data_3I89
# 
_entry.id   3I89 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I89         
RCSB  RCSB054088   
WWPDB D_1000054088 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7H 'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX'    unspecified 
PDB 3I7K 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX'    unspecified 
PDB 3I7L 'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2'   unspecified 
PDB 3I7N 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1'  unspecified 
PDB 3I7O 'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1'  unspecified 
PDB 3I7P 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR40A' unspecified 
PDB 3I8C 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' unspecified 
PDB 3I8E 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I89 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I89 
_cell.length_a           63.289 
_cell.length_b           133.670 
_cell.length_c           184.345 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I89 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1'    127399.766 1 ? ? ? ? 
2 polymer syn 'WD repeat-containing protein 22' 1358.547   1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
2 'Breakpoint cluster region protein 2, BCRP2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no SVVGFLSQRGLHG SVVGFLSQRGLHG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    SER n 
2 2    VAL n 
2 3    VAL n 
2 4    GLY n 
2 5    PHE n 
2 6    LEU n 
2 7    SER n 
2 8    GLN n 
2 9    ARG n 
2 10   GLY n 
2 11   LEU n 
2 12   HIS n 
2 13   GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN  Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1  ? 
2 UNP WDR22_HUMAN Q96JK2 2 SVVGFLSQRGLHG 13 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I89 A 4 ? 1143 ? Q16531 1  ? 1140 ? 1  1140 
2 2 3I89 B 1 ? 13   ? Q96JK2 13 ? 25   ? 13 25   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I89 GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1 
1 3I89 SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2 
1 3I89 HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3 
1 3I89 TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4 
1 3I89 ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5 
1 3I89 VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I89 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.03 
_exptl_crystal.density_percent_sol   59.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005M DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I89 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             45.22 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   29082 
_reflns.number_all                   31649 
_reflns.percent_possible_obs         91.9 
_reflns.pdbx_Rmerge_I_obs            0.087 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.078 
_reflns_shell.percent_possible_all   94.6 
_reflns_shell.Rmerge_I_obs           0.401 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1709 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3I89 
_refine.ls_number_reflns_obs                     29082 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.22 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    94.73 
_refine.ls_R_factor_obs                          0.25377 
_refine.ls_R_factor_all                          0.270 
_refine.ls_R_factor_R_work                       0.25142 
_refine.ls_R_factor_R_free                       0.30358 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.5 
_refine.ls_number_reflns_R_free                  1370 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.910 
_refine.correlation_coeff_Fo_to_Fc_free          0.874 
_refine.B_iso_mean                               88.649 
_refine.aniso_B[1][1]                            -2.87 
_refine.aniso_B[2][2]                            2.10 
_refine.aniso_B[3][3]                            0.77 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.431 
_refine.pdbx_overall_ESU_R_Free                  0.519 
_refine.overall_SU_ML                            0.415 
_refine.overall_SU_B                             22.598 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8821 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8821 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        45.22 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015  0.022  ? 8982  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.670  1.965  ? 12163 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.673  5.000  ? 1122  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   40.919 24.717 ? 407   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   21.841 15.000 ? 1587  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   17.154 15.000 ? 49    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.104  0.200  ? 1401  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 6703  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.271  0.200  ? 4661  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.326  0.200  ? 6065  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.200  0.200  ? 364   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.178  0.200  ? 32    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.218  0.200  ? 4     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.000 
_refine_ls_shell.d_res_low                        3.078 
_refine_ls_shell.number_reflns_R_work             1671 
_refine_ls_shell.R_factor_R_work                  0.321 
_refine_ls_shell.percent_reflns_obs               75.70 
_refine_ls_shell.R_factor_R_free                  0.371 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             77 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1671 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3I89 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, WD repeat-containing protein 22' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I89 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;DDB1, WDR22, DCAF5, H-Box Motif, Cytoplasm, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, Alternative splicing, WD repeat, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 253  ? GLN A 258  ? PRO A 250  GLN A 255  1 ? 6  
HELX_P HELX_P2 2 ALA A 384  ? GLU A 387  ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P3 3 SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P4 4 GLU A 1072 ? ARG A 1077 ? GLU A 1069 ARG A 1074 1 ? 6  
HELX_P HELX_P5 5 GLY A 1094 ? PHE A 1100 ? GLY A 1091 PHE A 1097 1 ? 7  
HELX_P HELX_P6 6 LEU A 1101 ? ILE A 1103 ? LEU A 1098 ILE A 1100 5 ? 3  
HELX_P HELX_P7 7 SER A 1104 ? VAL A 1111 ? SER A 1101 VAL A 1108 1 ? 8  
HELX_P HELX_P8 8 ASP A 1130 ? ARG A 1141 ? ASP A 1127 ARG A 1138 1 ? 12 
HELX_P HELX_P9 9 SER B 1    ? SER B 7    ? SER B 13   SER B 19   1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            21 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            316 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             18 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             313 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.035 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 2 ? 
I ? 4 ? 
J ? 4 ? 
K ? 2 ? 
L ? 3 ? 
M ? 3 ? 
N ? 2 ? 
O ? 4 ? 
P ? 3 ? 
Q ? 4 ? 
R ? 3 ? 
S ? 5 ? 
T ? 4 ? 
U ? 4 ? 
V ? 4 ? 
W ? 3 ? 
X ? 5 ? 
Y ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
S 4 5 ? parallel      
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
X 1 2 ? anti-parallel 
X 2 3 ? anti-parallel 
X 3 4 ? anti-parallel 
X 4 5 ? anti-parallel 
Y 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
A 2 GLN A 1028 ? THR A 1035 ? GLN A 1025 THR A 1032 
A 3 ILE A 1040 ? SER A 1045 ? ILE A 1037 SER A 1042 
A 4 ASN A 7    ? GLN A 13   ? ASN A 4    GLN A 10   
A 5 PHE A 1091 ? ASP A 1093 ? PHE A 1088 ASP A 1090 
B 1 GLY A 20   ? GLY A 24   ? GLY A 17   GLY A 21   
B 2 ASN A 33   ? ALA A 37   ? ASN A 30   ALA A 34   
B 3 ARG A 41   ? VAL A 47   ? ARG A 38   VAL A 44   
B 4 LEU A 52   ? GLY A 59   ? LEU A 49   GLY A 56   
C 1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C 2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C 3 ASN A 88   ? SER A 97   ? ASN A 85   SER A 94   
C 4 SER A 100  ? ASN A 110  ? SER A 97   ASN A 107  
D 1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D 2 MET A 133  ? ARG A 137  ? MET A 130  ARG A 134  
D 3 LEU A 142  ? PRO A 147  ? LEU A 139  PRO A 144  
D 4 PHE A 158  ? ARG A 161  ? PHE A 155  ARG A 158  
E 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
E 2 THR A 180  ? GLN A 186  ? THR A 177  GLN A 183  
E 3 ARG A 191  ? GLU A 197  ? ARG A 188  GLU A 194  
E 4 GLU A 213  ? VAL A 215  ? GLU A 210  VAL A 212  
F 1 MET A 221  ? ALA A 224  ? MET A 218  ALA A 221  
F 2 ALA A 232  ? ILE A 235  ? ALA A 229  ILE A 232  
F 3 ILE A 240  ? ASN A 244  ? ILE A 237  ASN A 241  
F 4 LYS A 247  ? ILE A 251  ? LYS A 244  ILE A 248  
G 1 ILE A 261  ? ARG A 266  ? ILE A 258  ARG A 263  
G 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
G 3 ARG A 282  ? GLU A 289  ? ARG A 279  GLU A 286  
G 4 ASP A 302  ? GLU A 310  ? ASP A 299  GLU A 307  
H 1 GLU A 292  ? GLN A 293  ? GLU A 289  GLN A 290  
H 2 GLY A 296  ? VAL A 298  ? GLY A 293  VAL A 295  
I 1 CYS A 316  ? TYR A 319  ? CYS A 313  TYR A 316  
I 2 VAL A 324  ? GLY A 328  ? VAL A 321  GLY A 325  
I 3 SER A 334  ? LEU A 339  ? SER A 331  LEU A 336  
I 4 VAL A 350  ? PHE A 356  ? VAL A 347  PHE A 353  
J 1 ILE A 362  ? VAL A 368  ? ILE A 359  VAL A 365  
J 2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
J 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
J 4 LEU A 713  ? PRO A 719  ? LEU A 710  PRO A 716  
K 1 LEU A 430  ? SER A 431  ? LEU A 427  SER A 428  
K 2 THR A 436  ? ARG A 437  ? THR A 433  ARG A 434  
L 1 GLN A 470  ? ILE A 474  ? GLN A 467  ILE A 471  
L 2 SER A 478  ? SER A 483  ? SER A 475  SER A 480  
L 3 SER A 491  ? LYS A 494  ? SER A 488  LYS A 491  
M 1 GLN A 510  ? VAL A 511  ? GLN A 507  VAL A 508  
M 2 LEU A 522  ? GLN A 523  ? LEU A 519  GLN A 520  
M 3 ARG A 530  ? GLN A 531  ? ARG A 527  GLN A 528  
N 1 ALA A 518  ? LEU A 519  ? ALA A 515  LEU A 516  
N 2 THR A 535  ? GLU A 536  ? THR A 532  GLU A 533  
O 1 VAL A 541  ? ASP A 545  ? VAL A 538  ASP A 542  
O 2 CYS A 559  ? LEU A 563  ? CYS A 556  LEU A 560  
O 3 ALA A 569  ? LEU A 572  ? ALA A 566  LEU A 569  
O 4 LEU A 579  ? GLU A 583  ? LEU A 576  GLU A 580  
P 1 PRO A 591  ? THR A 598  ? PRO A 588  THR A 595  
P 2 HIS A 603  ? LEU A 609  ? HIS A 600  LEU A 606  
P 3 LEU A 614  ? LEU A 619  ? LEU A 611  LEU A 616  
Q 1 VAL A 640  ? THR A 643  ? VAL A 637  THR A 640  
Q 2 VAL A 652  ? CYS A 655  ? VAL A 649  CYS A 652  
Q 3 THR A 660  ? ILE A 662  ? THR A 657  ILE A 659  
Q 4 PHE A 671  ? ASN A 673  ? PHE A 668  ASN A 670  
R 1 TYR A 681  ? PRO A 684  ? TYR A 678  PRO A 681  
R 2 LEU A 694  ? ALA A 697  ? LEU A 691  ALA A 694  
R 3 LEU A 702  ? GLY A 705  ? LEU A 699  GLY A 702  
S 1 ILE A 727  ? GLN A 730  ? ILE A 724  GLN A 727  
S 2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
S 3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
S 4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
S 5 SER A 767  ? VAL A 768  ? SER A 764  VAL A 765  
T 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
T 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
T 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
T 4 LEU A 861  ? ALA A 865  ? LEU A 858  ALA A 862  
U 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
U 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
U 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
U 4 GLU A 868  ? VAL A 869  ? GLU A 865  VAL A 866  
V 1 VAL A 873  ? SER A 875  ? VAL A 870  SER A 872  
V 2 LEU A 883  ? ILE A 887  ? LEU A 880  ILE A 884  
V 3 THR A 890  ? TRP A 896  ? THR A 887  TRP A 893  
V 4 VAL A 902  ? HIS A 908  ? VAL A 899  HIS A 905  
W 1 ILE A 924  ? LEU A 925  ? ILE A 921  LEU A 922  
W 2 LEU A 935  ? TYR A 938  ? LEU A 932  TYR A 935  
W 3 PHE A 945  ? ALA A 949  ? PHE A 942  ALA A 946  
X 1 MET A 930  ? ARG A 931  ? MET A 927  ARG A 928  
X 2 ASN A 955  ? ILE A 962  ? ASN A 952  ILE A 959  
X 3 PHE A 968  ? GLU A 972  ? PHE A 965  GLU A 969  
X 4 ASN A 976  ? CYS A 980  ? ASN A 973  CYS A 977  
X 5 GLU A 997  ? HIS A 1002 ? GLU A 994  HIS A 999  
Y 1 PHE A 1079 ? THR A 1081 ? PHE A 1076 THR A 1078 
Y 2 LYS A 1084 ? GLU A 1086 ? LYS A 1081 GLU A 1083 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 1011 ? N CYS A 1008 O LEU A 1032 ? O LEU A 1029 
A 2 3 N VAL A 1031 ? N VAL A 1028 O VAL A 1043 ? O VAL A 1040 
A 3 4 O ILE A 1040 ? O ILE A 1037 N ALA A 12   ? N ALA A 9    
A 4 5 N VAL A 9    ? N VAL A 6    O ILE A 1092 ? O ILE A 1089 
B 1 2 N VAL A 22   ? N VAL A 19   O LEU A 35   ? O LEU A 32   
B 2 3 N ILE A 36   ? N ILE A 33   O GLU A 43   ? O GLU A 40   
B 3 4 N LEU A 42   ? N LEU A 39   O VAL A 58   ? O VAL A 55   
C 1 2 N PHE A 70   ? N PHE A 67   O LEU A 79   ? O LEU A 76   
C 2 3 N LEU A 80   ? N LEU A 77   O LEU A 92   ? O LEU A 89   
C 3 4 N ILE A 91   ? N ILE A 88   O ARG A 106  ? O ARG A 103  
D 1 2 N ILE A 126  ? N ILE A 123  O GLY A 135  ? O GLY A 132  
D 2 3 N ILE A 134  ? N ILE A 131  O ILE A 146  ? O ILE A 143  
D 3 4 N VAL A 145  ? N VAL A 142  O PHE A 158  ? O PHE A 155  
E 1 2 N ILE A 168  ? N ILE A 165  O VAL A 184  ? O VAL A 181  
E 2 3 N TYR A 185  ? N TYR A 182  O HIS A 192  ? O HIS A 189  
E 3 4 N ARG A 191  ? N ARG A 188  O VAL A 215  ? O VAL A 212  
F 1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
F 2 3 N ALA A 232  ? N ALA A 229  O HIS A 243  ? O HIS A 240  
F 3 4 N ASN A 244  ? N ASN A 241  O LYS A 247  ? O LYS A 244  
G 1 2 N CYS A 263  ? N CYS A 260  O GLY A 277  ? O GLY A 274  
G 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
G 3 4 N LEU A 287  ? N LEU A 284  O ARG A 304  ? O ARG A 301  
H 1 2 N GLN A 293  ? N GLN A 290  O GLY A 296  ? O GLY A 293  
I 1 2 N THR A 318  ? N THR A 315  O PHE A 326  ? O PHE A 323  
I 2 3 N VAL A 325  ? N VAL A 322  O VAL A 337  ? O VAL A 334  
I 3 4 N LYS A 338  ? N LYS A 335  O VAL A 351  ? O VAL A 348  
J 1 2 N CYS A 366  ? N CYS A 363  O VAL A 379  ? O VAL A 376  
J 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
J 3 4 N ILE A 392  ? N ILE A 389  O ARG A 716  ? O ARG A 713  
K 1 2 N LEU A 430  ? N LEU A 427  O ARG A 437  ? O ARG A 434  
L 1 2 N LEU A 471  ? N LEU A 468  O VAL A 482  ? O VAL A 479  
L 2 3 N VAL A 479  ? N VAL A 476  O TRP A 493  ? O TRP A 490  
M 1 2 N VAL A 511  ? N VAL A 508  O LEU A 522  ? O LEU A 519  
M 2 3 N GLN A 523  ? N GLN A 520  O ARG A 530  ? O ARG A 527  
N 1 2 N LEU A 519  ? N LEU A 516  O THR A 535  ? O THR A 532  
O 1 2 N ALA A 542  ? N ALA A 539  O GLY A 562  ? O GLY A 559  
O 2 3 N CYS A 559  ? N CYS A 556  O LEU A 572  ? O LEU A 569  
O 3 4 N ILE A 571  ? N ILE A 568  O LEU A 580  ? O LEU A 577  
P 1 2 N LEU A 595  ? N LEU A 592  O LEU A 606  ? O LEU A 603  
P 2 3 N LEU A 605  ? N LEU A 602  O PHE A 617  ? O PHE A 614  
Q 1 2 N VAL A 640  ? N VAL A 637  O CYS A 655  ? O CYS A 652  
Q 2 3 N ALA A 654  ? N ALA A 651  O THR A 660  ? O THR A 657  
Q 3 4 N VAL A 661  ? N VAL A 658  O SER A 672  ? O SER A 669  
R 1 2 N CYS A 683  ? N CYS A 680  O ALA A 695  ? O ALA A 692  
R 2 3 N LEU A 696  ? N LEU A 693  O THR A 703  ? O THR A 700  
S 1 2 N CYS A 728  ? N CYS A 725  O GLY A 737  ? O GLY A 734  
S 2 3 N ARG A 742  ? N ARG A 739  O VAL A 791  ? O VAL A 788  
S 3 4 N ILE A 796  ? N ILE A 793  O LEU A 805  ? O LEU A 802  
S 4 5 O ALA A 807  ? O ALA A 804  N SER A 767  ? N SER A 764  
T 1 2 N CYS A 822  ? N CYS A 819  O TYR A 831  ? O TYR A 828  
T 2 3 N PHE A 832  ? N PHE A 829  O PHE A 854  ? O PHE A 851  
T 3 4 N VAL A 853  ? N VAL A 850  O ALA A 865  ? O ALA A 862  
U 1 2 N CYS A 822  ? N CYS A 819  O TYR A 831  ? O TYR A 828  
U 2 3 N PHE A 832  ? N PHE A 829  O PHE A 854  ? O PHE A 851  
U 3 4 N GLY A 849  ? N GLY A 846  O VAL A 869  ? O VAL A 866  
V 1 2 N SER A 875  ? N SER A 872  O SER A 886  ? O SER A 883  
V 2 3 N ILE A 887  ? N ILE A 884  O THR A 890  ? O THR A 887  
V 3 4 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
W 1 2 N LEU A 925  ? N LEU A 922  O LEU A 936  ? O LEU A 933  
W 2 3 N ALA A 937  ? N ALA A 934  O GLU A 946  ? O GLU A 943  
X 1 2 N ARG A 931  ? N ARG A 928  O ASN A 955  ? O ASN A 952  
X 2 3 N ALA A 959  ? N ALA A 956  O ALA A 971  ? O ALA A 968  
X 3 4 N PHE A 968  ? N PHE A 965  O CYS A 980  ? O CYS A 977  
X 4 5 N LEU A 977  ? N LEU A 974  O PHE A 1001 ? O PHE A 998  
Y 1 2 N THR A 1081 ? N THR A 1078 O LYS A 1084 ? O LYS A 1081 
# 
_database_PDB_matrix.entry_id          3I89 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I89 
_atom_sites.fract_transf_matrix[1][1]   0.015801 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007481 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005425 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 4    ? 23.875  26.054 11.089  1.00 86.68  ? 1    MET A N   1 
ATOM 2    C CA  . MET A 1 4    ? 22.844  26.583 10.132  1.00 86.68  ? 1    MET A CA  1 
ATOM 3    C C   . MET A 1 4    ? 21.562  27.175 10.787  1.00 86.68  ? 1    MET A C   1 
ATOM 4    O O   . MET A 1 4    ? 20.433  26.943 10.316  1.00 86.68  ? 1    MET A O   1 
ATOM 5    C CB  . MET A 1 4    ? 22.512  25.554 9.019   1.00 137.02 ? 1    MET A CB  1 
ATOM 6    C CG  . MET A 1 4    ? 22.094  24.151 9.469   1.00 137.02 ? 1    MET A CG  1 
ATOM 7    S SD  . MET A 1 4    ? 21.643  23.123 8.047   1.00 137.02 ? 1    MET A SD  1 
ATOM 8    C CE  . MET A 1 4    ? 21.563  21.488 8.782   1.00 137.02 ? 1    MET A CE  1 
ATOM 9    N N   . SER A 1 5    ? 21.757  27.938 11.867  1.00 166.10 ? 2    SER A N   1 
ATOM 10   C CA  . SER A 1 5    ? 20.692  28.742 12.480  1.00 166.10 ? 2    SER A CA  1 
ATOM 11   C C   . SER A 1 5    ? 20.766  30.155 11.967  1.00 166.10 ? 2    SER A C   1 
ATOM 12   O O   . SER A 1 5    ? 21.849  30.725 11.868  1.00 166.10 ? 2    SER A O   1 
ATOM 13   C CB  . SER A 1 5    ? 20.845  28.799 13.991  1.00 124.97 ? 2    SER A CB  1 
ATOM 14   O OG  . SER A 1 5    ? 20.437  30.059 14.508  1.00 124.97 ? 2    SER A OG  1 
ATOM 15   N N   . TYR A 1 6    ? 19.614  30.736 11.669  1.00 76.15  ? 3    TYR A N   1 
ATOM 16   C CA  . TYR A 1 6    ? 19.597  32.081 11.137  1.00 76.15  ? 3    TYR A CA  1 
ATOM 17   C C   . TYR A 1 6    ? 18.382  32.867 11.610  1.00 76.15  ? 3    TYR A C   1 
ATOM 18   O O   . TYR A 1 6    ? 17.255  32.590 11.201  1.00 76.15  ? 3    TYR A O   1 
ATOM 19   C CB  . TYR A 1 6    ? 19.621  32.073 9.602   1.00 110.80 ? 3    TYR A CB  1 
ATOM 20   C CG  . TYR A 1 6    ? 20.483  31.015 8.935   1.00 110.80 ? 3    TYR A CG  1 
ATOM 21   C CD1 . TYR A 1 6    ? 21.867  31.175 8.809   1.00 110.80 ? 3    TYR A CD1 1 
ATOM 22   C CD2 . TYR A 1 6    ? 19.904  29.865 8.397   1.00 110.80 ? 3    TYR A CD2 1 
ATOM 23   C CE1 . TYR A 1 6    ? 22.651  30.202 8.179   1.00 110.80 ? 3    TYR A CE1 1 
ATOM 24   C CE2 . TYR A 1 6    ? 20.681  28.888 7.766   1.00 110.80 ? 3    TYR A CE2 1 
ATOM 25   C CZ  . TYR A 1 6    ? 22.048  29.065 7.656   1.00 110.80 ? 3    TYR A CZ  1 
ATOM 26   O OH  . TYR A 1 6    ? 22.799  28.098 7.024   1.00 110.80 ? 3    TYR A OH  1 
ATOM 27   N N   . ASN A 1 7    ? 18.607  33.864 12.457  1.00 67.51  ? 4    ASN A N   1 
ATOM 28   C CA  . ASN A 1 7    ? 17.499  34.672 12.943  1.00 67.51  ? 4    ASN A CA  1 
ATOM 29   C C   . ASN A 1 7    ? 17.746  36.131 12.861  1.00 67.51  ? 4    ASN A C   1 
ATOM 30   O O   . ASN A 1 7    ? 18.837  36.577 12.524  1.00 67.51  ? 4    ASN A O   1 
ATOM 31   C CB  . ASN A 1 7    ? 17.200  34.343 14.378  1.00 53.91  ? 4    ASN A CB  1 
ATOM 32   C CG  . ASN A 1 7    ? 16.999  32.899 14.572  1.00 53.91  ? 4    ASN A CG  1 
ATOM 33   O OD1 . ASN A 1 7    ? 15.932  32.364 14.247  1.00 53.91  ? 4    ASN A OD1 1 
ATOM 34   N ND2 . ASN A 1 7    ? 18.042  32.220 15.072  1.00 53.91  ? 4    ASN A ND2 1 
ATOM 35   N N   . TYR A 1 8    ? 16.716  36.863 13.235  1.00 59.22  ? 5    TYR A N   1 
ATOM 36   C CA  . TYR A 1 8    ? 16.668  38.273 13.035  1.00 59.22  ? 5    TYR A CA  1 
ATOM 37   C C   . TYR A 1 8    ? 15.987  38.887 14.252  1.00 59.22  ? 5    TYR A C   1 
ATOM 38   O O   . TYR A 1 8    ? 14.941  38.422 14.684  1.00 59.22  ? 5    TYR A O   1 
ATOM 39   C CB  . TYR A 1 8    ? 15.886  38.525 11.765  1.00 55.69  ? 5    TYR A CB  1 
ATOM 40   C CG  . TYR A 1 8    ? 15.735  39.964 11.350  1.00 55.69  ? 5    TYR A CG  1 
ATOM 41   C CD1 . TYR A 1 8    ? 16.542  40.505 10.363  1.00 55.69  ? 5    TYR A CD1 1 
ATOM 42   C CD2 . TYR A 1 8    ? 14.755  40.771 11.899  1.00 55.69  ? 5    TYR A CD2 1 
ATOM 43   C CE1 . TYR A 1 8    ? 16.391  41.814 9.953   1.00 55.69  ? 5    TYR A CE1 1 
ATOM 44   C CE2 . TYR A 1 8    ? 14.607  42.070 11.489  1.00 55.69  ? 5    TYR A CE2 1 
ATOM 45   C CZ  . TYR A 1 8    ? 15.422  42.580 10.515  1.00 55.69  ? 5    TYR A CZ  1 
ATOM 46   O OH  . TYR A 1 8    ? 15.272  43.876 10.101  1.00 55.69  ? 5    TYR A OH  1 
ATOM 47   N N   . VAL A 1 9    ? 16.595  39.915 14.824  1.00 53.05  ? 6    VAL A N   1 
ATOM 48   C CA  . VAL A 1 9    ? 16.022  40.551 15.990  1.00 53.05  ? 6    VAL A CA  1 
ATOM 49   C C   . VAL A 1 9    ? 15.797  42.004 15.686  1.00 53.05  ? 6    VAL A C   1 
ATOM 50   O O   . VAL A 1 9    ? 16.660  42.636 15.087  1.00 53.05  ? 6    VAL A O   1 
ATOM 51   C CB  . VAL A 1 9    ? 16.934  40.432 17.222  1.00 55.00  ? 6    VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 9    ? 16.753  39.096 17.861  1.00 55.00  ? 6    VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 9    ? 18.382  40.641 16.846  1.00 55.00  ? 6    VAL A CG2 1 
ATOM 54   N N   . VAL A 1 10   ? 14.630  42.529 16.052  1.00 42.40  ? 7    VAL A N   1 
ATOM 55   C CA  . VAL A 1 10   ? 14.448  43.978 16.044  1.00 42.40  ? 7    VAL A CA  1 
ATOM 56   C C   . VAL A 1 10   ? 13.726  44.505 17.264  1.00 42.40  ? 7    VAL A C   1 
ATOM 57   O O   . VAL A 1 10   ? 12.833  43.855 17.841  1.00 42.40  ? 7    VAL A O   1 
ATOM 58   C CB  . VAL A 1 10   ? 13.641  44.509 14.864  1.00 46.50  ? 7    VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 10   ? 14.314  45.774 14.322  1.00 46.50  ? 7    VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 10   ? 13.461  43.461 13.808  1.00 46.50  ? 7    VAL A CG2 1 
ATOM 61   N N   . THR A 1 11   ? 14.124  45.713 17.628  1.00 43.24  ? 8    THR A N   1 
ATOM 62   C CA  . THR A 1 11   ? 13.375  46.515 18.546  1.00 43.24  ? 8    THR A CA  1 
ATOM 63   C C   . THR A 1 11   ? 12.055  46.886 17.878  1.00 43.24  ? 8    THR A C   1 
ATOM 64   O O   . THR A 1 11   ? 12.000  47.190 16.662  1.00 43.24  ? 8    THR A O   1 
ATOM 65   C CB  . THR A 1 11   ? 14.157  47.757 18.893  1.00 59.73  ? 8    THR A CB  1 
ATOM 66   O OG1 . THR A 1 11   ? 15.283  47.373 19.679  1.00 59.73  ? 8    THR A OG1 1 
ATOM 67   C CG2 . THR A 1 11   ? 13.322  48.688 19.688  1.00 59.73  ? 8    THR A CG2 1 
ATOM 68   N N   . ALA A 1 12   ? 10.995  46.837 18.679  1.00 60.77  ? 9    ALA A N   1 
ATOM 69   C CA  . ALA A 1 12   ? 9.680   47.273 18.255  1.00 60.77  ? 9    ALA A CA  1 
ATOM 70   C C   . ALA A 1 12   ? 9.296   48.475 19.086  1.00 60.77  ? 9    ALA A C   1 
ATOM 71   O O   . ALA A 1 12   ? 8.619   49.395 18.619  1.00 60.77  ? 9    ALA A O   1 
ATOM 72   C CB  . ALA A 1 12   ? 8.704   46.170 18.462  1.00 26.59  ? 9    ALA A CB  1 
ATOM 73   N N   . GLN A 1 13   ? 9.721   48.448 20.337  1.00 47.74  ? 10   GLN A N   1 
ATOM 74   C CA  . GLN A 1 13   ? 9.581   49.600 21.196  1.00 47.74  ? 10   GLN A CA  1 
ATOM 75   C C   . GLN A 1 13   ? 10.935  49.779 21.851  1.00 47.74  ? 10   GLN A C   1 
ATOM 76   O O   . GLN A 1 13   ? 11.486  48.817 22.414  1.00 47.74  ? 10   GLN A O   1 
ATOM 77   C CB  . GLN A 1 13   ? 8.476   49.336 22.219  1.00 51.08  ? 10   GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13   ? 8.346   50.353 23.313  1.00 51.08  ? 10   GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13   ? 8.072   51.758 22.796  1.00 51.08  ? 10   GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13   ? 6.972   52.070 22.271  1.00 51.08  ? 10   GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13   ? 9.078   52.634 22.952  1.00 51.08  ? 10   GLN A NE2 1 
ATOM 82   N N   . LYS A 1 14   ? 11.505  50.973 21.733  1.00 48.69  ? 11   LYS A N   1 
ATOM 83   C CA  . LYS A 1 14   ? 12.745  51.264 22.430  1.00 48.69  ? 11   LYS A CA  1 
ATOM 84   C C   . LYS A 1 14   ? 12.510  51.091 23.939  1.00 48.69  ? 11   LYS A C   1 
ATOM 85   O O   . LYS A 1 14   ? 11.384  51.267 24.400  1.00 48.69  ? 11   LYS A O   1 
ATOM 86   C CB  . LYS A 1 14   ? 13.170  52.698 22.165  1.00 61.48  ? 11   LYS A CB  1 
ATOM 87   C CG  . LYS A 1 14   ? 13.570  53.028 20.748  1.00 61.48  ? 11   LYS A CG  1 
ATOM 88   C CD  . LYS A 1 14   ? 13.893  54.542 20.685  1.00 61.48  ? 11   LYS A CD  1 
ATOM 89   C CE  . LYS A 1 14   ? 14.301  55.068 19.288  1.00 61.48  ? 11   LYS A CE  1 
ATOM 90   N NZ  . LYS A 1 14   ? 14.186  56.578 19.153  1.00 61.48  ? 11   LYS A NZ  1 
ATOM 91   N N   . PRO A 1 15   ? 13.565  50.829 24.727  1.00 50.58  ? 12   PRO A N   1 
ATOM 92   C CA  . PRO A 1 15   ? 13.366  50.734 26.172  1.00 50.58  ? 12   PRO A CA  1 
ATOM 93   C C   . PRO A 1 15   ? 12.792  52.031 26.733  1.00 50.58  ? 12   PRO A C   1 
ATOM 94   O O   . PRO A 1 15   ? 13.206  53.117 26.335  1.00 50.58  ? 12   PRO A O   1 
ATOM 95   C CB  . PRO A 1 15   ? 14.779  50.585 26.719  1.00 50.34  ? 12   PRO A CB  1 
ATOM 96   C CG  . PRO A 1 15   ? 15.617  50.202 25.561  1.00 50.34  ? 12   PRO A CG  1 
ATOM 97   C CD  . PRO A 1 15   ? 14.978  50.708 24.344  1.00 50.34  ? 12   PRO A CD  1 
ATOM 98   N N   . THR A 1 16   ? 11.854  51.952 27.659  1.00 49.34  ? 13   THR A N   1 
ATOM 99   C CA  . THR A 1 16   ? 11.333  53.199 28.194  1.00 49.34  ? 13   THR A CA  1 
ATOM 100  C C   . THR A 1 16   ? 11.738  53.471 29.625  1.00 49.34  ? 13   THR A C   1 
ATOM 101  O O   . THR A 1 16   ? 11.593  54.581 30.078  1.00 49.34  ? 13   THR A O   1 
ATOM 102  C CB  . THR A 1 16   ? 9.823   53.281 28.078  1.00 44.15  ? 13   THR A CB  1 
ATOM 103  O OG1 . THR A 1 16   ? 9.248   52.383 29.029  1.00 44.15  ? 13   THR A OG1 1 
ATOM 104  C CG2 . THR A 1 16   ? 9.333   52.912 26.638  1.00 44.15  ? 13   THR A CG2 1 
ATOM 105  N N   . ALA A 1 17   ? 12.239  52.471 30.340  1.00 54.26  ? 14   ALA A N   1 
ATOM 106  C CA  . ALA A 1 17   ? 12.756  52.716 31.688  1.00 54.26  ? 14   ALA A CA  1 
ATOM 107  C C   . ALA A 1 17   ? 13.932  53.661 31.653  1.00 54.26  ? 14   ALA A C   1 
ATOM 108  O O   . ALA A 1 17   ? 14.724  53.661 30.720  1.00 54.26  ? 14   ALA A O   1 
ATOM 109  C CB  . ALA A 1 17   ? 13.153  51.448 32.360  1.00 34.63  ? 14   ALA A CB  1 
ATOM 110  N N   . VAL A 1 18   ? 14.043  54.467 32.686  1.00 39.16  ? 15   VAL A N   1 
ATOM 111  C CA  . VAL A 1 18   ? 15.052  55.503 32.730  1.00 39.16  ? 15   VAL A CA  1 
ATOM 112  C C   . VAL A 1 18   ? 16.066  55.109 33.780  1.00 39.16  ? 15   VAL A C   1 
ATOM 113  O O   . VAL A 1 18   ? 15.815  55.226 34.989  1.00 39.16  ? 15   VAL A O   1 
ATOM 114  C CB  . VAL A 1 18   ? 14.430  56.868 33.052  1.00 26.00  ? 15   VAL A CB  1 
ATOM 115  C CG1 . VAL A 1 18   ? 15.465  57.852 33.591  1.00 26.00  ? 15   VAL A CG1 1 
ATOM 116  C CG2 . VAL A 1 18   ? 13.698  57.420 31.808  1.00 26.00  ? 15   VAL A CG2 1 
ATOM 117  N N   . ASN A 1 19   ? 17.207  54.617 33.303  1.00 53.75  ? 16   ASN A N   1 
ATOM 118  C CA  . ASN A 1 19   ? 18.209  54.033 34.167  1.00 53.75  ? 16   ASN A CA  1 
ATOM 119  C C   . ASN A 1 19   ? 19.065  55.153 34.768  1.00 53.75  ? 16   ASN A C   1 
ATOM 120  O O   . ASN A 1 19   ? 19.666  54.977 35.829  1.00 53.75  ? 16   ASN A O   1 
ATOM 121  C CB  . ASN A 1 19   ? 19.034  52.974 33.415  1.00 50.99  ? 16   ASN A CB  1 
ATOM 122  C CG  . ASN A 1 19   ? 18.227  51.649 33.097  1.00 50.99  ? 16   ASN A CG  1 
ATOM 123  O OD1 . ASN A 1 19   ? 17.222  51.305 33.757  1.00 50.99  ? 16   ASN A OD1 1 
ATOM 124  N ND2 . ASN A 1 19   ? 18.712  50.891 32.090  1.00 50.99  ? 16   ASN A ND2 1 
ATOM 125  N N   . GLY A 1 20   ? 19.077  56.319 34.116  1.00 42.37  ? 17   GLY A N   1 
ATOM 126  C CA  . GLY A 1 20   ? 19.834  57.477 34.600  1.00 42.37  ? 17   GLY A CA  1 
ATOM 127  C C   . GLY A 1 20   ? 19.587  58.773 33.851  1.00 42.37  ? 17   GLY A C   1 
ATOM 128  O O   . GLY A 1 20   ? 19.067  58.747 32.742  1.00 42.37  ? 17   GLY A O   1 
ATOM 129  N N   . CYS A 1 21   ? 19.965  59.908 34.431  1.00 50.34  ? 18   CYS A N   1 
ATOM 130  C CA  . CYS A 1 21   ? 19.626  61.192 33.825  1.00 50.34  ? 18   CYS A CA  1 
ATOM 131  C C   . CYS A 1 21   ? 20.396  62.342 34.439  1.00 50.34  ? 18   CYS A C   1 
ATOM 132  O O   . CYS A 1 21   ? 20.430  62.479 35.658  1.00 50.34  ? 18   CYS A O   1 
ATOM 133  C CB  . CYS A 1 21   ? 18.128  61.483 33.980  1.00 62.34  ? 18   CYS A CB  1 
ATOM 134  S SG  . CYS A 1 21   ? 17.580  61.766 35.727  1.00 62.34  ? 18   CYS A SG  1 
ATOM 135  N N   . VAL A 1 22   ? 20.990  63.207 33.628  1.00 45.41  ? 19   VAL A N   1 
ATOM 136  C CA  . VAL A 1 22   ? 21.796  64.267 34.210  1.00 45.41  ? 19   VAL A CA  1 
ATOM 137  C C   . VAL A 1 22   ? 21.434  65.621 33.597  1.00 45.41  ? 19   VAL A C   1 
ATOM 138  O O   . VAL A 1 22   ? 20.901  65.676 32.475  1.00 45.41  ? 19   VAL A O   1 
ATOM 139  C CB  . VAL A 1 22   ? 23.289  63.894 34.089  1.00 46.60  ? 19   VAL A CB  1 
ATOM 140  C CG1 . VAL A 1 22   ? 23.733  63.807 32.608  1.00 46.60  ? 19   VAL A CG1 1 
ATOM 141  C CG2 . VAL A 1 22   ? 24.175  64.822 34.929  1.00 46.60  ? 19   VAL A CG2 1 
ATOM 142  N N   . THR A 1 23   ? 21.694  66.694 34.350  1.00 54.74  ? 20   THR A N   1 
ATOM 143  C CA  . THR A 1 23   ? 21.419  68.073 33.920  1.00 54.74  ? 20   THR A CA  1 
ATOM 144  C C   . THR A 1 23   ? 22.678  68.920 33.752  1.00 54.74  ? 20   THR A C   1 
ATOM 145  O O   . THR A 1 23   ? 23.652  68.771 34.496  1.00 54.74  ? 20   THR A O   1 
ATOM 146  C CB  . THR A 1 23   ? 20.496  68.830 34.927  1.00 69.09  ? 20   THR A CB  1 
ATOM 147  O OG1 . THR A 1 23   ? 20.067  70.064 34.344  1.00 69.09  ? 20   THR A OG1 1 
ATOM 148  C CG2 . THR A 1 23   ? 21.215  69.156 36.261  1.00 69.09  ? 20   THR A CG2 1 
ATOM 149  N N   . GLY A 1 24   ? 22.648  69.850 32.811  1.00 78.24  ? 21   GLY A N   1 
ATOM 150  C CA  . GLY A 1 24   ? 23.760  70.775 32.662  1.00 78.24  ? 21   GLY A CA  1 
ATOM 151  C C   . GLY A 1 24   ? 23.669  71.474 31.333  1.00 78.24  ? 21   GLY A C   1 
ATOM 152  O O   . GLY A 1 24   ? 22.647  71.377 30.654  1.00 78.24  ? 21   GLY A O   1 
ATOM 153  N N   . HIS A 1 25   ? 24.745  72.164 30.959  1.00 63.86  ? 22   HIS A N   1 
ATOM 154  C CA  . HIS A 1 25   ? 24.799  72.945 29.728  1.00 63.86  ? 22   HIS A CA  1 
ATOM 155  C C   . HIS A 1 25   ? 25.691  72.236 28.715  1.00 63.86  ? 22   HIS A C   1 
ATOM 156  O O   . HIS A 1 25   ? 26.907  72.403 28.734  1.00 63.86  ? 22   HIS A O   1 
ATOM 157  C CB  . HIS A 1 25   ? 25.318  74.353 30.037  1.00 69.38  ? 22   HIS A CB  1 
ATOM 158  C CG  . HIS A 1 25   ? 24.629  75.009 31.197  1.00 69.38  ? 22   HIS A CG  1 
ATOM 159  N ND1 . HIS A 1 25   ? 25.030  74.822 32.503  1.00 69.38  ? 22   HIS A ND1 1 
ATOM 160  C CD2 . HIS A 1 25   ? 23.566  75.848 31.247  1.00 69.38  ? 22   HIS A CD2 1 
ATOM 161  C CE1 . HIS A 1 25   ? 24.244  75.513 33.310  1.00 69.38  ? 22   HIS A CE1 1 
ATOM 162  N NE2 . HIS A 1 25   ? 23.349  76.147 32.572  1.00 69.38  ? 22   HIS A NE2 1 
ATOM 163  N N   . PHE A 1 26   ? 25.081  71.446 27.835  1.00 71.97  ? 23   PHE A N   1 
ATOM 164  C CA  . PHE A 1 26   ? 25.808  70.535 26.955  1.00 71.97  ? 23   PHE A CA  1 
ATOM 165  C C   . PHE A 1 26   ? 25.575  70.932 25.525  1.00 71.97  ? 23   PHE A C   1 
ATOM 166  O O   . PHE A 1 26   ? 26.331  70.569 24.641  1.00 71.97  ? 23   PHE A O   1 
ATOM 167  C CB  . PHE A 1 26   ? 25.326  69.095 27.217  1.00 40.82  ? 23   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 26   ? 25.948  68.029 26.316  1.00 40.82  ? 23   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 26   ? 27.315  67.752 26.349  1.00 40.82  ? 23   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 26   ? 25.157  67.276 25.474  1.00 40.82  ? 23   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 26   ? 27.858  66.766 25.534  1.00 40.82  ? 23   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 26   ? 25.704  66.302 24.674  1.00 40.82  ? 23   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 26   ? 27.041  66.046 24.707  1.00 40.82  ? 23   PHE A CZ  1 
ATOM 174  N N   . THR A 1 27   ? 24.511  71.687 25.319  1.00 73.96  ? 24   THR A N   1 
ATOM 175  C CA  . THR A 1 27   ? 24.175  72.244 24.023  1.00 73.96  ? 24   THR A CA  1 
ATOM 176  C C   . THR A 1 27   ? 24.852  73.606 23.797  1.00 73.96  ? 24   THR A C   1 
ATOM 177  O O   . THR A 1 27   ? 25.434  73.834 22.744  1.00 73.96  ? 24   THR A O   1 
ATOM 178  C CB  . THR A 1 27   ? 22.638  72.310 23.870  1.00 66.77  ? 24   THR A CB  1 
ATOM 179  O OG1 . THR A 1 27   ? 22.146  70.983 23.673  1.00 66.77  ? 24   THR A OG1 1 
ATOM 180  C CG2 . THR A 1 27   ? 22.198  73.174 22.683  1.00 66.77  ? 24   THR A CG2 1 
ATOM 181  N N   . SER A 1 28   ? 24.759  74.493 24.790  1.00 96.81  ? 25   SER A N   1 
ATOM 182  C CA  . SER A 1 28   ? 25.427  75.799 24.792  1.00 96.81  ? 25   SER A CA  1 
ATOM 183  C C   . SER A 1 28   ? 25.699  76.190 26.230  1.00 96.81  ? 25   SER A C   1 
ATOM 184  O O   . SER A 1 28   ? 25.063  75.662 27.143  1.00 96.81  ? 25   SER A O   1 
ATOM 185  C CB  . SER A 1 28   ? 24.543  76.873 24.179  1.00 100.43 ? 25   SER A CB  1 
ATOM 186  O OG  . SER A 1 28   ? 23.522  76.303 23.392  1.00 100.43 ? 25   SER A OG  1 
ATOM 187  N N   . ALA A 1 29   ? 26.622  77.132 26.430  1.00 77.64  ? 26   ALA A N   1 
ATOM 188  C CA  . ALA A 1 29   ? 27.007  77.575 27.773  1.00 77.64  ? 26   ALA A CA  1 
ATOM 189  C C   . ALA A 1 29   ? 25.808  78.223 28.425  1.00 77.64  ? 26   ALA A C   1 
ATOM 190  O O   . ALA A 1 29   ? 25.649  78.195 29.639  1.00 77.64  ? 26   ALA A O   1 
ATOM 191  C CB  . ALA A 1 29   ? 28.168  78.543 27.708  1.00 98.41  ? 26   ALA A CB  1 
ATOM 192  N N   . GLU A 1 30   ? 24.968  78.820 27.595  1.00 81.67  ? 27   GLU A N   1 
ATOM 193  C CA  . GLU A 1 30   ? 23.613  79.142 27.996  1.00 81.67  ? 27   GLU A CA  1 
ATOM 194  C C   . GLU A 1 30   ? 22.688  78.274 27.161  1.00 81.67  ? 27   GLU A C   1 
ATOM 195  O O   . GLU A 1 30   ? 22.597  78.389 25.936  1.00 81.67  ? 27   GLU A O   1 
ATOM 196  C CB  . GLU A 1 30   ? 23.279  80.649 27.926  1.00 112.77 ? 27   GLU A CB  1 
ATOM 197  C CG  . GLU A 1 30   ? 24.241  81.503 27.116  1.00 112.77 ? 27   GLU A CG  1 
ATOM 198  C CD  . GLU A 1 30   ? 24.465  80.937 25.732  1.00 112.77 ? 27   GLU A CD  1 
ATOM 199  O OE1 . GLU A 1 30   ? 25.541  80.339 25.508  1.00 112.77 ? 27   GLU A OE1 1 
ATOM 200  O OE2 . GLU A 1 30   ? 23.550  81.053 24.889  1.00 112.77 ? 27   GLU A OE2 1 
ATOM 201  N N   . ASP A 1 31   ? 22.077  77.353 27.892  1.00 75.45  ? 28   ASP A N   1 
ATOM 202  C CA  . ASP A 1 31   ? 21.115  76.364 27.451  1.00 75.45  ? 28   ASP A CA  1 
ATOM 203  C C   . ASP A 1 31   ? 21.137  75.435 28.617  1.00 75.45  ? 28   ASP A C   1 
ATOM 204  O O   . ASP A 1 31   ? 22.204  75.158 29.161  1.00 75.45  ? 28   ASP A O   1 
ATOM 205  C CB  . ASP A 1 31   ? 21.529  75.613 26.185  1.00 68.29  ? 28   ASP A CB  1 
ATOM 206  C CG  . ASP A 1 31   ? 20.674  76.004 24.972  1.00 68.29  ? 28   ASP A CG  1 
ATOM 207  O OD1 . ASP A 1 31   ? 20.093  77.118 24.994  1.00 68.29  ? 28   ASP A OD1 1 
ATOM 208  O OD2 . ASP A 1 31   ? 20.570  75.209 23.999  1.00 68.29  ? 28   ASP A OD2 1 
ATOM 209  N N   . LEU A 1 32   ? 19.960  75.000 29.046  1.00 70.07  ? 29   LEU A N   1 
ATOM 210  C CA  . LEU A 1 32   ? 19.883  74.042 30.129  1.00 70.07  ? 29   LEU A CA  1 
ATOM 211  C C   . LEU A 1 32   ? 19.313  72.757 29.570  1.00 70.07  ? 29   LEU A C   1 
ATOM 212  O O   . LEU A 1 32   ? 18.244  72.734 28.950  1.00 70.07  ? 29   LEU A O   1 
ATOM 213  C CB  . LEU A 1 32   ? 19.080  74.583 31.311  1.00 53.33  ? 29   LEU A CB  1 
ATOM 214  C CG  . LEU A 1 32   ? 18.957  73.684 32.545  1.00 53.33  ? 29   LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 32   ? 20.310  73.391 33.210  1.00 53.33  ? 29   LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 32   ? 17.971  74.283 33.559  1.00 53.33  ? 29   LEU A CD2 1 
ATOM 217  N N   . ASN A 1 33   ? 20.077  71.695 29.777  1.00 60.89  ? 30   ASN A N   1 
ATOM 218  C CA  . ASN A 1 33   ? 19.816  70.418 29.162  1.00 60.89  ? 30   ASN A CA  1 
ATOM 219  C C   . ASN A 1 33   ? 19.474  69.379 30.192  1.00 60.89  ? 30   ASN A C   1 
ATOM 220  O O   . ASN A 1 33   ? 19.922  69.430 31.335  1.00 60.89  ? 30   ASN A O   1 
ATOM 221  C CB  . ASN A 1 33   ? 21.046  69.963 28.370  1.00 62.31  ? 30   ASN A CB  1 
ATOM 222  C CG  . ASN A 1 33   ? 21.427  70.944 27.273  1.00 62.31  ? 30   ASN A CG  1 
ATOM 223  O OD1 . ASN A 1 33   ? 20.684  71.106 26.301  1.00 62.31  ? 30   ASN A OD1 1 
ATOM 224  N ND2 . ASN A 1 33   ? 22.583  71.601 27.419  1.00 62.31  ? 30   ASN A ND2 1 
ATOM 225  N N   . LEU A 1 34   ? 18.667  68.431 29.773  1.00 59.03  ? 31   LEU A N   1 
ATOM 226  C CA  . LEU A 1 34   ? 18.396  67.303 30.588  1.00 59.03  ? 31   LEU A CA  1 
ATOM 227  C C   . LEU A 1 34   ? 18.791  66.153 29.713  1.00 59.03  ? 31   LEU A C   1 
ATOM 228  O O   . LEU A 1 34   ? 18.311  66.031 28.574  1.00 59.03  ? 31   LEU A O   1 
ATOM 229  C CB  . LEU A 1 34   ? 16.918  67.237 30.931  1.00 62.06  ? 31   LEU A CB  1 
ATOM 230  C CG  . LEU A 1 34   ? 16.437  65.927 31.542  1.00 62.06  ? 31   LEU A CG  1 
ATOM 231  C CD1 . LEU A 1 34   ? 16.565  65.952 33.056  1.00 62.06  ? 31   LEU A CD1 1 
ATOM 232  C CD2 . LEU A 1 34   ? 15.024  65.677 31.115  1.00 62.06  ? 31   LEU A CD2 1 
ATOM 233  N N   . LEU A 1 35   ? 19.696  65.327 30.239  1.00 49.51  ? 32   LEU A N   1 
ATOM 234  C CA  . LEU A 1 35   ? 20.141  64.149 29.533  1.00 49.51  ? 32   LEU A CA  1 
ATOM 235  C C   . LEU A 1 35   ? 19.464  62.952 30.136  1.00 49.51  ? 32   LEU A C   1 
ATOM 236  O O   . LEU A 1 35   ? 19.433  62.815 31.343  1.00 49.51  ? 32   LEU A O   1 
ATOM 237  C CB  . LEU A 1 35   ? 21.657  64.049 29.577  1.00 70.99  ? 32   LEU A CB  1 
ATOM 238  C CG  . LEU A 1 35   ? 22.382  64.612 28.344  1.00 70.99  ? 32   LEU A CG  1 
ATOM 239  C CD1 . LEU A 1 35   ? 21.603  65.701 27.646  1.00 70.99  ? 32   LEU A CD1 1 
ATOM 240  C CD2 . LEU A 1 35   ? 23.731  65.154 28.742  1.00 70.99  ? 32   LEU A CD2 1 
ATOM 241  N N   . ILE A 1 36   ? 18.795  62.159 29.333  1.00 50.52  ? 33   ILE A N   1 
ATOM 242  C CA  . ILE A 1 36   ? 18.066  61.033 29.849  1.00 50.52  ? 33   ILE A CA  1 
ATOM 243  C C   . ILE A 1 36   ? 18.685  59.853 29.213  1.00 50.52  ? 33   ILE A C   1 
ATOM 244  O O   . ILE A 1 36   ? 18.833  59.798 28.021  1.00 50.52  ? 33   ILE A O   1 
ATOM 245  C CB  . ILE A 1 36   ? 16.605  61.087 29.530  1.00 40.37  ? 33   ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 36   ? 15.927  62.119 30.388  1.00 40.37  ? 33   ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 36   ? 15.991  59.825 29.865  1.00 40.37  ? 33   ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 36   ? 14.830  62.753 29.711  1.00 40.37  ? 33   ILE A CD1 1 
ATOM 249  N N   . ALA A 1 37   ? 19.083  58.931 30.064  1.00 63.38  ? 34   ALA A N   1 
ATOM 250  C CA  . ALA A 1 37   ? 19.788  57.748 29.695  1.00 63.38  ? 34   ALA A CA  1 
ATOM 251  C C   . ALA A 1 37   ? 18.835  56.592 29.771  1.00 63.38  ? 34   ALA A C   1 
ATOM 252  O O   . ALA A 1 37   ? 18.070  56.440 30.697  1.00 63.38  ? 34   ALA A O   1 
ATOM 253  C CB  . ALA A 1 37   ? 20.890  57.512 30.618  1.00 43.71  ? 34   ALA A CB  1 
ATOM 254  N N   . LYS A 1 38   ? 18.719  55.755 28.769  1.00 65.39  ? 35   LYS A N   1 
ATOM 255  C CA  . LYS A 1 38   ? 17.730  54.699 28.945  1.00 65.39  ? 35   LYS A CA  1 
ATOM 256  C C   . LYS A 1 38   ? 18.405  53.374 29.133  1.00 65.39  ? 35   LYS A C   1 
ATOM 257  O O   . LYS A 1 38   ? 18.566  52.881 30.248  1.00 65.39  ? 35   LYS A O   1 
ATOM 258  C CB  . LYS A 1 38   ? 16.743  54.669 27.806  1.00 47.18  ? 35   LYS A CB  1 
ATOM 259  C CG  . LYS A 1 38   ? 16.068  55.982 27.651  1.00 47.18  ? 35   LYS A CG  1 
ATOM 260  C CD  . LYS A 1 38   ? 14.612  55.919 27.857  1.00 47.18  ? 35   LYS A CD  1 
ATOM 261  C CE  . LYS A 1 38   ? 14.039  57.288 28.088  1.00 47.18  ? 35   LYS A CE  1 
ATOM 262  N NZ  . LYS A 1 38   ? 12.907  57.595 27.188  1.00 47.18  ? 35   LYS A NZ  1 
ATOM 263  N N   . ASN A 1 39   ? 18.836  52.799 28.046  1.00 52.04  ? 36   ASN A N   1 
ATOM 264  C CA  . ASN A 1 39   ? 19.711  51.699 28.182  1.00 52.04  ? 36   ASN A CA  1 
ATOM 265  C C   . ASN A 1 39   ? 20.716  51.983 27.160  1.00 52.04  ? 36   ASN A C   1 
ATOM 266  O O   . ASN A 1 39   ? 21.872  52.132 27.431  1.00 52.04  ? 36   ASN A O   1 
ATOM 267  C CB  . ASN A 1 39   ? 18.991  50.423 27.851  1.00 39.48  ? 36   ASN A CB  1 
ATOM 268  C CG  . ASN A 1 39   ? 19.673  49.242 28.393  1.00 39.48  ? 36   ASN A CG  1 
ATOM 269  O OD1 . ASN A 1 39   ? 20.396  49.334 29.344  1.00 39.48  ? 36   ASN A OD1 1 
ATOM 270  N ND2 . ASN A 1 39   ? 19.461  48.120 27.784  1.00 39.48  ? 36   ASN A ND2 1 
ATOM 271  N N   . THR A 1 40   ? 20.266  52.099 25.946  1.00 46.15  ? 37   THR A N   1 
ATOM 272  C CA  . THR A 1 40   ? 21.229  52.276 24.921  1.00 46.15  ? 37   THR A CA  1 
ATOM 273  C C   . THR A 1 40   ? 20.700  53.414 24.080  1.00 46.15  ? 37   THR A C   1 
ATOM 274  O O   . THR A 1 40   ? 20.813  53.397 22.855  1.00 46.15  ? 37   THR A O   1 
ATOM 275  C CB  . THR A 1 40   ? 21.219  51.050 24.047  1.00 51.98  ? 37   THR A CB  1 
ATOM 276  O OG1 . THR A 1 40   ? 19.922  50.930 23.449  1.00 51.98  ? 37   THR A OG1 1 
ATOM 277  C CG2 . THR A 1 40   ? 21.518  49.804 24.862  1.00 51.98  ? 37   THR A CG2 1 
ATOM 278  N N   . ARG A 1 41   ? 20.066  54.383 24.734  1.00 53.53  ? 38   ARG A N   1 
ATOM 279  C CA  . ARG A 1 41   ? 19.459  55.510 24.049  1.00 53.53  ? 38   ARG A CA  1 
ATOM 280  C C   . ARG A 1 41   ? 19.764  56.724 24.862  1.00 53.53  ? 38   ARG A C   1 
ATOM 281  O O   . ARG A 1 41   ? 19.627  56.708 26.088  1.00 53.53  ? 38   ARG A O   1 
ATOM 282  C CB  . ARG A 1 41   ? 17.954  55.331 23.933  1.00 78.03  ? 38   ARG A CB  1 
ATOM 283  C CG  . ARG A 1 41   ? 17.525  54.378 22.845  1.00 78.03  ? 38   ARG A CG  1 
ATOM 284  C CD  . ARG A 1 41   ? 17.556  55.037 21.476  1.00 78.03  ? 38   ARG A CD  1 
ATOM 285  N NE  . ARG A 1 41   ? 18.040  54.109 20.464  1.00 78.03  ? 38   ARG A NE  1 
ATOM 286  C CZ  . ARG A 1 41   ? 18.439  54.455 19.246  1.00 78.03  ? 38   ARG A CZ  1 
ATOM 287  N NH1 . ARG A 1 41   ? 18.414  55.727 18.868  1.00 78.03  ? 38   ARG A NH1 1 
ATOM 288  N NH2 . ARG A 1 41   ? 18.875  53.518 18.408  1.00 78.03  ? 38   ARG A NH2 1 
ATOM 289  N N   . LEU A 1 42   ? 20.207  57.780 24.202  1.00 50.55  ? 39   LEU A N   1 
ATOM 290  C CA  . LEU A 1 42   ? 20.531  58.983 24.934  1.00 50.55  ? 39   LEU A CA  1 
ATOM 291  C C   . LEU A 1 42   ? 19.669  60.151 24.477  1.00 50.55  ? 39   LEU A C   1 
ATOM 292  O O   . LEU A 1 42   ? 19.737  60.576 23.326  1.00 50.55  ? 39   LEU A O   1 
ATOM 293  C CB  . LEU A 1 42   ? 22.012  59.275 24.820  1.00 57.81  ? 39   LEU A CB  1 
ATOM 294  C CG  . LEU A 1 42   ? 22.511  60.516 25.557  1.00 57.81  ? 39   LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 42   ? 22.356  60.428 27.103  1.00 57.81  ? 39   LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 42   ? 23.963  60.786 25.147  1.00 57.81  ? 39   LEU A CD2 1 
ATOM 297  N N   . GLU A 1 43   ? 18.828  60.633 25.390  1.00 51.77  ? 40   GLU A N   1 
ATOM 298  C CA  . GLU A 1 43   ? 17.833  61.660 25.082  1.00 51.77  ? 40   GLU A CA  1 
ATOM 299  C C   . GLU A 1 43   ? 18.336  62.986 25.588  1.00 51.77  ? 40   GLU A C   1 
ATOM 300  O O   . GLU A 1 43   ? 18.863  63.089 26.695  1.00 51.77  ? 40   GLU A O   1 
ATOM 301  C CB  . GLU A 1 43   ? 16.451  61.304 25.659  1.00 48.15  ? 40   GLU A CB  1 
ATOM 302  C CG  . GLU A 1 43   ? 15.454  60.757 24.598  1.00 48.15  ? 40   GLU A CG  1 
ATOM 303  C CD  . GLU A 1 43   ? 14.349  59.774 25.140  1.00 48.15  ? 40   GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 43   ? 13.785  60.003 26.263  1.00 48.15  ? 40   GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 43   ? 14.026  58.779 24.402  1.00 48.15  ? 40   GLU A OE2 1 
ATOM 306  N N   . ILE A 1 44   ? 18.202  63.998 24.748  1.00 55.62  ? 41   ILE A N   1 
ATOM 307  C CA  . ILE A 1 44   ? 18.801  65.294 25.014  1.00 55.62  ? 41   ILE A CA  1 
ATOM 308  C C   . ILE A 1 44   ? 17.759  66.370 24.784  1.00 55.62  ? 41   ILE A C   1 
ATOM 309  O O   . ILE A 1 44   ? 17.323  66.607 23.653  1.00 55.62  ? 41   ILE A O   1 
ATOM 310  C CB  . ILE A 1 44   ? 19.994  65.555 24.088  1.00 50.56  ? 41   ILE A CB  1 
ATOM 311  C CG1 . ILE A 1 44   ? 21.011  64.430 24.196  1.00 50.56  ? 41   ILE A CG1 1 
ATOM 312  C CG2 . ILE A 1 44   ? 20.653  66.851 24.438  1.00 50.56  ? 41   ILE A CG2 1 
ATOM 313  C CD1 . ILE A 1 44   ? 22.154  64.555 23.231  1.00 50.56  ? 41   ILE A CD1 1 
ATOM 314  N N   . TYR A 1 45   ? 17.370  67.020 25.864  1.00 44.77  ? 42   TYR A N   1 
ATOM 315  C CA  . TYR A 1 45   ? 16.348  68.014 25.801  1.00 44.77  ? 42   TYR A CA  1 
ATOM 316  C C   . TYR A 1 45   ? 16.893  69.340 26.264  1.00 44.77  ? 42   TYR A C   1 
ATOM 317  O O   . TYR A 1 45   ? 17.866  69.405 27.022  1.00 44.77  ? 42   TYR A O   1 
ATOM 318  C CB  . TYR A 1 45   ? 15.213  67.635 26.730  1.00 52.33  ? 42   TYR A CB  1 
ATOM 319  C CG  . TYR A 1 45   ? 14.570  66.304 26.471  1.00 52.33  ? 42   TYR A CG  1 
ATOM 320  C CD1 . TYR A 1 45   ? 15.138  65.133 26.933  1.00 52.33  ? 42   TYR A CD1 1 
ATOM 321  C CD2 . TYR A 1 45   ? 13.369  66.224 25.815  1.00 52.33  ? 42   TYR A CD2 1 
ATOM 322  C CE1 . TYR A 1 45   ? 14.536  63.905 26.696  1.00 52.33  ? 42   TYR A CE1 1 
ATOM 323  C CE2 . TYR A 1 45   ? 12.756  65.009 25.589  1.00 52.33  ? 42   TYR A CE2 1 
ATOM 324  C CZ  . TYR A 1 45   ? 13.340  63.853 26.025  1.00 52.33  ? 42   TYR A CZ  1 
ATOM 325  O OH  . TYR A 1 45   ? 12.717  62.655 25.793  1.00 52.33  ? 42   TYR A OH  1 
ATOM 326  N N   . VAL A 1 46   ? 16.246  70.410 25.811  1.00 61.72  ? 43   VAL A N   1 
ATOM 327  C CA  . VAL A 1 46   ? 16.453  71.726 26.399  1.00 61.72  ? 43   VAL A CA  1 
ATOM 328  C C   . VAL A 1 46   ? 15.205  72.041 27.171  1.00 61.72  ? 43   VAL A C   1 
ATOM 329  O O   . VAL A 1 46   ? 14.099  71.977 26.626  1.00 61.72  ? 43   VAL A O   1 
ATOM 330  C CB  . VAL A 1 46   ? 16.690  72.837 25.367  1.00 78.98  ? 43   VAL A CB  1 
ATOM 331  C CG1 . VAL A 1 46   ? 17.369  74.026 26.043  1.00 78.98  ? 43   VAL A CG1 1 
ATOM 332  C CG2 . VAL A 1 46   ? 17.536  72.335 24.201  1.00 78.98  ? 43   VAL A CG2 1 
ATOM 333  N N   . VAL A 1 47   ? 15.406  72.339 28.452  1.00 64.01  ? 44   VAL A N   1 
ATOM 334  C CA  . VAL A 1 47   ? 14.354  72.762 29.378  1.00 64.01  ? 44   VAL A CA  1 
ATOM 335  C C   . VAL A 1 47   ? 13.805  74.140 28.969  1.00 64.01  ? 44   VAL A C   1 
ATOM 336  O O   . VAL A 1 47   ? 14.575  75.018 28.555  1.00 64.01  ? 44   VAL A O   1 
ATOM 337  C CB  . VAL A 1 47   ? 14.920  72.916 30.820  1.00 53.70  ? 44   VAL A CB  1 
ATOM 338  C CG1 . VAL A 1 47   ? 13.798  72.914 31.852  1.00 53.70  ? 44   VAL A CG1 1 
ATOM 339  C CG2 . VAL A 1 47   ? 15.965  71.859 31.136  1.00 53.70  ? 44   VAL A CG2 1 
ATOM 340  N N   . THR A 1 48   ? 12.493  74.339 29.102  1.00 94.80  ? 45   THR A N   1 
ATOM 341  C CA  . THR A 1 48   ? 11.858  75.628 28.799  1.00 94.80  ? 45   THR A CA  1 
ATOM 342  C C   . THR A 1 48   ? 10.696  75.927 29.736  1.00 94.80  ? 45   THR A C   1 
ATOM 343  O O   . THR A 1 48   ? 10.169  75.027 30.403  1.00 94.80  ? 45   THR A O   1 
ATOM 344  C CB  . THR A 1 48   ? 11.274  75.659 27.375  1.00 89.75  ? 45   THR A CB  1 
ATOM 345  O OG1 . THR A 1 48   ? 10.286  74.623 27.240  1.00 89.75  ? 45   THR A OG1 1 
ATOM 346  C CG2 . THR A 1 48   ? 12.369  75.507 26.312  1.00 89.75  ? 45   THR A CG2 1 
ATOM 347  N N   . ALA A 1 49   ? 10.291  77.196 29.758  1.00 104.76 ? 46   ALA A N   1 
ATOM 348  C CA  . ALA A 1 49   ? 9.038   77.625 30.377  1.00 104.76 ? 46   ALA A CA  1 
ATOM 349  C C   . ALA A 1 49   ? 7.975   76.522 30.332  1.00 104.76 ? 46   ALA A C   1 
ATOM 350  O O   . ALA A 1 49   ? 7.379   76.180 31.357  1.00 104.76 ? 46   ALA A O   1 
ATOM 351  C CB  . ALA A 1 49   ? 8.524   78.884 29.680  1.00 61.65  ? 46   ALA A CB  1 
ATOM 352  N N   . GLU A 1 50   ? 7.762   75.972 29.138  1.00 126.69 ? 47   GLU A N   1 
ATOM 353  C CA  . GLU A 1 50   ? 6.787   74.909 28.909  1.00 126.69 ? 47   GLU A CA  1 
ATOM 354  C C   . GLU A 1 50   ? 7.245   73.583 29.514  1.00 126.69 ? 47   GLU A C   1 
ATOM 355  O O   . GLU A 1 50   ? 6.485   72.909 30.217  1.00 126.69 ? 47   GLU A O   1 
ATOM 356  C CB  . GLU A 1 50   ? 6.523   74.759 27.404  1.00 150.78 ? 47   GLU A CB  1 
ATOM 357  C CG  . GLU A 1 50   ? 5.687   73.541 27.000  1.00 150.78 ? 47   GLU A CG  1 
ATOM 358  C CD  . GLU A 1 50   ? 6.522   72.305 26.680  1.00 150.78 ? 47   GLU A CD  1 
ATOM 359  O OE1 . GLU A 1 50   ? 5.927   71.234 26.443  1.00 150.78 ? 47   GLU A OE1 1 
ATOM 360  O OE2 . GLU A 1 50   ? 7.768   72.395 26.658  1.00 150.78 ? 47   GLU A OE2 1 
ATOM 361  N N   . GLY A 1 51   ? 8.492   73.223 29.229  1.00 78.19  ? 48   GLY A N   1 
ATOM 362  C CA  . GLY A 1 51   ? 9.038   71.933 29.621  1.00 78.19  ? 48   GLY A CA  1 
ATOM 363  C C   . GLY A 1 51   ? 10.233  71.533 28.774  1.00 78.19  ? 48   GLY A C   1 
ATOM 364  O O   . GLY A 1 51   ? 11.252  72.216 28.755  1.00 78.19  ? 48   GLY A O   1 
ATOM 365  N N   . LEU A 1 52   ? 10.113  70.436 28.048  1.00 61.36  ? 49   LEU A N   1 
ATOM 366  C CA  . LEU A 1 52   ? 11.293  69.819 27.469  1.00 61.36  ? 49   LEU A CA  1 
ATOM 367  C C   . LEU A 1 52   ? 11.361  69.838 25.946  1.00 61.36  ? 49   LEU A C   1 
ATOM 368  O O   . LEU A 1 52   ? 10.683  69.062 25.274  1.00 61.36  ? 49   LEU A O   1 
ATOM 369  C CB  . LEU A 1 52   ? 11.399  68.396 27.999  1.00 49.42  ? 49   LEU A CB  1 
ATOM 370  C CG  . LEU A 1 52   ? 12.382  68.093 29.136  1.00 49.42  ? 49   LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 52   ? 12.704  69.278 30.012  1.00 49.42  ? 49   LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 52   ? 11.839  66.951 29.938  1.00 49.42  ? 49   LEU A CD2 1 
ATOM 373  N N   . ARG A 1 53   ? 12.189  70.733 25.406  1.00 62.83  ? 50   ARG A N   1 
ATOM 374  C CA  . ARG A 1 53   ? 12.425  70.790 23.962  1.00 62.83  ? 50   ARG A CA  1 
ATOM 375  C C   . ARG A 1 53   ? 13.374  69.653 23.598  1.00 62.83  ? 50   ARG A C   1 
ATOM 376  O O   . ARG A 1 53   ? 14.573  69.761 23.859  1.00 62.83  ? 50   ARG A O   1 
ATOM 377  C CB  . ARG A 1 53   ? 13.017  72.141 23.543  1.00 143.12 ? 50   ARG A CB  1 
ATOM 378  C CG  . ARG A 1 53   ? 13.467  72.177 22.091  1.00 143.12 ? 50   ARG A CG  1 
ATOM 379  C CD  . ARG A 1 53   ? 14.522  73.250 21.823  1.00 143.12 ? 50   ARG A CD  1 
ATOM 380  N NE  . ARG A 1 53   ? 13.921  74.536 21.458  1.00 143.12 ? 50   ARG A NE  1 
ATOM 381  C CZ  . ARG A 1 53   ? 13.310  74.785 20.297  1.00 143.12 ? 50   ARG A CZ  1 
ATOM 382  N NH1 . ARG A 1 53   ? 13.202  73.829 19.372  1.00 143.12 ? 50   ARG A NH1 1 
ATOM 383  N NH2 . ARG A 1 53   ? 12.792  75.994 20.061  1.00 143.12 ? 50   ARG A NH2 1 
ATOM 384  N N   . PRO A 1 54   ? 12.843  68.546 23.031  1.00 59.32  ? 51   PRO A N   1 
ATOM 385  C CA  . PRO A 1 54   ? 13.699  67.446 22.622  1.00 59.32  ? 51   PRO A CA  1 
ATOM 386  C C   . PRO A 1 54   ? 14.573  67.904 21.481  1.00 59.32  ? 51   PRO A C   1 
ATOM 387  O O   . PRO A 1 54   ? 14.149  68.691 20.649  1.00 59.32  ? 51   PRO A O   1 
ATOM 388  C CB  . PRO A 1 54   ? 12.714  66.380 22.153  1.00 61.12  ? 51   PRO A CB  1 
ATOM 389  C CG  . PRO A 1 54   ? 11.442  66.750 22.771  1.00 61.12  ? 51   PRO A CG  1 
ATOM 390  C CD  . PRO A 1 54   ? 11.439  68.239 22.750  1.00 61.12  ? 51   PRO A CD  1 
ATOM 391  N N   . VAL A 1 55   ? 15.803  67.432 21.448  1.00 65.41  ? 52   VAL A N   1 
ATOM 392  C CA  . VAL A 1 55   ? 16.765  68.067 20.585  1.00 65.41  ? 52   VAL A CA  1 
ATOM 393  C C   . VAL A 1 55   ? 17.646  67.073 19.860  1.00 65.41  ? 52   VAL A C   1 
ATOM 394  O O   . VAL A 1 55   ? 18.028  67.317 18.717  1.00 65.41  ? 52   VAL A O   1 
ATOM 395  C CB  . VAL A 1 55   ? 17.550  69.155 21.364  1.00 48.13  ? 52   VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 55   ? 19.073  68.990 21.239  1.00 48.13  ? 52   VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 55   ? 17.052  70.552 20.940  1.00 48.13  ? 52   VAL A CG2 1 
ATOM 398  N N   . LYS A 1 56   ? 17.929  65.943 20.511  1.00 72.22  ? 53   LYS A N   1 
ATOM 399  C CA  . LYS A 1 56   ? 18.748  64.896 19.905  1.00 72.22  ? 53   LYS A CA  1 
ATOM 400  C C   . LYS A 1 56   ? 18.535  63.547 20.558  1.00 72.22  ? 53   LYS A C   1 
ATOM 401  O O   . LYS A 1 56   ? 18.556  63.429 21.781  1.00 72.22  ? 53   LYS A O   1 
ATOM 402  C CB  . LYS A 1 56   ? 20.225  65.280 19.986  1.00 72.35  ? 53   LYS A CB  1 
ATOM 403  C CG  . LYS A 1 56   ? 21.146  64.511 19.057  1.00 72.35  ? 53   LYS A CG  1 
ATOM 404  C CD  . LYS A 1 56   ? 20.664  64.465 17.618  1.00 72.35  ? 53   LYS A CD  1 
ATOM 405  C CE  . LYS A 1 56   ? 21.838  64.116 16.739  1.00 72.35  ? 53   LYS A CE  1 
ATOM 406  N NZ  . LYS A 1 56   ? 21.414  63.270 15.619  1.00 72.35  ? 53   LYS A NZ  1 
ATOM 407  N N   . GLU A 1 57   ? 18.339  62.529 19.734  1.00 60.59  ? 54   GLU A N   1 
ATOM 408  C CA  . GLU A 1 57   ? 18.167  61.182 20.249  1.00 60.59  ? 54   GLU A CA  1 
ATOM 409  C C   . GLU A 1 57   ? 19.149  60.240 19.588  1.00 60.59  ? 54   GLU A C   1 
ATOM 410  O O   . GLU A 1 57   ? 18.893  59.704 18.507  1.00 60.59  ? 54   GLU A O   1 
ATOM 411  C CB  . GLU A 1 57   ? 16.726  60.684 20.053  1.00 63.39  ? 54   GLU A CB  1 
ATOM 412  C CG  . GLU A 1 57   ? 16.196  59.759 21.175  1.00 63.39  ? 54   GLU A CG  1 
ATOM 413  C CD  . GLU A 1 57   ? 16.315  58.241 20.872  1.00 63.39  ? 54   GLU A CD  1 
ATOM 414  O OE1 . GLU A 1 57   ? 15.753  57.428 21.660  1.00 63.39  ? 54   GLU A OE1 1 
ATOM 415  O OE2 . GLU A 1 57   ? 16.952  57.850 19.858  1.00 63.39  ? 54   GLU A OE2 1 
ATOM 416  N N   . VAL A 1 58   ? 20.279  60.038 20.245  1.00 72.22  ? 55   VAL A N   1 
ATOM 417  C CA  . VAL A 1 58   ? 21.207  59.017 19.801  1.00 72.22  ? 55   VAL A CA  1 
ATOM 418  C C   . VAL A 1 58   ? 21.074  57.724 20.571  1.00 72.22  ? 55   VAL A C   1 
ATOM 419  O O   . VAL A 1 58   ? 20.763  57.717 21.765  1.00 72.22  ? 55   VAL A O   1 
ATOM 420  C CB  . VAL A 1 58   ? 22.645  59.480 19.862  1.00 66.26  ? 55   VAL A CB  1 
ATOM 421  C CG1 . VAL A 1 58   ? 22.954  60.241 18.603  1.00 66.26  ? 55   VAL A CG1 1 
ATOM 422  C CG2 . VAL A 1 58   ? 22.920  60.296 21.140  1.00 66.26  ? 55   VAL A CG2 1 
ATOM 423  N N   . GLY A 1 59   ? 21.296  56.630 19.856  1.00 59.37  ? 56   GLY A N   1 
ATOM 424  C CA  . GLY A 1 59   ? 21.445  55.327 20.468  1.00 59.37  ? 56   GLY A CA  1 
ATOM 425  C C   . GLY A 1 59   ? 22.917  55.032 20.620  1.00 59.37  ? 56   GLY A C   1 
ATOM 426  O O   . GLY A 1 59   ? 23.745  55.696 20.022  1.00 59.37  ? 56   GLY A O   1 
ATOM 427  N N   . MET A 1 60   ? 23.247  54.045 21.440  1.00 64.34  ? 57   MET A N   1 
ATOM 428  C CA  . MET A 1 60   ? 24.625  53.593 21.559  1.00 64.34  ? 57   MET A CA  1 
ATOM 429  C C   . MET A 1 60   ? 24.734  52.092 21.457  1.00 64.34  ? 57   MET A C   1 
ATOM 430  O O   . MET A 1 60   ? 23.726  51.383 21.449  1.00 64.34  ? 57   MET A O   1 
ATOM 431  C CB  . MET A 1 60   ? 25.211  54.051 22.859  1.00 62.17  ? 57   MET A CB  1 
ATOM 432  C CG  . MET A 1 60   ? 25.480  55.502 22.857  1.00 62.17  ? 57   MET A CG  1 
ATOM 433  S SD  . MET A 1 60   ? 26.449  55.868 24.312  1.00 62.17  ? 57   MET A SD  1 
ATOM 434  C CE  . MET A 1 60   ? 27.862  54.813 24.012  1.00 62.17  ? 57   MET A CE  1 
ATOM 435  N N   . TYR A 1 61   ? 25.969  51.625 21.352  1.00 55.07  ? 58   TYR A N   1 
ATOM 436  C CA  . TYR A 1 61   ? 26.258  50.219 21.247  1.00 55.07  ? 58   TYR A CA  1 
ATOM 437  C C   . TYR A 1 61   ? 26.669  49.744 22.581  1.00 55.07  ? 58   TYR A C   1 
ATOM 438  O O   . TYR A 1 61   ? 27.710  49.140 22.711  1.00 55.07  ? 58   TYR A O   1 
ATOM 439  C CB  . TYR A 1 61   ? 27.398  49.979 20.267  1.00 57.23  ? 58   TYR A CB  1 
ATOM 440  C CG  . TYR A 1 61   ? 26.978  50.127 18.847  1.00 57.23  ? 58   TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 61   ? 25.647  50.086 18.502  1.00 57.23  ? 58   TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 61   ? 27.906  50.280 17.845  1.00 57.23  ? 58   TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 61   ? 25.244  50.206 17.221  1.00 57.23  ? 58   TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 61   ? 27.511  50.403 16.531  1.00 57.23  ? 58   TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 61   ? 26.171  50.364 16.228  1.00 57.23  ? 58   TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 61   ? 25.736  50.484 14.921  1.00 57.23  ? 58   TYR A OH  1 
ATOM 447  N N   . GLY A 1 62   ? 25.864  50.050 23.581  1.00 47.81  ? 59   GLY A N   1 
ATOM 448  C CA  . GLY A 1 62   ? 26.212  49.728 24.957  1.00 47.81  ? 59   GLY A CA  1 
ATOM 449  C C   . GLY A 1 62   ? 25.124  50.046 25.959  1.00 47.81  ? 59   GLY A C   1 
ATOM 450  O O   . GLY A 1 62   ? 24.237  50.826 25.692  1.00 47.81  ? 59   GLY A O   1 
ATOM 451  N N   . LYS A 1 63   ? 25.190  49.410 27.113  1.00 47.78  ? 60   LYS A N   1 
ATOM 452  C CA  . LYS A 1 63   ? 24.294  49.726 28.183  1.00 47.78  ? 60   LYS A CA  1 
ATOM 453  C C   . LYS A 1 63   ? 24.941  50.829 28.983  1.00 47.78  ? 60   LYS A C   1 
ATOM 454  O O   . LYS A 1 63   ? 25.891  50.569 29.723  1.00 47.78  ? 60   LYS A O   1 
ATOM 455  C CB  . LYS A 1 63   ? 24.087  48.518 29.089  1.00 46.19  ? 60   LYS A CB  1 
ATOM 456  C CG  . LYS A 1 63   ? 23.202  47.464 28.538  1.00 46.19  ? 60   LYS A CG  1 
ATOM 457  C CD  . LYS A 1 63   ? 23.310  46.197 29.356  1.00 46.19  ? 60   LYS A CD  1 
ATOM 458  C CE  . LYS A 1 63   ? 22.355  46.172 30.554  1.00 46.19  ? 60   LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 63   ? 20.893  46.296 30.109  1.00 46.19  ? 60   LYS A NZ  1 
ATOM 460  N N   . ILE A 1 64   ? 24.430  52.046 28.857  1.00 43.96  ? 61   ILE A N   1 
ATOM 461  C CA  . ILE A 1 64   ? 24.924  53.161 29.653  1.00 43.96  ? 61   ILE A CA  1 
ATOM 462  C C   . ILE A 1 64   ? 24.926  52.896 31.169  1.00 43.96  ? 61   ILE A C   1 
ATOM 463  O O   . ILE A 1 64   ? 23.888  52.744 31.765  1.00 43.96  ? 61   ILE A O   1 
ATOM 464  C CB  . ILE A 1 64   ? 24.161  54.429 29.318  1.00 36.97  ? 61   ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 64   ? 24.343  54.724 27.836  1.00 36.97  ? 61   ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 64   ? 24.651  55.591 30.158  1.00 36.97  ? 61   ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 64   ? 23.230  55.556 27.229  1.00 36.97  ? 61   ILE A CD1 1 
ATOM 468  N N   . ALA A 1 65   ? 26.099  52.807 31.776  1.00 44.44  ? 62   ALA A N   1 
ATOM 469  C CA  . ALA A 1 65   ? 26.195  52.479 33.184  1.00 44.44  ? 62   ALA A CA  1 
ATOM 470  C C   . ALA A 1 65   ? 26.517  53.704 33.998  1.00 44.44  ? 62   ALA A C   1 
ATOM 471  O O   . ALA A 1 65   ? 26.028  53.852 35.104  1.00 44.44  ? 62   ALA A O   1 
ATOM 472  C CB  . ALA A 1 65   ? 27.224  51.411 33.416  1.00 25.53  ? 62   ALA A CB  1 
ATOM 473  N N   . VAL A 1 66   ? 27.339  54.584 33.441  1.00 51.81  ? 63   VAL A N   1 
ATOM 474  C CA  . VAL A 1 66   ? 27.762  55.826 34.071  1.00 51.81  ? 63   VAL A CA  1 
ATOM 475  C C   . VAL A 1 66   ? 27.450  56.966 33.121  1.00 51.81  ? 63   VAL A C   1 
ATOM 476  O O   . VAL A 1 66   ? 27.537  56.827 31.913  1.00 51.81  ? 63   VAL A O   1 
ATOM 477  C CB  . VAL A 1 66   ? 29.267  55.782 34.349  1.00 46.07  ? 63   VAL A CB  1 
ATOM 478  C CG1 . VAL A 1 66   ? 29.778  57.089 34.966  1.00 46.07  ? 63   VAL A CG1 1 
ATOM 479  C CG2 . VAL A 1 66   ? 29.563  54.620 35.236  1.00 46.07  ? 63   VAL A CG2 1 
ATOM 480  N N   . MET A 1 67   ? 27.066  58.101 33.670  1.00 54.50  ? 64   MET A N   1 
ATOM 481  C CA  . MET A 1 67   ? 26.795  59.258 32.835  1.00 54.50  ? 64   MET A CA  1 
ATOM 482  C C   . MET A 1 67   ? 27.004  60.574 33.614  1.00 54.50  ? 64   MET A C   1 
ATOM 483  O O   . MET A 1 67   ? 26.245  60.902 34.532  1.00 54.50  ? 64   MET A O   1 
ATOM 484  C CB  . MET A 1 67   ? 25.396  59.157 32.212  1.00 43.51  ? 64   MET A CB  1 
ATOM 485  C CG  . MET A 1 67   ? 25.086  60.323 31.363  1.00 43.51  ? 64   MET A CG  1 
ATOM 486  S SD  . MET A 1 67   ? 23.570  60.269 30.383  1.00 43.51  ? 64   MET A SD  1 
ATOM 487  C CE  . MET A 1 67   ? 22.341  60.435 31.696  1.00 43.51  ? 64   MET A CE  1 
ATOM 488  N N   . GLU A 1 68   ? 28.049  61.311 33.255  1.00 61.60  ? 65   GLU A N   1 
ATOM 489  C CA  . GLU A 1 68   ? 28.294  62.610 33.863  1.00 61.60  ? 65   GLU A CA  1 
ATOM 490  C C   . GLU A 1 68   ? 28.587  63.709 32.864  1.00 61.60  ? 65   GLU A C   1 
ATOM 491  O O   . GLU A 1 68   ? 29.151  63.470 31.793  1.00 61.60  ? 65   GLU A O   1 
ATOM 492  C CB  . GLU A 1 68   ? 29.426  62.543 34.884  1.00 72.20  ? 65   GLU A CB  1 
ATOM 493  C CG  . GLU A 1 68   ? 29.150  61.661 36.115  1.00 72.20  ? 65   GLU A CG  1 
ATOM 494  C CD  . GLU A 1 68   ? 27.853  62.003 36.861  1.00 72.20  ? 65   GLU A CD  1 
ATOM 495  O OE1 . GLU A 1 68   ? 27.197  61.046 37.338  1.00 72.20  ? 65   GLU A OE1 1 
ATOM 496  O OE2 . GLU A 1 68   ? 27.486  63.203 36.974  1.00 72.20  ? 65   GLU A OE2 1 
ATOM 497  N N   . LEU A 1 69   ? 28.169  64.916 33.225  1.00 78.97  ? 66   LEU A N   1 
ATOM 498  C CA  . LEU A 1 69   ? 28.589  66.110 32.526  1.00 78.97  ? 66   LEU A CA  1 
ATOM 499  C C   . LEU A 1 69   ? 29.661  66.797 33.340  1.00 78.97  ? 66   LEU A C   1 
ATOM 500  O O   . LEU A 1 69   ? 29.718  66.658 34.569  1.00 78.97  ? 66   LEU A O   1 
ATOM 501  C CB  . LEU A 1 69   ? 27.424  67.054 32.280  1.00 55.51  ? 66   LEU A CB  1 
ATOM 502  C CG  . LEU A 1 69   ? 26.548  66.757 31.061  1.00 55.51  ? 66   LEU A CG  1 
ATOM 503  C CD1 . LEU A 1 69   ? 25.411  67.735 30.996  1.00 55.51  ? 66   LEU A CD1 1 
ATOM 504  C CD2 . LEU A 1 69   ? 27.321  66.802 29.761  1.00 55.51  ? 66   LEU A CD2 1 
ATOM 505  N N   . PHE A 1 70   ? 30.532  67.521 32.648  1.00 61.59  ? 67   PHE A N   1 
ATOM 506  C CA  . PHE A 1 70   ? 31.699  68.118 33.293  1.00 61.59  ? 67   PHE A CA  1 
ATOM 507  C C   . PHE A 1 70   ? 32.409  68.979 32.264  1.00 61.59  ? 67   PHE A C   1 
ATOM 508  O O   . PHE A 1 70   ? 32.213  68.798 31.048  1.00 61.59  ? 67   PHE A O   1 
ATOM 509  C CB  . PHE A 1 70   ? 32.652  67.036 33.802  1.00 63.05  ? 67   PHE A CB  1 
ATOM 510  C CG  . PHE A 1 70   ? 33.426  66.390 32.706  1.00 63.05  ? 67   PHE A CG  1 
ATOM 511  C CD1 . PHE A 1 70   ? 34.761  66.696 32.515  1.00 63.05  ? 67   PHE A CD1 1 
ATOM 512  C CD2 . PHE A 1 70   ? 32.793  65.529 31.813  1.00 63.05  ? 67   PHE A CD2 1 
ATOM 513  C CE1 . PHE A 1 70   ? 35.459  66.123 31.480  1.00 63.05  ? 67   PHE A CE1 1 
ATOM 514  C CE2 . PHE A 1 70   ? 33.476  64.956 30.783  1.00 63.05  ? 67   PHE A CE2 1 
ATOM 515  C CZ  . PHE A 1 70   ? 34.808  65.243 30.606  1.00 63.05  ? 67   PHE A CZ  1 
ATOM 516  N N   . ARG A 1 71   ? 33.240  69.891 32.776  1.00 81.44  ? 68   ARG A N   1 
ATOM 517  C CA  . ARG A 1 71   ? 33.868  70.944 31.987  1.00 81.44  ? 68   ARG A CA  1 
ATOM 518  C C   . ARG A 1 71   ? 35.221  71.289 32.600  1.00 81.44  ? 68   ARG A C   1 
ATOM 519  O O   . ARG A 1 71   ? 35.288  71.776 33.725  1.00 81.44  ? 68   ARG A O   1 
ATOM 520  C CB  . ARG A 1 71   ? 32.933  72.175 31.920  1.00 103.07 ? 68   ARG A CB  1 
ATOM 521  C CG  . ARG A 1 71   ? 33.534  73.475 31.383  1.00 103.07 ? 68   ARG A CG  1 
ATOM 522  C CD  . ARG A 1 71   ? 32.588  74.242 30.425  1.00 103.07 ? 68   ARG A CD  1 
ATOM 523  N NE  . ARG A 1 71   ? 31.307  74.680 31.014  1.00 103.07 ? 68   ARG A NE  1 
ATOM 524  C CZ  . ARG A 1 71   ? 30.584  75.726 30.585  1.00 103.07 ? 68   ARG A CZ  1 
ATOM 525  N NH1 . ARG A 1 71   ? 31.006  76.495 29.572  1.00 103.07 ? 68   ARG A NH1 1 
ATOM 526  N NH2 . ARG A 1 71   ? 29.428  76.025 31.183  1.00 103.07 ? 68   ARG A NH2 1 
ATOM 527  N N   . PRO A 1 72   ? 36.310  71.010 31.873  1.00 116.83 ? 69   PRO A N   1 
ATOM 528  C CA  . PRO A 1 72   ? 37.606  71.476 32.346  1.00 116.83 ? 69   PRO A CA  1 
ATOM 529  C C   . PRO A 1 72   ? 37.829  72.928 31.941  1.00 116.83 ? 69   PRO A C   1 
ATOM 530  O O   . PRO A 1 72   ? 36.988  73.522 31.258  1.00 116.83 ? 69   PRO A O   1 
ATOM 531  C CB  . PRO A 1 72   ? 38.608  70.560 31.638  1.00 69.32  ? 69   PRO A CB  1 
ATOM 532  C CG  . PRO A 1 72   ? 37.820  69.782 30.613  1.00 69.32  ? 69   PRO A CG  1 
ATOM 533  C CD  . PRO A 1 72   ? 36.404  70.267 30.607  1.00 69.32  ? 69   PRO A CD  1 
ATOM 534  N N   . LYS A 1 73   ? 38.955  73.491 32.371  1.00 83.52  ? 70   LYS A N   1 
ATOM 535  C CA  . LYS A 1 73   ? 39.294  74.882 32.078  1.00 83.52  ? 70   LYS A CA  1 
ATOM 536  C C   . LYS A 1 73   ? 39.498  75.024 30.572  1.00 83.52  ? 70   LYS A C   1 
ATOM 537  O O   . LYS A 1 73   ? 39.776  74.037 29.883  1.00 83.52  ? 70   LYS A O   1 
ATOM 538  C CB  . LYS A 1 73   ? 40.555  75.311 32.846  1.00 176.26 ? 70   LYS A CB  1 
ATOM 539  C CG  . LYS A 1 73   ? 40.771  74.607 34.194  1.00 176.26 ? 70   LYS A CG  1 
ATOM 540  C CD  . LYS A 1 73   ? 39.695  74.947 35.220  1.00 176.26 ? 70   LYS A CD  1 
ATOM 541  C CE  . LYS A 1 73   ? 39.400  73.759 36.125  1.00 176.26 ? 70   LYS A CE  1 
ATOM 542  N NZ  . LYS A 1 73   ? 38.663  72.666 35.420  1.00 176.26 ? 70   LYS A NZ  1 
ATOM 543  N N   . GLY A 1 74   ? 39.329  76.244 30.066  1.00 150.35 ? 71   GLY A N   1 
ATOM 544  C CA  . GLY A 1 74   ? 39.474  76.523 28.636  1.00 150.35 ? 71   GLY A CA  1 
ATOM 545  C C   . GLY A 1 74   ? 38.519  75.712 27.779  1.00 150.35 ? 71   GLY A C   1 
ATOM 546  O O   . GLY A 1 74   ? 38.882  75.263 26.686  1.00 150.35 ? 71   GLY A O   1 
ATOM 547  N N   . GLU A 1 75   ? 37.303  75.519 28.295  1.00 85.28  ? 72   GLU A N   1 
ATOM 548  C CA  . GLU A 1 75   ? 36.234  74.795 27.602  1.00 85.28  ? 72   GLU A CA  1 
ATOM 549  C C   . GLU A 1 75   ? 34.977  75.656 27.453  1.00 85.28  ? 72   GLU A C   1 
ATOM 550  O O   . GLU A 1 75   ? 34.515  76.250 28.429  1.00 85.28  ? 72   GLU A O   1 
ATOM 551  C CB  . GLU A 1 75   ? 35.916  73.493 28.344  1.00 79.70  ? 72   GLU A CB  1 
ATOM 552  C CG  . GLU A 1 75   ? 36.560  72.255 27.734  1.00 79.70  ? 72   GLU A CG  1 
ATOM 553  C CD  . GLU A 1 75   ? 36.124  72.017 26.281  1.00 79.70  ? 72   GLU A CD  1 
ATOM 554  O OE1 . GLU A 1 75   ? 36.908  71.424 25.507  1.00 79.70  ? 72   GLU A OE1 1 
ATOM 555  O OE2 . GLU A 1 75   ? 35.003  72.432 25.908  1.00 79.70  ? 72   GLU A OE2 1 
ATOM 556  N N   . SER A 1 76   ? 34.435  75.719 26.236  1.00 91.34  ? 73   SER A N   1 
ATOM 557  C CA  . SER A 1 76   ? 33.280  76.575 25.936  1.00 91.34  ? 73   SER A CA  1 
ATOM 558  C C   . SER A 1 76   ? 31.974  76.096 26.567  1.00 91.34  ? 73   SER A C   1 
ATOM 559  O O   . SER A 1 76   ? 31.195  76.907 27.063  1.00 91.34  ? 73   SER A O   1 
ATOM 560  C CB  . SER A 1 76   ? 33.097  76.740 24.429  1.00 81.20  ? 73   SER A CB  1 
ATOM 561  O OG  . SER A 1 76   ? 33.087  75.483 23.790  1.00 81.20  ? 73   SER A OG  1 
ATOM 562  N N   . LYS A 1 77   ? 31.736  74.785 26.542  1.00 87.85  ? 74   LYS A N   1 
ATOM 563  C CA  . LYS A 1 77   ? 30.557  74.185 27.175  1.00 87.85  ? 74   LYS A CA  1 
ATOM 564  C C   . LYS A 1 77   ? 30.891  72.815 27.732  1.00 87.85  ? 74   LYS A C   1 
ATOM 565  O O   . LYS A 1 77   ? 31.996  72.322 27.524  1.00 87.85  ? 74   LYS A O   1 
ATOM 566  C CB  . LYS A 1 77   ? 29.394  74.093 26.193  1.00 59.76  ? 74   LYS A CB  1 
ATOM 567  C CG  . LYS A 1 77   ? 29.716  73.380 24.902  1.00 59.76  ? 74   LYS A CG  1 
ATOM 568  C CD  . LYS A 1 77   ? 28.712  73.762 23.847  1.00 59.76  ? 74   LYS A CD  1 
ATOM 569  C CE  . LYS A 1 77   ? 28.736  72.777 22.708  1.00 59.76  ? 74   LYS A CE  1 
ATOM 570  N NZ  . LYS A 1 77   ? 30.014  72.776 21.949  1.00 59.76  ? 74   LYS A NZ  1 
ATOM 571  N N   . ASP A 1 78   ? 29.931  72.211 28.437  1.00 67.18  ? 75   ASP A N   1 
ATOM 572  C CA  . ASP A 1 78   ? 30.117  70.911 29.110  1.00 67.18  ? 75   ASP A CA  1 
ATOM 573  C C   . ASP A 1 78   ? 30.355  69.768 28.147  1.00 67.18  ? 75   ASP A C   1 
ATOM 574  O O   . ASP A 1 78   ? 29.872  69.738 27.015  1.00 67.18  ? 75   ASP A O   1 
ATOM 575  C CB  . ASP A 1 78   ? 28.922  70.557 30.003  1.00 78.62  ? 75   ASP A CB  1 
ATOM 576  C CG  . ASP A 1 78   ? 28.920  71.305 31.316  1.00 78.62  ? 75   ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 78   ? 28.043  71.043 32.156  1.00 78.62  ? 75   ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 78   ? 29.792  72.153 31.529  1.00 78.62  ? 75   ASP A OD2 1 
ATOM 579  N N   . LEU A 1 79   ? 31.116  68.815 28.626  1.00 57.92  ? 76   LEU A N   1 
ATOM 580  C CA  . LEU A 1 79   ? 31.387  67.628 27.857  1.00 57.92  ? 76   LEU A CA  1 
ATOM 581  C C   . LEU A 1 79   ? 30.737  66.448 28.542  1.00 57.92  ? 76   LEU A C   1 
ATOM 582  O O   . LEU A 1 79   ? 30.486  66.494 29.764  1.00 57.92  ? 76   LEU A O   1 
ATOM 583  C CB  . LEU A 1 79   ? 32.889  67.402 27.764  1.00 56.09  ? 76   LEU A CB  1 
ATOM 584  C CG  . LEU A 1 79   ? 33.624  68.253 26.744  1.00 56.09  ? 76   LEU A CG  1 
ATOM 585  C CD1 . LEU A 1 79   ? 35.074  67.928 26.926  1.00 56.09  ? 76   LEU A CD1 1 
ATOM 586  C CD2 . LEU A 1 79   ? 33.164  67.928 25.330  1.00 56.09  ? 76   LEU A CD2 1 
ATOM 587  N N   . LEU A 1 80   ? 30.496  65.390 27.772  1.00 58.49  ? 77   LEU A N   1 
ATOM 588  C CA  . LEU A 1 80   ? 29.788  64.248 28.302  1.00 58.49  ? 77   LEU A CA  1 
ATOM 589  C C   . LEU A 1 80   ? 30.647  63.028 28.450  1.00 58.49  ? 77   LEU A C   1 
ATOM 590  O O   . LEU A 1 80   ? 31.157  62.525 27.465  1.00 58.49  ? 77   LEU A O   1 
ATOM 591  C CB  . LEU A 1 80   ? 28.631  63.896 27.391  1.00 58.41  ? 77   LEU A CB  1 
ATOM 592  C CG  . LEU A 1 80   ? 27.752  62.787 27.952  1.00 58.41  ? 77   LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 80   ? 27.395  63.033 29.439  1.00 58.41  ? 77   LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 80   ? 26.515  62.646 27.083  1.00 58.41  ? 77   LEU A CD2 1 
ATOM 595  N N   . PHE A 1 81   ? 30.769  62.530 29.674  1.00 61.56  ? 78   PHE A N   1 
ATOM 596  C CA  . PHE A 1 81   ? 31.478  61.285 29.894  1.00 61.56  ? 78   PHE A CA  1 
ATOM 597  C C   . PHE A 1 81   ? 30.497  60.133 29.950  1.00 61.56  ? 78   PHE A C   1 
ATOM 598  O O   . PHE A 1 81   ? 29.533  60.184 30.694  1.00 61.56  ? 78   PHE A O   1 
ATOM 599  C CB  . PHE A 1 81   ? 32.292  61.318 31.187  1.00 51.64  ? 78   PHE A CB  1 
ATOM 600  C CG  . PHE A 1 81   ? 32.827  59.972 31.573  1.00 51.64  ? 78   PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 81   ? 33.818  59.359 30.820  1.00 51.64  ? 78   PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 81   ? 32.310  59.287 32.642  1.00 51.64  ? 78   PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 81   ? 34.290  58.099 31.147  1.00 51.64  ? 78   PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 81   ? 32.783  58.029 32.960  1.00 51.64  ? 78   PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 81   ? 33.763  57.442 32.208  1.00 51.64  ? 78   PHE A CZ  1 
ATOM 606  N N   . ILE A 1 82   ? 30.746  59.082 29.190  1.00 66.07  ? 79   ILE A N   1 
ATOM 607  C CA  . ILE A 1 82   ? 29.841  57.956 29.216  1.00 66.07  ? 79   ILE A CA  1 
ATOM 608  C C   . ILE A 1 82   ? 30.574  56.661 29.354  1.00 66.07  ? 79   ILE A C   1 
ATOM 609  O O   . ILE A 1 82   ? 31.487  56.382 28.593  1.00 66.07  ? 79   ILE A O   1 
ATOM 610  C CB  . ILE A 1 82   ? 28.990  57.876 27.937  1.00 44.92  ? 79   ILE A CB  1 
ATOM 611  C CG1 . ILE A 1 82   ? 28.049  59.061 27.854  1.00 44.92  ? 79   ILE A CG1 1 
ATOM 612  C CG2 . ILE A 1 82   ? 28.183  56.572 27.893  1.00 44.92  ? 79   ILE A CG2 1 
ATOM 613  C CD1 . ILE A 1 82   ? 26.769  58.732 27.230  1.00 44.92  ? 79   ILE A CD1 1 
ATOM 614  N N   . LEU A 1 83   ? 30.140  55.854 30.307  1.00 46.24  ? 80   LEU A N   1 
ATOM 615  C CA  . LEU A 1 83   ? 30.691  54.529 30.464  1.00 46.24  ? 80   LEU A CA  1 
ATOM 616  C C   . LEU A 1 83   ? 29.692  53.419 30.295  1.00 46.24  ? 80   LEU A C   1 
ATOM 617  O O   . LEU A 1 83   ? 28.755  53.309 31.039  1.00 46.24  ? 80   LEU A O   1 
ATOM 618  C CB  . LEU A 1 83   ? 31.316  54.368 31.828  1.00 30.95  ? 80   LEU A CB  1 
ATOM 619  C CG  . LEU A 1 83   ? 31.753  52.920 32.083  1.00 30.95  ? 80   LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 83   ? 32.775  52.458 31.035  1.00 30.95  ? 80   LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 83   ? 32.312  52.810 33.500  1.00 30.95  ? 80   LEU A CD2 1 
ATOM 622  N N   . THR A 1 84   ? 29.949  52.546 29.349  1.00 47.07  ? 81   THR A N   1 
ATOM 623  C CA  . THR A 1 84   ? 29.134  51.382 29.126  1.00 47.07  ? 81   THR A CA  1 
ATOM 624  C C   . THR A 1 84   ? 29.326  50.230 30.106  1.00 47.07  ? 81   THR A C   1 
ATOM 625  O O   . THR A 1 84   ? 30.265  50.201 30.914  1.00 47.07  ? 81   THR A O   1 
ATOM 626  C CB  . THR A 1 84   ? 29.418  50.905 27.745  1.00 32.91  ? 81   THR A CB  1 
ATOM 627  O OG1 . THR A 1 84   ? 28.397  51.424 26.896  1.00 32.91  ? 81   THR A OG1 1 
ATOM 628  C CG2 . THR A 1 84   ? 29.396  49.433 27.639  1.00 32.91  ? 81   THR A CG2 1 
ATOM 629  N N   . ALA A 1 85   ? 28.431  49.263 30.025  1.00 43.89  ? 82   ALA A N   1 
ATOM 630  C CA  . ALA A 1 85   ? 28.518  48.096 30.878  1.00 43.89  ? 82   ALA A CA  1 
ATOM 631  C C   . ALA A 1 85   ? 29.522  47.042 30.391  1.00 43.89  ? 82   ALA A C   1 
ATOM 632  O O   . ALA A 1 85   ? 29.762  46.073 31.091  1.00 43.89  ? 82   ALA A O   1 
ATOM 633  C CB  . ALA A 1 85   ? 27.118  47.486 31.092  1.00 25.90  ? 82   ALA A CB  1 
ATOM 634  N N   . LYS A 1 86   ? 30.086  47.207 29.200  1.00 65.84  ? 83   LYS A N   1 
ATOM 635  C CA  . LYS A 1 86   ? 31.169  46.351 28.733  1.00 65.84  ? 83   LYS A CA  1 
ATOM 636  C C   . LYS A 1 86   ? 32.418  47.173 28.713  1.00 65.84  ? 83   LYS A C   1 
ATOM 637  O O   . LYS A 1 86   ? 33.356  46.896 27.989  1.00 65.84  ? 83   LYS A O   1 
ATOM 638  C CB  . LYS A 1 86   ? 30.904  45.841 27.347  1.00 35.38  ? 83   LYS A CB  1 
ATOM 639  C CG  . LYS A 1 86   ? 29.980  44.715 27.309  1.00 35.38  ? 83   LYS A CG  1 
ATOM 640  C CD  . LYS A 1 86   ? 29.531  44.487 25.917  1.00 35.38  ? 83   LYS A CD  1 
ATOM 641  C CE  . LYS A 1 86   ? 29.055  43.064 25.751  1.00 35.38  ? 83   LYS A CE  1 
ATOM 642  N NZ  . LYS A 1 86   ? 28.812  42.750 24.284  1.00 35.38  ? 83   LYS A NZ  1 
ATOM 643  N N   . TYR A 1 87   ? 32.382  48.219 29.514  1.00 46.92  ? 84   TYR A N   1 
ATOM 644  C CA  . TYR A 1 87   ? 33.542  48.976 29.911  1.00 46.92  ? 84   TYR A CA  1 
ATOM 645  C C   . TYR A 1 87   ? 34.094  49.866 28.809  1.00 46.92  ? 84   TYR A C   1 
ATOM 646  O O   . TYR A 1 87   ? 35.261  50.245 28.840  1.00 46.92  ? 84   TYR A O   1 
ATOM 647  C CB  . TYR A 1 87   ? 34.599  48.057 30.546  1.00 45.09  ? 84   TYR A CB  1 
ATOM 648  C CG  . TYR A 1 87   ? 34.065  47.239 31.706  1.00 45.09  ? 84   TYR A CG  1 
ATOM 649  C CD1 . TYR A 1 87   ? 33.693  45.916 31.540  1.00 45.09  ? 84   TYR A CD1 1 
ATOM 650  C CD2 . TYR A 1 87   ? 33.927  47.796 32.966  1.00 45.09  ? 84   TYR A CD2 1 
ATOM 651  C CE1 . TYR A 1 87   ? 33.186  45.177 32.604  1.00 45.09  ? 84   TYR A CE1 1 
ATOM 652  C CE2 . TYR A 1 87   ? 33.419  47.060 34.031  1.00 45.09  ? 84   TYR A CE2 1 
ATOM 653  C CZ  . TYR A 1 87   ? 33.044  45.762 33.837  1.00 45.09  ? 84   TYR A CZ  1 
ATOM 654  O OH  . TYR A 1 87   ? 32.530  45.052 34.889  1.00 45.09  ? 84   TYR A OH  1 
ATOM 655  N N   . ASN A 1 88   ? 33.232  50.242 27.865  1.00 52.82  ? 85   ASN A N   1 
ATOM 656  C CA  . ASN A 1 88   ? 33.531  51.306 26.897  1.00 52.82  ? 85   ASN A CA  1 
ATOM 657  C C   . ASN A 1 88   ? 33.452  52.675 27.525  1.00 52.82  ? 85   ASN A C   1 
ATOM 658  O O   . ASN A 1 88   ? 32.372  53.174 27.776  1.00 52.82  ? 85   ASN A O   1 
ATOM 659  C CB  . ASN A 1 88   ? 32.527  51.265 25.770  1.00 58.08  ? 85   ASN A CB  1 
ATOM 660  C CG  . ASN A 1 88   ? 32.534  49.952 25.050  1.00 58.08  ? 85   ASN A CG  1 
ATOM 661  O OD1 . ASN A 1 88   ? 31.749  49.054 25.354  1.00 58.08  ? 85   ASN A OD1 1 
ATOM 662  N ND2 . ASN A 1 88   ? 33.444  49.815 24.096  1.00 58.08  ? 85   ASN A ND2 1 
ATOM 663  N N   . ALA A 1 89   ? 34.590  53.281 27.812  1.00 47.51  ? 86   ALA A N   1 
ATOM 664  C CA  . ALA A 1 89   ? 34.600  54.695 28.184  1.00 47.51  ? 86   ALA A CA  1 
ATOM 665  C C   . ALA A 1 89   ? 34.529  55.531 26.926  1.00 47.51  ? 86   ALA A C   1 
ATOM 666  O O   . ALA A 1 89   ? 34.892  55.068 25.854  1.00 47.51  ? 86   ALA A O   1 
ATOM 667  C CB  . ALA A 1 89   ? 35.845  55.029 28.932  1.00 39.21  ? 86   ALA A CB  1 
ATOM 668  N N   . CYS A 1 90   ? 34.046  56.753 27.039  1.00 53.52  ? 87   CYS A N   1 
ATOM 669  C CA  . CYS A 1 90   ? 34.160  57.685 25.927  1.00 53.52  ? 87   CYS A CA  1 
ATOM 670  C C   . CYS A 1 90   ? 33.727  59.065 26.347  1.00 53.52  ? 87   CYS A C   1 
ATOM 671  O O   . CYS A 1 90   ? 33.151  59.227 27.416  1.00 53.52  ? 87   CYS A O   1 
ATOM 672  C CB  . CYS A 1 90   ? 33.359  57.214 24.735  1.00 54.85  ? 87   CYS A CB  1 
ATOM 673  S SG  . CYS A 1 90   ? 31.669  57.586 24.911  1.00 54.85  ? 87   CYS A SG  1 
ATOM 674  N N   . ILE A 1 91   ? 34.031  60.066 25.533  1.00 59.19  ? 88   ILE A N   1 
ATOM 675  C CA  . ILE A 1 91   ? 33.726  61.430 25.908  1.00 59.19  ? 88   ILE A CA  1 
ATOM 676  C C   . ILE A 1 91   ? 33.124  62.134 24.748  1.00 59.19  ? 88   ILE A C   1 
ATOM 677  O O   . ILE A 1 91   ? 33.760  62.301 23.721  1.00 59.19  ? 88   ILE A O   1 
ATOM 678  C CB  . ILE A 1 91   ? 34.955  62.215 26.322  1.00 47.97  ? 88   ILE A CB  1 
ATOM 679  C CG1 . ILE A 1 91   ? 35.560  61.623 27.596  1.00 47.97  ? 88   ILE A CG1 1 
ATOM 680  C CG2 . ILE A 1 91   ? 34.583  63.674 26.507  1.00 47.97  ? 88   ILE A CG2 1 
ATOM 681  C CD1 . ILE A 1 91   ? 36.715  62.412 28.151  1.00 47.97  ? 88   ILE A CD1 1 
ATOM 682  N N   . LEU A 1 92   ? 31.893  62.573 24.913  1.00 45.38  ? 89   LEU A N   1 
ATOM 683  C CA  . LEU A 1 92   ? 31.189  63.140 23.792  1.00 45.38  ? 89   LEU A CA  1 
ATOM 684  C C   . LEU A 1 92   ? 31.049  64.633 23.912  1.00 45.38  ? 89   LEU A C   1 
ATOM 685  O O   . LEU A 1 92   ? 31.195  65.203 25.016  1.00 45.38  ? 89   LEU A O   1 
ATOM 686  C CB  . LEU A 1 92   ? 29.840  62.478 23.660  1.00 40.11  ? 89   LEU A CB  1 
ATOM 687  C CG  . LEU A 1 92   ? 29.910  60.959 23.783  1.00 40.11  ? 89   LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 92   ? 28.497  60.426 23.861  1.00 40.11  ? 89   LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 92   ? 30.673  60.302 22.629  1.00 40.11  ? 89   LEU A CD2 1 
ATOM 690  N N   . GLU A 1 93   ? 30.773  65.246 22.757  1.00 68.06  ? 90   GLU A N   1 
ATOM 691  C CA  . GLU A 1 93   ? 30.618  66.689 22.604  1.00 68.06  ? 90   GLU A CA  1 
ATOM 692  C C   . GLU A 1 93   ? 29.470  66.998 21.667  1.00 68.06  ? 90   GLU A C   1 
ATOM 693  O O   . GLU A 1 93   ? 29.270  66.301 20.671  1.00 68.06  ? 90   GLU A O   1 
ATOM 694  C CB  . GLU A 1 93   ? 31.889  67.295 22.032  1.00 83.45  ? 90   GLU A CB  1 
ATOM 695  C CG  . GLU A 1 93   ? 31.994  68.791 22.217  1.00 83.45  ? 90   GLU A CG  1 
ATOM 696  C CD  . GLU A 1 93   ? 32.730  69.461 21.072  1.00 83.45  ? 90   GLU A CD  1 
ATOM 697  O OE1 . GLU A 1 93   ? 33.987  69.379 21.011  1.00 83.45  ? 90   GLU A OE1 1 
ATOM 698  O OE2 . GLU A 1 93   ? 32.034  70.071 20.220  1.00 83.45  ? 90   GLU A OE2 1 
ATOM 699  N N   . TYR A 1 94   ? 28.729  68.058 21.990  1.00 97.47  ? 91   TYR A N   1 
ATOM 700  C CA  . TYR A 1 94   ? 27.622  68.504 21.155  1.00 97.47  ? 91   TYR A CA  1 
ATOM 701  C C   . TYR A 1 94   ? 28.081  69.414 20.026  1.00 97.47  ? 91   TYR A C   1 
ATOM 702  O O   . TYR A 1 94   ? 28.714  70.441 20.257  1.00 97.47  ? 91   TYR A O   1 
ATOM 703  C CB  . TYR A 1 94   ? 26.530  69.175 21.983  1.00 89.33  ? 91   TYR A CB  1 
ATOM 704  C CG  . TYR A 1 94   ? 25.255  69.357 21.196  1.00 89.33  ? 91   TYR A CG  1 
ATOM 705  C CD1 . TYR A 1 94   ? 24.590  68.255 20.649  1.00 89.33  ? 91   TYR A CD1 1 
ATOM 706  C CD2 . TYR A 1 94   ? 24.719  70.621 20.980  1.00 89.33  ? 91   TYR A CD2 1 
ATOM 707  C CE1 . TYR A 1 94   ? 23.428  68.407 19.910  1.00 89.33  ? 91   TYR A CE1 1 
ATOM 708  C CE2 . TYR A 1 94   ? 23.552  70.783 20.248  1.00 89.33  ? 91   TYR A CE2 1 
ATOM 709  C CZ  . TYR A 1 94   ? 22.912  69.673 19.713  1.00 89.33  ? 91   TYR A CZ  1 
ATOM 710  O OH  . TYR A 1 94   ? 21.756  69.830 18.972  1.00 89.33  ? 91   TYR A OH  1 
ATOM 711  N N   . LYS A 1 95   ? 27.742  69.028 18.802  1.00 69.17  ? 92   LYS A N   1 
ATOM 712  C CA  . LYS A 1 95   ? 28.276  69.685 17.615  1.00 69.17  ? 92   LYS A CA  1 
ATOM 713  C C   . LYS A 1 95   ? 27.186  69.985 16.588  1.00 69.17  ? 92   LYS A C   1 
ATOM 714  O O   . LYS A 1 95   ? 26.829  69.130 15.779  1.00 69.17  ? 92   LYS A O   1 
ATOM 715  C CB  . LYS A 1 95   ? 29.366  68.800 16.996  1.00 84.53  ? 92   LYS A CB  1 
ATOM 716  C CG  . LYS A 1 95   ? 30.170  69.445 15.866  1.00 84.53  ? 92   LYS A CG  1 
ATOM 717  C CD  . LYS A 1 95   ? 31.501  70.051 16.370  1.00 84.53  ? 92   LYS A CD  1 
ATOM 718  C CE  . LYS A 1 95   ? 32.289  70.795 15.250  1.00 84.53  ? 92   LYS A CE  1 
ATOM 719  N NZ  . LYS A 1 95   ? 32.606  69.977 14.013  1.00 84.53  ? 92   LYS A NZ  1 
ATOM 720  N N   . GLN A 1 96   ? 26.659  71.199 16.603  1.00 80.89  ? 93   GLN A N   1 
ATOM 721  C CA  . GLN A 1 96   ? 25.658  71.543 15.600  1.00 80.89  ? 93   GLN A CA  1 
ATOM 722  C C   . GLN A 1 96   ? 26.250  72.374 14.477  1.00 80.89  ? 93   GLN A C   1 
ATOM 723  O O   . GLN A 1 96   ? 26.501  73.568 14.653  1.00 80.89  ? 93   GLN A O   1 
ATOM 724  C CB  . GLN A 1 96   ? 24.468  72.272 16.220  1.00 102.06 ? 93   GLN A CB  1 
ATOM 725  C CG  . GLN A 1 96   ? 23.313  72.467 15.259  1.00 102.06 ? 93   GLN A CG  1 
ATOM 726  C CD  . GLN A 1 96   ? 22.204  73.304 15.852  1.00 102.06 ? 93   GLN A CD  1 
ATOM 727  O OE1 . GLN A 1 96   ? 22.287  73.747 17.002  1.00 102.06 ? 93   GLN A OE1 1 
ATOM 728  N NE2 . GLN A 1 96   ? 21.151  73.532 15.067  1.00 102.06 ? 93   GLN A NE2 1 
ATOM 729  N N   . SER A 1 97   ? 26.465  71.747 13.325  1.00 156.57 ? 94   SER A N   1 
ATOM 730  C CA  . SER A 1 97   ? 26.906  72.476 12.143  1.00 156.57 ? 94   SER A CA  1 
ATOM 731  C C   . SER A 1 97   ? 25.714  73.172 11.492  1.00 156.57 ? 94   SER A C   1 
ATOM 732  O O   . SER A 1 97   ? 25.201  72.731 10.459  1.00 156.57 ? 94   SER A O   1 
ATOM 733  C CB  . SER A 1 97   ? 27.612  71.547 11.158  1.00 125.92 ? 94   SER A CB  1 
ATOM 734  O OG  . SER A 1 97   ? 28.781  71.001 11.743  1.00 125.92 ? 94   SER A OG  1 
ATOM 735  N N   . GLY A 1 98   ? 25.272  74.254 12.129  1.00 84.28  ? 95   GLY A N   1 
ATOM 736  C CA  . GLY A 1 98   ? 24.165  75.072 11.638  1.00 84.28  ? 95   GLY A CA  1 
ATOM 737  C C   . GLY A 1 98   ? 22.807  74.396 11.708  1.00 84.28  ? 95   GLY A C   1 
ATOM 738  O O   . GLY A 1 98   ? 21.981  74.731 12.568  1.00 84.28  ? 95   GLY A O   1 
ATOM 739  N N   . GLU A 1 99   ? 22.570  73.457 10.791  1.00 78.58  ? 96   GLU A N   1 
ATOM 740  C CA  . GLU A 1 99   ? 21.329  72.679 10.776  1.00 78.58  ? 96   GLU A CA  1 
ATOM 741  C C   . GLU A 1 99   ? 21.592  71.195 11.107  1.00 78.58  ? 96   GLU A C   1 
ATOM 742  O O   . GLU A 1 99   ? 20.797  70.570 11.815  1.00 78.58  ? 96   GLU A O   1 
ATOM 743  C CB  . GLU A 1 99   ? 20.576  72.848 9.442   1.00 144.20 ? 96   GLU A CB  1 
ATOM 744  C CG  . GLU A 1 99   ? 21.132  72.059 8.241   1.00 144.20 ? 96   GLU A CG  1 
ATOM 745  C CD  . GLU A 1 99   ? 22.528  72.493 7.832   1.00 144.20 ? 96   GLU A CD  1 
ATOM 746  O OE1 . GLU A 1 99   ? 22.653  73.539 7.168   1.00 144.20 ? 96   GLU A OE1 1 
ATOM 747  O OE2 . GLU A 1 99   ? 23.497  71.783 8.171   1.00 144.20 ? 96   GLU A OE2 1 
ATOM 748  N N   . SER A 1 100  ? 22.698  70.636 10.604  1.00 103.25 ? 97   SER A N   1 
ATOM 749  C CA  . SER A 1 100  ? 23.102  69.283 10.983  1.00 103.25 ? 97   SER A CA  1 
ATOM 750  C C   . SER A 1 100  ? 23.499  69.272 12.438  1.00 103.25 ? 97   SER A C   1 
ATOM 751  O O   . SER A 1 100  ? 24.207  70.159 12.917  1.00 103.25 ? 97   SER A O   1 
ATOM 752  C CB  . SER A 1 100  ? 24.276  68.784 10.147  1.00 90.71  ? 97   SER A CB  1 
ATOM 753  O OG  . SER A 1 100  ? 23.826  68.147 8.970   1.00 90.71  ? 97   SER A OG  1 
ATOM 754  N N   . ILE A 1 101  ? 23.021  68.266 13.146  1.00 79.65  ? 98   ILE A N   1 
ATOM 755  C CA  . ILE A 1 101  ? 23.414  68.066 14.528  1.00 79.65  ? 98   ILE A CA  1 
ATOM 756  C C   . ILE A 1 101  ? 24.261  66.812 14.590  1.00 79.65  ? 98   ILE A C   1 
ATOM 757  O O   . ILE A 1 101  ? 24.050  65.859 13.822  1.00 79.65  ? 98   ILE A O   1 
ATOM 758  C CB  . ILE A 1 101  ? 22.195  67.965 15.507  1.00 77.58  ? 98   ILE A CB  1 
ATOM 759  C CG1 . ILE A 1 101  ? 21.077  67.013 14.988  1.00 77.58  ? 98   ILE A CG1 1 
ATOM 760  C CG2 . ILE A 1 101  ? 21.667  69.351 15.890  1.00 77.58  ? 98   ILE A CG2 1 
ATOM 761  C CD1 . ILE A 1 101  ? 20.806  66.973 13.463  1.00 77.58  ? 98   ILE A CD1 1 
ATOM 762  N N   . ASP A 1 102  ? 25.235  66.838 15.492  1.00 77.42  ? 99   ASP A N   1 
ATOM 763  C CA  . ASP A 1 102  ? 26.173  65.736 15.661  1.00 77.42  ? 99   ASP A CA  1 
ATOM 764  C C   . ASP A 1 102  ? 26.694  65.671 17.078  1.00 77.42  ? 99   ASP A C   1 
ATOM 765  O O   . ASP A 1 102  ? 26.974  66.692 17.713  1.00 77.42  ? 99   ASP A O   1 
ATOM 766  C CB  . ASP A 1 102  ? 27.369  65.876 14.718  1.00 97.51  ? 99   ASP A CB  1 
ATOM 767  C CG  . ASP A 1 102  ? 27.038  65.520 13.292  1.00 97.51  ? 99   ASP A CG  1 
ATOM 768  O OD1 . ASP A 1 102  ? 26.397  64.468 13.061  1.00 97.51  ? 99   ASP A OD1 1 
ATOM 769  O OD2 . ASP A 1 102  ? 27.437  66.302 12.403  1.00 97.51  ? 99   ASP A OD2 1 
ATOM 770  N N   . ILE A 1 103  ? 26.822  64.443 17.558  1.00 78.60  ? 100  ILE A N   1 
ATOM 771  C CA  . ILE A 1 103  ? 27.529  64.162 18.794  1.00 78.60  ? 100  ILE A CA  1 
ATOM 772  C C   . ILE A 1 103  ? 28.895  63.590 18.421  1.00 78.60  ? 100  ILE A C   1 
ATOM 773  O O   . ILE A 1 103  ? 28.983  62.572 17.722  1.00 78.60  ? 100  ILE A O   1 
ATOM 774  C CB  . ILE A 1 103  ? 26.731  63.188 19.659  1.00 74.65  ? 100  ILE A CB  1 
ATOM 775  C CG1 . ILE A 1 103  ? 25.544  63.918 20.272  1.00 74.65  ? 100  ILE A CG1 1 
ATOM 776  C CG2 . ILE A 1 103  ? 27.588  62.627 20.764  1.00 74.65  ? 100  ILE A CG2 1 
ATOM 777  C CD1 . ILE A 1 103  ? 24.280  63.163 20.169  1.00 74.65  ? 100  ILE A CD1 1 
ATOM 778  N N   . ILE A 1 104  ? 29.957  64.267 18.855  1.00 66.29  ? 101  ILE A N   1 
ATOM 779  C CA  . ILE A 1 104  ? 31.313  63.874 18.463  1.00 66.29  ? 101  ILE A CA  1 
ATOM 780  C C   . ILE A 1 104  ? 32.079  63.193 19.600  1.00 66.29  ? 101  ILE A C   1 
ATOM 781  O O   . ILE A 1 104  ? 31.875  63.481 20.784  1.00 66.29  ? 101  ILE A O   1 
ATOM 782  C CB  . ILE A 1 104  ? 32.091  65.047 17.805  1.00 86.17  ? 101  ILE A CB  1 
ATOM 783  C CG1 . ILE A 1 104  ? 32.654  64.589 16.462  1.00 86.17  ? 101  ILE A CG1 1 
ATOM 784  C CG2 . ILE A 1 104  ? 33.174  65.623 18.725  1.00 86.17  ? 101  ILE A CG2 1 
ATOM 785  C CD1 . ILE A 1 104  ? 32.575  65.638 15.366  1.00 86.17  ? 101  ILE A CD1 1 
ATOM 786  N N   . THR A 1 105  ? 32.936  62.257 19.228  1.00 60.74  ? 102  THR A N   1 
ATOM 787  C CA  . THR A 1 105  ? 33.708  61.507 20.205  1.00 60.74  ? 102  THR A CA  1 
ATOM 788  C C   . THR A 1 105  ? 35.060  62.159 20.368  1.00 60.74  ? 102  THR A C   1 
ATOM 789  O O   . THR A 1 105  ? 35.881  62.131 19.455  1.00 60.74  ? 102  THR A O   1 
ATOM 790  C CB  . THR A 1 105  ? 33.900  60.089 19.728  1.00 57.70  ? 102  THR A CB  1 
ATOM 791  O OG1 . THR A 1 105  ? 32.716  59.683 19.022  1.00 57.70  ? 102  THR A OG1 1 
ATOM 792  C CG2 . THR A 1 105  ? 34.170  59.178 20.891  1.00 57.70  ? 102  THR A CG2 1 
ATOM 793  N N   . ARG A 1 106  ? 35.275  62.763 21.528  1.00 62.57  ? 103  ARG A N   1 
ATOM 794  C CA  . ARG A 1 106  ? 36.507  63.472 21.813  1.00 62.57  ? 103  ARG A CA  1 
ATOM 795  C C   . ARG A 1 106  ? 37.586  62.510 22.281  1.00 62.57  ? 103  ARG A C   1 
ATOM 796  O O   . ARG A 1 106  ? 38.773  62.764 22.080  1.00 62.57  ? 103  ARG A O   1 
ATOM 797  C CB  . ARG A 1 106  ? 36.265  64.596 22.819  1.00 54.43  ? 103  ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106  ? 35.633  65.810 22.173  1.00 54.43  ? 103  ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106  ? 36.699  66.810 21.691  1.00 54.43  ? 103  ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106  ? 36.786  68.001 22.553  1.00 54.43  ? 103  ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106  ? 37.539  68.123 23.652  1.00 54.43  ? 103  ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106  ? 38.339  67.129 24.073  1.00 54.43  ? 103  ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106  ? 37.489  69.257 24.346  1.00 54.43  ? 103  ARG A NH2 1 
ATOM 804  N N   . ALA A 1 107  ? 37.166  61.396 22.871  1.00 57.08  ? 104  ALA A N   1 
ATOM 805  C CA  . ALA A 1 107  ? 38.068  60.356 23.340  1.00 57.08  ? 104  ALA A CA  1 
ATOM 806  C C   . ALA A 1 107  ? 37.275  59.093 23.528  1.00 57.08  ? 104  ALA A C   1 
ATOM 807  O O   . ALA A 1 107  ? 36.052  59.139 23.563  1.00 57.08  ? 104  ALA A O   1 
ATOM 808  C CB  . ALA A 1 107  ? 38.661  60.746 24.642  1.00 25.06  ? 104  ALA A CB  1 
ATOM 809  N N   . HIS A 1 108  ? 37.976  57.974 23.668  1.00 55.82  ? 105  HIS A N   1 
ATOM 810  C CA  . HIS A 1 108  ? 37.356  56.694 23.926  1.00 55.82  ? 105  HIS A CA  1 
ATOM 811  C C   . HIS A 1 108  ? 38.372  55.586 24.094  1.00 55.82  ? 105  HIS A C   1 
ATOM 812  O O   . HIS A 1 108  ? 39.413  55.549 23.447  1.00 55.82  ? 105  HIS A O   1 
ATOM 813  C CB  . HIS A 1 108  ? 36.451  56.317 22.785  1.00 75.07  ? 105  HIS A CB  1 
ATOM 814  C CG  . HIS A 1 108  ? 37.191  55.939 21.551  1.00 75.07  ? 105  HIS A CG  1 
ATOM 815  N ND1 . HIS A 1 108  ? 37.841  56.863 20.765  1.00 75.07  ? 105  HIS A ND1 1 
ATOM 816  C CD2 . HIS A 1 108  ? 37.403  54.733 20.977  1.00 75.07  ? 105  HIS A CD2 1 
ATOM 817  C CE1 . HIS A 1 108  ? 38.405  56.244 19.747  1.00 75.07  ? 105  HIS A CE1 1 
ATOM 818  N NE2 . HIS A 1 108  ? 38.156  54.950 19.855  1.00 75.07  ? 105  HIS A NE2 1 
ATOM 819  N N   . GLY A 1 109  ? 38.041  54.643 24.945  1.00 53.94  ? 106  GLY A N   1 
ATOM 820  C CA  . GLY A 1 109  ? 38.819  53.450 25.032  1.00 53.94  ? 106  GLY A CA  1 
ATOM 821  C C   . GLY A 1 109  ? 38.147  52.500 25.968  1.00 53.94  ? 106  GLY A C   1 
ATOM 822  O O   . GLY A 1 109  ? 37.410  52.902 26.860  1.00 53.94  ? 106  GLY A O   1 
ATOM 823  N N   . ASN A 1 110  ? 38.422  51.223 25.781  1.00 53.60  ? 107  ASN A N   1 
ATOM 824  C CA  . ASN A 1 110  ? 37.871  50.236 26.661  1.00 53.60  ? 107  ASN A CA  1 
ATOM 825  C C   . ASN A 1 110  ? 38.663  50.016 27.937  1.00 53.60  ? 107  ASN A C   1 
ATOM 826  O O   . ASN A 1 110  ? 39.824  49.625 27.882  1.00 53.60  ? 107  ASN A O   1 
ATOM 827  C CB  . ASN A 1 110  ? 37.723  48.941 25.928  1.00 49.08  ? 107  ASN A CB  1 
ATOM 828  C CG  . ASN A 1 110  ? 36.788  48.052 26.608  1.00 49.08  ? 107  ASN A CG  1 
ATOM 829  O OD1 . ASN A 1 110  ? 37.114  47.464 27.654  1.00 49.08  ? 107  ASN A OD1 1 
ATOM 830  N ND2 . ASN A 1 110  ? 35.584  47.956 26.061  1.00 49.08  ? 107  ASN A ND2 1 
ATOM 831  N N   . VAL A 1 111  ? 38.010  50.226 29.079  1.00 51.85  ? 108  VAL A N   1 
ATOM 832  C CA  . VAL A 1 111  ? 38.682  50.194 30.385  1.00 51.85  ? 108  VAL A CA  1 
ATOM 833  C C   . VAL A 1 111  ? 38.516  48.938 31.236  1.00 51.85  ? 108  VAL A C   1 
ATOM 834  O O   . VAL A 1 111  ? 38.820  48.957 32.428  1.00 51.85  ? 108  VAL A O   1 
ATOM 835  C CB  . VAL A 1 111  ? 38.242  51.351 31.283  1.00 35.28  ? 108  VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 111  ? 38.416  52.665 30.593  1.00 35.28  ? 108  VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 111  ? 36.807  51.187 31.656  1.00 35.28  ? 108  VAL A CG2 1 
ATOM 838  N N   . GLN A 1 112  ? 38.030  47.849 30.668  1.00 58.86  ? 109  GLN A N   1 
ATOM 839  C CA  . GLN A 1 112  ? 37.878  46.649 31.477  1.00 58.86  ? 109  GLN A CA  1 
ATOM 840  C C   . GLN A 1 112  ? 39.257  46.137 31.827  1.00 58.86  ? 109  GLN A C   1 
ATOM 841  O O   . GLN A 1 112  ? 40.244  46.602 31.268  1.00 58.86  ? 109  GLN A O   1 
ATOM 842  C CB  . GLN A 1 112  ? 37.126  45.594 30.704  1.00 76.36  ? 109  GLN A CB  1 
ATOM 843  C CG  . GLN A 1 112  ? 37.677  45.409 29.345  1.00 76.36  ? 109  GLN A CG  1 
ATOM 844  C CD  . GLN A 1 112  ? 37.385  44.064 28.828  1.00 76.36  ? 109  GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 112  ? 37.226  43.888 27.623  1.00 76.36  ? 109  GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 112  ? 37.296  43.082 29.728  1.00 76.36  ? 109  GLN A NE2 1 
ATOM 847  N N   . ASP A 1 113  ? 39.339  45.199 32.756  1.00 73.91  ? 110  ASP A N   1 
ATOM 848  C CA  . ASP A 1 113  ? 40.607  44.617 33.115  1.00 73.91  ? 110  ASP A CA  1 
ATOM 849  C C   . ASP A 1 113  ? 40.421  43.127 32.984  1.00 73.91  ? 110  ASP A C   1 
ATOM 850  O O   . ASP A 1 113  ? 39.298  42.645 33.142  1.00 73.91  ? 110  ASP A O   1 
ATOM 851  C CB  . ASP A 1 113  ? 40.974  45.012 34.544  1.00 62.78  ? 110  ASP A CB  1 
ATOM 852  C CG  . ASP A 1 113  ? 41.059  46.539 34.735  1.00 62.78  ? 110  ASP A CG  1 
ATOM 853  O OD1 . ASP A 1 113  ? 40.395  47.281 33.991  1.00 62.78  ? 110  ASP A OD1 1 
ATOM 854  O OD2 . ASP A 1 113  ? 41.771  47.019 35.639  1.00 62.78  ? 110  ASP A OD2 1 
ATOM 855  N N   . ARG A 1 114  ? 41.497  42.399 32.667  1.00 81.00  ? 111  ARG A N   1 
ATOM 856  C CA  . ARG A 1 114  ? 41.460  40.932 32.613  1.00 81.00  ? 111  ARG A CA  1 
ATOM 857  C C   . ARG A 1 114  ? 41.100  40.346 33.992  1.00 81.00  ? 111  ARG A C   1 
ATOM 858  O O   . ARG A 1 114  ? 40.410  39.332 34.091  1.00 81.00  ? 111  ARG A O   1 
ATOM 859  C CB  . ARG A 1 114  ? 42.819  40.399 32.158  1.00 168.99 ? 111  ARG A CB  1 
ATOM 860  C CG  . ARG A 1 114  ? 42.773  39.040 31.475  1.00 168.99 ? 111  ARG A CG  1 
ATOM 861  C CD  . ARG A 1 114  ? 42.747  39.186 29.967  1.00 168.99 ? 111  ARG A CD  1 
ATOM 862  N NE  . ARG A 1 114  ? 44.060  39.546 29.438  1.00 168.99 ? 111  ARG A NE  1 
ATOM 863  C CZ  . ARG A 1 114  ? 44.257  40.235 28.317  1.00 168.99 ? 111  ARG A CZ  1 
ATOM 864  N NH1 . ARG A 1 114  ? 43.227  40.658 27.599  1.00 168.99 ? 111  ARG A NH1 1 
ATOM 865  N NH2 . ARG A 1 114  ? 45.490  40.512 27.916  1.00 168.99 ? 111  ARG A NH2 1 
ATOM 866  N N   . ILE A 1 115  ? 41.580  41.003 35.046  1.00 126.79 ? 112  ILE A N   1 
ATOM 867  C CA  . ILE A 1 115  ? 41.303  40.618 36.426  1.00 126.79 ? 112  ILE A CA  1 
ATOM 868  C C   . ILE A 1 115  ? 39.977  41.233 36.823  1.00 126.79 ? 112  ILE A C   1 
ATOM 869  O O   . ILE A 1 115  ? 39.197  41.659 35.973  1.00 126.79 ? 112  ILE A O   1 
ATOM 870  C CB  . ILE A 1 115  ? 42.403  41.143 37.413  1.00 72.33  ? 112  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 115  ? 43.807  40.825 36.882  1.00 72.33  ? 112  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 115  ? 42.210  40.560 38.835  1.00 72.33  ? 112  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 115  ? 44.100  41.430 35.497  1.00 72.33  ? 112  ILE A CD1 1 
ATOM 874  N N   . GLY A 1 116  ? 39.739  41.274 38.129  1.00 83.45  ? 113  GLY A N   1 
ATOM 875  C CA  . GLY A 1 116  ? 38.559  41.882 38.692  1.00 83.45  ? 113  GLY A CA  1 
ATOM 876  C C   . GLY A 1 116  ? 37.296  41.067 38.524  1.00 83.45  ? 113  GLY A C   1 
ATOM 877  O O   . GLY A 1 116  ? 36.868  40.778 37.400  1.00 83.45  ? 113  GLY A O   1 
ATOM 878  N N   . ARG A 1 117  ? 36.728  40.683 39.667  1.00 74.69  ? 114  ARG A N   1 
ATOM 879  C CA  . ARG A 1 117  ? 35.366  40.194 39.776  1.00 74.69  ? 114  ARG A CA  1 
ATOM 880  C C   . ARG A 1 117  ? 34.557  41.430 40.154  1.00 74.69  ? 114  ARG A C   1 
ATOM 881  O O   . ARG A 1 117  ? 34.891  42.081 41.156  1.00 74.69  ? 114  ARG A O   1 
ATOM 882  C CB  . ARG A 1 117  ? 35.288  39.140 40.878  1.00 115.35 ? 114  ARG A CB  1 
ATOM 883  C CG  . ARG A 1 117  ? 33.993  38.323 40.918  1.00 115.35 ? 114  ARG A CG  1 
ATOM 884  C CD  . ARG A 1 117  ? 33.902  37.482 42.198  1.00 115.35 ? 114  ARG A CD  1 
ATOM 885  N NE  . ARG A 1 117  ? 34.128  38.279 43.410  1.00 115.35 ? 114  ARG A NE  1 
ATOM 886  C CZ  . ARG A 1 117  ? 34.308  37.772 44.630  1.00 115.35 ? 114  ARG A CZ  1 
ATOM 887  N NH1 . ARG A 1 117  ? 34.289  36.454 44.822  1.00 115.35 ? 114  ARG A NH1 1 
ATOM 888  N NH2 . ARG A 1 117  ? 34.509  38.585 45.664  1.00 115.35 ? 114  ARG A NH2 1 
ATOM 889  N N   . PRO A 1 118  ? 33.495  41.756 39.361  1.00 72.34  ? 115  PRO A N   1 
ATOM 890  C CA  . PRO A 1 118  ? 32.739  43.020 39.423  1.00 72.34  ? 115  PRO A CA  1 
ATOM 891  C C   . PRO A 1 118  ? 32.069  43.202 40.785  1.00 72.34  ? 115  PRO A C   1 
ATOM 892  O O   . PRO A 1 118  ? 31.531  42.243 41.331  1.00 72.34  ? 115  PRO A O   1 
ATOM 893  C CB  . PRO A 1 118  ? 31.681  42.849 38.325  1.00 53.29  ? 115  PRO A CB  1 
ATOM 894  C CG  . PRO A 1 118  ? 32.166  41.773 37.456  1.00 53.29  ? 115  PRO A CG  1 
ATOM 895  C CD  . PRO A 1 118  ? 32.901  40.849 38.361  1.00 53.29  ? 115  PRO A CD  1 
ATOM 896  N N   . SER A 1 119  ? 32.089  44.409 41.332  1.00 63.40  ? 116  SER A N   1 
ATOM 897  C CA  . SER A 1 119  ? 31.915  44.541 42.781  1.00 63.40  ? 116  SER A CA  1 
ATOM 898  C C   . SER A 1 119  ? 30.475  44.551 43.323  1.00 63.40  ? 116  SER A C   1 
ATOM 899  O O   . SER A 1 119  ? 29.551  44.015 42.709  1.00 63.40  ? 116  SER A O   1 
ATOM 900  C CB  . SER A 1 119  ? 32.691  45.750 43.303  1.00 51.70  ? 116  SER A CB  1 
ATOM 901  O OG  . SER A 1 119  ? 31.999  46.929 42.994  1.00 51.70  ? 116  SER A OG  1 
ATOM 902  N N   . GLU A 1 120  ? 30.310  45.142 44.502  1.00 164.94 ? 117  GLU A N   1 
ATOM 903  C CA  . GLU A 1 120  ? 29.011  45.235 45.133  1.00 164.94 ? 117  GLU A CA  1 
ATOM 904  C C   . GLU A 1 120  ? 28.499  46.665 45.098  1.00 164.94 ? 117  GLU A C   1 
ATOM 905  O O   . GLU A 1 120  ? 29.143  47.573 45.624  1.00 164.94 ? 117  GLU A O   1 
ATOM 906  C CB  . GLU A 1 120  ? 29.069  44.699 46.562  1.00 122.25 ? 117  GLU A CB  1 
ATOM 907  C CG  . GLU A 1 120  ? 27.705  44.577 47.234  1.00 122.25 ? 117  GLU A CG  1 
ATOM 908  C CD  . GLU A 1 120  ? 26.622  43.974 46.337  1.00 122.25 ? 117  GLU A CD  1 
ATOM 909  O OE1 . GLU A 1 120  ? 26.640  44.199 45.101  1.00 122.25 ? 117  GLU A OE1 1 
ATOM 910  O OE2 . GLU A 1 120  ? 25.734  43.286 46.887  1.00 122.25 ? 117  GLU A OE2 1 
ATOM 911  N N   . THR A 1 121  ? 27.318  46.832 44.500  1.00 83.10  ? 118  THR A N   1 
ATOM 912  C CA  . THR A 1 121  ? 26.754  48.129 44.089  1.00 83.10  ? 118  THR A CA  1 
ATOM 913  C C   . THR A 1 121  ? 27.159  48.397 42.640  1.00 83.10  ? 118  THR A C   1 
ATOM 914  O O   . THR A 1 121  ? 26.981  49.504 42.124  1.00 83.10  ? 118  THR A O   1 
ATOM 915  C CB  . THR A 1 121  ? 27.131  49.342 45.014  1.00 110.92 ? 118  THR A CB  1 
ATOM 916  O OG1 . THR A 1 121  ? 27.037  48.956 46.388  1.00 110.92 ? 118  THR A OG1 1 
ATOM 917  C CG2 . THR A 1 121  ? 26.205  50.554 44.771  1.00 110.92 ? 118  THR A CG2 1 
ATOM 918  N N   . GLY A 1 122  ? 27.692  47.367 41.989  1.00 64.69  ? 119  GLY A N   1 
ATOM 919  C CA  . GLY A 1 122  ? 28.090  47.456 40.589  1.00 64.69  ? 119  GLY A CA  1 
ATOM 920  C C   . GLY A 1 122  ? 28.971  48.652 40.270  1.00 64.69  ? 119  GLY A C   1 
ATOM 921  O O   . GLY A 1 122  ? 29.666  49.189 41.151  1.00 64.69  ? 119  GLY A O   1 
ATOM 922  N N   . ILE A 1 123  ? 28.943  49.081 39.010  1.00 41.59  ? 120  ILE A N   1 
ATOM 923  C CA  . ILE A 1 123  ? 29.860  50.139 38.546  1.00 41.59  ? 120  ILE A CA  1 
ATOM 924  C C   . ILE A 1 123  ? 29.563  51.454 39.246  1.00 41.59  ? 120  ILE A C   1 
ATOM 925  O O   . ILE A 1 123  ? 28.416  51.734 39.515  1.00 41.59  ? 120  ILE A O   1 
ATOM 926  C CB  . ILE A 1 123  ? 29.740  50.332 37.011  1.00 37.95  ? 120  ILE A CB  1 
ATOM 927  C CG1 . ILE A 1 123  ? 30.534  49.262 36.278  1.00 37.95  ? 120  ILE A CG1 1 
ATOM 928  C CG2 . ILE A 1 123  ? 30.189  51.709 36.578  1.00 37.95  ? 120  ILE A CG2 1 
ATOM 929  C CD1 . ILE A 1 123  ? 29.880  48.827 34.995  1.00 37.95  ? 120  ILE A CD1 1 
ATOM 930  N N   . ILE A 1 124  ? 30.597  52.237 39.547  1.00 56.29  ? 121  ILE A N   1 
ATOM 931  C CA  . ILE A 1 124  ? 30.449  53.642 39.943  1.00 56.29  ? 121  ILE A CA  1 
ATOM 932  C C   . ILE A 1 124  ? 31.490  54.464 39.219  1.00 56.29  ? 121  ILE A C   1 
ATOM 933  O O   . ILE A 1 124  ? 32.663  54.176 39.328  1.00 56.29  ? 121  ILE A O   1 
ATOM 934  C CB  . ILE A 1 124  ? 30.717  53.862 41.441  1.00 55.35  ? 121  ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 124  ? 29.940  52.870 42.288  1.00 55.35  ? 121  ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 124  ? 30.429  55.306 41.835  1.00 55.35  ? 121  ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 124  ? 30.459  52.754 43.703  1.00 55.35  ? 121  ILE A CD1 1 
ATOM 938  N N   . GLY A 1 125  ? 31.084  55.493 38.498  1.00 54.18  ? 122  GLY A N   1 
ATOM 939  C CA  . GLY A 1 125  ? 32.034  56.468 37.978  1.00 54.18  ? 122  GLY A CA  1 
ATOM 940  C C   . GLY A 1 125  ? 31.894  57.781 38.718  1.00 54.18  ? 122  GLY A C   1 
ATOM 941  O O   . GLY A 1 125  ? 30.800  58.168 39.075  1.00 54.18  ? 122  GLY A O   1 
ATOM 942  N N   . ILE A 1 126  ? 32.989  58.478 38.974  1.00 47.89  ? 123  ILE A N   1 
ATOM 943  C CA  . ILE A 1 126  ? 32.898  59.787 39.606  1.00 47.89  ? 123  ILE A CA  1 
ATOM 944  C C   . ILE A 1 126  ? 33.922  60.714 38.984  1.00 47.89  ? 123  ILE A C   1 
ATOM 945  O O   . ILE A 1 126  ? 34.879  60.243 38.350  1.00 47.89  ? 123  ILE A O   1 
ATOM 946  C CB  . ILE A 1 126  ? 33.084  59.707 41.137  1.00 43.55  ? 123  ILE A CB  1 
ATOM 947  C CG1 . ILE A 1 126  ? 34.448  59.086 41.469  1.00 43.55  ? 123  ILE A CG1 1 
ATOM 948  C CG2 . ILE A 1 126  ? 31.923  58.906 41.791  1.00 43.55  ? 123  ILE A CG2 1 
ATOM 949  C CD1 . ILE A 1 126  ? 34.685  58.831 42.941  1.00 43.55  ? 123  ILE A CD1 1 
ATOM 950  N N   . ILE A 1 127  ? 33.715  62.023 39.157  1.00 57.90  ? 124  ILE A N   1 
ATOM 951  C CA  . ILE A 1 127  ? 34.641  63.023 38.631  1.00 57.90  ? 124  ILE A CA  1 
ATOM 952  C C   . ILE A 1 127  ? 35.048  64.079 39.664  1.00 57.90  ? 124  ILE A C   1 
ATOM 953  O O   . ILE A 1 127  ? 34.196  64.657 40.341  1.00 57.90  ? 124  ILE A O   1 
ATOM 954  C CB  . ILE A 1 127  ? 34.041  63.747 37.445  1.00 41.22  ? 124  ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127  ? 33.648  62.743 36.378  1.00 41.22  ? 124  ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127  ? 35.026  64.745 36.879  1.00 41.22  ? 124  ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127  ? 33.534  63.356 34.983  1.00 41.22  ? 124  ILE A CD1 1 
ATOM 958  N N   . ASP A 1 128  ? 36.350  64.340 39.783  1.00 69.56  ? 125  ASP A N   1 
ATOM 959  C CA  . ASP A 1 128  ? 36.822  65.431 40.625  1.00 69.56  ? 125  ASP A CA  1 
ATOM 960  C C   . ASP A 1 128  ? 36.269  66.739 40.053  1.00 69.56  ? 125  ASP A C   1 
