767  767  SER SER A . n 
A 1 771  SER 771  768  768  SER SER A . n 
A 1 772  LYS 772  769  769  LYS LYS A . n 
A 1 773  LEU 773  770  770  LEU LEU A . n 
A 1 774  PHE 774  771  771  PHE PHE A . n 
A 1 775  SER 775  772  772  SER SER A . n 
A 1 776  SER 776  773  773  SER SER A . n 
A 1 777  SER 777  774  ?    ?   ?   A . n 
A 1 778  THR 778  775  ?    ?   ?   A . n 
A 1 779  ALA 779  776  ?    ?   ?   A . n 
A 1 780  PRO 780  777  ?    ?   ?   A . n 
A 1 781  HIS 781  778  ?    ?   ?   A . n 
A 1 782  GLU 782  779  ?    ?   ?   A . n 
A 1 783  THR 783  780  ?    ?   ?   A . n 
A 1 784  SER 784  781  ?    ?   ?   A . n 
A 1 785  PHE 785  782  ?    ?   ?   A . n 
A 1 786  GLY 786  783  783  GLY GLY A . n 
A 1 787  GLU 787  784  784  GLU GLU A . n 
A 1 788  GLU 788  785  785  GLU GLU A . n 
A 1 789  VAL 789  786  786  VAL VAL A . n 
A 1 790  GLU 790  787  787  GLU GLU A . n 
A 1 791  VAL 791  788  788  VAL VAL A . n 
A 1 792  HIS 792  789  789  HIS HIS A . n 
A 1 793  ASN 793  790  790  ASN ASN A . n 
A 1 794  LEU 794  791  791  LEU LEU A . n 
A 1 795  LEU 795  792  792  LEU LEU A . n 
A 1 796  ILE 796  793  793  ILE ILE A . n 
A 1 797  ILE 797  794  794  ILE ILE A . n 
A 1 798  ASP 798  795  795  ASP ASP A . n 
A 1 799  GLN 799  796  796  GLN GLN A . n 
A 1 800  HIS 800  797  797  HIS HIS A . n 
A 1 801  THR 801  798  798  THR THR A . n 
A 1 802  PHE 802  799  799  PHE PHE A . n 
A 1 803  GLU 803  800  800  GLU GLU A . n 
A 1 804  VAL 804  801  801  VAL VAL A . n 
A 1 805  LEU 805  802  802  LEU LEU A . n 
A 1 806  HIS 806  803  803  HIS HIS A . n 
A 1 807  ALA 807  804  804  ALA ALA A . n 
A 1 808  HIS 808  805  805  HIS HIS A . n 
A 1 809  GLN 809  806  806  GLN GLN A . n 
A 1 810  PHE 810  807  807  PHE PHE A . n 
A 1 811  LEU 811  808  808  LEU LEU A . n 
A 1 812  GLN 812  809  809  GLN GLN A . n 
A 1 813  ASN 813  810  810  ASN ASN A . n 
A 1 814  GLU 814  811  811  GLU GLU A . n 
A 1 815  TYR 815  812  812  TYR TYR A . n 
A 1 816  ALA 816  813  813  ALA ALA A . n 
A 1 817  LEU 817  814  814  LEU LEU A . n 
A 1 818  SER 818  815  815  SER SER A . n 
A 1 819  LEU 819  816  816  LEU LEU A . n 
A 1 820  VAL 820  817  817  VAL VAL A . n 
A 1 821  SER 821  818  818  SER SER A . n 
A 1 822  CYS 822  819  819  CYS CYS A . n 
A 1 823  LYS 823  820  820  LYS LYS A . n 
A 1 824  LEU 824  821  821  LEU LEU A . n 
A 1 825  GLY 825  822  822  GLY GLY A . n 
A 1 826  LYS 826  823  823  LYS LYS A . n 
A 1 827  ASP 827  824  824  ASP ASP A . n 
A 1 828  PRO 828  825  825  PRO PRO A . n 
A 1 829  ASN 829  826  826  ASN ASN A . n 
A 1 830  THR 830  827  827  THR THR A . n 
A 1 831  TYR 831  828  828  TYR TYR A . n 
A 1 832  PHE 832  829  829  PHE PHE A . n 
A 1 833  ILE 833  830  830  ILE ILE A . n 
A 1 834  VAL 834  831  831  VAL VAL A . n 
A 1 835  GLY 835  832  832  GLY GLY A . n 
A 1 836  THR 836  833  833  THR THR A . n 
A 1 837  ALA 837  834  834  ALA ALA A . n 
A 1 838  MET 838  835  835  MET MET A . n 
A 1 839  VAL 839  836  836  VAL VAL A . n 
A 1 840  TYR 840  837  837  TYR TYR A . n 
A 1 841  PRO 841  838  838  PRO PRO A . n 
A 1 842  GLU 842  839  839  GLU GLU A . n 
A 1 843  GLU 843  840  840  GLU GLU A . n 
A 1 844  ALA 844  841  841  ALA ALA A . n 
A 1 845  GLU 845  842  842  GLU GLU A . n 
A 1 846  PRO 846  843  843  PRO PRO A . n 
A 1 847  LYS 847  844  844  LYS LYS A . n 