ATOM 961  O O   . ASP A 1 128  ? 36.316  66.936 38.838  1.00 69.56  ? 125  ASP A O   1 
ATOM 962  C CB  . ASP A 1 128  ? 38.355  65.421 40.710  1.00 125.39 ? 125  ASP A CB  1 
ATOM 963  C CG  . ASP A 1 128  ? 38.960  66.817 40.771  1.00 125.39 ? 125  ASP A CG  1 
ATOM 964  O OD1 . ASP A 1 128  ? 39.234  67.314 41.889  1.00 125.39 ? 125  ASP A OD1 1 
ATOM 965  O OD2 . ASP A 1 128  ? 39.172  67.408 39.692  1.00 125.39 ? 125  ASP A OD2 1 
ATOM 966  N N   . PRO A 1 129  ? 35.718  67.616 40.926  1.00 65.68  ? 126  PRO A N   1 
ATOM 967  C CA  . PRO A 1 129  ? 35.187  68.929 40.566  1.00 65.68  ? 126  PRO A CA  1 
ATOM 968  C C   . PRO A 1 129  ? 36.147  69.784 39.730  1.00 65.68  ? 126  PRO A C   1 
ATOM 969  O O   . PRO A 1 129  ? 35.721  70.425 38.763  1.00 65.68  ? 126  PRO A O   1 
ATOM 970  C CB  . PRO A 1 129  ? 34.922  69.589 41.925  1.00 68.78  ? 126  PRO A CB  1 
ATOM 971  C CG  . PRO A 1 129  ? 35.597  68.734 42.931  1.00 68.78  ? 126  PRO A CG  1 
ATOM 972  C CD  . PRO A 1 129  ? 35.571  67.370 42.371  1.00 68.78  ? 126  PRO A CD  1 
ATOM 973  N N   . GLU A 1 130  ? 37.428  69.790 40.078  1.00 77.63  ? 127  GLU A N   1 
ATOM 974  C CA  . GLU A 1 130  ? 38.402  70.557 39.300  1.00 77.63  ? 127  GLU A CA  1 
ATOM 975  C C   . GLU A 1 130  ? 38.692  69.926 37.914  1.00 77.63  ? 127  GLU A C   1 
ATOM 976  O O   . GLU A 1 130  ? 39.420  70.513 37.097  1.00 77.63  ? 127  GLU A O   1 
ATOM 977  C CB  . GLU A 1 130  ? 39.682  70.774 40.110  1.00 118.52 ? 127  GLU A CB  1 
ATOM 978  C CG  . GLU A 1 130  ? 39.487  71.632 41.359  1.00 118.52 ? 127  GLU A CG  1 
ATOM 979  C CD  . GLU A 1 130  ? 40.524  71.351 42.443  1.00 118.52 ? 127  GLU A CD  1 
ATOM 980  O OE1 . GLU A 1 130  ? 40.134  71.294 43.632  1.00 118.52 ? 127  GLU A OE1 1 
ATOM 981  O OE2 . GLU A 1 130  ? 41.724  71.177 42.116  1.00 118.52 ? 127  GLU A OE2 1 
ATOM 982  N N   . CYS A 1 131  ? 38.109  68.744 37.664  1.00 59.07  ? 128  CYS A N   1 
ATOM 983  C CA  . CYS A 1 131  ? 38.142  68.067 36.357  1.00 59.07  ? 128  CYS A CA  1 
ATOM 984  C C   . CYS A 1 131  ? 39.510  67.567 35.944  1.00 59.07  ? 128  CYS A C   1 
ATOM 985  O O   . CYS A 1 131  ? 39.814  67.465 34.737  1.00 59.07  ? 128  CYS A O   1 
ATOM 986  C CB  . CYS A 1 131  ? 37.602  68.965 35.248  1.00 74.53  ? 128  CYS A CB  1 
ATOM 987  S SG  . CYS A 1 131  ? 35.864  68.809 35.077  1.00 74.53  ? 128  CYS A SG  1 
ATOM 988  N N   . ARG A 1 132  ? 40.337  67.275 36.936  1.00 127.28 ? 129  ARG A N   1 
ATOM 989  C CA  . ARG A 1 132  ? 41.662  66.757 36.675  1.00 127.28 ? 129  ARG A CA  1 
ATOM 990  C C   . ARG A 1 132  ? 41.587  65.300 36.220  1.00 127.28 ? 129  ARG A C   1 
ATOM 991  O O   . ARG A 1 132  ? 42.475  64.818 35.508  1.00 127.28 ? 129  ARG A O   1 
ATOM 992  C CB  . ARG A 1 132  ? 42.541  66.913 37.919  1.00 144.06 ? 129  ARG A CB  1 
ATOM 993  C CG  . ARG A 1 132  ? 43.217  68.281 38.037  1.00 144.06 ? 129  ARG A CG  1 
ATOM 994  C CD  . ARG A 1 132  ? 44.686  68.238 37.599  1.00 144.06 ? 129  ARG A CD  1 
ATOM 995  N NE  . ARG A 1 132  ? 45.499  67.453 38.531  1.00 144.06 ? 129  ARG A NE  1 
ATOM 996  C CZ  . ARG A 1 132  ? 46.111  67.944 39.608  1.00 144.06 ? 129  ARG A CZ  1 
ATOM 997  N NH1 . ARG A 1 132  ? 46.031  69.238 39.905  1.00 144.06 ? 129  ARG A NH1 1 
ATOM 998  N NH2 . ARG A 1 132  ? 46.814  67.134 40.393  1.00 144.06 ? 129  ARG A NH2 1 
ATOM 999  N N   . MET A 1 133  ? 40.514  64.612 36.611  1.00 106.25 ? 130  MET A N   1 
ATOM 1000 C CA  . MET A 1 133  ? 40.426  63.171 36.406  1.00 106.25 ? 130  MET A CA  1 
ATOM 1001 C C   . MET A 1 133  ? 39.073  62.540 36.677  1.00 106.25 ? 130  MET A C   1 
ATOM 1002 O O   . MET A 1 133  ? 38.153  63.179 37.174  1.00 106.25 ? 130  MET A O   1 
ATOM 1003 C CB  . MET A 1 133  ? 41.433  62.478 37.291  1.00 71.06  ? 130  MET A CB  1 
ATOM 1004 C CG  . MET A 1 133  ? 41.415  62.979 38.699  1.00 71.06  ? 130  MET A CG  1 
ATOM 1005 S SD  . MET A 1 133  ? 41.204  61.536 39.726  1.00 71.06  ? 130  MET A SD  1 
ATOM 1006 C CE  . MET A 1 133  ? 42.343  61.882 41.063  1.00 71.06  ? 130  MET A CE  1 
ATOM 1007 N N   . ILE A 1 134  ? 38.991  61.254 36.363  1.00 51.77  ? 131  ILE A N   1 
ATOM 1008 C CA  . ILE A 1 134  ? 37.769  60.470 36.500  1.00 51.77  ? 131  ILE A CA  1 
ATOM 1009 C C   . ILE A 1 134  ? 38.100  59.220 37.278  1.00 51.77  ? 131  ILE A C   1 
ATOM 1010 O O   . ILE A 1 134  ? 39.022  58.464 36.924  1.00 51.77  ? 131  ILE A O   1 
ATOM 1011 C CB  . ILE A 1 134  ? 37.171  60.034 35.151  1.00 60.34  ? 131  ILE A CB  1 
ATOM 1012 C CG1 . ILE A 1 134  ? 36.678  61.230 34.352  1.00 60.34  ? 131  ILE A CG1 1 
ATOM 1013 C CG2 . ILE A 1 134  ? 36.034  59.063 35.374  1.00 60.34  ? 131  ILE A CG2 1 
ATOM 1014 C CD1 . ILE A 1 134  ? 36.311  60.867 32.951  1.00 60.34  ? 131  ILE A CD1 1 
ATOM 1015 N N   . GLY A 1 135  ? 37.329  59.020 38.341  1.00 48.62  ? 132  GLY A N   1 
ATOM 1016 C CA  . GLY A 1 135  ? 37.566  57.951 39.282  1.00 48.62  ? 132  GLY A CA  1 
ATOM 1017 C C   . GLY A 1 135  ? 36.493  56.909 39.102  1.00 48.62  ? 132  GLY A C   1 
ATOM 1018 O O   . GLY A 1 135  ? 35.341  57.232 38.835  1.00 48.62  ? 132  GLY A O   1 
ATOM 1019 N N   . LEU A 1 136  ? 36.873  55.656 39.271  1.00 60.91  ? 133  LEU A N   1 
ATOM 1020 C CA  . LEU A 1 136  ? 36.000  54.582 38.924  1.00 60.91  ? 133  LEU A CA  1 
ATOM 1021 C C   . LEU A 1 136  ? 36.137  53.410 39.867  1.00 60.91  ? 133  LEU A C   1 
ATOM 1022 O O   . LEU A 1 136  ? 37.215  53.119 40.376  1.00 60.91  ? 133  LEU A O   1 
ATOM 1023 C CB  . LEU A 1 136  ? 36.342  54.113 37.530  1.00 52.68  ? 133  LEU A CB  1 
ATOM 1024 C CG  . LEU A 1 136  ? 35.418  54.347 36.358  1.00 52.68  ? 133  LEU A CG  1 
ATOM 1025 C CD1 . LEU A 1 136  ? 35.073  55.821 36.115  1.00 52.68  ? 133  LEU A CD1 1 
ATOM 1026 C CD2 . LEU A 1 136  ? 36.177  53.766 35.172  1.00 52.68  ? 133  LEU A CD2 1 
ATOM 1027 N N   . ARG A 1 137  ? 35.023  52.728 40.071  1.00 60.01  ? 134  ARG A N   1 
ATOM 1028 C CA  . ARG A 1 137  ? 35.013  51.510 40.796  1.00 60.01  ? 134  ARG A CA  1 
ATOM 1029 C C   . ARG A 1 137  ? 34.329  50.512 39.904  1.00 60.01  ? 134  ARG A C   1 
ATOM 1030 O O   . ARG A 1 137  ? 33.182  50.696 39.554  1.00 60.01  ? 134  ARG A O   1 
ATOM 1031 C CB  . ARG A 1 137  ? 34.234  51.705 42.074  1.00 55.48  ? 134  ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 137  ? 34.642  50.757 43.162  1.00 55.48  ? 134  ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 137  ? 34.032  49.409 42.937  1.00 55.48  ? 134  ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 137  ? 32.586  49.488 43.057  1.00 55.48  ? 134  ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 137  ? 31.913  49.279 44.186  1.00 55.48  ? 134  ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 137  ? 32.562  48.936 45.307  1.00 55.48  ? 134  ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 137  ? 30.584  49.391 44.185  1.00 55.48  ? 134  ARG A NH2 1 
ATOM 1038 N N   . LEU A 1 138  ? 35.038  49.473 39.498  1.00 59.81  ? 135  LEU A N   1 
ATOM 1039 C CA  . LEU A 1 138  ? 34.436  48.448 38.685  1.00 59.81  ? 135  LEU A CA  1 
ATOM 1040 C C   . LEU A 1 138  ? 34.611  47.131 39.400  1.00 59.81  ? 135  LEU A C   1 
ATOM 1041 O O   . LEU A 1 138  ? 33.770  46.235 39.300  1.00 59.81  ? 135  LEU A O   1 
ATOM 1042 C CB  . LEU A 1 138  ? 35.102  48.357 37.314  1.00 50.39  ? 135  LEU A CB  1 
ATOM 1043 C CG  . LEU A 1 138  ? 35.413  49.505 36.341  1.00 50.39  ? 135  LEU A CG  1 
ATOM 1044 C CD1 . LEU A 1 138  ? 34.213  49.929 35.536  1.00 50.39  ? 135  LEU A CD1 1 
ATOM 1045 C CD2 . LEU A 1 138  ? 36.005  50.715 37.029  1.00 50.39  ? 135  LEU A CD2 1 
ATOM 1046 N N   . TYR A 1 139  ? 35.722  46.998 40.112  1.00 66.47  ? 136  TYR A N   1 
ATOM 1047 C CA  . TYR A 1 139  ? 36.044  45.735 40.747  1.00 66.47  ? 136  TYR A CA  1 
ATOM 1048 C C   . TYR A 1 139  ? 36.421  45.951 42.163  1.00 66.47  ? 136  TYR A C   1 
ATOM 1049 O O   . TYR A 1 139  ? 36.829  47.045 42.553  1.00 66.47  ? 136  TYR A O   1 
ATOM 1050 C CB  . TYR A 1 139  ? 37.212  45.079 40.053  1.00 58.20  ? 136  TYR A CB  1 
ATOM 1051 C CG  . TYR A 1 139  ? 37.054  45.037 38.575  1.00 58.20  ? 136  TYR A CG  1 
ATOM 1052 C CD1 . TYR A 1 139  ? 37.723  45.942 37.760  1.00 58.20  ? 136  TYR A CD1 1 
ATOM 1053 C CD2 . TYR A 1 139  ? 36.210  44.101 37.986  1.00 58.20  ? 136  TYR A CD2 1 
ATOM 1054 C CE1 . TYR A 1 139  ? 37.570  45.890 36.409  1.00 58.20  ? 136  TYR A CE1 1 
ATOM 1055 C CE2 . TYR A 1 139  ? 36.061  44.046 36.651  1.00 58.20  ? 136  TYR A CE2 1 
ATOM 1056 C CZ  . TYR A 1 139  ? 36.741  44.938 35.878  1.00 58.20  ? 136  TYR A CZ  1 
ATOM 1057 O OH  . TYR A 1 139  ? 36.562  44.868 34.552  1.00 58.20  ? 136  TYR A OH  1 
ATOM 1058 N N   . ASP A 1 140  ? 36.297  44.876 42.924  1.00 50.37  ? 137  ASP A N   1 
ATOM 1059 C CA  . ASP A 1 140  ? 36.667  44.885 44.323  1.00 50.37  ? 137  ASP A CA  1 
ATOM 1060 C C   . ASP A 1 140  ? 38.176  44.968 44.491  1.00 50.37  ? 137  ASP A C   1 
ATOM 1061 O O   . ASP A 1 140  ? 38.912  44.180 43.895  1.00 50.37  ? 137  ASP A O   1 
ATOM 1062 C CB  . ASP A 1 140  ? 36.117  43.645 45.018  1.00 68.27  ? 137  ASP A CB  1 
ATOM 1063 C CG  . ASP A 1 140  ? 34.665  43.795 45.371  1.00 68.27  ? 137  ASP A CG  1 
ATOM 1064 O OD1 . ASP A 1 140  ? 34.308  44.879 45.892  1.00 68.27  ? 137  ASP A OD1 1 
ATOM 1065 O OD2 . ASP A 1 140  ? 33.875  42.853 45.120  1.00 68.27  ? 137  ASP A OD2 1 
ATOM 1066 N N   . GLY A 1 141  ? 38.625  45.922 45.299  1.00 67.12  ? 138  GLY A N   1 
ATOM 1067 C CA  . GLY A 1 141  ? 40.026  46.042 45.602  1.00 67.12  ? 138  GLY A CA  1 
ATOM 1068 C C   . GLY A 1 141  ? 40.729  47.028 44.706  1.00 67.12  ? 138  GLY A C   1 
ATOM 1069 O O   . GLY A 1 141  ? 41.772  47.547 45.074  1.00 67.12  ? 138  GLY A O   1 
ATOM 1070 N N   . LEU A 1 142  ? 40.197  47.294 43.523  1.00 53.08  ? 139  LEU A N   1 
ATOM 1071 C CA  . LEU A 1 142  ? 40.883  48.249 42.650  1.00 53.08  ? 139  LEU A CA  1 
ATOM 1072 C C   . LEU A 1 142  ? 40.070  49.488 42.450  1.00 53.08  ? 139  LEU A C   1 
ATOM 1073 O O   . LEU A 1 142  ? 38.864  49.494 42.654  1.00 53.08  ? 139  LEU A O   1 
ATOM 1074 C CB  . LEU A 1 142  ? 41.253  47.668 41.273  1.00 46.88  ? 139  LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 142  ? 41.436  46.157 41.125  1.00 46.88  ? 139  LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 142  ? 41.517  45.790 39.642  1.00 46.88  ? 139  LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 142  ? 42.632  45.612 41.938  1.00 46.88  ? 139  LEU A CD2 1 
ATOM 1078 N N   . PHE A 1 143  ? 40.747  50.533 42.031  1.00 59.64  ? 140  PHE A N   1 
ATOM 1079 C CA  . PHE A 1 143  ? 40.100  51.758 41.745  1.00 59.64  ? 140  PHE A CA  1 
ATOM 1080 C C   . PHE A 1 143  ? 40.842  52.331 40.551  1.00 59.64  ? 140  PHE A C   1 
ATOM 1081 O O   . PHE A 1 143  ? 41.915  52.890 40.695  1.00 59.64  ? 140  PHE A O   1 
ATOM 1082 C CB  . PHE A 1 143  ? 40.171  52.667 42.968  1.00 56.89  ? 140  PHE A CB  1 
ATOM 1083 C CG  . PHE A 1 143  ? 39.619  54.057 42.735  1.00 56.89  ? 140  PHE A CG  1 
ATOM 1084 C CD1 . PHE A 1 143  ? 38.256  54.323 42.886  1.00 56.89  ? 140  PHE A CD1 1 
ATOM 1085 C CD2 . PHE A 1 143  ? 40.459  55.117 42.377  1.00 56.89  ? 140  PHE A CD2 1 
ATOM 1086 C CE1 . PHE A 1 143  ? 37.750  55.620 42.660  1.00 56.89  ? 140  PHE A CE1 1 
ATOM 1087 C CE2 . PHE A 1 143  ? 39.946  56.416 42.163  1.00 56.89  ? 140  PHE A CE2 1 
ATOM 1088 C CZ  . PHE A 1 143  ? 38.605  56.659 42.306  1.00 56.89  ? 140  PHE A CZ  1 
ATOM 1089 N N   . LYS A 1 144  ? 40.274  52.153 39.364  1.00 50.82  ? 141  LYS A N   1 
ATOM 1090 C CA  . LYS A 1 144  ? 40.786  52.693 38.098  1.00 50.82  ? 141  LYS A CA  1 
ATOM 1091 C C   . LYS A 1 144  ? 40.804  54.234 38.139  1.00 50.82  ? 141  LYS A C   1 
ATOM 1092 O O   . LYS A 1 144  ? 39.949  54.836 38.757  1.00 50.82  ? 141  LYS A O   1 
ATOM 1093 C CB  . LYS A 1 144  ? 39.866  52.169 36.978  1.00 46.23  ? 141  LYS A CB  1 
ATOM 1094 C CG  . LYS A 1 144  ? 40.263  52.480 35.522  1.00 46.23  ? 141  LYS A CG  1 
ATOM 1095 C CD  . LYS A 1 144  ? 41.452  51.638 35.002  1.00 46.23  ? 141  LYS A CD  1 
ATOM 1096 C CE  . LYS A 1 144  ? 41.228  50.143 35.122  1.00 46.23  ? 141  LYS A CE  1 
ATOM 1097 N NZ  . LYS A 1 144  ? 40.543  49.710 33.927  1.00 46.23  ? 141  LYS A NZ  1 
ATOM 1098 N N   . VAL A 1 145  ? 41.785  54.879 37.524  1.00 62.02  ? 142  VAL A N   1 
ATOM 1099 C CA  . VAL A 1 145  ? 41.736  56.343 37.402  1.00 62.02  ? 142  VAL A CA  1 
ATOM 1100 C C   . VAL A 1 145  ? 42.103  56.783 36.008  1.00 62.02  ? 142  VAL A C   1 
ATOM 1101 O O   . VAL A 1 145  ? 43.188  56.470 35.507  1.00 62.02  ? 142  VAL A O   1 
ATOM 1102 C CB  . VAL A 1 145  ? 42.690  57.100 38.346  1.00 56.25  ? 142  VAL A CB  1 
ATOM 1103 C CG1 . VAL A 1 145  ? 42.620  58.584 38.054  1.00 56.25  ? 142  VAL A CG1 1 
ATOM 1104 C CG2 . VAL A 1 145  ? 42.347  56.858 39.772  1.00 56.25  ? 142  VAL A CG2 1 
ATOM 1105 N N   . ILE A 1 146  ? 41.210  57.548 35.401  1.00 48.81  ? 143  ILE A N   1 
ATOM 1106 C CA  . ILE A 1 146  ? 41.479  58.078 34.095  1.00 48.81  ? 143  ILE A CA  1 
ATOM 1107 C C   . ILE A 1 146  ? 41.854  59.525 34.245  1.00 48.81  ? 143  ILE A C   1 
ATOM 1108 O O   . ILE A 1 146  ? 40.981  60.360 34.449  1.00 48.81  ? 143  ILE A O   1 
ATOM 1109 C CB  . ILE A 1 146  ? 40.272  57.947 33.216  1.00 48.97  ? 143  ILE A CB  1 
ATOM 1110 C CG1 . ILE A 1 146  ? 39.939  56.456 33.062  1.00 48.97  ? 143  ILE A CG1 1 
ATOM 1111 C CG2 . ILE A 1 146  ? 40.545  58.625 31.896  1.00 48.97  ? 143  ILE A CG2 1 
ATOM 1112 C CD1 . ILE A 1 146  ? 38.613  56.145 32.383  1.00 48.97  ? 143  ILE A CD1 1 
ATOM 1113 N N   . PRO A 1 147  ? 43.163  59.829 34.163  1.00 66.59  ? 144  PRO A N   1 
ATOM 1114 C CA  . PRO A 1 147  ? 43.674  61.196 34.266  1.00 66.59  ? 144  PRO A CA  1 
ATOM 1115 C C   . PRO A 1 147  ? 43.237  61.964 33.046  1.00 66.59  ? 144  PRO A C   1 
ATOM 1116 O O   . PRO A 1 147  ? 43.169  61.399 31.951  1.00 66.59  ? 144  PRO A O   1 
ATOM 1117 C CB  . PRO A 1 147  ? 45.182  61.008 34.232  1.00 86.73  ? 144  PRO A CB  1 
ATOM 1118 C CG  . PRO A 1 147  ? 45.404  59.553 34.552  1.00 86.73  ? 144  PRO A CG  1 
ATOM 1119 C CD  . PRO A 1 147  ? 44.252  58.864 33.944  1.00 86.73  ? 144  PRO A CD  1 
ATOM 1120 N N   . LEU A 1 148  ? 42.907  63.233 33.241  1.00 79.29  ? 145  LEU A N   1 
ATOM 1121 C CA  . LEU A 1 148  ? 42.399  64.062 32.147  1.00 79.29  ? 145  LEU A CA  1 
ATOM 1122 C C   . LEU A 1 148  ? 43.430  65.069 31.665  1.00 79.29  ? 145  LEU A C   1 
ATOM 1123 O O   . LEU A 1 148  ? 44.012  65.822 32.463  1.00 79.29  ? 145  LEU A O   1 
ATOM 1124 C CB  . LEU A 1 148  ? 41.106  64.763 32.547  1.00 73.38  ? 145  LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 148  ? 39.948  63.779 32.636  1.00 73.38  ? 145  LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 148  ? 38.903  64.289 33.594  1.00 73.38  ? 145  LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 148  ? 39.352  63.537 31.250  1.00 73.38  ? 145  LEU A CD2 1 
ATOM 1128 N N   . ASP A 1 149  ? 43.660  65.034 30.354  1.00 117.67 ? 146  ASP A N   1 
ATOM 1129 C CA  . ASP A 1 149  ? 44.593  65.908 29.661  1.00 117.67 ? 146  ASP A CA  1 
ATOM 1130 C C   . ASP A 1 149  ? 44.025  66.122 28.283  1.00 117.67 ? 146  ASP A C   1 
ATOM 1131 O O   . ASP A 1 149  ? 43.094  65.418 27.882  1.00 117.67 ? 146  ASP A O   1 
ATOM 1132 C CB  . ASP A 1 149  ? 45.968  65.259 29.542  1.00 120.30 ? 146  ASP A CB  1 
ATOM 1133 C CG  . ASP A 1 149  ? 46.592  64.971 30.885  1.00 120.30 ? 146  ASP A CG  1 
ATOM 1134 O OD1 . ASP A 1 149  ? 46.597  63.786 31.277  1.00 120.30 ? 146  ASP A OD1 1 
ATOM 1135 O OD2 . ASP A 1 149  ? 47.055  65.926 31.554  1.00 120.30 ? 146  ASP A OD2 1 
ATOM 1136 N N   . ARG A 1 150  ? 44.596  67.079 27.555  1.00 89.51  ? 147  ARG A N   1 
ATOM 1137 C CA  . ARG A 1 150  ? 44.047  67.501 26.274  1.00 89.51  ? 147  ARG A CA  1 
ATOM 1138 C C   . ARG A 1 150  ? 43.980  66.286 25.357  1.00 89.51  ? 147  ARG A C   1 
ATOM 1139 O O   . ARG A 1 150  ? 43.031  66.106 24.579  1.00 89.51  ? 147  ARG A O   1 
ATOM 1140 C CB  . ARG A 1 150  ? 44.910  68.608 25.670  1.00 179.42 ? 147  ARG A CB  1 
ATOM 1141 C CG  . ARG A 1 150  ? 44.119  69.819 25.215  1.00 179.42 ? 147  ARG A CG  1 
ATOM 1142 C CD  . ARG A 1 150  ? 43.524  69.616 23.828  1.00 179.42 ? 147  ARG A CD  1 
ATOM 1143 N NE  . ARG A 1 150  ? 42.443  70.572 23.558  1.00 179.42 ? 147  ARG A NE  1 
ATOM 1144 C CZ  . ARG A 1 150  ? 42.625  71.854 23.213  1.00 179.42 ? 147  ARG A CZ  1 
ATOM 1145 N NH1 . ARG A 1 150  ? 43.853  72.370 23.096  1.00 179.42 ? 147  ARG A NH1 1 
ATOM 1146 N NH2 . ARG A 1 150  ? 41.569  72.629 22.989  1.00 179.42 ? 147  ARG A NH2 1 
ATOM 1147 N N   . ASP A 1 151  ? 44.991  65.441 25.494  1.00 186.03 ? 148  ASP A N   1 
ATOM 1148 C CA  . ASP A 1 151  ? 45.056  64.163 24.826  1.00 186.03 ? 148  ASP A CA  1 
ATOM 1149 C C   . ASP A 1 151  ? 44.353  63.110 25.677  1.00 186.03 ? 148  ASP A C   1 
ATOM 1150 O O   . ASP A 1 151  ? 43.143  63.206 25.896  1.00 186.03 ? 148  ASP A O   1 
ATOM 1151 C CB  . ASP A 1 151  ? 46.514  63.810 24.624  1.00 185.42 ? 148  ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 151  ? 47.390  64.470 25.650  1.00 185.42 ? 148  ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 151  ? 48.182  65.348 25.264  1.00 185.42 ? 148  ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 151  ? 47.239  64.155 26.850  1.00 185.42 ? 148  ASP A OD2 1 
ATOM 1155 N N   . ASN A 1 152  ? 45.114  62.131 26.175  1.00 99.73  ? 149  ASN A N   1 
ATOM 1156 C CA  . ASN A 1 152  ? 44.555  60.889 26.726  1.00 99.73  ? 149  ASN A CA  1 
ATOM 1157 C C   . ASN A 1 152  ? 43.326  60.429 25.919  1.00 99.73  ? 149  ASN A C   1 
ATOM 1158 O O   . ASN A 1 152  ? 42.389  59.845 26.455  1.00 99.73  ? 149  ASN A O   1 
ATOM 1159 C CB  . ASN A 1 152  ? 44.249  61.035 28.224  1.00 82.65  ? 149  ASN A CB  1 
ATOM 1160 C CG  . ASN A 1 152  ? 44.358  59.710 28.982  1.00 82.65  ? 149  ASN A CG  1 
ATOM 1161 O OD1 . ASN A 1 152  ? 44.392  58.640 28.382  1.00 82.65  ? 149  ASN A OD1 1 
ATOM 1162 N ND2 . ASN A 1 152  ? 44.420  59.785 30.307  1.00 82.65  ? 149  ASN A ND2 1 
ATOM 1163 N N   . LYS A 1 153  ? 43.365  60.708 24.614  1.00 60.12  ? 150  LYS A N   1 
ATOM 1164 C CA  . LYS A 1 153  ? 42.277  60.462 23.676  1.00 60.12  ? 150  LYS A CA  1 
ATOM 1165 C C   . LYS A 1 153  ? 41.863  58.988 23.573  1.00 60.12  ? 150  LYS A C   1 
ATOM 1166 O O   . LYS A 1 153  ? 40.921  58.639 22.827  1.00 60.12  ? 150  LYS A O   1 
ATOM 1167 C CB  . LYS A 1 153  ? 42.656  61.008 22.298  1.00 96.24  ? 150  LYS A CB  1 
ATOM 1168 C CG  . LYS A 1 153  ? 42.621  62.520 22.203  1.00 96.24  ? 150  LYS A CG  1 
ATOM 1169 C CD  . LYS A 1 153  ? 42.824  63.003 20.764  1.00 96.24  ? 150  LYS A CD  1 
ATOM 1170 C CE  . LYS A 1 153  ? 42.320  64.442 20.573  1.00 96.24  ? 150  LYS A CE  1 
ATOM 1171 N NZ  . LYS A 1 153  ? 42.924  65.419 21.547  1.00 96.24  ? 150  LYS A NZ  1 
ATOM 1172 N N   . GLU A 1 154  ? 42.581  58.146 24.319  1.00 64.83  ? 151  GLU A N   1 
ATOM 1173 C CA  . GLU A 1 154  ? 42.318  56.712 24.429  1.00 64.83  ? 151  GLU A CA  1 
ATOM 1174 C C   . GLU A 1 154  ? 42.133  56.311 25.890  1.00 64.83  ? 151  GLU A C   1 
ATOM 1175 O O   . GLU A 1 154  ? 42.334  55.148 26.268  1.00 64.83  ? 151  GLU A O   1 
ATOM 1176 C CB  . GLU A 1 154  ? 43.451  55.908 23.802  1.00 94.36  ? 151  GLU A CB  1 
ATOM 1177 C CG  . GLU A 1 154  ? 43.390  55.867 22.295  1.00 94.36  ? 151  GLU A CG  1 
ATOM 1178 C CD  . GLU A 1 154  ? 44.687  55.388 21.668  1.00 94.36  ? 151  GLU A CD  1 
ATOM 1179 O OE1 . GLU A 1 154  ? 44.634  54.872 20.523  1.00 94.36  ? 151  GLU A OE1 1 
ATOM 1180 O OE2 . GLU A 1 154  ? 45.753  55.522 22.314  1.00 94.36  ? 151  GLU A OE2 1 
ATOM 1181 N N   . LEU A 1 155  ? 41.772  57.307 26.693  1.00 66.65  ? 152  LEU A N   1 
ATOM 1182 C CA  . LEU A 1 155  ? 41.405  57.159 28.096  1.00 66.65  ? 152  LEU A CA  1 
ATOM 1183 C C   . LEU A 1 155  ? 42.186  56.103 28.802  1.00 66.65  ? 152  LEU A C   1 
ATOM 1184 O O   . LEU A 1 155  ? 41.643  55.130 29.313  1.00 66.65  ? 152  LEU A O   1 
ATOM 1185 C CB  . LEU A 1 155  ? 39.902  56.949 28.228  1.00 56.46  ? 152  LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 155  ? 39.227  58.206 27.664  1.00 56.46  ? 152  LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 155  ? 37.851  57.929 27.077  1.00 56.46  ? 152  LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 155  ? 39.218  59.341 28.704  1.00 56.46  ? 152  LEU A CD2 1 
ATOM 1189 N N   . LYS A 1 156  ? 43.493  56.293 28.806  1.00 61.64  ? 153  LYS A N   1 
ATOM 1190 C CA  . LYS A 1 156  ? 44.379  55.350 29.475  1.00 61.64  ? 153  LYS A CA  1 
ATOM 1191 C C   . LYS A 1 156  ? 44.245  55.599 30.967  1.00 61.64  ? 153  LYS A C   1 
ATOM 1192 O O   . LYS A 1 156  ? 44.224  56.745 31.424  1.00 61.64  ? 153  LYS A O   1 
ATOM 1193 C CB  . LYS A 1 156  ? 45.833  55.491 28.996  1.00 86.71  ? 153  LYS A CB  1 
ATOM 1194 C CG  . LYS A 1 156  ? 46.036  55.371 27.479  1.00 86.71  ? 153  LYS A CG  1 
ATOM 1195 C CD  . LYS A 1 156  ? 45.931  53.932 26.945  1.00 86.71  ? 153  LYS A CD  1 
ATOM 1196 C CE  . LYS A 1 156  ? 46.227  53.877 25.422  1.00 86.71  ? 153  LYS A CE  1 
ATOM 1197 N NZ  . LYS A 1 156  ? 45.980  52.555 24.749  1.00 86.71  ? 153  LYS A NZ  1 
ATOM 1198 N N   . ALA A 1 157  ? 44.126  54.517 31.713  1.00 73.43  ? 154  ALA A N   1 
ATOM 1199 C CA  . ALA A 1 157  ? 43.905  54.603 33.133  1.00 73.43  ? 154  ALA A CA  1 
ATOM 1200 C C   . ALA A 1 157  ? 44.788  53.613 33.853  1.00 73.43  ? 154  ALA A C   1 
ATOM 1201 O O   . ALA A 1 157  ? 45.281  52.662 33.258  1.00 73.43  ? 154  ALA A O   1 
ATOM 1202 C CB  . ALA A 1 157  ? 42.454  54.314 33.429  1.00 51.48  ? 154  ALA A CB  1 
ATOM 1203 N N   . PHE A 1 158  ? 44.989  53.835 35.140  1.00 73.45  ? 155  PHE A N   1 
ATOM 1204 C CA  . PHE A 1 158  ? 45.704  52.876 35.962  1.00 73.45  ? 155  PHE A CA  1 
ATOM 1205 C C   . PHE A 1 158  ? 44.831  52.565 37.145  1.00 73.45  ? 155  PHE A C   1 
ATOM 1206 O O   . PHE A 1 158  ? 44.059  53.412 37.571  1.00 73.45  ? 155  PHE A O   1 
ATOM 1207 C CB  . PHE A 1 158  ? 47.030  53.453 36.440  1.00 73.63  ? 155  PHE A CB  1 
ATOM 1208 C CG  . PHE A 1 158  ? 46.893  54.744 37.183  1.00 73.63  ? 155  PHE A CG  1 
ATOM 1209 C CD1 . PHE A 1 158  ? 46.985  54.771 38.569  1.00 73.63  ? 155  PHE A CD1 1 
ATOM 1210 C CD2 . PHE A 1 158  ? 46.670  55.935 36.499  1.00 73.63  ? 155  PHE A CD2 1 
ATOM 1211 C CE1 . PHE A 1 158  ? 46.855  55.977 39.264  1.00 73.63  ? 155  PHE A CE1 1 
ATOM 1212 C CE2 . PHE A 1 158  ? 46.540  57.131 37.174  1.00 73.63  ? 155  PHE A CE2 1 
ATOM 1213 C CZ  . PHE A 1 158  ? 46.637  57.159 38.559  1.00 73.63  ? 155  PHE A CZ  1 
ATOM 1214 N N   . ASN A 1 159  ? 44.936  51.350 37.662  1.00 60.21  ? 156  ASN A N   1 
ATOM 1215 C CA  . ASN A 1 159  ? 44.306  51.018 38.920  1.00 60.21  ? 156  ASN A CA  1 
ATOM 1216 C C   . ASN A 1 159  ? 45.240  51.346 40.084  1.00 60.21  ? 156  ASN A C   1 
ATOM 1217 O O   . ASN A 1 159  ? 46.432  51.155 39.972  1.00 60.21  ? 156  ASN A O   1 
ATOM 1218 C CB  . ASN A 1 159  ? 43.971  49.531 38.961  1.00 82.82  ? 156  ASN A CB  1 
ATOM 1219 C CG  . ASN A 1 159  ? 43.055  49.123 37.864  1.00 82.82  ? 156  ASN A CG  1 
ATOM 1220 O OD1 . ASN A 1 159  ? 41.852  49.329 37.940  1.00 82.82  ? 156  ASN A OD1 1 
ATOM 1221 N ND2 . ASN A 1 159  ? 43.612  48.524 36.833  1.00 82.82  ? 156  ASN A ND2 1 
ATOM 1222 N N   . ILE A 1 160  ? 44.699  51.824 41.193  1.00 78.82  ? 157  ILE A N   1 
ATOM 1223 C CA  . ILE A 1 160  ? 45.417  51.832 42.444  1.00 78.82  ? 157  ILE A CA  1 
ATOM 1224 C C   . ILE A 1 160  ? 44.907  50.640 43.234  1.00 78.82  ? 157  ILE A C   1 
ATOM 1225 O O   . ILE A 1 160  ? 43.882  50.072 42.880  1.00 78.82  ? 157  ILE A O   1 
ATOM 1226 C CB  . ILE A 1 160  ? 45.089  53.076 43.206  1.00 48.83  ? 157  ILE A CB  1 
ATOM 1227 C CG1 . ILE A 1 160  ? 45.451  54.313 42.357  1.00 48.83  ? 157  ILE A CG1 1 
ATOM 1228 C CG2 . ILE A 1 160  ? 45.764  53.039 44.564  1.00 48.83  ? 157  ILE A CG2 1 
ATOM 1229 C CD1 . ILE A 1 160  ? 45.312  55.666 43.068  1.00 48.83  ? 157  ILE A CD1 1 
ATOM 1230 N N   . ARG A 1 161  ? 45.595  50.239 44.299  1.00 84.95  ? 158  ARG A N   1 
ATOM 1231 C CA  . ARG A 1 161  ? 45.044  49.172 45.130  1.00 84.95  ? 158  ARG A CA  1 
ATOM 1232 C C   . ARG A 1 161  ? 44.216  49.726 46.271  1.00 84.95  ? 158  ARG A C   1 
ATOM 1233 O O   . ARG A 1 161  ? 44.506  50.793 46.808  1.00 84.95  ? 158  ARG A O   1 
ATOM 1234 C CB  . ARG A 1 161  ? 46.107  48.205 45.647  1.00 120.33 ? 158  ARG A CB  1 
ATOM 1235 C CG  . ARG A 1 161  ? 45.620  46.764 45.538  1.00 120.33 ? 158  ARG A CG  1 
ATOM 1236 C CD  . ARG A 1 161  ? 45.765  45.987 46.833  1.00 120.33 ? 158  ARG A CD  1 
ATOM 1237 N NE  . ARG A 1 161  ? 47.137  45.523 47.040  1.00 120.33 ? 158  ARG A NE  1 
ATOM 1238 C CZ  . ARG A 1 161  ? 47.921  46.004 48.041  1.00 120.33 ? 158  ARG A CZ  1 
ATOM 1239 N NH1 . ARG A 1 161  ? 47.460  46.956 48.933  1.00 120.33 ? 158  ARG A NH1 1 
ATOM 1240 N NH2 . ARG A 1 161  ? 49.161  45.521 48.154  1.00 120.33 ? 158  ARG A NH2 1 
ATOM 1241 N N   . LEU A 1 162  ? 43.174  48.985 46.628  1.00 58.22  ? 159  LEU A N   1 
ATOM 1242 C CA  . LEU A 1 162  ? 42.222  49.411 47.651  1.00 58.22  ? 159  LEU A CA  1 
ATOM 1243 C C   . LEU A 1 162  ? 42.082  48.398 48.760  1.00 58.22  ? 159  LEU A C   1 
ATOM 1244 O O   . LEU A 1 162  ? 41.469  47.360 48.574  1.00 58.22  ? 159  LEU A O   1 
ATOM 1245 C CB  . LEU A 1 162  ? 40.848  49.643 47.029  1.00 62.74  ? 159  LEU A CB  1 
ATOM 1246 C CG  . LEU A 1 162  ? 40.086  50.865 47.536  1.00 62.74  ? 159  LEU A CG  1 
ATOM 1247 C CD1 . LEU A 1 162  ? 38.923  51.137 46.606  1.00 62.74  ? 159  LEU A CD1 1 
ATOM 1248 C CD2 . LEU A 1 162  ? 39.597  50.652 48.959  1.00 62.74  ? 159  LEU A CD2 1 
ATOM 1249 N N   . GLU A 1 163  ? 42.646  48.726 49.920  1.00 61.99  ? 160  GLU A N   1 
ATOM 1250 C CA  . GLU A 1 163  ? 42.528  47.896 51.123  1.00 61.99  ? 160  GLU A CA  1 
ATOM 1251 C C   . GLU A 1 163  ? 41.114  47.354 51.310  1.00 61.99  ? 160  GLU A C   1 
ATOM 1252 O O   . GLU A 1 163  ? 40.922  46.151 51.527  1.00 61.99  ? 160  GLU A O   1 
ATOM 1253 C CB  . GLU A 1 163  ? 42.947  48.698 52.355  1.00 148.97 ? 160  GLU A CB  1 
ATOM 1254 C CG  . GLU A 1 163  ? 44.405  48.563 52.703  1.00 148.97 ? 160  GLU A CG  1 
ATOM 1255 C CD  . GLU A 1 163  ? 44.767  47.141 53.077  1.00 148.97 ? 160  GLU A CD  1 
ATOM 1256 O OE1 . GLU A 1 163  ? 44.162  46.602 54.029  1.00 148.97 ? 160  GLU A OE1 1 
ATOM 1257 O OE2 . GLU A 1 163  ? 45.650  46.560 52.414  1.00 148.97 ? 160  GLU A OE2 1 
ATOM 1258 N N   . GLU A 1 164  ? 40.130  48.245 51.183  1.00 63.39  ? 161  GLU A N   1 
ATOM 1259 C CA  . GLU A 1 164  ? 38.742  47.907 51.450  1.00 63.39  ? 161  GLU A CA  1 
ATOM 1260 C C   . GLU A 1 164  ? 38.092  47.159 50.290  1.00 63.39  ? 161  GLU A C   1 
ATOM 1261 O O   . GLU A 1 164  ? 37.846  47.722 49.230  1.00 63.39  ? 161  GLU A O   1 
ATOM 1262 C CB  . GLU A 1 164  ? 37.976  49.151 51.827  1.00 79.28  ? 161  GLU A CB  1 
ATOM 1263 C CG  . GLU A 1 164  ? 38.444  49.718 53.135  1.00 79.28  ? 161  GLU A CG  1 
ATOM 1264 C CD  . GLU A 1 164  ? 39.883  50.196 53.102  1.00 79.28  ? 161  GLU A CD  1 
ATOM 1265 O OE1 . GLU A 1 164  ? 40.292  50.799 52.085  1.00 79.28  ? 161  GLU A OE1 1 
ATOM 1266 O OE2 . GLU A 1 164  ? 40.604  49.969 54.102  1.00 79.28  ? 161  GLU A OE2 1 
ATOM 1267 N N   . LEU A 1 165  ? 37.841  45.874 50.526  1.00 77.53  ? 162  LEU A N   1 
ATOM 1268 C CA  . LEU A 1 165  ? 37.365  44.936 49.518  1.00 77.53  ? 162  LEU A CA  1 
ATOM 1269 C C   . LEU A 1 165  ? 35.884  45.059 49.197  1.00 77.53  ? 162  LEU A C   1 
ATOM 1270 O O   . LEU A 1 165  ? 35.385  44.319 48.350  1.00 77.53  ? 162  LEU A O   1 
ATOM 1271 C CB  . LEU A 1 165  ? 37.600  43.491 49.996  1.00 47.26  ? 162  LEU A CB  1 
ATOM 1272 C CG  . LEU A 1 165  ? 38.834  42.631 49.684  1.00 47.26  ? 162  LEU A CG  1 
ATOM 1273 C CD1 . LEU A 1 165  ? 38.345  41.202 49.310  1.00 47.26  ? 162  LEU A CD1 1 
ATOM 1274 C CD2 . LEU A 1 165  ? 39.756  43.239 48.587  1.00 47.26  ? 162  LEU A CD2 1 
ATOM 1275 N N   . HIS A 1 166  ? 35.188  45.958 49.898  1.00 71.08  ? 163  HIS A N   1 
ATOM 1276 C CA  . HIS A 1 166  ? 33.715  46.058 49.856  1.00 71.08  ? 163  HIS A CA  1 
ATOM 1277 C C   . HIS A 1 166  ? 33.241  47.506 50.080  1.00 71.08  ? 163  HIS A C   1 
ATOM 1278 O O   . HIS A 1 166  ? 32.904  47.905 51.188  1.00 71.08  ? 163  HIS A O   1 
ATOM 1279 C CB  . HIS A 1 166  ? 33.082  45.092 50.882  1.00 79.08  ? 163  HIS A CB  1 
ATOM 1280 C CG  . HIS A 1 166  ? 31.597  44.908 50.723  1.00 79.08  ? 163  HIS A CG  1 
ATOM 1281 N ND1 . HIS A 1 166  ? 30.672  45.772 51.273  1.00 79.08  ? 163  HIS A ND1 1 
ATOM 1282 C CD2 . HIS A 1 166  ? 30.878  43.945 50.092  1.00 79.08  ? 163  HIS A CD2 1 
ATOM 1283 C CE1 . HIS A 1 166  ? 29.452  45.355 50.983  1.00 79.08  ? 163  HIS A CE1 1 
ATOM 1284 N NE2 . HIS A 1 166  ? 29.548  44.251 50.264  1.00 79.08  ? 163  HIS A NE2 1 
ATOM 1285 N N   . VAL A 1 167  ? 33.236  48.289 49.009  1.00 53.06  ? 164  VAL A N   1 
ATOM 1286 C CA  . VAL A 1 167  ? 32.797  49.686 49.065  1.00 53.06  ? 164  VAL A CA  1 
ATOM 1287 C C   . VAL A 1 167  ? 31.336  49.850 48.632  1.00 53.06  ? 164  VAL A C   1 
ATOM 1288 O O   . VAL A 1 167  ? 30.859  49.194 47.700  1.00 53.06  ? 164  VAL A O   1 
ATOM 1289 C CB  . VAL A 1 167  ? 33.724  50.570 48.222  1.00 41.60  ? 164  VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 167  ? 33.318  52.056 48.285  1.00 41.60  ? 164  VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 167  ? 35.135  50.391 48.712  1.00 41.60  ? 164  VAL A CG2 1 
ATOM 1292 N N   . ILE A 1 168  ? 30.646  50.740 49.338  1.00 53.64  ? 165  ILE A N   1 
ATOM 1293 C CA  . ILE A 1 168  ? 29.198  50.938 49.191  1.00 53.64  ? 165  ILE A CA  1 
ATOM 1294 C C   . ILE A 1 168  ? 28.916  52.060 48.190  1.00 53.64  ? 165  ILE A C   1 
ATOM 1295 O O   . ILE A 1 168  ? 28.263  51.822 47.171  1.00 53.64  ? 165  ILE A O   1 
ATOM 1296 C CB  . ILE A 1 168  ? 28.520  51.182 50.579  1.00 43.67  ? 165  ILE A CB  1 
ATOM 1297 C CG1 . ILE A 1 168  ? 28.764  49.996 51.524  1.00 43.67  ? 165  ILE A CG1 1 
ATOM 1298 C CG2 . ILE A 1 168  ? 27.051  51.436 50.446  1.00 43.67  ? 165  ILE A CG2 1 
ATOM 1299 C CD1 . ILE A 1 168  ? 28.408  48.647 50.944  1.00 43.67  ? 165  ILE A CD1 1 
ATOM 1300 N N   . ASP A 1 169  ? 29.437  53.257 48.484  1.00 43.51  ? 166  ASP A N   1 
ATOM 1301 C CA  . ASP A 1 169  ? 29.365  54.415 47.584  1.00 43.51  ? 166  ASP A CA  1 
ATOM 1302 C C   . ASP A 1 169  ? 30.563  55.350 47.800  1.00 43.51  ? 166  ASP A C   1 
ATOM 1303 O O   . ASP A 1 169  ? 31.293  55.209 48.758  1.00 43.51  ? 166  ASP A O   1 
ATOM 1304 C CB  . ASP A 1 169  ? 28.028  55.164 47.731  1.00 57.49  ? 166  ASP A CB  1 
ATOM 1305 C CG  . ASP A 1 169  ? 27.898  56.357 46.773  1.00 57.49  ? 166  ASP A CG  1 
ATOM 1306 O OD1 . ASP A 1 169  ? 28.391  56.279 45.611  1.00 57.49  ? 166  ASP A OD1 1 
ATOM 1307 O OD2 . ASP A 1 169  ? 27.295  57.387 47.193  1.00 57.49  ? 166  ASP A OD2 1 
ATOM 1308 N N   . VAL A 1 170  ? 30.764  56.288 46.877  1.00 62.99  ? 167  VAL A N   1 
ATOM 1309 C CA  . VAL A 1 170  ? 31.988  57.067 46.774  1.00 62.99  ? 167  VAL A CA  1 
ATOM 1310 C C   . VAL A 1 170  ? 31.703  58.288 45.953  1.00 62.99  ? 167  VAL A C   1 
ATOM 1311 O O   . VAL A 1 170  ? 31.005  58.211 44.939  1.00 62.99  ? 167  VAL A O   1 
ATOM 1312 C CB  . VAL A 1 170  ? 33.062  56.367 45.922  1.00 52.55  ? 167  VAL A CB  1 
ATOM 1313 C CG1 . VAL A 1 170  ? 34.462  56.836 46.327  1.00 52.55  ? 167  VAL A CG1 1 
ATOM 1314 C CG2 . VAL A 1 170  ? 32.930  54.858 45.962  1.00 52.55  ? 167  VAL A CG2 1 
ATOM 1315 N N   . LYS A 1 171  ? 32.276  59.406 46.375  1.00 54.85  ? 168  LYS A N   1 
ATOM 1316 C CA  . LYS A 1 171  ? 32.249  60.644 45.619  1.00 54.85  ? 168  LYS A CA  1 
ATOM 1317 C C   . LYS A 1 171  ? 33.588  61.278 45.888  1.00 54.85  ? 168  LYS A C   1 
ATOM 1318 O O   . LYS A 1 171  ? 34.252  60.907 46.857  1.00 54.85  ? 168  LYS A O   1 
ATOM 1319 C CB  . LYS A 1 171  ? 31.164  61.592 46.154  1.00 42.52  ? 168  LYS A CB  1 
ATOM 1320 C CG  . LYS A 1 171  ? 29.715  61.093 46.141  1.00 42.52  ? 168  LYS A CG  1 
ATOM 1321 C CD  . LYS A 1 171  ? 29.100  61.138 44.755  1.00 42.52  ? 168  LYS A CD  1 
ATOM 1322 C CE  . LYS A 1 171  ? 28.234  59.917 44.490  1.00 42.52  ? 168  LYS A CE  1 
ATOM 1323 N NZ  . LYS A 1 171  ? 27.123  59.777 45.487  1.00 42.52  ? 168  LYS A NZ  1 
ATOM 1324 N N   . PHE A 1 172  ? 33.992  62.214 45.035  1.00 55.40  ? 169  PHE A N   1 
ATOM 1325 C CA  . PHE A 1 172  ? 35.046  63.164 45.372  1.00 55.40  ? 169  PHE A CA  1 
ATOM 1326 C C   . PHE A 1 172  ? 34.435  64.264 46.223  1.00 55.40  ? 169  PHE A C   1 
ATOM 1327 O O   . PHE A 1 172  ? 33.309  64.674 45.959  1.00 55.40  ? 169  PHE A O   1 
ATOM 1328 C CB  . PHE A 1 172  ? 35.629  63.805 44.117  1.00 67.73  ? 169  PHE A CB  1 
ATOM 1329 C CG  . PHE A 1 172  ? 36.596  62.938 43.393  1.00 67.73  ? 169  PHE A CG  1 
ATOM 1330 C CD1 . PHE A 1 172  ? 36.204  62.228 42.267  1.00 67.73  ? 169  PHE A CD1 1 
ATOM 1331 C CD2 . PHE A 1 172  ? 37.901  62.827 43.825  1.00 67.73  ? 169  PHE A CD2 1 
ATOM 1332 C CE1 . PHE A 1 172  ? 37.104  61.427 41.577  1.00 67.73  ? 169  PHE A CE1 1 
ATOM 1333 C CE2 . PHE A 1 172  ? 38.792  62.036 43.145  1.00 67.73  ? 169  PHE A CE2 1 
ATOM 1334 C CZ  . PHE A 1 172  ? 38.384  61.332 42.020  1.00 67.73  ? 169  PHE A CZ  1 
ATOM 1335 N N   . LEU A 1 173  ? 35.187  64.728 47.222  1.00 58.97  ? 170  LEU A N   1 
ATOM 1336 C CA  . LEU A 1 173  ? 34.819  65.864 48.077  1.00 58.97  ? 170  LEU A CA  1 
ATOM 1337 C C   . LEU A 1 173  ? 35.153  67.189 47.424  1.00 58.97  ? 170  LEU A C   1 
ATOM 1338 O O   . LEU A 1 173  ? 35.943  67.256 46.482  1.00 58.97  ? 170  LEU A O   1 
ATOM 1339 C CB  . LEU A 1 173  ? 35.562  65.804 49.411  1.00 60.46  ? 170  LEU A CB  1 
ATOM 1340 C CG  . LEU A 1 173  ? 35.272  64.645 50.354  1.00 60.46  ? 170  LEU A CG  1 
ATOM 1341 C CD1 . LEU A 1 173  ? 36.499  64.345 51.152  1.00 60.46  ? 170  LEU A CD1 1 
ATOM 1342 C CD2 . LEU A 1 173  ? 34.151  64.993 51.280  1.00 60.46  ? 170  LEU A CD2 1 
ATOM 1343 N N   . TYR A 1 174  ? 34.564  68.254 47.945  1.00 75.98  ? 171  TYR A N   1 
ATOM 1344 C CA  . TYR A 1 174  ? 34.825  69.577 47.422  1.00 75.98  ? 171  TYR A CA  1 
ATOM 1345 C C   . TYR A 1 174  ? 35.738  70.311 48.366  1.00 75.98  ? 171  TYR A C   1 
ATOM 1346 O O   . TYR A 1 174  ? 35.854  69.942 49.539  1.00 75.98  ? 171  TYR A O   1 
ATOM 1347 C CB  . TYR A 1 174  ? 33.538  70.365 47.339  1.00 61.45  ? 171  TYR A CB  1 
ATOM 1348 C CG  . TYR A 1 174  ? 32.652  70.062 46.175  1.00 61.45  ? 171  TYR A CG  1 
ATOM 1349 C CD1 . TYR A 1 174  ? 31.649  69.105 46.268  1.00 61.45  ? 171  TYR A CD1 1 
ATOM 1350 C CD2 . TYR A 1 174  ? 32.777  70.774 44.997  1.00 61.45  ? 171  TYR A CD2 1 
ATOM 1351 C CE1 . TYR A 1 174  ? 30.804  68.858 45.199  1.00 61.45  ? 171  TYR A CE1 1 
ATOM 1352 C CE2 . TYR A 1 174  ? 31.941  70.547 43.931  1.00 61.45  ? 171  TYR A CE2 1 
ATOM 1353 C CZ  . TYR A 1 174  ? 30.959  69.591 44.031  1.00 61.45  ? 171  TYR A CZ  1 
ATOM 1354 O OH  . TYR A 1 174  ? 30.137  69.374 42.952  1.00 61.45  ? 171  TYR A OH  1 
ATOM 1355 N N   . GLY A 1 175  ? 36.357  71.371 47.850  1.00 93.81  ? 172  GLY A N   1 
ATOM 1356 C CA  . GLY A 1 175  ? 37.197  72.262 48.644  1.00 93.81  ? 172  GLY A CA  1 
ATOM 1357 C C   . GLY A 1 175  ? 38.512  71.602 48.990  1.00 93.81  ? 172  GLY A C   1 
ATOM 1358 O O   . GLY A 1 175  ? 39.214  72.031 49.906  1.00 93.81  ? 172  GLY A O   1 
ATOM 1359 N N   . CYS A 1 176  ? 38.845  70.552 48.255  1.00 134.63 ? 173  CYS A N   1 
ATOM 1360 C CA  . CYS A 1 176  ? 40.058  69.817 48.520  1.00 134.63 ? 173  CYS A CA  1 
ATOM 1361 C C   . CYS A 1 176  ? 41.178  70.331 47.646  1.00 134.63 ? 173  CYS A C   1 
ATOM 1362 O O   . CYS A 1 176  ? 40.983  70.579 46.453  1.00 134.63 ? 173  CYS A O   1 
ATOM 1363 C CB  . CYS A 1 176  ? 39.830  68.326 48.295  1.00 78.50  ? 173  CYS A CB  1 
ATOM 1364 S SG  . CYS A 1 176  ? 38.950  67.533 49.671  1.00 78.50  ? 173  CYS A SG  1 
ATOM 1365 N N   . GLN A 1 177  ? 42.343  70.508 48.259  1.00 86.85  ? 174  GLN A N   1 
ATOM 1366 C CA  . GLN A 1 177  ? 43.551  70.875 47.533  1.00 86.85  ? 174  GLN A CA  1 
ATOM 1367 C C   . GLN A 1 177  ? 43.798  69.749 46.536  1.00 86.85  ? 174  GLN A C   1 
ATOM 1368 O O   . GLN A 1 177  ? 43.514  69.870 45.332  1.00 86.85  ? 174  GLN A O   1 
ATOM 1369 C CB  . GLN A 1 177  ? 44.739  70.985 48.495  1.00 143.11 ? 174  GLN A CB  1 
ATOM 1370 C CG  . GLN A 1 177  ? 44.368  71.267 49.956  1.00 143.11 ? 174  GLN A CG  1 
ATOM 1371 C CD  . GLN A 1 177  ? 44.358  72.770 50.299  1.00 143.11 ? 174  GLN A CD  1 
ATOM 1372 O OE1 . GLN A 1 177  ? 43.448  73.515 49.708  1.00 143.11 ? 174  GLN A OE1 1 
ATOM 1373 N NE2 . GLN A 1 177  ? 44.942  73.235 51.343  1.00 143.11 ? 174  GLN A NE2 1 
ATOM 1374 N N   . ALA A 1 178  ? 44.290  68.635 47.064  1.00 86.26  ? 175  ALA A N   1 
ATOM 1375 C CA  . ALA A 1 178  ? 44.446  67.429 46.284  1.00 86.26  ? 175  ALA A CA  1 
ATOM 1376 C C   . ALA A 1 178  ? 43.107  66.704 46.141  1.00 86.26  ? 175  ALA A C   1 
ATOM 1377 O O   . ALA A 1 178  ? 42.402  66.495 47.138  1.00 86.26  ? 175  ALA A O   1 
ATOM 1378 C CB  . ALA A 1 178  ? 45.468  66.527 46.932  1.00 69.45  ? 175  ALA A CB  1 
ATOM 1379 N N   . PRO A 1 179  ? 42.734  66.360 44.888  1.00 68.14  ? 176  PRO A N   1 
ATOM 1380 C CA  . PRO A 1 179  ? 41.752  65.330 44.561  1.00 68.14  ? 176  PRO A CA  1 
ATOM 1381 C C   . PRO A 1 179  ? 41.583  64.315 45.675  1.00 68.14  ? 176  PRO A C   1 
ATOM 1382 O O   . PRO A 1 179  ? 42.451  63.464 45.867  1.00 68.14  ? 176  PRO A O   1 
ATOM 1383 C CB  . PRO A 1 179  ? 42.378  64.675 43.333  1.00 83.28  ? 176  PRO A CB  1 
ATOM 1384 C CG  . PRO A 1 179  ? 43.100  65.855 42.628  1.00 83.28  ? 176  PRO A CG  1 
ATOM 1385 C CD  . PRO A 1 179  ? 43.225  66.991 43.651  1.00 83.28  ? 176  PRO A CD  1 
ATOM 1386 N N   . THR A 1 180  ? 40.488  64.446 46.419  1.00 70.70  ? 177  THR A N   1 
ATOM 1387 C CA  . THR A 1 180  ? 40.216  63.588 47.568  1.00 70.70  ? 177  THR A CA  1 
ATOM 1388 C C   . THR A 1 180  ? 38.929  62.782 47.380  1.00 70.70  ? 177  THR A C   1 
ATOM 1389 O O   . THR A 1 180  ? 37.863  63.341 47.161  1.00 70.70  ? 177  THR A O   1 
ATOM 1390 C CB  . THR A 1 180  ? 40.147  64.401 48.896  1.00 59.99  ? 177  THR A CB  1 
ATOM 1391 O OG1 . THR A 1 180  ? 41.435  64.427 49.512  1.00 59.99  ? 177  THR A OG1 1 
ATOM 1392 C CG2 . THR A 1 180  ? 39.198  63.765 49.876  1.00 59.99  ? 177  THR A CG2 1 
ATOM 1393 N N   . ILE A 1 181  ? 39.021  61.464 47.467  1.00 77.07  ? 178  ILE A N   1 
ATOM 1394 C CA  . ILE A 1 181  ? 37.809  60.663 47.441  1.00 77.07  ? 178  ILE A CA  1 
ATOM 1395 C C   . ILE A 1 181  ? 37.250  60.496 48.841  1.00 77.07  ? 178  ILE A C   1 
ATOM 1396 O O   . ILE A 1 181  ? 37.923  60.777 49.840  1.00 77.07  ? 178  ILE A O   1 
ATOM 1397 C CB  . ILE A 1 181  ? 38.005  59.271 46.779  1.00 78.04  ? 178  ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 181  ? 39.109  58.478 47.473  1.00 78.04  ? 178  ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 181  ? 38.298  59.417 45.302  1.00 78.04  ? 178  ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 181  ? 39.004  56.985 47.262  1.00 78.04  ? 178  ILE A CD1 1 
ATOM 1401 N N   . CYS A 1 182  ? 36.013  60.026 48.895  1.00 77.46  ? 179  CYS A N   1 
ATOM 1402 C CA  . CYS A 1 182  ? 35.366  59.729 50.141  1.00 77.46  ? 179  CYS A CA  1 
ATOM 1403 C C   . CYS A 1 182  ? 34.384  58.604 49.914  1.00 77.46  ? 179  CYS A C   1 
ATOM 1404 O O   . CYS A 1 182  ? 33.615  58.632 48.960  1.00 77.46  ? 179  CYS A O   1 
ATOM 1405 C CB  . CYS A 1 182  ? 34.647  60.967 50.645  1.00 61.01  ? 179  CYS A CB  1 
ATOM 1406 S SG  . CYS A 1 182  ? 33.551  60.631 52.027  1.00 61.01  ? 179  CYS A SG  1 
ATOM 1407 N N   . PHE A 1 183  ? 34.400  57.619 50.799  1.00 61.81  ? 180  PHE A N   1 
ATOM 1408 C CA  . PHE A 1 183  ? 33.620  56.420 50.568  1.00 61.81  ? 180  PHE A CA  1 
ATOM 1409 C C   . PHE A 1 183  ? 33.167  55.720 51.835  1.00 61.81  ? 180  PHE A C   1 
ATOM 1410 O O   . PHE A 1 183  ? 33.755  55.874 52.890  1.00 61.81  ? 180  PHE A O   1 
ATOM 1411 C CB  . PHE A 1 183  ? 34.383  55.433 49.659  1.00 60.60  ? 180  PHE A CB  1 
ATOM 1412 C CG  . PHE A 1 183  ? 35.687  54.886 50.263  1.00 60.60  ? 180  PHE A CG  1 
ATOM 1413 C CD1 . PHE A 1 183  ? 35.794  53.532 50.622  1.00 60.60  ? 180  PHE A CD1 1 
ATOM 1414 C CD2 . PHE A 1 183  ? 36.817  55.719 50.450  1.00 60.60  ? 180  PHE A CD2 1 
ATOM 1415 C CE1 . PHE A 1 183  ? 36.989  53.035 51.166  1.00 60.60  ? 180  PHE A CE1 1 
ATOM 1416 C CE2 . PHE A 1 183  ? 38.000  55.220 50.991  1.00 60.60  ? 180  PHE A CE2 1 
ATOM 1417 C CZ  . PHE A 1 183  ? 38.083  53.882 51.350  1.00 60.60  ? 180  PHE A CZ  1 
ATOM 1418 N N   . VAL A 1 184  ? 32.107  54.950 51.706  1.00 69.17  ? 181  VAL A N   1 
ATOM 1419 C CA  . VAL A 1 184  ? 31.585  54.185 52.792  1.00 69.17  ? 181  VAL A CA  1 
ATOM 1420 C C   . VAL A 1 184  ? 31.821  52.751 52.396  1.00 69.17  ? 181  VAL A C   1 
ATOM 1421 O O   . VAL A 1 184  ? 31.546  52.368 51.255  1.00 69.17  ? 181  VAL A O   1 
ATOM 1422 C CB  . VAL A 1 184  ? 30.064  54.454 52.975  1.00 31.40  ? 181  VAL A CB  1 
ATOM 1423 C CG1 . VAL A 1 184  ? 29.361  53.401 53.947  1.00 31.40  ? 181  VAL A CG1 1 
ATOM 1424 C CG2 . VAL A 1 184  ? 29.849  55.827 53.465  1.00 31.40  ? 181  VAL A CG2 1 
ATOM 1425 N N   . TYR A 1 185  ? 32.330  51.961 53.335  1.00 63.39  ? 182  TYR A N   1 
ATOM 1426 C CA  . TYR A 1 185  ? 32.610  50.556 53.064  1.00 63.39  ? 182  TYR A CA  1 
ATOM 1427 C C   . TYR A 1 185  ? 32.248  49.683 54.255  1.00 63.39  ? 182  TYR A C   1 
ATOM 1428 O O   . TYR A 1 185  ? 32.259  50.153 55.396  1.00 63.39  ? 182  TYR A O   1 
ATOM 1429 C CB  . TYR A 1 185  ? 34.086  50.379 52.737  1.00 75.61  ? 182  TYR A CB  1 
ATOM 1430 C CG  . TYR A 1 185  ? 34.966  50.570 53.941  1.00 75.61  ? 182  TYR A CG  1 
ATOM 1431 C CD1 . TYR A 1 185  ? 35.351  49.477 54.735  1.00 75.61  ? 182  TYR A CD1 1 
ATOM 1432 C CD2 . TYR A 1 185  ? 35.400  51.834 54.302  1.00 75.61  ? 182  TYR A CD2 1 
ATOM 1433 C CE1 . TYR A 1 185  ? 36.152  49.645 55.851  1.00 75.61  ? 182  TYR A CE1 1 
ATOM 1434 C CE2 . TYR A 1 185  ? 36.211  52.014 55.413  1.00 75.61  ? 182  TYR A CE2 1 
ATOM 1435 C CZ  . TYR A 1 185  ? 36.582  50.917 56.185  1.00 75.61  ? 182  TYR A CZ  1 
ATOM 1436 O OH  . TYR A 1 185  ? 37.383  51.119 57.287  1.00 75.61  ? 182  TYR A OH  1 
ATOM 1437 N N   . GLN A 1 186  ? 31.946  48.415 53.974  1.00 73.51  ? 183  GLN A N   1 
ATOM 1438 C CA  . GLN A 1 186  ? 31.596  47.431 54.987  1.00 73.51  ? 183  GLN A CA  1 
ATOM 1439 C C   . GLN A 1 186  ? 32.728  46.422 55.163  1.00 73.51  ? 183  GLN A C   1 
ATOM 1440 O O   . GLN A 1 186  ? 33.260  45.888 54.193  1.00 73.51  ? 183  GLN A O   1 
ATOM 1441 C CB  . GLN A 1 186  ? 30.300  46.715 54.601  1.00 75.00  ? 183  GLN A CB  1 
ATOM 1442 C CG  . GLN A 1 186  ? 29.749  45.739 55.637  1.00 75.00  ? 183  GLN A CG  1 
ATOM 1443 C CD  . GLN A 1 186  ? 28.622  44.837 55.084  1.00 75.00  ? 183  GLN A CD  1 
ATOM 1444 O OE1 . GLN A 1 186  ? 27.893  45.211 54.152  1.00 75.00  ? 183  GLN A OE1 1 
ATOM 1445 N NE2 . GLN A 1 186  ? 28.476  43.644 55.675  1.00 75.00  ? 183  GLN A NE2 1 
ATOM 1446 N N   . ASP A 1 187  ? 33.113  46.199 56.415  1.00 84.01  ? 184  ASP A N   1 
ATOM 1447 C CA  . ASP A 1 187  ? 33.942  45.065 56.800  1.00 84.01  ? 184  ASP A CA  1 
ATOM 1448 C C   . ASP A 1 187  ? 33.317  44.464 58.049  1.00 84.01  ? 184  ASP A C   1 
ATOM 1449 O O   . ASP A 1 187  ? 32.514  45.130 58.715  1.00 84.01  ? 184  ASP A O   1 
ATOM 1450 C CB  . ASP A 1 187  ? 35.371  45.507 57.080  1.00 70.45  ? 184  ASP A CB  1 
ATOM 1451 C CG  . ASP A 1 187  ? 35.460  46.540 58.190  1.00 70.45  ? 184  ASP A CG  1 
ATOM 1452 O OD1 . ASP A 1 187  ? 34.960  46.302 59.315  1.00 70.45  ? 184  ASP A OD1 1 
ATOM 1453 O OD2 . ASP A 1 187  ? 36.060  47.601 57.930  1.00 70.45  ? 184  ASP A OD2 1 
ATOM 1454 N N   . PRO A 1 188  ? 33.677  43.224 58.365  1.00 108.54 ? 185  PRO A N   1 
ATOM 1455 C CA  . PRO A 1 188  ? 33.138  42.546 59.545  1.00 108.54 ? 185  PRO A CA  1 
ATOM 1456 C C   . PRO A 1 188  ? 32.224  43.455 60.361  1.00 108.54 ? 185  PRO A C   1 
ATOM 1457 O O   . PRO A 1 188  ? 31.062  43.642 60.002  1.00 108.54 ? 185  PRO A O   1 
ATOM 1458 C CB  . PRO A 1 188  ? 34.408  42.230 60.336  1.00 64.35  ? 185  PRO A CB  1 
ATOM 1459 C CG  . PRO A 1 188  ? 35.368  41.897 59.246  1.00 64.35  ? 185  PRO A CG  1 
ATOM 1460 C CD  . PRO A 1 188  ? 35.140  43.068 58.309  1.00 64.35  ? 185  PRO A CD  1 
ATOM 1461 N N   . GLN A 1 189  ? 32.752  44.009 61.448  1.00 127.81 ? 186  GLN A N   1 
ATOM 1462 C CA  . GLN A 1 189  ? 31.985  44.895 62.317  1.00 127.81 ? 186  GLN A CA  1 
ATOM 1463 C C   . GLN A 1 189  ? 30.790  45.516 61.599  1.00 127.81 ? 186  GLN A C   1 
ATOM 1464 O O   . GLN A 1 189  ? 29.751  44.876 61.433  1.00 127.81 ? 186  GLN A O   1 
ATOM 1465 C CB  . GLN A 1 189  ? 32.883  45.996 62.888  1.00 101.94 ? 186  GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 189  ? 34.029  45.482 63.745  1.00 101.94 ? 186  GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 189  ? 35.019  44.647 62.957  1.00 101.94 ? 186  GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 189  ? 34.960  44.588 61.729  1.00 101.94 ? 186  GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 189  ? 35.938  43.998 63.662  1.00 101.94 ? 186  GLN A NE2 1 
ATOM 1470 N N   . GLY A 1 190  ? 30.943  46.768 61.179  1.00 106.96 ? 187  GLY A N   1 
ATOM 1471 C CA  . GLY A 1 190  ? 29.883  47.476 60.485  1.00 106.96 ? 187  GLY A CA  1 
ATOM 1472 C C   . GLY A 1 190  ? 30.384  48.224 59.266  1.00 106.96 ? 187  GLY A C   1 
ATOM 1473 O O   . GLY A 1 190  ? 31.185  47.700 58.491  1.00 106.96 ? 187  GLY A O   1 
ATOM 1474 N N   . ARG A 1 191  ? 29.912  49.455 59.094  1.00 65.10  ? 188  ARG A N   1 
ATOM 1475 C CA  . ARG A 1 191  ? 30.316  50.270 57.966  1.00 65.10  ? 188  ARG A CA  1 
ATOM 1476 C C   . ARG A 1 191  ? 31.079  51.455 58.480  1.00 65.10  ? 188  ARG A C   1 
ATOM 1477 O O   . ARG A 1 191  ? 30.824  51.945 59.583  1.00 65.10  ? 188  ARG A O   1 
ATOM 1478 C CB  . ARG A 1 191  ? 29.121  50.749 57.144  1.00 72.15  ? 188  ARG A CB  1 
ATOM 1479 C CG  . ARG A 1 191  ? 28.554  49.751 56.162  1.00 72.15  ? 188  ARG A CG  1 
ATOM 1480 C CD  . ARG A 1 191  ? 27.187  50.248 55.759  1.00 72.15  ? 188  ARG A CD  1 
ATOM 1481 N NE  . ARG A 1 191  ? 26.658  49.692 54.515  1.00 72.15  ? 188  ARG A NE  1 
ATOM 1482 C CZ  . ARG A 1 191  ? 26.392  48.407 54.293  1.00 72.15  ? 188  ARG A CZ  1 
ATOM 1483 N NH1 . ARG A 1 191  ? 26.638  47.479 55.199  1.00 72.15  ? 188  ARG A NH1 1 
ATOM 1484 N NH2 . ARG A 1 191  ? 25.894  48.042 53.134  1.00 72.15  ? 188  ARG A NH2 1 
ATOM 1485 N N   . HIS A 1 192  ? 32.014  51.913 57.658  1.00 77.15  ? 189  HIS A N   1 
ATOM 1486 C CA  . HIS A 1 192  ? 32.921  52.982 58.033  1.00 77.15  ? 189  HIS A CA  1 
ATOM 1487 C C   . HIS A 1 192  ? 33.041  53.960 56.876  1.00 77.15  ? 189  HIS A C   1 
ATOM 1488 O O   . HIS A 1 192  ? 32.758  53.609 55.722  1.00 77.15  ? 189  HIS A O   1 
ATOM 1489 C CB  . HIS A 1 192  ? 34.288  52.409 58.422  1.00 79.68  ? 189  HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 192  ? 34.205  51.220 59.331  1.00 79.68  ? 189  HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 192  ? 33.883  49.958 58.878  1.00 79.68  ? 189  HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 192  ? 34.380  51.105 60.668  1.00 79.68  ? 189  HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 192  ? 33.870  49.116 59.896  1.00 79.68  ? 189  HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 192  ? 34.165  49.788 60.994  1.00 79.68  ? 189  HIS A NE2 1 
ATOM 1495 N N   . VAL A 1 193  ? 33.433  55.188 57.197  1.00 68.65  ? 190  VAL A N   1 
ATOM 1496 C CA  . VAL A 1 193  ? 33.603  56.227 56.203  1.00 68.65  ? 190  VAL A CA  1 
ATOM 1497 C C   . VAL A 1 193  ? 35.078  56.614 56.154  1.00 68.65  ? 190  VAL A C   1 
ATOM 1498 O O   . VAL A 1 193  ? 35.643  57.034 57.152  1.00 68.65  ? 190  VAL A O   1 
ATOM 1499 C CB  . VAL A 1 193  ? 32.682  57.456 56.498  1.00 59.17  ? 190  VAL A CB  1 
ATOM 1500 C CG1 . VAL A 1 193  ? 32.606  57.745 58.008  1.00 59.17  ? 190  VAL A CG1 1 
ATOM 1501 C CG2 . VAL A 1 193  ? 33.107  58.721 55.681  1.00 59.17  ? 190  VAL A CG2 1 
ATOM 1502 N N   . LYS A 1 194  ? 35.697  56.464 54.990  1.00 59.00  ? 191  LYS A N   1 
ATOM 1503 C CA  . LYS A 1 194  ? 37.127  56.726 54.844  1.00 59.00  ? 191  LYS A CA  1 
ATOM 1504 C C   . LYS A 1 194  ? 37.442  57.765 53.747  1.00 59.00  ? 191  LYS A C   1 
ATOM 1505 O O   . LYS A 1 194  ? 36.603  58.040 52.886  1.00 59.00  ? 191  LYS A O   1 
ATOM 1506 C CB  . LYS A 1 194  ? 37.845  55.406 54.581  1.00 76.17  ? 191  LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 194  ? 39.299  55.385 54.988  1.00 76.17  ? 191  LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 194  ? 39.712  53.970 55.305  1.00 76.17  ? 191  LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 194  ? 41.200  53.819 55.192  1.00 76.17  ? 191  LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 194  ? 41.523  52.520 54.540  1.00 76.17  ? 191  LYS A NZ  1 
ATOM 1511 N N   . THR A 1 195  ? 38.634  58.349 53.786  1.00 58.11  ? 192  THR A N   1 
ATOM 1512 C CA  . THR A 1 195  ? 39.034  59.323 52.770  1.00 58.11  ? 192  THR A CA  1 
ATOM 1513 C C   . THR A 1 195  ? 40.444  59.053 52.292  1.00 58.11  ? 192  THR A C   1 
ATOM 1514 O O   . THR A 1 195  ? 41.296  58.642 53.087  1.00 58.11  ? 192  THR A O   1 
ATOM 1515 C CB  . THR A 1 195  ? 39.056  60.722 53.346  1.00 53.06  ? 192  THR A CB  1 
ATOM 1516 O OG1 . THR A 1 195  ? 39.566  60.647 54.681  1.00 53.06  ? 192  THR A OG1 1 
ATOM 1517 C CG2 . THR A 1 195  ? 37.665  61.283 53.389  1.00 53.06  ? 192  THR A CG2 1 
ATOM 1518 N N   . TYR A 1 196  ? 40.698  59.268 51.004  1.00 61.43  ? 193  TYR A N   1 
ATOM 1519 C CA  . TYR A 1 196  ? 42.077  59.347 50.519  1.00 61.43  ? 193  TYR A CA  1 
ATOM 1520 C C   . TYR A 1 196  ? 42.226  60.604 49.685  1.00 61.43  ? 193  TYR A C   1 
ATOM 1521 O O   . TYR A 1 196  ? 41.231  61.179 49.243  1.00 61.43  ? 193  TYR A O   1 
ATOM 1522 C CB  . TYR A 1 196  ? 42.512  58.129 49.695  1.00 65.12  ? 193  TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 196  ? 42.378  56.789 50.376  1.00 65.12  ? 193  TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 196  ? 41.731  55.733 49.740  1.00 65.12  ? 193  TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 196  ? 42.900  56.563 51.643  1.00 65.12  ? 193  TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 196  ? 41.599  54.473 50.354  1.00 65.12  ? 193  TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 196  ? 42.767  55.308 52.283  1.00 65.12  ? 193  TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 196  ? 42.116  54.267 51.632  1.00 65.12  ? 193  TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 196  ? 41.979  53.030 52.239  1.00 65.12  ? 193  TYR A OH  1 
ATOM 1530 N N   . GLU A 1 197  ? 43.472  61.051 49.526  1.00 62.67  ? 194  GLU A N   1 
ATOM 1531 C CA  . GLU A 1 197  ? 43.857  61.972 48.448  1.00 62.67  ? 194  GLU A CA  1 
ATOM 1532 C C   . GLU A 1 197  ? 44.197  61.092 47.263  1.00 62.67  ? 194  GLU A C   1 
ATOM 1533 O O   . GLU A 1 197  ? 44.330  59.875 47.398  1.00 62.67  ? 194  GLU A O   1 
ATOM 1534 C CB  . GLU A 1 197  ? 45.115  62.760 48.827  1.00 103.95 ? 194  GLU A CB  1 
ATOM 1535 C CG  . GLU A 1 197  ? 44.880  64.051 49.578  1.00 103.95 ? 194  GLU A CG  1 
ATOM 1536 C CD  . GLU A 1 197  ? 46.171  64.800 49.880  1.00 103.95 ? 194  GLU A CD  1 
ATOM 1537 O OE1 . GLU A 1 197  ? 47.136  64.706 49.076  1.00 103.95 ? 194  GLU A OE1 1 
ATOM 1538 O OE2 . GLU A 1 197  ? 46.213  65.496 50.929  1.00 103.95 ? 194  GLU A OE2 1 
ATOM 1539 N N   . VAL A 1 198  ? 44.362  61.692 46.102  1.00 102.37 ? 195  VAL A N   1 
ATOM 1540 C CA  . VAL A 1 198  ? 44.838  60.915 44.993  1.00 102.37 ? 195  VAL A CA  1 
ATOM 1541 C C   . VAL A 1 198  ? 45.889  61.714 44.255  1.00 102.37 ? 195  VAL A C   1 
ATOM 1542 O O   . VAL A 1 198  ? 45.581  62.698 43.574  1.00 102.37 ? 195  VAL A O   1 
ATOM 1543 C CB  . VAL A 1 198  ? 43.689  60.448 44.072  1.00 71.50  ? 195  VAL A CB  1 
ATOM 1544 C CG1 . VAL A 1 198  ? 44.195  59.507 43.025  1.00 71.50  ? 195  VAL A CG1 1 
ATOM 1545 C CG2 . VAL A 1 198  ? 42.615  59.730 44.873  1.00 71.50  ? 195  VAL A CG2 1 
ATOM 1546 N N   . SER A 1 199  ? 47.142  61.307 44.447  1.00 92.92  ? 196  SER A N   1 
ATOM 1547 C CA  . SER A 1 199  ? 48.243  61.816 43.656  1.00 92.92  ? 196  SER A CA  1 
ATOM 1548 C C   . SER A 1 199  ? 48.410  60.870 42.507  1.00 92.92  ? 196  SER A C   1 
ATOM 1549 O O   . SER A 1 199  ? 48.474  59.656 42.696  1.00 92.92  ? 196  SER A O   1 
ATOM 1550 C CB  . SER A 1 199  ? 49.539  61.877 44.457  1.00 136.31 ? 196  SER A CB  1 
ATOM 1551 O OG  . SER A 1 199  ? 50.623  62.166 43.589  1.00 136.31 ? 196  SER A OG  1 
ATOM 1552 N N   . LEU A 1 200  ? 48.482  61.444 41.317  1.00 119.26 ? 197  LEU A N   1 
ATOM 1553 C CA  . LEU A 1 200  ? 48.540  60.679 40.083  1.00 119.26 ? 197  LEU A CA  1 
ATOM 1554 C C   . LEU A 1 200  ? 49.964  60.607 39.560  1.00 119.26 ? 197  LEU A C   1 
ATOM 1555 O O   . LEU A 1 200  ? 50.333  59.672 38.846  1.00 119.26 ? 197  LEU A O   1 
ATOM 1556 C CB  . LEU A 1 200  ? 47.569  61.256 39.042  1.00 69.47  ? 197  LEU A CB  1 
ATOM 1557 C CG  . LEU A 1 200  ? 47.198  62.745 38.968  1.00 69.47  ? 197  LEU A CG  1 
ATOM 1558 C CD1 . LEU A 1 200  ? 46.043  62.924 37.979  1.00 69.47  ? 197  LEU A CD1 1 
ATOM 1559 C CD2 . LEU A 1 200  ? 46.864  63.391 40.365  1.00 69.47  ? 197  LEU A CD2 1 
ATOM 1560 N N   . ARG A 1 201  ? 50.750  61.605 39.946  1.00 162.72 ? 198  ARG A N   1 
ATOM 1561 C CA  . ARG A 1 201  ? 52.183  61.609 39.745  1.00 162.72 ? 198  ARG A CA  1 
ATOM 1562 C C   . ARG A 1 201  ? 52.794  60.253 40.089  1.00 162.72 ? 198  ARG A C   1 
ATOM 1563 O O   . ARG A 1 201  ? 53.488  59.647 39.270  1.00 162.72 ? 198  ARG A O   1 
ATOM 1564 C CB  . ARG A 1 201  ? 52.797  62.695 40.622  1.00 147.10 ? 198  ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 201  ? 54.300  62.583 40.827  1.00 147.10 ? 198  ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 201  ? 54.862  63.856 41.431  1.00 147.10 ? 198  ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 201  ? 54.337  65.040 40.747  1.00 147.10 ? 198  ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 201  ? 54.656  65.408 39.504  1.00 147.10 ? 198  ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 201  ? 55.510  64.691 38.777  1.00 147.10 ? 198  ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 201  ? 54.113  66.501 38.981  1.00 147.10 ? 198  ARG A NH2 1 
ATOM 1571 N N   . GLU A 1 202  ? 52.519  59.781 41.299  1.00 82.37  ? 199  GLU A N   1 
ATOM 1572 C CA  . GLU A 1 202  ? 53.135  58.560 41.805  1.00 82.37  ? 199  GLU A CA  1 
ATOM 1573 C C   . GLU A 1 202  ? 52.176  57.386 41.819  1.00 82.37  ? 199  GLU A C   1 
ATOM 1574 O O   . GLU A 1 202  ? 52.528  56.306 42.309  1.00 82.37  ? 199  GLU A O   1 
ATOM 1575 C CB  . GLU A 1 202  ? 53.749  58.764 43.198  1.00 158.02 ? 199  GLU A CB  1 
ATOM 1576 C CG  . GLU A 1 202  ? 53.064  59.807 44.070  1.00 158.02 ? 199  GLU A CG  1 
ATOM 1577 C CD  . GLU A 1 202  ? 53.688  61.191 43.928  1.00 158.02 ? 199  GLU A CD  1 
ATOM 1578 O OE1 . GLU A 1 202  ? 52.936  62.184 43.871  1.00 158.02 ? 199  GLU A OE1 1 
ATOM 1579 O OE2 . GLU A 1 202  ? 54.932  61.294 43.869  1.00 158.02 ? 199  GLU A OE2 1 
ATOM 1580 N N   . LYS A 1 203  ? 50.949  57.709 41.458  1.00 91.03  ? 200  LYS A N   1 
ATOM 1581 C CA  . LYS A 1 203  ? 49.829  56.794 41.453  1.00 91.03  ? 200  LYS A CA  1 
ATOM 1582 C C   . LYS A 1 203  ? 49.659  55.875 42.685  1.00 91.03  ? 200  LYS A C   1 
ATOM 1583 O O   . LYS A 1 203  ? 50.044  54.726 42.627  1.00 91.03  ? 200  LYS A O   1 
ATOM 1584 C CB  . LYS A 1 203  ? 49.966  55.910 40.236  1.00 99.79  ? 200  LYS A CB  1 
ATOM 1585 C CG  . LYS A 1 203  ? 50.417  56.650 39.018  1.00 99.79  ? 200  LYS A CG  1 
ATOM 1586 C CD  . LYS A 1 203  ? 51.102  55.703 38.074  1.00 99.79  ? 200  LYS A CD  1 
ATOM 1587 C CE  . LYS A 1 203  ? 51.272  56.344 36.728  1.00 99.79  ? 200  LYS A CE  1 
ATOM 1588 N NZ  . LYS A 1 203  ? 51.489  57.804 36.861  1.00 99.79  ? 200  LYS A NZ  1 
ATOM 1589 N N   . GLU A 1 204  ? 49.082  56.370 43.779  1.00 95.59  ? 201  GLU A N   1 
ATOM 1590 C CA  . GLU A 1 204  ? 48.842  55.561 44.970  1.00 95.59  ? 201  GLU A CA  1 
ATOM 1591 C C   . GLU A 1 204  ? 47.559  56.139 45.618  1.00 95.59  ? 201  GLU A C   1 
ATOM 1592 O O   . GLU A 1 204  ? 46.462  55.761 45.237  1.00 95.59  ? 201  GLU A O   1 
ATOM 1593 C CB  . GLU A 1 204  ? 50.044  55.497 45.912  1.00 123.88 ? 201  GLU A CB  1 
ATOM 1594 C CG  . GLU A 1 204  ? 50.890  56.746 46.144  1.00 123.88 ? 201  GLU A CG  1 
ATOM 1595 C CD  . GLU A 1 204  ? 51.910  56.545 47.293  1.00 123.88 ? 201  GLU A CD  1 
ATOM 1596 O OE1 . GLU A 1 204  ? 52.272  55.389 47.592  1.00 123.88 ? 201  GLU A OE1 1 
ATOM 1597 O OE2 . GLU A 1 204  ? 52.355  57.535 47.908  1.00 123.88 ? 201  GLU A OE2 1 
ATOM 1598 N N   . PHE A 1 205  ? 47.688  57.047 46.577  1.00 103.87 ? 202  PHE A N   1 
ATOM 1599 C CA  . PHE A 1 205  ? 46.578  57.689 47.311  1.00 103.87 ? 202  PHE A CA  1 
ATOM 1600 C C   . PHE A 1 205  ? 47.465  58.575 48.165  1.00 103.87 ? 202  PHE A C   1 
ATOM 1601 O O   . PHE A 1 205  ? 48.350  59.228 47.642  1.00 103.87 ? 202  PHE A O   1 
ATOM 1602 C CB  . PHE A 1 205  ? 45.860  56.665 48.174  1.00 73.08  ? 202  PHE A CB  1 
ATOM 1603 C CG  . PHE A 1 205  ? 44.746  55.933 47.466  1.00 73.08  ? 202  PHE A CG  1 
ATOM 1604 C CD1 . PHE A 1 205  ? 43.847  56.601 46.669  1.00 73.08  ? 202  PHE A CD1 1 
ATOM 1605 C CD2 . PHE A 1 205  ? 44.574  54.587 47.633  1.00 73.08  ? 202  PHE A CD2 1 
ATOM 1606 C CE1 . PHE A 1 205  ? 42.836  55.935 46.039  1.00 73.08  ? 202  PHE A CE1 1 
ATOM 1607 C CE2 . PHE A 1 205  ? 43.547  53.926 47.004  1.00 73.08  ? 202  PHE A CE2 1 
ATOM 1608 C CZ  . PHE A 1 205  ? 42.686  54.604 46.212  1.00 73.08  ? 202  PHE A CZ  1 
ATOM 1609 N N   . ASN A 1 206  ? 47.279  58.588 49.467  1.00 75.89  ? 203  ASN A N   1 
ATOM 1610 C CA  . ASN A 1 206  ? 48.087  59.416 50.350  1.00 75.89  ? 203  ASN A CA  1 
ATOM 1611 C C   . ASN A 1 206  ? 47.065  59.364 51.497  1.00 75.89  ? 203  ASN A C   1 
ATOM 1612 O O   . ASN A 1 206  ? 46.308  58.411 51.604  1.00 75.89  ? 203  ASN A O   1 
ATOM 1613 C CB  . ASN A 1 206  ? 48.231  60.792 49.785  1.00 73.45  ? 203  ASN A CB  1 
ATOM 1614 C CG  . ASN A 1 206  ? 49.579  61.018 49.251  1.00 73.45  ? 203  ASN A CG  1 
ATOM 1615 O OD1 . ASN A 1 206  ? 50.525  61.137 50.007  1.00 73.45  ? 203  ASN A OD1 1 
ATOM 1616 N ND2 . ASN A 1 206  ? 49.701  61.063 47.947  1.00 73.45  ? 203  ASN A ND2 1 
ATOM 1617 N N   . LYS A 1 207  ? 47.008  60.356 52.357  1.00 95.11  ? 204  LYS A N   1 
ATOM 1618 C CA  . LYS A 1 207  ? 46.054  60.314 53.443  1.00 95.11  ? 204  LYS A CA  1 
ATOM 1619 C C   . LYS A 1 207  ? 45.067  61.425 53.120  1.00 95.11  ? 204  LYS A C   1 
ATOM 1620 O O   . LYS A 1 207  ? 45.430  62.567 52.656  1.00 95.11  ? 204  LYS A O   1 
ATOM 1621 C CB  . LYS A 1 207  ? 46.801  60.543 54.750  1.00 181.36 ? 204  LYS A CB  1 
ATOM 1622 C CG  . LYS A 1 207  ? 45.948  60.623 56.006  1.00 181.36 ? 204  LYS A CG  1 
ATOM 1623 C CD  . LYS A 1 207  ? 45.903  62.057 56.567  1.00 181.36 ? 204  LYS A CD  1 
ATOM 1624 C CE  . LYS A 1 207  ? 45.151  62.146 57.891  1.00 181.36 ? 204  LYS A CE  1 
ATOM 1625 N NZ  . LYS A 1 207  ? 45.365  63.463 58.544  1.00 181.36 ? 204  LYS A NZ  1 
ATOM 1626 N N   . GLY A 1 208  ? 43.821  61.031 53.369  1.00 96.47  ? 205  GLY A N   1 
ATOM 1627 C CA  . GLY A 1 208  ? 42.611  61.801 53.179  1.00 96.47  ? 205  GLY A CA  1 
ATOM 1628 C C   . GLY A 1 208  ? 42.388  62.516 54.498  1.00 96.47  ? 205  GLY A C   1 
ATOM 1629 O O   . GLY A 1 208  ? 42.511  61.945 55.604  1.00 96.47  ? 205  GLY A O   1 
ATOM 1630 N N   . PRO A 1 209  ? 42.011  63.763 54.292  1.00 83.23  ? 206  PRO A N   1 
ATOM 1631 C CA  . PRO A 1 209  ? 41.821  64.912 55.178  1.00 83.23  ? 206  PRO A CA  1 
ATOM 1632 C C   . PRO A 1 209  ? 41.342  64.554 56.583  1.00 83.23  ? 206  PRO A C   1 
ATOM 1633 O O   . PRO A 1 209  ? 41.715  65.249 57.529  1.00 83.23  ? 206  PRO A O   1 
ATOM 1634 C CB  . PRO A 1 209  ? 40.737  65.703 54.442  1.00 99.18  ? 206  PRO A CB  1 
ATOM 1635 C CG  . PRO A 1 209  ? 41.124  65.493 53.020  1.00 99.18  ? 206  PRO A CG  1 
ATOM 1636 C CD  . PRO A 1 209  ? 41.328  63.990 53.008  1.00 99.18  ? 206  PRO A CD  1 
ATOM 1637 N N   . TRP A 1 210  ? 40.534  63.508 56.729  1.00 70.86  ? 207  TRP A N   1 
ATOM 1638 C CA  . TRP A 1 210  ? 40.037  63.154 58.068  1.00 70.86  ? 207  TRP A CA  1 
ATOM 1639 C C   . TRP A 1 210  ? 39.853  61.702 58.445  1.00 70.86  ? 207  TRP A C   1 
ATOM 1640 O O   . TRP A 1 210  ? 39.611  60.826 57.599  1.00 70.86  ? 207  TRP A O   1 
ATOM 1641 C CB  . TRP A 1 210  ? 38.796  63.966 58.466  1.00 90.78  ? 207  TRP A CB  1 
ATOM 1642 C CG  . TRP A 1 210  ? 37.583  63.689 57.639  1.00 90.78  ? 207  TRP A CG  1 
ATOM 1643 C CD1 . TRP A 1 210  ? 36.712  62.634 57.769  1.00 90.78  ? 207  TRP A CD1 1 
ATOM 1644 C CD2 . TRP A 1 210  ? 37.085  64.492 56.568  1.00 90.78  ? 207  TRP A CD2 1 
ATOM 1645 N NE1 . TRP A 1 210  ? 35.706  62.732 56.833  1.00 90.78  ? 207  TRP A NE1 1 
ATOM 1646 C CE2 . TRP A 1 210  ? 35.907  63.862 56.084  1.00 90.78  ? 207  TRP A CE2 1 
ATOM 1647 C CE3 . TRP A 1 210  ? 37.519  65.683 55.965  1.00 90.78  ? 207  TRP A CE3 1 
ATOM 1648 C CZ2 . TRP A 1 210  ? 35.157  64.383 55.026  1.00 90.78  ? 207  TRP A CZ2 1 
ATOM 1649 C CZ3 . TRP A 1 210  ? 36.775  66.204 54.913  1.00 90.78  ? 207  TRP A CZ3 1 
ATOM 1650 C CH2 . TRP A 1 210  ? 35.602  65.551 54.455  1.00 90.78  ? 207  TRP A CH2 1 
ATOM 1651 N N   . LYS A 1 211  ? 39.960  61.486 59.757  1.00 67.53  ? 208  LYS A N   1 
ATOM 1652 C CA  . LYS A 1 211  ? 39.998  60.178 60.359  1.00 67.53  ? 208  LYS A CA  1 
ATOM 1653 C C   . LYS A 1 211  ? 38.832  59.367 59.888  1.00 67.53  ? 208  LYS A C   1 
ATOM 1654 O O   . LYS A 1 211  ? 37.741  59.881 59.735  1.00 67.53  ? 208  LYS A O   1 
ATOM 1655 C CB  . LYS A 1 211  ? 39.944  60.308 61.876  1.00 104.58 ? 208  LYS A CB  1 
ATOM 1656 C CG  . LYS A 1 211  ? 41.295  60.318 62.558  1.00 104.58 ? 208  LYS A CG  1 
ATOM 1657 C CD  . LYS A 1 211  ? 42.023  61.644 62.391  1.00 104.58 ? 208  LYS A CD  1 
ATOM 1658 C CE  . LYS A 1 211  ? 43.417  61.565 63.003  1.00 104.58 ? 208  LYS A CE  1 
ATOM 1659 N NZ  . LYS A 1 211  ? 44.264  62.692 62.544  1.00 104.58 ? 208  LYS A NZ  1 
ATOM 1660 N N   . GLN A 1 212  ? 39.086  58.097 59.628  1.00 85.61  ? 209  GLN A N   1 
ATOM 1661 C CA  . GLN A 1 212  ? 38.038  57.128 59.405  1.00 85.61  ? 209  GLN A CA  1 
ATOM 1662 C C   . GLN A 1 212  ? 37.086  57.110 60.611  1.00 85.61  ? 209  GLN A C   1 
ATOM 1663 O O   . GLN A 1 212  ? 37.472  56.767 61.732  1.00 85.61  ? 209  GLN A O   1 
ATOM 1664 C CB  . GLN A 1 212  ? 38.651  55.747 59.181  1.00 145.45 ? 209  GLN A CB  1 
ATOM 1665 C CG  . GLN A 1 212  ? 37.642  54.648 58.963  1.00 145.45 ? 209  GLN A CG  1 
ATOM 1666 C CD  . GLN A 1 212  ? 37.995  53.403 59.730  1.00 145.45 ? 209  GLN A CD  1 
ATOM 1667 O OE1 . GLN A 1 212  ? 39.096  52.871 59.600  1.00 145.45 ? 209  GLN A OE1 1 
ATOM 1668 N NE2 . GLN A 1 212  ? 37.062  52.931 60.547  1.00 145.45 ? 209  GLN A NE2 1 
ATOM 1669 N N   . GLU A 1 213  ? 35.842  57.499 60.373  1.00 94.78  ? 210  GLU A N   1 
ATOM 1670 C CA  . GLU A 1 213  ? 34.820  57.418 61.409  1.00 94.78  ? 210  GLU A CA  1 
ATOM 1671 C C   . GLU A 1 213  ? 33.936  56.183 61.176  1.00 94.78  ? 210  GLU A C   1 
ATOM 1672 O O   . GLU A 1 213  ? 34.161  55.423 60.224  1.00 94.78  ? 210  GLU A O   1 
ATOM 1673 C CB  . GLU A 1 213  ? 33.977  58.704 61.443  1.00 132.19 ? 210  GLU A CB  1 
ATOM 1674 C CG  . GLU A 1 213  ? 34.769  60.018 61.309  1.00 132.19 ? 210  GLU A CG  1 
ATOM 1675 C CD  . GLU A 1 213  ? 35.405  60.504 62.610  1.00 132.19 ? 210  GLU A CD  1 
ATOM 1676 O OE1 . GLU A 1 213  ? 35.680  59.681 63.512  1.00 132.19 ? 210  GLU A OE1 1 
ATOM 1677 O OE2 . GLU A 1 213  ? 35.638  61.728 62.719  1.00 132.19 ? 210  GLU A OE2 1 
ATOM 1678 N N   . ASN A 1 214  ? 32.951  55.982 62.050  1.00 118.15 ? 211  ASN A N   1 
ATOM 1679 C CA  . ASN A 1 214  ? 31.925  54.971 61.826  1.00 118.15 ? 211  ASN A CA  1 
ATOM 1680 C C   . ASN A 1 214  ? 30.680  55.551 61.168  1.00 118.15 ? 211  ASN A C   1 
ATOM 1681 O O   . ASN A 1 214  ? 30.446  56.760 61.210  1.00 118.15 ? 211  ASN A O   1 
ATOM 1682 C CB  . ASN A 1 214  ? 31.520  54.310 63.138  1.00 79.16  ? 211  ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 214  ? 32.534  53.295 63.630  1.00 79.16  ? 211  ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 214  ? 33.159  52.578 62.834  1.00 79.16  ? 211  ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 214  ? 32.682  53.206 64.959  1.00 79.16  ? 211  ASN A ND2 1 
ATOM 1686 N N   . VAL A 1 215  ? 29.888  54.675 60.557  1.00 54.17  ? 212  VAL A N   1 
ATOM 1687 C CA  . VAL A 1 215  ? 28.580  55.037 60.012  1.00 54.17  ? 212  VAL A CA  1 
ATOM 1688 C C   . VAL A 1 215  ? 27.646  53.858 60.236  1.00 54.17  ? 212  VAL A C   1 
ATOM 1689 O O   . VAL A 1 215  ? 28.097  52.781 60.655  1.00 54.17  ? 212  VAL A O   1 
ATOM 1690 C CB  . VAL A 1 215  ? 28.630  55.414 58.518  1.00 84.50  ? 212  VAL A CB  1 
ATOM 1691 C CG1 . VAL A 1 215  ? 29.296  56.771 58.326  1.00 84.50  ? 212  VAL A CG1 1 
ATOM 1692 C CG2 . VAL A 1 215  ? 29.322  54.337 57.706  1.00 84.50  ? 212  VAL A CG2 1 
ATOM 1693 N N   . GLU A 1 216  ? 26.360  54.037 59.961  1.00 57.29  ? 213  GLU A N   1 
ATOM 1694 C CA  . GLU A 1 216  ? 25.389  53.041 60.371  1.00 57.29  ? 213  GLU A CA  1 
ATOM 1695 C C   . GLU A 1 216  ? 25.338  51.791 59.484  1.00 57.29  ? 213  GLU A C   1 
ATOM 1696 O O   . GLU A 1 216  ? 25.636  51.836 58.287  1.00 57.29  ? 213  GLU A O   1 
ATOM 1697 C CB  . GLU A 1 216  ? 24.001  53.676 60.524  1.00 57.29  ? 213  GLU A CB  1 
ATOM 1698 C CG  . GLU A 1 216  ? 23.129  53.610 59.277  1.00 57.29  ? 213  GLU A CG  1 
ATOM 1699 C CD  . GLU A 1 216  ? 21.702  54.095 59.518  1.00 57.29  ? 213  GLU A CD  1 
ATOM 1700 O OE1 . GLU A 1 216  ? 21.521  55.330 59.706  1.00 57.29  ? 213  GLU A OE1 1 
ATOM 1701 O OE2 . GLU A 1 216  ? 20.775  53.235 59.492  1.00 57.29  ? 213  GLU A OE2 1 
ATOM 1702 N N   . ALA A 1 217  ? 24.938  50.686 60.108  1.00 66.64  ? 214  ALA A N   1 
ATOM 1703 C CA  . ALA A 1 217  ? 24.741  49.391 59.463  1.00 66.64  ? 214  ALA A CA  1 
ATOM 1704 C C   . ALA A 1 217  ? 24.274  49.491 58.039  1.00 66.64  ? 214  ALA A C   1 
ATOM 1705 O O   . ALA A 1 217  ? 24.707  48.702 57.205  1.00 66.64  ? 214  ALA A O   1 
ATOM 1706 C CB  . ALA A 1 217  ? 23.738  48.564 60.235  1.00 45.98  ? 214  ALA A CB  1 
ATOM 1707 N N   . GLU A 1 218  ? 23.364  50.420 57.755  1.00 72.59  ? 215  GLU A N   1 
ATOM 1708 C CA  . GLU A 1 218  ? 22.806  50.493 56.411  1.00 72.59  ? 215  GLU A CA  1 
ATOM 1709 C C   . GLU A 1 218  ? 23.053  51.828 55.703  1.00 72.59  ? 215  GLU A C   1 
ATOM 1710 O O   . GLU A 1 218  ? 22.349  52.192 54.752  1.00 72.59  ? 215  GLU A O   1 
ATOM 1711 C CB  . GLU A 1 218  ? 21.340  50.032 56.391  1.00 93.55  ? 215  GLU A CB  1 
ATOM 1712 C CG  . GLU A 1 218  ? 21.177  48.495 56.434  1.00 93.55  ? 215  GLU A CG  1 
ATOM 1713 C CD  . GLU A 1 218  ? 21.505  47.778 55.094  1.00 93.55  ? 215  GLU A CD  1 
ATOM 1714 O OE1 . GLU A 1 218  ? 21.591  48.451 54.035  1.00 93.55  ? 215  GLU A OE1 1 
ATOM 1715 O OE2 . GLU A 1 218  ? 21.663  46.527 55.094  1.00 93.55  ? 215  GLU A OE2 1 
ATOM 1716 N N   . ALA A 1 219  ? 24.082  52.540 56.150  1.00 74.54  ? 216  ALA A N   1 
ATOM 1717 C CA  . ALA A 1 219  ? 24.587  53.685 55.401  1.00 74.54  ? 216  ALA A CA  1 
ATOM 1718 C C   . ALA A 1 219  ? 24.888  53.261 53.952  1.00 74.54  ? 216  ALA A C   1 
ATOM 1719 O O   . ALA A 1 219  ? 25.528  52.223 53.708  1.00 74.54  ? 216  ALA A O   1 
ATOM 1720 C CB  . ALA A 1 219  ? 25.823  54.265 56.075  1.00 49.76  ? 216  ALA A CB  1 
ATOM 1721 N N   . SER A 1 220  ? 24.415  54.056 52.992  1.00 50.09  ? 217  SER A N   1 
ATOM 1722 C CA  . SER A 1 220  ? 24.395  53.599 51.620  1.00 50.09  ? 217  SER A CA  1 
ATOM 1723 C C   . SER A 1 220  ? 24.605  54.666 50.564  1.00 50.09  ? 217  SER A C   1 
ATOM 1724 O O   . SER A 1 220  ? 24.946  54.341 49.411  1.00 50.09  ? 217  SER A O   1 
ATOM 1725 C CB  . SER A 1 220  ? 23.060  52.961 51.339  1.00 43.24  ? 217  SER A CB  1 
ATOM 1726 O OG  . SER A 1 220  ? 22.196  53.975 50.872  1.00 43.24  ? 217  SER A OG  1 
ATOM 1727 N N   . MET A 1 221  ? 24.337  55.917 50.910  1.00 46.52  ? 218  MET A N   1 
ATOM 1728 C CA  . MET A 1 221  ? 24.487  56.984 49.933  1.00 46.52  ? 218  MET A CA  1 
ATOM 1729 C C   . MET A 1 221  ? 25.512  57.947 50.467  1.00 46.52  ? 218  MET A C   1 
ATOM 1730 O O   . MET A 1 221  ? 25.658  58.130 51.682  1.00 46.52  ? 218  MET A O   1 
ATOM 1731 C CB  . MET A 1 221  ? 23.168  57.720 49.650  1.00 99.43  ? 218  MET A CB  1 
ATOM 1732 C CG  . MET A 1 221  ? 22.061  56.865 49.037  1.00 99.43  ? 218  MET A CG  1 
ATOM 1733 S SD  . MET A 1 221  ? 20.950  57.746 47.902  1.00 99.43  ? 218  MET A SD  1 
ATOM 1734 C CE  . MET A 1 221  ? 21.592  57.201 46.313  1.00 99.43  ? 218  MET A CE  1 
ATOM 1735 N N   . VAL A 1 222  ? 26.244  58.558 49.558  1.00 60.51  ? 219  VAL A N   1 
ATOM 1736 C CA  . VAL A 1 222  ? 27.195  59.540 49.952  1.00 60.51  ? 219  VAL A CA  1 
ATOM 1737 C C   . VAL A 1 222  ? 26.960  60.731 49.088  1.00 60.51  ? 219  VAL A C   1 
ATOM 1738 O O   . VAL A 1 222  ? 27.016  60.637 47.856  1.00 60.51  ? 219  VAL A O   1 
ATOM 1739 C CB  . VAL A 1 222  ? 28.605  59.053 49.718  1.00 46.81  ? 219  VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 222  ? 29.631  60.229 49.833  1.00 46.81  ? 219  VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 222  ? 28.928  57.914 50.699  1.00 46.81  ? 219  VAL A CG2 1 
ATOM 1742 N N   . ILE A 1 223  ? 26.683  61.854 49.747  1.00 69.73  ? 220  ILE A N   1 
ATOM 1743 C CA  . ILE A 1 223  ? 26.557  63.139 49.084  1.00 69.73  ? 220  ILE A CA  1 
ATOM 1744 C C   . ILE A 1 223  ? 27.743  63.978 49.480  1.00 69.73  ? 220  ILE A C   1 
ATOM 1745 O O   . ILE A 1 223  ? 28.192  63.940 50.625  1.00 69.73  ? 220  ILE A O   1 
ATOM 1746 C CB  . ILE A 1 223  ? 25.250  63.833 49.440  1.00 57.67  ? 220  ILE A CB  1 
ATOM 1747 C CG1 . ILE A 1 223  ? 24.093  62.853 49.187  1.00 57.67  ? 220  ILE A CG1 1 
ATOM 1748 C CG2 . ILE A 1 223  ? 25.109  65.105 48.620  1.00 57.67  ? 220  ILE A CG2 1 
ATOM 1749 C CD1 . ILE A 1 223  ? 22.694  63.375 49.446  1.00 57.67  ? 220  ILE A CD1 1 
ATOM 1750 N N   . ALA A 1 224  ? 28.256  64.713 48.504  1.00 67.28  ? 221  ALA A N   1 
ATOM 1751 C CA  . ALA A 1 224  ? 29.419  65.543 48.698  1.00 67.28  ? 221  ALA A CA  1 
ATOM 1752 C C   . ALA A 1 224  ? 29.037  66.998 48.429  1.00 67.28  ? 221  ALA A C   1 
ATOM 1753 O O   . ALA A 1 224  ? 28.797  67.402 47.290  1.00 67.28  ? 221  ALA A O   1 
ATOM 1754 C CB  . ALA A 1 224  ? 30.536  65.082 47.795  1.00 46.92  ? 221  ALA A CB  1 
ATOM 1755 N N   . VAL A 1 225  ? 28.990  67.776 49.502  1.00 78.13  ? 222  VAL A N   1 
ATOM 1756 C CA  . VAL A 1 225  ? 28.483  69.132 49.451  1.00 78.13  ? 222  VAL A CA  1 
ATOM 1757 C C   . VAL A 1 225  ? 29.467  70.128 48.854  1.00 78.13  ? 222  VAL A C   1 
ATOM 1758 O O   . VAL A 1 225  ? 30.613  70.219 49.304  1.00 78.13  ? 222  VAL A O   1 
ATOM 1759 C CB  . VAL A 1 225  ? 28.083  69.604 50.831  1.00 89.32  ? 222  VAL A CB  1 
ATOM 1760 C CG1 . VAL A 1 225  ? 27.419  70.956 50.736  1.00 89.32  ? 222  VAL A CG1 1 
ATOM 1761 C CG2 . VAL A 1 225  ? 27.147  68.595 51.460  1.00 89.32  ? 222  VAL A CG2 1 
ATOM 1762 N N   . PRO A 1 226  ? 29.004  70.888 47.839  1.00 56.93  ? 223  PRO A N   1 
ATOM 1763 C CA  . PRO A 1 226  ? 29.813  71.867 47.121  1.00 56.93  ? 223  PRO A CA  1 
ATOM 1764 C C   . PRO A 1 226  ? 30.483  72.923 47.990  1.00 56.93  ? 223  PRO A C   1 
ATOM 1765 O O   . PRO A 1 226  ? 29.978  73.298 49.075  1.00 56.93  ? 223  PRO A O   1 
ATOM 1766 C CB  . PRO A 1 226  ? 28.814  72.524 46.152  1.00 81.15  ? 223  PRO A CB  1 
ATOM 1767 C CG  . PRO A 1 226  ? 27.477  72.170 46.671  1.00 81.15  ? 223  PRO A CG  1 
ATOM 1768 C CD  . PRO A 1 226  ? 27.634  70.833 47.294  1.00 81.15  ? 223  PRO A CD  1 
ATOM 1769 N N   . GLU A 1 227  ? 31.606  73.384 47.439  1.00 218.25 ? 224  GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227  ? 32.504  74.398 47.981  1.00 218.25 ? 224  GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227  ? 32.033  75.126 49.235  1.00 218.25 ? 224  GLU A C   1 
ATOM 1772 O O   . GLU A 1 227  ? 32.497  74.800 50.328  1.00 218.25 ? 224  GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227  ? 32.907  75.400 46.881  1.00 123.57 ? 224  GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227  ? 34.287  75.153 46.237  1.00 123.57 ? 224  GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227  ? 35.431  75.903 46.935  1.00 123.57 ? 224  GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227  ? 36.463  75.264 47.251  1.00 123.57 ? 224  GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227  ? 35.302  77.129 47.165  1.00 123.57 ? 224  GLU A OE2 1 
ATOM 1778 N N   . PRO A 1 228  ? 31.098  76.087 49.093  1.00 105.84 ? 225  PRO A N   1 
ATOM 1779 C CA  . PRO A 1 228  ? 30.859  76.991 50.217  1.00 105.84 ? 225  PRO A CA  1 
ATOM 1780 C C   . PRO A 1 228  ? 30.440  76.292 51.514  1.00 105.84 ? 225  PRO A C   1 
ATOM 1781 O O   . PRO A 1 228  ? 30.276  76.954 52.533  1.00 105.84 ? 225  PRO A O   1 
ATOM 1782 C CB  . PRO A 1 228  ? 29.758  77.914 49.693  1.00 118.02 ? 225  PRO A CB  1 
ATOM 1783 C CG  . PRO A 1 228  ? 29.872  77.826 48.204  1.00 118.02 ? 225  PRO A CG  1 
ATOM 1784 C CD  . PRO A 1 228  ? 30.214  76.401 47.956  1.00 118.02 ? 225  PRO A CD  1 
ATOM 1785 N N   . PHE A 1 229  ? 30.296  74.968 51.470  1.00 108.95 ? 226  PHE A N   1 
ATOM 1786 C CA  . PHE A 1 229  ? 30.082  74.166 52.673  1.00 108.95 ? 226  PHE A CA  1 
ATOM 1787 C C   . PHE A 1 229  ? 31.124  73.065 52.836  1.00 108.95 ? 226  PHE A C   1 
ATOM 1788 O O   . PHE A 1 229  ? 31.661  72.877 53.926  1.00 108.95 ? 226  PHE A O   1 
ATOM 1789 C CB  . PHE A 1 229  ? 28.710  73.503 52.650  1.00 151.77 ? 226  PHE A CB  1 
ATOM 1790 C CG  . PHE A 1 229  ? 27.558  74.460 52.630  1.00 151.77 ? 226  PHE A CG  1 
ATOM 1791 C CD1 . PHE A 1 229  ? 27.041  74.922 51.420  1.00 151.77 ? 226  PHE A CD1 1 
ATOM 1792 C CD2 . PHE A 1 229  ? 26.959  74.870 53.817  1.00 151.77 ? 226  PHE A CD2 1 
ATOM 1793 C CE1 . PHE A 1 229  ? 25.957  75.797 51.394  1.00 151.77 ? 226  PHE A CE1 1 
ATOM 1794 C CE2 . PHE A 1 229  ? 25.878  75.743 53.802  1.00 151.77 ? 226  PHE A CE2 1 
ATOM 1795 C CZ  . PHE A 1 229  ? 25.376  76.207 52.586  1.00 151.77 ? 226  PHE A CZ  1 
ATOM 1796 N N   . GLY A 1 230  ? 31.377  72.319 51.758  1.00 67.29  ? 227  GLY A N   1 
ATOM 1797 C CA  . GLY A 1 230  ? 32.227  71.130 51.804  1.00 67.29  ? 227  GLY A CA  1 
ATOM 1798 C C   . GLY A 1 230  ? 31.658  70.050 52.700  1.00 67.29  ? 227  GLY A C   1 
ATOM 1799 O O   . GLY A 1 230  ? 30.626  70.235 53.335  1.00 67.29  ? 227  GLY A O   1 
ATOM 1800 N N   . GLY A 1 231  ? 32.339  68.916 52.764  1.00 57.86  ? 228  GLY A N   1 
ATOM 1801 C CA  . GLY A 1 231  ? 31.951  67.840 53.685  1.00 57.86  ? 228  GLY A CA  1 
ATOM 1802 C C   . GLY A 1 231  ? 31.133  66.762 53.012  1.00 57.86  ? 228  GLY A C   1 
ATOM 1803 O O   . GLY A 1 231  ? 31.007  66.737 51.785  1.00 57.86  ? 228  GLY A O   1 
ATOM 1804 N N   . ALA A 1 232  ? 30.553  65.876 53.807  1.00 70.20  ? 229  ALA A N   1 
ATOM 1805 C CA  . ALA A 1 232  ? 29.882  64.726 53.229  1.00 70.20  ? 229  ALA A CA  1 
ATOM 1806 C C   . ALA A 1 232  ? 28.599  64.305 53.931  1.00 70.20  ? 229  ALA A C   1 
ATOM 1807 O O   . ALA A 1 232  ? 28.547  64.156 55.156  1.00 70.20  ? 229  ALA A O   1 
ATOM 1808 C CB  . ALA A 1 232  ? 30.846  63.548 53.125  1.00 51.57  ? 229  ALA A CB  1 
ATOM 1809 N N   . ILE A 1 233  ? 27.572  64.076 53.129  1.00 58.38  ? 230  ILE A N   1 
ATOM 1810 C CA  . ILE A 1 233  ? 26.320  63.642 53.671  1.00 58.38  ? 230  ILE A CA  1 
ATOM 1811 C C   . ILE A 1 233  ? 26.140  62.145 53.502  1.00 58.38  ? 230  ILE A C   1 
ATOM 1812 O O   . ILE A 1 233  ? 26.353  61.602 52.424  1.00 58.38  ? 230  ILE A O   1 
ATOM 1813 C CB  . ILE A 1 233  ? 25.160  64.455 53.109  1.00 77.87  ? 230  ILE A CB  1 
ATOM 1814 C CG1 . ILE A 1 233  ? 25.246  65.872 53.674  1.00 77.87  ? 230  ILE A CG1 1 
ATOM 1815 C CG2 . ILE A 1 233  ? 23.824  63.825 53.485  1.00 77.87  ? 230  ILE A CG2 1 
ATOM 1816 C CD1 . ILE A 1 233  ? 24.510  66.910 52.858  1.00 77.87  ? 230  ILE A CD1 1 
ATOM 1817 N N   . ILE A 1 234  ? 25.748  61.495 54.594  1.00 55.02  ? 231  ILE A N   1 
ATOM 1818 C CA  . ILE A 1 234  ? 25.719  60.048 54.694  1.00 55.02  ? 231  ILE A CA  1 
ATOM 1819 C C   . ILE A 1 234  ? 24.310  59.577 55.020  1.00 55.02  ? 231  ILE A C   1 
ATOM 1820 O O   . ILE A 1 234  ? 23.683  60.081 55.943  1.00 55.02  ? 231  ILE A O   1 
ATOM 1821 C CB  . ILE A 1 234  ? 26.764  59.567 55.750  1.00 46.53  ? 231  ILE A CB  1 
ATOM 1822 C CG1 . ILE A 1 234  ? 28.159  59.521 55.115  1.00 46.53  ? 231  ILE A CG1 1 
ATOM 1823 C CG2 . ILE A 1 234  ? 26.413  58.205 56.323  1.00 46.53  ? 231  ILE A CG2 1 
ATOM 1824 C CD1 . ILE A 1 234  ? 28.805  60.902 54.916  1.00 46.53  ? 231  ILE A CD1 1 
ATOM 1825 N N   . ILE A 1 235  ? 23.799  58.614 54.270  1.00 63.94  ? 232  ILE A N   1 
ATOM 1826 C CA  . ILE A 1 235  ? 22.412  58.259 54.449  1.00 63.94  ? 232  ILE A CA  1 
ATOM 1827 C C   . ILE A 1 235  ? 22.220  56.793 54.706  1.00 63.94  ? 232  ILE A C   1 
ATOM 1828 O O   . ILE A 1 235  ? 22.553  55.961 53.870  1.00 63.94  ? 232  ILE A O   1 
ATOM 1829 C CB  . ILE A 1 235  ? 21.572  58.693 53.246  1.00 63.15  ? 232  ILE A CB  1 
ATOM 1830 C CG1 . ILE A 1 235  ? 21.447  60.215 53.235  1.00 63.15  ? 232  ILE A CG1 1 
ATOM 1831 C CG2 . ILE A 1 235  ? 20.183  58.047 53.301  1.00 63.15  ? 232  ILE A CG2 1 
ATOM 1832 C CD1 . ILE A 1 235  ? 21.418  60.810 51.888  1.00 63.15  ? 232  ILE A CD1 1 
ATOM 1833 N N   . GLY A 1 236  ? 21.655  56.482 55.863  1.00 53.89  ? 233  GLY A N   1 
ATOM 1834 C CA  . GLY A 1 236  ? 21.335  55.105 56.214  1.00 53.89  ? 233  GLY A CA  1 
ATOM 1835 C C   . GLY A 1 236  ? 19.846  54.939 56.227  1.00 53.89  ? 233  GLY A C   1 
ATOM 1836 O O   . GLY A 1 236  ? 19.161  55.654 55.512  1.00 53.89  ? 233  GLY A O   1 
ATOM 1837 N N   . GLN A 1 237  ? 19.349  54.051 57.083  1.00 70.02  ? 234  GLN A N   1 
ATOM 1838 C CA  . GLN A 1 237  ? 17.922  53.953 57.360  1.00 70.02  ? 234  GLN A CA  1 
ATOM 1839 C C   . GLN A 1 237  ? 17.611  54.767 58.614  1.00 70.02  ? 234  GLN A C   1 
ATOM 1840 O O   . GLN A 1 237  ? 18.475  54.946 59.472  1.00 70.02  ? 234  GLN A O   1 
ATOM 1841 C CB  . GLN A 1 237  ? 17.510  52.494 57.558  1.00 86.22  ? 234  GLN A CB  1 
ATOM 1842 C CG  . GLN A 1 237  ? 17.248  51.741 56.264  1.00 86.22  ? 234  GLN A CG  1 
ATOM 1843 C CD  . GLN A 1 237  ? 15.861  52.000 55.711  1.00 86.22  ? 234  GLN A CD  1 
ATOM 1844 O OE1 . GLN A 1 237  ? 15.297  53.078 55.896  1.00 86.22  ? 234  GLN A OE1 1 
ATOM 1845 N NE2 . GLN A 1 237  ? 15.302  51.008 55.027  1.00 86.22  ? 234  GLN A NE2 1 
ATOM 1846 N N   . GLU A 1 238  ? 16.382  55.265 58.718  1.00 136.52 ? 235  GLU A N   1 
ATOM 1847 C CA  . GLU A 1 238  ? 15.990  56.128 59.855  1.00 136.52 ? 235  GLU A CA  1 
ATOM 1848 C C   . GLU A 1 238  ? 16.902  57.326 60.164  1.00 136.52 ? 235  GLU A C   1 
ATOM 1849 O O   . GLU A 1 238  ? 16.497  58.232 60.894  1.00 136.52 ? 235  GLU A O   1 
ATOM 1850 C CB  . GLU A 1 238  ? 15.735  55.312 61.145  1.00 123.46 ? 235  GLU A CB  1 
ATOM 1851 C CG  . GLU A 1 238  ? 16.549  54.013 61.341  1.00 123.46 ? 235  GLU A CG  1 
ATOM 1852 C CD  . GLU A 1 238  ? 17.962  54.229 61.873  1.00 123.46 ? 235  GLU A CD  1 
ATOM 1853 O OE1 . GLU A 1 238  ? 18.313  55.368 62.231  1.00 123.46 ? 235  GLU A OE1 1 
ATOM 1854 O OE2 . GLU A 1 238  ? 18.732  53.249 61.936  1.00 123.46 ? 235  GLU A OE2 1 
ATOM 1855 N N   . SER A 1 239  ? 18.106  57.335 59.590  1.00 90.29  ? 236  SER A N   1 
ATOM 1856 C CA  . SER A 1 239  ? 19.164  58.264 59.987  1.00 90.29  ? 236  SER A CA  1 
ATOM 1857 C C   . SER A 1 239  ? 19.970  58.847 58.819  1.00 90.29  ? 236  SER A C   1 
ATOM 1858 O O   . SER A 1 239  ? 20.167  58.194 57.790  1.00 90.29  ? 236  SER A O   1 
ATOM 1859 C CB  . SER A 1 239  ? 20.095  57.572 60.996  1.00 50.91  ? 236  SER A CB  1 
ATOM 1860 O OG  . SER A 1 239  ? 21.392  58.179 61.061  1.00 50.91  ? 236  SER A OG  1 
ATOM 1861 N N   . ILE A 1 240  ? 20.435  60.081 59.025  1.00 69.95  ? 237  ILE A N   1 
ATOM 1862 C CA  . ILE A 1 240  ? 21.159  60.877 58.038  1.00 69.95  ? 237  ILE A CA  1 
ATOM 1863 C C   . ILE A 1 240  ? 22.171  61.649 58.828  1.00 69.95  ? 237  ILE A C   1 
ATOM 1864 O O   . ILE A 1 240  ? 21.825  62.183 59.883  1.00 69.95  ? 237  ILE A O   1 
ATOM 1865 C CB  . ILE A 1 240  ? 20.259  61.971 57.436  1.00 57.04  ? 237  ILE A CB  1 
ATOM 1866 C CG1 . ILE A 1 240  ? 19.304  61.399 56.391  1.00 57.04  ? 237  ILE A CG1 1 
ATOM 1867 C CG2 . ILE A 1 240  ? 21.081  63.105 56.828  1.00 57.04  ? 237  ILE A CG2 1 
ATOM 1868 C CD1 . ILE A 1 240  ? 17.866  61.877 56.581  1.00 57.04  ? 237  ILE A CD1 1 
ATOM 1869 N N   . THR A 1 241  ? 23.397  61.747 58.312  1.00 103.00 ? 238  THR A N   1 
ATOM 1870 C CA  . THR A 1 241  ? 24.503  62.389 59.022  1.00 103.00 ? 238  THR A CA  1 
ATOM 1871 C C   . THR A 1 241  ? 25.396  63.239 58.122  1.00 103.00 ? 238  THR A C   1 
ATOM 1872 O O   . THR A 1 241  ? 25.392  63.104 56.903  1.00 103.00 ? 238  THR A O   1 
ATOM 1873 C CB  . THR A 1 241  ? 25.401  61.344 59.683  1.00 83.58  ? 238  THR A CB  1 
ATOM 1874 O OG1 . THR A 1 241  ? 25.620  60.268 58.761  1.00 83.58  ? 238  THR A OG1 1 
ATOM 1875 C CG2 . THR A 1 241  ? 24.774  60.801 60.959  1.00 83.58  ? 238  THR A CG2 1 
ATOM 1876 N N   . TYR A 1 242  ? 26.182  64.099 58.751  1.00 90.62  ? 239  TYR A N   1 
ATOM 1877 C CA  . TYR A 1 242  ? 27.122  64.959 58.068  1.00 90.62  ? 239  TYR A CA  1 
ATOM 1878 C C   . TYR A 1 242  ? 28.474  64.781 58.711  1.00 90.62  ? 239  TYR A C   1 
ATOM 1879 O O   . TYR A 1 242  ? 28.578  64.596 59.939  1.00 90.62  ? 239  TYR A O   1 
ATOM 1880 C CB  . TYR A 1 242  ? 26.700  66.403 58.243  1.00 69.46  ? 239  TYR A CB  1 
ATOM 1881 C CG  . TYR A 1 242  ? 27.588  67.446 57.598  1.00 69.46  ? 239  TYR A CG  1 
ATOM 1882 C CD1 . TYR A 1 242  ? 27.420  67.789 56.258  1.00 69.46  ? 239  TYR A CD1 1 
ATOM 1883 C CD2 . TYR A 1 242  ? 28.549  68.130 58.338  1.00 69.46  ? 239  TYR A CD2 1 
ATOM 1884 C CE1 . TYR A 1 242  ? 28.209  68.765 55.649  1.00 69.46  ? 239  TYR A CE1 1 
ATOM 1885 C CE2 . TYR A 1 242  ? 29.346  69.123 57.744  1.00 69.46  ? 239  TYR A CE2 1 
ATOM 1886 C CZ  . TYR A 1 242  ? 29.170  69.438 56.388  1.00 69.46  ? 239  TYR A CZ  1 
ATOM 1887 O OH  . TYR A 1 242  ? 29.943  70.410 55.763  1.00 69.46  ? 239  TYR A OH  1 
ATOM 1888 N N   . HIS A 1 243  ? 29.506  64.835 57.872  1.00 62.22  ? 240  HIS A N   1 
ATOM 1889 C CA  . HIS A 1 243  ? 30.872  64.747 58.332  1.00 62.22  ? 240  HIS A CA  1 
ATOM 1890 C C   . HIS A 1 243  ? 31.666  65.721 57.527  1.00 62.22  ? 240  HIS A C   1 
ATOM 1891 O O   . HIS A 1 243  ? 31.340  65.989 56.364  1.00 62.22  ? 240  HIS A O   1 
ATOM 1892 C CB  . HIS A 1 243  ? 31.443  63.356 58.103  1.00 74.06  ? 240  HIS A CB  1 
ATOM 1893 C CG  . HIS A 1 243  ? 30.616  62.255 58.678  1.00 74.06  ? 240  HIS A CG  1 
ATOM 1894 N ND1 . HIS A 1 243  ? 30.926  61.639 59.869  1.00 74.06  ? 240  HIS A ND1 1 
ATOM 1895 C CD2 . HIS A 1 243  ? 29.495  61.648 58.217  1.00 74.06  ? 240  HIS A CD2 1 
ATOM 1896 C CE1 . HIS A 1 243  ? 30.026  60.701 60.120  1.00 74.06  ? 240  HIS A CE1 1 
ATOM 1897 N NE2 . HIS A 1 243  ? 29.148  60.685 59.131  1.00 74.06  ? 240  HIS A NE2 1 
ATOM 1898 N N   . ASN A 1 244  ? 32.692  66.260 58.177  1.00 104.27 ? 241  ASN A N   1 
ATOM 1899 C CA  . ASN A 1 244  ? 33.755  67.052 57.572  1.00 104.27 ? 241  ASN A CA  1 
ATOM 1900 C C   . ASN A 1 244  ? 34.709  67.334 58.705  1.00 104.27 ? 241  ASN A C   1 
ATOM 1901 O O   . ASN A 1 244  ? 34.276  67.757 59.772  1.00 104.27 ? 241  ASN A O   1 
ATOM 1902 C CB  . ASN A 1 244  ? 33.248  68.371 56.990  1.00 90.92  ? 241  ASN A CB  1 
ATOM 1903 C CG  . ASN A 1 244  ? 34.375  69.250 56.485  1.00 90.92  ? 241  ASN A CG  1 
ATOM 1904 O OD1 . ASN A 1 244  ? 35.415  69.387 57.140  1.00 90.92  ? 241  ASN A OD1 1 
ATOM 1905 N ND2 . ASN A 1 244  ? 34.178  69.857 55.317  1.00 90.92  ? 241  ASN A ND2 1 
ATOM 1906 N N   . GLY A 1 245  ? 35.998  67.099 58.484  1.00 124.11 ? 242  GLY A N   1 
ATOM 1907 C CA  . GLY A 1 245  ? 36.984  67.199 59.549  1.00 124.11 ? 242  GLY A CA  1 
ATOM 1908 C C   . GLY A 1 245  ? 36.387  66.778 60.881  1.00 124.11 ? 242  GLY A C   1 
ATOM 1909 O O   . GLY A 1 245  ? 35.884  65.653 61.025  1.00 124.11 ? 242  GLY A O   1 
ATOM 1910 N N   . ASP A 1 246  ? 36.402  67.716 61.830  1.00 105.13 ? 243  ASP A N   1 
ATOM 1911 C CA  . ASP A 1 246  ? 35.970  67.495 63.215  1.00 105.13 ? 243  ASP A CA  1 
ATOM 1912 C C   . ASP A 1 246  ? 34.448  67.559 63.382  1.00 105.13 ? 243  ASP A C   1 
ATOM 1913 O O   . ASP A 1 246  ? 33.903  67.151 64.415  1.00 105.13 ? 243  ASP A O   1 
ATOM 1914 C CB  . ASP A 1 246  ? 36.611  68.550 64.125  1.00 193.27 ? 243  ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 246  ? 37.996  68.965 63.660  1.00 193.27 ? 243  ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 246  ? 38.145  70.109 63.181  1.00 193.27 ? 243  ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 246  ? 38.931  68.144 63.761  1.00 193.27 ? 243  ASP A OD2 1 
ATOM 1918 N N   . LYS A 1 247  ? 33.776  68.072 62.354  1.00 66.86  ? 244  LYS A N   1 
ATOM 1919 C CA  . LYS A 1 247  ? 32.362  68.398 62.423  1.00 66.86  ? 244  LYS A CA  1 
ATOM 1920 C C   . LYS A 1 247  ? 31.498  67.184 62.155  1.00 66.86  ? 244  LYS A C   1 
ATOM 1921 O O   . LYS A 1 247  ? 31.671  66.512 61.132  1.00 66.86  ? 244  LYS A O   1 
ATOM 1922 C CB  . LYS A 1 247  ? 32.035  69.493 61.428  1.00 63.71  ? 244  LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 247  ? 30.703  70.130 61.685  1.00 63.71  ? 244  LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 247  ? 30.823  71.367 62.565  1.00 63.71  ? 244  LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 247  ? 29.493  72.152 62.583  1.00 63.71  ? 244  LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 247  ? 28.349  71.389 63.262  1.00 63.71  ? 244  LYS A NZ  1 
ATOM 1927 N N   . TYR A 1 248  ? 30.572  66.915 63.078  1.00 61.61  ? 245  TYR A N   1 
ATOM 1928 C CA  . TYR A 1 248  ? 29.700  65.753 62.982  1.00 61.61  ? 245  TYR A CA  1 
ATOM 1929 C C   . TYR A 1 248  ? 28.276  66.103 63.368  1.00 61.61  ? 245  TYR A C   1 
ATOM 1930 O O   . TYR A 1 248  ? 27.970  66.177 64.549  1.00 61.61  ? 245  TYR A O   1 
ATOM 1931 C CB  . TYR A 1 248  ? 30.196  64.627 63.880  1.00 84.38  ? 245  TYR A CB  1 
ATOM 1932 C CG  . TYR A 1 248  ? 29.214  63.491 63.981  1.00 84.38  ? 245  TYR A CG  1 
ATOM 1933 C CD1 . TYR A 1 248  ? 29.192  62.483 63.024  1.00 84.38  ? 245  TYR A CD1 1 
ATOM 1934 C CD2 . TYR A 1 248  ? 28.291  63.430 65.016  1.00 84.38  ? 245  TYR A CD2 1 
ATOM 1935 C CE1 . TYR A 1 248  ? 28.278  61.426 63.099  1.00 84.38  ? 245  TYR A CE1 1 
ATOM 1936 C CE2 . TYR A 1 248  ? 27.373  62.381 65.105  1.00 84.38  ? 245  TYR A CE2 1 
ATOM 1937 C CZ  . TYR A 1 248  ? 27.377  61.382 64.143  1.00 84.38  ? 245  TYR A CZ  1 
ATOM 1938 O OH  . TYR A 1 248  ? 26.485  60.339 64.218  1.00 84.38  ? 245  TYR A OH  1 
ATOM 1939 N N   . LEU A 1 249  ? 27.409  66.283 62.369  1.00 71.61  ? 246  LEU A N   1 
ATOM 1940 C CA  . LEU A 1 249  ? 26.004  66.647 62.585  1.00 71.61  ? 246  LEU A CA  1 
ATOM 1941 C C   . LEU A 1 249  ? 25.046  65.532 62.180  1.00 71.61  ? 246  LEU A C   1 
ATOM 1942 O O   . LEU A 1 249  ? 25.168  65.010 61.075  1.00 71.61  ? 246  LEU A O   1 
ATOM 1943 C CB  . LEU A 1 249  ? 25.676  67.883 61.764  1.00 91.47  ? 246  LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 249  ? 25.904  69.222 62.445  1.00 91.47  ? 246  LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 249  ? 25.868  70.341 61.408  1.00 91.47  ? 246  LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 249  ? 24.852  69.429 63.533  1.00 91.47  ? 246  LEU A CD2 1 
ATOM 1947 N N   . ALA A 1 250  ? 24.077  65.184 63.032  1.00 75.07  ? 247  ALA A N   1 
ATOM 1948 C CA  . ALA A 1 250  ? 23.195  64.045 62.721  1.00 75.07  ? 247  ALA A CA  1 
ATOM 1949 C C   . ALA A 1 250  ? 21.738  64.137 63.199  1.00 75.07  ? 247  ALA A C   1 
ATOM 1950 O O   . ALA A 1 250  ? 21.452  64.795 64.195  1.00 75.07  ? 247  ALA A O   1 
ATOM 1951 C CB  . ALA A 1 250  ? 23.816  62.780 63.219  1.00 36.17  ? 247  ALA A CB  1 
ATOM 1952 N N   . ILE A 1 251  ? 20.834  63.456 62.484  1.00 90.31  ? 248  ILE A N   1 
ATOM 1953 C CA  . ILE A 1 251  ? 19.395  63.430 62.802  1.00 90.31  ? 248  ILE A CA  1 
ATOM 1954 C C   . ILE A 1 251  ? 18.751  62.064 62.539  1.00 90.31  ? 248  ILE A C   1 
ATOM 1955 O O   . ILE A 1 251  ? 19.216  61.306 61.679  1.00 90.31  ? 248  ILE A O   1 
ATOM 1956 C CB  . ILE A 1 251  ? 18.597  64.502 62.009  1.00 70.41  ? 248  ILE A CB  1 
ATOM 1957 C CG1 . ILE A 1 251  ? 18.647  64.234 60.499  1.00 70.41  ? 248  ILE A CG1 1 
ATOM 1958 C CG2 . ILE A 1 251  ? 19.106  65.892 62.325  1.00 70.41  ? 248  ILE A CG2 1 
ATOM 1959 C CD1 . ILE A 1 251  ? 17.553  64.938 59.700  1.00 70.41  ? 248  ILE A CD1 1 
ATOM 1960 N N   . ALA A 1 252  ? 17.666  61.765 63.251  1.00 76.22  ? 249  ALA A N   1 
ATOM 1961 C CA  . ALA A 1 252  ? 17.016  60.464 63.101  1.00 76.22  ? 249  ALA A CA  1 
ATOM 1962 C C   . ALA A 1 252  ? 15.475  60.516 62.969  1.00 76.22  ? 249  ALA A C   1 
ATOM 1963 O O   . ALA A 1 252  ? 14.755  59.961 63.831  1.00 76.22  ? 249  ALA A O   1 
ATOM 1964 C CB  . ALA A 1 252  ? 17.452  59.515 64.221  1.00 50.43  ? 249  ALA A CB  1 
ATOM 1965 N N   . PRO A 1 253  ? 14.972  61.133 61.861  1.00 61.31  ? 250  PRO A N   1 
ATOM 1966 C CA  . PRO A 1 253  ? 13.564  61.493 61.704  1.00 61.31  ? 250  PRO A CA  1 
ATOM 1967 C C   . PRO A 1 253  ? 12.715  60.280 61.401  1.00 61.31  ? 250  PRO A C   1 
ATOM 1968 O O   . PRO A 1 253  ? 12.750  59.776 60.279  1.00 61.31  ? 250  PRO A O   1 
ATOM 1969 C CB  . PRO A 1 253  ? 13.580  62.444 60.501  1.00 72.33  ? 250  PRO A CB  1 
ATOM 1970 C CG  . PRO A 1 253  ? 14.707  61.996 59.691  1.00 72.33  ? 250  PRO A CG  1 
ATOM 1971 C CD  . PRO A 1 253  ? 15.749  61.500 60.659  1.00 72.33  ? 250  PRO A CD  1 
ATOM 1972 N N   . PRO A 1 254  ? 11.941  59.806 62.392  1.00 95.68  ? 251  PRO A N   1 
ATOM 1973 C CA  . PRO A 1 254  ? 11.166  58.577 62.217  1.00 95.68  ? 251  PRO A CA  1 
ATOM 1974 C C   . PRO A 1 254  ? 10.513  58.539 60.847  1.00 95.68  ? 251  PRO A C   1 
ATOM 1975 O O   . PRO A 1 254  ? 10.341  57.461 60.277  1.00 95.68  ? 251  PRO A O   1 
ATOM 1976 C CB  . PRO A 1 254  ? 10.101  58.685 63.310  1.00 74.26  ? 251  PRO A CB  1 
ATOM 1977 C CG  . PRO A 1 254  ? 10.792  59.419 64.400  1.00 74.26  ? 251  PRO A CG  1 
ATOM 1978 C CD  . PRO A 1 254  ? 11.727  60.406 63.721  1.00 74.26  ? 251  PRO A CD  1 
ATOM 1979 N N   . ILE A 1 255  ? 10.191  59.728 60.331  1.00 87.29  ? 252  ILE A N   1 
ATOM 1980 C CA  . ILE A 1 255  ? 9.550   59.909 59.037  1.00 87.29  ? 252  ILE A CA  1 
ATOM 1981 C C   . ILE A 1 255  ? 10.145  59.019 57.953  1.00 87.29  ? 252  ILE A C   1 
ATOM 1982 O O   . ILE A 1 255  ? 9.401   58.365 57.217  1.00 87.29  ? 252  ILE A O   1 
ATOM 1983 C CB  . ILE A 1 255  ? 9.574   61.393 58.607  1.00 51.06  ? 252  ILE A CB  1 
ATOM 1984 C CG1 . ILE A 1 255  ? 8.530   61.681 57.506  1.00 51.06  ? 252  ILE A CG1 1 
ATOM 1985 C CG2 . ILE A 1 255  ? 11.002  61.870 58.243  1.00 51.06  ? 252  ILE A CG2 1 
ATOM 1986 C CD1 . ILE A 1 255  ? 8.429   63.190 57.143  1.00 51.06  ? 252  ILE A CD1 1 
ATOM 1987 N N   . ILE A 1 256  ? 11.477  58.971 57.878  1.00 61.29  ? 253  ILE A N   1 
ATOM 1988 C CA  . ILE A 1 256  ? 12.160  58.179 56.843  1.00 61.29  ? 253  ILE A CA  1 
ATOM 1989 C C   . ILE A 1 256  ? 12.338  56.718 57.180  1.00 61.29  ? 253  ILE A C   1 
ATOM 1990 O O   . ILE A 1 256  ? 12.526  55.909 56.280  1.00 61.29  ? 253  ILE A O   1 
ATOM 1991 C CB  . ILE A 1 256  ? 13.540  58.749 56.466  1.00 52.91  ? 253  ILE A CB  1 
ATOM 1992 C CG1 . ILE A 1 256  ? 14.533  58.567 57.631  1.00 52.91  ? 253  ILE A CG1 1 
ATOM 1993 C CG2 . ILE A 1 256  ? 13.391  60.202 55.924  1.00 52.91  ? 253  ILE A CG2 1 
ATOM 1994 C CD1 . ILE A 1 256  ? 15.928  59.117 57.391  1.00 52.91  ? 253  ILE A CD1 1 
ATOM 1995 N N   . LYS A 1 257  ? 12.291  56.373 58.461  1.00 71.14  ? 254  LYS A N   1 
ATOM 1996 C CA  . LYS A 1 257  ? 12.585  55.004 58.851  1.00 71.14  ? 254  LYS A CA  1 
ATOM 1997 C C   . LYS A 1 257  ? 11.755  54.086 57.979  1.00 71.14  ? 254  LYS A C   1 
ATOM 1998 O O   . LYS A 1 257  ? 12.242  53.049 57.507  1.00 71.14  ? 254  LYS A O   1 
ATOM 1999 C CB  . LYS A 1 257  ? 12.321  54.763 60.335  1.00 99.99  ? 254  LYS A CB  1 
ATOM 2000 C CG  . LYS A 1 257  ? 12.830  53.415 60.815  1.00 99.99  ? 254  LYS A CG  1 
ATOM 2001 C CD  . LYS A 1 257  ? 13.035  53.362 62.327  1.00 99.99  ? 254  LYS A CD  1 
ATOM 2002 C CE  . LYS A 1 257  ? 13.510  51.969 62.764  1.00 99.99  ? 254  LYS A CE  1 
ATOM 2003 N NZ  . LYS A 1 257  ? 14.656  51.426 61.948  1.00 99.99  ? 254  LYS A NZ  1 
ATOM 2004 N N   . GLN A 1 258  ? 10.522  54.515 57.714  1.00 64.91  ? 255  GLN A N   1 
ATOM 2005 C CA  . GLN A 1 258  ? 9.561   53.726 56.919  1.00 64.91  ? 255  GLN A CA  1 
ATOM 2006 C C   . GLN A 1 258  ? 10.102  53.167 55.579  1.00 64.91  ? 255  GLN A C   1 
ATOM 2007 O O   . GLN A 1 258  ? 9.667   52.111 55.100  1.00 64.91  ? 255  GLN A O   1 
ATOM 2008 C CB  . GLN A 1 258  ? 8.274   54.529 56.694  1.00 123.84 ? 255  GLN A CB  1 
ATOM 2009 C CG  . GLN A 1 258  ? 7.342   54.576 57.899  1.00 123.84 ? 255  GLN A CG  1 
ATOM 2010 C CD  . GLN A 1 258  ? 6.177   55.527 57.692  1.00 123.84 ? 255  GLN A CD  1 
ATOM 2011 O OE1 . GLN A 1 258  ? 6.361   56.743 57.645  1.00 123.84 ? 255  GLN A OE1 1 
ATOM 2012 N NE2 . GLN A 1 258  ? 4.968   54.977 57.575  1.00 123.84 ? 255  GLN A NE2 1 
ATOM 2013 N N   . SER A 1 259  ? 11.052  53.877 54.984  1.00 67.55  ? 256  SER A N   1 
ATOM 2014 C CA  . SER A 1 259  ? 11.644  53.410 53.754  1.00 67.55  ? 256  SER A CA  1 
ATOM 2015 C C   . SER A 1 259  ? 13.068  53.864 53.548  1.00 67.55  ? 256  SER A C   1 
ATOM 2016 O O   . SER A 1 259  ? 13.533  54.803 54.190  1.00 67.55  ? 256  SER A O   1 
ATOM 2017 C CB  . SER A 1 259  ? 10.806  53.823 52.561  1.00 65.81  ? 256  SER A CB  1 
ATOM 2018 O OG  . SER A 1 259  ? 11.495  53.497 51.363  1.00 65.81  ? 256  SER A OG  1 
ATOM 2019 N N   . THR A 1 260  ? 13.740  53.178 52.626  1.00 72.35  ? 257  THR A N   1 
ATOM 2020 C CA  . THR A 1 260  ? 15.113  53.466 52.268  1.00 72.35  ? 257  THR A CA  1 
ATOM 2021 C C   . THR A 1 260  ? 15.158  54.599 51.269  1.00 72.35  ? 257  THR A C   1 
ATOM 2022 O O   . THR A 1 260  ? 14.371  54.647 50.312  1.00 72.35  ? 257  THR A O   1 
ATOM 2023 C CB  . THR A 1 260  ? 15.786  52.265 51.584  1.00 68.62  ? 257  THR A CB  1 
ATOM 2024 O OG1 . THR A 1 260  ? 15.400  51.046 52.227  1.00 68.62  ? 257  THR A OG1 1 
ATOM 2025 C CG2 . THR A 1 260  ? 17.279  52.402 51.640  1.00 68.62  ? 257  THR A CG2 1 
ATOM 2026 N N   . ILE A 1 261  ? 16.091  55.508 51.489  1.00 53.95  ? 258  ILE A N   1 
ATOM 2027 C CA  . ILE A 1 261  ? 16.437  56.470 50.460  1.00 53.95  ? 258  ILE A CA  1 
ATOM 2028 C C   . ILE A 1 261  ? 17.216  55.774 49.326  1.00 53.95  ? 258  ILE A C   1 
ATOM 2029 O O   . ILE A 1 261  ? 17.829  54.720 49.513  1.00 53.95  ? 258  ILE A O   1 
ATOM 2030 C CB  . ILE A 1 261  ? 17.099  57.680 51.085  1.00 46.31  ? 258  ILE A CB  1 
ATOM 2031 C CG1 . ILE A 1 261  ? 16.004  58.416 51.861  1.00 46.31  ? 258  ILE A CG1 1 
ATOM 2032 C CG2 . ILE A 1 261  ? 17.648  58.621 50.045  1.00 46.31  ? 258  ILE A CG2 1 
ATOM 2033 C CD1 . ILE A 1 261  ? 16.313  58.669 53.326  1.00 46.31  ? 258  ILE A CD1 1 
ATOM 2034 N N   . VAL A 1 262  ? 17.164  56.336 48.133  1.00 51.41  ? 259  VAL A N   1 
ATOM 2035 C CA  . VAL A 1 262  ? 17.467  55.548 46.953  1.00 51.41  ? 259  VAL A CA  1 
ATOM 2036 C C   . VAL A 1 262  ? 18.060  56.415 45.859  1.00 51.41  ? 259  VAL A C   1 
ATOM 2037 O O   . VAL A 1 262  ? 18.731  55.912 44.966  1.00 51.41  ? 259  VAL A O   1 
ATOM 2038 C CB  . VAL A 1 262  ? 16.165  54.833 46.510  1.00 41.19  ? 259  VAL A CB  1 
ATOM 2039 C CG1 . VAL A 1 262  ? 15.820  55.040 45.017  1.00 41.19  ? 259  VAL A CG1 1 
ATOM 2040 C CG2 . VAL A 1 262  ? 16.215  53.389 46.934  1.00 41.19  ? 259  VAL A CG2 1 
ATOM 2041 N N   . CYS A 1 263  ? 17.793  57.716 45.940  1.00 65.12  ? 260  CYS A N   1 
ATOM 2042 C CA  . CYS A 1 263  ? 18.321  58.694 45.002  1.00 65.12  ? 260  CYS A CA  1 
ATOM 2043 C C   . CYS A 1 263  ? 18.202  60.079 45.575  1.00 65.12  ? 260  CYS A C   1 
ATOM 2044 O O   . CYS A 1 263  ? 17.321  60.352 46.378  1.00 65.12  ? 260  CYS A O   1 
ATOM 2045 C CB  . CYS A 1 263  ? 17.561  58.664 43.689  1.00 50.46  ? 260  CYS A CB  1 
ATOM 2046 S SG  . CYS A 1 263  ? 15.749  58.691 43.862  1.00 50.46  ? 260  CYS A SG  1 
ATOM 2047 N N   . HIS A 1 264  ? 19.082  60.960 45.131  1.00 47.98  ? 261  HIS A N   1 
ATOM 2048 C CA  . HIS A 1 264  ? 19.175  62.299 45.669  1.00 47.98  ? 261  HIS A CA  1 
ATOM 2049 C C   . HIS A 1 264  ? 19.587  63.275 44.575  1.00 47.98  ? 261  HIS A C   1 
ATOM 2050 O O   . HIS A 1 264  ? 19.985  62.870 43.482  1.00 47.98  ? 261  HIS A O   1 
ATOM 2051 C CB  . HIS A 1 264  ? 20.187  62.325 46.802  1.00 59.57  ? 261  HIS A CB  1 
ATOM 2052 C CG  . HIS A 1 264  ? 21.590  62.079 46.356  1.00 59.57  ? 261  HIS A CG  1 
ATOM 2053 N ND1 . HIS A 1 264  ? 22.384  63.075 45.820  1.00 59.57  ? 261  HIS A ND1 1 
ATOM 2054 C CD2 . HIS A 1 264  ? 22.341  60.951 46.364  1.00 59.57  ? 261  HIS A CD2 1 
ATOM 2055 C CE1 . HIS A 1 264  ? 23.565  62.567 45.513  1.00 59.57  ? 261  HIS A CE1 1 
ATOM 2056 N NE2 . HIS A 1 264  ? 23.563  61.280 45.830  1.00 59.57  ? 261  HIS A NE2 1 
ATOM 2057 N N   . ASN A 1 265  ? 19.491  64.561 44.860  1.00 49.20  ? 262  ASN A N   1 
ATOM 2058 C CA  . ASN A 1 265  ? 19.797  65.541 43.862  1.00 49.20  ? 262  ASN A CA  1 
ATOM 2059 C C   . ASN A 1 265  ? 19.938  66.901 44.465  1.00 49.20  ? 262  ASN A C   1 
ATOM 2060 O O   . ASN A 1 265  ? 19.066  67.324 45.221  1.00 49.20  ? 262  ASN A O   1 
ATOM 2061 C CB  . ASN A 1 265  ? 18.682  65.618 42.852  1.00 64.42  ? 262  ASN A CB  1 
ATOM 2062 C CG  . ASN A 1 265  ? 19.055  66.456 41.691  1.00 64.42  ? 262  ASN A CG  1 
ATOM 2063 O OD1 . ASN A 1 265  ? 19.928  66.070 40.927  1.00 64.42  ? 262  ASN A OD1 1 
ATOM 2064 N ND2 . ASN A 1 265  ? 18.435  67.628 41.555  1.00 64.42  ? 262  ASN A ND2 1 
ATOM 2065 N N   . ARG A 1 266  ? 21.018  67.599 44.135  1.00 53.10  ? 263  ARG A N   1 
ATOM 2066 C CA  . ARG A 1 266  ? 21.154  68.950 44.601  1.00 53.10  ? 263  ARG A CA  1 
ATOM 2067 C C   . ARG A 1 266  ? 20.210  69.851 43.828  1.00 53.10  ? 263  ARG A C   1 
ATOM 2068 O O   . ARG A 1 266  ? 20.066  69.730 42.612  1.00 53.10  ? 263  ARG A O   1 
ATOM 2069 C CB  . ARG A 1 266  ? 22.583  69.430 44.469  1.00 61.33  ? 263  ARG A CB  1 
ATOM 2070 C CG  . ARG A 1 266  ? 22.755  70.909 44.740  1.00 61.33  ? 263  ARG A CG  1 
ATOM 2071 C CD  . ARG A 1 266  ? 24.108  71.225 45.336  1.00 61.33  ? 263  ARG A CD  1 
ATOM 2072 N NE  . ARG A 1 266  ? 25.201  70.501 44.696  1.00 61.33  ? 263  ARG A NE  1 
ATOM 2073 C CZ  . ARG A 1 266  ? 25.601  70.684 43.440  1.00 61.33  ? 263  ARG A CZ  1 
ATOM 2074 N NH1 . ARG A 1 266  ? 24.989  71.565 42.657  1.00 61.33  ? 263  ARG A NH1 1 
ATOM 2075 N NH2 . ARG A 1 266  ? 26.611  69.961 42.967  1.00 61.33  ? 263  ARG A NH2 1 
ATOM 2076 N N   . VAL A 1 267  ? 19.557  70.730 44.581  1.00 54.16  ? 264  VAL A N   1 
ATOM 2077 C CA  . VAL A 1 267  ? 18.693  71.784 44.074  1.00 54.16  ? 264  VAL A CA  1 
ATOM 2078 C C   . VAL A 1 267  ? 19.522  73.066 43.965  1.00 54.16  ? 264  VAL A C   1 
ATOM 2079 O O   . VAL A 1 267  ? 19.655  73.665 42.898  1.00 54.16  ? 264  VAL A O   1 
ATOM 2080 C CB  . VAL A 1 267  ? 17.517  72.043 45.065  1.00 72.56  ? 264  VAL A CB  1 
ATOM 2081 C CG1 . VAL A 1 267  ? 16.482  73.001 44.469  1.00 72.56  ? 264  VAL A CG1 1 
ATOM 2082 C CG2 . VAL A 1 267  ? 16.871  70.741 45.473  1.00 72.56  ? 264  VAL A CG2 1 
ATOM 2083 N N   . ASP A 1 268  ? 20.081  73.474 45.092  1.00 76.00  ? 265  ASP A N   1 
ATOM 2084 C CA  . ASP A 1 268  ? 20.741  74.752 45.167  1.00 76.00  ? 265  ASP A CA  1 
ATOM 2085 C C   . ASP A 1 268  ? 22.239  74.591 44.938  1.00 76.00  ? 265  ASP A C   1 
ATOM 2086 O O   . ASP A 1 268  ? 22.932  73.946 45.724  1.00 76.00  ? 265  ASP A O   1 
ATOM 2087 C CB  . ASP A 1 268  ? 20.407  75.431 46.503  1.00 71.87  ? 265  ASP A CB  1 
ATOM 2088 C CG  . ASP A 1 268  ? 18.929  75.826 46.598  1.00 71.87  ? 265  ASP A CG  1 
ATOM 2089 O OD1 . ASP A 1 268  ? 18.394  76.337 45.580  1.00 71.87  ? 265  ASP A OD1 1 
ATOM 2090 O OD2 . ASP A 1 268  ? 18.304  75.626 47.669  1.00 71.87  ? 265  ASP A OD2 1 
ATOM 2091 N N   . PRO A 1 269  ? 22.741  75.151 43.832  1.00 69.64  ? 266  PRO A N   1 
ATOM 2092 C CA  . PRO A 1 269  ? 24.165  75.084 43.546  1.00 69.64  ? 266  PRO A CA  1 
ATOM 2093 C C   . PRO A 1 269  ? 25.024  75.155 44.816  1.00 69.64  ? 266  PRO A C   1 
ATOM 2094 O O   . PRO A 1 269  ? 25.990  74.399 44.953  1.00 69.64  ? 266  PRO A O   1 
ATOM 2095 C CB  . PRO A 1 269  ? 24.403  76.310 42.640  1.00 50.31  ? 266  PRO A CB  1 
ATOM 2096 C CG  . PRO A 1 269  ? 22.986  76.934 42.363  1.00 50.31  ? 266  PRO A CG  1 
ATOM 2097 C CD  . PRO A 1 269  ? 22.006  75.865 42.772  1.00 50.31  ? 266  PRO A CD  1 
ATOM 2098 N N   . ASN A 1 270  ? 24.662  76.050 45.736  1.00 58.72  ? 267  ASN A N   1 
ATOM 2099 C CA  . ASN A 1 270  ? 25.407  76.217 46.983  1.00 58.72  ? 267  ASN A CA  1 
ATOM 2100 C C   . ASN A 1 270  ? 25.208  74.986 47.826  1.00 58.72  ? 267  ASN A C   1 
ATOM 2101 O O   . ASN A 1 270  ? 26.110  74.561 48.545  1.00 58.72  ? 267  ASN A O   1 
ATOM 2102 C CB  . ASN A 1 270  ? 24.931  77.445 47.742  1.00 80.73  ? 267  ASN A CB  1 
ATOM 2103 C CG  . ASN A 1 270  ? 23.486  77.360 48.087  1.00 80.73  ? 267  ASN A CG  1 
ATOM 2104 O OD1 . ASN A 1 270  ? 22.628  77.525 47.221  1.00 80.73  ? 267  ASN A OD1 1 
ATOM 2105 N ND2 . ASN A 1 270  ? 23.193  77.054 49.341  1.00 80.73  ? 267  ASN A ND2 1 
ATOM 2106 N N   . GLY A 1 271  ? 24.016  74.414 47.729  1.00 60.15  ? 268  GLY A N   1 
ATOM 2107 C CA  . GLY A 1 271  ? 23.738  73.123 48.333  1.00 60.15  ? 268  GLY A CA  1 
ATOM 2108 C C   . GLY A 1 271  ? 23.067  73.170 49.686  1.00 60.15  ? 268  GLY A C   1 
ATOM 2109 O O   . GLY A 1 271  ? 23.311  72.302 50.525  1.00 60.15  ? 268  GLY A O   1 
ATOM 2110 N N   . SER A 1 272  ? 22.225  74.178 49.905  1.00 84.32  ? 269  SER A N   1 
ATOM 2111 C CA  . SER A 1 272  ? 21.392  74.225 51.097  1.00 84.32  ? 269  SER A CA  1 
ATOM 2112 C C   . SER A 1 272  ? 20.269  73.200 50.975  1.00 84.32  ? 269  SER A C   1 
ATOM 2113 O O   . SER A 1 272  ? 19.778  72.674 51.985  1.00 84.32  ? 269  SER A O   1 
ATOM 2114 C CB  . SER A 1 272  ? 20.806  75.611 51.251  1.00 95.08  ? 269  SER A CB  1 
ATOM 2115 O OG  . SER A 1 272  ? 20.542  76.142 49.970  1.00 95.08  ? 269  SER A OG  1 
ATOM 2116 N N   . ARG A 1 273  ? 19.869  72.917 49.733  1.00 72.12  ? 270  ARG A N   1 
ATOM 2117 C CA  . ARG A 1 273  ? 18.729  72.033 49.461  1.00 72.12  ? 270  ARG A CA  1 
ATOM 2118 C C   . ARG A 1 273  ? 19.053  70.863 48.533  1.00 72.12  ? 270  ARG A C   1 
ATOM 2119 O O   . ARG A 1 273  ? 19.907  70.971 47.647  1.00 72.12  ? 270  ARG A O   1 
ATOM 2120 C CB  . ARG A 1 273  ? 17.529  72.832 48.929  1.00 64.61  ? 270  ARG A CB  1 
ATOM 2121 C CG  . ARG A 1 273  ? 16.978  73.853 49.943  1.00 64.61  ? 270  ARG A CG  1 
ATOM 2122 C CD  . ARG A 1 273  ? 15.750  74.569 49.447  1.00 64.61  ? 270  ARG A CD  1 
ATOM 2123 N NE  . ARG A 1 273  ? 15.880  75.040 48.069  1.00 64.61  ? 270  ARG A NE  1 
ATOM 2124 C CZ  . ARG A 1 273  ? 14.892  75.626 47.398  1.00 64.61  ? 270  ARG A CZ  1 
ATOM 2125 N NH1 . ARG A 1 273  ? 13.716  75.821 47.987  1.00 64.61  ? 270  ARG A NH1 1 
ATOM 2126 N NH2 . ARG A 1 273  ? 15.072  76.022 46.149  1.00 64.61  ? 270  ARG A NH2 1 
ATOM 2127 N N   . TYR A 1 274  ? 18.344  69.759 48.760  1.00 51.41  ? 271  TYR A N   1 
ATOM 2128 C CA  . TYR A 1 274  ? 18.562  68.489 48.093  1.00 51.41  ? 271  TYR A CA  1 
ATOM 2129 C C   . TYR A 1 274  ? 17.264  67.720 48.084  1.00 51.41  ? 271  TYR A C   1 
ATOM 2130 O O   . TYR A 1 274  ? 16.537  67.726 49.077  1.00 51.41  ? 271  TYR A O   1 
ATOM 2131 C CB  . TYR A 1 274  ? 19.563  67.635 48.875  1.00 68.12  ? 271  TYR A CB  1 
ATOM 2132 C CG  . TYR A 1 274  ? 21.014  67.937 48.611  1.00 68.12  ? 271  TYR A CG  1 
ATOM 2133 C CD1 . TYR A 1 274  ? 21.742  68.722 49.494  1.00 68.12  ? 271  TYR A CD1 1 
ATOM 2134 C CD2 . TYR A 1 274  ? 21.666  67.422 47.493  1.00 68.12  ? 271  TYR A CD2 1 
ATOM 2135 C CE1 . TYR A 1 274  ? 23.079  69.006 49.261  1.00 68.12  ? 271  TYR A CE1 1 
ATOM 2136 C CE2 . TYR A 1 274  ? 22.989  67.702 47.254  1.00 68.12  ? 271  TYR A CE2 1 
ATOM 2137 C CZ  . TYR A 1 274  ? 23.687  68.498 48.141  1.00 68.12  ? 271  TYR A CZ  1 
ATOM 2138 O OH  . TYR A 1 274  ? 25.001  68.803 47.923  1.00 68.12  ? 271  TYR A OH  1 
ATOM 2139 N N   . LEU A 1 275  ? 16.999  67.026 46.985  1.00 51.40  ? 272  LEU A N   1 
ATOM 2140 C CA  . LEU A 1 275  ? 15.853  66.114 46.886  1.00 51.40  ? 272  LEU A CA  1 
ATOM 2141 C C   . LEU A 1 275  ? 16.216  64.703 47.345  1.00 51.40  ? 272  LEU A C   1 
ATOM 2142 O O   . LEU A 1 275  ? 17.365  64.333 47.295  1.00 51.40  ? 272  LEU A O   1 
ATOM 2143 C CB  . LEU A 1 275  ? 15.332  66.078 45.453  1.00 52.06  ? 272  LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 275  ? 14.898  67.446 44.930  1.00 52.06  ? 272  LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 275  ? 14.299  67.396 43.490  1.00 52.06  ? 272  LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 275  ? 13.917  68.048 45.931  1.00 52.06  ? 272  LEU A CD2 1 
ATOM 2147 N N   . LEU A 1 276  ? 15.254  63.928 47.813  1.00 55.04  ? 273  LEU A N   1 
ATOM 2148 C CA  . LEU A 1 276  ? 15.554  62.595 48.260  1.00 55.04  ? 273  LEU A CA  1 
ATOM 2149 C C   . LEU A 1 276  ? 14.474  61.640 47.793  1.00 55.04  ? 273  LEU A C   1 
ATOM 2150 O O   . LEU A 1 276  ? 13.289  61.895 47.961  1.00 55.04  ? 273  LEU A O   1 
ATOM 2151 C CB  . LEU A 1 276  ? 15.705  62.545 49.780  1.00 67.67  ? 273  LEU A CB  1 
ATOM 2152 C CG  . LEU A 1 276  ? 16.740  63.363 50.586  1.00 67.67  ? 273  LEU A CG  1 
ATOM 2153 C CD1 . LEU A 1 276  ? 17.009  62.675 51.913  1.00 67.67  ? 273  LEU A CD1 1 
ATOM 2154 C CD2 . LEU A 1 276  ? 18.063  63.582 49.900  1.00 67.67  ? 273  LEU A CD2 1 
ATOM 2155 N N   . GLY A 1 277  ? 14.884  60.535 47.189  1.00 55.43  ? 274  GLY A N   1 
ATOM 2156 C CA  . GLY A 1 277  ? 13.939  59.572 46.661  1.00 55.43  ? 274  GLY A CA  1 
ATOM 2157 C C   . GLY A 1 277  ? 13.838  58.385 47.579  1.00 55.43  ? 274  GLY A C   1 
ATOM 2158 O O   . GLY A 1 277  ? 14.723  58.150 48.383  1.00 55.43  ? 274  GLY A O   1 
ATOM 2159 N N   . ASP A 1 278  ? 12.769  57.618 47.420  1.00 50.71  ? 275  ASP A N   1 
ATOM 2160 C CA  . ASP A 1 278  ? 12.344  56.634 48.402  1.00 50.71  ? 275  ASP A CA  1 
ATOM 2161 C C   . ASP A 1 278  ? 11.858  55.341 47.707  1.00 50.71  ? 275  ASP A C   1 
ATOM 2162 O O   . ASP A 1 278  ? 11.225  55.427 46.652  1.00 50.71  ? 275  ASP A O   1 
ATOM 2163 C CB  . ASP A 1 278  ? 11.188  57.263 49.178  1.00 91.70  ? 275  ASP A CB  1 
ATOM 2164 C CG  . ASP A 1 278  ? 10.920  56.585 50.487  1.00 91.70  ? 275  ASP A CG  1 
ATOM 2165 O OD1 . ASP A 1 278  ? 9.796   56.748 51.001  1.00 91.70  ? 275  ASP A OD1 1 
ATOM 2166 O OD2 . ASP A 1 278  ? 11.824  55.905 51.015  1.00 91.70  ? 275  ASP A OD2 1 
ATOM 2167 N N   . MET A 1 279  ? 12.108  54.158 48.275  1.00 46.06  ? 276  MET A N   1 
ATOM 2168 C CA  . MET A 1 279  ? 11.532  52.947 47.669  1.00 46.06  ? 276  MET A CA  1 
ATOM 2169 C C   . MET A 1 279  ? 10.037  53.149 47.440  1.00 46.06  ? 276  MET A C   1 
ATOM 2170 O O   . MET A 1 279  ? 9.468   52.554 46.522  1.00 46.06  ? 276  MET A O   1 
ATOM 2171 C CB  . MET A 1 279  ? 11.770  51.683 48.523  1.00 106.06 ? 276  MET A CB  1 
ATOM 2172 C CG  . MET A 1 279  ? 11.330  50.332 47.855  1.00 106.06 ? 276  MET A CG  1 
ATOM 2173 S SD  . MET A 1 279  ? 9.598   49.742 48.078  1.00 106.06 ? 276  MET A SD  1 
ATOM 2174 C CE  . MET A 1 279  ? 9.801   48.265 49.096  1.00 106.06 ? 276  MET A CE  1 
ATOM 2175 N N   . GLU A 1 280  ? 9.423   54.001 48.276  1.00 59.53  ? 277  GLU A N   1 
ATOM 2176 C CA  . GLU A 1 280  ? 7.965   54.232 48.336  1.00 59.53  ? 277  GLU A CA  1 
ATOM 2177 C C   . GLU A 1 280  ? 7.407   55.162 47.250  1.00 59.53  ? 277  GLU A C   1 
ATOM 2178 O O   . GLU A 1 280  ? 6.276   54.990 46.798  1.00 59.53  ? 277  GLU A O   1 
ATOM 2179 C CB  . GLU A 1 280  ? 7.589   54.821 49.692  1.00 131.38 ? 277  GLU A CB  1 
ATOM 2180 C CG  . GLU A 1 280  ? 7.967   53.981 50.886  1.00 131.38 ? 277  GLU A CG  1 
ATOM 2181 C CD  . GLU A 1 280  ? 6.819   53.158 51.401  1.00 131.38 ? 277  GLU A CD  1 
ATOM 2182 O OE1 . GLU A 1 280  ? 6.223   52.409 50.599  1.00 131.38 ? 277  GLU A OE1 1 
ATOM 2183 O OE2 . GLU A 1 280  ? 6.517   53.260 52.610  1.00 131.38 ? 277  GLU A OE2 1 
ATOM 2184 N N   . GLY A 1 281  ? 8.178   56.162 46.846  1.00 54.16  ? 278  GLY A N   1 
ATOM 2185 C CA  . GLY A 1 281  ? 7.682   57.171 45.904  1.00 54.16  ? 278  GLY A CA  1 
ATOM 2186 C C   . GLY A 1 281  ? 7.667   58.548 46.546  1.00 54.16  ? 278  GLY A C   1 
ATOM 2187 O O   . GLY A 1 281  ? 7.317   59.531 45.906  1.00 54.16  ? 278  GLY A O   1 
ATOM 2188 N N   . ARG A 1 282  ? 8.069   58.602 47.815  1.00 41.42  ? 279  ARG A N   1 
ATOM 2189 C CA  . ARG A 1 282  ? 8.045   59.831 48.612  1.00 41.42  ? 279  ARG A CA  1 
ATOM 2190 C C   . ARG A 1 282  ? 9.203   60.730 48.269  1.00 41.42  ? 279  ARG A C   1 
ATOM 2191 O O   . ARG A 1 282  ? 10.271  60.259 47.915  1.00 41.42  ? 279  ARG A O   1 
ATOM 2192 C CB  . ARG A 1 282  ? 8.040   59.529 50.119  1.00 72.10  ? 279  ARG A CB  1 
ATOM 2193 C CG  . ARG A 1 282  ? 6.765   58.835 50.577  1.00 72.10  ? 279  ARG A CG  1 
ATOM 2194 C CD  . ARG A 1 282  ? 6.685   58.717 52.076  1.00 72.10  ? 279  ARG A CD  1 
ATOM 2195 N NE  . ARG A 1 282  ? 7.577   57.704 52.633  1.00 72.10  ? 279  ARG A NE  1 
ATOM 2196 C CZ  . ARG A 1 282  ? 7.968   57.690 53.905  1.00 72.10  ? 279  ARG A CZ  1 
ATOM 2197 N NH1 . ARG A 1 282  ? 7.550   58.634 54.741  1.00 72.10  ? 279  ARG A NH1 1 
ATOM 2198 N NH2 . ARG A 1 282  ? 8.784   56.747 54.350  1.00 72.10  ? 279  ARG A NH2 1 
ATOM 2199 N N   . LEU A 1 283  ? 8.995   62.030 48.393  1.00 54.99  ? 280  LEU A N   1 
ATOM 2200 C CA  . LEU A 1 283  ? 9.989   62.978 47.959  1.00 54.99  ? 280  LEU A CA  1 
ATOM 2201 C C   . LEU A 1 283  ? 10.351  63.851 49.121  1.00 54.99  ? 280  LEU A C   1 
ATOM 2202 O O   . LEU A 1 283  ? 9.475   64.381 49.783  1.00 54.99  ? 280  LEU A O   1 
ATOM 2203 C CB  . LEU A 1 283  ? 9.434   63.830 46.823  1.00 46.89  ? 280  LEU A CB  1 
ATOM 2204 C CG  . LEU A 1 283  ? 10.515  64.630 46.114  1.00 46.89  ? 280  LEU A CG  1 
ATOM 2205 C CD1 . LEU A 1 283  ? 11.531  63.675 45.522  1.00 46.89  ? 280  LEU A CD1 1 
ATOM 2206 C CD2 . LEU A 1 283  ? 9.931   65.456 45.009  1.00 46.89  ? 280  LEU A CD2 1 
ATOM 2207 N N   . PHE A 1 284  ? 11.630  64.015 49.385  1.00 65.36  ? 281  PHE A N   1 
ATOM 2208 C CA  . PHE A 1 284  ? 12.002  64.801 50.532  1.00 65.36  ? 281  PHE A CA  1 
ATOM 2209 C C   . PHE A 1 284  ? 12.795  65.991 50.117  1.00 65.36  ? 281  PHE A C   1 
ATOM 2210 O O   . PHE A 1 284  ? 13.345  66.036 49.033  1.00 65.36  ? 281  PHE A O   1 
ATOM 2211 C CB  . PHE A 1 284  ? 12.764  63.961 51.561  1.00 63.00  ? 281  PHE A CB  1 
ATOM 2212 C CG  . PHE A 1 284  ? 11.943  62.858 52.154  1.00 63.00  ? 281  PHE A CG  1 
ATOM 2213 C CD1 . PHE A 1 284  ? 11.956  61.585 51.594  1.00 63.00  ? 281  PHE A CD1 1 
ATOM 2214 C CD2 . PHE A 1 284  ? 11.119  63.101 53.242  1.00 63.00  ? 281  PHE A CD2 1 
ATOM 2215 C CE1 . PHE A 1 284  ? 11.175  60.558 52.124  1.00 63.00  ? 281  PHE A CE1 1 
ATOM 2216 C CE2 . PHE A 1 284  ? 10.338  62.082 53.792  1.00 63.00  ? 281  PHE A CE2 1 
ATOM 2217 C CZ  . PHE A 1 284  ? 10.371  60.801 53.231  1.00 63.00  ? 281  PHE A CZ  1 
ATOM 2218 N N   . MET A 1 285  ? 12.778  66.985 50.987  1.00 49.40  ? 282  MET A N   1 
ATOM 2219 C CA  . MET A 1 285  ? 13.686  68.096 50.936  1.00 49.40  ? 282  MET A CA  1 
ATOM 2220 C C   . MET A 1 285  ? 14.621  67.936 52.128  1.00 49.40  ? 282  MET A C   1 
ATOM 2221 O O   . MET A 1 285  ? 14.183  67.727 53.268  1.00 49.40  ? 282  MET A O   1 
ATOM 2222 C CB  . MET A 1 285  ? 12.932  69.406 51.021  1.00 68.60  ? 282  MET A CB  1 
ATOM 2223 C CG  . MET A 1 285  ? 13.792  70.585 50.693  1.00 68.60  ? 282  MET A CG  1 
ATOM 2224 S SD  . MET A 1 285  ? 14.389  70.481 49.001  1.00 68.60  ? 282  MET A SD  1 
ATOM 2225 C CE  . MET A 1 285  ? 13.117  71.344 48.067  1.00 68.60  ? 282  MET A CE  1 
ATOM 2226 N N   . LEU A 1 286  ? 15.913  67.999 51.851  1.00 62.86  ? 283  LEU A N   1 
ATOM 2227 C CA  . LEU A 1 286  ? 16.891  67.896 52.903  1.00 62.86  ? 283  LEU A CA  1 
ATOM 2228 C C   . LEU A 1 286  ? 17.531  69.256 53.058  1.00 62.86  ? 283  LEU A C   1 
ATOM 2229 O O   . LEU A 1 286  ? 18.175  69.757 52.130  1.00 62.86  ? 283  LEU A O   1 
ATOM 2230 C CB  . LEU A 1 286  ? 17.941  66.852 52.547  1.00 57.79  ? 283  LEU A CB  1 
ATOM 2231 C CG  . LEU A 1 286  ? 18.875  66.200 53.585  1.00 57.79  ? 283  LEU A CG  1 
ATOM 2232 C CD1 . LEU A 1 286  ? 20.192  65.922 52.853  1.00 57.79  ? 283  LEU A CD1 1 
ATOM 2233 C CD2 . LEU A 1 286  ? 19.146  67.025 54.846  1.00 57.79  ? 283  LEU A CD2 1 
ATOM 2234 N N   . LEU A 1 287  ? 17.353  69.858 54.229  1.00 62.96  ? 284  LEU A N   1 
ATOM 2235 C CA  . LEU A 1 287  ? 17.798  71.229 54.404  1.00 62.96  ? 284  LEU A CA  1 
ATOM 2236 C C   . LEU A 1 287  ? 18.985  71.355 55.312  1.00 62.96  ? 284  LEU A C   1 
ATOM 2237 O O   . LEU A 1 287  ? 19.053  70.737 56.376  1.00 62.96  ? 284  LEU A O   1 
ATOM 2238 C CB  . LEU A 1 287  ? 16.675  72.149 54.870  1.00 69.99  ? 284  LEU A CB  1 
ATOM 2239 C CG  . LEU A 1 287  ? 15.644  72.381 53.781  1.00 69.99  ? 284  LEU A CG  1 
ATOM 2240 C CD1 . LEU A 1 287  ? 14.461  71.503 54.089  1.00 69.99  ? 284  LEU A CD1 1 
ATOM 2241 C CD2 . LEU A 1 287  ? 15.233  73.841 53.737  1.00 69.99  ? 284  LEU A CD2 1 
ATOM 2242 N N   . LEU A 1 288  ? 19.904  72.188 54.851  1.00 75.74  ? 285  LEU A N   1 
ATOM 2243 C CA  . LEU A 1 288  ? 21.120  72.473 55.549  1.00 75.74  ? 285  LEU A CA  1 
ATOM 2244 C C   . LEU A 1 288  ? 21.047  73.901 56.006  1.00 75.74  ? 285  LEU A C   1 
ATOM 2245 O O   . LEU A 1 288  ? 21.112  74.838 55.195  1.00 75.74  ? 285  LEU A O   1 
ATOM 2246 C CB  . LEU A 1 288  ? 22.312  72.293 54.615  1.00 77.14  ? 285  LEU A CB  1 
ATOM 2247 C CG  . LEU A 1 288  ? 22.640  70.874 54.150  1.00 77.14  ? 285  LEU A CG  1 
ATOM 2248 C CD1 . LEU A 1 288  ? 23.818  70.931 53.205  1.00 77.14  ? 285  LEU A CD1 1 
ATOM 2249 C CD2 . LEU A 1 288  ? 22.929  69.945 55.331  1.00 77.14  ? 285  LEU A CD2 1 
ATOM 2250 N N   . GLU A 1 289  ? 20.910  74.067 57.313  1.00 79.77  ? 286  GLU A N   1 
ATOM 2251 C CA  . GLU A 1 289  ? 20.846  75.387 57.877  1.00 79.77  ? 286  GLU A CA  1 
ATOM 2252 C C   . GLU A 1 289  ? 22.250  75.975 58.033  1.00 79.77  ? 286  GLU A C   1 
ATOM 2253 O O   . GLU A 1 289  ? 23.044  75.490 58.848  1.00 79.77  ? 286  GLU A O   1 
ATOM 2254 C CB  . GLU A 1 289  ? 20.107  75.347 59.200  1.00 99.99  ? 286  GLU A CB  1 
ATOM 2255 C CG  . GLU A 1 289  ? 19.128  76.487 59.339  1.00 99.99  ? 286  GLU A CG  1 
ATOM 2256 C CD  . GLU A 1 289  ? 18.870  76.823 60.782  1.00 99.99  ? 286  GLU A CD  1 
ATOM 2257 O OE1 . GLU A 1 289  ? 19.257  77.939 61.209  1.00 99.99  ? 286  GLU A OE1 1 
ATOM 2258 O OE2 . GLU A 1 289  ? 18.309  75.953 61.492  1.00 99.99  ? 286  GLU A OE2 1 
ATOM 2259 N N   . LYS A 1 290  ? 22.533  77.009 57.231  1.00 83.27  ? 287  LYS A N   1 
ATOM 2260 C CA  . LYS A 1 290  ? 23.812  77.729 57.238  1.00 83.27  ? 287  LYS A CA  1 
ATOM 2261 C C   . LYS A 1 290  ? 23.945  78.492 58.535  1.00 83.27  ? 287  LYS A C   1 
ATOM 2262 O O   . LYS A 1 290  ? 23.214  78.229 59.482  1.00 83.27  ? 287  LYS A O   1 
ATOM 2263 C CB  . LYS A 1 290  ? 23.916  78.719 56.061  1.00 91.44  ? 287  LYS A CB  1 
ATOM 2264 C CG  . LYS A 1 290  ? 23.220  78.267 54.775  1.00 91.44  ? 287  LYS A CG  1 
ATOM 2265 C CD  . LYS A 1 290  ? 23.502  79.173 53.567  1.00 91.44  ? 287  LYS A CD  1 
ATOM 2266 C CE  . LYS A 1 290  ? 22.714  78.664 52.341  1.00 91.44  ? 287  LYS A CE  1 
ATOM 2267 N NZ  . LYS A 1 290  ? 23.214  79.107 50.994  1.00 91.44  ? 287  LYS A NZ  1 
ATOM 2268 N N   . GLU A 1 291  ? 24.883  79.437 58.572  1.00 177.98 ? 288  GLU A N   1 
ATOM 2269 C CA  . GLU A 1 291  ? 25.130  80.283 59.739  1.00 177.98 ? 288  GLU A CA  1 
ATOM 2270 C C   . GLU A 1 291  ? 26.470  80.969 59.591  1.00 177.98 ? 288  GLU A C   1 
ATOM 2271 O O   . GLU A 1 291  ? 27.436  80.369 59.121  1.00 177.98 ? 288  GLU A O   1 
ATOM 2272 C CB  . GLU A 1 291  ? 25.137  79.462 61.014  1.00 120.28 ? 288  GLU A CB  1 
ATOM 2273 C CG  . GLU A 1 291  ? 24.758  80.235 62.237  1.00 120.28 ? 288  GLU A CG  1 
ATOM 2274 C CD  . GLU A 1 291  ? 24.559  79.320 63.414  1.00 120.28 ? 288  GLU A CD  1 
ATOM 2275 O OE1 . GLU A 1 291  ? 25.120  78.198 63.401  1.00 120.28 ? 288  GLU A OE1 1 
ATOM 2276 O OE2 . GLU A 1 291  ? 23.842  79.718 64.351  1.00 120.28 ? 288  GLU A OE2 1 
ATOM 2277 N N   . GLU A 1 292  ? 26.539  82.219 60.025  1.00 206.60 ? 289  GLU A N   1 
ATOM 2278 C CA  . GLU A 1 292  ? 27.660  83.055 59.652  1.00 206.60 ? 289  GLU A CA  1 
ATOM 2279 C C   . GLU A 1 292  ? 28.413  83.635 60.839  1.00 206.60 ? 289  GLU A C   1 
ATOM 2280 O O   . GLU A 1 292  ? 27.981  83.535 61.991  1.00 206.60 ? 289  GLU A O   1 
ATOM 2281 C CB  . GLU A 1 292  ? 27.159  84.183 58.741  1.00 204.72 ? 289  GLU A CB  1 
ATOM 2282 C CG  . GLU A 1 292  ? 28.136  84.615 57.650  1.00 204.72 ? 289  GLU A CG  1 
ATOM 2283 C CD  . GLU A 1 292  ? 27.539  85.634 56.683  1.00 204.72 ? 289  GLU A CD  1 
ATOM 2284 O OE1 . GLU A 1 292  ? 26.667  86.435 57.106  1.00 204.72 ? 289  GLU A OE1 1 
ATOM 2285 O OE2 . GLU A 1 292  ? 27.950  85.641 55.495  1.00 204.72 ? 289  GLU A OE2 1 
ATOM 2286 N N   . GLN A 1 293  ? 29.580  84.190 60.525  1.00 212.28 ? 290  GLN A N   1 
ATOM 2287 C CA  . GLN A 1 293  ? 30.237  85.212 61.325  1.00 212.28 ? 290  GLN A CA  1 
ATOM 2288 C C   . GLN A 1 293  ? 30.912  86.153 60.320  1.00 212.28 ? 290  GLN A C   1 
ATOM 2289 O O   . GLN A 1 293  ? 30.971  85.827 59.135  1.00 212.28 ? 290  GLN A O   1 
ATOM 2290 C CB  . GLN A 1 293  ? 31.232  84.604 62.310  1.00 111.55 ? 290  GLN A CB  1 
ATOM 2291 C CG  . GLN A 1 293  ? 32.418  83.907 61.674  1.00 111.55 ? 290  GLN A CG  1 
ATOM 2292 C CD  . GLN A 1 293  ? 33.575  83.759 62.635  1.00 111.55 ? 290  GLN A CD  1 
ATOM 2293 O OE1 . GLN A 1 293  ? 33.643  84.437 63.670  1.00 111.55 ? 290  GLN A OE1 1 
ATOM 2294 N NE2 . GLN A 1 293  ? 34.500  82.870 62.300  1.00 111.55 ? 290  GLN A NE2 1 
ATOM 2295 N N   . MET A 1 294  ? 31.409  87.302 60.782  1.00 218.25 ? 291  MET A N   1 
ATOM 2296 C CA  . MET A 1 294  ? 31.857  88.392 59.886  1.00 218.25 ? 291  MET A CA  1 
ATOM 2297 C C   . MET A 1 294  ? 33.007  88.044 58.920  1.00 218.25 ? 291  MET A C   1 
ATOM 2298 O O   . MET A 1 294  ? 32.750  87.477 57.857  1.00 218.25 ? 291  MET A O   1 
ATOM 2299 C CB  . MET A 1 294  ? 32.112  89.681 60.672  1.00 174.94 ? 291  MET A CB  1 
ATOM 2300 C CG  . MET A 1 294  ? 30.829  90.450 60.967  1.00 174.94 ? 291  MET A CG  1 
ATOM 2301 S SD  . MET A 1 294  ? 30.864  91.433 62.475  1.00 174.94 ? 291  MET A SD  1 
ATOM 2302 C CE  . MET A 1 294  ? 31.989  92.748 62.013  1.00 174.94 ? 291  MET A CE  1 
ATOM 2303 N N   . ASP A 1 295  ? 34.253  88.391 59.253  1.00 173.18 ? 292  ASP A N   1 
ATOM 2304 C CA  . ASP A 1 295  ? 35.387  87.934 58.430  1.00 173.18 ? 292  ASP A CA  1 
ATOM 2305 C C   . ASP A 1 295  ? 35.734  86.471 58.745  1.00 173.18 ? 292  ASP A C   1 
ATOM 2306 O O   . ASP A 1 295  ? 36.795  86.152 59.298  1.00 173.18 ? 292  ASP A O   1 
ATOM 2307 C CB  . ASP A 1 295  ? 36.606  88.878 58.483  1.00 218.25 ? 292  ASP A CB  1 
ATOM 2308 C CG  . ASP A 1 295  ? 36.379  90.187 57.760  1.00 218.25 ? 292  ASP A CG  1 
ATOM 2309 O OD1 . ASP A 1 295  ? 35.411  90.273 56.980  1.00 218.25 ? 292  ASP A OD1 1 
ATOM 2310 O OD2 . ASP A 1 295  ? 37.190  91.116 57.951  1.00 218.25 ? 292  ASP A OD2 1 
ATOM 2311 N N   . GLY A 1 296  ? 34.789  85.603 58.381  1.00 194.07 ? 293  GLY A N   1 
ATOM 2312 C CA  . GLY A 1 296  ? 34.849  84.151 58.558  1.00 194.07 ? 293  GLY A CA  1 
ATOM 2313 C C   . GLY A 1 296  ? 33.677  83.548 57.797  1.00 194.07 ? 293  GLY A C   1 
ATOM 2314 O O   . GLY A 1 296  ? 32.580  84.112 57.803  1.00 194.07 ? 293  GLY A O   1 
ATOM 2315 N N   . THR A 1 297  ? 33.901  82.406 57.143  1.00 218.25 ? 294  THR A N   1 
ATOM 2316 C CA  . THR A 1 297  ? 32.908  81.817 56.225  1.00 218.25 ? 294  THR A CA  1 
ATOM 2317 C C   . THR A 1 297  ? 31.669  81.268 56.951  1.00 218.25 ? 294  THR A C   1 
ATOM 2318 O O   . THR A 1 297  ? 31.155  81.889 57.894  1.00 218.25 ? 294  THR A O   1 
ATOM 2319 C CB  . THR A 1 297  ? 33.525  80.730 55.263  1.00 135.99 ? 294  THR A CB  1 
ATOM 2320 O OG1 . THR A 1 297  ? 34.912  81.007 55.014  1.00 135.99 ? 294  THR A OG1 1 
ATOM 2321 C CG2 . THR A 1 297  ? 32.782  80.699 53.916  1.00 135.99 ? 294  THR A CG2 1 
ATOM 2322 N N   . VAL A 1 298  ? 31.198  80.100 56.509  1.00 167.84 ? 295  VAL A N   1 
ATOM 2323 C CA  . VAL A 1 298  ? 29.904  79.587 56.939  1.00 167.84 ? 295  VAL A CA  1 
ATOM 2324 C C   . VAL A 1 298  ? 29.922  78.145 57.444  1.00 167.84 ? 295  VAL A C   1 
ATOM 2325 O O   . VAL A 1 298  ? 30.196  77.198 56.699  1.00 167.84 ? 295  VAL A O   1 
ATOM 2326 C CB  . VAL A 1 298  ? 28.809  79.784 55.845  1.00 148.13 ? 295  VAL A CB  1 
ATOM 2327 C CG1 . VAL A 1 298  ? 28.230  81.194 55.926  1.00 148.13 ? 295  VAL A CG1 1 
ATOM 2328 C CG2 . VAL A 1 298  ? 29.367  79.510 54.440  1.00 148.13 ? 295  VAL A CG2 1 
ATOM 2329 N N   . THR A 1 299  ? 29.624  78.007 58.732  1.00 118.11 ? 296  THR A N   1 
ATOM 2330 C CA  . THR A 1 299  ? 29.428  76.712 59.379  1.00 118.11 ? 296  THR A CA  1 
ATOM 2331 C C   . THR A 1 299  ? 28.139  76.033 58.898  1.00 118.11 ? 296  THR A C   1 
ATOM 2332 O O   . THR A 1 299  ? 27.649  76.309 57.805  1.00 118.11 ? 296  THR A O   1 
ATOM 2333 C CB  . THR A 1 299  ? 29.404  76.861 60.935  1.00 123.10 ? 296  THR A CB  1 
ATOM 2334 O OG1 . THR A 1 299  ? 28.910  75.655 61.540  1.00 123.10 ? 296  THR A OG1 1 
ATOM 2335 C CG2 . THR A 1 299  ? 28.523  78.040 61.371  1.00 123.10 ? 296  THR A CG2 1 
ATOM 2336 N N   . LEU A 1 300  ? 27.626  75.118 59.716  1.00 131.48 ? 297  LEU A N   1 
ATOM 2337 C CA  . LEU A 1 300  ? 26.293  74.561 59.563  1.00 131.48 ? 297  LEU A CA  1 
ATOM 2338 C C   . LEU A 1 300  ? 25.760  74.264 60.954  1.00 131.48 ? 297  LEU A C   1 
ATOM 2339 O O   . LEU A 1 300  ? 26.429  73.629 61.764  1.00 131.48 ? 297  LEU A O   1 
ATOM 2340 C CB  . LEU A 1 300  ? 26.308  73.286 58.720  1.00 218.25 ? 297  LEU A CB  1 
ATOM 2341 C CG  . LEU A 1 300  ? 26.513  73.438 57.214  1.00 218.25 ? 297  LEU A CG  1 
ATOM 2342 C CD1 . LEU A 1 300  ? 27.968  73.208 56.830  1.00 218.25 ? 297  LEU A CD1 1 
ATOM 2343 C CD2 . LEU A 1 300  ? 25.618  72.474 56.477  1.00 218.25 ? 297  LEU A CD2 1 
ATOM 2344 N N   . LYS A 1 301  ? 24.559  74.738 61.238  1.00 92.33  ? 298  LYS A N   1 
ATOM 2345 C CA  . LYS A 1 301  ? 24.003  74.567 62.559  1.00 92.33  ? 298  LYS A CA  1 
ATOM 2346 C C   . LYS A 1 301  ? 23.143  73.312 62.633  1.00 92.33  ? 298  LYS A C   1 
ATOM 2347 O O   . LYS A 1 301  ? 23.259  72.544 63.596  1.00 92.33  ? 298  LYS A O   1 
ATOM 2348 C CB  . LYS A 1 301  ? 23.220  75.817 62.988  1.00 145.24 ? 298  LYS A CB  1 
ATOM 2349 C CG  . LYS A 1 301  ? 22.628  75.792 64.417  1.00 145.24 ? 298  LYS A CG  1 
ATOM 2350 C CD  . LYS A 1 301  ? 23.567  75.197 65.491  1.00 145.24 ? 298  LYS A CD  1 
ATOM 2351 C CE  . LYS A 1 301  ? 24.743  76.105 65.840  1.00 145.24 ? 298  LYS A CE  1 
ATOM 2352 N NZ  . LYS A 1 301  ? 24.314  77.348 66.541  1.00 145.24 ? 298  LYS A NZ  1 
ATOM 2353 N N   . ASP A 1 302  ? 22.280  73.100 61.637  1.00 78.50  ? 299  ASP A N   1 
ATOM 2354 C CA  . ASP A 1 302  ? 21.448  71.887 61.609  1.00 78.50  ? 299  ASP A CA  1 
ATOM 2355 C C   . ASP A 1 302  ? 21.118  71.485 60.184  1.00 78.50  ? 299  ASP A C   1 
ATOM 2356 O O   . ASP A 1 302  ? 21.580  72.111 59.231  1.00 78.50  ? 299  ASP A O   1 
ATOM 2357 C CB  . ASP A 1 302  ? 20.156  72.063 62.449  1.00 83.54  ? 299  ASP A CB  1 
ATOM 2358 C CG  . ASP A 1 302  ? 19.475  70.705 62.831  1.00 83.54  ? 299  ASP A CG  1 
ATOM 2359 O OD1 . ASP A 1 302  ? 20.065  69.622 62.586  1.00 83.54  ? 299  ASP A OD1 1 
ATOM 2360 O OD2 . ASP A 1 302  ? 18.340  70.714 63.386  1.00 83.54  ? 299  ASP A OD2 1 
ATOM 2361 N N   . LEU A 1 303  ? 20.320  70.425 60.077  1.00 76.43  ? 300  LEU A N   1 
ATOM 2362 C CA  . LEU A 1 303  ? 19.757  69.905 58.839  1.00 76.43  ? 300  LEU A CA  1 
ATOM 2363 C C   . LEU A 1 303  ? 18.414  69.186 59.129  1.00 76.43  ? 300  LEU A C   1 
ATOM 2364 O O   . LEU A 1 303  ? 18.238  68.599 60.210  1.00 76.43  ? 300  LEU A O   1 
ATOM 2365 C CB  . LEU A 1 303  ? 20.761  68.953 58.176  1.00 89.14  ? 300  LEU A CB  1 
ATOM 2366 C CG  . LEU A 1 303  ? 21.049  67.548 58.721  1.00 89.14  ? 300  LEU A CG  1 
ATOM 2367 C CD1 . LEU A 1 303  ? 22.180  66.944 57.911  1.00 89.14  ? 300  LEU A CD1 1 
ATOM 2368 C CD2 . LEU A 1 303  ? 21.388  67.497 60.210  1.00 89.14  ? 300  LEU A CD2 1 
ATOM 2369 N N   . ARG A 1 304  ? 17.459  69.242 58.194  1.00 71.65  ? 301  ARG A N   1 
ATOM 2370 C CA  . ARG A 1 304  ? 16.203  68.476 58.372  1.00 71.65  ? 301  ARG A CA  1 
ATOM 2371 C C   . ARG A 1 304  ? 15.508  67.999 57.098  1.00 71.65  ? 301  ARG A C   1 
ATOM 2372 O O   . ARG A 1 304  ? 15.806  68.425 55.978  1.00 71.65  ? 301  ARG A O   1 
ATOM 2373 C CB  . ARG A 1 304  ? 15.186  69.227 59.248  1.00 68.64  ? 301  ARG A CB  1 
ATOM 2374 C CG  . ARG A 1 304  ? 14.388  70.269 58.499  1.00 68.64  ? 301  ARG A CG  1 
ATOM 2375 C CD  . ARG A 1 304  ? 14.277  71.539 59.304  1.00 68.64  ? 301  ARG A CD  1 
ATOM 2376 N NE  . ARG A 1 304  ? 14.541  72.698 58.462  1.00 68.64  ? 301  ARG A NE  1 
ATOM 2377 C CZ  . ARG A 1 304  ? 13.645  73.276 57.654  1.00 68.64  ? 301  ARG A CZ  1 
ATOM 2378 N NH1 . ARG A 1 304  ? 12.392  72.815 57.578  1.00 68.64  ? 301  ARG A NH1 1 
ATOM 2379 N NH2 . ARG A 1 304  ? 14.006  74.332 56.913  1.00 68.64  ? 301  ARG A NH2 1 
ATOM 2380 N N   . VAL A 1 305  ? 14.544  67.120 57.330  1.00 59.73  ? 302  VAL A N   1 
ATOM 2381 C CA  . VAL A 1 305  ? 13.777  66.484 56.301  1.00 59.73  ? 302  VAL A CA  1 
ATOM 2382 C C   . VAL A 1 305  ? 12.361  67.010 56.353  1.00 59.73  ? 302  VAL A C   1 
ATOM 2383 O O   . VAL A 1 305  ? 11.761  67.127 57.422  1.00 59.73  ? 302  VAL A O   1 
ATOM 2384 C CB  . VAL A 1 305  ? 13.788  64.965 56.530  1.00 48.97  ? 302  VAL A CB  1 
ATOM 2385 C CG1 . VAL A 1 305  ? 12.406  64.346 56.300  1.00 48.97  ? 302  VAL A CG1 1 
ATOM 2386 C CG2 . VAL A 1 305  ? 14.857  64.301 55.669  1.00 48.97  ? 302  VAL A CG2 1 
ATOM 2387 N N   . GLU A 1 306  ? 11.836  67.341 55.187  1.00 56.45  ? 303  GLU A N   1 
ATOM 2388 C CA  . GLU A 1 306  ? 10.461  67.721 55.084  1.00 56.45  ? 303  GLU A CA  1 
ATOM 2389 C C   . GLU A 1 306  ? 9.819   66.926 53.984  1.00 56.45  ? 303  GLU A C   1 
ATOM 2390 O O   . GLU A 1 306  ? 10.159  67.117 52.837  1.00 56.45  ? 303  GLU A O   1 
ATOM 2391 C CB  . GLU A 1 306  ? 10.366  69.205 54.772  1.00 87.08  ? 303  GLU A CB  1 
ATOM 2392 C CG  . GLU A 1 306  ? 10.279  70.067 56.006  1.00 87.08  ? 303  GLU A CG  1 
ATOM 2393 C CD  . GLU A 1 306  ? 9.860   71.491 55.692  1.00 87.08  ? 303  GLU A CD  1 
ATOM 2394 O OE1 . GLU A 1 306  ? 9.736   71.823 54.484  1.00 87.08  ? 303  GLU A OE1 1 
ATOM 2395 O OE2 . GLU A 1 306  ? 9.658   72.276 56.654  1.00 87.08  ? 303  GLU A OE2 1 
ATOM 2396 N N   . LEU A 1 307  ? 8.890   66.039 54.309  1.00 71.87  ? 304  LEU A N   1 
ATOM 2397 C CA  . LEU A 1 307  ? 8.167   65.349 53.257  1.00 71.87  ? 304  LEU A CA  1 
ATOM 2398 C C   . LEU A 1 307  ? 7.587   66.365 52.294  1.00 71.87  ? 304  LEU A C   1 
ATOM 2399 O O   . LEU A 1 307  ? 7.182   67.441 52.681  1.00 71.87  ? 304  LEU A O   1 
ATOM 2400 C CB  . LEU A 1 307  ? 7.059   64.493 53.840  1.00 55.69  ? 304  LEU A CB  1 
ATOM 2401 C CG  . LEU A 1 307  ? 6.149   63.649 52.939  1.00 55.69  ? 304  LEU A CG  1 
ATOM 2402 C CD1 . LEU A 1 307  ? 6.808   63.253 51.613  1.00 55.69  ? 304  LEU A CD1 1 
ATOM 2403 C CD2 . LEU A 1 307  ? 5.663   62.390 53.697  1.00 55.69  ? 304  LEU A CD2 1 
ATOM 2404 N N   . LEU A 1 308  ? 7.569   66.030 51.024  1.00 59.67  ? 305  LEU A N   1 
ATOM 2405 C CA  . LEU A 1 308  ? 6.998   66.916 50.039  1.00 59.67  ? 305  LEU A CA  1 
ATOM 2406 C C   . LEU A 1 308  ? 5.810   66.255 49.378  1.00 59.67  ? 305  LEU A C   1 
ATOM 2407 O O   . LEU A 1 308  ? 4.840   66.911 48.991  1.00 59.67  ? 305  LEU A O   1 
ATOM 2408 C CB  . LEU A 1 308  ? 8.028   67.272 48.978  1.00 49.87  ? 305  LEU A CB  1 
ATOM 2409 C CG  . LEU A 1 308  ? 9.177   68.153 49.410  1.00 49.87  ? 305  LEU A CG  1 
ATOM 2410 C CD1 . LEU A 1 308  ? 9.935   68.638 48.178  1.00 49.87  ? 305  LEU A CD1 1 
ATOM 2411 C CD2 . LEU A 1 308  ? 8.614   69.302 50.208  1.00 49.87  ? 305  LEU A CD2 1 
ATOM 2412 N N   . GLY A 1 309  ? 5.886   64.949 49.225  1.00 50.82  ? 306  GLY A N   1 
ATOM 2413 C CA  . GLY A 1 309  ? 4.779   64.273 48.622  1.00 50.82  ? 306  GLY A CA  1 
ATOM 2414 C C   . GLY A 1 309  ? 5.201   63.001 47.950  1.00 50.82  ? 306  GLY A C   1 
ATOM 2415 O O   . GLY A 1 309  ? 5.915   62.191 48.533  1.00 50.82  ? 306  GLY A O   1 
ATOM 2416 N N   . GLU A 1 310  ? 4.778   62.833 46.711  1.00 67.21  ? 307  GLU A N   1 
ATOM 2417 C CA  . GLU A 1 310  ? 4.797   61.531 46.115  1.00 67.21  ? 307  GLU A CA  1 
ATOM 2418 C C   . GLU A 1 310  ? 5.053   61.663 44.622  1.00 67.21  ? 307  GLU A C   1 
ATOM 2419 O O   . GLU A 1 310  ? 4.357   62.393 43.908  1.00 67.21  ? 307  GLU A O   1 
ATOM 2420 C CB  . GLU A 1 310  ? 3.462   60.870 46.418  1.00 67.19  ? 307  GLU A CB  1 
ATOM 2421 C CG  . GLU A 1 310  ? 3.217   59.559 45.766  1.00 67.19  ? 307  GLU A CG  1 
ATOM 2422 C CD  . GLU A 1 310  ? 2.265   58.698 46.583  1.00 67.19  ? 307  GLU A CD  1 
ATOM 2423 O OE1 . GLU A 1 310  ? 2.400   58.668 47.834  1.00 67.19  ? 307  GLU A OE1 1 
ATOM 2424 O OE2 . GLU A 1 310  ? 1.388   58.043 45.976  1.00 67.19  ? 307  GLU A OE2 1 
ATOM 2425 N N   . THR A 1 311  ? 6.089   60.980 44.165  1.00 47.38  ? 308  THR A N   1 
ATOM 2426 C CA  . THR A 1 311  ? 6.417   60.925 42.757  1.00 47.38  ? 308  THR A CA  1 
ATOM 2427 C C   . THR A 1 311  ? 6.232   59.487 42.372  1.00 47.38  ? 308  THR A C   1 
ATOM 2428 O O   . THR A 1 311  ? 5.773   58.695 43.202  1.00 47.38  ? 308  THR A O   1 
ATOM 2429 C CB  . THR A 1 311  ? 7.870   61.300 42.508  1.00 42.67  ? 308  THR A CB  1 
ATOM 2430 O OG1 . THR A 1 311  ? 8.731   60.447 43.286  1.00 42.67  ? 308  THR A OG1 1 
ATOM 2431 C CG2 . THR A 1 311  ? 8.119   62.762 42.875  1.00 42.67  ? 308  THR A CG2 1 
ATOM 2432 N N   . SER A 1 312  ? 6.573   59.143 41.128  1.00 51.20  ? 309  SER A N   1 
ATOM 2433 C CA  . SER A 1 312  ? 6.641   57.748 40.740  1.00 51.20  ? 309  SER A CA  1 
ATOM 2434 C C   . SER A 1 312  ? 7.808   57.263 41.508  1.00 51.20  ? 309  SER A C   1 
ATOM 2435 O O   . SER A 1 312  ? 8.547   58.080 42.047  1.00 51.20  ? 309  SER A O   1 
ATOM 2436 C CB  . SER A 1 312  ? 6.979   57.609 39.277  1.00 40.71  ? 309  SER A CB  1 
ATOM 2437 O OG  . SER A 1 312  ? 5.963   58.161 38.468  1.00 40.71  ? 309  SER A OG  1 
ATOM 2438 N N   . ILE A 1 313  ? 8.005   55.957 41.581  1.00 56.83  ? 310  ILE A N   1 
ATOM 2439 C CA  . ILE A 1 313  ? 9.227   55.480 42.204  1.00 56.83  ? 310  ILE A CA  1 
ATOM 2440 C C   . ILE A 1 313  ? 10.423  55.986 41.368  1.00 56.83  ? 310  ILE A C   1 
ATOM 2441 O O   . ILE A 1 313  ? 10.515  55.757 40.151  1.00 56.83  ? 310  ILE A O   1 
ATOM 2442 C CB  . ILE A 1 313  ? 9.279   53.957 42.369  1.00 51.91  ? 310  ILE A CB  1 
ATOM 2443 C CG1 . ILE A 1 313  ? 7.933   53.389 42.823  1.00 51.91  ? 310  ILE A CG1 1 
ATOM 2444 C CG2 . ILE A 1 313  ? 10.386  53.603 43.351  1.00 51.91  ? 310  ILE A CG2 1 
ATOM 2445 C CD1 . ILE A 1 313  ? 7.767   53.363 44.297  1.00 51.91  ? 310  ILE A CD1 1 
ATOM 2446 N N   . ALA A 1 314  ? 11.319  56.701 42.045  1.00 36.95  ? 311  ALA A N   1 
ATOM 2447 C CA  . ALA A 1 314  ? 12.428  57.389 41.382  1.00 36.95  ? 311  ALA A CA  1 
ATOM 2448 C C   . ALA A 1 314  ? 13.709  56.580 41.468  1.00 36.95  ? 311  ALA A C   1 
ATOM 2449 O O   . ALA A 1 314  ? 14.076  56.116 42.575  1.00 36.95  ? 311  ALA A O   1 
ATOM 2450 C CB  . ALA A 1 314  ? 12.662  58.780 42.007  1.00 19.25  ? 311  ALA A CB  1 
ATOM 2451 N N   . GLU A 1 315  ? 14.352  56.398 40.300  1.00 55.11  ? 312  GLU A N   1 
ATOM 2452 C CA  . GLU A 1 315  ? 15.751  56.004 40.220  1.00 55.11  ? 312  GLU A CA  1 
ATOM 2453 C C   . GLU A 1 315  ? 16.545  57.264 40.182  1.00 55.11  ? 312  GLU A C   1 
ATOM 2454 O O   . GLU A 1 315  ? 17.339  57.520 41.077  1.00 55.11  ? 312  GLU A O   1 
ATOM 2455 C CB  . GLU A 1 315  ? 16.030  55.200 38.965  1.00 62.62  ? 312  GLU A CB  1 
ATOM 2456 C CG  . GLU A 1 315  ? 16.062  53.698 39.240  1.00 62.62  ? 312  GLU A CG  1 
ATOM 2457 C CD  . GLU A 1 315  ? 17.477  53.137 39.388  1.00 62.62  ? 312  GLU A CD  1 
ATOM 2458 O OE1 . GLU A 1 315  ? 18.459  53.888 39.116  1.00 62.62  ? 312  GLU A OE1 1 
ATOM 2459 O OE2 . GLU A 1 315  ? 17.591  51.941 39.776  1.00 62.62  ? 312  GLU A OE2 1 
ATOM 2460 N N   . CYS A 1 316  ? 16.269  58.054 39.140  1.00 55.82  ? 313  CYS A N   1 
ATOM 2461 C CA  . CYS A 1 316  ? 16.965  59.275 38.767  1.00 55.82  ? 313  CYS A CA  1 
ATOM 2462 C C   . CYS A 1 316  ? 16.053  60.458 39.112  1.00 55.82  ? 313  CYS A C   1 
ATOM 2463 O O   . CYS A 1 316  ? 14.838  60.368 38.951  1.00 55.82  ? 313  CYS A O   1 
ATOM 2464 C CB  . CYS A 1 316  ? 17.193  59.229 37.269  1.00 190.13 ? 313  CYS A CB  1 
ATOM 2465 S SG  . CYS A 1 316  ? 18.505  60.258 36.733  1.00 190.13 ? 313  CYS A SG  1 
ATOM 2466 N N   . LEU A 1 317  ? 16.629  61.572 39.559  1.00 63.99  ? 314  LEU A N   1 
ATOM 2467 C CA  . LEU A 1 317  ? 15.857  62.691 40.110  1.00 63.99  ? 314  LEU A CA  1 
ATOM 2468 C C   . LEU A 1 317  ? 16.616  63.979 39.940  1.00 63.99  ? 314  LEU A C   1 
ATOM 2469 O O   . LEU A 1 317  ? 17.721  64.110 40.448  1.00 63.99  ? 314  LEU A O   1 
ATOM 2470 C CB  . LEU A 1 317  ? 15.708  62.470 41.593  1.00 45.21  ? 314  LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 317  ? 14.566  62.993 42.445  1.00 45.21  ? 314  LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 317  ? 13.245  62.624 41.804  1.00 45.21  ? 314  LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 317  ? 14.669  62.359 43.851  1.00 45.21  ? 314  LEU A CD2 1 
ATOM 2474 N N   . THR A 1 318  ? 16.029  64.950 39.257  1.00 50.73  ? 315  THR A N   1 
ATOM 2475 C CA  . THR A 1 318  ? 16.801  66.108 38.794  1.00 50.73  ? 315  THR A CA  1 
ATOM 2476 C C   . THR A 1 318  ? 16.029  67.426 38.767  1.00 50.73  ? 315  THR A C   1 
ATOM 2477 O O   . THR A 1 318  ? 15.168  67.619 37.907  1.00 50.73  ? 315  THR A O   1 
ATOM 2478 C CB  . THR A 1 318  ? 17.398  65.831 37.391  1.00 60.59  ? 315  THR A CB  1 
ATOM 2479 O OG1 . THR A 1 318  ? 18.091  64.570 37.407  1.00 60.59  ? 315  THR A OG1 1 
ATOM 2480 C CG2 . THR A 1 318  ? 18.354  66.926 36.987  1.00 60.59  ? 315  THR A CG2 1 
ATOM 2481 N N   . TYR A 1 319  ? 16.362  68.315 39.713  1.00 42.77  ? 316  TYR A N   1 
ATOM 2482 C CA  . TYR A 1 319  ? 15.829  69.670 39.764  1.00 42.77  ? 316  TYR A CA  1 
ATOM 2483 C C   . TYR A 1 319  ? 16.200  70.366 38.486  1.00 42.77  ? 316  TYR A C   1 
ATOM 2484 O O   . TYR A 1 319  ? 17.277  70.125 37.987  1.00 42.77  ? 316  TYR A O   1 
ATOM 2485 C CB  . TYR A 1 319  ? 16.392  70.456 40.952  1.00 68.43  ? 316  TYR A CB  1 
ATOM 2486 C CG  . TYR A 1 319  ? 15.803  71.846 41.018  1.00 68.43  ? 316  TYR A CG  1 
ATOM 2487 C CD1 . TYR A 1 319  ? 14.493  72.050 41.458  1.00 68.43  ? 316  TYR A CD1 1 
ATOM 2488 C CD2 . TYR A 1 319  ? 16.535  72.955 40.603  1.00 68.43  ? 316  TYR A CD2 1 
ATOM 2489 C CE1 . TYR A 1 319  ? 13.921  73.336 41.494  1.00 68.43  ? 316  TYR A CE1 1 
ATOM 2490 C CE2 . TYR A 1 319  ? 15.976  74.256 40.632  1.00 68.43  ? 316  TYR A CE2 1 
ATOM 2491 C CZ  . TYR A 1 319  ? 14.661  74.445 41.077  1.00 68.43  ? 316  TYR A CZ  1 
ATOM 2492 O OH  . TYR A 1 319  ? 14.099  75.722 41.107  1.00 68.43  ? 316  TYR A OH  1 
ATOM 2493 N N   . LEU A 1 320  ? 15.315  71.201 37.942  1.00 58.83  ? 317  LEU A N   1 
ATOM 2494 C CA  . LEU A 1 320  ? 15.618  71.979 36.721  1.00 58.83  ? 317  LEU A CA  1 
ATOM 2495 C C   . LEU A 1 320  ? 15.380  73.481 36.928  1.00 58.83  ? 317  LEU A C   1 
ATOM 2496 O O   . LEU A 1 320  ? 15.911  74.095 37.857  1.00 58.83  ? 317  LEU A O   1 
ATOM 2497 C CB  . LEU A 1 320  ? 14.766  71.516 35.538  1.00 60.56  ? 317  LEU A CB  1 
ATOM 2498 C CG  . LEU A 1 320  ? 14.353  70.070 35.363  1.00 60.56  ? 317  LEU A CG  1 
ATOM 2499 C CD1 . LEU A 1 320  ? 13.548  69.967 34.112  1.00 60.56  ? 317  LEU A CD1 1 
ATOM 2500 C CD2 . LEU A 1 320  ? 15.547  69.199 35.244  1.00 60.56  ? 317  LEU A CD2 1 
ATOM 2501 N N   . ASP A 1 321  ? 14.561  74.065 36.053  1.00 100.77 ? 318  ASP A N   1 
ATOM 2502 C CA  . ASP A 1 321  ? 14.080  75.423 36.239  1.00 100.77 ? 318  ASP A CA  1 
ATOM 2503 C C   . ASP A 1 321  ? 13.244  75.541 37.503  1.00 100.77 ? 318  ASP A C   1 
ATOM 2504 O O   . ASP A 1 321  ? 13.087  74.590 38.273  1.00 100.77 ? 318  ASP A O   1 
ATOM 2505 C CB  . ASP A 1 321  ? 13.271  75.896 35.023  1.00 159.80 ? 318  ASP A CB  1 
ATOM 2506 C CG  . ASP A 1 321  ? 13.971  77.004 34.240  1.00 159.80 ? 318  ASP A CG  1 
ATOM 2507 O OD1 . ASP A 1 321  ? 13.487  77.352 33.139  1.00 159.80 ? 318  ASP A OD1 1 
ATOM 2508 O OD2 . ASP A 1 321  ? 14.996  77.533 34.726  1.00 159.80 ? 318  ASP A OD2 1 
ATOM 2509 N N   . ASN A 1 322  ? 12.692  76.728 37.685  1.00 57.47  ? 319  ASN A N   1 
ATOM 2510 C CA  . ASN A 1 322  ? 12.022  77.102 38.900  1.00 57.47  ? 319  ASN A CA  1 
ATOM 2511 C C   . ASN A 1 322  ? 11.000  76.065 39.364  1.00 57.47  ? 319  ASN A C   1 
ATOM 2512 O O   . ASN A 1 322  ? 9.967   75.840 38.710  1.00 57.47  ? 319  ASN A O   1 
ATOM 2513 C CB  . ASN A 1 322  ? 11.414  78.483 38.704  1.00 102.76 ? 319  ASN A CB  1 
ATOM 2514 C CG  . ASN A 1 322  ? 12.315  79.380 37.879  1.00 102.76 ? 319  ASN A CG  1 
ATOM 2515 O OD1 . ASN A 1 322  ? 13.344  79.861 38.358  1.00 102.76 ? 319  ASN A OD1 1 
ATOM 2516 N ND2 . ASN A 1 322  ? 11.957  79.571 36.617  1.00 102.76 ? 319  ASN A ND2 1 
ATOM 2517 N N   . GLY A 1 323  ? 11.338  75.406 40.479  1.00 78.23  ? 320  GLY A N   1 
ATOM 2518 C CA  . GLY A 1 323  ? 10.443  74.483 41.178  1.00 78.23  ? 320  GLY A CA  1 
ATOM 2519 C C   . GLY A 1 323  ? 10.062  73.245 40.391  1.00 78.23  ? 320  GLY A C   1 
ATOM 2520 O O   . GLY A 1 323  ? 9.335   72.389 40.898  1.00 78.23  ? 320  GLY A O   1 
ATOM 2521 N N   . VAL A 1 324  ? 10.530  73.151 39.148  1.00 59.96  ? 321  VAL A N   1 
ATOM 2522 C CA  . VAL A 1 324  ? 10.291  71.947 38.335  1.00 59.96  ? 321  VAL A CA  1 
ATOM 2523 C C   . VAL A 1 324  ? 11.373  70.879 38.577  1.00 59.96  ? 321  VAL A C   1 
ATOM 2524 O O   . VAL A 1 324  ? 12.528  71.188 38.895  1.00 59.96  ? 321  VAL A O   1 
ATOM 2525 C CB  . VAL A 1 324  ? 10.190  72.239 36.819  1.00 71.52  ? 321  VAL A CB  1 
ATOM 2526 C CG1 . VAL A 1 324  ? 9.521   71.073 36.098  1.00 71.52  ? 321  VAL A CG1 1 
ATOM 2527 C CG2 . VAL A 1 324  ? 9.420   73.533 36.572  1.00 71.52  ? 321  VAL A CG2 1 
ATOM 2528 N N   . VAL A 1 325  ? 10.974  69.623 38.419  1.00 44.54  ? 322  VAL A N   1 
ATOM 2529 C CA  . VAL A 1 325  ? 11.797  68.489 38.766  1.00 44.54  ? 322  VAL A CA  1 
ATOM 2530 C C   . VAL A 1 325  ? 11.467  67.408 37.785  1.00 44.54  ? 322  VAL A C   1 
ATOM 2531 O O   . VAL A 1 325  ? 10.292  67.043 37.662  1.00 44.54  ? 322  VAL A O   1 
ATOM 2532 C CB  . VAL A 1 325  ? 11.464  67.955 40.176  1.00 47.28  ? 322  VAL A CB  1 
ATOM 2533 C CG1 . VAL A 1 325  ? 12.166  66.635 40.430  1.00 47.28  ? 322  VAL A CG1 1 
ATOM 2534 C CG2 . VAL A 1 325  ? 11.862  68.957 41.225  1.00 47.28  ? 322  VAL A CG2 1 
ATOM 2535 N N   . PHE A 1 326  ? 12.483  66.913 37.069  1.00 51.31  ? 323  PHE A N   1 
ATOM 2536 C CA  . PHE A 1 326  ? 12.311  65.692 36.297  1.00 51.31  ? 323  PHE A CA  1 
ATOM 2537 C C   . PHE A 1 326  ? 12.509  64.525 37.215  1.00 51.31  ? 323  PHE A C   1 
ATOM 2538 O O   . PHE A 1 326  ? 13.386  64.543 38.039  1.00 51.31  ? 323  PHE A O   1 
ATOM 2539 C CB  . PHE A 1 326  ? 13.277  65.574 35.148  1.00 47.04  ? 323  PHE A CB  1 
ATOM 2540 C CG  . PHE A 1 326  ? 13.144  64.286 34.414  1.00 47.04  ? 323  PHE A CG  1 
ATOM 2541 C CD1 . PHE A 1 326  ? 12.113  64.095 33.511  1.00 47.04  ? 323  PHE A CD1 1 
ATOM 2542 C CD2 . PHE A 1 326  ? 14.020  63.253 34.645  1.00 47.04  ? 323  PHE A CD2 1 
ATOM 2543 C CE1 . PHE A 1 326  ? 11.974  62.900 32.840  1.00 47.04  ? 323  PHE A CE1 1 
ATOM 2544 C CE2 . PHE A 1 326  ? 13.899  62.075 33.979  1.00 47.04  ? 323  PHE A CE2 1 
ATOM 2545 C CZ  . PHE A 1 326  ? 12.873  61.891 33.077  1.00 47.04  ? 323  PHE A CZ  1 
ATOM 2546 N N   . VAL A 1 327  ? 11.683  63.509 37.071  1.00 47.19  ? 324  VAL A N   1 
ATOM 2547 C CA  . VAL A 1 327  ? 11.705  62.376 37.967  1.00 47.19  ? 324  VAL A CA  1 
ATOM 2548 C C   . VAL A 1 327  ? 11.805  61.128 37.100  1.00 47.19  ? 324  VAL A C   1 
ATOM 2549 O O   . VAL A 1 327  ? 10.818  60.715 36.476  1.00 47.19  ? 324  VAL A O   1 
ATOM 2550 C CB  . VAL A 1 327  ? 10.410  62.327 38.817  1.00 46.11  ? 324  VAL A CB  1 
ATOM 2551 C CG1 . VAL A 1 327  ? 10.359  61.080 39.679  1.00 46.11  ? 324  VAL A CG1 1 
ATOM 2552 C CG2 . VAL A 1 327  ? 10.303  63.559 39.671  1.00 46.11  ? 324  VAL A CG2 1 
ATOM 2553 N N   . GLY A 1 328  ? 12.993  60.536 37.042  1.00 46.74  ? 325  GLY A N   1 
ATOM 2554 C CA  . GLY A 1 328  ? 13.173  59.318 36.269  1.00 46.74  ? 325  GLY A CA  1 
ATOM 2555 C C   . GLY A 1 328  ? 12.766  58.069 37.025  1.00 46.74  ? 325  GLY A C   1 
ATOM 2556 O O   . GLY A 1 328  ? 13.182  57.856 38.181  1.00 46.74  ? 325  GLY A O   1 
ATOM 2557 N N   . SER A 1 329  ? 11.972  57.231 36.376  1.00 44.63  ? 326  SER A N   1 
ATOM 2558 C CA  . SER A 1 329  ? 11.476  56.057 37.021  1.00 44.63  ? 326  SER A CA  1 
ATOM 2559 C C   . SER A 1 329  ? 11.717  54.868 36.117  1.00 44.63  ? 326  SER A C   1 
ATOM 2560 O O   . SER A 1 329  ? 11.417  54.957 34.926  1.00 44.63  ? 326  SER A O   1 
ATOM 2561 C CB  . SER A 1 329  ? 9.985   56.236 37.287  1.00 46.01  ? 326  SER A CB  1 
ATOM 2562 O OG  . SER A 1 329  ? 9.402   55.105 37.910  1.00 46.01  ? 326  SER A OG  1 
ATOM 2563 N N   . ARG A 1 330  ? 12.257  53.764 36.659  1.00 46.98  ? 327  ARG A N   1 
ATOM 2564 C CA  . ARG A 1 330  ? 12.209  52.503 35.909  1.00 46.98  ? 327  ARG A CA  1 
ATOM 2565 C C   . ARG A 1 330  ? 11.063  51.575 36.252  1.00 46.98  ? 327  ARG A C   1 
ATOM 2566 O O   . ARG A 1 330  ? 10.552  50.884 35.356  1.00 46.98  ? 327  ARG A O   1 
ATOM 2567 C CB  . ARG A 1 330  ? 13.540  51.739 35.793  1.00 57.24  ? 327  ARG A CB  1 
ATOM 2568 C CG  . ARG A 1 330  ? 14.722  52.138 36.648  1.00 57.24  ? 327  ARG A CG  1 
ATOM 2569 C CD  . ARG A 1 330  ? 15.739  50.967 36.686  1.00 57.24  ? 327  ARG A CD  1 
ATOM 2570 N NE  . ARG A 1 330  ? 15.968  50.592 38.078  1.00 57.24  ? 327  ARG A NE  1 
ATOM 2571 C CZ  . ARG A 1 330  ? 15.125  49.861 38.853  1.00 57.24  ? 327  ARG A CZ  1 
ATOM 2572 N NH1 . ARG A 1 330  ? 13.972  49.349 38.360  1.00 57.24  ? 327  ARG A NH1 1 
ATOM 2573 N NH2 . ARG A 1 330  ? 15.452  49.605 40.143  1.00 57.24  ? 327  ARG A NH2 1 
ATOM 2574 N N   . LEU A 1 331  ? 10.649  51.563 37.524  1.00 42.16  ? 328  LEU A N   1 
ATOM 2575 C CA  . LEU A 1 331  ? 9.541   50.686 37.973  1.00 42.16  ? 328  LEU A CA  1 
ATOM 2576 C C   . LEU A 1 331  ? 8.176   51.093 37.439  1.00 42.16  ? 328  LEU A C   1 
ATOM 2577 O O   . LEU A 1 331  ? 7.279   50.294 37.480  1.00 42.16  ? 328  LEU A O   1 
ATOM 2578 C CB  . LEU A 1 331  ? 9.442   50.628 39.490  1.00 37.39  ? 328  LEU A CB  1 
ATOM 2579 C CG  . LEU A 1 331  ? 10.560  49.969 40.291  1.00 37.39  ? 328  LEU A CG  1 
ATOM 2580 C CD1 . LEU A 1 331  ? 10.418  50.233 41.767  1.00 37.39  ? 328  LEU A CD1 1 
ATOM 2581 C CD2 . LEU A 1 331  ? 10.613  48.498 40.058  1.00 37.39  ? 328  LEU A CD2 1 
ATOM 2582 N N   . GLY A 1 332  ? 8.026   52.342 36.989  1.00 35.00  ? 329  GLY A N   1 
ATOM 2583 C CA  . GLY A 1 332  ? 6.803   52.859 36.375  1.00 35.00  ? 329  GLY A CA  1 
ATOM 2584 C C   . GLY A 1 332  ? 7.048   54.184 35.675  1.00 35.00  ? 329  GLY A C   1 
ATOM 2585 O O   . GLY A 1 332  ? 8.186   54.486 35.376  1.00 35.00  ? 329  GLY A O   1 
ATOM 2586 N N   . ASP A 1 333  ? 6.005   54.993 35.453  1.00 45.96  ? 330  ASP A N   1 
ATOM 2587 C CA  . ASP A 1 333  ? 6.072   56.167 34.537  1.00 45.96  ? 330  ASP A CA  1 
ATOM 2588 C C   . ASP A 1 333  ? 6.960   57.340 35.015  1.00 45.96  ? 330  ASP A C   1 
ATOM 2589 O O   . ASP A 1 333  ? 6.790   57.876 36.113  1.00 45.96  ? 330  ASP A O   1 
ATOM 2590 C CB  . ASP A 1 333  ? 4.660   56.709 34.221  1.00 33.56  ? 330  ASP A CB  1 
ATOM 2591 C CG  . ASP A 1 333  ? 3.885   55.886 33.110  1.00 33.56  ? 330  ASP A CG  1 
ATOM 2592 O OD1 . ASP A 1 333  ? 4.233   54.744 32.708  1.00 33.56  ? 330  ASP A OD1 1 
ATOM 2593 O OD2 . ASP A 1 333  ? 2.862   56.435 32.613  1.00 33.56  ? 330  ASP A OD2 1 
ATOM 2594 N N   . SER A 1 334  ? 7.908   57.748 34.178  1.00 50.21  ? 331  SER A N   1 
ATOM 2595 C CA  . SER A 1 334  ? 8.663   58.956 34.466  1.00 50.21  ? 331  SER A CA  1 
ATOM 2596 C C   . SER A 1 334  ? 7.780   60.165 34.296  1.00 50.21  ? 331  SER A C   1 
ATOM 2597 O O   . SER A 1 334  ? 6.850   60.177 33.490  1.00 50.21  ? 331  SER A O   1 
ATOM 2598 C CB  . SER A 1 334  ? 9.868   59.082 33.560  1.00 56.28  ? 331  SER A CB  1 
ATOM 2599 O OG  . SER A 1 334  ? 10.873  58.169 33.949  1.00 56.28  ? 331  SER A OG  1 
ATOM 2600 N N   . GLN A 1 335  ? 8.068   61.201 35.058  1.00 51.06  ? 332  GLN A N   1 
ATOM 2601 C CA  . GLN A 1 335  ? 7.174   62.317 35.084  1.00 51.06  ? 332  GLN A CA  1 
ATOM 2602 C C   . GLN A 1 335  ? 7.901   63.605 35.350  1.00 51.06  ? 332  GLN A C   1 
ATOM 2603 O O   . GLN A 1 335  ? 9.024   63.612 35.855  1.00 51.06  ? 332  GLN A O   1 
ATOM 2604 C CB  . GLN A 1 335  ? 6.074   62.082 36.116  1.00 43.82  ? 332  GLN A CB  1 
ATOM 2605 C CG  . GLN A 1 335  ? 6.483   62.256 37.571  1.00 43.82  ? 332  GLN A CG  1 
ATOM 2606 C CD  . GLN A 1 335  ? 5.485   61.606 38.537  1.00 43.82  ? 332  GLN A CD  1 
ATOM 2607 O OE1 . GLN A 1 335  ? 4.432   61.151 38.117  1.00 43.82  ? 332  GLN A OE1 1 
ATOM 2608 N NE2 . GLN A 1 335  ? 5.826   61.545 39.815  1.00 43.82  ? 332  GLN A NE2 1 
ATOM 2609 N N   . LEU A 1 336  ? 7.223   64.692 34.985  1.00 56.55  ? 333  LEU A N   1 
ATOM 2610 C CA  . LEU A 1 336  ? 7.706   66.043 35.155  1.00 56.55  ? 333  LEU A CA  1 
ATOM 2611 C C   . LEU A 1 336  ? 6.876   66.650 36.253  1.00 56.55  ? 333  LEU A C   1 
ATOM 2612 O O   . LEU A 1 336  ? 5.680   66.486 36.269  1.00 56.55  ? 333  LEU A O   1 
ATOM 2613 C CB  . LEU A 1 336  ? 7.527   66.797 33.844  1.00 67.31  ? 333  LEU A CB  1 
ATOM 2614 C CG  . LEU A 1 336  ? 8.491   67.944 33.588  1.00 67.31  ? 333  LEU A CG  1 
ATOM 2615 C CD1 . LEU A 1 336  ? 9.808   67.699 34.266  1.00 67.31  ? 333  LEU A CD1 1 
ATOM 2616 C CD2 . LEU A 1 336  ? 8.678   68.103 32.109  1.00 67.31  ? 333  LEU A CD2 1 
ATOM 2617 N N   . VAL A 1 337  ? 7.519   67.335 37.180  1.00 48.58  ? 334  VAL A N   1 
ATOM 2618 C CA  . VAL A 1 337  ? 6.888   67.662 38.454  1.00 48.58  ? 334  VAL A CA  1 
ATOM 2619 C C   . VAL A 1 337  ? 7.187   69.072 38.989  1.00 48.58  ? 334  VAL A C   1 
ATOM 2620 O O   . VAL A 1 337  ? 8.314   69.548 38.971  1.00 48.58  ? 334  VAL A O   1 
ATOM 2621 C CB  . VAL A 1 337  ? 7.204   66.564 39.513  1.00 46.24  ? 334  VAL A CB  1 
ATOM 2622 C CG1 . VAL A 1 337  ? 7.211   67.111 40.909  1.00 46.24  ? 334  VAL A CG1 1 
ATOM 2623 C CG2 . VAL A 1 337  ? 6.199   65.480 39.420  1.00 46.24  ? 334  VAL A CG2 1 
ATOM 2624 N N   . LYS A 1 338  ? 6.148   69.742 39.456  1.00 63.90  ? 335  LYS A N   1 
ATOM 2625 C CA  . LYS A 1 338  ? 6.299   71.067 40.009  1.00 63.90  ? 335  LYS A CA  1 
ATOM 2626 C C   . LYS A 1 338  ? 6.241   71.015 41.528  1.00 63.90  ? 335  LYS A C   1 
ATOM 2627 O O   . LYS A 1 338  ? 5.273   70.487 42.101  1.00 63.90  ? 335  LYS A O   1 
ATOM 2628 C CB  . LYS A 1 338  ? 5.205   71.989 39.462  1.00 61.27  ? 335  LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 338  ? 5.172   73.368 40.087  1.00 61.27  ? 335  LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 338  ? 6.090   74.362 39.411  1.00 61.27  ? 335  LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 338  ? 6.208   75.604 40.280  1.00 61.27  ? 335  LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 338  ? 6.830   76.760 39.573  1.00 61.27  ? 335  LYS A NZ  1 
ATOM 2633 N N   . LEU A 1 339  ? 7.285   71.549 42.166  1.00 63.73  ? 336  LEU A N   1 
ATOM 2634 C CA  . LEU A 1 339  ? 7.225   71.882 43.587  1.00 63.73  ? 336  LEU A CA  1 
ATOM 2635 C C   . LEU A 1 339  ? 6.754   73.306 43.763  1.00 63.73  ? 336  LEU A C   1 
ATOM 2636 O O   . LEU A 1 339  ? 7.295   74.237 43.155  1.00 63.73  ? 336  LEU A O   1 
ATOM 2637 C CB  . LEU A 1 339  ? 8.578   71.795 44.265  1.00 38.52  ? 336  LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 339  ? 9.577   70.666 44.050  1.00 38.52  ? 336  LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 339  ? 10.930  71.139 44.613  1.00 38.52  ? 336  LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 339  ? 9.104   69.376 44.702  1.00 38.52  ? 336  LEU A CD2 1 
ATOM 2641 N N   . ASN A 1 340  ? 5.759   73.464 44.621  1.00 49.77  ? 337  ASN A N   1 
ATOM 2642 C CA  . ASN A 1 340  ? 5.249   74.758 44.963  1.00 49.77  ? 337  ASN A CA  1 
ATOM 2643 C C   . ASN A 1 340  ? 5.578   75.074 46.400  1.00 49.77  ? 337  ASN A C   1 
ATOM 2644 O O   . ASN A 1 340  ? 5.904   74.188 47.187  1.00 49.77  ? 337  ASN A O   1 
ATOM 2645 C CB  . ASN A 1 340  ? 3.765   74.761 44.757  1.00 47.16  ? 337  ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 340  ? 3.393   74.366 43.366  1.00 47.16  ? 337  ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 340  ? 2.683   73.384 43.156  1.00 47.16  ? 337  ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 340  ? 3.871   75.125 42.390  1.00 47.16  ? 337  ASN A ND2 1 
ATOM 2649 N N   . VAL A 1 341  ? 5.491   76.355 46.733  1.00 71.61  ? 338  VAL A N   1 
ATOM 2650 C CA  . VAL A 1 341  ? 5.762   76.825 48.092  1.00 71.61  ? 338  VAL A CA  1 
ATOM 2651 C C   . VAL A 1 341  ? 4.660   76.405 49.074  1.00 71.61  ? 338  VAL A C   1 
ATOM 2652 O O   . VAL A 1 341  ? 4.910   76.259 50.285  1.00 71.61  ? 338  VAL A O   1 
ATOM 2653 C CB  . VAL A 1 341  ? 5.891   78.354 48.121  1.00 99.70  ? 338  VAL A CB  1 
ATOM 2654 C CG1 . VAL A 1 341  ? 6.630   78.809 49.385  1.00 99.70  ? 338  VAL A CG1 1 
ATOM 2655 C CG2 . VAL A 1 341  ? 6.587   78.849 46.850  1.00 99.70  ? 338  VAL A CG2 1 
ATOM 2656 N N   . ASP A 1 342  ? 3.452   76.213 48.555  1.00 67.44  ? 339  ASP A N   1 
ATOM 2657 C CA  . ASP A 1 342  ? 2.318   75.813 49.381  1.00 67.44  ? 339  ASP A CA  1 
ATOM 2658 C C   . ASP A 1 342  ? 1.862   74.397 49.044  1.00 67.44  ? 339  ASP A C   1 
ATOM 2659 O O   . ASP A 1 342  ? 2.066   73.918 47.928  1.00 67.44  ? 339  ASP A O   1 
ATOM 2660 C CB  . ASP A 1 342  ? 1.157   76.794 49.210  1.00 85.99  ? 339  ASP A CB  1 
ATOM 2661 C CG  . ASP A 1 342  ? 1.525   78.208 49.614  1.00 85.99  ? 339  ASP A CG  1 
ATOM 2662 O OD1 . ASP A 1 342  ? 2.680   78.425 50.039  1.00 85.99  ? 339  ASP A OD1 1 
ATOM 2663 O OD2 . ASP A 1 342  ? 0.661   79.103 49.508  1.00 85.99  ? 339  ASP A OD2 1 
ATOM 2664 N N   . SER A 1 343  ? 1.244   73.733 50.014  1.00 75.21  ? 340  SER A N   1 
ATOM 2665 C CA  . SER A 1 343  ? 0.757   72.372 49.822  1.00 75.21  ? 340  SER A CA  1 
ATOM 2666 C C   . SER A 1 343  ? -0.728  72.361 49.475  1.00 75.21  ? 340  SER A C   1 
ATOM 2667 O O   . SER A 1 343  ? -1.547  72.936 50.192  1.00 75.21  ? 340  SER A O   1 
ATOM 2668 C CB  . SER A 1 343  ? 1.011   71.531 51.075  1.00 77.67  ? 340  SER A CB  1 
ATOM 2669 O OG  . SER A 1 343  ? 0.349   72.080 52.201  1.00 77.67  ? 340  SER A OG  1 
ATOM 2670 N N   . ASN A 1 344  ? -1.068  71.704 48.371  1.00 85.42  ? 341  ASN A N   1 
ATOM 2671 C CA  . ASN A 1 344  ? -2.454  71.617 47.927  1.00 85.42  ? 341  ASN A CA  1 
ATOM 2672 C C   . ASN A 1 344  ? -3.335  70.882 48.931  1.00 85.42  ? 341  ASN A C   1 
ATOM 2673 O O   . ASN A 1 344  ? -3.277  71.144 50.132  1.00 85.42  ? 341  ASN A O   1 
ATOM 2674 C CB  . ASN A 1 344  ? -2.537  70.939 46.559  1.00 57.42  ? 341  ASN A CB  1 
ATOM 2675 C CG  . ASN A 1 344  ? -1.986  69.526 46.574  1.00 57.42  ? 341  ASN A CG  1 
ATOM 2676 O OD1 . ASN A 1 344  ? -1.545  69.031 47.612  1.00 57.42  ? 341  ASN A OD1 1 
ATOM 2677 N ND2 . ASN A 1 344  ? -2.009  68.869 45.421  1.00 57.42  ? 341  ASN A ND2 1 
ATOM 2678 N N   . GLU A 1 345  ? -4.152  69.961 48.430  1.00 104.06 ? 342  GLU A N   1 
ATOM 2679 C CA  . GLU A 1 345  ? -5.047  69.186 49.282  1.00 104.06 ? 342  GLU A CA  1 
ATOM 2680 C C   . GLU A 1 345  ? -4.376  67.905 49.764  1.00 104.06 ? 342  GLU A C   1 
ATOM 2681 O O   . GLU A 1 345  ? -4.116  66.994 48.977  1.00 104.06 ? 342  GLU A O   1 
ATOM 2682 C CB  . GLU A 1 345  ? -6.341  68.854 48.536  1.00 143.59 ? 342  GLU A CB  1 
ATOM 2683 C CG  . GLU A 1 345  ? -7.126  70.074 48.081  1.00 143.59 ? 342  GLU A CG  1 
ATOM 2684 C CD  . GLU A 1 345  ? -7.543  70.963 49.236  1.00 143.59 ? 342  GLU A CD  1 
ATOM 2685 O OE1 . GLU A 1 345  ? -7.218  70.627 50.394  1.00 143.59 ? 342  GLU A OE1 1 
ATOM 2686 O OE2 . GLU A 1 345  ? -8.196  71.997 48.985  1.00 143.59 ? 342  GLU A OE2 1 
ATOM 2687 N N   . GLN A 1 346  ? -4.099  67.840 51.063  1.00 89.74  ? 343  GLN A N   1 
ATOM 2688 C CA  . GLN A 1 346  ? -3.459  66.672 51.652  1.00 89.74  ? 343  GLN A CA  1 
ATOM 2689 C C   . GLN A 1 346  ? -2.017  66.944 52.066  1.00 89.74  ? 343  GLN A C   1 
ATOM 2690 O O   . GLN A 1 346  ? -1.329  66.045 52.550  1.00 89.74  ? 343  GLN A O   1 
ATOM 2691 C CB  . GLN A 1 346  ? -3.511  65.489 50.682  1.00 186.07 ? 343  GLN A CB  1 
ATOM 2692 C CG  . GLN A 1 346  ? -2.865  64.221 51.214  1.00 186.07 ? 343  GLN A CG  1 
ATOM 2693 C CD  . GLN A 1 346  ? -2.935  63.073 50.227  1.00 186.07 ? 343  GLN A CD  1 
ATOM 2694 O OE1 . GLN A 1 346  ? -3.471  63.215 49.128  1.00 186.07 ? 343  GLN A OE1 1 
ATOM 2695 N NE2 . GLN A 1 346  ? -2.392  61.925 50.615  1.00 186.07 ? 343  GLN A NE2 1 
ATOM 2696 N N   . GLY A 1 347  ? -1.557  68.177 51.878  1.00 60.97  ? 344  GLY A N   1 
ATOM 2697 C CA  . GLY A 1 347  ? -0.194  68.513 52.247  1.00 60.97  ? 344  GLY A CA  1 
ATOM 2698 C C   . GLY A 1 347  ? 0.825   67.934 51.286  1.00 60.97  ? 344  GLY A C   1 
ATOM 2699 O O   . GLY A 1 347  ? 1.766   67.256 51.699  1.00 60.97  ? 344  GLY A O   1 
ATOM 2700 N N   . SER A 1 348  ? 0.637   68.202 49.998  1.00 59.36  ? 345  SER A N   1 
ATOM 2701 C CA  . SER A 1 348  ? 1.544   67.704 48.971  1.00 59.36  ? 345  SER A CA  1 
ATOM 2702 C C   . SER A 1 348  ? 2.127   68.847 48.147  1.00 59.36  ? 345  SER A C   1 
ATOM 2703 O O   . SER A 1 348  ? 1.587   69.211 47.103  1.00 59.36  ? 345  SER A O   1 
ATOM 2704 C CB  . SER A 1 348  ? 0.824   66.710 48.057  1.00 51.90  ? 345  SER A CB  1 
ATOM 2705 O OG  . SER A 1 348  ? 1.695   66.218 47.053  1.00 51.90  ? 345  SER A OG  1 
ATOM 2706 N N   . TYR A 1 349  ? 3.234   69.408 48.623  1.00 61.33  ? 346  TYR A N   1 
ATOM 2707 C CA  . TYR A 1 349  ? 3.895   70.510 47.930  1.00 61.33  ? 346  TYR A CA  1 
ATOM 2708 C C   . TYR A 1 349  ? 4.286   70.117 46.488  1.00 61.33  ? 346  TYR A C   1 
ATOM 2709 O O   . TYR A 1 349  ? 4.966   70.859 45.784  1.00 61.33  ? 346  TYR A O   1 
ATOM 2710 C CB  . TYR A 1 349  ? 5.108   70.983 48.750  1.00 71.39  ? 346  TYR A CB  1 
ATOM 2711 C CG  . TYR A 1 349  ? 4.781   71.347 50.191  1.00 71.39  ? 346  TYR A CG  1 
ATOM 2712 C CD1 . TYR A 1 349  ? 4.708   70.373 51.183  1.00 71.39  ? 346  TYR A CD1 1 
ATOM 2713 C CD2 . TYR A 1 349  ? 4.545   72.666 50.554  1.00 71.39  ? 346  TYR A CD2 1 
ATOM 2714 C CE1 . TYR A 1 349  ? 4.403   70.707 52.498  1.00 71.39  ? 346  TYR A CE1 1 
ATOM 2715 C CE2 . TYR A 1 349  ? 4.238   73.018 51.864  1.00 71.39  ? 346  TYR A CE2 1 
ATOM 2716 C CZ  . TYR A 1 349  ? 4.164   72.040 52.834  1.00 71.39  ? 346  TYR A CZ  1 
ATOM 2717 O OH  . TYR A 1 349  ? 3.851   72.392 54.138  1.00 71.39  ? 346  TYR A OH  1 
ATOM 2718 N N   . VAL A 1 350  ? 3.817   68.956 46.046  1.00 70.04  ? 347  VAL A N   1 
ATOM 2719 C CA  . VAL A 1 350  ? 4.229   68.374 44.776  1.00 70.04  ? 347  VAL A CA  1 
ATOM 2720 C C   . VAL A 1 350  ? 3.056   68.286 43.838  1.00 70.04  ? 347  VAL A C   1 
ATOM 2721 O O   . VAL A 1 350  ? 1.996   67.812 44.211  1.00 70.04  ? 347  VAL A O   1 
ATOM 2722 C CB  . VAL A 1 350  ? 4.798   66.952 44.987  1.00 76.05  ? 347  VAL A CB  1 
ATOM 2723 C CG1 . VAL A 1 350  ? 4.931   66.211 43.669  1.00 76.05  ? 347  VAL A CG1 1 
ATOM 2724 C CG2 . VAL A 1 350  ? 6.129   67.011 45.705  1.00 76.05  ? 347  VAL A CG2 1 
ATOM 2725 N N   . VAL A 1 351  ? 3.250   68.748 42.616  1.00 58.85  ? 348  VAL A N   1 
ATOM 2726 C CA  . VAL A 1 351  ? 2.227   68.608 41.589  1.00 58.85  ? 348  VAL A CA  1 
ATOM 2727 C C   . VAL A 1 351  ? 2.834   68.072 40.295  1.00 58.85  ? 348  VAL A C   1 
ATOM 2728 O O   . VAL A 1 351  ? 3.856   68.583 39.828  1.00 58.85  ? 348  VAL A O   1 
ATOM 2729 C CB  . VAL A 1 351  ? 1.531   69.968 41.269  1.00 49.89  ? 348  VAL A CB  1 
ATOM 2730 C CG1 . VAL A 1 351  ? 0.538   69.821 40.062  1.00 49.89  ? 348  VAL A CG1 1 
ATOM 2731 C CG2 . VAL A 1 351  ? 0.851   70.555 42.518  1.00 49.89  ? 348  VAL A CG2 1 
ATOM 2732 N N   . ALA A 1 352  ? 2.192   67.064 39.704  1.00 40.61  ? 349  ALA A N   1 
ATOM 2733 C CA  . ALA A 1 352  ? 2.636   66.516 38.420  1.00 40.61  ? 349  ALA A CA  1 
ATOM 2734 C C   . ALA A 1 352  ? 2.265   67.413 37.275  1.00 40.61  ? 349  ALA A C   1 
ATOM 2735 O O   . ALA A 1 352  ? 1.107   67.732 37.134  1.00 40.61  ? 349  ALA A O   1 
ATOM 2736 C CB  . ALA A 1 352  ? 2.010   65.143 38.187  1.00 19.25  ? 349  ALA A CB  1 
ATOM 2737 N N   . MET A 1 353  ? 3.231   67.776 36.442  1.00 69.15  ? 350  MET A N   1 
ATOM 2738 C CA  . MET A 1 353  ? 2.959   68.523 35.223  1.00 69.15  ? 350  MET A CA  1 
ATOM 2739 C C   . MET A 1 353  ? 2.809   67.600 34.037  1.00 69.15  ? 350  MET A C   1 
ATOM 2740 O O   . MET A 1 353  ? 1.793   67.628 33.360  1.00 69.15  ? 350  MET A O   1 
ATOM 2741 C CB  . MET A 1 353  ? 4.064   69.523 34.957  1.00 65.08  ? 350  MET A CB  1 
ATOM 2742 C CG  . MET A 1 353  ? 4.240   70.536 36.086  1.00 65.08  ? 350  MET A CG  1 
ATOM 2743 S SD  . MET A 1 353  ? 5.931   71.174 36.188  1.00 65.08  ? 350  MET A SD  1 
ATOM 2744 C CE  . MET A 1 353  ? 6.181   71.935 34.541  1.00 65.08  ? 350  MET A CE  1 
ATOM 2745 N N   . GLU A 1 354  ? 3.821   66.785 33.777  1.00 69.77  ? 351  GLU A N   1 
ATOM 2746 C CA  . GLU A 1 354  ? 3.717   65.820 32.694  1.00 69.77  ? 351  GLU A CA  1 
ATOM 2747 C C   . GLU A 1 354  ? 3.994   64.411 33.169  1.00 69.77  ? 351  GLU A C   1 
ATOM 2748 O O   . GLU A 1 354  ? 4.318   64.198 34.330  1.00 69.77  ? 351  GLU A O   1 
ATOM 2749 C CB  . GLU A 1 354  ? 4.611   66.191 31.509  1.00 83.78  ? 351  GLU A CB  1 
ATOM 2750 C CG  . GLU A 1 354  ? 3.926   65.910 30.174  1.00 83.78  ? 351  GLU A CG  1 
ATOM 2751 C CD  . GLU A 1 354  ? 4.865   65.997 28.983  1.00 83.78  ? 351  GLU A CD  1 
ATOM 2752 O OE1 . GLU A 1 354  ? 5.608   67.009 28.851  1.00 83.78  ? 351  GLU A OE1 1 
ATOM 2753 O OE2 . GLU A 1 354  ? 4.843   65.044 28.168  1.00 83.78  ? 351  GLU A OE2 1 
ATOM 2754 N N   . THR A 1 355  ? 3.866   63.459 32.253  1.00 43.29  ? 352  THR A N   1 
ATOM 2755 C CA  . THR A 1 355  ? 3.831   62.062 32.610  1.00 43.29  ? 352  THR A CA  1 
ATOM 2756 C C   . THR A 1 355  ? 4.152   61.166 31.404  1.00 43.29  ? 352  THR A C   1 
ATOM 2757 O O   . THR A 1 355  ? 3.371   61.005 30.453  1.00 43.29  ? 352  THR A O   1 
ATOM 2758 C CB  . THR A 1 355  ? 2.493   61.724 33.300  1.00 46.03  ? 352  THR A CB  1 
ATOM 2759 O OG1 . THR A 1 355  ? 2.688   61.771 34.711  1.00 46.03  ? 352  THR A OG1 1 
ATOM 2760 C CG2 . THR A 1 355  ? 1.996   60.361 32.938  1.00 46.03  ? 352  THR A CG2 1 
ATOM 2761 N N   . PHE A 1 356  ? 5.324   60.567 31.461  1.00 54.06  ? 353  PHE A N   1 
ATOM 2762 C CA  . PHE A 1 356  ? 5.831   59.847 30.329  1.00 54.06  ? 353  PHE A CA  1 
ATOM 2763 C C   . PHE A 1 356  ? 5.674   58.341 30.517  1.00 54.06  ? 353  PHE A C   1 
ATOM 2764 O O   . PHE A 1 356  ? 6.061   57.782 31.541  1.00 54.06  ? 353  PHE A O   1 
ATOM 2765 C CB  . PHE A 1 356  ? 7.289   60.218 30.149  1.00 47.36  ? 353  PHE A CB  1 
ATOM 2766 C CG  . PHE A 1 356  ? 7.571   61.688 30.282  1.00 47.36  ? 353  PHE A CG  1 
ATOM 2767 C CD1 . PHE A 1 356  ? 8.077   62.203 31.472  1.00 47.36  ? 353  PHE A CD1 1 
ATOM 2768 C CD2 . PHE A 1 356  ? 7.369   62.543 29.208  1.00 47.36  ? 353  PHE A CD2 1 
ATOM 2769 C CE1 . PHE A 1 356  ? 8.369   63.556 31.593  1.00 47.36  ? 353  PHE A CE1 1 
ATOM 2770 C CE2 . PHE A 1 356  ? 7.634   63.885 29.311  1.00 47.36  ? 353  PHE A CE2 1 
ATOM 2771 C CZ  . PHE A 1 356  ? 8.133   64.403 30.498  1.00 47.36  ? 353  PHE A CZ  1 
ATOM 2772 N N   . THR A 1 357  ? 5.113   57.697 29.504  1.00 50.83  ? 354  THR A N   1 
ATOM 2773 C CA  . THR A 1 357  ? 4.733   56.294 29.564  1.00 50.83  ? 354  THR A CA  1 
ATOM 2774 C C   . THR A 1 357  ? 5.934   55.426 29.562  1.00 50.83  ? 354  THR A C   1 
ATOM 2775 O O   . THR A 1 357  ? 6.748   55.515 28.659  1.00 50.83  ? 354  THR A O   1 
ATOM 2776 C CB  . THR A 1 357  ? 3.941   55.915 28.336  1.00 54.95  ? 354  THR A CB  1 
ATOM 2777 O OG1 . THR A 1 357  ? 4.371   56.733 27.232  1.00 54.95  ? 354  THR A OG1 1 
ATOM 2778 C CG2 . THR A 1 357  ? 2.452   56.160 28.590  1.00 54.95  ? 354  THR A CG2 1 
ATOM 2779 N N   . ASN A 1 358  ? 6.041   54.589 30.586  1.00 39.77  ? 355  ASN A N   1 
ATOM 2780 C CA  . ASN A 1 358  ? 7.173   53.670 30.782  1.00 39.77  ? 355  ASN A CA  1 
ATOM 2781 C C   . ASN A 1 358  ? 6.625   52.277 30.821  1.00 39.77  ? 355  ASN A C   1 
ATOM 2782 O O   . ASN A 1 358  ? 5.984   51.945 31.817  1.00 39.77  ? 355  ASN A O   1 
ATOM 2783 C CB  . ASN A 1 358  ? 7.872   53.936 32.136  1.00 39.44  ? 355  ASN A CB  1 
ATOM 2784 C CG  . ASN A 1 358  ? 8.958   52.882 32.465  1.00 39.44  ? 355  ASN A CG  1 
ATOM 2785 O OD1 . ASN A 1 358  ? 9.212   51.980 31.668  1.00 39.44  ? 355  ASN A OD1 1 
ATOM 2786 N ND2 . ASN A 1 358  ? 9.598   53.001 33.639  1.00 39.44  ? 355  ASN A ND2 1 
ATOM 2787 N N   . LEU A 1 359  ? 6.865   51.442 29.808  1.00 41.64  ? 356  LEU A N   1 
ATOM 2788 C CA  . LEU A 1 359  ? 6.397   50.030 29.908  1.00 41.64  ? 356  LEU A CA  1 
ATOM 2789 C C   . LEU A 1 359  ? 7.098   49.197 30.978  1.00 41.64  ? 356  LEU A C   1 
ATOM 2790 O O   . LEU A 1 359  ? 6.884   47.976 31.037  1.00 41.64  ? 356  LEU A O   1 
ATOM 2791 C CB  . LEU A 1 359  ? 6.379   49.288 28.580  1.00 31.19  ? 356  LEU A CB  1 
ATOM 2792 C CG  . LEU A 1 359  ? 5.660   50.102 27.496  1.00 31.19  ? 356  LEU A CG  1 
ATOM 2793 C CD1 . LEU A 1 359  ? 5.826   49.482 26.101  1.00 31.19  ? 356  LEU A CD1 1 
ATOM 2794 C CD2 . LEU A 1 359  ? 4.154   50.339 27.852  1.00 31.19  ? 356  LEU A CD2 1 
ATOM 2795 N N   . GLY A 1 360  ? 7.920   49.896 31.785  1.00 82.63  ? 357  GLY A N   1 
ATOM 2796 C CA  . GLY A 1 360  ? 8.313   49.537 33.153  1.00 82.63  ? 357  GLY A CA  1 
ATOM 2797 C C   . GLY A 1 360  ? 9.064   48.273 33.055  1.00 82.63  ? 357  GLY A C   1 
ATOM 2798 O O   . GLY A 1 360  ? 9.563   47.976 31.992  1.00 82.63  ? 357  GLY A O   1 
ATOM 2799 N N   . PRO A 1 361  ? 9.190   47.530 34.154  1.00 47.63  ? 358  PRO A N   1 
ATOM 2800 C CA  . PRO A 1 361  ? 9.447   46.104 33.956  1.00 47.63  ? 358  PRO A CA  1 
ATOM 2801 C C   . PRO A 1 361  ? 8.245   45.482 33.249  1.00 47.63  ? 358  PRO A C   1 
ATOM 2802 O O   . PRO A 1 361  ? 7.144   45.694 33.687  1.00 47.63  ? 358  PRO A O   1 
ATOM 2803 C CB  . PRO A 1 361  ? 9.567   45.547 35.381  1.00 34.58  ? 358  PRO A CB  1 
ATOM 2804 C CG  . PRO A 1 361  ? 9.644   46.673 36.279  1.00 34.58  ? 358  PRO A CG  1 
ATOM 2805 C CD  . PRO A 1 361  ? 9.192   47.915 35.568  1.00 34.58  ? 358  PRO A CD  1 
ATOM 2806 N N   . ILE A 1 362  ? 8.446   44.786 32.142  1.00 37.18  ? 359  ILE A N   1 
ATOM 2807 C CA  . ILE A 1 362  ? 7.407   43.939 31.586  1.00 37.18  ? 359  ILE A CA  1 
ATOM 2808 C C   . ILE A 1 362  ? 7.610   42.525 32.143  1.00 37.18  ? 359  ILE A C   1 
ATOM 2809 O O   . ILE A 1 362  ? 8.382   41.733 31.590  1.00 37.18  ? 359  ILE A O   1 
ATOM 2810 C CB  . ILE A 1 362  ? 7.490   43.843 30.067  1.00 32.45  ? 359  ILE A CB  1 
ATOM 2811 C CG1 . ILE A 1 362  ? 7.554   45.245 29.452  1.00 32.45  ? 359  ILE A CG1 1 
ATOM 2812 C CG2 . ILE A 1 362  ? 6.382   42.938 29.514  1.00 32.45  ? 359  ILE A CG2 1 
ATOM 2813 C CD1 . ILE A 1 362  ? 7.358   45.277 27.955  1.00 32.45  ? 359  ILE A CD1 1 
ATOM 2814 N N   . VAL A 1 363  ? 6.891   42.224 33.227  1.00 47.20  ? 360  VAL A N   1 
ATOM 2815 C CA  . VAL A 1 363  ? 7.025   40.991 33.997  1.00 47.20  ? 360  VAL A CA  1 
ATOM 2816 C C   . VAL A 1 363  ? 6.439   39.762 33.306  1.00 47.20  ? 360  VAL A C   1 
ATOM 2817 O O   . VAL A 1 363  ? 6.965   38.647 33.477  1.00 47.20  ? 360  VAL A O   1 
ATOM 2818 C CB  . VAL A 1 363  ? 6.349   41.172 35.330  1.00 52.28  ? 360  VAL A CB  1 
ATOM 2819 C CG1 . VAL A 1 363  ? 6.084   39.837 35.991  1.00 52.28  ? 360  VAL A CG1 1 
ATOM 2820 C CG2 . VAL A 1 363  ? 7.212   42.034 36.209  1.00 52.28  ? 360  VAL A CG2 1 
ATOM 2821 N N   . ASP A 1 364  ? 5.348   39.975 32.564  1.00 38.40  ? 361  ASP A N   1 
ATOM 2822 C CA  . ASP A 1 364  ? 4.722   38.981 31.706  1.00 38.40  ? 361  ASP A CA  1 
ATOM 2823 C C   . ASP A 1 364  ? 3.868   39.743 30.703  1.00 38.40  ? 361  ASP A C   1 
ATOM 2824 O O   . ASP A 1 364  ? 3.618   40.936 30.886  1.00 38.40  ? 361  ASP A O   1 
ATOM 2825 C CB  . ASP A 1 364  ? 3.842   38.008 32.504  1.00 59.11  ? 361  ASP A CB  1 
ATOM 2826 C CG  . ASP A 1 364  ? 3.255   36.856 31.623  1.00 59.11  ? 361  ASP A CG  1 
ATOM 2827 O OD1 . ASP A 1 364  ? 2.378   36.079 32.118  1.00 59.11  ? 361  ASP A OD1 1 
ATOM 2828 O OD2 . ASP A 1 364  ? 3.668   36.725 30.436  1.00 59.11  ? 361  ASP A OD2 1 
ATOM 2829 N N   . MET A 1 365  ? 3.419   39.083 29.643  1.00 37.87  ? 362  MET A N   1 
ATOM 2830 C CA  . MET A 1 365  ? 2.579   39.749 28.674  1.00 37.87  ? 362  MET A CA  1 
ATOM 2831 C C   . MET A 1 365  ? 1.849   38.711 27.839  1.00 37.87  ? 362  MET A C   1 
ATOM 2832 O O   . MET A 1 365  ? 1.979   37.527 28.128  1.00 37.87  ? 362  MET A O   1 
ATOM 2833 C CB  . MET A 1 365  ? 3.426   40.671 27.812  1.00 49.82  ? 362  MET A CB  1 
ATOM 2834 C CG  . MET A 1 365  ? 4.380   39.933 26.876  1.00 49.82  ? 362  MET A CG  1 
ATOM 2835 S SD  . MET A 1 365  ? 5.590   41.006 26.052  1.00 49.82  ? 362  MET A SD  1 
ATOM 2836 C CE  . MET A 1 365  ? 5.848   40.025 24.573  1.00 49.82  ? 362  MET A CE  1 
ATOM 2837 N N   . CYS A 1 366  ? 1.044   39.127 26.853  1.00 50.25  ? 363  CYS A N   1 
ATOM 2838 C CA  . CYS A 1 366  ? 0.464   38.187 25.845  1.00 50.25  ? 363  CYS A CA  1 
ATOM 2839 C C   . CYS A 1 366  ? -0.249  38.913 24.713  1.00 50.25  ? 363  CYS A C   1 
ATOM 2840 O O   . CYS A 1 366  ? -0.406  40.145 24.787  1.00 50.25  ? 363  CYS A O   1 
ATOM 2841 C CB  . CYS A 1 366  ? -0.476  37.155 26.480  1.00 50.65  ? 363  CYS A CB  1 
ATOM 2842 S SG  . CYS A 1 366  ? -2.140  37.795 26.847  1.00 50.65  ? 363  CYS A SG  1 
ATOM 2843 N N   . VAL A 1 367  ? -0.671  38.178 23.690  1.00 58.92  ? 364  VAL A N   1 
ATOM 2844 C CA  . VAL A 1 367  ? -1.363  38.773 22.553  1.00 58.92  ? 364  VAL A CA  1 
ATOM 2845 C C   . VAL A 1 367  ? -2.873  38.584 22.660  1.00 58.92  ? 364  VAL A C   1 
ATOM 2846 O O   . VAL A 1 367  ? -3.349  37.714 23.389  1.00 58.92  ? 364  VAL A O   1 
ATOM 2847 C CB  . VAL A 1 367  ? -0.875  38.176 21.219  1.00 50.14  ? 364  VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 367  ? -1.661  38.763 20.057  1.00 50.14  ? 364  VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 367  ? 0.616   38.423 21.043  1.00 50.14  ? 364  VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 368  ? -3.620  39.405 21.929  1.00 82.35  ? 365  VAL A N   1 
ATOM 2851 C CA  . VAL A 1 368  ? -5.076  39.331 21.940  1.00 82.35  ? 365  VAL A CA  1 
ATOM 2852 C C   . VAL A 1 368  ? -5.682  40.251 20.886  1.00 82.35  ? 365  VAL A C   1 
ATOM 2853 O O   . VAL A 1 368  ? -5.379  41.444 20.842  1.00 82.35  ? 365  VAL A O   1 
ATOM 2854 C CB  . VAL A 1 368  ? -5.650  39.699 23.321  1.00 48.75  ? 365  VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 368  ? -7.170  39.684 23.285  1.00 48.75  ? 365  VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 368  ? -5.125  38.746 24.384  1.00 48.75  ? 365  VAL A CG2 1 
ATOM 2857 N N   . ASP A 1 369  ? -6.603  39.717 20.077  1.00 130.75 ? 366  ASP A N   1 
ATOM 2858 C CA  . ASP A 1 369  ? -7.252  40.485 19.022  1.00 130.75 ? 366  ASP A CA  1 
ATOM 2859 C C   . ASP A 1 369  ? -8.503  41.187 19.539  1.00 130.75 ? 366  ASP A C   1 
ATOM 2860 O O   . ASP A 1 369  ? -9.395  41.486 18.703  1.00 130.75 ? 366  ASP A O   1 
ATOM 2861 C CB  . ASP A 1 369  ? -7.607  39.580 17.840  1.00 84.09  ? 366  ASP A CB  1 
ATOM 2862 C CG  . ASP A 1 369  ? -6.385  39.126 17.067  1.00 84.09  ? 366  ASP A CG  1 
ATOM 2863 O OD1 . ASP A 1 369  ? -5.304  39.722 17.255  1.00 84.09  ? 366  ASP A OD1 1 
ATOM 2864 O OD2 . ASP A 1 369  ? -6.506  38.172 16.269  1.00 84.09  ? 366  ASP A OD2 1 
ATOM 2865 N N   . LEU A 1 370  ? -8.431  41.506 20.784  1.00 128.33 ? 367  LEU A N   1 
ATOM 2866 C CA  . LEU A 1 370  ? -9.564  42.183 21.403  1.00 128.33 ? 367  LEU A CA  1 
ATOM 2867 C C   . LEU A 1 370  ? -10.760 42.229 20.457  1.00 128.33 ? 367  LEU A C   1 
ATOM 2868 O O   . LEU A 1 370  ? -11.572 41.305 20.421  1.00 128.33 ? 367  LEU A O   1 
ATOM 2869 C CB  . LEU A 1 370  ? -9.176  43.600 21.829  1.00 93.64  ? 367  LEU A CB  1 
ATOM 2870 C CG  . LEU A 1 370  ? -8.004  43.716 22.806  1.00 93.64  ? 367  LEU A CG  1 
ATOM 2871 C CD1 . LEU A 1 370  ? -7.844  45.151 23.286  1.00 93.64  ? 367  LEU A CD1 1 
ATOM 2872 C CD2 . LEU A 1 370  ? -8.188  42.770 23.983  1.00 93.64  ? 367  LEU A CD2 1 
ATOM 2873 N N   . GLU A 1 371  ? -10.860 43.311 19.691  1.00 149.99 ? 368  GLU A N   1 
ATOM 2874 C CA  . GLU A 1 371  ? -11.953 43.478 18.741  1.00 149.99 ? 368  GLU A CA  1 
ATOM 2875 C C   . GLU A 1 371  ? -11.923 42.392 17.671  1.00 149.99 ? 368  GLU A C   1 
ATOM 2876 O O   . GLU A 1 371  ? -12.434 42.582 16.567  1.00 149.99 ? 368  GLU A O   1 
ATOM 2877 C CB  . GLU A 1 371  ? -11.891 44.861 18.089  1.00 151.11 ? 368  GLU A CB  1 
ATOM 2878 C CG  . GLU A 1 371  ? -10.613 45.125 17.309  1.00 151.11 ? 368  GLU A CG  1 
ATOM 2879 C CD  . GLU A 1 371  ? -9.383  45.154 18.195  1.00 151.11 ? 368  GLU A CD  1 
ATOM 2880 O OE1 . GLU A 1 371  ? -9.541  45.177 19.434  1.00 151.11 ? 368  GLU A OE1 1 
ATOM 2881 O OE2 . GLU A 1 371  ? -8.258  45.157 17.652  1.00 151.11 ? 368  GLU A OE2 1 
ATOM 2882 N N   . ARG A 1 372  ? -11.464 41.259 17.911  1.00 190.63 ? 369  ARG A N   1 
ATOM 2883 C CA  . ARG A 1 372  ? -11.225 40.138 17.073  1.00 190.63 ? 369  ARG A CA  1 
ATOM 2884 C C   . ARG A 1 372  ? -11.176 40.630 15.630  1.00 190.63 ? 369  ARG A C   1 
ATOM 2885 O O   . ARG A 1 372  ? -12.208 40.750 14.970  1.00 190.63 ? 369  ARG A O   1 
ATOM 2886 C CB  . ARG A 1 372  ? -12.403 39.180 17.261  1.00 135.45 ? 369  ARG A CB  1 
ATOM 2887 C CG  . ARG A 1 372  ? -12.383 37.980 16.328  1.00 135.45 ? 369  ARG A CG  1 
ATOM 2888 C CD  . ARG A 1 372  ? -13.591 37.086 16.552  1.00 135.45 ? 369  ARG A CD  1 
ATOM 2889 N NE  . ARG A 1 372  ? -13.650 36.578 17.920  1.00 135.45 ? 369  ARG A NE  1 
ATOM 2890 C CZ  . ARG A 1 372  ? -14.608 35.780 18.380  1.00 135.45 ? 369  ARG A CZ  1 
ATOM 2891 N NH1 . ARG A 1 372  ? -15.593 35.394 17.581  1.00 135.45 ? 369  ARG A NH1 1 
ATOM 2892 N NH2 . ARG A 1 372  ? -14.582 35.367 19.640  1.00 135.45 ? 369  ARG A NH2 1 
ATOM 2893 N N   . GLN A 1 373  ? -9.971  40.915 15.148  1.00 132.99 ? 370  GLN A N   1 
ATOM 2894 C CA  . GLN A 1 373  ? -9.787  41.397 13.782  1.00 132.99 ? 370  GLN A CA  1 
ATOM 2895 C C   . GLN A 1 373  ? -8.841  40.545 12.958  1.00 132.99 ? 370  GLN A C   1 
ATOM 2896 O O   . GLN A 1 373  ? -9.254  39.737 12.130  1.00 132.99 ? 370  GLN A O   1 
ATOM 2897 C CB  . GLN A 1 373  ? -9.227  42.814 13.788  1.00 108.37 ? 370  GLN A CB  1 
ATOM 2898 C CG  . GLN A 1 373  ? -9.848  43.766 14.771  1.00 108.37 ? 370  GLN A CG  1 
ATOM 2899 C CD  . GLN A 1 373  ? -9.349  45.181 14.556  1.00 108.37 ? 370  GLN A CD  1 
ATOM 2900 O OE1 . GLN A 1 373  ? -8.580  45.446 13.622  1.00 108.37 ? 370  GLN A OE1 1 
ATOM 2901 N NE2 . GLN A 1 373  ? -9.787  46.102 15.411  1.00 108.37 ? 370  GLN A NE2 1 
ATOM 2902 N N   . GLY A 1 374  ? -7.556  40.763 13.189  1.00 73.39  ? 371  GLY A N   1 
ATOM 2903 C CA  . GLY A 1 374  ? -6.502  40.198 12.368  1.00 73.39  ? 371  GLY A CA  1 
ATOM 2904 C C   . GLY A 1 374  ? -5.149  40.770 12.764  1.00 73.39  ? 371  GLY A C   1 
ATOM 2905 O O   . GLY A 1 374  ? -4.101  40.159 12.498  1.00 73.39  ? 371  GLY A O   1 
ATOM 2906 N N   . GLN A 1 375  ? -5.170  41.957 13.367  1.00 92.04  ? 372  GLN A N   1 
ATOM 2907 C CA  . GLN A 1 375  ? -4.013  42.456 14.067  1.00 92.04  ? 372  GLN A CA  1 
ATOM 2908 C C   . GLN A 1 375  ? -4.093  41.916 15.487  1.00 92.04  ? 372  GLN A C   1 
ATOM 2909 O O   . GLN A 1 375  ? -5.165  41.549 15.965  1.00 92.04  ? 372  GLN A O   1 
ATOM 2910 C CB  . GLN A 1 375  ? -3.943  43.988 14.037  1.00 123.17 ? 372  GLN A CB  1 
ATOM 2911 C CG  . GLN A 1 375  ? -5.268  44.702 14.235  1.00 123.17 ? 372  GLN A CG  1 
ATOM 2912 C CD  . GLN A 1 375  ? -5.786  44.630 15.664  1.00 123.17 ? 372  GLN A CD  1 
ATOM 2913 O OE1 . GLN A 1 375  ? -5.407  45.434 16.514  1.00 123.17 ? 372  GLN A OE1 1 
ATOM 2914 N NE2 . GLN A 1 375  ? -6.672  43.675 15.927  1.00 123.17 ? 372  GLN A NE2 1 
ATOM 2915 N N   . GLY A 1 376  ? -2.943  41.822 16.137  1.00 94.05  ? 373  GLY A N   1 
ATOM 2916 C CA  . GLY A 1 376  ? -2.893  41.529 17.550  1.00 94.05  ? 373  GLY A CA  1 
ATOM 2917 C C   . GLY A 1 376  ? -2.734  42.842 18.267  1.00 94.05  ? 373  GLY A C   1 
ATOM 2918 O O   . GLY A 1 376  ? -2.117  43.766 17.754  1.00 94.05  ? 373  GLY A O   1 
ATOM 2919 N N   . GLN A 1 377  ? -3.352  42.944 19.428  1.00 50.30  ? 374  GLN A N   1 
ATOM 2920 C CA  . GLN A 1 377  ? -3.005  43.970 20.388  1.00 50.30  ? 374  GLN A CA  1 
ATOM 2921 C C   . GLN A 1 377  ? -2.057  43.252 21.323  1.00 50.30  ? 374  GLN A C   1 
ATOM 2922 O O   . GLN A 1 377  ? -1.955  42.022 21.296  1.00 50.30  ? 374  GLN A O   1 
ATOM 2923 C CB  . GLN A 1 377  ? -4.224  44.415 21.185  1.00 94.77  ? 374  GLN A CB  1 
ATOM 2924 C CG  . GLN A 1 377  ? -5.354  44.994 20.378  1.00 94.77  ? 374  GLN A CG  1 
ATOM 2925 C CD  . GLN A 1 377  ? -5.520  46.486 20.572  1.00 94.77  ? 374  GLN A CD  1 
ATOM 2926 O OE1 . GLN A 1 377  ? -6.137  47.153 19.752  1.00 94.77  ? 374  GLN A OE1 1 
ATOM 2927 N NE2 . GLN A 1 377  ? -4.985  47.016 21.658  1.00 94.77  ? 374  GLN A NE2 1 
ATOM 2928 N N   . LEU A 1 378  ? -1.374  43.996 22.174  1.00 59.91  ? 375  LEU A N   1 
ATOM 2929 C CA  . LEU A 1 378  ? -0.523  43.356 23.152  1.00 59.91  ? 375  LEU A CA  1 
ATOM 2930 C C   . LEU A 1 378  ? -0.858  43.827 24.557  1.00 59.91  ? 375  LEU A C   1 
ATOM 2931 O O   . LEU A 1 378  ? -1.131  45.013 24.763  1.00 59.91  ? 375  LEU A O   1 
ATOM 2932 C CB  . LEU A 1 378  ? 0.929   43.663 22.837  1.00 46.90  ? 375  LEU A CB  1 
ATOM 2933 C CG  . LEU A 1 378  ? 1.844   42.663 23.509  1.00 46.90  ? 375  LEU A CG  1 
ATOM 2934 C CD1 . LEU A 1 378  ? 1.829   41.393 22.689  1.00 46.90  ? 375  LEU A CD1 1 
ATOM 2935 C CD2 . LEU A 1 378  ? 3.205   43.261 23.618  1.00 46.90  ? 375  LEU A CD2 1 
ATOM 2936 N N   . VAL A 1 379  ? -0.818  42.918 25.527  1.00 53.57  ? 376  VAL A N   1 
ATOM 2937 C CA  . VAL A 1 379  ? -1.226  43.295 26.876  1.00 53.57  ? 376  VAL A CA  1 
ATOM 2938 C C   . VAL A 1 379  ? -0.193  42.845 27.895  1.00 53.57  ? 376  VAL A C   1 
ATOM 2939 O O   . VAL A 1 379  ? 0.113   41.660 27.978  1.00 53.57  ? 376  VAL A O   1 
ATOM 2940 C CB  . VAL A 1 379  ? -2.615  42.685 27.256  1.00 38.38  ? 376  VAL A CB  1 
ATOM 2941 C CG1 . VAL A 1 379  ? -3.299  43.538 28.300  1.00 38.38  ? 376  VAL A CG1 1 
ATOM 2942 C CG2 . VAL A 1 379  ? -3.527  42.515 26.019  1.00 38.38  ? 376  VAL A CG2 1 
ATOM 2943 N N   . THR A 1 380  ? 0.298   43.777 28.703  1.00 48.65  ? 377  THR A N   1 
ATOM 2944 C CA  . THR A 1 380  ? 1.512   43.559 29.471  1.00 48.65  ? 377  THR A CA  1 
ATOM 2945 C C   . THR A 1 380  ? 1.303   43.808 30.931  1.00 48.65  ? 377  THR A C   1 
ATOM 2946 O O   . THR A 1 380  ? 0.709   44.811 31.271  1.00 48.65  ? 377  THR A O   1 
ATOM 2947 C CB  . THR A 1 380  ? 2.580   44.623 29.088  1.00 29.12  ? 377  THR A CB  1 
ATOM 2948 O OG1 . THR A 1 380  ? 2.029   45.938 29.315  1.00 29.12  ? 377  THR A OG1 1 
ATOM 2949 C CG2 . THR A 1 380  ? 3.094   44.467 27.619  1.00 29.12  ? 377  THR A CG2 1 
ATOM 2950 N N   . CYS A 1 381  ? 1.852   42.959 31.798  1.00 33.39  ? 378  CYS A N   1 
ATOM 2951 C CA  . CYS A 1 381  ? 1.924   43.292 33.231  1.00 33.39  ? 378  CYS A CA  1 
ATOM 2952 C C   . CYS A 1 381  ? 3.150   44.150 33.435  1.00 33.39  ? 378  CYS A C   1 
ATOM 2953 O O   . CYS A 1 381  ? 4.189   43.782 32.922  1.00 33.39  ? 378  CYS A O   1 
ATOM 2954 C CB  . CYS A 1 381  ? 2.028   42.038 34.093  1.00 43.29  ? 378  CYS A CB  1 
ATOM 2955 S SG  . CYS A 1 381  ? 0.799   40.778 33.671  1.00 43.29  ? 378  CYS A SG  1 
ATOM 2956 N N   . SER A 1 382  ? 3.048   45.260 34.178  1.00 42.60  ? 379  SER A N   1 
ATOM 2957 C CA  . SER A 1 382  ? 4.096   46.262 34.193  1.00 42.60  ? 379  SER A CA  1 
ATOM 2958 C C   . SER A 1 382  ? 4.175   46.982 35.485  1.00 42.60  ? 379  SER A C   1 
ATOM 2959 O O   . SER A 1 382  ? 3.204   47.019 36.243  1.00 42.60  ? 379  SER A O   1 
ATOM 2960 C CB  . SER A 1 382  ? 3.878   47.281 33.095  1.00 44.40  ? 379  SER A CB  1 
ATOM 2961 O OG  . SER A 1 382  ? 3.352   46.638 31.969  1.00 44.40  ? 379  SER A OG  1 
ATOM 2962 N N   . GLY A 1 383  ? 5.337   47.583 35.724  1.00 36.59  ? 380  GLY A N   1 
ATOM 2963 C CA  . GLY A 1 383  ? 5.598   48.237 36.970  1.00 36.59  ? 380  GLY A CA  1 
ATOM 2964 C C   . GLY A 1 383  ? 5.703   47.240 38.096  1.00 36.59  ? 380  GLY A C   1 
ATOM 2965 O O   . GLY A 1 383  ? 5.713   46.016 37.886  1.00 36.59  ? 380  GLY A O   1 
ATOM 2966 N N   . ALA A 1 384  ? 5.783   47.781 39.304  1.00 47.50  ? 381  ALA A N   1 
ATOM 2967 C CA  . ALA A 1 384  ? 5.877   47.002 40.512  1.00 47.50  ? 381  ALA A CA  1 
ATOM 2968 C C   . ALA A 1 384  ? 5.242   47.857 41.560  1.00 47.50  ? 381  ALA A C   1 
ATOM 2969 O O   . ALA A 1 384  ? 5.190   49.073 41.411  1.00 47.50  ? 381  ALA A O   1 
ATOM 2970 C CB  . ALA A 1 384  ? 7.298   46.798 40.837  1.00 48.69  ? 381  ALA A CB  1 
ATOM 2971 N N   . PHE A 1 385  ? 4.747   47.237 42.620  1.00 50.68  ? 382  PHE A N   1 
ATOM 2972 C CA  . PHE A 1 385  ? 4.210   48.029 43.718  1.00 50.68  ? 382  PHE A CA  1 
ATOM 2973 C C   . PHE A 1 385  ? 3.199   49.096 43.178  1.00 50.68  ? 382  PHE A C   1 
ATOM 2974 O O   . PHE A 1 385  ? 2.486   48.807 42.225  1.00 50.68  ? 382  PHE A O   1 
ATOM 2975 C CB  . PHE A 1 385  ? 5.372   48.592 44.559  1.00 28.96  ? 382  PHE A CB  1 
ATOM 2976 C CG  . PHE A 1 385  ? 6.600   47.675 44.586  1.00 28.96  ? 382  PHE A CG  1 
ATOM 2977 C CD1 . PHE A 1 385  ? 7.815   48.068 43.991  1.00 28.96  ? 382  PHE A CD1 1 
ATOM 2978 C CD2 . PHE A 1 385  ? 6.546   46.398 45.173  1.00 28.96  ? 382  PHE A CD2 1 
ATOM 2979 C CE1 . PHE A 1 385  ? 8.945   47.214 43.993  1.00 28.96  ? 382  PHE A CE1 1 
ATOM 2980 C CE2 . PHE A 1 385  ? 7.676   45.518 45.159  1.00 28.96  ? 382  PHE A CE2 1 
ATOM 2981 C CZ  . PHE A 1 385  ? 8.868   45.936 44.574  1.00 28.96  ? 382  PHE A CZ  1 
ATOM 2982 N N   . LYS A 1 386  ? 3.113   50.297 43.758  1.00 53.59  ? 383  LYS A N   1 
ATOM 2983 C CA  . LYS A 1 386  ? 2.067   51.225 43.292  1.00 53.59  ? 383  LYS A CA  1 
ATOM 2984 C C   . LYS A 1 386  ? 2.174   51.517 41.772  1.00 53.59  ? 383  LYS A C   1 
ATOM 2985 O O   . LYS A 1 386  ? 1.099   51.617 41.059  1.00 53.59  ? 383  LYS A O   1 
ATOM 2986 C CB  . LYS A 1 386  ? 2.104   52.527 44.080  1.00 34.99  ? 383  LYS A CB  1 
ATOM 2987 C CG  . LYS A 1 386  ? 3.156   53.542 43.642  1.00 34.99  ? 383  LYS A CG  1 
ATOM 2988 C CD  . LYS A 1 386  ? 3.766   54.157 44.895  1.00 34.99  ? 383  LYS A CD  1 
ATOM 2989 C CE  . LYS A 1 386  ? 3.893   55.676 44.757  1.00 34.99  ? 383  LYS A CE  1 
ATOM 2990 N NZ  . LYS A 1 386  ? 4.141   56.197 43.378  1.00 34.99  ? 383  LYS A NZ  1 
ATOM 2991 N N   . GLU A 1 387  ? 3.478   51.564 41.261  1.00 41.80  ? 384  GLU A N   1 
ATOM 2992 C CA  . GLU A 1 387  ? 3.563   51.827 39.815  1.00 41.80  ? 384  GLU A CA  1 
ATOM 2993 C C   . GLU A 1 387  ? 2.947   50.745 38.987  1.00 41.80  ? 384  GLU A C   1 
ATOM 2994 O O   . GLU A 1 387  ? 2.719   50.948 37.750  1.00 41.80  ? 384  GLU A O   1 
ATOM 2995 C CB  . GLU A 1 387  ? 4.994   51.971 39.480  1.00 45.55  ? 384  GLU A CB  1 
ATOM 2996 C CG  . GLU A 1 387  ? 5.791   52.829 40.384  1.00 45.55  ? 384  GLU A CG  1 
ATOM 2997 C CD  . GLU A 1 387  ? 5.029   54.180 40.492  1.00 45.55  ? 384  GLU A CD  1 
ATOM 2998 O OE1 . GLU A 1 387  ? 4.182   54.382 39.500  1.00 45.55  ? 384  GLU A OE1 1 
ATOM 2999 O OE2 . GLU A 1 387  ? 5.248   54.927 41.549  1.00 45.55  ? 384  GLU A OE2 1 
ATOM 3000 N N   . GLY A 1 388  ? 2.681   49.634 39.652  1.00 26.04  ? 385  GLY A N   1 
ATOM 3001 C CA  . GLY A 1 388  ? 2.227   48.418 38.868  1.00 26.04  ? 385  GLY A CA  1 
ATOM 3002 C C   . GLY A 1 388  ? 1.003   48.722 38.009  1.00 26.04  ? 385  GLY A C   1 
ATOM 3003 O O   . GLY A 1 388  ? 0.344   49.726 38.274  1.00 26.04  ? 385  GLY A O   1 
ATOM 3004 N N   . SER A 1 389  ? 0.738   47.840 37.005  1.00 39.03  ? 386  SER A N   1 
ATOM 3005 C CA  . SER A 1 389  ? -0.260  48.194 36.039  1.00 39.03  ? 386  SER A CA  1 
ATOM 3006 C C   . SER A 1 389  ? -0.351  47.291 34.799  1.00 39.03  ? 386  SER A C   1 
ATOM 3007 O O   . SER A 1 389  ? 0.493   46.411 34.663  1.00 39.03  ? 386  SER A O   1 
ATOM 3008 C CB  . SER A 1 389  ? 0.030   49.579 35.471  1.00 44.32  ? 386  SER A CB  1 
ATOM 3009 O OG  . SER A 1 389  ? 0.645   49.514 34.176  1.00 44.32  ? 386  SER A OG  1 
ATOM 3010 N N   . LEU A 1 390  ? -1.354  47.480 33.931  1.00 42.35  ? 387  LEU A N   1 
ATOM 3011 C CA  . LEU A 1 390  ? -1.358  46.807 32.670  1.00 42.35  ? 387  LEU A CA  1 
ATOM 3012 C C   . LEU A 1 390  ? -1.402  47.798 31.546  1.00 42.35  ? 387  LEU A C   1 
ATOM 3013 O O   . LEU A 1 390  ? -2.063  48.848 31.639  1.00 42.35  ? 387  LEU A O   1 
ATOM 3014 C CB  . LEU A 1 390  ? -2.557  45.904 32.339  1.00 28.71  ? 387  LEU A CB  1 
ATOM 3015 C CG  . LEU A 1 390  ? -3.138  44.885 33.353  1.00 28.71  ? 387  LEU A CG  1 
ATOM 3016 C CD1 . LEU A 1 390  ? -4.270  44.049 32.709  1.00 28.71  ? 387  LEU A CD1 1 
ATOM 3017 C CD2 . LEU A 1 390  ? -2.005  43.987 33.935  1.00 28.71  ? 387  LEU A CD2 1 
ATOM 3018 N N   . ARG A 1 391  ? -0.753  47.453 30.434  1.00 48.75  ? 388  ARG A N   1 
ATOM 3019 C CA  . ARG A 1 391  ? -0.646  48.342 29.303  1.00 48.75  ? 388  ARG A CA  1 
ATOM 3020 C C   . ARG A 1 391  ? -1.079  47.614 28.059  1.00 48.75  ? 388  ARG A C   1 
ATOM 3021 O O   . ARG A 1 391  ? -0.633  46.493 27.795  1.00 48.75  ? 388  ARG A O   1 
ATOM 3022 C CB  . ARG A 1 391  ? 0.790   48.806 29.133  1.00 40.25  ? 388  ARG A CB  1 
ATOM 3023 C CG  . ARG A 1 391  ? 1.442   49.336 30.403  1.00 40.25  ? 388  ARG A CG  1 
ATOM 3024 C CD  . ARG A 1 391  ? 1.263   50.816 30.600  1.00 40.25  ? 388  ARG A CD  1 
ATOM 3025 N NE  . ARG A 1 391  ? 1.777   51.222 31.904  1.00 40.25  ? 388  ARG A NE  1 
ATOM 3026 C CZ  . ARG A 1 391  ? 2.258   52.446 32.168  1.00 40.25  ? 388  ARG A CZ  1 
ATOM 3027 N NH1 . ARG A 1 391  ? 2.300   53.391 31.219  1.00 40.25  ? 388  ARG A NH1 1 
ATOM 3028 N NH2 . ARG A 1 391  ? 2.705   52.749 33.393  1.00 40.25  ? 388  ARG A NH2 1 
ATOM 3029 N N   . ILE A 1 392  ? -1.958  48.248 27.286  1.00 59.18  ? 389  ILE A N   1 
ATOM 3030 C CA  . ILE A 1 392  ? -2.426  47.626 26.057  1.00 59.18  ? 389  ILE A CA  1 
ATOM 3031 C C   . ILE A 1 392  ? -1.736  48.298 24.884  1.00 59.18  ? 389  ILE A C   1 
ATOM 3032 O O   . ILE A 1 392  ? -1.657  49.512 24.856  1.00 59.18  ? 389  ILE A O   1 
ATOM 3033 C CB  . ILE A 1 392  ? -3.977  47.632 25.909  1.00 45.34  ? 389  ILE A CB  1 
ATOM 3034 C CG1 . ILE A 1 392  ? -4.660  46.926 27.079  1.00 45.34  ? 389  ILE A CG1 1 
ATOM 3035 C CG2 . ILE A 1 392  ? -4.370  46.801 24.727  1.00 45.34  ? 389  ILE A CG2 1 
ATOM 3036 C CD1 . ILE A 1 392  ? -4.913  47.808 28.292  1.00 45.34  ? 389  ILE A CD1 1 
ATOM 3037 N N   . ILE A 1 393  ? -1.211  47.519 23.939  1.00 62.89  ? 390  ILE A N   1 
ATOM 3038 C CA  . ILE A 1 393  ? -0.397  48.093 22.871  1.00 62.89  ? 390  ILE A CA  1 
ATOM 3039 C C   . ILE A 1 393  ? -0.843  47.663 21.493  1.00 62.89  ? 390  ILE A C   1 
ATOM 3040 O O   . ILE A 1 393  ? -0.911  46.468 21.178  1.00 62.89  ? 390  ILE A O   1 
ATOM 3041 C CB  . ILE A 1 393  ? 1.079   47.722 22.982  1.00 50.68  ? 390  ILE A CB  1 
ATOM 3042 C CG1 . ILE A 1 393  ? 1.370   46.892 24.233  1.00 50.68  ? 390  ILE A CG1 1 
ATOM 3043 C CG2 . ILE A 1 393  ? 1.925   48.967 22.926  1.00 50.68  ? 390  ILE A CG2 1 
ATOM 3044 C CD1 . ILE A 1 393  ? 2.080   47.674 25.333  1.00 50.68  ? 390  ILE A CD1 1 
ATOM 3045 N N   . ARG A 1 394  ? -1.105  48.658 20.658  1.00 53.62  ? 391  ARG A N   1 
ATOM 3046 C CA  . ARG A 1 394  ? -1.763  48.458 19.375  1.00 53.62  ? 391  ARG A CA  1 
ATOM 3047 C C   . ARG A 1 394  ? -0.985  49.219 18.306  1.00 53.62  ? 391  ARG A C   1 
ATOM 3048 O O   . ARG A 1 394  ? -0.686  50.418 18.464  1.00 53.62  ? 391  ARG A O   1 
ATOM 3049 C CB  . ARG A 1 394  ? -3.191  49.002 19.472  1.00 88.38  ? 391  ARG A CB  1 
ATOM 3050 C CG  . ARG A 1 394  ? -4.094  48.731 18.277  1.00 88.38  ? 391  ARG A CG  1 
ATOM 3051 C CD  . ARG A 1 394  ? -4.195  49.898 17.269  1.00 88.38  ? 391  ARG A CD  1 
ATOM 3052 N NE  . ARG A 1 394  ? -4.374  51.229 17.856  1.00 88.38  ? 391  ARG A NE  1 
ATOM 3053 C CZ  . ARG A 1 394  ? -5.447  51.634 18.531  1.00 88.38  ? 391  ARG A CZ  1 
ATOM 3054 N NH1 . ARG A 1 394  ? -6.458  50.809 18.758  1.00 88.38  ? 391  ARG A NH1 1 
ATOM 3055 N NH2 . ARG A 1 394  ? -5.496  52.871 19.002  1.00 88.38  ? 391  ARG A NH2 1 
ATOM 3056 N N   . ASN A 1 395  ? -0.669  48.521 17.221  1.00 68.29  ? 392  ASN A N   1 
ATOM 3057 C CA  . ASN A 1 395  ? -0.018  49.143 16.088  1.00 68.29  ? 392  ASN A CA  1 
ATOM 3058 C C   . ASN A 1 395  ? -0.980  50.043 15.332  1.00 68.29  ? 392  ASN A C   1 
ATOM 3059 O O   . ASN A 1 395  ? -2.160  49.739 15.191  1.00 68.29  ? 392  ASN A O   1 
ATOM 3060 C CB  . ASN A 1 395  ? 0.534   48.071 15.153  1.00 157.59 ? 392  ASN A CB  1 
ATOM 3061 C CG  . ASN A 1 395  ? 1.861   48.460 14.539  1.00 157.59 ? 392  ASN A CG  1 
ATOM 3062 O OD1 . ASN A 1 395  ? 2.892   47.875 14.863  1.00 157.59 ? 392  ASN A OD1 1 
ATOM 3063 N ND2 . ASN A 1 395  ? 1.846   49.450 13.652  1.00 157.59 ? 392  ASN A ND2 1 
ATOM 3064 N N   . GLY A 1 396  ? -0.462  51.171 14.876  1.00 55.21  ? 393  GLY A N   1 
ATOM 3065 C CA  . GLY A 1 396  ? -1.157  52.019 13.937  1.00 55.21  ? 393  GLY A CA  1 
ATOM 3066 C C   . GLY A 1 396  ? -2.114  53.024 14.523  1.00 55.21  ? 393  GLY A C   1 
ATOM 3067 O O   . GLY A 1 396  ? -2.206  53.232 15.741  1.00 55.21  ? 393  GLY A O   1 
ATOM 3068 N N   . ILE A 1 397  ? -2.832  53.666 13.627  1.00 81.44  ? 394  ILE A N   1 
ATOM 3069 C CA  . ILE A 1 397  ? -3.764  54.679 14.011  1.00 81.44  ? 394  ILE A CA  1 
ATOM 3070 C C   . ILE A 1 397  ? -5.110  54.196 13.491  1.00 81.44  ? 394  ILE A C   1 
ATOM 3071 O O   . ILE A 1 397  ? -5.263  53.921 12.299  1.00 81.44  ? 394  ILE A O   1 
ATOM 3072 C CB  . ILE A 1 397  ? -3.348  56.033 13.393  1.00 50.73  ? 394  ILE A CB  1 
ATOM 3073 C CG1 . ILE A 1 397  ? -1.868  56.308 13.644  1.00 50.73  ? 394  ILE A CG1 1 
ATOM 3074 C CG2 . ILE A 1 397  ? -4.177  57.201 13.963  1.00 50.73  ? 394  ILE A CG2 1 
ATOM 3075 C CD1 . ILE A 1 397  ? -1.341  57.445 12.797  1.00 50.73  ? 394  ILE A CD1 1 
ATOM 3076 N N   . GLY A 1 398  ? -6.076  54.062 14.395  1.00 66.41  ? 395  GLY A N   1 
ATOM 3077 C CA  . GLY A 1 398  ? -7.403  53.543 14.041  1.00 66.41  ? 395  GLY A CA  1 
ATOM 3078 C C   . GLY A 1 398  ? -8.456  54.633 14.038  1.00 66.41  ? 395  GLY A C   1 
ATOM 3079 O O   . GLY A 1 398  ? -8.210  55.740 14.536  1.00 66.41  ? 395  GLY A O   1 
ATOM 3080 N N   . ILE A 1 399  ? -9.621  54.323 13.461  1.00 64.17  ? 396  ILE A N   1 
ATOM 3081 C CA  . ILE A 1 399  ? -10.740 55.270 13.348  1.00 64.17  ? 396  ILE A CA  1 
ATOM 3082 C C   . ILE A 1 399  ? -12.096 54.569 13.603  1.00 64.17  ? 396  ILE A C   1 
ATOM 3083 O O   . ILE A 1 399  ? -12.242 53.360 13.288  1.00 64.17  ? 396  ILE A O   1 
ATOM 3084 C CB  . ILE A 1 399  ? -10.741 56.020 11.955  1.00 81.39  ? 396  ILE A CB  1 
ATOM 3085 C CG1 . ILE A 1 399  ? -11.809 55.478 10.982  1.00 81.39  ? 396  ILE A CG1 1 
ATOM 3086 C CG2 . ILE A 1 399  ? -9.340  56.074 11.318  1.00 81.39  ? 396  ILE A CG2 1 
ATOM 3087 C CD1 . ILE A 1 399  ? -11.577 54.058 10.454  1.00 81.39  ? 396  ILE A CD1 1 
ATOM 3088 N N   . HIS A 1 400  ? -13.084 55.316 14.128  1.00 90.31  ? 397  HIS A N   1 
ATOM 3089 C CA  . HIS A 1 400  ? -14.411 54.742 14.475  1.00 90.31  ? 397  HIS A CA  1 
ATOM 3090 C C   . HIS A 1 400  ? -15.555 55.120 13.514  1.00 90.31  ? 397  HIS A C   1 
ATOM 3091 O O   . HIS A 1 400  ? -15.965 56.280 13.439  1.00 90.31  ? 397  HIS A O   1 
ATOM 3092 C CB  . HIS A 1 400  ? -14.786 55.091 15.915  1.00 141.24 ? 397  HIS A CB  1 
ATOM 3093 C CG  . HIS A 1 400  ? -13.613 55.455 16.767  1.00 141.24 ? 397  HIS A CG  1 
ATOM 3094 N ND1 . HIS A 1 400  ? -12.614 54.558 17.079  1.00 141.24 ? 397  HIS A ND1 1 
ATOM 3095 C CD2 . HIS A 1 400  ? -13.272 56.624 17.361  1.00 141.24 ? 397  HIS A CD2 1 
ATOM 3096 C CE1 . HIS A 1 400  ? -11.710 55.157 17.835  1.00 141.24 ? 397  HIS A CE1 1 
ATOM 3097 N NE2 . HIS A 1 400  ? -12.088 56.410 18.023  1.00 141.24 ? 397  HIS A NE2 1 
ATOM 3098 N N   . GLU A 1 401  ? -16.083 54.112 12.818  1.00 102.41 ? 398  GLU A N   1 
ATOM 3099 C CA  . GLU A 1 401  ? -17.045 54.300 11.703  1.00 102.41 ? 398  GLU A CA  1 
ATOM 3100 C C   . GLU A 1 401  ? -18.538 54.460 12.062  1.00 102.41 ? 398  GLU A C   1 
ATOM 3101 O O   . GLU A 1 401  ? -19.145 53.590 12.700  1.00 102.41 ? 398  GLU A O   1 
ATOM 3102 C CB  . GLU A 1 401  ? -16.876 53.205 10.639  1.00 117.37 ? 398  GLU A CB  1 
ATOM 3103 C CG  . GLU A 1 401  ? -16.958 51.780 11.161  1.00 117.37 ? 398  GLU A CG  1 
ATOM 3104 C CD  . GLU A 1 401  ? -17.485 50.815 10.117  1.00 117.37 ? 398  GLU A CD  1 
ATOM 3105 O OE1 . GLU A 1 401  ? -18.580 51.072 9.564   1.00 117.37 ? 398  GLU A OE1 1 
ATOM 3106 O OE2 . GLU A 1 401  ? -16.809 49.794 9.853   1.00 117.37 ? 398  GLU A OE2 1 
ATOM 3107 N N   . HIS A 1 402  ? -19.126 55.560 11.601  1.00 204.41 ? 399  HIS A N   1 
ATOM 3108 C CA  . HIS A 1 402  ? -20.499 55.897 11.957  1.00 204.41 ? 399  HIS A CA  1 
ATOM 3109 C C   . HIS A 1 402  ? -21.508 55.509 10.867  1.00 204.41 ? 399  HIS A C   1 
ATOM 3110 O O   . HIS A 1 402  ? -22.314 54.605 11.074  1.00 204.41 ? 399  HIS A O   1 
ATOM 3111 C CB  . HIS A 1 402  ? -20.608 57.373 12.361  1.00 103.75 ? 399  HIS A CB  1 
ATOM 3112 C CG  . HIS A 1 402  ? -19.612 57.796 13.402  1.00 103.75 ? 399  HIS A CG  1 
ATOM 3113 N ND1 . HIS A 1 402  ? -19.239 59.112 13.583  1.00 103.75 ? 399  HIS A ND1 1 
ATOM 3114 C CD2 . HIS A 1 402  ? -18.906 57.079 14.310  1.00 103.75 ? 399  HIS A CD2 1 
ATOM 3115 C CE1 . HIS A 1 402  ? -18.356 59.187 14.563  1.00 103.75 ? 399  HIS A CE1 1 
ATOM 3116 N NE2 . HIS A 1 402  ? -18.133 57.967 15.018  1.00 103.75 ? 399  HIS A NE2 1 
ATOM 3117 N N   . ALA A 1 403  ? -21.465 56.179 9.717   1.00 85.67  ? 400  ALA A N   1 
ATOM 3118 C CA  . ALA A 1 403  ? -22.282 55.777 8.561   1.00 85.67  ? 400  ALA A CA  1 
ATOM 3119 C C   . ALA A 1 403  ? -21.525 54.819 7.636   1.00 85.67  ? 400  ALA A C   1 
ATOM 3120 O O   . ALA A 1 403  ? -20.329 54.600 7.798   1.00 85.67  ? 400  ALA A O   1 
ATOM 3121 C CB  . ALA A 1 403  ? -22.783 57.007 7.780   1.00 48.13  ? 400  ALA A CB  1 
ATOM 3122 N N   . SER A 1 404  ? -22.232 54.241 6.674   1.00 115.86 ? 401  SER A N   1 
ATOM 3123 C CA  . SER A 1 404  ? -21.611 53.311 5.745   1.00 115.86 ? 401  SER A CA  1 
ATOM 3124 C C   . SER A 1 404  ? -22.427 53.195 4.453   1.00 115.86 ? 401  SER A C   1 
ATOM 3125 O O   . SER A 1 404  ? -23.290 52.320 4.315   1.00 115.86 ? 401  SER A O   1 
ATOM 3126 C CB  . SER A 1 404  ? -21.426 51.942 6.409   1.00 78.97  ? 401  SER A CB  1 
ATOM 3127 O OG  . SER A 1 404  ? -20.310 51.257 5.868   1.00 78.97  ? 401  SER A OG  1 
ATOM 3128 N N   . ILE A 1 405  ? -22.150 54.091 3.511   1.00 209.02 ? 402  ILE A N   1 
ATOM 3129 C CA  . ILE A 1 405  ? -22.862 54.110 2.237   1.00 209.02 ? 402  ILE A CA  1 
ATOM 3130 C C   . ILE A 1 405  ? -21.964 53.597 1.115   1.00 209.02 ? 402  ILE A C   1 
ATOM 3131 O O   . ILE A 1 405  ? -21.042 54.290 0.677   1.00 209.02 ? 402  ILE A O   1 
ATOM 3132 C CB  . ILE A 1 405  ? -23.381 55.524 1.879   1.00 80.95  ? 402  ILE A CB  1 
ATOM 3133 C CG1 . ILE A 1 405  ? -24.274 56.103 2.989   1.00 80.95  ? 402  ILE A CG1 1 
ATOM 3134 C CG2 . ILE A 1 405  ? -24.119 55.505 0.543   1.00 80.95  ? 402  ILE A CG2 1 
ATOM 3135 C CD1 . ILE A 1 405  ? -23.531 57.010 3.966   1.00 80.95  ? 402  ILE A CD1 1 
ATOM 3136 N N   . ASP A 1 406  ? -22.253 52.385 0.653   1.00 158.60 ? 403  ASP A N   1 
ATOM 3137 C CA  . ASP A 1 406  ? -21.459 51.718 -0.385  1.00 158.60 ? 403  ASP A CA  1 
ATOM 3138 C C   . ASP A 1 406  ? -21.682 52.299 -1.785  1.00 158.60 ? 403  ASP A C   1 
ATOM 3139 O O   . ASP A 1 406  ? -22.697 52.015 -2.430  1.00 158.60 ? 403  ASP A O   1 
ATOM 3140 C CB  . ASP A 1 406  ? -21.726 50.205 -0.377  1.00 147.05 ? 403  ASP A CB  1 
ATOM 3141 C CG  . ASP A 1 406  ? -23.182 49.861 -0.067  1.00 147.05 ? 403  ASP A CG  1 
ATOM 3142 O OD1 . ASP A 1 406  ? -23.484 48.652 0.060   1.00 147.05 ? 403  ASP A OD1 1 
ATOM 3143 O OD2 . ASP A 1 406  ? -24.021 50.792 0.060   1.00 147.05 ? 403  ASP A OD2 1 
ATOM 3144 N N   . LEU A 1 407  ? -20.724 53.104 -2.248  1.00 204.30 ? 404  LEU A N   1 
ATOM 3145 C CA  . LEU A 1 407  ? -20.815 53.758 -3.559  1.00 204.30 ? 404  LEU A CA  1 
ATOM 3146 C C   . LEU A 1 407  ? -19.646 53.386 -4.474  1.00 204.30 ? 404  LEU A C   1 
ATOM 3147 O O   . LEU A 1 407  ? -18.602 54.045 -4.453  1.00 204.30 ? 404  LEU A O   1 
ATOM 3148 C CB  . LEU A 1 407  ? -20.938 55.281 -3.407  1.00 76.04  ? 404  LEU A CB  1 
ATOM 3149 C CG  . LEU A 1 407  ? -22.089 55.776 -2.523  1.00 76.04  ? 404  LEU A CG  1 
ATOM 3150 C CD1 . LEU A 1 407  ? -21.844 57.189 -1.935  1.00 76.04  ? 404  LEU A CD1 1 
ATOM 3151 C CD2 . LEU A 1 407  ? -23.416 55.688 -3.290  1.00 76.04  ? 404  LEU A CD2 1 
ATOM 3152 N N   . PRO A 1 408  ? -19.824 52.319 -5.280  1.00 184.93 ? 405  PRO A N   1 
ATOM 3153 C CA  . PRO A 1 408  ? -18.818 51.806 -6.211  1.00 184.93 ? 405  PRO A CA  1 
ATOM 3154 C C   . PRO A 1 408  ? -18.407 52.816 -7.280  1.00 184.93 ? 405  PRO A C   1 
ATOM 3155 O O   . PRO A 1 408  ? -18.738 52.649 -8.456  1.00 184.93 ? 405  PRO A O   1 
ATOM 3156 C CB  . PRO A 1 408  ? -19.514 50.593 -6.848  1.00 163.51 ? 405  PRO A CB  1 
ATOM 3157 C CG  . PRO A 1 408  ? -20.592 50.213 -5.887  1.00 163.51 ? 405  PRO A CG  1 
ATOM 3158 C CD  . PRO A 1 408  ? -21.056 51.507 -5.316  1.00 163.51 ? 405  PRO A CD  1 
ATOM 3159 N N   . GLY A 1 409  ? -17.680 53.851 -6.870  1.00 140.27 ? 406  GLY A N   1 
ATOM 3160 C CA  . GLY A 1 409  ? -17.229 54.865 -7.808  1.00 140.27 ? 406  GLY A CA  1 
ATOM 3161 C C   . GLY A 1 409  ? -16.479 56.038 -7.216  1.00 140.27 ? 406  GLY A C   1 
ATOM 3162 O O   . GLY A 1 409  ? -15.391 56.360 -7.677  1.00 140.27 ? 406  GLY A O   1 
ATOM 3163 N N   . ILE A 1 410  ? -17.059 56.666 -6.196  1.00 134.61 ? 407  ILE A N   1 
ATOM 3164 C CA  . ILE A 1 410  ? -16.566 57.941 -5.650  1.00 134.61 ? 407  ILE A CA  1 
ATOM 3165 C C   . ILE A 1 410  ? -15.142 58.295 -6.063  1.00 134.61 ? 407  ILE A C   1 
ATOM 3166 O O   . ILE A 1 410  ? -14.185 57.666 -5.615  1.00 134.61 ? 407  ILE A O   1 
ATOM 3167 C CB  . ILE A 1 410  ? -16.644 57.996 -4.114  1.00 78.34  ? 407  ILE A CB  1 
ATOM 3168 C CG1 . ILE A 1 410  ? -17.952 57.367 -3.602  1.00 78.34  ? 407  ILE A CG1 1 
ATOM 3169 C CG2 . ILE A 1 410  ? -16.468 59.449 -3.638  1.00 78.34  ? 407  ILE A CG2 1 
ATOM 3170 C CD1 . ILE A 1 410  ? -18.056 57.246 -2.088  1.00 78.34  ? 407  ILE A CD1 1 
ATOM 3171 N N   . LYS A 1 411  ? -15.021 59.317 -6.907  1.00 104.68 ? 408  LYS A N   1 
ATOM 3172 C CA  . LYS A 1 411  ? -13.733 59.738 -7.465  1.00 104.68 ? 408  LYS A CA  1 
ATOM 3173 C C   . LYS A 1 411  ? -13.273 61.060 -6.884  1.00 104.68 ? 408  LYS A C   1 
ATOM 3174 O O   . LYS A 1 411  ? -12.395 61.720 -7.429  1.00 104.68 ? 408  LYS A O   1 
ATOM 3175 C CB  . LYS A 1 411  ? -13.809 59.852 -8.987  1.00 69.09  ? 408  LYS A CB  1 
ATOM 3176 C CG  . LYS A 1 411  ? -14.136 58.549 -9.710  1.00 69.09  ? 408  LYS A CG  1 
ATOM 3177 C CD  . LYS A 1 411  ? -12.896 57.704 -10.065 1.00 69.09  ? 408  LYS A CD  1 
ATOM 3178 C CE  . LYS A 1 411  ? -13.292 56.220 -10.327 1.00 69.09  ? 408  LYS A CE  1 
ATOM 3179 N NZ  . LYS A 1 411  ? -12.403 55.471 -11.263 1.00 69.09  ? 408  LYS A NZ  1 
ATOM 3180 N N   . GLY A 1 412  ? -13.871 61.452 -5.775  1.00 72.09  ? 409  GLY A N   1 
ATOM 3181 C CA  . GLY A 1 412  ? -13.407 62.634 -5.076  1.00 72.09  ? 409  GLY A CA  1 
ATOM 3182 C C   . GLY A 1 412  ? -14.398 62.990 -4.004  1.00 72.09  ? 409  GLY A C   1 
ATOM 3183 O O   . GLY A 1 412  ? -15.489 62.401 -3.966  1.00 72.09  ? 409  GLY A O   1 
ATOM 3184 N N   . LEU A 1 413  ? -14.003 63.909 -3.115  1.00 73.66  ? 410  LEU A N   1 
ATOM 3185 C CA  . LEU A 1 413  ? -14.954 64.600 -2.234  1.00 73.66  ? 410  LEU A CA  1 
ATOM 3186 C C   . LEU A 1 413  ? -14.377 65.744 -1.406  1.00 73.66  ? 410  LEU A C   1 
ATOM 3187 O O   . LEU A 1 413  ? -13.254 65.664 -0.904  1.00 73.66  ? 410  LEU A O   1 
ATOM 3188 C CB  . LEU A 1 413  ? -15.766 63.634 -1.358  1.00 116.26 ? 410  LEU A CB  1 
ATOM 3189 C CG  . LEU A 1 413  ? -15.087 62.496 -0.604  1.00 116.26 ? 410  LEU A CG  1 
ATOM 3190 C CD1 . LEU A 1 413  ? -14.649 62.960 0.765   1.00 116.26 ? 410  LEU A CD1 1 
ATOM 3191 C CD2 . LEU A 1 413  ? -16.049 61.322 -0.488  1.00 116.26 ? 410  LEU A CD2 1 
ATOM 3192 N N   . TRP A 1 414  ? -15.175 66.811 -1.305  1.00 121.80 ? 411  TRP A N   1 
ATOM 3193 C CA  . TRP A 1 414  ? -14.847 68.020 -0.544  1.00 121.80 ? 411  TRP A CA  1 
ATOM 3194 C C   . TRP A 1 414  ? -16.036 68.351 0.348   1.00 121.80 ? 411  TRP A C   1 
ATOM 3195 O O   . TRP A 1 414  ? -17.173 67.981 0.011   1.00 121.80 ? 411  TRP A O   1 
ATOM 3196 C CB  . TRP A 1 414  ? -14.563 69.228 -1.462  1.00 76.33  ? 411  TRP A CB  1 
ATOM 3197 C CG  . TRP A 1 414  ? -13.605 68.967 -2.589  1.00 76.33  ? 411  TRP A CG  1 
ATOM 3198 C CD1 . TRP A 1 414  ? -12.345 69.484 -2.735  1.00 76.33  ? 411  TRP A CD1 1 
ATOM 3199 C CD2 . TRP A 1 414  ? -13.833 68.130 -3.730  1.00 76.33  ? 411  TRP A CD2 1 
ATOM 3200 N NE1 . TRP A 1 414  ? -11.775 69.010 -3.888  1.00 76.33  ? 411  TRP A NE1 1 
ATOM 3201 C CE2 . TRP A 1 414  ? -12.663 68.172 -4.516  1.00 76.33  ? 411  TRP A CE2 1 
ATOM 3202 C CE3 . TRP A 1 414  ? -14.912 67.341 -4.159  1.00 76.33  ? 411  TRP A CE3 1 
ATOM 3203 C CZ2 . TRP A 1 414  ? -12.538 67.451 -5.720  1.00 76.33  ? 411  TRP A CZ2 1 
ATOM 3204 C CZ3 . TRP A 1 414  ? -14.790 66.613 -5.350  1.00 76.33  ? 411  TRP A CZ3 1 
ATOM 3205 C CH2 . TRP A 1 414  ? -13.612 66.684 -6.122  1.00 76.33  ? 411  TRP A CH2 1 
ATOM 3206 N N   . PRO A 1 415  ? -15.777 69.072 1.471   1.00 114.35 ? 412  PRO A N   1 
ATOM 3207 C CA  . PRO A 1 415  ? -16.757 69.478 2.499   1.00 114.35 ? 412  PRO A CA  1 
ATOM 3208 C C   . PRO A 1 415  ? -17.959 70.215 1.912   1.00 114.35 ? 412  PRO A C   1 
ATOM 3209 O O   . PRO A 1 415  ? -18.110 70.247 0.690   1.00 114.35 ? 412  PRO A O   1 
ATOM 3210 C CB  . PRO A 1 415  ? -15.949 70.439 3.389   1.00 106.82 ? 412  PRO A CB  1 
ATOM 3211 C CG  . PRO A 1 415  ? -14.526 70.005 3.232   1.00 106.82 ? 412  PRO A CG  1 
ATOM 3212 C CD  . PRO A 1 415  ? -14.416 69.562 1.797   1.00 106.82 ? 412  PRO A CD  1 
ATOM 3213 N N   . LEU A 1 416  ? -18.813 70.774 2.774   1.00 171.50 ? 413  LEU A N   1 
ATOM 3214 C CA  . LEU A 1 416  ? -19.832 71.751 2.349   1.00 171.50 ? 413  LEU A CA  1 
ATOM 3215 C C   . LEU A 1 416  ? -20.899 72.088 3.386   1.00 171.50 ? 413  LEU A C   1 
ATOM 3216 O O   . LEU A 1 416  ? -21.743 71.261 3.734   1.00 171.50 ? 413  LEU A O   1 
ATOM 3217 C CB  . LEU A 1 416  ? -20.505 71.355 1.026   1.00 164.39 ? 413  LEU A CB  1 
ATOM 3218 C CG  . LEU A 1 416  ? -21.118 72.494 0.205   1.00 164.39 ? 413  LEU A CG  1 
ATOM 3219 C CD1 . LEU A 1 416  ? -20.056 73.494 -0.238  1.00 164.39 ? 413  LEU A CD1 1 
ATOM 3220 C CD2 . LEU A 1 416  ? -21.860 71.937 -0.997  1.00 164.39 ? 413  LEU A CD2 1 
ATOM 3221 N N   . ARG A 1 417  ? -20.837 73.327 3.857   1.00 154.14 ? 414  ARG A N   1 
ATOM 3222 C CA  . ARG A 1 417  ? -21.858 73.925 4.700   1.00 154.14 ? 414  ARG A CA  1 
ATOM 3223 C C   . ARG A 1 417  ? -22.880 74.622 3.809   1.00 154.14 ? 414  ARG A C   1 
ATOM 3224 O O   . ARG A 1 417  ? -22.545 75.098 2.724   1.00 154.14 ? 414  ARG A O   1 
ATOM 3225 C CB  . ARG A 1 417  ? -21.212 74.941 5.645   1.00 77.44  ? 414  ARG A CB  1 
ATOM 3226 C CG  . ARG A 1 417  ? -20.246 75.904 4.935   1.00 77.44  ? 414  ARG A CG  1 
ATOM 3227 C CD  . ARG A 1 417  ? -19.911 77.173 5.729   1.00 77.44  ? 414  ARG A CD  1 
ATOM 3228 N NE  . ARG A 1 417  ? -18.847 76.992 6.727   1.00 77.44  ? 414  ARG A NE  1 
ATOM 3229 C CZ  . ARG A 1 417  ? -17.553 76.829 6.446   1.00 77.44  ? 414  ARG A CZ  1 
ATOM 3230 N NH1 . ARG A 1 417  ? -17.134 76.785 5.183   1.00 77.44  ? 414  ARG A NH1 1 
ATOM 3231 N NH2 . ARG A 1 417  ? -16.673 76.694 7.431   1.00 77.44  ? 414  ARG A NH2 1 
ATOM 3232 N N   . SER A 1 418  ? -24.126 74.680 4.264   1.00 134.33 ? 415  SER A N   1 
ATOM 3233 C CA  . SER A 1 418  ? -25.166 75.407 3.533   1.00 134.33 ? 415  SER A CA  1 
ATOM 3234 C C   . SER A 1 418  ? -25.665 76.619 4.340   1.00 134.33 ? 415  SER A C   1 
ATOM 3235 O O   . SER A 1 418  ? -26.727 77.188 4.059   1.00 134.33 ? 415  SER A O   1 
ATOM 3236 C CB  . SER A 1 418  ? -26.316 74.468 3.150   1.00 117.79 ? 415  SER A CB  1 
ATOM 3237 O OG  . SER A 1 418  ? -26.768 74.727 1.831   1.00 117.79 ? 415  SER A OG  1 
ATOM 3238 N N   . ASP A 1 419  ? -24.875 77.006 5.339   1.00 217.91 ? 416  ASP A N   1 
ATOM 3239 C CA  . ASP A 1 419  ? -25.162 78.175 6.155   1.00 217.91 ? 416  ASP A CA  1 
ATOM 3240 C C   . ASP A 1 419  ? -23.856 78.893 6.506   1.00 217.91 ? 416  ASP A C   1 
ATOM 3241 O O   . ASP A 1 419  ? -22.991 78.316 7.175   1.00 217.91 ? 416  ASP A O   1 
ATOM 3242 C CB  . ASP A 1 419  ? -25.919 77.769 7.421   1.00 186.25 ? 416  ASP A CB  1 
ATOM 3243 C CG  . ASP A 1 419  ? -26.819 78.872 7.950   1.00 186.25 ? 416  ASP A CG  1 
ATOM 3244 O OD1 . ASP A 1 419  ? -27.731 78.553 8.744   1.00 186.25 ? 416  ASP A OD1 1 
ATOM 3245 O OD2 . ASP A 1 419  ? -26.629 80.052 7.577   1.00 186.25 ? 416  ASP A OD2 1 
ATOM 3246 N N   . PRO A 1 420  ? -23.704 80.149 6.035   1.00 173.97 ? 417  PRO A N   1 
ATOM 3247 C CA  . PRO A 1 420  ? -22.528 81.012 6.270   1.00 173.97 ? 417  PRO A CA  1 
ATOM 3248 C C   . PRO A 1 420  ? -22.106 81.182 7.740   1.00 173.97 ? 417  PRO A C   1 
ATOM 3249 O O   . PRO A 1 420  ? -20.984 81.622 8.006   1.00 173.97 ? 417  PRO A O   1 
ATOM 3250 C CB  . PRO A 1 420  ? -22.967 82.365 5.695   1.00 144.26 ? 417  PRO A CB  1 
ATOM 3251 C CG  . PRO A 1 420  ? -23.979 82.019 4.659   1.00 144.26 ? 417  PRO A CG  1 
ATOM 3252 C CD  . PRO A 1 420  ? -24.708 80.815 5.180   1.00 144.26 ? 417  PRO A CD  1 
ATOM 3253 N N   . ASN A 1 421  ? -22.998 80.846 8.674   1.00 217.67 ? 418  ASN A N   1 
ATOM 3254 C CA  . ASN A 1 421  ? -22.715 80.960 10.108  1.00 217.67 ? 418  ASN A CA  1 
ATOM 3255 C C   . ASN A 1 421  ? -21.879 79.788 10.625  1.00 217.67 ? 418  ASN A C   1 
ATOM 3256 O O   . ASN A 1 421  ? -20.659 79.903 10.787  1.00 217.67 ? 418  ASN A O   1 
ATOM 3257 C CB  . ASN A 1 421  ? -24.014 81.048 10.935  1.00 133.25 ? 418  ASN A CB  1 
ATOM 3258 C CG  . ASN A 1 421  ? -25.030 82.020 10.352  1.00 133.25 ? 418  ASN A CG  1 
ATOM 3259 O OD1 . ASN A 1 421  ? -24.807 83.235 10.326  1.00 133.25 ? 418  ASN A OD1 1 
ATOM 3260 N ND2 . ASN A 1 421  ? -26.166 81.485 9.902   1.00 133.25 ? 418  ASN A ND2 1 
ATOM 3261 N N   . ARG A 1 422  ? -22.562 78.665 10.863  1.00 218.25 ? 419  ARG A N   1 
ATOM 3262 C CA  . ARG A 1 422  ? -22.014 77.487 11.547  1.00 218.25 ? 419  ARG A CA  1 
ATOM 3263 C C   . ARG A 1 422  ? -20.709 76.962 10.956  1.00 218.25 ? 419  ARG A C   1 
ATOM 3264 O O   . ARG A 1 422  ? -20.543 76.922 9.733   1.00 218.25 ? 419  ARG A O   1 
ATOM 3265 C CB  . ARG A 1 422  ? -23.064 76.360 11.616  1.00 144.17 ? 419  ARG A CB  1 
ATOM 3266 C CG  . ARG A 1 422  ? -24.072 76.338 10.458  1.00 144.17 ? 419  ARG A CG  1 
ATOM 3267 C CD  . ARG A 1 422  ? -24.874 75.022 10.367  1.00 144.17 ? 419  ARG A CD  1 
ATOM 3268 N NE  . ARG A 1 422  ? -25.861 74.827 11.440  1.00 144.17 ? 419  ARG A NE  1 
ATOM 3269 C CZ  . ARG A 1 422  ? -26.742 73.823 11.492  1.00 144.17 ? 419  ARG A CZ  1 
ATOM 3270 N NH1 . ARG A 1 422  ? -26.778 72.903 10.534  1.00 144.17 ? 419  ARG A NH1 1 