A 1 848  GLN 848  845  845  GLN GLN A . n 
A 1 849  GLY 849  846  846  GLY GLY A . n 
A 1 850  ARG 850  847  847  ARG ARG A . n 
A 1 851  ILE 851  848  848  ILE ILE A . n 
A 1 852  VAL 852  849  849  VAL VAL A . n 
A 1 853  VAL 853  850  850  VAL VAL A . n 
A 1 854  PHE 854  851  851  PHE PHE A . n 
A 1 855  GLN 855  852  852  GLN GLN A . n 
A 1 856  TYR 856  853  853  TYR TYR A . n 
A 1 857  SER 857  854  854  SER SER A . n 
A 1 858  ASP 858  855  855  ASP ASP A . n 
A 1 859  GLY 859  856  856  GLY GLY A . n 
A 1 860  LYS 860  857  857  LYS LYS A . n 
A 1 861  LEU 861  858  858  LEU LEU A . n 
A 1 862  GLN 862  859  859  GLN GLN A . n 
A 1 863  THR 863  860  860  THR THR A . n 
A 1 864  VAL 864  861  861  VAL VAL A . n 
A 1 865  ALA 865  862  862  ALA ALA A . n 
A 1 866  GLU 866  863  863  GLU GLU A . n 
A 1 867  LYS 867  864  864  LYS LYS A . n 
A 1 868  GLU 868  865  865  GLU GLU A . n 
A 1 869  VAL 869  866  866  VAL VAL A . n 
A 1 870  LYS 870  867  867  LYS LYS A . n 
A 1 871  GLY 871  868  868  GLY GLY A . n 
A 1 872  ALA 872  869  869  ALA ALA A . n 
A 1 873  VAL 873  870  870  VAL VAL A . n 
A 1 874  TYR 874  871  871  TYR TYR A . n 
A 1 875  SER 875  872  872  SER SER A . n 
A 1 876  MET 876  873  873  MET MET A . n 
A 1 877  VAL 877  874  874  VAL VAL A . n 
A 1 878  GLU 878  875  875  GLU GLU A . n 
A 1 879  PHE 879  876  876  PHE PHE A . n 
A 1 880  ASN 880  877  877  ASN ASN A . n 
A 1 881  GLY 881  878  878  GLY GLY A . n 
A 1 882  LYS 882  879  879  LYS LYS A . n 
A 1 883  LEU 883  880  880  LEU LEU A . n 
A 1 884  LEU 884  881  881  LEU LEU A . n 
A 1 885  ALA 885  882  882  ALA ALA A . n 
A 1 886  SER 886  883  883  SER SER A . n 
A 1 887  ILE 887  884  884  ILE ILE A . n 
A 1 888  ASN 888  885  885  ASN ASN A . n 
A 1 889  SER 889  886  886  SER SER A . n 
A 1 890  THR 890  887  887  THR THR A . n 
A 1 891  VAL 891  888  888  VAL VAL A . n 
A 1 892  ARG 892  889  889  ARG ARG A . n 
A 1 893  LEU 893  890  890  LEU LEU A . n 
A 1 894  TYR 894  891  891  TYR TYR A . n 
A 1 895  GLU 895  892  892  GLU GLU A . n 
A 1 896  TRP 896  893  893  TRP TRP A . n 
A 1 897  THR 897  894  894  THR THR A . n 
A 1 898  THR 898  895  895  THR THR A . n 
A 1 899  GLU 899  896  896  GLU GLU A . n 
A 1 900  LYS 900  897  897  LYS LYS A . n 
A 1 901  ASP 901  898  898  ASP ASP A . n 
A 1 902  VAL 902  899  899  VAL VAL A . n 
A 1 903  ARG 903  900  900  ARG ARG A . n 
A 1 904  THR 904  901  901  THR THR A . n 
A 1 905  GLU 905  902  902  GLU GLU A . n 
A 1 906  CYS 906  903  903  CYS CYS A . n 
A 1 907  ASN 907  904  904  ASN ASN A . n 
A 1 908  HIS 908  905  905  HIS HIS A . n 
A 1 909  TYR 909  906  906  TYR TYR A . n 
A 1 910  ASN 910  907  907  ASN ASN A . n 
A 1 911  ASN 911  908  908  ASN ASN A . n 
A 1 912  ILE 912  909  909  ILE ILE A . n 
A 1 913  MET 913  910  910  MET MET A . n 
A 1 914  ALA 914  911  911  ALA ALA A . n 
A 1 915  LEU 915  912  912  LEU LEU A . n 
A 1 916  TYR 916  913  913  TYR TYR A . n 
A 1 917  LEU 917  914  914  LEU LEU A . n 
A 1 918  LYS 918  915  915  LYS LYS A . n 
A 1 919  THR 919  916  916  THR THR A . n 
A 1 920  LYS 920  917  917  LYS LYS A . n 
A 1 921  GLY 921  918  918  GLY GLY A . n 
A 1 922  ASP 922  919  919  ASP ASP A . n 
A 1 923  PHE 923  920  920  PHE PHE A . n 
A 1 924  ILE 924  921  921  ILE ILE A . n 
A 1 925  LEU 925  922  922  LEU LEU A . n 