ATOM 3271 N NH2 . ARG A 1 422  ? -27.596 73.732 12.505  1.00 144.17 ? 419  ARG A NH2 1 
ATOM 3272 N N   . GLU A 1 423  ? -19.791 76.568 11.841  1.00 136.72 ? 420  GLU A N   1 
ATOM 3273 C CA  . GLU A 1 423  ? -18.533 75.925 11.446  1.00 136.72 ? 420  GLU A CA  1 
ATOM 3274 C C   . GLU A 1 423  ? -18.807 74.531 10.900  1.00 136.72 ? 420  GLU A C   1 
ATOM 3275 O O   . GLU A 1 423  ? -17.890 73.824 10.469  1.00 136.72 ? 420  GLU A O   1 
ATOM 3276 C CB  . GLU A 1 423  ? -17.555 75.838 12.629  1.00 135.07 ? 420  GLU A CB  1 
ATOM 3277 C CG  . GLU A 1 423  ? -17.065 77.187 13.150  1.00 135.07 ? 420  GLU A CG  1 
ATOM 3278 C CD  . GLU A 1 423  ? -16.674 78.135 12.034  1.00 135.07 ? 420  GLU A CD  1 
ATOM 3279 O OE1 . GLU A 1 423  ? -15.684 77.848 11.335  1.00 135.07 ? 420  GLU A OE1 1 
ATOM 3280 O OE2 . GLU A 1 423  ? -17.362 79.163 11.854  1.00 135.07 ? 420  GLU A OE2 1 
ATOM 3281 N N   . THR A 1 424  ? -20.085 74.157 10.922  1.00 157.50 ? 421  THR A N   1 
ATOM 3282 C CA  . THR A 1 424  ? -20.533 72.837 10.498  1.00 157.50 ? 421  THR A CA  1 
ATOM 3283 C C   . THR A 1 424  ? -21.036 72.829 9.046   1.00 157.50 ? 421  THR A C   1 
ATOM 3284 O O   . THR A 1 424  ? -21.442 73.858 8.499   1.00 157.50 ? 421  THR A O   1 
ATOM 3285 C CB  . THR A 1 424  ? -21.600 72.236 11.475  1.00 138.98 ? 421  THR A CB  1 
ATOM 3286 O OG1 . THR A 1 424  ? -22.846 72.929 11.340  1.00 138.98 ? 421  THR A OG1 1 
ATOM 3287 C CG2 . THR A 1 424  ? -21.129 72.311 12.936  1.00 138.98 ? 421  THR A CG2 1 
ATOM 3288 N N   . TYR A 1 425  ? -20.993 71.644 8.445   1.00 125.39 ? 422  TYR A N   1 
ATOM 3289 C CA  . TYR A 1 425  ? -21.324 71.428 7.046   1.00 125.39 ? 422  TYR A CA  1 
ATOM 3290 C C   . TYR A 1 425  ? -22.525 70.473 6.962   1.00 125.39 ? 422  TYR A C   1 
ATOM 3291 O O   . TYR A 1 425  ? -22.869 69.826 7.948   1.00 125.39 ? 422  TYR A O   1 
ATOM 3292 C CB  . TYR A 1 425  ? -20.090 70.870 6.320   1.00 157.18 ? 422  TYR A CB  1 
ATOM 3293 C CG  . TYR A 1 425  ? -18.827 71.693 6.538   1.00 157.18 ? 422  TYR A CG  1 
ATOM 3294 C CD1 . TYR A 1 425  ? -18.068 71.552 7.700   1.00 157.18 ? 422  TYR A CD1 1 
ATOM 3295 C CD2 . TYR A 1 425  ? -18.394 72.615 5.586   1.00 157.18 ? 422  TYR A CD2 1 
ATOM 3296 C CE1 . TYR A 1 425  ? -16.916 72.307 7.911   1.00 157.18 ? 422  TYR A CE1 1 
ATOM 3297 C CE2 . TYR A 1 425  ? -17.241 73.377 5.785   1.00 157.18 ? 422  TYR A CE2 1 
ATOM 3298 C CZ  . TYR A 1 425  ? -16.509 73.216 6.951   1.00 157.18 ? 422  TYR A CZ  1 
ATOM 3299 O OH  . TYR A 1 425  ? -15.369 73.957 7.163   1.00 157.18 ? 422  TYR A OH  1 
ATOM 3300 N N   . ASP A 1 426  ? -23.191 70.404 5.812   1.00 142.31 ? 423  ASP A N   1 
ATOM 3301 C CA  . ASP A 1 426  ? -24.382 69.548 5.703   1.00 142.31 ? 423  ASP A CA  1 
ATOM 3302 C C   . ASP A 1 426  ? -24.535 68.840 4.356   1.00 142.31 ? 423  ASP A C   1 
ATOM 3303 O O   . ASP A 1 426  ? -25.469 68.054 4.168   1.00 142.31 ? 423  ASP A O   1 
ATOM 3304 C CB  . ASP A 1 426  ? -25.664 70.327 6.051   1.00 126.11 ? 423  ASP A CB  1 
ATOM 3305 C CG  . ASP A 1 426  ? -26.204 71.143 4.879   1.00 126.11 ? 423  ASP A CG  1 
ATOM 3306 O OD1 . ASP A 1 426  ? -27.444 71.230 4.742   1.00 126.11 ? 423  ASP A OD1 1 
ATOM 3307 O OD2 . ASP A 1 426  ? -25.395 71.693 4.098   1.00 126.11 ? 423  ASP A OD2 1 
ATOM 3308 N N   . THR A 1 427  ? -23.636 69.135 3.423   1.00 103.34 ? 424  THR A N   1 
ATOM 3309 C CA  . THR A 1 427  ? -23.625 68.445 2.148   1.00 103.34 ? 424  THR A CA  1 
ATOM 3310 C C   . THR A 1 427  ? -22.259 67.837 1.921   1.00 103.34 ? 424  THR A C   1 
ATOM 3311 O O   . THR A 1 427  ? -21.259 68.348 2.424   1.00 103.34 ? 424  THR A O   1 
ATOM 3312 C CB  . THR A 1 427  ? -23.970 69.398 0.991   1.00 144.19 ? 424  THR A CB  1 
ATOM 3313 O OG1 . THR A 1 427  ? -25.188 70.086 1.289   1.00 144.19 ? 424  THR A OG1 1 
ATOM 3314 C CG2 . THR A 1 427  ? -24.148 68.634 -0.305  1.00 144.19 ? 424  THR A CG2 1 
ATOM 3315 N N   . LEU A 1 428  ? -22.204 66.742 1.174   1.00 178.88 ? 425  LEU A N   1 
ATOM 3316 C CA  . LEU A 1 428  ? -20.923 66.294 0.659   1.00 178.88 ? 425  LEU A CA  1 
ATOM 3317 C C   . LEU A 1 428  ? -20.979 66.046 -0.839  1.00 178.88 ? 425  LEU A C   1 
ATOM 3318 O O   . LEU A 1 428  ? -21.533 65.047 -1.299  1.00 178.88 ? 425  LEU A O   1 
ATOM 3319 C CB  . LEU A 1 428  ? -20.401 65.070 1.407   1.00 175.09 ? 425  LEU A CB  1 
ATOM 3320 C CG  . LEU A 1 428  ? -18.875 64.985 1.333   1.00 175.09 ? 425  LEU A CG  1 
ATOM 3321 C CD1 . LEU A 1 428  ? -18.233 65.861 2.410   1.00 175.09 ? 425  LEU A CD1 1 
ATOM 3322 C CD2 . LEU A 1 428  ? -18.409 63.550 1.452   1.00 175.09 ? 425  LEU A CD2 1 
ATOM 3323 N N   . VAL A 1 429  ? -20.406 66.974 -1.595  1.00 186.21 ? 426  VAL A N   1 
ATOM 3324 C CA  . VAL A 1 429  ? -20.350 66.830 -3.036  1.00 186.21 ? 426  VAL A CA  1 
ATOM 3325 C C   . VAL A 1 429  ? -19.144 65.979 -3.381  1.00 186.21 ? 426  VAL A C   1 
ATOM 3326 O O   . VAL A 1 429  ? -18.076 66.105 -2.772  1.00 186.21 ? 426  VAL A O   1 
ATOM 3327 C CB  . VAL A 1 429  ? -20.300 68.178 -3.760  1.00 191.99 ? 426  VAL A CB  1 
ATOM 3328 C CG1 . VAL A 1 429  ? -20.651 68.000 -5.233  1.00 191.99 ? 426  VAL A CG1 1 
ATOM 3329 C CG2 . VAL A 1 429  ? -21.263 69.156 -3.114  1.00 191.99 ? 426  VAL A CG2 1 
ATOM 3330 N N   . LEU A 1 430  ? -19.337 65.111 -4.364  1.00 112.55 ? 427  LEU A N   1 
ATOM 3331 C CA  . LEU A 1 430  ? -18.402 64.037 -4.640  1.00 112.55 ? 427  LEU A CA  1 
ATOM 3332 C C   . LEU A 1 430  ? -18.219 63.770 -6.129  1.00 112.55 ? 427  LEU A C   1 
ATOM 3333 O O   . LEU A 1 430  ? -19.156 63.347 -6.807  1.00 112.55 ? 427  LEU A O   1 
ATOM 3334 C CB  . LEU A 1 430  ? -18.868 62.754 -3.929  1.00 124.30 ? 427  LEU A CB  1 
ATOM 3335 C CG  . LEU A 1 430  ? -20.365 62.473 -3.720  1.00 124.30 ? 427  LEU A CG  1 
ATOM 3336 C CD1 . LEU A 1 430  ? -21.062 62.116 -5.005  1.00 124.30 ? 427  LEU A CD1 1 
ATOM 3337 C CD2 . LEU A 1 430  ? -20.557 61.355 -2.726  1.00 124.30 ? 427  LEU A CD2 1 
ATOM 3338 N N   . SER A 1 431  ? -17.013 64.002 -6.638  1.00 114.82 ? 428  SER A N   1 
ATOM 3339 C CA  . SER A 1 431  ? -16.696 63.573 -7.994  1.00 114.82 ? 428  SER A CA  1 
ATOM 3340 C C   . SER A 1 431  ? -17.046 62.093 -8.144  1.00 114.82 ? 428  SER A C   1 
ATOM 3341 O O   . SER A 1 431  ? -16.931 61.323 -7.191  1.00 114.82 ? 428  SER A O   1 
ATOM 3342 C CB  . SER A 1 431  ? -15.221 63.785 -8.297  1.00 163.55 ? 428  SER A CB  1 
ATOM 3343 O OG  . SER A 1 431  ? -14.978 63.597 -9.680  1.00 163.55 ? 428  SER A OG  1 
ATOM 3344 N N   . PHE A 1 432  ? -17.469 61.692 -9.336  1.00 105.00 ? 429  PHE A N   1 
ATOM 3345 C CA  . PHE A 1 432  ? -17.972 60.338 -9.524  1.00 105.00 ? 429  PHE A CA  1 
ATOM 3346 C C   . PHE A 1 432  ? -17.632 59.800 -10.916 1.00 105.00 ? 429  PHE A C   1 
ATOM 3347 O O   . PHE A 1 432  ? -17.024 60.499 -11.730 1.00 105.00 ? 429  PHE A O   1 
ATOM 3348 C CB  . PHE A 1 432  ? -19.486 60.348 -9.319  1.00 143.03 ? 429  PHE A CB  1 
ATOM 3349 C CG  . PHE A 1 432  ? -19.975 59.408 -8.253  1.00 143.03 ? 429  PHE A CG  1 
ATOM 3350 C CD1 . PHE A 1 432  ? -20.703 58.271 -8.590  1.00 143.03 ? 429  PHE A CD1 1 
ATOM 3351 C CD2 . PHE A 1 432  ? -19.739 59.679 -6.908  1.00 143.03 ? 429  PHE A CD2 1 
ATOM 3352 C CE1 . PHE A 1 432  ? -21.173 57.405 -7.602  1.00 143.03 ? 429  PHE A CE1 1 
ATOM 3353 C CE2 . PHE A 1 432  ? -20.203 58.820 -5.913  1.00 143.03 ? 429  PHE A CE2 1 
ATOM 3354 C CZ  . PHE A 1 432  ? -20.919 57.681 -6.260  1.00 143.03 ? 429  PHE A CZ  1 
ATOM 3355 N N   . VAL A 1 433  ? -18.051 58.561 -11.181 1.00 179.13 ? 430  VAL A N   1 
ATOM 3356 C CA  . VAL A 1 433  ? -17.798 57.857 -12.449 1.00 179.13 ? 430  VAL A CA  1 
ATOM 3357 C C   . VAL A 1 433  ? -18.295 58.640 -13.676 1.00 179.13 ? 430  VAL A C   1 
ATOM 3358 O O   . VAL A 1 433  ? -19.187 58.185 -14.395 1.00 179.13 ? 430  VAL A O   1 
ATOM 3359 C CB  . VAL A 1 433  ? -18.458 56.437 -12.460 1.00 151.40 ? 430  VAL A CB  1 
ATOM 3360 C CG1 . VAL A 1 433  ? -17.597 55.446 -13.238 1.00 151.40 ? 430  VAL A CG1 1 
ATOM 3361 C CG2 . VAL A 1 433  ? -18.714 55.923 -11.044 1.00 151.40 ? 430  VAL A CG2 1 
ATOM 3362 N N   . GLY A 1 434  ? -17.707 59.810 -13.914 1.00 101.71 ? 431  GLY A N   1 
ATOM 3363 C CA  . GLY A 1 434  ? -18.169 60.714 -14.973 1.00 101.71 ? 431  GLY A CA  1 
ATOM 3364 C C   . GLY A 1 434  ? -19.507 61.387 -14.682 1.00 101.71 ? 431  GLY A C   1 
ATOM 3365 O O   . GLY A 1 434  ? -20.262 61.717 -15.601 1.00 101.71 ? 431  GLY A O   1 
ATOM 3366 N N   . GLN A 1 435  ? -19.806 61.575 -13.400 1.00 125.12 ? 432  GLN A N   1 
ATOM 3367 C CA  . GLN A 1 435  ? -21.026 62.251 -12.962 1.00 125.12 ? 432  GLN A CA  1 
ATOM 3368 C C   . GLN A 1 435  ? -20.701 63.150 -11.781 1.00 125.12 ? 432  GLN A C   1 
ATOM 3369 O O   . GLN A 1 435  ? -19.533 63.393 -11.467 1.00 125.12 ? 432  GLN A O   1 
ATOM 3370 C CB  . GLN A 1 435  ? -22.082 61.243 -12.496 1.00 131.99 ? 432  GLN A CB  1 
ATOM 3371 C CG  . GLN A 1 435  ? -22.507 60.170 -13.485 1.00 131.99 ? 432  GLN A CG  1 
ATOM 3372 C CD  . GLN A 1 435  ? -23.440 59.149 -12.842 1.00 131.99 ? 432  GLN A CD  1 
ATOM 3373 O OE1 . GLN A 1 435  ? -23.075 57.987 -12.653 1.00 131.99 ? 432  GLN A OE1 1 
ATOM 3374 N NE2 . GLN A 1 435  ? -24.642 59.589 -12.484 1.00 131.99 ? 432  GLN A NE2 1 
ATOM 3375 N N   . THR A 1 436  ? -21.751 63.632 -11.127 1.00 214.16 ? 433  THR A N   1 
ATOM 3376 C CA  . THR A 1 436  ? -21.642 64.252 -9.818  1.00 214.16 ? 433  THR A CA  1 
ATOM 3377 C C   . THR A 1 436  ? -22.969 64.128 -9.104  1.00 214.16 ? 433  THR A C   1 
ATOM 3378 O O   . THR A 1 436  ? -24.018 64.484 -9.641  1.00 214.16 ? 433  THR A O   1 
ATOM 3379 C CB  . THR A 1 436  ? -21.222 65.729 -9.900  1.00 78.33  ? 433  THR A CB  1 
ATOM 3380 O OG1 . THR A 1 436  ? -19.860 65.803 -10.318 1.00 78.33  ? 433  THR A OG1 1 
ATOM 3381 C CG2 . THR A 1 436  ? -21.348 66.421 -8.548  1.00 78.33  ? 433  THR A CG2 1 
ATOM 3382 N N   . ARG A 1 437  ? -22.907 63.593 -7.895  1.00 123.86 ? 434  ARG A N   1 
ATOM 3383 C CA  . ARG A 1 437  ? -24.049 63.585 -6.998  1.00 123.86 ? 434  ARG A CA  1 
ATOM 3384 C C   . ARG A 1 437  ? -23.793 64.560 -5.858  1.00 123.86 ? 434  ARG A C   1 
ATOM 3385 O O   . ARG A 1 437  ? -22.689 65.082 -5.705  1.00 123.86 ? 434  ARG A O   1 
ATOM 3386 C CB  . ARG A 1 437  ? -24.336 62.169 -6.473  1.00 177.06 ? 434  ARG A CB  1 
ATOM 3387 C CG  . ARG A 1 437  ? -24.817 61.196 -7.546  1.00 177.06 ? 434  ARG A CG  1 
ATOM 3388 C CD  . ARG A 1 437  ? -26.321 61.313 -7.788  1.00 177.06 ? 434  ARG A CD  1 
ATOM 3389 N NE  . ARG A 1 437  ? -26.643 61.598 -9.187  1.00 177.06 ? 434  ARG A NE  1 
ATOM 3390 C CZ  . ARG A 1 437  ? -26.651 60.703 -10.172 1.00 177.06 ? 434  ARG A CZ  1 
ATOM 3391 N NH1 . ARG A 1 437  ? -26.346 59.432 -9.942  1.00 177.06 ? 434  ARG A NH1 1 
ATOM 3392 N NH2 . ARG A 1 437  ? -26.962 61.088 -11.399 1.00 177.06 ? 434  ARG A NH2 1 
ATOM 3393 N N   . VAL A 1 438  ? -24.831 64.819 -5.078  1.00 128.56 ? 435  VAL A N   1 
ATOM 3394 C CA  . VAL A 1 438  ? -24.752 65.739 -3.961  1.00 128.56 ? 435  VAL A CA  1 
ATOM 3395 C C   . VAL A 1 438  ? -25.317 64.985 -2.765  1.00 128.56 ? 435  VAL A C   1 
ATOM 3396 O O   . VAL A 1 438  ? -25.999 63.977 -2.946  1.00 128.56 ? 435  VAL A O   1 
ATOM 3397 C CB  . VAL A 1 438  ? -25.574 67.013 -4.239  1.00 134.27 ? 435  VAL A CB  1 
ATOM 3398 C CG1 . VAL A 1 438  ? -25.074 68.157 -3.390  1.00 134.27 ? 435  VAL A CG1 1 
ATOM 3399 C CG2 . VAL A 1 438  ? -25.509 67.396 -5.723  1.00 134.27 ? 435  VAL A CG2 1 
ATOM 3400 N N   . LEU A 1 439  ? -25.031 65.452 -1.551  1.00 218.25 ? 436  LEU A N   1 
ATOM 3401 C CA  . LEU A 1 439  ? -25.556 64.799 -0.353  1.00 218.25 ? 436  LEU A CA  1 
ATOM 3402 C C   . LEU A 1 439  ? -25.949 65.758 0.764   1.00 218.25 ? 436  LEU A C   1 
ATOM 3403 O O   . LEU A 1 439  ? -25.155 66.031 1.663   1.00 218.25 ? 436  LEU A O   1 
ATOM 3404 C CB  . LEU A 1 439  ? -24.582 63.731 0.170   1.00 121.28 ? 436  LEU A CB  1 
ATOM 3405 C CG  . LEU A 1 439  ? -24.707 62.296 -0.373  1.00 121.28 ? 436  LEU A CG  1 
ATOM 3406 C CD1 . LEU A 1 439  ? -23.426 61.506 -0.152  1.00 121.28 ? 436  LEU A CD1 1 
ATOM 3407 C CD2 . LEU A 1 439  ? -25.901 61.549 0.225   1.00 121.28 ? 436  LEU A CD2 1 
ATOM 3408 N N   . MET A 1 440  ? -27.181 66.261 0.697   1.00 144.63 ? 437  MET A N   1 
ATOM 3409 C CA  . MET A 1 440  ? -27.751 67.081 1.766   1.00 144.63 ? 437  MET A CA  1 
ATOM 3410 C C   . MET A 1 440  ? -27.961 66.198 2.998   1.00 144.63 ? 437  MET A C   1 
ATOM 3411 O O   . MET A 1 440  ? -28.184 64.996 2.869   1.00 144.63 ? 437  MET A O   1 
ATOM 3412 C CB  . MET A 1 440  ? -29.073 67.717 1.316   1.00 195.83 ? 437  MET A CB  1 
ATOM 3413 C CG  . MET A 1 440  ? -28.945 68.759 0.191   1.00 195.83 ? 437  MET A CG  1 
ATOM 3414 S SD  . MET A 1 440  ? -29.329 70.474 0.639   1.00 195.83 ? 437  MET A SD  1 
ATOM 3415 C CE  . MET A 1 440  ? -31.125 70.460 0.613   1.00 195.83 ? 437  MET A CE  1 
ATOM 3416 N N   . LEU A 1 441  ? -27.868 66.785 4.187   1.00 217.86 ? 438  LEU A N   1 
ATOM 3417 C CA  . LEU A 1 441  ? -28.056 66.017 5.418   1.00 217.86 ? 438  LEU A CA  1 
ATOM 3418 C C   . LEU A 1 441  ? -29.025 66.670 6.381   1.00 217.86 ? 438  LEU A C   1 
ATOM 3419 O O   . LEU A 1 441  ? -28.955 67.876 6.631   1.00 217.86 ? 438  LEU A O   1 
ATOM 3420 C CB  . LEU A 1 441  ? -26.728 65.784 6.140   1.00 82.49  ? 438  LEU A CB  1 
ATOM 3421 C CG  . LEU A 1 441  ? -25.612 65.035 5.410   1.00 82.49  ? 438  LEU A CG  1 
ATOM 3422 C CD1 . LEU A 1 441  ? -24.254 65.462 5.961   1.00 82.49  ? 438  LEU A CD1 1 
ATOM 3423 C CD2 . LEU A 1 441  ? -25.766 63.523 5.478   1.00 82.49  ? 438  LEU A CD2 1 
ATOM 3424 N N   . ASN A 1 442  ? -29.918 65.854 6.933   1.00 207.69 ? 439  ASN A N   1 
ATOM 3425 C CA  . ASN A 1 442  ? -30.776 66.268 8.032   1.00 207.69 ? 439  ASN A CA  1 
ATOM 3426 C C   . ASN A 1 442  ? -29.903 66.444 9.283   1.00 207.69 ? 439  ASN A C   1 
ATOM 3427 O O   . ASN A 1 442  ? -30.405 66.605 10.395  1.00 207.69 ? 439  ASN A O   1 
ATOM 3428 C CB  . ASN A 1 442  ? -31.880 65.220 8.257   1.00 165.52 ? 439  ASN A CB  1 
ATOM 3429 C CG  . ASN A 1 442  ? -33.292 65.822 8.266   1.00 165.52 ? 439  ASN A CG  1 
ATOM 3430 O OD1 . ASN A 1 442  ? -34.246 65.195 7.798   1.00 165.52 ? 439  ASN A OD1 1 
ATOM 3431 N ND2 . ASN A 1 442  ? -33.426 67.033 8.799   1.00 165.52 ? 439  ASN A ND2 1 
ATOM 3432 N N   . GLY A 1 443  ? -28.587 66.422 9.070   1.00 110.52 ? 440  GLY A N   1 
ATOM 3433 C CA  . GLY A 1 443  ? -27.589 66.545 10.129  1.00 110.52 ? 440  GLY A CA  1 
ATOM 3434 C C   . GLY A 1 443  ? -26.711 65.308 10.172  1.00 110.52 ? 440  GLY A C   1 
ATOM 3435 O O   . GLY A 1 443  ? -25.548 65.340 9.763   1.00 110.52 ? 440  GLY A O   1 
ATOM 3436 N N   . GLU A 1 444  ? -27.293 64.218 10.666  1.00 99.96  ? 441  GLU A N   1 
ATOM 3437 C CA  . GLU A 1 444  ? -26.640 62.910 10.727  1.00 99.96  ? 441  GLU A CA  1 
ATOM 3438 C C   . GLU A 1 444  ? -27.201 61.941 9.688   1.00 99.96  ? 441  GLU A C   1 
ATOM 3439 O O   . GLU A 1 444  ? -26.712 60.819 9.549   1.00 99.96  ? 441  GLU A O   1 
ATOM 3440 C CB  . GLU A 1 444  ? -26.787 62.304 12.130  1.00 218.25 ? 441  GLU A CB  1 
ATOM 3441 C CG  . GLU A 1 444  ? -28.224 62.246 12.676  1.00 218.25 ? 441  GLU A CG  1 
ATOM 3442 C CD  . GLU A 1 444  ? -28.944 60.937 12.371  1.00 218.25 ? 441  GLU A CD  1 
ATOM 3443 O OE1 . GLU A 1 444  ? -29.275 60.206 13.326  1.00 218.25 ? 441  GLU A OE1 1 
ATOM 3444 O OE2 . GLU A 1 444  ? -29.188 60.635 11.186  1.00 218.25 ? 441  GLU A OE2 1 
ATOM 3445 N N   . GLU A 1 445  ? -28.237 62.371 8.972   1.00 168.20 ? 442  GLU A N   1 
ATOM 3446 C CA  . GLU A 1 445  ? -28.943 61.480 8.058   1.00 168.20 ? 442  GLU A CA  1 
ATOM 3447 C C   . GLU A 1 445  ? -28.580 61.688 6.590   1.00 168.20 ? 442  GLU A C   1 
ATOM 3448 O O   . GLU A 1 445  ? -28.385 62.818 6.146   1.00 168.20 ? 442  GLU A O   1 
ATOM 3449 C CB  . GLU A 1 445  ? -30.455 61.592 8.247   1.00 131.61 ? 442  GLU A CB  1 
ATOM 3450 C CG  . GLU A 1 445  ? -31.206 60.318 7.862   1.00 131.61 ? 442  GLU A CG  1 
ATOM 3451 C CD  . GLU A 1 445  ? -32.645 60.568 7.424   1.00 131.61 ? 442  GLU A CD  1 
ATOM 3452 O OE1 . GLU A 1 445  ? -33.249 59.639 6.828   1.00 131.61 ? 442  GLU A OE1 1 
ATOM 3453 O OE2 . GLU A 1 445  ? -33.175 61.682 7.673   1.00 131.61 ? 442  GLU A OE2 1 
ATOM 3454 N N   . VAL A 1 446  ? -28.522 60.576 5.855   1.00 198.09 ? 443  VAL A N   1 
ATOM 3455 C CA  . VAL A 1 446  ? -28.139 60.533 4.438   1.00 198.09 ? 443  VAL A CA  1 
ATOM 3456 C C   . VAL A 1 446  ? -29.291 60.881 3.498   1.00 198.09 ? 443  VAL A C   1 
ATOM 3457 O O   . VAL A 1 446  ? -30.396 60.345 3.627   1.00 198.09 ? 443  VAL A O   1 
ATOM 3458 C CB  . VAL A 1 446  ? -27.585 59.132 4.066   1.00 121.50 ? 443  VAL A CB  1 
ATOM 3459 C CG1 . VAL A 1 446  ? -27.434 58.968 2.543   1.00 121.50 ? 443  VAL A CG1 1 
ATOM 3460 C CG2 . VAL A 1 446  ? -26.265 58.886 4.785   1.00 121.50 ? 443  VAL A CG2 1 
ATOM 3461 N N   . GLU A 1 447  ? -29.014 61.774 2.547   1.00 217.09 ? 444  GLU A N   1 
ATOM 3462 C CA  . GLU A 1 447  ? -30.002 62.220 1.566   1.00 217.09 ? 444  GLU A CA  1 
ATOM 3463 C C   . GLU A 1 447  ? -29.310 62.853 0.357   1.00 217.09 ? 444  GLU A C   1 
ATOM 3464 O O   . GLU A 1 447  ? -28.411 63.678 0.517   1.00 217.09 ? 444  GLU A O   1 
ATOM 3465 C CB  . GLU A 1 447  ? -30.960 63.237 2.202   1.00 134.66 ? 444  GLU A CB  1 
ATOM 3466 C CG  . GLU A 1 447  ? -32.230 63.509 1.387   1.00 134.66 ? 444  GLU A CG  1 
ATOM 3467 C CD  . GLU A 1 447  ? -32.643 64.978 1.387   1.00 134.66 ? 444  GLU A CD  1 
ATOM 3468 O OE1 . GLU A 1 447  ? -31.897 65.818 1.942   1.00 134.66 ? 444  GLU A OE1 1 
ATOM 3469 O OE2 . GLU A 1 447  ? -33.712 65.292 0.815   1.00 134.66 ? 444  GLU A OE2 1 
ATOM 3470 N N   . GLU A 1 448  ? -29.737 62.472 -0.847  1.00 138.46 ? 445  GLU A N   1 
ATOM 3471 C CA  . GLU A 1 448  ? -29.183 63.055 -2.076  1.00 138.46 ? 445  GLU A CA  1 
ATOM 3472 C C   . GLU A 1 448  ? -30.197 63.861 -2.908  1.00 138.46 ? 445  GLU A C   1 
ATOM 3473 O O   . GLU A 1 448  ? -31.234 63.332 -3.328  1.00 138.46 ? 445  GLU A O   1 
ATOM 3474 C CB  . GLU A 1 448  ? -28.478 61.992 -2.933  1.00 207.63 ? 445  GLU A CB  1 
ATOM 3475 C CG  . GLU A 1 448  ? -29.332 60.805 -3.354  1.00 207.63 ? 445  GLU A CG  1 
ATOM 3476 C CD  . GLU A 1 448  ? -28.655 59.951 -4.406  1.00 207.63 ? 445  GLU A CD  1 
ATOM 3477 O OE1 . GLU A 1 448  ? -29.200 58.876 -4.735  1.00 207.63 ? 445  GLU A OE1 1 
ATOM 3478 O OE2 . GLU A 1 448  ? -27.581 60.354 -4.906  1.00 207.63 ? 445  GLU A OE2 1 
ATOM 3479 N N   . THR A 1 449  ? -29.889 65.139 -3.137  1.00 201.68 ? 446  THR A N   1 
ATOM 3480 C CA  . THR A 1 449  ? -30.725 66.002 -3.983  1.00 201.68 ? 446  THR A CA  1 
ATOM 3481 C C   . THR A 1 449  ? -29.938 66.735 -5.081  1.00 201.68 ? 446  THR A C   1 
ATOM 3482 O O   . THR A 1 449  ? -29.320 66.099 -5.941  1.00 201.68 ? 446  THR A O   1 
ATOM 3483 C CB  . THR A 1 449  ? -31.578 67.020 -3.160  1.00 97.34  ? 446  THR A CB  1 
ATOM 3484 O OG1 . THR A 1 449  ? -30.734 67.783 -2.287  1.00 97.34  ? 446  THR A OG1 1 
ATOM 3485 C CG2 . THR A 1 449  ? -32.672 66.314 -2.354  1.00 97.34  ? 446  THR A CG2 1 
ATOM 3486 N N   . GLU A 1 450  ? -29.970 68.071 -5.026  1.00 110.61 ? 447  GLU A N   1 
ATOM 3487 C CA  . GLU A 1 450  ? -29.502 68.955 -6.101  1.00 110.61 ? 447  GLU A CA  1 
ATOM 3488 C C   . GLU A 1 450  ? -29.167 70.348 -5.553  1.00 110.61 ? 447  GLU A C   1 
ATOM 3489 O O   . GLU A 1 450  ? -29.731 70.778 -4.542  1.00 110.61 ? 447  GLU A O   1 
ATOM 3490 C CB  . GLU A 1 450  ? -30.588 69.078 -7.181  1.00 178.07 ? 447  GLU A CB  1 
ATOM 3491 C CG  . GLU A 1 450  ? -32.014 69.254 -6.619  1.00 178.07 ? 447  GLU A CG  1 
ATOM 3492 C CD  . GLU A 1 450  ? -33.086 69.470 -7.693  1.00 178.07 ? 447  GLU A CD  1 
ATOM 3493 O OE1 . GLU A 1 450  ? -34.146 68.801 -7.625  1.00 178.07 ? 447  GLU A OE1 1 
ATOM 3494 O OE2 . GLU A 1 450  ? -32.882 70.315 -8.596  1.00 178.07 ? 447  GLU A OE2 1 
ATOM 3495 N N   . LEU A 1 451  ? -28.244 71.042 -6.212  1.00 212.94 ? 448  LEU A N   1 
ATOM 3496 C CA  . LEU A 1 451  ? -27.972 72.445 -5.908  1.00 212.94 ? 448  LEU A CA  1 
ATOM 3497 C C   . LEU A 1 451  ? -27.729 73.213 -7.198  1.00 212.94 ? 448  LEU A C   1 
ATOM 3498 O O   . LEU A 1 451  ? -27.044 72.723 -8.097  1.00 212.94 ? 448  LEU A O   1 
ATOM 3499 C CB  . LEU A 1 451  ? -26.794 72.599 -4.937  1.00 105.84 ? 448  LEU A CB  1 
ATOM 3500 C CG  . LEU A 1 451  ? -27.092 72.890 -3.454  1.00 105.84 ? 448  LEU A CG  1 
ATOM 3501 C CD1 . LEU A 1 451  ? -27.469 71.647 -2.656  1.00 105.84 ? 448  LEU A CD1 1 
ATOM 3502 C CD2 . LEU A 1 451  ? -25.895 73.551 -2.802  1.00 105.84 ? 448  LEU A CD2 1 
ATOM 3503 N N   . MET A 1 452  ? -28.304 74.412 -7.279  1.00 205.75 ? 449  MET A N   1 
ATOM 3504 C CA  . MET A 1 452  ? -28.277 75.233 -8.495  1.00 205.75 ? 449  MET A CA  1 
ATOM 3505 C C   . MET A 1 452  ? -26.846 75.507 -8.924  1.00 205.75 ? 449  MET A C   1 
ATOM 3506 O O   . MET A 1 452  ? -25.968 75.673 -8.080  1.00 205.75 ? 449  MET A O   1 
ATOM 3507 C CB  . MET A 1 452  ? -28.992 76.572 -8.279  1.00 166.79 ? 449  MET A CB  1 
ATOM 3508 C CG  . MET A 1 452  ? -29.565 76.780 -6.888  1.00 166.79 ? 449  MET A CG  1 
ATOM 3509 S SD  . MET A 1 452  ? -31.014 75.793 -6.491  1.00 166.79 ? 449  MET A SD  1 
ATOM 3510 C CE  . MET A 1 452  ? -31.019 75.888 -4.698  1.00 166.79 ? 449  MET A CE  1 
ATOM 3511 N N   . GLY A 1 453  ? -26.620 75.539 -10.236 1.00 208.33 ? 450  GLY A N   1 
ATOM 3512 C CA  . GLY A 1 453  ? -25.303 75.827 -10.809 1.00 208.33 ? 450  GLY A CA  1 
ATOM 3513 C C   . GLY A 1 453  ? -24.220 74.808 -10.492 1.00 208.33 ? 450  GLY A C   1 
ATOM 3514 O O   . GLY A 1 453  ? -23.028 75.125 -10.533 1.00 208.33 ? 450  GLY A O   1 
ATOM 3515 N N   . PHE A 1 454  ? -24.639 73.588 -10.166 1.00 163.19 ? 451  PHE A N   1 
ATOM 3516 C CA  . PHE A 1 454  ? -23.725 72.493 -9.878  1.00 163.19 ? 451  PHE A CA  1 
ATOM 3517 C C   . PHE A 1 454  ? -24.118 71.284 -10.712 1.00 163.19 ? 451  PHE A C   1 
ATOM 3518 O O   . PHE A 1 454  ? -25.041 70.560 -10.339 1.00 163.19 ? 451  PHE A O   1 
ATOM 3519 C CB  . PHE A 1 454  ? -23.772 72.143 -8.391  1.00 160.44 ? 451  PHE A CB  1 
ATOM 3520 C CG  . PHE A 1 454  ? -22.868 72.981 -7.537  1.00 160.44 ? 451  PHE A CG  1 
ATOM 3521 C CD1 . PHE A 1 454  ? -23.086 74.344 -7.383  1.00 160.44 ? 451  PHE A CD1 1 
ATOM 3522 C CD2 . PHE A 1 454  ? -21.807 72.399 -6.860  1.00 160.44 ? 451  PHE A CD2 1 
ATOM 3523 C CE1 . PHE A 1 454  ? -22.246 75.120 -6.587  1.00 160.44 ? 451  PHE A CE1 1 
ATOM 3524 C CE2 . PHE A 1 454  ? -20.963 73.171 -6.057  1.00 160.44 ? 451  PHE A CE2 1 
ATOM 3525 C CZ  . PHE A 1 454  ? -21.185 74.535 -5.925  1.00 160.44 ? 451  PHE A CZ  1 
ATOM 3526 N N   . VAL A 1 455  ? -23.429 71.068 -11.836 1.00 103.25 ? 452  VAL A N   1 
ATOM 3527 C CA  . VAL A 1 455  ? -23.817 70.000 -12.786 1.00 103.25 ? 452  VAL A CA  1 
ATOM 3528 C C   . VAL A 1 455  ? -23.922 68.604 -12.162 1.00 103.25 ? 452  VAL A C   1 
ATOM 3529 O O   . VAL A 1 455  ? -23.271 68.302 -11.153 1.00 103.25 ? 452  VAL A O   1 
ATOM 3530 C CB  . VAL A 1 455  ? -22.950 69.948 -14.075 1.00 108.69 ? 452  VAL A CB  1 
ATOM 3531 C CG1 . VAL A 1 455  ? -23.804 70.233 -15.311 1.00 108.69 ? 452  VAL A CG1 1 
ATOM 3532 C CG2 . VAL A 1 455  ? -21.748 70.883 -13.982 1.00 108.69 ? 452  VAL A CG2 1 
ATOM 3533 N N   . ASP A 1 456  ? -24.771 67.779 -12.773 1.00 98.39  ? 453  ASP A N   1 
ATOM 3534 C CA  . ASP A 1 456  ? -25.105 66.443 -12.278 1.00 98.39  ? 453  ASP A CA  1 
ATOM 3535 C C   . ASP A 1 456  ? -24.538 65.365 -13.200 1.00 98.39  ? 453  ASP A C   1 
ATOM 3536 O O   . ASP A 1 456  ? -24.090 64.309 -12.743 1.00 98.39  ? 453  ASP A O   1 
ATOM 3537 C CB  . ASP A 1 456  ? -26.628 66.286 -12.138 1.00 206.15 ? 453  ASP A CB  1 
ATOM 3538 C CG  . ASP A 1 456  ? -27.396 66.761 -13.375 1.00 206.15 ? 453  ASP A CG  1 
ATOM 3539 O OD1 . ASP A 1 456  ? -27.196 66.195 -14.472 1.00 206.15 ? 453  ASP A OD1 1 
ATOM 3540 O OD2 . ASP A 1 456  ? -28.216 67.696 -13.244 1.00 206.15 ? 453  ASP A OD2 1 
ATOM 3541 N N   . ASP A 1 457  ? -24.574 65.641 -14.500 1.00 201.12 ? 454  ASP A N   1 
ATOM 3542 C CA  . ASP A 1 457  ? -24.037 64.738 -15.507 1.00 201.12 ? 454  ASP A CA  1 
ATOM 3543 C C   . ASP A 1 457  ? -22.590 65.098 -15.832 1.00 201.12 ? 454  ASP A C   1 
ATOM 3544 O O   . ASP A 1 457  ? -21.896 64.351 -16.521 1.00 201.12 ? 454  ASP A O   1 
ATOM 3545 C CB  . ASP A 1 457  ? -24.905 64.763 -16.769 1.00 177.86 ? 454  ASP A CB  1 
ATOM 3546 C CG  . ASP A 1 457  ? -25.130 66.171 -17.309 1.00 177.86 ? 454  ASP A CG  1 
ATOM 3547 O OD1 . ASP A 1 457  ? -25.703 66.286 -18.414 1.00 177.86 ? 454  ASP A OD1 1 
ATOM 3548 O OD2 . ASP A 1 457  ? -24.744 67.160 -16.642 1.00 177.86 ? 454  ASP A OD2 1 
ATOM 3549 N N   . GLN A 1 458  ? -22.144 66.246 -15.330 1.00 194.86 ? 455  GLN A N   1 
ATOM 3550 C CA  . GLN A 1 458  ? -20.760 66.668 -15.493 1.00 194.86 ? 455  GLN A CA  1 
ATOM 3551 C C   . GLN A 1 458  ? -19.946 66.369 -14.248 1.00 194.86 ? 455  GLN A C   1 
ATOM 3552 O O   . GLN A 1 458  ? -20.350 66.696 -13.133 1.00 194.86 ? 455  GLN A O   1 
ATOM 3553 C CB  . GLN A 1 458  ? -20.680 68.150 -15.829 1.00 138.96 ? 455  GLN A CB  1 
ATOM 3554 C CG  . GLN A 1 458  ? -21.090 68.493 -17.237 1.00 138.96 ? 455  GLN A CG  1 
ATOM 3555 C CD  . GLN A 1 458  ? -20.067 68.048 -18.252 1.00 138.96 ? 455  GLN A CD  1 
ATOM 3556 O OE1 . GLN A 1 458  ? -19.228 68.839 -18.687 1.00 138.96 ? 455  GLN A OE1 1 
ATOM 3557 N NE2 . GLN A 1 458  ? -20.115 66.772 -18.626 1.00 138.96 ? 455  GLN A NE2 1 
ATOM 3558 N N   . GLN A 1 459  ? -18.787 65.758 -14.457 1.00 140.78 ? 456  GLN A N   1 
ATOM 3559 C CA  . GLN A 1 459  ? -17.970 65.251 -13.368 1.00 140.78 ? 456  GLN A CA  1 
ATOM 3560 C C   . GLN A 1 459  ? -17.176 66.336 -12.641 1.00 140.78 ? 456  GLN A C   1 
ATOM 3561 O O   . GLN A 1 459  ? -16.211 66.872 -13.176 1.00 140.78 ? 456  GLN A O   1 
ATOM 3562 C CB  . GLN A 1 459  ? -17.034 64.175 -13.901 1.00 131.88 ? 456  GLN A CB  1 
ATOM 3563 C CG  . GLN A 1 459  ? -16.268 63.443 -12.831 1.00 131.88 ? 456  GLN A CG  1 
ATOM 3564 C CD  . GLN A 1 459  ? -15.117 62.645 -13.394 1.00 131.88 ? 456  GLN A CD  1 
ATOM 3565 O OE1 . GLN A 1 459  ? -14.210 62.258 -12.663 1.00 131.88 ? 456  GLN A OE1 1 
ATOM 3566 N NE2 . GLN A 1 459  ? -15.141 62.400 -14.701 1.00 131.88 ? 456  GLN A NE2 1 
ATOM 3567 N N   . THR A 1 460  ? -17.589 66.633 -11.412 1.00 125.39 ? 457  THR A N   1 
ATOM 3568 C CA  . THR A 1 460  ? -16.969 67.658 -10.566 1.00 125.39 ? 457  THR A CA  1 
ATOM 3569 C C   . THR A 1 460  ? -15.513 67.322 -10.203 1.00 125.39 ? 457  THR A C   1 
ATOM 3570 O O   . THR A 1 460  ? -15.205 66.193 -9.841  1.00 125.39 ? 457  THR A O   1 
ATOM 3571 C CB  . THR A 1 460  ? -17.831 67.882 -9.291  1.00 99.40  ? 457  THR A CB  1 
ATOM 3572 O OG1 . THR A 1 460  ? -19.104 68.416 -9.669  1.00 99.40  ? 457  THR A OG1 1 
ATOM 3573 C CG2 . THR A 1 460  ? -17.173 68.837 -8.317  1.00 99.40  ? 457  THR A CG2 1 
ATOM 3574 N N   . PHE A 1 461  ? -14.630 68.313 -10.316 1.00 94.43  ? 458  PHE A N   1 
ATOM 3575 C CA  . PHE A 1 461  ? -13.206 68.152 -10.013 1.00 94.43  ? 458  PHE A CA  1 
ATOM 3576 C C   . PHE A 1 461  ? -12.784 68.859 -8.737  1.00 94.43  ? 458  PHE A C   1 
ATOM 3577 O O   . PHE A 1 461  ? -11.618 68.797 -8.352  1.00 94.43  ? 458  PHE A O   1 
ATOM 3578 C CB  . PHE A 1 461  ? -12.337 68.713 -11.148 1.00 177.69 ? 458  PHE A CB  1 
ATOM 3579 C CG  . PHE A 1 461  ? -12.175 67.790 -12.328 1.00 177.69 ? 458  PHE A CG  1 
ATOM 3580 C CD1 . PHE A 1 461  ? -12.618 66.469 -12.284 1.00 177.69 ? 458  PHE A CD1 1 
ATOM 3581 C CD2 . PHE A 1 461  ? -11.540 68.245 -13.481 1.00 177.69 ? 458  PHE A CD2 1 
ATOM 3582 C CE1 . PHE A 1 461  ? -12.455 65.624 -13.382 1.00 177.69 ? 458  PHE A CE1 1 
ATOM 3583 C CE2 . PHE A 1 461  ? -11.367 67.409 -14.582 1.00 177.69 ? 458  PHE A CE2 1 
ATOM 3584 C CZ  . PHE A 1 461  ? -11.825 66.095 -14.533 1.00 177.69 ? 458  PHE A CZ  1 
ATOM 3585 N N   . PHE A 1 462  ? -13.723 69.551 -8.099  1.00 70.29  ? 459  PHE A N   1 
ATOM 3586 C CA  . PHE A 1 462  ? -13.429 70.414 -6.945  1.00 70.29  ? 459  PHE A CA  1 
ATOM 3587 C C   . PHE A 1 462  ? -14.689 71.092 -6.404  1.00 70.29  ? 459  PHE A C   1 
ATOM 3588 O O   . PHE A 1 462  ? -15.674 71.194 -7.121  1.00 70.29  ? 459  PHE A O   1 
ATOM 3589 C CB  . PHE A 1 462  ? -12.355 71.464 -7.271  1.00 91.84  ? 459  PHE A CB  1 
ATOM 3590 C CG  . PHE A 1 462  ? -11.794 72.138 -6.057  1.00 91.84  ? 459  PHE A CG  1 
ATOM 3591 C CD1 . PHE A 1 462  ? -10.670 71.632 -5.429  1.00 91.84  ? 459  PHE A CD1 1 
ATOM 3592 C CD2 . PHE A 1 462  ? -12.403 73.277 -5.531  1.00 91.84  ? 459  PHE A CD2 1 
ATOM 3593 C CE1 . PHE A 1 462  ? -10.158 72.256 -4.294  1.00 91.84  ? 459  PHE A CE1 1 
ATOM 3594 C CE2 . PHE A 1 462  ? -11.904 73.902 -4.402  1.00 91.84  ? 459  PHE A CE2 1 
ATOM 3595 C CZ  . PHE A 1 462  ? -10.785 73.395 -3.779  1.00 91.84  ? 459  PHE A CZ  1 
ATOM 3596 N N   . CYS A 1 463  ? -14.628 71.562 -5.147  1.00 107.84 ? 460  CYS A N   1 
ATOM 3597 C CA  . CYS A 1 463  ? -15.793 72.050 -4.383  1.00 107.84 ? 460  CYS A CA  1 
ATOM 3598 C C   . CYS A 1 463  ? -15.485 72.967 -3.195  1.00 107.84 ? 460  CYS A C   1 
ATOM 3599 O O   . CYS A 1 463  ? -16.412 73.348 -2.477  1.00 107.84 ? 460  CYS A O   1 
ATOM 3600 C CB  . CYS A 1 463  ? -16.592 70.863 -3.834  1.00 131.01 ? 460  CYS A CB  1 
ATOM 3601 S SG  . CYS A 1 463  ? -18.147 70.529 -4.644  1.00 131.01 ? 460  CYS A SG  1 
ATOM 3602 N N   . GLY A 1 464  ? -14.205 73.298 -2.980  1.00 95.39  ? 461  GLY A N   1 
ATOM 3603 C CA  . GLY A 1 464  ? -13.737 74.102 -1.824  1.00 95.39  ? 461  GLY A CA  1 
ATOM 3604 C C   . GLY A 1 464  ? -14.597 75.299 -1.435  1.00 95.39  ? 461  GLY A C   1 
ATOM 3605 O O   . GLY A 1 464  ? -15.449 75.747 -2.220  1.00 95.39  ? 461  GLY A O   1 
ATOM 3606 N N   . ASN A 1 465  ? -14.374 75.824 -0.227  1.00 218.25 ? 462  ASN A N   1 
ATOM 3607 C CA  . ASN A 1 465  ? -15.216 76.890 0.355   1.00 218.25 ? 462  ASN A CA  1 
ATOM 3608 C C   . ASN A 1 465  ? -14.748 78.341 0.070   1.00 218.25 ? 462  ASN A C   1 
ATOM 3609 O O   . ASN A 1 465  ? -14.133 78.975 0.933   1.00 218.25 ? 462  ASN A O   1 
ATOM 3610 C CB  . ASN A 1 465  ? -15.378 76.671 1.879   1.00 210.38 ? 462  ASN A CB  1 
ATOM 3611 C CG  . ASN A 1 465  ? -16.205 75.425 2.227   1.00 210.38 ? 462  ASN A CG  1 
ATOM 3612 O OD1 . ASN A 1 465  ? -15.667 74.411 2.675   1.00 210.38 ? 462  ASN A OD1 1 
ATOM 3613 N ND2 . ASN A 1 465  ? -17.517 75.511 2.036   1.00 210.38 ? 462  ASN A ND2 1 
ATOM 3614 N N   . VAL A 1 466  ? -15.060 78.862 -1.124  1.00 123.19 ? 463  VAL A N   1 
ATOM 3615 C CA  . VAL A 1 466  ? -14.684 80.242 -1.528  1.00 123.19 ? 463  VAL A CA  1 
ATOM 3616 C C   . VAL A 1 466  ? -15.456 81.350 -0.785  1.00 123.19 ? 463  VAL A C   1 
ATOM 3617 O O   . VAL A 1 466  ? -16.692 81.348 -0.737  1.00 123.19 ? 463  VAL A O   1 
ATOM 3618 C CB  . VAL A 1 466  ? -14.769 80.473 -3.078  1.00 133.08 ? 463  VAL A CB  1 
ATOM 3619 C CG1 . VAL A 1 466  ? -13.659 79.737 -3.802  1.00 133.08 ? 463  VAL A CG1 1 
ATOM 3620 C CG2 . VAL A 1 466  ? -16.120 80.072 -3.636  1.00 133.08 ? 463  VAL A CG2 1 
ATOM 3621 N N   . ALA A 1 467  ? -14.711 82.292 -0.209  1.00 104.14 ? 464  ALA A N   1 
ATOM 3622 C CA  . ALA A 1 467  ? -15.293 83.418 0.515   1.00 104.14 ? 464  ALA A CA  1 
ATOM 3623 C C   . ALA A 1 467  ? -16.159 84.302 -0.402  1.00 104.14 ? 464  ALA A C   1 
ATOM 3624 O O   . ALA A 1 467  ? -16.286 84.026 -1.604  1.00 104.14 ? 464  ALA A O   1 
ATOM 3625 C CB  . ALA A 1 467  ? -14.187 84.236 1.192   1.00 127.77 ? 464  ALA A CB  1 
ATOM 3626 N N   . HIS A 1 468  ? -16.755 85.351 0.175   1.00 112.59 ? 465  HIS A N   1 
ATOM 3627 C CA  . HIS A 1 468  ? -17.627 86.300 -0.552  1.00 112.59 ? 465  HIS A CA  1 
ATOM 3628 C C   . HIS A 1 468  ? -19.030 85.731 -0.833  1.00 112.59 ? 465  HIS A C   1 
ATOM 3629 O O   . HIS A 1 468  ? -19.668 86.074 -1.841  1.00 112.59 ? 465  HIS A O   1 
ATOM 3630 C CB  . HIS A 1 468  ? -16.958 86.808 -1.849  1.00 145.06 ? 465  HIS A CB  1 
ATOM 3631 C CG  . HIS A 1 468  ? -15.698 87.593 -1.623  1.00 145.06 ? 465  HIS A CG  1 
ATOM 3632 N ND1 . HIS A 1 468  ? -14.629 87.105 -0.898  1.00 145.06 ? 465  HIS A ND1 1 
ATOM 3633 C CD2 . HIS A 1 468  ? -15.329 88.825 -2.049  1.00 145.06 ? 465  HIS A CD2 1 
ATOM 3634 C CE1 . HIS A 1 468  ? -13.665 88.007 -0.876  1.00 145.06 ? 465  HIS A CE1 1 
ATOM 3635 N NE2 . HIS A 1 468  ? -14.063 89.060 -1.568  1.00 145.06 ? 465  HIS A NE2 1 
ATOM 3636 N N   . GLN A 1 469  ? -19.488 84.870 0.080   1.00 101.04 ? 466  GLN A N   1 
ATOM 3637 C CA  . GLN A 1 469  ? -20.836 84.297 0.065   1.00 101.04 ? 466  GLN A CA  1 
ATOM 3638 C C   . GLN A 1 469  ? -21.203 83.529 -1.212  1.00 101.04 ? 466  GLN A C   1 
ATOM 3639 O O   . GLN A 1 469  ? -22.328 83.639 -1.703  1.00 101.04 ? 466  GLN A O   1 
ATOM 3640 C CB  . GLN A 1 469  ? -21.888 85.383 0.331   1.00 117.89 ? 466  GLN A CB  1 
ATOM 3641 C CG  . GLN A 1 469  ? -22.067 85.806 1.788   1.00 117.89 ? 466  GLN A CG  1 
ATOM 3642 C CD  . GLN A 1 469  ? -23.135 86.896 1.931   1.00 117.89 ? 466  GLN A CD  1 
ATOM 3643 O OE1 . GLN A 1 469  ? -24.029 86.806 2.782   1.00 117.89 ? 466  GLN A OE1 1 
ATOM 3644 N NE2 . GLN A 1 469  ? -23.046 87.929 1.088   1.00 117.89 ? 466  GLN A NE2 1 
ATOM 3645 N N   . GLN A 1 470  ? -20.270 82.746 -1.743  1.00 176.95 ? 467  GLN A N   1 
ATOM 3646 C CA  . GLN A 1 470  ? -20.560 81.950 -2.943  1.00 176.95 ? 467  GLN A CA  1 
ATOM 3647 C C   . GLN A 1 470  ? -20.015 80.510 -2.940  1.00 176.95 ? 467  GLN A C   1 
ATOM 3648 O O   . GLN A 1 470  ? -19.049 80.211 -2.238  1.00 176.95 ? 467  GLN A O   1 
ATOM 3649 C CB  . GLN A 1 470  ? -20.174 82.704 -4.229  1.00 123.55 ? 467  GLN A CB  1 
ATOM 3650 C CG  . GLN A 1 470  ? -19.107 83.771 -4.095  1.00 123.55 ? 467  GLN A CG  1 
ATOM 3651 C CD  . GLN A 1 470  ? -19.441 84.995 -4.915  1.00 123.55 ? 467  GLN A CD  1 
ATOM 3652 O OE1 . GLN A 1 470  ? -18.805 85.266 -5.929  1.00 123.55 ? 467  GLN A OE1 1 
ATOM 3653 N NE2 . GLN A 1 470  ? -20.465 85.730 -4.491  1.00 123.55 ? 467  GLN A NE2 1 
ATOM 3654 N N   . LEU A 1 471  ? -20.662 79.635 -3.720  1.00 180.54 ? 468  LEU A N   1 
ATOM 3655 C CA  . LEU A 1 471  ? -20.283 78.215 -3.850  1.00 180.54 ? 468  LEU A CA  1 
ATOM 3656 C C   . LEU A 1 471  ? -19.691 77.901 -5.230  1.00 180.54 ? 468  LEU A C   1 
ATOM 3657 O O   . LEU A 1 471  ? -20.234 78.321 -6.252  1.00 180.54 ? 468  LEU A O   1 
ATOM 3658 C CB  . LEU A 1 471  ? -21.490 77.292 -3.612  1.00 115.28 ? 468  LEU A CB  1 
ATOM 3659 C CG  . LEU A 1 471  ? -22.497 77.396 -2.448  1.00 115.28 ? 468  LEU A CG  1 
ATOM 3660 C CD1 . LEU A 1 471  ? -23.614 76.354 -2.610  1.00 115.28 ? 468  LEU A CD1 1 
ATOM 3661 C CD2 . LEU A 1 471  ? -21.850 77.260 -1.073  1.00 115.28 ? 468  LEU A CD2 1 
ATOM 3662 N N   . ILE A 1 472  ? -18.600 77.136 -5.248  1.00 135.04 ? 469  ILE A N   1 
ATOM 3663 C CA  . ILE A 1 472  ? -17.832 76.868 -6.477  1.00 135.04 ? 469  ILE A CA  1 
ATOM 3664 C C   . ILE A 1 472  ? -17.847 75.388 -6.885  1.00 135.04 ? 469  ILE A C   1 
ATOM 3665 O O   . ILE A 1 472  ? -17.714 74.496 -6.048  1.00 135.04 ? 469  ILE A O   1 
ATOM 3666 C CB  . ILE A 1 472  ? -16.353 77.447 -6.383  1.00 73.51  ? 469  ILE A CB  1 
ATOM 3667 C CG1 . ILE A 1 472  ? -15.669 77.530 -7.760  1.00 73.51  ? 469  ILE A CG1 1 
ATOM 3668 C CG2 . ILE A 1 472  ? -15.488 76.705 -5.316  1.00 73.51  ? 469  ILE A CG2 1 
ATOM 3669 C CD1 . ILE A 1 472  ? -14.857 76.296 -8.168  1.00 73.51  ? 469  ILE A CD1 1 
ATOM 3670 N N   . GLN A 1 473  ? -18.029 75.145 -8.178  1.00 101.83 ? 470  GLN A N   1 
ATOM 3671 C CA  . GLN A 1 473  ? -17.937 73.804 -8.746  1.00 101.83 ? 470  GLN A CA  1 
ATOM 3672 C C   . GLN A 1 473  ? -17.077 73.840 -10.010 1.00 101.83 ? 470  GLN A C   1 
ATOM 3673 O O   . GLN A 1 473  ? -17.504 74.366 -11.041 1.00 101.83 ? 470  GLN A O   1 
ATOM 3674 C CB  . GLN A 1 473  ? -19.327 73.244 -9.084  1.00 112.38 ? 470  GLN A CB  1 
ATOM 3675 C CG  . GLN A 1 473  ? -19.355 71.740 -9.429  1.00 112.38 ? 470  GLN A CG  1 
ATOM 3676 C CD  . GLN A 1 473  ? -20.550 71.322 -10.299 1.00 112.38 ? 470  GLN A CD  1 
ATOM 3677 O OE1 . GLN A 1 473  ? -21.013 72.078 -11.161 1.00 112.38 ? 470  GLN A OE1 1 
ATOM 3678 N NE2 . GLN A 1 473  ? -21.041 70.106 -10.080 1.00 112.38 ? 470  GLN A NE2 1 
ATOM 3679 N N   . ILE A 1 474  ? -15.865 73.298 -9.935  1.00 95.80  ? 471  ILE A N   1 
ATOM 3680 C CA  . ILE A 1 474  ? -15.094 73.081 -11.141 1.00 95.80  ? 471  ILE A CA  1 
ATOM 3681 C C   . ILE A 1 474  ? -15.469 71.724 -11.680 1.00 95.80  ? 471  ILE A C   1 
ATOM 3682 O O   . ILE A 1 474  ? -15.399 70.712 -10.985 1.00 95.80  ? 471  ILE A O   1 
ATOM 3683 C CB  . ILE A 1 474  ? -13.580 73.168 -10.936 1.00 66.10  ? 471  ILE A CB  1 
ATOM 3684 C CG1 . ILE A 1 474  ? -13.237 74.264 -9.908  1.00 66.10  ? 471  ILE A CG1 1 
ATOM 3685 C CG2 . ILE A 1 474  ? -12.880 73.344 -12.324 1.00 66.10  ? 471  ILE A CG2 1 
ATOM 3686 C CD1 . ILE A 1 474  ? -11.758 74.586 -9.755  1.00 66.10  ? 471  ILE A CD1 1 
ATOM 3687 N N   . THR A 1 475  ? -15.905 71.730 -12.929 1.00 90.13  ? 472  THR A N   1 
ATOM 3688 C CA  . THR A 1 475  ? -16.253 70.515 -13.641 1.00 90.13  ? 472  THR A CA  1 
ATOM 3689 C C   . THR A 1 475  ? -15.240 70.356 -14.810 1.00 90.13  ? 472  THR A C   1 
ATOM 3690 O O   . THR A 1 475  ? -14.273 71.138 -14.913 1.00 90.13  ? 472  THR A O   1 
ATOM 3691 C CB  . THR A 1 475  ? -17.787 70.525 -14.018 1.00 122.44 ? 472  THR A CB  1 
ATOM 3692 O OG1 . THR A 1 475  ? -18.297 69.189 -14.075 1.00 122.44 ? 472  THR A OG1 1 
ATOM 3693 C CG2 . THR A 1 475  ? -18.088 71.270 -15.316 1.00 122.44 ? 472  THR A CG2 1 
ATOM 3694 N N   . SER A 1 476  ? -15.424 69.337 -15.651 1.00 105.34 ? 473  SER A N   1 
ATOM 3695 C CA  . SER A 1 476  ? -14.561 69.133 -16.813 1.00 105.34 ? 473  SER A CA  1 
ATOM 3696 C C   . SER A 1 476  ? -14.635 70.383 -17.649 1.00 105.34 ? 473  SER A C   1 
ATOM 3697 O O   . SER A 1 476  ? -13.625 71.000 -17.960 1.00 105.34 ? 473  SER A O   1 
ATOM 3698 C CB  . SER A 1 476  ? -15.039 67.951 -17.661 1.00 121.34 ? 473  SER A CB  1 
ATOM 3699 O OG  . SER A 1 476  ? -15.508 66.877 -16.865 1.00 121.34 ? 473  SER A OG  1 
ATOM 3700 N N   . ALA A 1 477  ? -15.865 70.761 -17.968 1.00 135.09 ? 474  ALA A N   1 
ATOM 3701 C CA  . ALA A 1 477  ? -16.159 71.846 -18.880 1.00 135.09 ? 474  ALA A CA  1 
ATOM 3702 C C   . ALA A 1 477  ? -15.880 73.231 -18.295 1.00 135.09 ? 474  ALA A C   1 
ATOM 3703 O O   . ALA A 1 477  ? -14.919 73.898 -18.702 1.00 135.09 ? 474  ALA A O   1 
ATOM 3704 C CB  . ALA A 1 477  ? -17.596 71.740 -19.320 1.00 58.72  ? 474  ALA A CB  1 
ATOM 3705 N N   . SER A 1 478  ? -16.723 73.653 -17.350 1.00 100.99 ? 475  SER A N   1 
ATOM 3706 C CA  . SER A 1 478  ? -16.658 74.999 -16.787 1.00 100.99 ? 475  SER A CA  1 
ATOM 3707 C C   . SER A 1 478  ? -16.245 75.020 -15.323 1.00 100.99 ? 475  SER A C   1 
ATOM 3708 O O   . SER A 1 478  ? -16.428 74.047 -14.595 1.00 100.99 ? 475  SER A O   1 
ATOM 3709 C CB  . SER A 1 478  ? -18.007 75.703 -16.952 1.00 170.24 ? 475  SER A CB  1 
ATOM 3710 O OG  . SER A 1 478  ? -19.055 74.915 -16.417 1.00 170.24 ? 475  SER A OG  1 
ATOM 3711 N N   . VAL A 1 479  ? -15.670 76.138 -14.903 1.00 98.22  ? 476  VAL A N   1 
ATOM 3712 C CA  . VAL A 1 479  ? -15.496 76.399 -13.485 1.00 98.22  ? 476  VAL A CA  1 
ATOM 3713 C C   . VAL A 1 479  ? -16.659 77.311 -13.050 1.00 98.22  ? 476  VAL A C   1 
ATOM 3714 O O   . VAL A 1 479  ? -16.569 78.537 -13.140 1.00 98.22  ? 476  VAL A O   1 
ATOM 3715 C CB  . VAL A 1 479  ? -14.043 76.911 -13.152 1.00 105.11 ? 476  VAL A CB  1 
ATOM 3716 C CG1 . VAL A 1 479  ? -13.505 77.772 -14.254 1.00 105.11 ? 476  VAL A CG1 1 
ATOM 3717 C CG2 . VAL A 1 479  ? -13.956 77.621 -11.792 1.00 105.11 ? 476  VAL A CG2 1 
ATOM 3718 N N   . ARG A 1 480  ? -17.760 76.680 -12.615 1.00 103.11 ? 477  ARG A N   1 
ATOM 3719 C CA  . ARG A 1 480  ? -19.056 77.345 -12.337 1.00 103.11 ? 477  ARG A CA  1 
ATOM 3720 C C   . ARG A 1 480  ? -19.045 78.222 -11.083 1.00 103.11 ? 477  ARG A C   1 
ATOM 3721 O O   . ARG A 1 480  ? -18.068 78.217 -10.335 1.00 103.11 ? 477  ARG A O   1 
ATOM 3722 C CB  . ARG A 1 480  ? -20.187 76.310 -12.225 1.00 180.05 ? 477  ARG A CB  1 
ATOM 3723 C CG  . ARG A 1 480  ? -20.346 75.411 -13.436 1.00 180.05 ? 477  ARG A CG  1 
ATOM 3724 C CD  . ARG A 1 480  ? -21.575 74.518 -13.330 1.00 180.05 ? 477  ARG A CD  1 
ATOM 3725 N NE  . ARG A 1 480  ? -22.816 75.246 -13.597 1.00 180.05 ? 477  ARG A NE  1 
ATOM 3726 C CZ  . ARG A 1 480  ? -23.966 74.680 -13.960 1.00 180.05 ? 477  ARG A CZ  1 
ATOM 3727 N NH1 . ARG A 1 480  ? -24.056 73.363 -14.110 1.00 180.05 ? 477  ARG A NH1 1 
ATOM 3728 N NH2 . ARG A 1 480  ? -25.033 75.436 -14.181 1.00 180.05 ? 477  ARG A NH2 1 
ATOM 3729 N N   . LEU A 1 481  ? -20.130 78.973 -10.863 1.00 133.74 ? 478  LEU A N   1 
ATOM 3730 C CA  . LEU A 1 481  ? -20.293 79.816 -9.660  1.00 133.74 ? 478  LEU A CA  1 
ATOM 3731 C C   . LEU A 1 481  ? -21.754 79.924 -9.214  1.00 133.74 ? 478  LEU A C   1 
ATOM 3732 O O   . LEU A 1 481  ? -22.659 80.092 -10.039 1.00 133.74 ? 478  LEU A O   1 
ATOM 3733 C CB  . LEU A 1 481  ? -19.695 81.223 -9.866  1.00 93.99  ? 478  LEU A CB  1 
ATOM 3734 C CG  . LEU A 1 481  ? -19.429 82.130 -8.647  1.00 93.99  ? 478  LEU A CG  1 
ATOM 3735 C CD1 . LEU A 1 481  ? -18.062 81.876 -7.997  1.00 93.99  ? 478  LEU A CD1 1 
ATOM 3736 C CD2 . LEU A 1 481  ? -19.551 83.601 -9.009  1.00 93.99  ? 478  LEU A CD2 1 
ATOM 3737 N N   . VAL A 1 482  ? -21.955 79.833 -7.899  1.00 154.11 ? 479  VAL A N   1 
ATOM 3738 C CA  . VAL A 1 482  ? -23.274 79.836 -7.258  1.00 154.11 ? 479  VAL A CA  1 
ATOM 3739 C C   . VAL A 1 482  ? -23.183 80.701 -6.004  1.00 154.11 ? 479  VAL A C   1 
ATOM 3740 O O   . VAL A 1 482  ? -22.084 80.996 -5.558  1.00 154.11 ? 479  VAL A O   1 
ATOM 3741 C CB  . VAL A 1 482  ? -23.692 78.395 -6.888  1.00 111.66 ? 479  VAL A CB  1 
ATOM 3742 C CG1 . VAL A 1 482  ? -25.044 78.358 -6.170  1.00 111.66 ? 479  VAL A CG1 1 
ATOM 3743 C CG2 . VAL A 1 482  ? -23.744 77.551 -8.133  1.00 111.66 ? 479  VAL A CG2 1 
ATOM 3744 N N   . SER A 1 483  ? -24.318 81.110 -5.439  1.00 153.14 ? 480  SER A N   1 
ATOM 3745 C CA  . SER A 1 483  ? -24.304 81.964 -4.248  1.00 153.14 ? 480  SER A CA  1 
ATOM 3746 C C   . SER A 1 483  ? -25.038 81.397 -3.037  1.00 153.14 ? 480  SER A C   1 
ATOM 3747 O O   . SER A 1 483  ? -25.682 80.346 -3.105  1.00 153.14 ? 480  SER A O   1 
ATOM 3748 C CB  . SER A 1 483  ? -24.867 83.350 -4.571  1.00 99.57  ? 480  SER A CB  1 
ATOM 3749 O OG  . SER A 1 483  ? -23.938 84.141 -5.292  1.00 99.57  ? 480  SER A OG  1 
ATOM 3750 N N   . GLN A 1 484  ? -24.900 82.104 -1.918  1.00 218.25 ? 481  GLN A N   1 
ATOM 3751 C CA  . GLN A 1 484  ? -25.745 81.907 -0.750  1.00 218.25 ? 481  GLN A CA  1 
ATOM 3752 C C   . GLN A 1 484  ? -26.913 82.874 -0.901  1.00 218.25 ? 481  GLN A C   1 
ATOM 3753 O O   . GLN A 1 484  ? -28.065 82.520 -0.642  1.00 218.25 ? 481  GLN A O   1 
ATOM 3754 C CB  . GLN A 1 484  ? -24.988 82.223 0.545   1.00 122.06 ? 481  GLN A CB  1 
ATOM 3755 C CG  . GLN A 1 484  ? -23.479 81.987 0.500   1.00 122.06 ? 481  GLN A CG  1 
ATOM 3756 C CD  . GLN A 1 484  ? -23.059 80.591 0.896   1.00 122.06 ? 481  GLN A CD  1 
ATOM 3757 O OE1 . GLN A 1 484  ? -23.722 79.609 0.577   1.00 122.06 ? 481  GLN A OE1 1 
ATOM 3758 N NE2 . GLN A 1 484  ? -21.938 80.498 1.590   1.00 122.06 ? 481  GLN A NE2 1 
ATOM 3759 N N   . GLU A 1 485  ? -26.592 84.097 -1.329  1.00 193.45 ? 482  GLU A N   1 
ATOM 3760 C CA  . GLU A 1 485  ? -27.586 85.129 -1.616  1.00 193.45 ? 482  GLU A CA  1 
ATOM 3761 C C   . GLU A 1 485  ? -28.386 84.758 -2.890  1.00 193.45 ? 482  GLU A C   1 
ATOM 3762 O O   . GLU A 1 485  ? -29.462 84.170 -2.770  1.00 193.45 ? 482  GLU A O   1 
ATOM 3763 C CB  . GLU A 1 485  ? -26.931 86.520 -1.724  1.00 197.62 ? 482  GLU A CB  1 
ATOM 3764 C CG  . GLU A 1 485  ? -25.728 86.772 -0.802  1.00 197.62 ? 482  GLU A CG  1 
ATOM 3765 C CD  . GLU A 1 485  ? -26.061 87.668 0.388   1.00 197.62 ? 482  GLU A CD  1 
ATOM 3766 O OE1 . GLU A 1 485  ? -26.922 87.277 1.231   1.00 197.62 ? 482  GLU A OE1 1 
ATOM 3767 O OE2 . GLU A 1 485  ? -25.445 88.769 0.481   1.00 197.62 ? 482  GLU A OE2 1 
ATOM 3768 N N   . PRO A 1 486  ? -27.871 85.091 -4.104  1.00 218.25 ? 483  PRO A N   1 
ATOM 3769 C CA  . PRO A 1 486  ? -28.517 84.696 -5.368  1.00 218.25 ? 483  PRO A CA  1 
ATOM 3770 C C   . PRO A 1 486  ? -28.767 83.195 -5.549  1.00 218.25 ? 483  PRO A C   1 
ATOM 3771 O O   . PRO A 1 486  ? -29.894 82.808 -5.865  1.00 218.25 ? 483  PRO A O   1 
ATOM 3772 C CB  . PRO A 1 486  ? -27.536 85.197 -6.430  1.00 187.81 ? 483  PRO A CB  1 
ATOM 3773 C CG  . PRO A 1 486  ? -26.869 86.335 -5.791  1.00 187.81 ? 483  PRO A CG  1 
ATOM 3774 C CD  . PRO A 1 486  ? -26.678 85.916 -4.370  1.00 187.81 ? 483  PRO A CD  1 
ATOM 3775 N N   . LYS A 1 487  ? -27.732 82.370 -5.375  1.00 143.21 ? 484  LYS A N   1 
ATOM 3776 C CA  . LYS A 1 487  ? -27.871 80.907 -5.422  1.00 143.21 ? 484  LYS A CA  1 
ATOM 3777 C C   . LYS A 1 487  ? -28.338 80.403 -6.804  1.00 143.21 ? 484  LYS A C   1 
ATOM 3778 O O   . LYS A 1 487  ? -29.321 79.675 -6.923  1.00 143.21 ? 484  LYS A O   1 
ATOM 3779 C CB  . LYS A 1 487  ? -28.780 80.426 -4.264  1.00 115.73 ? 484  LYS A CB  1 
ATOM 3780 C CG  . LYS A 1 487  ? -29.139 78.939 -4.241  1.00 115.73 ? 484  LYS A CG  1 
ATOM 3781 C CD  . LYS A 1 487  ? -27.976 78.027 -3.870  1.00 115.73 ? 484  LYS A CD  1 
ATOM 3782 C CE  . LYS A 1 487  ? -27.905 77.803 -2.372  1.00 115.73 ? 484  LYS A CE  1 
ATOM 3783 N NZ  . LYS A 1 487  ? -27.460 76.420 -2.070  1.00 115.73 ? 484  LYS A NZ  1 
ATOM 3784 N N   . ALA A 1 488  ? -27.623 80.809 -7.847  1.00 211.11 ? 485  ALA A N   1 
ATOM 3785 C CA  . ALA A 1 488  ? -27.961 80.405 -9.209  1.00 211.11 ? 485  ALA A CA  1 
ATOM 3786 C C   . ALA A 1 488  ? -26.719 80.435 -10.104 1.00 211.11 ? 485  ALA A C   1 
ATOM 3787 O O   . ALA A 1 488  ? -25.649 79.990 -9.690  1.00 211.11 ? 485  ALA A O   1 
ATOM 3788 C CB  . ALA A 1 488  ? -29.072 81.297 -9.767  1.00 148.86 ? 485  ALA A CB  1 
ATOM 3789 N N   . LEU A 1 489  ? -26.867 80.956 -11.323 1.00 171.85 ? 486  LEU A N   1 
ATOM 3790 C CA  . LEU A 1 489  ? -25.751 81.110 -12.267 1.00 171.85 ? 486  LEU A CA  1 
ATOM 3791 C C   . LEU A 1 489  ? -25.051 82.460 -12.063 1.00 171.85 ? 486  LEU A C   1 
ATOM 3792 O O   . LEU A 1 489  ? -24.960 83.287 -12.982 1.00 171.85 ? 486  LEU A O   1 
ATOM 3793 C CB  . LEU A 1 489  ? -26.243 80.949 -13.716 1.00 123.28 ? 486  LEU A CB  1 
ATOM 3794 C CG  . LEU A 1 489  ? -25.257 80.606 -14.844 1.00 123.28 ? 486  LEU A CG  1 
ATOM 3795 C CD1 . LEU A 1 489  ? -24.344 79.424 -14.486 1.00 123.28 ? 486  LEU A CD1 1 
ATOM 3796 C CD2 . LEU A 1 489  ? -26.012 80.342 -16.149 1.00 123.28 ? 486  LEU A CD2 1 
ATOM 3797 N N   . VAL A 1 490  ? -24.560 82.654 -10.838 1.00 148.08 ? 487  VAL A N   1 
ATOM 3798 C CA  . VAL A 1 490  ? -23.908 83.887 -10.386 1.00 148.08 ? 487  VAL A CA  1 
ATOM 3799 C C   . VAL A 1 490  ? -22.766 84.281 -11.315 1.00 148.08 ? 487  VAL A C   1 
ATOM 3800 O O   . VAL A 1 490  ? -22.599 85.456 -11.655 1.00 148.08 ? 487  VAL A O   1 
ATOM 3801 C CB  . VAL A 1 490  ? -23.412 83.714 -8.930  1.00 84.50  ? 487  VAL A CB  1 
ATOM 3802 C CG1 . VAL A 1 490  ? -22.692 84.960 -8.420  1.00 84.50  ? 487  VAL A CG1 1 
ATOM 3803 C CG2 . VAL A 1 490  ? -24.591 83.372 -8.037  1.00 84.50  ? 487  VAL A CG2 1 
ATOM 3804 N N   . SER A 1 491  ? -21.989 83.280 -11.715 1.00 176.06 ? 488  SER A N   1 
ATOM 3805 C CA  . SER A 1 491  ? -20.991 83.414 -12.766 1.00 176.06 ? 488  SER A CA  1 
ATOM 3806 C C   . SER A 1 491  ? -20.679 82.014 -13.296 1.00 176.06 ? 488  SER A C   1 
ATOM 3807 O O   . SER A 1 491  ? -21.329 81.034 -12.910 1.00 176.06 ? 488  SER A O   1 
ATOM 3808 C CB  . SER A 1 491  ? -19.727 84.109 -12.244 1.00 183.70 ? 488  SER A CB  1 
ATOM 3809 O OG  . SER A 1 491  ? -19.064 84.840 -13.261 1.00 183.70 ? 488  SER A OG  1 
ATOM 3810 N N   . GLU A 1 492  ? -19.690 81.935 -14.182 1.00 127.67 ? 489  GLU A N   1 
ATOM 3811 C CA  . GLU A 1 492  ? -19.295 80.694 -14.835 1.00 127.67 ? 489  GLU A CA  1 
ATOM 3812 C C   . GLU A 1 492  ? -18.176 80.998 -15.822 1.00 127.67 ? 489  GLU A C   1 
ATOM 3813 O O   . GLU A 1 492  ? -18.344 81.814 -16.729 1.00 127.67 ? 489  GLU A O   1 
ATOM 3814 C CB  . GLU A 1 492  ? -20.483 80.075 -15.568 1.00 121.34 ? 489  GLU A CB  1 
ATOM 3815 C CG  . GLU A 1 492  ? -20.242 78.675 -16.069 1.00 121.34 ? 489  GLU A CG  1 
ATOM 3816 C CD  . GLU A 1 492  ? -21.387 78.165 -16.904 1.00 121.34 ? 489  GLU A CD  1 
ATOM 3817 O OE1 . GLU A 1 492  ? -22.416 78.871 -16.988 1.00 121.34 ? 489  GLU A OE1 1 
ATOM 3818 O OE2 . GLU A 1 492  ? -21.259 77.062 -17.478 1.00 121.34 ? 489  GLU A OE2 1 
ATOM 3819 N N   . TRP A 1 493  ? -17.034 80.346 -15.643 1.00 218.25 ? 490  TRP A N   1 
ATOM 3820 C CA  . TRP A 1 493  ? -15.913 80.541 -16.546 1.00 218.25 ? 490  TRP A CA  1 
ATOM 3821 C C   . TRP A 1 493  ? -15.816 79.364 -17.507 1.00 218.25 ? 490  TRP A C   1 
ATOM 3822 O O   . TRP A 1 493  ? -15.782 78.205 -17.086 1.00 218.25 ? 490  TRP A O   1 
ATOM 3823 C CB  . TRP A 1 493  ? -14.616 80.725 -15.760 1.00 117.84 ? 490  TRP A CB  1 
ATOM 3824 C CG  . TRP A 1 493  ? -13.420 81.082 -16.598 1.00 117.84 ? 490  TRP A CG  1 
ATOM 3825 C CD1 . TRP A 1 493  ? -12.983 82.335 -16.900 1.00 117.84 ? 490  TRP A CD1 1 
ATOM 3826 C CD2 . TRP A 1 493  ? -12.496 80.175 -17.223 1.00 117.84 ? 490  TRP A CD2 1 
ATOM 3827 N NE1 . TRP A 1 493  ? -11.854 82.271 -17.682 1.00 117.84 ? 490  TRP A NE1 1 
ATOM 3828 C CE2 . TRP A 1 493  ? -11.535 80.957 -17.896 1.00 117.84 ? 490  TRP A CE2 1 
ATOM 3829 C CE3 . TRP A 1 493  ? -12.391 78.777 -17.283 1.00 117.84 ? 490  TRP A CE3 1 
ATOM 3830 C CZ2 . TRP A 1 493  ? -10.480 80.391 -18.618 1.00 117.84 ? 490  TRP A CZ2 1 
ATOM 3831 C CZ3 . TRP A 1 493  ? -11.340 78.213 -18.005 1.00 117.84 ? 490  TRP A CZ3 1 
ATOM 3832 C CH2 . TRP A 1 493  ? -10.401 79.022 -18.662 1.00 117.84 ? 490  TRP A CH2 1 
ATOM 3833 N N   . LYS A 1 494  ? -15.790 79.683 -18.799 1.00 192.97 ? 491  LYS A N   1 
ATOM 3834 C CA  . LYS A 1 494  ? -15.677 78.688 -19.857 1.00 192.97 ? 491  LYS A CA  1 
ATOM 3835 C C   . LYS A 1 494  ? -14.411 78.974 -20.665 1.00 192.97 ? 491  LYS A C   1 
ATOM 3836 O O   . LYS A 1 494  ? -14.113 80.130 -20.974 1.00 192.97 ? 491  LYS A O   1 
ATOM 3837 C CB  . LYS A 1 494  ? -16.921 78.738 -20.751 1.00 110.92 ? 491  LYS A CB  1 
ATOM 3838 C CG  . LYS A 1 494  ? -17.006 77.660 -21.825 1.00 110.92 ? 491  LYS A CG  1 
ATOM 3839 C CD  . LYS A 1 494  ? -17.719 76.414 -21.333 1.00 110.92 ? 491  LYS A CD  1 
ATOM 3840 C CE  . LYS A 1 494  ? -17.591 75.298 -22.361 1.00 110.92 ? 491  LYS A CE  1 
ATOM 3841 N NZ  . LYS A 1 494  ? -18.060 73.966 -21.870 1.00 110.92 ? 491  LYS A NZ  1 
ATOM 3842 N N   . GLU A 1 495  ? -13.670 77.918 -20.995 1.00 116.95 ? 492  GLU A N   1 
ATOM 3843 C CA  . GLU A 1 495  ? -12.388 78.039 -21.703 1.00 116.95 ? 492  GLU A CA  1 
ATOM 3844 C C   . GLU A 1 495  ? -12.564 78.530 -23.145 1.00 116.95 ? 492  GLU A C   1 
ATOM 3845 O O   . GLU A 1 495  ? -13.298 77.919 -23.929 1.00 116.95 ? 492  GLU A O   1 
ATOM 3846 C CB  . GLU A 1 495  ? -11.618 76.709 -21.657 1.00 145.18 ? 492  GLU A CB  1 
ATOM 3847 C CG  . GLU A 1 495  ? -10.142 76.787 -22.072 1.00 145.18 ? 492  GLU A CG  1 
ATOM 3848 C CD  . GLU A 1 495  ? -9.929  76.672 -23.577 1.00 145.18 ? 492  GLU A CD  1 
ATOM 3849 O OE1 . GLU A 1 495  ? -10.888 76.318 -24.293 1.00 145.18 ? 492  GLU A OE1 1 
ATOM 3850 O OE2 . GLU A 1 495  ? -8.797  76.929 -24.044 1.00 145.18 ? 492  GLU A OE2 1 
ATOM 3851 N N   . PRO A 1 496  ? -11.873 79.631 -23.495 1.00 172.56 ? 493  PRO A N   1 
ATOM 3852 C CA  . PRO A 1 496  ? -12.002 80.247 -24.802 1.00 172.56 ? 493  PRO A CA  1 
ATOM 3853 C C   . PRO A 1 496  ? -11.426 79.338 -25.876 1.00 172.56 ? 493  PRO A C   1 
ATOM 3854 O O   . PRO A 1 496  ? -10.276 79.522 -26.282 1.00 172.56 ? 493  PRO A O   1 
ATOM 3855 C CB  . PRO A 1 496  ? -11.157 81.517 -24.665 1.00 88.41  ? 493  PRO A CB  1 
ATOM 3856 C CG  . PRO A 1 496  ? -10.145 81.186 -23.648 1.00 88.41  ? 493  PRO A CG  1 
ATOM 3857 C CD  . PRO A 1 496  ? -10.898 80.351 -22.656 1.00 88.41  ? 493  PRO A CD  1 
ATOM 3858 N N   . GLN A 1 497  ? -12.229 78.363 -26.310 1.00 88.40  ? 494  GLN A N   1 
ATOM 3859 C CA  . GLN A 1 497  ? -11.840 77.368 -27.321 1.00 88.40  ? 494  GLN A CA  1 
ATOM 3860 C C   . GLN A 1 497  ? -12.671 76.089 -27.248 1.00 88.40  ? 494  GLN A C   1 
ATOM 3861 O O   . GLN A 1 497  ? -12.620 75.270 -28.171 1.00 88.40  ? 494  GLN A O   1 
ATOM 3862 C CB  . GLN A 1 497  ? -10.354 77.001 -27.202 1.00 118.68 ? 494  GLN A CB  1 
ATOM 3863 C CG  . GLN A 1 497  ? -9.444  77.725 -28.172 1.00 118.68 ? 494  GLN A CG  1 
ATOM 3864 C CD  . GLN A 1 497  ? -9.393  77.053 -29.516 1.00 118.68 ? 494  GLN A CD  1 
ATOM 3865 O OE1 . GLN A 1 497  ? -10.395 76.966 -30.229 1.00 118.68 ? 494  GLN A OE1 1 
ATOM 3866 N NE2 . GLN A 1 497  ? -8.218  76.565 -29.871 1.00 118.68 ? 494  GLN A NE2 1 
ATOM 3867 N N   . ALA A 1 498  ? -13.423 75.929 -26.153 1.00 184.44 ? 495  ALA A N   1 
ATOM 3868 C CA  . ALA A 1 498  ? -14.179 74.702 -25.834 1.00 184.44 ? 495  ALA A CA  1 
ATOM 3869 C C   . ALA A 1 498  ? -13.259 73.530 -25.499 1.00 184.44 ? 495  ALA A C   1 
ATOM 3870 O O   . ALA A 1 498  ? -13.364 72.455 -26.091 1.00 184.44 ? 495  ALA A O   1 
ATOM 3871 C CB  . ALA A 1 498  ? -15.148 74.331 -26.958 1.00 78.45  ? 495  ALA A CB  1 
ATOM 3872 N N   . LYS A 1 499  ? -12.363 73.754 -24.542 1.00 108.99 ? 496  LYS A N   1 
ATOM 3873 C CA  . LYS A 1 499  ? -11.357 72.764 -24.137 1.00 108.99 ? 496  LYS A CA  1 
ATOM 3874 C C   . LYS A 1 499  ? -11.453 72.450 -22.646 1.00 108.99 ? 496  LYS A C   1 
ATOM 3875 O O   . LYS A 1 499  ? -11.581 73.356 -21.814 1.00 108.99 ? 496  LYS A O   1 
ATOM 3876 C CB  . LYS A 1 499  ? -9.930  73.240 -24.473 1.00 88.53  ? 496  LYS A CB  1 
ATOM 3877 C CG  . LYS A 1 499  ? -9.405  72.820 -25.855 1.00 88.53  ? 496  LYS A CG  1 
ATOM 3878 C CD  . LYS A 1 499  ? -7.891  73.076 -26.001 1.00 88.53  ? 496  LYS A CD  1 
ATOM 3879 C CE  . LYS A 1 499  ? -7.581  74.520 -26.360 1.00 88.53  ? 496  LYS A CE  1 
ATOM 3880 N NZ  . LYS A 1 499  ? -6.131  74.724 -26.531 1.00 88.53  ? 496  LYS A NZ  1 
ATOM 3881 N N   . ASN A 1 500  ? -11.363 71.164 -22.313 1.00 105.49 ? 497  ASN A N   1 
ATOM 3882 C CA  . ASN A 1 500  ? -11.570 70.717 -20.940 1.00 105.49 ? 497  ASN A CA  1 
ATOM 3883 C C   . ASN A 1 500  ? -10.480 71.092 -19.953 1.00 105.49 ? 497  ASN A C   1 
ATOM 3884 O O   . ASN A 1 500  ? -9.303  71.199 -20.298 1.00 105.49 ? 497  ASN A O   1 
ATOM 3885 C CB  . ASN A 1 500  ? -11.860 69.212 -20.880 1.00 111.78 ? 497  ASN A CB  1 
ATOM 3886 C CG  . ASN A 1 500  ? -13.354 68.898 -20.977 1.00 111.78 ? 497  ASN A CG  1 
ATOM 3887 O OD1 . ASN A 1 500  ? -14.199 69.698 -20.571 1.00 111.78 ? 497  ASN A OD1 1 
ATOM 3888 N ND2 . ASN A 1 500  ? -13.681 67.728 -21.513 1.00 111.78 ? 497  ASN A ND2 1 
ATOM 3889 N N   . ILE A 1 501  ? -10.916 71.330 -18.723 1.00 175.24 ? 498  ILE A N   1 
ATOM 3890 C CA  . ILE A 1 501  ? -10.026 71.524 -17.602 1.00 175.24 ? 498  ILE A CA  1 
ATOM 3891 C C   . ILE A 1 501  ? -9.467  70.150 -17.252 1.00 175.24 ? 498  ILE A C   1 
ATOM 3892 O O   . ILE A 1 501  ? -10.209 69.171 -17.138 1.00 175.24 ? 498  ILE A O   1 
ATOM 3893 C CB  . ILE A 1 501  ? -10.775 72.138 -16.402 1.00 131.46 ? 498  ILE A CB  1 
ATOM 3894 C CG1 . ILE A 1 501  ? -11.504 73.416 -16.835 1.00 131.46 ? 498  ILE A CG1 1 
ATOM 3895 C CG2 . ILE A 1 501  ? -9.808  72.429 -15.267 1.00 131.46 ? 498  ILE A CG2 1 
ATOM 3896 C CD1 . ILE A 1 501  ? -12.746 73.743 -16.031 1.00 131.46 ? 498  ILE A CD1 1 
ATOM 3897 N N   . SER A 1 502  ? -8.157  70.095 -17.035 1.00 82.95  ? 499  SER A N   1 
ATOM 3898 C CA  . SER A 1 502  ? -7.453  68.876 -16.678 1.00 82.95  ? 499  SER A CA  1 
ATOM 3899 C C   . SER A 1 502  ? -7.242  68.751 -15.186 1.00 82.95  ? 499  SER A C   1 
ATOM 3900 O O   . SER A 1 502  ? -7.690  67.789 -14.590 1.00 82.95  ? 499  SER A O   1 
ATOM 3901 C CB  . SER A 1 502  ? -6.105  68.891 -17.343 1.00 77.20  ? 499  SER A CB  1 
ATOM 3902 O OG  . SER A 1 502  ? -5.574  70.186 -17.247 1.00 77.20  ? 499  SER A OG  1 
ATOM 3903 N N   . VAL A 1 503  ? -6.547  69.732 -14.615 1.00 91.05  ? 500  VAL A N   1 
ATOM 3904 C CA  . VAL A 1 503  ? -6.218  69.849 -13.190 1.00 91.05  ? 500  VAL A CA  1 
ATOM 3905 C C   . VAL A 1 503  ? -6.986  71.068 -12.755 1.00 91.05  ? 500  VAL A C   1 
ATOM 3906 O O   . VAL A 1 503  ? -7.008  72.014 -13.508 1.00 91.05  ? 500  VAL A O   1 
ATOM 3907 C CB  . VAL A 1 503  ? -4.774  70.191 -13.001 1.00 65.60  ? 500  VAL A CB  1 
ATOM 3908 C CG1 . VAL A 1 503  ? -4.556  70.794 -11.653 1.00 65.60  ? 500  VAL A CG1 1 
ATOM 3909 C CG2 . VAL A 1 503  ? -3.923  69.006 -13.235 1.00 65.60  ? 500  VAL A CG2 1 
ATOM 3910 N N   . ALA A 1 504  ? -7.480  70.979 -11.530 1.00 137.16 ? 501  ALA A N   1 
ATOM 3911 C CA  . ALA A 1 504  ? -8.232  71.980 -10.821 1.00 137.16 ? 501  ALA A CA  1 
ATOM 3912 C C   . ALA A 1 504  ? -7.362  72.453 -9.664  1.00 137.16 ? 501  ALA A C   1 
ATOM 3913 O O   . ALA A 1 504  ? -6.293  71.935 -9.419  1.00 137.16 ? 501  ALA A O   1 
ATOM 3914 C CB  . ALA A 1 504  ? -9.492  71.360 -10.287 1.00 108.42 ? 501  ALA A CB  1 
ATOM 3915 N N   . SER A 1 505  ? -7.833  73.444 -8.941  1.00 174.54 ? 502  SER A N   1 
ATOM 3916 C CA  . SER A 1 505  ? -7.111  73.982 -7.811  1.00 174.54 ? 502  SER A CA  1 
ATOM 3917 C C   . SER A 1 505  ? -7.880  75.251 -7.532  1.00 174.54 ? 502  SER A C   1 
ATOM 3918 O O   . SER A 1 505  ? -7.723  76.250 -8.250  1.00 174.54 ? 502  SER A O   1 
ATOM 3919 C CB  . SER A 1 505  ? -5.650  74.251 -8.159  1.00 70.60  ? 502  SER A CB  1 
ATOM 3920 O OG  . SER A 1 505  ? -4.787  73.436 -7.384  1.00 70.60  ? 502  SER A OG  1 
ATOM 3921 N N   . CYS A 1 506  ? -8.732  75.176 -6.508  1.00 160.78 ? 503  CYS A N   1 
ATOM 3922 C CA  . CYS A 1 506  ? -9.544  76.286 -6.032  1.00 160.78 ? 503  CYS A CA  1 
ATOM 3923 C C   . CYS A 1 506  ? -9.009  76.487 -4.622  1.00 160.78 ? 503  CYS A C   1 
ATOM 3924 O O   . CYS A 1 506  ? -8.656  75.520 -3.925  1.00 160.78 ? 503  CYS A O   1 
ATOM 3925 C CB  . CYS A 1 506  ? -11.016 75.992 -5.897  1.00 143.13 ? 503  CYS A CB  1 
ATOM 3926 S SG  . CYS A 1 506  ? -11.771 77.374 -5.007  1.00 143.13 ? 503  CYS A SG  1 
ATOM 3927 N N   . ASN A 1 507  ? -8.961  77.748 -4.226  1.00 218.25 ? 504  ASN A N   1 
ATOM 3928 C CA  . ASN A 1 507  ? -8.501  78.196 -2.928  1.00 218.25 ? 504  ASN A CA  1 
ATOM 3929 C C   . ASN A 1 507  ? -9.736  78.960 -2.378  1.00 218.25 ? 504  ASN A C   1 
ATOM 3930 O O   . ASN A 1 507  ? -10.654 79.283 -3.126  1.00 218.25 ? 504  ASN A O   1 
ATOM 3931 C CB  . ASN A 1 507  ? -7.307  79.118 -3.147  1.00 93.67  ? 504  ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 507  ? -6.648  79.541 -1.888  1.00 93.67  ? 504  ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 507  ? -7.074  80.482 -1.242  1.00 93.67  ? 504  ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 507  ? -5.568  78.879 -1.549  1.00 93.67  ? 504  ASN A ND2 1 
ATOM 3935 N N   . SER A 1 508  ? -9.805  79.258 -1.090  1.00 178.61 ? 505  SER A N   1 
ATOM 3936 C CA  . SER A 1 508  ? -10.978 79.969 -0.596  1.00 178.61 ? 505  SER A CA  1 
ATOM 3937 C C   . SER A 1 508  ? -10.964 81.429 -1.037  1.00 178.61 ? 505  SER A C   1 
ATOM 3938 O O   . SER A 1 508  ? -11.639 82.272 -0.447  1.00 178.61 ? 505  SER A O   1 
ATOM 3939 C CB  . SER A 1 508  ? -11.056 79.881 0.929   1.00 123.71 ? 505  SER A CB  1 
ATOM 3940 O OG  . SER A 1 508  ? -12.193 80.569 1.423   1.00 123.71 ? 505  SER A OG  1 
ATOM 3941 N N   . SER A 1 509  ? -10.191 81.720 -2.078  1.00 154.30 ? 506  SER A N   1 
ATOM 3942 C CA  . SER A 1 509  ? -10.087 83.078 -2.600  1.00 154.30 ? 506  SER A CA  1 
ATOM 3943 C C   . SER A 1 509  ? -9.573  83.077 -4.036  1.00 154.30 ? 506  SER A C   1 
ATOM 3944 O O   . SER A 1 509  ? -10.115 83.767 -4.899  1.00 154.30 ? 506  SER A O   1 
ATOM 3945 C CB  . SER A 1 509  ? -9.171  83.924 -1.714  1.00 127.11 ? 506  SER A CB  1 
ATOM 3946 O OG  . SER A 1 509  ? -9.668  83.998 -0.389  1.00 127.11 ? 506  SER A OG  1 
ATOM 3947 N N   . GLN A 1 510  ? -8.525  82.299 -4.283  1.00 218.25 ? 507  GLN A N   1 
ATOM 3948 C CA  . GLN A 1 510  ? -7.930  82.205 -5.627  1.00 218.25 ? 507  GLN A CA  1 
ATOM 3949 C C   . GLN A 1 510  ? -8.424  80.971 -6.400  1.00 218.25 ? 507  GLN A C   1 
ATOM 3950 O O   . GLN A 1 510  ? -9.066  80.088 -5.826  1.00 218.25 ? 507  GLN A O   1 
ATOM 3951 C CB  . GLN A 1 510  ? -6.403  82.119 -5.533  1.00 102.71 ? 507  GLN A CB  1 
ATOM 3952 C CG  . GLN A 1 510  ? -5.658  83.367 -5.075  1.00 102.71 ? 507  GLN A CG  1 
ATOM 3953 C CD  . GLN A 1 510  ? -4.295  83.006 -4.518  1.00 102.71 ? 507  GLN A CD  1 
ATOM 3954 O OE1 . GLN A 1 510  ? -3.253  83.436 -5.025  1.00 102.71 ? 507  GLN A OE1 1 
ATOM 3955 N NE2 . GLN A 1 510  ? -4.296  82.179 -3.479  1.00 102.71 ? 507  GLN A NE2 1 
ATOM 3956 N N   . VAL A 1 511  ? -8.103  80.924 -7.698  1.00 218.25 ? 508  VAL A N   1 
ATOM 3957 C CA  . VAL A 1 511  ? -8.371  79.769 -8.580  1.00 218.25 ? 508  VAL A CA  1 
ATOM 3958 C C   . VAL A 1 511  ? -7.223  79.579 -9.597  1.00 218.25 ? 508  VAL A C   1 
ATOM 3959 O O   . VAL A 1 511  ? -6.871  80.511 -10.327 1.00 218.25 ? 508  VAL A O   1 
ATOM 3960 C CB  . VAL A 1 511  ? -9.750  79.896 -9.337  1.00 137.17 ? 508  VAL A CB  1 
ATOM 3961 C CG1 . VAL A 1 511  ? -9.911  78.823 -10.419 1.00 137.17 ? 508  VAL A CG1 1 
ATOM 3962 C CG2 . VAL A 1 511  ? -10.930 79.829 -8.374  1.00 137.17 ? 508  VAL A CG2 1 
ATOM 3963 N N   . VAL A 1 512  ? -6.635  78.380 -9.620  1.00 124.29 ? 509  VAL A N   1 
ATOM 3964 C CA  . VAL A 1 512  ? -5.687  77.971 -10.673 1.00 124.29 ? 509  VAL A CA  1 
ATOM 3965 C C   . VAL A 1 512  ? -6.099  76.648 -11.330 1.00 124.29 ? 509  VAL A C   1 
ATOM 3966 O O   . VAL A 1 512  ? -6.014  75.581 -10.709 1.00 124.29 ? 509  VAL A O   1 
ATOM 3967 C CB  . VAL A 1 512  ? -4.229  77.799 -10.155 1.00 62.42  ? 509  VAL A CB  1 
ATOM 3968 C CG1 . VAL A 1 512  ? -3.321  77.235 -11.278 1.00 62.42  ? 509  VAL A CG1 1 
ATOM 3969 C CG2 . VAL A 1 512  ? -3.672  79.115 -9.599  1.00 62.42  ? 509  VAL A CG2 1 
ATOM 3970 N N   . VAL A 1 513  ? -6.532  76.716 -12.585 1.00 95.83  ? 510  VAL A N   1 
ATOM 3971 C CA  . VAL A 1 513  ? -6.776  75.498 -13.363 1.00 95.83  ? 510  VAL A CA  1 
ATOM 3972 C C   . VAL A 1 513  ? -5.577  75.164 -14.272 1.00 95.83  ? 510  VAL A C   1 
ATOM 3973 O O   . VAL A 1 513  ? -4.543  75.859 -14.261 1.00 95.83  ? 510  VAL A O   1 
ATOM 3974 C CB  . VAL A 1 513  ? -8.114  75.547 -14.174 1.00 143.96 ? 510  VAL A CB  1 
ATOM 3975 C CG1 . VAL A 1 513  ? -9.321  75.402 -13.250 1.00 143.96 ? 510  VAL A CG1 1 
ATOM 3976 C CG2 . VAL A 1 513  ? -8.215  76.817 -15.001 1.00 143.96 ? 510  VAL A CG2 1 
ATOM 3977 N N   . ALA A 1 514  ? -5.709  74.077 -15.024 1.00 68.40  ? 511  ALA A N   1 
ATOM 3978 C CA  . ALA A 1 514  ? -4.739  73.731 -16.040 1.00 68.40  ? 511  ALA A CA  1 
ATOM 3979 C C   . ALA A 1 514  ? -5.504  72.994 -17.112 1.00 68.40  ? 511  ALA A C   1 
ATOM 3980 O O   . ALA A 1 514  ? -6.442  72.244 -16.806 1.00 68.40  ? 511  ALA A O   1 
ATOM 3981 C CB  . ALA A 1 514  ? -3.630  72.874 -15.465 1.00 75.43  ? 511  ALA A CB  1 
ATOM 3982 N N   . VAL A 1 515  ? -5.121  73.251 -18.366 1.00 92.75  ? 512  VAL A N   1 
ATOM 3983 C CA  . VAL A 1 515  ? -5.768  72.646 -19.535 1.00 92.75  ? 512  VAL A CA  1 
ATOM 3984 C C   . VAL A 1 515  ? -4.849  71.617 -20.216 1.00 92.75  ? 512  VAL A C   1 
ATOM 3985 O O   . VAL A 1 515  ? -5.238  70.963 -21.188 1.00 92.75  ? 512  VAL A O   1 
ATOM 3986 C CB  . VAL A 1 515  ? -6.290  73.731 -20.508 1.00 109.00 ? 512  VAL A CB  1 
ATOM 3987 C CG1 . VAL A 1 515  ? -6.620  73.157 -21.890 1.00 109.00 ? 512  VAL A CG1 1 
ATOM 3988 C CG2 . VAL A 1 515  ? -7.517  74.410 -19.904 1.00 109.00 ? 512  VAL A CG2 1 
ATOM 3989 N N   . GLY A 1 516  ? -3.655  71.443 -19.654 1.00 79.20  ? 513  GLY A N   1 
ATOM 3990 C CA  . GLY A 1 516  ? -2.639  70.563 -20.218 1.00 79.20  ? 513  GLY A CA  1 
ATOM 3991 C C   . GLY A 1 516  ? -1.289  71.157 -19.900 1.00 79.20  ? 513  GLY A C   1 
ATOM 3992 O O   . GLY A 1 516  ? -0.636  70.748 -18.934 1.00 79.20  ? 513  GLY A O   1 
ATOM 3993 N N   . ARG A 1 517  ? -0.797  71.996 -20.800 1.00 101.23 ? 514  ARG A N   1 
ATOM 3994 C CA  . ARG A 1 517  ? 0.473   72.671 -20.611 1.00 101.23 ? 514  ARG A CA  1 
ATOM 3995 C C   . ARG A 1 517  ? 0.022   74.092 -20.454 1.00 101.23 ? 514  ARG A C   1 
ATOM 3996 O O   . ARG A 1 517  ? 0.785   74.992 -20.101 1.00 101.23 ? 514  ARG A O   1 
ATOM 3997 C CB  . ARG A 1 517  ? 1.358   72.522 -21.846 1.00 92.67  ? 514  ARG A CB  1 
ATOM 3998 C CG  . ARG A 1 517  ? 1.065   71.281 -22.674 1.00 92.67  ? 514  ARG A CG  1 
ATOM 3999 C CD  . ARG A 1 517  ? 2.018   71.165 -23.852 1.00 92.67  ? 514  ARG A CD  1 
ATOM 4000 N NE  . ARG A 1 517  ? 1.887   72.289 -24.775 1.00 92.67  ? 514  ARG A NE  1 
ATOM 4001 C CZ  . ARG A 1 517  ? 1.043   72.319 -25.800 1.00 92.67  ? 514  ARG A CZ  1 
ATOM 4002 N NH1 . ARG A 1 517  ? 0.249   71.284 -26.039 1.00 92.67  ? 514  ARG A NH1 1 
ATOM 4003 N NH2 . ARG A 1 517  ? 0.991   73.384 -26.588 1.00 92.67  ? 514  ARG A NH2 1 
ATOM 4004 N N   . ALA A 1 518  ? -1.264  74.262 -20.725 1.00 88.78  ? 515  ALA A N   1 
ATOM 4005 C CA  . ALA A 1 518  ? -1.945  75.536 -20.549 1.00 88.78  ? 515  ALA A CA  1 
ATOM 4006 C C   . ALA A 1 518  ? -2.266  75.803 -19.090 1.00 88.78  ? 515  ALA A C   1 
ATOM 4007 O O   . ALA A 1 518  ? -2.750  74.920 -18.372 1.00 88.78  ? 515  ALA A O   1 
ATOM 4008 C CB  . ALA A 1 518  ? -3.223  75.573 -21.397 1.00 137.39 ? 515  ALA A CB  1 
ATOM 4009 N N   . LEU A 1 519  ? -1.992  77.027 -18.662 1.00 150.54 ? 516  LEU A N   1 
ATOM 4010 C CA  . LEU A 1 519  ? -2.287  77.432 -17.306 1.00 150.54 ? 516  LEU A CA  1 
ATOM 4011 C C   . LEU A 1 519  ? -2.974  78.777 -17.309 1.00 150.54 ? 516  LEU A C   1 
ATOM 4012 O O   . LEU A 1 519  ? -2.376  79.791 -17.669 1.00 150.54 ? 516  LEU A O   1 
ATOM 4013 C CB  . LEU A 1 519  ? -1.011  77.496 -16.471 1.00 90.09  ? 516  LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 519  ? -0.245  76.197 -16.233 1.00 90.09  ? 516  LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 519  ? 1.153   76.521 -15.736 1.00 90.09  ? 516  LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 519  ? -0.990  75.322 -15.236 1.00 90.09  ? 516  LEU A CD2 1 
ATOM 4017 N N   . TYR A 1 520  ? -4.242  78.770 -16.917 1.00 104.79 ? 517  TYR A N   1 
ATOM 4018 C CA  . TYR A 1 520  ? -5.007  79.997 -16.738 1.00 104.79 ? 517  TYR A CA  1 
ATOM 4019 C C   . TYR A 1 520  ? -4.869  80.500 -15.283 1.00 104.79 ? 517  TYR A C   1 
ATOM 4020 O O   . TYR A 1 520  ? -3.810  80.304 -14.655 1.00 104.79 ? 517  TYR A O   1 
ATOM 4021 C CB  . TYR A 1 520  ? -6.475  79.793 -17.154 1.00 138.85 ? 517  TYR A CB  1 
ATOM 4022 C CG  . TYR A 1 520  ? -6.684  79.529 -18.639 1.00 138.85 ? 517  TYR A CG  1 
ATOM 4023 C CD1 . TYR A 1 520  ? -6.439  78.268 -19.189 1.00 138.85 ? 517  TYR A CD1 1 
ATOM 4024 C CD2 . TYR A 1 520  ? -7.144  80.534 -19.489 1.00 138.85 ? 517  TYR A CD2 1 
ATOM 4025 C CE1 . TYR A 1 520  ? -6.635  78.021 -20.547 1.00 138.85 ? 517  TYR A CE1 1 
ATOM 4026 C CE2 . TYR A 1 520  ? -7.349  80.295 -20.851 1.00 138.85 ? 517  TYR A CE2 1 
ATOM 4027 C CZ  . TYR A 1 520  ? -7.091  79.037 -21.370 1.00 138.85 ? 517  TYR A CZ  1 
ATOM 4028 O OH  . TYR A 1 520  ? -7.285  78.792 -22.710 1.00 138.85 ? 517  TYR A OH  1 
ATOM 4029 N N   . TYR A 1 521  ? -5.924  81.158 -14.779 1.00 218.25 ? 518  TYR A N   1 
ATOM 4030 C CA  . TYR A 1 521  ? -5.997  81.776 -13.436 1.00 218.25 ? 518  TYR A CA  1 
ATOM 4031 C C   . TYR A 1 521  ? -7.219  82.703 -13.398 1.00 218.25 ? 518  TYR A C   1 
ATOM 4032 O O   . TYR A 1 521  ? -7.341  83.603 -14.231 1.00 218.25 ? 518  TYR A O   1 
ATOM 4033 C CB  . TYR A 1 521  ? -4.720  82.578 -13.108 1.00 112.19 ? 518  TYR A CB  1 
ATOM 4034 C CG  . TYR A 1 521  ? -4.694  83.317 -11.775 1.00 112.19 ? 518  TYR A CG  1 
ATOM 4035 C CD1 . TYR A 1 521  ? -3.493  83.799 -11.252 1.00 112.19 ? 518  TYR A CD1 1 
ATOM 4036 C CD2 . TYR A 1 521  ? -5.857  83.534 -11.041 1.00 112.19 ? 518  TYR A CD2 1 
ATOM 4037 C CE1 . TYR A 1 521  ? -3.464  84.485 -10.032 1.00 112.19 ? 518  TYR A CE1 1 
ATOM 4038 C CE2 . TYR A 1 521  ? -5.841  84.212 -9.833  1.00 112.19 ? 518  TYR A CE2 1 
ATOM 4039 C CZ  . TYR A 1 521  ? -4.650  84.685 -9.330  1.00 112.19 ? 518  TYR A CZ  1 
ATOM 4040 O OH  . TYR A 1 521  ? -4.661  85.357 -8.126  1.00 112.19 ? 518  TYR A OH  1 
ATOM 4041 N N   . LEU A 1 522  ? -8.117  82.480 -12.436 1.00 215.74 ? 519  LEU A N   1 
ATOM 4042 C CA  . LEU A 1 522  ? -9.311  83.328 -12.260 1.00 215.74 ? 519  LEU A CA  1 
ATOM 4043 C C   . LEU A 1 522  ? -9.503  83.777 -10.797 1.00 215.74 ? 519  LEU A C   1 
ATOM 4044 O O   . LEU A 1 522  ? -8.824  83.280 -9.898  1.00 215.74 ? 519  LEU A O   1 
ATOM 4045 C CB  . LEU A 1 522  ? -10.577 82.617 -12.764 1.00 144.36 ? 519  LEU A CB  1 
ATOM 4046 C CG  . LEU A 1 522  ? -10.495 81.341 -13.606 1.00 144.36 ? 519  LEU A CG  1 
ATOM 4047 C CD1 . LEU A 1 522  ? -11.844 80.661 -13.571 1.00 144.36 ? 519  LEU A CD1 1 
ATOM 4048 C CD2 . LEU A 1 522  ? -10.035 81.594 -15.036 1.00 144.36 ? 519  LEU A CD2 1 
ATOM 4049 N N   . GLN A 1 523  ? -10.430 84.711 -10.565 1.00 179.16 ? 520  GLN A N   1 
ATOM 4050 C CA  . GLN A 1 523  ? -10.679 85.253 -9.218  1.00 179.16 ? 520  GLN A CA  1 
ATOM 4051 C C   . GLN A 1 523  ? -12.170 85.308 -8.879  1.00 179.16 ? 520  GLN A C   1 
ATOM 4052 O O   . GLN A 1 523  ? -12.988 85.685 -9.723  1.00 179.16 ? 520  GLN A O   1 
ATOM 4053 C CB  . GLN A 1 523  ? -10.090 86.657 -9.083  1.00 132.61 ? 520  GLN A CB  1 
ATOM 4054 C CG  . GLN A 1 523  ? -8.650  86.802 -9.530  1.00 132.61 ? 520  GLN A CG  1 
ATOM 4055 C CD  . GLN A 1 523  ? -8.487  87.936 -10.520 1.00 132.61 ? 520  GLN A CD  1 
ATOM 4056 O OE1 . GLN A 1 523  ? -8.797  87.793 -11.705 1.00 132.61 ? 520  GLN A OE1 1 
ATOM 4057 N NE2 . GLN A 1 523  ? -7.990  89.071 -10.040 1.00 132.61 ? 520  GLN A NE2 1 
ATOM 4058 N N   . ILE A 1 524  ? -12.506 84.958 -7.635  1.00 184.11 ? 521  ILE A N   1 
ATOM 4059 C CA  . ILE A 1 524  ? -13.900 84.922 -7.166  1.00 184.11 ? 521  ILE A CA  1 
ATOM 4060 C C   . ILE A 1 524  ? -14.355 86.290 -6.606  1.00 184.11 ? 521  ILE A C   1 
ATOM 4061 O O   . ILE A 1 524  ? -14.971 86.367 -5.535  1.00 184.11 ? 521  ILE A O   1 
ATOM 4062 C CB  . ILE A 1 524  ? -14.142 83.786 -6.096  1.00 126.99 ? 521  ILE A CB  1 
ATOM 4063 C CG1 . ILE A 1 524  ? -13.368 82.488 -6.424  1.00 126.99 ? 521  ILE A CG1 1 
ATOM 4064 C CG2 . ILE A 1 524  ? -15.650 83.533 -5.892  1.00 126.99 ? 521  ILE A CG2 1 
ATOM 4065 C CD1 . ILE A 1 524  ? -14.165 81.392 -7.163  1.00 126.99 ? 521  ILE A CD1 1 
ATOM 4066 N N   . HIS A 1 525  ? -14.061 87.367 -7.332  1.00 194.16 ? 522  HIS A N   1 
ATOM 4067 C CA  . HIS A 1 525  ? -14.415 88.707 -6.868  1.00 194.16 ? 522  HIS A CA  1 
ATOM 4068 C C   . HIS A 1 525  ? -15.917 88.945 -6.888  1.00 194.16 ? 522  HIS A C   1 
ATOM 4069 O O   . HIS A 1 525  ? -16.607 88.416 -7.760  1.00 194.16 ? 522  HIS A O   1 
ATOM 4070 C CB  . HIS A 1 525  ? -13.657 89.771 -7.647  1.00 119.88 ? 522  HIS A CB  1 
ATOM 4071 C CG  . HIS A 1 525  ? -12.232 89.893 -7.225  1.00 119.88 ? 522  HIS A CG  1 
ATOM 4072 N ND1 . HIS A 1 525  ? -11.869 90.249 -5.944  1.00 119.88 ? 522  HIS A ND1 1 
ATOM 4073 C CD2 . HIS A 1 525  ? -11.079 89.676 -7.899  1.00 119.88 ? 522  HIS A CD2 1 
ATOM 4074 C CE1 . HIS A 1 525  ? -10.551 90.256 -5.850  1.00 119.88 ? 522  HIS A CE1 1 
ATOM 4075 N NE2 . HIS A 1 525  ? -10.047 89.914 -7.023  1.00 119.88 ? 522  HIS A NE2 1 
ATOM 4076 N N   . PRO A 1 526  ? -16.422 89.746 -5.925  1.00 180.94 ? 523  PRO A N   1 
ATOM 4077 C CA  . PRO A 1 526  ? -17.850 89.812 -5.626  1.00 180.94 ? 523  PRO A CA  1 
ATOM 4078 C C   . PRO A 1 526  ? -18.773 89.350 -6.765  1.00 180.94 ? 523  PRO A C   1 
ATOM 4079 O O   . PRO A 1 526  ? -19.092 90.126 -7.672  1.00 180.94 ? 523  PRO A O   1 
ATOM 4080 C CB  . PRO A 1 526  ? -18.052 91.292 -5.285  1.00 76.89  ? 523  PRO A CB  1 
ATOM 4081 C CG  . PRO A 1 526  ? -16.733 91.684 -4.609  1.00 76.89  ? 523  PRO A CG  1 
ATOM 4082 C CD  . PRO A 1 526  ? -15.666 90.689 -5.074  1.00 76.89  ? 523  PRO A CD  1 
ATOM 4083 N N   . GLN A 1 527  ? -19.152 88.071 -6.712  1.00 119.08 ? 524  GLN A N   1 
ATOM 4084 C CA  . GLN A 1 527  ? -20.199 87.486 -7.561  1.00 119.08 ? 524  GLN A CA  1 
ATOM 4085 C C   . GLN A 1 527  ? -19.837 87.322 -9.036  1.00 119.08 ? 524  GLN A C   1 
ATOM 4086 O O   . GLN A 1 527  ? -20.716 87.386 -9.906  1.00 119.08 ? 524  GLN A O   1 
ATOM 4087 C CB  . GLN A 1 527  ? -21.506 88.274 -7.440  1.00 126.28 ? 524  GLN A CB  1 
ATOM 4088 C CG  . GLN A 1 527  ? -22.118 88.281 -6.056  1.00 126.28 ? 524  GLN A CG  1 
ATOM 4089 C CD  . GLN A 1 527  ? -23.593 88.620 -6.090  1.00 126.28 ? 524  GLN A CD  1 
ATOM 4090 O OE1 . GLN A 1 527  ? -24.355 88.028 -6.857  1.00 126.28 ? 524  GLN A OE1 1 
ATOM 4091 N NE2 . GLN A 1 527  ? -24.007 89.574 -5.256  1.00 126.28 ? 524  GLN A NE2 1 
ATOM 4092 N N   . GLU A 1 528  ? -18.553 87.111 -9.318  1.00 104.54 ? 525  GLU A N   1 
ATOM 4093 C CA  . GLU A 1 528  ? -18.088 86.942 -10.701 1.00 104.54 ? 525  GLU A CA  1 
ATOM 4094 C C   . GLU A 1 528  ? -16.670 86.373 -10.802 1.00 104.54 ? 525  GLU A C   1 
ATOM 4095 O O   . GLU A 1 528  ? -15.880 86.491 -9.865  1.00 104.54 ? 525  GLU A O   1 
ATOM 4096 C CB  . GLU A 1 528  ? -18.223 88.249 -11.509 1.00 182.57 ? 525  GLU A CB  1 
ATOM 4097 C CG  . GLU A 1 528  ? -17.760 89.522 -10.796 1.00 182.57 ? 525  GLU A CG  1 
ATOM 4098 C CD  . GLU A 1 528  ? -16.266 89.757 -10.901 1.00 182.57 ? 525  GLU A CD  1 
ATOM 4099 O OE1 . GLU A 1 528  ? -15.647 90.102 -9.877  1.00 182.57 ? 525  GLU A OE1 1 
ATOM 4100 O OE2 . GLU A 1 528  ? -15.708 89.604 -12.007 1.00 182.57 ? 525  GLU A OE2 1 
ATOM 4101 N N   . LEU A 1 529  ? -16.360 85.782 -11.957 1.00 103.45 ? 526  LEU A N   1 
ATOM 4102 C CA  . LEU A 1 529  ? -15.056 85.161 -12.210 1.00 103.45 ? 526  LEU A CA  1 
ATOM 4103 C C   . LEU A 1 529  ? -14.139 85.927 -13.193 1.00 103.45 ? 526  LEU A C   1 
ATOM 4104 O O   . LEU A 1 529  ? -14.169 85.685 -14.409 1.00 103.45 ? 526  LEU A O   1 
ATOM 4105 C CB  . LEU A 1 529  ? -15.261 83.726 -12.695 1.00 95.74  ? 526  LEU A CB  1 
ATOM 4106 C CG  . LEU A 1 529  ? -16.178 82.837 -11.851 1.00 95.74  ? 526  LEU A CG  1 
ATOM 4107 C CD1 . LEU A 1 529  ? -16.509 81.573 -12.617 1.00 95.74  ? 526  LEU A CD1 1 
ATOM 4108 C CD2 . LEU A 1 529  ? -15.567 82.501 -10.480 1.00 95.74  ? 526  LEU A CD2 1 
ATOM 4109 N N   . ARG A 1 530  ? -13.315 86.831 -12.659 1.00 167.75 ? 527  ARG A N   1 
ATOM 4110 C CA  . ARG A 1 530  ? -12.377 87.618 -13.473 1.00 167.75 ? 527  ARG A CA  1 
ATOM 4111 C C   . ARG A 1 530  ? -11.083 86.850 -13.711 1.00 167.75 ? 527  ARG A C   1 
ATOM 4112 O O   . ARG A 1 530  ? -10.631 86.122 -12.833 1.00 167.75 ? 527  ARG A O   1 
ATOM 4113 C CB  . ARG A 1 530  ? -12.065 88.951 -12.794 1.00 114.23 ? 527  ARG A CB  1 
ATOM 4114 C CG  . ARG A 1 530  ? -11.572 90.034 -13.745 1.00 114.23 ? 527  ARG A CG  1 
ATOM 4115 C CD  . ARG A 1 530  ? -11.405 91.369 -13.031 1.00 114.23 ? 527  ARG A CD  1 
ATOM 4116 N NE  . ARG A 1 530  ? -12.679 91.917 -12.557 1.00 114.23 ? 527  ARG A NE  1 
ATOM 4117 C CZ  . ARG A 1 530  ? -13.082 91.925 -11.286 1.00 114.23 ? 527  ARG A CZ  1 
ATOM 4118 N NH1 . ARG A 1 530  ? -12.316 91.412 -10.328 1.00 114.23 ? 527  ARG A NH1 1 
ATOM 4119 N NH2 . ARG A 1 530  ? -14.261 92.450 -10.971 1.00 114.23 ? 527  ARG A NH2 1 
ATOM 4120 N N   . GLN A 1 531  ? -10.482 87.039 -14.886 1.00 145.56 ? 528  GLN A N   1 
ATOM 4121 C CA  . GLN A 1 531  ? -9.308  86.264 -15.323 1.00 145.56 ? 528  GLN A CA  1 
ATOM 4122 C C   . GLN A 1 531  ? -7.999  87.063 -15.245 1.00 145.56 ? 528  GLN A C   1 
ATOM 4123 O O   . GLN A 1 531  ? -8.022  88.291 -15.331 1.00 145.56 ? 528  GLN A O   1 
ATOM 4124 C CB  . GLN A 1 531  ? -9.527  85.776 -16.759 1.00 137.56 ? 528  GLN A CB  1 
ATOM 4125 C CG  . GLN A 1 531  ? -8.905  84.426 -17.085 1.00 137.56 ? 528  GLN A CG  1 
ATOM 4126 C CD  . GLN A 1 531  ? -8.847  84.160 -18.576 1.00 137.56 ? 528  GLN A CD  1 
ATOM 4127 O OE1 . GLN A 1 531  ? -9.615  83.358 -19.108 1.00 137.56 ? 528  GLN A OE1 1 
ATOM 4128 N NE2 . GLN A 1 531  ? -7.940  84.846 -19.262 1.00 137.56 ? 528  GLN A NE2 1 
ATOM 4129 N N   . ILE A 1 532  ? -6.865  86.370 -15.091 1.00 112.46 ? 529  ILE A N   1 
ATOM 4130 C CA  . ILE A 1 532  ? -5.554  87.040 -15.025 1.00 112.46 ? 529  ILE A CA  1 
ATOM 4131 C C   . ILE A 1 532  ? -4.514  86.603 -16.069 1.00 112.46 ? 529  ILE A C   1 
ATOM 4132 O O   . ILE A 1 532  ? -4.411  87.222 -17.129 1.00 112.46 ? 529  ILE A O   1 
ATOM 4133 C CB  . ILE A 1 532  ? -4.933  87.015 -13.604 1.00 56.94  ? 529  ILE A CB  1 
ATOM 4134 C CG1 . ILE A 1 532  ? -5.961  87.526 -12.579 1.00 56.94  ? 529  ILE A CG1 1 
ATOM 4135 C CG2 . ILE A 1 532  ? -3.582  87.806 -13.579 1.00 56.94  ? 529  ILE A CG2 1 
ATOM 4136 C CD1 . ILE A 1 532  ? -5.403  88.476 -11.493 1.00 56.94  ? 529  ILE A CD1 1 
ATOM 4137 N N   . SER A 1 533  ? -3.737  85.564 -15.773 1.00 108.54 ? 530  SER A N   1 
ATOM 4138 C CA  . SER A 1 533  ? -2.557  85.249 -16.594 1.00 108.54 ? 530  SER A CA  1 
ATOM 4139 C C   . SER A 1 533  ? -2.771  84.057 -17.550 1.00 108.54 ? 530  SER A C   1 
ATOM 4140 O O   . SER A 1 533  ? -3.759  83.326 -17.438 1.00 108.54 ? 530  SER A O   1 
ATOM 4141 C CB  . SER A 1 533  ? -1.314  85.002 -15.705 1.00 73.26  ? 530  SER A CB  1 
ATOM 4142 O OG  . SER A 1 533  ? -1.375  85.683 -14.457 1.00 73.26  ? 530  SER A OG  1 
ATOM 4143 N N   . HIS A 1 534  ? -1.846  83.887 -18.497 1.00 124.90 ? 531  HIS A N   1 
ATOM 4144 C CA  . HIS A 1 534  ? -1.743  82.648 -19.281 1.00 124.90 ? 531  HIS A CA  1 
ATOM 4145 C C   . HIS A 1 534  ? -0.284  82.235 -19.501 1.00 124.90 ? 531  HIS A C   1 
ATOM 4146 O O   . HIS A 1 534  ? 0.563   83.065 -19.850 1.00 124.90 ? 531  HIS A O   1 
ATOM 4147 C CB  . HIS A 1 534  ? -2.481  82.744 -20.623 1.00 154.58 ? 531  HIS A CB  1 
ATOM 4148 C CG  . HIS A 1 534  ? -2.487  81.457 -21.393 1.00 154.58 ? 531  HIS A CG  1 
ATOM 4149 N ND1 . HIS A 1 534  ? -3.414  80.460 -21.170 1.00 154.58 ? 531  HIS A ND1 1 
ATOM 4150 C CD2 . HIS A 1 534  ? -1.664  80.995 -22.365 1.00 154.58 ? 531  HIS A CD2 1 
ATOM 4151 C CE1 . HIS A 1 534  ? -3.168  79.445 -21.978 1.00 154.58 ? 531  HIS A CE1 1 
ATOM 4152 N NE2 . HIS A 1 534  ? -2.111  79.743 -22.714 1.00 154.58 ? 531  HIS A NE2 1 
ATOM 4153 N N   . THR A 1 535  ? -0.003  80.951 -19.283 1.00 132.52 ? 532  THR A N   1 
ATOM 4154 C CA  . THR A 1 535  ? 1.337   80.399 -19.461 1.00 132.52 ? 532  THR A CA  1 
ATOM 4155 C C   . THR A 1 535  ? 1.265   78.908 -19.746 1.00 132.52 ? 532  THR A C   1 
ATOM 4156 O O   . THR A 1 535  ? 0.465   78.179 -19.161 1.00 132.52 ? 532  THR A O   1 
ATOM 4157 C CB  . THR A 1 535  ? 2.250   80.695 -18.246 1.00 80.61  ? 532  THR A CB  1 
ATOM 4158 O OG1 . THR A 1 535  ? 2.213   82.103 -17.975 1.00 80.61  ? 532  THR A OG1 1 
ATOM 4159 C CG2 . THR A 1 535  ? 3.716   80.263 -18.495 1.00 80.61  ? 532  THR A CG2 1 
ATOM 4160 N N   . GLU A 1 536  ? 2.112   78.486 -20.675 1.00 80.51  ? 533  GLU A N   1 
ATOM 4161 C CA  . GLU A 1 536  ? 2.192   77.120 -21.149 1.00 80.51  ? 533  GLU A CA  1 
ATOM 4162 C C   . GLU A 1 536  ? 3.509   76.533 -20.637 1.00 80.51  ? 533  GLU A C   1 
ATOM 4163 O O   . GLU A 1 536  ? 4.452   77.278 -20.344 1.00 80.51  ? 533  GLU A O   1 
ATOM 4164 C CB  . GLU A 1 536  ? 2.175   77.143 -22.680 1.00 168.79 ? 533  GLU A CB  1 
ATOM 4165 C CG  . GLU A 1 536  ? 1.663   75.894 -23.365 1.00 168.79 ? 533  GLU A CG  1 
ATOM 4166 C CD  . GLU A 1 536  ? 1.704   76.018 -24.879 1.00 168.79 ? 533  GLU A CD  1 
ATOM 4167 O OE1 . GLU A 1 536  ? 2.453   75.246 -25.513 1.00 168.79 ? 533  GLU A OE1 1 
ATOM 4168 O OE2 . GLU A 1 536  ? 1.003   76.896 -25.433 1.00 168.79 ? 533  GLU A OE2 1 
ATOM 4169 N N   . MET A 1 537  ? 3.590   75.210 -20.524 1.00 70.60  ? 534  MET A N   1 
ATOM 4170 C CA  . MET A 1 537  ? 4.826   74.595 -20.041 1.00 70.60  ? 534  MET A CA  1 
ATOM 4171 C C   . MET A 1 537  ? 5.341   73.560 -21.029 1.00 70.60  ? 534  MET A C   1 
ATOM 4172 O O   . MET A 1 537  ? 4.587   73.037 -21.851 1.00 70.60  ? 534  MET A O   1 
ATOM 4173 C CB  . MET A 1 537  ? 4.627   73.938 -18.666 1.00 94.10  ? 534  MET A CB  1 
ATOM 4174 C CG  . MET A 1 537  ? 3.696   74.684 -17.688 1.00 94.10  ? 534  MET A CG  1 
ATOM 4175 S SD  . MET A 1 537  ? 4.476   75.632 -16.341 1.00 94.10  ? 534  MET A SD  1 
ATOM 4176 C CE  . MET A 1 537  ? 5.489   74.372 -15.542 1.00 94.10  ? 534  MET A CE  1 
ATOM 4177 N N   . GLU A 1 538  ? 6.638   73.284 -20.926 1.00 85.42  ? 535  GLU A N   1 
ATOM 4178 C CA  . GLU A 1 538  ? 7.306   72.226 -21.672 1.00 85.42  ? 535  GLU A CA  1 
ATOM 4179 C C   . GLU A 1 538  ? 6.334   71.103 -22.065 1.00 85.42  ? 535  GLU A C   1 
ATOM 4180 O O   . GLU A 1 538  ? 6.087   70.870 -23.263 1.00 85.42  ? 535  GLU A O   1 
ATOM 4181 C CB  . GLU A 1 538  ? 8.449   71.656 -20.820 1.00 137.54 ? 535  GLU A CB  1 
ATOM 4182 C CG  . GLU A 1 538  ? 9.638   72.579 -20.618 1.00 137.54 ? 535  GLU A CG  1 
ATOM 4183 C CD  . GLU A 1 538  ? 10.779  72.255 -21.560 1.00 137.54 ? 535  GLU A CD  1 
ATOM 4184 O OE1 . GLU A 1 538  ? 10.904  72.934 -22.606 1.00 137.54 ? 535  GLU A OE1 1 
ATOM 4185 O OE2 . GLU A 1 538  ? 11.543  71.308 -21.262 1.00 137.54 ? 535  GLU A OE2 1 
ATOM 4186 N N   . HIS A 1 539  ? 5.769   70.451 -21.038 1.00 75.85  ? 536  HIS A N   1 
ATOM 4187 C CA  . HIS A 1 539  ? 4.931   69.237 -21.165 1.00 75.85  ? 536  HIS A CA  1 
ATOM 4188 C C   . HIS A 1 539  ? 3.588   69.405 -20.440 1.00 75.85  ? 536  HIS A C   1 
ATOM 4189 O O   . HIS A 1 539  ? 3.232   70.520 -20.041 1.00 75.85  ? 536  HIS A O   1 
ATOM 4190 C CB  . HIS A 1 539  ? 5.676   68.010 -20.621 1.00 107.42 ? 536  HIS A CB  1 
ATOM 4191 C CG  . HIS A 1 539  ? 7.164   68.144 -20.670 1.00 107.42 ? 536  HIS A CG  1 
ATOM 4192 N ND1 . HIS A 1 539  ? 7.915   67.710 -21.740 1.00 107.42 ? 536  HIS A ND1 1 
ATOM 4193 C CD2 . HIS A 1 539  ? 8.036   68.695 -19.794 1.00 107.42 ? 536  HIS A CD2 1 
ATOM 4194 C CE1 . HIS A 1 539  ? 9.189   67.979 -21.517 1.00 107.42 ? 536  HIS A CE1 1 
ATOM 4195 N NE2 . HIS A 1 539  ? 9.289   68.581 -20.345 1.00 107.42 ? 536  HIS A NE2 1 
ATOM 4196 N N   . GLU A 1 540  ? 2.859   68.298 -20.274 1.00 74.82  ? 537  GLU A N   1 
ATOM 4197 C CA  . GLU A 1 540  ? 1.532   68.296 -19.657 1.00 74.82  ? 537  GLU A CA  1 
ATOM 4198 C C   . GLU A 1 540  ? 1.545   68.473 -18.148 1.00 74.82  ? 537  GLU A C   1 
ATOM 4199 O O   . GLU A 1 540  ? 2.287   67.798 -17.426 1.00 74.82  ? 537  GLU A O   1 
ATOM 4200 C CB  . GLU A 1 540  ? 0.807   67.002 -19.974 1.00 84.76  ? 537  GLU A CB  1 
ATOM 4201 C CG  . GLU A 1 540  ? -0.107  67.036 -21.174 1.00 84.76  ? 537  GLU A CG  1 
ATOM 4202 C CD  . GLU A 1 540  ? -0.827  65.704 -21.352 1.00 84.76  ? 537  GLU A CD  1 
ATOM 4203 O OE1 . GLU A 1 540  ? -0.143  64.654 -21.504 1.00 84.76  ? 537  GLU A OE1 1 
ATOM 4204 O OE2 . GLU A 1 540  ? -2.078  65.704 -21.320 1.00 84.76  ? 537  GLU A OE2 1 
ATOM 4205 N N   . VAL A 1 541  ? 0.688   69.371 -17.677 1.00 69.72  ? 538  VAL A N   1 
ATOM 4206 C CA  . VAL A 1 541  ? 0.507   69.589 -16.247 1.00 69.72  ? 538  VAL A CA  1 
ATOM 4207 C C   . VAL A 1 541  ? -0.072  68.340 -15.572 1.00 69.72  ? 538  VAL A C   1 
ATOM 4208 O O   . VAL A 1 541  ? -1.227  67.975 -15.821 1.00 69.72  ? 538  VAL A O   1 
ATOM 4209 C CB  . VAL A 1 541  ? -0.416  70.786 -15.972 1.00 86.67  ? 538  VAL A CB  1 
ATOM 4210 C CG1 . VAL A 1 541  ? -0.563  70.997 -14.477 1.00 86.67  ? 538  VAL A CG1 1 
ATOM 4211 C CG2 . VAL A 1 541  ? 0.120   72.033 -16.640 1.00 86.67  ? 538  VAL A CG2 1 
ATOM 4212 N N   . ALA A 1 542  ? 0.733   67.698 -14.721 1.00 70.23  ? 539  ALA A N   1 
ATOM 4213 C CA  . ALA A 1 542  ? 0.303   66.496 -13.989 1.00 70.23  ? 539  ALA A CA  1 
ATOM 4214 C C   . ALA A 1 542  ? -0.601  66.732 -12.778 1.00 70.23  ? 539  ALA A C   1 
ATOM 4215 O O   . ALA A 1 542  ? -1.534  65.969 -12.575 1.00 70.23  ? 539  ALA A O   1 
ATOM 4216 C CB  . ALA A 1 542  ? 1.506   65.644 -13.578 1.00 57.26  ? 539  ALA A CB  1 
ATOM 4217 N N   . CYS A 1 543  ? -0.318  67.766 -11.982 1.00 76.27  ? 540  CYS A N   1 
ATOM 4218 C CA  . CYS A 1 543  ? -1.009  68.006 -10.701 1.00 76.27  ? 540  CYS A CA  1 
ATOM 4219 C C   . CYS A 1 543  ? -0.665  69.375 -10.135 1.00 76.27  ? 540  CYS A C   1 
ATOM 4220 O O   . CYS A 1 543  ? 0.445   69.873 -10.352 1.00 76.27  ? 540  CYS A O   1 
ATOM 4221 C CB  . CYS A 1 543  ? -0.585  66.956 -9.676  1.00 64.23  ? 540  CYS A CB  1 
ATOM 4222 S SG  . CYS A 1 543  ? 1.232   66.770 -9.558  1.00 64.23  ? 540  CYS A SG  1 
ATOM 4223 N N   . LEU A 1 544  ? -1.591  69.969 -9.385  1.00 112.23 ? 541  LEU A N   1 
ATOM 4224 C CA  . LEU A 1 544  ? -1.369  71.303 -8.812  1.00 112.23 ? 541  LEU A CA  1 
ATOM 4225 C C   . LEU A 1 544  ? -1.949  71.478 -7.416  1.00 112.23 ? 541  LEU A C   1 
ATOM 4226 O O   . LEU A 1 544  ? -2.946  70.836 -7.066  1.00 112.23 ? 541  LEU A O   1 
ATOM 4227 C CB  . LEU A 1 544  ? -1.979  72.375 -9.715  1.00 63.94  ? 541  LEU A CB  1 
ATOM 4228 C CG  . LEU A 1 544  ? -1.315  72.726 -11.044 1.00 63.94  ? 541  LEU A CG  1 
ATOM 4229 C CD1 . LEU A 1 544  ? -2.379  73.347 -11.940 1.00 63.94  ? 541  LEU A CD1 1 
ATOM 4230 C CD2 . LEU A 1 544  ? -0.111  73.663 -10.814 1.00 63.94  ? 541  LEU A CD2 1 
ATOM 4231 N N   . ASP A 1 545  ? -1.331  72.363 -6.635  1.00 214.00 ? 542  ASP A N   1 
ATOM 4232 C CA  . ASP A 1 545  ? -1.852  72.744 -5.323  1.00 214.00 ? 542  ASP A CA  1 
ATOM 4233 C C   . ASP A 1 545  ? -1.556  74.197 -4.983  1.00 214.00 ? 542  ASP A C   1 
ATOM 4234 O O   . ASP A 1 545  ? -0.444  74.671 -5.199  1.00 214.00 ? 542  ASP A O   1 
ATOM 4235 C CB  . ASP A 1 545  ? -1.278  71.847 -4.225  1.00 162.78 ? 542  ASP A CB  1 
ATOM 4236 C CG  . ASP A 1 545  ? -1.445  72.445 -2.832  1.00 162.78 ? 542  ASP A CG  1 
ATOM 4237 O OD1 . ASP A 1 545  ? -2.564  72.883 -2.489  1.00 162.78 ? 542  ASP A OD1 1 
ATOM 4238 O OD2 . ASP A 1 545  ? -0.453  72.486 -2.078  1.00 162.78 ? 542  ASP A OD2 1 
ATOM 4239 N N   . ILE A 1 546  ? -2.558  74.884 -4.436  1.00 193.65 ? 543  ILE A N   1 
ATOM 4240 C CA  . ILE A 1 546  ? -2.375  76.228 -3.886  1.00 193.65 ? 543  ILE A CA  1 
ATOM 4241 C C   . ILE A 1 546  ? -3.162  76.487 -2.621  1.00 193.65 ? 543  ILE A C   1 
ATOM 4242 O O   . ILE A 1 546  ? -4.377  76.306 -2.570  1.00 193.65 ? 543  ILE A O   1 
ATOM 4243 C CB  . ILE A 1 546  ? -2.693  77.345 -4.886  1.00 99.98  ? 543  ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 546  ? -3.768  76.911 -5.886  1.00 99.98  ? 543  ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 546  ? -1.431  77.773 -5.591  1.00 99.98  ? 543  ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 546  ? -5.153  77.290 -5.502  1.00 99.98  ? 543  ILE A CD1 1 
ATOM 4247 N N   . THR A 1 547  ? -2.436  76.922 -1.602  1.00 150.22 ? 544  THR A N   1 
ATOM 4248 C CA  . THR A 1 547  ? -3.006  77.255 -0.318  1.00 150.22 ? 544  THR A CA  1 
ATOM 4249 C C   . THR A 1 547  ? -2.142  78.374 0.256   1.00 150.22 ? 544  THR A C   1 
ATOM 4250 O O   . THR A 1 547  ? -0.949  78.168 0.495   1.00 150.22 ? 544  THR A O   1 
ATOM 4251 C CB  . THR A 1 547  ? -3.017  76.038 0.652   1.00 124.67 ? 544  THR A CB  1 
ATOM 4252 O OG1 . THR A 1 547  ? -2.614  74.842 -0.030  1.00 124.67 ? 544  THR A OG1 1 
ATOM 4253 C CG2 . THR A 1 547  ? -4.402  75.840 1.248   1.00 124.67 ? 544  THR A CG2 1 
ATOM 4254 N N   . PRO A 1 548  ? -2.730  79.569 0.457   1.00 218.25 ? 545  PRO A N   1 
ATOM 4255 C CA  . PRO A 1 548  ? -2.020  80.708 1.038   1.00 218.25 ? 545  PRO A CA  1 
ATOM 4256 C C   . PRO A 1 548  ? -1.469  80.314 2.402   1.00 218.25 ? 545  PRO A C   1 
ATOM 4257 O O   . PRO A 1 548  ? -2.240  80.076 3.334   1.00 218.25 ? 545  PRO A O   1 
ATOM 4258 C CB  . PRO A 1 548  ? -3.116  81.774 1.174   1.00 173.73 ? 545  PRO A CB  1 
ATOM 4259 C CG  . PRO A 1 548  ? -4.407  81.019 1.097   1.00 173.73 ? 545  PRO A CG  1 
ATOM 4260 C CD  . PRO A 1 548  ? -4.129  79.904 0.156   1.00 173.73 ? 545  PRO A CD  1 
ATOM 4261 N N   . LEU A 1 549  ? -0.145  80.238 2.506   1.00 139.10 ? 546  LEU A N   1 
ATOM 4262 C CA  . LEU A 1 549  ? 0.490   79.517 3.616   1.00 139.10 ? 546  LEU A CA  1 
ATOM 4263 C C   . LEU A 1 549  ? 0.365   80.162 5.017   1.00 139.10 ? 546  LEU A C   1 
ATOM 4264 O O   . LEU A 1 549  ? -0.578  79.859 5.753   1.00 139.10 ? 546  LEU A O   1 
ATOM 4265 C CB  . LEU A 1 549  ? 1.933   79.075 3.259   1.00 84.87  ? 546  LEU A CB  1 
ATOM 4266 C CG  . LEU A 1 549  ? 2.105   78.038 2.133   1.00 84.87  ? 546  LEU A CG  1 
ATOM 4267 C CD1 . LEU A 1 549  ? 2.222   78.745 0.811   1.00 84.87  ? 546  LEU A CD1 1 
ATOM 4268 C CD2 . LEU A 1 549  ? 3.328   77.194 2.347   1.00 84.87  ? 546  LEU A CD2 1 
ATOM 4269 N N   . GLY A 1 550  ? 1.287   81.052 5.381   1.00 168.77 ? 547  GLY A N   1 
ATOM 4270 C CA  . GLY A 1 550  ? 1.306   81.608 6.738   1.00 168.77 ? 547  GLY A CA  1 
ATOM 4271 C C   . GLY A 1 550  ? 0.907   83.067 6.821   1.00 168.77 ? 547  GLY A C   1 
ATOM 4272 O O   . GLY A 1 550  ? -0.143  83.409 7.369   1.00 168.77 ? 547  GLY A O   1 
ATOM 4273 N N   . ASP A 1 551  ? 1.763   83.923 6.276   1.00 211.73 ? 548  ASP A N   1 
ATOM 4274 C CA  . ASP A 1 551  ? 1.528   85.360 6.231   1.00 211.73 ? 548  ASP A CA  1 
ATOM 4275 C C   . ASP A 1 551  ? 0.790   85.738 4.947   1.00 211.73 ? 548  ASP A C   1 
ATOM 4276 O O   . ASP A 1 551  ? 1.207   86.643 4.217   1.00 211.73 ? 548  ASP A O   1 
ATOM 4277 C CB  . ASP A 1 551  ? 2.862   86.106 6.331   1.00 157.20 ? 548  ASP A CB  1 
ATOM 4278 C CG  . ASP A 1 551  ? 3.971   85.427 5.541   1.00 157.20 ? 548  ASP A CG  1 
ATOM 4279 O OD1 . ASP A 1 551  ? 4.974   85.019 6.166   1.00 157.20 ? 548  ASP A OD1 1 
ATOM 4280 O OD2 . ASP A 1 551  ? 3.832   85.282 4.304   1.00 157.20 ? 548  ASP A OD2 1 
ATOM 4281 N N   . SER A 1 552  ? -0.306  85.031 4.677   1.00 157.75 ? 549  SER A N   1 
ATOM 4282 C CA  . SER A 1 552  ? -1.097  85.259 3.469   1.00 157.75 ? 549  SER A CA  1 
ATOM 4283 C C   . SER A 1 552  ? -2.600  85.049 3.689   1.00 157.75 ? 549  SER A C   1 
ATOM 4284 O O   . SER A 1 552  ? -3.098  83.922 3.689   1.00 157.75 ? 549  SER A O   1 
ATOM 4285 C CB  . SER A 1 552  ? -0.563  84.424 2.290   1.00 151.72 ? 549  SER A CB  1 
ATOM 4286 O OG  . SER A 1 552  ? 0.029   83.204 2.711   1.00 151.72 ? 549  SER A OG  1 
ATOM 4287 N N   . ASN A 1 553  ? -3.309  86.152 3.901   1.00 147.12 ? 550  ASN A N   1 
ATOM 4288 C CA  . ASN A 1 553  ? -4.761  86.131 3.974   1.00 147.12 ? 550  ASN A CA  1 
ATOM 4289 C C   . ASN A 1 553  ? -5.354  85.871 2.598   1.00 147.12 ? 550  ASN A C   1 
ATOM 4290 O O   . ASN A 1 553  ? -5.408  86.779 1.762   1.00 147.12 ? 550  ASN A O   1 
ATOM 4291 C CB  . ASN A 1 553  ? -5.292  87.459 4.522   1.00 194.40 ? 550  ASN A CB  1 
ATOM 4292 C CG  . ASN A 1 553  ? -5.290  87.510 6.029   1.00 194.40 ? 550  ASN A CG  1 
ATOM 4293 O OD1 . ASN A 1 553  ? -5.885  86.660 6.691   1.00 194.40 ? 550  ASN A OD1 1 
ATOM 4294 N ND2 . ASN A 1 553  ? -4.632  88.519 6.585   1.00 194.40 ? 550  ASN A ND2 1 
ATOM 4295 N N   . GLY A 1 554  ? -5.768  84.627 2.359   1.00 175.69 ? 551  GLY A N   1 
ATOM 4296 C CA  . GLY A 1 554  ? -6.454  84.246 1.119   1.00 175.69 ? 551  GLY A CA  1 
ATOM 4297 C C   . GLY A 1 554  ? -5.607  84.235 -0.147  1.00 175.69 ? 551  GLY A C   1 
ATOM 4298 O O   . GLY A 1 554  ? -5.566  83.230 -0.862  1.00 175.69 ? 551  GLY A O   1 
ATOM 4299 N N   . LEU A 1 555  ? -4.955  85.363 -0.433  1.00 141.07 ? 552  LEU A N   1 
ATOM 4300 C CA  . LEU A 1 555  ? -4.068  85.503 -1.589  1.00 141.07 ? 552  LEU A CA  1 
ATOM 4301 C C   . LEU A 1 555  ? -2.778  84.716 -1.330  1.00 141.07 ? 552  LEU A C   1 
ATOM 4302 O O   . LEU A 1 555  ? -2.194  84.821 -0.249  1.00 141.07 ? 552  LEU A O   1 
ATOM 4303 C CB  . LEU A 1 555  ? -3.776  86.994 -1.851  1.00 112.82 ? 552  LEU A CB  1 
ATOM 4304 C CG  . LEU A 1 555  ? -3.365  87.515 -3.244  1.00 112.82 ? 552  LEU A CG  1 
ATOM 4305 C CD1 . LEU A 1 555  ? -4.459  87.278 -4.289  1.00 112.82 ? 552  LEU A CD1 1 
ATOM 4306 C CD2 . LEU A 1 555  ? -2.981  89.004 -3.209  1.00 112.82 ? 552  LEU A CD2 1 
ATOM 4307 N N   . SER A 1 556  ? -2.344  83.933 -2.321  1.00 126.48 ? 553  SER A N   1 
ATOM 4308 C CA  . SER A 1 556  ? -1.243  82.974 -2.154  1.00 126.48 ? 553  SER A CA  1 
ATOM 4309 C C   . SER A 1 556  ? 0.048   83.350 -2.896  1.00 126.48 ? 553  SER A C   1 
ATOM 4310 O O   . SER A 1 556  ? 0.001   83.635 -4.095  1.00 126.48 ? 553  SER A O   1 
ATOM 4311 C CB  . SER A 1 556  ? -1.698  81.582 -2.600  1.00 113.51 ? 553  SER A CB  1 
ATOM 4312 O OG  . SER A 1 556  ? -0.769  80.584 -2.228  1.00 113.51 ? 553  SER A OG  1 
ATOM 4313 N N   . PRO A 1 557  ? 1.200   83.354 -2.177  1.00 191.93 ? 554  PRO A N   1 
ATOM 4314 C CA  . PRO A 1 557  ? 2.569   83.487 -2.731  1.00 191.93 ? 554  PRO A CA  1 
ATOM 4315 C C   . PRO A 1 557  ? 2.928   82.485 -3.857  1.00 191.93 ? 554  PRO A C   1 
ATOM 4316 O O   . PRO A 1 557  ? 2.110   82.256 -4.752  1.00 191.93 ? 554  PRO A O   1 
ATOM 4317 C CB  . PRO A 1 557  ? 3.468   83.300 -1.495  1.00 124.12 ? 554  PRO A CB  1 
ATOM 4318 C CG  . PRO A 1 557  ? 2.612   83.759 -0.347  1.00 124.12 ? 554  PRO A CG  1 
ATOM 4319 C CD  . PRO A 1 557  ? 1.223   83.285 -0.700  1.00 124.12 ? 554  PRO A CD  1 
ATOM 4320 N N   . LEU A 1 558  ? 4.133   81.905 -3.821  1.00 155.27 ? 555  LEU A N   1 
ATOM 4321 C CA  . LEU A 1 558  ? 4.641   81.070 -4.936  1.00 155.27 ? 555  LEU A CA  1 
ATOM 4322 C C   . LEU A 1 558  ? 3.959   79.702 -5.094  1.00 155.27 ? 555  LEU A C   1 
ATOM 4323 O O   . LEU A 1 558  ? 2.925   79.455 -4.470  1.00 155.27 ? 555  LEU A O   1 
ATOM 4324 C CB  . LEU A 1 558  ? 6.170   80.924 -4.886  1.00 122.23 ? 555  LEU A CB  1 
ATOM 4325 C CG  . LEU A 1 558  ? 6.861   80.594 -3.566  1.00 122.23 ? 555  LEU A CG  1 
ATOM 4326 C CD1 . LEU A 1 558  ? 7.899   79.486 -3.761  1.00 122.23 ? 555  LEU A CD1 1 
ATOM 4327 C CD2 . LEU A 1 558  ? 7.486   81.866 -2.982  1.00 122.23 ? 555  LEU A CD2 1 
ATOM 4328 N N   . CYS A 1 559  ? 4.523   78.826 -5.938  1.00 142.82 ? 556  CYS A N   1 
ATOM 4329 C CA  . CYS A 1 559  ? 3.897   77.522 -6.230  1.00 142.82 ? 556  CYS A CA  1 
ATOM 4330 C C   . CYS A 1 559  ? 4.743   76.417 -6.901  1.00 142.82 ? 556  CYS A C   1 
ATOM 4331 O O   . CYS A 1 559  ? 5.929   76.586 -7.198  1.00 142.82 ? 556  CYS A O   1 
ATOM 4332 C CB  . CYS A 1 559  ? 2.600   77.710 -7.022  1.00 163.13 ? 556  CYS A CB  1 
ATOM 4333 S SG  . CYS A 1 559  ? 1.570   76.236 -6.988  1.00 163.13 ? 556  CYS A SG  1 
ATOM 4334 N N   . ALA A 1 560  ? 4.072   75.285 -7.128  1.00 117.67 ? 557  ALA A N   1 
ATOM 4335 C CA  . ALA A 1 560  ? 4.671   74.048 -7.608  1.00 117.67 ? 557  ALA A CA  1 
ATOM 4336 C C   . ALA A 1 560  ? 3.667   73.183 -8.386  1.00 117.67 ? 557  ALA A C   1 
ATOM 4337 O O   . ALA A 1 560  ? 2.441   73.270 -8.200  1.00 117.67 ? 557  ALA A O   1 
ATOM 4338 C CB  . ALA A 1 560  ? 5.268   73.267 -6.454  1.00 214.44 ? 557  ALA A CB  1 
ATOM 4339 N N   . ILE A 1 561  ? 4.221   72.320 -9.231  1.00 75.39  ? 558  ILE A N   1 
ATOM 4340 C CA  . ILE A 1 561  ? 3.505   71.739 -10.339 1.00 75.39  ? 558  ILE A CA  1 
ATOM 4341 C C   . ILE A 1 561  ? 4.252   70.504 -10.808 1.00 75.39  ? 558  ILE A C   1 
ATOM 4342 O O   . ILE A 1 561  ? 5.478   70.545 -11.031 1.00 75.39  ? 558  ILE A O   1 
ATOM 4343 C CB  . ILE A 1 561  ? 3.428   72.766 -11.496 1.00 101.15 ? 558  ILE A CB  1 
ATOM 4344 C CG1 . ILE A 1 561  ? 2.820   72.149 -12.756 1.00 101.15 ? 558  ILE A CG1 1 
ATOM 4345 C CG2 . ILE A 1 561  ? 4.810   73.348 -11.805 1.00 101.15 ? 558  ILE A CG2 1 
ATOM 4346 C CD1 . ILE A 1 561  ? 2.334   73.188 -13.754 1.00 101.15 ? 558  ILE A CD1 1 
ATOM 4347 N N   . GLY A 1 562  ? 3.522   69.398 -10.952 1.00 61.64  ? 559  GLY A N   1 
ATOM 4348 C CA  . GLY A 1 562  ? 4.098   68.177 -11.554 1.00 61.64  ? 559  GLY A CA  1 
ATOM 4349 C C   . GLY A 1 562  ? 3.800   68.148 -13.042 1.00 61.64  ? 559  GLY A C   1 
ATOM 4350 O O   . GLY A 1 562  ? 2.681   68.497 -13.446 1.00 61.64  ? 559  GLY A O   1 
ATOM 4351 N N   . LEU A 1 563  ? 4.769   67.737 -13.858 1.00 78.80  ? 560  LEU A N   1 
ATOM 4352 C CA  . LEU A 1 563  ? 4.579   67.666 -15.310 1.00 78.80  ? 560  LEU A CA  1 
ATOM 4353 C C   . LEU A 1 563  ? 4.540   66.215 -15.787 1.00 78.80  ? 560  LEU A C   1 
ATOM 4354 O O   . LEU A 1 563  ? 4.626   65.295 -14.973 1.00 78.80  ? 560  LEU A O   1 
ATOM 4355 C CB  . LEU A 1 563  ? 5.688   68.431 -16.035 1.00 90.87  ? 560  LEU A CB  1 
ATOM 4356 C CG  . LEU A 1 563  ? 5.798   69.925 -15.722 1.00 90.87  ? 560  LEU A CG  1 
ATOM 4357 C CD1 . LEU A 1 563  ? 6.986   70.539 -16.446 1.00 90.87  ? 560  LEU A CD1 1 
ATOM 4358 C CD2 . LEU A 1 563  ? 4.510   70.647 -16.088 1.00 90.87  ? 560  LEU A CD2 1 
ATOM 4359 N N   . TRP A 1 564  ? 4.412   65.999 -17.096 1.00 86.19  ? 561  TRP A N   1 
ATOM 4360 C CA  . TRP A 1 564  ? 4.369   64.608 -17.612 1.00 86.19  ? 561  TRP A CA  1 
ATOM 4361 C C   . TRP A 1 564  ? 5.464   63.681 -18.243 1.00 86.19  ? 561  TRP A C   1 
ATOM 4362 O O   . TRP A 1 564  ? 5.657   62.570 -17.748 1.00 86.19  ? 561  TRP A O   1 
ATOM 4363 C CB  . TRP A 1 564  ? 3.124   64.481 -18.506 1.00 80.83  ? 561  TRP A CB  1 
ATOM 4364 C CG  . TRP A 1 564  ? 1.831   64.594 -17.758 1.00 80.83  ? 561  TRP A CG  1 
ATOM 4365 C CD1 . TRP A 1 564  ? 1.188   65.743 -17.402 1.00 80.83  ? 561  TRP A CD1 1 
ATOM 4366 C CD2 . TRP A 1 564  ? 1.021   63.515 -17.276 1.00 80.83  ? 561  TRP A CD2 1 
ATOM 4367 N NE1 . TRP A 1 564  ? 0.029   65.447 -16.726 1.00 80.83  ? 561  TRP A NE1 1 
ATOM 4368 C CE2 . TRP A 1 564  ? -0.097  64.086 -16.636 1.00 80.83  ? 561  TRP A CE2 1 
ATOM 4369 C CE3 . TRP A 1 564  ? 1.133   62.122 -17.323 1.00 80.83  ? 561  TRP A CE3 1 
ATOM 4370 C CZ2 . TRP A 1 564  ? -1.096  63.313 -16.048 1.00 80.83  ? 561  TRP A CZ2 1 
ATOM 4371 C CZ3 . TRP A 1 564  ? 0.141   61.356 -16.738 1.00 80.83  ? 561  TRP A CZ3 1 
ATOM 4372 C CH2 . TRP A 1 564  ? -0.959  61.953 -16.109 1.00 80.83  ? 561  TRP A CH2 1 
ATOM 4373 N N   . THR A 1 565  ? 6.005   64.086 -19.386 1.00 96.95  ? 562  THR A N   1 
ATOM 4374 C CA  . THR A 1 565  ? 6.932   63.250 -20.137 1.00 96.95  ? 562  THR A CA  1 
ATOM 4375 C C   . THR A 1 565  ? 8.298   63.219 -19.504 1.00 96.95  ? 562  THR A C   1 
ATOM 4376 O O   . THR A 1 565  ? 8.947   62.174 -19.437 1.00 96.95  ? 562  THR A O   1 
ATOM 4377 C CB  . THR A 1 565  ? 7.067   63.730 -21.595 1.00 87.69  ? 562  THR A CB  1 
ATOM 4378 O OG1 . THR A 1 565  ? 5.785   63.696 -22.234 1.00 87.69  ? 562  THR A OG1 1 
ATOM 4379 C CG2 . THR A 1 565  ? 8.035   62.841 -22.361 1.00 87.69  ? 562  THR A CG2 1 
ATOM 4380 N N   . ASP A 1 566  ? 8.735   64.377 -19.039 1.00 93.91  ? 563  ASP A N   1 
ATOM 4381 C CA  . ASP A 1 566  ? 10.050  64.472 -18.412 1.00 93.91  ? 563  ASP A CA  1 
ATOM 4382 C C   . ASP A 1 566  ? 10.024  63.962 -16.977 1.00 93.91  ? 563  ASP A C   1 
ATOM 4383 O O   . ASP A 1 566  ? 11.075  63.652 -16.422 1.00 93.91  ? 563  ASP A O   1 
ATOM 4384 C CB  . ASP A 1 566  ? 10.590  65.896 -18.462 1.00 87.23  ? 563  ASP A CB  1 
ATOM 4385 C CG  . ASP A 1 566  ? 9.806   66.847 -17.591 1.00 87.23  ? 563  ASP A CG  1 
ATOM 4386 O OD1 . ASP A 1 566  ? 8.605   66.607 -17.344 1.00 87.23  ? 563  ASP A OD1 1 
ATOM 4387 O OD2 . ASP A 1 566  ? 10.401  67.855 -17.163 1.00 87.23  ? 563  ASP A OD2 1 
ATOM 4388 N N   . ILE A 1 567  ? 8.828   63.880 -16.389 1.00 137.21 ? 564  ILE A N   1 
ATOM 4389 C CA  . ILE A 1 567  ? 8.646   63.354 -15.036 1.00 137.21 ? 564  ILE A CA  1 
ATOM 4390 C C   . ILE A 1 567  ? 9.402   64.241 -14.035 1.00 137.21 ? 564  ILE A C   1 
ATOM 4391 O O   . ILE A 1 567  ? 10.594  64.051 -13.767 1.00 137.21 ? 564  ILE A O   1 
ATOM 4392 C CB  . ILE A 1 567  ? 9.006   61.821 -14.960 1.00 73.76  ? 564  ILE A CB  1 
ATOM 4393 C CG1 . ILE A 1 567  ? 7.849   60.962 -15.481 1.00 73.76  ? 564  ILE A CG1 1 
ATOM 4394 C CG2 . ILE A 1 567  ? 9.329   61.362 -13.536 1.00 73.76  ? 564  ILE A CG2 1 
ATOM 4395 C CD1 . ILE A 1 567  ? 8.000   60.478 -16.913 1.00 73.76  ? 564  ILE A CD1 1 
ATOM 4396 N N   . SER A 1 568  ? 8.694   65.229 -13.499 1.00 63.98  ? 565  SER A N   1 
ATOM 4397 C CA  . SER A 1 568  ? 9.351   66.333 -12.813 1.00 63.98  ? 565  SER A CA  1 
ATOM 4398 C C   . SER A 1 568  ? 8.423   67.184 -11.951 1.00 63.98  ? 565  SER A C   1 
ATOM 4399 O O   . SER A 1 568  ? 7.197   67.182 -12.137 1.00 63.98  ? 565  SER A O   1 
ATOM 4400 C CB  . SER A 1 568  ? 9.972   67.260 -13.851 1.00 83.71  ? 565  SER A CB  1 
ATOM 4401 O OG  . SER A 1 568  ? 8.987   68.131 -14.385 1.00 83.71  ? 565  SER A OG  1 
ATOM 4402 N N   . ALA A 1 569  ? 9.028   67.943 -11.037 1.00 76.33  ? 566  ALA A N   1 
ATOM 4403 C CA  . ALA A 1 569  ? 8.313   68.896 -10.190 1.00 76.33  ? 566  ALA A CA  1 
ATOM 4404 C C   . ALA A 1 569  ? 9.165   70.150 -10.007 1.00 76.33  ? 566  ALA A C   1 
ATOM 4405 O O   . ALA A 1 569  ? 10.405  70.076 -9.907  1.00 76.33  ? 566  ALA A O   1 
ATOM 4406 C CB  . ALA A 1 569  ? 7.991   68.279 -8.864  1.00 110.28 ? 566  ALA A CB  1 
ATOM 4407 N N   . ARG A 1 570  ? 8.496   71.297 -9.952  1.00 89.39  ? 567  ARG A N   1 
ATOM 4408 C CA  . ARG A 1 570  ? 9.169   72.571 -10.180 1.00 89.39  ? 567  ARG A CA  1 
ATOM 4409 C C   . ARG A 1 570  ? 8.555   73.769 -9.445  1.00 89.39  ? 567  ARG A C   1 
ATOM 4410 O O   . ARG A 1 570  ? 7.339   73.815 -9.208  1.00 89.39  ? 567  ARG A O   1 
ATOM 4411 C CB  . ARG A 1 570  ? 9.295   72.835 -11.693 1.00 117.70 ? 567  ARG A CB  1 
ATOM 4412 C CG  . ARG A 1 570  ? 8.133   72.327 -12.555 1.00 117.70 ? 567  ARG A CG  1 
ATOM 4413 C CD  . ARG A 1 570  ? 8.616   71.371 -13.650 1.00 117.70 ? 567  ARG A CD  1 
ATOM 4414 N NE  . ARG A 1 570  ? 9.356   72.041 -14.724 1.00 117.70 ? 567  ARG A NE  1 
ATOM 4415 C CZ  . ARG A 1 570  ? 9.834   71.433 -15.810 1.00 117.70 ? 567  ARG A CZ  1 
ATOM 4416 N NH1 . ARG A 1 570  ? 9.655   70.131 -15.984 1.00 117.70 ? 567  ARG A NH1 1 
ATOM 4417 N NH2 . ARG A 1 570  ? 10.491  72.127 -16.731 1.00 117.70 ? 567  ARG A NH2 1 
ATOM 4418 N N   . ILE A 1 571  ? 9.414   74.737 -9.104  1.00 141.63 ? 568  ILE A N   1 
ATOM 4419 C CA  . ILE A 1 571  ? 9.063   75.857 -8.219  1.00 141.63 ? 568  ILE A CA  1 
ATOM 4420 C C   . ILE A 1 571  ? 8.749   77.128 -9.004  1.00 141.63 ? 568  ILE A C   1 
ATOM 4421 O O   . ILE A 1 571  ? 9.577   77.591 -9.779  1.00 141.63 ? 568  ILE A O   1 
ATOM 4422 C CB  . ILE A 1 571  ? 10.215  76.170 -7.220  1.00 204.79 ? 568  ILE A CB  1 
ATOM 4423 C CG1 . ILE A 1 571  ? 10.881  74.888 -6.684  1.00 204.79 ? 568  ILE A CG1 1 
ATOM 4424 C CG2 . ILE A 1 571  ? 9.730   77.108 -6.103  1.00 204.79 ? 568  ILE A CG2 1 
ATOM 4425 C CD1 . ILE A 1 571  ? 9.983   73.962 -5.871  1.00 204.79 ? 568  ILE A CD1 1 
ATOM 4426 N N   . LEU A 1 572  ? 7.563   77.696 -8.790  1.00 208.82 ? 569  LEU A N   1 
ATOM 4427 C CA  . LEU A 1 572  ? 7.083   78.832 -9.592  1.00 208.82 ? 569  LEU A CA  1 
ATOM 4428 C C   . LEU A 1 572  ? 6.304   79.870 -8.783  1.00 208.82 ? 569  LEU A C   1 
ATOM 4429 O O   . LEU A 1 572  ? 5.676   79.524 -7.793  1.00 208.82 ? 569  LEU A O   1 
ATOM 4430 C CB  . LEU A 1 572  ? 6.210   78.327 -10.745 1.00 172.72 ? 569  LEU A CB  1 
ATOM 4431 C CG  . LEU A 1 572  ? 6.906   77.687 -11.954 1.00 172.72 ? 569  LEU A CG  1 