A 1 926  VAL 926  923  923  VAL VAL A . n 
A 1 927  GLY 927  924  924  GLY GLY A . n 
A 1 928  ASP 928  925  925  ASP ASP A . n 
A 1 929  LEU 929  926  926  LEU LEU A . n 
A 1 930  MET 930  927  927  MET MET A . n 
A 1 931  ARG 931  928  928  ARG ARG A . n 
A 1 932  SER 932  929  929  SER SER A . n 
A 1 933  VAL 933  930  930  VAL VAL A . n 
A 1 934  LEU 934  931  931  LEU LEU A . n 
A 1 935  LEU 935  932  932  LEU LEU A . n 
A 1 936  LEU 936  933  933  LEU LEU A . n 
A 1 937  ALA 937  934  934  ALA ALA A . n 
A 1 938  TYR 938  935  935  TYR TYR A . n 
A 1 939  LYS 939  936  936  LYS LYS A . n 
A 1 940  PRO 940  937  937  PRO PRO A . n 
A 1 941  MET 941  938  938  MET MET A . n 
A 1 942  GLU 942  939  939  GLU GLU A . n 
A 1 943  GLY 943  940  940  GLY GLY A . n 
A 1 944  ASN 944  941  941  ASN ASN A . n 
A 1 945  PHE 945  942  942  PHE PHE A . n 
A 1 946  GLU 946  943  943  GLU GLU A . n 
A 1 947  GLU 947  944  944  GLU GLU A . n 
A 1 948  ILE 948  945  945  ILE ILE A . n 
A 1 949  ALA 949  946  946  ALA ALA A . n 
A 1 950  ARG 950  947  947  ARG ARG A . n 
A 1 951  ASP 951  948  948  ASP ASP A . n 
A 1 952  PHE 952  949  949  PHE PHE A . n 
A 1 953  ASN 953  950  950  ASN ASN A . n 
A 1 954  PRO 954  951  951  PRO PRO A . n 
A 1 955  ASN 955  952  952  ASN ASN A . n 
A 1 956  TRP 956  953  953  TRP TRP A . n 
A 1 957  MET 957  954  954  MET MET A . n 
A 1 958  SER 958  955  955  SER SER A . n 
A 1 959  ALA 959  956  956  ALA ALA A . n 
A 1 960  VAL 960  957  957  VAL VAL A . n 
A 1 961  GLU 961  958  958  GLU GLU A . n 
A 1 962  ILE 962  959  959  ILE ILE A . n 
A 1 963  LEU 963  960  960  LEU LEU A . n 
A 1 964  ASP 964  961  961  ASP ASP A . n 
A 1 965  ASP 965  962  962  ASP ASP A . n 
A 1 966  ASP 966  963  963  ASP ASP A . n 
A 1 967  ASN 967  964  964  ASN ASN A . n 
A 1 968  PHE 968  965  965  PHE PHE A . n 
A 1 969  LEU 969  966  966  LEU LEU A . n 
A 1 970  GLY 970  967  967  GLY GLY A . n 
A 1 971  ALA 971  968  968  ALA ALA A . n 
A 1 972  GLU 972  969  969  GLU GLU A . n 
A 1 973  ASN 973  970  970  ASN ASN A . n 
A 1 974  ALA 974  971  971  ALA ALA A . n 
A 1 975  PHE 975  972  972  PHE PHE A . n 
A 1 976  ASN 976  973  973  ASN ASN A . n 
A 1 977  LEU 977  974  974  LEU LEU A . n 
A 1 978  PHE 978  975  975  PHE PHE A . n 
A 1 979  VAL 979  976  976  VAL VAL A . n 
A 1 980  CYS 980  977  977  CYS CYS A . n 
A 1 981  GLN 981  978  978  GLN GLN A . n 
A 1 982  LYS 982  979  979  LYS LYS A . n 
A 1 983  ASP 983  980  980  ASP ASP A . n 
A 1 984  SER 984  981  981  SER SER A . n 
A 1 985  ALA 985  982  982  ALA ALA A . n 
A 1 986  ALA 986  983  983  ALA ALA A . n 
A 1 987  THR 987  984  984  THR THR A . n 
A 1 988  THR 988  985  985  THR THR A . n 
A 1 989  ASP 989  986  986  ASP ASP A . n 
A 1 990  GLU 990  987  987  GLU GLU A . n 
A 1 991  GLU 991  988  988  GLU GLU A . n 
A 1 992  ARG 992  989  989  ARG ARG A . n 
A 1 993  GLN 993  990  990  GLN GLN A . n 
A 1 994  HIS 994  991  991  HIS HIS A . n 
A 1 995  LEU 995  992  992  LEU LEU A . n 
A 1 996  GLN 996  993  993  GLN GLN A . n 
A 1 997  GLU 997  994  994  GLU GLU A . n 
A 1 998  VAL 998  995  995  VAL VAL A . n 
A 1 999  GLY 999  996  996  GLY GLY A . n 
A 1 1000 LEU 1000 997  997  LEU LEU A . n 
A 1 1001 PHE 1001 998  998  PHE PHE A . n 
A 1 1002 HIS 1002 999  999  HIS HIS A . n 