ATOM 4432 C CD1 . LEU A 1 572  ? 7.082   76.173 -11.795 1.00 172.72 ? 569  LEU A CD1 1 
ATOM 4433 C CD2 . LEU A 1 572  ? 6.099   77.992 -13.207 1.00 172.72 ? 569  LEU A CD2 1 
ATOM 4434 N N   . LYS A 1 573  ? 6.330   81.133 -9.219  1.00 154.86 ? 570  LYS A N   1 
ATOM 4435 C CA  . LYS A 1 573  ? 5.591   82.219 -8.541  1.00 154.86 ? 570  LYS A CA  1 
ATOM 4436 C C   . LYS A 1 573  ? 4.108   82.296 -8.993  1.00 154.86 ? 570  LYS A C   1 
ATOM 4437 O O   . LYS A 1 573  ? 3.549   81.261 -9.348  1.00 154.86 ? 570  LYS A O   1 
ATOM 4438 C CB  . LYS A 1 573  ? 6.332   83.548 -8.687  1.00 83.01  ? 570  LYS A CB  1 
ATOM 4439 C CG  . LYS A 1 573  ? 5.877   84.614 -7.723  1.00 83.01  ? 570  LYS A CG  1 
ATOM 4440 C CD  . LYS A 1 573  ? 5.999   85.996 -8.345  1.00 83.01  ? 570  LYS A CD  1 
ATOM 4441 C CE  . LYS A 1 573  ? 5.010   86.990 -7.715  1.00 83.01  ? 570  LYS A CE  1 
ATOM 4442 N NZ  . LYS A 1 573  ? 3.731   87.050 -8.479  1.00 83.01  ? 570  LYS A NZ  1 
ATOM 4443 N N   . LEU A 1 574  ? 3.471   83.480 -8.973  1.00 218.25 ? 571  LEU A N   1 
ATOM 4444 C CA  . LEU A 1 574  ? 1.996   83.580 -9.196  1.00 218.25 ? 571  LEU A CA  1 
ATOM 4445 C C   . LEU A 1 574  ? 1.470   84.102 -10.568 1.00 218.25 ? 571  LEU A C   1 
ATOM 4446 O O   . LEU A 1 574  ? 1.358   83.305 -11.498 1.00 218.25 ? 571  LEU A O   1 
ATOM 4447 C CB  . LEU A 1 574  ? 1.259   84.222 -8.001  1.00 119.54 ? 571  LEU A CB  1 
ATOM 4448 C CG  . LEU A 1 574  ? -0.280  84.190 -8.045  1.00 119.54 ? 571  LEU A CG  1 
ATOM 4449 C CD1 . LEU A 1 574  ? -0.856  82.770 -7.936  1.00 119.54 ? 571  LEU A CD1 1 
ATOM 4450 C CD2 . LEU A 1 574  ? -0.871  85.113 -6.986  1.00 119.54 ? 571  LEU A CD2 1 
ATOM 4451 N N   . PRO A 1 575  ? 1.116   85.409 -10.703 1.00 207.25 ? 572  PRO A N   1 
ATOM 4452 C CA  . PRO A 1 575  ? 0.525   85.753 -12.002 1.00 207.25 ? 572  PRO A CA  1 
ATOM 4453 C C   . PRO A 1 575  ? 1.561   85.816 -13.126 1.00 207.25 ? 572  PRO A C   1 
ATOM 4454 O O   . PRO A 1 575  ? 1.195   85.842 -14.300 1.00 207.25 ? 572  PRO A O   1 
ATOM 4455 C CB  . PRO A 1 575  ? -0.098  87.139 -11.761 1.00 196.19 ? 572  PRO A CB  1 
ATOM 4456 C CG  . PRO A 1 575  ? 0.004   87.387 -10.287 1.00 196.19 ? 572  PRO A CG  1 
ATOM 4457 C CD  . PRO A 1 575  ? 1.183   86.595 -9.834  1.00 196.19 ? 572  PRO A CD  1 
ATOM 4458 N N   . SER A 1 576  ? 2.839   85.828 -12.753 1.00 157.77 ? 573  SER A N   1 
ATOM 4459 C CA  . SER A 1 576  ? 3.950   85.855 -13.708 1.00 157.77 ? 573  SER A CA  1 
ATOM 4460 C C   . SER A 1 576  ? 4.271   84.467 -14.289 1.00 157.77 ? 573  SER A C   1 
ATOM 4461 O O   . SER A 1 576  ? 4.454   84.328 -15.506 1.00 157.77 ? 573  SER A O   1 
ATOM 4462 C CB  . SER A 1 576  ? 5.195   86.489 -13.068 1.00 146.13 ? 573  SER A CB  1 
ATOM 4463 O OG  . SER A 1 576  ? 5.442   85.965 -11.771 1.00 146.13 ? 573  SER A OG  1 
ATOM 4464 N N   . PHE A 1 577  ? 4.323   83.459 -13.409 1.00 136.50 ? 574  PHE A N   1 
ATOM 4465 C CA  . PHE A 1 577  ? 4.598   82.042 -13.751 1.00 136.50 ? 574  PHE A CA  1 
ATOM 4466 C C   . PHE A 1 577  ? 6.097   81.760 -14.004 1.00 136.50 ? 574  PHE A C   1 
ATOM 4467 O O   . PHE A 1 577  ? 6.461   81.048 -14.942 1.00 136.50 ? 574  PHE A O   1 
ATOM 4468 C CB  . PHE A 1 577  ? 3.730   81.549 -14.932 1.00 114.82 ? 574  PHE A CB  1 
ATOM 4469 C CG  . PHE A 1 577  ? 2.238   81.434 -14.627 1.00 114.82 ? 574  PHE A CG  1 
ATOM 4470 C CD1 . PHE A 1 577  ? 1.405   82.563 -14.650 1.00 114.82 ? 574  PHE A CD1 1 
ATOM 4471 C CD2 . PHE A 1 577  ? 1.658   80.181 -14.375 1.00 114.82 ? 574  PHE A CD2 1 
ATOM 4472 C CE1 . PHE A 1 577  ? 0.024   82.447 -14.389 1.00 114.82 ? 574  PHE A CE1 1 
ATOM 4473 C CE2 . PHE A 1 577  ? 0.278   80.058 -14.119 1.00 114.82 ? 574  PHE A CE2 1 
ATOM 4474 C CZ  . PHE A 1 577  ? -0.540  81.194 -14.127 1.00 114.82 ? 574  PHE A CZ  1 
ATOM 4475 N N   . GLU A 1 578  ? 6.953   82.304 -13.146 1.00 151.72 ? 575  GLU A N   1 
ATOM 4476 C CA  . GLU A 1 578  ? 8.399   82.215 -13.323 1.00 151.72 ? 575  GLU A CA  1 
ATOM 4477 C C   . GLU A 1 578  ? 9.005   81.002 -12.607 1.00 151.72 ? 575  GLU A C   1 
ATOM 4478 O O   . GLU A 1 578  ? 8.840   80.842 -11.398 1.00 151.72 ? 575  GLU A O   1 
ATOM 4479 C CB  . GLU A 1 578  ? 9.046   83.518 -12.845 1.00 154.32 ? 575  GLU A CB  1 
ATOM 4480 C CG  . GLU A 1 578  ? 8.579   83.967 -11.455 1.00 154.32 ? 575  GLU A CG  1 
ATOM 4481 C CD  . GLU A 1 578  ? 8.517   85.476 -11.287 1.00 154.32 ? 575  GLU A CD  1 
ATOM 4482 O OE1 . GLU A 1 578  ? 8.192   86.176 -12.268 1.00 154.32 ? 575  GLU A OE1 1 
ATOM 4483 O OE2 . GLU A 1 578  ? 8.774   85.964 -10.164 1.00 154.32 ? 575  GLU A OE2 1 
ATOM 4484 N N   . LEU A 1 579  ? 9.701   80.152 -13.364 1.00 101.32 ? 576  LEU A N   1 
ATOM 4485 C CA  . LEU A 1 579  ? 10.377  78.956 -12.813 1.00 101.32 ? 576  LEU A CA  1 
ATOM 4486 C C   . LEU A 1 579  ? 11.641  79.271 -12.007 1.00 101.32 ? 576  LEU A C   1 
ATOM 4487 O O   . LEU A 1 579  ? 12.567  79.911 -12.508 1.00 101.32 ? 576  LEU A O   1 
ATOM 4488 C CB  . LEU A 1 579  ? 10.703  77.930 -13.924 1.00 117.66 ? 576  LEU A CB  1 
ATOM 4489 C CG  . LEU A 1 579  ? 11.454  76.583 -13.707 1.00 117.66 ? 576  LEU A CG  1 
ATOM 4490 C CD1 . LEU A 1 579  ? 12.999  76.702 -13.701 1.00 117.66 ? 576  LEU A CD1 1 
ATOM 4491 C CD2 . LEU A 1 579  ? 10.972  75.777 -12.492 1.00 117.66 ? 576  LEU A CD2 1 
ATOM 4492 N N   . LEU A 1 580  ? 11.679  78.775 -10.772 1.00 212.15 ? 577  LEU A N   1 
ATOM 4493 C CA  . LEU A 1 580  ? 12.825  78.945 -9.877  1.00 212.15 ? 577  LEU A CA  1 
ATOM 4494 C C   . LEU A 1 580  ? 13.777  77.742 -9.956  1.00 212.15 ? 577  LEU A C   1 
ATOM 4495 O O   . LEU A 1 580  ? 14.687  77.703 -10.791 1.00 212.15 ? 577  LEU A O   1 
ATOM 4496 C CB  . LEU A 1 580  ? 12.344  79.161 -8.430  1.00 119.94 ? 577  LEU A CB  1 
ATOM 4497 C CG  . LEU A 1 580  ? 11.589  80.446 -8.061  1.00 119.94 ? 577  LEU A CG  1 
ATOM 4498 C CD1 . LEU A 1 580  ? 10.087  80.334 -8.302  1.00 119.94 ? 577  LEU A CD1 1 
ATOM 4499 C CD2 . LEU A 1 580  ? 11.857  80.819 -6.610  1.00 119.94 ? 577  LEU A CD2 1 
ATOM 4500 N N   . HIS A 1 581  ? 13.544  76.775 -9.072  1.00 114.85 ? 578  HIS A N   1 
ATOM 4501 C CA  . HIS A 1 581  ? 14.288  75.515 -8.996  1.00 114.85 ? 578  HIS A CA  1 
ATOM 4502 C C   . HIS A 1 581  ? 13.374  74.358 -9.447  1.00 114.85 ? 578  HIS A C   1 
ATOM 4503 O O   . HIS A 1 581  ? 12.162  74.553 -9.638  1.00 114.85 ? 578  HIS A O   1 
ATOM 4504 C CB  . HIS A 1 581  ? 14.803  75.333 -7.550  1.00 145.43 ? 578  HIS A CB  1 
ATOM 4505 C CG  . HIS A 1 581  ? 15.224  73.937 -7.201  1.00 145.43 ? 578  HIS A CG  1 
ATOM 4506 N ND1 . HIS A 1 581  ? 16.363  73.351 -7.708  1.00 145.43 ? 578  HIS A ND1 1 
ATOM 4507 C CD2 . HIS A 1 581  ? 14.669  73.024 -6.370  1.00 145.43 ? 578  HIS A CD2 1 
ATOM 4508 C CE1 . HIS A 1 581  ? 16.483  72.129 -7.219  1.00 145.43 ? 578  HIS A CE1 1 
ATOM 4509 N NE2 . HIS A 1 581  ? 15.466  71.906 -6.406  1.00 145.43 ? 578  HIS A NE2 1 
ATOM 4510 N N   . LYS A 1 582  ? 13.957  73.174 -9.635  1.00 116.78 ? 579  LYS A N   1 
ATOM 4511 C CA  . LYS A 1 582  ? 13.201  71.976 -10.017 1.00 116.78 ? 579  LYS A CA  1 
ATOM 4512 C C   . LYS A 1 582  ? 13.980  70.674 -9.779  1.00 116.78 ? 579  LYS A C   1 
ATOM 4513 O O   . LYS A 1 582  ? 15.218  70.666 -9.804  1.00 116.78 ? 579  LYS A O   1 
ATOM 4514 C CB  . LYS A 1 582  ? 12.774  72.059 -11.485 1.00 86.81  ? 579  LYS A CB  1 
ATOM 4515 C CG  . LYS A 1 582  ? 13.919  72.301 -12.463 1.00 86.81  ? 579  LYS A CG  1 
ATOM 4516 C CD  . LYS A 1 582  ? 13.936  71.223 -13.557 1.00 86.81  ? 579  LYS A CD  1 
ATOM 4517 C CE  . LYS A 1 582  ? 14.443  69.871 -13.016 1.00 86.81  ? 579  LYS A CE  1 
ATOM 4518 N NZ  . LYS A 1 582  ? 13.634  68.745 -13.554 1.00 86.81  ? 579  LYS A NZ  1 
ATOM 4519 N N   . GLU A 1 583  ? 13.255  69.575 -9.564  1.00 120.88 ? 580  GLU A N   1 
ATOM 4520 C CA  . GLU A 1 583  ? 13.890  68.265 -9.423  1.00 120.88 ? 580  GLU A CA  1 
ATOM 4521 C C   . GLU A 1 583  ? 13.468  67.318 -10.536 1.00 120.88 ? 580  GLU A C   1 
ATOM 4522 O O   . GLU A 1 583  ? 12.277  67.151 -10.806 1.00 120.88 ? 580  GLU A O   1 
ATOM 4523 C CB  . GLU A 1 583  ? 13.591  67.653 -8.053  1.00 135.68 ? 580  GLU A CB  1 
ATOM 4524 C CG  . GLU A 1 583  ? 13.946  66.160 -7.920  1.00 135.68 ? 580  GLU A CG  1 
ATOM 4525 C CD  . GLU A 1 583  ? 15.419  65.900 -7.650  1.00 135.68 ? 580  GLU A CD  1 
ATOM 4526 O OE1 . GLU A 1 583  ? 15.934  66.359 -6.602  1.00 135.68 ? 580  GLU A OE1 1 
ATOM 4527 O OE2 . GLU A 1 583  ? 16.053  65.217 -8.481  1.00 135.68 ? 580  GLU A OE2 1 
ATOM 4528 N N   . MET A 1 584  ? 14.459  66.701 -11.171 1.00 153.01 ? 581  MET A N   1 
ATOM 4529 C CA  . MET A 1 584  ? 14.224  65.791 -12.282 1.00 153.01 ? 581  MET A CA  1 
ATOM 4530 C C   . MET A 1 584  ? 14.171  64.358 -11.758 1.00 153.01 ? 581  MET A C   1 
ATOM 4531 O O   . MET A 1 584  ? 15.098  63.581 -11.986 1.00 153.01 ? 581  MET A O   1 
ATOM 4532 C CB  . MET A 1 584  ? 15.338  65.950 -13.340 1.00 106.63 ? 581  MET A CB  1 
ATOM 4533 C CG  . MET A 1 584  ? 14.978  65.568 -14.809 1.00 106.63 ? 581  MET A CG  1 
ATOM 4534 S SD  . MET A 1 584  ? 14.141  66.861 -15.807 1.00 106.63 ? 581  MET A SD  1 
ATOM 4535 C CE  . MET A 1 584  ? 14.988  66.735 -17.401 1.00 106.63 ? 581  MET A CE  1 
ATOM 4536 N N   . LEU A 1 585  ? 13.094  64.013 -11.051 1.00 83.34  ? 582  LEU A N   1 
ATOM 4537 C CA  . LEU A 1 585  ? 12.914  62.635 -10.531 1.00 83.34  ? 582  LEU A CA  1 
ATOM 4538 C C   . LEU A 1 585  ? 12.861  61.594 -11.652 1.00 83.34  ? 582  LEU A C   1 
ATOM 4539 O O   . LEU A 1 585  ? 12.546  61.923 -12.809 1.00 83.34  ? 582  LEU A O   1 
ATOM 4540 C CB  . LEU A 1 585  ? 11.632  62.500 -9.706  1.00 55.01  ? 582  LEU A CB  1 
ATOM 4541 C CG  . LEU A 1 585  ? 10.846  63.798 -9.508  1.00 55.01  ? 582  LEU A CG  1 
ATOM 4542 C CD1 . LEU A 1 585  ? 9.413   63.636 -10.053 1.00 55.01  ? 582  LEU A CD1 1 
ATOM 4543 C CD2 . LEU A 1 585  ? 10.868  64.248 -8.061  1.00 55.01  ? 582  LEU A CD2 1 
ATOM 4544 N N   . GLY A 1 586  ? 13.144  60.340 -11.297 1.00 86.45  ? 583  GLY A N   1 
ATOM 4545 C CA  . GLY A 1 586  ? 13.260  59.268 -12.286 1.00 86.45  ? 583  GLY A CA  1 
ATOM 4546 C C   . GLY A 1 586  ? 11.939  58.603 -12.633 1.00 86.45  ? 583  GLY A C   1 
ATOM 4547 O O   . GLY A 1 586  ? 10.861  59.091 -12.253 1.00 86.45  ? 583  GLY A O   1 
ATOM 4548 N N   . GLY A 1 587  ? 12.026  57.487 -13.361 1.00 106.22 ? 584  GLY A N   1 
ATOM 4549 C CA  . GLY A 1 587  ? 10.860  56.676 -13.723 1.00 106.22 ? 584  GLY A CA  1 
ATOM 4550 C C   . GLY A 1 587  ? 10.126  57.104 -14.986 1.00 106.22 ? 584  GLY A C   1 
ATOM 4551 O O   . GLY A 1 587  ? 10.387  58.177 -15.551 1.00 106.22 ? 584  GLY A O   1 
ATOM 4552 N N   . GLU A 1 588  ? 9.212   56.244 -15.432 1.00 170.54 ? 585  GLU A N   1 
ATOM 4553 C CA  . GLU A 1 588  ? 8.321   56.551 -16.551 1.00 170.54 ? 585  GLU A CA  1 
ATOM 4554 C C   . GLU A 1 588  ? 6.867   56.707 -16.053 1.00 170.54 ? 585  GLU A C   1 
ATOM 4555 O O   . GLU A 1 588  ? 5.922   56.697 -16.844 1.00 170.54 ? 585  GLU A O   1 
ATOM 4556 C CB  . GLU A 1 588  ? 8.442   55.488 -17.665 1.00 116.15 ? 585  GLU A CB  1 
ATOM 4557 C CG  . GLU A 1 588  ? 9.877   55.228 -18.203 1.00 116.15 ? 585  GLU A CG  1 
ATOM 4558 C CD  . GLU A 1 588  ? 10.463  56.369 -19.071 1.00 116.15 ? 585  GLU A CD  1 
ATOM 4559 O OE1 . GLU A 1 588  ? 10.501  57.536 -18.608 1.00 116.15 ? 585  GLU A OE1 1 
ATOM 4560 O OE2 . GLU A 1 588  ? 10.918  56.089 -20.211 1.00 116.15 ? 585  GLU A OE2 1 
ATOM 4561 N N   . ILE A 1 589  ? 6.718   56.861 -14.733 1.00 94.19  ? 586  ILE A N   1 
ATOM 4562 C CA  . ILE A 1 589  ? 5.425   57.093 -14.061 1.00 94.19  ? 586  ILE A CA  1 
ATOM 4563 C C   . ILE A 1 589  ? 5.364   58.506 -13.436 1.00 94.19  ? 586  ILE A C   1 
ATOM 4564 O O   . ILE A 1 589  ? 6.332   58.963 -12.816 1.00 94.19  ? 586  ILE A O   1 
ATOM 4565 C CB  . ILE A 1 589  ? 5.149   55.996 -12.976 1.00 92.67  ? 586  ILE A CB  1 
ATOM 4566 C CG1 . ILE A 1 589  ? 4.888   54.622 -13.629 1.00 92.67  ? 586  ILE A CG1 1 
ATOM 4567 C CG2 . ILE A 1 589  ? 4.008   56.421 -12.021 1.00 92.67  ? 586  ILE A CG2 1 
ATOM 4568 C CD1 . ILE A 1 589  ? 3.569   54.499 -14.443 1.00 92.67  ? 586  ILE A CD1 1 
ATOM 4569 N N   . ILE A 1 590  ? 4.232   59.191 -13.592 1.00 94.84  ? 587  ILE A N   1 
ATOM 4570 C CA  . ILE A 1 590  ? 4.154   60.594 -13.174 1.00 94.84  ? 587  ILE A CA  1 
ATOM 4571 C C   . ILE A 1 590  ? 3.666   60.843 -11.757 1.00 94.84  ? 587  ILE A C   1 
ATOM 4572 O O   . ILE A 1 590  ? 3.030   59.991 -11.147 1.00 94.84  ? 587  ILE A O   1 
ATOM 4573 C CB  . ILE A 1 590  ? 3.308   61.487 -14.131 1.00 67.85  ? 587  ILE A CB  1 
ATOM 4574 C CG1 . ILE A 1 590  ? 1.813   61.117 -14.088 1.00 67.85  ? 587  ILE A CG1 1 
ATOM 4575 C CG2 . ILE A 1 590  ? 3.956   61.578 -15.532 1.00 67.85  ? 587  ILE A CG2 1 
ATOM 4576 C CD1 . ILE A 1 590  ? 1.401   59.909 -14.919 1.00 67.85  ? 587  ILE A CD1 1 
ATOM 4577 N N   . PRO A 1 591  ? 3.964   62.035 -11.241 1.00 69.22  ? 588  PRO A N   1 
ATOM 4578 C CA  . PRO A 1 591  ? 3.482   62.503 -9.965  1.00 69.22  ? 588  PRO A CA  1 
ATOM 4579 C C   . PRO A 1 591  ? 1.972   62.692 -9.978  1.00 69.22  ? 588  PRO A C   1 
ATOM 4580 O O   . PRO A 1 591  ? 1.455   63.571 -10.678 1.00 69.22  ? 588  PRO A O   1 
ATOM 4581 C CB  . PRO A 1 591  ? 4.179   63.864 -9.806  1.00 68.38  ? 588  PRO A CB  1 
ATOM 4582 C CG  . PRO A 1 591  ? 4.449   64.310 -11.194 1.00 68.38  ? 588  PRO A CG  1 
ATOM 4583 C CD  . PRO A 1 591  ? 4.828   63.036 -11.889 1.00 68.38  ? 588  PRO A CD  1 
ATOM 4584 N N   . ARG A 1 592  ? 1.279   61.866 -9.203  1.00 77.53  ? 589  ARG A N   1 
ATOM 4585 C CA  . ARG A 1 592  ? -0.161  61.952 -9.049  1.00 77.53  ? 589  ARG A CA  1 
ATOM 4586 C C   . ARG A 1 592  ? -0.525  63.124 -8.139  1.00 77.53  ? 589  ARG A C   1 
ATOM 4587 O O   . ARG A 1 592  ? -1.607  63.695 -8.256  1.00 77.53  ? 589  ARG A O   1 
ATOM 4588 C CB  . ARG A 1 592  ? -0.678  60.643 -8.450  1.00 131.32 ? 589  ARG A CB  1 
ATOM 4589 C CG  . ARG A 1 592  ? -1.704  59.931 -9.313  1.00 131.32 ? 589  ARG A CG  1 
ATOM 4590 C CD  . ARG A 1 592  ? -3.124  60.170 -8.829  1.00 131.32 ? 589  ARG A CD  1 
ATOM 4591 N NE  . ARG A 1 592  ? -4.109  59.849 -9.862  1.00 131.32 ? 589  ARG A NE  1 
ATOM 4592 C CZ  . ARG A 1 592  ? -5.422  59.782 -9.651  1.00 131.32 ? 589  ARG A CZ  1 
ATOM 4593 N NH1 . ARG A 1 592  ? -5.916  60.003 -8.436  1.00 131.32 ? 589  ARG A NH1 1 
ATOM 4594 N NH2 . ARG A 1 592  ? -6.245  59.487 -10.652 1.00 131.32 ? 589  ARG A NH2 1 
ATOM 4595 N N   . SER A 1 593  ? 0.385   63.495 -7.238  1.00 64.90  ? 590  SER A N   1 
ATOM 4596 C CA  . SER A 1 593  ? 0.019   64.420 -6.156  1.00 64.90  ? 590  SER A CA  1 
ATOM 4597 C C   . SER A 1 593  ? 1.177   65.290 -5.637  1.00 64.90  ? 590  SER A C   1 
ATOM 4598 O O   . SER A 1 593  ? 2.273   64.788 -5.321  1.00 64.90  ? 590  SER A O   1 
ATOM 4599 C CB  . SER A 1 593  ? -0.625  63.633 -5.002  1.00 93.09  ? 590  SER A CB  1 
ATOM 4600 O OG  . SER A 1 593  ? -1.653  64.375 -4.374  1.00 93.09  ? 590  SER A OG  1 
ATOM 4601 N N   . ILE A 1 594  ? 0.904   66.591 -5.551  1.00 89.82  ? 591  ILE A N   1 
ATOM 4602 C CA  . ILE A 1 594  ? 1.866   67.579 -5.070  1.00 89.82  ? 591  ILE A CA  1 
ATOM 4603 C C   . ILE A 1 594  ? 1.191   68.447 -4.004  1.00 89.82  ? 591  ILE A C   1 
ATOM 4604 O O   . ILE A 1 594  ? 0.064   68.913 -4.214  1.00 89.82  ? 591  ILE A O   1 
ATOM 4605 C CB  . ILE A 1 594  ? 2.423   68.443 -6.259  1.00 97.23  ? 591  ILE A CB  1 
ATOM 4606 C CG1 . ILE A 1 594  ? 3.756   69.094 -5.894  1.00 97.23  ? 591  ILE A CG1 1 
ATOM 4607 C CG2 . ILE A 1 594  ? 1.391   69.466 -6.789  1.00 97.23  ? 591  ILE A CG2 1 
ATOM 4608 C CD1 . ILE A 1 594  ? 4.951   68.214 -6.157  1.00 97.23  ? 591  ILE A CD1 1 
ATOM 4609 N N   . LEU A 1 595  ? 1.842   68.652 -2.859  1.00 91.99  ? 592  LEU A N   1 
ATOM 4610 C CA  . LEU A 1 595  ? 1.178   69.420 -1.792  1.00 91.99  ? 592  LEU A CA  1 
ATOM 4611 C C   . LEU A 1 595  ? 2.076   70.404 -1.064  1.00 91.99  ? 592  LEU A C   1 
ATOM 4612 O O   . LEU A 1 595  ? 3.247   70.098 -0.806  1.00 91.99  ? 592  LEU A O   1 
ATOM 4613 C CB  . LEU A 1 595  ? 0.476   68.491 -0.781  1.00 151.47 ? 592  LEU A CB  1 
ATOM 4614 C CG  . LEU A 1 595  ? -0.334  69.063 0.403   1.00 151.47 ? 592  LEU A CG  1 
ATOM 4615 C CD1 . LEU A 1 595  ? -1.433  70.033 -0.027  1.00 151.47 ? 592  LEU A CD1 1 
ATOM 4616 C CD2 . LEU A 1 595  ? -0.936  67.949 1.243   1.00 151.47 ? 592  LEU A CD2 1 
ATOM 4617 N N   . MET A 1 596  ? 1.509   71.573 -0.739  1.00 140.30 ? 593  MET A N   1 
ATOM 4618 C CA  . MET A 1 596  ? 2.149   72.581 0.109   1.00 140.30 ? 593  MET A CA  1 
ATOM 4619 C C   . MET A 1 596  ? 1.386   72.766 1.414   1.00 140.30 ? 593  MET A C   1 
ATOM 4620 O O   . MET A 1 596  ? 0.156   72.664 1.438   1.00 140.30 ? 593  MET A O   1 
ATOM 4621 C CB  . MET A 1 596  ? 2.300   73.919 -0.621  1.00 122.37 ? 593  MET A CB  1 
ATOM 4622 C CG  . MET A 1 596  ? 1.117   74.870 -0.517  1.00 122.37 ? 593  MET A CG  1 
ATOM 4623 S SD  . MET A 1 596  ? 1.454   76.468 -1.286  1.00 122.37 ? 593  MET A SD  1 
ATOM 4624 C CE  . MET A 1 596  ? 1.458   76.051 -3.029  1.00 122.37 ? 593  MET A CE  1 
ATOM 4625 N N   . THR A 1 597  ? 2.128   73.065 2.483   1.00 189.43 ? 594  THR A N   1 
ATOM 4626 C CA  . THR A 1 597  ? 1.618   73.001 3.861   1.00 189.43 ? 594  THR A CA  1 
ATOM 4627 C C   . THR A 1 597  ? 2.380   73.851 4.884   1.00 189.43 ? 594  THR A C   1 
ATOM 4628 O O   . THR A 1 597  ? 3.260   74.640 4.533   1.00 189.43 ? 594  THR A O   1 
ATOM 4629 C CB  . THR A 1 597  ? 1.675   71.557 4.386   1.00 88.15  ? 594  THR A CB  1 
ATOM 4630 O OG1 . THR A 1 597  ? 2.676   70.836 3.653   1.00 88.15  ? 594  THR A OG1 1 
ATOM 4631 C CG2 . THR A 1 597  ? 0.321   70.867 4.237   1.00 88.15  ? 594  THR A CG2 1 
ATOM 4632 N N   . THR A 1 598  ? 2.011   73.659 6.155   1.00 105.20 ? 595  THR A N   1 
ATOM 4633 C CA  . THR A 1 598  ? 2.663   74.254 7.336   1.00 105.20 ? 595  THR A CA  1 
ATOM 4634 C C   . THR A 1 598  ? 2.310   73.341 8.523   1.00 105.20 ? 595  THR A C   1 
ATOM 4635 O O   . THR A 1 598  ? 1.433   72.478 8.404   1.00 105.20 ? 595  THR A O   1 
ATOM 4636 C CB  . THR A 1 598  ? 2.203   75.738 7.587   1.00 192.10 ? 595  THR A CB  1 
ATOM 4637 O OG1 . THR A 1 598  ? 2.693   76.582 6.537   1.00 192.10 ? 595  THR A OG1 1 
ATOM 4638 C CG2 . THR A 1 598  ? 2.714   76.293 8.927   1.00 192.10 ? 595  THR A CG2 1 
ATOM 4639 N N   . PHE A 1 599  ? 2.995   73.518 9.651   1.00 169.75 ? 596  PHE A N   1 
ATOM 4640 C CA  . PHE A 1 599  ? 2.679   72.767 10.863  1.00 169.75 ? 596  PHE A CA  1 
ATOM 4641 C C   . PHE A 1 599  ? 2.755   73.638 12.113  1.00 169.75 ? 596  PHE A C   1 
ATOM 4642 O O   . PHE A 1 599  ? 1.748   73.875 12.787  1.00 169.75 ? 596  PHE A O   1 
ATOM 4643 C CB  . PHE A 1 599  ? 3.582   71.532 10.978  1.00 124.75 ? 596  PHE A CB  1 
ATOM 4644 C CG  . PHE A 1 599  ? 3.074   70.342 10.210  1.00 124.75 ? 596  PHE A CG  1 
ATOM 4645 C CD1 . PHE A 1 599  ? 3.484   70.112 8.900   1.00 124.75 ? 596  PHE A CD1 1 
ATOM 4646 C CD2 . PHE A 1 599  ? 2.168   69.455 10.794  1.00 124.75 ? 596  PHE A CD2 1 
ATOM 4647 C CE1 . PHE A 1 599  ? 3.006   69.012 8.179   1.00 124.75 ? 596  PHE A CE1 1 
ATOM 4648 C CE2 . PHE A 1 599  ? 1.688   68.348 10.083  1.00 124.75 ? 596  PHE A CE2 1 
ATOM 4649 C CZ  . PHE A 1 599  ? 2.110   68.126 8.773   1.00 124.75 ? 596  PHE A CZ  1 
ATOM 4650 N N   . GLU A 1 600  ? 3.958   74.109 12.413  1.00 189.77 ? 597  GLU A N   1 
ATOM 4651 C CA  . GLU A 1 600  ? 4.187   74.999 13.535  1.00 189.77 ? 597  GLU A CA  1 
ATOM 4652 C C   . GLU A 1 600  ? 5.276   75.973 13.108  1.00 189.77 ? 597  GLU A C   1 
ATOM 4653 O O   . GLU A 1 600  ? 5.085   77.193 13.142  1.00 189.77 ? 597  GLU A O   1 
ATOM 4654 C CB  . GLU A 1 600  ? 4.631   74.222 14.786  1.00 161.88 ? 597  GLU A CB  1 
ATOM 4655 C CG  . GLU A 1 600  ? 4.495   72.687 14.714  1.00 161.88 ? 597  GLU A CG  1 
ATOM 4656 C CD  . GLU A 1 600  ? 5.670   71.997 14.003  1.00 161.88 ? 597  GLU A CD  1 
ATOM 4657 O OE1 . GLU A 1 600  ? 6.734   72.633 13.818  1.00 161.88 ? 597  GLU A OE1 1 
ATOM 4658 O OE2 . GLU A 1 600  ? 5.532   70.807 13.634  1.00 161.88 ? 597  GLU A OE2 1 
ATOM 4659 N N   . SER A 1 601  ? 6.403   75.404 12.674  1.00 198.70 ? 598  SER A N   1 
ATOM 4660 C CA  . SER A 1 601  ? 7.613   76.150 12.339  1.00 198.70 ? 598  SER A CA  1 
ATOM 4661 C C   . SER A 1 601  ? 8.245   75.653 11.038  1.00 198.70 ? 598  SER A C   1 
ATOM 4662 O O   . SER A 1 601  ? 9.397   75.215 11.041  1.00 198.70 ? 598  SER A O   1 
ATOM 4663 C CB  . SER A 1 601  ? 8.646   76.021 13.470  1.00 153.17 ? 598  SER A CB  1 
ATOM 4664 O OG  . SER A 1 601  ? 8.112   76.378 14.732  1.00 153.17 ? 598  SER A OG  1 
ATOM 4665 N N   . SER A 1 602  ? 7.498   75.717 9.936   1.00 217.08 ? 599  SER A N   1 
ATOM 4666 C CA  . SER A 1 602  ? 8.023   75.348 8.612   1.00 217.08 ? 599  SER A CA  1 
ATOM 4667 C C   . SER A 1 602  ? 6.951   75.344 7.527   1.00 217.08 ? 599  SER A C   1 
ATOM 4668 O O   . SER A 1 602  ? 5.753   75.311 7.823   1.00 217.08 ? 599  SER A O   1 
ATOM 4669 C CB  . SER A 1 602  ? 8.737   73.985 8.650   1.00 140.47 ? 599  SER A CB  1 
ATOM 4670 O OG  . SER A 1 602  ? 9.345   73.673 7.404   1.00 140.47 ? 599  SER A OG  1 
ATOM 4671 N N   . HIS A 1 603  ? 7.402   75.388 6.271   1.00 217.07 ? 600  HIS A N   1 
ATOM 4672 C CA  . HIS A 1 603  ? 6.531   75.238 5.108   1.00 217.07 ? 600  HIS A CA  1 
ATOM 4673 C C   . HIS A 1 603  ? 7.005   74.020 4.306   1.00 217.07 ? 600  HIS A C   1 
ATOM 4674 O O   . HIS A 1 603  ? 8.209   73.834 4.113   1.00 217.07 ? 600  HIS A O   1 
ATOM 4675 C CB  . HIS A 1 603  ? 6.536   76.520 4.262   1.00 103.05 ? 600  HIS A CB  1 
ATOM 4676 C CG  . HIS A 1 603  ? 6.100   77.743 5.013   1.00 103.05 ? 600  HIS A CG  1 
ATOM 4677 N ND1 . HIS A 1 603  ? 4.833   78.274 4.904   1.00 103.05 ? 600  HIS A ND1 1 
ATOM 4678 C CD2 . HIS A 1 603  ? 6.761   78.535 5.894   1.00 103.05 ? 600  HIS A CD2 1 
ATOM 4679 C CE1 . HIS A 1 603  ? 4.731   79.339 5.681   1.00 103.05 ? 600  HIS A CE1 1 
ATOM 4680 N NE2 . HIS A 1 603  ? 5.887   79.519 6.294   1.00 103.05 ? 600  HIS A NE2 1 
ATOM 4681 N N   . TYR A 1 604  ? 6.058   73.193 3.853   1.00 116.13 ? 601  TYR A N   1 
ATOM 4682 C CA  . TYR A 1 604  ? 6.362   71.858 3.303   1.00 116.13 ? 601  TYR A CA  1 
ATOM 4683 C C   . TYR A 1 604  ? 5.835   71.566 1.881   1.00 116.13 ? 601  TYR A C   1 
ATOM 4684 O O   . TYR A 1 604  ? 4.732   71.984 1.509   1.00 116.13 ? 601  TYR A O   1 
ATOM 4685 C CB  . TYR A 1 604  ? 5.829   70.775 4.244   1.00 134.99 ? 601  TYR A CB  1 
ATOM 4686 C CG  . TYR A 1 604  ? 6.450   70.735 5.619   1.00 134.99 ? 601  TYR A CG  1 
ATOM 4687 C CD1 . TYR A 1 604  ? 5.943   71.509 6.660   1.00 134.99 ? 601  TYR A CD1 1 
ATOM 4688 C CD2 . TYR A 1 604  ? 7.521   69.891 5.890   1.00 134.99 ? 601  TYR A CD2 1 
ATOM 4689 C CE1 . TYR A 1 604  ? 6.503   71.455 7.933   1.00 134.99 ? 601  TYR A CE1 1 
ATOM 4690 C CE2 . TYR A 1 604  ? 8.087   69.830 7.157   1.00 134.99 ? 601  TYR A CE2 1 
ATOM 4691 C CZ  . TYR A 1 604  ? 7.575   70.613 8.172   1.00 134.99 ? 601  TYR A CZ  1 
ATOM 4692 O OH  . TYR A 1 604  ? 8.141   70.549 9.424   1.00 134.99 ? 601  TYR A OH  1 
ATOM 4693 N N   . LEU A 1 605  ? 6.634   70.826 1.110   1.00 147.10 ? 602  LEU A N   1 
ATOM 4694 C CA  . LEU A 1 605  ? 6.231   70.311 -0.202  1.00 147.10 ? 602  LEU A CA  1 
ATOM 4695 C C   . LEU A 1 605  ? 6.368   68.793 -0.299  1.00 147.10 ? 602  LEU A C   1 
ATOM 4696 O O   . LEU A 1 605  ? 7.421   68.219 0.008   1.00 147.10 ? 602  LEU A O   1 
ATOM 4697 C CB  . LEU A 1 605  ? 7.017   70.969 -1.343  1.00 125.82 ? 602  LEU A CB  1 
ATOM 4698 C CG  . LEU A 1 605  ? 7.074   70.170 -2.661  1.00 125.82 ? 602  LEU A CG  1 
ATOM 4699 C CD1 . LEU A 1 605  ? 6.881   71.056 -3.871  1.00 125.82 ? 602  LEU A CD1 1 
ATOM 4700 C CD2 . LEU A 1 605  ? 8.341   69.302 -2.795  1.00 125.82 ? 602  LEU A CD2 1 
ATOM 4701 N N   . LEU A 1 606  ? 5.305   68.154 -0.768  1.00 122.08 ? 603  LEU A N   1 
ATOM 4702 C CA  . LEU A 1 606  ? 5.283   66.711 -0.863  1.00 122.08 ? 603  LEU A CA  1 
ATOM 4703 C C   . LEU A 1 606  ? 4.823   66.303 -2.239  1.00 122.08 ? 603  LEU A C   1 
ATOM 4704 O O   . LEU A 1 606  ? 4.020   66.999 -2.873  1.00 122.08 ? 603  LEU A O   1 
ATOM 4705 C CB  . LEU A 1 606  ? 4.349   66.123 0.197   1.00 116.09 ? 603  LEU A CB  1 
ATOM 4706 C CG  . LEU A 1 606  ? 4.427   66.645 1.640   1.00 116.09 ? 603  LEU A CG  1 
ATOM 4707 C CD1 . LEU A 1 606  ? 3.631   67.942 1.828   1.00 116.09 ? 603  LEU A CD1 1 
ATOM 4708 C CD2 . LEU A 1 606  ? 3.924   65.580 2.587   1.00 116.09 ? 603  LEU A CD2 1 
ATOM 4709 N N   . CYS A 1 607  ? 5.325   65.161 -2.692  1.00 56.96  ? 604  CYS A N   1 
ATOM 4710 C CA  . CYS A 1 607  ? 4.991   64.709 -4.021  1.00 56.96  ? 604  CYS A CA  1 
ATOM 4711 C C   . CYS A 1 607  ? 4.839   63.209 -4.192  1.00 56.96  ? 604  CYS A C   1 
ATOM 4712 O O   . CYS A 1 607  ? 5.827   62.466 -4.172  1.00 56.96  ? 604  CYS A O   1 
ATOM 4713 C CB  . CYS A 1 607  ? 6.023   65.213 -5.024  1.00 87.08  ? 604  CYS A CB  1 
ATOM 4714 S SG  . CYS A 1 607  ? 5.584   64.753 -6.715  1.00 87.08  ? 604  CYS A SG  1 
ATOM 4715 N N   . ALA A 1 608  ? 3.604   62.778 -4.434  1.00 76.69  ? 605  ALA A N   1 
ATOM 4716 C CA  . ALA A 1 608  ? 3.308   61.358 -4.651  1.00 76.69  ? 605  ALA A CA  1 
ATOM 4717 C C   . ALA A 1 608  ? 3.487   60.910 -6.099  1.00 76.69  ? 605  ALA A C   1 
ATOM 4718 O O   . ALA A 1 608  ? 3.230   61.684 -7.021  1.00 76.69  ? 605  ALA A O   1 
ATOM 4719 C CB  . ALA A 1 608  ? 1.897   61.056 -4.193  1.00 65.79  ? 605  ALA A CB  1 
ATOM 4720 N N   . LEU A 1 609  ? 3.907   59.658 -6.283  1.00 72.94  ? 606  LEU A N   1 
ATOM 4721 C CA  . LEU A 1 609  ? 3.964   59.029 -7.605  1.00 72.94  ? 606  LEU A CA  1 
ATOM 4722 C C   . LEU A 1 609  ? 2.943   57.918 -7.757  1.00 72.94  ? 606  LEU A C   1 
ATOM 4723 O O   . LEU A 1 609  ? 2.379   57.439 -6.770  1.00 72.94  ? 606  LEU A O   1 
ATOM 4724 C CB  . LEU A 1 609  ? 5.335   58.431 -7.879  1.00 69.49  ? 606  LEU A CB  1 
ATOM 4725 C CG  . LEU A 1 609  ? 6.530   59.347 -8.063  1.00 69.49  ? 606  LEU A CG  1 
ATOM 4726 C CD1 . LEU A 1 609  ? 7.408   58.698 -9.103  1.00 69.49  ? 606  LEU A CD1 1 
ATOM 4727 C CD2 . LEU A 1 609  ? 6.131   60.741 -8.502  1.00 69.49  ? 606  LEU A CD2 1 
ATOM 4728 N N   . GLY A 1 610  ? 2.734   57.485 -9.001  1.00 60.36  ? 607  GLY A N   1 
ATOM 4729 C CA  . GLY A 1 610  ? 1.718   56.473 -9.317  1.00 60.36  ? 607  GLY A CA  1 
ATOM 4730 C C   . GLY A 1 610  ? 2.028   55.064 -8.832  1.00 60.36  ? 607  GLY A C   1 
ATOM 4731 O O   . GLY A 1 610  ? 1.140   54.217 -8.781  1.00 60.36  ? 607  GLY A O   1 
ATOM 4732 N N   . ASP A 1 611  ? 3.286   54.822 -8.472  1.00 108.89 ? 608  ASP A N   1 
ATOM 4733 C CA  . ASP A 1 611  ? 3.777   53.510 -8.028  1.00 108.89 ? 608  ASP A CA  1 
ATOM 4734 C C   . ASP A 1 611  ? 3.483   53.228 -6.560  1.00 108.89 ? 608  ASP A C   1 
ATOM 4735 O O   . ASP A 1 611  ? 3.431   52.067 -6.135  1.00 108.89 ? 608  ASP A O   1 
ATOM 4736 C CB  . ASP A 1 611  ? 5.282   53.493 -8.198  1.00 106.65 ? 608  ASP A CB  1 
ATOM 4737 C CG  . ASP A 1 611  ? 5.919   54.778 -7.714  1.00 106.65 ? 608  ASP A CG  1 
ATOM 4738 O OD1 . ASP A 1 611  ? 6.989   55.138 -8.241  1.00 106.65 ? 608  ASP A OD1 1 
ATOM 4739 O OD2 . ASP A 1 611  ? 5.337   55.447 -6.826  1.00 106.65 ? 608  ASP A OD2 1 
ATOM 4740 N N   . GLY A 1 612  ? 3.341   54.303 -5.788  1.00 96.07  ? 609  GLY A N   1 
ATOM 4741 C CA  . GLY A 1 612  ? 3.079   54.214 -4.361  1.00 96.07  ? 609  GLY A CA  1 
ATOM 4742 C C   . GLY A 1 612  ? 4.084   54.961 -3.508  1.00 96.07  ? 609  GLY A C   1 
ATOM 4743 O O   . GLY A 1 612  ? 3.833   55.232 -2.333  1.00 96.07  ? 609  GLY A O   1 
ATOM 4744 N N   . ALA A 1 613  ? 5.219   55.310 -4.100  1.00 70.44  ? 610  ALA A N   1 
ATOM 4745 C CA  . ALA A 1 613  ? 6.322   55.904 -3.356  1.00 70.44  ? 610  ALA A CA  1 
ATOM 4746 C C   . ALA A 1 613  ? 6.172   57.408 -3.313  1.00 70.44  ? 610  ALA A C   1 
ATOM 4747 O O   . ALA A 1 613  ? 5.610   57.990 -4.223  1.00 70.44  ? 610  ALA A O   1 
ATOM 4748 C CB  . ALA A 1 613  ? 7.645   55.512 -3.995  1.00 111.15 ? 610  ALA A CB  1 
ATOM 4749 N N   . LEU A 1 614  ? 6.673   58.041 -2.261  1.00 97.50  ? 611  LEU A N   1 
ATOM 4750 C CA  . LEU A 1 614  ? 6.613   59.493 -2.163  1.00 97.50  ? 611  LEU A CA  1 
ATOM 4751 C C   . LEU A 1 614  ? 8.003   60.098 -2.102  1.00 97.50  ? 611  LEU A C   1 
ATOM 4752 O O   . LEU A 1 614  ? 8.959   59.435 -1.690  1.00 97.50  ? 611  LEU A O   1 
ATOM 4753 C CB  . LEU A 1 614  ? 5.847   59.891 -0.915  1.00 69.80  ? 611  LEU A CB  1 
ATOM 4754 C CG  . LEU A 1 614  ? 5.241   61.289 -0.784  1.00 69.80  ? 611  LEU A CG  1 
ATOM 4755 C CD1 . LEU A 1 614  ? 4.204   61.285 0.327   1.00 69.80  ? 611  LEU A CD1 1 
ATOM 4756 C CD2 . LEU A 1 614  ? 6.256   62.372 -0.515  1.00 69.80  ? 611  LEU A CD2 1 
ATOM 4757 N N   . PHE A 1 615  ? 8.063   61.402 -2.361  1.00 94.78  ? 612  PHE A N   1 
ATOM 4758 C CA  . PHE A 1 615  ? 9.195   62.268 -2.044  1.00 94.78  ? 612  PHE A CA  1 
ATOM 4759 C C   . PHE A 1 615  ? 8.550   63.471 -1.378  1.00 94.78  ? 612  PHE A C   1 
ATOM 4760 O O   . PHE A 1 615  ? 7.526   63.942 -1.835  1.00 94.78  ? 612  PHE A O   1 
ATOM 4761 C CB  . PHE A 1 615  ? 9.925   62.696 -3.300  1.00 92.28  ? 612  PHE A CB  1 
ATOM 4762 C CG  . PHE A 1 615  ? 10.315  61.562 -4.188  1.00 92.28  ? 612  PHE A CG  1 
ATOM 4763 C CD1 . PHE A 1 615  ? 9.442   61.059 -5.110  1.00 92.28  ? 612  PHE A CD1 1 
ATOM 4764 C CD2 . PHE A 1 615  ? 11.561  61.007 -4.110  1.00 92.28  ? 612  PHE A CD2 1 
ATOM 4765 C CE1 . PHE A 1 615  ? 9.801   60.022 -5.923  1.00 92.28  ? 612  PHE A CE1 1 
ATOM 4766 C CE2 . PHE A 1 615  ? 11.917  59.970 -4.931  1.00 92.28  ? 612  PHE A CE2 1 
ATOM 4767 C CZ  . PHE A 1 615  ? 11.037  59.479 -5.834  1.00 92.28  ? 612  PHE A CZ  1 
ATOM 4768 N N   . TYR A 1 616  ? 9.125   63.938 -0.278  1.00 154.32 ? 613  TYR A N   1 
ATOM 4769 C CA  . TYR A 1 616  ? 8.660   65.134 0.429   1.00 154.32 ? 613  TYR A CA  1 
ATOM 4770 C C   . TYR A 1 616  ? 9.921   65.981 0.441   1.00 154.32 ? 613  TYR A C   1 
ATOM 4771 O O   . TYR A 1 616  ? 11.029  65.448 0.502   1.00 154.32 ? 613  TYR A O   1 
ATOM 4772 C CB  . TYR A 1 616  ? 8.277   64.828 1.864   1.00 160.76 ? 613  TYR A CB  1 
ATOM 4773 C CG  . TYR A 1 616  ? 9.150   65.521 2.895   1.00 160.76 ? 613  TYR A CG  1 
ATOM 4774 C CD1 . TYR A 1 616  ? 9.783   66.730 2.611   1.00 160.76 ? 613  TYR A CD1 1 
ATOM 4775 C CD2 . TYR A 1 616  ? 9.342   64.965 4.154   1.00 160.76 ? 613  TYR A CD2 1 
ATOM 4776 C CE1 . TYR A 1 616  ? 10.575  67.363 3.563   1.00 160.76 ? 613  TYR A CE1 1 
ATOM 4777 C CE2 . TYR A 1 616  ? 10.132  65.583 5.089   1.00 160.76 ? 613  TYR A CE2 1 
ATOM 4778 C CZ  . TYR A 1 616  ? 10.748  66.783 4.795   1.00 160.76 ? 613  TYR A CZ  1 
ATOM 4779 O OH  . TYR A 1 616  ? 11.531  67.400 5.742   1.00 160.76 ? 613  TYR A OH  1 
ATOM 4780 N N   . PHE A 1 617  ? 9.771   67.294 0.383   1.00 112.23 ? 614  PHE A N   1 
ATOM 4781 C CA  . PHE A 1 617  ? 10.924  68.169 0.441   1.00 112.23 ? 614  PHE A CA  1 
ATOM 4782 C C   . PHE A 1 617  ? 10.512  69.430 1.233   1.00 112.23 ? 614  PHE A C   1 
ATOM 4783 O O   . PHE A 1 617  ? 9.342   69.611 1.526   1.00 112.23 ? 614  PHE A O   1 
ATOM 4784 C CB  . PHE A 1 617  ? 11.437  68.468 -0.964  1.00 108.56 ? 614  PHE A CB  1 
ATOM 4785 C CG  . PHE A 1 617  ? 11.946  67.249 -1.689  1.00 108.56 ? 614  PHE A CG  1 
ATOM 4786 C CD1 . PHE A 1 617  ? 13.228  66.788 -1.482  1.00 108.56 ? 614  PHE A CD1 1 
ATOM 4787 C CD2 . PHE A 1 617  ? 11.135  66.575 -2.581  1.00 108.56 ? 614  PHE A CD2 1 
ATOM 4788 C CE1 . PHE A 1 617  ? 13.688  65.685 -2.138  1.00 108.56 ? 614  PHE A CE1 1 
ATOM 4789 C CE2 . PHE A 1 617  ? 11.592  65.471 -3.235  1.00 108.56 ? 614  PHE A CE2 1 
ATOM 4790 C CZ  . PHE A 1 617  ? 12.875  65.025 -3.011  1.00 108.56 ? 614  PHE A CZ  1 
ATOM 4791 N N   . GLY A 1 618  ? 11.468  70.275 1.621   1.00 127.72 ? 615  GLY A N   1 
ATOM 4792 C CA  . GLY A 1 618  ? 11.146  71.460 2.423   1.00 127.72 ? 615  GLY A CA  1 
ATOM 4793 C C   . GLY A 1 618  ? 11.216  72.759 1.630   1.00 127.72 ? 615  GLY A C   1 
ATOM 4794 O O   . GLY A 1 618  ? 12.227  73.069 0.992   1.00 127.72 ? 615  GLY A O   1 
ATOM 4795 N N   . LEU A 1 619  ? 10.126  73.521 1.694   1.00 218.25 ? 616  LEU A N   1 
ATOM 4796 C CA  . LEU A 1 619  ? 9.946   74.753 0.919   1.00 218.25 ? 616  LEU A CA  1 
ATOM 4797 C C   . LEU A 1 619  ? 10.248  76.008 1.736   1.00 218.25 ? 616  LEU A C   1 
ATOM 4798 O O   . LEU A 1 619  ? 10.421  75.949 2.954   1.00 218.25 ? 616  LEU A O   1 
ATOM 4799 C CB  . LEU A 1 619  ? 8.509   74.818 0.370   1.00 189.33 ? 616  LEU A CB  1 
ATOM 4800 C CG  . LEU A 1 619  ? 7.906   76.115 -0.202  1.00 189.33 ? 616  LEU A CG  1 
ATOM 4801 C CD1 . LEU A 1 619  ? 8.333   76.350 -1.651  1.00 189.33 ? 616  LEU A CD1 1 
ATOM 4802 C CD2 . LEU A 1 619  ? 6.383   76.108 -0.081  1.00 189.33 ? 616  LEU A CD2 1 
ATOM 4803 N N   . ASN A 1 620  ? 10.300  77.141 1.039   1.00 134.39 ? 617  ASN A N   1 
ATOM 4804 C CA  . ASN A 1 620  ? 10.581  78.435 1.627   1.00 134.39 ? 617  ASN A CA  1 
ATOM 4805 C C   . ASN A 1 620  ? 9.683   79.453 0.970   1.00 134.39 ? 617  ASN A C   1 
ATOM 4806 O O   . ASN A 1 620  ? 9.928   79.822 -0.178  1.00 134.39 ? 617  ASN A O   1 
ATOM 4807 C CB  . ASN A 1 620  ? 12.033  78.795 1.355   1.00 102.53 ? 617  ASN A CB  1 
ATOM 4808 C CG  . ASN A 1 620  ? 12.943  77.597 1.471   1.00 102.53 ? 617  ASN A CG  1 
ATOM 4809 O OD1 . ASN A 1 620  ? 13.151  77.076 2.570   1.00 102.53 ? 617  ASN A OD1 1 
ATOM 4810 N ND2 . ASN A 1 620  ? 13.460  77.120 0.334   1.00 102.53 ? 617  ASN A ND2 1 
ATOM 4811 N N   . ILE A 1 621  ? 8.641   79.892 1.681   1.00 214.03 ? 618  ILE A N   1 
ATOM 4812 C CA  . ILE A 1 621  ? 7.699   80.910 1.175   1.00 214.03 ? 618  ILE A CA  1 
ATOM 4813 C C   . ILE A 1 621  ? 8.412   82.178 0.687   1.00 214.03 ? 618  ILE A C   1 
ATOM 4814 O O   . ILE A 1 621  ? 7.778   83.103 0.165   1.00 214.03 ? 618  ILE A O   1 
ATOM 4815 C CB  . ILE A 1 621  ? 6.612   81.291 2.222   1.00 165.51 ? 618  ILE A CB  1 
ATOM 4816 C CG1 . ILE A 1 621  ? 7.210   81.350 3.637   1.00 165.51 ? 618  ILE A CG1 1 
ATOM 4817 C CG2 . ILE A 1 621  ? 5.446   80.315 2.154   1.00 165.51 ? 618  ILE A CG2 1 
ATOM 4818 C CD1 . ILE A 1 621  ? 6.508   82.315 4.585   1.00 165.51 ? 618  ILE A CD1 1 
ATOM 4819 N N   . GLU A 1 622  ? 9.735   82.188 0.857   1.00 198.16 ? 619  GLU A N   1 
ATOM 4820 C CA  . GLU A 1 622  ? 10.600  83.289 0.454   1.00 198.16 ? 619  GLU A CA  1 
ATOM 4821 C C   . GLU A 1 622  ? 11.474  82.874 -0.732  1.00 198.16 ? 619  GLU A C   1 
ATOM 4822 O O   . GLU A 1 622  ? 11.274  83.335 -1.860  1.00 198.16 ? 619  GLU A O   1 
ATOM 4823 C CB  . GLU A 1 622  ? 11.505  83.714 1.621   1.00 184.94 ? 619  GLU A CB  1 
ATOM 4824 C CG  . GLU A 1 622  ? 11.121  83.165 3.000   1.00 184.94 ? 619  GLU A CG  1 
ATOM 4825 C CD  . GLU A 1 622  ? 10.093  84.018 3.730   1.00 184.94 ? 619  GLU A CD  1 
ATOM 4826 O OE1 . GLU A 1 622  ? 8.974   84.206 3.206   1.00 184.94 ? 619  GLU A OE1 1 
ATOM 4827 O OE2 . GLU A 1 622  ? 10.400  84.491 4.844   1.00 184.94 ? 619  GLU A OE2 1 
ATOM 4828 N N   . THR A 1 623  ? 12.429  81.984 -0.464  1.00 204.69 ? 620  THR A N   1 
ATOM 4829 C CA  . THR A 1 623  ? 13.495  81.661 -1.413  1.00 204.69 ? 620  THR A CA  1 
ATOM 4830 C C   . THR A 1 623  ? 13.057  80.632 -2.452  1.00 204.69 ? 620  THR A C   1 
ATOM 4831 O O   . THR A 1 623  ? 13.179  80.874 -3.653  1.00 204.69 ? 620  THR A O   1 
ATOM 4832 C CB  . THR A 1 623  ? 14.792  81.195 -0.691  1.00 99.17  ? 620  THR A CB  1 
ATOM 4833 O OG1 . THR A 1 623  ? 14.882  79.765 -0.691  1.00 99.17  ? 620  THR A OG1 1 
ATOM 4834 C CG2 . THR A 1 623  ? 14.837  81.702 0.747   1.00 99.17  ? 620  THR A CG2 1 
ATOM 4835 N N   . GLY A 1 624  ? 12.558  79.489 -1.978  1.00 216.17 ? 621  GLY A N   1 
ATOM 4836 C CA  . GLY A 1 624  ? 12.047  78.419 -2.840  1.00 216.17 ? 621  GLY A CA  1 
ATOM 4837 C C   . GLY A 1 624  ? 13.113  77.613 -3.564  1.00 216.17 ? 621  GLY A C   1 
ATOM 4838 O O   . GLY A 1 624  ? 13.422  77.887 -4.726  1.00 216.17 ? 621  GLY A O   1 
ATOM 4839 N N   . LEU A 1 625  ? 13.672  76.621 -2.878  1.00 172.64 ? 622  LEU A N   1 
ATOM 4840 C CA  . LEU A 1 625  ? 14.706  75.774 -3.460  1.00 172.64 ? 622  LEU A CA  1 
ATOM 4841 C C   . LEU A 1 625  ? 14.529  74.319 -3.039  1.00 172.64 ? 622  LEU A C   1 
ATOM 4842 O O   . LEU A 1 625  ? 13.478  73.936 -2.525  1.00 172.64 ? 622  LEU A O   1 
ATOM 4843 C CB  . LEU A 1 625  ? 16.096  76.273 -3.059  1.00 100.34 ? 622  LEU A CB  1 
ATOM 4844 C CG  . LEU A 1 625  ? 16.458  77.694 -3.493  1.00 100.34 ? 622  LEU A CG  1 
ATOM 4845 C CD1 . LEU A 1 625  ? 15.439  78.693 -2.967  1.00 100.34 ? 622  LEU A CD1 1 
ATOM 4846 C CD2 . LEU A 1 625  ? 17.860  78.058 -3.030  1.00 100.34 ? 622  LEU A CD2 1 
ATOM 4847 N N   . LEU A 1 626  ? 15.563  73.514 -3.260  1.00 129.74 ? 623  LEU A N   1 
ATOM 4848 C CA  . LEU A 1 626  ? 15.523  72.101 -2.905  1.00 129.74 ? 623  LEU A CA  1 
ATOM 4849 C C   . LEU A 1 626  ? 15.450  71.913 -1.393  1.00 129.74 ? 623  LEU A C   1 
ATOM 4850 O O   . LEU A 1 626  ? 15.476  72.883 -0.636  1.00 129.74 ? 623  LEU A O   1 
ATOM 4851 C CB  . LEU A 1 626  ? 16.746  71.372 -3.466  1.00 167.85 ? 623  LEU A CB  1 
ATOM 4852 C CG  . LEU A 1 626  ? 16.873  69.889 -3.109  1.00 167.85 ? 623  LEU A CG  1 
ATOM 4853 C CD1 . LEU A 1 626  ? 15.708  69.097 -3.685  1.00 167.85 ? 623  LEU A CD1 1 
ATOM 4854 C CD2 . LEU A 1 626  ? 18.200  69.331 -3.599  1.00 167.85 ? 623  LEU A CD2 1 
ATOM 4855 N N   . SER A 1 627  ? 15.358  70.660 -0.961  1.00 180.15 ? 624  SER A N   1 
ATOM 4856 C CA  . SER A 1 627  ? 15.281  70.343 0.460   1.00 180.15 ? 624  SER A CA  1 
ATOM 4857 C C   . SER A 1 627  ? 15.992  69.030 0.772   1.00 180.15 ? 624  SER A C   1 
ATOM 4858 O O   . SER A 1 627  ? 17.213  68.995 0.922   1.00 180.15 ? 624  SER A O   1 
ATOM 4859 C CB  . SER A 1 627  ? 13.822  70.271 0.915   1.00 91.80  ? 624  SER A CB  1 
ATOM 4860 O OG  . SER A 1 627  ? 13.138  69.212 0.268   1.00 91.80  ? 624  SER A OG  1 
ATOM 4861 N N   . ASP A 1 628  ? 15.220  67.953 0.868   1.00 135.63 ? 625  ASP A N   1 
ATOM 4862 C CA  . ASP A 1 628  ? 15.774  66.637 1.162   1.00 135.63 ? 625  ASP A CA  1 
ATOM 4863 C C   . ASP A 1 628  ? 15.177  65.570 0.250   1.00 135.63 ? 625  ASP A C   1 
ATOM 4864 O O   . ASP A 1 628  ? 13.959  65.397 0.195   1.00 135.63 ? 625  ASP A O   1 
ATOM 4865 C CB  . ASP A 1 628  ? 15.534  66.270 2.627   1.00 189.78 ? 625  ASP A CB  1 
ATOM 4866 C CG  . ASP A 1 628  ? 16.178  67.251 3.587   1.00 189.78 ? 625  ASP A CG  1 
ATOM 4867 O OD1 . ASP A 1 628  ? 16.812  68.218 3.114   1.00 189.78 ? 625  ASP A OD1 1 
ATOM 4868 O OD2 . ASP A 1 628  ? 16.051  67.056 4.814   1.00 189.78 ? 625  ASP A OD2 1 
ATOM 4869 N N   . ARG A 1 629  ? 16.042  64.858 -0.465  1.00 160.33 ? 626  ARG A N   1 
ATOM 4870 C CA  . ARG A 1 629  ? 15.600  63.801 -1.381  1.00 160.33 ? 626  ARG A CA  1 
ATOM 4871 C C   . ARG A 1 629  ? 15.677  62.432 -0.745  1.00 160.33 ? 626  ARG A C   1 
ATOM 4872 O O   . ARG A 1 629  ? 16.766  61.882 -0.551  1.00 160.33 ? 626  ARG A O   1 
ATOM 4873 C CB  . ARG A 1 629  ? 16.366  63.796 -2.712  1.00 142.38 ? 626  ARG A CB  1 
ATOM 4874 C CG  . ARG A 1 629  ? 15.829  62.752 -3.709  1.00 142.38 ? 626  ARG A CG  1 
ATOM 4875 C CD  . ARG A 1 629  ? 16.464  62.880 -5.084  1.00 142.38 ? 626  ARG A CD  1 
ATOM 4876 N NE  . ARG A 1 629  ? 16.236  61.703 -5.928  1.00 142.38 ? 626  ARG A NE  1 
ATOM 4877 C CZ  . ARG A 1 629  ? 15.279  61.595 -6.848  1.00 142.38 ? 626  ARG A CZ  1 
ATOM 4878 N NH1 . ARG A 1 629  ? 14.428  62.593 -7.057  1.00 142.38 ? 626  ARG A NH1 1 
ATOM 4879 N NH2 . ARG A 1 629  ? 15.168  60.482 -7.563  1.00 142.38 ? 626  ARG A NH2 1 
ATOM 4880 N N   . LYS A 1 630  ? 14.517  61.874 -0.417  1.00 87.67  ? 627  LYS A N   1 
ATOM 4881 C CA  . LYS A 1 630  ? 14.448  60.556 0.204   1.00 87.67  ? 627  LYS A CA  1 
ATOM 4882 C C   . LYS A 1 630  ? 13.120  59.872 -0.101  1.00 87.67  ? 627  LYS A C   1 
ATOM 4883 O O   . LYS A 1 630  ? 12.210  59.863 0.728   1.00 87.67  ? 627  LYS A O   1 
ATOM 4884 C CB  . LYS A 1 630  ? 14.648  60.665 1.717   1.00 99.98  ? 627  LYS A CB  1 
ATOM 4885 C CG  . LYS A 1 630  ? 15.985  61.263 2.124   1.00 99.98  ? 627  LYS A CG  1 
ATOM 4886 C CD  . LYS A 1 630  ? 16.117  61.339 3.637   1.00 99.98  ? 627  LYS A CD  1 
ATOM 4887 C CE  . LYS A 1 630  ? 16.020  59.961 4.269   1.00 99.98  ? 627  LYS A CE  1 
ATOM 4888 N NZ  . LYS A 1 630  ? 17.087  59.047 3.777   1.00 99.98  ? 627  LYS A NZ  1 
ATOM 4889 N N   . LYS A 1 631  ? 13.015  59.301 -1.297  1.00 86.14  ? 628  LYS A N   1 
ATOM 4890 C CA  . LYS A 1 631  ? 11.798  58.614 -1.714  1.00 86.14  ? 628  LYS A CA  1 
ATOM 4891 C C   . LYS A 1 631  ? 11.246  57.738 -0.595  1.00 86.14  ? 628  LYS A C   1 
ATOM 4892 O O   . LYS A 1 631  ? 11.990  57.284 0.275   1.00 86.14  ? 628  LYS A O   1 
ATOM 4893 C CB  . LYS A 1 631  ? 12.061  57.769 -2.962  1.00 80.79  ? 628  LYS A CB  1 
ATOM 4894 C CG  . LYS A 1 631  ? 10.843  57.013 -3.468  1.00 80.79  ? 628  LYS A CG  1 
ATOM 4895 C CD  . LYS A 1 631  ? 11.175  56.196 -4.705  1.00 80.79  ? 628  LYS A CD  1 
ATOM 4896 C CE  . LYS A 1 631  ? 9.957   55.440 -5.210  1.00 80.79  ? 628  LYS A CE  1 
ATOM 4897 N NZ  . LYS A 1 631  ? 10.267  54.633 -6.423  1.00 80.79  ? 628  LYS A NZ  1 
ATOM 4898 N N   . VAL A 1 632  ? 9.938   57.504 -0.623  1.00 110.91 ? 629  VAL A N   1 
ATOM 4899 C CA  . VAL A 1 632  ? 9.285   56.683 0.390   1.00 110.91 ? 629  VAL A CA  1 
ATOM 4900 C C   . VAL A 1 632  ? 8.587   55.482 -0.240  1.00 110.91 ? 629  VAL A C   1 
ATOM 4901 O O   . VAL A 1 632  ? 8.537   55.351 -1.463  1.00 110.91 ? 629  VAL A O   1 
ATOM 4902 C CB  . VAL A 1 632  ? 8.258   57.496 1.199   1.00 77.15  ? 629  VAL A CB  1 
ATOM 4903 C CG1 . VAL A 1 632  ? 8.950   58.614 1.964   1.00 77.15  ? 629  VAL A CG1 1 
ATOM 4904 C CG2 . VAL A 1 632  ? 7.182   58.056 0.281   1.00 77.15  ? 629  VAL A CG2 1 
ATOM 4905 N N   . THR A 1 633  ? 8.049   54.608 0.605   1.00 94.89  ? 630  THR A N   1 
ATOM 4906 C CA  . THR A 1 633  ? 7.353   53.416 0.134   1.00 94.89  ? 630  THR A CA  1 
ATOM 4907 C C   . THR A 1 633  ? 5.863   53.684 -0.052  1.00 94.89  ? 630  THR A C   1 
ATOM 4908 O O   . THR A 1 633  ? 5.407   53.963 -1.161  1.00 94.89  ? 630  THR A O   1 
ATOM 4909 C CB  . THR A 1 633  ? 7.536   52.235 1.105   1.00 98.98  ? 630  THR A CB  1 
ATOM 4910 O OG1 . THR A 1 633  ? 6.846   51.086 0.598   1.00 98.98  ? 630  THR A OG1 1 
ATOM 4911 C CG2 . THR A 1 633  ? 6.986   52.586 2.479   1.00 98.98  ? 630  THR A CG2 1 
ATOM 4912 N N   . LEU A 1 634  ? 5.111   53.597 1.039   1.00 76.68  ? 631  LEU A N   1 
ATOM 4913 C CA  . LEU A 1 634  ? 3.672   53.829 0.998   1.00 76.68  ? 631  LEU A CA  1 
ATOM 4914 C C   . LEU A 1 634  ? 2.958   52.720 0.232   1.00 76.68  ? 631  LEU A C   1 
ATOM 4915 O O   . LEU A 1 634  ? 3.453   51.596 0.143   1.00 76.68  ? 631  LEU A O   1 
ATOM 4916 C CB  . LEU A 1 634  ? 3.366   55.187 0.365   1.00 70.03  ? 631  LEU A CB  1 
ATOM 4917 C CG  . LEU A 1 634  ? 3.956   56.411 1.068   1.00 70.03  ? 631  LEU A CG  1 
ATOM 4918 C CD1 . LEU A 1 634  ? 3.643   57.681 0.291   1.00 70.03  ? 631  LEU A CD1 1 
ATOM 4919 C CD2 . LEU A 1 634  ? 3.443   56.511 2.496   1.00 70.03  ? 631  LEU A CD2 1 
ATOM 4920 N N   . GLY A 1 635  ? 1.794   53.044 -0.321  1.00 85.09  ? 632  GLY A N   1 
ATOM 4921 C CA  . GLY A 1 635  ? 1.016   52.081 -1.077  1.00 85.09  ? 632  GLY A CA  1 
ATOM 4922 C C   . GLY A 1 635  ? 1.749   51.528 -2.281  1.00 85.09  ? 632  GLY A C   1 
ATOM 4923 O O   . GLY A 1 635  ? 2.880   51.917 -2.579  1.00 85.09  ? 632  GLY A O   1 
ATOM 4924 N N   . THR A 1 636  ? 1.098   50.601 -2.968  1.00 93.13  ? 633  THR A N   1 
ATOM 4925 C CA  . THR A 1 636  ? 1.530   50.186 -4.293  1.00 93.13  ? 633  THR A CA  1 
ATOM 4926 C C   . THR A 1 636  ? 0.681   50.936 -5.323  1.00 93.13  ? 633  THR A C   1 
ATOM 4927 O O   . THR A 1 636  ? 0.842   50.770 -6.537  1.00 93.13  ? 633  THR A O   1 
ATOM 4928 C CB  . THR A 1 636  ? 1.364   48.676 -4.481  1.00 111.49 ? 633  THR A CB  1 
ATOM 4929 O OG1 . THR A 1 636  ? 0.014   48.385 -4.877  1.00 111.49 ? 633  THR A OG1 1 
ATOM 4930 C CG2 . THR A 1 636  ? 1.699   47.938 -3.179  1.00 111.49 ? 633  THR A CG2 1 
ATOM 4931 N N   . GLN A 1 637  ? -0.219  51.768 -4.803  1.00 97.77  ? 634  GLN A N   1 
ATOM 4932 C CA  . GLN A 1 637  ? -1.158  52.538 -5.600  1.00 97.77  ? 634  GLN A CA  1 
ATOM 4933 C C   . GLN A 1 637  ? -0.908  54.037 -5.446  1.00 97.77  ? 634  GLN A C   1 
ATOM 4934 O O   . GLN A 1 637  ? -0.316  54.472 -4.446  1.00 97.77  ? 634  GLN A O   1 
ATOM 4935 C CB  . GLN A 1 637  ? -2.597  52.188 -5.200  1.00 105.07 ? 634  GLN A CB  1 
ATOM 4936 C CG  . GLN A 1 637  ? -2.988  50.739 -5.487  1.00 105.07 ? 634  GLN A CG  1 
ATOM 4937 C CD  . GLN A 1 637  ? -3.101  50.424 -6.975  1.00 105.07 ? 634  GLN A CD  1 
ATOM 4938 O OE1 . GLN A 1 637  ? -2.444  51.050 -7.815  1.00 105.07 ? 634  GLN A OE1 1 
ATOM 4939 N NE2 . GLN A 1 637  ? -3.942  49.442 -7.303  1.00 105.07 ? 634  GLN A NE2 1 
ATOM 4940 N N   . PRO A 1 638  ? -1.354  54.833 -6.439  1.00 92.58  ? 635  PRO A N   1 
ATOM 4941 C CA  . PRO A 1 638  ? -1.123  56.272 -6.442  1.00 92.58  ? 635  PRO A CA  1 
ATOM 4942 C C   . PRO A 1 638  ? -1.597  56.902 -5.151  1.00 92.58  ? 635  PRO A C   1 
ATOM 4943 O O   . PRO A 1 638  ? -2.742  56.732 -4.751  1.00 92.58  ? 635  PRO A O   1 
ATOM 4944 C CB  . PRO A 1 638  ? -1.974  56.767 -7.616  1.00 108.91 ? 635  PRO A CB  1 
ATOM 4945 C CG  . PRO A 1 638  ? -2.885  55.638 -7.956  1.00 108.91 ? 635  PRO A CG  1 
ATOM 4946 C CD  . PRO A 1 638  ? -2.113  54.414 -7.627  1.00 108.91 ? 635  PRO A CD  1 
ATOM 4947 N N   . THR A 1 639  ? -0.706  57.615 -4.491  1.00 70.09  ? 636  THR A N   1 
ATOM 4948 C CA  . THR A 1 639  ? -1.053  58.215 -3.236  1.00 70.09  ? 636  THR A CA  1 
ATOM 4949 C C   . THR A 1 639  ? -1.699  59.578 -3.468  1.00 70.09  ? 636  THR A C   1 
ATOM 4950 O O   . THR A 1 639  ? -1.262  60.345 -4.330  1.00 70.09  ? 636  THR A O   1 
ATOM 4951 C CB  . THR A 1 639  ? 0.185   58.303 -2.344  1.00 75.36  ? 636  THR A CB  1 
ATOM 4952 O OG1 . THR A 1 639  ? 0.860   57.033 -2.349  1.00 75.36  ? 636  THR A OG1 1 
ATOM 4953 C CG2 . THR A 1 639  ? -0.205  58.654 -0.921  1.00 75.36  ? 636  THR A CG2 1 
ATOM 4954 N N   . VAL A 1 640  ? -2.762  59.860 -2.714  1.00 60.02  ? 637  VAL A N   1 
ATOM 4955 C CA  . VAL A 1 640  ? -3.446  61.159 -2.759  1.00 60.02  ? 637  VAL A CA  1 
ATOM 4956 C C   . VAL A 1 640  ? -3.338  61.815 -1.399  1.00 60.02  ? 637  VAL A C   1 
ATOM 4957 O O   . VAL A 1 640  ? -3.684  61.212 -0.383  1.00 60.02  ? 637  VAL A O   1 
ATOM 4958 C CB  . VAL A 1 640  ? -4.932  61.024 -3.101  1.00 60.75  ? 637  VAL A CB  1 
ATOM 4959 C CG1 . VAL A 1 640  ? -5.505  62.373 -3.500  1.00 60.75  ? 637  VAL A CG1 1 
ATOM 4960 C CG2 . VAL A 1 640  ? -5.119  60.007 -4.209  1.00 60.75  ? 637  VAL A CG2 1 
ATOM 4961 N N   . LEU A 1 641  ? -2.869  63.057 -1.397  1.00 79.92  ? 638  LEU A N   1 
ATOM 4962 C CA  . LEU A 1 641  ? -2.557  63.781 -0.180  1.00 79.92  ? 638  LEU A CA  1 
ATOM 4963 C C   . LEU A 1 641  ? -3.568  64.876 0.099   1.00 79.92  ? 638  LEU A C   1 
ATOM 4964 O O   . LEU A 1 641  ? -3.802  65.732 -0.752  1.00 79.92  ? 638  LEU A O   1 
ATOM 4965 C CB  . LEU A 1 641  ? -1.187  64.411 -0.325  1.00 71.40  ? 638  LEU A CB  1 
ATOM 4966 C CG  . LEU A 1 641  ? -0.046  63.427 -0.562  1.00 71.40  ? 638  LEU A CG  1 
ATOM 4967 C CD1 . LEU A 1 641  ? 0.994   64.020 -1.495  1.00 71.40  ? 638  LEU A CD1 1 
ATOM 4968 C CD2 . LEU A 1 641  ? 0.577   63.002 0.774   1.00 71.40  ? 638  LEU A CD2 1 
ATOM 4969 N N   . ARG A 1 642  ? -4.168  64.843 1.288   1.00 80.37  ? 639  ARG A N   1 
ATOM 4970 C CA  . ARG A 1 642  ? -5.095  65.885 1.731   1.00 80.37  ? 639  ARG A CA  1 
ATOM 4971 C C   . ARG A 1 642  ? -4.816  66.183 3.185   1.00 80.37  ? 639  ARG A C   1 
ATOM 4972 O O   . ARG A 1 642  ? -4.202  65.374 3.868   1.00 80.37  ? 639  ARG A O   1 
ATOM 4973 C CB  . ARG A 1 642  ? -6.551  65.446 1.558   1.00 185.52 ? 639  ARG A CB  1 
ATOM 4974 C CG  . ARG A 1 642  ? -7.557  66.396 2.197   1.00 185.52 ? 639  ARG A CG  1 
ATOM 4975 C CD  . ARG A 1 642  ? -7.769  67.632 1.354   1.00 185.52 ? 639  ARG A CD  1 
ATOM 4976 N NE  . ARG A 1 642  ? -8.896  67.438 0.455   1.00 185.52 ? 639  ARG A NE  1 
ATOM 4977 C CZ  . ARG A 1 642  ? -10.149 67.756 0.759   1.00 185.52 ? 639  ARG A CZ  1 
ATOM 4978 N NH1 . ARG A 1 642  ? -10.432 68.299 1.936   1.00 185.52 ? 639  ARG A NH1 1 
ATOM 4979 N NH2 . ARG A 1 642  ? -11.121 67.537 -0.114  1.00 185.52 ? 639  ARG A NH2 1 
ATOM 4980 N N   . THR A 1 643  ? -5.262  67.346 3.648   1.00 127.42 ? 640  THR A N   1 
ATOM 4981 C CA  . THR A 1 643  ? -5.071  67.745 5.036   1.00 127.42 ? 640  THR A CA  1 
ATOM 4982 C C   . THR A 1 643  ? -6.365  67.700 5.852   1.00 127.42 ? 640  THR A C   1 
ATOM 4983 O O   . THR A 1 643  ? -7.444  67.999 5.339   1.00 127.42 ? 640  THR A O   1 
ATOM 4984 C CB  . THR A 1 643  ? -4.322  69.096 5.128   1.00 79.27  ? 640  THR A CB  1 
ATOM 4985 O OG1 . THR A 1 643  ? -2.948  68.831 5.453   1.00 79.27  ? 640  THR A OG1 1 
ATOM 4986 C CG2 . THR A 1 643  ? -4.931  70.050 6.181   1.00 79.27  ? 640  THR A CG2 1 
ATOM 4987 N N   . PHE A 1 644  ? -6.228  67.294 7.116   1.00 147.53 ? 641  PHE A N   1 
ATOM 4988 C CA  . PHE A 1 644  ? -7.359  67.047 8.020   1.00 147.53 ? 641  PHE A CA  1 
ATOM 4989 C C   . PHE A 1 644  ? -7.349  67.957 9.253   1.00 147.53 ? 641  PHE A C   1 
ATOM 4990 O O   . PHE A 1 644  ? -6.330  68.582 9.573   1.00 147.53 ? 641  PHE A O   1 
ATOM 4991 C CB  . PHE A 1 644  ? -7.423  65.555 8.448   1.00 90.45  ? 641  PHE A CB  1 
ATOM 4992 C CG  . PHE A 1 644  ? -6.121  65.010 9.022   1.00 90.45  ? 641  PHE A CG  1 
ATOM 4993 C CD1 . PHE A 1 644  ? -5.789  65.210 10.367  1.00 90.45  ? 641  PHE A CD1 1 
ATOM 4994 C CD2 . PHE A 1 644  ? -5.229  64.296 8.215   1.00 90.45  ? 641  PHE A CD2 1 
ATOM 4995 C CE1 . PHE A 1 644  ? -4.583  64.716 10.894  1.00 90.45  ? 641  PHE A CE1 1 
ATOM 4996 C CE2 . PHE A 1 644  ? -4.024  63.797 8.735   1.00 90.45  ? 641  PHE A CE2 1 
ATOM 4997 C CZ  . PHE A 1 644  ? -3.705  64.003 10.075  1.00 90.45  ? 641  PHE A CZ  1 
ATOM 4998 N N   . ARG A 1 645  ? -8.493  68.017 9.935   1.00 201.74 ? 642  ARG A N   1 
ATOM 4999 C CA  . ARG A 1 645  ? -8.600  68.706 11.218  1.00 201.74 ? 642  ARG A CA  1 
ATOM 5000 C C   . ARG A 1 645  ? -8.288  67.756 12.378  1.00 201.74 ? 642  ARG A C   1 
ATOM 5001 O O   . ARG A 1 645  ? -8.896  66.685 12.495  1.00 201.74 ? 642  ARG A O   1 
ATOM 5002 C CB  . ARG A 1 645  ? -9.993  69.332 11.396  1.00 121.89 ? 642  ARG A CB  1 
ATOM 5003 C CG  . ARG A 1 645  ? -10.227 69.959 12.796  1.00 121.89 ? 642  ARG A CG  1 
ATOM 5004 C CD  . ARG A 1 645  ? -11.487 70.831 12.893  1.00 121.89 ? 642  ARG A CD  1 
ATOM 5005 N NE  . ARG A 1 645  ? -12.593 70.315 12.083  1.00 121.89 ? 642  ARG A NE  1 
ATOM 5006 C CZ  . ARG A 1 645  ? -13.844 70.755 12.151  1.00 121.89 ? 642  ARG A CZ  1 
ATOM 5007 N NH1 . ARG A 1 645  ? -14.181 71.721 13.004  1.00 121.89 ? 642  ARG A NH1 1 
ATOM 5008 N NH2 . ARG A 1 645  ? -14.755 70.222 11.355  1.00 121.89 ? 642  ARG A NH2 1 
ATOM 5009 N N   . SER A 1 646  ? -7.341  68.165 13.225  1.00 218.25 ? 643  SER A N   1 
ATOM 5010 C CA  . SER A 1 646  ? -6.963  67.405 14.420  1.00 218.25 ? 643  SER A CA  1 
ATOM 5011 C C   . SER A 1 646  ? -6.859  68.295 15.668  1.00 218.25 ? 643  SER A C   1 
ATOM 5012 O O   . SER A 1 646  ? -7.762  69.084 15.954  1.00 218.25 ? 643  SER A O   1 
ATOM 5013 C CB  . SER A 1 646  ? -5.664  66.619 14.179  1.00 107.81 ? 643  SER A CB  1 
ATOM 5014 O OG  . SER A 1 646  ? -4.640  67.459 13.670  1.00 107.81 ? 643  SER A OG  1 
ATOM 5015 N N   . LEU A 1 647  ? -5.757  68.158 16.400  1.00 161.42 ? 644  LEU A N   1 
ATOM 5016 C CA  . LEU A 1 647  ? -5.522  68.897 17.640  1.00 161.42 ? 644  LEU A CA  1 
ATOM 5017 C C   . LEU A 1 647  ? -5.139  70.360 17.382  1.00 161.42 ? 644  LEU A C   1 
ATOM 5018 O O   . LEU A 1 647  ? -5.940  71.136 16.851  1.00 161.42 ? 644  LEU A O   1 
ATOM 5019 C CB  . LEU A 1 647  ? -4.457  68.174 18.494  1.00 102.76 ? 644  LEU A CB  1 
ATOM 5020 C CG  . LEU A 1 647  ? -2.971  68.038 18.087  1.00 102.76 ? 644  LEU A CG  1 
ATOM 5021 C CD1 . LEU A 1 647  ? -2.141  67.381 19.210  1.00 102.76 ? 644  LEU A CD1 1 
ATOM 5022 C CD2 . LEU A 1 647  ? -2.757  67.308 16.742  1.00 102.76 ? 644  LEU A CD2 1 
ATOM 5023 N N   . SER A 1 648  ? -3.913  70.716 17.768  1.00 174.00 ? 645  SER A N   1 
ATOM 5024 C CA  . SER A 1 648  ? -3.363  72.059 17.601  1.00 174.00 ? 645  SER A CA  1 
ATOM 5025 C C   . SER A 1 648  ? -2.419  72.141 16.403  1.00 174.00 ? 645  SER A C   1 
ATOM 5026 O O   . SER A 1 648  ? -2.203  73.223 15.842  1.00 174.00 ? 645  SER A O   1 
ATOM 5027 C CB  . SER A 1 648  ? -2.618  72.483 18.871  1.00 169.57 ? 645  SER A CB  1 
ATOM 5028 O OG  . SER A 1 648  ? -1.518  71.627 19.128  1.00 169.57 ? 645  SER A OG  1 
ATOM 5029 N N   . THR A 1 649  ? -1.843  70.999 16.028  1.00 218.25 ? 646  THR A N   1 
ATOM 5030 C CA  . THR A 1 649  ? -0.947  70.942 14.883  1.00 218.25 ? 646  THR A CA  1 
ATOM 5031 C C   . THR A 1 649  ? -1.552  70.000 13.840  1.00 218.25 ? 646  THR A C   1 
ATOM 5032 O O   . THR A 1 649  ? -1.175  68.833 13.751  1.00 218.25 ? 646  THR A O   1 
ATOM 5033 C CB  . THR A 1 649  ? 0.501   70.532 15.296  1.00 107.13 ? 646  THR A CB  1 
ATOM 5034 O OG1 . THR A 1 649  ? 0.599   69.110 15.429  1.00 107.13 ? 646  THR A OG1 1 
ATOM 5035 C CG2 . THR A 1 649  ? 0.909   71.193 16.622  1.00 107.13 ? 646  THR A CG2 1 
ATOM 5036 N N   . THR A 1 650  ? -2.509  70.522 13.070  1.00 171.12 ? 647  THR A N   1 
ATOM 5037 C CA  . THR A 1 650  ? -3.264  69.741 12.078  1.00 171.12 ? 647  THR A CA  1 
ATOM 5038 C C   . THR A 1 650  ? -2.349  69.137 11.012  1.00 171.12 ? 647  THR A C   1 
ATOM 5039 O O   . THR A 1 650  ? -1.291  69.694 10.727  1.00 171.12 ? 647  THR A O   1 
ATOM 5040 C CB  . THR A 1 650  ? -4.330  70.597 11.395  1.00 98.12  ? 647  THR A CB  1 
ATOM 5041 O OG1 . THR A 1 650  ? -3.712  71.429 10.411  1.00 98.12  ? 647  THR A OG1 1 
ATOM 5042 C CG2 . THR A 1 650  ? -5.048  71.471 12.412  1.00 98.12  ? 647  THR A CG2 1 
ATOM 5043 N N   . ASN A 1 651  ? -2.754  68.014 10.418  1.00 149.19 ? 648  ASN A N   1 
ATOM 5044 C CA  . ASN A 1 651  ? -1.801  67.198 9.654   1.00 149.19 ? 648  ASN A CA  1 
ATOM 5045 C C   . ASN A 1 651  ? -2.223  66.754 8.251   1.00 149.19 ? 648  ASN A C   1 
ATOM 5046 O O   . ASN A 1 651  ? -3.283  67.148 7.756   1.00 149.19 ? 648  ASN A O   1 
ATOM 5047 C CB  . ASN A 1 651  ? -1.374  65.979 10.476  1.00 185.84 ? 648  ASN A CB  1 
ATOM 5048 C CG  . ASN A 1 651  ? -1.052  66.325 11.911  1.00 185.84 ? 648  ASN A CG  1 
ATOM 5049 O OD1 . ASN A 1 651  ? 0.077   66.694 12.231  1.00 185.84 ? 648  ASN A OD1 1 
ATOM 5050 N ND2 . ASN A 1 651  ? -2.045  66.201 12.789  1.00 185.84 ? 648  ASN A ND2 1 
ATOM 5051 N N   . VAL A 1 652  ? -1.369  65.930 7.631   1.00 103.17 ? 649  VAL A N   1 
ATOM 5052 C CA  . VAL A 1 652  ? -1.575  65.409 6.272   1.00 103.17 ? 649  VAL A CA  1 
ATOM 5053 C C   . VAL A 1 652  ? -1.783  63.887 6.207   1.00 103.17 ? 649  VAL A C   1 
ATOM 5054 O O   . VAL A 1 652  ? -0.914  63.086 6.587   1.00 103.17 ? 649  VAL A O   1 
ATOM 5055 C CB  . VAL A 1 652  ? -0.416  65.793 5.319   1.00 122.13 ? 649  VAL A CB  1 
ATOM 5056 C CG1 . VAL A 1 652  ? -0.651  65.223 3.923   1.00 122.13 ? 649  VAL A CG1 1 
ATOM 5057 C CG2 . VAL A 1 652  ? -0.269  67.295 5.244   1.00 122.13 ? 649  VAL A CG2 1 
ATOM 5058 N N   . PHE A 1 653  ? -2.952  63.525 5.690   1.00 66.44  ? 650  PHE A N   1 
ATOM 5059 C CA  . PHE A 1 653  ? -3.358  62.154 5.439   1.00 66.44  ? 650  PHE A CA  1 
ATOM 5060 C C   . PHE A 1 653  ? -2.954  61.695 4.033   1.00 66.44  ? 650  PHE A C   1 
ATOM 5061 O O   . PHE A 1 653  ? -3.150  62.413 3.041   1.00 66.44  ? 650  PHE A O   1 
ATOM 5062 C CB  . PHE A 1 653  ? -4.872  62.108 5.549   1.00 88.27  ? 650  PHE A CB  1 
ATOM 5063 C CG  . PHE A 1 653  ? -5.438  60.734 5.553   1.00 88.27  ? 650  PHE A CG  1 
ATOM 5064 C CD1 . PHE A 1 653  ? -5.995  60.211 6.714   1.00 88.27  ? 650  PHE A CD1 1 
ATOM 5065 C CD2 . PHE A 1 653  ? -5.437  59.961 4.398   1.00 88.27  ? 650  PHE A CD2 1 
ATOM 5066 C CE1 . PHE A 1 653  ? -6.528  58.938 6.727   1.00 88.27  ? 650  PHE A CE1 1 
ATOM 5067 C CE2 . PHE A 1 653  ? -5.969  58.687 4.400   1.00 88.27  ? 650  PHE A CE2 1 
ATOM 5068 C CZ  . PHE A 1 653  ? -6.519  58.173 5.564   1.00 88.27  ? 650  PHE A CZ  1 
ATOM 5069 N N   . ALA A 1 654  ? -2.420  60.481 3.960   1.00 61.14  ? 651  ALA A N   1 
ATOM 5070 C CA  . ALA A 1 654  ? -1.972  59.888 2.707   1.00 61.14  ? 651  ALA A CA  1 
ATOM 5071 C C   . ALA A 1 654  ? -2.879  58.729 2.277   1.00 61.14  ? 651  ALA A C   1 
ATOM 5072 O O   . ALA A 1 654  ? -2.981  57.717 2.968   1.00 61.14  ? 651  ALA A O   1 
ATOM 5073 C CB  . ALA A 1 654  ? -0.559  59.417 2.864   1.00 76.50  ? 651  ALA A CB  1 
ATOM 5074 N N   . CYS A 1 655  ? -3.541  58.870 1.138   1.00 67.51  ? 652  CYS A N   1 
ATOM 5075 C CA  . CYS A 1 655  ? -4.448  57.827 0.693   1.00 67.51  ? 652  CYS A CA  1 
ATOM 5076 C C   . CYS A 1 655  ? -3.744  56.922 -0.291  1.00 67.51  ? 652  CYS A C   1 
ATOM 5077 O O   . CYS A 1 655  ? -3.302  57.358 -1.338  1.00 67.51  ? 652  CYS A O   1 
ATOM 5078 C CB  . CYS A 1 655  ? -5.706  58.414 0.068   1.00 80.95  ? 652  CYS A CB  1 
ATOM 5079 S SG  . CYS A 1 655  ? -6.412  59.803 0.978   1.00 80.95  ? 652  CYS A SG  1 
ATOM 5080 N N   . SER A 1 656  ? -3.615  55.660 0.076   1.00 64.07  ? 653  SER A N   1 
ATOM 5081 C CA  . SER A 1 656  ? -3.029  54.652 -0.772  1.00 64.07  ? 653  SER A CA  1 
ATOM 5082 C C   . SER A 1 656  ? -3.827  53.418 -0.488  1.00 64.07  ? 653  SER A C   1 
ATOM 5083 O O   . SER A 1 656  ? -4.801  53.477 0.272   1.00 64.07  ? 653  SER A O   1 
ATOM 5084 C CB  . SER A 1 656  ? -1.584  54.396 -0.354  1.00 69.35  ? 653  SER A CB  1 
ATOM 5085 O OG  . SER A 1 656  ? -0.645  54.851 -1.329  1.00 69.35  ? 653  SER A OG  1 
ATOM 5086 N N   . ASP A 1 657  ? -3.426  52.290 -1.067  1.00 82.02  ? 654  ASP A N   1 
ATOM 5087 C CA  . ASP A 1 657  ? -3.914  51.007 -0.554  1.00 82.02  ? 654  ASP A CA  1 
ATOM 5088 C C   . ASP A 1 657  ? -3.518  50.876 0.919   1.00 82.02  ? 654  ASP A C   1 
ATOM 5089 O O   . ASP A 1 657  ? -4.325  50.488 1.747   1.00 82.02  ? 654  ASP A O   1 
ATOM 5090 C CB  . ASP A 1 657  ? -3.434  49.801 -1.390  1.00 114.88 ? 654  ASP A CB  1 
ATOM 5091 C CG  . ASP A 1 657  ? -1.964  49.889 -1.790  1.00 114.88 ? 654  ASP A CG  1 
ATOM 5092 O OD1 . ASP A 1 657  ? -1.513  50.978 -2.215  1.00 114.88 ? 654  ASP A OD1 1 
ATOM 5093 O OD2 . ASP A 1 657  ? -1.269  48.851 -1.704  1.00 114.88 ? 654  ASP A OD2 1 
ATOM 5094 N N   . ARG A 1 658  ? -2.280  51.235 1.231   1.00 65.25  ? 655  ARG A N   1 
ATOM 5095 C CA  . ARG A 1 658  ? -1.795  51.324 2.601   1.00 65.25  ? 655  ARG A CA  1 
ATOM 5096 C C   . ARG A 1 658  ? -2.009  52.768 3.104   1.00 65.25  ? 655  ARG A C   1 
ATOM 5097 O O   . ARG A 1 658  ? -1.151  53.644 2.903   1.00 65.25  ? 655  ARG A O   1 
ATOM 5098 C CB  . ARG A 1 658  ? -0.309  50.949 2.653   1.00 124.21 ? 655  ARG A CB  1 
ATOM 5099 C CG  . ARG A 1 658  ? 0.091   50.048 3.816   1.00 124.21 ? 655  ARG A CG  1 
ATOM 5100 C CD  . ARG A 1 658  ? 1.617   49.973 4.013   1.00 124.21 ? 655  ARG A CD  1 
ATOM 5101 N NE  . ARG A 1 658  ? 2.379   49.880 2.762   1.00 124.21 ? 655  ARG A NE  1 
ATOM 5102 C CZ  . ARG A 1 658  ? 2.493   48.786 2.003   1.00 124.21 ? 655  ARG A CZ  1 
ATOM 5103 N NH1 . ARG A 1 658  ? 1.879   47.655 2.336   1.00 124.21 ? 655  ARG A NH1 1 
ATOM 5104 N NH2 . ARG A 1 658  ? 3.218   48.827 0.891   1.00 124.21 ? 655  ARG A NH2 1 
ATOM 5105 N N   . PRO A 1 659  ? -3.158  53.017 3.756   1.00 56.13  ? 656  PRO A N   1 
ATOM 5106 C CA  . PRO A 1 659  ? -3.472  54.367 4.162   1.00 56.13  ? 656  PRO A CA  1 
ATOM 5107 C C   . PRO A 1 659  ? -2.526  54.750 5.277   1.00 56.13  ? 656  PRO A C   1 
ATOM 5108 O O   . PRO A 1 659  ? -2.085  53.883 6.041   1.00 56.13  ? 656  PRO A O   1 
ATOM 5109 C CB  . PRO A 1 659  ? -4.903  54.256 4.668   1.00 67.56  ? 656  PRO A CB  1 
ATOM 5110 C CG  . PRO A 1 659  ? -5.065  52.848 5.061   1.00 67.56  ? 656  PRO A CG  1 
ATOM 5111 C CD  . PRO A 1 659  ? -4.189  52.052 4.179   1.00 67.56  ? 656  PRO A CD  1 
ATOM 5112 N N   . THR A 1 660  ? -2.208  56.038 5.356   1.00 55.02  ? 657  THR A N   1 
ATOM 5113 C CA  . THR A 1 660  ? -1.105  56.513 6.180   1.00 55.02  ? 657  THR A CA  1 
ATOM 5114 C C   . THR A 1 660  ? -1.279  57.950 6.612   1.00 55.02  ? 657  THR A C   1 
ATOM 5115 O O   . THR A 1 660  ? -1.770  58.785 5.861   1.00 55.02  ? 657  THR A O   1 
ATOM 5116 C CB  . THR A 1 660  ? 0.218   56.442 5.406   1.00 61.45  ? 657  THR A CB  1 
ATOM 5117 O OG1 . THR A 1 660  ? 0.450   55.095 4.973   1.00 61.45  ? 657  THR A OG1 1 
ATOM 5118 C CG2 . THR A 1 660  ? 1.375   56.901 6.279   1.00 61.45  ? 657  THR A CG2 1 
ATOM 5119 N N   . VAL A 1 661  ? -0.866  58.249 7.831   1.00 62.43  ? 658  VAL A N   1 
ATOM 5120 C CA  . VAL A 1 661  ? -0.892  59.617 8.275   1.00 62.43  ? 658  VAL A CA  1 
ATOM 5121 C C   . VAL A 1 661  ? 0.507   60.123 8.216   1.00 62.43  ? 658  VAL A C   1 
ATOM 5122 O O   . VAL A 1 661  ? 1.463   59.322 8.293   1.00 62.43  ? 658  VAL A O   1 
ATOM 5123 C CB  . VAL A 1 661  ? -1.377  59.766 9.703   1.00 48.00  ? 658  VAL A CB  1 
ATOM 5124 C CG1 . VAL A 1 661  ? -0.999  61.114 10.209  1.00 48.00  ? 658  VAL A CG1 1 
ATOM 5125 C CG2 . VAL A 1 661  ? -2.873  59.643 9.758   1.00 48.00  ? 658  VAL A CG2 1 
ATOM 5126 N N   . ILE A 1 662  ? 0.599   61.449 8.054   1.00 139.48 ? 659  ILE A N   1 
ATOM 5127 C CA  . ILE A 1 662  ? 1.816   62.239 8.195   1.00 139.48 ? 659  ILE A CA  1 
ATOM 5128 C C   . ILE A 1 662  ? 1.615   63.302 9.290   1.00 139.48 ? 659  ILE A C   1 
ATOM 5129 O O   . ILE A 1 662  ? 1.073   64.385 9.031   1.00 139.48 ? 659  ILE A O   1 
ATOM 5130 C CB  . ILE A 1 662  ? 2.183   62.917 6.873   1.00 111.95 ? 659  ILE A CB  1 
ATOM 5131 C CG1 . ILE A 1 662  ? 2.210   61.883 5.743   1.00 111.95 ? 659  ILE A CG1 1 
ATOM 5132 C CG2 . ILE A 1 662  ? 3.519   63.626 7.000   1.00 111.95 ? 659  ILE A CG2 1 
ATOM 5133 C CD1 . ILE A 1 662  ? 1.868   62.441 4.377   1.00 111.95 ? 659  ILE A CD1 1 
ATOM 5134 N N   . TYR A 1 663  ? 2.050   62.961 10.508  1.00 163.02 ? 660  TYR A N   1 
ATOM 5135 C CA  . TYR A 1 663  ? 1.931   63.808 11.710  1.00 163.02 ? 660  TYR A CA  1 
ATOM 5136 C C   . TYR A 1 663  ? 3.164   64.721 11.865  1.00 163.02 ? 660  TYR A C   1 
ATOM 5137 O O   . TYR A 1 663  ? 3.541   65.424 10.925  1.00 163.02 ? 660  TYR A O   1 
ATOM 5138 C CB  . TYR A 1 663  ? 1.781   62.934 12.977  1.00 163.09 ? 660  TYR A CB  1 
ATOM 5139 C CG  . TYR A 1 663  ? 0.371   62.642 13.494  1.00 163.09 ? 660  TYR A CG  1 
ATOM 5140 C CD1 . TYR A 1 663  ? -0.168  61.350 13.428  1.00 163.09 ? 660  TYR A CD1 1 
ATOM 5141 C CD2 . TYR A 1 663  ? -0.395  63.638 14.112  1.00 163.09 ? 660  TYR A CD2 1 
ATOM 5142 C CE1 . TYR A 1 663  ? -1.451  61.071 13.921  1.00 163.09 ? 660  TYR A CE1 1 
ATOM 5143 C CE2 . TYR A 1 663  ? -1.680  63.364 14.611  1.00 163.09 ? 660  TYR A CE2 1 
ATOM 5144 C CZ  . TYR A 1 663  ? -2.195  62.081 14.511  1.00 163.09 ? 660  TYR A CZ  1 
ATOM 5145 O OH  . TYR A 1 663  ? -3.452  61.813 15.000  1.00 163.09 ? 660  TYR A OH  1 
ATOM 5146 N N   . SER A 1 664  ? 3.782   64.693 13.054  1.00 218.25 ? 661  SER A N   1 
ATOM 5147 C CA  . SER A 1 664  ? 5.003   65.464 13.367  1.00 218.25 ? 661  SER A CA  1 
ATOM 5148 C C   . SER A 1 664  ? 5.865   64.852 14.482  1.00 218.25 ? 661  SER A C   1 
ATOM 5149 O O   . SER A 1 664  ? 5.363   64.534 15.566  1.00 218.25 ? 661  SER A O   1 
ATOM 5150 C CB  . SER A 1 664  ? 4.659   66.909 13.732  1.00 112.91 ? 661  SER A CB  1 
ATOM 5151 O OG  . SER A 1 664  ? 4.283   67.635 12.581  1.00 112.91 ? 661  SER A OG  1 
ATOM 5152 N N   . SER A 1 665  ? 7.162   64.707 14.208  1.00 166.99 ? 662  SER A N   1 
ATOM 5153 C CA  . SER A 1 665  ? 8.123   64.150 15.165  1.00 166.99 ? 662  SER A CA  1 
ATOM 5154 C C   . SER A 1 665  ? 8.679   65.271 16.074  1.00 166.99 ? 662  SER A C   1 
ATOM 5155 O O   . SER A 1 665  ? 7.900   66.032 16.657  1.00 166.99 ? 662  SER A O   1 
ATOM 5156 C CB  . SER A 1 665  ? 9.220   63.377 14.407  1.00 86.40  ? 662  SER A CB  1 
ATOM 5157 O OG  . SER A 1 665  ? 10.016  62.564 15.252  1.00 86.40  ? 662  SER A OG  1 
ATOM 5158 N N   . ASN A 1 666  ? 10.005  65.370 16.199  1.00 199.17 ? 663  ASN A N   1 
ATOM 5159 C CA  . ASN A 1 666  ? 10.644  66.432 16.995  1.00 199.17 ? 663  ASN A CA  1 
ATOM 5160 C C   . ASN A 1 666  ? 10.337  67.834 16.453  1.00 199.17 ? 663  ASN A C   1 
ATOM 5161 O O   . ASN A 1 666  ? 9.961   68.737 17.200  1.00 199.17 ? 663  ASN A O   1 
ATOM 5162 C CB  . ASN A 1 666  ? 12.162  66.190 17.145  1.00 170.63 ? 663  ASN A CB  1 
ATOM 5163 C CG  . ASN A 1 666  ? 12.775  65.428 15.961  1.00 170.63 ? 663  ASN A CG  1 
ATOM 5164 O OD1 . ASN A 1 666  ? 12.831  65.933 14.838  1.00 170.63 ? 663  ASN A OD1 1 
ATOM 5165 N ND2 . ASN A 1 666  ? 13.258  64.215 16.225  1.00 170.63 ? 663  ASN A ND2 1 
ATOM 5166 N N   . HIS A 1 667  ? 10.516  67.978 15.143  1.00 98.02  ? 664  HIS A N   1 
ATOM 5167 C CA  . HIS A 1 667  ? 10.051  69.099 14.320  1.00 98.02  ? 664  HIS A CA  1 
ATOM 5168 C C   . HIS A 1 667  ? 9.921   68.479 12.929  1.00 98.02  ? 664  HIS A C   1 
ATOM 5169 O O   . HIS A 1 667  ? 9.745   69.170 11.924  1.00 98.02  ? 664  HIS A O   1 
ATOM 5170 C CB  . HIS A 1 667  ? 11.048  70.270 14.334  1.00 137.45 ? 664  HIS A CB  1 
ATOM 5171 C CG  . HIS A 1 667  ? 10.742  71.352 13.337  1.00 137.45 ? 664  HIS A CG  1 
ATOM 5172 N ND1 . HIS A 1 667  ? 11.435  71.490 12.150  1.00 137.45 ? 664  HIS A ND1 1 
ATOM 5173 C CD2 . HIS A 1 667  ? 9.817   72.345 13.350  1.00 137.45 ? 664  HIS A CD2 1 
ATOM 5174 C CE1 . HIS A 1 667  ? 10.953  72.520 11.476  1.00 137.45 ? 664  HIS A CE1 1 
ATOM 5175 N NE2 . HIS A 1 667  ? 9.968   73.054 12.181  1.00 137.45 ? 664  HIS A NE2 1 
ATOM 5176 N N   . LYS A 1 668  ? 10.015  67.148 12.913  1.00 218.25 ? 665  LYS A N   1 
ATOM 5177 C CA  . LYS A 1 668  ? 9.900   66.313 11.721  1.00 218.25 ? 665  LYS A CA  1 
ATOM 5178 C C   . LYS A 1 668  ? 8.439   65.982 11.385  1.00 218.25 ? 665  LYS A C   1 
ATOM 5179 O O   . LYS A 1 668  ? 7.554   66.820 11.563  1.00 218.25 ? 665  LYS A O   1 
ATOM 5180 C CB  . LYS A 1 668  ? 10.648  65.002 11.941  1.00 95.15  ? 665  LYS A CB  1 
ATOM 5181 C CG  . LYS A 1 668  ? 12.098  64.955 11.555  1.00 95.15  ? 665  LYS A CG  1 
ATOM 5182 C CD  . LYS A 1 668  ? 12.381  63.547 11.051  1.00 95.15  ? 665  LYS A CD  1 
ATOM 5183 C CE  . LYS A 1 668  ? 13.744  63.044 11.477  1.00 95.15  ? 665  LYS A CE  1 
ATOM 5184 N NZ  . LYS A 1 668  ? 13.819  61.558 11.322  1.00 95.15  ? 665  LYS A NZ  1 
ATOM 5185 N N   . LEU A 1 669  ? 8.199   64.754 10.912  1.00 97.28  ? 666  LEU A N   1 
ATOM 5186 C CA  . LEU A 1 669  ? 6.885   64.313 10.413  1.00 97.28  ? 666  LEU A CA  1 
ATOM 5187 C C   . LEU A 1 669  ? 6.724   62.819 10.621  1.00 97.28  ? 666  LEU A C   1 
ATOM 5188 O O   . LEU A 1 669  ? 7.499   62.052 10.057  1.00 97.28  ? 666  LEU A O   1 
ATOM 5189 C CB  . LEU A 1 669  ? 6.761   64.567 8.903   1.00 120.38 ? 666  LEU A CB  1 
ATOM 5190 C CG  . LEU A 1 669  ? 7.055   65.882 8.177   1.00 120.38 ? 666  LEU A CG  1 
ATOM 5191 C CD1 . LEU A 1 669  ? 7.603   65.571 6.789   1.00 120.38 ? 666  LEU A CD1 1 
ATOM 5192 C CD2 . LEU A 1 669  ? 5.817   66.749 8.080   1.00 120.38 ? 666  LEU A CD2 1 
ATOM 5193 N N   . VAL A 1 670  ? 5.721   62.394 11.389  1.00 150.19 ? 667  VAL A N   1 
ATOM 5194 C CA  . VAL A 1 670  ? 5.505   60.956 11.612  1.00 150.19 ? 667  VAL A CA  1 
ATOM 5195 C C   . VAL A 1 670  ? 4.981   60.308 10.336  1.00 150.19 ? 667  VAL A C   1 
ATOM 5196 O O   . VAL A 1 670  ? 4.360   60.969 9.504   1.00 150.19 ? 667  VAL A O   1 
ATOM 5197 C CB  . VAL A 1 670  ? 4.561   60.640 12.818  1.00 90.48  ? 667  VAL A CB  1 
ATOM 5198 C CG1 . VAL A 1 670  ? 4.653   59.170 13.221  1.00 90.48  ? 667  VAL A CG1 1 
ATOM 5199 C CG2 . VAL A 1 670  ? 4.909   61.489 14.008  1.00 90.48  ? 667  VAL A CG2 1 
ATOM 5200 N N   . PHE A 1 671  ? 5.261   59.017 10.193  1.00 156.38 ? 668  PHE A N   1 
ATOM 5201 C CA  . PHE A 1 671  ? 4.877   58.247 9.021   1.00 156.38 ? 668  PHE A CA  1 
ATOM 5202 C C   . PHE A 1 671  ? 4.205   56.932 9.399   1.00 156.38 ? 668  PHE A C   1 
ATOM 5203 O O   . PHE A 1 671  ? 4.687   55.847 9.051   1.00 156.38 ? 668  PHE A O   1 
ATOM 5204 C CB  . PHE A 1 671  ? 6.107   58.002 8.148   1.00 148.44 ? 668  PHE A CB  1 
ATOM 5205 C CG  . PHE A 1 671  ? 6.021   58.647 6.805   1.00 148.44 ? 668  PHE A CG  1 
ATOM 5206 C CD1 . PHE A 1 671  ? 5.335   59.852 6.637   1.00 148.44 ? 668  PHE A CD1 1 
ATOM 5207 C CD2 . PHE A 1 671  ? 6.620   58.053 5.702   1.00 148.44 ? 668  PHE A CD2 1 
ATOM 5208 C CE1 . PHE A 1 671  ? 5.244   60.450 5.391   1.00 148.44 ? 668  PHE A CE1 1 
ATOM 5209 C CE2 . PHE A 1 671  ? 6.538   58.648 4.449   1.00 148.44 ? 668  PHE A CE2 1 
ATOM 5210 C CZ  . PHE A 1 671  ? 5.847   59.849 4.293   1.00 148.44 ? 668  PHE A CZ  1 
ATOM 5211 N N   . SER A 1 672  ? 3.077   57.037 10.098  1.00 67.03  ? 669  SER A N   1 
ATOM 5212 C CA  . SER A 1 672  ? 2.463   55.866 10.718  1.00 67.03  ? 669  SER A CA  1 
ATOM 5213 C C   . SER A 1 672  ? 1.327   55.290 9.895   1.00 67.03  ? 669  SER A C   1 
ATOM 5214 O O   . SER A 1 672  ? 0.609   56.035 9.229   1.00 67.03  ? 669  SER A O   1 
ATOM 5215 C CB  . SER A 1 672  ? 1.951   56.203 12.120  1.00 199.47 ? 669  SER A CB  1 
ATOM 5216 O OG  . SER A 1 672  ? 3.023   56.433 13.014  1.00 199.47 ? 669  SER A OG  1 
ATOM 5217 N N   . ASN A 1 673  ? 1.192   53.962 9.947   1.00 54.59  ? 670  ASN A N   1 
ATOM 5218 C CA  . ASN A 1 673  ? 0.006   53.257 9.474   1.00 54.59  ? 670  ASN A CA  1 
ATOM 5219 C C   . ASN A 1 673  ? -1.332  53.736 10.077  1.00 54.59  ? 670  ASN A C   1 
ATOM 5220 O O   . ASN A 1 673  ? -1.431  54.082 11.277  1.00 54.59  ? 670  ASN A O   1 
ATOM 5221 C CB  . ASN A 1 673  ? 0.133   51.768 9.769   1.00 77.89  ? 670  ASN A CB  1 
ATOM 5222 C CG  . ASN A 1 673  ? 1.079   51.061 8.833   1.00 77.89  ? 670  ASN A CG  1 
ATOM 5223 O OD1 . ASN A 1 673  ? 0.937   51.119 7.607   1.00 77.89  ? 670  ASN A OD1 1 
ATOM 5224 N ND2 . ASN A 1 673  ? 2.047   50.353 9.411   1.00 77.89  ? 670  ASN A ND2 1 
ATOM 5225 N N   . VAL A 1 674  ? -2.351  53.729 9.215   1.00 64.58  ? 671  VAL A N   1 
ATOM 5226 C CA  . VAL A 1 674  ? -3.737  53.903 9.616   1.00 64.58  ? 671  VAL A CA  1 
ATOM 5227 C C   . VAL A 1 674  ? -4.446  52.574 9.429   1.00 64.58  ? 671  VAL A C   1 
ATOM 5228 O O   . VAL A 1 674  ? -4.304  51.927 8.400   1.00 64.58  ? 671  VAL A O   1 
ATOM 5229 C CB  . VAL A 1 674  ? -4.430  55.009 8.790   1.00 51.59  ? 671  VAL A CB  1 
ATOM 5230 C CG1 . VAL A 1 674  ? -5.816  55.328 9.337   1.00 51.59  ? 671  VAL A CG1 1 
ATOM 5231 C CG2 . VAL A 1 674  ? -3.608  56.260 8.821   1.00 51.59  ? 671  VAL A CG2 1 
ATOM 5232 N N   . ASN A 1 675  ? -5.207  52.174 10.438  1.00 74.00  ? 672  ASN A N   1 
ATOM 5233 C CA  . ASN A 1 675  ? -5.799  50.836 10.465  1.00 74.00  ? 672  ASN A CA  1 
ATOM 5234 C C   . ASN A 1 675  ? -7.069  50.679 9.613   1.00 74.00  ? 672  ASN A C   1 
ATOM 5235 O O   . ASN A 1 675  ? -8.178  50.484 10.148  1.00 74.00  ? 672  ASN A O   1 
ATOM 5236 C CB  . ASN A 1 675  ? -6.003  50.357 11.911  1.00 52.75  ? 672  ASN A CB  1 
ATOM 5237 C CG  . ASN A 1 675  ? -4.696  50.349 12.717  1.00 52.75  ? 672  ASN A CG  1 
ATOM 5238 O OD1 . ASN A 1 675  ? -3.625  50.073 12.179  1.00 52.75  ? 672  ASN A OD1 1 
ATOM 5239 N ND2 . ASN A 1 675  ? -4.787  50.656 14.016  1.00 52.75  ? 672  ASN A ND2 1 
ATOM 5240 N N   . LEU A 1 676  ? -6.878  50.772 8.289   1.00 70.69  ? 673  LEU A N   1 
ATOM 5241 C CA  . LEU A 1 676  ? -7.948  50.605 7.300   1.00 70.69  ? 673  LEU A CA  1 
ATOM 5242 C C   . LEU A 1 676  ? -7.495  49.812 6.104   1.00 70.69  ? 673  LEU A C   1 
ATOM 5243 O O   . LEU A 1 676  ? -6.306  49.731 5.798   1.00 70.69  ? 673  LEU A O   1 
ATOM 5244 C CB  . LEU A 1 676  ? -8.492  51.941 6.823   1.00 61.47  ? 673  LEU A CB  1 
ATOM 5245 C CG  . LEU A 1 676  ? -9.110  52.733 7.961   1.00 61.47  ? 673  LEU A CG  1 
ATOM 5246 C CD1 . LEU A 1 676  ? -9.147  54.221 7.687   1.00 61.47  ? 673  LEU A CD1 1 
ATOM 5247 C CD2 . LEU A 1 676  ? -10.489 52.182 8.252   1.00 61.47  ? 673  LEU A CD2 1 
ATOM 5248 N N   . LYS A 1 677  ? -8.483  49.252 5.425   1.00 95.48  ? 674  LYS A N   1 
ATOM 5249 C CA  . LYS A 1 677  ? -8.294  48.311 4.337   1.00 95.48  ? 674  LYS A CA  1 
ATOM 5250 C C   . LYS A 1 677  ? -7.766  49.024 3.073   1.00 95.48  ? 674  LYS A C   1 
ATOM 5251 O O   . LYS A 1 677  ? -6.795  48.569 2.466   1.00 95.48  ? 674  LYS A O   1 
ATOM 5252 C CB  . LYS A 1 677  ? -9.631  47.579 4.104   1.00 99.15  ? 674  LYS A CB  1 
ATOM 5253 C CG  . LYS A 1 677  ? -9.638  46.436 3.091   1.00 99.15  ? 674  LYS A CG  1 
ATOM 5254 C CD  . LYS A 1 677  ? -11.042 45.826 2.976   1.00 99.15  ? 674  LYS A CD  1 
ATOM 5255 C CE  . LYS A 1 677  ? -11.309 45.309 1.573   1.00 99.15  ? 674  LYS A CE  1 
ATOM 5256 N NZ  . LYS A 1 677  ? -12.349 44.246 1.577   1.00 99.15  ? 674  LYS A NZ  1 
ATOM 5257 N N   . GLU A 1 678  ? -8.408  50.132 2.688   1.00 79.64  ? 675  GLU A N   1 
ATOM 5258 C CA  . GLU A 1 678  ? -7.943  50.997 1.599   1.00 79.64  ? 675  GLU A CA  1 
ATOM 5259 C C   . GLU A 1 678  ? -8.704  52.308 1.636   1.00 79.64  ? 675  GLU A C   1 
ATOM 5260 O O   . GLU A 1 678  ? -9.879  52.333 1.936   1.00 79.64  ? 675  GLU A O   1 
ATOM 5261 C CB  . GLU A 1 678  ? -8.096  50.334 0.225   1.00 146.26 ? 675  GLU A CB  1 
ATOM 5262 C CG  . GLU A 1 678  ? -7.435  51.130 -0.908  1.00 146.26 ? 675  GLU A CG  1 
ATOM 5263 C CD  . GLU A 1 678  ? -7.085  50.296 -2.138  1.00 146.26 ? 675  GLU A CD  1 
ATOM 5264 O OE1 . GLU A 1 678  ? -7.627  49.175 -2.297  1.00 146.26 ? 675  GLU A OE1 1 
ATOM 5265 O OE2 . GLU A 1 678  ? -6.265  50.773 -2.959  1.00 146.26 ? 675  GLU A OE2 1 
ATOM 5266 N N   . VAL A 1 679  ? -8.025  53.403 1.343   1.00 81.27  ? 676  VAL A N   1 
ATOM 5267 C CA  . VAL A 1 679  ? -8.658  54.698 1.337   1.00 81.27  ? 676  VAL A CA  1 
ATOM 5268 C C   . VAL A 1 679  ? -8.270  55.352 0.026   1.00 81.27  ? 676  VAL A C   1 
ATOM 5269 O O   . VAL A 1 679  ? -7.114  55.271 -0.383  1.00 81.27  ? 676  VAL A O   1 
ATOM 5270 C CB  . VAL A 1 679  ? -8.202  55.523 2.549   1.00 67.40  ? 676  VAL A CB  1 
ATOM 5271 C CG1 . VAL A 1 679  ? -8.649  56.937 2.445   1.00 67.40  ? 676  VAL A CG1 1 
ATOM 5272 C CG2 . VAL A 1 679  ? -8.752  54.934 3.810   1.00 67.40  ? 676  VAL A CG2 1 
ATOM 5273 N N   . ASN A 1 680  ? -9.248  55.970 -0.637  1.00 83.00  ? 677  ASN A N   1 
ATOM 5274 C CA  . ASN A 1 680  ? -9.062  56.599 -1.943  1.00 83.00  ? 677  ASN A CA  1 
ATOM 5275 C C   . ASN A 1 680  ? -8.890  58.099 -1.858  1.00 83.00  ? 677  ASN A C   1 
ATOM 5276 O O   . ASN A 1 680  ? -7.892  58.660 -2.327  1.00 83.00  ? 677  ASN A O   1 
ATOM 5277 C CB  . ASN A 1 680  ? -10.240 56.278 -2.844  1.00 117.67 ? 677  ASN A CB  1 
ATOM 5278 C CG  . ASN A 1 680  ? -10.241 54.854 -3.292  1.00 117.67 ? 677  ASN A CG  1 
ATOM 5279 O OD1 . ASN A 1 680  ? -9.267  54.136 -3.096  1.00 117.67 ? 677  ASN A OD1 1 
ATOM 5280 N ND2 . ASN A 1 680  ? -11.331 54.427 -3.906  1.00 117.67 ? 677  ASN A ND2 1 
ATOM 5281 N N   . TYR A 1 681  ? -9.893  58.742 -1.272  1.00 66.55  ? 678  TYR A N   1 
ATOM 5282 C CA  . TYR A 1 681  ? -9.894  60.184 -1.055  1.00 66.55  ? 678  TYR A CA  1 
ATOM 5283 C C   . TYR A 1 681  ? -10.430 60.330 0.329   1.00 66.55  ? 678  TYR A C   1 
ATOM 5284 O O   . TYR A 1 681  ? -11.065 59.399 0.841   1.00 66.55  ? 678  TYR A O   1 
ATOM 5285 C CB  . TYR A 1 681  ? -10.811 60.904 -2.056  1.00 80.32  ? 678  TYR A CB  1 
ATOM 5286 C CG  . TYR A 1 681  ? -10.691 60.342 -3.438  1.00 80.32  ? 678  TYR A CG  1 
ATOM 5287 C CD1 . TYR A 1 681  ? -11.455 59.254 -3.820  1.00 80.32  ? 678  TYR A CD1 1 
ATOM 5288 C CD2 . TYR A 1 681  ? -9.772  60.859 -4.346  1.00 80.32  ? 678  TYR A CD2 1 
ATOM 5289 C CE1 . TYR A 1 681  ? -11.326 58.701 -5.070  1.00 80.32  ? 678  TYR A CE1 1 
ATOM 5290 C CE2 . TYR A 1 681  ? -9.635  60.315 -5.611  1.00 80.32  ? 678  TYR A CE2 1 
ATOM 5291 C CZ  . TYR A 1 681  ? -10.423 59.233 -5.965  1.00 80.32  ? 678  TYR A CZ  1 
ATOM 5292 O OH  . TYR A 1 681  ? -10.318 58.663 -7.212  1.00 80.32  ? 678  TYR A OH  1 
ATOM 5293 N N   . MET A 1 682  ? -10.188 61.493 0.921   1.00 86.44  ? 679  MET A N   1 
ATOM 5294 C CA  . MET A 1 682  ? -10.483 61.728 2.314   1.00 86.44  ? 679  MET A CA  1 
ATOM 5295 C C   . MET A 1 682  ? -10.483 63.230 2.603   1.00 86.44  ? 679  MET A C   1 
ATOM 5296 O O   . MET A 1 682  ? -9.675  63.954 2.025   1.00 86.44  ? 679  MET A O   1 
ATOM 5297 C CB  . MET A 1 682  ? -9.446  60.990 3.168   1.00 99.95  ? 679  MET A CB  1 
ATOM 5298 C CG  . MET A 1 682  ? -9.207  61.573 4.529   1.00 99.95  ? 679  MET A CG  1 
ATOM 5299 S SD  . MET A 1 682  ? -8.305  63.105 4.351   1.00 99.95  ? 679  MET A SD  1 
ATOM 5300 C CE  . MET A 1 682  ? -8.850  64.007 5.794   1.00 99.95  ? 679  MET A CE  1 
ATOM 5301 N N   . CYS A 1 683  ? -11.373 63.689 3.496   1.00 141.04 ? 680  CYS A N   1 
ATOM 5302 C CA  . CYS A 1 683  ? -11.416 65.100 3.947   1.00 141.04 ? 680  CYS A CA  1 
ATOM 5303 C C   . CYS A 1 683  ? -12.006 65.285 5.350   1.00 141.04 ? 680  CYS A C   1 
ATOM 5304 O O   . CYS A 1 683  ? -12.770 64.436 5.805   1.00 141.04 ? 680  CYS A O   1 
ATOM 5305 C CB  . CYS A 1 683  ? -12.197 65.961 2.962   1.00 114.78 ? 680  CYS A CB  1 
ATOM 5306 S SG  . CYS A 1 683  ? -13.899 65.459 2.728   1.00 114.78 ? 680  CYS A SG  1 
ATOM 5307 N N   . PRO A 1 684  ? -11.648 66.396 6.038   1.00 125.01 ? 681  PRO A N   1 
ATOM 5308 C CA  . PRO A 1 684  ? -12.183 66.752 7.368   1.00 125.01 ? 681  PRO A CA  1 
ATOM 5309 C C   . PRO A 1 684  ? -13.674 67.056 7.332   1.00 125.01 ? 681  PRO A C   1 
ATOM 5310 O O   . PRO A 1 684  ? -14.240 67.199 6.247   1.00 125.01 ? 681  PRO A O   1 
ATOM 5311 C CB  . PRO A 1 684  ? -11.419 68.028 7.744   1.00 94.21  ? 681  PRO A CB  1 
ATOM 5312 C CG  . PRO A 1 684  ? -10.279 68.087 6.843   1.00 94.21  ? 681  PRO A CG  1 
ATOM 5313 C CD  . PRO A 1 684  ? -10.664 67.387 5.577   1.00 94.21  ? 681  PRO A CD  1 
ATOM 5314 N N   . LEU A 1 685  ? -14.293 67.171 8.511   1.00 217.58 ? 682  LEU A N   1 
ATOM 5315 C CA  . LEU A 1 685  ? -15.750 67.349 8.629   1.00 217.58 ? 682  LEU A CA  1 
ATOM 5316 C C   . LEU A 1 685  ? -16.179 67.830 10.028  1.00 217.58 ? 682  LEU A C   1 
ATOM 5317 O O   . LEU A 1 685  ? -15.374 67.790 10.965  1.00 217.58 ? 682  LEU A O   1 
ATOM 5318 C CB  . LEU A 1 685  ? -16.452 66.036 8.279   1.00 91.11  ? 682  LEU A CB  1 
ATOM 5319 C CG  . LEU A 1 685  ? -17.855 66.085 7.680   1.00 91.11  ? 682  LEU A CG  1 
ATOM 5320 C CD1 . LEU A 1 685  ? -17.807 66.477 6.212   1.00 91.11  ? 682  LEU A CD1 1 
ATOM 5321 C CD2 . LEU A 1 685  ? -18.542 64.734 7.846   1.00 91.11  ? 682  LEU A CD2 1 
ATOM 5322 N N   . ASN A 1 686  ? -17.440 68.271 10.168  1.00 164.88 ? 683  ASN A N   1 
ATOM 5323 C CA  . ASN A 1 686  ? -17.928 68.892 11.420  1.00 164.88 ? 683  ASN A CA  1 
ATOM 5324 C C   . ASN A 1 686  ? -19.448 68.892 11.717  1.00 164.88 ? 683  ASN A C   1 
ATOM 5325 O O   . ASN A 1 686  ? -19.854 69.318 12.806  1.00 164.88 ? 683  ASN A O   1 
ATOM 5326 C CB  . ASN A 1 686  ? -17.413 70.336 11.512  1.00 121.95 ? 683  ASN A CB  1 
ATOM 5327 C CG  . ASN A 1 686  ? -17.344 70.850 12.940  1.00 121.95 ? 683  ASN A CG  1 
ATOM 5328 O OD1 . ASN A 1 686  ? -17.436 70.084 13.903  1.00 121.95 ? 683  ASN A OD1 1 
ATOM 5329 N ND2 . ASN A 1 686  ? -17.172 72.160 13.082  1.00 121.95 ? 683  ASN A ND2 1 
ATOM 5330 N N   . SER A 1 687  ? -20.272 68.409 10.782  1.00 168.39 ? 684  SER A N   1 
ATOM 5331 C CA  . SER A 1 687  ? -21.751 68.527 10.869  1.00 168.39 ? 684  SER A CA  1 
ATOM 5332 C C   . SER A 1 687  ? -22.367 68.251 12.252  1.00 168.39 ? 684  SER A C   1 
ATOM 5333 O O   . SER A 1 687  ? -21.833 67.470 13.045  1.00 168.39 ? 684  SER A O   1 
ATOM 5334 C CB  . SER A 1 687  ? -22.444 67.650 9.807   1.00 135.73 ? 684  SER A CB  1 
ATOM 5335 O OG  . SER A 1 687  ? -23.778 68.088 9.543   1.00 135.73 ? 684  SER A OG  1 
ATOM 5336 N N   . ASP A 1 688  ? -23.490 68.910 12.535  1.00 184.77 ? 685  ASP A N   1 
ATOM 5337 C CA  . ASP A 1 688  ? -24.264 68.607 13.731  1.00 184.77 ? 685  ASP A CA  1 
ATOM 5338 C C   . ASP A 1 688  ? -24.946 67.249 13.540  1.00 184.77 ? 685  ASP A C   1 
ATOM 5339 O O   . ASP A 1 688  ? -26.059 67.145 13.023  1.00 184.77 ? 685  ASP A O   1 
ATOM 5340 C CB  . ASP A 1 688  ? -25.241 69.747 14.091  1.00 99.60  ? 685  ASP A CB  1 
ATOM 5341 C CG  . ASP A 1 688  ? -26.125 70.192 12.916  1.00 99.60  ? 685  ASP A CG  1 
ATOM 5342 O OD1 . ASP A 1 688  ? -26.071 69.590 11.817  1.00 99.60  ? 685  ASP A OD1 1 
ATOM 5343 O OD2 . ASP A 1 688  ? -26.896 71.160 13.109  1.00 99.60  ? 685  ASP A OD2 1 
ATOM 5344 N N   . GLY A 1 689  ? -24.227 66.207 13.943  1.00 90.46  ? 686  GLY A N   1 
ATOM 5345 C CA  . GLY A 1 689  ? -24.594 64.812 13.670  1.00 90.46  ? 686  GLY A CA  1 
ATOM 5346 C C   . GLY A 1 689  ? -23.394 63.922 13.325  1.00 90.46  ? 686  GLY A C   1 
ATOM 5347 O O   . GLY A 1 689  ? -23.469 62.695 13.433  1.00 90.46  ? 686  GLY A O   1 
ATOM 5348 N N   . TYR A 1 690  ? -22.298 64.565 12.895  1.00 82.99  ? 687  TYR A N   1 
ATOM 5349 C CA  . TYR A 1 690  ? -21.003 63.947 12.577  1.00 82.99  ? 687  TYR A CA  1 
ATOM 5350 C C   . TYR A 1 690  ? -19.826 64.949 12.756  1.00 82.99  ? 687  TYR A C   1 
ATOM 5351 O O   . TYR A 1 690  ? -19.163 65.290 11.768  1.00 82.99  ? 687  TYR A O   1 
ATOM 5352 C CB  . TYR A 1 690  ? -21.010 63.439 11.133  1.00 104.53 ? 687  TYR A CB  1 
ATOM 5353 C CG  . TYR A 1 690  ? -21.808 62.188 10.899  1.00 104.53 ? 687  TYR A CG  1 
ATOM 5354 C CD1 . TYR A 1 690  ? -21.456 60.987 11.513  1.00 104.53 ? 687  TYR A CD1 1 
ATOM 5355 C CD2 . TYR A 1 690  ? -22.900 62.192 10.039  1.00 104.53 ? 687  TYR A CD2 1 
ATOM 5356 C CE1 . TYR A 1 690  ? -22.187 59.823 11.292  1.00 104.53 ? 687  TYR A CE1 1 
ATOM 5357 C CE2 . TYR A 1 690  ? -23.639 61.032 9.802   1.00 104.53 ? 687  TYR A CE2 1 
ATOM 5358 C CZ  . TYR A 1 690  ? -23.277 59.848 10.434  1.00 104.53 ? 687  TYR A CZ  1 
ATOM 5359 O OH  . TYR A 1 690  ? -24.000 58.692 10.207  1.00 104.53 ? 687  TYR A OH  1 
ATOM 5360 N N   . PRO A 1 691  ? -19.557 65.416 14.005  1.00 124.94 ? 688  PRO A N   1 
ATOM 5361 C CA  . PRO A 1 691  ? -18.556 66.471 14.234  1.00 124.94 ? 688  PRO A CA  1 
ATOM 5362 C C   . PRO A 1 691  ? -17.122 65.949 14.385  1.00 124.94 ? 688  PRO A C   1 
ATOM 5363 O O   . PRO A 1 691  ? -16.926 64.737 14.504  1.00 124.94 ? 688  PRO A O   1 
ATOM 5364 C CB  . PRO A 1 691  ? -19.033 67.141 15.533  1.00 99.58  ? 688  PRO A CB  1 
ATOM 5365 C CG  . PRO A 1 691  ? -20.113 66.258 16.087  1.00 99.58  ? 688  PRO A CG  1 
ATOM 5366 C CD  . PRO A 1 691  ? -20.161 64.996 15.279  1.00 99.58  ? 688  PRO A CD  1 
ATOM 5367 N N   . ASP A 1 692  ? -16.147 66.869 14.388  1.00 114.44 ? 689  ASP A N   1 
ATOM 5368 C CA  . ASP A 1 692  ? -14.691 66.566 14.276  1.00 114.44 ? 689  ASP A CA  1 
ATOM 5369 C C   . ASP A 1 692  ? -14.361 65.257 13.525  1.00 114.44 ? 689  ASP A C   1 
ATOM 5370 O O   . ASP A 1 692  ? -13.375 64.561 13.808  1.00 114.44 ? 689  ASP A O   1 
ATOM 5371 C CB  . ASP A 1 692  ? -13.966 66.654 15.637  1.00 112.14 ? 689  ASP A CB  1 
ATOM 5372 C CG  . ASP A 1 692  ? -12.481 67.056 15.494  1.00 112.14 ? 689  ASP A CG  1 
ATOM 5373 O OD1 . ASP A 1 692  ? -12.141 68.214 15.847  1.00 112.14 ? 689  ASP A OD1 1 
ATOM 5374 O OD2 . ASP A 1 692  ? -11.662 66.227 15.020  1.00 112.14 ? 689  ASP A OD2 1 
ATOM 5375 N N   . SER A 1 693  ? -15.200 64.954 12.546  1.00 207.40 ? 690  SER A N   1 
ATOM 5376 C CA  . SER A 1 693  ? -15.090 63.728 11.793  1.00 207.40 ? 690  SER A CA  1 
ATOM 5377 C C   . SER A 1 693  ? -14.179 63.926 10.585  1.00 207.40 ? 690  SER A C   1 
ATOM 5378 O O   . SER A 1 693  ? -13.807 65.055 10.246  1.00 207.40 ? 690  SER A O   1 
ATOM 5379 C CB  . SER A 1 693  ? -16.485 63.266 11.362  1.00 101.24 ? 690  SER A CB  1 
ATOM 5380 O OG  . SER A 1 693  ? -16.413 62.083 10.579  1.00 101.24 ? 690  SER A OG  1 
ATOM 5381 N N   . LEU A 1 694  ? -13.804 62.808 9.967   1.00 68.80  ? 691  LEU A N   1 
ATOM 5382 C CA  . LEU A 1 694  ? -13.080 62.798 8.710   1.00 68.80  ? 691  LEU A CA  1 
ATOM 5383 C C   . LEU A 1 694  ? -13.883 61.912 7.764   1.00 68.80  ? 691  LEU A C   1 
ATOM 5384 O O   . LEU A 1 694  ? -14.550 60.966 8.204   1.00 68.80  ? 691  LEU A O   1 
ATOM 5385 C CB  . LEU A 1 694  ? -11.654 62.263 8.899   1.00 70.32  ? 691  LEU A CB  1 
ATOM 5386 C CG  . LEU A 1 694  ? -10.716 62.807 10.000  1.00 70.32  ? 691  LEU A CG  1 
ATOM 5387 C CD1 . LEU A 1 694  ? -9.297  62.280 9.773   1.00 70.32  ? 691  LEU A CD1 1 
ATOM 5388 C CD2 . LEU A 1 694  ? -10.691 64.349 10.155  1.00 70.32  ? 691  LEU A CD2 1 
ATOM 5389 N N   . ALA A 1 695  ? -13.858 62.245 6.479   1.00 104.68 ? 692  ALA A N   1 
ATOM 5390 C CA  . ALA A 1 695  ? -14.584 61.469 5.487   1.00 104.68 ? 692  ALA A CA  1 
ATOM 5391 C C   . ALA A 1 695  ? -13.569 60.759 4.634   1.00 104.68 ? 692  ALA A C   1 
ATOM 5392 O O   . ALA A 1 695  ? -12.493 61.287 4.403   1.00 104.68 ? 692  ALA A O   1 
ATOM 5393 C CB  . ALA A 1 695  ? -15.454 62.361 4.643   1.00 130.45 ? 692  ALA A CB  1 
ATOM 5394 N N   . LEU A 1 696  ? -13.907 59.558 4.179   1.00 83.62  ? 693  LEU A N   1 
ATOM 5395 C CA  . LEU A 1 696  ? -12.941 58.690 3.537   1.00 83.62  ? 693  LEU A CA  1 
ATOM 5396 C C   . LEU A 1 696  ? -13.647 57.628 2.728   1.00 83.62  ? 693  LEU A C   1 
ATOM 5397 O O   . LEU A 1 696  ? -14.406 56.826 3.271   1.00 83.62  ? 693  LEU A O   1 
ATOM 5398 C CB  . LEU A 1 696  ? -12.089 57.961 4.575   1.00 74.68  ? 693  LEU A CB  1 
ATOM 5399 C CG  . LEU A 1 696  ? -11.197 58.587 5.643   1.00 74.68  ? 693  LEU A CG  1 
ATOM 5400 C CD1 . LEU A 1 696  ? -11.977 59.112 6.839   1.00 74.68  ? 693  LEU A CD1 1 
ATOM 5401 C CD2 . LEU A 1 696  ? -10.279 57.490 6.117   1.00 74.68  ? 693  LEU A CD2 1 
ATOM 5402 N N   . ALA A 1 697  ? -13.362 57.585 1.435   1.00 77.65  ? 694  ALA A N   1 
ATOM 5403 C CA  . ALA A 1 697  ? -14.037 56.635 0.559   1.00 77.65  ? 694  ALA A CA  1 
ATOM 5404 C C   . ALA A 1 697  ? -13.093 55.561 0.064   1.00 77.65  ? 694  ALA A C   1 
ATOM 5405 O O   . ALA A 1 697  ? -11.875 55.719 0.147   1.00 77.65  ? 694  ALA A O   1 
ATOM 5406 C CB  . ALA A 1 697  ? -14.671 57.361 -0.617  1.00 170.87 ? 694  ALA A CB  1 
ATOM 5407 N N   . ASN A 1 698  ? -13.660 54.474 -0.448  1.00 107.90 ? 695  ASN A N   1 
ATOM 5408 C CA  . ASN A 1 698  ? -12.886 53.427 -1.097  1.00 107.90 ? 695  ASN A CA  1 
ATOM 5409 C C   . ASN A 1 698  ? -13.623 52.919 -2.331  1.00 107.90 ? 695  ASN A C   1 
ATOM 5410 O O   . ASN A 1 698  ? -14.629 53.515 -2.749  1.00 107.90 ? 695  ASN A O   1 
ATOM 5411 C CB  . ASN A 1 698  ? -12.616 52.280 -0.128  1.00 143.28 ? 695  ASN A CB  1 
ATOM 5412 C CG  . ASN A 1 698  ? -13.861 51.501 0.202   1.00 143.28 ? 695  ASN A CG  1 
ATOM 5413 O OD1 . ASN A 1 698  ? -14.763 52.001 0.870   1.00 143.28 ? 695  ASN A OD1 1 
ATOM 5414 N ND2 . ASN A 1 698  ? -13.920 50.266 -0.271  1.00 143.28 ? 695  ASN A ND2 1 
ATOM 5415 N N   . ASN A 1 699  ? -13.111 51.825 -2.903  1.00 112.80 ? 696  ASN A N   1 
ATOM 5416 C CA  . ASN A 1 699  ? -13.729 51.134 -4.039  1.00 112.80 ? 696  ASN A CA  1 
ATOM 5417 C C   . ASN A 1 699  ? -15.259 51.204 -3.997  1.00 112.80 ? 696  ASN A C   1 
ATOM 5418 O O   . ASN A 1 699  ? -15.901 51.339 -5.039  1.00 112.80 ? 696  ASN A O   1 
ATOM 5419 C CB  . ASN A 1 699  ? -13.254 49.674 -4.091  1.00 182.97 ? 696  ASN A CB  1 
ATOM 5420 C CG  . ASN A 1 699  ? -13.282 49.090 -5.497  1.00 182.97 ? 696  ASN A CG  1 
ATOM 5421 O OD1 . ASN A 1 699  ? -14.360 49.009 -6.133  1.00 182.97 ? 696  ASN A OD1 1 
ATOM 5422 N ND2 . ASN A 1 699  ? -12.091 48.662 -5.980  1.00 182.97 ? 696  ASN A ND2 1 
ATOM 5423 N N   . SER A 1 700  ? -15.822 51.120 -2.787  1.00 100.95 ? 697  SER A N   1 
ATOM 5424 C CA  . SER A 1 700  ? -17.253 51.336 -2.531  1.00 100.95 ? 697  SER A CA  1 
ATOM 5425 C C   . SER A 1 700  ? -17.542 51.444 -1.034  1.00 100.95 ? 697  SER A C   1 
ATOM 5426 O O   . SER A 1 700  ? -17.465 50.447 -0.319  1.00 100.95 ? 697  SER A O   1 
ATOM 5427 C CB  . SER A 1 700  ? -18.087 50.199 -3.119  1.00 148.61 ? 697  SER A CB  1 
ATOM 5428 O OG  . SER A 1 700  ? -17.679 48.954 -2.585  1.00 148.61 ? 697  SER A OG  1 
ATOM 5429 N N   . THR A 1 701  ? -17.882 52.647 -0.577  1.00 100.60 ? 698  THR A N   1 
ATOM 5430 C CA  . THR A 1 701  ? -18.271 52.922 0.811   1.00 100.60 ? 698  THR A CA  1 
ATOM 5431 C C   . THR A 1 701  ? -17.762 54.291 1.212   1.00 100.60 ? 698  THR A C   1 
ATOM 5432 O O   . THR A 1 701  ? -16.595 54.606 0.994   1.00 100.60 ? 698  THR A O   1 
ATOM 5433 C CB  . THR A 1 701  ? -17.759 51.857 1.832   1.00 158.00 ? 698  THR A CB  1 
ATOM 5434 O OG1 . THR A 1 701  ? -18.593 50.698 1.773   1.00 158.00 ? 698  THR A OG1 1 
ATOM 5435 C CG2 . THR A 1 701  ? -17.780 52.389 3.259   1.00 158.00 ? 698  THR A CG2 1 
ATOM 5436 N N   . LEU A 1 702  ? -18.640 55.107 1.785   1.00 100.85 ? 699  LEU A N   1 
ATOM 5437 C CA  . LEU A 1 702  ? -18.212 56.332 2.440   1.00 100.85 ? 699  LEU A CA  1 
ATOM 5438 C C   . LEU A 1 702  ? -18.226 56.135 3.955   1.00 100.85 ? 699  LEU A C   1 
ATOM 5439 O O   . LEU A 1 702  ? -19.181 55.587 4.509   1.00 100.85 ? 699  LEU A O   1 
ATOM 5440 C CB  . LEU A 1 702  ? -19.099 57.510 2.039   1.00 68.54  ? 699  LEU A CB  1 
ATOM 5441 C CG  . LEU A 1 702  ? -18.935 58.807 2.848   1.00 68.54  ? 699  LEU A CG  1 
ATOM 5442 C CD1 . LEU A 1 702  ? -17.684 59.602 2.472   1.00 68.54  ? 699  LEU A CD1 1 
ATOM 5443 C CD2 . LEU A 1 702  ? -20.152 59.664 2.669   1.00 68.54  ? 699  LEU A CD2 1 
ATOM 5444 N N   . THR A 1 703  ? -17.158 56.580 4.611   1.00 116.58 ? 700  THR A N   1 
ATOM 5445 C CA  . THR A 1 703  ? -17.037 56.477 6.059   1.00 116.58 ? 700  THR A CA  1 
ATOM 5446 C C   . THR A 1 703  ? -16.589 57.793 6.697   1.00 116.58 ? 700  THR A C   1 
ATOM 5447 O O   . THR A 1 703  ? -16.063 58.677 6.028   1.00 116.58 ? 700  THR A O   1 
ATOM 5448 C CB  . THR A 1 703  ? -16.120 55.293 6.495   1.00 105.68 ? 700  THR A CB  1 
ATOM 5449 O OG1 . THR A 1 703  ? -15.027 55.156 5.582   1.00 105.68 ? 700  THR A OG1 1 
ATOM 5450 C CG2 . THR A 1 703  ? -16.887 53.997 6.498   1.00 105.68 ? 700  THR A CG2 1 
ATOM 5451 N N   . ILE A 1 704  ? -16.812 57.900 8.003   1.00 95.58  ? 701  ILE A N   1 
ATOM 5452 C CA  . ILE A 1 704  ? -16.667 59.141 8.762   1.00 95.58  ? 701  ILE A CA  1 
ATOM 5453 C C   . ILE A 1 704  ? -16.330 58.829 10.221  1.00 95.58  ? 701  ILE A C   1 
ATOM 5454 O O   . ILE A 1 704  ? -16.873 57.884 10.789  1.00 95.58  ? 701  ILE A O   1 
ATOM 5455 C CB  . ILE A 1 704  ? -17.988 59.957 8.747   1.00 108.43 ? 701  ILE A CB  1 
ATOM 5456 C CG1 . ILE A 1 704  ? -19.200 59.105 9.194   1.00 108.43 ? 701  ILE A CG1 1 
ATOM 5457 C CG2 . ILE A 1 704  ? -18.218 60.617 7.400   1.00 108.43 ? 701  ILE A CG2 1 
ATOM 5458 C CD1 . ILE A 1 704  ? -19.374 57.758 8.502   1.00 108.43 ? 701  ILE A CD1 1 
ATOM 5459 N N   . GLY A 1 705  ? -15.461 59.620 10.840  1.00 64.12  ? 702  GLY A N   1 
ATOM 5460 C CA  . GLY A 1 705  ? -15.115 59.383 12.241  1.00 64.12  ? 702  GLY A CA  1 
ATOM 5461 C C   . GLY A 1 705  ? -13.845 60.073 12.712  1.00 64.12  ? 702  GLY A C   1 
ATOM 5462 O O   . GLY A 1 705  ? -13.177 60.761 11.928  1.00 64.12  ? 702  GLY A O   1 
ATOM 5463 N N   . THR A 1 706  ? -13.487 59.902 13.981  1.00 78.22  ? 703  THR A N   1 
ATOM 5464 C CA  . THR A 1 706  ? -12.306 60.605 14.496  1.00 78.22  ? 703  THR A CA  1 
ATOM 5465 C C   . THR A 1 706  ? -11.046 59.725 14.493  1.00 78.22  ? 703  THR A C   1 
ATOM 5466 O O   . THR A 1 706  ? -11.071 58.584 14.029  1.00 78.22  ? 703  THR A O   1 
ATOM 5467 C CB  . THR A 1 706  ? -12.545 61.245 15.894  1.00 120.39 ? 703  THR A CB  1 
ATOM 5468 O OG1 . THR A 1 706  ? -12.339 60.268 16.925  1.00 120.39 ? 703  THR A OG1 1 
ATOM 5469 C CG2 . THR A 1 706  ? -13.959 61.830 15.995  1.00 120.39 ? 703  THR A CG2 1 
ATOM 5470 N N   . ILE A 1 707  ? -9.959  60.265 15.031  1.00 86.50  ? 704  ILE A N   1 
ATOM 5471 C CA  . ILE A 1 707  ? -8.645  59.671 14.897  1.00 86.50  ? 704  ILE A CA  1 
ATOM 5472 C C   . ILE A 1 707  ? -7.939  59.589 16.238  1.00 86.50  ? 704  ILE A C   1 
ATOM 5473 O O   . ILE A 1 707  ? -7.974  60.535 17.019  1.00 86.50  ? 704  ILE A O   1 
ATOM 5474 C CB  . ILE A 1 707  ? -7.787  60.508 13.908  1.00 91.03  ? 704  ILE A CB  1 
ATOM 5475 C CG1 . ILE A 1 707  ? -8.422  60.504 12.514  1.00 91.03  ? 704  ILE A CG1 1 
ATOM 5476 C CG2 . ILE A 1 707  ? -6.315  60.030 13.844  1.00 91.03  ? 704  ILE A CG2 1 
ATOM 5477 C CD1 . ILE A 1 707  ? -8.611  59.118 11.892  1.00 91.03  ? 704  ILE A CD1 1 
ATOM 5478 N N   . ASP A 1 708  ? -7.272  58.458 16.473  1.00 63.74  ? 705  ASP A N   1 
ATOM 5479 C CA  . ASP A 1 708  ? -6.520  58.176 17.710  1.00 63.74  ? 705  ASP A CA  1 
ATOM 5480 C C   . ASP A 1 708  ? -5.244  59.004 17.857  1.00 63.74  ? 705  ASP A C   1 
ATOM 5481 O O   . ASP A 1 708  ? -5.056  60.007 17.175  1.00 63.74  ? 705  ASP A O   1 
ATOM 5482 C CB  . ASP A 1 708  ? -6.135  56.684 17.769  1.00 128.12 ? 705  ASP A CB  1 
ATOM 5483 C CG  . ASP A 1 708  ? -7.287  55.744 17.414  1.00 128.12 ? 705  ASP A CG  1 
ATOM 5484 O OD1 . ASP A 1 708  ? -8.474  56.133 17.513  1.00 128.12 ? 705  ASP A OD1 1 
ATOM 5485 O OD2 . ASP A 1 708  ? -6.990  54.591 17.037  1.00 128.12 ? 705  ASP A OD2 1 
ATOM 5486 N N   . GLU A 1 709  ? -4.364  58.544 18.742  1.00 132.41 ? 706  GLU A N   1 
ATOM 5487 C CA  . GLU A 1 709  ? -3.082  59.185 19.038  1.00 132.41 ? 706  GLU A CA  1 
ATOM 5488 C C   . GLU A 1 709  ? -2.254  59.507 17.787  1.00 132.41 ? 706  GLU A C   1 
ATOM 5489 O O   . GLU A 1 709  ? -2.769  60.039 16.799  1.00 132.41 ? 706  GLU A O   1 
ATOM 5490 C CB  . GLU A 1 709  ? -2.272  58.297 19.996  1.00 152.16 ? 706  GLU A CB  1 
ATOM 5491 C CG  . GLU A 1 709  ? -1.206  59.028 20.812  1.00 152.16 ? 706  GLU A CG  1 
ATOM 5492 C CD  . GLU A 1 709  ? -1.715  59.521 22.156  1.00 152.16 ? 706  GLU A CD  1 
ATOM 5493 O OE1 . GLU A 1 709  ? -1.150  59.101 23.191  1.00 152.16 ? 706  GLU A OE1 1 
ATOM 5494 O OE2 . GLU A 1 709  ? -2.677  60.325 22.181  1.00 152.16 ? 706  GLU A OE2 1 
ATOM 5495 N N   . ILE A 1 710  ? -0.965  59.190 17.842  1.00 62.79  ? 707  ILE A N   1 
ATOM 5496 C CA  . ILE A 1 710  ? -0.039  59.562 16.787  1.00 62.79  ? 707  ILE A CA  1 
ATOM 5497 C C   . ILE A 1 710  ? 0.809   58.333 16.487  1.00 62.79  ? 707  ILE A C   1 
ATOM 5498 O O   . ILE A 1 710  ? 0.426   57.488 15.671  1.00 62.79  ? 707  ILE A O   1 
ATOM 5499 C CB  . ILE A 1 710  ? 0.830   60.801 17.211  1.00 99.03  ? 707  ILE A CB  1 
ATOM 5500 C CG1 . ILE A 1 710  ? -0.065  61.994 17.611  1.00 99.03  ? 707  ILE A CG1 1 
ATOM 5501 C CG2 . ILE A 1 710  ? 1.849   61.187 16.112  1.00 99.03  ? 707  ILE A CG2 1 
ATOM 5502 C CD1 . ILE A 1 710  ? 0.532   62.914 18.672  1.00 99.03  ? 707  ILE A CD1 1 
ATOM 5503 N N   . GLN A 1 711  ? 1.947   58.260 17.170  1.00 60.77  ? 708  GLN A N   1 
ATOM 5504 C CA  . GLN A 1 711  ? 2.913   57.149 17.179  1.00 60.77  ? 708  GLN A CA  1 
ATOM 5505 C C   . GLN A 1 711  ? 2.535   55.871 16.446  1.00 60.77  ? 708  GLN A C   1 
ATOM 5506 O O   . GLN A 1 711  ? 1.378   55.486 16.403  1.00 60.77  ? 708  GLN A O   1 
ATOM 5507 C CB  . GLN A 1 711  ? 3.272   56.835 18.640  1.00 157.52 ? 708  GLN A CB  1 
ATOM 5508 C CG  . GLN A 1 711  ? 2.457   57.666 19.646  1.00 157.52 ? 708  GLN A CG  1 
ATOM 5509 C CD  . GLN A 1 711  ? 1.698   56.814 20.644  1.00 157.52 ? 708  GLN A CD  1 
ATOM 5510 O OE1 . GLN A 1 711  ? 0.486   56.594 20.499  1.00 157.52 ? 708  GLN A OE1 1 
ATOM 5511 N NE2 . GLN A 1 711  ? 2.409   56.306 21.653  1.00 157.52 ? 708  GLN A NE2 1 
ATOM 5512 N N   . LYS A 1 712  ? 3.537   55.206 15.879  1.00 83.01  ? 709  LYS A N   1 
ATOM 5513 C CA  . LYS A 1 712  ? 3.348   53.876 15.292  1.00 83.01  ? 709  LYS A CA  1 
ATOM 5514 C C   . LYS A 1 712  ? 2.667   52.939 16.299  1.00 83.01  ? 709  LYS A C   1 
ATOM 5515 O O   . LYS A 1 712  ? 2.013   51.966 15.906  1.00 83.01  ? 709  LYS A O   1 
ATOM 5516 C CB  . LYS A 1 712  ? 4.685   53.281 14.838  1.00 136.07 ? 709  LYS A CB  1 
ATOM 5517 C CG  . LYS A 1 712  ? 4.529   52.054 13.950  1.00 136.07 ? 709  LYS A CG  1 
ATOM 5518 C CD  . LYS A 1 712  ? 5.705   51.103 14.083  1.00 136.07 ? 709  LYS A CD  1 
ATOM 5519 C CE  . LYS A 1 712  ? 5.295   49.675 13.750  1.00 136.07 ? 709  LYS A CE  1 
ATOM 5520 N NZ  . LYS A 1 712  ? 4.717   49.516 12.381  1.00 136.07 ? 709  LYS A NZ  1 
ATOM 5521 N N   . LEU A 1 713  ? 2.829   53.248 17.593  1.00 65.14  ? 710  LEU A N   1 
ATOM 5522 C CA  . LEU A 1 713  ? 2.152   52.527 18.674  1.00 65.14  ? 710  LEU A CA  1 
ATOM 5523 C C   . LEU A 1 713  ? 1.233   53.413 19.488  1.00 65.14  ? 710  LEU A C   1 
ATOM 5524 O O   . LEU A 1 713  ? 1.634   54.476 19.935  1.00 65.14  ? 710  LEU A O   1 
ATOM 5525 C CB  . LEU A 1 713  ? 3.172   51.865 19.594  1.00 64.01  ? 710  LEU A CB  1 
ATOM 5526 C CG  . LEU A 1 713  ? 3.933   50.761 18.862  1.00 64.01  ? 710  LEU A CG  1 
ATOM 5527 C CD1 . LEU A 1 713  ? 5.123   50.238 19.670  1.00 64.01  ? 710  LEU A CD1 1 
ATOM 5528 C CD2 . LEU A 1 713  ? 2.976   49.639 18.482  1.00 64.01  ? 710  LEU A CD2 1 
ATOM 5529 N N   . HIS A 1 714  ? -0.004  52.966 19.663  1.00 81.37  ? 711  HIS A N   1 
ATOM 5530 C CA  . HIS A 1 714  ? -0.849  53.510 20.703  1.00 81.37  ? 711  HIS A CA  1 
ATOM 5531 C C   . HIS A 1 714  ? -0.820  52.606 21.946  1.00 81.37  ? 711  HIS A C   1 
ATOM 5532 O O   . HIS A 1 714  ? -0.827  51.371 21.840  1.00 81.37  ? 711  HIS A O   1 
ATOM 5533 C CB  . HIS A 1 714  ? -2.273  53.685 20.213  1.00 96.24  ? 711  HIS A CB  1 
ATOM 5534 C CG  . HIS A 1 714  ? -3.261  53.763 21.326  1.00 96.24  ? 711  HIS A CG  1 
ATOM 5535 N ND1 . HIS A 1 714  ? -3.483  54.920 22.039  1.00 96.24  ? 711  HIS A ND1 1 
ATOM 5536 C CD2 . HIS A 1 714  ? -4.034  52.810 21.900  1.00 96.24  ? 711  HIS A CD2 1 
ATOM 5537 C CE1 . HIS A 1 714  ? -4.379  54.686 22.983  1.00 96.24  ? 711  HIS A CE1 1 
ATOM 5538 N NE2 . HIS A 1 714  ? -4.728  53.413 22.920  1.00 96.24  ? 711  HIS A NE2 1 
ATOM 5539 N N   . ILE A 1 715  ? -0.813  53.241 23.117  1.00 68.22  ? 712  ILE A N   1 
ATOM 5540 C CA  . ILE A 1 715  ? -0.673  52.544 24.382  1.00 68.22  ? 712  ILE A CA  1 
ATOM 5541 C C   . ILE A 1 715  ? -1.757  52.929 25.364  1.00 68.22  ? 712  ILE A C   1 
ATOM 5542 O O   . ILE A 1 715  ? -1.846  54.094 25.731  1.00 68.22  ? 712  ILE A O   1 
ATOM 5543 C CB  . ILE A 1 715  ? 0.648   52.931 25.064  1.00 67.85  ? 712  ILE A CB  1 
ATOM 5544 C CG1 . ILE A 1 715  ? 1.849   52.436 24.265  1.00 67.85  ? 712  ILE A CG1 1 
ATOM 5545 C CG2 . ILE A 1 715  ? 0.714   52.369 26.477  1.00 67.85  ? 712  ILE A CG2 1 
ATOM 5546 C CD1 . ILE A 1 715  ? 3.146   53.143 24.626  1.00 67.85  ? 712  ILE A CD1 1 
ATOM 5547 N N   . ARG A 1 716  ? -2.559  51.946 25.761  1.00 77.66  ? 713  ARG A N   1 
ATOM 5548 C CA  . ARG A 1 716  ? -3.639  52.124 26.717  1.00 77.66  ? 713  ARG A CA  1 
ATOM 5549 C C   . ARG A 1 716  ? -3.146  51.551 28.036  1.00 77.66  ? 713  ARG A C   1 
ATOM 5550 O O   . ARG A 1 716  ? -2.379  50.587 28.043  1.00 77.66  ? 713  ARG A O   1 
ATOM 5551 C CB  . ARG A 1 716  ? -4.881  51.373 26.238  1.00 64.35  ? 713  ARG A CB  1 
ATOM 5552 C CG  . ARG A 1 716  ? -6.098  51.485 27.142  1.00 64.35  ? 713  ARG A CG  1 
ATOM 5553 C CD  . ARG A 1 716  ? -7.291  50.783 26.508  1.00 64.35  ? 713  ARG A CD  1 
ATOM 5554 N NE  . ARG A 1 716  ? -8.465  50.771 27.376  1.00 64.35  ? 713  ARG A NE  1 
ATOM 5555 C CZ  . ARG A 1 716  ? -8.506  51.308 28.591  1.00 64.35  ? 713  ARG A CZ  1 
ATOM 5556 N NH1 . ARG A 1 716  ? -7.433  51.907 29.089  1.00 64.35  ? 713  ARG A NH1 1 
ATOM 5557 N NH2 . ARG A 1 716  ? -9.620  51.248 29.308  1.00 64.35  ? 713  ARG A NH2 1 
ATOM 5558 N N   . THR A 1 717  ? -3.566  52.135 29.152  1.00 45.99  ? 714  THR A N   1 
ATOM 5559 C CA  . THR A 1 717  ? -3.096  51.654 30.446  1.00 45.99  ? 714  THR A CA  1 
ATOM 5560 C C   . THR A 1 717  ? -4.158  51.542 31.537  1.00 45.99  ? 714  THR A C   1 
ATOM 5561 O O   . THR A 1 717  ? -5.057  52.375 31.649  1.00 45.99  ? 714  THR A O   1 
ATOM 5562 C CB  . THR A 1 717  ? -1.940  52.528 30.979  1.00 37.03  ? 714  THR A CB  1 
ATOM 5563 O OG1 . THR A 1 717  ? -0.847  52.494 30.054  1.00 37.03  ? 714  THR A OG1 1 
ATOM 5564 C CG2 . THR A 1 717  ? -1.469  52.024 32.333  1.00 37.03  ? 714  THR A CG2 1 
ATOM 5565 N N   . VAL A 1 718  ? -4.021  50.494 32.342  1.00 46.29  ? 715  VAL A N   1 
ATOM 5566 C CA  . VAL A 1 718  ? -4.884  50.232 33.472  1.00 46.29  ? 715  VAL A CA  1 
ATOM 5567 C C   . VAL A 1 718  ? -4.070  50.168 34.765  1.00 46.29  ? 715  VAL A C   1 
ATOM 5568 O O   . VAL A 1 718  ? -3.535  49.108 35.142  1.00 46.29  ? 715  VAL A O   1 
ATOM 5569 C CB  . VAL A 1 718  ? -5.630  48.926 33.270  1.00 58.82  ? 715  VAL A CB  1 
ATOM 5570 C CG1 . VAL A 1 718  ? -6.546  48.631 34.471  1.00 58.82  ? 715  VAL A CG1 1 
ATOM 5571 C CG2 . VAL A 1 718  ? -6.403  48.981 31.980  1.00 58.82  ? 715  VAL A CG2 1 
ATOM 5572 N N   . PRO A 1 719  ? -3.969  51.299 35.461  1.00 36.91  ? 716  PRO A N   1 
ATOM 5573 C CA  . PRO A 1 719  ? -3.285  51.384 36.765  1.00 36.91  ? 716  PRO A CA  1 
ATOM 5574 C C   . PRO A 1 719  ? -3.673  50.222 37.661  1.00 36.91  ? 716  PRO A C   1 
ATOM 5575 O O   . PRO A 1 719  ? -4.849  50.075 37.941  1.00 36.91  ? 716  PRO A O   1 
ATOM 5576 C CB  . PRO A 1 719  ? -3.869  52.655 37.401  1.00 28.06  ? 716  PRO A CB  1 
ATOM 5577 C CG  . PRO A 1 719  ? -4.376  53.465 36.253  1.00 28.06  ? 716  PRO A CG  1 
ATOM 5578 C CD  . PRO A 1 719  ? -4.507  52.583 35.014  1.00 28.06  ? 716  PRO A CD  1 
ATOM 5579 N N   . LEU A 1 720  ? -2.728  49.413 38.135  1.00 45.50  ? 717  LEU A N   1 
ATOM 5580 C CA  . LEU A 1 720  ? -3.131  48.392 39.095  1.00 45.50  ? 717  LEU A CA  1 
ATOM 5581 C C   . LEU A 1 720  ? -2.955  48.792 40.541  1.00 45.50  ? 717  LEU A C   1 
ATOM 5582 O O   . LEU A 1 720  ? -3.697  48.339 41.366  1.00 45.50  ? 717  LEU A O   1 
ATOM 5583 C CB  . LEU A 1 720  ? -2.446  47.084 38.794  1.00 42.38  ? 717  LEU A CB  1 
ATOM 5584 C CG  . LEU A 1 720  ? -3.220  46.472 37.639  1.00 42.38  ? 717  LEU A CG  1 
ATOM 5585 C CD1 . LEU A 1 720  ? -2.521  45.290 36.996  1.00 42.38  ? 717  LEU A CD1 1 
ATOM 5586 C CD2 . LEU A 1 720  ? -4.564  46.056 38.147  1.00 42.38  ? 717  LEU A CD2 1 
ATOM 5587 N N   . TYR A 1 721  ? -2.013  49.683 40.835  1.00 46.39  ? 718  TYR A N   1 
ATOM 5588 C CA  . TYR A 1 721  ? -1.704  50.123 42.204  1.00 46.39  ? 718  TYR A CA  1 
ATOM 5589 C C   . TYR A 1 721  ? -1.039  49.038 42.972  1.00 46.39  ? 718  TYR A C   1 
ATOM 5590 O O   . TYR A 1 721  ? -0.824  49.149 44.166  1.00 46.39  ? 718  TYR A O   1 
ATOM 5591 C CB  . TYR A 1 721  ? -2.908  50.718 42.957  1.00 35.97  ? 718  TYR A CB  1 
ATOM 5592 C CG  . TYR A 1 721  ? -3.387  51.885 42.212  1.00 35.97  ? 718  TYR A CG  1 
ATOM 5593 C CD1 . TYR A 1 721  ? -4.417  51.738 41.285  1.00 35.97  ? 718  TYR A CD1 1 
ATOM 5594 C CD2 . TYR A 1 721  ? -2.731  53.104 42.314  1.00 35.97  ? 718  TYR A CD2 1 