A 1 1003 LEU 1003 1000 1000 LEU LEU A . n 
A 1 1004 GLY 1004 1001 1001 GLY GLY A . n 
A 1 1005 GLU 1005 1002 1002 GLU GLU A . n 
A 1 1006 PHE 1006 1003 1003 PHE PHE A . n 
A 1 1007 VAL 1007 1004 1004 VAL VAL A . n 
A 1 1008 ASN 1008 1005 1005 ASN ASN A . n 
A 1 1009 VAL 1009 1006 1006 VAL VAL A . n 
A 1 1010 PHE 1010 1007 1007 PHE PHE A . n 
A 1 1011 CYS 1011 1008 1008 CYS CYS A . n 
A 1 1012 HIS 1012 1009 1009 HIS HIS A . n 
A 1 1013 GLY 1013 1010 1010 GLY GLY A . n 
A 1 1014 SER 1014 1011 1011 SER SER A . n 
A 1 1015 LEU 1015 1012 1012 LEU LEU A . n 
A 1 1016 VAL 1016 1013 1013 VAL VAL A . n 
A 1 1017 MET 1017 1014 1014 MET MET A . n 
A 1 1018 GLN 1018 1015 1015 GLN GLN A . n 
A 1 1019 ASN 1019 1016 ?    ?   ?   A . n 
A 1 1020 LEU 1020 1017 ?    ?   ?   A . n 
A 1 1021 GLY 1021 1018 ?    ?   ?   A . n 
A 1 1022 GLU 1022 1019 ?    ?   ?   A . n 
A 1 1023 THR 1023 1020 ?    ?   ?   A . n 
A 1 1024 SER 1024 1021 ?    ?   ?   A . n 
A 1 1025 THR 1025 1022 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1023 1023 PRO PRO A . n 
A 1 1027 THR 1027 1024 1024 THR THR A . n 
A 1 1028 GLN 1028 1025 1025 GLN GLN A . n 
A 1 1029 GLY 1029 1026 1026 GLY GLY A . n 
A 1 1030 SER 1030 1027 1027 SER SER A . n 
A 1 1031 VAL 1031 1028 1028 VAL VAL A . n 
A 1 1032 LEU 1032 1029 1029 LEU LEU A . n 
A 1 1033 PHE 1033 1030 1030 PHE PHE A . n 
A 1 1034 GLY 1034 1031 1031 GLY GLY A . n 
A 1 1035 THR 1035 1032 1032 THR THR A . n 
A 1 1036 VAL 1036 1033 1033 VAL VAL A . n 
A 1 1037 ASN 1037 1034 1034 ASN ASN A . n 
A 1 1038 GLY 1038 1035 1035 GLY GLY A . n 
A 1 1039 MET 1039 1036 1036 MET MET A . n 
A 1 1040 ILE 1040 1037 1037 ILE ILE A . n 
A 1 1041 GLY 1041 1038 1038 GLY GLY A . n 
A 1 1042 LEU 1042 1039 1039 LEU LEU A . n 
A 1 1043 VAL 1043 1040 1040 VAL VAL A . n 
A 1 1044 THR 1044 1041 1041 THR THR A . n 
A 1 1045 SER 1045 1042 1042 SER SER A . n 
A 1 1046 LEU 1046 1043 1043 LEU LEU A . n 
A 1 1047 SER 1047 1044 1044 SER SER A . n 
A 1 1048 GLU 1048 1045 1045 GLU GLU A . n 
A 1 1049 SER 1049 1046 1046 SER SER A . n 
A 1 1050 TRP 1050 1047 1047 TRP TRP A . n 
A 1 1051 TYR 1051 1048 1048 TYR TYR A . n 
A 1 1052 ASN 1052 1049 1049 ASN ASN A . n 
A 1 1053 LEU 1053 1050 1050 LEU LEU A . n 
A 1 1054 LEU 1054 1051 1051 LEU LEU A . n 
A 1 1055 LEU 1055 1052 1052 LEU LEU A . n 
A 1 1056 ASP 1056 1053 1053 ASP ASP A . n 
A 1 1057 MET 1057 1054 1054 MET MET A . n 
A 1 1058 GLN 1058 1055 1055 GLN GLN A . n 
A 1 1059 ASN 1059 1056 1056 ASN ASN A . n 
A 1 1060 ARG 1060 1057 1057 ARG ARG A . n 
A 1 1061 LEU 1061 1058 1058 LEU LEU A . n 
A 1 1062 ASN 1062 1059 1059 ASN ASN A . n 
A 1 1063 LYS 1063 1060 1060 LYS LYS A . n 
A 1 1064 VAL 1064 1061 1061 VAL VAL A . n 
A 1 1065 ILE 1065 1062 1062 ILE ILE A . n 
A 1 1066 LYS 1066 1063 1063 LYS LYS A . n 
A 1 1067 SER 1067 1064 1064 SER SER A . n 
A 1 1068 VAL 1068 1065 1065 VAL VAL A . n 
A 1 1069 GLY 1069 1066 1066 GLY GLY A . n 
A 1 1070 LYS 1070 1067 1067 LYS LYS A . n 
A 1 1071 ILE 1071 1068 1068 ILE ILE A . n 
A 1 1072 GLU 1072 1069 1069 GLU GLU A . n 
A 1 1073 HIS 1073 1070 1070 HIS HIS A . n 
A 1 1074 SER 1074 1071 1071 SER SER A . n 
A 1 1075 PHE 1075 1072 1072 PHE PHE A . n 
A 1 1076 TRP 1076 1073 1073 TRP TRP A . n 
A 1 1077 ARG 1077 1074 1074 ARG ARG A . n 
A 1 1078 SER 1078 1075 1075 SER SER A . n 
A 1 1079 PHE 1079 1076 1076 PHE PHE A . n 
A 1 1080 HIS 1080 1077 1077 HIS HIS A . n 
A 1 1081 THR 1081 1078 1078 THR THR A . n 
A 1 1082 GLU 1082 1079 1079 GLU GLU A . n 
A 1 1083 ARG 1083 1080 1080 ARG ARG A . n 
A 1 1084 LYS 1084 1081 1081 LYS LYS A . n 
A 1 1085 THR 1085 1082 1082 THR THR A . n 
A 1 1086 GLU 1086 1083 1083 GLU GLU A . n 
A 1 1087 PRO 1087 1084 1084 PRO PRO A . n 
A 1 1088 ALA 1088 1085 1085 ALA ALA A . n 
A 1 1089 THR 1089 1086 1086 THR THR A . n 
A 1 1090 GLY 1090 1087 1087 GLY GLY A . n 
A 1 1091 PHE 1091 1088 1088 PHE PHE A . n 
A 1 1092 ILE 1092 1089 1089 ILE ILE A . n 
A 1 1093 ASP 1093 1090 1090 ASP ASP A . n 
A 1 1094 GLY 1094 1091 1091 GLY GLY A . n 
A 1 1095 ASP 1095 1092 1092 ASP ASP A . n 
A 1 1096 LEU 1096 1093 1093 LEU LEU A . n 
A 1 1097 ILE 1097 1094 1094 ILE ILE A . n 
A 1 1098 GLU 1098 1095 1095 GLU GLU A . n 
A 1 1099 SER 1099 1096 1096 SER SER A . n 
A 1 1100 PHE 1100 1097 1097 PHE PHE A . n 
A 1 1101 LEU 1101 1098 1098 LEU LEU A . n 
A 1 1102 ASP 1102 1099 1099 ASP ASP A . n 
A 1 1103 ILE 1103 1100 1100 ILE ILE A . n 
A 1 1104 SER 1104 1101 1101 SER SER A . n 
A 1 1105 ARG 1105 1102 1102 ARG ARG A . n 
A 1 1106 PRO 1106 1103 1103 PRO PRO A . n 
A 1 1107 LYS 1107 1104 1104 LYS LYS A . n 
A 1 1108 MET 1108 1105 1105 MET MET A . n 
A 1 1109 GLN 1109 1106 1106 GLN GLN A . n 
A 1 1110 GLU 1110 1107 1107 GLU GLU A . n 
A 1 1111 VAL 1111 1108 1108 VAL VAL A . n 
A 1 1112 VAL 1112 1109 1109 VAL VAL A . n 
A 1 1113 ALA 1113 1110 1110 ALA ALA A . n 
A 1 1114 ASN 1114 1111 1111 ASN ASN A . n 
A 1 1115 LEU 1115 1112 ?    ?   ?   A . n 
A 1 1116 GLN 1116 1113 ?    ?   ?   A . n 
A 1 1117 TYR 1117 1114 ?    ?   ?   A . n 
A 1 1118 ASP 1118 1115 ?    ?   ?   A . n 
A 1 1119 ASP 1119 1116 ?    ?   ?   A . n 
A 1 1120 GLY 1120 1117 ?    ?   ?   A . n 
A 1 1121 SER 1121 1118 ?    ?   ?   A . n 
A 1 1122 GLY 1122 1119 ?    ?   ?   A . n 
A 1 1123 MET 1123 1120 ?    ?   ?   A . n 
A 1 1124 LYS 1124 1121 ?    ?   ?   A . n 
A 1 1125 ARG 1125 1122 1122 ARG ARG A . n 
A 1 1126 GLU 1126 1123 1123 GLU GLU A . n 
A 1 1127 ALA 1127 1124 1124 ALA ALA A . n 
A 1 1128 THR 1128 1125 1125 THR THR A . n 
A 1 1129 ALA 1129 1126 1126 ALA ALA A . n 
A 1 1130 ASP 1130 1127 1127 ASP ASP A . n 
A 1 1131 ASP 1131 1128 1128 ASP ASP A . n 
A 1 1132 LEU 1132 1129 1129 LEU LEU A . n 
A 1 1133 ILE 1133 1130 1130 ILE ILE A . n 
A 1 1134 LYS 1134 1131 1131 LYS LYS A . n 
A 1 1135 VAL 1135 1132 1132 VAL VAL A . n 
A 1 1136 VAL 1136 1133 1133 VAL VAL A . n 
A 1 1137 GLU 1137 1134 1134 GLU GLU A . n 
A 1 1138 GLU 1138 1135 1135 GLU GLU A . n 
A 1 1139 LEU 1139 1136 1136 LEU LEU A . n 
A 1 1140 THR 1140 1137 1137 THR THR A . n 
A 1 1141 ARG 1141 1138 1138 ARG ARG A . n 
A 1 1142 ILE 1142 1139 1139 ILE ILE A . n 
A 1 1143 HIS 1143 1140 1140 HIS HIS A . n 
B 2 1    SER 1    45   45   SER SER B . n 
B 2 2    LEU 2    46   46   LEU LEU B . n 
B 2 3    VAL 3    47   47   VAL VAL B . n 
B 2 4    TYR 4    48   48   TYR TYR B . n 
B 2 5    TYR 5    49   49   TYR TYR B . n 
B 2 6    LEU 6    50   50   LEU LEU B . n 
B 2 7    LYS 7    51   51   LYS LYS B . n 
B 2 8    ASN 8    52   52   ASN ASN B . n 
B 2 9    ARG 9    53   53   ARG ARG B . n 
B 2 10   GLU 10   54   54   GLU GLU B . n 
B 2 11   VAL 11   55   55   VAL VAL B . n 
B 2 12   ARG 12   56   56   ARG ARG B . n 
B 2 13   LEU 13   57   57   LEU LEU B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1450  ? 