ATOM 5595 C CE1 . TYR A 1 721  ? -4.823  52.778 40.505  1.00 35.97  ? 718  TYR A CE1 1 
ATOM 5596 C CE2 . TYR A 1 721  ? -3.124  54.172 41.553  1.00 35.97  ? 718  TYR A CE2 1 
ATOM 5597 C CZ  . TYR A 1 721  ? -4.178  53.996 40.643  1.00 35.97  ? 718  TYR A CZ  1 
ATOM 5598 O OH  . TYR A 1 721  ? -4.604  55.021 39.839  1.00 35.97  ? 718  TYR A OH  1 
ATOM 5599 N N   . GLU A 1 722  ? -0.679  47.992 42.258  1.00 87.40  ? 719  GLU A N   1 
ATOM 5600 C CA  . GLU A 1 722  ? 0.096   46.925 42.818  1.00 87.40  ? 719  GLU A CA  1 
ATOM 5601 C C   . GLU A 1 722  ? 0.866   46.259 41.678  1.00 87.40  ? 719  GLU A C   1 
ATOM 5602 O O   . GLU A 1 722  ? 1.047   46.855 40.616  1.00 87.40  ? 719  GLU A O   1 
ATOM 5603 C CB  . GLU A 1 722  ? -0.806  45.973 43.581  1.00 50.13  ? 719  GLU A CB  1 
ATOM 5604 C CG  . GLU A 1 722  ? -2.018  45.548 42.808  1.00 50.13  ? 719  GLU A CG  1 
ATOM 5605 C CD  . GLU A 1 722  ? -2.825  44.518 43.561  1.00 50.13  ? 719  GLU A CD  1 
ATOM 5606 O OE1 . GLU A 1 722  ? -2.770  43.320 43.146  1.00 50.13  ? 719  GLU A OE1 1 
ATOM 5607 O OE2 . GLU A 1 722  ? -3.482  44.911 44.580  1.00 50.13  ? 719  GLU A OE2 1 
ATOM 5608 N N   . SER A 1 723  ? 1.325   45.038 41.890  1.00 35.13  ? 720  SER A N   1 
ATOM 5609 C CA  . SER A 1 723  ? 2.409   44.550 41.103  1.00 35.13  ? 720  SER A CA  1 
ATOM 5610 C C   . SER A 1 723  ? 1.932   43.328 40.388  1.00 35.13  ? 720  SER A C   1 
ATOM 5611 O O   . SER A 1 723  ? 1.892   42.245 40.976  1.00 35.13  ? 720  SER A O   1 
ATOM 5612 C CB  . SER A 1 723  ? 3.562   44.222 42.023  1.00 46.15  ? 720  SER A CB  1 
ATOM 5613 O OG  . SER A 1 723  ? 3.071   43.433 43.081  1.00 46.15  ? 720  SER A OG  1 
ATOM 5614 N N   . PRO A 1 724  ? 1.549   43.478 39.117  1.00 29.56  ? 721  PRO A N   1 
ATOM 5615 C CA  . PRO A 1 724  ? 0.976   42.338 38.402  1.00 29.56  ? 721  PRO A CA  1 
ATOM 5616 C C   . PRO A 1 724  ? 2.098   41.337 38.171  1.00 29.56  ? 721  PRO A C   1 
ATOM 5617 O O   . PRO A 1 724  ? 3.271   41.737 38.113  1.00 29.56  ? 721  PRO A O   1 
ATOM 5618 C CB  . PRO A 1 724  ? 0.557   42.934 37.072  1.00 33.29  ? 721  PRO A CB  1 
ATOM 5619 C CG  . PRO A 1 724  ? 1.438   44.108 36.910  1.00 33.29  ? 721  PRO A CG  1 
ATOM 5620 C CD  . PRO A 1 724  ? 1.674   44.665 38.273  1.00 33.29  ? 721  PRO A CD  1 
ATOM 5621 N N   . ARG A 1 725  ? 1.775   40.057 38.041  1.00 53.69  ? 722  ARG A N   1 
ATOM 5622 C CA  . ARG A 1 725  ? 2.819   39.057 37.878  1.00 53.69  ? 722  ARG A CA  1 
ATOM 5623 C C   . ARG A 1 725  ? 2.649   38.189 36.626  1.00 53.69  ? 722  ARG A C   1 
ATOM 5624 O O   . ARG A 1 725  ? 3.611   38.033 35.861  1.00 53.69  ? 722  ARG A O   1 
ATOM 5625 C CB  . ARG A 1 725  ? 2.931   38.191 39.134  1.00 38.08  ? 722  ARG A CB  1 
ATOM 5626 C CG  . ARG A 1 725  ? 3.396   38.905 40.388  1.00 38.08  ? 722  ARG A CG  1 
ATOM 5627 C CD  . ARG A 1 725  ? 4.905   39.025 40.442  1.00 38.08  ? 722  ARG A CD  1 
ATOM 5628 N NE  . ARG A 1 725  ? 5.365   39.870 41.553  1.00 38.08  ? 722  ARG A NE  1 
ATOM 5629 C CZ  . ARG A 1 725  ? 5.387   39.467 42.811  1.00 38.08  ? 722  ARG A CZ  1 
ATOM 5630 N NH1 . ARG A 1 725  ? 4.956   38.260 43.100  1.00 38.08  ? 722  ARG A NH1 1 
ATOM 5631 N NH2 . ARG A 1 725  ? 5.821   40.260 43.760  1.00 38.08  ? 722  ARG A NH2 1 
ATOM 5632 N N   . LYS A 1 726  ? 1.456   37.614 36.416  1.00 37.25  ? 723  LYS A N   1 
ATOM 5633 C CA  . LYS A 1 726  ? 1.191   36.816 35.182  1.00 37.25  ? 723  LYS A CA  1 
ATOM 5634 C C   . LYS A 1 726  ? -0.083  37.244 34.463  1.00 37.25  ? 723  LYS A C   1 
ATOM 5635 O O   . LYS A 1 726  ? -0.780  38.118 34.960  1.00 37.25  ? 723  LYS A O   1 
ATOM 5636 C CB  . LYS A 1 726  ? 1.169   35.326 35.496  1.00 47.10  ? 723  LYS A CB  1 
ATOM 5637 C CG  . LYS A 1 726  ? 2.443   34.841 36.170  1.00 47.10  ? 723  LYS A CG  1 
ATOM 5638 C CD  . LYS A 1 726  ? 3.644   34.912 35.244  1.00 47.10  ? 723  LYS A CD  1 
ATOM 5639 C CE  . LYS A 1 726  ? 3.630   33.784 34.231  1.00 47.10  ? 723  LYS A CE  1 
ATOM 5640 N NZ  . LYS A 1 726  ? 4.240   32.587 34.871  1.00 47.10  ? 723  LYS A NZ  1 
ATOM 5641 N N   . ILE A 1 727  ? -0.399  36.657 33.309  1.00 35.93  ? 724  ILE A N   1 
ATOM 5642 C CA  . ILE A 1 727  ? -1.586  37.105 32.556  1.00 35.93  ? 724  ILE A CA  1 
ATOM 5643 C C   . ILE A 1 727  ? -2.081  36.143 31.479  1.00 35.93  ? 724  ILE A C   1 
ATOM 5644 O O   . ILE A 1 727  ? -1.335  35.763 30.593  1.00 35.93  ? 724  ILE A O   1 
ATOM 5645 C CB  . ILE A 1 727  ? -1.350  38.477 31.926  1.00 32.37  ? 724  ILE A CB  1 
ATOM 5646 C CG1 . ILE A 1 727  ? -2.647  39.136 31.538  1.00 32.37  ? 724  ILE A CG1 1 
ATOM 5647 C CG2 . ILE A 1 727  ? -0.498  38.374 30.707  1.00 32.37  ? 724  ILE A CG2 1 
ATOM 5648 C CD1 . ILE A 1 727  ? -2.582  40.609 31.751  1.00 32.37  ? 724  ILE A CD1 1 
ATOM 5649 N N   . CYS A 1 728  ? -3.358  35.765 31.567  1.00 50.28  ? 725  CYS A N   1 
ATOM 5650 C CA  . CYS A 1 728  ? -3.994  34.834 30.623  1.00 50.28  ? 725  CYS A CA  1 
ATOM 5651 C C   . CYS A 1 728  ? -5.171  35.454 29.920  1.00 50.28  ? 725  CYS A C   1 
ATOM 5652 O O   . CYS A 1 728  ? -5.695  36.482 30.340  1.00 50.28  ? 725  CYS A O   1 
ATOM 5653 C CB  . CYS A 1 728  ? -4.508  33.620 31.355  1.00 80.24  ? 725  CYS A CB  1 
ATOM 5654 S SG  . CYS A 1 728  ? -3.194  32.643 31.867  1.00 80.24  ? 725  CYS A SG  1 
ATOM 5655 N N   . TYR A 1 729  ? -5.608  34.804 28.853  1.00 67.59  ? 726  TYR A N   1 
ATOM 5656 C CA  . TYR A 1 729  ? -6.811  35.244 28.205  1.00 67.59  ? 726  TYR A CA  1 
ATOM 5657 C C   . TYR A 1 729  ? -7.748  34.071 27.986  1.00 67.59  ? 726  TYR A C   1 
ATOM 5658 O O   . TYR A 1 729  ? -7.574  33.287 27.052  1.00 67.59  ? 726  TYR A O   1 
ATOM 5659 C CB  . TYR A 1 729  ? -6.491  35.998 26.922  1.00 57.65  ? 726  TYR A CB  1 
ATOM 5660 C CG  . TYR A 1 729  ? -7.691  36.487 26.157  1.00 57.65  ? 726  TYR A CG  1 
ATOM 5661 C CD1 . TYR A 1 729  ? -8.650  37.313 26.751  1.00 57.65  ? 726  TYR A CD1 1 
ATOM 5662 C CD2 . TYR A 1 729  ? -7.859  36.133 24.824  1.00 57.65  ? 726  TYR A CD2 1 
ATOM 5663 C CE1 . TYR A 1 729  ? -9.754  37.768 26.031  1.00 57.65  ? 726  TYR A CE1 1 
ATOM 5664 C CE2 . TYR A 1 729  ? -8.944  36.572 24.095  1.00 57.65  ? 726  TYR A CE2 1 
ATOM 5665 C CZ  . TYR A 1 729  ? -9.895  37.393 24.694  1.00 57.65  ? 726  TYR A CZ  1 
ATOM 5666 O OH  . TYR A 1 729  ? -10.967 37.818 23.926  1.00 57.65  ? 726  TYR A OH  1 
ATOM 5667 N N   . GLN A 1 730  ? -8.705  33.954 28.913  1.00 45.88  ? 727  GLN A N   1 
ATOM 5668 C CA  . GLN A 1 730  ? -9.918  33.140 28.768  1.00 45.88  ? 727  GLN A CA  1 
ATOM 5669 C C   . GLN A 1 730  ? -10.964 33.880 27.879  1.00 45.88  ? 727  GLN A C   1 
ATOM 5670 O O   . GLN A 1 730  ? -11.755 34.749 28.362  1.00 45.88  ? 727  GLN A O   1 
ATOM 5671 C CB  . GLN A 1 730  ? -10.498 32.887 30.153  1.00 62.61  ? 727  GLN A CB  1 
ATOM 5672 C CG  . GLN A 1 730  ? -11.425 31.717 30.231  1.00 62.61  ? 727  GLN A CG  1 
ATOM 5673 C CD  . GLN A 1 730  ? -11.454 31.108 31.619  1.00 62.61  ? 727  GLN A CD  1 
ATOM 5674 O OE1 . GLN A 1 730  ? -10.700 30.162 31.894  1.00 62.61  ? 727  GLN A OE1 1 
ATOM 5675 N NE2 . GLN A 1 730  ? -12.294 31.660 32.518  1.00 62.61  ? 727  GLN A NE2 1 
ATOM 5676 N N   . GLU A 1 731  ? -10.961 33.558 26.589  1.00 71.72  ? 728  GLU A N   1 
ATOM 5677 C CA  . GLU A 1 731  ? -11.728 34.341 25.641  1.00 71.72  ? 728  GLU A CA  1 
ATOM 5678 C C   . GLU A 1 731  ? -13.181 33.958 25.714  1.00 71.72  ? 728  GLU A C   1 
ATOM 5679 O O   . GLU A 1 731  ? -14.050 34.810 25.575  1.00 71.72  ? 728  GLU A O   1 
ATOM 5680 C CB  . GLU A 1 731  ? -11.192 34.149 24.233  1.00 102.90 ? 728  GLU A CB  1 
ATOM 5681 C CG  . GLU A 1 731  ? -12.173 34.436 23.132  1.00 102.90 ? 728  GLU A CG  1 
ATOM 5682 C CD  . GLU A 1 731  ? -12.334 33.227 22.247  1.00 102.90 ? 728  GLU A CD  1 
ATOM 5683 O OE1 . GLU A 1 731  ? -11.950 33.316 21.059  1.00 102.90 ? 728  GLU A OE1 1 
ATOM 5684 O OE2 . GLU A 1 731  ? -12.815 32.178 22.757  1.00 102.90 ? 728  GLU A OE2 1 
ATOM 5685 N N   . VAL A 1 732  ? -13.455 32.679 25.943  1.00 69.14  ? 729  VAL A N   1 
ATOM 5686 C CA  . VAL A 1 732  ? -14.845 32.243 26.022  1.00 69.14  ? 729  VAL A CA  1 
ATOM 5687 C C   . VAL A 1 732  ? -15.524 32.980 27.168  1.00 69.14  ? 729  VAL A C   1 
ATOM 5688 O O   . VAL A 1 732  ? -16.729 33.209 27.105  1.00 69.14  ? 729  VAL A O   1 
ATOM 5689 C CB  . VAL A 1 732  ? -15.026 30.702 26.118  1.00 57.50  ? 729  VAL A CB  1 
ATOM 5690 C CG1 . VAL A 1 732  ? -14.146 29.989 25.069  1.00 57.50  ? 729  VAL A CG1 1 
ATOM 5691 C CG2 . VAL A 1 732  ? -14.758 30.207 27.526  1.00 57.50  ? 729  VAL A CG2 1 
ATOM 5692 N N   . SER A 1 733  ? -14.750 33.397 28.176  1.00 55.67  ? 730  SER A N   1 
ATOM 5693 C CA  . SER A 1 733  ? -15.277 34.280 29.226  1.00 55.67  ? 730  SER A CA  1 
ATOM 5694 C C   . SER A 1 733  ? -15.094 35.764 28.940  1.00 55.67  ? 730  SER A C   1 
ATOM 5695 O O   . SER A 1 733  ? -15.405 36.592 29.800  1.00 55.67  ? 730  SER A O   1 
ATOM 5696 C CB  . SER A 1 733  ? -14.617 33.992 30.568  1.00 66.75  ? 730  SER A CB  1 
ATOM 5697 O OG  . SER A 1 733  ? -14.235 32.641 30.671  1.00 66.75  ? 730  SER A OG  1 
ATOM 5698 N N   . GLN A 1 734  ? -14.573 36.102 27.759  1.00 69.23  ? 731  GLN A N   1 
ATOM 5699 C CA  . GLN A 1 734  ? -14.256 37.500 27.380  1.00 69.23  ? 731  GLN A CA  1 
ATOM 5700 C C   . GLN A 1 734  ? -13.525 38.296 28.480  1.00 69.23  ? 731  GLN A C   1 
ATOM 5701 O O   . GLN A 1 734  ? -13.890 39.429 28.807  1.00 69.23  ? 731  GLN A O   1 
ATOM 5702 C CB  . GLN A 1 734  ? -15.508 38.248 26.893  1.00 70.06  ? 731  GLN A CB  1 
ATOM 5703 C CG  . GLN A 1 734  ? -16.184 37.628 25.688  1.00 70.06  ? 731  GLN A CG  1 
ATOM 5704 C CD  . GLN A 1 734  ? -15.437 37.884 24.382  1.00 70.06  ? 731  GLN A CD  1 
ATOM 5705 O OE1 . GLN A 1 734  ? -15.621 38.917 23.723  1.00 70.06  ? 731  GLN A OE1 1 
ATOM 5706 N NE2 . GLN A 1 734  ? -14.612 36.928 23.987  1.00 70.06  ? 731  GLN A NE2 1 
ATOM 5707 N N   . CYS A 1 735  ? -12.490 37.685 29.044  1.00 52.97  ? 732  CYS A N   1 
ATOM 5708 C CA  . CYS A 1 735  ? -11.725 38.334 30.095  1.00 52.97  ? 732  CYS A CA  1 
ATOM 5709 C C   . CYS A 1 735  ? -10.277 37.844 30.226  1.00 52.97  ? 732  CYS A C   1 
ATOM 5710 O O   . CYS A 1 735  ? -9.875  36.783 29.706  1.00 52.97  ? 732  CYS A O   1 
ATOM 5711 C CB  . CYS A 1 735  ? -12.409 38.118 31.431  1.00 84.78  ? 732  CYS A CB  1 
ATOM 5712 S SG  . CYS A 1 735  ? -12.463 36.380 31.825  1.00 84.78  ? 732  CYS A SG  1 
ATOM 5713 N N   . PHE A 1 736  ? -9.515  38.634 30.967  1.00 57.33  ? 733  PHE A N   1 
ATOM 5714 C CA  . PHE A 1 736  ? -8.172  38.270 31.350  1.00 57.33  ? 733  PHE A CA  1 
ATOM 5715 C C   . PHE A 1 736  ? -8.142  37.818 32.783  1.00 57.33  ? 733  PHE A C   1 
ATOM 5716 O O   . PHE A 1 736  ? -8.878  38.342 33.626  1.00 57.33  ? 733  PHE A O   1 
ATOM 5717 C CB  . PHE A 1 736  ? -7.239  39.471 31.221  1.00 45.10  ? 733  PHE A CB  1 
ATOM 5718 C CG  . PHE A 1 736  ? -7.016  39.910 29.813  1.00 45.10  ? 733  PHE A CG  1 
ATOM 5719 C CD1 . PHE A 1 736  ? -7.257  41.235 29.441  1.00 45.10  ? 733  PHE A CD1 1 
ATOM 5720 C CD2 . PHE A 1 736  ? -6.569  39.006 28.856  1.00 45.10  ? 733  PHE A CD2 1 
ATOM 5721 C CE1 . PHE A 1 736  ? -7.059  41.659 28.122  1.00 45.10  ? 733  PHE A CE1 1 
ATOM 5722 C CE2 . PHE A 1 736  ? -6.364  39.409 27.559  1.00 45.10  ? 733  PHE A CE2 1 
ATOM 5723 C CZ  . PHE A 1 736  ? -6.611  40.747 27.180  1.00 45.10  ? 733  PHE A CZ  1 
ATOM 5724 N N   . GLY A 1 737  ? -7.284  36.841 33.043  1.00 43.14  ? 734  GLY A N   1 
ATOM 5725 C CA  . GLY A 1 737  ? -6.912  36.491 34.411  1.00 43.14  ? 734  GLY A CA  1 
ATOM 5726 C C   . GLY A 1 737  ? -5.526  37.013 34.761  1.00 43.14  ? 734  GLY A C   1 
ATOM 5727 O O   . GLY A 1 737  ? -4.593  36.924 33.978  1.00 43.14  ? 734  GLY A O   1 
ATOM 5728 N N   . VAL A 1 738  ? -5.360  37.536 35.950  1.00 37.77  ? 735  VAL A N   1 
ATOM 5729 C CA  . VAL A 1 738  ? -4.099  38.152 36.217  1.00 37.77  ? 735  VAL A CA  1 
ATOM 5730 C C   . VAL A 1 738  ? -3.610  37.825 37.620  1.00 37.77  ? 735  VAL A C   1 
ATOM 5731 O O   . VAL A 1 738  ? -4.379  37.938 38.565  1.00 37.77  ? 735  VAL A O   1 
ATOM 5732 C CB  . VAL A 1 738  ? -4.215  39.653 35.962  1.00 30.67  ? 735  VAL A CB  1 
ATOM 5733 C CG1 . VAL A 1 738  ? -3.288  40.472 36.843  1.00 30.67  ? 735  VAL A CG1 1 
ATOM 5734 C CG2 . VAL A 1 738  ? -3.906  39.902 34.568  1.00 30.67  ? 735  VAL A CG2 1 
ATOM 5735 N N   . LEU A 1 739  ? -2.356  37.394 37.754  1.00 40.90  ? 736  LEU A N   1 
ATOM 5736 C CA  . LEU A 1 739  ? -1.818  37.139 39.065  1.00 40.90  ? 736  LEU A CA  1 
ATOM 5737 C C   . LEU A 1 739  ? -1.383  38.475 39.603  1.00 40.90  ? 736  LEU A C   1 
ATOM 5738 O O   . LEU A 1 739  ? -0.948  39.309 38.837  1.00 40.90  ? 736  LEU A O   1 
ATOM 5739 C CB  . LEU A 1 739  ? -0.685  36.108 39.014  1.00 54.23  ? 736  LEU A CB  1 
ATOM 5740 C CG  . LEU A 1 739  ? -1.220  34.675 38.812  1.00 54.23  ? 736  LEU A CG  1 
ATOM 5741 C CD1 . LEU A 1 739  ? -0.149  33.619 39.003  1.00 54.23  ? 736  LEU A CD1 1 
ATOM 5742 C CD2 . LEU A 1 739  ? -2.372  34.401 39.759  1.00 54.23  ? 736  LEU A CD2 1 
ATOM 5743 N N   . SER A 1 740  ? -1.526  38.704 40.902  1.00 40.12  ? 737  SER A N   1 
ATOM 5744 C CA  . SER A 1 740  ? -1.305  40.038 41.438  1.00 40.12  ? 737  SER A CA  1 
ATOM 5745 C C   . SER A 1 740  ? -0.702  39.974 42.819  1.00 40.12  ? 737  SER A C   1 
ATOM 5746 O O   . SER A 1 740  ? -0.696  38.932 43.462  1.00 40.12  ? 737  SER A O   1 
ATOM 5747 C CB  . SER A 1 740  ? -2.622  40.779 41.537  1.00 75.73  ? 737  SER A CB  1 
ATOM 5748 O OG  . SER A 1 740  ? -3.116  40.739 42.863  1.00 75.73  ? 737  SER A OG  1 
ATOM 5749 N N   . SER A 1 741  ? -0.195  41.091 43.300  1.00 39.95  ? 738  SER A N   1 
ATOM 5750 C CA  . SER A 1 741  ? 0.458   41.061 44.597  1.00 39.95  ? 738  SER A CA  1 
ATOM 5751 C C   . SER A 1 741  ? 0.501   42.440 45.250  1.00 39.95  ? 738  SER A C   1 
ATOM 5752 O O   . SER A 1 741  ? 0.869   43.443 44.647  1.00 39.95  ? 738  SER A O   1 
ATOM 5753 C CB  . SER A 1 741  ? 1.852   40.445 44.512  1.00 52.11  ? 738  SER A CB  1 
ATOM 5754 O OG  . SER A 1 741  ? 2.606   40.810 45.645  1.00 52.11  ? 738  SER A OG  1 
ATOM 5755 N N   . ARG A 1 742  ? 0.097   42.492 46.497  1.00 34.62  ? 739  ARG A N   1 
ATOM 5756 C CA  . ARG A 1 742  ? 0.243   43.716 47.212  1.00 34.62  ? 739  ARG A CA  1 
ATOM 5757 C C   . ARG A 1 742  ? 1.035   43.384 48.444  1.00 34.62  ? 739  ARG A C   1 
ATOM 5758 O O   . ARG A 1 742  ? 1.113   42.212 48.841  1.00 34.62  ? 739  ARG A O   1 
ATOM 5759 C CB  . ARG A 1 742  ? -1.116  44.323 47.545  1.00 61.85  ? 739  ARG A CB  1 
ATOM 5760 C CG  . ARG A 1 742  ? -2.198  43.322 47.843  1.00 61.85  ? 739  ARG A CG  1 
ATOM 5761 C CD  . ARG A 1 742  ? -3.493  44.045 48.003  1.00 61.85  ? 739  ARG A CD  1 
ATOM 5762 N NE  . ARG A 1 742  ? -4.104  43.723 49.279  1.00 61.85  ? 739  ARG A NE  1 
ATOM 5763 C CZ  . ARG A 1 742  ? -4.882  42.673 49.487  1.00 61.85  ? 739  ARG A CZ  1 
ATOM 5764 N NH1 . ARG A 1 742  ? -5.154  41.833 48.492  1.00 61.85  ? 739  ARG A NH1 1 
ATOM 5765 N NH2 . ARG A 1 742  ? -5.385  42.469 50.698  1.00 61.85  ? 739  ARG A NH2 1 
ATOM 5766 N N   . ILE A 1 743  ? 1.656   44.423 48.985  1.00 55.55  ? 740  ILE A N   1 
ATOM 5767 C CA  . ILE A 1 743  ? 2.403   44.365 50.203  1.00 55.55  ? 740  ILE A CA  1 
ATOM 5768 C C   . ILE A 1 743  ? 1.404   44.672 51.328  1.00 55.55  ? 740  ILE A C   1 
ATOM 5769 O O   . ILE A 1 743  ? 0.232   44.990 51.072  1.00 55.55  ? 740  ILE A O   1 
ATOM 5770 C CB  . ILE A 1 743  ? 3.560   45.362 50.111  1.00 45.49  ? 740  ILE A CB  1 
ATOM 5771 C CG1 . ILE A 1 743  ? 4.584   44.867 49.074  1.00 45.49  ? 740  ILE A CG1 1 
ATOM 5772 C CG2 . ILE A 1 743  ? 4.255   45.557 51.456  1.00 45.49  ? 740  ILE A CG2 1 
ATOM 5773 C CD1 . ILE A 1 743  ? 5.530   45.944 48.512  1.00 45.49  ? 740  ILE A CD1 1 
ATOM 5774 N N   . GLU A 1 744  ? 1.825   44.503 52.572  1.00 66.42  ? 741  GLU A N   1 
ATOM 5775 C CA  . GLU A 1 744  ? 0.988   44.778 53.727  1.00 66.42  ? 741  GLU A CA  1 
ATOM 5776 C C   . GLU A 1 744  ? 1.952   44.734 54.874  1.00 66.42  ? 741  GLU A C   1 
ATOM 5777 O O   . GLU A 1 744  ? 3.064   44.249 54.710  1.00 66.42  ? 741  GLU A O   1 
ATOM 5778 C CB  . GLU A 1 744  ? -0.114  43.725 53.908  1.00 69.28  ? 741  GLU A CB  1 
ATOM 5779 C CG  . GLU A 1 744  ? -1.321  43.914 52.969  1.00 69.28  ? 741  GLU A CG  1 
ATOM 5780 C CD  . GLU A 1 744  ? -2.604  43.162 53.409  1.00 69.28  ? 741  GLU A CD  1 
ATOM 5781 O OE1 . GLU A 1 744  ? -2.654  42.652 54.562  1.00 69.28  ? 741  GLU A OE1 1 
ATOM 5782 O OE2 . GLU A 1 744  ? -3.578  43.099 52.595  1.00 69.28  ? 741  GLU A OE2 1 
ATOM 5783 N N   . VAL A 1 745  ? 1.547   45.249 56.028  1.00 70.14  ? 742  VAL A N   1 
ATOM 5784 C CA  . VAL A 1 745  ? 2.412   45.253 57.213  1.00 70.14  ? 742  VAL A CA  1 
ATOM 5785 C C   . VAL A 1 745  ? 1.730   44.595 58.419  1.00 70.14  ? 742  VAL A C   1 
ATOM 5786 O O   . VAL A 1 745  ? 0.489   44.573 58.514  1.00 70.14  ? 742  VAL A O   1 
ATOM 5787 C CB  . VAL A 1 745  ? 2.878   46.681 57.560  1.00 72.08  ? 742  VAL A CB  1 
ATOM 5788 C CG1 . VAL A 1 745  ? 3.793   47.214 56.467  1.00 72.08  ? 742  VAL A CG1 1 
ATOM 5789 C CG2 . VAL A 1 745  ? 1.671   47.614 57.765  1.00 72.08  ? 742  VAL A CG2 1 
ATOM 5790 N N   . GLN A 1 746  ? 2.544   44.043 59.319  1.00 107.24 ? 743  GLN A N   1 
ATOM 5791 C CA  . GLN A 1 746  ? 2.076   43.573 60.625  1.00 107.24 ? 743  GLN A CA  1 
ATOM 5792 C C   . GLN A 1 746  ? 1.248   44.668 61.313  1.00 107.24 ? 743  GLN A C   1 
ATOM 5793 O O   . GLN A 1 746  ? 1.428   45.864 61.048  1.00 107.24 ? 743  GLN A O   1 
ATOM 5794 C CB  . GLN A 1 746  ? 3.270   43.215 61.515  1.00 96.28  ? 743  GLN A CB  1 
ATOM 5795 C CG  . GLN A 1 746  ? 4.104   44.442 61.923  1.00 96.28  ? 743  GLN A CG  1 
ATOM 5796 C CD  . GLN A 1 746  ? 4.971   44.209 63.145  1.00 96.28  ? 743  GLN A CD  1 
ATOM 5797 O OE1 . GLN A 1 746  ? 6.199   44.169 63.042  1.00 96.28  ? 743  GLN A OE1 1 
ATOM 5798 N NE2 . GLN A 1 746  ? 4.334   44.064 64.317  1.00 96.28  ? 743  GLN A NE2 1 
ATOM 5799 N N   . ASP A 1 747  ? 0.347   44.259 62.197  1.00 151.99 ? 744  ASP A N   1 
ATOM 5800 C CA  . ASP A 1 747  ? -0.448  45.214 62.959  1.00 151.99 ? 744  ASP A CA  1 
ATOM 5801 C C   . ASP A 1 747  ? -0.044  45.229 64.429  1.00 151.99 ? 744  ASP A C   1 
ATOM 5802 O O   . ASP A 1 747  ? 0.889   44.520 64.827  1.00 151.99 ? 744  ASP A O   1 
ATOM 5803 C CB  . ASP A 1 747  ? -1.938  44.907 62.802  1.00 111.68 ? 744  ASP A CB  1 
ATOM 5804 C CG  . ASP A 1 747  ? -2.544  45.578 61.580  1.00 111.68 ? 744  ASP A CG  1 
ATOM 5805 O OD1 . ASP A 1 747  ? -2.526  46.825 61.518  1.00 111.68 ? 744  ASP A OD1 1 
ATOM 5806 O OD2 . ASP A 1 747  ? -3.041  44.864 60.685  1.00 111.68 ? 744  ASP A OD2 1 
ATOM 5807 N N   . THR A 1 748  ? -0.719  46.065 65.222  1.00 103.83 ? 745  THR A N   1 
ATOM 5808 C CA  . THR A 1 748  ? -0.670  45.945 66.685  1.00 103.83 ? 745  THR A CA  1 
ATOM 5809 C C   . THR A 1 748  ? -1.530  44.729 67.099  1.00 103.83 ? 745  THR A C   1 
ATOM 5810 O O   . THR A 1 748  ? -1.203  44.018 68.056  1.00 103.83 ? 745  THR A O   1 
ATOM 5811 C CB  . THR A 1 748  ? -1.111  47.246 67.422  1.00 91.86  ? 745  THR A CB  1 
ATOM 5812 O OG1 . THR A 1 748  ? -2.386  47.673 66.927  1.00 91.86  ? 745  THR A OG1 1 
ATOM 5813 C CG2 . THR A 1 748  ? -0.095  48.367 67.226  1.00 91.86  ? 745  THR A CG2 1 
ATOM 5814 N N   . SER A 1 749  ? -2.608  44.492 66.346  1.00 100.50 ? 746  SER A N   1 
ATOM 5815 C CA  . SER A 1 749  ? -3.411  43.267 66.447  1.00 100.50 ? 746  SER A CA  1 
ATOM 5816 C C   . SER A 1 749  ? -2.648  42.023 65.960  1.00 100.50 ? 746  SER A C   1 
ATOM 5817 O O   . SER A 1 749  ? -3.029  40.884 66.269  1.00 100.50 ? 746  SER A O   1 
ATOM 5818 C CB  . SER A 1 749  ? -4.689  43.415 65.625  1.00 141.38 ? 746  SER A CB  1 
ATOM 5819 O OG  . SER A 1 749  ? -4.401  43.343 64.237  1.00 141.38 ? 746  SER A OG  1 
ATOM 5820 N N   . GLY A 1 750  ? -1.589  42.256 65.183  1.00 97.96  ? 747  GLY A N   1 
ATOM 5821 C CA  . GLY A 1 750  ? -0.730  41.189 64.687  1.00 97.96  ? 747  GLY A CA  1 
ATOM 5822 C C   . GLY A 1 750  ? -0.902  40.999 63.199  1.00 97.96  ? 747  GLY A C   1 
ATOM 5823 O O   . GLY A 1 750  ? 0.083   40.981 62.452  1.00 97.96  ? 747  GLY A O   1 
ATOM 5824 N N   . GLY A 1 751  ? -2.163  40.874 62.780  1.00 130.70 ? 748  GLY A N   1 
ATOM 5825 C CA  . GLY A 1 751  ? -2.543  40.632 61.381  1.00 130.70 ? 748  GLY A CA  1 
ATOM 5826 C C   . GLY A 1 751  ? -2.058  41.679 60.395  1.00 130.70 ? 748  GLY A C   1 
ATOM 5827 O O   . GLY A 1 751  ? -1.250  42.546 60.743  1.00 130.70 ? 748  GLY A O   1 
ATOM 5828 N N   . THR A 1 752  ? -2.538  41.605 59.155  1.00 84.36  ? 749  THR A N   1 
ATOM 5829 C CA  . THR A 1 752  ? -2.020  42.523 58.117  1.00 84.36  ? 749  THR A CA  1 
ATOM 5830 C C   . THR A 1 752  ? -3.001  43.518 57.474  1.00 84.36  ? 749  THR A C   1 
ATOM 5831 O O   . THR A 1 752  ? -4.043  43.146 56.907  1.00 84.36  ? 749  THR A O   1 
ATOM 5832 C CB  . THR A 1 752  ? -1.101  41.836 57.032  1.00 54.28  ? 749  THR A CB  1 
ATOM 5833 O OG1 . THR A 1 752  ? -1.703  40.625 56.509  1.00 54.28  ? 749  THR A OG1 1 
ATOM 5834 C CG2 . THR A 1 752  ? 0.288   41.553 57.612  1.00 54.28  ? 749  THR A CG2 1 
ATOM 5835 N N   . THR A 1 753  ? -2.619  44.785 57.574  1.00 125.00 ? 750  THR A N   1 
ATOM 5836 C CA  . THR A 1 753  ? -3.398  45.886 57.051  1.00 125.00 ? 750  THR A CA  1 
ATOM 5837 C C   . THR A 1 753  ? -3.274  45.998 55.537  1.00 125.00 ? 750  THR A C   1 
ATOM 5838 O O   . THR A 1 753  ? -4.008  45.329 54.813  1.00 125.00 ? 750  THR A O   1 
ATOM 5839 C CB  . THR A 1 753  ? -3.002  47.212 57.717  1.00 117.78 ? 750  THR A CB  1 
ATOM 5840 O OG1 . THR A 1 753  ? -1.705  47.076 58.321  1.00 117.78 ? 750  THR A OG1 1 
ATOM 5841 C CG2 . THR A 1 753  ? -4.017  47.575 58.778  1.00 117.78 ? 750  THR A CG2 1 
ATOM 5842 N N   . ALA A 1 754  ? -2.327  46.824 55.085  1.00 97.54  ? 751  ALA A N   1 
ATOM 5843 C CA  . ALA A 1 754  ? -2.184  47.283 53.695  1.00 97.54  ? 751  ALA A CA  1 
ATOM 5844 C C   . ALA A 1 754  ? -1.555  48.668 53.809  1.00 97.54  ? 751  ALA A C   1 
ATOM 5845 O O   . ALA A 1 754  ? -1.164  49.063 54.913  1.00 97.54  ? 751  ALA A O   1 
ATOM 5846 C CB  . ALA A 1 754  ? -3.549  47.362 52.959  1.00 54.41  ? 751  ALA A CB  1 
ATOM 5847 N N   . LEU A 1 755  ? -1.465  49.405 52.694  1.00 59.83  ? 752  LEU A N   1 
ATOM 5848 C CA  . LEU A 1 755  ? -0.795  50.718 52.680  1.00 59.83  ? 752  LEU A CA  1 
ATOM 5849 C C   . LEU A 1 755  ? -1.451  51.669 51.675  1.00 59.83  ? 752  LEU A C   1 
ATOM 5850 O O   . LEU A 1 755  ? -1.144  52.875 51.646  1.00 59.83  ? 752  LEU A O   1 
ATOM 5851 C CB  . LEU A 1 755  ? 0.719   50.560 52.395  1.00 77.06  ? 752  LEU A CB  1 
ATOM 5852 C CG  . LEU A 1 755  ? 1.605   49.571 53.212  1.00 77.06  ? 752  LEU A CG  1 
ATOM 5853 C CD1 . LEU A 1 755  ? 2.992   49.335 52.582  1.00 77.06  ? 752  LEU A CD1 1 
ATOM 5854 C CD2 . LEU A 1 755  ? 1.747   49.934 54.717  1.00 77.06  ? 752  LEU A CD2 1 
ATOM 5855 N N   . ARG A 1 756  ? -2.357  51.108 50.864  1.00 46.55  ? 753  ARG A N   1 
ATOM 5856 C CA  . ARG A 1 756  ? -3.151  51.845 49.870  1.00 46.55  ? 753  ARG A CA  1 
ATOM 5857 C C   . ARG A 1 756  ? -4.224  50.941 49.234  1.00 46.55  ? 753  ARG A C   1 
ATOM 5858 O O   . ARG A 1 756  ? -4.074  49.712 49.215  1.00 46.55  ? 753  ARG A O   1 
ATOM 5859 C CB  . ARG A 1 756  ? -2.250  52.421 48.769  1.00 66.88  ? 753  ARG A CB  1 
ATOM 5860 C CG  . ARG A 1 756  ? -1.710  51.387 47.738  1.00 66.88  ? 753  ARG A CG  1 
ATOM 5861 C CD  . ARG A 1 756  ? -0.996  52.048 46.536  1.00 66.88  ? 753  ARG A CD  1 
ATOM 5862 N NE  . ARG A 1 756  ? -0.367  53.315 46.926  1.00 66.88  ? 753  ARG A NE  1 
ATOM 5863 C CZ  . ARG A 1 756  ? 0.761   53.412 47.632  1.00 66.88  ? 753  ARG A CZ  1 
ATOM 5864 N NH1 . ARG A 1 756  ? 1.397   52.304 48.021  1.00 66.88  ? 753  ARG A NH1 1 
ATOM 5865 N NH2 . ARG A 1 756  ? 1.234   54.621 47.958  1.00 66.88  ? 753  ARG A NH2 1 
ATOM 5866 N N   . PRO A 1 757  ? -5.289  51.544 48.674  1.00 58.80  ? 754  PRO A N   1 
ATOM 5867 C CA  . PRO A 1 757  ? -6.268  50.745 47.927  1.00 58.80  ? 754  PRO A CA  1 
ATOM 5868 C C   . PRO A 1 757  ? -5.565  50.168 46.730  1.00 58.80  ? 754  PRO A C   1 
ATOM 5869 O O   . PRO A 1 757  ? -4.694  50.828 46.160  1.00 58.80  ? 754  PRO A O   1 
ATOM 5870 C CB  . PRO A 1 757  ? -7.297  51.779 47.446  1.00 45.93  ? 754  PRO A CB  1 
ATOM 5871 C CG  . PRO A 1 757  ? -6.551  53.113 47.469  1.00 45.93  ? 754  PRO A CG  1 
ATOM 5872 C CD  . PRO A 1 757  ? -5.603  52.988 48.656  1.00 45.93  ? 754  PRO A CD  1 
ATOM 5873 N N   . SER A 1 758  ? -5.917  48.949 46.361  1.00 58.32  ? 755  SER A N   1 
ATOM 5874 C CA  . SER A 1 758  ? -5.251  48.261 45.269  1.00 58.32  ? 755  SER A CA  1 
ATOM 5875 C C   . SER A 1 758  ? -6.298  47.764 44.349  1.00 58.32  ? 755  SER A C   1 
ATOM 5876 O O   . SER A 1 758  ? -7.450  47.647 44.704  1.00 58.32  ? 755  SER A O   1 
ATOM 5877 C CB  . SER A 1 758  ? -4.518  47.009 45.758  1.00 47.17  ? 755  SER A CB  1 
ATOM 5878 O OG  . SER A 1 758  ? -3.763  47.233 46.943  1.00 47.17  ? 755  SER A OG  1 
ATOM 5879 N N   . ALA A 1 759  ? -5.883  47.404 43.165  1.00 52.25  ? 756  ALA A N   1 
ATOM 5880 C CA  . ALA A 1 759  ? -6.750  46.715 42.254  1.00 52.25  ? 756  ALA A CA  1 
ATOM 5881 C C   . ALA A 1 759  ? -7.476  45.555 42.902  1.00 52.25  ? 756  ALA A C   1 
ATOM 5882 O O   . ALA A 1 759  ? -8.497  45.105 42.398  1.00 52.25  ? 756  ALA A O   1 
ATOM 5883 C CB  . ALA A 1 759  ? -5.934  46.212 41.097  1.00 19.25  ? 756  ALA A CB  1 
ATOM 5884 N N   . SER A 1 760  ? -6.954  45.041 44.000  1.00 55.58  ? 757  SER A N   1 
ATOM 5885 C CA  . SER A 1 760  ? -7.496  43.794 44.518  1.00 55.58  ? 757  SER A CA  1 
ATOM 5886 C C   . SER A 1 760  ? -8.359  44.042 45.786  1.00 55.58  ? 757  SER A C   1 
ATOM 5887 O O   . SER A 1 760  ? -9.093  43.160 46.290  1.00 55.58  ? 757  SER A O   1 
ATOM 5888 C CB  . SER A 1 760  ? -6.350  42.851 44.788  1.00 47.08  ? 757  SER A CB  1 
ATOM 5889 O OG  . SER A 1 760  ? -5.463  43.511 45.663  1.00 47.08  ? 757  SER A OG  1 
ATOM 5890 N N   . THR A 1 761  ? -8.275  45.268 46.279  1.00 50.21  ? 758  THR A N   1 
ATOM 5891 C CA  . THR A 1 761  ? -9.105  45.672 47.370  1.00 50.21  ? 758  THR A CA  1 
ATOM 5892 C C   . THR A 1 761  ? -10.312 46.446 46.850  1.00 50.21  ? 758  THR A C   1 
ATOM 5893 O O   . THR A 1 761  ? -11.389 46.322 47.411  1.00 50.21  ? 758  THR A O   1 
ATOM 5894 C CB  . THR A 1 761  ? -8.315  46.467 48.421  1.00 49.29  ? 758  THR A CB  1 
ATOM 5895 O OG1 . THR A 1 761  ? -7.702  47.604 47.809  1.00 49.29  ? 758  THR A OG1 1 
ATOM 5896 C CG2 . THR A 1 761  ? -7.238  45.592 49.046  1.00 49.29  ? 758  THR A CG2 1 
ATOM 5897 N N   . GLN A 1 762  ? -10.148 47.218 45.780  1.00 50.65  ? 759  GLN A N   1 
ATOM 5898 C CA  . GLN A 1 762  ? -11.250 47.942 45.148  1.00 50.65  ? 759  GLN A CA  1 
ATOM 5899 C C   . GLN A 1 762  ? -12.006 47.046 44.180  1.00 50.65  ? 759  GLN A C   1 
ATOM 5900 O O   . GLN A 1 762  ? -12.683 47.538 43.278  1.00 50.65  ? 759  GLN A O   1 
ATOM 5901 C CB  . GLN A 1 762  ? -10.710 49.157 44.394  1.00 88.59  ? 759  GLN A CB  1 
ATOM 5902 C CG  . GLN A 1 762  ? -9.800  49.999 45.224  1.00 88.59  ? 759  GLN A CG  1 
ATOM 5903 C CD  . GLN A 1 762  ? -10.310 50.081 46.647  1.00 88.59  ? 759  GLN A CD  1 
ATOM 5904 O OE1 . GLN A 1 762  ? -9.910  49.294 47.515  1.00 88.59  ? 759  GLN A OE1 1 
ATOM 5905 N NE2 . GLN A 1 762  ? -11.234 51.007 46.889  1.00 88.59  ? 759  GLN A NE2 1 
ATOM 5906 N N   . ALA A 1 763  ? -11.891 45.729 44.346  1.00 53.47  ? 760  ALA A N   1 
ATOM 5907 C CA  . ALA A 1 763  ? -12.445 44.775 43.371  1.00 53.47  ? 760  ALA A CA  1 
ATOM 5908 C C   . ALA A 1 763  ? -13.970 44.745 43.437  1.00 53.47  ? 760  ALA A C   1 
ATOM 5909 O O   . ALA A 1 763  ? -14.524 44.888 44.521  1.00 53.47  ? 760  ALA A O   1 
ATOM 5910 C CB  . ALA A 1 763  ? -11.878 43.391 43.628  1.00 59.48  ? 760  ALA A CB  1 
ATOM 5911 N N   . LEU A 1 764  ? -14.650 44.533 42.311  1.00 81.90  ? 761  LEU A N   1 
ATOM 5912 C CA  . LEU A 1 764  ? -16.128 44.545 42.299  1.00 81.90  ? 761  LEU A CA  1 
ATOM 5913 C C   . LEU A 1 764  ? -16.779 43.491 43.213  1.00 81.90  ? 761  LEU A C   1 
ATOM 5914 O O   . LEU A 1 764  ? -17.642 43.826 44.038  1.00 81.90  ? 761  LEU A O   1 
ATOM 5915 C CB  . LEU A 1 764  ? -16.695 44.494 40.869  1.00 64.59  ? 761  LEU A CB  1 
ATOM 5916 C CG  . LEU A 1 764  ? -16.210 45.570 39.878  1.00 64.59  ? 761  LEU A CG  1 
ATOM 5917 C CD1 . LEU A 1 764  ? -17.099 45.673 38.638  1.00 64.59  ? 761  LEU A CD1 1 
ATOM 5918 C CD2 . LEU A 1 764  ? -16.056 46.948 40.527  1.00 64.59  ? 761  LEU A CD2 1 
ATOM 5919 N N   . SER A 1 765  ? -16.370 42.236 43.061  1.00 86.67  ? 762  SER A N   1 
ATOM 5920 C CA  . SER A 1 765  ? -16.704 41.191 44.024  1.00 86.67  ? 762  SER A CA  1 
ATOM 5921 C C   . SER A 1 765  ? -15.418 40.722 44.708  1.00 86.67  ? 762  SER A C   1 
ATOM 5922 O O   . SER A 1 765  ? -14.456 41.494 44.756  1.00 86.67  ? 762  SER A O   1 
ATOM 5923 C CB  . SER A 1 765  ? -17.430 40.044 43.347  1.00 68.77  ? 762  SER A CB  1 
ATOM 5924 O OG  . SER A 1 765  ? -16.796 39.697 42.150  1.00 68.77  ? 762  SER A OG  1 
ATOM 5925 N N   . SER A 1 766  ? -15.390 39.500 45.257  1.00 74.63  ? 763  SER A N   1 
ATOM 5926 C CA  . SER A 1 766  ? -14.164 38.960 45.879  1.00 74.63  ? 763  SER A CA  1 
ATOM 5927 C C   . SER A 1 766  ? -14.298 37.627 46.663  1.00 74.63  ? 763  SER A C   1 
ATOM 5928 O O   . SER A 1 766  ? -15.370 37.269 47.116  1.00 74.63  ? 763  SER A O   1 
ATOM 5929 C CB  . SER A 1 766  ? -13.479 40.031 46.734  1.00 47.67  ? 763  SER A CB  1 
ATOM 5930 O OG  . SER A 1 766  ? -13.929 39.970 48.058  1.00 47.67  ? 763  SER A OG  1 
ATOM 5931 N N   . SER A 1 767  ? -13.188 36.910 46.809  1.00 48.94  ? 764  SER A N   1 
ATOM 5932 C CA  . SER A 1 767  ? -13.142 35.599 47.444  1.00 48.94  ? 764  SER A CA  1 
ATOM 5933 C C   . SER A 1 767  ? -11.917 35.518 48.307  1.00 48.94  ? 764  SER A C   1 
ATOM 5934 O O   . SER A 1 767  ? -11.171 36.482 48.411  1.00 48.94  ? 764  SER A O   1 
ATOM 5935 C CB  . SER A 1 767  ? -13.006 34.509 46.399  1.00 47.33  ? 764  SER A CB  1 
ATOM 5936 O OG  . SER A 1 767  ? -14.052 34.573 45.458  1.00 47.33  ? 764  SER A OG  1 
ATOM 5937 N N   . VAL A 1 768  ? -11.705 34.370 48.930  1.00 62.61  ? 765  VAL A N   1 
ATOM 5938 C CA  . VAL A 1 768  ? -10.501 34.135 49.700  1.00 62.61  ? 765  VAL A CA  1 
ATOM 5939 C C   . VAL A 1 768  ? -10.354 32.633 49.839  1.00 62.61  ? 765  VAL A C   1 
ATOM 5940 O O   . VAL A 1 768  ? -11.354 31.916 49.887  1.00 62.61  ? 765  VAL A O   1 
ATOM 5941 C CB  . VAL A 1 768  ? -10.587 34.736 51.084  1.00 48.51  ? 765  VAL A CB  1 
ATOM 5942 C CG1 . VAL A 1 768  ? -11.258 33.754 52.000  1.00 48.51  ? 765  VAL A CG1 1 
ATOM 5943 C CG2 . VAL A 1 768  ? -9.202  35.006 51.635  1.00 48.51  ? 765  VAL A CG2 1 
ATOM 5944 N N   . SER A 1 769  ? -9.123  32.138 49.886  1.00 68.16  ? 766  SER A N   1 
ATOM 5945 C CA  . SER A 1 769  ? -8.980  30.695 49.919  1.00 68.16  ? 766  SER A CA  1 
ATOM 5946 C C   . SER A 1 769  ? -9.433  30.209 51.268  1.00 68.16  ? 766  SER A C   1 
ATOM 5947 O O   . SER A 1 769  ? -9.062  30.784 52.309  1.00 68.16  ? 766  SER A O   1 
ATOM 5948 C CB  . SER A 1 769  ? -7.569  30.201 49.552  1.00 61.31  ? 766  SER A CB  1 
ATOM 5949 O OG  . SER A 1 769  ? -7.543  29.644 48.234  1.00 61.31  ? 766  SER A OG  1 
ATOM 5950 N N   . SER A 1 770  ? -10.294 29.192 51.212  1.00 74.69  ? 767  SER A N   1 
ATOM 5951 C CA  . SER A 1 770  ? -10.820 28.521 52.385  1.00 74.69  ? 767  SER A CA  1 
ATOM 5952 C C   . SER A 1 770  ? -9.907  27.360 52.746  1.00 74.69  ? 767  SER A C   1 
ATOM 5953 O O   . SER A 1 770  ? -9.391  27.310 53.860  1.00 74.69  ? 767  SER A O   1 
ATOM 5954 C CB  . SER A 1 770  ? -12.248 28.045 52.129  1.00 62.15  ? 767  SER A CB  1 
ATOM 5955 O OG  . SER A 1 770  ? -12.298 27.227 50.985  1.00 62.15  ? 767  SER A OG  1 
ATOM 5956 N N   . SER A 1 771  ? -9.714  26.446 51.791  1.00 74.00  ? 768  SER A N   1 
ATOM 5957 C CA  . SER A 1 771  ? -8.720  25.349 51.855  1.00 74.00  ? 768  SER A CA  1 
ATOM 5958 C C   . SER A 1 771  ? -7.857  25.233 53.141  1.00 74.00  ? 768  SER A C   1 
ATOM 5959 O O   . SER A 1 771  ? -7.296  26.222 53.640  1.00 74.00  ? 768  SER A O   1 
ATOM 5960 C CB  . SER A 1 771  ? -7.829  25.392 50.603  1.00 68.50  ? 768  SER A CB  1 
ATOM 5961 O OG  . SER A 1 771  ? -6.667  24.595 50.776  1.00 68.50  ? 768  SER A OG  1 
ATOM 5962 N N   . LYS A 1 772  ? -7.747  24.009 53.653  1.00 90.72  ? 769  LYS A N   1 
ATOM 5963 C CA  . LYS A 1 772  ? -7.140  23.780 54.965  1.00 90.72  ? 769  LYS A CA  1 
ATOM 5964 C C   . LYS A 1 772  ? -5.921  22.845 54.961  1.00 90.72  ? 769  LYS A C   1 
ATOM 5965 O O   . LYS A 1 772  ? -5.505  22.349 56.026  1.00 90.72  ? 769  LYS A O   1 
ATOM 5966 C CB  . LYS A 1 772  ? -8.202  23.267 55.943  1.00 112.22 ? 769  LYS A CB  1 
ATOM 5967 C CG  . LYS A 1 772  ? -8.870  24.349 56.773  1.00 112.22 ? 769  LYS A CG  1 
ATOM 5968 C CD  . LYS A 1 772  ? -7.953  24.811 57.909  1.00 112.22 ? 769  LYS A CD  1 
ATOM 5969 C CE  . LYS A 1 772  ? -8.648  25.819 58.819  1.00 112.22 ? 769  LYS A CE  1 
ATOM 5970 N NZ  . LYS A 1 772  ? -9.204  26.981 58.042  1.00 112.22 ? 769  LYS A NZ  1 
ATOM 5971 N N   . LEU A 1 773  ? -5.330  22.657 53.775  1.00 93.74  ? 770  LEU A N   1 
ATOM 5972 C CA  . LEU A 1 773  ? -4.273  21.653 53.536  1.00 93.74  ? 770  LEU A CA  1 
ATOM 5973 C C   . LEU A 1 773  ? -3.017  21.761 54.397  1.00 93.74  ? 770  LEU A C   1 
ATOM 5974 O O   . LEU A 1 773  ? -2.165  20.872 54.357  1.00 93.74  ? 770  LEU A O   1 
ATOM 5975 C CB  . LEU A 1 773  ? -3.875  21.625 52.060  1.00 85.91  ? 770  LEU A CB  1 
ATOM 5976 C CG  . LEU A 1 773  ? -4.996  21.327 51.069  1.00 85.91  ? 770  LEU A CG  1 
ATOM 5977 C CD1 . LEU A 1 773  ? -4.415  20.712 49.824  1.00 85.91  ? 770  LEU A CD1 1 
ATOM 5978 C CD2 . LEU A 1 773  ? -6.062  20.402 51.664  1.00 85.91  ? 770  LEU A CD2 1 
ATOM 5979 N N   . PHE A 1 774  ? -2.910  22.839 55.169  1.00 97.49  ? 771  PHE A N   1 
ATOM 5980 C CA  . PHE A 1 774  ? -1.755  23.059 56.033  1.00 97.49  ? 771  PHE A CA  1 
ATOM 5981 C C   . PHE A 1 774  ? -2.175  23.310 57.511  1.00 97.49  ? 771  PHE A C   1 
ATOM 5982 O O   . PHE A 1 774  ? -3.373  23.458 57.813  1.00 97.49  ? 771  PHE A O   1 
ATOM 5983 C CB  . PHE A 1 774  ? -0.844  24.160 55.436  1.00 84.85  ? 771  PHE A CB  1 
ATOM 5984 C CG  . PHE A 1 774  ? -0.494  23.949 53.950  1.00 84.85  ? 771  PHE A CG  1 
ATOM 5985 C CD1 . PHE A 1 774  ? -1.125  24.691 52.948  1.00 84.85  ? 771  PHE A CD1 1 
ATOM 5986 C CD2 . PHE A 1 774  ? 0.462   23.010 53.556  1.00 84.85  ? 771  PHE A CD2 1 
ATOM 5987 C CE1 . PHE A 1 774  ? -0.819  24.498 51.569  1.00 84.85  ? 771  PHE A CE1 1 
ATOM 5988 C CE2 . PHE A 1 774  ? 0.774   22.817 52.181  1.00 84.85  ? 771  PHE A CE2 1 
ATOM 5989 C CZ  . PHE A 1 774  ? 0.124   23.566 51.192  1.00 84.85  ? 771  PHE A CZ  1 
ATOM 5990 N N   . SER A 1 775  ? -1.194  23.330 58.424  1.00 218.25 ? 772  SER A N   1 
ATOM 5991 C CA  . SER A 1 775  ? -1.468  23.241 59.872  1.00 218.25 ? 772  SER A CA  1 
ATOM 5992 C C   . SER A 1 775  ? -0.542  23.993 60.825  1.00 218.25 ? 772  SER A C   1 
ATOM 5993 O O   . SER A 1 775  ? -0.957  24.964 61.458  1.00 218.25 ? 772  SER A O   1 
ATOM 5994 C CB  . SER A 1 775  ? -1.484  21.778 60.307  1.00 81.00  ? 772  SER A CB  1 
ATOM 5995 O OG  . SER A 1 775  ? -2.506  21.082 59.633  1.00 81.00  ? 772  SER A OG  1 
ATOM 5996 N N   . SER A 1 776  ? 0.693   23.503 60.945  1.00 206.17 ? 773  SER A N   1 
ATOM 5997 C CA  . SER A 1 776  ? 1.671   23.946 61.951  1.00 206.17 ? 773  SER A CA  1 
ATOM 5998 C C   . SER A 1 776  ? 1.746   25.482 62.145  1.00 206.17 ? 773  SER A C   1 
ATOM 5999 O O   . SER A 1 776  ? 2.647   26.045 62.721  1.00 206.17 ? 773  SER A O   1 
ATOM 6000 C CB  . SER A 1 776  ? 3.055   23.415 61.555  1.00 99.74  ? 773  SER A CB  1 
ATOM 6001 O OG  . SER A 1 776  ? 3.500   24.068 60.361  1.00 99.74  ? 773  SER A OG  1 
ATOM 6002 N N   . GLY A 1 786  ? 5.232   47.373 60.411  1.00 128.99 ? 783  GLY A N   1 
ATOM 6003 C CA  . GLY A 1 786  ? 6.521   46.727 60.632  1.00 128.99 ? 783  GLY A CA  1 
ATOM 6004 C C   . GLY A 1 786  ? 6.773   45.589 59.661  1.00 128.99 ? 783  GLY A C   1 
ATOM 6005 O O   . GLY A 1 786  ? 6.942   45.815 58.461  1.00 128.99 ? 783  GLY A O   1 
ATOM 6006 N N   . GLU A 1 787  ? 6.805   44.367 60.191  1.00 88.07  ? 784  GLU A N   1 
ATOM 6007 C CA  . GLU A 1 787  ? 6.998   43.138 59.399  1.00 88.07  ? 784  GLU A CA  1 
ATOM 6008 C C   . GLU A 1 787  ? 6.192   43.141 58.094  1.00 88.07  ? 784  GLU A C   1 
ATOM 6009 O O   . GLU A 1 787  ? 4.957   43.273 58.112  1.00 88.07  ? 784  GLU A O   1 
ATOM 6010 C CB  . GLU A 1 787  ? 6.617   41.910 60.242  1.00 128.98 ? 784  GLU A CB  1 
ATOM 6011 C CG  . GLU A 1 787  ? 7.438   41.728 61.527  1.00 128.98 ? 784  GLU A CG  1 
ATOM 6012 C CD  . GLU A 1 787  ? 6.686   40.983 62.629  1.00 128.98 ? 784  GLU A CD  1 
ATOM 6013 O OE1 . GLU A 1 787  ? 7.353   40.440 63.534  1.00 128.98 ? 784  GLU A OE1 1 
ATOM 6014 O OE2 . GLU A 1 787  ? 5.436   40.941 62.601  1.00 128.98 ? 784  GLU A OE2 1 
ATOM 6015 N N   . GLU A 1 788  ? 6.890   42.999 56.968  1.00 82.88  ? 785  GLU A N   1 
ATOM 6016 C CA  . GLU A 1 788  ? 6.236   43.063 55.649  1.00 82.88  ? 785  GLU A CA  1 
ATOM 6017 C C   . GLU A 1 788  ? 5.861   41.705 55.089  1.00 82.88  ? 785  GLU A C   1 
ATOM 6018 O O   . GLU A 1 788  ? 6.540   40.724 55.358  1.00 82.88  ? 785  GLU A O   1 
ATOM 6019 C CB  . GLU A 1 788  ? 7.118   43.787 54.639  1.00 80.03  ? 785  GLU A CB  1 
ATOM 6020 C CG  . GLU A 1 788  ? 7.319   45.247 54.964  1.00 80.03  ? 785  GLU A CG  1 
ATOM 6021 C CD  . GLU A 1 788  ? 7.422   46.111 53.724  1.00 80.03  ? 785  GLU A CD  1 
ATOM 6022 O OE1 . GLU A 1 788  ? 7.895   45.610 52.672  1.00 80.03  ? 785  GLU A OE1 1 
ATOM 6023 O OE2 . GLU A 1 788  ? 7.029   47.303 53.806  1.00 80.03  ? 785  GLU A OE2 1 
ATOM 6024 N N   . VAL A 1 789  ? 4.781   41.652 54.315  1.00 59.99  ? 786  VAL A N   1 
ATOM 6025 C CA  . VAL A 1 789  ? 4.428   40.445 53.571  1.00 59.99  ? 786  VAL A CA  1 
ATOM 6026 C C   . VAL A 1 789  ? 3.698   40.788 52.269  1.00 59.99  ? 786  VAL A C   1 
ATOM 6027 O O   . VAL A 1 789  ? 3.255   41.910 52.058  1.00 59.99  ? 786  VAL A O   1 
ATOM 6028 C CB  . VAL A 1 789  ? 3.622   39.429 54.432  1.00 75.03  ? 786  VAL A CB  1 
ATOM 6029 C CG1 . VAL A 1 789  ? 2.112   39.798 54.497  1.00 75.03  ? 786  VAL A CG1 1 
ATOM 6030 C CG2 . VAL A 1 789  ? 3.829   38.009 53.919  1.00 75.03  ? 786  VAL A CG2 1 
ATOM 6031 N N   . GLU A 1 790  ? 3.611   39.815 51.385  1.00 43.60  ? 787  GLU A N   1 
ATOM 6032 C CA  . GLU A 1 790  ? 2.970   40.012 50.121  1.00 43.60  ? 787  GLU A CA  1 
ATOM 6033 C C   . GLU A 1 790  ? 1.604   39.389 50.253  1.00 43.60  ? 787  GLU A C   1 
ATOM 6034 O O   . GLU A 1 790  ? 1.431   38.459 51.025  1.00 43.60  ? 787  GLU A O   1 
ATOM 6035 C CB  . GLU A 1 790  ? 3.776   39.340 49.004  1.00 41.06  ? 787  GLU A CB  1 
ATOM 6036 C CG  . GLU A 1 790  ? 4.854   40.244 48.406  1.00 41.06  ? 787  GLU A CG  1 
ATOM 6037 C CD  . GLU A 1 790  ? 5.487   39.716 47.098  1.00 41.06  ? 787  GLU A CD  1 
ATOM 6038 O OE1 . GLU A 1 790  ? 6.632   40.148 46.805  1.00 41.06  ? 787  GLU A OE1 1 
ATOM 6039 O OE2 . GLU A 1 790  ? 4.872   38.884 46.364  1.00 41.06  ? 787  GLU A OE2 1 
ATOM 6040 N N   . VAL A 1 791  ? 0.612   39.904 49.539  1.00 56.82  ? 788  VAL A N   1 
ATOM 6041 C CA  . VAL A 1 791  ? -0.686  39.263 49.541  1.00 56.82  ? 788  VAL A CA  1 
ATOM 6042 C C   . VAL A 1 791  ? -0.998  39.145 48.089  1.00 56.82  ? 788  VAL A C   1 
ATOM 6043 O O   . VAL A 1 791  ? -0.849  40.111 47.353  1.00 56.82  ? 788  VAL A O   1 
ATOM 6044 C CB  . VAL A 1 791  ? -1.757  40.090 50.296  1.00 44.51  ? 788  VAL A CB  1 
ATOM 6045 C CG1 . VAL A 1 791  ? -3.153  39.482 50.117  1.00 44.51  ? 788  VAL A CG1 1 
ATOM 6046 C CG2 . VAL A 1 791  ? -1.439  40.167 51.776  1.00 44.51  ? 788  VAL A CG2 1 
ATOM 6047 N N   . HIS A 1 792  ? -1.407  37.954 47.681  1.00 59.90  ? 789  HIS A N   1 
ATOM 6048 C CA  . HIS A 1 792  ? -1.469  37.607 46.277  1.00 59.90  ? 789  HIS A CA  1 
ATOM 6049 C C   . HIS A 1 792  ? -2.880  37.331 45.844  1.00 59.90  ? 789  HIS A C   1 
ATOM 6050 O O   . HIS A 1 792  ? -3.613  36.681 46.575  1.00 59.90  ? 789  HIS A O   1 
ATOM 6051 C CB  . HIS A 1 792  ? -0.642  36.343 46.019  1.00 50.13  ? 789  HIS A CB  1 
ATOM 6052 C CG  . HIS A 1 792  ? 0.819   36.599 45.870  1.00 50.13  ? 789  HIS A CG  1 
ATOM 6053 N ND1 . HIS A 1 792  ? 1.469   36.487 44.662  1.00 50.13  ? 789  HIS A ND1 1 
ATOM 6054 C CD2 . HIS A 1 792  ? 1.756   36.978 46.773  1.00 50.13  ? 789  HIS A CD2 1 
ATOM 6055 C CE1 . HIS A 1 792  ? 2.744   36.782 44.830  1.00 50.13  ? 789  HIS A CE1 1 
ATOM 6056 N NE2 . HIS A 1 792  ? 2.943   37.088 46.100  1.00 50.13  ? 789  HIS A NE2 1 
ATOM 6057 N N   . ASN A 1 793  ? -3.250  37.777 44.648  1.00 50.33  ? 790  ASN A N   1 
ATOM 6058 C CA  . ASN A 1 793  ? -4.574  37.509 44.118  1.00 50.33  ? 790  ASN A CA  1 
ATOM 6059 C C   . ASN A 1 793  ? -4.572  37.035 42.707  1.00 50.33  ? 790  ASN A C   1 
ATOM 6060 O O   . ASN A 1 793  ? -3.739  37.453 41.918  1.00 50.33  ? 790  ASN A O   1 
ATOM 6061 C CB  . ASN A 1 793  ? -5.402  38.774 44.132  1.00 61.37  ? 790  ASN A CB  1 
ATOM 6062 C CG  . ASN A 1 793  ? -5.610  39.299 45.510  1.00 61.37  ? 790  ASN A CG  1 
ATOM 6063 O OD1 . ASN A 1 793  ? -6.509  38.838 46.234  1.00 61.37  ? 790  ASN A OD1 1 
ATOM 6064 N ND2 . ASN A 1 793  ? -4.781  40.272 45.902  1.00 61.37  ? 790  ASN A ND2 1 
ATOM 6065 N N   . LEU A 1 794  ? -5.517  36.167 42.381  1.00 53.52  ? 791  LEU A N   1 
ATOM 6066 C CA  . LEU A 1 794  ? -5.956  36.055 41.021  1.00 53.52  ? 791  LEU A CA  1 
ATOM 6067 C C   . LEU A 1 794  ? -6.934  37.221 40.847  1.00 53.52  ? 791  LEU A C   1 
ATOM 6068 O O   . LEU A 1 794  ? -7.541  37.664 41.803  1.00 53.52  ? 791  LEU A O   1 
ATOM 6069 C CB  . LEU A 1 794  ? -6.605  34.696 40.779  1.00 39.23  ? 791  LEU A CB  1 
ATOM 6070 C CG  . LEU A 1 794  ? -7.360  34.423 39.459  1.00 39.23  ? 791  LEU A CG  1 
ATOM 6071 C CD1 . LEU A 1 794  ? -6.580  34.884 38.188  1.00 39.23  ? 791  LEU A CD1 1 
ATOM 6072 C CD2 . LEU A 1 794  ? -7.796  32.950 39.322  1.00 39.23  ? 791  LEU A CD2 1 
ATOM 6073 N N   . LEU A 1 795  ? -7.022  37.767 39.643  1.00 44.76  ? 792  LEU A N   1 
ATOM 6074 C CA  . LEU A 1 795  ? -7.872  38.918 39.359  1.00 44.76  ? 792  LEU A CA  1 
ATOM 6075 C C   . LEU A 1 795  ? -8.578  38.601 38.077  1.00 44.76  ? 792  LEU A C   1 
ATOM 6076 O O   . LEU A 1 795  ? -8.051  37.840 37.246  1.00 44.76  ? 792  LEU A O   1 
ATOM 6077 C CB  . LEU A 1 795  ? -7.051  40.183 39.155  1.00 38.99  ? 792  LEU A CB  1 
ATOM 6078 C CG  . LEU A 1 795  ? -6.280  40.697 40.375  1.00 38.99  ? 792  LEU A CG  1 
ATOM 6079 C CD1 . LEU A 1 795  ? -5.635  42.061 40.116  1.00 38.99  ? 792  LEU A CD1 1 
ATOM 6080 C CD2 . LEU A 1 795  ? -7.171  40.770 41.593  1.00 38.99  ? 792  LEU A CD2 1 
ATOM 6081 N N   . ILE A 1 796  ? -9.774  39.142 37.902  1.00 44.19  ? 793  ILE A N   1 
ATOM 6082 C CA  . ILE A 1 796  ? -10.471 38.867 36.677  1.00 44.19  ? 793  ILE A CA  1 
ATOM 6083 C C   . ILE A 1 796  ? -10.786 40.160 35.981  1.00 44.19  ? 793  ILE A C   1 
ATOM 6084 O O   . ILE A 1 796  ? -11.512 40.997 36.522  1.00 44.19  ? 793  ILE A O   1 
ATOM 6085 C CB  . ILE A 1 796  ? -11.734 38.062 36.912  1.00 55.58  ? 793  ILE A CB  1 
ATOM 6086 C CG1 . ILE A 1 796  ? -11.409 36.789 37.686  1.00 55.58  ? 793  ILE A CG1 1 
ATOM 6087 C CG2 . ILE A 1 796  ? -12.366 37.684 35.566  1.00 55.58  ? 793  ILE A CG2 1 
ATOM 6088 C CD1 . ILE A 1 796  ? -10.810 35.681 36.836  1.00 55.58  ? 793  ILE A CD1 1 
ATOM 6089 N N   . ILE A 1 797  ? -10.241 40.339 34.786  1.00 46.51  ? 794  ILE A N   1 
ATOM 6090 C CA  . ILE A 1 797  ? -10.409 41.623 34.130  1.00 46.51  ? 794  ILE A CA  1 
ATOM 6091 C C   . ILE A 1 797  ? -11.302 41.571 32.902  1.00 46.51  ? 794  ILE A C   1 
ATOM 6092 O O   . ILE A 1 797  ? -11.072 40.807 31.937  1.00 46.51  ? 794  ILE A O   1 
ATOM 6093 C CB  . ILE A 1 797  ? -9.057  42.351 33.840  1.00 48.50  ? 794  ILE A CB  1 
ATOM 6094 C CG1 . ILE A 1 797  ? -8.520  43.014 35.113  1.00 48.50  ? 794  ILE A CG1 1 
ATOM 6095 C CG2 . ILE A 1 797  ? -9.253  43.462 32.833  1.00 48.50  ? 794  ILE A CG2 1 
ATOM 6096 C CD1 . ILE A 1 797  ? -7.799  42.098 36.042  1.00 48.50  ? 794  ILE A CD1 1 
ATOM 6097 N N   . ASP A 1 798  ? -12.331 42.404 32.942  1.00 43.16  ? 795  ASP A N   1 
ATOM 6098 C CA  . ASP A 1 798  ? -13.171 42.513 31.776  1.00 43.16  ? 795  ASP A CA  1 
ATOM 6099 C C   . ASP A 1 798  ? -12.281 42.944 30.599  1.00 43.16  ? 795  ASP A C   1 
ATOM 6100 O O   . ASP A 1 798  ? -11.541 43.952 30.680  1.00 43.16  ? 795  ASP A O   1 
ATOM 6101 C CB  . ASP A 1 798  ? -14.293 43.518 32.031  1.00 59.09  ? 795  ASP A CB  1 
ATOM 6102 C CG  . ASP A 1 798  ? -15.345 43.506 30.929  1.00 59.09  ? 795  ASP A CG  1 
ATOM 6103 O OD1 . ASP A 1 798  ? -15.261 44.364 30.007  1.00 59.09  ? 795  ASP A OD1 1 
ATOM 6104 O OD2 . ASP A 1 798  ? -16.254 42.636 30.994  1.00 59.09  ? 795  ASP A OD2 1 
ATOM 6105 N N   . GLN A 1 799  ? -12.331 42.196 29.509  1.00 56.82  ? 796  GLN A N   1 
ATOM 6106 C CA  . GLN A 1 799  ? -11.478 42.558 28.388  1.00 56.82  ? 796  GLN A CA  1 
ATOM 6107 C C   . GLN A 1 799  ? -11.912 43.824 27.698  1.00 56.82  ? 796  GLN A C   1 
ATOM 6108 O O   . GLN A 1 799  ? -11.181 44.326 26.875  1.00 56.82  ? 796  GLN A O   1 
ATOM 6109 C CB  . GLN A 1 799  ? -11.411 41.448 27.359  1.00 67.34  ? 796  GLN A CB  1 
ATOM 6110 C CG  . GLN A 1 799  ? -12.604 41.430 26.460  1.00 67.34  ? 796  GLN A CG  1 
ATOM 6111 C CD  . GLN A 1 799  ? -12.457 40.471 25.325  1.00 67.34  ? 796  GLN A CD  1 
ATOM 6112 O OE1 . GLN A 1 799  ? -12.303 40.881 24.171  1.00 67.34  ? 796  GLN A OE1 1 
ATOM 6113 N NE2 . GLN A 1 799  ? -12.498 39.183 25.633  1.00 67.34  ? 796  GLN A NE2 1 
ATOM 6114 N N   . HIS A 1 800  ? -13.105 44.326 28.001  1.00 58.78  ? 797  HIS A N   1 
ATOM 6115 C CA  . HIS A 1 800  ? -13.656 45.487 27.291  1.00 58.78  ? 797  HIS A CA  1 
ATOM 6116 C C   . HIS A 1 800  ? -13.560 46.731 28.113  1.00 58.78  ? 797  HIS A C   1 
ATOM 6117 O O   . HIS A 1 800  ? -13.208 47.785 27.618  1.00 58.78  ? 797  HIS A O   1 
ATOM 6118 C CB  . HIS A 1 800  ? -15.109 45.254 26.894  1.00 61.13  ? 797  HIS A CB  1 
ATOM 6119 C CG  . HIS A 1 800  ? -15.277 44.264 25.792  1.00 61.13  ? 797  HIS A CG  1 
ATOM 6120 N ND1 . HIS A 1 800  ? -15.158 44.606 24.462  1.00 61.13  ? 797  HIS A ND1 1 
ATOM 6121 C CD2 . HIS A 1 800  ? -15.546 42.937 25.818  1.00 61.13  ? 797  HIS A CD2 1 
ATOM 6122 C CE1 . HIS A 1 800  ? -15.343 43.532 23.715  1.00 61.13  ? 797  HIS A CE1 1 
ATOM 6123 N NE2 . HIS A 1 800  ? -15.583 42.505 24.513  1.00 61.13  ? 797  HIS A NE2 1 
ATOM 6124 N N   . THR A 1 801  ? -13.876 46.598 29.383  1.00 56.44  ? 798  THR A N   1 
ATOM 6125 C CA  . THR A 1 801  ? -13.845 47.723 30.303  1.00 56.44  ? 798  THR A CA  1 
ATOM 6126 C C   . THR A 1 801  ? -12.552 47.836 31.124  1.00 56.44  ? 798  THR A C   1 
ATOM 6127 O O   . THR A 1 801  ? -12.291 48.866 31.740  1.00 56.44  ? 798  THR A O   1 
ATOM 6128 C CB  . THR A 1 801  ? -15.000 47.600 31.279  1.00 54.53  ? 798  THR A CB  1 
ATOM 6129 O OG1 . THR A 1 801  ? -14.895 46.357 31.995  1.00 54.53  ? 798  THR A OG1 1 
ATOM 6130 C CG2 . THR A 1 801  ? -16.293 47.622 30.512  1.00 54.53  ? 798  THR A CG2 1 
ATOM 6131 N N   . PHE A 1 802  ? -11.770 46.758 31.140  1.00 57.43  ? 799  PHE A N   1 
ATOM 6132 C CA  . PHE A 1 802  ? -10.614 46.621 32.031  1.00 57.43  ? 799  PHE A CA  1 
ATOM 6133 C C   . PHE A 1 802  ? -10.913 46.952 33.504  1.00 57.43  ? 799  PHE A C   1 
ATOM 6134 O O   . PHE A 1 802  ? -10.226 47.730 34.157  1.00 57.43  ? 799  PHE A O   1 
ATOM 6135 C CB  . PHE A 1 802  ? -9.359  47.296 31.427  1.00 54.20  ? 799  PHE A CB  1 
ATOM 6136 C CG  . PHE A 1 802  ? -8.782  46.508 30.280  1.00 54.20  ? 799  PHE A CG  1 
ATOM 6137 C CD1 . PHE A 1 802  ? -9.121  46.807 28.963  1.00 54.20  ? 799  PHE A CD1 1 
ATOM 6138 C CD2 . PHE A 1 802  ? -7.972  45.409 30.518  1.00 54.20  ? 799  PHE A CD2 1 
ATOM 6139 C CE1 . PHE A 1 802  ? -8.636  46.037 27.897  1.00 54.20  ? 799  PHE A CE1 1 
ATOM 6140 C CE2 . PHE A 1 802  ? -7.484  44.634 29.464  1.00 54.20  ? 799  PHE A CE2 1 
ATOM 6141 C CZ  . PHE A 1 802  ? -7.816  44.949 28.148  1.00 54.20  ? 799  PHE A CZ  1 
ATOM 6142 N N   . GLU A 1 803  ? -11.983 46.343 34.000  1.00 64.96  ? 800  GLU A N   1 
ATOM 6143 C CA  . GLU A 1 803  ? -12.330 46.410 35.410  1.00 64.96  ? 800  GLU A CA  1 
ATOM 6144 C C   . GLU A 1 803  ? -11.900 45.122 36.081  1.00 64.96  ? 800  GLU A C   1 
ATOM 6145 O O   . GLU A 1 803  ? -11.945 44.031 35.476  1.00 64.96  ? 800  GLU A O   1 
ATOM 6146 C CB  . GLU A 1 803  ? -13.835 46.593 35.614  1.00 112.12 ? 800  GLU A CB  1 
ATOM 6147 C CG  . GLU A 1 803  ? -14.372 47.975 35.272  1.00 112.12 ? 800  GLU A CG  1 
ATOM 6148 C CD  . GLU A 1 803  ? -15.719 48.269 35.937  1.00 112.12 ? 800  GLU A CD  1 
ATOM 6149 O OE1 . GLU A 1 803  ? -15.727 48.859 37.047  1.00 112.12 ? 800  GLU A OE1 1 
ATOM 6150 O OE2 . GLU A 1 803  ? -16.768 47.920 35.339  1.00 112.12 ? 800  GLU A OE2 1 
ATOM 6151 N N   . VAL A 1 804  ? -11.467 45.273 37.328  1.00 49.85  ? 801  VAL A N   1 
ATOM 6152 C CA  . VAL A 1 804  ? -11.310 44.156 38.254  1.00 49.85  ? 801  VAL A CA  1 
ATOM 6153 C C   . VAL A 1 804  ? -12.692 43.590 38.560  1.00 49.85  ? 801  VAL A C   1 
ATOM 6154 O O   . VAL A 1 804  ? -13.311 43.963 39.546  1.00 49.85  ? 801  VAL A O   1 
ATOM 6155 C CB  . VAL A 1 804  ? -10.749 44.632 39.611  1.00 45.94  ? 801  VAL A CB  1 
ATOM 6156 C CG1 . VAL A 1 804  ? -10.187 43.450 40.366  1.00 45.94  ? 801  VAL A CG1 1 
ATOM 6157 C CG2 . VAL A 1 804  ? -9.691  45.725 39.414  1.00 45.94  ? 801  VAL A CG2 1 
ATOM 6158 N N   . LEU A 1 805  ? -13.190 42.716 37.705  1.00 57.47  ? 802  LEU A N   1 
ATOM 6159 C CA  . LEU A 1 805  ? -14.451 42.098 37.973  1.00 57.47  ? 802  LEU A CA  1 
ATOM 6160 C C   . LEU A 1 805  ? -14.374 41.426 39.339  1.00 57.47  ? 802  LEU A C   1 
ATOM 6161 O O   . LEU A 1 805  ? -14.843 41.972 40.328  1.00 57.47  ? 802  LEU A O   1 
ATOM 6162 C CB  . LEU A 1 805  ? -14.800 41.112 36.869  1.00 56.19  ? 802  LEU A CB  1 
ATOM 6163 C CG  . LEU A 1 805  ? -15.095 41.776 35.519  1.00 56.19  ? 802  LEU A CG  1 
ATOM 6164 C CD1 . LEU A 1 805  ? -15.504 40.763 34.407  1.00 56.19  ? 802  LEU A CD1 1 
ATOM 6165 C CD2 . LEU A 1 805  ? -16.123 42.902 35.648  1.00 56.19  ? 802  LEU A CD2 1 
ATOM 6166 N N   . HIS A 1 806  ? -13.726 40.276 39.410  1.00 67.83  ? 803  HIS A N   1 
ATOM 6167 C CA  . HIS A 1 806  ? -13.589 39.559 40.676  1.00 67.83  ? 803  HIS A CA  1 
ATOM 6168 C C   . HIS A 1 806  ? -12.125 39.529 41.216  1.00 67.83  ? 803  HIS A C   1 
ATOM 6169 O O   . HIS A 1 806  ? -11.167 39.778 40.455  1.00 67.83  ? 803  HIS A O   1 
ATOM 6170 C CB  . HIS A 1 806  ? -14.181 38.155 40.489  1.00 59.37  ? 803  HIS A CB  1 
ATOM 6171 C CG  . HIS A 1 806  ? -14.171 37.319 41.727  1.00 59.37  ? 803  HIS A CG  1 
ATOM 6172 N ND1 . HIS A 1 806  ? -14.846 37.677 42.876  1.00 59.37  ? 803  HIS A ND1 1 
ATOM 6173 C CD2 . HIS A 1 806  ? -13.570 36.135 41.995  1.00 59.37  ? 803  HIS A CD2 1 
ATOM 6174 C CE1 . HIS A 1 806  ? -14.659 36.747 43.798  1.00 59.37  ? 803  HIS A CE1 1 
ATOM 6175 N NE2 . HIS A 1 806  ? -13.888 35.801 43.289  1.00 59.37  ? 803  HIS A NE2 1 
ATOM 6176 N N   . ALA A 1 807  ? -11.974 39.255 42.521  1.00 71.03  ? 804  ALA A N   1 
ATOM 6177 C CA  . ALA A 1 807  ? -10.664 38.941 43.154  1.00 71.03  ? 804  ALA A CA  1 
ATOM 6178 C C   . ALA A 1 807  ? -10.687 37.713 44.073  1.00 71.03  ? 804  ALA A C   1 
ATOM 6179 O O   . ALA A 1 807  ? -11.466 37.665 45.008  1.00 71.03  ? 804  ALA A O   1 
ATOM 6180 C CB  . ALA A 1 807  ? -10.097 40.151 43.935  1.00 46.15  ? 804  ALA A CB  1 
ATOM 6181 N N   . HIS A 1 808  ? -9.820  36.733 43.814  1.00 51.40  ? 805  HIS A N   1 
ATOM 6182 C CA  . HIS A 1 808  ? -9.544  35.686 44.792  1.00 51.40  ? 805  HIS A CA  1 
ATOM 6183 C C   . HIS A 1 808  ? -8.250  35.919 45.570  1.00 51.40  ? 805  HIS A C   1 
ATOM 6184 O O   . HIS A 1 808  ? -7.190  35.882 44.996  1.00 51.40  ? 805  HIS A O   1 
ATOM 6185 C CB  . HIS A 1 808  ? -9.486  34.317 44.145  1.00 82.69  ? 805  HIS A CB  1 
ATOM 6186 C CG  . HIS A 1 808  ? -9.302  33.226 45.140  1.00 82.69  ? 805  HIS A CG  1 
ATOM 6187 N ND1 . HIS A 1 808  ? -10.359 32.520 45.669  1.00 82.69  ? 805  HIS A ND1 1 
ATOM 6188 C CD2 . HIS A 1 808  ? -8.193  32.770 45.768  1.00 82.69  ? 805  HIS A CD2 1 
ATOM 6189 C CE1 . HIS A 1 808  ? -9.904  31.648 46.551  1.00 82.69  ? 805  HIS A CE1 1 
ATOM 6190 N NE2 . HIS A 1 808  ? -8.592  31.781 46.632  1.00 82.69  ? 805  HIS A NE2 1 
ATOM 6191 N N   . GLN A 1 809  ? -8.332  36.141 46.874  1.00 65.60  ? 806  GLN A N   1 
ATOM 6192 C CA  . GLN A 1 809  ? -7.129  36.229 47.699  1.00 65.60  ? 806  GLN A CA  1 
ATOM 6193 C C   . GLN A 1 809  ? -6.604  34.856 48.098  1.00 65.60  ? 806  GLN A C   1 
ATOM 6194 O O   . GLN A 1 809  ? -7.357  33.979 48.503  1.00 65.60  ? 806  GLN A O   1 
ATOM 6195 C CB  . GLN A 1 809  ? -7.372  37.054 48.951  1.00 51.64  ? 806  GLN A CB  1 
ATOM 6196 C CG  . GLN A 1 809  ? -6.296  36.880 49.967  1.00 51.64  ? 806  GLN A CG  1 
ATOM 6197 C CD  . GLN A 1 809  ? -6.322  37.908 51.076  1.00 51.64  ? 806  GLN A CD  1 
ATOM 6198 O OE1 . GLN A 1 809  ? -6.598  39.087 50.858  1.00 51.64  ? 806  GLN A OE1 1 
ATOM 6199 N NE2 . GLN A 1 809  ? -6.005  37.468 52.279  1.00 51.64  ? 806  GLN A NE2 1 
ATOM 6200 N N   . PHE A 1 810  ? -5.298  34.676 48.000  1.00 52.91  ? 807  PHE A N   1 
ATOM 6201 C CA  . PHE A 1 810  ? -4.694  33.407 48.336  1.00 52.91  ? 807  PHE A CA  1 
ATOM 6202 C C   . PHE A 1 810  ? -4.320  33.312 49.816  1.00 52.91  ? 807  PHE A C   1 
ATOM 6203 O O   . PHE A 1 810  ? -4.431  34.295 50.545  1.00 52.91  ? 807  PHE A O   1 
ATOM 6204 C CB  . PHE A 1 810  ? -3.484  33.188 47.441  1.00 39.22  ? 807  PHE A CB  1 
ATOM 6205 C CG  . PHE A 1 810  ? -3.837  32.872 46.051  1.00 39.22  ? 807  PHE A CG  1 
ATOM 6206 C CD1 . PHE A 1 810  ? -3.803  33.849 45.086  1.00 39.22  ? 807  PHE A CD1 1 
ATOM 6207 C CD2 . PHE A 1 810  ? -4.225  31.606 45.711  1.00 39.22  ? 807  PHE A CD2 1 
ATOM 6208 C CE1 . PHE A 1 810  ? -4.131  33.565 43.780  1.00 39.22  ? 807  PHE A CE1 1 
ATOM 6209 C CE2 . PHE A 1 810  ? -4.574  31.303 44.412  1.00 39.22  ? 807  PHE A CE2 1 
ATOM 6210 C CZ  . PHE A 1 810  ? -4.518  32.287 43.436  1.00 39.22  ? 807  PHE A CZ  1 
ATOM 6211 N N   . LEU A 1 811  ? -3.870  32.133 50.248  1.00 46.33  ? 808  LEU A N   1 
ATOM 6212 C CA  . LEU A 1 811  ? -3.546  31.875 51.659  1.00 46.33  ? 808  LEU A CA  1 
ATOM 6213 C C   . LEU A 1 811  ? -2.585  32.874 52.305  1.00 46.33  ? 808  LEU A C   1 
ATOM 6214 O O   . LEU A 1 811  ? -1.951  33.655 51.615  1.00 46.33  ? 808  LEU A O   1 
ATOM 6215 C CB  . LEU A 1 811  ? -3.023  30.458 51.824  1.00 76.21  ? 808  LEU A CB  1 
ATOM 6216 C CG  . LEU A 1 811  ? -4.149  29.442 51.716  1.00 76.21  ? 808  LEU A CG  1 
ATOM 6217 C CD1 . LEU A 1 811  ? -3.590  28.049 51.542  1.00 76.21  ? 808  LEU A CD1 1 
ATOM 6218 C CD2 . LEU A 1 811  ? -5.047  29.542 52.936  1.00 76.21  ? 808  LEU A CD2 1 
ATOM 6219 N N   . GLN A 1 812  ? -2.492  32.877 53.624  1.00 71.29  ? 809  GLN A N   1 
ATOM 6220 C CA  . GLN A 1 812  ? -1.519  33.733 54.262  1.00 71.29  ? 809  GLN A CA  1 
ATOM 6221 C C   . GLN A 1 812  ? -0.116  33.149 54.113  1.00 71.29  ? 809  GLN A C   1 
ATOM 6222 O O   . GLN A 1 812  ? 0.288   32.249 54.867  1.00 71.29  ? 809  GLN A O   1 
ATOM 6223 C CB  . GLN A 1 812  ? -1.855  33.925 55.721  1.00 85.75  ? 809  GLN A CB  1 
ATOM 6224 C CG  . GLN A 1 812  ? -0.997  34.939 56.418  1.00 85.75  ? 809  GLN A CG  1 
ATOM 6225 C CD  . GLN A 1 812  ? -1.378  35.052 57.870  1.00 85.75  ? 809  GLN A CD  1 
ATOM 6226 O OE1 . GLN A 1 812  ? -0.639  35.622 58.677  1.00 85.75  ? 809  GLN A OE1 1 
ATOM 6227 N NE2 . GLN A 1 812  ? -2.542  34.498 58.221  1.00 85.75  ? 809  GLN A NE2 1 
ATOM 6228 N N   . ASN A 1 813  ? 0.605   33.681 53.121  1.00 65.41  ? 810  ASN A N   1 
ATOM 6229 C CA  . ASN A 1 813  ? 2.014   33.371 52.805  1.00 65.41  ? 810  ASN A CA  1 
ATOM 6230 C C   . ASN A 1 813  ? 2.109   32.475 51.620  1.00 65.41  ? 810  ASN A C   1 
ATOM 6231 O O   . ASN A 1 813  ? 2.938   31.592 51.557  1.00 65.41  ? 810  ASN A O   1 
ATOM 6232 C CB  . ASN A 1 813  ? 2.787   32.797 53.991  1.00 60.68  ? 810  ASN A CB  1 
ATOM 6233 C CG  . ASN A 1 813  ? 3.008   33.817 55.060  1.00 60.68  ? 810  ASN A CG  1 
ATOM 6234 O OD1 . ASN A 1 813  ? 3.554   34.890 54.799  1.00 60.68  ? 810  ASN A OD1 1 
ATOM 6235 N ND2 . ASN A 1 813  ? 2.553   33.517 56.271  1.00 60.68  ? 810  ASN A ND2 1 
ATOM 6236 N N   . GLU A 1 814  ? 1.248   32.723 50.665  1.00 63.91  ? 811  GLU A N   1 
ATOM 6237 C CA  . GLU A 1 814  ? 1.263   31.956 49.463  1.00 63.91  ? 811  GLU A CA  1 
ATOM 6238 C C   . GLU A 1 814  ? 1.575   32.879 48.307  1.00 63.91  ? 811  GLU A C   1 
ATOM 6239 O O   . GLU A 1 814  ? 1.053   33.976 48.249  1.00 63.91  ? 811  GLU A O   1 
ATOM 6240 C CB  . GLU A 1 814  ? -0.098  31.330 49.280  1.00 43.22  ? 811  GLU A CB  1 
ATOM 6241 C CG  . GLU A 1 814  ? -0.152  30.370 48.165  1.00 43.22  ? 811  GLU A CG  1 
ATOM 6242 C CD  . GLU A 1 814  ? -1.405  29.537 48.215  1.00 43.22  ? 811  GLU A CD  1 
ATOM 6243 O OE1 . GLU A 1 814  ? -2.473  30.086 48.605  1.00 43.22  ? 811  GLU A OE1 1 
ATOM 6244 O OE2 . GLU A 1 814  ? -1.329  28.332 47.855  1.00 43.22  ? 811  GLU A OE2 1 
ATOM 6245 N N   . TYR A 1 815  ? 2.445   32.457 47.402  1.00 65.18  ? 812  TYR A N   1 
ATOM 6246 C CA  . TYR A 1 815  ? 2.652   33.186 46.175  1.00 65.18  ? 812  TYR A CA  1 
ATOM 6247 C C   . TYR A 1 815  ? 2.045   32.353 45.095  1.00 65.18  ? 812  TYR A C   1 
ATOM 6248 O O   . TYR A 1 815  ? 2.252   31.144 45.044  1.00 65.18  ? 812  TYR A O   1 
ATOM 6249 C CB  . TYR A 1 815  ? 4.122   33.321 45.892  1.00 39.86  ? 812  TYR A CB  1 
ATOM 6250 C CG  . TYR A 1 815  ? 4.834   34.387 46.698  1.00 39.86  ? 812  TYR A CG  1 
ATOM 6251 C CD1 . TYR A 1 815  ? 5.743   35.280 46.078  1.00 39.86  ? 812  TYR A CD1 1 
ATOM 6252 C CD2 . TYR A 1 815  ? 4.604   34.516 48.068  1.00 39.86  ? 812  TYR A CD2 1 
ATOM 6253 C CE1 . TYR A 1 815  ? 6.391   36.262 46.797  1.00 39.86  ? 812  TYR A CE1 1 
ATOM 6254 C CE2 . TYR A 1 815  ? 5.253   35.496 48.809  1.00 39.86  ? 812  TYR A CE2 1 
ATOM 6255 C CZ  . TYR A 1 815  ? 6.148   36.363 48.172  1.00 39.86  ? 812  TYR A CZ  1 
ATOM 6256 O OH  . TYR A 1 815  ? 6.765   37.327 48.942  1.00 39.86  ? 812  TYR A OH  1 
ATOM 6257 N N   . ALA A 1 816  ? 1.264   32.995 44.244  1.00 46.30  ? 813  ALA A N   1 
ATOM 6258 C CA  . ALA A 1 816  ? 0.787   32.353 43.041  1.00 46.30  ? 813  ALA A CA  1 
ATOM 6259 C C   . ALA A 1 816  ? 1.807   32.716 41.974  1.00 46.30  ? 813  ALA A C   1 
ATOM 6260 O O   . ALA A 1 816  ? 2.051   33.896 41.722  1.00 46.30  ? 813  ALA A O   1 
ATOM 6261 C CB  . ALA A 1 816  ? -0.557  32.888 42.679  1.00 41.29  ? 813  ALA A CB  1 
ATOM 6262 N N   . LEU A 1 817  ? 2.435   31.722 41.360  1.00 47.00  ? 814  LEU A N   1 
ATOM 6263 C CA  . LEU A 1 817  ? 3.561   32.034 40.510  1.00 47.00  ? 814  LEU A CA  1 
ATOM 6264 C C   . LEU A 1 817  ? 3.266   31.741 39.053  1.00 47.00  ? 814  LEU A C   1 
ATOM 6265 O O   . LEU A 1 817  ? 3.886   32.338 38.199  1.00 47.00  ? 814  LEU A O   1 
ATOM 6266 C CB  . LEU A 1 817  ? 4.815   31.296 40.985  1.00 33.74  ? 814  LEU A CB  1 
ATOM 6267 C CG  . LEU A 1 817  ? 5.262   31.342 42.462  1.00 33.74  ? 814  LEU A CG  1 
ATOM 6268 C CD1 . LEU A 1 817  ? 5.801   29.981 42.859  1.00 33.74  ? 814  LEU A CD1 1 
ATOM 6269 C CD2 . LEU A 1 817  ? 6.286   32.418 42.757  1.00 33.74  ? 814  LEU A CD2 1 
ATOM 6270 N N   . SER A 1 818  ? 2.330   30.842 38.765  1.00 50.47  ? 815  SER A N   1 
ATOM 6271 C CA  . SER A 1 818  ? 1.990   30.495 37.375  1.00 50.47  ? 815  SER A CA  1 
ATOM 6272 C C   . SER A 1 818  ? 0.503   30.553 37.086  1.00 50.47  ? 815  SER A C   1 
ATOM 6273 O O   . SER A 1 818  ? -0.300  30.387 37.993  1.00 50.47  ? 815  SER A O   1 
ATOM 6274 C CB  . SER A 1 818  ? 2.488   29.091 37.025  1.00 40.71  ? 815  SER A CB  1 
ATOM 6275 O OG  . SER A 1 818  ? 2.229   28.135 38.047  1.00 40.71  ? 815  SER A OG  1 
ATOM 6276 N N   . LEU A 1 819  ? 0.126   30.762 35.826  1.00 36.08  ? 816  LEU A N   1 
ATOM 6277 C CA  . LEU A 1 819  ? -1.293  30.867 35.479  1.00 36.08  ? 816  LEU A CA  1 
ATOM 6278 C C   . LEU A 1 819  ? -1.587  30.426 34.063  1.00 36.08  ? 816  LEU A C   1 
ATOM 6279 O O   . LEU A 1 819  ? -0.921  30.863 33.151  1.00 36.08  ? 816  LEU A O   1 
ATOM 6280 C CB  . LEU A 1 819  ? -1.759  32.304 35.653  1.00 46.04  ? 816  LEU A CB  1 
ATOM 6281 C CG  . LEU A 1 819  ? -3.229  32.579 35.349  1.00 46.04  ? 816  LEU A CG  1 
ATOM 6282 C CD1 . LEU A 1 819  ? -4.113  32.069 36.488  1.00 46.04  ? 816  LEU A CD1 1 
ATOM 6283 C CD2 . LEU A 1 819  ? -3.477  34.064 35.111  1.00 46.04  ? 816  LEU A CD2 1 
ATOM 6284 N N   . VAL A 1 820  ? -2.584  29.575 33.862  1.00 57.66  ? 817  VAL A N   1 
ATOM 6285 C CA  . VAL A 1 820  ? -2.971  29.155 32.510  1.00 57.66  ? 817  VAL A CA  1 
ATOM 6286 C C   . VAL A 1 820  ? -4.470  29.244 32.343  1.00 57.66  ? 817  VAL A C   1 
ATOM 6287 O O   . VAL A 1 820  ? -5.204  29.234 33.333  1.00 57.66  ? 817  VAL A O   1 
ATOM 6288 C CB  . VAL A 1 820  ? -2.628  27.693 32.247  1.00 62.17  ? 817  VAL A CB  1 
ATOM 6289 C CG1 . VAL A 1 820  ? -1.339  27.574 31.512  1.00 62.17  ? 817  VAL A CG1 1 
ATOM 6290 C CG2 . VAL A 1 820  ? -2.598  26.922 33.544  1.00 62.17  ? 817  VAL A CG2 1 
ATOM 6291 N N   . SER A 1 821  ? -4.925  29.311 31.094  1.00 50.99  ? 818  SER A N   1 
ATOM 6292 C CA  . SER A 1 821  ? -6.338  29.213 30.798  1.00 50.99  ? 818  SER A CA  1 
ATOM 6293 C C   . SER A 1 821  ? -6.555  28.153 29.764  1.00 50.99  ? 818  SER A C   1 
ATOM 6294 O O   . SER A 1 821  ? -6.266  28.365 28.602  1.00 50.99  ? 818  SER A O   1 
ATOM 6295 C CB  . SER A 1 821  ? -6.868  30.542 30.272  1.00 46.91  ? 818  SER A CB  1 
ATOM 6296 O OG  . SER A 1 821  ? -8.264  30.471 29.975  1.00 46.91  ? 818  SER A OG  1 
ATOM 6297 N N   . CYS A 1 822  ? -7.113  27.025 30.158  1.00 72.29  ? 819  CYS A N   1 
ATOM 6298 C CA  . CYS A 1 822  ? -7.279  25.953 29.199  1.00 72.29  ? 819  CYS A CA  1 
ATOM 6299 C C   . CYS A 1 822  ? -8.455  25.015 29.491  1.00 72.29  ? 819  CYS A C   1 
ATOM 6300 O O   . CYS A 1 822  ? -9.014  25.027 30.591  1.00 72.29  ? 819  CYS A O   1 
ATOM 6301 C CB  . CYS A 1 822  ? -6.010  25.129 29.206  1.00 54.76  ? 819  CYS A CB  1 
ATOM 6302 S SG  . CYS A 1 822  ? -5.860  24.256 30.790  1.00 54.76  ? 819  CYS A SG  1 
ATOM 6303 N N   . LYS A 1 823  ? -8.796  24.199 28.492  1.00 69.69  ? 820  LYS A N   1 
ATOM 6304 C CA  . LYS A 1 823  ? -9.700  23.063 28.633  1.00 69.69  ? 820  LYS A CA  1 
ATOM 6305 C C   . LYS A 1 823  ? -8.884  21.852 29.003  1.00 69.69  ? 820  LYS A C   1 
ATOM 6306 O O   . LYS A 1 823  ? -7.725  21.779 28.644  1.00 69.69  ? 820  LYS A O   1 
ATOM 6307 C CB  . LYS A 1 823  ? -10.413 22.806 27.307  1.00 66.31  ? 820  LYS A CB  1 
ATOM 6308 C CG  . LYS A 1 823  ? -11.676 23.646 27.140  1.00 66.31  ? 820  LYS A CG  1 
ATOM 6309 C CD  . LYS A 1 823  ? -11.968 24.050 25.711  1.00 66.31  ? 820  LYS A CD  1 
ATOM 6310 C CE  . LYS A 1 823  ? -12.607 22.948 24.916  1.00 66.31  ? 820  LYS A CE  1 
ATOM 6311 N NZ  . LYS A 1 823  ? -13.385 23.580 23.834  1.00 66.31  ? 820  LYS A NZ  1 
ATOM 6312 N N   . LEU A 1 824  ? -9.470  20.894 29.708  1.00 81.22  ? 821  LEU A N   1 
ATOM 6313 C CA  . LEU A 1 824  ? -8.700  19.719 30.135  1.00 81.22  ? 821  LEU A CA  1 
ATOM 6314 C C   . LEU A 1 824  ? -9.431  18.385 30.005  1.00 81.22  ? 821  LEU A C   1 
ATOM 6315 O O   . LEU A 1 824  ? -10.665 18.350 30.027  1.00 81.22  ? 821  LEU A O   1 
ATOM 6316 C CB  . LEU A 1 824  ? -8.228  19.880 31.575  1.00 69.94  ? 821  LEU A CB  1 
ATOM 6317 C CG  . LEU A 1 824  ? -7.034  20.775 31.889  1.00 69.94  ? 821  LEU A CG  1 
ATOM 6318 C CD1 . LEU A 1 824  ? -6.767  20.673 33.377  1.00 69.94  ? 821  LEU A CD1 1 
ATOM 6319 C CD2 . LEU A 1 824  ? -5.796  20.364 31.106  1.00 69.94  ? 821  LEU A CD2 1 
ATOM 6320 N N   . GLY A 1 825  ? -8.660  17.294 29.897  1.00 79.67  ? 822  GLY A N   1 
ATOM 6321 C CA  . GLY A 1 825  ? -9.203  15.932 29.716  1.00 79.67  ? 822  GLY A CA  1 
ATOM 6322 C C   . GLY A 1 825  ? -10.304 15.852 28.663  1.00 79.67  ? 822  GLY A C   1 
ATOM 6323 O O   . GLY A 1 825  ? -10.145 16.362 27.548  1.00 79.67  ? 822  GLY A O   1 
ATOM 6324 N N   . LYS A 1 826  ? -11.424 15.221 29.023  1.00 87.60  ? 823  LYS A N   1 
ATOM 6325 C CA  . LYS A 1 826  ? -12.635 15.247 28.191  1.00 87.60  ? 823  LYS A CA  1 
ATOM 6326 C C   . LYS A 1 826  ? -13.465 16.513 28.477  1.00 87.60  ? 823  LYS A C   1 
ATOM 6327 O O   . LYS A 1 826  ? -14.025 17.131 27.568  1.00 87.60  ? 823  LYS A O   1 
ATOM 6328 C CB  . LYS A 1 826  ? -13.466 13.975 28.425  1.00 108.16 ? 823  LYS A CB  1 
ATOM 6329 C CG  . LYS A 1 826  ? -13.207 12.828 27.421  1.00 108.16 ? 823  LYS A CG  1 
ATOM 6330 C CD  . LYS A 1 826  ? -12.012 11.934 27.790  1.00 108.16 ? 823  LYS A CD  1 
ATOM 6331 C CE  . LYS A 1 826  ? -12.427 10.700 28.601  1.00 108.16 ? 823  LYS A CE  1 
ATOM 6332 N NZ  . LYS A 1 826  ? -11.434 9.584  28.475  1.00 108.16 ? 823  LYS A NZ  1 
ATOM 6333 N N   . ASP A 1 827  ? -13.514 16.863 29.765  1.00 71.36  ? 824  ASP A N   1 
ATOM 6334 C CA  . ASP A 1 827  ? -14.151 18.050 30.341  1.00 71.36  ? 824  ASP A CA  1 
ATOM 6335 C C   . ASP A 1 827  ? -14.272 19.264 29.412  1.00 71.36  ? 824  ASP A C   1 
ATOM 6336 O O   . ASP A 1 827  ? -13.263 19.776 28.913  1.00 71.36  ? 824  ASP A O   1 
ATOM 6337 C CB  . ASP A 1 827  ? -13.345 18.424 31.583  1.00 67.77  ? 824  ASP A CB  1 
ATOM 6338 C CG  . ASP A 1 827  ? -14.093 19.327 32.526  1.00 67.77  ? 824  ASP A CG  1 
ATOM 6339 O OD1 . ASP A 1 827  ? -14.879 20.210 32.078  1.00 67.77  ? 824  ASP A OD1 1 
ATOM 6340 O OD2 . ASP A 1 827  ? -13.862 19.151 33.743  1.00 67.77  ? 824  ASP A OD2 1 
ATOM 6341 N N   . PRO A 1 828  ? -15.508 19.756 29.198  1.00 87.14  ? 825  PRO A N   1 
ATOM 6342 C CA  . PRO A 1 828  ? -15.707 20.827 28.214  1.00 87.14  ? 825  PRO A CA  1 
ATOM 6343 C C   . PRO A 1 828  ? -15.556 22.232 28.805  1.00 87.14  ? 825  PRO A C   1 
ATOM 6344 O O   . PRO A 1 828  ? -15.897 23.217 28.151  1.00 87.14  ? 825  PRO A O   1 
ATOM 6345 C CB  . PRO A 1 828  ? -17.146 20.597 27.760  1.00 127.15 ? 825  PRO A CB  1 
ATOM 6346 C CG  . PRO A 1 828  ? -17.830 20.058 28.992  1.00 127.15 ? 825  PRO A CG  1 
ATOM 6347 C CD  . PRO A 1 828  ? -16.779 19.362 29.836  1.00 127.15 ? 825  PRO A CD  1 
ATOM 6348 N N   . ASN A 1 829  ? -15.054 22.319 30.027  1.00 104.43 ? 826  ASN A N   1 
ATOM 6349 C CA  . ASN A 1 829  ? -14.905 23.601 30.685  1.00 104.43 ? 826  ASN A CA  1 
ATOM 6350 C C   . ASN A 1 829  ? -13.567 24.249 30.431  1.00 104.43 ? 826  ASN A C   1 
ATOM 6351 O O   . ASN A 1 829  ? -12.559 23.554 30.382  1.00 104.43 ? 826  ASN A O   1 
ATOM 6352 C CB  . ASN A 1 829  ? -15.078 23.419 32.180  1.00 70.36  ? 826  ASN A CB  1 
ATOM 6353 C CG  . ASN A 1 829  ? -16.500 23.300 32.562  1.00 70.36  ? 826  ASN A CG  1 
ATOM 6354 O OD1 . ASN A 1 829  ? -17.371 23.206 31.688  1.00 70.36  ? 826  ASN A OD1 1 
ATOM 6355 N ND2 . ASN A 1 829  ? -16.772 23.327 33.863  1.00 70.36  ? 826  ASN A ND2 1 
ATOM 6356 N N   . THR A 1 830  ? -13.552 25.572 30.280  1.00 72.61  ? 827  THR A N   1 
ATOM 6357 C CA  . THR A 1 830  ? -12.295 26.321 30.192  1.00 72.61  ? 827  THR A CA  1 
ATOM 6358 C C   . THR A 1 830  ? -11.948 26.891 31.575  1.00 72.61  ? 827  THR A C   1 
ATOM 6359 O O   . THR A 1 830  ? -12.665 27.749 32.097  1.00 72.61  ? 827  THR A O   1 
ATOM 6360 C CB  . THR A 1 830  ? -12.341 27.443 29.093  1.00 70.20  ? 827  THR A CB  1 
ATOM 6361 O OG1 . THR A 1 830  ? -12.341 26.859 27.778  1.00 70.20  ? 827  THR A OG1 1 
ATOM 6362 C CG2 . THR A 1 830  ? -11.135 28.383 29.214  1.00 70.20  ? 827  THR A CG2 1 
ATOM 6363 N N   . TYR A 1 831  ? -10.847 26.409 32.157  1.00 52.17  ? 828  TYR A N   1 
ATOM 6364 C CA  . TYR A 1 831  ? -10.446 26.771 33.531  1.00 52.17  ? 828  TYR A CA  1 
ATOM 6365 C C   . TYR A 1 831  ? -9.351  27.838 33.618  1.00 52.17  ? 828  TYR A C   1 
ATOM 6366 O O   . TYR A 1 831  ? -8.790  28.273 32.604  1.00 52.17  ? 828  TYR A O   1 
ATOM 6367 C CB  . TYR A 1 831  ? -9.966  25.534 34.300  1.00 80.21  ? 828  TYR A CB  1 
ATOM 6368 C CG  . TYR A 1 831  ? -11.010 24.475 34.494  1.00 80.21  ? 828  TYR A CG  1 
ATOM 6369 C CD1 . TYR A 1 831  ? -11.330 23.599 33.465  1.00 80.21  ? 828  TYR A CD1 1 
ATOM 6370 C CD2 . TYR A 1 831  ? -11.683 24.344 35.705  1.00 80.21  ? 828  TYR A CD2 1 
ATOM 6371 C CE1 . TYR A 1 831  ? -12.292 22.615 33.632  1.00 80.21  ? 828  TYR A CE1 1 
ATOM 6372 C CE2 . TYR A 1 831  ? -12.651 23.359 35.887  1.00 80.21  ? 828  TYR A CE2 1 
ATOM 6373 C CZ  . TYR A 1 831  ? -12.949 22.497 34.845  1.00 80.21  ? 828  TYR A CZ  1 
ATOM 6374 O OH  . TYR A 1 831  ? -13.907 21.522 34.996  1.00 80.21  ? 828  TYR A OH  1 
ATOM 6375 N N   . PHE A 1 832  ? -9.065  28.243 34.855  1.00 49.32  ? 829  PHE A N   1 
ATOM 6376 C CA  . PHE A 1 832  ? -7.938  29.089 35.183  1.00 49.32  ? 829  PHE A CA  1 
ATOM 6377 C C   . PHE A 1 832  ? -7.113  28.385 36.218  1.00 49.32  ? 829  PHE A C   1 
ATOM 6378 O O   . PHE A 1 832  ? -7.460  28.421 37.390  1.00 49.32  ? 829  PHE A O   1 
ATOM 6379 C CB  . PHE A 1 832  ? -8.413  30.367 35.838  1.00 51.04  ? 829  PHE A CB  1 
ATOM 6380 C CG  . PHE A 1 832  ? -8.835  31.406 34.884  1.00 51.04  ? 829  PHE A CG  1 
ATOM 6381 C CD1 . PHE A 1 832  ? -8.416  31.358 33.558  1.00 51.04  ? 829  PHE A CD1 1 
ATOM 6382 C CD2 . PHE A 1 832  ? -9.625  32.475 35.321  1.00 51.04  ? 829  PHE A CD2 1 
ATOM 6383 C CE1 . PHE A 1 832  ? -8.793  32.362 32.674  1.00 51.04  ? 829  PHE A CE1 1 
ATOM 6384 C CE2 . PHE A 1 832  ? -10.026 33.471 34.452  1.00 51.04  ? 829  PHE A CE2 1 
ATOM 6385 C CZ  . PHE A 1 832  ? -9.606  33.429 33.129  1.00 51.04  ? 829  PHE A CZ  1 
ATOM 6386 N N   . ILE A 1 833  ? -6.003  27.780 35.823  1.00 67.89  ? 830  ILE A N   1 
ATOM 6387 C CA  . ILE A 1 833  ? -5.188  27.058 36.790  1.00 67.89  ? 830  ILE A CA  1 
ATOM 6388 C C   . ILE A 1 833  ? -4.043  27.895 37.346  1.00 67.89  ? 830  ILE A C   1 
ATOM 6389 O O   . ILE A 1 833  ? -3.496  28.753 36.661  1.00 67.89  ? 830  ILE A O   1 
ATOM 6390 C CB  . ILE A 1 833  ? -4.681  25.779 36.188  1.00 48.28  ? 830  ILE A CB  1 
ATOM 6391 C CG1 . ILE A 1 833  ? -5.829  25.090 35.430  1.00 48.28  ? 830  ILE A CG1 1 
ATOM 6392 C CG2 . ILE A 1 833  ? -4.162  24.871 37.280  1.00 48.28  ? 830  ILE A CG2 1 
ATOM 6393 C CD1 . ILE A 1 833  ? -5.389  24.080 34.332  1.00 48.28  ? 830  ILE A CD1 1 
ATOM 6394 N N   . VAL A 1 834  ? -3.694  27.649 38.600  1.00 52.40  ? 831  VAL A N   1 
ATOM 6395 C CA  . VAL A 1 834  ? -2.737  28.488 39.286  1.00 52.40  ? 831  VAL A CA  1 
ATOM 6396 C C   . VAL A 1 834  ? -1.776  27.720 40.202  1.00 52.40  ? 831  VAL A C   1 
ATOM 6397 O O   . VAL A 1 834  ? -2.173  27.224 41.266  1.00 52.40  ? 831  VAL A O   1 
ATOM 6398 C CB  . VAL A 1 834  ? -3.481  29.553 40.089  1.00 40.31  ? 831  VAL A CB  1 
ATOM 6399 C CG1 . VAL A 1 834  ? -2.534  30.346 40.967  1.00 40.31  ? 831  VAL A CG1 1 
ATOM 6400 C CG2 . VAL A 1 834  ? -4.193  30.459 39.159  1.00 40.31  ? 831  VAL A CG2 1 
ATOM 6401 N N   . GLY A 1 835  ? -0.510  27.640 39.804  1.00 69.96  ? 832  GLY A N   1 
ATOM 6402 C CA  . GLY A 1 835  ? 0.523   27.112 40.686  1.00 69.96  ? 832  GLY A CA  1 
ATOM 6403 C C   . GLY A 1 835  ? 0.925   28.103 41.755  1.00 69.96  ? 832  GLY A C   1 
ATOM 6404 O O   . GLY A 1 835  ? 1.022   29.300 41.506  1.00 69.96  ? 832  GLY A O   1 
ATOM 6405 N N   . THR A 1 836  ? 1.172   27.609 42.953  1.00 50.91  ? 833  THR A N   1 
ATOM 6406 C CA  . THR A 1 836  ? 1.397   28.497 44.094  1.00 50.91  ? 833  THR A CA  1 
ATOM 6407 C C   . THR A 1 836  ? 2.589   28.028 44.887  1.00 50.91  ? 833  THR A C   1 
ATOM 6408 O O   . THR A 1 836  ? 3.291   27.152 44.428  1.00 50.91  ? 833  THR A O   1 
ATOM 6409 C CB  . THR A 1 836  ? 0.173   28.520 45.033  1.00 56.56  ? 833  THR A CB  1 
ATOM 6410 O OG1 . THR A 1 836  ? -0.081  27.195 45.527  1.00 56.56  ? 833  THR A OG1 1 
ATOM 6411 C CG2 . THR A 1 836  ? -1.071  29.030 44.305  1.00 56.56  ? 833  THR A CG2 1 
ATOM 6412 N N   . ALA A 1 837  ? 2.810   28.586 46.072  1.00 51.48  ? 834  ALA A N   1 
ATOM 6413 C CA  . ALA A 1 837  ? 3.918   28.161 46.902  1.00 51.48  ? 834  ALA A CA  1 
ATOM 6414 C C   . ALA A 1 837  ? 3.907   28.795 48.269  1.00 51.48  ? 834  ALA A C   1 
ATOM 6415 O O   . ALA A 1 837  ? 3.630   29.978 48.419  1.00 51.48  ? 834  ALA A O   1 
ATOM 6416 C CB  . ALA A 1 837  ? 5.165   28.516 46.251  1.00 36.00  ? 834  ALA A CB  1 
ATOM 6417 N N   . MET A 1 838  ? 4.261   28.029 49.281  1.00 51.16  ? 835  MET A N   1 
ATOM 6418 C CA  . MET A 1 838  ? 4.365   28.605 50.605  1.00 51.16  ? 835  MET A CA  1 
ATOM 6419 C C   . MET A 1 838  ? 5.788   29.071 50.816  1.00 51.16  ? 835  MET A C   1 
ATOM 6420 O O   . MET A 1 838  ? 6.729   28.265 50.837  1.00 51.16  ? 835  MET A O   1 
ATOM 6421 C CB  . MET A 1 838  ? 3.925   27.601 51.666  1.00 48.83  ? 835  MET A CB  1 
ATOM 6422 C CG  . MET A 1 838  ? 2.549   26.950 51.389  1.00 48.83  ? 835  MET A CG  1 
ATOM 6423 S SD  . MET A 1 838  ? 1.145   28.121 51.264  1.00 48.83  ? 835  MET A SD  1 
ATOM 6424 C CE  . MET A 1 838  ? 1.388   29.123 52.771  1.00 48.83  ? 835  MET A CE  1 
ATOM 6425 N N   . VAL A 1 839  ? 5.945   30.380 50.942  1.00 57.09  ? 836  VAL A N   1 
ATOM 6426 C CA  . VAL A 1 839  ? 7.242   31.016 50.951  1.00 57.09  ? 836  VAL A CA  1 
ATOM 6427 C C   . VAL A 1 839  ? 7.527   31.442 52.355  1.00 57.09  ? 836  VAL A C   1 
ATOM 6428 O O   . VAL A 1 839  ? 6.654   32.022 52.971  1.00 57.09  ? 836  VAL A O   1 
ATOM 6429 C CB  . VAL A 1 839  ? 7.170   32.303 50.114  1.00 43.16  ? 836  VAL A CB  1 
ATOM 6430 C CG1 . VAL A 1 839  ? 8.300   33.300 50.457  1.00 43.16  ? 836  VAL A CG1 1 
ATOM 6431 C CG2 . VAL A 1 839  ? 7.097   31.967 48.621  1.00 43.16  ? 836  VAL A CG2 1 
ATOM 6432 N N   . TYR A 1 840  ? 8.724   31.179 52.873  1.00 74.13  ? 837  TYR A N   1 
ATOM 6433 C CA  . TYR A 1 840  ? 9.145   31.793 54.129  1.00 74.13  ? 837  TYR A CA  1 
ATOM 6434 C C   . TYR A 1 840  ? 10.646  32.133 54.109  1.00 74.13  ? 837  TYR A C   1 
ATOM 6435 O O   . TYR A 1 840  ? 11.427  31.390 53.516  1.00 74.13  ? 837  TYR A O   1 
ATOM 6436 C CB  . TYR A 1 840  ? 8.850   30.856 55.282  1.00 41.96  ? 837  TYR A CB  1 
ATOM 6437 C CG  . TYR A 1 840  ? 7.460   30.248 55.311  1.00 41.96  ? 837  TYR A CG  1 
ATOM 6438 C CD1 . TYR A 1 840  ? 7.163   29.127 54.550  1.00 41.96  ? 837  TYR A CD1 1 
ATOM 6439 C CD2 . TYR A 1 840  ? 6.452   30.777 56.141  1.00 41.96  ? 837  TYR A CD2 1 
ATOM 6440 C CE1 . TYR A 1 840  ? 5.909   28.560 54.566  1.00 41.96  ? 837  TYR A CE1 1 
ATOM 6441 C CE2 . TYR A 1 840  ? 5.186   30.215 56.174  1.00 41.96  ? 837  TYR A CE2 1 
ATOM 6442 C CZ  . TYR A 1 840  ? 4.920   29.102 55.372  1.00 41.96  ? 837  TYR A CZ  1 
ATOM 6443 O OH  . TYR A 1 840  ? 3.657   28.509 55.370  1.00 41.96  ? 837  TYR A OH  1 
ATOM 6444 N N   . PRO A 1 841  ? 11.065  33.245 54.756  1.00 95.32  ? 838  PRO A N   1 
ATOM 6445 C CA  . PRO A 1 841  ? 12.467  33.680 54.670  1.00 95.32  ? 838  PRO A CA  1 
ATOM 6446 C C   . PRO A 1 841  ? 13.467  32.730 55.317  1.00 95.32  ? 838  PRO A C   1 
ATOM 6447 O O   . PRO A 1 841  ? 14.653  32.781 55.004  1.00 95.32  ? 838  PRO A O   1 
ATOM 6448 C CB  . PRO A 1 841  ? 12.474  35.019 55.420  1.00 89.76  ? 838  PRO A CB  1 
ATOM 6449 C CG  . PRO A 1 841  ? 11.093  35.432 55.504  1.00 89.76  ? 838  PRO A CG  1 
ATOM 6450 C CD  . PRO A 1 841  ? 10.282  34.174 55.580  1.00 89.76  ? 838  PRO A CD  1 
ATOM 6451 N N   . GLU A 1 842  ? 13.001  31.884 56.224  1.00 89.35  ? 839  GLU A N   1 
ATOM 6452 C CA  . GLU A 1 842  ? 13.866  30.887 56.849  1.00 89.35  ? 839  GLU A CA  1 
ATOM 6453 C C   . GLU A 1 842  ? 14.123  29.709 55.917  1.00 89.35  ? 839  GLU A C   1 
ATOM 6454 O O   . GLU A 1 842  ? 15.112  29.001 56.085  1.00 89.35  ? 839  GLU A O   1 
ATOM 6455 C CB  . GLU A 1 842  ? 13.286  30.392 58.182  1.00 105.54 ? 839  GLU A CB  1 
ATOM 6456 C CG  . GLU A 1 842  ? 11.810  29.976 58.138  1.00 105.54 ? 839  GLU A CG  1 
ATOM 6457 C CD  . GLU A 1 842  ? 10.875  31.163 58.312  1.00 105.54 ? 839  GLU A CD  1 
ATOM 6458 O OE1 . GLU A 1 842  ? 10.318  31.330 59.421  1.00 105.54 ? 839  GLU A OE1 1 
ATOM 6459 O OE2 . GLU A 1 842  ? 10.712  31.947 57.353  1.00 105.54 ? 839  GLU A OE2 1 
ATOM 6460 N N   . GLU A 1 843  ? 13.223  29.500 54.954  1.00 80.57  ? 840  GLU A N   1 
ATOM 6461 C CA  . GLU A 1 843  ? 13.399  28.474 53.930  1.00 80.57  ? 840  GLU A CA  1 
ATOM 6462 C C   . GLU A 1 843  ? 14.117  29.024 52.706  1.00 80.57  ? 840  GLU A C   1 
ATOM 6463 O O   . GLU A 1 843  ? 13.598  29.904 52.019  1.00 80.57  ? 840  GLU A O   1 
ATOM 6464 C CB  . GLU A 1 843  ? 12.057  27.885 53.508  1.00 79.73  ? 840  GLU A CB  1 
ATOM 6465 C CG  . GLU A 1 843  ? 11.436  26.959 54.531  1.00 79.73  ? 840  GLU A CG  1 
ATOM 6466 C CD  . GLU A 1 843  ? 10.002  26.574 54.194  1.00 79.73  ? 840  GLU A CD  1 
ATOM 6467 O OE1 . GLU A 1 843  ? 9.346   25.929 55.054  1.00 79.73  ? 840  GLU A OE1 1 
ATOM 6468 O OE2 . GLU A 1 843  ? 9.535   26.918 53.080  1.00 79.73  ? 840  GLU A OE2 1 
ATOM 6469 N N   . ALA A 1 844  ? 15.307  28.495 52.428  1.00 77.63  ? 841  ALA A N   1 
ATOM 6470 C CA  . ALA A 1 844  ? 16.082  28.896 51.253  1.00 77.63  ? 841  ALA A CA  1 
ATOM 6471 C C   . ALA A 1 844  ? 15.296  28.599 49.983  1.00 77.63  ? 841  ALA A C   1 
ATOM 6472 O O   . ALA A 1 844  ? 15.558  29.165 48.919  1.00 77.63  ? 841  ALA A O   1 
ATOM 6473 C CB  . ALA A 1 844  ? 17.416  28.163 51.231  1.00 63.15  ? 841  ALA A CB  1 
ATOM 6474 N N   . GLU A 1 845  ? 14.305  27.726 50.131  1.00 64.75  ? 842  GLU A N   1 
ATOM 6475 C CA  . GLU A 1 845  ? 13.571  27.169 49.021  1.00 64.75  ? 842  GLU A CA  1 
ATOM 6476 C C   . GLU A 1 845  ? 12.259  26.525 49.544  1.00 64.75  ? 842  GLU A C   1 
ATOM 6477 O O   . GLU A 1 845  ? 12.272  25.775 50.525  1.00 64.75  ? 842  GLU A O   1 
ATOM 6478 C CB  . GLU A 1 845  ? 14.471  26.163 48.341  1.00 65.43  ? 842  GLU A CB  1 
ATOM 6479 C CG  . GLU A 1 845  ? 13.953  25.600 47.077  1.00 65.43  ? 842  GLU A CG  1 
ATOM 6480 C CD  . GLU A 1 845  ? 14.887  24.515 46.527  1.00 65.43  ? 842  GLU A CD  1 
ATOM 6481 O OE1 . GLU A 1 845  ? 15.579  23.840 47.332  1.00 65.43  ? 842  GLU A OE1 1 
ATOM 6482 O OE2 . GLU A 1 845  ? 14.926  24.342 45.284  1.00 65.43  ? 842  GLU A OE2 1 
ATOM 6483 N N   . PRO A 1 846  ? 11.105  26.894 48.951  1.00 87.53  ? 843  PRO A N   1 
ATOM 6484 C CA  . PRO A 1 846  ? 9.821   26.278 49.309  1.00 87.53  ? 843  PRO A CA  1 
ATOM 6485 C C   . PRO A 1 846  ? 9.638   24.799 48.924  1.00 87.53  ? 843  PRO A C   1 
ATOM 6486 O O   . PRO A 1 846  ? 10.001  24.382 47.819  1.00 87.53  ? 843  PRO A O   1 
ATOM 6487 C CB  . PRO A 1 846  ? 8.794   27.165 48.581  1.00 45.85  ? 843  PRO A CB  1 
ATOM 6488 C CG  . PRO A 1 846  ? 9.536   27.727 47.444  1.00 45.85  ? 843  PRO A CG  1 
ATOM 6489 C CD  . PRO A 1 846  ? 10.921  27.989 47.977  1.00 45.85  ? 843  PRO A CD  1 
ATOM 6490 N N   . LYS A 1 847  ? 9.044   24.053 49.866  1.00 80.57  ? 844  LYS A N   1 
ATOM 6491 C CA  . LYS A 1 847  ? 8.730   22.612 49.774  1.00 80.57  ? 844  LYS A CA  1 
ATOM 6492 C C   . LYS A 1 847  ? 7.217   22.316 49.910  1.00 80.57  ? 844  LYS A C   1 
ATOM 6493 O O   . LYS A 1 847  ? 6.803   21.160 50.054  1.00 80.57  ? 844  LYS A O   1 
ATOM 6494 C CB  . LYS A 1 847  ? 9.529   21.831 50.838  1.00 187.38 ? 844  LYS A CB  1 
ATOM 6495 C CG  . LYS A 1 847  ? 9.014   21.975 52.280  1.00 187.38 ? 844  LYS A CG  1 
ATOM 6496 C CD  . LYS A 1 847  ? 9.016   23.426 52.745  1.00 187.38 ? 844  LYS A CD  1 
ATOM 6497 C CE  . LYS A 1 847  ? 7.628   23.850 53.200  1.00 187.38 ? 844  LYS A CE  1 
ATOM 6498 N NZ  . LYS A 1 847  ? 7.298   25.257 52.817  1.00 187.38 ? 844  LYS A NZ  1 
ATOM 6499 N N   . GLN A 1 848  ? 6.402   23.367 49.880  1.00 74.25  ? 845  GLN A N   1 
ATOM 6500 C CA  . GLN A 1 848  ? 4.956   23.241 49.887  1.00 74.25  ? 845  GLN A CA  1 
ATOM 6501 C C   . GLN A 1 848  ? 4.351   24.224 48.906  1.00 74.25  ? 845  GLN A C   1 
ATOM 6502 O O   . GLN A 1 848  ? 4.816   25.362 48.789  1.00 74.25  ? 845  GLN A O   1 
ATOM 6503 C CB  . GLN A 1 848  ? 4.419   23.561 51.265  1.00 84.28  ? 845  GLN A CB  1 
ATOM 6504 C CG  . GLN A 1 848  ? 4.462   22.413 52.227  1.00 84.28  ? 845  GLN A CG  1 
ATOM 6505 C CD  . GLN A 1 848  ? 4.103   22.834 53.635  1.00 84.28  ? 845  GLN A CD  1 
ATOM 6506 O OE1 . GLN A 1 848  ? 3.769   23.992 53.881  1.00 84.28  ? 845  GLN A OE1 1 
ATOM 6507 N NE2 . GLN A 1 848  ? 4.176   21.895 54.572  1.00 84.28  ? 845  GLN A NE2 1 
ATOM 6508 N N   . GLY A 1 849  ? 3.302   23.795 48.217  1.00 52.66  ? 846  GLY A N   1 
ATOM 6509 C CA  . GLY A 1 849  ? 2.563   24.670 47.325  1.00 52.66  ? 846  GLY A CA  1 
ATOM 6510 C C   . GLY A 1 849  ? 1.450   23.872 46.699  1.00 52.66  ? 846  GLY A C   1 
ATOM 6511 O O   . GLY A 1 849  ? 1.336   22.685 46.962  1.00 52.66  ? 846  GLY A O   1 
ATOM 6512 N N   . ARG A 1 850  ? 0.633   24.501 45.863  1.00 60.66  ? 847  ARG A N   1 
ATOM 6513 C CA  . ARG A 1 850  ? -0.474  23.788 45.259  1.00 60.66  ? 847  ARG A CA  1 
ATOM 6514 C C   . ARG A 1 850  ? -0.864  24.313 43.915  1.00 60.66  ? 847  ARG A C   1 
ATOM 6515 O O   . ARG A 1 850  ? -0.790  25.502 43.620  1.00 60.66  ? 847  ARG A O   1 
ATOM 6516 C CB  . ARG A 1 850  ? -1.708  23.791 46.169  1.00 75.14  ? 847  ARG A CB  1 
ATOM 6517 C CG  . ARG A 1 850  ? -2.156  25.166 46.615  1.00 75.14  ? 847  ARG A CG  1 
ATOM 6518 C CD  . ARG A 1 850  ? -2.889  25.133 47.951  1.00 75.14  ? 847  ARG A CD  1 
ATOM 6519 N NE  . ARG A 1 850  ? -3.270  26.478 48.407  1.00 75.14  ? 847  ARG A NE  1 
ATOM 6520 C CZ  . ARG A 1 850  ? -4.420  27.089 48.112  1.00 75.14  ? 847  ARG A CZ  1 
ATOM 6521 N NH1 . ARG A 1 850  ? -5.333  26.487 47.359  1.00 75.14  ? 847  ARG A NH1 1 
ATOM 6522 N NH2 . ARG A 1 850  ? -4.657  28.309 48.570  1.00 75.14  ? 847  ARG A NH2 1 
ATOM 6523 N N   . ILE A 1 851  ? -1.291  23.386 43.098  1.00 57.47  ? 848  ILE A N   1 
ATOM 6524 C CA  . ILE A 1 851  ? -1.982  23.705 41.897  1.00 57.47  ? 848  ILE A CA  1 
ATOM 6525 C C   . ILE A 1 851  ? -3.484  23.803 42.252  1.00 57.47  ? 848  ILE A C   1 
ATOM 6526 O O   . ILE A 1 851  ? -3.983  23.022 43.081  1.00 57.47  ? 848  ILE A O   1 
ATOM 6527 C CB  . ILE A 1 851  ? -1.773  22.569 40.937  1.00 39.96  ? 848  ILE A CB  1 
ATOM 6528 C CG1 . ILE A 1 851  ? -0.329  22.120 40.975  1.00 39.96  ? 848  ILE A CG1 1 
ATOM 6529 C CG2 . ILE A 1 851  ? -2.209  22.934 39.502  1.00 39.96  ? 848  ILE A CG2 1 
ATOM 6530 C CD1 . ILE A 1 851  ? -0.196  20.753 40.381  1.00 39.96  ? 848  ILE A CD1 1 
ATOM 6531 N N   . VAL A 1 852  ? -4.187  24.768 41.641  1.00 58.46  ? 849  VAL A N   1 
ATOM 6532 C CA  . VAL A 1 852  ? -5.614  24.999 41.906  1.00 58.46  ? 849  VAL A CA  1 
ATOM 6533 C C   . VAL A 1 852  ? -6.360  25.217 40.619  1.00 58.46  ? 849  VAL A C   1 
ATOM 6534 O O   . VAL A 1 852  ? -5.941  26.027 39.784  1.00 58.46  ? 849  VAL A O   1 
ATOM 6535 C CB  . VAL A 1 852  ? -5.923  26.291 42.710  1.00 41.95  ? 849  VAL A CB  1 
ATOM 6536 C CG1 . VAL A 1 852  ? -7.355  26.219 43.202  1.00 41.95  ? 849  VAL A CG1 1 
ATOM 6537 C CG2 . VAL A 1 852  ? -4.957  26.532 43.885  1.00 41.95  ? 849  VAL A CG2 1 
ATOM 6538 N N   . VAL A 1 853  ? -7.491  24.551 40.475  1.00 79.43  ? 850  VAL A N   1 
ATOM 6539 C CA  . VAL A 1 853  ? -8.286  24.736 39.303  1.00 79.43  ? 850  VAL A CA  1 
ATOM 6540 C C   . VAL A 1 853  ? -9.501  25.582 39.623  1.00 79.43  ? 850  VAL A C   1 
ATOM 6541 O O   . VAL A 1 853  ? -10.184 25.340 40.603  1.00 79.43  ? 850  VAL A O   1 
ATOM 6542 C CB  . VAL A 1 853  ? -8.696  23.414 38.749  1.00 43.06  ? 850  VAL A CB  1 
ATOM 6543 C CG1 . VAL A 1 853  ? -9.744  23.604 37.691  1.00 43.06  ? 850  VAL A CG1 1 
ATOM 6544 C CG2 . VAL A 1 853  ? -7.505  22.733 38.133  1.00 43.06  ? 850  VAL A CG2 1 
ATOM 6545 N N   . PHE A 1 854  ? -9.760  26.568 38.772  1.00 62.07  ? 851  PHE A N   1 
ATOM 6546 C CA  . PHE A 1 854  ? -10.779 27.575 38.979  1.00 62.07  ? 851  PHE A CA  1 
ATOM 6547 C C   . PHE A 1 854  ? -11.660 27.706 37.755  1.00 62.07  ? 851  PHE A C   1 
ATOM 6548 O O   . PHE A 1 854  ? -11.231 27.479 36.612  1.00 62.07  ? 851  PHE A O   1 
ATOM 6549 C CB  . PHE A 1 854  ? -10.119 28.924 39.145  1.00 57.83  ? 851  PHE A CB  1 
ATOM 6550 C CG  . PHE A 1 854  ? -9.478  29.155 40.477  1.00 57.83  ? 851  PHE A CG  1 
ATOM 6551 C CD1 . PHE A 1 854  ? -8.115  29.060 40.624  1.00 57.83  ? 851  PHE A CD1 1 
ATOM 6552 C CD2 . PHE A 1 854  ? -10.230 29.566 41.565  1.00 57.83  ? 851  PHE A CD2 1 
ATOM 6553 C CE1 . PHE A 1 854  ? -7.512  29.342 41.848  1.00 57.83  ? 851  PHE A CE1 1 
ATOM 6554 C CE2 . PHE A 1 854  ? -9.638  29.843 42.792  1.00 57.83  ? 851  PHE A CE2 1 
ATOM 6555 C CZ  . PHE A 1 854  ? -8.281  29.733 42.933  1.00 57.83  ? 851  PHE A CZ  1 
ATOM 6556 N N   . GLN A 1 855  ? -12.894 28.122 37.985  1.00 84.02  ? 852  GLN A N   1 
ATOM 6557 C CA  . GLN A 1 855  ? -13.736 28.497 36.873  1.00 84.02  ? 852  GLN A CA  1 
ATOM 6558 C C   . GLN A 1 855  ? -14.377 29.846 37.108  1.00 84.02  ? 852  GLN A C   1 
ATOM 6559 O O   . GLN A 1 855  ? -14.672 30.216 38.244  1.00 84.02  ? 852  GLN A O   1 
ATOM 6560 C CB  . GLN A 1 855  ? -14.801 27.440 36.603  1.00 68.48  ? 852  GLN A CB  1 
ATOM 6561 C CG  . GLN A 1 855  ? -15.450 27.586 35.237  1.00 68.48  ? 852  GLN A CG  1 
ATOM 6562 C CD  . GLN A 1 855  ? -16.431 26.486 34.940  1.00 68.48  ? 852  GLN A CD  1 
ATOM 6563 O OE1 . GLN A 1 855  ? -16.788 25.693 35.827  1.00 68.48  ? 852  GLN A OE1 1 
ATOM 6564 N NE2 . GLN A 1 855  ? -16.876 26.420 33.683  1.00 68.48  ? 852  GLN A NE2 1 
ATOM 6565 N N   . TYR A 1 856  ? -14.560 30.571 36.006  1.00 58.30  ? 853  TYR A N   1 
ATOM 6566 C CA  . TYR A 1 856  ? -15.361 31.803 35.959  1.00 58.30  ? 853  TYR A CA  1 
ATOM 6567 C C   . TYR A 1 856  ? -16.692 31.566 35.214  1.00 58.30  ? 853  TYR A C   1 
ATOM 6568 O O   . TYR A 1 856  ? -16.713 31.265 33.997  1.00 58.30  ? 853  TYR A O   1 
ATOM 6569 C CB  . TYR A 1 856  ? -14.550 32.951 35.338  1.00 63.31  ? 853  TYR A CB  1 
ATOM 6570 C CG  . TYR A 1 856  ? -15.077 34.338 35.615  1.00 63.31  ? 853  TYR A CG  1 
ATOM 6571 C CD1 . TYR A 1 856  ? -15.279 34.789 36.924  1.00 63.31  ? 853  TYR A CD1 1 
ATOM 6572 C CD2 . TYR A 1 856  ? -15.350 35.218 34.564  1.00 63.31  ? 853  TYR A CD2 1 
ATOM 6573 C CE1 . TYR A 1 856  ? -15.761 36.092 37.180  1.00 63.31  ? 853  TYR A CE1 1 
ATOM 6574 C CE2 . TYR A 1 856  ? -15.835 36.523 34.805  1.00 63.31  ? 853  TYR A CE2 1 
ATOM 6575 C CZ  . TYR A 1 856  ? -16.034 36.949 36.115  1.00 63.31  ? 853  TYR A CZ  1 
ATOM 6576 O OH  . TYR A 1 856  ? -16.512 38.216 36.344  1.00 63.31  ? 853  TYR A OH  1 
ATOM 6577 N N   . SER A 1 857  ? -17.787 31.713 35.962  1.00 142.34 ? 854  SER A N   1 
ATOM 6578 C CA  . SER A 1 857  ? -19.126 31.344 35.511  1.00 142.34 ? 854  SER A CA  1 
ATOM 6579 C C   . SER A 1 857  ? -19.876 32.540 34.919  1.00 142.34 ? 854  SER A C   1 
ATOM 6580 O O   . SER A 1 857  ? -19.500 33.061 33.862  1.00 142.34 ? 854  SER A O   1 
ATOM 6581 C CB  . SER A 1 857  ? -19.924 30.730 36.673  1.00 89.48  ? 854  SER A CB  1 
ATOM 6582 O OG  . SER A 1 857  ? -19.096 29.969 37.538  1.00 89.48  ? 854  SER A OG  1 
ATOM 6583 N N   . ASP A 1 858  ? -20.946 32.952 35.594  1.00 144.36 ? 855  ASP A N   1 
ATOM 6584 C CA  . ASP A 1 858  ? -21.687 34.145 35.221  1.00 144.36 ? 855  ASP A CA  1 
ATOM 6585 C C   . ASP A 1 858  ? -20.873 35.355 35.636  1.00 144.36 ? 855  ASP A C   1 
ATOM 6586 O O   . ASP A 1 858  ? -20.592 36.242 34.833  1.00 144.36 ? 855  ASP A O   1 
ATOM 6587 C CB  . ASP A 1 858  ? -23.052 34.178 35.918  1.00 129.23 ? 855  ASP A CB  1 
ATOM 6588 C CG  . ASP A 1 858  ? -24.149 33.495 35.113  1.00 129.23 ? 855  ASP A CG  1 
ATOM 6589 O OD1 . ASP A 1 858  ? -23.839 32.571 34.326  1.00 129.23 ? 855  ASP A OD1 1 
ATOM 6590 O OD2 . ASP A 1 858  ? -25.329 33.886 35.274  1.00 129.23 ? 855  ASP A OD2 1 
ATOM 6591 N N   . GLY A 1 859  ? -20.499 35.367 36.906  1.00 86.57  ? 856  GLY A N   1 
ATOM 6592 C CA  . GLY A 1 859  ? -19.681 36.421 37.487  1.00 86.57  ? 856  GLY A CA  1 
ATOM 6593 C C   . GLY A 1 859  ? -19.072 35.736 38.676  1.00 86.57  ? 856  GLY A C   1 
ATOM 6594 O O   . GLY A 1 859  ? -18.641 36.381 39.646  1.00 86.57  ? 856  GLY A O   1 
ATOM 6595 N N   . LYS A 1 860  ? -19.046 34.405 38.555  1.00 68.53  ? 857  LYS A N   1 
ATOM 6596 C CA  . LYS A 1 860  ? -18.732 33.492 39.652  1.00 68.53  ? 857  LYS A CA  1 
ATOM 6597 C C   . LYS A 1 860  ? -17.330 32.851 39.528  1.00 68.53  ? 857  LYS A C   1 
ATOM 6598 O O   . LYS A 1 860  ? -16.886 32.522 38.422  1.00 68.53  ? 857  LYS A O   1 
ATOM 6599 C CB  . LYS A 1 860  ? -19.833 32.432 39.750  1.00 161.97 ? 857  LYS A CB  1 
ATOM 6600 C CG  . LYS A 1 860  ? -21.139 32.879 39.086  1.00 161.97 ? 857  LYS A CG  1 
ATOM 6601 C CD  . LYS A 1 860  ? -22.331 32.782 40.011  1.00 161.97 ? 857  LYS A CD  1 
ATOM 6602 C CE  . LYS A 1 860  ? -23.418 33.749 39.579  1.00 161.97 ? 857  LYS A CE  1 
ATOM 6603 N NZ  . LYS A 1 860  ? -24.529 33.798 40.560  1.00 161.97 ? 857  LYS A NZ  1 
ATOM 6604 N N   . LEU A 1 861  ? -16.637 32.704 40.665  1.00 77.43  ? 858  LEU A N   1 
ATOM 6605 C CA  . LEU A 1 861  ? -15.297 32.111 40.700  1.00 77.43  ? 858  LEU A CA  1 
ATOM 6606 C C   . LEU A 1 861  ? -15.271 30.803 41.486  1.00 77.43  ? 858  LEU A C   1 
ATOM 6607 O O   . LEU A 1 861  ? -14.975 30.787 42.682  1.00 77.43  ? 858  LEU A O   1 
ATOM 6608 C CB  . LEU A 1 861  ? -14.261 33.115 41.259  1.00 52.35  ? 858  LEU A CB  1 
ATOM 6609 C CG  . LEU A 1 861  ? -12.854 33.277 40.583  1.00 52.35  ? 858  LEU A CG  1 
ATOM 6610 C CD1 . LEU A 1 861  ? -11.620 32.901 41.452  1.00 52.35  ? 858  LEU A CD1 1 
ATOM 6611 C CD2 . LEU A 1 861  ? -12.776 32.620 39.155  1.00 52.35  ? 858  LEU A CD2 1 
ATOM 6612 N N   . GLN A 1 862  ? -15.567 29.703 40.803  1.00 56.30  ? 859  GLN A N   1 
ATOM 6613 C CA  . GLN A 1 862  ? -15.625 28.379 41.449  1.00 56.30  ? 859  GLN A CA  1 
ATOM 6614 C C   . GLN A 1 862  ? -14.248 27.680 41.651  1.00 56.30  ? 859  GLN A C   1 
ATOM 6615 O O   . GLN A 1 862  ? -13.573 27.333 40.670  1.00 56.30  ? 859  GLN A O   1 
ATOM 6616 C CB  . GLN A 1 862  ? -16.605 27.468 40.682  1.00 121.87 ? 859  GLN A CB  1 
ATOM 6617 C CG  . GLN A 1 862  ? -17.155 26.282 41.500  1.00 121.87 ? 859  GLN A CG  1 
ATOM 6618 C CD  . GLN A 1 862  ? -18.287 25.519 40.803  1.00 121.87 ? 859  GLN A CD  1 
ATOM 6619 O OE1 . GLN A 1 862  ? -18.125 25.006 39.692  1.00 121.87 ? 859  GLN A OE1 1 
ATOM 6620 N NE2 . GLN A 1 862  ? -19.434 25.429 41.472  1.00 121.87 ? 859  GLN A NE2 1 
ATOM 6621 N N   . THR A 1 863  ? -13.857 27.491 42.919  1.00 67.58  ? 860  THR A N   1 
ATOM 6622 C CA  . THR A 1 863  ? -12.675 26.694 43.314  1.00 67.58  ? 860  THR A CA  1 
ATOM 6623 C C   . THR A 1 863  ? -12.847 25.198 42.965  1.00 67.58  ? 860  THR A C   1 
ATOM 6624 O O   . THR A 1 863  ? -13.099 24.382 43.850  1.00 67.58  ? 860  THR A O   1 
ATOM 6625 C CB  . THR A 1 863  ? -12.391 26.853 44.858  1.00 59.46  ? 860  THR A CB  1 
ATOM 6626 O OG1 . THR A 1 863  ? -12.216 28.235 45.185  1.00 59.46  ? 860  THR A OG1 1 
ATOM 6627 C CG2 . THR A 1 863  ? -11.149 26.096 45.319  1.00 59.46  ? 860  THR A CG2 1 
ATOM 6628 N N   . VAL A 1 864  ? -12.692 24.843 41.688  1.00 60.93  ? 861  VAL A N   1 
ATOM 6629 C CA  . VAL A 1 864  ? -13.045 23.500 41.163  1.00 60.93  ? 861  VAL A CA  1 
ATOM 6630 C C   . VAL A 1 864  ? -12.293 22.336 41.803  1.00 60.93  ? 861  VAL A C   1 
ATOM 6631 O O   . VAL A 1 864  ? -12.898 21.308 42.130  1.00 60.93  ? 861  VAL A O   1 
ATOM 6632 C CB  . VAL A 1 864  ? -12.855 23.373 39.611  1.00 55.17  ? 861  VAL A CB  1 
ATOM 6633 C CG1 . VAL A 1 864  ? -13.267 21.961 39.101  1.00 55.17  ? 861  VAL A CG1 1 
ATOM 6634 C CG2 . VAL A 1 864  ? -13.592 24.477 38.839  1.00 55.17  ? 861  VAL A CG2 1 
ATOM 6635 N N   . ALA A 1 865  ? -10.979 22.479 41.957  1.00 66.29  ? 862  ALA A N   1 
ATOM 6636 C CA  . ALA A 1 865  ? -10.138 21.394 42.456  1.00 66.29  ? 862  ALA A CA  1 
ATOM 6637 C C   . ALA A 1 865  ? -8.812  21.944 42.909  1.00 66.29  ? 862  ALA A C   1 
ATOM 6638 O O   . ALA A 1 865  ? -8.168  22.663 42.151  1.00 66.29  ? 862  ALA A O   1 
ATOM 6639 C CB  . ALA A 1 865  ? -9.913  20.359 41.367  1.00 55.69  ? 862  ALA A CB  1 
ATOM 6640 N N   . GLU A 1 866  ? -8.397  21.619 44.130  1.00 85.42  ? 863  GLU A N   1 
ATOM 6641 C CA  . GLU A 1 866  ? -7.024  21.890 44.533  1.00 85.42  ? 863  GLU A CA  1 
ATOM 6642 C C   . GLU A 1 866  ? -6.139  20.655 44.340  1.00 85.42  ? 863  GLU A C   1 
ATOM 6643 O O   . GLU A 1 866  ? -6.566  19.693 43.688  1.00 85.42  ? 863  GLU A O   1 
ATOM 6644 C CB  . GLU A 1 866  ? -6.931  22.510 45.931  1.00 77.74  ? 863  GLU A CB  1 
ATOM 6645 C CG  . GLU A 1 866  ? -7.397  21.679 47.127  1.00 77.74  ? 863  GLU A CG  1 
ATOM 6646 C CD  . GLU A 1 866  ? -7.314  22.476 48.456  1.00 77.74  ? 863  GLU A CD  1 
ATOM 6647 O OE1 . GLU A 1 866  ? -6.448  23.384 48.563  1.00 77.74  ? 863  GLU A OE1 1 
ATOM 6648 O OE2 . GLU A 1 866  ? -8.116  22.203 49.390  1.00 77.74  ? 863  GLU A OE2 1 
ATOM 6649 N N   . LYS A 1 867  ? -4.911  20.701 44.864  1.00 61.82  ? 864  LYS A N   1 
ATOM 6650 C CA  . LYS A 1 867  ? -3.901  19.642 44.664  1.00 61.82  ? 864  LYS A CA  1 
ATOM 6651 C C   . LYS A 1 867  ? -2.564  20.023 45.284  1.00 61.82  ? 864  LYS A C   1 
ATOM 6652 O O   . LYS A 1 867  ? -1.746  20.640 44.613  1.00 61.82  ? 864  LYS A O   1 
ATOM 6653 C CB  . LYS A 1 867  ? -3.667  19.365 43.173  1.00 87.48  ? 864  LYS A CB  1 
ATOM 6654 C CG  . LYS A 1 867  ? -2.696  18.230 42.910  1.00 87.48  ? 864  LYS A CG  1 
ATOM 6655 C CD  . LYS A 1 867  ? -3.304  16.894 43.285  1.00 87.48  ? 864  LYS A CD  1 
ATOM 6656 C CE  . LYS A 1 867  ? -2.387  15.749 42.933  1.00 87.48  ? 864  LYS A CE  1 
ATOM 6657 N NZ  . LYS A 1 867  ? -3.170  14.497 42.812  1.00 87.48  ? 864  LYS A NZ  1 
ATOM 6658 N N   . GLU A 1 868  ? -2.344  19.661 46.546  1.00 64.95  ? 865  GLU A N   1 
ATOM 6659 C CA  . GLU A 1 868  ? -1.113  19.973 47.248  1.00 64.95  ? 865  GLU A CA  1 
ATOM 6660 C C   . GLU A 1 868  ? 0.062   19.374 46.500  1.00 64.95  ? 865  GLU A C   1 
ATOM 6661 O O   . GLU A 1 868  ? -0.062  18.307 45.878  1.00 64.95  ? 865  GLU A O   1 
ATOM 6662 C CB  . GLU A 1 868  ? -1.164  19.398 48.650  1.00 73.31  ? 865  GLU A CB  1 
ATOM 6663 C CG  . GLU A 1 868  ? -0.031  19.826 49.582  1.00 73.31  ? 865  GLU A CG  1 
ATOM 6664 C CD  . GLU A 1 868  ? -0.098  19.132 50.961  1.00 73.31  ? 865  GLU A CD  1 
ATOM 6665 O OE1 . GLU A 1 868  ? 0.283   19.749 51.992  1.00 73.31  ? 865  GLU A OE1 1 
ATOM 6666 O OE2 . GLU A 1 868  ? -0.538  17.960 51.014  1.00 73.31  ? 865  GLU A OE2 1 
ATOM 6667 N N   . VAL A 1 869  ? 1.189   20.088 46.530  1.00 59.91  ? 866  VAL A N   1 
ATOM 6668 C CA  . VAL A 1 869  ? 2.459   19.616 45.955  1.00 59.91  ? 866  VAL A CA  1 
ATOM 6669 C C   . VAL A 1 869  ? 3.602   19.963 46.890  1.00 59.91  ? 866  VAL A C   1 
ATOM 6670 O O   . VAL A 1 869  ? 3.510   20.928 47.675  1.00 59.91  ? 866  VAL A O   1 
ATOM 6671 C CB  . VAL A 1 869  ? 2.768   20.170 44.531  1.00 71.15  ? 866  VAL A CB  1 
ATOM 6672 C CG1 . VAL A 1 869  ? 1.847   19.548 43.477  1.00 71.15  ? 866  VAL A CG1 1 
ATOM 6673 C CG2 . VAL A 1 869  ? 2.696   21.671 44.497  1.00 71.15  ? 866  VAL A CG2 1 
ATOM 6674 N N   . LYS A 1 870  ? 4.678   19.177 46.791  1.00 79.09  ? 867  LYS A N   1 
ATOM 6675 C CA  . LYS A 1 870  ? 5.792   19.238 47.741  1.00 79.09  ? 867  LYS A CA  1 
ATOM 6676 C C   . LYS A 1 870  ? 6.873   20.243 47.318  1.00 79.09  ? 867  LYS A C   1 
ATOM 6677 O O   . LYS A 1 870  ? 8.054   20.045 47.582  1.00 79.09  ? 867  LYS A O   1 
ATOM 6678 C CB  . LYS A 1 870  ? 6.379   17.836 47.940  1.00 80.36  ? 867  LYS A CB  1 
ATOM 6679 C CG  . LYS A 1 870  ? 5.408   16.824 48.561  1.00 80.36  ? 867  LYS A CG  1 
ATOM 6680 C CD  . LYS A 1 870  ? 5.806   15.360 48.278  1.00 80.36  ? 867  LYS A CD  1 
ATOM 6681 C CE  . LYS A 1 870  ? 5.212   14.819 46.950  1.00 80.36  ? 867  LYS A CE  1 
ATOM 6682 N NZ  . LYS A 1 870  ? 5.729   13.450 46.544  1.00 80.36  ? 867  LYS A NZ  1 
ATOM 6683 N N   . GLY A 1 871  ? 6.450   21.336 46.685  1.00 81.13  ? 868  GLY A N   1 
ATOM 6684 C CA  . GLY A 1 871  ? 7.359   22.368 46.187  1.00 81.13  ? 868  GLY A CA  1 
ATOM 6685 C C   . GLY A 1 871  ? 6.619   23.553 45.597  1.00 81.13  ? 868  GLY A C   1 
ATOM 6686 O O   . GLY A 1 871  ? 5.401   23.621 45.664  1.00 81.13  ? 868  GLY A O   1 
ATOM 6687 N N   . ALA A 1 872  ? 7.375   24.485 45.027  1.00 53.15  ? 869  ALA A N   1 
ATOM 6688 C CA  . ALA A 1 872  ? 6.867   25.724 44.439  1.00 53.15  ? 869  ALA A CA  1 
ATOM 6689 C C   . ALA A 1 872  ? 6.586   25.524 42.963  1.00 53.15  ? 869  ALA A C   1 
ATOM 6690 O O   . ALA A 1 872  ? 7.500   25.194 42.208  1.00 53.15  ? 869  ALA A O   1 
ATOM 6691 C CB  . ALA A 1 872  ? 7.894   26.827 44.608  1.00 43.34  ? 869  ALA A CB  1 
ATOM 6692 N N   . VAL A 1 873  ? 5.346   25.733 42.530  1.00 61.84  ? 870  VAL A N   1 
ATOM 6693 C CA  . VAL A 1 873  ? 5.055   25.591 41.113  1.00 61.84  ? 870  VAL A CA  1 
ATOM 6694 C C   . VAL A 1 873  ? 5.561   26.796 40.325  1.00 61.84  ? 870  VAL A C   1 
ATOM 6695 O O   . VAL A 1 873  ? 4.979   27.894 40.381  1.00 61.84  ? 870  VAL A O   1 
ATOM 6696 C CB  . VAL A 1 873  ? 3.585   25.378 40.834  1.00 52.11  ? 870  VAL A CB  1 
ATOM 6697 C CG1 . VAL A 1 873  ? 3.427   24.965 39.409  1.00 52.11  ? 870  VAL A CG1 1 
ATOM 6698 C CG2 . VAL A 1 873  ? 3.028   24.326 41.729  1.00 52.11  ? 870  VAL A CG2 1 
ATOM 6699 N N   . TYR A 1 874  ? 6.656   26.577 39.595  1.00 62.78  ? 871  TYR A N   1 
ATOM 6700 C CA  . TYR A 1 874  ? 7.346   27.658 38.901  1.00 62.78  ? 871  TYR A CA  1 
ATOM 6701 C C   . TYR A 1 874  ? 6.743   27.978 37.580  1.00 62.78  ? 871  TYR A C   1 
ATOM 6702 O O   . TYR A 1 874  ? 6.776   29.105 37.145  1.00 62.78  ? 871  TYR A O   1 
ATOM 6703 C CB  . TYR A 1 874  ? 8.813   27.364 38.759  1.00 51.70  ? 871  TYR A CB  1 
ATOM 6704 C CG  . TYR A 1 874  ? 9.530   27.652 40.045  1.00 51.70  ? 871  TYR A CG  1 
ATOM 6705 C CD1 . TYR A 1 874  ? 10.110  26.632 40.769  1.00 51.70  ? 871  TYR A CD1 1 
ATOM 6706 C CD2 . TYR A 1 874  ? 9.603   28.947 40.553  1.00 51.70  ? 871  TYR A CD2 1 
ATOM 6707 C CE1 . TYR A 1 874  ? 10.759  26.879 41.939  1.00 51.70  ? 871  TYR A CE1 1 
ATOM 6708 C CE2 . TYR A 1 874  ? 10.249  29.209 41.722  1.00 51.70  ? 871  TYR A CE2 1 
ATOM 6709 C CZ  . TYR A 1 874  ? 10.830  28.170 42.428  1.00 51.70  ? 871  TYR A CZ  1 
ATOM 6710 O OH  . TYR A 1 874  ? 11.507  28.393 43.636  1.00 51.70  ? 871  TYR A OH  1 
ATOM 6711 N N   . SER A 1 875  ? 6.161   26.990 36.948  1.00 58.20  ? 872  SER A N   1 
ATOM 6712 C CA  . SER A 1 875  ? 5.424   27.269 35.768  1.00 58.20  ? 872  SER A CA  1 
ATOM 6713 C C   . SER A 1 875  ? 4.636   26.032 35.370  1.00 58.20  ? 872  SER A C   1 
ATOM 6714 O O   . SER A 1 875  ? 4.785   24.973 35.995  1.00 58.20  ? 872  SER A O   1 
ATOM 6715 C CB  . SER A 1 875  ? 6.362   27.733 34.653  1.00 45.33  ? 872  SER A CB  1 
ATOM 6716 O OG  . SER A 1 875  ? 6.897   26.631 33.941  1.00 45.33  ? 872  SER A OG  1 
ATOM 6717 N N   . MET A 1 876  ? 3.800   26.180 34.335  1.00 52.07  ? 873  MET A N   1 
ATOM 6718 C CA  . MET A 1 876  ? 2.949   25.104 33.875  1.00 52.07  ? 873  MET A CA  1 
ATOM 6719 C C   . MET A 1 876  ? 2.232   25.383 32.559  1.00 52.07  ? 873  MET A C   1 
ATOM 6720 O O   . MET A 1 876  ? 1.444   26.285 32.470  1.00 52.07  ? 873  MET A O   1 
ATOM 6721 C CB  . MET A 1 876  ? 1.914   24.777 34.954  1.00 55.15  ? 873  MET A CB  1 
ATOM 6722 C CG  . MET A 1 876  ? 1.008   25.930 35.398  1.00 55.15  ? 873  MET A CG  1 
ATOM 6723 S SD  . MET A 1 876  ? -0.157  25.411 36.685  1.00 55.15  ? 873  MET A SD  1 
ATOM 6724 C CE  . MET A 1 876  ? 0.951   24.994 38.004  1.00 55.15  ? 873  MET A CE  1 
ATOM 6725 N N   . VAL A 1 877  ? 2.469   24.597 31.530  1.00 62.11  ? 874  VAL A N   1 
ATOM 6726 C CA  . VAL A 1 877  ? 1.666   24.774 30.338  1.00 62.11  ? 874  VAL A CA  1 
ATOM 6727 C C   . VAL A 1 877  ? 0.599   23.683 30.229  1.00 62.11  ? 874  VAL A C   1 
ATOM 6728 O O   . VAL A 1 877  ? 0.765   22.574 30.738  1.00 62.11  ? 874  VAL A O   1 
ATOM 6729 C CB  . VAL A 1 877  ? 2.529   24.862 29.039  1.00 54.63  ? 874  VAL A CB  1 
ATOM 6730 C CG1 . VAL A 1 877  ? 3.280   23.559 28.762  1.00 54.63  ? 874  VAL A CG1 1 
ATOM 6731 C CG2 . VAL A 1 877  ? 1.670   25.231 27.826  1.00 54.63  ? 874  VAL A CG2 1 
ATOM 6732 N N   . GLU A 1 878  ? -0.510  24.032 29.592  1.00 75.91  ? 875  GLU A N   1 
ATOM 6733 C CA  . GLU A 1 878  ? -1.424  23.051 29.032  1.00 75.91  ? 875  GLU A CA  1 
ATOM 6734 C C   . GLU A 1 878  ? -0.599  22.238 28.056  1.00 75.91  ? 875  GLU A C   1 
ATOM 6735 O O   . GLU A 1 878  ? 0.158   22.804 27.265  1.00 75.91  ? 875  GLU A O   1 
ATOM 6736 C CB  . GLU A 1 878  ? -2.573  23.769 28.300  1.00 87.78  ? 875  GLU A CB  1 
ATOM 6737 C CG  . GLU A 1 878  ? -3.516  22.886 27.473  1.00 87.78  ? 875  GLU A CG  1 
ATOM 6738 C CD  . GLU A 1 878  ? -3.021  22.635 26.038  1.00 87.78  ? 875  GLU A CD  1 
ATOM 6739 O OE1 . GLU A 1 878  ? -2.115  23.373 25.556  1.00 87.78  ? 875  GLU A OE1 1 
ATOM 6740 O OE2 . GLU A 1 878  ? -3.550  21.687 25.392  1.00 87.78  ? 875  GLU A OE2 1 
ATOM 6741 N N   . PHE A 1 879  ? -0.728  20.920 28.105  1.00 106.73 ? 876  PHE A N   1 
ATOM 6742 C CA  . PHE A 1 879  ? 0.044   20.119 27.182  1.00 106.73 ? 876  PHE A CA  1 
ATOM 6743 C C   . PHE A 1 879  ? -0.765  19.695 25.952  1.00 106.73 ? 876  PHE A C   1 
ATOM 6744 O O   . PHE A 1 879  ? -0.938  20.485 25.022  1.00 106.73 ? 876  PHE A O   1 
ATOM 6745 C CB  . PHE A 1 879  ? 0.763   18.962 27.890  1.00 71.14  ? 876  PHE A CB  1 
ATOM 6746 C CG  . PHE A 1 879  ? 1.844   18.329 27.052  1.00 71.14  ? 876  PHE A CG  1 
ATOM 6747 C CD1 . PHE A 1 879  ? 2.551   19.089 26.110  1.00 71.14  ? 876  PHE A CD1 1 
ATOM 6748 C CD2 . PHE A 1 879  ? 2.152   16.982 27.190  1.00 71.14  ? 876  PHE A CD2 1 
ATOM 6749 C CE1 . PHE A 1 879  ? 3.533   18.526 25.318  1.00 71.14  ? 876  PHE A CE1 1 
ATOM 6750 C CE2 . PHE A 1 879  ? 3.143   16.408 26.402  1.00 71.14  ? 876  PHE A CE2 1 
ATOM 6751 C CZ  . PHE A 1 879  ? 3.833   17.191 25.461  1.00 71.14  ? 876  PHE A CZ  1 
ATOM 6752 N N   . ASN A 1 880  ? -1.221  18.446 25.940  1.00 73.19  ? 877  ASN A N   1 
ATOM 6753 C CA  . ASN A 1 880  ? -2.125  17.943 24.921  1.00 73.19  ? 877  ASN A CA  1 
ATOM 6754 C C   . ASN A 1 880  ? -3.359  17.466 25.641  1.00 73.19  ? 877  ASN A C   1 
ATOM 6755 O O   . ASN A 1 880  ? -3.534  16.265 25.876  1.00 73.19  ? 877  ASN A O   1 
ATOM 6756 C CB  . ASN A 1 880  ? -1.497  16.783 24.168  1.00 64.88  ? 877  ASN A CB  1 
ATOM 6757 C CG  . ASN A 1 880  ? -0.524  17.233 23.126  1.00 64.88  ? 877  ASN A CG  1 