1 MORE         -9    ? 
1 'SSA (A^2)'  47670 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3I7P 
_pdbx_entry_details.sequence_details     'MUTATIONS OCCURRED DURING THE CLONING OF DDB1' 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A CYS 725  ? ? SG A CYS 725  ? ? 1.643 1.812 -0.169 0.016 N 
2 1 CB A CYS 1008 ? ? SG A CYS 1008 ? ? 1.674 1.812 -0.138 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A PRO 185  ? ? CA A PRO 185  ? ? C   A PRO 185  ? ? 125.17 111.70 13.47  2.10 N 
2  1 N  A PRO 185  ? ? CA A PRO 185  ? ? C   A PRO 185  ? ? 128.54 112.10 16.44  2.60 N 
3  1 N  A GLN 186  ? ? CA A GLN 186  ? ? CB  A GLN 186  ? ? 83.34  110.60 -27.26 1.80 N 
4  1 NE A ARG 327  ? ? CZ A ARG 327  ? ? NH1 A ARG 327  ? ? 123.45 120.30 3.15   0.50 N 
5  1 CB A ASP 330  ? ? CG A ASP 330  ? ? OD1 A ASP 330  ? ? 125.17 118.30 6.87   0.90 N 
6  1 N  A LEU 367  ? ? CA A LEU 367  ? ? CB  A LEU 367  ? ? 89.16  110.40 -21.24 2.00 N 
7  1 CA A LEU 576  ? ? CB A LEU 576  ? ? CG  A LEU 576  ? ? 129.52 115.30 14.22  2.30 N 
8  1 CA A CYS 725  ? ? CB A CYS 725  ? ? SG  A CYS 725  ? ? 101.92 114.00 -12.08 1.80 N 
9  1 N  A ARG 1080 ? ? CA A ARG 1080 ? ? CB  A ARG 1080 ? ? 79.57  110.60 -31.03 1.80 N 
10 1 N  A ARG 1080 ? ? CA A ARG 1080 ? ? C   A ARG 1080 ? ? 133.54 111.00 22.54  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASP A 28   ? ? 179.80  141.53  
2   1 LYS A 35   ? ? -87.77  -106.41 
3   1 TYR A 58   ? ? -100.44 45.90   
4   1 ILE A 61   ? ? -59.03  108.79  
5   1 ASN A 85   ? ? -67.04  96.01   
6   1 HIS A 105  ? ? -173.99 142.26  
7   1 SER A 116  ? ? -100.64 -160.50 
8   1 THR A 118  ? ? 103.92  3.34    
9   1 ASP A 148  ? ? -96.45  -117.70 
10  1 ASN A 149  ? ? 39.84   26.49   
11  1 LEU A 152  ? ? 32.25   65.37   
12  1 HIS A 163  ? ? -156.91 57.73   
13  1 PRO A 176  ? ? -36.57  132.82  
14  1 GLN A 186  ? ? -68.32  3.68    
15  1 LYS A 204  ? ? -26.26  116.45  
16  1 PRO A 206  ? ? -58.86  -7.42   
17  1 GLU A 210  ? ? -116.95 -159.84 
18  1 ALA A 214  ? ? -25.97  -31.70  
19  1 SER A 217  ? ? -149.18 -25.43  
20  1 GLU A 224  ? ? -18.39  -60.33  
21  1 GLU A 235  ? ? 45.22   -9.82   
22  1 ALA A 247  ? ? -172.84 133.93  
23  1 VAL A 259  ? ? -153.67 -25.43  
24  1 MET A 291  ? ? -38.23  -76.67  
25  1 ASP A 292  ? ? -102.39 71.53   
26  1 THR A 296  ? ? -83.44  -154.28 
27  1 THR A 308  ? ? -124.74 -168.89 
28  1 LEU A 317  ? ? -107.47 -126.18 
29  1 ASP A 318  ? ? -64.18  -102.07 
30  1 GLU A 342  ? ? -32.97  123.75  
31  1 GLN A 343  ? ? 100.54  -26.98  
32  1 ARG A 369  ? ? 76.21   54.89   
33  1 GLN A 370  ? ? -101.60 -70.80  
34  1 PHE A 382  ? ? 48.80   -139.71 
35  1 SER A 401  ? ? -161.26 94.55   
36  1 PRO A 405  ? ? -64.47  74.05   
37  1 ILE A 407  ? ? 0.45    105.58  
38  1 LEU A 413  ? ? 179.97  89.29   
39  1 ASN A 418  ? ? -101.91 -69.28  
40  1 VAL A 430  ? ? -55.14  53.93   
41  1 PHE A 459  ? ? 171.84  153.84  
42  1 CYS A 460  ? ? -151.85 -4.51   
43  1 ASN A 462  ? ? -152.29 65.79   
44  1 HIS A 465  ? ? 72.19   40.41   
45  1 ALA A 474  ? ? -69.81  -95.73  
46  1 GLU A 482  ? ? -74.31  -75.19  
47  1 LYS A 484  ? ? 62.41   64.91   
48  1 ALA A 485  ? ? 157.89  110.65  
49  1 LEU A 486  ? ? 64.04   -8.72   
50  1 VAL A 487  ? ? -17.10  -58.01  
51  1 GLU A 489  ? ? -177.64 124.02  
52  1 PRO A 493  ? ? -61.93  74.81   
53  1 GLN A 494  ? ? 171.65  -7.07   
54  1 ALA A 495  ? ? 61.46   67.34   
55  1 CYS A 503  ? ? 170.51  144.66  
56  1 ASN A 504  ? ? -105.15 -61.94  
57  1 SER A 505  ? ? -178.83 -2.99   
58  1 SER A 506  ? ? -138.12 -55.09  
59  1 VAL A 510  ? ? -107.89 -166.73 
60  1 TYR A 517  ? ? -69.52  -150.15 
61  1 TYR A 518  ? ? 174.05  131.35  
62  1 PRO A 523  ? ? -34.01  76.72   
63  1 GLN A 524  ? ? 102.42  9.92    
64  1 ILE A 529  ? ? -146.30 -98.91  
65  1 HIS A 531  ? ? -170.82 137.07  
66  1 GLU A 535  ? ? -19.36  -59.92  
67  1 LEU A 546  ? ? -88.58  -105.30 
68  1 ASP A 548  ? ? -86.70  39.78   
69  1 PRO A 554  ? ? -52.13  -135.00 
70  1 LEU A 555  ? ? -69.27  -176.96 
71  1 ILE A 564  ? ? 45.41   84.68   
72  1 LYS A 570  ? ? -86.52  -155.64 
73  1 LEU A 571  ? ? -104.91 -86.78  
74  1 LEU A 577  ? ? -97.57  -114.77 
75  1 PHE A 596  ? ? -141.48 -58.72  
76  1 GLU A 597  ? ? -129.54 -112.68 
77  1 SER A 598  ? ? -108.07 75.69   
78  1 SER A 599  ? ? 170.52  135.05  
79  1 GLU A 619  ? ? -92.40  -80.04  
80  1 THR A 620  ? ? -65.27  -82.14  
81  1 LEU A 622  ? ? -138.10 -151.25 
82  1 SER A 624  ? ? -64.26  -112.53 
83  1 ASP A 625  ? ? -118.56 -115.45 
84  1 ARG A 626  ? ? 165.76  119.84  
85  1 VAL A 629  ? ? -92.79  -154.74 
86  1 THR A 630  ? ? -169.22 62.22   
87  1 LEU A 631  ? ? -61.82  -143.60 
88  1 SER A 643  ? ? -131.89 -83.49  
89  1 LEU A 644  ? ? -129.13 -122.83 
90  1 THR A 647  ? ? -36.28  130.84  
91  1 SER A 653  ? ? -120.77 -168.61 
92  1 ARG A 655  ? ? -119.78 78.03   
93  1 TYR A 660  ? ? -98.46  -140.69 
94  1 SER A 662  ? ? -81.75  -116.65 
95  1 LYS A 665  ? ? -70.64  -108.60 
96  1 LEU A 666  ? ? 176.51  117.76  
97  1 ASN A 677  ? ? -92.99  -60.18  
98  1 ASN A 683  ? ? 174.41  37.90   
99  1 TYR A 687  ? ? -160.99 55.88   
100 1 ASP A 689  ? ? 24.04   51.43   
101 1 ASN A 695  ? ? -124.24 -165.46 
102 1 SER A 697  ? ? -171.63 107.51  
103 1 THR A 698  ? ? 153.17  125.38  
104 1 ASP A 705  ? ? -69.66  -172.21 
105 1 GLU A 706  ? ? -39.27  -115.38 
106 1 ILE A 707  ? ? -163.69 -84.76  
107 1 GLN A 708  ? ? -2.96   138.50  
108 1 VAL A 729  ? ? -29.53  -36.17  
109 1 THR A 750  ? ? -108.79 -74.32  
110 1 ALA A 751  ? ? 130.89  154.59  
111 1 ARG A 753  ? ? -173.17 149.69  
112 1 SER A 755  ? ? -107.07 -164.19 
113 1 ALA A 760  ? ? -44.51  152.51  
114 1 SER A 762  ? ? -106.14 -163.52 
115 1 SER A 763  ? ? 172.77  172.22  
116 1 SER A 768  ? ? -6.85   141.31  
117 1 SER A 772  ? ? -139.07 -57.90  
118 1 GLU A 784  ? ? -31.08  135.92  
119 1 VAL A 801  ? ? -55.48  86.51   
120 1 LEU A 802  ? ? -51.48  -84.52  
121 1 LEU A 808  ? ? -59.34  -168.36 
122 1 ASN A 810  ? ? 86.77   28.56   