ATOM 6758 O OD1 . ASN A 1 880  ? -0.856  18.054 22.257  1.00 64.88  ? 877  ASN A OD1 1 
ATOM 6759 N ND2 . ASN A 1 880  ? 0.694   16.686 23.183  1.00 64.88  ? 877  ASN A ND2 1 
ATOM 6760 N N   . GLY A 1 881  ? -4.195  18.423 26.037  1.00 67.38  ? 878  GLY A N   1 
ATOM 6761 C CA  . GLY A 1 881  ? -5.359  18.129 26.868  1.00 67.38  ? 878  GLY A CA  1 
ATOM 6762 C C   . GLY A 1 881  ? -4.996  17.803 28.304  1.00 67.38  ? 878  GLY A C   1 
ATOM 6763 O O   . GLY A 1 881  ? -5.887  17.756 29.149  1.00 67.38  ? 878  GLY A O   1 
ATOM 6764 N N   . LYS A 1 882  ? -3.702  17.565 28.573  1.00 58.35  ? 879  LYS A N   1 
ATOM 6765 C CA  . LYS A 1 882  ? -3.185  17.313 29.936  1.00 58.35  ? 879  LYS A CA  1 
ATOM 6766 C C   . LYS A 1 882  ? -2.494  18.566 30.491  1.00 58.35  ? 879  LYS A C   1 
ATOM 6767 O O   . LYS A 1 882  ? -2.345  19.581 29.781  1.00 58.35  ? 879  LYS A O   1 
ATOM 6768 C CB  . LYS A 1 882  ? -2.200  16.143 29.960  1.00 79.98  ? 879  LYS A CB  1 
ATOM 6769 C CG  . LYS A 1 882  ? -2.572  14.961 29.089  1.00 79.98  ? 879  LYS A CG  1 
ATOM 6770 C CD  . LYS A 1 882  ? -1.704  13.752 29.403  1.00 79.98  ? 879  LYS A CD  1 
ATOM 6771 C CE  . LYS A 1 882  ? -1.982  12.576 28.459  1.00 79.98  ? 879  LYS A CE  1 
ATOM 6772 N NZ  . LYS A 1 882  ? -1.351  12.730 27.119  1.00 79.98  ? 879  LYS A NZ  1 
ATOM 6773 N N   . LEU A 1 883  ? -2.051  18.478 31.747  1.00 64.65  ? 880  LEU A N   1 
ATOM 6774 C CA  . LEU A 1 883  ? -1.461  19.616 32.455  1.00 64.65  ? 880  LEU A CA  1 
ATOM 6775 C C   . LEU A 1 883  ? -0.030  19.390 32.886  1.00 64.65  ? 880  LEU A C   1 
ATOM 6776 O O   . LEU A 1 883  ? 0.244   18.674 33.861  1.00 64.65  ? 880  LEU A O   1 
ATOM 6777 C CB  . LEU A 1 883  ? -2.280  19.983 33.691  1.00 50.29  ? 880  LEU A CB  1 
ATOM 6778 C CG  . LEU A 1 883  ? -1.775  21.118 34.591  1.00 50.29  ? 880  LEU A CG  1 
ATOM 6779 C CD1 . LEU A 1 883  ? -2.059  22.503 33.992  1.00 50.29  ? 880  LEU A CD1 1 
ATOM 6780 C CD2 . LEU A 1 883  ? -2.391  21.005 35.977  1.00 50.29  ? 880  LEU A CD2 1 
ATOM 6781 N N   . LEU A 1 884  ? 0.868   20.066 32.172  1.00 53.96  ? 881  LEU A N   1 
ATOM 6782 C CA  . LEU A 1 884  ? 2.303   20.031 32.452  1.00 53.96  ? 881  LEU A CA  1 
ATOM 6783 C C   . LEU A 1 884  ? 2.683   21.129 33.420  1.00 53.96  ? 881  LEU A C   1 
ATOM 6784 O O   . LEU A 1 884  ? 2.196   22.236 33.293  1.00 53.96  ? 881  LEU A O   1 
ATOM 6785 C CB  . LEU A 1 884  ? 3.094   20.202 31.168  1.00 72.45  ? 881  LEU A CB  1 
ATOM 6786 C CG  . LEU A 1 884  ? 4.539   19.827 31.427  1.00 72.45  ? 881  LEU A CG  1 
ATOM 6787 C CD1 . LEU A 1 884  ? 4.631   18.325 31.610  1.00 72.45  ? 881  LEU A CD1 1 
ATOM 6788 C CD2 . LEU A 1 884  ? 5.358   20.285 30.275  1.00 72.45  ? 881  LEU A CD2 1 
ATOM 6789 N N   . ALA A 1 885  ? 3.573   20.824 34.354  1.00 55.80  ? 882  ALA A N   1 
ATOM 6790 C CA  . ALA A 1 885  ? 3.783   21.702 35.477  1.00 55.80  ? 882  ALA A CA  1 
ATOM 6791 C C   . ALA A 1 885  ? 5.097   21.444 36.162  1.00 55.80  ? 882  ALA A C   1 
ATOM 6792 O O   . ALA A 1 885  ? 5.313   20.353 36.677  1.00 55.80  ? 882  ALA A O   1 
ATOM 6793 C CB  . ALA A 1 885  ? 2.684   21.507 36.454  1.00 45.18  ? 882  ALA A CB  1 
ATOM 6794 N N   . SER A 1 886  ? 5.962   22.453 36.194  1.00 56.96  ? 883  SER A N   1 
ATOM 6795 C CA  . SER A 1 886  ? 7.245   22.341 36.870  1.00 56.96  ? 883  SER A CA  1 
ATOM 6796 C C   . SER A 1 886  ? 7.047   22.526 38.370  1.00 56.96  ? 883  SER A C   1 
ATOM 6797 O O   . SER A 1 886  ? 6.496   23.547 38.816  1.00 56.96  ? 883  SER A O   1 
ATOM 6798 C CB  . SER A 1 886  ? 8.211   23.394 36.337  1.00 102.38 ? 883  SER A CB  1 
ATOM 6799 O OG  . SER A 1 886  ? 7.617   24.677 36.375  1.00 102.38 ? 883  SER A OG  1 
ATOM 6800 N N   . ILE A 1 887  ? 7.473   21.528 39.143  1.00 61.81  ? 884  ILE A N   1 
ATOM 6801 C CA  . ILE A 1 887  ? 7.432   21.634 40.601  1.00 61.81  ? 884  ILE A CA  1 
ATOM 6802 C C   . ILE A 1 887  ? 8.841   21.638 41.145  1.00 61.81  ? 884  ILE A C   1 
ATOM 6803 O O   . ILE A 1 887  ? 9.425   20.588 41.399  1.00 61.81  ? 884  ILE A O   1 
ATOM 6804 C CB  . ILE A 1 887  ? 6.587   20.499 41.335  1.00 54.90  ? 884  ILE A CB  1 
ATOM 6805 C CG1 . ILE A 1 887  ? 5.188   20.312 40.727  1.00 54.90  ? 884  ILE A CG1 1 
ATOM 6806 C CG2 . ILE A 1 887  ? 6.475   20.784 42.863  1.00 54.90  ? 884  ILE A CG2 1 
ATOM 6807 C CD1 . ILE A 1 887  ? 5.100   19.229 39.703  1.00 54.90  ? 884  ILE A CD1 1 
ATOM 6808 N N   . ASN A 1 888  ? 9.392   22.830 41.289  1.00 69.03  ? 885  ASN A N   1 
ATOM 6809 C CA  . ASN A 1 888  ? 10.542  23.057 42.143  1.00 69.03  ? 885  ASN A CA  1 
ATOM 6810 C C   . ASN A 1 888  ? 11.867  22.440 41.714  1.00 69.03  ? 885  ASN A C   1 
ATOM 6811 O O   . ASN A 1 888  ? 12.888  22.755 42.308  1.00 69.03  ? 885  ASN A O   1 
ATOM 6812 C CB  . ASN A 1 888  ? 10.203  22.607 43.563  1.00 67.97  ? 885  ASN A CB  1 
ATOM 6813 C CG  . ASN A 1 888  ? 11.083  23.244 44.600  1.00 67.97  ? 885  ASN A CG  1 
ATOM 6814 O OD1 . ASN A 1 888  ? 11.735  22.540 45.357  1.00 67.97  ? 885  ASN A OD1 1 
ATOM 6815 N ND2 . ASN A 1 888  ? 11.120  24.583 44.643  1.00 67.97  ? 885  ASN A ND2 1 
ATOM 6816 N N   . SER A 1 889  ? 11.864  21.594 40.684  1.00 55.78  ? 886  SER A N   1 
ATOM 6817 C CA  . SER A 1 889  ? 12.957  20.605 40.451  1.00 55.78  ? 886  SER A CA  1 
ATOM 6818 C C   . SER A 1 889  ? 12.439  19.376 39.715  1.00 55.78  ? 886  SER A C   1 
ATOM 6819 O O   . SER A 1 889  ? 13.176  18.676 39.044  1.00 55.78  ? 886  SER A O   1 
ATOM 6820 C CB  . SER A 1 889  ? 13.560  20.128 41.772  1.00 55.90  ? 886  SER A CB  1 
ATOM 6821 O OG  . SER A 1 889  ? 14.831  19.592 41.538  1.00 55.90  ? 886  SER A OG  1 
ATOM 6822 N N   . THR A 1 890  ? 11.153  19.117 39.876  1.00 75.68  ? 887  THR A N   1 
ATOM 6823 C CA  . THR A 1 890  ? 10.485  18.045 39.189  1.00 75.68  ? 887  THR A CA  1 
ATOM 6824 C C   . THR A 1 890  ? 9.634   18.625 38.078  1.00 75.68  ? 887  THR A C   1 
ATOM 6825 O O   . THR A 1 890  ? 9.138   19.745 38.173  1.00 75.68  ? 887  THR A O   1 
ATOM 6826 C CB  . THR A 1 890  ? 9.587   17.313 40.158  1.00 56.14  ? 887  THR A CB  1 
ATOM 6827 O OG1 . THR A 1 890  ? 10.303  17.105 41.380  1.00 56.14  ? 887  THR A OG1 1 
ATOM 6828 C CG2 . THR A 1 890  ? 9.162   15.997 39.579  1.00 56.14  ? 887  THR A CG2 1 
ATOM 6829 N N   . VAL A 1 891  ? 9.460   17.859 37.022  1.00 70.21  ? 888  VAL A N   1 
ATOM 6830 C CA  . VAL A 1 891  ? 8.626   18.294 35.933  1.00 70.21  ? 888  VAL A CA  1 
ATOM 6831 C C   . VAL A 1 891  ? 7.551   17.246 35.779  1.00 70.21  ? 888  VAL A C   1 
ATOM 6832 O O   . VAL A 1 891  ? 7.847   16.100 35.541  1.00 70.21  ? 888  VAL A O   1 
ATOM 6833 C CB  . VAL A 1 891  ? 9.470   18.479 34.677  1.00 44.49  ? 888  VAL A CB  1 
ATOM 6834 C CG1 . VAL A 1 891  ? 8.653   18.299 33.386  1.00 44.49  ? 888  VAL A CG1 1 
ATOM 6835 C CG2 . VAL A 1 891  ? 10.108  19.829 34.728  1.00 44.49  ? 888  VAL A CG2 1 
ATOM 6836 N N   . ARG A 1 892  ? 6.296   17.636 35.928  1.00 55.49  ? 889  ARG A N   1 
ATOM 6837 C CA  . ARG A 1 892  ? 5.243   16.658 36.101  1.00 55.49  ? 889  ARG A CA  1 
ATOM 6838 C C   . ARG A 1 892  ? 4.145   16.794 35.083  1.00 55.49  ? 889  ARG A C   1 
ATOM 6839 O O   . ARG A 1 892  ? 3.863   17.893 34.616  1.00 55.49  ? 889  ARG A O   1 
ATOM 6840 C CB  . ARG A 1 892  ? 4.656   16.803 37.490  1.00 55.90  ? 889  ARG A CB  1 
ATOM 6841 C CG  . ARG A 1 892  ? 4.727   15.528 38.269  1.00 55.90  ? 889  ARG A CG  1 
ATOM 6842 C CD  . ARG A 1 892  ? 3.676   15.473 39.316  1.00 55.90  ? 889  ARG A CD  1 
ATOM 6843 N NE  . ARG A 1 892  ? 4.092   16.033 40.594  1.00 55.90  ? 889  ARG A NE  1 
ATOM 6844 C CZ  . ARG A 1 892  ? 5.052   15.531 41.365  1.00 55.90  ? 889  ARG A CZ  1 
ATOM 6845 N NH1 . ARG A 1 892  ? 5.761   14.473 40.960  1.00 55.90  ? 889  ARG A NH1 1 
ATOM 6846 N NH2 . ARG A 1 892  ? 5.312   16.109 42.538  1.00 55.90  ? 889  ARG A NH2 1 
ATOM 6847 N N   . LEU A 1 893  ? 3.508   15.682 34.742  1.00 70.82  ? 890  LEU A N   1 
ATOM 6848 C CA  . LEU A 1 893  ? 2.443   15.734 33.754  1.00 70.82  ? 890  LEU A CA  1 
ATOM 6849 C C   . LEU A 1 893  ? 1.143   15.203 34.302  1.00 70.82  ? 890  LEU A C   1 
ATOM 6850 O O   . LEU A 1 893  ? 0.923   14.000 34.327  1.00 70.82  ? 890  LEU A O   1 
ATOM 6851 C CB  . LEU A 1 893  ? 2.805   14.961 32.505  1.00 69.05  ? 890  LEU A CB  1 
ATOM 6852 C CG  . LEU A 1 893  ? 1.609   14.834 31.574  1.00 69.05  ? 890  LEU A CG  1 
ATOM 6853 C CD1 . LEU A 1 893  ? 1.168   16.197 31.013  1.00 69.05  ? 890  LEU A CD1 1 
ATOM 6854 C CD2 . LEU A 1 893  ? 1.962   13.862 30.479  1.00 69.05  ? 890  LEU A CD2 1 
ATOM 6855 N N   . TYR A 1 894  ? 0.265   16.121 34.687  1.00 67.96  ? 891  TYR A N   1 
ATOM 6856 C CA  . TYR A 1 894  ? -0.987  15.794 35.345  1.00 67.96  ? 891  TYR A CA  1 
ATOM 6857 C C   . TYR A 1 894  ? -2.090  15.469 34.375  1.00 67.96  ? 891  TYR A C   1 
ATOM 6858 O O   . TYR A 1 894  ? -2.096  15.940 33.237  1.00 67.96  ? 891  TYR A O   1 
ATOM 6859 C CB  . TYR A 1 894  ? -1.420  16.960 36.191  1.00 61.38  ? 891  TYR A CB  1 
ATOM 6860 C CG  . TYR A 1 894  ? -0.614  17.118 37.452  1.00 61.38  ? 891  TYR A CG  1 
ATOM 6861 C CD1 . TYR A 1 894  ? 0.335   18.120 37.581  1.00 61.38  ? 891  TYR A CD1 1 
ATOM 6862 C CD2 . TYR A 1 894  ? -0.821  16.281 38.531  1.00 61.38  ? 891  TYR A CD2 1 
ATOM 6863 C CE1 . TYR A 1 894  ? 1.056   18.275 38.752  1.00 61.38  ? 891  TYR A CE1 1 
ATOM 6864 C CE2 . TYR A 1 894  ? -0.107  16.440 39.713  1.00 61.38  ? 891  TYR A CE2 1 
ATOM 6865 C CZ  . TYR A 1 894  ? 0.822   17.435 39.813  1.00 61.38  ? 891  TYR A CZ  1 
ATOM 6866 O OH  . TYR A 1 894  ? 1.515   17.566 40.990  1.00 61.38  ? 891  TYR A OH  1 
ATOM 6867 N N   . GLU A 1 895  ? -3.027  14.653 34.839  1.00 80.44  ? 892  GLU A N   1 
ATOM 6868 C CA  . GLU A 1 895  ? -4.217  14.325 34.069  1.00 80.44  ? 892  GLU A CA  1 
ATOM 6869 C C   . GLU A 1 895  ? -5.491  14.740 34.820  1.00 80.44  ? 892  GLU A C   1 
ATOM 6870 O O   . GLU A 1 895  ? -5.517  14.814 36.056  1.00 80.44  ? 892  GLU A O   1 
ATOM 6871 C CB  . GLU A 1 895  ? -4.245  12.835 33.735  1.00 73.92  ? 892  GLU A CB  1 
ATOM 6872 C CG  . GLU A 1 895  ? -3.509  12.442 32.467  1.00 73.92  ? 892  GLU A CG  1 
ATOM 6873 C CD  . GLU A 1 895  ? -3.568  10.923 32.197  1.00 73.92  ? 892  GLU A CD  1 
ATOM 6874 O OE1 . GLU A 1 895  ? -3.540  10.131 33.176  1.00 73.92  ? 892  GLU A OE1 1 
ATOM 6875 O OE2 . GLU A 1 895  ? -3.631  10.515 31.007  1.00 73.92  ? 892  GLU A OE2 1 
ATOM 6876 N N   . TRP A 1 896  ? -6.532  15.026 34.047  1.00 58.64  ? 893  TRP A N   1 
ATOM 6877 C CA  . TRP A 1 896  ? -7.831  15.370 34.582  1.00 58.64  ? 893  TRP A CA  1 
ATOM 6878 C C   . TRP A 1 896  ? -8.640  14.085 34.594  1.00 58.64  ? 893  TRP A C   1 
ATOM 6879 O O   . TRP A 1 896  ? -8.837  13.450 33.557  1.00 58.64  ? 893  TRP A O   1 
ATOM 6880 C CB  . TRP A 1 896  ? -8.497  16.380 33.658  1.00 56.44  ? 893  TRP A CB  1 
ATOM 6881 C CG  . TRP A 1 896  ? -9.460  17.342 34.291  1.00 56.44  ? 893  TRP A CG  1 
ATOM 6882 C CD1 . TRP A 1 896  ? -10.592 17.858 33.711  1.00 56.44  ? 893  TRP A CD1 1 
ATOM 6883 C CD2 . TRP A 1 896  ? -9.376  17.939 35.595  1.00 56.44  ? 893  TRP A CD2 1 
ATOM 6884 N NE1 . TRP A 1 896  ? -11.218 18.735 34.574  1.00 56.44  ? 893  TRP A NE1 1 
ATOM 6885 C CE2 . TRP A 1 896  ? -10.497 18.799 35.737  1.00 56.44  ? 893  TRP A CE2 1 
ATOM 6886 C CE3 . TRP A 1 896  ? -8.463  17.847 36.650  1.00 56.44  ? 893  TRP A CE3 1 
ATOM 6887 C CZ2 . TRP A 1 896  ? -10.729 19.554 36.897  1.00 56.44  ? 893  TRP A CZ2 1 
ATOM 6888 C CZ3 . TRP A 1 896  ? -8.696  18.611 37.817  1.00 56.44  ? 893  TRP A CZ3 1 
ATOM 6889 C CH2 . TRP A 1 896  ? -9.823  19.443 37.925  1.00 56.44  ? 893  TRP A CH2 1 
ATOM 6890 N N   . THR A 1 897  ? -9.106  13.684 35.765  1.00 102.41 ? 894  THR A N   1 
ATOM 6891 C CA  . THR A 1 897  ? -10.027 12.570 35.834  1.00 102.41 ? 894  THR A CA  1 
ATOM 6892 C C   . THR A 1 897  ? -11.362 13.053 35.279  1.00 102.41 ? 894  THR A C   1 
ATOM 6893 O O   . THR A 1 897  ? -11.627 14.259 35.234  1.00 102.41 ? 894  THR A O   1 
ATOM 6894 C CB  . THR A 1 897  ? -10.236 12.132 37.274  1.00 67.98  ? 894  THR A CB  1 
ATOM 6895 O OG1 . THR A 1 897  ? -10.868 13.193 37.997  1.00 67.98  ? 894  THR A OG1 1 
ATOM 6896 C CG2 . THR A 1 897  ? -8.892  11.808 37.941  1.00 67.98  ? 894  THR A CG2 1 
ATOM 6897 N N   . THR A 1 898  ? -12.197 12.119 34.843  1.00 118.88 ? 895  THR A N   1 
ATOM 6898 C CA  . THR A 1 898  ? -13.594 12.438 34.575  1.00 118.88 ? 895  THR A CA  1 
ATOM 6899 C C   . THR A 1 898  ? -14.269 12.753 35.903  1.00 118.88 ? 895  THR A C   1 
ATOM 6900 O O   . THR A 1 898  ? -15.271 13.460 35.944  1.00 118.88 ? 895  THR A O   1 
ATOM 6901 C CB  . THR A 1 898  ? -14.328 11.282 33.890  1.00 103.86 ? 895  THR A CB  1 
ATOM 6902 O OG1 . THR A 1 898  ? -13.870 10.037 34.437  1.00 103.86 ? 895  THR A OG1 1 
ATOM 6903 C CG2 . THR A 1 898  ? -14.073 11.301 32.389  1.00 103.86 ? 895  THR A CG2 1 
ATOM 6904 N N   . GLU A 1 899  ? -13.687 12.230 36.983  1.00 87.65  ? 896  GLU A N   1 
ATOM 6905 C CA  . GLU A 1 899  ? -14.085 12.544 38.348  1.00 87.65  ? 896  GLU A CA  1 
ATOM 6906 C C   . GLU A 1 899  ? -13.647 13.967 38.737  1.00 87.65  ? 896  GLU A C   1 
ATOM 6907 O O   . GLU A 1 899  ? -13.659 14.316 39.932  1.00 87.65  ? 896  GLU A O   1 
ATOM 6908 C CB  . GLU A 1 899  ? -13.450 11.550 39.320  1.00 99.12  ? 896  GLU A CB  1 
ATOM 6909 C CG  . GLU A 1 899  ? -13.038 10.207 38.708  1.00 99.12  ? 896  GLU A CG  1 
ATOM 6910 C CD  . GLU A 1 899  ? -11.654 9.735  39.178  1.00 99.12  ? 896  GLU A CD  1 
ATOM 6911 O OE1 . GLU A 1 899  ? -11.042 10.381 40.059  1.00 99.12  ? 896  GLU A OE1 1 
ATOM 6912 O OE2 . GLU A 1 899  ? -11.164 8.720  38.649  1.00 99.12  ? 896  GLU A OE2 1 
ATOM 6913 N N   . LYS A 1 900  ? -13.248 14.762 37.727  1.00 76.13  ? 897  LYS A N   1 
ATOM 6914 C CA  . LYS A 1 900  ? -12.766 16.162 37.869  1.00 76.13  ? 897  LYS A CA  1 
ATOM 6915 C C   . LYS A 1 900  ? -11.662 16.378 38.916  1.00 76.13  ? 897  LYS A C   1 
ATOM 6916 O O   . LYS A 1 900  ? -11.807 17.209 39.828  1.00 76.13  ? 897  LYS A O   1 
ATOM 6917 C CB  . LYS A 1 900  ? -13.920 17.142 38.128  1.00 71.07  ? 897  LYS A CB  1 
ATOM 6918 C CG  . LYS A 1 900  ? -14.777 17.455 36.923  1.00 71.07  ? 897  LYS A CG  1 
ATOM 6919 C CD  . LYS A 1 900  ? -15.513 18.791 37.141  1.00 71.07  ? 897  LYS A CD  1 
ATOM 6920 C CE  . LYS A 1 900  ? -16.886 18.856 36.448  1.00 71.07  ? 897  LYS A CE  1 
ATOM 6921 N NZ  . LYS A 1 900  ? -16.926 18.244 35.087  1.00 71.07  ? 897  LYS A NZ  1 
ATOM 6922 N N   . ASP A 1 901  ? -10.565 15.632 38.786  1.00 60.77  ? 898  ASP A N   1 
ATOM 6923 C CA  . ASP A 1 901  ? -9.395  15.845 39.668  1.00 60.77  ? 898  ASP A CA  1 
ATOM 6924 C C   . ASP A 1 901  ? -8.025  15.732 38.940  1.00 60.77  ? 898  ASP A C   1 
ATOM 6925 O O   . ASP A 1 901  ? -7.924  15.073 37.875  1.00 60.77  ? 898  ASP A O   1 
ATOM 6926 C CB  . ASP A 1 901  ? -9.451  14.957 40.916  1.00 106.05 ? 898  ASP A CB  1 
ATOM 6927 C CG  . ASP A 1 901  ? -8.855  15.637 42.136  1.00 106.05 ? 898  ASP A CG  1 
ATOM 6928 O OD1 . ASP A 1 901  ? -9.386  15.405 43.237  1.00 106.05 ? 898  ASP A OD1 1 
ATOM 6929 O OD2 . ASP A 1 901  ? -7.871  16.410 41.999  1.00 106.05 ? 898  ASP A OD2 1 
ATOM 6930 N N   . VAL A 1 902  ? -7.009  16.421 39.483  1.00 67.36  ? 899  VAL A N   1 
ATOM 6931 C CA  . VAL A 1 902  ? -5.655  16.375 38.901  1.00 67.36  ? 899  VAL A CA  1 
ATOM 6932 C C   . VAL A 1 902  ? -4.832  15.205 39.465  1.00 67.36  ? 899  VAL A C   1 
ATOM 6933 O O   . VAL A 1 902  ? -4.436  15.211 40.635  1.00 67.36  ? 899  VAL A O   1 
ATOM 6934 C CB  . VAL A 1 902  ? -4.839  17.762 38.946  1.00 53.58  ? 899  VAL A CB  1 
ATOM 6935 C CG1 . VAL A 1 902  ? -4.743  18.398 37.581  1.00 53.58  ? 899  VAL A CG1 1 
ATOM 6936 C CG2 . VAL A 1 902  ? -5.416  18.763 39.945  1.00 53.58  ? 899  VAL A CG2 1 
ATOM 6937 N N   . ARG A 1 903  ? -4.596  14.200 38.625  1.00 62.27  ? 900  ARG A N   1 
ATOM 6938 C CA  . ARG A 1 903  ? -3.759  13.082 39.029  1.00 62.27  ? 900  ARG A CA  1 
ATOM 6939 C C   . ARG A 1 903  ? -2.646  12.719 38.030  1.00 62.27  ? 900  ARG A C   1 
ATOM 6940 O O   . ARG A 1 903  ? -2.857  12.644 36.807  1.00 62.27  ? 900  ARG A O   1 
ATOM 6941 C CB  . ARG A 1 903  ? -4.598  11.866 39.470  1.00 76.85  ? 900  ARG A CB  1 
ATOM 6942 C CG  . ARG A 1 903  ? -5.252  11.046 38.365  1.00 76.85  ? 900  ARG A CG  1 
ATOM 6943 C CD  . ARG A 1 903  ? -4.589  9.700  38.215  1.00 76.85  ? 900  ARG A CD  1 
ATOM 6944 N NE  . ARG A 1 903  ? -4.802  9.200  36.864  1.00 76.85  ? 900  ARG A NE  1 
ATOM 6945 C CZ  . ARG A 1 903  ? -5.870  8.521  36.461  1.00 76.85  ? 900  ARG A CZ  1 
ATOM 6946 N NH1 . ARG A 1 903  ? -6.841  8.238  37.313  1.00 76.85  ? 900  ARG A NH1 1 
ATOM 6947 N NH2 . ARG A 1 903  ? -5.960  8.124  35.197  1.00 76.85  ? 900  ARG A NH2 1 
ATOM 6948 N N   . THR A 1 904  ? -1.468  12.491 38.617  1.00 71.16  ? 901  THR A N   1 
ATOM 6949 C CA  . THR A 1 904  ? -0.188  12.262 37.953  1.00 71.16  ? 901  THR A CA  1 
ATOM 6950 C C   . THR A 1 904  ? -0.218  11.232 36.829  1.00 71.16  ? 901  THR A C   1 
ATOM 6951 O O   . THR A 1 904  ? -1.044  10.314 36.826  1.00 71.16  ? 901  THR A O   1 
ATOM 6952 C CB  . THR A 1 904  ? 0.838   11.782 38.987  1.00 83.87  ? 901  THR A CB  1 
ATOM 6953 O OG1 . THR A 1 904  ? 0.717   12.564 40.181  1.00 83.87  ? 901  THR A OG1 1 
ATOM 6954 C CG2 . THR A 1 904  ? 2.250   11.909 38.445  1.00 83.87  ? 901  THR A CG2 1 
ATOM 6955 N N   . GLU A 1 905  ? 0.691   11.383 35.878  1.00 214.25 ? 902  GLU A N   1 
ATOM 6956 C CA  . GLU A 1 905  ? 0.924   10.339 34.908  1.00 214.25 ? 902  GLU A CA  1 
ATOM 6957 C C   . GLU A 1 905  ? 2.395   9.973  34.937  1.00 214.25 ? 902  GLU A C   1 
ATOM 6958 O O   . GLU A 1 905  ? 2.749   8.793  34.910  1.00 214.25 ? 902  GLU A O   1 
ATOM 6959 C CB  . GLU A 1 905  ? 0.514   10.803 33.522  1.00 145.32 ? 902  GLU A CB  1 
ATOM 6960 C CG  . GLU A 1 905  ? 0.341   9.673  32.549  1.00 145.32 ? 902  GLU A CG  1 
ATOM 6961 C CD  . GLU A 1 905  ? 0.399   10.135 31.117  1.00 145.32 ? 902  GLU A CD  1 
ATOM 6962 O OE1 . GLU A 1 905  ? -0.119  11.229 30.812  1.00 145.32 ? 902  GLU A OE1 1 
ATOM 6963 O OE2 . GLU A 1 905  ? 0.966   9.394  30.292  1.00 145.32 ? 902  GLU A OE2 1 
ATOM 6964 N N   . CYS A 1 906  ? 3.241   10.999 35.010  1.00 185.72 ? 903  CYS A N   1 
ATOM 6965 C CA  . CYS A 1 906  ? 4.688   10.830 35.000  1.00 185.72 ? 903  CYS A CA  1 
ATOM 6966 C C   . CYS A 1 906  ? 5.413   12.089 35.439  1.00 185.72 ? 903  CYS A C   1 
ATOM 6967 O O   . CYS A 1 906  ? 4.833   13.177 35.469  1.00 185.72 ? 903  CYS A O   1 
ATOM 6968 C CB  . CYS A 1 906  ? 5.166   10.469 33.597  1.00 77.22  ? 903  CYS A CB  1 
ATOM 6969 S SG  . CYS A 1 906  ? 4.779   11.694 32.372  1.00 77.22  ? 903  CYS A SG  1 
ATOM 6970 N N   . ASN A 1 907  ? 6.687   11.921 35.784  1.00 73.99  ? 904  ASN A N   1 
ATOM 6971 C CA  . ASN A 1 907  ? 7.585   13.050 36.034  1.00 73.99  ? 904  ASN A CA  1 
ATOM 6972 C C   . ASN A 1 907  ? 9.099   12.857 35.778  1.00 73.99  ? 904  ASN A C   1 
ATOM 6973 O O   . ASN A 1 907  ? 9.666   11.817 36.077  1.00 73.99  ? 904  ASN A O   1 
ATOM 6974 C CB  . ASN A 1 907  ? 7.335   13.688 37.408  1.00 95.68  ? 904  ASN A CB  1 
ATOM 6975 C CG  . ASN A 1 907  ? 6.911   12.700 38.442  1.00 95.68  ? 904  ASN A CG  1 
ATOM 6976 O OD1 . ASN A 1 907  ? 7.648   12.429 39.376  1.00 95.68  ? 904  ASN A OD1 1 
ATOM 6977 N ND2 . ASN A 1 907  ? 5.710   12.164 38.300  1.00 95.68  ? 904  ASN A ND2 1 
ATOM 6978 N N   . HIS A 1 908  ? 9.711   13.896 35.209  1.00 73.71  ? 905  HIS A N   1 
ATOM 6979 C CA  . HIS A 1 908  ? 11.148  14.047 35.021  1.00 73.71  ? 905  HIS A CA  1 
ATOM 6980 C C   . HIS A 1 908  ? 11.780  14.615 36.279  1.00 73.71  ? 905  HIS A C   1 
ATOM 6981 O O   . HIS A 1 908  ? 11.186  15.451 36.945  1.00 73.71  ? 905  HIS A O   1 
ATOM 6982 C CB  . HIS A 1 908  ? 11.378  15.025 33.876  1.00 71.88  ? 905  HIS A CB  1 
ATOM 6983 C CG  . HIS A 1 908  ? 12.816  15.227 33.525  1.00 71.88  ? 905  HIS A CG  1 
ATOM 6984 N ND1 . HIS A 1 908  ? 13.423  14.575 32.475  1.00 71.88  ? 905  HIS A ND1 1 
ATOM 6985 C CD2 . HIS A 1 908  ? 13.768  16.016 34.078  1.00 71.88  ? 905  HIS A CD2 1 
ATOM 6986 C CE1 . HIS A 1 908  ? 14.690  14.945 32.402  1.00 71.88  ? 905  HIS A CE1 1 
ATOM 6987 N NE2 . HIS A 1 908  ? 14.925  15.816 33.366  1.00 71.88  ? 905  HIS A NE2 1 
ATOM 6988 N N   . TYR A 1 909  ? 12.996  14.186 36.597  1.00 64.61  ? 906  TYR A N   1 
ATOM 6989 C CA  . TYR A 1 909  ? 13.644  14.661 37.812  1.00 64.61  ? 906  TYR A CA  1 
ATOM 6990 C C   . TYR A 1 909  ? 14.964  15.356 37.598  1.00 64.61  ? 906  TYR A C   1 
ATOM 6991 O O   . TYR A 1 909  ? 15.425  16.058 38.501  1.00 64.61  ? 906  TYR A O   1 
ATOM 6992 C CB  . TYR A 1 909  ? 13.888  13.507 38.766  1.00 93.86  ? 906  TYR A CB  1 
ATOM 6993 C CG  . TYR A 1 909  ? 12.659  13.067 39.490  1.00 93.86  ? 906  TYR A CG  1 
ATOM 6994 C CD1 . TYR A 1 909  ? 11.963  11.930 39.083  1.00 93.86  ? 906  TYR A CD1 1 
ATOM 6995 C CD2 . TYR A 1 909  ? 12.183  13.784 40.580  1.00 93.86  ? 906  TYR A CD2 1 
ATOM 6996 C CE1 . TYR A 1 909  ? 10.834  11.520 39.745  1.00 93.86  ? 906  TYR A CE1 1 
ATOM 6997 C CE2 . TYR A 1 909  ? 11.050  13.384 41.247  1.00 93.86  ? 906  TYR A CE2 1 
ATOM 6998 C CZ  . TYR A 1 909  ? 10.383  12.250 40.825  1.00 93.86  ? 906  TYR A CZ  1 
ATOM 6999 O OH  . TYR A 1 909  ? 9.250   11.846 41.485  1.00 93.86  ? 906  TYR A OH  1 
ATOM 7000 N N   . ASN A 1 910  ? 15.577  15.136 36.432  1.00 78.26  ? 907  ASN A N   1 
ATOM 7001 C CA  . ASN A 1 910  ? 16.943  15.592 36.134  1.00 78.26  ? 907  ASN A CA  1 
ATOM 7002 C C   . ASN A 1 910  ? 17.059  17.103 35.875  1.00 78.26  ? 907  ASN A C   1 
ATOM 7003 O O   . ASN A 1 910  ? 17.487  17.538 34.805  1.00 78.26  ? 907  ASN A O   1 
ATOM 7004 C CB  . ASN A 1 910  ? 17.517  14.770 34.958  1.00 87.42  ? 907  ASN A CB  1 
ATOM 7005 C CG  . ASN A 1 910  ? 18.999  15.073 34.668  1.00 87.42  ? 907  ASN A CG  1 
ATOM 7006 O OD1 . ASN A 1 910  ? 19.424  15.079 33.509  1.00 87.42  ? 907  ASN A OD1 1 
ATOM 7007 N ND2 . ASN A 1 910  ? 19.779  15.322 35.717  1.00 87.42  ? 907  ASN A ND2 1 
ATOM 7008 N N   . ASN A 1 911  ? 16.685  17.896 36.869  1.00 86.03  ? 908  ASN A N   1 
ATOM 7009 C CA  . ASN A 1 911  ? 16.675  19.341 36.748  1.00 86.03  ? 908  ASN A CA  1 
ATOM 7010 C C   . ASN A 1 911  ? 17.285  19.939 37.974  1.00 86.03  ? 908  ASN A C   1 
ATOM 7011 O O   . ASN A 1 911  ? 17.032  19.486 39.079  1.00 86.03  ? 908  ASN A O   1 
ATOM 7012 C CB  . ASN A 1 911  ? 15.250  19.854 36.650  1.00 63.54  ? 908  ASN A CB  1 
ATOM 7013 C CG  . ASN A 1 911  ? 14.621  19.581 35.308  1.00 63.54  ? 908  ASN A CG  1 
ATOM 7014 O OD1 . ASN A 1 911  ? 14.928  20.245 34.309  1.00 63.54  ? 908  ASN A OD1 1 
ATOM 7015 N ND2 . ASN A 1 911  ? 13.713  18.618 35.274  1.00 63.54  ? 908  ASN A ND2 1 
ATOM 7016 N N   . ILE A 1 912  ? 18.088  20.970 37.798  1.00 88.38  ? 909  ILE A N   1 
ATOM 7017 C CA  . ILE A 1 912  ? 18.594  21.659 38.957  1.00 88.38  ? 909  ILE A CA  1 
ATOM 7018 C C   . ILE A 1 912  ? 17.440  22.461 39.544  1.00 88.38  ? 909  ILE A C   1 
ATOM 7019 O O   . ILE A 1 912  ? 17.190  22.399 40.743  1.00 88.38  ? 909  ILE A O   1 
ATOM 7020 C CB  . ILE A 1 912  ? 19.825  22.512 38.612  1.00 82.62  ? 909  ILE A CB  1 
ATOM 7021 C CG1 . ILE A 1 912  ? 20.725  22.689 39.843  1.00 82.62  ? 909  ILE A CG1 1 
ATOM 7022 C CG2 . ILE A 1 912  ? 19.425  23.833 37.948  1.00 82.62  ? 909  ILE A CG2 1 
ATOM 7023 C CD1 . ILE A 1 912  ? 21.499  21.419 40.244  1.00 82.62  ? 909  ILE A CD1 1 
ATOM 7024 N N   . MET A 1 913  ? 16.729  23.182 38.674  1.00 80.05  ? 910  MET A N   1 
ATOM 7025 C CA  . MET A 1 913  ? 15.433  23.811 38.996  1.00 80.05  ? 910  MET A CA  1 
ATOM 7026 C C   . MET A 1 913  ? 14.646  24.355 37.798  1.00 80.05  ? 910  MET A C   1 
ATOM 7027 O O   . MET A 1 913  ? 14.917  25.443 37.308  1.00 80.05  ? 910  MET A O   1 
ATOM 7028 C CB  . MET A 1 913  ? 15.577  24.908 40.029  1.00 70.40  ? 910  MET A CB  1 
ATOM 7029 C CG  . MET A 1 913  ? 14.275  25.158 40.683  1.00 70.40  ? 910  MET A CG  1 
ATOM 7030 S SD  . MET A 1 913  ? 14.538  25.221 42.433  1.00 70.40  ? 910  MET A SD  1 
ATOM 7031 C CE  . MET A 1 913  ? 14.961  26.965 42.590  1.00 70.40  ? 910  MET A CE  1 
ATOM 7032 N N   . ALA A 1 914  ? 13.645  23.590 37.376  1.00 57.81  ? 911  ALA A N   1 
ATOM 7033 C CA  . ALA A 1 914  ? 12.760  23.941 36.253  1.00 57.81  ? 911  ALA A CA  1 
ATOM 7034 C C   . ALA A 1 914  ? 11.968  25.248 36.455  1.00 57.81  ? 911  ALA A C   1 
ATOM 7035 O O   . ALA A 1 914  ? 11.099  25.350 37.340  1.00 57.81  ? 911  ALA A O   1 
ATOM 7036 C CB  . ALA A 1 914  ? 11.806  22.785 35.973  1.00 52.73  ? 911  ALA A CB  1 
ATOM 7037 N N   . LEU A 1 915  ? 12.255  26.233 35.614  1.00 60.17  ? 912  LEU A N   1 
ATOM 7038 C CA  . LEU A 1 915  ? 11.697  27.564 35.789  1.00 60.17  ? 912  LEU A CA  1 
ATOM 7039 C C   . LEU A 1 915  ? 10.728  27.924 34.698  1.00 60.17  ? 912  LEU A C   1 
ATOM 7040 O O   . LEU A 1 915  ? 9.880   28.785 34.867  1.00 60.17  ? 912  LEU A O   1 
ATOM 7041 C CB  . LEU A 1 915  ? 12.811  28.606 35.806  1.00 35.88  ? 912  LEU A CB  1 
ATOM 7042 C CG  . LEU A 1 915  ? 13.569  28.743 37.108  1.00 35.88  ? 912  LEU A CG  1 
ATOM 7043 C CD1 . LEU A 1 915  ? 14.067  30.167 37.253  1.00 35.88  ? 912  LEU A CD1 1 
ATOM 7044 C CD2 . LEU A 1 915  ? 12.695  28.285 38.323  1.00 35.88  ? 912  LEU A CD2 1 
ATOM 7045 N N   . TYR A 1 916  ? 10.871  27.268 33.566  1.00 43.65  ? 913  TYR A N   1 
ATOM 7046 C CA  . TYR A 1 916  ? 10.233  27.705 32.352  1.00 43.65  ? 913  TYR A CA  1 
ATOM 7047 C C   . TYR A 1 916  ? 9.915   26.428 31.631  1.00 43.65  ? 913  TYR A C   1 
ATOM 7048 O O   . TYR A 1 916  ? 10.602  25.437 31.823  1.00 43.65  ? 913  TYR A O   1 
ATOM 7049 C CB  . TYR A 1 916  ? 11.190  28.627 31.545  1.00 31.87  ? 913  TYR A CB  1 
ATOM 7050 C CG  . TYR A 1 916  ? 11.742  29.720 32.412  1.00 31.87  ? 913  TYR A CG  1 
ATOM 7051 C CD1 . TYR A 1 916  ? 13.049  29.703 32.859  1.00 31.87  ? 913  TYR A CD1 1 
ATOM 7052 C CD2 . TYR A 1 916  ? 10.918  30.714 32.881  1.00 31.87  ? 913  TYR A CD2 1 
ATOM 7053 C CE1 . TYR A 1 916  ? 13.514  30.698 33.738  1.00 31.87  ? 913  TYR A CE1 1 
ATOM 7054 C CE2 . TYR A 1 916  ? 11.353  31.684 33.756  1.00 31.87  ? 913  TYR A CE2 1 
ATOM 7055 C CZ  . TYR A 1 916  ? 12.630  31.694 34.166  1.00 31.87  ? 913  TYR A CZ  1 
ATOM 7056 O OH  . TYR A 1 916  ? 13.002  32.699 35.023  1.00 31.87  ? 913  TYR A OH  1 
ATOM 7057 N N   . LEU A 1 917  ? 8.840   26.425 30.861  1.00 41.20  ? 914  LEU A N   1 
ATOM 7058 C CA  . LEU A 1 917  ? 8.459   25.264 30.082  1.00 41.20  ? 914  LEU A CA  1 
ATOM 7059 C C   . LEU A 1 917  ? 7.719   25.780 28.859  1.00 41.20  ? 914  LEU A C   1 
ATOM 7060 O O   . LEU A 1 917  ? 7.045   26.816 28.937  1.00 41.20  ? 914  LEU A O   1 
ATOM 7061 C CB  . LEU A 1 917  ? 7.534   24.346 30.892  1.00 37.08  ? 914  LEU A CB  1 
ATOM 7062 C CG  . LEU A 1 917  ? 7.879   23.842 32.303  1.00 37.08  ? 914  LEU A CG  1 
ATOM 7063 C CD1 . LEU A 1 917  ? 6.660   23.253 33.014  1.00 37.08  ? 914  LEU A CD1 1 
ATOM 7064 C CD2 . LEU A 1 917  ? 8.981   22.825 32.215  1.00 37.08  ? 914  LEU A CD2 1 
ATOM 7065 N N   . LYS A 1 918  ? 7.853   25.091 27.732  1.00 56.69  ? 915  LYS A N   1 
ATOM 7066 C CA  . LYS A 1 918  ? 7.092   25.453 26.548  1.00 56.69  ? 915  LYS A CA  1 
ATOM 7067 C C   . LYS A 1 918  ? 6.762   24.182 25.786  1.00 56.69  ? 915  LYS A C   1 
ATOM 7068 O O   . LYS A 1 918  ? 7.230   23.101 26.156  1.00 56.69  ? 915  LYS A O   1 
ATOM 7069 C CB  . LYS A 1 918  ? 7.868   26.440 25.673  1.00 42.04  ? 915  LYS A CB  1 
ATOM 7070 C CG  . LYS A 1 918  ? 7.892   27.903 26.167  1.00 42.04  ? 915  LYS A CG  1 
ATOM 7071 C CD  . LYS A 1 918  ? 6.687   28.735 25.720  1.00 42.04  ? 915  LYS A CD  1 
ATOM 7072 C CE  . LYS A 1 918  ? 6.602   30.035 26.537  1.00 42.04  ? 915  LYS A CE  1 
ATOM 7073 N NZ  . LYS A 1 918  ? 7.479   31.205 26.102  1.00 42.04  ? 915  LYS A NZ  1 
ATOM 7074 N N   . THR A 1 919  ? 5.945   24.280 24.739  1.00 51.82  ? 916  THR A N   1 
ATOM 7075 C CA  . THR A 1 919  ? 5.500   23.064 24.079  1.00 51.82  ? 916  THR A CA  1 
ATOM 7076 C C   . THR A 1 919  ? 5.446   23.188 22.583  1.00 51.82  ? 916  THR A C   1 
ATOM 7077 O O   . THR A 1 919  ? 4.775   24.053 22.034  1.00 51.82  ? 916  THR A O   1 
ATOM 7078 C CB  . THR A 1 919  ? 4.144   22.592 24.648  1.00 65.41  ? 916  THR A CB  1 
ATOM 7079 O OG1 . THR A 1 919  ? 4.364   21.995 25.939  1.00 65.41  ? 916  THR A OG1 1 
ATOM 7080 C CG2 . THR A 1 919  ? 3.440   21.586 23.699  1.00 65.41  ? 916  THR A CG2 1 
ATOM 7081 N N   . LYS A 1 920  ? 6.161   22.278 21.923  1.00 89.30  ? 917  LYS A N   1 
ATOM 7082 C CA  . LYS A 1 920  ? 6.080   22.097 20.481  1.00 89.30  ? 917  LYS A CA  1 
ATOM 7083 C C   . LYS A 1 920  ? 4.882   21.201 20.198  1.00 89.30  ? 917  LYS A C   1 
ATOM 7084 O O   . LYS A 1 920  ? 5.005   19.982 20.078  1.00 89.30  ? 917  LYS A O   1 
ATOM 7085 C CB  . LYS A 1 920  ? 7.361   21.459 19.943  1.00 212.20 ? 917  LYS A CB  1 
ATOM 7086 C CG  . LYS A 1 920  ? 7.645   21.773 18.484  1.00 212.20 ? 917  LYS A CG  1 
ATOM 7087 C CD  . LYS A 1 920  ? 6.949   20.787 17.560  1.00 212.20 ? 917  LYS A CD  1 
ATOM 7088 C CE  . LYS A 1 920  ? 7.722   19.482 17.462  1.00 212.20 ? 917  LYS A CE  1 
ATOM 7089 N NZ  . LYS A 1 920  ? 7.240   18.475 18.448  1.00 212.20 ? 917  LYS A NZ  1 
ATOM 7090 N N   . GLY A 1 921  ? 3.719   21.832 20.107  1.00 188.17 ? 918  GLY A N   1 
ATOM 7091 C CA  . GLY A 1 921  ? 2.418   21.151 20.040  1.00 188.17 ? 918  GLY A CA  1 
ATOM 7092 C C   . GLY A 1 921  ? 2.461   19.681 20.380  1.00 188.17 ? 918  GLY A C   1 
ATOM 7093 O O   . GLY A 1 921  ? 1.907   19.249 21.397  1.00 188.17 ? 918  GLY A O   1 
ATOM 7094 N N   . ASP A 1 922  ? 3.122   18.902 19.532  1.00 106.46 ? 919  ASP A N   1 
ATOM 7095 C CA  . ASP A 1 922  ? 3.253   17.471 19.765  1.00 106.46 ? 919  ASP A CA  1 
ATOM 7096 C C   . ASP A 1 922  ? 3.765   17.205 21.176  1.00 106.46 ? 919  ASP A C   1 
ATOM 7097 O O   . ASP A 1 922  ? 3.672   18.062 22.054  1.00 106.46 ? 919  ASP A O   1 
ATOM 7098 C CB  . ASP A 1 922  ? 4.195   16.843 18.736  1.00 218.25 ? 919  ASP A CB  1 
ATOM 7099 C CG  . ASP A 1 922  ? 4.006   15.344 18.611  1.00 218.25 ? 919  ASP A CG  1 
ATOM 7100 O OD1 . ASP A 1 922  ? 2.857   14.875 18.748  1.00 218.25 ? 919  ASP A OD1 1 
ATOM 7101 O OD2 . ASP A 1 922  ? 5.007   14.635 18.376  1.00 218.25 ? 919  ASP A OD2 1 
ATOM 7102 N N   . PHE A 1 923  ? 4.306   16.010 21.384  1.00 91.39  ? 920  PHE A N   1 
ATOM 7103 C CA  . PHE A 1 923  ? 4.846   15.624 22.671  1.00 91.39  ? 920  PHE A CA  1 
ATOM 7104 C C   . PHE A 1 923  ? 6.297   16.075 22.894  1.00 91.39  ? 920  PHE A C   1 
ATOM 7105 O O   . PHE A 1 923  ? 7.150   15.251 23.197  1.00 91.39  ? 920  PHE A O   1 
ATOM 7106 C CB  . PHE A 1 923  ? 4.697   14.102 22.854  1.00 132.36 ? 920  PHE A CB  1 
ATOM 7107 C CG  . PHE A 1 923  ? 3.375   13.550 22.366  1.00 132.36 ? 920  PHE A CG  1 
ATOM 7108 C CD1 . PHE A 1 923  ? 2.202   13.738 23.108  1.00 132.36 ? 920  PHE A CD1 1 
ATOM 7109 C CD2 . PHE A 1 923  ? 3.302   12.842 21.166  1.00 132.36 ? 920  PHE A CD2 1 
ATOM 7110 C CE1 . PHE A 1 923  ? 0.974   13.231 22.663  1.00 132.36 ? 920  PHE A CE1 1 
ATOM 7111 C CE2 . PHE A 1 923  ? 2.078   12.334 20.705  1.00 132.36 ? 920  PHE A CE2 1 
ATOM 7112 C CZ  . PHE A 1 923  ? 0.911   12.528 21.458  1.00 132.36 ? 920  PHE A CZ  1 
ATOM 7113 N N   . ILE A 1 924  ? 6.560   17.381 22.757  1.00 57.46  ? 921  ILE A N   1 
ATOM 7114 C CA  . ILE A 1 924  ? 7.900   17.963 22.998  1.00 57.46  ? 921  ILE A CA  1 
ATOM 7115 C C   . ILE A 1 924  ? 7.871   19.189 23.953  1.00 57.46  ? 921  ILE A C   1 
ATOM 7116 O O   . ILE A 1 924  ? 7.097   20.120 23.724  1.00 57.46  ? 921  ILE A O   1 
ATOM 7117 C CB  . ILE A 1 924  ? 8.658   18.215 21.646  1.00 56.91  ? 921  ILE A CB  1 
ATOM 7118 C CG1 . ILE A 1 924  ? 9.286   16.902 21.121  1.00 56.91  ? 921  ILE A CG1 1 
ATOM 7119 C CG2 . ILE A 1 924  ? 9.759   19.250 21.805  1.00 56.91  ? 921  ILE A CG2 1 
ATOM 7120 C CD1 . ILE A 1 924  ? 9.674   16.867 19.612  1.00 56.91  ? 921  ILE A CD1 1 
ATOM 7121 N N   . LEU A 1 925  ? 8.706   19.129 25.011  1.00 57.21  ? 922  LEU A N   1 
ATOM 7122 C CA  . LEU A 1 925  ? 8.837   20.092 26.153  1.00 57.21  ? 922  LEU A CA  1 
ATOM 7123 C C   . LEU A 1 925  ? 10.294  20.551 26.347  1.00 57.21  ? 922  LEU A C   1 
ATOM 7124 O O   . LEU A 1 925  ? 11.152  20.092 25.624  1.00 57.21  ? 922  LEU A O   1 
ATOM 7125 C CB  . LEU A 1 925  ? 8.423   19.424 27.455  1.00 60.15  ? 922  LEU A CB  1 
ATOM 7126 C CG  . LEU A 1 925  ? 7.123   18.603 27.582  1.00 60.15  ? 922  LEU A CG  1 
ATOM 7127 C CD1 . LEU A 1 925  ? 6.803   17.694 26.383  1.00 60.15  ? 922  LEU A CD1 1 
ATOM 7128 C CD2 . LEU A 1 925  ? 7.129   17.753 28.862  1.00 60.15  ? 922  LEU A CD2 1 
ATOM 7129 N N   . VAL A 1 926  ? 10.602  21.382 27.358  1.00 60.65  ? 923  VAL A N   1 
ATOM 7130 C CA  . VAL A 1 926  ? 11.860  22.190 27.367  1.00 60.65  ? 923  VAL A CA  1 
ATOM 7131 C C   . VAL A 1 926  ? 12.083  23.104 28.594  1.00 60.65  ? 923  VAL A C   1 
ATOM 7132 O O   . VAL A 1 926  ? 11.191  23.874 28.878  1.00 60.65  ? 923  VAL A O   1 
ATOM 7133 C CB  . VAL A 1 926  ? 11.826  23.083 26.089  1.00 53.93  ? 923  VAL A CB  1 
ATOM 7134 C CG1 . VAL A 1 926  ? 10.470  23.660 25.920  1.00 53.93  ? 923  VAL A CG1 1 
ATOM 7135 C CG2 . VAL A 1 926  ? 12.865  24.181 26.067  1.00 53.93  ? 923  VAL A CG2 1 
ATOM 7136 N N   . GLY A 1 927  ? 13.231  23.046 29.299  1.00 84.62  ? 924  GLY A N   1 
ATOM 7137 C CA  . GLY A 1 927  ? 13.691  24.190 30.165  1.00 84.62  ? 924  GLY A CA  1 
ATOM 7138 C C   . GLY A 1 927  ? 14.463  23.915 31.462  1.00 84.62  ? 924  GLY A C   1 
ATOM 7139 O O   . GLY A 1 927  ? 14.447  22.759 31.903  1.00 84.62  ? 924  GLY A O   1 
ATOM 7140 N N   . ASP A 1 928  ? 15.125  24.946 32.065  1.00 105.08 ? 925  ASP A N   1 
ATOM 7141 C CA  . ASP A 1 928  ? 15.853  24.890 33.420  1.00 105.08 ? 925  ASP A CA  1 
ATOM 7142 C C   . ASP A 1 928  ? 16.475  26.200 33.982  1.00 105.08 ? 925  ASP A C   1 
ATOM 7143 O O   . ASP A 1 928  ? 16.788  27.097 33.230  1.00 105.08 ? 925  ASP A O   1 
ATOM 7144 C CB  . ASP A 1 928  ? 16.938  23.782 33.479  1.00 82.29  ? 925  ASP A CB  1 
ATOM 7145 C CG  . ASP A 1 928  ? 17.589  23.616 34.907  1.00 82.29  ? 925  ASP A CG  1 
ATOM 7146 O OD1 . ASP A 1 928  ? 17.366  22.572 35.565  1.00 82.29  ? 925  ASP A OD1 1 
ATOM 7147 O OD2 . ASP A 1 928  ? 18.337  24.507 35.374  1.00 82.29  ? 925  ASP A OD2 1 
ATOM 7148 N N   . LEU A 1 929  ? 16.709  26.259 35.302  1.00 69.51  ? 926  LEU A N   1 
ATOM 7149 C CA  . LEU A 1 929  ? 17.163  27.474 36.029  1.00 69.51  ? 926  LEU A CA  1 
ATOM 7150 C C   . LEU A 1 929  ? 18.582  27.912 35.810  1.00 69.51  ? 926  LEU A C   1 
ATOM 7151 O O   . LEU A 1 929  ? 18.807  29.008 35.355  1.00 69.51  ? 926  LEU A O   1 
ATOM 7152 C CB  . LEU A 1 929  ? 16.975  27.347 37.557  1.00 59.63  ? 926  LEU A CB  1 
ATOM 7153 C CG  . LEU A 1 929  ? 17.877  28.194 38.505  1.00 59.63  ? 926  LEU A CG  1 
ATOM 7154 C CD1 . LEU A 1 929  ? 17.426  29.618 38.700  1.00 59.63  ? 926  LEU A CD1 1 
ATOM 7155 C CD2 . LEU A 1 929  ? 18.023  27.583 39.869  1.00 59.63  ? 926  LEU A CD2 1 
ATOM 7156 N N   . MET A 1 930  ? 19.535  27.046 36.138  1.00 64.79  ? 927  MET A N   1 
ATOM 7157 C CA  . MET A 1 930  ? 20.948  27.362 35.970  1.00 64.79  ? 927  MET A CA  1 
ATOM 7158 C C   . MET A 1 930  ? 21.658  26.296 35.142  1.00 64.79  ? 927  MET A C   1 
ATOM 7159 O O   . MET A 1 930  ? 22.704  25.781 35.540  1.00 64.79  ? 927  MET A O   1 
ATOM 7160 C CB  . MET A 1 930  ? 21.630  27.511 37.331  1.00 74.01  ? 927  MET A CB  1 
ATOM 7161 C CG  . MET A 1 930  ? 21.568  26.262 38.196  1.00 74.01  ? 927  MET A CG  1 
ATOM 7162 S SD  . MET A 1 930  ? 22.382  26.479 39.790  1.00 74.01  ? 927  MET A SD  1 
ATOM 7163 C CE  . MET A 1 930  ? 22.125  24.865 40.524  1.00 74.01  ? 927  MET A CE  1 
ATOM 7164 N N   . ARG A 1 931  ? 21.083  25.959 33.919  1.00 53.57  ? 928  ARG A N   1 
ATOM 7165 C CA  . ARG A 1 931  ? 21.741  25.006 33.039  1.00 53.57  ? 928  ARG A CA  1 
ATOM 7166 C C   . ARG A 1 931  ? 21.667  25.434 31.552  1.00 53.57  ? 928  ARG A C   1 
ATOM 7167 O O   . ARG A 1 931  ? 22.820  25.551 31.077  1.00 53.57  ? 928  ARG A O   1 
ATOM 7168 C CB  . ARG A 1 931  ? 21.412  23.594 33.460  1.00 80.58  ? 928  ARG A CB  1 
ATOM 7169 C CG  . ARG A 1 931  ? 22.464  23.011 34.370  1.00 80.58  ? 928  ARG A CG  1 
ATOM 7170 C CD  . ARG A 1 931  ? 21.876  22.139 35.439  1.00 80.58  ? 928  ARG A CD  1 
ATOM 7171 N NE  . ARG A 1 931  ? 21.057  21.086 34.869  1.00 80.58  ? 928  ARG A NE  1 
ATOM 7172 C CZ  . ARG A 1 931  ? 21.296  19.793 34.997  1.00 80.58  ? 928  ARG A CZ  1 
ATOM 7173 N NH1 . ARG A 1 931  ? 22.335  19.366 35.675  1.00 80.58  ? 928  ARG A NH1 1 
ATOM 7174 N NH2 . ARG A 1 931  ? 20.490  18.929 34.437  1.00 80.58  ? 928  ARG A NH2 1 
ATOM 7175 N N   . SER A 1 932  ? 20.600  25.719 31.057  1.00 60.59  ? 929  SER A N   1 
ATOM 7176 C CA  . SER A 1 932  ? 20.549  26.215 29.687  1.00 60.59  ? 929  SER A CA  1 
ATOM 7177 C C   . SER A 1 932  ? 19.204  25.908 29.038  1.00 60.59  ? 929  SER A C   1 
ATOM 7178 O O   . SER A 1 932  ? 18.587  26.780 28.428  1.00 60.59  ? 929  SER A O   1 
ATOM 7179 C CB  . SER A 1 932  ? 21.683  25.610 28.856  1.00 67.77  ? 929  SER A CB  1 
ATOM 7180 O OG  . SER A 1 932  ? 21.589  24.197 28.816  1.00 67.77  ? 929  SER A OG  1 
ATOM 7181 N N   . VAL A 1 933  ? 18.758  24.663 29.176  1.00 45.60  ? 930  VAL A N   1 
ATOM 7182 C CA  . VAL A 1 933  ? 17.487  24.219 28.611  1.00 45.60  ? 930  VAL A CA  1 
ATOM 7183 C C   . VAL A 1 933  ? 17.602  22.809 28.040  1.00 45.60  ? 930  VAL A C   1 
ATOM 7184 O O   . VAL A 1 933  ? 18.531  22.506 27.291  1.00 45.60  ? 930  VAL A O   1 
ATOM 7185 C CB  . VAL A 1 933  ? 16.979  25.169 27.508  1.00 50.30  ? 930  VAL A CB  1 
ATOM 7186 C CG1 . VAL A 1 933  ? 16.339  26.408 28.118  1.00 50.30  ? 930  VAL A CG1 1 
ATOM 7187 C CG2 . VAL A 1 933  ? 18.107  25.536 26.555  1.00 50.30  ? 930  VAL A CG2 1 
ATOM 7188 N N   . LEU A 1 934  ? 16.652  21.952 28.399  1.00 68.87  ? 931  LEU A N   1 
ATOM 7189 C CA  . LEU A 1 934  ? 16.645  20.573 27.923  1.00 68.87  ? 931  LEU A CA  1 
ATOM 7190 C C   . LEU A 1 934  ? 15.509  20.339 26.934  1.00 68.87  ? 931  LEU A C   1 
ATOM 7191 O O   . LEU A 1 934  ? 14.748  21.254 26.618  1.00 68.87  ? 931  LEU A O   1 
ATOM 7192 C CB  . LEU A 1 934  ? 16.527  19.602 29.099  1.00 71.70  ? 931  LEU A CB  1 
ATOM 7193 C CG  . LEU A 1 934  ? 17.640  19.668 30.147  1.00 71.70  ? 931  LEU A CG  1 
ATOM 7194 C CD1 . LEU A 1 934  ? 17.757  21.073 30.718  1.00 71.70  ? 931  LEU A CD1 1 
ATOM 7195 C CD2 . LEU A 1 934  ? 17.396  18.654 31.254  1.00 71.70  ? 931  LEU A CD2 1 
ATOM 7196 N N   . LEU A 1 935  ? 15.399  19.107 26.447  1.00 71.94  ? 932  LEU A N   1 
ATOM 7197 C CA  . LEU A 1 935  ? 14.368  18.755 25.504  1.00 71.94  ? 932  LEU A CA  1 
ATOM 7198 C C   . LEU A 1 935  ? 13.748  17.455 25.965  1.00 71.94  ? 932  LEU A C   1 
ATOM 7199 O O   . LEU A 1 935  ? 14.452  16.507 26.331  1.00 71.94  ? 932  LEU A O   1 
ATOM 7200 C CB  . LEU A 1 935  ? 14.959  18.587 24.118  1.00 54.46  ? 932  LEU A CB  1 
ATOM 7201 C CG  . LEU A 1 935  ? 13.920  18.481 23.006  1.00 54.46  ? 932  LEU A CG  1 
ATOM 7202 C CD1 . LEU A 1 935  ? 12.992  19.670 23.078  1.00 54.46  ? 932  LEU A CD1 1 
ATOM 7203 C CD2 . LEU A 1 935  ? 14.571  18.399 21.611  1.00 54.46  ? 932  LEU A CD2 1 
ATOM 7204 N N   . LEU A 1 936  ? 12.426  17.414 25.964  1.00 88.00  ? 933  LEU A N   1 
ATOM 7205 C CA  . LEU A 1 936  ? 11.736  16.247 26.448  1.00 88.00  ? 933  LEU A CA  1 
ATOM 7206 C C   . LEU A 1 936  ? 10.558  15.884 25.583  1.00 88.00  ? 933  LEU A C   1 
ATOM 7207 O O   . LEU A 1 936  ? 9.749   16.734 25.242  1.00 88.00  ? 933  LEU A O   1 
ATOM 7208 C CB  . LEU A 1 936  ? 11.274  16.480 27.875  1.00 70.39  ? 933  LEU A CB  1 
ATOM 7209 C CG  . LEU A 1 936  ? 12.222  16.017 28.982  1.00 70.39  ? 933  LEU A CG  1 
ATOM 7210 C CD1 . LEU A 1 936  ? 13.414  16.955 29.163  1.00 70.39  ? 933  LEU A CD1 1 
ATOM 7211 C CD2 . LEU A 1 936  ? 11.442  15.931 30.265  1.00 70.39  ? 933  LEU A CD2 1 
ATOM 7212 N N   . ALA A 1 937  ? 10.480  14.614 25.210  1.00 75.57  ? 934  ALA A N   1 
ATOM 7213 C CA  . ALA A 1 937  ? 9.261   14.084 24.610  1.00 75.57  ? 934  ALA A CA  1 
ATOM 7214 C C   . ALA A 1 937  ? 8.395   13.417 25.669  1.00 75.57  ? 934  ALA A C   1 
ATOM 7215 O O   . ALA A 1 937  ? 8.888   12.899 26.686  1.00 75.57  ? 934  ALA A O   1 
ATOM 7216 C CB  . ALA A 1 937  ? 9.555   13.099 23.407  1.00 37.38  ? 934  ALA A CB  1 
ATOM 7217 N N   . TYR A 1 938  ? 7.095   13.471 25.441  1.00 98.02  ? 935  TYR A N   1 
ATOM 7218 C CA  . TYR A 1 938  ? 6.203   12.599 26.145  1.00 98.02  ? 935  TYR A CA  1 
ATOM 7219 C C   . TYR A 1 938  ? 5.934   11.424 25.222  1.00 98.02  ? 935  TYR A C   1 
ATOM 7220 O O   . TYR A 1 938  ? 5.948   11.565 23.990  1.00 98.02  ? 935  TYR A O   1 
ATOM 7221 C CB  . TYR A 1 938  ? 4.915   13.313 26.501  1.00 69.97  ? 935  TYR A CB  1 
ATOM 7222 C CG  . TYR A 1 938  ? 3.812   12.363 26.842  1.00 69.97  ? 935  TYR A CG  1 
ATOM 7223 C CD1 . TYR A 1 938  ? 3.648   11.887 28.147  1.00 69.97  ? 935  TYR A CD1 1 
ATOM 7224 C CD2 . TYR A 1 938  ? 2.939   11.906 25.850  1.00 69.97  ? 935  TYR A CD2 1 
ATOM 7225 C CE1 . TYR A 1 938  ? 2.623   11.003 28.453  1.00 69.97  ? 935  TYR A CE1 1 
ATOM 7226 C CE2 . TYR A 1 938  ? 1.929   11.015 26.140  1.00 69.97  ? 935  TYR A CE2 1 
ATOM 7227 C CZ  . TYR A 1 938  ? 1.772   10.575 27.439  1.00 69.97  ? 935  TYR A CZ  1 
ATOM 7228 O OH  . TYR A 1 938  ? 0.753   9.701  27.704  1.00 69.97  ? 935  TYR A OH  1 
ATOM 7229 N N   . LYS A 1 939  ? 5.691   10.262 25.818  1.00 90.12  ? 936  LYS A N   1 
ATOM 7230 C CA  . LYS A 1 939  ? 5.530   9.043  25.042  1.00 90.12  ? 936  LYS A CA  1 
ATOM 7231 C C   . LYS A 1 939  ? 4.160   8.365  25.192  1.00 90.12  ? 936  LYS A C   1 
ATOM 7232 O O   . LYS A 1 939  ? 3.847   7.811  26.247  1.00 90.12  ? 936  LYS A O   1 
ATOM 7233 C CB  . LYS A 1 939  ? 6.666   8.069  25.362  1.00 69.88  ? 936  LYS A CB  1 
ATOM 7234 C CG  . LYS A 1 939  ? 8.084   8.650  25.205  1.00 69.88  ? 936  LYS A CG  1 
ATOM 7235 C CD  . LYS A 1 939  ? 8.325   9.267  23.821  1.00 69.88  ? 936  LYS A CD  1 
ATOM 7236 C CE  . LYS A 1 939  ? 8.473   8.206  22.742  1.00 69.88  ? 936  LYS A CE  1 
ATOM 7237 N NZ  . LYS A 1 939  ? 9.844   7.634  22.779  1.00 69.88  ? 936  LYS A NZ  1 
ATOM 7238 N N   . PRO A 1 940  ? 3.337   8.418  24.128  1.00 77.67  ? 937  PRO A N   1 
ATOM 7239 C CA  . PRO A 1 940  ? 2.242   7.455  23.956  1.00 77.67  ? 937  PRO A CA  1 
ATOM 7240 C C   . PRO A 1 940  ? 2.800   6.014  23.957  1.00 77.67  ? 937  PRO A C   1 
ATOM 7241 O O   . PRO A 1 940  ? 2.286   5.115  23.281  1.00 77.67  ? 937  PRO A O   1 
ATOM 7242 C CB  . PRO A 1 940  ? 1.669   7.818  22.572  1.00 71.27  ? 937  PRO A CB  1 
ATOM 7243 C CG  . PRO A 1 940  ? 2.059   9.251  22.357  1.00 71.27  ? 937  PRO A CG  1 
ATOM 7244 C CD  . PRO A 1 940  ? 3.389   9.414  23.039  1.00 71.27  ? 937  PRO A CD  1 
ATOM 7245 N N   . MET A 1 941  ? 3.876   5.823  24.705  1.00 115.31 ? 938  MET A N   1 
ATOM 7246 C CA  . MET A 1 941  ? 4.499   4.539  24.868  1.00 115.31 ? 938  MET A CA  1 
ATOM 7247 C C   . MET A 1 941  ? 3.753   3.964  26.036  1.00 115.31 ? 938  MET A C   1 
ATOM 7248 O O   . MET A 1 941  ? 2.594   3.582  25.905  1.00 115.31 ? 938  MET A O   1 
ATOM 7249 C CB  . MET A 1 941  ? 5.979   4.754  25.196  1.00 147.03 ? 938  MET A CB  1 
ATOM 7250 C CG  . MET A 1 941  ? 6.765   3.560  25.742  1.00 147.03 ? 938  MET A CG  1 
ATOM 7251 S SD  . MET A 1 941  ? 8.114   4.097  26.833  1.00 147.03 ? 938  MET A SD  1 
ATOM 7252 C CE  . MET A 1 941  ? 9.182   4.998  25.700  1.00 147.03 ? 938  MET A CE  1 
ATOM 7253 N N   . GLU A 1 942  ? 4.415   3.927  27.185  1.00 159.24 ? 939  GLU A N   1 
ATOM 7254 C CA  . GLU A 1 942  ? 3.759   3.639  28.438  1.00 159.24 ? 939  GLU A CA  1 
ATOM 7255 C C   . GLU A 1 942  ? 3.360   4.975  29.053  1.00 159.24 ? 939  GLU A C   1 
ATOM 7256 O O   . GLU A 1 942  ? 3.179   5.088  30.267  1.00 159.24 ? 939  GLU A O   1 
ATOM 7257 C CB  . GLU A 1 942  ? 4.677   2.833  29.368  1.00 174.91 ? 939  GLU A CB  1 
ATOM 7258 C CG  . GLU A 1 942  ? 6.037   3.474  29.670  1.00 174.91 ? 939  GLU A CG  1 
ATOM 7259 C CD  . GLU A 1 942  ? 6.737   2.842  30.869  1.00 174.91 ? 939  GLU A CD  1 
ATOM 7260 O OE1 . GLU A 1 942  ? 7.343   3.767  31.687  1.00 174.91 ? 939  GLU A OE1 1 
ATOM 7261 O OE2 . GLU A 1 942  ? 6.672   1.431  31.010  1.00 174.91 ? 939  GLU A OE2 1 
ATOM 7262 N N   . GLY A 1 943  ? 3.215   5.984  28.198  1.00 158.07 ? 940  GLY A N   1 
ATOM 7263 C CA  . GLY A 1 943  ? 2.895   7.326  28.653  1.00 158.07 ? 940  GLY A CA  1 
ATOM 7264 C C   . GLY A 1 943  ? 4.003   7.827  29.548  1.00 158.07 ? 940  GLY A C   1 
ATOM 7265 O O   . GLY A 1 943  ? 3.761   8.196  30.697  1.00 158.07 ? 940  GLY A O   1 
ATOM 7266 N N   . ASN A 1 944  ? 5.224   7.814  29.021  1.00 87.67  ? 941  ASN A N   1 
ATOM 7267 C CA  . ASN A 1 944  ? 6.400   8.199  29.804  1.00 87.67  ? 941  ASN A CA  1 
ATOM 7268 C C   . ASN A 1 944  ? 7.105   9.457  29.274  1.00 87.67  ? 941  ASN A C   1 
ATOM 7269 O O   . ASN A 1 944  ? 6.898   9.853  28.116  1.00 87.67  ? 941  ASN A O   1 
ATOM 7270 C CB  . ASN A 1 944  ? 7.381   7.027  29.893  1.00 176.87 ? 941  ASN A CB  1 
ATOM 7271 C CG  . ASN A 1 944  ? 8.271   7.101  31.118  1.00 176.87 ? 941  ASN A CG  1 
ATOM 7272 O OD1 . ASN A 1 944  ? 9.410   6.642  31.094  1.00 176.87 ? 941  ASN A OD1 1 
ATOM 7273 N ND2 . ASN A 1 944  ? 7.756   7.683  32.197  1.00 176.87 ? 941  ASN A ND2 1 
ATOM 7274 N N   . PHE A 1 945  ? 7.908   10.098 30.129  1.00 54.96  ? 942  PHE A N   1 
ATOM 7275 C CA  . PHE A 1 945  ? 8.793   11.157 29.662  1.00 54.96  ? 942  PHE A CA  1 
ATOM 7276 C C   . PHE A 1 945  ? 10.104  10.583 29.223  1.00 54.96  ? 942  PHE A C   1 
ATOM 7277 O O   . PHE A 1 945  ? 10.707  9.787  29.950  1.00 54.96  ? 942  PHE A O   1 
ATOM 7278 C CB  . PHE A 1 945  ? 9.097   12.168 30.758  1.00 53.23  ? 942  PHE A CB  1 
ATOM 7279 C CG  . PHE A 1 945  ? 8.042   13.190 30.932  1.00 53.23  ? 942  PHE A CG  1 
ATOM 7280 C CD1 . PHE A 1 945  ? 7.799   13.726 32.193  1.00 53.23  ? 942  PHE A CD1 1 
ATOM 7281 C CD2 . PHE A 1 945  ? 7.270   13.594 29.838  1.00 53.23  ? 942  PHE A CD2 1 
ATOM 7282 C CE1 . PHE A 1 945  ? 6.815   14.665 32.372  1.00 53.23  ? 942  PHE A CE1 1 
ATOM 7283 C CE2 . PHE A 1 945  ? 6.276   14.529 29.997  1.00 53.23  ? 942  PHE A CE2 1 
ATOM 7284 C CZ  . PHE A 1 945  ? 6.047   15.077 31.277  1.00 53.23  ? 942  PHE A CZ  1 
ATOM 7285 N N   . GLU A 1 946  ? 10.554  11.014 28.047  1.00 102.18 ? 943  GLU A N   1 
ATOM 7286 C CA  . GLU A 1 946  ? 11.902  10.709 27.588  1.00 102.18 ? 943  GLU A CA  1 
ATOM 7287 C C   . GLU A 1 946  ? 12.709  11.991 27.332  1.00 102.18 ? 943  GLU A C   1 
ATOM 7288 O O   . GLU A 1 946  ? 12.286  12.859 26.556  1.00 102.18 ? 943  GLU A O   1 
ATOM 7289 C CB  . GLU A 1 946  ? 11.861  9.838  26.337  1.00 98.63  ? 943  GLU A CB  1 
ATOM 7290 C CG  . GLU A 1 946  ? 13.158  9.077  26.115  1.00 98.63  ? 943  GLU A CG  1 
ATOM 7291 C CD  . GLU A 1 946  ? 13.390  8.729  24.660  1.00 98.63  ? 943  GLU A CD  1 
ATOM 7292 O OE1 . GLU A 1 946  ? 14.538  8.902  24.183  1.00 98.63  ? 943  GLU A OE1 1 
ATOM 7293 O OE2 . GLU A 1 946  ? 12.422  8.294  23.994  1.00 98.63  ? 943  GLU A OE2 1 
ATOM 7294 N N   . GLU A 1 947  ? 13.866  12.095 27.990  1.00 55.04  ? 944  GLU A N   1 
ATOM 7295 C CA  . GLU A 1 947  ? 14.733  13.260 27.867  1.00 55.04  ? 944  GLU A CA  1 
ATOM 7296 C C   . GLU A 1 947  ? 15.560  13.167 26.590  1.00 55.04  ? 944  GLU A C   1 
ATOM 7297 O O   . GLU A 1 947  ? 16.663  12.607 26.620  1.00 55.04  ? 944  GLU A O   1 
ATOM 7298 C CB  . GLU A 1 947  ? 15.657  13.341 29.079  1.00 87.98  ? 944  GLU A CB  1 
ATOM 7299 C CG  . GLU A 1 947  ? 16.647  14.477 29.010  1.00 87.98  ? 944  GLU A CG  1 
ATOM 7300 C CD  . GLU A 1 947  ? 17.507  14.571 30.240  1.00 87.98  ? 944  GLU A CD  1 
ATOM 7301 O OE1 . GLU A 1 947  ? 18.471  15.365 30.228  1.00 87.98  ? 944  GLU A OE1 1 
ATOM 7302 O OE2 . GLU A 1 947  ? 17.222  13.853 31.222  1.00 87.98  ? 944  GLU A OE2 1 
ATOM 7303 N N   . ILE A 1 948  ? 15.046  13.705 25.480  1.00 64.31  ? 945  ILE A N   1 
ATOM 7304 C CA  . ILE A 1 948  ? 15.776  13.656 24.200  1.00 64.31  ? 945  ILE A CA  1 
ATOM 7305 C C   . ILE A 1 948  ? 17.210  14.178 24.287  1.00 64.31  ? 945  ILE A C   1 
ATOM 7306 O O   . ILE A 1 948  ? 18.150  13.495 23.859  1.00 64.31  ? 945  ILE A O   1 
ATOM 7307 C CB  . ILE A 1 948  ? 15.058  14.402 23.042  1.00 68.29  ? 945  ILE A CB  1 
ATOM 7308 C CG1 . ILE A 1 948  ? 14.150  13.456 22.269  1.00 68.29  ? 945  ILE A CG1 1 
ATOM 7309 C CG2 . ILE A 1 948  ? 16.052  14.990 22.051  1.00 68.29  ? 945  ILE A CG2 1 
ATOM 7310 C CD1 . ILE A 1 948  ? 12.686  13.811 22.421  1.00 68.29  ? 945  ILE A CD1 1 
ATOM 7311 N N   . ALA A 1 949  ? 17.365  15.386 24.828  1.00 69.62  ? 946  ALA A N   1 
ATOM 7312 C CA  . ALA A 1 949  ? 18.644  16.094 24.767  1.00 69.62  ? 946  ALA A CA  1 
ATOM 7313 C C   . ALA A 1 949  ? 18.765  17.221 25.797  1.00 69.62  ? 946  ALA A C   1 
ATOM 7314 O O   . ALA A 1 949  ? 17.808  17.542 26.505  1.00 69.62  ? 946  ALA A O   1 
ATOM 7315 C CB  . ALA A 1 949  ? 18.882  16.643 23.332  1.00 53.29  ? 946  ALA A CB  1 
ATOM 7316 N N   . ARG A 1 950  ? 19.959  17.795 25.888  1.00 60.78  ? 947  ARG A N   1 
ATOM 7317 C CA  . ARG A 1 950  ? 20.129  19.081 26.544  1.00 60.78  ? 947  ARG A CA  1 
ATOM 7318 C C   . ARG A 1 950  ? 21.312  19.873 25.989  1.00 60.78  ? 947  ARG A C   1 
ATOM 7319 O O   . ARG A 1 950  ? 21.832  19.565 24.918  1.00 60.78  ? 947  ARG A O   1 
ATOM 7320 C CB  . ARG A 1 950  ? 20.180  18.969 28.069  1.00 74.11  ? 947  ARG A CB  1 
ATOM 7321 C CG  . ARG A 1 950  ? 21.196  18.054 28.609  1.00 74.11  ? 947  ARG A CG  1 
ATOM 7322 C CD  . ARG A 1 950  ? 20.838  17.757 30.028  1.00 74.11  ? 947  ARG A CD  1 
ATOM 7323 N NE  . ARG A 1 950  ? 21.513  18.678 30.920  1.00 74.11  ? 947  ARG A NE  1 
ATOM 7324 C CZ  . ARG A 1 950  ? 22.484  18.317 31.746  1.00 74.11  ? 947  ARG A CZ  1 
ATOM 7325 N NH1 . ARG A 1 950  ? 22.859  17.047 31.793  1.00 74.11  ? 947  ARG A NH1 1 
ATOM 7326 N NH2 . ARG A 1 950  ? 23.073  19.219 32.527  1.00 74.11  ? 947  ARG A NH2 1 
ATOM 7327 N N   . ASP A 1 951  ? 21.711  20.887 26.719  1.00 57.20  ? 948  ASP A N   1 
ATOM 7328 C CA  . ASP A 1 951  ? 22.738  21.775 26.281  1.00 57.20  ? 948  ASP A CA  1 
ATOM 7329 C C   . ASP A 1 951  ? 23.570  22.019 27.491  1.00 57.20  ? 948  ASP A C   1 
ATOM 7330 O O   . ASP A 1 951  ? 23.064  22.413 28.507  1.00 57.20  ? 948  ASP A O   1 
ATOM 7331 C CB  . ASP A 1 951  ? 22.098  23.051 25.809  1.00 66.72  ? 948  ASP A CB  1 
ATOM 7332 C CG  . ASP A 1 951  ? 23.073  23.992 25.251  1.00 66.72  ? 948  ASP A CG  1 
ATOM 7333 O OD1 . ASP A 1 951  ? 24.245  23.639 25.215  1.00 66.72  ? 948  ASP A OD1 1 
ATOM 7334 O OD2 . ASP A 1 951  ? 22.675  25.077 24.831  1.00 66.72  ? 948  ASP A OD2 1 
ATOM 7335 N N   . PHE A 1 952  ? 24.849  21.720 27.401  1.00 63.47  ? 949  PHE A N   1 
ATOM 7336 C CA  . PHE A 1 952  ? 25.688  21.691 28.587  1.00 63.47  ? 949  PHE A CA  1 
ATOM 7337 C C   . PHE A 1 952  ? 26.460  23.011 28.715  1.00 63.47  ? 949  PHE A C   1 
ATOM 7338 O O   . PHE A 1 952  ? 27.663  23.063 28.469  1.00 63.47  ? 949  PHE A O   1 
ATOM 7339 C CB  . PHE A 1 952  ? 26.621  20.467 28.553  1.00 70.64  ? 949  PHE A CB  1 
ATOM 7340 C CG  . PHE A 1 952  ? 25.905  19.114 28.593  1.00 70.64  ? 949  PHE A CG  1 
ATOM 7341 C CD1 . PHE A 1 952  ? 24.958  18.757 27.626  1.00 70.64  ? 949  PHE A CD1 1 
ATOM 7342 C CD2 . PHE A 1 952  ? 26.218  18.171 29.583  1.00 70.64  ? 949  PHE A CD2 1 
ATOM 7343 C CE1 . PHE A 1 952  ? 24.316  17.486 27.669  1.00 70.64  ? 949  PHE A CE1 1 
ATOM 7344 C CE2 . PHE A 1 952  ? 25.587  16.907 29.624  1.00 70.64  ? 949  PHE A CE2 1 
ATOM 7345 C CZ  . PHE A 1 952  ? 24.636  16.571 28.670  1.00 70.64  ? 949  PHE A CZ  1 
ATOM 7346 N N   . ASN A 1 953  ? 25.829  24.085 29.043  1.00 56.28  ? 950  ASN A N   1 
ATOM 7347 C CA  . ASN A 1 953  ? 26.677  25.185 29.301  1.00 56.28  ? 950  ASN A CA  1 
ATOM 7348 C C   . ASN A 1 953  ? 26.166  25.527 30.603  1.00 56.28  ? 950  ASN A C   1 
ATOM 7349 O O   . ASN A 1 953  ? 25.896  24.667 31.396  1.00 56.28  ? 950  ASN A O   1 
ATOM 7350 C CB  . ASN A 1 953  ? 26.415  26.284 28.320  1.00 69.15  ? 950  ASN A CB  1 
ATOM 7351 C CG  . ASN A 1 953  ? 26.606  25.836 26.914  1.00 69.15  ? 950  ASN A CG  1 
ATOM 7352 O OD1 . ASN A 1 953  ? 25.650  25.544 26.203  1.00 69.15  ? 950  ASN A OD1 1 
ATOM 7353 N ND2 . ASN A 1 953  ? 27.846  25.770 26.496  1.00 69.15  ? 950  ASN A ND2 1 
ATOM 7354 N N   . PRO A 1 954  ? 26.051  26.788 30.897  1.00 65.08  ? 951  PRO A N   1 
ATOM 7355 C CA  . PRO A 1 954  ? 25.376  26.975 32.133  1.00 65.08  ? 951  PRO A CA  1 
ATOM 7356 C C   . PRO A 1 954  ? 24.768  28.279 32.225  1.00 65.08  ? 951  PRO A C   1 
ATOM 7357 O O   . PRO A 1 954  ? 25.343  29.118 32.823  1.00 65.08  ? 951  PRO A O   1 
ATOM 7358 C CB  . PRO A 1 954  ? 26.522  26.926 33.131  1.00 51.12  ? 951  PRO A CB  1 
ATOM 7359 C CG  . PRO A 1 954  ? 27.746  27.194 32.373  1.00 51.12  ? 951  PRO A CG  1 
ATOM 7360 C CD  . PRO A 1 954  ? 27.378  27.424 30.973  1.00 51.12  ? 951  PRO A CD  1 
ATOM 7361 N N   . ASN A 1 955  ? 23.609  28.432 31.649  1.00 45.59  ? 952  ASN A N   1 
ATOM 7362 C CA  . ASN A 1 955  ? 23.024  29.699 31.567  1.00 45.59  ? 952  ASN A CA  1 
ATOM 7363 C C   . ASN A 1 955  ? 21.905  29.860 32.530  1.00 45.59  ? 952  ASN A C   1 
ATOM 7364 O O   . ASN A 1 955  ? 20.874  29.269 32.435  1.00 45.59  ? 952  ASN A O   1 
ATOM 7365 C CB  . ASN A 1 955  ? 22.524  29.872 30.147  1.00 52.79  ? 952  ASN A CB  1 
ATOM 7366 C CG  . ASN A 1 955  ? 23.567  29.569 29.116  1.00 52.79  ? 952  ASN A CG  1 
ATOM 7367 O OD1 . ASN A 1 955  ? 24.654  30.087 29.161  1.00 52.79  ? 952  ASN A OD1 1 
ATOM 7368 N ND2 . ASN A 1 955  ? 23.219  28.748 28.163  1.00 52.79  ? 952  ASN A ND2 1 
ATOM 7369 N N   . TRP A 1 956  ? 22.090  30.734 33.460  1.00 48.55  ? 953  TRP A N   1 
ATOM 7370 C CA  . TRP A 1 956  ? 20.950  31.065 34.296  1.00 48.55  ? 953  TRP A CA  1 
ATOM 7371 C C   . TRP A 1 956  ? 19.843  31.687 33.425  1.00 48.55  ? 953  TRP A C   1 
ATOM 7372 O O   . TRP A 1 956  ? 19.813  32.884 33.161  1.00 48.55  ? 953  TRP A O   1 
ATOM 7373 C CB  . TRP A 1 956  ? 21.358  32.013 35.383  1.00 71.41  ? 953  TRP A CB  1 
ATOM 7374 C CG  . TRP A 1 956  ? 22.362  31.475 36.260  1.00 71.41  ? 953  TRP A CG  1 
ATOM 7375 C CD1 . TRP A 1 956  ? 23.554  30.958 35.903  1.00 71.41  ? 953  TRP A CD1 1 
ATOM 7376 C CD2 . TRP A 1 956  ? 22.297  31.411 37.681  1.00 71.41  ? 953  TRP A CD2 1 
ATOM 7377 N NE1 . TRP A 1 956  ? 24.235  30.555 37.009  1.00 71.41  ? 953  TRP A NE1 1 
ATOM 7378 C CE2 . TRP A 1 956  ? 23.485  30.829 38.120  1.00 71.41  ? 953  TRP A CE2 1 
ATOM 7379 C CE3 . TRP A 1 956  ? 21.333  31.776 38.630  1.00 71.41  ? 953  TRP A CE3 1 
ATOM 7380 C CZ2 . TRP A 1 956  ? 23.747  30.597 39.467  1.00 71.41  ? 953  TRP A CZ2 1 
ATOM 7381 C CZ3 . TRP A 1 956  ? 21.599  31.556 39.975  1.00 71.41  ? 953  TRP A CZ3 1 
ATOM 7382 C CH2 . TRP A 1 956  ? 22.792  30.968 40.379  1.00 71.41  ? 953  TRP A CH2 1 
ATOM 7383 N N   . MET A 1 957  ? 18.939  30.851 32.951  1.00 47.09  ? 954  MET A N   1 
ATOM 7384 C CA  . MET A 1 957  ? 17.873  31.291 32.092  1.00 47.09  ? 954  MET A CA  1 
ATOM 7385 C C   . MET A 1 957  ? 16.971  32.284 32.776  1.00 47.09  ? 954  MET A C   1 
ATOM 7386 O O   . MET A 1 957  ? 16.831  32.286 34.013  1.00 47.09  ? 954  MET A O   1 
ATOM 7387 C CB  . MET A 1 957  ? 17.046  30.086 31.690  1.00 45.48  ? 954  MET A CB  1 
ATOM 7388 C CG  . MET A 1 957  ? 17.885  28.953 31.154  1.00 45.48  ? 954  MET A CG  1 
ATOM 7389 S SD  . MET A 1 957  ? 18.855  29.517 29.747  1.00 45.48  ? 954  MET A SD  1 
ATOM 7390 C CE  . MET A 1 957  ? 17.626  29.672 28.468  1.00 45.48  ? 954  MET A CE  1 
ATOM 7391 N N   . SER A 1 958  ? 16.337  33.111 31.958  1.00 47.23  ? 955  SER A N   1 
ATOM 7392 C CA  . SER A 1 958  ? 15.251  33.937 32.423  1.00 47.23  ? 955  SER A CA  1 
ATOM 7393 C C   . SER A 1 958  ? 13.998  33.665 31.593  1.00 47.23  ? 955  SER A C   1 
ATOM 7394 O O   . SER A 1 958  ? 12.876  33.849 32.057  1.00 47.23  ? 955  SER A O   1 
ATOM 7395 C CB  . SER A 1 958  ? 15.653  35.400 32.328  1.00 49.48  ? 955  SER A CB  1 
ATOM 7396 O OG  . SER A 1 958  ? 15.728  35.806 30.981  1.00 49.48  ? 955  SER A OG  1 
ATOM 7397 N N   . ALA A 1 959  ? 14.199  33.214 30.363  1.00 39.44  ? 956  ALA A N   1 
ATOM 7398 C CA  . ALA A 1 959  ? 13.099  33.110 29.418  1.00 39.44  ? 956  ALA A CA  1 
ATOM 7399 C C   . ALA A 1 959  ? 13.426  32.114 28.317  1.00 39.44  ? 956  ALA A C   1 
ATOM 7400 O O   . ALA A 1 959  ? 14.558  31.986 27.940  1.00 39.44  ? 956  ALA A O   1 
ATOM 7401 C CB  . ALA A 1 959  ? 12.773  34.480 28.837  1.00 57.67  ? 956  ALA A CB  1 
ATOM 7402 N N   . VAL A 1 960  ? 12.422  31.427 27.795  1.00 47.45  ? 957  VAL A N   1 
ATOM 7403 C CA  . VAL A 1 960  ? 12.638  30.272 26.933  1.00 47.45  ? 957  VAL A CA  1 
ATOM 7404 C C   . VAL A 1 960  ? 11.552  30.280 25.876  1.00 47.45  ? 957  VAL A C   1 
ATOM 7405 O O   . VAL A 1 960  ? 10.499  30.844 26.099  1.00 47.45  ? 957  VAL A O   1 
ATOM 7406 C CB  . VAL A 1 960  ? 12.515  29.002 27.777  1.00 51.15  ? 957  VAL A CB  1 
ATOM 7407 C CG1 . VAL A 1 960  ? 12.167  27.806 26.951  1.00 51.15  ? 957  VAL A CG1 1 
ATOM 7408 C CG2 . VAL A 1 960  ? 13.794  28.758 28.556  1.00 51.15  ? 957  VAL A CG2 1 
ATOM 7409 N N   . GLU A 1 961  ? 11.779  29.707 24.712  1.00 61.93  ? 958  GLU A N   1 
ATOM 7410 C CA  . GLU A 1 961  ? 10.708  29.679 23.733  1.00 61.93  ? 958  GLU A CA  1 
ATOM 7411 C C   . GLU A 1 961  ? 11.033  28.610 22.739  1.00 61.93  ? 958  GLU A C   1 
ATOM 7412 O O   . GLU A 1 961  ? 12.153  28.099 22.732  1.00 61.93  ? 958  GLU A O   1 
ATOM 7413 C CB  . GLU A 1 961  ? 10.573  31.028 23.030  1.00 58.72  ? 958  GLU A CB  1 
ATOM 7414 C CG  . GLU A 1 961  ? 9.362   31.173 22.117  1.00 58.72  ? 958  GLU A CG  1 
ATOM 7415 C CD  . GLU A 1 961  ? 8.035   30.902 22.839  1.00 58.72  ? 958  GLU A CD  1 
ATOM 7416 O OE1 . GLU A 1 961  ? 7.526   29.745 22.706  1.00 58.72  ? 958  GLU A OE1 1 
ATOM 7417 O OE2 . GLU A 1 961  ? 7.512   31.837 23.528  1.00 58.72  ? 958  GLU A OE2 1 
ATOM 7418 N N   . ILE A 1 962  ? 10.063  28.242 21.914  1.00 54.15  ? 959  ILE A N   1 
ATOM 7419 C CA  . ILE A 1 962  ? 10.325  27.264 20.888  1.00 54.15  ? 959  ILE A CA  1 
ATOM 7420 C C   . ILE A 1 962  ? 9.920   27.888 19.579  1.00 54.15  ? 959  ILE A C   1 
ATOM 7421 O O   . ILE A 1 962  ? 8.778   28.319 19.426  1.00 54.15  ? 959  ILE A O   1 
ATOM 7422 C CB  . ILE A 1 962  ? 9.530   25.967 21.129  1.00 49.89  ? 959  ILE A CB  1 
ATOM 7423 C CG1 . ILE A 1 962  ? 9.990   25.259 22.423  1.00 49.89  ? 959  ILE A CG1 1 
ATOM 7424 C CG2 . ILE A 1 962  ? 9.632   25.040 19.907  1.00 49.89  ? 959  ILE A CG2 1 
ATOM 7425 C CD1 . ILE A 1 962  ? 9.091   24.067 22.865  1.00 49.89  ? 959  ILE A CD1 1 
ATOM 7426 N N   . LEU A 1 963  ? 10.838  27.960 18.629  1.00 68.13  ? 960  LEU A N   1 
ATOM 7427 C CA  . LEU A 1 963  ? 10.461  28.505 17.333  1.00 68.13  ? 960  LEU A CA  1 
ATOM 7428 C C   . LEU A 1 963  ? 9.931   27.418 16.406  1.00 68.13  ? 960  LEU A C   1 
ATOM 7429 O O   . LEU A 1 963  ? 8.998   27.648 15.624  1.00 68.13  ? 960  LEU A O   1 
ATOM 7430 C CB  . LEU A 1 963  ? 11.624  29.217 16.676  1.00 46.93  ? 960  LEU A CB  1 
ATOM 7431 C CG  . LEU A 1 963  ? 12.720  29.814 17.549  1.00 46.93  ? 960  LEU A CG  1 
ATOM 7432 C CD1 . LEU A 1 963  ? 13.709  30.430 16.580  1.00 46.93  ? 960  LEU A CD1 1 
ATOM 7433 C CD2 . LEU A 1 963  ? 12.234  30.866 18.575  1.00 46.93  ? 960  LEU A CD2 1 
ATOM 7434 N N   . ASP A 1 964  ? 10.543  26.242 16.484  1.00 74.76  ? 961  ASP A N   1 
ATOM 7435 C CA  . ASP A 1 964  ? 10.112  25.112 15.700  1.00 74.76  ? 961  ASP A CA  1 
ATOM 7436 C C   . ASP A 1 964  ? 10.745  23.819 16.196  1.00 74.76  ? 961  ASP A C   1 
ATOM 7437 O O   . ASP A 1 964  ? 11.558  23.824 17.134  1.00 74.76  ? 961  ASP A O   1 
ATOM 7438 C CB  . ASP A 1 964  ? 10.387  25.331 14.202  1.00 85.37  ? 961  ASP A CB  1 
ATOM 7439 C CG  . ASP A 1 964  ? 11.863  25.412 13.879  1.00 85.37  ? 961  ASP A CG  1 
ATOM 7440 O OD1 . ASP A 1 964  ? 12.287  26.471 13.370  1.00 85.37  ? 961  ASP A OD1 1 
ATOM 7441 O OD2 . ASP A 1 964  ? 12.597  24.425 14.121  1.00 85.37  ? 961  ASP A OD2 1 
ATOM 7442 N N   . ASP A 1 965  ? 10.368  22.726 15.525  1.00 67.39  ? 962  ASP A N   1 
ATOM 7443 C CA  . ASP A 1 965  ? 10.720  21.352 15.897  1.00 67.39  ? 962  ASP A CA  1 
ATOM 7444 C C   . ASP A 1 965  ? 12.170  21.139 16.340  1.00 67.39  ? 962  ASP A C   1 
ATOM 7445 O O   . ASP A 1 965  ? 12.470  20.131 17.000  1.00 67.39  ? 962  ASP A O   1 
ATOM 7446 C CB  . ASP A 1 965  ? 10.392  20.394 14.744  1.00 123.17 ? 962  ASP A CB  1 
ATOM 7447 C CG  . ASP A 1 965  ? 9.022   20.645 14.150  1.00 123.17 ? 962  ASP A CG  1 
ATOM 7448 O OD1 . ASP A 1 965  ? 8.776   21.787 13.695  1.00 123.17 ? 962  ASP A OD1 1 
ATOM 7449 O OD2 . ASP A 1 965  ? 8.202   19.698 14.133  1.00 123.17 ? 962  ASP A OD2 1 
ATOM 7450 N N   . ASP A 1 966  ? 13.053  22.070 15.959  1.00 100.49 ? 963  ASP A N   1 
ATOM 7451 C CA  . ASP A 1 966  ? 14.486  21.985 16.259  1.00 100.49 ? 963  ASP A CA  1 
ATOM 7452 C C   . ASP A 1 966  ? 14.972  23.216 17.022  1.00 100.49 ? 963  ASP A C   1 
ATOM 7453 O O   . ASP A 1 966  ? 15.961  23.142 17.755  1.00 100.49 ? 963  ASP A O   1 
ATOM 7454 C CB  . ASP A 1 966  ? 15.321  21.846 14.969  1.00 128.92 ? 963  ASP A CB  1 
ATOM 7455 C CG  . ASP A 1 966  ? 14.683  20.922 13.931  1.00 128.92 ? 963  ASP A CG  1 
ATOM 7456 O OD1 . ASP A 1 966  ? 14.505  19.712 14.202  1.00 128.92 ? 963  ASP A OD1 1 
ATOM 7457 O OD2 . ASP A 1 966  ? 14.379  21.409 12.823  1.00 128.92 ? 963  ASP A OD2 1 
ATOM 7458 N N   . ASN A 1 967  ? 14.272  24.340 16.849  1.00 80.78  ? 964  ASN A N   1 
ATOM 7459 C CA  . ASN A 1 967  ? 14.803  25.636 17.257  1.00 80.78  ? 964  ASN A CA  1 
ATOM 7460 C C   . ASN A 1 967  ? 14.348  26.195 18.580  1.00 80.78  ? 964  ASN A C   1 
ATOM 7461 O O   . ASN A 1 967  ? 13.174  26.477 18.798  1.00 80.78  ? 964  ASN A O   1 
ATOM 7462 C CB  . ASN A 1 967  ? 14.634  26.664 16.154  1.00 88.08  ? 964  ASN A CB  1 
ATOM 7463 C CG  . ASN A 1 967  ? 15.847  26.751 15.278  1.00 88.08  ? 964  ASN A CG  1 
ATOM 7464 O OD1 . ASN A 1 967  ? 16.671  25.829 15.238  1.00 88.08  ? 964  ASN A OD1 1 
ATOM 7465 N ND2 . ASN A 1 967  ? 15.983  27.869 14.574  1.00 88.08  ? 964  ASN A ND2 1 
ATOM 7466 N N   . PHE A 1 968  ? 15.327  26.376 19.454  1.00 46.90  ? 965  PHE A N   1 
ATOM 7467 C CA  . PHE A 1 968  ? 15.069  26.743 20.830  1.00 46.90  ? 965  PHE A CA  1 
ATOM 7468 C C   . PHE A 1 968  ? 15.734  28.071 21.266  1.00 46.90  ? 965  PHE A C   1 
ATOM 7469 O O   . PHE A 1 968  ? 16.959  28.172 21.399  1.00 46.90  ? 965  PHE A O   1 
ATOM 7470 C CB  . PHE A 1 968  ? 15.426  25.554 21.703  1.00 46.02  ? 965  PHE A CB  1 
ATOM 7471 C CG  . PHE A 1 968  ? 14.881  24.256 21.166  1.00 46.02  ? 965  PHE A CG  1 
ATOM 7472 C CD1 . PHE A 1 968  ? 15.685  23.116 21.075  1.00 46.02  ? 965  PHE A CD1 1 
ATOM 7473 C CD2 . PHE A 1 968  ? 13.560  24.171 20.715  1.00 46.02  ? 965  PHE A CD2 1 
ATOM 7474 C CE1 . PHE A 1 968  ? 15.183  21.885 20.566  1.00 46.02  ? 965  PHE A CE1 1 
ATOM 7475 C CE2 . PHE A 1 968  ? 13.040  22.970 20.209  1.00 46.02  ? 965  PHE A CE2 1 
ATOM 7476 C CZ  . PHE A 1 968  ? 13.868  21.819 20.139  1.00 46.02  ? 965  PHE A CZ  1 
ATOM 7477 N N   . LEU A 1 969  ? 14.897  29.098 21.441  1.00 49.44  ? 966  LEU A N   1 
ATOM 7478 C CA  . LEU A 1 969  ? 15.327  30.407 21.921  1.00 49.44  ? 966  LEU A CA  1 
ATOM 7479 C C   . LEU A 1 969  ? 15.536  30.426 23.427  1.00 49.44  ? 966  LEU A C   1 
ATOM 7480 O O   . LEU A 1 969  ? 14.789  29.815 24.180  1.00 49.44  ? 966  LEU A O   1 
ATOM 7481 C CB  . LEU A 1 969  ? 14.276  31.446 21.575  1.00 47.62  ? 966  LEU A CB  1 
ATOM 7482 C CG  . LEU A 1 969  ? 14.828  32.688 20.876  1.00 47.62  ? 966  LEU A CG  1 
ATOM 7483 C CD1 . LEU A 1 969  ? 13.732  33.708 20.678  1.00 47.62  ? 966  LEU A CD1 1 
ATOM 7484 C CD2 . LEU A 1 969  ? 16.016  33.294 21.628  1.00 47.62  ? 966  LEU A CD2 1 
ATOM 7485 N N   . GLY A 1 970  ? 16.544  31.157 23.865  1.00 51.32  ? 967  GLY A N   1 
ATOM 7486 C CA  . GLY A 1 970  ? 16.874  31.234 25.273  1.00 51.32  ? 967  GLY A CA  1 
ATOM 7487 C C   . GLY A 1 970  ? 17.389  32.615 25.562  1.00 51.32  ? 967  GLY A C   1 
ATOM 7488 O O   . GLY A 1 970  ? 18.060  33.210 24.729  1.00 51.32  ? 967  GLY A O   1 
ATOM 7489 N N   . ALA A 1 971  ? 17.031  33.137 26.723  1.00 45.11  ? 968  ALA A N   1 
ATOM 7490 C CA  . ALA A 1 971  ? 17.437  34.450 27.166  1.00 45.11  ? 968  ALA A CA  1 
ATOM 7491 C C   . ALA A 1 971  ? 17.976  34.191 28.535  1.00 45.11  ? 968  ALA A C   1 
ATOM 7492 O O   . ALA A 1 971  ? 17.565  33.220 29.159  1.00 45.11  ? 968  ALA A O   1 
ATOM 7493 C CB  . ALA A 1 971  ? 16.239  35.344 27.243  1.00 51.52  ? 968  ALA A CB  1 
ATOM 7494 N N   . GLU A 1 972  ? 18.881  35.016 29.042  1.00 35.49  ? 969  GLU A N   1 
ATOM 7495 C CA  . GLU A 1 972  ? 19.459  34.641 30.339  1.00 35.49  ? 969  GLU A CA  1 
ATOM 7496 C C   . GLU A 1 972  ? 20.192  35.687 31.158  1.00 35.49  ? 969  GLU A C   1 
ATOM 7497 O O   . GLU A 1 972  ? 20.537  36.735 30.655  1.00 35.49  ? 969  GLU A O   1 
ATOM 7498 C CB  . GLU A 1 972  ? 20.322  33.373 30.190  1.00 62.40  ? 969  GLU A CB  1 
ATOM 7499 C CG  . GLU A 1 972  ? 21.819  33.585 30.318  1.00 62.40  ? 969  GLU A CG  1 
ATOM 7500 C CD  . GLU A 1 972  ? 22.349  34.584 29.312  1.00 62.40  ? 969  GLU A CD  1 
ATOM 7501 O OE1 . GLU A 1 972  ? 22.005  34.413 28.123  1.00 62.40  ? 969  GLU A OE1 1 
ATOM 7502 O OE2 . GLU A 1 972  ? 23.082  35.532 29.708  1.00 62.40  ? 969  GLU A OE2 1 
ATOM 7503 N N   . ASN A 1 973  ? 20.387  35.368 32.432  1.00 53.97  ? 970  ASN A N   1 
ATOM 7504 C CA  . ASN A 1 973  ? 21.139  36.138 33.400  1.00 53.97  ? 970  ASN A CA  1 
ATOM 7505 C C   . ASN A 1 973  ? 21.910  37.327 32.876  1.00 53.97  ? 970  ASN A C   1 
ATOM 7506 O O   . ASN A 1 973  ? 21.916  38.353 33.502  1.00 53.97  ? 970  ASN A O   1 
ATOM 7507 C CB  . ASN A 1 973  ? 22.131  35.203 34.085  1.00 109.64 ? 970  ASN A CB  1 
ATOM 7508 C CG  . ASN A 1 973  ? 22.297  35.502 35.552  1.00 109.64 ? 970  ASN A CG  1 
ATOM 7509 O OD1 . ASN A 1 973  ? 21.375  35.990 36.201  1.00 109.64 ? 970  ASN A OD1 1 
ATOM 7510 N ND2 . ASN A 1 973  ? 23.472  35.189 36.095  1.00 109.64 ? 970  ASN A ND2 1 
ATOM 7511 N N   . ALA A 1 974  ? 22.583  37.180 31.738  1.00 54.17  ? 971  ALA A N   1 
ATOM 7512 C CA  . ALA A 1 974  ? 23.538  38.182 31.261  1.00 54.17  ? 971  ALA A CA  1 
ATOM 7513 C C   . ALA A 1 974  ? 23.146  38.896 29.954  1.00 54.17  ? 971  ALA A C   1 
ATOM 7514 O O   . ALA A 1 974  ? 24.008  39.291 29.161  1.00 54.17  ? 971  ALA A O   1 
ATOM 7515 C CB  . ALA A 1 974  ? 24.881  37.540 31.113  1.00 33.58  ? 971  ALA A CB  1 
ATOM 7516 N N   . PHE A 1 975  ? 21.848  39.064 29.727  1.00 48.25  ? 972  PHE A N   1 
ATOM 7517 C CA  . PHE A 1 975  ? 21.355  39.865 28.612  1.00 48.25  ? 972  PHE A CA  1 
ATOM 7518 C C   . PHE A 1 975  ? 21.820  39.295 27.297  1.00 48.25  ? 972  PHE A C   1 
ATOM 7519 O O   . PHE A 1 975  ? 22.006  40.019 26.317  1.00 48.25  ? 972  PHE A O   1 
ATOM 7520 C CB  . PHE A 1 975  ? 21.751  41.346 28.784  1.00 34.41  ? 972  PHE A CB  1 
ATOM 7521 C CG  . PHE A 1 975  ? 21.794  41.766 30.218  1.00 34.41  ? 972  PHE A CG  1 
ATOM 7522 C CD1 . PHE A 1 975  ? 23.003  42.055 30.837  1.00 34.41  ? 972  PHE A CD1 1 
ATOM 7523 C CD2 . PHE A 1 975  ? 20.611  41.772 30.995  1.00 34.41  ? 972  PHE A CD2 1 
ATOM 7524 C CE1 . PHE A 1 975  ? 23.041  42.390 32.190  1.00 34.41  ? 972  PHE A CE1 1 
ATOM 7525 C CE2 . PHE A 1 975  ? 20.634  42.131 32.370  1.00 34.41  ? 972  PHE A CE2 1 
ATOM 7526 C CZ  . PHE A 1 975  ? 21.849  42.439 32.961  1.00 34.41  ? 972  PHE A CZ  1 
ATOM 7527 N N   . ASN A 1 976  ? 21.989  37.983 27.272  1.00 54.28  ? 973  ASN A N   1 
ATOM 7528 C CA  . ASN A 1 976  ? 22.279  37.317 26.011  1.00 54.28  ? 973  ASN A CA  1 
ATOM 7529 C C   . ASN A 1 976  ? 21.097  36.515 25.494  1.00 54.28  ? 973  ASN A C   1 
ATOM 7530 O O   . ASN A 1 976  ? 20.292  36.018 26.254  1.00 54.28  ? 973  ASN A O   1 
ATOM 7531 C CB  . ASN A 1 976  ? 23.554  36.459 26.098  1.00 39.42  ? 973  ASN A CB  1 
ATOM 7532 C CG  . ASN A 1 976  ? 24.793  37.282 26.401  1.00 39.42  ? 973  ASN A CG  1 
ATOM 7533 O OD1 . ASN A 1 976  ? 25.054  38.316 25.777  1.00 39.42  ? 973  ASN A OD1 1 
ATOM 7534 N ND2 . ASN A 1 976  ? 25.568  36.820 27.366  1.00 39.42  ? 973  ASN A ND2 1 
ATOM 7535 N N   . LEU A 1 977  ? 20.992  36.439 24.185  1.00 49.53  ? 974  LEU A N   1 
ATOM 7536 C CA  . LEU A 1 977  ? 20.065  35.559 23.547  1.00 49.53  ? 974  LEU A CA  1 
ATOM 7537 C C   . LEU A 1 977  ? 20.884  34.439 22.959  1.00 49.53  ? 974  LEU A C   1 
ATOM 7538 O O   . LEU A 1 977  ? 22.065  34.632 22.623  1.00 49.53  ? 974  LEU A O   1 
ATOM 7539 C CB  . LEU A 1 977  ? 19.371  36.268 22.405  1.00 61.37  ? 974  LEU A CB  1 
ATOM 7540 C CG  . LEU A 1 977  ? 18.462  37.432 22.732  1.00 61.37  ? 974  LEU A CG  1 
ATOM 7541 C CD1 . LEU A 1 977  ? 17.734  37.777 21.497  1.00 61.37  ? 974  LEU A CD1 1 
ATOM 7542 C CD2 . LEU A 1 977  ? 17.491  37.031 23.814  1.00 61.37  ? 974  LEU A CD2 1 
ATOM 7543 N N   . PHE A 1 978  ? 20.268  33.264 22.819  1.00 49.03  ? 975  PHE A N   1 
ATOM 7544 C CA  . PHE A 1 978  ? 20.946  32.119 22.222  1.00 49.03  ? 975  PHE A CA  1 
ATOM 7545 C C   . PHE A 1 978  ? 19.988  31.104 21.688  1.00 49.03  ? 975  PHE A C   1 
ATOM 7546 O O   . PHE A 1 978  ? 18.863  31.021 22.132  1.00 49.03  ? 975  PHE A O   1 
ATOM 7547 C CB  . PHE A 1 978  ? 21.906  31.480 23.208  1.00 48.66  ? 975  PHE A CB  1 
ATOM 7548 C CG  . PHE A 1 978  ? 21.266  30.554 24.178  1.00 48.66  ? 975  PHE A CG  1 
ATOM 7549 C CD1 . PHE A 1 978  ? 20.866  29.275 23.793  1.00 48.66  ? 975  PHE A CD1 1 
ATOM 7550 C CD2 . PHE A 1 978  ? 21.127  30.923 25.519  1.00 48.66  ? 975  PHE A CD2 1 
ATOM 7551 C CE1 . PHE A 1 978  ? 20.302  28.395 24.741  1.00 48.66  ? 975  PHE A CE1 1 
ATOM 7552 C CE2 . PHE A 1 978  ? 20.575  30.041 26.462  1.00 48.66  ? 975  PHE A CE2 1 
ATOM 7553 C CZ  . PHE A 1 978  ? 20.174  28.784 26.079  1.00 48.66  ? 975  PHE A CZ  1 
ATOM 7554 N N   . VAL A 1 979  ? 20.447  30.328 20.725  1.00 53.05  ? 976  VAL A N   1 
ATOM 7555 C CA  . VAL A 1 979  ? 19.608  29.355 20.086  1.00 53.05  ? 976  VAL A CA  1 
ATOM 7556 C C   . VAL A 1 979  ? 20.266  27.989 20.166  1.00 53.05  ? 976  VAL A C   1 
ATOM 7557 O O   . VAL A 1 979  ? 21.482  27.873 20.217  1.00 53.05  ? 976  VAL A O   1 
ATOM 7558 C CB  . VAL A 1 979  ? 19.339  29.770 18.643  1.00 39.82  ? 976  VAL A CB  1 
ATOM 7559 C CG1 . VAL A 1 979  ? 18.707  28.620 17.808  1.00 39.82  ? 976  VAL A CG1 1 
ATOM 7560 C CG2 . VAL A 1 979  ? 18.475  31.002 18.624  1.00 39.82  ? 976  VAL A CG2 1 
ATOM 7561 N N   . CYS A 1 980  ? 19.438  26.960 20.216  1.00 56.11  ? 977  CYS A N   1 
ATOM 7562 C CA  . CYS A 1 980  ? 19.888  25.598 20.201  1.00 56.11  ? 977  CYS A CA  1 
ATOM 7563 C C   . CYS A 1 980  ? 19.066  24.866 19.195  1.00 56.11  ? 977  CYS A C   1 
ATOM 7564 O O   . CYS A 1 980  ? 17.850  25.097 19.075  1.00 56.11  ? 977  CYS A O   1 
ATOM 7565 C CB  . CYS A 1 980  ? 19.648  24.946 21.546  1.00 64.89  ? 977  CYS A CB  1 
ATOM 7566 S SG  . CYS A 1 980  ? 20.750  25.517 22.816  1.00 64.89  ? 977  CYS A SG  1 
ATOM 7567 N N   . GLN A 1 981  ? 19.749  24.007 18.440  1.00 74.78  ? 978  GLN A N   1 
ATOM 7568 C CA  . GLN A 1 981  ? 19.100  22.872 17.778  1.00 74.78  ? 978  GLN A CA  1 
ATOM 7569 C C   . GLN A 1 981  ? 19.775  21.562 18.181  1.00 74.78  ? 978  GLN A C   1 
ATOM 7570 O O   . GLN A 1 981  ? 20.682  21.554 19.024  1.00 74.78  ? 978  GLN A O   1 
ATOM 7571 C CB  . GLN A 1 981  ? 19.026  23.040 16.267  1.00 63.53  ? 978  GLN A CB  1 
ATOM 7572 C CG  . GLN A 1 981  ? 20.245  23.580 15.637  1.00 63.53  ? 978  GLN A CG  1 
ATOM 7573 C CD  . GLN A 1 981  ? 19.969  23.943 14.207  1.00 63.53  ? 978  GLN A CD  1 
ATOM 7574 O OE1 . GLN A 1 981  ? 19.875  23.075 13.344  1.00 63.53  ? 978  GLN A OE1 1 
ATOM 7575 N NE2 . GLN A 1 981  ? 19.824  25.230 13.939  1.00 63.53  ? 978  GLN A NE2 1 
ATOM 7576 N N   . LYS A 1 982  ? 19.308  20.457 17.616  1.00 73.73  ? 979  LYS A N   1 
ATOM 7577 C CA  . LYS A 1 982  ? 19.894  19.170 17.954  1.00 73.73  ? 979  LYS A CA  1 
ATOM 7578 C C   . LYS A 1 982  ? 20.670  18.623 16.756  1.00 73.73  ? 979  LYS A C   1 
ATOM 7579 O O   . LYS A 1 982  ? 20.334  18.909 15.604  1.00 73.73  ? 979  LYS A O   1 
ATOM 7580 C CB  . LYS A 1 982  ? 18.847  18.190 18.517  1.00 106.54 ? 979  LYS A CB  1 
ATOM 7581 C CG  . LYS A 1 982  ? 17.880  17.575 17.511  1.00 106.54 ? 979  LYS A CG  1 
ATOM 7582 C CD  . LYS A 1 982  ? 16.719  18.497 17.163  1.00 106.54 ? 979  LYS A CD  1 
ATOM 7583 C CE  . LYS A 1 982  ? 15.616  17.723 16.447  1.00 106.54 ? 979  LYS A CE  1 
ATOM 7584 N NZ  . LYS A 1 982  ? 14.984  16.707 17.342  1.00 106.54 ? 979  LYS A NZ  1 
ATOM 7585 N N   . ASP A 1 983  ? 21.721  17.861 17.048  1.00 169.85 ? 980  ASP A N   1 
ATOM 7586 C CA  . ASP A 1 983  ? 22.720  17.458 16.060  1.00 169.85 ? 980  ASP A CA  1 
ATOM 7587 C C   . ASP A 1 983  ? 22.171  16.529 14.971  1.00 169.85 ? 980  ASP A C   1 
ATOM 7588 O O   . ASP A 1 983  ? 21.406  15.610 15.267  1.00 169.85 ? 980  ASP A O   1 
ATOM 7589 C CB  . ASP A 1 983  ? 23.882  16.779 16.793  1.00 115.61 ? 980  ASP A CB  1 
ATOM 7590 C CG  . ASP A 1 983  ? 25.225  17.036 16.146  1.00 115.61 ? 980  ASP A CG  1 
ATOM 7591 O OD1 . ASP A 1 983  ? 25.263  17.554 15.007  1.00 115.61 ? 980  ASP A OD1 1 
ATOM 7592 O OD2 . ASP A 1 983  ? 26.249  16.714 16.791  1.00 115.61 ? 980  ASP A OD2 1 
ATOM 7593 N N   . SER A 1 984  ? 22.543  16.787 13.716  1.00 111.05 ? 981  SER A N   1 
ATOM 7594 C CA  . SER A 1 984  ? 22.324  15.815 12.625  1.00 111.05 ? 981  SER A CA  1 
ATOM 7595 C C   . SER A 1 984  ? 23.575  14.936 12.435  1.00 111.05 ? 981  SER A C   1 
ATOM 7596 O O   . SER A 1 984  ? 24.376  15.148 11.513  1.00 111.05 ? 981  SER A O   1 
ATOM 7597 C CB  . SER A 1 984  ? 21.923  16.506 11.311  1.00 131.16 ? 981  SER A CB  1 
ATOM 7598 O OG  . SER A 1 984  ? 20.581  16.214 10.952  1.00 131.16 ? 981  SER A OG  1 
ATOM 7599 N N   . ALA A 1 985  ? 23.724  13.943 13.312  1.00 86.71  ? 982  ALA A N   1 
ATOM 7600 C CA  . ALA A 1 985  ? 24.994  13.234 13.450  1.00 86.71  ? 982  ALA A CA  1 
ATOM 7601 C C   . ALA A 1 985  ? 24.882  11.724 13.661  1.00 86.71  ? 982  ALA A C   1 
ATOM 7602 O O   . ALA A 1 985  ? 24.062  11.239 14.453  1.00 86.71  ? 982  ALA A O   1 
ATOM 7603 C CB  . ALA A 1 985  ? 25.821  13.860 14.583  1.00 90.52  ? 982  ALA A CB  1 
ATOM 7604 N N   . ALA A 1 986  ? 25.741  10.994 12.955  1.00 179.56 ? 983  ALA A N   1 
ATOM 7605 C CA  . ALA A 1 986  ? 25.987  9.587  13.223  1.00 179.56 ? 983  ALA A CA  1 
ATOM 7606 C C   . ALA A 1 986  ? 26.306  9.401  14.702  1.00 179.56 ? 983  ALA A C   1 
ATOM 7607 O O   . ALA A 1 986  ? 26.752  10.343 15.363  1.00 179.56 ? 983  ALA A O   1 
ATOM 7608 C CB  . ALA A 1 986  ? 27.148  9.121  12.389  1.00 61.59  ? 983  ALA A CB  1 
ATOM 7609 N N   . THR A 1 987  ? 26.080  8.190  15.213  1.00 93.31  ? 984  THR A N   1 
ATOM 7610 C CA  . THR A 1 987  ? 26.425  7.819  16.605  1.00 93.31  ? 984  THR A CA  1 
ATOM 7611 C C   . THR A 1 987  ? 25.501  8.470  17.657  1.00 93.31  ? 984  THR A C   1 
ATOM 7612 O O   . THR A 1 987  ? 25.960  9.070  18.649  1.00 93.31  ? 984  THR A O   1 
ATOM 7613 C CB  . THR A 1 987  ? 27.934  8.077  16.952  1.00 175.79 ? 984  THR A CB  1 
ATOM 7614 O OG1 . THR A 1 987  ? 28.162  9.478  17.161  1.00 175.79 ? 984  THR A OG1 1 
ATOM 7615 C CG2 . THR A 1 987  ? 28.860  7.558  15.848  1.00 175.79 ? 984  THR A CG2 1 
ATOM 7616 N N   . THR A 1 988  ? 24.199  8.301  17.436  1.00 173.09 ? 985  THR A N   1 
ATOM 7617 C CA  . THR A 1 988  ? 23.153  9.052  18.136  1.00 173.09 ? 985  THR A CA  1 
ATOM 7618 C C   . THR A 1 988  ? 22.943  8.655  19.601  1.00 173.09 ? 985  THR A C   1 
ATOM 7619 O O   . THR A 1 988  ? 21.806  8.517  20.052  1.00 173.09 ? 985  THR A O   1 
ATOM 7620 C CB  . THR A 1 988  ? 21.792  8.960  17.380  1.00 145.25 ? 985  THR A CB  1 
ATOM 7621 O OG1 . THR A 1 988  ? 21.189  7.680  17.612  1.00 145.25 ? 985  THR A OG1 1 
ATOM 7622 C CG2 . THR A 1 988  ? 21.986  9.159  15.883  1.00 145.25 ? 985  THR A CG2 1 
ATOM 7623 N N   . ASP A 1 989  ? 24.032  8.483  20.341  1.00 161.06 ? 986  ASP A N   1 
ATOM 7624 C CA  . ASP A 1 989  ? 23.936  8.145  21.760  1.00 161.06 ? 986  ASP A CA  1 
ATOM 7625 C C   . ASP A 1 989  ? 24.755  9.085  22.614  1.00 161.06 ? 986  ASP A C   1 
ATOM 7626 O O   . ASP A 1 989  ? 24.887  8.914  23.827  1.00 161.06 ? 986  ASP A O   1 
ATOM 7627 C CB  . ASP A 1 989  ? 24.331  6.689  22.009  1.00 116.10 ? 986  ASP A CB  1 
ATOM 7628 C CG  . ASP A 1 989  ? 23.129  5.757  22.017  1.00 116.10 ? 986  ASP A CG  1 
ATOM 7629 O OD1 . ASP A 1 989  ? 22.513  5.563  20.943  1.00 116.10 ? 986  ASP A OD1 1 
ATOM 7630 O OD2 . ASP A 1 989  ? 22.798  5.228  23.104  1.00 116.10 ? 986  ASP A OD2 1 
ATOM 7631 N N   . GLU A 1 990  ? 25.301  10.090 21.953  1.00 90.65  ? 987  GLU A N   1 
ATOM 7632 C CA  . GLU A 1 990  ? 25.973  11.172 22.629  1.00 90.65  ? 987  GLU A CA  1 
ATOM 7633 C C   . GLU A 1 990  ? 25.806  12.389 21.753  1.00 90.65  ? 987  GLU A C   1 
ATOM 7634 O O   . GLU A 1 990  ? 25.329  13.422 22.197  1.00 90.65  ? 987  GLU A O   1 
ATOM 7635 C CB  . GLU A 1 990  ? 27.453  10.850 22.830  1.00 200.88 ? 987  GLU A CB  1 
ATOM 7636 C CG  . GLU A 1 990  ? 28.039  11.464 24.084  1.00 200.88 ? 987  GLU A CG  1 
ATOM 7637 C CD  . GLU A 1 990  ? 27.318  11.013 25.338  1.00 200.88 ? 987  GLU A CD  1 
ATOM 7638 O OE1 . GLU A 1 990  ? 27.152  9.789  25.529  1.00 200.88 ? 987  GLU A OE1 1 
ATOM 7639 O OE2 . GLU A 1 990  ? 26.914  11.887 26.130  1.00 200.88 ? 987  GLU A OE2 1 
ATOM 7640 N N   . GLU A 1 991  ? 26.168  12.235 20.486  1.00 114.38 ? 988  GLU A N   1 
ATOM 7641 C CA  . GLU A 1 991  ? 26.000  13.291 19.514  1.00 114.38 ? 988  GLU A CA  1 
ATOM 7642 C C   . GLU A 1 991  ? 24.532  13.654 19.385  1.00 114.38 ? 988  GLU A C   1 
ATOM 7643 O O   . GLU A 1 991  ? 24.182  14.564 18.640  1.00 114.38 ? 988  GLU A O   1 
ATOM 7644 C CB  . GLU A 1 991  ? 26.571  12.872 18.160  1.00 122.35 ? 988  GLU A CB  1 
ATOM 7645 C CG  . GLU A 1 991  ? 28.092  12.806 18.126  1.00 122.35 ? 988  GLU A CG  1 
ATOM 7646 C CD  . GLU A 1 991  ? 28.640  12.683 16.720  1.00 122.35 ? 988  GLU A CD  1 
ATOM 7647 O OE1 . GLU A 1 991  ? 28.269  13.504 15.853  1.00 122.35 ? 988  GLU A OE1 1 
ATOM 7648 O OE2 . GLU A 1 991  ? 29.454  11.767 16.485  1.00 122.35 ? 988  GLU A OE2 1 
ATOM 7649 N N   . ARG A 1 992  ? 23.683  12.940 20.122  1.00 114.62 ? 989  ARG A N   1 
ATOM 7650 C CA  . ARG A 1 992  ? 22.248  13.212 20.141  1.00 114.62 ? 989  ARG A CA  1 
ATOM 7651 C C   . ARG A 1 992  ? 21.805  13.736 21.500  1.00 114.62 ? 989  ARG A C   1 
ATOM 7652 O O   . ARG A 1 992  ? 20.917  14.586 21.590  1.00 114.62 ? 989  ARG A O   1 
ATOM 7653 C CB  . ARG A 1 992  ? 21.459  11.952 19.777  1.00 164.90 ? 989  ARG A CB  1 
ATOM 7654 C CG  . ARG A 1 992  ? 20.017  12.202 19.339  1.00 164.90 ? 989  ARG A CG  1 
ATOM 7655 C CD  . ARG A 1 992  ? 19.937  12.955 18.011  1.00 164.90 ? 989  ARG A CD  1 
ATOM 7656 N NE  . ARG A 1 992  ? 20.467  12.183 16.885  1.00 164.90 ? 989  ARG A NE  1 
ATOM 7657 C CZ  . ARG A 1 992  ? 20.369  12.548 15.607  1.00 164.90 ? 989  ARG A CZ  1 
ATOM 7658 N NH1 . ARG A 1 992  ? 19.754  13.678 15.274  1.00 164.90 ? 989  ARG A NH1 1 
ATOM 7659 N NH2 . ARG A 1 992  ? 20.882  11.781 14.653  1.00 164.90 ? 989  ARG A NH2 1 
ATOM 7660 N N   . GLN A 1 993  ? 22.441  13.220 22.547  1.00 99.83  ? 990  GLN A N   1 
ATOM 7661 C CA  . GLN A 1 993  ? 22.152  13.600 23.924  1.00 99.83  ? 990  GLN A CA  1 
ATOM 7662 C C   . GLN A 1 993  ? 22.653  15.018 24.233  1.00 99.83  ? 990  GLN A C   1 
ATOM 7663 O O   . GLN A 1 993  ? 22.542  15.503 25.372  1.00 99.83  ? 990  GLN A O   1 
ATOM 7664 C CB  . GLN A 1 993  ? 22.805  12.592 24.871  1.00 140.29 ? 990  GLN A CB  1 
ATOM 7665 C CG  . GLN A 1 993  ? 21.976  12.263 26.095  1.00 140.29 ? 990  GLN A CG  1 
ATOM 7666 C CD  . GLN A 1 993  ? 20.708  11.504 25.752  1.00 140.29 ? 990  GLN A CD  1 
ATOM 7667 O OE1 . GLN A 1 993  ? 19.621  11.850 26.215  1.00 140.29 ? 990  GLN A OE1 1 
ATOM 7668 N NE2 . GLN A 1 993  ? 20.839  10.469 24.929  1.00 140.29 ? 990  GLN A NE2 1 
ATOM 7669 N N   . HIS A 1 994  ? 23.208  15.663 23.203  1.00 94.77  ? 991  HIS A N   1 
ATOM 7670 C CA  . HIS A 1 994  ? 23.820  16.989 23.292  1.00 94.77  ? 991  HIS A CA  1 
ATOM 7671 C C   . HIS A 1 994  ? 23.288  17.821 22.141  1.00 94.77  ? 991  HIS A C   1 
ATOM 7672 O O   . HIS A 1 994  ? 23.144  17.310 21.031  1.00 94.77  ? 991  HIS A O   1 
ATOM 7673 C CB  . HIS A 1 994  ? 25.351  16.884 23.209  1.00 111.37 ? 991  HIS A CB  1 
ATOM 7674 C CG  . HIS A 1 994  ? 25.980  16.151 24.362  1.00 111.37 ? 991  HIS A CG  1 
ATOM 7675 N ND1 . HIS A 1 994  ? 26.727  16.787 25.332  1.00 111.37 ? 991  HIS A ND1 1 
ATOM 7676 C CD2 . HIS A 1 994  ? 25.973  14.837 24.698  1.00 111.37 ? 991  HIS A CD2 1 
ATOM 7677 C CE1 . HIS A 1 994  ? 27.144  15.900 26.218  1.00 111.37 ? 991  HIS A CE1 1 
ATOM 7678 N NE2 . HIS A 1 994  ? 26.700  14.709 25.855  1.00 111.37 ? 991  HIS A NE2 1 
ATOM 7679 N N   . LEU A 1 995  ? 22.953  19.082 22.418  1.00 80.05  ? 992  LEU A N   1 
ATOM 7680 C CA  . LEU A 1 995  ? 22.452  20.020 21.392  1.00 80.05  ? 992  LEU A CA  1 
ATOM 7681 C C   . LEU A 1 995  ? 23.225  21.323 21.422  1.00 80.05  ? 992  LEU A C   1 
ATOM 7682 O O   . LEU A 1 995  ? 23.479  21.890 22.482  1.00 80.05  ? 992  LEU A O   1 
ATOM 7683 C CB  . LEU A 1 995  ? 20.920  20.258 21.453  1.00 69.27  ? 992  LEU A CB  1 
ATOM 7684 C CG  . LEU A 1 995  ? 19.990  20.426 22.685  1.00 69.27  ? 992  LEU A CG  1 
ATOM 7685 C CD1 . LEU A 1 995  ? 20.409  21.536 23.636  1.00 69.27  ? 992  LEU A CD1 1 
ATOM 7686 C CD2 . LEU A 1 995  ? 18.535  20.675 22.244  1.00 69.27  ? 992  LEU A CD2 1 
ATOM 7687 N N   . GLN A 1 996  ? 23.608  21.793 20.244  1.00 61.22  ? 993  GLN A N   1 
ATOM 7688 C CA  . GLN A 1 996  ? 24.687  22.779 20.160  1.00 61.22  ? 993  GLN A CA  1 
ATOM 7689 C C   . GLN A 1 996  ? 24.152  24.185 20.083  1.00 61.22  ? 993  GLN A C   1 
ATOM 7690 O O   . GLN A 1 996  ? 23.096  24.406 19.495  1.00 61.22  ? 993  GLN A O   1 
ATOM 7691 C CB  . GLN A 1 996  ? 25.607  22.489 18.967  1.00 150.22 ? 993  GLN A CB  1 
ATOM 7692 C CG  . GLN A 1 996  ? 26.617  21.371 19.204  1.00 150.22 ? 993  GLN A CG  1 
ATOM 7693 C CD  . GLN A 1 996  ? 26.000  19.986 19.132  1.00 150.22 ? 993  GLN A CD  1 
ATOM 7694 O OE1 . GLN A 1 996  ? 25.372  19.626 18.135  1.00 150.22 ? 993  GLN A OE1 1 
ATOM 7695 N NE2 . GLN A 1 996  ? 26.181  19.199 20.191  1.00 150.22 ? 993  GLN A NE2 1 
ATOM 7696 N N   . GLU A 1 997  ? 24.882  25.130 20.668  1.00 74.52  ? 994  GLU A N   1 
ATOM 7697 C CA  . GLU A 1 997  ? 24.475  26.530 20.630  1.00 74.52  ? 994  GLU A CA  1 
ATOM 7698 C C   . GLU A 1 997  ? 24.760  27.161 19.258  1.00 74.52  ? 994  GLU A C   1 
ATOM 7699 O O   . GLU A 1 997  ? 25.822  27.710 19.020  1.00 74.52  ? 994  GLU A O   1 
ATOM 7700 C CB  . GLU A 1 997  ? 25.133  27.314 21.778  1.00 66.16  ? 994  GLU A CB  1 
ATOM 7701 C CG  . GLU A 1 997  ? 24.987  26.640 23.156  1.00 66.16  ? 994  GLU A CG  1 
ATOM 7702 C CD  . GLU A 1 997  ? 24.885  27.610 24.344  1.00 66.16  ? 994  GLU A CD  1 
ATOM 7703 O OE1 . GLU A 1 997  ? 25.559  28.670 24.325  1.00 66.16  ? 994  GLU A OE1 1 
ATOM 7704 O OE2 . GLU A 1 997  ? 24.146  27.288 25.311  1.00 66.16  ? 994  GLU A OE2 1 
ATOM 7705 N N   . VAL A 1 998  ? 23.796  27.090 18.358  1.00 54.19  ? 995  VAL A N   1 
ATOM 7706 C CA  . VAL A 1 998  ? 24.024  27.478 16.972  1.00 54.19  ? 995  VAL A CA  1 
ATOM 7707 C C   . VAL A 1 998  ? 23.769  28.950 16.689  1.00 54.19  ? 995  VAL A C   1 
ATOM 7708 O O   . VAL A 1 998  ? 23.955  29.400 15.575  1.00 54.19  ? 995  VAL A O   1 
ATOM 7709 C CB  . VAL A 1 998  ? 23.216  26.587 15.948  1.00 42.48  ? 995  VAL A CB  1 
ATOM 7710 C CG1 . VAL A 1 998  ? 23.288  25.108 16.306  1.00 42.48  ? 995  VAL A CG1 1 
ATOM 7711 C CG2 . VAL A 1 998  ? 21.791  26.973 15.914  1.00 42.48  ? 995  VAL A CG2 1 
ATOM 7712 N N   . GLY A 1 999  ? 23.321  29.694 17.686  1.00 54.03  ? 996  GLY A N   1 
ATOM 7713 C CA  . GLY A 1 999  ? 23.152  31.151 17.552  1.00 54.03  ? 996  GLY A CA  1 
ATOM 7714 C C   . GLY A 1 999  ? 23.522  31.823 18.860  1.00 54.03  ? 996  GLY A C   1 
ATOM 7715 O O   . GLY A 1 999  ? 23.166  31.340 19.922  1.00 54.03  ? 996  GLY A O   1 
ATOM 7716 N N   . LEU A 1 1000 ? 24.273  32.907 18.812  1.00 55.99  ? 997  LEU A N   1 
ATOM 7717 C CA  . LEU A 1 1000 ? 24.528  33.622 20.049  1.00 55.99  ? 997  LEU A CA  1 
ATOM 7718 C C   . LEU A 1 1000 ? 24.431  35.091 19.731  1.00 55.99  ? 997  LEU A C   1 
ATOM 7719 O O   . LEU A 1 1000 ? 24.698  35.478 18.588  1.00 55.99  ? 997  LEU A O   1 
ATOM 7720 C CB  . LEU A 1 1000 ? 25.906  33.290 20.632  1.00 38.85  ? 997  LEU A CB  1 
ATOM 7721 C CG  . LEU A 1 1000 ? 26.456  31.856 20.625  1.00 38.85  ? 997  LEU A CG  1 
ATOM 7722 C CD1 . LEU A 1 1000 ? 27.926  31.825 20.928  1.00 38.85  ? 997  LEU A CD1 1 
ATOM 7723 C CD2 . LEU A 1 1000 ? 25.759  31.052 21.671  1.00 38.85  ? 997  LEU A CD2 1 
ATOM 7724 N N   . PHE A 1 1001 ? 24.075  35.889 20.745  1.00 56.29  ? 998  PHE A N   1 
ATOM 7725 C CA  . PHE A 1 1001 ? 23.752  37.302 20.586  1.00 56.29  ? 998  PHE A CA  1 
ATOM 7726 C C   . PHE A 1 1001 ? 23.586  38.065 21.918  1.00 56.29  ? 998  PHE A C   1 
ATOM 7727 O O   . PHE A 1 1001 ? 22.938  37.606 22.855  1.00 56.29  ? 998  PHE A O   1 
ATOM 7728 C CB  . PHE A 1 1001 ? 22.473  37.392 19.800  1.00 54.45  ? 998  PHE A CB  1 
ATOM 7729 C CG  . PHE A 1 1001 ? 22.215  38.735 19.215  1.00 54.45  ? 998  PHE A CG  1 
ATOM 7730 C CD1 . PHE A 1 1001 ? 22.776  39.092 17.995  1.00 54.45  ? 998  PHE A CD1 1 
ATOM 7731 C CD2 . PHE A 1 1001 ? 21.379  39.644 19.868  1.00 54.45  ? 998  PHE A CD2 1 
ATOM 7732 C CE1 . PHE A 1 1001 ? 22.510  40.334 17.441  1.00 54.45  ? 998  PHE A CE1 1 
ATOM 7733 C CE2 . PHE A 1 1001 ? 21.118  40.881 19.336  1.00 54.45  ? 998  PHE A CE2 1 
ATOM 7734 C CZ  . PHE A 1 1001 ? 21.676  41.232 18.123  1.00 54.45  ? 998  PHE A CZ  1 
ATOM 7735 N N   . HIS A 1 1002 ? 24.157  39.252 22.009  1.00 41.19  ? 999  HIS A N   1 
ATOM 7736 C CA  . HIS A 1 1002 ? 23.978  40.040 23.214  1.00 41.19  ? 999  HIS A CA  1 
ATOM 7737 C C   . HIS A 1 1002 ? 22.936  41.106 22.935  1.00 41.19  ? 999  HIS A C   1 
ATOM 7738 O O   . HIS A 1 1002 ? 23.096  41.977 22.061  1.00 41.19  ? 999  HIS A O   1 
ATOM 7739 C CB  . HIS A 1 1002 ? 25.284  40.664 23.641  1.00 54.02  ? 999  HIS A CB  1 
ATOM 7740 C CG  . HIS A 1 1002 ? 25.228  41.339 24.967  1.00 54.02  ? 999  HIS A CG  1 
ATOM 7741 N ND1 . HIS A 1 1002 ? 25.514  40.685 26.143  1.00 54.02  ? 999  HIS A ND1 1 
ATOM 7742 C CD2 . HIS A 1 1002 ? 24.965  42.621 25.303  1.00 54.02  ? 999  HIS A CD2 1 
ATOM 7743 C CE1 . HIS A 1 1002 ? 25.423  41.536 27.148  1.00 54.02  ? 999  HIS A CE1 1 
ATOM 7744 N NE2 . HIS A 1 1002 ? 25.105  42.722 26.664  1.00 54.02  ? 999  HIS A NE2 1 
ATOM 7745 N N   . LEU A 1 1003 ? 21.840  41.012 23.675  1.00 59.48  ? 1000 LEU A N   1 
ATOM 7746 C CA  . LEU A 1 1003 ? 20.690  41.880 23.471  1.00 59.48  ? 1000 LEU A CA  1 
ATOM 7747 C C   . LEU A 1 1003 ? 20.920  43.141 24.261  1.00 59.48  ? 1000 LEU A C   1 
ATOM 7748 O O   . LEU A 1 1003 ? 20.754  44.231 23.756  1.00 59.48  ? 1000 LEU A O   1 
ATOM 7749 C CB  . LEU A 1 1003 ? 19.432  41.184 23.975  1.00 37.68  ? 1000 LEU A CB  1 
ATOM 7750 C CG  . LEU A 1 1003 ? 18.068  41.178 23.281  1.00 37.68  ? 1000 LEU A CG  1 
ATOM 7751 C CD1 . LEU A 1 1003 ? 17.050  41.103 24.437  1.00 37.68  ? 1000 LEU A CD1 1 
ATOM 7752 C CD2 . LEU A 1 1003 ? 17.782  42.364 22.369  1.00 37.68  ? 1000 LEU A CD2 1 
ATOM 7753 N N   . GLY A 1 1004 ? 21.332  42.983 25.502  1.00 46.79  ? 1001 GLY A N   1 
ATOM 7754 C CA  . GLY A 1 1004 ? 21.639  44.127 26.302  1.00 46.79  ? 1001 GLY A CA  1 
ATOM 7755 C C   . GLY A 1 1004 ? 20.398  44.446 27.065  1.00 46.79  ? 1001 GLY A C   1 
ATOM 7756 O O   . GLY A 1 1004 ? 20.210  45.560 27.548  1.00 46.79  ? 1001 GLY A O   1 
ATOM 7757 N N   . GLU A 1 1005 ? 19.548  43.437 27.169  1.00 48.68  ? 1002 GLU A N   1 
ATOM 7758 C CA  . GLU A 1 1005 ? 18.282  43.555 27.847  1.00 48.68  ? 1002 GLU A CA  1 
ATOM 7759 C C   . GLU A 1 1005 ? 17.997  42.279 28.601  1.00 48.68  ? 1002 GLU A C   1 
ATOM 7760 O O   . GLU A 1 1005 ? 18.425  41.233 28.200  1.00 48.68  ? 1002 GLU A O   1 
ATOM 7761 C CB  . GLU A 1 1005 ? 17.178  43.806 26.827  1.00 50.52  ? 1002 GLU A CB  1 
ATOM 7762 C CG  . GLU A 1 1005 ? 17.045  45.243 26.339  1.00 50.52  ? 1002 GLU A CG  1 
ATOM 7763 C CD  . GLU A 1 1005 ? 16.652  46.224 27.433  1.00 50.52  ? 1002 GLU A CD  1 
ATOM 7764 O OE1 . GLU A 1 1005 ? 16.781  47.434 27.158  1.00 50.52  ? 1002 GLU A OE1 1 
ATOM 7765 O OE2 . GLU A 1 1005 ? 16.220  45.810 28.554  1.00 50.52  ? 1002 GLU A OE2 1 
ATOM 7766 N N   . PHE A 1 1006 ? 17.267  42.374 29.699  1.00 39.08  ? 1003 PHE A N   1 
ATOM 7767 C CA  . PHE A 1 1006 ? 16.879  41.204 30.466  1.00 39.08  ? 1003 PHE A CA  1 
ATOM 7768 C C   . PHE A 1 1006 ? 15.506  40.791 30.052  1.00 39.08  ? 1003 PHE A C   1 
ATOM 7769 O O   . PHE A 1 1006 ? 14.570  41.525 30.240  1.00 39.08  ? 1003 PHE A O   1 
ATOM 7770 C CB  . PHE A 1 1006 ? 16.821  41.540 31.942  1.00 38.03  ? 1003 PHE A CB  1 
ATOM 7771 C CG  . PHE A 1 1006 ? 16.621  40.351 32.815  1.00 38.03  ? 1003 PHE A CG  1 
ATOM 7772 C CD1 . PHE A 1 1006 ? 17.686  39.768 33.457  1.00 38.03  ? 1003 PHE A CD1 1 
ATOM 7773 C CD2 . PHE A 1 1006 ? 15.384  39.801 32.991  1.00 38.03  ? 1003 PHE A CD2 1 
ATOM 7774 C CE1 . PHE A 1 1006 ? 17.502  38.671 34.287  1.00 38.03  ? 1003 PHE A CE1 1 
ATOM 7775 C CE2 . PHE A 1 1006 ? 15.208  38.692 33.810  1.00 38.03  ? 1003 PHE A CE2 1 
ATOM 7776 C CZ  . PHE A 1 1006 ? 16.255  38.135 34.457  1.00 38.03  ? 1003 PHE A CZ  1 
ATOM 7777 N N   . VAL A 1 1007 ? 15.352  39.605 29.525  1.00 40.19  ? 1004 VAL A N   1 
ATOM 7778 C CA  . VAL A 1 1007 ? 14.062  39.217 29.004  1.00 40.19  ? 1004 VAL A CA  1 
ATOM 7779 C C   . VAL A 1 1007 ? 13.235  38.441 30.055  1.00 40.19  ? 1004 VAL A C   1 
ATOM 7780 O O   . VAL A 1 1007 ? 13.732  37.479 30.631  1.00 40.19  ? 1004 VAL A O   1 
ATOM 7781 C CB  . VAL A 1 1007 ? 14.310  38.460 27.696  1.00 31.30  ? 1004 VAL A CB  1 
ATOM 7782 C CG1 . VAL A 1 1007 ? 13.114  37.732 27.232  1.00 31.30  ? 1004 VAL A CG1 1 
ATOM 7783 C CG2 . VAL A 1 1007 ? 14.719  39.433 26.665  1.00 31.30  ? 1004 VAL A CG2 1 
ATOM 7784 N N   . ASN A 1 1008 ? 12.007  38.881 30.341  1.00 36.66  ? 1005 ASN A N   1 
ATOM 7785 C CA  . ASN A 1 1008 ? 11.091  38.092 31.179  1.00 36.66  ? 1005 ASN A CA  1 
ATOM 7786 C C   . ASN A 1 1008 ? 10.179  37.173 30.393  1.00 36.66  ? 1005 ASN A C   1 
ATOM 7787 O O   . ASN A 1 1008 ? 9.705   36.191 30.943  1.00 36.66  ? 1005 ASN A O   1 
ATOM 7788 C CB  . ASN A 1 1008 ? 10.150  38.941 31.990  1.00 34.91  ? 1005 ASN A CB  1 
ATOM 7789 C CG  . ASN A 1 1008 ? 10.841  39.820 32.973  1.00 34.91  ? 1005 ASN A CG  1 
ATOM 7790 O OD1 . ASN A 1 1008 ? 11.715  39.371 33.711  1.00 34.91  ? 1005 ASN A OD1 1 
ATOM 7791 N ND2 . ASN A 1 1008 ? 10.394  41.095 33.052  1.00 34.91  ? 1005 ASN A ND2 1 
ATOM 7792 N N   . VAL A 1 1009 ? 9.885   37.483 29.133  1.00 37.81  ? 1006 VAL A N   1 
ATOM 7793 C CA  . VAL A 1 1009 ? 8.855   36.699 28.431  1.00 37.81  ? 1006 VAL A CA  1 
ATOM 7794 C C   . VAL A 1 1009 ? 9.027   36.614 26.924  1.00 37.81  ? 1006 VAL A C   1 
ATOM 7795 O O   . VAL A 1 1009 ? 9.273   37.614 26.248  1.00 37.81  ? 1006 VAL A O   1 
ATOM 7796 C CB  . VAL A 1 1009 ? 7.396   37.201 28.784  1.00 38.22  ? 1006 VAL A CB  1 
ATOM 7797 C CG1 . VAL A 1 1009 ? 7.370   38.703 29.050  1.00 38.22  ? 1006 VAL A CG1 1 
ATOM 7798 C CG2 . VAL A 1 1009 ? 6.391   36.864 27.705  1.00 38.22  ? 1006 VAL A CG2 1 
ATOM 7799 N N   . PHE A 1 1010 ? 8.872   35.416 26.401  1.00 48.33  ? 1007 PHE A N   1 
ATOM 7800 C CA  . PHE A 1 1010 ? 8.702   35.274 24.970  1.00 48.33  ? 1007 PHE A CA  1 
ATOM 7801 C C   . PHE A 1 1010 ? 7.268   34.925 24.675  1.00 48.33  ? 1007 PHE A C   1 
ATOM 7802 O O   . PHE A 1 1010 ? 6.622   34.274 25.462  1.00 48.33  ? 1007 PHE A O   1 
ATOM 7803 C CB  . PHE A 1 1010 ? 9.545   34.105 24.438  1.00 37.58  ? 1007 PHE A CB  1 
ATOM 7804 C CG  . PHE A 1 1010 ? 11.025  34.348 24.446  1.00 37.58  ? 1007 PHE A CG  1 
ATOM 7805 C CD1 . PHE A 1 1010 ? 11.848  33.617 25.277  1.00 37.58  ? 1007 PHE A CD1 1 
ATOM 7806 C CD2 . PHE A 1 1010 ? 11.599  35.296 23.597  1.00 37.58  ? 1007 PHE A CD2 1 
ATOM 7807 C CE1 . PHE A 1 1010 ? 13.219  33.828 25.259  1.00 37.58  ? 1007 PHE A CE1 1 
ATOM 7808 C CE2 . PHE A 1 1010 ? 12.953  35.503 23.590  1.00 37.58  ? 1007 PHE A CE2 1 
ATOM 7809 C CZ  . PHE A 1 1010 ? 13.763  34.765 24.412  1.00 37.58  ? 1007 PHE A CZ  1 
ATOM 7810 N N   . CYS A 1 1011 ? 6.776   35.306 23.519  1.00 59.41  ? 1008 CYS A N   1 
ATOM 7811 C CA  . CYS A 1 1011 ? 5.588   34.659 23.038  1.00 59.41  ? 1008 CYS A CA  1 
ATOM 7812 C C   . CYS A 1 1011 ? 5.402   34.865 21.563  1.00 59.41  ? 1008 CYS A C   1 
ATOM 7813 O O   . CYS A 1 1011 ? 5.749   35.901 21.009  1.00 59.41  ? 1008 CYS A O   1 
ATOM 7814 C CB  . CYS A 1 1011 ? 4.374   35.165 23.777  1.00 65.73  ? 1008 CYS A CB  1 
ATOM 7815 S SG  . CYS A 1 1011 ? 3.844   36.694 23.142  1.00 65.73  ? 1008 CYS A SG  1 
ATOM 7816 N N   . HIS A 1 1012 ? 4.858   33.840 20.928  1.00 61.33  ? 1009 HIS A N   1 
ATOM 7817 C CA  . HIS A 1 1012 ? 4.467   33.924 19.534  1.00 61.33  ? 1009 HIS A CA  1 
ATOM 7818 C C   . HIS A 1 1012 ? 3.317   34.883 19.455  1.00 61.33  ? 1009 HIS A C   1 
ATOM 7819 O O   . HIS A 1 1012 ? 2.443   34.899 20.319  1.00 61.33  ? 1009 HIS A O   1 
ATOM 7820 C CB  . HIS A 1 1012 ? 4.085   32.547 19.012  1.00 54.35  ? 1009 HIS A CB  1 
ATOM 7821 C CG  . HIS A 1 1012 ? 5.141   31.528 19.266  1.00 54.35  ? 1009 HIS A CG  1 
ATOM 7822 N ND1 . HIS A 1 1012 ? 5.951   31.039 18.267  1.00 54.35  ? 1009 HIS A ND1 1 
ATOM 7823 C CD2 . HIS A 1 1012 ? 5.580   30.969 20.421  1.00 54.35  ? 1009 HIS A CD2 1 
ATOM 7824 C CE1 . HIS A 1 1012 ? 6.818   30.186 18.789  1.00 54.35  ? 1009 HIS A CE1 1 
ATOM 7825 N NE2 . HIS A 1 1012 ? 6.615   30.127 20.095  1.00 54.35  ? 1009 HIS A NE2 1 
ATOM 7826 N N   . GLY A 1 1013 ? 3.350   35.714 18.436  1.00 45.59  ? 1010 GLY A N   1 
ATOM 7827 C CA  . GLY A 1 1013 ? 2.401   36.803 18.310  1.00 45.59  ? 1010 GLY A CA  1 
ATOM 7828 C C   . GLY A 1 1013 ? 2.962   37.759 17.277  1.00 45.59  ? 1010 GLY A C   1 
ATOM 7829 O O   . GLY A 1 1013 ? 4.054   37.528 16.747  1.00 45.59  ? 1010 GLY A O   1 
ATOM 7830 N N   . SER A 1 1014 ? 2.201   38.807 16.971  1.00 65.48  ? 1011 SER A N   1 
ATOM 7831 C CA  . SER A 1 1014 ? 2.641   39.885 16.103  1.00 65.48  ? 1011 SER A CA  1 
ATOM 7832 C C   . SER A 1 1014 ? 1.657   41.013 16.228  1.00 65.48  ? 1011 SER A C   1 
ATOM 7833 O O   . SER A 1 1014 ? 0.509   40.799 16.599  1.00 65.48  ? 1011 SER A O   1 
ATOM 7834 C CB  . SER A 1 1014 ? 2.706   39.455 14.649  1.00 54.13  ? 1011 SER A CB  1 
ATOM 7835 O OG  . SER A 1 1014 ? 2.602   40.605 13.834  1.00 54.13  ? 1011 SER A OG  1 
ATOM 7836 N N   . LEU A 1 1015 ? 2.098   42.213 15.900  1.00 49.76  ? 1012 LEU A N   1 
ATOM 7837 C CA  . LEU A 1 1015 ? 1.256   43.359 16.069  1.00 49.76  ? 1012 LEU A CA  1 
ATOM 7838 C C   . LEU A 1 1015 ? 0.672   43.862 14.756  1.00 49.76  ? 1012 LEU A C   1 
ATOM 7839 O O   . LEU A 1 1015 ? -0.110  44.819 14.747  1.00 49.76  ? 1012 LEU A O   1 
ATOM 7840 C CB  . LEU A 1 1015 ? 2.005   44.477 16.785  1.00 78.17  ? 1012 LEU A CB  1 
ATOM 7841 C CG  . LEU A 1 1015 ? 2.570   44.172 18.171  1.00 78.17  ? 1012 LEU A CG  1 
ATOM 7842 C CD1 . LEU A 1 1015 ? 2.857   45.477 18.876  1.00 78.17  ? 1012 LEU A CD1 1 
ATOM 7843 C CD2 . LEU A 1 1015 ? 1.642   43.327 19.011  1.00 78.17  ? 1012 LEU A CD2 1 
ATOM 7844 N N   . VAL A 1 1016 ? 0.997   43.215 13.650  1.00 77.58  ? 1013 VAL A N   1 
ATOM 7845 C CA  . VAL A 1 1016 ? 0.638   43.810 12.385  1.00 77.58  ? 1013 VAL A CA  1 
ATOM 7846 C C   . VAL A 1 1016 ? -0.240  42.947 11.503  1.00 77.58  ? 1013 VAL A C   1 
ATOM 7847 O O   . VAL A 1 1016 ? -0.933  42.066 11.992  1.00 77.58  ? 1013 VAL A O   1 
ATOM 7848 C CB  . VAL A 1 1016 ? 1.889   44.255 11.639  1.00 73.74  ? 1013 VAL A CB  1 
ATOM 7849 C CG1 . VAL A 1 1016 ? 2.285   45.657 12.092  1.00 73.74  ? 1013 VAL A CG1 1 
ATOM 7850 C CG2 . VAL A 1 1016 ? 3.018   43.249 11.852  1.00 73.74  ? 1013 VAL A CG2 1 
ATOM 7851 N N   . MET A 1 1017 ? -0.197  43.217 10.199  1.00 96.01  ? 1014 MET A N   1 
ATOM 7852 C CA  . MET A 1 1017 ? -0.992  42.526 9.180   1.00 96.01  ? 1014 MET A CA  1 
ATOM 7853 C C   . MET A 1 1017 ? -2.471  42.788 9.415   1.00 96.01  ? 1014 MET A C   1 
ATOM 7854 O O   . MET A 1 1017 ? -2.829  43.581 10.295  1.00 96.01  ? 1014 MET A O   1 
ATOM 7855 C CB  . MET A 1 1017 ? -0.627  41.032 9.055   1.00 128.24 ? 1014 MET A CB  1 
ATOM 7856 C CG  . MET A 1 1017 ? -1.373  40.067 9.956   1.00 128.24 ? 1014 MET A CG  1 
ATOM 7857 S SD  . MET A 1 1017 ? -2.662  39.253 9.022   1.00 128.24 ? 1014 MET A SD  1 
ATOM 7858 C CE  . MET A 1 1017 ? -3.302  38.100 10.240  1.00 128.24 ? 1014 MET A CE  1 
ATOM 7859 N N   . GLN A 1 1018 ? -3.311  42.127 8.618   1.00 98.71  ? 1015 GLN A N   1 
ATOM 7860 C CA  . GLN A 1 1018 ? -4.745  42.446 8.492   1.00 98.71  ? 1015 GLN A CA  1 
ATOM 7861 C C   . GLN A 1 1018 ? -5.402  42.870 9.803   1.00 98.71  ? 1015 GLN A C   1 
ATOM 7862 O O   . GLN A 1 1018 ? -6.353  43.652 9.795   1.00 98.71  ? 1015 GLN A O   1 
ATOM 7863 C CB  . GLN A 1 1018 ? -5.541  41.276 7.871   1.00 160.73 ? 1015 GLN A CB  1 
ATOM 7864 C CG  . GLN A 1 1018 ? -4.757  40.281 6.971   1.00 160.73 ? 1015 GLN A CG  1 
ATOM 7865 C CD  . GLN A 1 1018 ? -3.903  40.934 5.876   1.00 160.73 ? 1015 GLN A CD  1 
ATOM 7866 O OE1 . GLN A 1 1018 ? -4.296  41.943 5.265   1.00 160.73 ? 1015 GLN A OE1 1 
ATOM 7867 N NE2 . GLN A 1 1018 ? -2.724  40.346 5.619   1.00 160.73 ? 1015 GLN A NE2 1 
ATOM 7868 N N   . PRO A 1 1026 ? 10.052  36.289 2.853   1.00 102.86 ? 1023 PRO A N   1 
ATOM 7869 C CA  . PRO A 1 1026 ? 11.180  37.053 3.414   1.00 102.86 ? 1023 PRO A CA  1 
ATOM 7870 C C   . PRO A 1 1026 ? 11.649  36.477 4.746   1.00 102.86 ? 1023 PRO A C   1 
ATOM 7871 O O   . PRO A 1 1026 ? 12.846  36.215 4.921   1.00 102.86 ? 1023 PRO A O   1 
ATOM 7872 C CB  . PRO A 1 1026 ? 10.603  38.467 3.627   1.00 66.86  ? 1023 PRO A CB  1 
ATOM 7873 C CG  . PRO A 1 1026 ? 9.077   38.304 3.523   1.00 66.86  ? 1023 PRO A CG  1 
ATOM 7874 C CD  . PRO A 1 1026 ? 8.882   37.145 2.561   1.00 66.86  ? 1023 PRO A CD  1 
ATOM 7875 N N   . THR A 1 1027 ? 10.698  36.298 5.667   1.00 76.59  ? 1024 THR A N   1 
ATOM 7876 C CA  . THR A 1 1027 ? 10.944  35.769 7.024   1.00 76.59  ? 1024 THR A CA  1 
ATOM 7877 C C   . THR A 1 1027 ? 9.760   34.907 7.499   1.00 76.59  ? 1024 THR A C   1 
ATOM 7878 O O   . THR A 1 1027 ? 8.598   35.206 7.191   1.00 76.59  ? 1024 THR A O   1 
ATOM 7879 C CB  . THR A 1 1027 ? 11.195  36.897 8.076   1.00 97.53  ? 1024 THR A CB  1 
ATOM 7880 O OG1 . THR A 1 1027 ? 10.063  37.771 8.144   1.00 97.53  ? 1024 THR A OG1 1 
ATOM 7881 C CG2 . THR A 1 1027 ? 12.440  37.708 7.757   1.00 97.53  ? 1024 THR A CG2 1 
ATOM 7882 N N   . GLN A 1 1028 ? 10.066  33.847 8.243   1.00 66.86  ? 1025 GLN A N   1 
ATOM 7883 C CA  . GLN A 1 1028 ? 9.063   32.924 8.764   1.00 66.86  ? 1025 GLN A CA  1 
ATOM 7884 C C   . GLN A 1 1028 ? 9.002   33.043 10.292  1.00 66.86  ? 1025 GLN A C   1 
ATOM 7885 O O   . GLN A 1 1028 ? 9.972   33.463 10.913  1.00 66.86  ? 1025 GLN A O   1 
ATOM 7886 C CB  . GLN A 1 1028 ? 9.413   31.492 8.345   1.00 206.51 ? 1025 GLN A CB  1 
ATOM 7887 C CG  . GLN A 1 1028 ? 8.221   30.548 8.241   1.00 206.51 ? 1025 GLN A CG  1 
ATOM 7888 C CD  . GLN A 1 1028 ? 8.586   29.198 7.640   1.00 206.51 ? 1025 GLN A CD  1 
ATOM 7889 O OE1 . GLN A 1 1028 ? 9.592   28.587 8.010   1.00 206.51 ? 1025 GLN A OE1 1 
ATOM 7890 N NE2 . GLN A 1 1028 ? 7.760   28.723 6.713   1.00 206.51 ? 1025 GLN A NE2 1 
ATOM 7891 N N   . GLY A 1 1029 ? 7.876   32.679 10.905  1.00 74.40  ? 1026 GLY A N   1 
ATOM 7892 C CA  . GLY A 1 1029 ? 7.714   32.810 12.363  1.00 74.40  ? 1026 GLY A CA  1 
ATOM 7893 C C   . GLY A 1 1029 ? 7.747   34.245 12.892  1.00 74.40  ? 1026 GLY A C   1 
ATOM 7894 O O   . GLY A 1 1029 ? 8.149   35.185 12.185  1.00 74.40  ? 1026 GLY A O   1 
ATOM 7895 N N   . SER A 1 1030 ? 7.312   34.413 14.142  1.00 55.36  ? 1027 SER A N   1 
ATOM 7896 C CA  . SER A 1 1030 ? 7.370   35.714 14.835  1.00 55.36  ? 1027 SER A CA  1 
ATOM 7897 C C   . SER A 1 1030 ? 7.117   35.589 16.341  1.00 55.36  ? 1027 SER A C   1 
ATOM 7898 O O   . SER A 1 1030 ? 5.988   35.345 16.762  1.00 55.36  ? 1027 SER A O   1 
ATOM 7899 C CB  . SER A 1 1030 ? 6.389   36.710 14.206  1.00 58.68  ? 1027 SER A CB  1 
ATOM 7900 O OG  . SER A 1 1030 ? 6.282   37.888 14.981  1.00 58.68  ? 1027 SER A OG  1 
ATOM 7901 N N   . VAL A 1 1031 ? 8.176   35.753 17.132  1.00 52.55  ? 1028 VAL A N   1 
ATOM 7902 C CA  . VAL A 1 1031 ? 8.116   35.657 18.589  1.00 52.55  ? 1028 VAL A CA  1 
ATOM 7903 C C   . VAL A 1 1031 ? 8.425   37.009 19.158  1.00 52.55  ? 1028 VAL A C   1 
ATOM 7904 O O   . VAL A 1 1031 ? 9.364   37.643 18.725  1.00 52.55  ? 1028 VAL A O   1 
ATOM 7905 C CB  . VAL A 1 1031 ? 9.180   34.723 19.091  1.00 33.15  ? 1028 VAL A CB  1 
ATOM 7906 C CG1 . VAL A 1 1031 ? 9.311   34.802 20.609  1.00 33.15  ? 1028 VAL A CG1 1 
ATOM 7907 C CG2 . VAL A 1 1031 ? 8.855   33.304 18.635  1.00 33.15  ? 1028 VAL A CG2 1 
ATOM 7908 N N   . LEU A 1 1032 ? 7.651   37.454 20.128  1.00 57.39  ? 1029 LEU A N   1 
ATOM 7909 C CA  . LEU A 1 1032 ? 7.869   38.762 20.691  1.00 57.39  ? 1029 LEU A CA  1 
ATOM 7910 C C   . LEU A 1 1032 ? 8.475   38.584 22.056  1.00 57.39  ? 1029 LEU A C   1 
ATOM 7911 O O   . LEU A 1 1032 ? 8.346   37.524 22.658  1.00 57.39  ? 1029 LEU A O   1 
ATOM 7912 C CB  . LEU A 1 1032 ? 6.536   39.488 20.804  1.00 43.21  ? 1029 LEU A CB  1 
ATOM 7913 C CG  . LEU A 1 1032 ? 6.015   40.195 19.548  1.00 43.21  ? 1029 LEU A CG  1 
ATOM 7914 C CD1 . LEU A 1 1032 ? 4.602   39.773 19.147  1.00 43.21  ? 1029 LEU A CD1 1 
ATOM 7915 C CD2 . LEU A 1 1032 ? 6.086   41.694 19.772  1.00 43.21  ? 1029 LEU A CD2 1 
ATOM 7916 N N   . PHE A 1 1033 ? 9.137   39.610 22.565  1.00 45.98  ? 1030 PHE A N   1 
ATOM 7917 C CA  . PHE A 1 1033 ? 9.648   39.498 23.917  1.00 45.98  ? 1030 PHE A CA  1 
ATOM 7918 C C   . PHE A 1 1033 ? 9.595   40.763 24.720  1.00 45.98  ? 1030 PHE A C   1 
ATOM 7919 O O   . PHE A 1 1033 ? 9.497   41.865 24.167  1.00 45.98  ? 1030 PHE A O   1 
ATOM 7920 C CB  . PHE A 1 1033 ? 11.050  38.900 23.946  1.00 38.26  ? 1030 PHE A CB  1 