123 1 ASP A 824  ? ? -31.94  111.77  
124 1 GLU A 839  ? ? -63.15  -72.48  
125 1 GLU A 842  ? ? 175.14  125.75  
126 1 SER A 854  ? ? -106.68 -132.90 
127 1 THR A 860  ? ? -57.85  85.33   
128 1 ALA A 862  ? ? 170.88  144.41  
129 1 GLU A 863  ? ? -121.27 -169.51 
130 1 LYS A 864  ? ? 179.91  111.25  
131 1 PHE A 876  ? ? -80.03  -89.56  
132 1 ASN A 885  ? ? 69.97   -10.43  
133 1 SER A 886  ? ? 151.80  -42.62  
134 1 MET A 910  ? ? -175.83 98.73   
135 1 ASP A 919  ? ? -58.56  -154.23 
136 1 PHE A 920  ? ? -103.40 45.66   
137 1 VAL A 923  ? ? -171.03 146.86  
138 1 ASP A 925  ? ? 173.51  148.32  
139 1 ARG A 928  ? ? 97.65   80.62   
140 1 SER A 929  ? ? -163.45 -70.61  
141 1 PRO A 937  ? ? -61.99  53.17   
142 1 MET A 938  ? ? -109.06 -109.93 
143 1 PRO A 951  ? ? -83.96  38.10   
144 1 TRP A 953  ? ? -68.41  94.58   
145 1 ASP A 962  ? ? -39.12  -23.29  
146 1 ASN A 970  ? ? 17.16   -39.92  
147 1 ASP A 980  ? ? -67.77  97.93   
148 1 SER A 981  ? ? -62.92  96.68   
149 1 THR A 985  ? ? -66.82  66.62   
150 1 ASP A 986  ? ? -155.35 -2.76   
151 1 GLU A 987  ? ? -131.11 -58.67  
152 1 GLU A 988  ? ? -65.43  11.53   
153 1 PHE A 998  ? ? -173.89 132.08  
154 1 MET A 1014 ? ? 72.15   177.32  
155 1 SER A 1027 ? ? -173.20 112.55  
156 1 HIS A 1077 ? ? -165.81 115.85  
157 1 GLU A 1079 ? ? -29.62  -84.54  
158 1 ARG A 1080 ? ? -45.75  21.05   
159 1 LYS A 1081 ? ? -175.35 141.99  
160 1 PHE A 1097 ? ? -27.36  -59.88  
161 1 GLU A 1107 ? ? -23.65  -49.67  
162 1 ALA A 1110 ? ? 178.11  -20.58  
163 1 THR A 1125 ? ? -115.27 -161.67 
164 1 ILE A 1130 ? ? -53.88  0.63    
165 1 GLU A 1135 ? ? -59.31  -3.28   
166 1 ASN B 52   ? ? -92.08  -65.88  
167 1 ARG B 53   ? ? -43.74  -19.99  
168 1 ARG B 56   ? ? 132.61  140.36  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    115 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   SER 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    116 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -147.82 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2   ? A GLY 1    
2  1 Y 1 A SER -1   ? A SER 2    
3  1 Y 1 A HIS 0    ? A HIS 3    
4  1 Y 1 A SER 774  ? A SER 777  
5  1 Y 1 A THR 775  ? A THR 778  
6  1 Y 1 A ALA 776  ? A ALA 779  
7  1 Y 1 A PRO 777  ? A PRO 780  
8  1 Y 1 A HIS 778  ? A HIS 781  
9  1 Y 1 A GLU 779  ? A GLU 782  
10 1 Y 1 A THR 780  ? A THR 783  
11 1 Y 1 A SER 781  ? A SER 784  
12 1 Y 1 A PHE 782  ? A PHE 785  
13 1 Y 1 A ASN 1016 ? A ASN 1019 
14 1 Y 1 A LEU 1017 ? A LEU 1020 
15 1 Y 1 A GLY 1018 ? A GLY 1021 
16 1 Y 1 A GLU 1019 ? A GLU 1022 
17 1 Y 1 A THR 1020 ? A THR 1023 
18 1 Y 1 A SER 1021 ? A SER 1024 
19 1 Y 1 A THR 1022 ? A THR 1025 
20 1 Y 1 A LEU 1112 ? A LEU 1115 
21 1 Y 1 A GLN 1113 ? A GLN 1116 
22 1 Y 1 A TYR 1114 ? A TYR 1117 
23 1 Y 1 A ASP 1115 ? A ASP 1118 
24 1 Y 1 A ASP 1116 ? A ASP 1119 
25 1 Y 1 A GLY 1117 ? A GLY 1120 
26 1 Y 1 A SER 1118 ? A SER 1121 
27 1 Y 1 A GLY 1119 ? A GLY 1122 
28 1 Y 1 A MET 1120 ? A MET 1123 
29 1 Y 1 A LYS 1121 ? A LYS 1124 
#