ATOM 7921 C CG  . PHE A 1 1033 ? 12.063  39.675 23.178  1.00 38.26  ? 1030 PHE A CG  1 
ATOM 7922 C CD1 . PHE A 1 1033 ? 12.785  40.681 23.792  1.00 38.26  ? 1030 PHE A CD1 1 
ATOM 7923 C CD2 . PHE A 1 1033 ? 12.311  39.369 21.828  1.00 38.26  ? 1030 PHE A CD2 1 
ATOM 7924 C CE1 . PHE A 1 1033 ? 13.730  41.392 23.067  1.00 38.26  ? 1030 PHE A CE1 1 
ATOM 7925 C CE2 . PHE A 1 1033 ? 13.250  40.058 21.091  1.00 38.26  ? 1030 PHE A CE2 1 
ATOM 7926 C CZ  . PHE A 1 1033 ? 13.970  41.077 21.711  1.00 38.26  ? 1030 PHE A CZ  1 
ATOM 7927 N N   . GLY A 1 1034 ? 9.644   40.599 26.036  1.00 42.69  ? 1031 GLY A N   1 
ATOM 7928 C CA  . GLY A 1 1034 ? 9.446   41.726 26.907  1.00 42.69  ? 1031 GLY A CA  1 
ATOM 7929 C C   . GLY A 1 1034 ? 10.499  41.736 27.967  1.00 42.69  ? 1031 GLY A C   1 
ATOM 7930 O O   . GLY A 1 1034 ? 10.878  40.677 28.481  1.00 42.69  ? 1031 GLY A O   1 
ATOM 7931 N N   . THR A 1 1035 ? 10.942  42.941 28.302  1.00 35.87  ? 1032 THR A N   1 
ATOM 7932 C CA  . THR A 1 1035 ? 12.150  43.111 29.061  1.00 35.87  ? 1032 THR A CA  1 
ATOM 7933 C C   . THR A 1 1035 ? 11.982  43.991 30.301  1.00 35.87  ? 1032 THR A C   1 
ATOM 7934 O O   . THR A 1 1035 ? 11.132  44.887 30.365  1.00 35.87  ? 1032 THR A O   1 
ATOM 7935 C CB  . THR A 1 1035 ? 13.223  43.766 28.182  1.00 42.44  ? 1032 THR A CB  1 
ATOM 7936 O OG1 . THR A 1 1035 ? 12.802  45.091 27.854  1.00 42.44  ? 1032 THR A OG1 1 
ATOM 7937 C CG2 . THR A 1 1035 ? 13.431  42.987 26.890  1.00 42.44  ? 1032 THR A CG2 1 
ATOM 7938 N N   . VAL A 1 1036 ? 12.843  43.787 31.274  1.00 38.84  ? 1033 VAL A N   1 
ATOM 7939 C CA  . VAL A 1 1036 ? 12.848  44.611 32.450  1.00 38.84  ? 1033 VAL A CA  1 
ATOM 7940 C C   . VAL A 1 1036 ? 12.840  46.122 32.146  1.00 38.84  ? 1033 VAL A C   1 
ATOM 7941 O O   . VAL A 1 1036 ? 12.485  46.955 32.976  1.00 38.84  ? 1033 VAL A O   1 
ATOM 7942 C CB  . VAL A 1 1036 ? 14.029  44.174 33.283  1.00 31.31  ? 1033 VAL A CB  1 
ATOM 7943 C CG1 . VAL A 1 1036 ? 14.408  45.181 34.368  1.00 31.31  ? 1033 VAL A CG1 1 
ATOM 7944 C CG2 . VAL A 1 1036 ? 13.746  42.790 33.833  1.00 31.31  ? 1033 VAL A CG2 1 
ATOM 7945 N N   . ASN A 1 1037 ? 13.189  46.485 30.933  1.00 45.60  ? 1034 ASN A N   1 
ATOM 7946 C CA  . ASN A 1 1037 ? 13.518  47.855 30.666  1.00 45.60  ? 1034 ASN A CA  1 
ATOM 7947 C C   . ASN A 1 1037 ? 12.476  48.612 29.877  1.00 45.60  ? 1034 ASN A C   1 
ATOM 7948 O O   . ASN A 1 1037 ? 12.542  49.836 29.743  1.00 45.60  ? 1034 ASN A O   1 
ATOM 7949 C CB  . ASN A 1 1037 ? 14.856  47.885 29.957  1.00 37.25  ? 1034 ASN A CB  1 
ATOM 7950 C CG  . ASN A 1 1037 ? 15.947  48.429 30.821  1.00 37.25  ? 1034 ASN A CG  1 
ATOM 7951 O OD1 . ASN A 1 1037 ? 15.721  48.799 31.983  1.00 37.25  ? 1034 ASN A OD1 1 
ATOM 7952 N ND2 . ASN A 1 1037 ? 17.139  48.532 30.257  1.00 37.25  ? 1034 ASN A ND2 1 
ATOM 7953 N N   . GLY A 1 1038 ? 11.505  47.878 29.361  1.00 53.43  ? 1035 GLY A N   1 
ATOM 7954 C CA  . GLY A 1 1038 ? 10.428  48.489 28.610  1.00 53.43  ? 1035 GLY A CA  1 
ATOM 7955 C C   . GLY A 1 1038 ? 10.519  48.108 27.164  1.00 53.43  ? 1035 GLY A C   1 
ATOM 7956 O O   . GLY A 1 1038 ? 9.638   48.397 26.371  1.00 53.43  ? 1035 GLY A O   1 
ATOM 7957 N N   . MET A 1 1039 ? 11.595  47.425 26.826  1.00 45.96  ? 1036 MET A N   1 
ATOM 7958 C CA  . MET A 1 1039 ? 11.841  47.109 25.456  1.00 45.96  ? 1036 MET A CA  1 
ATOM 7959 C C   . MET A 1 1039 ? 10.951  45.945 25.047  1.00 45.96  ? 1036 MET A C   1 
ATOM 7960 O O   . MET A 1 1039 ? 10.730  44.990 25.811  1.00 45.96  ? 1036 MET A O   1 
ATOM 7961 C CB  . MET A 1 1039 ? 13.333  46.854 25.284  1.00 49.69  ? 1036 MET A CB  1 
ATOM 7962 C CG  . MET A 1 1039 ? 13.827  46.767 23.876  1.00 49.69  ? 1036 MET A CG  1 
ATOM 7963 S SD  . MET A 1 1039 ? 14.084  45.033 23.489  1.00 49.69  ? 1036 MET A SD  1 
ATOM 7964 C CE  . MET A 1 1039 ? 14.938  45.159 21.897  1.00 49.69  ? 1036 MET A CE  1 
ATOM 7965 N N   . ILE A 1 1040 ? 10.384  46.071 23.854  1.00 52.34  ? 1037 ILE A N   1 
ATOM 7966 C CA  . ILE A 1 1040 ? 9.660   44.981 23.195  1.00 52.34  ? 1037 ILE A CA  1 
ATOM 7967 C C   . ILE A 1 1040 ? 10.395  44.753 21.897  1.00 52.34  ? 1037 ILE A C   1 
ATOM 7968 O O   . ILE A 1 1040 ? 10.387  45.626 21.014  1.00 52.34  ? 1037 ILE A O   1 
ATOM 7969 C CB  . ILE A 1 1040 ? 8.199   45.352 22.828  1.00 40.77  ? 1037 ILE A CB  1 
ATOM 7970 C CG1 . ILE A 1 1040 ? 7.370   45.661 24.055  1.00 40.77  ? 1037 ILE A CG1 1 
ATOM 7971 C CG2 . ILE A 1 1040 ? 7.523   44.220 22.141  1.00 40.77  ? 1037 ILE A CG2 1 
ATOM 7972 C CD1 . ILE A 1 1040 ? 6.123   46.336 23.735  1.00 40.77  ? 1037 ILE A CD1 1 
ATOM 7973 N N   . GLY A 1 1041 ? 11.044  43.599 21.800  1.00 76.71  ? 1038 GLY A N   1 
ATOM 7974 C CA  . GLY A 1 1041 ? 11.705  43.191 20.581  1.00 76.71  ? 1038 GLY A CA  1 
ATOM 7975 C C   . GLY A 1 1041 ? 10.924  42.072 19.925  1.00 76.71  ? 1038 GLY A C   1 
ATOM 7976 O O   . GLY A 1 1041 ? 9.847   41.709 20.394  1.00 76.71  ? 1038 GLY A O   1 
ATOM 7977 N N   . LEU A 1 1042 ? 11.490  41.504 18.861  1.00 42.52  ? 1039 LEU A N   1 
ATOM 7978 C CA  . LEU A 1 1042 ? 10.812  40.528 18.019  1.00 42.52  ? 1039 LEU A CA  1 
ATOM 7979 C C   . LEU A 1 1042 ? 11.812  39.573 17.391  1.00 42.52  ? 1039 LEU A C   1 
ATOM 7980 O O   . LEU A 1 1042 ? 12.839  40.015 16.939  1.00 42.52  ? 1039 LEU A O   1 
ATOM 7981 C CB  . LEU A 1 1042 ? 10.102  41.291 16.907  1.00 65.91  ? 1039 LEU A CB  1 
ATOM 7982 C CG  . LEU A 1 1042 ? 9.396   40.521 15.805  1.00 65.91  ? 1039 LEU A CG  1 
ATOM 7983 C CD1 . LEU A 1 1042 ? 8.112   39.927 16.347  1.00 65.91  ? 1039 LEU A CD1 1 
ATOM 7984 C CD2 . LEU A 1 1042 ? 9.104   41.483 14.707  1.00 65.91  ? 1039 LEU A CD2 1 
ATOM 7985 N N   . VAL A 1 1043 ? 11.549  38.278 17.325  1.00 67.29  ? 1040 VAL A N   1 
ATOM 7986 C CA  . VAL A 1 1043 ? 12.532  37.398 16.692  1.00 67.29  ? 1040 VAL A CA  1 
ATOM 7987 C C   . VAL A 1 1043 ? 11.893  36.621 15.575  1.00 67.29  ? 1040 VAL A C   1 
ATOM 7988 O O   . VAL A 1 1043 ? 10.951  35.871 15.802  1.00 67.29  ? 1040 VAL A O   1 
ATOM 7989 C CB  . VAL A 1 1043 ? 13.216  36.412 17.683  1.00 42.30  ? 1040 VAL A CB  1 
ATOM 7990 C CG1 . VAL A 1 1043 ? 14.281  35.642 16.990  1.00 42.30  ? 1040 VAL A CG1 1 
ATOM 7991 C CG2 . VAL A 1 1043 ? 13.828  37.150 18.824  1.00 42.30  ? 1040 VAL A CG2 1 
ATOM 7992 N N   . THR A 1 1044 ? 12.419  36.797 14.372  1.00 74.51  ? 1041 THR A N   1 
ATOM 7993 C CA  . THR A 1 1044 ? 11.947  36.054 13.209  1.00 74.51  ? 1041 THR A CA  1 
ATOM 7994 C C   . THR A 1 1044 ? 13.012  35.059 12.754  1.00 74.51  ? 1041 THR A C   1 
ATOM 7995 O O   . THR A 1 1044 ? 14.192  35.196 13.086  1.00 74.51  ? 1041 THR A O   1 
ATOM 7996 C CB  . THR A 1 1044 ? 11.533  37.012 12.035  1.00 60.52  ? 1041 THR A CB  1 
ATOM 7997 O OG1 . THR A 1 1044 ? 10.555  37.961 12.493  1.00 60.52  ? 1041 THR A OG1 1 
ATOM 7998 C CG2 . THR A 1 1044 ? 10.921  36.236 10.882  1.00 60.52  ? 1041 THR A CG2 1 
ATOM 7999 N N   . SER A 1 1045 ? 12.575  34.048 12.009  1.00 66.45  ? 1042 SER A N   1 
ATOM 8000 C CA  . SER A 1 1045 ? 13.467  33.099 11.354  1.00 66.45  ? 1042 SER A CA  1 
ATOM 8001 C C   . SER A 1 1045 ? 13.823  33.556 9.933   1.00 66.45  ? 1042 SER A C   1 
ATOM 8002 O O   . SER A 1 1045 ? 13.185  34.456 9.384   1.00 66.45  ? 1042 SER A O   1 
ATOM 8003 C CB  . SER A 1 1045 ? 12.831  31.714 11.349  1.00 82.92  ? 1042 SER A CB  1 
ATOM 8004 O OG  . SER A 1 1045 ? 12.674  31.244 12.675  1.00 82.92  ? 1042 SER A OG  1 
ATOM 8005 N N   . LEU A 1 1046 ? 14.851  32.946 9.347   1.00 85.39  ? 1043 LEU A N   1 
ATOM 8006 C CA  . LEU A 1 1046 ? 15.414  33.414 8.083   1.00 85.39  ? 1043 LEU A CA  1 
ATOM 8007 C C   . LEU A 1 1046 ? 15.806  32.260 7.196   1.00 85.39  ? 1043 LEU A C   1 
ATOM 8008 O O   . LEU A 1 1046 ? 15.910  31.127 7.662   1.00 85.39  ? 1043 LEU A O   1 
ATOM 8009 C CB  . LEU A 1 1046 ? 16.676  34.228 8.343   1.00 48.16  ? 1043 LEU A CB  1 
ATOM 8010 C CG  . LEU A 1 1046 ? 16.677  35.698 8.764   1.00 48.16  ? 1043 LEU A CG  1 
ATOM 8011 C CD1 . LEU A 1 1046 ? 18.099  36.095 9.200   1.00 48.16  ? 1043 LEU A CD1 1 
ATOM 8012 C CD2 . LEU A 1 1046 ? 16.169  36.625 7.671   1.00 48.16  ? 1043 LEU A CD2 1 
ATOM 8013 N N   . SER A 1 1047 ? 16.052  32.570 5.921   1.00 83.30  ? 1044 SER A N   1 
ATOM 8014 C CA  . SER A 1 1047 ? 16.615  31.622 4.952   1.00 83.30  ? 1044 SER A CA  1 
ATOM 8015 C C   . SER A 1 1047 ? 18.107  31.891 4.742   1.00 83.30  ? 1044 SER A C   1 
ATOM 8016 O O   . SER A 1 1047 ? 18.494  33.030 4.443   1.00 83.30  ? 1044 SER A O   1 
ATOM 8017 C CB  . SER A 1 1047 ? 15.882  31.736 3.616   1.00 96.84  ? 1044 SER A CB  1 
ATOM 8018 O OG  . SER A 1 1047 ? 16.085  33.012 3.044   1.00 96.84  ? 1044 SER A OG  1 
ATOM 8019 N N   . GLU A 1 1048 ? 18.931  30.844 4.894   1.00 69.01  ? 1045 GLU A N   1 
ATOM 8020 C CA  . GLU A 1 1048 ? 20.406  30.915 4.715   1.00 69.01  ? 1045 GLU A CA  1 
ATOM 8021 C C   . GLU A 1 1048 ? 20.847  32.029 3.758   1.00 69.01  ? 1045 GLU A C   1 
ATOM 8022 O O   . GLU A 1 1048 ? 21.736  32.813 4.076   1.00 69.01  ? 1045 GLU A O   1 
ATOM 8023 C CB  . GLU A 1 1048 ? 20.980  29.555 4.278   1.00 128.43 ? 1045 GLU A CB  1 
ATOM 8024 C CG  . GLU A 1 1048 ? 20.748  29.166 2.804   1.00 128.43 ? 1045 GLU A CG  1 
ATOM 8025 C CD  . GLU A 1 1048 ? 19.273  29.116 2.401   1.00 128.43 ? 1045 GLU A CD  1 
ATOM 8026 O OE1 . GLU A 1 1048 ? 18.574  28.148 2.775   1.00 128.43 ? 1045 GLU A OE1 1 
ATOM 8027 O OE2 . GLU A 1 1048 ? 18.818  30.044 1.698   1.00 128.43 ? 1045 GLU A OE2 1 
ATOM 8028 N N   . SER A 1 1049 ? 20.197  32.107 2.600   1.00 64.06  ? 1046 SER A N   1 
ATOM 8029 C CA  . SER A 1 1049 ? 20.490  33.132 1.629   1.00 64.06  ? 1046 SER A CA  1 
ATOM 8030 C C   . SER A 1 1049 ? 20.209  34.506 2.225   1.00 64.06  ? 1046 SER A C   1 
ATOM 8031 O O   . SER A 1 1049 ? 21.101  35.365 2.255   1.00 64.06  ? 1046 SER A O   1 
ATOM 8032 C CB  . SER A 1 1049 ? 19.667  32.923 0.360   1.00 76.30  ? 1046 SER A CB  1 
ATOM 8033 O OG  . SER A 1 1049 ? 18.390  33.532 0.485   1.00 76.30  ? 1046 SER A OG  1 
ATOM 8034 N N   . TRP A 1 1050 ? 18.986  34.713 2.705   1.00 79.17  ? 1047 TRP A N   1 
ATOM 8035 C CA  . TRP A 1 1050 ? 18.628  35.986 3.308   1.00 79.17  ? 1047 TRP A CA  1 
ATOM 8036 C C   . TRP A 1 1050 ? 19.535  36.315 4.471   1.00 79.17  ? 1047 TRP A C   1 
ATOM 8037 O O   . TRP A 1 1050 ? 19.897  37.478 4.679   1.00 79.17  ? 1047 TRP A O   1 
ATOM 8038 C CB  . TRP A 1 1050 ? 17.190  35.967 3.753   1.00 98.71  ? 1047 TRP A CB  1 
ATOM 8039 C CG  . TRP A 1 1050 ? 16.333  36.307 2.649   1.00 98.71  ? 1047 TRP A CG  1 
ATOM 8040 C CD1 . TRP A 1 1050 ? 15.945  35.494 1.636   1.00 98.71  ? 1047 TRP A CD1 1 
ATOM 8041 C CD2 . TRP A 1 1050 ? 15.766  37.581 2.391   1.00 98.71  ? 1047 TRP A CD2 1 
ATOM 8042 N NE1 . TRP A 1 1050 ? 15.146  36.179 0.765   1.00 98.71  ? 1047 TRP A NE1 1 
ATOM 8043 C CE2 . TRP A 1 1050 ? 15.019  37.469 1.207   1.00 98.71  ? 1047 TRP A CE2 1 
ATOM 8044 C CE3 . TRP A 1 1050 ? 15.802  38.809 3.054   1.00 98.71  ? 1047 TRP A CE3 1 
ATOM 8045 C CZ2 . TRP A 1 1050 ? 14.316  38.540 0.665   1.00 98.71  ? 1047 TRP A CZ2 1 
ATOM 8046 C CZ3 . TRP A 1 1050 ? 15.100  39.870 2.520   1.00 98.71  ? 1047 TRP A CZ3 1 
ATOM 8047 C CH2 . TRP A 1 1050 ? 14.369  39.732 1.336   1.00 98.71  ? 1047 TRP A CH2 1 
ATOM 8048 N N   . TYR A 1 1051 ? 19.923  35.280 5.213   1.00 66.73  ? 1048 TYR A N   1 
ATOM 8049 C CA  . TYR A 1 1051 ? 20.859  35.476 6.281   1.00 66.73  ? 1048 TYR A CA  1 
ATOM 8050 C C   . TYR A 1 1051 ? 22.035  36.176 5.666   1.00 66.73  ? 1048 TYR A C   1 
ATOM 8051 O O   . TYR A 1 1051 ? 22.373  37.288 6.072   1.00 66.73  ? 1048 TYR A O   1 
ATOM 8052 C CB  . TYR A 1 1051 ? 21.295  34.160 6.899   1.00 80.09  ? 1048 TYR A CB  1 
ATOM 8053 C CG  . TYR A 1 1051 ? 22.358  34.345 7.942   1.00 80.09  ? 1048 TYR A CG  1 
ATOM 8054 C CD1 . TYR A 1 1051 ? 22.029  34.715 9.247   1.00 80.09  ? 1048 TYR A CD1 1 
ATOM 8055 C CD2 . TYR A 1 1051 ? 23.695  34.176 7.630   1.00 80.09  ? 1048 TYR A CD2 1 
ATOM 8056 C CE1 . TYR A 1 1051 ? 23.011  34.905 10.216  1.00 80.09  ? 1048 TYR A CE1 1 
ATOM 8057 C CE2 . TYR A 1 1051 ? 24.681  34.353 8.591   1.00 80.09  ? 1048 TYR A CE2 1 
ATOM 8058 C CZ  . TYR A 1 1051 ? 24.332  34.711 9.881   1.00 80.09  ? 1048 TYR A CZ  1 
ATOM 8059 O OH  . TYR A 1 1051 ? 25.314  34.883 10.822  1.00 80.09  ? 1048 TYR A OH  1 
ATOM 8060 N N   . ASN A 1 1052 ? 22.616  35.541 4.643   1.00 49.32  ? 1049 ASN A N   1 
ATOM 8061 C CA  . ASN A 1 1052 ? 23.905  35.969 4.074   1.00 49.32  ? 1049 ASN A CA  1 
ATOM 8062 C C   . ASN A 1 1052 ? 23.855  37.317 3.396   1.00 49.32  ? 1049 ASN A C   1 
ATOM 8063 O O   . ASN A 1 1052 ? 24.744  38.155 3.600   1.00 49.32  ? 1049 ASN A O   1 
ATOM 8064 C CB  . ASN A 1 1052 ? 24.487  34.882 3.194   1.00 74.95  ? 1049 ASN A CB  1 
ATOM 8065 C CG  . ASN A 1 1052 ? 24.833  33.663 3.993   1.00 74.95  ? 1049 ASN A CG  1 
ATOM 8066 O OD1 . ASN A 1 1052 ? 25.505  33.757 5.010   1.00 74.95  ? 1049 ASN A OD1 1 
ATOM 8067 N ND2 . ASN A 1 1052 ? 24.350  32.519 3.569   1.00 74.95  ? 1049 ASN A ND2 1 
ATOM 8068 N N   . LEU A 1 1053 ? 22.790  37.547 2.646   1.00 64.45  ? 1050 LEU A N   1 
ATOM 8069 C CA  . LEU A 1 1053 ? 22.567  38.851 2.081   1.00 64.45  ? 1050 LEU A CA  1 
ATOM 8070 C C   . LEU A 1 1053 ? 22.680  39.895 3.185   1.00 64.45  ? 1050 LEU A C   1 
ATOM 8071 O O   . LEU A 1 1053 ? 23.209  40.986 2.984   1.00 64.45  ? 1050 LEU A O   1 
ATOM 8072 C CB  . LEU A 1 1053 ? 21.175  38.902 1.501   1.00 59.79  ? 1050 LEU A CB  1 
ATOM 8073 C CG  . LEU A 1 1053 ? 20.936  39.740 0.254   1.00 59.79  ? 1050 LEU A CG  1 
ATOM 8074 C CD1 . LEU A 1 1053 ? 19.458  39.587 -0.167  1.00 59.79  ? 1050 LEU A CD1 1 
ATOM 8075 C CD2 . LEU A 1 1053 ? 21.338  41.212 0.437   1.00 59.79  ? 1050 LEU A CD2 1 
ATOM 8076 N N   . LEU A 1 1054 ? 22.197  39.534 4.367   1.00 76.26  ? 1051 LEU A N   1 
ATOM 8077 C CA  . LEU A 1 1054 ? 22.120  40.471 5.474   1.00 76.26  ? 1051 LEU A CA  1 
ATOM 8078 C C   . LEU A 1 1054 ? 23.377  40.487 6.337   1.00 76.26  ? 1051 LEU A C   1 
ATOM 8079 O O   . LEU A 1 1054 ? 23.744  41.527 6.890   1.00 76.26  ? 1051 LEU A O   1 
ATOM 8080 C CB  . LEU A 1 1054 ? 20.894  40.164 6.341   1.00 46.26  ? 1051 LEU A CB  1 
ATOM 8081 C CG  . LEU A 1 1054 ? 19.445  40.383 5.885   1.00 46.26  ? 1051 LEU A CG  1 
ATOM 8082 C CD1 . LEU A 1 1054 ? 18.501  39.907 6.984   1.00 46.26  ? 1051 LEU A CD1 1 
ATOM 8083 C CD2 . LEU A 1 1054 ? 19.150  41.840 5.538   1.00 46.26  ? 1051 LEU A CD2 1 
ATOM 8084 N N   . LEU A 1 1055 ? 24.018  39.331 6.476   1.00 61.96  ? 1052 LEU A N   1 
ATOM 8085 C CA  . LEU A 1 1055 ? 25.242  39.282 7.254   1.00 61.96  ? 1052 LEU A CA  1 
ATOM 8086 C C   . LEU A 1 1055 ? 26.220  40.197 6.549   1.00 61.96  ? 1052 LEU A C   1 
ATOM 8087 O O   . LEU A 1 1055 ? 26.733  41.151 7.125   1.00 61.96  ? 1052 LEU A O   1 
ATOM 8088 C CB  . LEU A 1 1055 ? 25.823  37.860 7.367   1.00 51.33  ? 1052 LEU A CB  1 
ATOM 8089 C CG  . LEU A 1 1055 ? 26.746  37.690 8.602   1.00 51.33  ? 1052 LEU A CG  1 
ATOM 8090 C CD1 . LEU A 1 1055 ? 27.445  36.350 8.594   1.00 51.33  ? 1052 LEU A CD1 1 
ATOM 8091 C CD2 . LEU A 1 1055 ? 27.773  38.782 8.749   1.00 51.33  ? 1052 LEU A CD2 1 
ATOM 8092 N N   . ASP A 1 1056 ? 26.439  39.906 5.274   1.00 79.70  ? 1053 ASP A N   1 
ATOM 8093 C CA  . ASP A 1 1056 ? 27.328  40.699 4.463   1.00 79.70  ? 1053 ASP A CA  1 
ATOM 8094 C C   . ASP A 1 1056 ? 26.976  42.156 4.674   1.00 79.70  ? 1053 ASP A C   1 
ATOM 8095 O O   . ASP A 1 1056 ? 27.826  42.947 5.063   1.00 79.70  ? 1053 ASP A O   1 
ATOM 8096 C CB  . ASP A 1 1056 ? 27.191  40.303 2.995   1.00 107.20 ? 1053 ASP A CB  1 
ATOM 8097 C CG  . ASP A 1 1056 ? 28.305  40.871 2.128   1.00 107.20 ? 1053 ASP A CG  1 
ATOM 8098 O OD1 . ASP A 1 1056 ? 29.202  40.092 1.717   1.00 107.20 ? 1053 ASP A OD1 1 
ATOM 8099 O OD2 . ASP A 1 1056 ? 28.281  42.098 1.857   1.00 107.20 ? 1053 ASP A OD2 1 
ATOM 8100 N N   . MET A 1 1057 ? 25.702  42.479 4.475   1.00 81.04  ? 1054 MET A N   1 
ATOM 8101 C CA  . MET A 1 1057 ? 25.223  43.851 4.580   1.00 81.04  ? 1054 MET A CA  1 
ATOM 8102 C C   . MET A 1 1057 ? 25.372  44.486 5.969   1.00 81.04  ? 1054 MET A C   1 
ATOM 8103 O O   . MET A 1 1057 ? 25.329  45.708 6.106   1.00 81.04  ? 1054 MET A O   1 
ATOM 8104 C CB  . MET A 1 1057 ? 23.784  43.945 4.099   1.00 93.58  ? 1054 MET A CB  1 
ATOM 8105 C CG  . MET A 1 1057 ? 23.139  45.250 4.470   1.00 93.58  ? 1054 MET A CG  1 
ATOM 8106 S SD  . MET A 1 1057 ? 21.927  45.840 3.295   1.00 93.58  ? 1054 MET A SD  1 
ATOM 8107 C CE  . MET A 1 1057 ? 20.867  44.401 3.157   1.00 93.58  ? 1054 MET A CE  1 
ATOM 8108 N N   . GLN A 1 1058 ? 25.541  43.655 6.992   1.00 74.52  ? 1055 GLN A N   1 
ATOM 8109 C CA  . GLN A 1 1058 ? 25.854  44.156 8.320   1.00 74.52  ? 1055 GLN A CA  1 
ATOM 8110 C C   . GLN A 1 1058 ? 27.251  44.702 8.307   1.00 74.52  ? 1055 GLN A C   1 
ATOM 8111 O O   . GLN A 1 1058 ? 27.508  45.790 8.809   1.00 74.52  ? 1055 GLN A O   1 
ATOM 8112 C CB  . GLN A 1 1058 ? 25.781  43.040 9.348   1.00 74.89  ? 1055 GLN A CB  1 
ATOM 8113 C CG  . GLN A 1 1058 ? 24.475  42.969 10.118  1.00 74.89  ? 1055 GLN A CG  1 
ATOM 8114 C CD  . GLN A 1 1058 ? 24.666  42.308 11.453  1.00 74.89  ? 1055 GLN A CD  1 
ATOM 8115 O OE1 . GLN A 1 1058 ? 23.717  41.864 12.091  1.00 74.89  ? 1055 GLN A OE1 1 
ATOM 8116 N NE2 . GLN A 1 1058 ? 25.910  42.230 11.883  1.00 74.89  ? 1055 GLN A NE2 1 
ATOM 8117 N N   . ASN A 1 1059 ? 28.147  43.928 7.707   1.00 56.99  ? 1056 ASN A N   1 
ATOM 8118 C CA  . ASN A 1 1059 ? 29.559  44.266 7.654   1.00 56.99  ? 1056 ASN A CA  1 
ATOM 8119 C C   . ASN A 1 1059 ? 29.834  45.456 6.745   1.00 56.99  ? 1056 ASN A C   1 
ATOM 8120 O O   . ASN A 1 1059 ? 30.485  46.418 7.154   1.00 56.99  ? 1056 ASN A O   1 
ATOM 8121 C CB  . ASN A 1 1059 ? 30.396  43.027 7.336   1.00 77.77  ? 1056 ASN A CB  1 
ATOM 8122 C CG  . ASN A 1 1059 ? 30.364  42.006 8.478   1.00 77.77  ? 1056 ASN A CG  1 
ATOM 8123 O OD1 . ASN A 1 1059 ? 30.424  40.800 8.259   1.00 77.77  ? 1056 ASN A OD1 1 
ATOM 8124 N ND2 . ASN A 1 1059 ? 30.251  42.502 9.710   1.00 77.77  ? 1056 ASN A ND2 1 
ATOM 8125 N N   . ARG A 1 1060 ? 29.281  45.445 5.546   1.00 65.62  ? 1057 ARG A N   1 
ATOM 8126 C CA  . ARG A 1 1060 ? 29.385  46.625 4.721   1.00 65.62  ? 1057 ARG A CA  1 
ATOM 8127 C C   . ARG A 1 1060 ? 28.901  47.829 5.513   1.00 65.62  ? 1057 ARG A C   1 
ATOM 8128 O O   . ARG A 1 1060 ? 29.589  48.838 5.575   1.00 65.62  ? 1057 ARG A O   1 
ATOM 8129 C CB  . ARG A 1 1060 ? 28.620  46.468 3.413   1.00 89.09  ? 1057 ARG A CB  1 
ATOM 8130 C CG  . ARG A 1 1060 ? 28.922  45.173 2.678   1.00 89.09  ? 1057 ARG A CG  1 
ATOM 8131 C CD  . ARG A 1 1060 ? 29.345  45.431 1.245   1.00 89.09  ? 1057 ARG A CD  1 
ATOM 8132 N NE  . ARG A 1 1060 ? 28.707  44.494 0.325   1.00 89.09  ? 1057 ARG A NE  1 
ATOM 8133 C CZ  . ARG A 1 1060 ? 28.875  44.492 -0.996  1.00 89.09  ? 1057 ARG A CZ  1 
ATOM 8134 N NH1 . ARG A 1 1060 ? 29.681  45.376 -1.584  1.00 89.09  ? 1057 ARG A NH1 1 
ATOM 8135 N NH2 . ARG A 1 1060 ? 28.232  43.595 -1.732  1.00 89.09  ? 1057 ARG A NH2 1 
ATOM 8136 N N   . LEU A 1 1061 ? 27.749  47.696 6.165   1.00 83.17  ? 1058 LEU A N   1 
ATOM 8137 C CA  . LEU A 1 1061 ? 27.127  48.808 6.884   1.00 83.17  ? 1058 LEU A CA  1 
ATOM 8138 C C   . LEU A 1 1061 ? 27.907  49.348 8.044   1.00 83.17  ? 1058 LEU A C   1 
ATOM 8139 O O   . LEU A 1 1061 ? 27.819  50.538 8.339   1.00 83.17  ? 1058 LEU A O   1 
ATOM 8140 C CB  . LEU A 1 1061 ? 25.747  48.434 7.403   1.00 62.67  ? 1058 LEU A CB  1 
ATOM 8141 C CG  . LEU A 1 1061 ? 24.605  49.004 6.569   1.00 62.67  ? 1058 LEU A CG  1 
ATOM 8142 C CD1 . LEU A 1 1061 ? 23.329  48.251 6.876   1.00 62.67  ? 1058 LEU A CD1 1 
ATOM 8143 C CD2 . LEU A 1 1061 ? 24.421  50.489 6.793   1.00 62.67  ? 1058 LEU A CD2 1 
ATOM 8144 N N   . ASN A 1 1062 ? 28.637  48.483 8.732   1.00 77.86  ? 1059 ASN A N   1 
ATOM 8145 C CA  . ASN A 1 1062 ? 29.347  48.942 9.908   1.00 77.86  ? 1059 ASN A CA  1 
ATOM 8146 C C   . ASN A 1 1062 ? 30.445  49.905 9.549   1.00 77.86  ? 1059 ASN A C   1 
ATOM 8147 O O   . ASN A 1 1062 ? 30.535  50.980 10.152  1.00 77.86  ? 1059 ASN A O   1 
ATOM 8148 C CB  . ASN A 1 1062 ? 29.868  47.788 10.735  1.00 71.49  ? 1059 ASN A CB  1 
ATOM 8149 C CG  . ASN A 1 1062 ? 28.780  47.136 11.548  1.00 71.49  ? 1059 ASN A CG  1 
ATOM 8150 O OD1 . ASN A 1 1062 ? 27.984  47.805 12.222  1.00 71.49  ? 1059 ASN A OD1 1 
ATOM 8151 N ND2 . ASN A 1 1062 ? 28.733  45.817 11.487  1.00 71.49  ? 1059 ASN A ND2 1 
ATOM 8152 N N   . LYS A 1 1063 ? 31.240  49.538 8.539   1.00 75.00  ? 1060 LYS A N   1 
ATOM 8153 C CA  . LYS A 1 1063 ? 32.259  50.420 7.966   1.00 75.00  ? 1060 LYS A CA  1 
ATOM 8154 C C   . LYS A 1 1063 ? 31.748  51.847 7.656   1.00 75.00  ? 1060 LYS A C   1 
ATOM 8155 O O   . LYS A 1 1063 ? 32.438  52.825 7.894   1.00 75.00  ? 1060 LYS A O   1 
ATOM 8156 C CB  . LYS A 1 1063 ? 32.860  49.768 6.723   1.00 87.58  ? 1060 LYS A CB  1 
ATOM 8157 C CG  . LYS A 1 1063 ? 33.752  48.583 7.012   1.00 87.58  ? 1060 LYS A CG  1 
ATOM 8158 C CD  . LYS A 1 1063 ? 34.608  48.263 5.800   1.00 87.58  ? 1060 LYS A CD  1 
ATOM 8159 C CE  . LYS A 1 1063 ? 35.592  47.139 6.079   1.00 87.58  ? 1060 LYS A CE  1 
ATOM 8160 N NZ  . LYS A 1 1063 ? 34.910  45.825 6.125   1.00 87.58  ? 1060 LYS A NZ  1 
ATOM 8161 N N   . VAL A 1 1064 ? 30.524  51.960 7.164   1.00 86.48  ? 1061 VAL A N   1 
ATOM 8162 C CA  . VAL A 1 1064 ? 29.954  53.256 6.805   1.00 86.48  ? 1061 VAL A CA  1 
ATOM 8163 C C   . VAL A 1 1064 ? 29.465  54.120 7.985   1.00 86.48  ? 1061 VAL A C   1 
ATOM 8164 O O   . VAL A 1 1064 ? 29.725  55.323 8.013   1.00 86.48  ? 1061 VAL A O   1 
ATOM 8165 C CB  . VAL A 1 1064 ? 28.816  53.082 5.800   1.00 99.46  ? 1061 VAL A CB  1 
ATOM 8166 C CG1 . VAL A 1 1064 ? 28.487  54.406 5.133   1.00 99.46  ? 1061 VAL A CG1 1 
ATOM 8167 C CG2 . VAL A 1 1064 ? 29.206  52.047 4.764   1.00 99.46  ? 1061 VAL A CG2 1 
ATOM 8168 N N   . ILE A 1 1065 ? 28.757  53.516 8.942   1.00 92.85  ? 1062 ILE A N   1 
ATOM 8169 C CA  . ILE A 1 1065 ? 28.216  54.251 10.110  1.00 92.85  ? 1062 ILE A CA  1 
ATOM 8170 C C   . ILE A 1 1065 ? 29.257  54.563 11.183  1.00 92.85  ? 1062 ILE A C   1 
ATOM 8171 O O   . ILE A 1 1065 ? 29.946  53.661 11.677  1.00 92.85  ? 1062 ILE A O   1 
ATOM 8172 C CB  . ILE A 1 1065 ? 27.050  53.484 10.798  1.00 56.98  ? 1062 ILE A CB  1 
ATOM 8173 C CG1 . ILE A 1 1065 ? 25.838  53.431 9.883   1.00 56.98  ? 1062 ILE A CG1 1 
ATOM 8174 C CG2 . ILE A 1 1065 ? 26.712  54.100 12.173  1.00 56.98  ? 1062 ILE A CG2 1 
ATOM 8175 C CD1 . ILE A 1 1065 ? 25.156  52.130 9.956   1.00 56.98  ? 1062 ILE A CD1 1 
ATOM 8176 N N   . LYS A 1 1066 ? 29.334  55.843 11.550  1.00 90.00  ? 1063 LYS A N   1 
ATOM 8177 C CA  . LYS A 1 1066 ? 30.153  56.291 12.677  1.00 90.00  ? 1063 LYS A CA  1 
ATOM 8178 C C   . LYS A 1 1066 ? 29.413  56.073 13.999  1.00 90.00  ? 1063 LYS A C   1 
ATOM 8179 O O   . LYS A 1 1066 ? 28.436  56.763 14.307  1.00 90.00  ? 1063 LYS A O   1 
ATOM 8180 C CB  . LYS A 1 1066 ? 30.595  57.757 12.508  1.00 133.87 ? 1063 LYS A CB  1 
ATOM 8181 C CG  . LYS A 1 1066 ? 29.497  58.724 12.083  1.00 133.87 ? 1063 LYS A CG  1 
ATOM 8182 C CD  . LYS A 1 1066 ? 29.236  58.649 10.589  1.00 133.87 ? 1063 LYS A CD  1 
ATOM 8183 C CE  . LYS A 1 1066 ? 27.750  58.726 10.290  1.00 133.87 ? 1063 LYS A CE  1 
ATOM 8184 N NZ  . LYS A 1 1066 ? 27.496  58.722 8.827   1.00 133.87 ? 1063 LYS A NZ  1 
ATOM 8185 N N   . SER A 1 1067 ? 29.884  55.093 14.763  1.00 48.62  ? 1064 SER A N   1 
ATOM 8186 C CA  . SER A 1 1067 ? 29.242  54.727 16.000  1.00 48.62  ? 1064 SER A CA  1 
ATOM 8187 C C   . SER A 1 1067 ? 29.613  55.738 17.056  1.00 48.62  ? 1064 SER A C   1 
ATOM 8188 O O   . SER A 1 1067 ? 30.730  56.214 17.092  1.00 48.62  ? 1064 SER A O   1 
ATOM 8189 C CB  . SER A 1 1067 ? 29.672  53.342 16.449  1.00 68.24  ? 1064 SER A CB  1 
ATOM 8190 O OG  . SER A 1 1067 ? 30.674  53.420 17.443  1.00 68.24  ? 1064 SER A OG  1 
ATOM 8191 N N   . VAL A 1 1068 ? 28.674  56.024 17.944  1.00 80.49  ? 1065 VAL A N   1 
ATOM 8192 C CA  . VAL A 1 1068 ? 28.804  57.159 18.824  1.00 80.49  ? 1065 VAL A CA  1 
ATOM 8193 C C   . VAL A 1 1068 ? 30.073  57.163 19.634  1.00 80.49  ? 1065 VAL A C   1 
ATOM 8194 O O   . VAL A 1 1068 ? 30.929  57.997 19.395  1.00 80.49  ? 1065 VAL A O   1 
ATOM 8195 C CB  . VAL A 1 1068 ? 27.570  57.366 19.688  1.00 56.55  ? 1065 VAL A CB  1 
ATOM 8196 C CG1 . VAL A 1 1068 ? 27.841  58.382 20.840  1.00 56.55  ? 1065 VAL A CG1 1 
ATOM 8197 C CG2 . VAL A 1 1068 ? 26.415  57.824 18.782  1.00 56.55  ? 1065 VAL A CG2 1 
ATOM 8198 N N   . GLY A 1 1069 ? 30.227  56.250 20.576  1.00 54.60  ? 1066 GLY A N   1 
ATOM 8199 C CA  . GLY A 1 1069 ? 31.443  56.292 21.400  1.00 54.60  ? 1066 GLY A CA  1 
ATOM 8200 C C   . GLY A 1 1069 ? 32.577  55.571 20.703  1.00 54.60  ? 1066 GLY A C   1 
ATOM 8201 O O   . GLY A 1 1069 ? 33.403  54.939 21.358  1.00 54.60  ? 1066 GLY A O   1 
ATOM 8202 N N   . LYS A 1 1070 ? 32.584  55.654 19.369  1.00 69.00  ? 1067 LYS A N   1 
ATOM 8203 C CA  . LYS A 1 1070 ? 33.458  54.886 18.478  1.00 69.00  ? 1067 LYS A CA  1 
ATOM 8204 C C   . LYS A 1 1070 ? 33.513  53.442 18.895  1.00 69.00  ? 1067 LYS A C   1 
ATOM 8205 O O   . LYS A 1 1070 ? 34.578  52.862 18.942  1.00 69.00  ? 1067 LYS A O   1 
ATOM 8206 C CB  . LYS A 1 1070 ? 34.867  55.467 18.423  1.00 85.50  ? 1067 LYS A CB  1 
ATOM 8207 C CG  . LYS A 1 1070 ? 34.931  56.923 18.027  1.00 85.50  ? 1067 LYS A CG  1 
ATOM 8208 C CD  . LYS A 1 1070 ? 34.733  57.135 16.538  1.00 85.50  ? 1067 LYS A CD  1 
ATOM 8209 C CE  . LYS A 1 1070 ? 34.962  58.596 16.150  1.00 85.50  ? 1067 LYS A CE  1 
ATOM 8210 N NZ  . LYS A 1 1070 ? 36.384  59.027 16.320  1.00 85.50  ? 1067 LYS A NZ  1 
ATOM 8211 N N   . ILE A 1 1071 ? 32.359  52.864 19.202  1.00 47.31  ? 1068 ILE A N   1 
ATOM 8212 C CA  . ILE A 1 1071 ? 32.284  51.508 19.733  1.00 47.31  ? 1068 ILE A CA  1 
ATOM 8213 C C   . ILE A 1 1071 ? 32.012  50.501 18.625  1.00 47.31  ? 1068 ILE A C   1 
ATOM 8214 O O   . ILE A 1 1071 ? 31.200  50.743 17.726  1.00 47.31  ? 1068 ILE A O   1 
ATOM 8215 C CB  . ILE A 1 1071 ? 31.170  51.371 20.793  1.00 45.05  ? 1068 ILE A CB  1 
ATOM 8216 C CG1 . ILE A 1 1071 ? 31.488  52.168 22.040  1.00 45.05  ? 1068 ILE A CG1 1 
ATOM 8217 C CG2 . ILE A 1 1071 ? 30.954  49.910 21.174  1.00 45.05  ? 1068 ILE A CG2 1 
ATOM 8218 C CD1 . ILE A 1 1071 ? 30.421  52.026 23.064  1.00 45.05  ? 1068 ILE A CD1 1 
ATOM 8219 N N   . GLU A 1 1072 ? 32.683  49.356 18.714  1.00 55.68  ? 1069 GLU A N   1 
ATOM 8220 C CA  . GLU A 1 1072 ? 32.541  48.306 17.713  1.00 55.68  ? 1069 GLU A CA  1 
ATOM 8221 C C   . GLU A 1 1072 ? 31.177  47.606 17.834  1.00 55.68  ? 1069 GLU A C   1 
ATOM 8222 O O   . GLU A 1 1072 ? 30.896  46.910 18.816  1.00 55.68  ? 1069 GLU A O   1 
ATOM 8223 C CB  . GLU A 1 1072 ? 33.709  47.312 17.810  1.00 165.62 ? 1069 GLU A CB  1 
ATOM 8224 C CG  . GLU A 1 1072 ? 33.903  46.412 16.588  1.00 165.62 ? 1069 GLU A CG  1 
ATOM 8225 C CD  . GLU A 1 1072 ? 34.778  47.027 15.500  1.00 165.62 ? 1069 GLU A CD  1 
ATOM 8226 O OE1 . GLU A 1 1072 ? 35.431  46.251 14.764  1.00 165.62 ? 1069 GLU A OE1 1 
ATOM 8227 O OE2 . GLU A 1 1072 ? 34.819  48.272 15.375  1.00 165.62 ? 1069 GLU A OE2 1 
ATOM 8228 N N   . HIS A 1 1073 ? 30.339  47.790 16.820  1.00 48.79  ? 1070 HIS A N   1 
ATOM 8229 C CA  . HIS A 1 1073 ? 29.075  47.067 16.739  1.00 48.79  ? 1070 HIS A CA  1 
ATOM 8230 C C   . HIS A 1 1073 ? 29.179  45.587 17.119  1.00 48.79  ? 1070 HIS A C   1 
ATOM 8231 O O   . HIS A 1 1073 ? 28.333  45.046 17.836  1.00 48.79  ? 1070 HIS A O   1 
ATOM 8232 C CB  . HIS A 1 1073 ? 28.450  47.186 15.352  1.00 46.04  ? 1070 HIS A CB  1 
ATOM 8233 C CG  . HIS A 1 1073 ? 27.255  46.301 15.179  1.00 46.04  ? 1070 HIS A CG  1 
ATOM 8234 N ND1 . HIS A 1 1073 ? 25.970  46.714 15.473  1.00 46.04  ? 1070 HIS A ND1 1 
ATOM 8235 C CD2 . HIS A 1 1073 ? 27.155  44.999 14.803  1.00 46.04  ? 1070 HIS A CD2 1 
ATOM 8236 C CE1 . HIS A 1 1073 ? 25.129  45.716 15.261  1.00 46.04  ? 1070 HIS A CE1 1 
ATOM 8237 N NE2 . HIS A 1 1073 ? 25.822  44.668 14.849  1.00 46.04  ? 1070 HIS A NE2 1 
ATOM 8238 N N   . SER A 1 1074 ? 30.215  44.939 16.600  1.00 55.43  ? 1071 SER A N   1 
ATOM 8239 C CA  . SER A 1 1074 ? 30.425  43.520 16.813  1.00 55.43  ? 1071 SER A CA  1 
ATOM 8240 C C   . SER A 1 1074 ? 30.948  43.268 18.211  1.00 55.43  ? 1071 SER A C   1 
ATOM 8241 O O   . SER A 1 1074 ? 30.771  42.183 18.720  1.00 55.43  ? 1071 SER A O   1 
ATOM 8242 C CB  . SER A 1 1074 ? 31.336  42.908 15.736  1.00 70.41  ? 1071 SER A CB  1 
ATOM 8243 O OG  . SER A 1 1074 ? 32.384  43.785 15.365  1.00 70.41  ? 1071 SER A OG  1 
ATOM 8244 N N   . PHE A 1 1075 ? 31.575  44.260 18.836  1.00 59.91  ? 1072 PHE A N   1 
ATOM 8245 C CA  . PHE A 1 1075 ? 31.957  44.126 20.232  1.00 59.91  ? 1072 PHE A CA  1 
ATOM 8246 C C   . PHE A 1 1075 ? 30.702  44.186 21.096  1.00 59.91  ? 1072 PHE A C   1 
ATOM 8247 O O   . PHE A 1 1075 ? 30.538  43.435 22.086  1.00 59.91  ? 1072 PHE A O   1 
ATOM 8248 C CB  . PHE A 1 1075 ? 32.887  45.244 20.636  1.00 42.45  ? 1072 PHE A CB  1 
ATOM 8249 C CG  . PHE A 1 1075 ? 33.345  45.170 22.065  1.00 42.45  ? 1072 PHE A CG  1 
ATOM 8250 C CD1 . PHE A 1 1075 ? 34.370  44.325 22.439  1.00 42.45  ? 1072 PHE A CD1 1 
ATOM 8251 C CD2 . PHE A 1 1075 ? 32.763  45.970 23.044  1.00 42.45  ? 1072 PHE A CD2 1 
ATOM 8252 C CE1 . PHE A 1 1075 ? 34.800  44.283 23.758  1.00 42.45  ? 1072 PHE A CE1 1 
ATOM 8253 C CE2 . PHE A 1 1075 ? 33.192  45.912 24.382  1.00 42.45  ? 1072 PHE A CE2 1 
ATOM 8254 C CZ  . PHE A 1 1075 ? 34.204  45.078 24.727  1.00 42.45  ? 1072 PHE A CZ  1 
ATOM 8255 N N   . TRP A 1 1076 ? 29.826  45.103 20.707  1.00 56.40  ? 1073 TRP A N   1 
ATOM 8256 C CA  . TRP A 1 1076 ? 28.548  45.256 21.329  1.00 56.40  ? 1073 TRP A CA  1 
ATOM 8257 C C   . TRP A 1 1076 ? 27.827  43.913 21.302  1.00 56.40  ? 1073 TRP A C   1 
ATOM 8258 O O   . TRP A 1 1076 ? 27.494  43.417 22.369  1.00 56.40  ? 1073 TRP A O   1 
ATOM 8259 C CB  . TRP A 1 1076 ? 27.784  46.398 20.639  1.00 51.38  ? 1073 TRP A CB  1 
ATOM 8260 C CG  . TRP A 1 1076 ? 26.328  46.590 20.994  1.00 51.38  ? 1073 TRP A CG  1 
ATOM 8261 C CD1 . TRP A 1 1076 ? 25.317  46.831 20.123  1.00 51.38  ? 1073 TRP A CD1 1 
ATOM 8262 C CD2 . TRP A 1 1076 ? 25.730  46.562 22.298  1.00 51.38  ? 1073 TRP A CD2 1 
ATOM 8263 N NE1 . TRP A 1 1076 ? 24.132  46.953 20.790  1.00 51.38  ? 1073 TRP A NE1 1 
ATOM 8264 C CE2 . TRP A 1 1076 ? 24.361  46.791 22.130  1.00 51.38  ? 1073 TRP A CE2 1 
ATOM 8265 C CE3 . TRP A 1 1076 ? 26.219  46.348 23.589  1.00 51.38  ? 1073 TRP A CE3 1 
ATOM 8266 C CZ2 . TRP A 1 1076 ? 23.479  46.819 23.202  1.00 51.38  ? 1073 TRP A CZ2 1 
ATOM 8267 C CZ3 . TRP A 1 1076 ? 25.347  46.387 24.646  1.00 51.38  ? 1073 TRP A CZ3 1 
ATOM 8268 C CH2 . TRP A 1 1076 ? 24.001  46.616 24.451  1.00 51.38  ? 1073 TRP A CH2 1 
ATOM 8269 N N   . ARG A 1 1077 ? 27.658  43.293 20.121  1.00 45.89  ? 1074 ARG A N   1 
ATOM 8270 C CA  . ARG A 1 1077 ? 26.752  42.134 19.977  1.00 45.89  ? 1074 ARG A CA  1 
ATOM 8271 C C   . ARG A 1 1077 ? 27.359  40.813 20.399  1.00 45.89  ? 1074 ARG A C   1 
ATOM 8272 O O   . ARG A 1 1077 ? 26.835  39.752 20.096  1.00 45.89  ? 1074 ARG A O   1 
ATOM 8273 C CB  . ARG A 1 1077 ? 26.217  41.998 18.556  1.00 50.91  ? 1074 ARG A CB  1 
ATOM 8274 C CG  . ARG A 1 1077 ? 25.192  43.041 18.134  1.00 50.91  ? 1074 ARG A CG  1 
ATOM 8275 C CD  . ARG A 1 1077 ? 24.051  43.116 19.126  1.00 50.91  ? 1074 ARG A CD  1 
ATOM 8276 N NE  . ARG A 1 1077 ? 23.056  44.153 18.841  1.00 50.91  ? 1074 ARG A NE  1 
ATOM 8277 C CZ  . ARG A 1 1077 ? 22.121  44.556 19.707  1.00 50.91  ? 1074 ARG A CZ  1 
ATOM 8278 N NH1 . ARG A 1 1077 ? 22.013  44.040 20.936  1.00 50.91  ? 1074 ARG A NH1 1 
ATOM 8279 N NH2 . ARG A 1 1077 ? 21.289  45.502 19.341  1.00 50.91  ? 1074 ARG A NH2 1 
ATOM 8280 N N   . SER A 1 1078 ? 28.468  40.859 21.114  1.00 44.40  ? 1075 SER A N   1 
ATOM 8281 C CA  . SER A 1 1078 ? 29.235  39.647 21.318  1.00 44.40  ? 1075 SER A CA  1 
ATOM 8282 C C   . SER A 1 1078 ? 28.742  38.927 22.534  1.00 44.40  ? 1075 SER A C   1 
ATOM 8283 O O   . SER A 1 1078 ? 28.755  39.489 23.637  1.00 44.40  ? 1075 SER A O   1 
ATOM 8284 C CB  . SER A 1 1078 ? 30.707  39.985 21.474  1.00 56.45  ? 1075 SER A CB  1 
ATOM 8285 O OG  . SER A 1 1078 ? 31.272  40.240 20.212  1.00 56.45  ? 1075 SER A OG  1 
ATOM 8286 N N   . PHE A 1 1079 ? 28.301  37.687 22.335  1.00 56.67  ? 1076 PHE A N   1 
ATOM 8287 C CA  . PHE A 1 1079 ? 27.804  36.870 23.436  1.00 56.67  ? 1076 PHE A CA  1 
ATOM 8288 C C   . PHE A 1 1079 ? 28.772  36.987 24.570  1.00 56.67  ? 1076 PHE A C   1 
ATOM 8289 O O   . PHE A 1 1079 ? 29.962  36.955 24.341  1.00 56.67  ? 1076 PHE A O   1 
ATOM 8290 C CB  . PHE A 1 1079 ? 27.699  35.406 23.044  1.00 60.95  ? 1076 PHE A CB  1 
ATOM 8291 C CG  . PHE A 1 1079 ? 27.176  34.538 24.151  1.00 60.95  ? 1076 PHE A CG  1 
ATOM 8292 C CD1 . PHE A 1 1079 ? 25.865  34.063 24.117  1.00 60.95  ? 1076 PHE A CD1 1 
ATOM 8293 C CD2 . PHE A 1 1079 ? 27.973  34.235 25.252  1.00 60.95  ? 1076 PHE A CD2 1 
ATOM 8294 C CE1 . PHE A 1 1079 ? 25.378  33.282 25.160  1.00 60.95  ? 1076 PHE A CE1 1 
ATOM 8295 C CE2 . PHE A 1 1079 ? 27.489  33.462 26.282  1.00 60.95  ? 1076 PHE A CE2 1 
ATOM 8296 C CZ  . PHE A 1 1079 ? 26.196  32.987 26.242  1.00 60.95  ? 1076 PHE A CZ  1 
ATOM 8297 N N   . HIS A 1 1080 ? 28.277  37.121 25.791  1.00 48.40  ? 1077 HIS A N   1 
ATOM 8298 C CA  . HIS A 1 1080 ? 29.161  37.514 26.889  1.00 48.40  ? 1077 HIS A CA  1 
ATOM 8299 C C   . HIS A 1 1080 ? 28.694  37.270 28.326  1.00 48.40  ? 1077 HIS A C   1 
ATOM 8300 O O   . HIS A 1 1080 ? 27.610  37.654 28.746  1.00 48.40  ? 1077 HIS A O   1 
ATOM 8301 C CB  . HIS A 1 1080 ? 29.551  38.968 26.734  1.00 64.65  ? 1077 HIS A CB  1 
ATOM 8302 C CG  . HIS A 1 1080 ? 30.385  39.473 27.853  1.00 64.65  ? 1077 HIS A CG  1 
ATOM 8303 N ND1 . HIS A 1 1080 ? 31.754  39.551 27.775  1.00 64.65  ? 1077 HIS A ND1 1 
ATOM 8304 C CD2 . HIS A 1 1080 ? 30.049  39.908 29.088  1.00 64.65  ? 1077 HIS A CD2 1 
ATOM 8305 C CE1 . HIS A 1 1080 ? 32.229  40.031 28.910  1.00 64.65  ? 1077 HIS A CE1 1 
ATOM 8306 N NE2 . HIS A 1 1080 ? 31.215  40.249 29.728  1.00 64.65  ? 1077 HIS A NE2 1 
ATOM 8307 N N   . THR A 1 1081 ? 29.591  36.647 29.074  1.00 68.73  ? 1078 THR A N   1 
ATOM 8308 C CA  . THR A 1 1081 ? 29.377  36.285 30.453  1.00 68.73  ? 1078 THR A CA  1 
ATOM 8309 C C   . THR A 1 1081 ? 30.632  36.627 31.207  1.00 68.73  ? 1078 THR A C   1 
ATOM 8310 O O   . THR A 1 1081 ? 31.641  36.968 30.612  1.00 68.73  ? 1078 THR A O   1 
ATOM 8311 C CB  . THR A 1 1081 ? 29.257  34.774 30.605  1.00 61.35  ? 1078 THR A CB  1 
ATOM 8312 O OG1 . THR A 1 1081 ? 30.579  34.206 30.618  1.00 61.35  ? 1078 THR A OG1 1 
ATOM 8313 C CG2 . THR A 1 1081 ? 28.412  34.159 29.488  1.00 61.35  ? 1078 THR A CG2 1 
ATOM 8314 N N   . GLU A 1 1082 ? 30.579  36.457 32.521  1.00 98.68  ? 1079 GLU A N   1 
ATOM 8315 C CA  . GLU A 1 1082 ? 31.749  36.595 33.368  1.00 98.68  ? 1079 GLU A CA  1 
ATOM 8316 C C   . GLU A 1 1082 ? 32.608  35.325 33.270  1.00 98.68  ? 1079 GLU A C   1 
ATOM 8317 O O   . GLU A 1 1082 ? 32.991  34.754 34.297  1.00 98.68  ? 1079 GLU A O   1 
ATOM 8318 C CB  . GLU A 1 1082 ? 31.312  36.887 34.819  1.00 218.25 ? 1079 GLU A CB  1 
ATOM 8319 C CG  . GLU A 1 1082 ? 32.438  37.213 35.823  1.00 218.25 ? 1079 GLU A CG  1 
ATOM 8320 C CD  . GLU A 1 1082 ? 33.094  38.578 35.607  1.00 218.25 ? 1079 GLU A CD  1 
ATOM 8321 O OE1 . GLU A 1 1082 ? 34.257  38.739 36.049  1.00 218.25 ? 1079 GLU A OE1 1 
ATOM 8322 O OE2 . GLU A 1 1082 ? 32.461  39.492 35.008  1.00 218.25 ? 1079 GLU A OE2 1 
ATOM 8323 N N   . ARG A 1 1083 ? 32.886  34.881 32.036  1.00 67.10  ? 1080 ARG A N   1 
ATOM 8324 C CA  . ARG A 1 1083 ? 33.744  33.705 31.757  1.00 67.10  ? 1080 ARG A CA  1 
ATOM 8325 C C   . ARG A 1 1083 ? 33.625  33.177 30.320  1.00 67.10  ? 1080 ARG A C   1 
ATOM 8326 O O   . ARG A 1 1083 ? 33.924  32.021 30.058  1.00 67.10  ? 1080 ARG A O   1 
ATOM 8327 C CB  . ARG A 1 1083 ? 33.548  32.547 32.762  1.00 134.35 ? 1080 ARG A CB  1 
ATOM 8328 C CG  . ARG A 1 1083 ? 32.131  32.013 32.860  1.00 134.35 ? 1080 ARG A CG  1 
ATOM 8329 C CD  . ARG A 1 1083 ? 32.096  30.496 32.951  1.00 134.35 ? 1080 ARG A CD  1 
ATOM 8330 N NE  . ARG A 1 1083 ? 32.129  29.854 31.632  1.00 134.35 ? 1080 ARG A NE  1 
ATOM 8331 C CZ  . ARG A 1 1083 ? 31.130  29.867 30.742  1.00 134.35 ? 1080 ARG A CZ  1 
ATOM 8332 N NH1 . ARG A 1 1083 ? 29.993  30.511 30.997  1.00 134.35 ? 1080 ARG A NH1 1 
ATOM 8333 N NH2 . ARG A 1 1083 ? 31.272  29.241 29.576  1.00 134.35 ? 1080 ARG A NH2 1 
ATOM 8334 N N   . LYS A 1 1084 ? 33.223  34.031 29.388  1.00 77.51  ? 1081 LYS A N   1 
ATOM 8335 C CA  . LYS A 1 1084 ? 33.152  33.643 27.987  1.00 77.51  ? 1081 LYS A CA  1 
ATOM 8336 C C   . LYS A 1 1084 ? 32.795  34.869 27.169  1.00 77.51  ? 1081 LYS A C   1 
ATOM 8337 O O   . LYS A 1 1084 ? 31.917  35.641 27.563  1.00 77.51  ? 1081 LYS A O   1 
ATOM 8338 C CB  . LYS A 1 1084 ? 32.109  32.526 27.805  1.00 60.75  ? 1081 LYS A CB  1 
ATOM 8339 C CG  . LYS A 1 1084 ? 31.776  32.106 26.380  1.00 60.75  ? 1081 LYS A CG  1 
ATOM 8340 C CD  . LYS A 1 1084 ? 31.196  30.680 26.347  1.00 60.75  ? 1081 LYS A CD  1 
ATOM 8341 C CE  . LYS A 1 1084 ? 30.200  30.457 25.164  1.00 60.75  ? 1081 LYS A CE  1 
ATOM 8342 N NZ  . LYS A 1 1084 ? 30.130  29.057 24.575  1.00 60.75  ? 1081 LYS A NZ  1 
ATOM 8343 N N   . THR A 1 1085 ? 33.491  35.063 26.047  1.00 57.17  ? 1082 THR A N   1 
ATOM 8344 C CA  . THR A 1 1085 ? 33.071  36.082 25.066  1.00 57.17  ? 1082 THR A CA  1 
ATOM 8345 C C   . THR A 1 1085 ? 33.198  35.653 23.594  1.00 57.17  ? 1082 THR A C   1 
ATOM 8346 O O   . THR A 1 1085 ? 34.251  35.792 22.995  1.00 57.17  ? 1082 THR A O   1 
ATOM 8347 C CB  . THR A 1 1085 ? 33.727  37.454 25.346  1.00 53.99  ? 1082 THR A CB  1 
ATOM 8348 O OG1 . THR A 1 1085 ? 33.357  37.868 26.662  1.00 53.99  ? 1082 THR A OG1 1 
ATOM 8349 C CG2 . THR A 1 1085 ? 33.242  38.502 24.366  1.00 53.99  ? 1082 THR A CG2 1 
ATOM 8350 N N   . GLU A 1 1086 ? 32.111  35.138 23.025  1.00 59.93  ? 1083 GLU A N   1 
ATOM 8351 C CA  . GLU A 1 1086 ? 32.076  34.748 21.619  1.00 59.93  ? 1083 GLU A CA  1 
ATOM 8352 C C   . GLU A 1 1086 ? 31.422  35.834 20.790  1.00 59.93  ? 1083 GLU A C   1 
ATOM 8353 O O   . GLU A 1 1086 ? 30.521  36.510 21.276  1.00 59.93  ? 1083 GLU A O   1 
ATOM 8354 C CB  . GLU A 1 1086 ? 31.264  33.469 21.439  1.00 98.48  ? 1083 GLU A CB  1 
ATOM 8355 C CG  . GLU A 1 1086 ? 31.473  32.438 22.510  1.00 98.48  ? 1083 GLU A CG  1 
ATOM 8356 C CD  . GLU A 1 1086 ? 32.927  32.077 22.675  1.00 98.48  ? 1083 GLU A CD  1 
ATOM 8357 O OE1 . GLU A 1 1086 ? 33.452  32.244 23.799  1.00 98.48  ? 1083 GLU A OE1 1 
ATOM 8358 O OE2 . GLU A 1 1086 ? 33.550  31.652 21.673  1.00 98.48  ? 1083 GLU A OE2 1 
ATOM 8359 N N   . PRO A 1 1087 ? 31.872  36.016 19.538  1.00 60.37  ? 1084 PRO A N   1 
ATOM 8360 C CA  . PRO A 1 1087 ? 31.124  36.882 18.626  1.00 60.37  ? 1084 PRO A CA  1 
ATOM 8361 C C   . PRO A 1 1087 ? 29.791  36.259 18.192  1.00 60.37  ? 1084 PRO A C   1 
ATOM 8362 O O   . PRO A 1 1087 ? 29.612  35.035 18.270  1.00 60.37  ? 1084 PRO A O   1 
ATOM 8363 C CB  . PRO A 1 1087 ? 32.084  37.059 17.441  1.00 49.11  ? 1084 PRO A CB  1 
ATOM 8364 C CG  . PRO A 1 1087 ? 32.909  35.874 17.467  1.00 49.11  ? 1084 PRO A CG  1 
ATOM 8365 C CD  . PRO A 1 1087 ? 33.099  35.504 18.907  1.00 49.11  ? 1084 PRO A CD  1 
ATOM 8366 N N   . ALA A 1 1088 ? 28.869  37.120 17.762  1.00 54.83  ? 1085 ALA A N   1 
ATOM 8367 C CA  . ALA A 1 1088 ? 27.487  36.715 17.462  1.00 54.83  ? 1085 ALA A CA  1 
ATOM 8368 C C   . ALA A 1 1088 ? 27.394  35.917 16.187  1.00 54.83  ? 1085 ALA A C   1 
ATOM 8369 O O   . ALA A 1 1088 ? 27.923  36.301 15.146  1.00 54.83  ? 1085 ALA A O   1 
ATOM 8370 C CB  . ALA A 1 1088 ? 26.520  37.944 17.396  1.00 24.12  ? 1085 ALA A CB  1 
ATOM 8371 N N   . THR A 1 1089 ? 26.696  34.804 16.276  1.00 42.42  ? 1086 THR A N   1 
ATOM 8372 C CA  . THR A 1 1089 ? 26.522  33.969 15.132  1.00 42.42  ? 1086 THR A CA  1 
ATOM 8373 C C   . THR A 1 1089 ? 25.017  33.843 14.960  1.00 42.42  ? 1086 THR A C   1 
ATOM 8374 O O   . THR A 1 1089 ? 24.274  33.713 15.957  1.00 42.42  ? 1086 THR A O   1 
ATOM 8375 C CB  . THR A 1 1089 ? 27.111  32.589 15.393  1.00 59.14  ? 1086 THR A CB  1 
ATOM 8376 O OG1 . THR A 1 1089 ? 26.089  31.726 15.905  1.00 59.14  ? 1086 THR A OG1 1 
ATOM 8377 C CG2 . THR A 1 1089 ? 28.217  32.668 16.428  1.00 59.14  ? 1086 THR A CG2 1 
ATOM 8378 N N   . GLY A 1 1090 ? 24.562  33.906 13.715  1.00 59.25  ? 1087 GLY A N   1 
ATOM 8379 C CA  . GLY A 1 1090 ? 23.212  33.492 13.384  1.00 59.25  ? 1087 GLY A CA  1 
ATOM 8380 C C   . GLY A 1 1090 ? 22.109  34.418 13.854  1.00 59.25  ? 1087 GLY A C   1 
ATOM 8381 O O   . GLY A 1 1090 ? 20.945  33.992 13.996  1.00 59.25  ? 1087 GLY A O   1 
ATOM 8382 N N   . PHE A 1 1091 ? 22.474  35.681 14.072  1.00 57.82  ? 1088 PHE A N   1 
ATOM 8383 C CA  . PHE A 1 1091 ? 21.524  36.721 14.452  1.00 57.82  ? 1088 PHE A CA  1 
ATOM 8384 C C   . PHE A 1 1091 ? 21.771  38.019 13.695  1.00 57.82  ? 1088 PHE A C   1 
ATOM 8385 O O   . PHE A 1 1091 ? 22.917  38.386 13.444  1.00 57.82  ? 1088 PHE A O   1 
ATOM 8386 C CB  . PHE A 1 1091 ? 21.664  37.017 15.935  1.00 57.50  ? 1088 PHE A CB  1 
ATOM 8387 C CG  . PHE A 1 1091 ? 20.914  36.092 16.808  1.00 57.50  ? 1088 PHE A CG  1 
ATOM 8388 C CD1 . PHE A 1 1091 ? 21.567  35.090 17.490  1.00 57.50  ? 1088 PHE A CD1 1 
ATOM 8389 C CD2 . PHE A 1 1091 ? 19.545  36.227 16.967  1.00 57.50  ? 1088 PHE A CD2 1 
ATOM 8390 C CE1 . PHE A 1 1091 ? 20.853  34.225 18.337  1.00 57.50  ? 1088 PHE A CE1 1 
ATOM 8391 C CE2 . PHE A 1 1091 ? 18.835  35.375 17.788  1.00 57.50  ? 1088 PHE A CE2 1 
ATOM 8392 C CZ  . PHE A 1 1091 ? 19.483  34.374 18.478  1.00 57.50  ? 1088 PHE A CZ  1 
ATOM 8393 N N   . ILE A 1 1092 ? 20.711  38.742 13.376  1.00 69.46  ? 1089 ILE A N   1 
ATOM 8394 C CA  . ILE A 1 1092 ? 20.860  39.988 12.667  1.00 69.46  ? 1089 ILE A CA  1 
ATOM 8395 C C   . ILE A 1 1092 ? 19.972  41.049 13.303  1.00 69.46  ? 1089 ILE A C   1 
ATOM 8396 O O   . ILE A 1 1092 ? 18.747  40.874 13.363  1.00 69.46  ? 1089 ILE A O   1 
ATOM 8397 C CB  . ILE A 1 1092 ? 20.488  39.793 11.180  1.00 77.65  ? 1089 ILE A CB  1 
ATOM 8398 C CG1 . ILE A 1 1092 ? 21.498  38.871 10.491  1.00 77.65  ? 1089 ILE A CG1 1 
ATOM 8399 C CG2 . ILE A 1 1092 ? 20.430  41.127 10.451  1.00 77.65  ? 1089 ILE A CG2 1 
ATOM 8400 C CD1 . ILE A 1 1092 ? 21.037  38.297 9.181   1.00 77.65  ? 1089 ILE A CD1 1 
ATOM 8401 N N   . ASP A 1 1093 ? 20.534  42.159 13.786  1.00 49.22  ? 1090 ASP A N   1 
ATOM 8402 C CA  . ASP A 1 1093 ? 19.573  43.210 14.174  1.00 49.22  ? 1090 ASP A CA  1 
ATOM 8403 C C   . ASP A 1 1093 ? 19.180  44.054 13.012  1.00 49.22  ? 1090 ASP A C   1 
ATOM 8404 O O   . ASP A 1 1093 ? 19.992  44.756 12.441  1.00 49.22  ? 1090 ASP A O   1 
ATOM 8405 C CB  . ASP A 1 1093 ? 19.905  44.068 15.430  1.00 52.44  ? 1090 ASP A CB  1 
ATOM 8406 C CG  . ASP A 1 1093 ? 21.289  44.510 15.452  1.00 52.44  ? 1090 ASP A CG  1 
ATOM 8407 O OD1 . ASP A 1 1093 ? 21.661  45.256 16.377  1.00 52.44  ? 1090 ASP A OD1 1 
ATOM 8408 O OD2 . ASP A 1 1093 ? 22.002  44.071 14.539  1.00 52.44  ? 1090 ASP A OD2 1 
ATOM 8409 N N   . GLY A 1 1094 ? 17.912  43.929 12.668  1.00 55.05  ? 1091 GLY A N   1 
ATOM 8410 C CA  . GLY A 1 1094 ? 17.268  44.893 11.827  1.00 55.05  ? 1091 GLY A CA  1 
ATOM 8411 C C   . GLY A 1 1094 ? 17.568  46.253 12.368  1.00 55.05  ? 1091 GLY A C   1 
ATOM 8412 O O   . GLY A 1 1094 ? 17.785  47.181 11.622  1.00 55.05  ? 1091 GLY A O   1 
ATOM 8413 N N   . ASP A 1 1095 ? 17.617  46.357 13.683  1.00 55.92  ? 1092 ASP A N   1 
ATOM 8414 C CA  . ASP A 1 1095 ? 17.985  47.590 14.329  1.00 55.92  ? 1092 ASP A CA  1 
ATOM 8415 C C   . ASP A 1 1095 ? 19.114  48.245 13.578  1.00 55.92  ? 1092 ASP A C   1 
ATOM 8416 O O   . ASP A 1 1095 ? 19.061  49.427 13.260  1.00 55.92  ? 1092 ASP A O   1 
ATOM 8417 C CB  . ASP A 1 1095 ? 18.387  47.300 15.759  1.00 48.67  ? 1092 ASP A CB  1 
ATOM 8418 C CG  . ASP A 1 1095 ? 17.255  47.555 16.732  1.00 48.67  ? 1092 ASP A CG  1 
ATOM 8419 O OD1 . ASP A 1 1095 ? 16.157  47.923 16.263  1.00 48.67  ? 1092 ASP A OD1 1 
ATOM 8420 O OD2 . ASP A 1 1095 ? 17.469  47.403 17.959  1.00 48.67  ? 1092 ASP A OD2 1 
ATOM 8421 N N   . LEU A 1 1096 ? 20.103  47.434 13.244  1.00 73.80  ? 1093 LEU A N   1 
ATOM 8422 C CA  . LEU A 1 1096 ? 21.266  47.873 12.505  1.00 73.80  ? 1093 LEU A CA  1 
ATOM 8423 C C   . LEU A 1 1096 ? 20.993  47.981 11.009  1.00 73.80  ? 1093 LEU A C   1 
ATOM 8424 O O   . LEU A 1 1096 ? 21.244  49.006 10.392  1.00 73.80  ? 1093 LEU A O   1 
ATOM 8425 C CB  . LEU A 1 1096 ? 22.387  46.889 12.777  1.00 46.65  ? 1093 LEU A CB  1 
ATOM 8426 C CG  . LEU A 1 1096 ? 23.805  47.263 12.401  1.00 46.65  ? 1093 LEU A CG  1 
ATOM 8427 C CD1 . LEU A 1 1096 ? 24.264  46.348 11.265  1.00 46.65  ? 1093 LEU A CD1 1 
ATOM 8428 C CD2 . LEU A 1 1096 ? 23.949  48.774 12.086  1.00 46.65  ? 1093 LEU A CD2 1 
ATOM 8429 N N   . ILE A 1 1097 ? 20.500  46.899 10.434  1.00 55.84  ? 1094 ILE A N   1 
ATOM 8430 C CA  . ILE A 1 1097 ? 20.006  46.887 9.079   1.00 55.84  ? 1094 ILE A CA  1 
ATOM 8431 C C   . ILE A 1 1097 ? 19.107  48.094 8.768   1.00 55.84  ? 1094 ILE A C   1 
ATOM 8432 O O   . ILE A 1 1097 ? 19.149  48.643 7.668   1.00 55.84  ? 1094 ILE A O   1 
ATOM 8433 C CB  . ILE A 1 1097 ? 19.168  45.634 8.880   1.00 46.91  ? 1094 ILE A CB  1 
ATOM 8434 C CG1 . ILE A 1 1097 ? 20.025  44.373 9.038   1.00 46.91  ? 1094 ILE A CG1 1 
ATOM 8435 C CG2 . ILE A 1 1097 ? 18.426  45.676 7.553   1.00 46.91  ? 1094 ILE A CG2 1 
ATOM 8436 C CD1 . ILE A 1 1097 ? 20.729  43.870 7.746   1.00 46.91  ? 1094 ILE A CD1 1 
ATOM 8437 N N   . GLU A 1 1098 ? 18.274  48.488 9.730   1.00 87.21  ? 1095 GLU A N   1 
ATOM 8438 C CA  . GLU A 1 1098 ? 17.357  49.608 9.539   1.00 87.21  ? 1095 GLU A CA  1 
ATOM 8439 C C   . GLU A 1 1098 ? 18.133  50.899 9.408   1.00 87.21  ? 1095 GLU A C   1 
ATOM 8440 O O   . GLU A 1 1098 ? 17.688  51.831 8.734   1.00 87.21  ? 1095 GLU A O   1 
ATOM 8441 C CB  . GLU A 1 1098 ? 16.345  49.706 10.685  1.00 74.25  ? 1095 GLU A CB  1 
ATOM 8442 C CG  . GLU A 1 1098 ? 15.212  48.644 10.621  1.00 74.25  ? 1095 GLU A CG  1 
ATOM 8443 C CD  . GLU A 1 1098 ? 14.045  48.859 11.627  1.00 74.25  ? 1095 GLU A CD  1 
ATOM 8444 O OE1 . GLU A 1 1098 ? 14.060  49.832 12.446  1.00 74.25  ? 1095 GLU A OE1 1 
ATOM 8445 O OE2 . GLU A 1 1098 ? 13.098  48.029 11.578  1.00 74.25  ? 1095 GLU A OE2 1 
ATOM 8446 N N   . SER A 1 1099 ? 19.304  50.936 10.043  1.00 72.61  ? 1096 SER A N   1 
ATOM 8447 C CA  . SER A 1 1099 ? 20.196  52.080 9.948   1.00 72.61  ? 1096 SER A CA  1 
ATOM 8448 C C   . SER A 1 1099 ? 20.421  52.441 8.483   1.00 72.61  ? 1096 SER A C   1 
ATOM 8449 O O   . SER A 1 1099 ? 20.406  53.617 8.127   1.00 72.61  ? 1096 SER A O   1 
ATOM 8450 C CB  . SER A 1 1099 ? 21.531  51.804 10.646  1.00 159.12 ? 1096 SER A CB  1 
ATOM 8451 O OG  . SER A 1 1099 ? 21.345  51.199 11.913  1.00 159.12 ? 1096 SER A OG  1 
ATOM 8452 N N   . PHE A 1 1100 ? 20.594  51.423 7.644   1.00 80.09  ? 1097 PHE A N   1 
ATOM 8453 C CA  . PHE A 1 1100 ? 20.767  51.584 6.203   1.00 80.09  ? 1097 PHE A CA  1 
ATOM 8454 C C   . PHE A 1 1100 ? 19.912  52.697 5.614   1.00 80.09  ? 1097 PHE A C   1 
ATOM 8455 O O   . PHE A 1 1100 ? 20.381  53.467 4.785   1.00 80.09  ? 1097 PHE A O   1 
ATOM 8456 C CB  . PHE A 1 1100 ? 20.435  50.266 5.522   1.00 90.48  ? 1097 PHE A CB  1 
ATOM 8457 C CG  . PHE A 1 1100 ? 20.647  50.258 4.043   1.00 90.48  ? 1097 PHE A CG  1 
ATOM 8458 C CD1 . PHE A 1 1100 ? 21.821  49.765 3.507   1.00 90.48  ? 1097 PHE A CD1 1 
ATOM 8459 C CD2 . PHE A 1 1100 ? 19.645  50.690 3.177   1.00 90.48  ? 1097 PHE A CD2 1 
ATOM 8460 C CE1 . PHE A 1 1100 ? 22.007  49.731 2.123   1.00 90.48  ? 1097 PHE A CE1 1 
ATOM 8461 C CE2 . PHE A 1 1100 ? 19.822  50.662 1.790   1.00 90.48  ? 1097 PHE A CE2 1 
ATOM 8462 C CZ  . PHE A 1 1100 ? 21.001  50.180 1.263   1.00 90.48  ? 1097 PHE A CZ  1 
ATOM 8463 N N   . LEU A 1 1101 ? 18.659  52.779 6.054   1.00 60.74  ? 1098 LEU A N   1 
ATOM 8464 C CA  . LEU A 1 1101 ? 17.700  53.752 5.511   1.00 60.74  ? 1098 LEU A CA  1 
ATOM 8465 C C   . LEU A 1 1101 ? 17.972  55.184 5.923   1.00 60.74  ? 1098 LEU A C   1 
ATOM 8466 O O   . LEU A 1 1101 ? 17.562  56.111 5.233   1.00 60.74  ? 1098 LEU A O   1 
ATOM 8467 C CB  . LEU A 1 1101 ? 16.271  53.382 5.906   1.00 60.49  ? 1098 LEU A CB  1 
ATOM 8468 C CG  . LEU A 1 1101 ? 15.700  52.116 5.258   1.00 60.49  ? 1098 LEU A CG  1 
ATOM 8469 C CD1 . LEU A 1 1101 ? 14.185  52.090 5.368   1.00 60.49  ? 1098 LEU A CD1 1 
ATOM 8470 C CD2 . LEU A 1 1101 ? 16.110  52.007 3.786   1.00 60.49  ? 1098 LEU A CD2 1 
ATOM 8471 N N   . ASP A 1 1102 ? 18.647  55.365 7.052   1.00 79.86  ? 1099 ASP A N   1 
ATOM 8472 C CA  . ASP A 1 1102 ? 18.949  56.697 7.557   1.00 79.86  ? 1099 ASP A CA  1 
ATOM 8473 C C   . ASP A 1 1102 ? 20.170  57.258 6.852   1.00 79.86  ? 1099 ASP A C   1 
ATOM 8474 O O   . ASP A 1 1102 ? 20.548  58.401 7.071   1.00 79.86  ? 1099 ASP A O   1 
ATOM 8475 C CB  . ASP A 1 1102 ? 19.179  56.654 9.070   1.00 116.14 ? 1099 ASP A CB  1 
ATOM 8476 C CG  . ASP A 1 1102 ? 17.902  56.374 9.850   1.00 116.14 ? 1099 ASP A CG  1 
ATOM 8477 O OD1 . ASP A 1 1102 ? 17.090  57.307 10.015  1.00 116.14 ? 1099 ASP A OD1 1 
ATOM 8478 O OD2 . ASP A 1 1102 ? 17.713  55.225 10.309  1.00 116.14 ? 1099 ASP A OD2 1 
ATOM 8479 N N   . ILE A 1 1103 ? 20.777  56.447 5.994   1.00 102.53 ? 1100 ILE A N   1 
ATOM 8480 C CA  . ILE A 1 1103 ? 22.004  56.812 5.307   1.00 102.53 ? 1100 ILE A CA  1 
ATOM 8481 C C   . ILE A 1 1103 ? 21.768  57.566 3.999   1.00 102.53 ? 1100 ILE A C   1 
ATOM 8482 O O   . ILE A 1 1103 ? 20.809  57.307 3.274   1.00 102.53 ? 1100 ILE A O   1 
ATOM 8483 C CB  . ILE A 1 1103 ? 22.869  55.568 5.094   1.00 108.04 ? 1100 ILE A CB  1 
ATOM 8484 C CG1 . ILE A 1 1103 ? 23.908  55.492 6.200   1.00 108.04 ? 1100 ILE A CG1 1 
ATOM 8485 C CG2 . ILE A 1 1103 ? 23.542  55.570 3.742   1.00 108.04 ? 1100 ILE A CG2 1 
ATOM 8486 C CD1 . ILE A 1 1103 ? 24.525  54.140 6.330   1.00 108.04 ? 1100 ILE A CD1 1 
ATOM 8487 N N   . SER A 1 1104 ? 22.659  58.512 3.725   1.00 126.44 ? 1101 SER A N   1 
ATOM 8488 C CA  . SER A 1 1104 ? 22.656  59.287 2.492   1.00 126.44 ? 1101 SER A CA  1 
ATOM 8489 C C   . SER A 1 1104 ? 23.027  58.419 1.299   1.00 126.44 ? 1101 SER A C   1 
ATOM 8490 O O   . SER A 1 1104 ? 23.908  57.568 1.405   1.00 126.44 ? 1101 SER A O   1 
ATOM 8491 C CB  . SER A 1 1104 ? 23.695  60.382 2.618   1.00 64.15  ? 1101 SER A CB  1 
ATOM 8492 O OG  . SER A 1 1104 ? 24.969  59.784 2.806   1.00 64.15  ? 1101 SER A OG  1 
ATOM 8493 N N   . ARG A 1 1105 ? 22.389  58.662 0.157   1.00 188.50 ? 1102 ARG A N   1 
ATOM 8494 C CA  . ARG A 1 1105 ? 22.664  57.879 -1.050  1.00 188.50 ? 1102 ARG A CA  1 
ATOM 8495 C C   . ARG A 1 1105 ? 24.162  57.674 -1.327  1.00 188.50 ? 1102 ARG A C   1 
ATOM 8496 O O   . ARG A 1 1105 ? 24.574  56.563 -1.662  1.00 188.50 ? 1102 ARG A O   1 
ATOM 8497 C CB  . ARG A 1 1105 ? 21.945  58.445 -2.282  1.00 139.25 ? 1102 ARG A CB  1 
ATOM 8498 C CG  . ARG A 1 1105 ? 22.073  57.540 -3.506  1.00 139.25 ? 1102 ARG A CG  1 
ATOM 8499 C CD  . ARG A 1 1105 ? 20.986  57.775 -4.533  1.00 139.25 ? 1102 ARG A CD  1 
ATOM 8500 N NE  . ARG A 1 1105 ? 20.545  56.498 -5.092  1.00 139.25 ? 1102 ARG A NE  1 
ATOM 8501 C CZ  . ARG A 1 1105 ? 19.740  56.375 -6.146  1.00 139.25 ? 1102 ARG A CZ  1 
ATOM 8502 N NH1 . ARG A 1 1105 ? 19.282  57.458 -6.791  1.00 139.25 ? 1102 ARG A NH1 1 
ATOM 8503 N NH2 . ARG A 1 1105 ? 19.400  55.159 -6.556  1.00 139.25 ? 1102 ARG A NH2 1 
ATOM 8504 N N   . PRO A 1 1106 ? 24.973  58.744 -1.210  1.00 108.33 ? 1103 PRO A N   1 
ATOM 8505 C CA  . PRO A 1 1106 ? 26.432  58.578 -1.287  1.00 108.33 ? 1103 PRO A CA  1 
ATOM 8506 C C   . PRO A 1 1106 ? 26.962  57.420 -0.438  1.00 108.33 ? 1103 PRO A C   1 
ATOM 8507 O O   . PRO A 1 1106 ? 27.523  56.467 -0.982  1.00 108.33 ? 1103 PRO A O   1 
ATOM 8508 C CB  . PRO A 1 1106 ? 26.981  59.917 -0.770  1.00 95.39  ? 1103 PRO A CB  1 
ATOM 8509 C CG  . PRO A 1 1106 ? 25.775  60.754 -0.386  1.00 95.39  ? 1103 PRO A CG  1 
ATOM 8510 C CD  . PRO A 1 1106 ? 24.593  60.161 -1.065  1.00 95.39  ? 1103 PRO A CD  1 
ATOM 8511 N N   . LYS A 1 1107 ? 26.753  57.499 0.875   1.00 107.85 ? 1104 LYS A N   1 
ATOM 8512 C CA  . LYS A 1 1107 ? 27.243  56.494 1.823   1.00 107.85 ? 1104 LYS A CA  1 
ATOM 8513 C C   . LYS A 1 1107 ? 26.561  55.154 1.598   1.00 107.85 ? 1104 LYS A C   1 
ATOM 8514 O O   . LYS A 1 1107 ? 26.987  54.128 2.115   1.00 107.85 ? 1104 LYS A O   1 
ATOM 8515 C CB  . LYS A 1 1107 ? 27.029  56.965 3.265   1.00 182.39 ? 1104 LYS A CB  1 
ATOM 8516 C CG  . LYS A 1 1107 ? 27.454  58.407 3.556   1.00 182.39 ? 1104 LYS A CG  1 
ATOM 8517 C CD  . LYS A 1 1107 ? 28.923  58.676 3.241   1.00 182.39 ? 1104 LYS A CD  1 
ATOM 8518 C CE  . LYS A 1 1107 ? 29.244  60.168 3.280   1.00 182.39 ? 1104 LYS A CE  1 
ATOM 8519 N NZ  . LYS A 1 1107 ? 28.556  60.936 2.204   1.00 182.39 ? 1104 LYS A NZ  1 
ATOM 8520 N N   . MET A 1 1108 ? 25.514  55.192 0.788   1.00 74.06  ? 1105 MET A N   1 
ATOM 8521 C CA  . MET A 1 1108 ? 24.675  54.047 0.490   1.00 74.06  ? 1105 MET A CA  1 
ATOM 8522 C C   . MET A 1 1108 ? 25.171  53.269 -0.715  1.00 74.06  ? 1105 MET A C   1 
ATOM 8523 O O   . MET A 1 1108 ? 25.181  52.031 -0.711  1.00 74.06  ? 1105 MET A O   1 
ATOM 8524 C CB  . MET A 1 1108 ? 23.270  54.541 0.195   1.00 86.76  ? 1105 MET A CB  1 
ATOM 8525 C CG  . MET A 1 1108 ? 22.188  53.538 0.451   1.00 86.76  ? 1105 MET A CG  1 
ATOM 8526 S SD  . MET A 1 1108 ? 20.584  54.237 0.041   1.00 86.76  ? 1105 MET A SD  1 
ATOM 8527 C CE  . MET A 1 1108 ? 20.518  55.719 1.067   1.00 86.76  ? 1105 MET A CE  1 
ATOM 8528 N N   . GLN A 1 1109 ? 25.553  54.004 -1.762  1.00 101.12 ? 1106 GLN A N   1 
ATOM 8529 C CA  . GLN A 1 1109 ? 26.120  53.403 -2.966  1.00 101.12 ? 1106 GLN A CA  1 
ATOM 8530 C C   . GLN A 1 1109 ? 27.300  52.557 -2.555  1.00 101.12 ? 1106 GLN A C   1 
ATOM 8531 O O   . GLN A 1 1109 ? 27.383  51.388 -2.917  1.00 101.12 ? 1106 GLN A O   1 
ATOM 8532 C CB  . GLN A 1 1109 ? 26.543  54.478 -3.974  1.00 98.31  ? 1106 GLN A CB  1 
ATOM 8533 C CG  . GLN A 1 1109 ? 25.389  55.082 -4.785  1.00 98.31  ? 1106 GLN A CG  1 
ATOM 8534 C CD  . GLN A 1 1109 ? 24.630  54.050 -5.632  1.00 98.31  ? 1106 GLN A CD  1 
ATOM 8535 O OE1 . GLN A 1 1109 ? 25.121  52.941 -5.890  1.00 98.31  ? 1106 GLN A OE1 1 
ATOM 8536 N NE2 . GLN A 1 1109 ? 23.426  54.419 -6.068  1.00 98.31  ? 1106 GLN A NE2 1 
ATOM 8537 N N   . GLU A 1 1110 ? 28.181  53.171 -1.764  1.00 87.83  ? 1107 GLU A N   1 
ATOM 8538 C CA  . GLU A 1 1110 ? 29.312  52.514 -1.103  1.00 87.83  ? 1107 GLU A CA  1 
ATOM 8539 C C   . GLU A 1 1110 ? 29.036  51.106 -0.618  1.00 87.83  ? 1107 GLU A C   1 
ATOM 8540 O O   . GLU A 1 1110 ? 29.813  50.188 -0.878  1.00 87.83  ? 1107 GLU A O   1 
ATOM 8541 C CB  . GLU A 1 1110 ? 29.727  53.312 0.121   1.00 88.02  ? 1107 GLU A CB  1 
ATOM 8542 C CG  . GLU A 1 1110 ? 30.095  54.742 -0.150  1.00 88.02  ? 1107 GLU A CG  1 
ATOM 8543 C CD  . GLU A 1 1110 ? 30.854  55.339 1.013   1.00 88.02  ? 1107 GLU A CD  1 
ATOM 8544 O OE1 . GLU A 1 1110 ? 31.689  54.609 1.601   1.00 88.02  ? 1107 GLU A OE1 1 
ATOM 8545 O OE2 . GLU A 1 1110 ? 30.612  56.524 1.345   1.00 88.02  ? 1107 GLU A OE2 1 
ATOM 8546 N N   . VAL A 1 1111 ? 27.932  50.958 0.107   1.00 114.81 ? 1108 VAL A N   1 
ATOM 8547 C CA  . VAL A 1 1111 ? 27.548  49.700 0.729   1.00 114.81 ? 1108 VAL A CA  1 
ATOM 8548 C C   . VAL A 1 1111 ? 27.405  48.616 -0.332  1.00 114.81 ? 1108 VAL A C   1 
ATOM 8549 O O   . VAL A 1 1111 ? 27.185  47.447 -0.036  1.00 114.81 ? 1108 VAL A O   1 
ATOM 8550 C CB  . VAL A 1 1111 ? 26.253  49.877 1.549   1.00 103.35 ? 1108 VAL A CB  1 
ATOM 8551 C CG1 . VAL A 1 1111 ? 26.047  48.721 2.494   1.00 103.35 ? 1108 VAL A CG1 1 
ATOM 8552 C CG2 . VAL A 1 1111 ? 26.316  51.164 2.348   1.00 103.35 ? 1108 VAL A CG2 1 
ATOM 8553 N N   . VAL A 1 1112 ? 27.553  49.018 -1.585  1.00 130.40 ? 1109 VAL A N   1 
ATOM 8554 C CA  . VAL A 1 1112 ? 27.594  48.064 -2.671  1.00 130.40 ? 1109 VAL A CA  1 
ATOM 8555 C C   . VAL A 1 1112 ? 28.769  48.298 -3.622  1.00 130.40 ? 1109 VAL A C   1 
ATOM 8556 O O   . VAL A 1 1112 ? 28.967  49.396 -4.152  1.00 130.40 ? 1109 VAL A O   1 
ATOM 8557 C CB  . VAL A 1 1112 ? 26.298  48.084 -3.495  1.00 61.66  ? 1109 VAL A CB  1 
ATOM 8558 C CG1 . VAL A 1 1112 ? 26.251  46.870 -4.413  1.00 61.66  ? 1109 VAL A CG1 1 
ATOM 8559 C CG2 . VAL A 1 1112 ? 25.050  48.193 -2.589  1.00 61.66  ? 1109 VAL A CG2 1 
ATOM 8560 N N   . ALA A 1 1113 ? 29.556  47.249 -3.804  1.00 156.17 ? 1110 ALA A N   1 
ATOM 8561 C CA  . ALA A 1 1113 ? 30.379  47.104 -4.981  1.00 156.17 ? 1110 ALA A CA  1 
ATOM 8562 C C   . ALA A 1 1113 ? 29.854  45.854 -5.665  1.00 156.17 ? 1110 ALA A C   1 
ATOM 8563 O O   . ALA A 1 1113 ? 30.120  45.617 -6.843  1.00 156.17 ? 1110 ALA A O   1 
ATOM 8564 C CB  . ALA A 1 1113 ? 31.802  46.951 -4.609  1.00 55.66  ? 1110 ALA A CB  1 
ATOM 8565 N N   . ASN A 1 1114 ? 29.112  45.060 -4.888  1.00 91.12  ? 1111 ASN A N   1 
ATOM 8566 C CA  . ASN A 1 1114 ? 28.264  43.957 -5.381  1.00 91.12  ? 1111 ASN A CA  1 
ATOM 8567 C C   . ASN A 1 1114 ? 27.249  43.486 -4.328  1.00 91.12  ? 1111 ASN A C   1 
ATOM 8568 O O   . ASN A 1 1114 ? 26.894  42.308 -4.261  1.00 91.12  ? 1111 ASN A O   1 
ATOM 8569 C CB  . ASN A 1 1114 ? 29.106  42.778 -5.870  1.00 125.64 ? 1111 ASN A CB  1 
ATOM 8570 C CG  . ASN A 1 1114 ? 30.242  42.446 -4.923  1.00 125.64 ? 1111 ASN A CG  1 
ATOM 8571 O OD1 . ASN A 1 1114 ? 30.841  43.341 -4.311  1.00 125.64 ? 1111 ASN A OD1 1 
ATOM 8572 N ND2 . ASN A 1 1114 ? 30.553  41.157 -4.802  1.00 125.64 ? 1111 ASN A ND2 1 
ATOM 8573 N N   . ARG A 1 1125 ? 21.830  35.256 -9.770  1.00 99.37  ? 1122 ARG A N   1 
ATOM 8574 C CA  . ARG A 1 1125 ? 22.059  36.269 -8.733  1.00 99.37  ? 1122 ARG A CA  1 
ATOM 8575 C C   . ARG A 1 1125 ? 22.825  37.524 -9.228  1.00 99.37  ? 1122 ARG A C   1 
ATOM 8576 O O   . ARG A 1 1125 ? 23.656  37.445 -10.153 1.00 99.37  ? 1122 ARG A O   1 
ATOM 8577 C CB  . ARG A 1 1125 ? 22.749  35.648 -7.511  1.00 137.00 ? 1122 ARG A CB  1 
ATOM 8578 C CG  . ARG A 1 1125 ? 24.182  35.209 -7.758  1.00 137.00 ? 1122 ARG A CG  1 
ATOM 8579 C CD  . ARG A 1 1125 ? 25.062  35.672 -6.609  1.00 137.00 ? 1122 ARG A CD  1 
ATOM 8580 N NE  . ARG A 1 1125 ? 26.464  35.853 -6.997  1.00 137.00 ? 1122 ARG A NE  1 
ATOM 8581 C CZ  . ARG A 1 1125 ? 26.964  36.954 -7.568  1.00 137.00 ? 1122 ARG A CZ  1 
ATOM 8582 N NH1 . ARG A 1 1125 ? 26.179  37.996 -7.848  1.00 137.00 ? 1122 ARG A NH1 1 
ATOM 8583 N NH2 . ARG A 1 1125 ? 28.258  37.011 -7.868  1.00 137.00 ? 1122 ARG A NH2 1 
ATOM 8584 N N   . GLU A 1 1126 ? 22.538  38.666 -8.586  1.00 163.90 ? 1123 GLU A N   1 
ATOM 8585 C CA  . GLU A 1 1126 ? 23.037  39.985 -9.011  1.00 163.90 ? 1123 GLU A CA  1 
ATOM 8586 C C   . GLU A 1 1126 ? 23.399  40.911 -7.835  1.00 163.90 ? 1123 GLU A C   1 
ATOM 8587 O O   . GLU A 1 1126 ? 23.612  40.446 -6.712  1.00 163.90 ? 1123 GLU A O   1 
ATOM 8588 C CB  . GLU A 1 1126 ? 22.000  40.659 -9.918  1.00 150.33 ? 1123 GLU A CB  1 
ATOM 8589 C CG  . GLU A 1 1126 ? 22.588  41.626 -10.941 1.00 150.33 ? 1123 GLU A CG  1 
ATOM 8590 C CD  . GLU A 1 1126 ? 21.526  42.380 -11.722 1.00 150.33 ? 1123 GLU A CD  1 
ATOM 8591 O OE1 . GLU A 1 1126 ? 20.427  42.631 -11.178 1.00 150.33 ? 1123 GLU A OE1 1 
ATOM 8592 O OE2 . GLU A 1 1126 ? 21.798  42.729 -12.889 1.00 150.33 ? 1123 GLU A OE2 1 
ATOM 8593 N N   . ALA A 1 1127 ? 23.462  42.218 -8.115  1.00 162.24 ? 1124 ALA A N   1 
ATOM 8594 C CA  . ALA A 1 1127 ? 23.830  43.251 -7.142  1.00 162.24 ? 1124 ALA A CA  1 
ATOM 8595 C C   . ALA A 1 1127 ? 23.555  44.656 -7.693  1.00 162.24 ? 1124 ALA A C   1 
ATOM 8596 O O   . ALA A 1 1127 ? 24.140  45.044 -8.709  1.00 162.24 ? 1124 ALA A O   1 
ATOM 8597 C CB  . ALA A 1 1127 ? 25.284  43.123 -6.796  1.00 126.07 ? 1124 ALA A CB  1 
ATOM 8598 N N   . THR A 1 1128 ? 22.685  45.420 -7.025  1.00 122.25 ? 1125 THR A N   1 
ATOM 8599 C CA  . THR A 1 1128 ? 22.286  46.751 -7.527  1.00 122.25 ? 1125 THR A CA  1 
ATOM 8600 C C   . THR A 1 1128 ? 22.795  47.902 -6.663  1.00 122.25 ? 1125 THR A C   1 
ATOM 8601 O O   . THR A 1 1128 ? 23.987  47.975 -6.389  1.00 122.25 ? 1125 THR A O   1 
ATOM 8602 C CB  . THR A 1 1128 ? 20.749  46.845 -7.830  1.00 75.20  ? 1125 THR A CB  1 
ATOM 8603 O OG1 . THR A 1 1128 ? 20.434  45.969 -8.922  1.00 75.20  ? 1125 THR A OG1 1 
ATOM 8604 C CG2 . THR A 1 1128 ? 20.291  48.288 -8.210  1.00 75.20  ? 1125 THR A CG2 1 
ATOM 8605 N N   . ALA A 1 1129 ? 21.891  48.789 -6.246  1.00 102.79 ? 1126 ALA A N   1 
ATOM 8606 C CA  . ALA A 1 1129 ? 22.254  50.091 -5.686  1.00 102.79 ? 1126 ALA A CA  1 
ATOM 8607 C C   . ALA A 1 1129 ? 21.124  50.694 -4.845  1.00 102.79 ? 1126 ALA A C   1 
ATOM 8608 O O   . ALA A 1 1129 ? 21.359  51.413 -3.874  1.00 102.79 ? 1126 ALA A O   1 
ATOM 8609 C CB  . ALA A 1 1129 ? 22.642  51.050 -6.818  1.00 131.30 ? 1126 ALA A CB  1 
ATOM 8610 N N   . ASP A 1 1130 ? 19.897  50.399 -5.242  1.00 98.23  ? 1127 ASP A N   1 
ATOM 8611 C CA  . ASP A 1 1130 ? 18.704  50.913 -4.587  1.00 98.23  ? 1127 ASP A CA  1 
ATOM 8612 C C   . ASP A 1 1130 ? 17.705  49.766 -4.523  1.00 98.23  ? 1127 ASP A C   1 
ATOM 8613 O O   . ASP A 1 1130 ? 16.567  49.913 -4.072  1.00 98.23  ? 1127 ASP A O   1 
ATOM 8614 C CB  . ASP A 1 1130 ? 18.139  52.099 -5.373  1.00 146.05 ? 1127 ASP A CB  1 
ATOM 8615 C CG  . ASP A 1 1130 ? 18.523  52.063 -6.852  1.00 146.05 ? 1127 ASP A CG  1 
ATOM 8616 O OD1 . ASP A 1 1130 ? 19.020  51.025 -7.349  1.00 146.05 ? 1127 ASP A OD1 1 
ATOM 8617 O OD2 . ASP A 1 1130 ? 18.331  53.097 -7.525  1.00 146.05 ? 1127 ASP A OD2 1 
ATOM 8618 N N   . ASP A 1 1131 ? 18.159  48.612 -4.996  1.00 133.87 ? 1128 ASP A N   1 
ATOM 8619 C CA  . ASP A 1 1131 ? 17.393  47.393 -4.914  1.00 133.87 ? 1128 ASP A CA  1 
ATOM 8620 C C   . ASP A 1 1131 ? 17.163  47.071 -3.445  1.00 133.87 ? 1128 ASP A C   1 
ATOM 8621 O O   . ASP A 1 1131 ? 16.086  46.635 -3.054  1.00 133.87 ? 1128 ASP A O   1 
ATOM 8622 C CB  . ASP A 1 1131 ? 18.173  46.261 -5.578  1.00 138.11 ? 1128 ASP A CB  1 
ATOM 8623 C CG  . ASP A 1 1131 ? 17.336  45.469 -6.573  1.00 138.11 ? 1128 ASP A CG  1 
ATOM 8624 O OD1 . ASP A 1 1131 ? 16.783  46.091 -7.516  1.00 138.11 ? 1128 ASP A OD1 1 
ATOM 8625 O OD2 . ASP A 1 1131 ? 17.249  44.220 -6.429  1.00 138.11 ? 1128 ASP A OD2 1 
ATOM 8626 N N   . LEU A 1 1132 ? 18.185  47.317 -2.633  1.00 71.50  ? 1129 LEU A N   1 
ATOM 8627 C CA  . LEU A 1 1132 ? 18.186  46.903 -1.230  1.00 71.50  ? 1129 LEU A CA  1 
ATOM 8628 C C   . LEU A 1 1132 ? 17.371  47.834 -0.368  1.00 71.50  ? 1129 LEU A C   1 
ATOM 8629 O O   . LEU A 1 1132 ? 16.663  47.394 0.555   1.00 71.50  ? 1129 LEU A O   1 
ATOM 8630 C CB  . LEU A 1 1132 ? 19.619  46.795 -0.703  1.00 80.93  ? 1129 LEU A CB  1 
ATOM 8631 C CG  . LEU A 1 1132 ? 20.305  45.477 -1.106  1.00 80.93  ? 1129 LEU A CG  1 
ATOM 8632 C CD1 . LEU A 1 1132 ? 19.624  44.294 -0.422  1.00 80.93  ? 1129 LEU A CD1 1 
ATOM 8633 C CD2 . LEU A 1 1132 ? 20.406  45.219 -2.647  1.00 80.93  ? 1129 LEU A CD2 1 
ATOM 8634 N N   . ILE A 1 1133 ? 17.464  49.121 -0.687  1.00 89.41  ? 1130 ILE A N   1 
ATOM 8635 C CA  . ILE A 1 1133 ? 16.605  50.102 -0.063  1.00 89.41  ? 1130 ILE A CA  1 
ATOM 8636 C C   . ILE A 1 1133 ? 15.160  49.580 -0.039  1.00 89.41  ? 1130 ILE A C   1 
ATOM 8637 O O   . ILE A 1 1133 ? 14.481  49.727 0.979   1.00 89.41  ? 1130 ILE A O   1 
ATOM 8638 C CB  . ILE A 1 1133 ? 16.764  51.514 -0.700  1.00 99.04  ? 1130 ILE A CB  1 
ATOM 8639 C CG1 . ILE A 1 1133 ? 16.284  52.594 0.267   1.00 99.04  ? 1130 ILE A CG1 1 
ATOM 8640 C CG2 . ILE A 1 1133 ? 16.030  51.623 -2.028  1.00 99.04  ? 1130 ILE A CG2 1 
ATOM 8641 C CD1 . ILE A 1 1133 ? 16.973  53.920 0.077   1.00 99.04  ? 1130 ILE A CD1 1 
ATOM 8642 N N   . LYS A 1 1134 ? 14.721  48.923 -1.120  1.00 92.56  ? 1131 LYS A N   1 
ATOM 8643 C CA  . LYS A 1 1134 ? 13.434  48.197 -1.114  1.00 92.56  ? 1131 LYS A CA  1 
ATOM 8644 C C   . LYS A 1 1134 ? 13.381  47.120 -0.014  1.00 92.56  ? 1131 LYS A C   1 
ATOM 8645 O O   . LYS A 1 1134 ? 12.550  47.193 0.898   1.00 92.56  ? 1131 LYS A O   1 
ATOM 8646 C CB  . LYS A 1 1134 ? 13.120  47.549 -2.474  1.00 152.01 ? 1131 LYS A CB  1 
ATOM 8647 C CG  . LYS A 1 1134 ? 11.864  46.656 -2.442  1.00 152.01 ? 1131 LYS A CG  1 
ATOM 8648 C CD  . LYS A 1 1134 ? 12.166  45.202 -2.854  1.00 152.01 ? 1131 LYS A CD  1 
ATOM 8649 C CE  . LYS A 1 1134 ? 11.485  44.816 -4.169  1.00 152.01 ? 1131 LYS A CE  1 
ATOM 8650 N NZ  . LYS A 1 1134 ? 11.821  45.746 -5.300  1.00 152.01 ? 1131 LYS A NZ  1 
ATOM 8651 N N   . VAL A 1 1135 ? 14.270  46.132 -0.118  1.00 83.10  ? 1132 VAL A N   1 
ATOM 8652 C CA  . VAL A 1 1135 ? 14.332  45.008 0.810   1.00 83.10  ? 1132 VAL A CA  1 
ATOM 8653 C C   . VAL A 1 1135 ? 14.221  45.484 2.248   1.00 83.10  ? 1132 VAL A C   1 
ATOM 8654 O O   . VAL A 1 1135 ? 13.573  44.842 3.074   1.00 83.10  ? 1132 VAL A O   1 
ATOM 8655 C CB  . VAL A 1 1135 ? 15.658  44.227 0.652   1.00 88.78  ? 1132 VAL A CB  1 
ATOM 8656 C CG1 . VAL A 1 1135 ? 15.786  43.133 1.707   1.00 88.78  ? 1132 VAL A CG1 1 
ATOM 8657 C CG2 . VAL A 1 1135 ? 15.770  43.638 -0.740  1.00 88.78  ? 1132 VAL A CG2 1 
ATOM 8658 N N   . VAL A 1 1136 ? 14.843  46.619 2.538   1.00 97.79  ? 1133 VAL A N   1 
ATOM 8659 C CA  . VAL A 1 1136 ? 14.932  47.083 3.904   1.00 97.79  ? 1133 VAL A CA  1 
ATOM 8660 C C   . VAL A 1 1136 ? 13.632  47.692 4.398   1.00 97.79  ? 1133 VAL A C   1 
ATOM 8661 O O   . VAL A 1 1136 ? 13.331  47.639 5.592   1.00 97.79  ? 1133 VAL A O   1 
ATOM 8662 C CB  . VAL A 1 1136 ? 16.102  48.024 4.079   1.00 62.80  ? 1133 VAL A CB  1 
ATOM 8663 C CG1 . VAL A 1 1136 ? 16.082  48.667 5.460   1.00 62.80  ? 1133 VAL A CG1 1 
ATOM 8664 C CG2 . VAL A 1 1136 ? 17.382  47.246 3.887   1.00 62.80  ? 1133 VAL A CG2 1 
ATOM 8665 N N   . GLU A 1 1137 ? 12.848  48.256 3.489   1.00 87.45  ? 1134 GLU A N   1 
ATOM 8666 C CA  . GLU A 1 1137 ? 11.490  48.647 3.858   1.00 87.45  ? 1134 GLU A CA  1 
ATOM 8667 C C   . GLU A 1 1137 ? 10.660  47.387 4.041   1.00 87.45  ? 1134 GLU A C   1 
ATOM 8668 O O   . GLU A 1 1137 ? 9.989   47.214 5.066   1.00 87.45  ? 1134 GLU A O   1 
ATOM 8669 C CB  . GLU A 1 1137 ? 10.839  49.510 2.791   1.00 108.33 ? 1134 GLU A CB  1 
ATOM 8670 C CG  . GLU A 1 1137 ? 11.640  50.696 2.327   1.00 108.33 ? 1134 GLU A CG  1 
ATOM 8671 C CD  . GLU A 1 1137 ? 11.136  51.206 0.982   1.00 108.33 ? 1134 GLU A CD  1 
ATOM 8672 O OE1 . GLU A 1 1137 ? 10.764  50.375 0.113   1.00 108.33 ? 1134 GLU A OE1 1 
ATOM 8673 O OE2 . GLU A 1 1137 ? 11.104  52.440 0.790   1.00 108.33 ? 1134 GLU A OE2 1 
ATOM 8674 N N   . GLU A 1 1138 ? 10.728  46.499 3.053   1.00 106.41 ? 1135 GLU A N   1 
ATOM 8675 C CA  . GLU A 1 1138 ? 9.962   45.273 3.101   1.00 106.41 ? 1135 GLU A CA  1 
ATOM 8676 C C   . GLU A 1 1138 ? 10.395  44.475 4.324   1.00 106.41 ? 1135 GLU A C   1 
ATOM 8677 O O   . GLU A 1 1138 ? 10.112  43.286 4.437   1.00 106.41 ? 1135 GLU A O   1 
ATOM 8678 C CB  . GLU A 1 1138 ? 10.104  44.463 1.804   1.00 175.85 ? 1135 GLU A CB  1 
ATOM 8679 C CG  . GLU A 1 1138 ? 8.782   43.678 1.457   1.00 175.85 ? 1135 GLU A CG  1 
ATOM 8680 C CD  . GLU A 1 1138 ? 9.159   42.496 0.470   1.00 175.85 ? 1135 GLU A CD  1 
ATOM 8681 O OE1 . GLU A 1 1138 ? 8.335   41.302 0.705   1.00 175.85 ? 1135 GLU A OE1 1 
ATOM 8682 O OE2 . GLU A 1 1138 ? 9.969   42.766 -0.479  1.00 175.85 ? 1135 GLU A OE2 1 
ATOM 8683 N N   . LEU A 1 1139 ? 11.076  45.146 5.246   1.00 86.08  ? 1136 LEU A N   1 
ATOM 8684 C CA  . LEU A 1 1139 ? 11.440  44.536 6.508   1.00 86.08  ? 1136 LEU A CA  1 
ATOM 8685 C C   . LEU A 1 1139 ? 10.849  45.261 7.675   1.00 86.08  ? 1136 LEU A C   1 
ATOM 8686 O O   . LEU A 1 1139 ? 10.087  44.670 8.406   1.00 86.08  ? 1136 LEU A O   1 
ATOM 8687 C CB  . LEU A 1 1139 ? 12.940  44.399 6.658   1.00 70.66  ? 1136 LEU A CB  1 
ATOM 8688 C CG  . LEU A 1 1139 ? 13.411  43.086 6.046   1.00 70.66  ? 1136 LEU A CG  1 
ATOM 8689 C CD1 . LEU A 1 1139 ? 14.869  43.195 5.697   1.00 70.66  ? 1136 LEU A CD1 1 
ATOM 8690 C CD2 . LEU A 1 1139 ? 13.177  41.922 6.979   1.00 70.66  ? 1136 LEU A CD2 1 
ATOM 8691 N N   . THR A 1 1140 ? 11.175  46.537 7.850   1.00 77.22  ? 1137 THR A N   1 
ATOM 8692 C CA  . THR A 1 1140 ? 10.507  47.352 8.873   1.00 77.22  ? 1137 THR A CA  1 
ATOM 8693 C C   . THR A 1 1140 ? 9.071   46.892 9.066   1.00 77.22  ? 1137 THR A C   1 
ATOM 8694 O O   . THR A 1 1140 ? 8.638   46.633 10.183  1.00 77.22  ? 1137 THR A O   1 
ATOM 8695 C CB  . THR A 1 1140 ? 10.381  48.797 8.434   1.00 59.84  ? 1137 THR A CB  1 
ATOM 8696 O OG1 . THR A 1 1140 ? 9.968   48.802 7.059   1.00 59.84  ? 1137 THR A OG1 1 
ATOM 8697 C CG2 . THR A 1 1140 ? 11.712  49.561 8.608   1.00 59.84  ? 1137 THR A CG2 1 
ATOM 8698 N N   . ARG A 1 1141 ? 8.346   46.785 7.953   1.00 75.47  ? 1138 ARG A N   1 
ATOM 8699 C CA  . ARG A 1 1141 ? 6.935   46.396 7.950   1.00 75.47  ? 1138 ARG A CA  1 
ATOM 8700 C C   . ARG A 1 1141 ? 6.647   44.993 8.535   1.00 75.47  ? 1138 ARG A C   1 
ATOM 8701 O O   . ARG A 1 1141 ? 5.524   44.497 8.466   1.00 75.47  ? 1138 ARG A O   1 
ATOM 8702 C CB  . ARG A 1 1141 ? 6.358   46.563 6.540   1.00 121.93 ? 1138 ARG A CB  1 
ATOM 8703 C CG  . ARG A 1 1141 ? 6.300   48.027 6.079   1.00 121.93 ? 1138 ARG A CG  1 
ATOM 8704 C CD  . ARG A 1 1141 ? 5.608   48.163 4.732   1.00 121.93 ? 1138 ARG A CD  1 
ATOM 8705 N NE  . ARG A 1 1141 ? 6.477   47.750 3.618   1.00 121.93 ? 1138 ARG A NE  1 
ATOM 8706 C CZ  . ARG A 1 1141 ? 6.117   46.885 2.657   1.00 121.93 ? 1138 ARG A CZ  1 
ATOM 8707 N NH1 . ARG A 1 1141 ? 4.897   46.308 2.662   1.00 121.93 ? 1138 ARG A NH1 1 
ATOM 8708 N NH2 . ARG A 1 1141 ? 6.987   46.581 1.692   1.00 121.93 ? 1138 ARG A NH2 1 
ATOM 8709 N N   . ILE A 1 1142 ? 7.661   44.379 9.137   1.00 67.63  ? 1139 ILE A N   1 
ATOM 8710 C CA  . ILE A 1 1142 ? 7.528   43.091 9.833   1.00 67.63  ? 1139 ILE A CA  1 
ATOM 8711 C C   . ILE A 1 1142 ? 7.037   43.252 11.277  1.00 67.63  ? 1139 ILE A C   1 
ATOM 8712 O O   . ILE A 1 1142 ? 6.744   42.259 11.956  1.00 67.63  ? 1139 ILE A O   1 
ATOM 8713 C CB  . ILE A 1 1142 ? 8.859   42.301 9.768   1.00 83.16  ? 1139 ILE A CB  1 
ATOM 8714 C CG1 . ILE A 1 1142 ? 8.924   41.526 8.447   1.00 83.16  ? 1139 ILE A CG1 1 
ATOM 8715 C CG2 . ILE A 1 1142 ? 9.058   41.386 10.973  1.00 83.16  ? 1139 ILE A CG2 1 
ATOM 8716 C CD1 . ILE A 1 1142 ? 10.179  40.703 8.280   1.00 83.16  ? 1139 ILE A CD1 1 
ATOM 8717 N N   . HIS A 1 1143 ? 6.943   44.503 11.735  1.00 62.65  ? 1140 HIS A N   1 
ATOM 8718 C CA  . HIS A 1 1143 ? 6.272   44.836 12.994  1.00 62.65  ? 1140 HIS A CA  1 
ATOM 8719 C C   . HIS A 1 1143 ? 5.650   46.227 12.870  1.00 62.65  ? 1140 HIS A C   1 
ATOM 8720 O O   . HIS A 1 1143 ? 6.291   47.187 12.415  1.00 62.65  ? 1140 HIS A O   1 
ATOM 8721 C CB  . HIS A 1 1143 ? 7.256   44.815 14.161  1.00 59.95  ? 1140 HIS A CB  1 
ATOM 8722 C CG  . HIS A 1 1143 ? 8.265   45.919 14.104  1.00 59.95  ? 1140 HIS A CG  1 
ATOM 8723 N ND1 . HIS A 1 1143 ? 9.323   45.914 13.218  1.00 59.95  ? 1140 HIS A ND1 1 
ATOM 8724 C CD2 . HIS A 1 1143 ? 8.354   47.085 14.789  1.00 59.95  ? 1140 HIS A CD2 1 
ATOM 8725 C CE1 . HIS A 1 1143 ? 10.034  47.017 13.374  1.00 59.95  ? 1140 HIS A CE1 1 
ATOM 8726 N NE2 . HIS A 1 1143 ? 9.467   47.744 14.321  1.00 59.95  ? 1140 HIS A NE2 1 
ATOM 8727 N N   . SER B 2 1    ? 15.964  32.859 50.026  1.00 37.25  ? 13   SER B N   1 
ATOM 8728 C CA  . SER B 2 1    ? 14.926  32.188 49.233  1.00 37.25  ? 13   SER B CA  1 
ATOM 8729 C C   . SER B 2 1    ? 14.963  32.435 47.703  1.00 37.25  ? 13   SER B C   1 
ATOM 8730 O O   . SER B 2 1    ? 15.064  33.618 47.280  1.00 54.41  ? 13   SER B O   1 
ATOM 8731 C CB  . SER B 2 1    ? 13.545  32.629 49.699  1.00 37.25  ? 13   SER B CB  1 
ATOM 8732 O OG  . SER B 2 1    ? 12.604  32.279 48.672  1.00 37.25  ? 13   SER B OG  1 
ATOM 8733 N N   . VAL B 2 2    ? 14.867  31.374 46.909  1.00 37.25  ? 14   VAL B N   1 
ATOM 8734 C CA  . VAL B 2 2    ? 14.861  31.515 45.461  1.00 37.25  ? 14   VAL B CA  1 
ATOM 8735 C C   . VAL B 2 2    ? 13.807  32.545 45.077  1.00 37.25  ? 14   VAL B C   1 
ATOM 8736 O O   . VAL B 2 2    ? 13.899  33.185 44.029  1.00 52.16  ? 14   VAL B O   1 
ATOM 8737 C CB  . VAL B 2 2    ? 14.548  30.181 44.762  1.00 37.25  ? 14   VAL B CB  1 
ATOM 8738 C CG1 . VAL B 2 2    ? 15.631  29.157 45.064  1.00 37.25  ? 14   VAL B CG1 1 
ATOM 8739 C CG2 . VAL B 2 2    ? 13.182  29.665 45.191  1.00 37.25  ? 14   VAL B CG2 1 
ATOM 8740 N N   . VAL B 2 3    ? 12.807  32.701 45.940  1.00 37.25  ? 15   VAL B N   1 
ATOM 8741 C CA  . VAL B 2 3    ? 11.736  33.663 45.714  1.00 37.25  ? 15   VAL B CA  1 
ATOM 8742 C C   . VAL B 2 3    ? 12.286  35.077 45.837  1.00 37.25  ? 15   VAL B C   1 
ATOM 8743 O O   . VAL B 2 3    ? 12.612  35.714 44.835  1.00 54.52  ? 15   VAL B O   1 
ATOM 8744 C CB  . VAL B 2 3    ? 10.586  33.476 46.719  1.00 37.25  ? 15   VAL B CB  1 
ATOM 8745 C CG1 . VAL B 2 3    ? 9.516   34.535 46.503  1.00 37.25  ? 15   VAL B CG1 1 
ATOM 8746 C CG2 . VAL B 2 3    ? 9.996   32.080 46.596  1.00 37.25  ? 15   VAL B CG2 1 
ATOM 8747 N N   . GLY B 2 4    ? 12.395  35.566 47.069  1.00 37.25  ? 16   GLY B N   1 
ATOM 8748 C CA  . GLY B 2 4    ? 12.938  36.915 47.303  1.00 37.25  ? 16   GLY B CA  1 
ATOM 8749 C C   . GLY B 2 4    ? 13.889  37.254 45.984  1.00 37.25  ? 16   GLY B C   1 
ATOM 8750 O O   . GLY B 2 4    ? 13.489  38.248 45.462  1.00 56.13  ? 16   GLY B O   1 
ATOM 8751 N N   . PHE B 2 5    ? 14.920  36.501 45.613  1.00 37.25  ? 17   PHE B N   1 
ATOM 8752 C CA  . PHE B 2 5    ? 15.729  36.832 44.447  1.00 37.25  ? 17   PHE B CA  1 
ATOM 8753 C C   . PHE B 2 5    ? 14.899  36.770 43.170  1.00 37.25  ? 17   PHE B C   1 
ATOM 8754 O O   . PHE B 2 5    ? 15.069  37.588 42.266  1.00 56.27  ? 17   PHE B O   1 
ATOM 8755 C CB  . PHE B 2 5    ? 16.928  35.887 44.341  1.00 37.25  ? 17   PHE B CB  1 
ATOM 8756 C CG  . PHE B 2 5    ? 17.833  35.919 45.539  1.00 37.25  ? 17   PHE B CG  1 
ATOM 8757 C CD1 . PHE B 2 5    ? 17.619  35.067 46.609  1.00 37.25  ? 17   PHE B CD1 1 
ATOM 8758 C CD2 . PHE B 2 5    ? 18.898  36.802 45.596  1.00 37.25  ? 17   PHE B CD2 1 
ATOM 8759 C CE1 . PHE B 2 5    ? 18.450  35.094 47.713  1.00 37.25  ? 17   PHE B CE1 1 
ATOM 8760 C CE2 . PHE B 2 5    ? 19.733  36.835 46.697  1.00 37.25  ? 17   PHE B CE2 1 
ATOM 8761 C CZ  . PHE B 2 5    ? 19.508  35.979 47.757  1.00 37.25  ? 17   PHE B CZ  1 
ATOM 8762 N N   . LEU B 2 6    ? 14.185  35.705 43.019  1.00 37.25  ? 18   LEU B N   1 
ATOM 8763 C CA  . LEU B 2 6    ? 13.778  35.351 41.714  1.00 37.25  ? 18   LEU B CA  1 
ATOM 8764 C C   . LEU B 2 6    ? 12.577  36.132 41.260  1.00 37.25  ? 18   LEU B C   1 
ATOM 8765 O O   . LEU B 2 6    ? 12.340  36.254 40.099  1.00 44.92  ? 18   LEU B O   1 
ATOM 8766 C CB  . LEU B 2 6    ? 13.561  33.867 41.671  1.00 37.25  ? 18   LEU B CB  1 
ATOM 8767 C CG  . LEU B 2 6    ? 13.109  33.435 40.328  1.00 37.25  ? 18   LEU B CG  1 
ATOM 8768 C CD1 . LEU B 2 6    ? 13.032  31.984 40.388  1.00 37.25  ? 18   LEU B CD1 1 
ATOM 8769 C CD2 . LEU B 2 6    ? 11.763  34.035 40.226  1.00 37.25  ? 18   LEU B CD2 1 
ATOM 8770 N N   . SER B 2 7    ? 11.824  36.706 42.170  1.00 37.25  ? 19   SER B N   1 
ATOM 8771 C CA  . SER B 2 7    ? 10.682  37.484 41.751  1.00 37.25  ? 19   SER B CA  1 
ATOM 8772 C C   . SER B 2 7    ? 11.083  38.923 41.726  1.00 37.25  ? 19   SER B C   1 
ATOM 8773 O O   . SER B 2 7    ? 10.296  39.796 41.463  1.00 47.56  ? 19   SER B O   1 
ATOM 8774 C CB  . SER B 2 7    ? 9.490   37.265 42.674  1.00 37.25  ? 19   SER B CB  1 
ATOM 8775 O OG  . SER B 2 7    ? 8.591   36.336 42.114  1.00 37.25  ? 19   SER B OG  1 
ATOM 8776 N N   . GLN B 2 8    ? 12.338  39.167 41.990  1.00 37.25  ? 20   GLN B N   1 
ATOM 8777 C CA  . GLN B 2 8    ? 12.818  40.510 42.012  1.00 37.25  ? 20   GLN B CA  1 
ATOM 8778 C C   . GLN B 2 8    ? 13.765  40.705 40.888  1.00 37.25  ? 20   GLN B C   1 
ATOM 8779 O O   . GLN B 2 8    ? 13.986  41.785 40.426  1.00 53.04  ? 20   GLN B O   1 
ATOM 8780 C CB  . GLN B 2 8    ? 13.620  40.720 43.245  1.00 37.25  ? 20   GLN B CB  1 
ATOM 8781 C CG  . GLN B 2 8    ? 14.992  41.044 42.889  1.00 37.25  ? 20   GLN B CG  1 
ATOM 8782 C CD  . GLN B 2 8    ? 15.466  42.180 43.660  1.00 37.25  ? 20   GLN B CD  1 
ATOM 8783 O OE1 . GLN B 2 8    ? 14.820  42.596 44.585  1.00 37.25  ? 20   GLN B OE1 1 
ATOM 8784 N NE2 . GLN B 2 8    ? 16.591  42.716 43.287  1.00 37.25  ? 20   GLN B NE2 1 
ATOM 8785 N N   . ARG B 2 9    ? 14.368  39.632 40.462  1.00 37.25  ? 21   ARG B N   1 
ATOM 8786 C CA  . ARG B 2 9    ? 15.260  39.730 39.364  1.00 37.25  ? 21   ARG B CA  1 
ATOM 8787 C C   . ARG B 2 9    ? 14.399  40.026 38.189  1.00 37.25  ? 21   ARG B C   1 
ATOM 8788 O O   . ARG B 2 9    ? 14.802  39.983 37.075  1.00 42.46  ? 21   ARG B O   1 
ATOM 8789 C CB  . ARG B 2 9    ? 16.084  38.462 39.212  1.00 37.25  ? 21   ARG B CB  1 
ATOM 8790 C CG  . ARG B 2 9    ? 15.558  37.431 38.275  1.00 37.25  ? 21   ARG B CG  1 
ATOM 8791 C CD  . ARG B 2 9    ? 16.676  36.539 37.879  1.00 37.25  ? 21   ARG B CD  1 
ATOM 8792 N NE  . ARG B 2 9    ? 16.273  35.383 37.111  1.00 37.25  ? 21   ARG B NE  1 
ATOM 8793 C CZ  . ARG B 2 9    ? 17.099  34.390 36.860  1.00 37.25  ? 21   ARG B CZ  1 
ATOM 8794 N NH1 . ARG B 2 9    ? 18.309  34.447 37.339  1.00 37.25  ? 21   ARG B NH1 1 
ATOM 8795 N NH2 . ARG B 2 9    ? 16.728  33.350 36.161  1.00 37.25  ? 21   ARG B NH2 1 
ATOM 8796 N N   . GLY B 2 10   ? 13.184  40.389 38.456  1.00 37.25  ? 22   GLY B N   1 
ATOM 8797 C CA  . GLY B 2 10   ? 12.426  41.066 37.422  1.00 37.25  ? 22   GLY B CA  1 
ATOM 8798 C C   . GLY B 2 10   ? 12.581  42.561 37.613  1.00 37.25  ? 22   GLY B C   1 
ATOM 8799 O O   . GLY B 2 10   ? 13.043  43.264 36.715  1.00 46.98  ? 22   GLY B O   1 
ATOM 8800 N N   . LEU B 2 11   ? 12.136  43.070 38.710  1.00 37.25  ? 23   LEU B N   1 
ATOM 8801 C CA  . LEU B 2 11   ? 12.280  44.458 38.866  1.00 37.25  ? 23   LEU B CA  1 
ATOM 8802 C C   . LEU B 2 11   ? 13.631  44.915 38.337  1.00 37.25  ? 23   LEU B C   1 
ATOM 8803 O O   . LEU B 2 11   ? 13.620  45.633 37.368  1.00 44.42  ? 23   LEU B O   1 
ATOM 8804 C CB  . LEU B 2 11   ? 12.058  44.803 40.303  1.00 37.25  ? 23   LEU B CB  1 
ATOM 8805 C CG  . LEU B 2 11   ? 10.676  44.285 40.629  1.00 37.25  ? 23   LEU B CG  1 
ATOM 8806 C CD1 . LEU B 2 11   ? 10.039  43.622 39.441  1.00 37.25  ? 23   LEU B CD1 1 
ATOM 8807 C CD2 . LEU B 2 11   ? 10.749  43.372 41.806  1.00 37.25  ? 23   LEU B CD2 1 
ATOM 8808 N N   . HIS B 2 12   ? 14.776  44.545 38.930  1.00 37.25  ? 24   HIS B N   1 
ATOM 8809 C CA  . HIS B 2 12   ? 16.067  44.894 38.349  1.00 37.25  ? 24   HIS B CA  1 
ATOM 8810 C C   . HIS B 2 12   ? 16.659  46.128 39.021  1.00 37.25  ? 24   HIS B C   1 
ATOM 8811 O O   . HIS B 2 12   ? 16.944  47.129 38.362  1.00 44.31  ? 24   HIS B O   1 
ATOM 8812 C CB  . HIS B 2 12   ? 15.931  45.129 36.843  1.00 37.25  ? 24   HIS B CB  1 
ATOM 8813 C CG  . HIS B 2 12   ? 17.221  45.470 36.166  1.00 37.25  ? 24   HIS B CG  1 
ATOM 8814 N ND1 . HIS B 2 12   ? 17.668  46.766 36.025  1.00 37.25  ? 24   HIS B ND1 1 
ATOM 8815 C CD2 . HIS B 2 12   ? 18.161  44.684 35.589  1.00 37.25  ? 24   HIS B CD2 1 
ATOM 8816 C CE1 . HIS B 2 12   ? 18.828  46.764 35.392  1.00 37.25  ? 24   HIS B CE1 1 
ATOM 8817 N NE2 . HIS B 2 12   ? 19.149  45.513 35.116  1.00 37.25  ? 24   HIS B NE2 1 
ATOM 8818 N N   . GLY B 2 13   ? 16.842  46.051 40.335  1.00 37.25  ? 25   GLY B N   1 
ATOM 8819 C CA  . GLY B 2 13   ? 17.397  47.155 41.094  1.00 37.25  ? 25   GLY B CA  1 
ATOM 8820 C C   . GLY B 2 13   ? 18.200  46.689 42.293  1.00 37.25  ? 25   GLY B C   1 
ATOM 8821 O O   . GLY B 2 13   ? 19.427  46.791 42.307  1.00 179.24 ? 25   GLY B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    GLY 1    -2   ?    ?   ?   A . n 
A 1 2    SER 2    -1   ?    ?   ?   A . n 
A 1 3    HIS 3    0    ?    ?   ?   A . n 
A 1 4    MET 4    1    1    MET MET A . n 
A 1 5    SER 5    2    2    SER SER A . n 
A 1 6    TYR 6    3    3    TYR TYR A . n 
A 1 7    ASN 7    4    4    ASN ASN A . n 
A 1 8    TYR 8    5    5    TYR TYR A . n 
A 1 9    VAL 9    6    6    VAL VAL A . n 
A 1 10   VAL 10   7    7    VAL VAL A . n 
A 1 11   THR 11   8    8    THR THR A . n 
A 1 12   ALA 12   9    9    ALA ALA A . n 
A 1 13   GLN 13   10   10   GLN GLN A . n 
A 1 14   LYS 14   11   11   LYS LYS A . n 
A 1 15   PRO 15   12   12   PRO PRO A . n 
A 1 16   THR 16   13   13   THR THR A . n 
A 1 17   ALA 17   14   14   ALA ALA A . n 
A 1 18   VAL 18   15   15   VAL VAL A . n 
A 1 19   ASN 19   16   16   ASN ASN A . n 
A 1 20   GLY 20   17   17   GLY GLY A . n 
A 1 21   CYS 21   18   18   CYS CYS A . n 
A 1 22   VAL 22   19   19   VAL VAL A . n 
A 1 23   THR 23   20   20   THR THR A . n 
A 1 24   GLY 24   21   21   GLY GLY A . n 
A 1 25   HIS 25   22   22   HIS HIS A . n 
A 1 26   PHE 26   23   23   PHE PHE A . n 
A 1 27   THR 27   24   24   THR THR A . n 
A 1 28   SER 28   25   25   SER SER A . n 
A 1 29   ALA 29   26   26   ALA ALA A . n 
A 1 30   GLU 30   27   27   GLU GLU A . n 
A 1 31   ASP 31   28   28   ASP ASP A . n 
A 1 32   LEU 32   29   29   LEU LEU A . n 
A 1 33   ASN 33   30   30   ASN ASN A . n 
A 1 34   LEU 34   31   31   LEU LEU A . n 
A 1 35   LEU 35   32   32   LEU LEU A . n 
A 1 36   ILE 36   33   33   ILE ILE A . n 
A 1 37   ALA 37   34   34   ALA ALA A . n 
A 1 38   LYS 38   35   35   LYS LYS A . n 
A 1 39   ASN 39   36   36   ASN ASN A . n 
A 1 40   THR 40   37   37   THR THR A . n 
A 1 41   ARG 41   38   38   ARG ARG A . n 
A 1 42   LEU 42   39   39   LEU LEU A . n 
A 1 43   GLU 43   40   40   GLU GLU A . n 
A 1 44   ILE 44   41   41   ILE ILE A . n 
A 1 45   TYR 45   42   42   TYR TYR A . n 
A 1 46   VAL 46   43   43   VAL VAL A . n 
A 1 47   VAL 47   44   44   VAL VAL A . n 
A 1 48   THR 48   45   45   THR THR A . n 
A 1 49   ALA 49   46   46   ALA ALA A . n 
A 1 50   GLU 50   47   47   GLU GLU A . n 
A 1 51   GLY 51   48   48   GLY GLY A . n 
A 1 52   LEU 52   49   49   LEU LEU A . n 
A 1 53   ARG 53   50   50   ARG ARG A . n 
A 1 54   PRO 54   51   51   PRO PRO A . n 
A 1 55   VAL 55   52   52   VAL VAL A . n 
A 1 56   LYS 56   53   53   LYS LYS A . n 
A 1 57   GLU 57   54   54   GLU GLU A . n 
A 1 58   VAL 58   55   55   VAL VAL A . n 
A 1 59   GLY 59   56   56   GLY GLY A . n 
A 1 60   MET 60   57   57   MET MET A . n 
A 1 61   TYR 61   58   58   TYR TYR A . n 
A 1 62   GLY 62   59   59   GLY GLY A . n 
A 1 63   LYS 63   60   60   LYS LYS A . n 
A 1 64   ILE 64   61   61   ILE ILE A . n 
A 1 65   ALA 65   62   62   ALA ALA A . n 
A 1 66   VAL 66   63   63   VAL VAL A . n 
A 1 67   MET 67   64   64   MET MET A . n 
A 1 68   GLU 68   65   65   GLU GLU A . n 
A 1 69   LEU 69   66   66   LEU LEU A . n 
A 1 70   PHE 70   67   67   PHE PHE A . n 
A 1 71   ARG 71   68   68   ARG ARG A . n 
A 1 72   PRO 72   69   69   PRO PRO A . n 
A 1 73   LYS 73   70   70   LYS LYS A . n 
A 1 74   GLY 74   71   71   GLY GLY A . n 
A 1 75   GLU 75   72   72   GLU GLU A . n 
A 1 76   SER 76   73   73   SER SER A . n 
A 1 77   LYS 77   74   74   LYS LYS A . n 
A 1 78   ASP 78   75   75   ASP ASP A . n 
A 1 79   LEU 79   76   76   LEU LEU A . n 
A 1 80   LEU 80   77   77   LEU LEU A . n 
A 1 81   PHE 81   78   78   PHE PHE A . n 
A 1 82   ILE 82   79   79   ILE ILE A . n 
A 1 83   LEU 83   80   80   LEU LEU A . n 
A 1 84   THR 84   81   81   THR THR A . n 
A 1 85   ALA 85   82   82   ALA ALA A . n 
A 1 86   LYS 86   83   83   LYS LYS A . n 
A 1 87   TYR 87   84   84   TYR TYR A . n 
A 1 88   ASN 88   85   85   ASN ASN A . n 
A 1 89   ALA 89   86   86   ALA ALA A . n 
A 1 90   CYS 90   87   87   CYS CYS A . n 
A 1 91   ILE 91   88   88   ILE ILE A . n 
A 1 92   LEU 92   89   89   LEU LEU A . n 
A 1 93   GLU 93   90   90   GLU GLU A . n 
A 1 94   TYR 94   91   91   TYR TYR A . n 
A 1 95   LYS 95   92   92   LYS LYS A . n 
A 1 96   GLN 96   93   93   GLN GLN A . n 
A 1 97   SER 97   94   94   SER SER A . n 
A 1 98   GLY 98   95   95   GLY GLY A . n 
A 1 99   GLU 99   96   96   GLU GLU A . n 
A 1 100  SER 100  97   97   SER SER A . n 
A 1 101  ILE 101  98   98   ILE ILE A . n 
A 1 102  ASP 102  99   99   ASP ASP A . n 
A 1 103  ILE 103  100  100  ILE ILE A . n 
A 1 104  ILE 104  101  101  ILE ILE A . n 
A 1 105  THR 105  102  102  THR THR A . n 
A 1 106  ARG 106  103  103  ARG ARG A . n 
A 1 107  ALA 107  104  104  ALA ALA A . n 
A 1 108  HIS 108  105  105  HIS HIS A . n 
A 1 109  GLY 109  106  106  GLY GLY A . n 
A 1 110  ASN 110  107  107  ASN ASN A . n 
A 1 111  VAL 111  108  108  VAL VAL A . n 
A 1 112  GLN 112  109  109  GLN GLN A . n 
A 1 113  ASP 113  110  110  ASP ASP A . n 
A 1 114  ARG 114  111  111  ARG ARG A . n 
A 1 115  ILE 115  112  112  ILE ILE A . n 
A 1 116  GLY 116  113  113  GLY GLY A . n 
A 1 117  ARG 117  114  114  ARG ARG A . n 
A 1 118  PRO 118  115  115  PRO PRO A . n 
A 1 119  SER 119  116  116  SER SER A . n 
A 1 120  GLU 120  117  117  GLU GLU A . n 
A 1 121  THR 121  118  118  THR THR A . n 
A 1 122  GLY 122  119  119  GLY GLY A . n 
A 1 123  ILE 123  120  120  ILE ILE A . n 
A 1 124  ILE 124  121  121  ILE ILE A . n 
A 1 125  GLY 125  122  122  GLY GLY A . n 
A 1 126  ILE 126  123  123  ILE ILE A . n 
A 1 127  ILE 127  124  124  ILE ILE A . n 
A 1 128  ASP 128  125  125  ASP ASP A . n 
A 1 129  PRO 129  126  126  PRO PRO A . n 
A 1 130  GLU 130  127  127  GLU GLU A . n 
A 1 131  CYS 131  128  128  CYS CYS A . n 
A 1 132  ARG 132  129  129  ARG ARG A . n 
A 1 133  MET 133  130  130  MET MET A . n 
A 1 134  ILE 134  131  131  ILE ILE A . n 
A 1 135  GLY 135  132  132  GLY GLY A . n 
A 1 136  LEU 136  133  133  LEU LEU A . n 
A 1 137  ARG 137  134  134  ARG ARG A . n 
A 1 138  LEU 138  135  135  LEU LEU A . n 
A 1 139  TYR 139  136  136  TYR TYR A . n 
A 1 140  ASP 140  137  137  ASP ASP A . n 
A 1 141  GLY 141  138  138  GLY GLY A . n 
A 1 142  LEU 142  139  139  LEU LEU A . n 
A 1 143  PHE 143  140  140  PHE PHE A . n 
A 1 144  LYS 144  141  141  LYS LYS A . n 
A 1 145  VAL 145  142  142  VAL VAL A . n 
A 1 146  ILE 146  143  143  ILE ILE A . n 
A 1 147  PRO 147  144  144  PRO PRO A . n 
A 1 148  LEU 148  145  145  LEU LEU A . n 
A 1 149  ASP 149  146  146  ASP ASP A . n 
A 1 150  ARG 150  147  147  ARG ARG A . n 
A 1 151  ASP 151  148  148  ASP ASP A . n 
A 1 152  ASN 152  149  149  ASN ASN A . n 
A 1 153  LYS 153  150  150  LYS LYS A . n 
A 1 154  GLU 154  151  151  GLU GLU A . n 
A 1 155  LEU 155  152  152  LEU LEU A . n 
A 1 156  LYS 156  153  153  LYS LYS A . n 
A 1 157  ALA 157  154  154  ALA ALA A . n 
A 1 158  PHE 158  155  155  PHE PHE A . n 
A 1 159  ASN 159  156  156  ASN ASN A . n 
A 1 160  ILE 160  157  157  ILE ILE A . n 
A 1 161  ARG 161  158  158  ARG ARG A . n 
A 1 162  LEU 162  159  159  LEU LEU A . n 
A 1 163  GLU 163  160  160  GLU GLU A . n 
A 1 164  GLU 164  161  161  GLU GLU A . n 
A 1 165  LEU 165  162  162  LEU LEU A . n 
A 1 166  HIS 166  163  163  HIS HIS A . n 
A 1 167  VAL 167  164  164  VAL VAL A . n 
A 1 168  ILE 168  165  165  ILE ILE A . n 
A 1 169  ASP 169  166  166  ASP ASP A . n 
A 1 170  VAL 170  167  167  VAL VAL A . n 
A 1 171  LYS 171  168  168  LYS LYS A . n 
A 1 172  PHE 172  169  169  PHE PHE A . n 
A 1 173  LEU 173  170  170  LEU LEU A . n 
A 1 174  TYR 174  171  171  TYR TYR A . n 
A 1 175  GLY 175  172  172  GLY GLY A . n 
A 1 176  CYS 176  173  173  CYS CYS A . n 
A 1 177  GLN 177  174  174  GLN GLN A . n 
A 1 178  ALA 178  175  175  ALA ALA A . n 
A 1 179  PRO 179  176  176  PRO PRO A . n 
A 1 180  THR 180  177  177  THR THR A . n 
A 1 181  ILE 181  178  178  ILE ILE A . n 
A 1 182  CYS 182  179  179  CYS CYS A . n 
A 1 183  PHE 183  180  180  PHE PHE A . n 
A 1 184  VAL 184  181  181  VAL VAL A . n 
A 1 185  TYR 185  182  182  TYR TYR A . n 
A 1 186  GLN 186  183  183  GLN GLN A . n 
A 1 187  ASP 187  184  184  ASP ASP A . n 
A 1 188  PRO 188  185  185  PRO PRO A . n 
A 1 189  GLN 189  186  186  GLN GLN A . n 
A 1 190  GLY 190  187  187  GLY GLY A . n 
A 1 191  ARG 191  188  188  ARG ARG A . n 
A 1 192  HIS 192  189  189  HIS HIS A . n 
A 1 193  VAL 193  190  190  VAL VAL A . n 
A 1 194  LYS 194  191  191  LYS LYS A . n 
A 1 195  THR 195  192  192  THR THR A . n 
A 1 196  TYR 196  193  193  TYR TYR A . n 
A 1 197  GLU 197  194  194  GLU GLU A . n 
A 1 198  VAL 198  195  195  VAL VAL A . n 
A 1 199  SER 199  196  196  SER SER A . n 
A 1 200  LEU 200  197  197  LEU LEU A . n 
A 1 201  ARG 201  198  198  ARG ARG A . n 
A 1 202  GLU 202  199  199  GLU GLU A . n 
A 1 203  LYS 203  200  200  LYS LYS A . n 
A 1 204  GLU 204  201  201  GLU GLU A . n 
A 1 205  PHE 205  202  202  PHE PHE A . n 
A 1 206  ASN 206  203  203  ASN ASN A . n 
A 1 207  LYS 207  204  204  LYS LYS A . n 
A 1 208  GLY 208  205  205  GLY GLY A . n 
A 1 209  PRO 209  206  206  PRO PRO A . n 
A 1 210  TRP 210  207  207  TRP TRP A . n 
A 1 211  LYS 211  208  208  LYS LYS A . n 
A 1 212  GLN 212  209  209  GLN GLN A . n 
A 1 213  GLU 213  210  210  GLU GLU A . n 
A 1 214  ASN 214  211  211  ASN ASN A . n 
A 1 215  VAL 215  212  212  VAL VAL A . n 
A 1 216  GLU 216  213  213  GLU GLU A . n 
A 1 217  ALA 217  214  214  ALA ALA A . n 
A 1 218  GLU 218  215  215  GLU GLU A . n 
A 1 219  ALA 219  216  216  ALA ALA A . n 
A 1 220  SER 220  217  217  SER SER A . n 
A 1 221  MET 221  218  218  MET MET A . n 
A 1 222  VAL 222  219  219  VAL VAL A . n 
A 1 223  ILE 223  220  220  ILE ILE A . n 
A 1 224  ALA 224  221  221  ALA ALA A . n 
A 1 225  VAL 225  222  222  VAL VAL A . n 
A 1 226  PRO 226  223  223  PRO PRO A . n 
A 1 227  GLU 227  224  224  GLU GLU A . n 
A 1 228  PRO 228  225  225  PRO PRO A . n 
A 1 229  PHE 229  226  226  PHE PHE A . n 
A 1 230  GLY 230  227  227  GLY GLY A . n 
A 1 231  GLY 231  228  228  GLY GLY A . n 
A 1 232  ALA 232  229  229  ALA ALA A . n 
A 1 233  ILE 233  230  230  ILE ILE A . n 
A 1 234  ILE 234  231  231  ILE ILE A . n 
A 1 235  ILE 235  232  232  ILE ILE A . n 
A 1 236  GLY 236  233  233  GLY GLY A . n 
A 1 237  GLN 237  234  234  GLN GLN A . n 
A 1 238  GLU 238  235  235  GLU GLU A . n 
A 1 239  SER 239  236  236  SER SER A . n 
A 1 240  ILE 240  237  237  ILE ILE A . n 
A 1 241  THR 241  238  238  THR THR A . n 
A 1 242  TYR 242  239  239  TYR TYR A . n 
A 1 243  HIS 243  240  240  HIS HIS A . n 
A 1 244  ASN 244  241  241  ASN ASN A . n 
A 1 245  GLY 245  242  242  GLY GLY A . n 
A 1 246  ASP 246  243  243  ASP ASP A . n 
A 1 247  LYS 247  244  244  LYS LYS A . n 
A 1 248  TYR 248  245  245  TYR TYR A . n 
A 1 249  LEU 249  246  246  LEU LEU A . n 
A 1 250  ALA 250  247  247  ALA ALA A . n 
A 1 251  ILE 251  248  248  ILE ILE A . n 
A 1 252  ALA 252  249  249  ALA ALA A . n 
A 1 253  PRO 253  250  250  PRO PRO A . n 
A 1 254  PRO 254  251  251  PRO PRO A . n 
A 1 255  ILE 255  252  252  ILE ILE A . n 
A 1 256  ILE 256  253  253  ILE ILE A . n 
A 1 257  LYS 257  254  254  LYS LYS A . n 
A 1 258  GLN 258  255  255  GLN GLN A . n 
A 1 259  SER 259  256  256  SER SER A . n 
A 1 260  THR 260  257  257  THR THR A . n 
A 1 261  ILE 261  258  258  ILE ILE A . n 
A 1 262  VAL 262  259  259  VAL VAL A . n 
A 1 263  CYS 263  260  260  CYS CYS A . n 
A 1 264  HIS 264  261  261  HIS HIS A . n 
A 1 265  ASN 265  262  262  ASN ASN A . n 
A 1 266  ARG 266  263  263  ARG ARG A . n 
A 1 267  VAL 267  264  264  VAL VAL A . n 
A 1 268  ASP 268  265  265  ASP ASP A . n 
A 1 269  PRO 269  266  266  PRO PRO A . n 
A 1 270  ASN 270  267  267  ASN ASN A . n 
A 1 271  GLY 271  268  268  GLY GLY A . n 
A 1 272  SER 272  269  269  SER SER A . n 
A 1 273  ARG 273  270  270  ARG ARG A . n 
A 1 274  TYR 274  271  271  TYR TYR A . n 
A 1 275  LEU 275  272  272  LEU LEU A . n 
A 1 276  LEU 276  273  273  LEU LEU A . n 
A 1 277  GLY 277  274  274  GLY GLY A . n 
A 1 278  ASP 278  275  275  ASP ASP A . n 
A 1 279  MET 279  276  276  MET MET A . n 
A 1 280  GLU 280  277  277  GLU GLU A . n 
A 1 281  GLY 281  278  278  GLY GLY A . n 
A 1 282  ARG 282  279  279  ARG ARG A . n 
A 1 283  LEU 283  280  280  LEU LEU A . n 
A 1 284  PHE 284  281  281  PHE PHE A . n 
A 1 285  MET 285  282  282  MET MET A . n 
A 1 286  LEU 286  283  283  LEU LEU A . n 
A 1 287  LEU 287  284  284  LEU LEU A . n 
A 1 288  LEU 288  285  285  LEU LEU A . n 
A 1 289  GLU 289  286  286  GLU GLU A . n 
A 1 290  LYS 290  287  287  LYS LYS A . n 
A 1 291  GLU 291  288  288  GLU GLU A . n 
A 1 292  GLU 292  289  289  GLU GLU A . n 
A 1 293  GLN 293  290  290  GLN GLN A . n 
A 1 294  MET 294  291  291  MET MET A . n 
A 1 295  ASP 295  292  292  ASP ASP A . n 
A 1 296  GLY 296  293  293  GLY GLY A . n 
A 1 297  THR 297  294  294  THR THR A . n 
A 1 298  VAL 298  295  295  VAL VAL A . n 
A 1 299  THR 299  296  296  THR THR A . n 
A 1 300  LEU 300  297  297  LEU LEU A . n 
A 1 301  LYS 301  298  298  LYS LYS A . n 
A 1 302  ASP 302  299  299  ASP ASP A . n 
A 1 303  LEU 303  300  300  LEU LEU A . n 
A 1 304  ARG 304  301  301  ARG ARG A . n 
A 1 305  VAL 305  302  302  VAL VAL A . n 
A 1 306  GLU 306  303  303  GLU GLU A . n 
A 1 307  LEU 307  304  304  LEU LEU A . n 
A 1 308  LEU 308  305  305  LEU LEU A . n 
A 1 309  GLY 309  306  306  GLY GLY A . n 
A 1 310  GLU 310  307  307  GLU GLU A . n 
A 1 311  THR 311  308  308  THR THR A . n 
A 1 312  SER 312  309  309  SER SER A . n 
A 1 313  ILE 313  310  310  ILE ILE A . n 
A 1 314  ALA 314  311  311  ALA ALA A . n 
A 1 315  GLU 315  312  312  GLU GLU A . n 
A 1 316  CYS 316  313  313  CYS CYS A . n 
A 1 317  LEU 317  314  314  LEU LEU A . n 
A 1 318  THR 318  315  315  THR THR A . n 
A 1 319  TYR 319  316  316  TYR TYR A . n 
A 1 320  LEU 320  317  317  LEU LEU A . n 
A 1 321  ASP 321  318  318  ASP ASP A . n 
A 1 322  ASN 322  319  319  ASN ASN A . n 
A 1 323  GLY 323  320  320  GLY GLY A . n 
A 1 324  VAL 324  321  321  VAL VAL A . n 
A 1 325  VAL 325  322  322  VAL VAL A . n 
A 1 326  PHE 326  323  323  PHE PHE A . n 
A 1 327  VAL 327  324  324  VAL VAL A . n 
A 1 328  GLY 328  325  325  GLY GLY A . n 
A 1 329  SER 329  326  326  SER SER A . n 
A 1 330  ARG 330  327  327  ARG ARG A . n 
A 1 331  LEU 331  328  328  LEU LEU A . n 
A 1 332  GLY 332  329  329  GLY GLY A . n 
A 1 333  ASP 333  330  330  ASP ASP A . n 
A 1 334  SER 334  331  331  SER SER A . n 
A 1 335  GLN 335  332  332  GLN GLN A . n 
A 1 336  LEU 336  333  333  LEU LEU A . n 
A 1 337  VAL 337  334  334  VAL VAL A . n 
A 1 338  LYS 338  335  335  LYS LYS A . n 
A 1 339  LEU 339  336  336  LEU LEU A . n 
A 1 340  ASN 340  337  337  ASN ASN A . n 
A 1 341  VAL 341  338  338  VAL VAL A . n 
A 1 342  ASP 342  339  339  ASP ASP A . n 
A 1 343  SER 343  340  340  SER SER A . n 
A 1 344  ASN 344  341  341  ASN ASN A . n 
A 1 345  GLU 345  342  342  GLU GLU A . n 
A 1 346  GLN 346  343  343  GLN GLN A . n 
A 1 347  GLY 347  344  344  GLY GLY A . n 
A 1 348  SER 348  345  345  SER SER A . n 
A 1 349  TYR 349  346  346  TYR TYR A . n 
A 1 350  VAL 350  347  347  VAL VAL A . n 
A 1 351  VAL 351  348  348  VAL VAL A . n 
A 1 352  ALA 352  349  349  ALA ALA A . n 
A 1 353  MET 353  350  350  MET MET A . n 
A 1 354  GLU 354  351  351  GLU GLU A . n 
A 1 355  THR 355  352  352  THR THR A . n 
A 1 356  PHE 356  353  353  PHE PHE A . n 
A 1 357  THR 357  354  354  THR THR A . n 
A 1 358  ASN 358  355  355  ASN ASN A . n 
A 1 359  LEU 359  356  356  LEU LEU A . n 
A 1 360  GLY 360  357  357  GLY GLY A . n 
A 1 361  PRO 361  358  358  PRO PRO A . n 
A 1 362  ILE 362  359  359  ILE ILE A . n 
A 1 363  VAL 363  360  360  VAL VAL A . n 
A 1 364  ASP 364  361  361  ASP ASP A . n 
A 1 365  MET 365  362  362  MET MET A . n 
A 1 366  CYS 366  363  363  CYS CYS A . n 
A 1 367  VAL 367  364  364  VAL VAL A . n 
A 1 368  VAL 368  365  365  VAL VAL A . n 
A 1 369  ASP 369  366  366  ASP ASP A . n 
A 1 370  LEU 370  367  367  LEU LEU A . n 
A 1 371  GLU 371  368  368  GLU GLU A . n 
A 1 372  ARG 372  369  369  ARG ARG A . n 
A 1 373  GLN 373  370  370  GLN GLN A . n 
A 1 374  GLY 374  371  371  GLY GLY A . n 
A 1 375  GLN 375  372  372  GLN GLN A . n 
A 1 376  GLY 376  373  373  GLY GLY A . n 
A 1 377  GLN 377  374  374  GLN GLN A . n 
A 1 378  LEU 378  375  375  LEU LEU A . n 
A 1 379  VAL 379  376  376  VAL VAL A . n 
A 1 380  THR 380  377  377  THR THR A . n 
A 1 381  CYS 381  378  378  CYS CYS A . n 
A 1 382  SER 382  379  379  SER SER A . n 
A 1 383  GLY 383  380  380  GLY GLY A . n 
A 1 384  ALA 384  381  381  ALA ALA A . n 
A 1 385  PHE 385  382  382  PHE PHE A . n 
A 1 386  LYS 386  383  383  LYS LYS A . n 
A 1 387  GLU 387  384  384  GLU GLU A . n 
A 1 388  GLY 388  385  385  GLY GLY A . n 
A 1 389  SER 389  386  386  SER SER A . n 
A 1 390  LEU 390  387  387  LEU LEU A . n 
A 1 391  ARG 391  388  388  ARG ARG A . n 
A 1 392  ILE 392  389  389  ILE ILE A . n 
A 1 393  ILE 393  390  390  ILE ILE A . n 
A 1 394  ARG 394  391  391  ARG ARG A . n 
A 1 395  ASN 395  392  392  ASN ASN A . n 
A 1 396  GLY 396  393  393  GLY GLY A . n 
A 1 397  ILE 397  394  394  ILE ILE A . n 
A 1 398  GLY 398  395  395  GLY GLY A . n 
A 1 399  ILE 399  396  396  ILE ILE A . n 
A 1 400  HIS 400  397  397  HIS HIS A . n 
A 1 401  GLU 401  398  398  GLU GLU A . n 
A 1 402  HIS 402  399  399  HIS HIS A . n 
A 1 403  ALA 403  400  400  ALA ALA A . n 
A 1 404  SER 404  401  401  SER SER A . n 
A 1 405  ILE 405  402  402  ILE ILE A . n 
A 1 406  ASP 406  403  403  ASP ASP A . n 
A 1 407  LEU 407  404  404  LEU LEU A . n 
A 1 408  PRO 408  405  405  PRO PRO A . n 
A 1 409  GLY 409  406  406  GLY GLY A . n 
A 1 410  ILE 410  407  407  ILE ILE A . n 
A 1 411  LYS 411  408  408  LYS LYS A . n 
A 1 412  GLY 412  409  409  GLY GLY A . n 
A 1 413  LEU 413  410  410  LEU LEU A . n 
A 1 414  TRP 414  411  411  TRP TRP A . n 
A 1 415  PRO 415  412  412  PRO PRO A . n 
A 1 416  LEU 416  413  413  LEU LEU A . n 
A 1 417  ARG 417  414  414  ARG ARG A . n 
A 1 418  SER 418  415  415  SER SER A . n 
A 1 419  ASP 419  416  416  ASP ASP A . n 
A 1 420  PRO 420  417  417  PRO PRO A . n 
A 1 421  ASN 421  418  418  ASN ASN A . n 
A 1 422  ARG 422  419  419  ARG ARG A . n 
A 1 423  GLU 423  420  420  GLU GLU A . n 
A 1 424  THR 424  421  421  THR THR A . n 
A 1 425  TYR 425  422  422  TYR TYR A . n 
A 1 426  ASP 426  423  423  ASP ASP A . n 
A 1 427  THR 427  424  424  THR THR A . n 
A 1 428  LEU 428  425  425  LEU LEU A . n 
A 1 429  VAL 429  426  426  VAL VAL A . n 
A 1 430  LEU 430  427  427  LEU LEU A . n 
A 1 431  SER 431  428  428  SER SER A . n 
A 1 432  PHE 432  429  429  PHE PHE A . n 
A 1 433  VAL 433  430  430  VAL VAL A . n 
A 1 434  GLY 434  431  431  GLY GLY A . n 
A 1 435  GLN 435  432  432  GLN GLN A . n 
A 1 436  THR 436  433  433  THR THR A . n 
A 1 437  ARG 437  434  434  ARG ARG A . n 
A 1 438  VAL 438  435  435  VAL VAL A . n 
A 1 439  LEU 439  436  436  LEU LEU A . n 
A 1 440  MET 440  437  437  MET MET A . n 
A 1 441  LEU 441  438  438  LEU LEU A . n 
A 1 442  ASN 442  439  439  ASN ASN A . n 
A 1 443  GLY 443  440  440  GLY GLY A . n 
A 1 444  GLU 444  441  441  GLU GLU A . n 
A 1 445  GLU 445  442  442  GLU GLU A . n 
A 1 446  VAL 446  443  443  VAL VAL A . n 
A 1 447  GLU 447  444  444  GLU GLU A . n 
A 1 448  GLU 448  445  445  GLU GLU A . n 
A 1 449  THR 449  446  446  THR THR A . n 
A 1 450  GLU 450  447  447  GLU GLU A . n 
A 1 451  LEU 451  448  448  LEU LEU A . n 
A 1 452  MET 452  449  449  MET MET A . n 
A 1 453  GLY 453  450  450  GLY GLY A . n 
A 1 454  PHE 454  451  451  PHE PHE A . n 
A 1 455  VAL 455  452  452  VAL VAL A . n 
A 1 456  ASP 456  453  453  ASP ASP A . n 
A 1 457  ASP 457  454  454  ASP ASP A . n 
A 1 458  GLN 458  455  455  GLN GLN A . n 
A 1 459  GLN 459  456  456  GLN GLN A . n 
A 1 460  THR 460  457  457  THR THR A . n 
A 1 461  PHE 461  458  458  PHE PHE A . n 
A 1 462  PHE 462  459  459  PHE PHE A . n 
A 1 463  CYS 463  460  460  CYS CYS A . n 
A 1 464  GLY 464  461  461  GLY GLY A . n 
A 1 465  ASN 465  462  462  ASN ASN A . n 
A 1 466  VAL 466  463  463  VAL VAL A . n 
A 1 467  ALA 467  464  464  ALA ALA A . n 
A 1 468  HIS 468  465  465  HIS HIS A . n 
A 1 469  GLN 469  466  466  GLN GLN A . n 
A 1 470  GLN 470  467  467  GLN GLN A . n 
A 1 471  LEU 471  468  468  LEU LEU A . n 
A 1 472  ILE 472  469  469  ILE ILE A . n 
A 1 473  GLN 473  470  470  GLN GLN A . n 
A 1 474  ILE 474  471  471  ILE ILE A . n 
A 1 475  THR 475  472  472  THR THR A . n 
A 1 476  SER 476  473  473  SER SER A . n 
A 1 477  ALA 477  474  474  ALA ALA A . n 
A 1 478  SER 478  475  475  SER SER A . n 
A 1 479  VAL 479  476  476  VAL VAL A . n 
A 1 480  ARG 480  477  477  ARG ARG A . n 
A 1 481  LEU 481  478  478  LEU LEU A . n 
A 1 482  VAL 482  479  479  VAL VAL A . n 
A 1 483  SER 483  480  480  SER SER A . n 
A 1 484  GLN 484  481  481  GLN GLN A . n 
A 1 485  GLU 485  482  482  GLU GLU A . n 
A 1 486  PRO 486  483  483  PRO PRO A . n 
A 1 487  LYS 487  484  484  LYS LYS A . n 
A 1 488  ALA 488  485  485  ALA ALA A . n 
A 1 489  LEU 489  486  486  LEU LEU A . n 
A 1 490  VAL 490  487  487  VAL VAL A . n 
A 1 491  SER 491  488  488  SER SER A . n 
A 1 492  GLU 492  489  489  GLU GLU A . n 
A 1 493  TRP 493  490  490  TRP TRP A . n 
A 1 494  LYS 494  491  491  LYS LYS A . n 
A 1 495  GLU 495  492  492  GLU GLU A . n 
A 1 496  PRO 496  493  493  PRO PRO A . n 
A 1 497  GLN 497  494  494  GLN GLN A . n 
A 1 498  ALA 498  495  495  ALA ALA A . n 
A 1 499  LYS 499  496  496  LYS LYS A . n 
A 1 500  ASN 500  497  497  ASN ASN A . n 
A 1 501  ILE 501  498  498  ILE ILE A . n 
A 1 502  SER 502  499  499  SER SER A . n 
A 1 503  VAL 503  500  500  VAL VAL A . n 
A 1 504  ALA 504  501  501  ALA ALA A . n 
A 1 505  SER 505  502  502  SER SER A . n 
A 1 506  CYS 506  503  503  CYS CYS A . n 
A 1 507  ASN 507  504  504  ASN ASN A . n 
A 1 508  SER 508  505  505  SER SER A . n 
A 1 509  SER 509  506  506  SER SER A . n 
A 1 510  GLN 510  507  507  GLN GLN A . n 
A 1 511  VAL 511  508  508  VAL VAL A . n 
A 1 512  VAL 512  509  509  VAL VAL A . n 
A 1 513  VAL 513  510  510  VAL VAL A . n 
A 1 514  ALA 514  511  511  ALA ALA A . n 
A 1 515  VAL 515  512  512  VAL VAL A . n 
A 1 516  GLY 516  513  513  GLY GLY A . n 
A 1 517  ARG 517  514  514  ARG ARG A . n 
A 1 518  ALA 518  515  515  ALA ALA A . n 
A 1 519  LEU 519  516  516  LEU LEU A . n 
A 1 520  TYR 520  517  517  TYR TYR A . n 
A 1 521  TYR 521  518  518  TYR TYR A . n 
A 1 522  LEU 522  519  519  LEU LEU A . n 
A 1 523  GLN 523  520  520  GLN GLN A . n 
A 1 524  ILE 524  521  521  ILE ILE A . n 
A 1 525  HIS 525  522  522  HIS HIS A . n 
A 1 526  PRO 526  523  523  PRO PRO A . n 
A 1 527  GLN 527  524  524  GLN GLN A . n 
A 1 528  GLU 528  525  525  GLU GLU A . n 
A 1 529  LEU 529  526  526  LEU LEU A . n 
A 1 530  ARG 530  527  527  ARG ARG A . n 
A 1 531  GLN 531  528  528  GLN GLN A . n 
A 1 532  ILE 532  529  529  ILE ILE A . n 
A 1 533  SER 533  530  530  SER SER A . n 
A 1 534  HIS 534  531  531  HIS HIS A . n 
A 1 535  THR 535  532  532  THR THR A . n 
A 1 536  GLU 536  533  533  GLU GLU A . n 
A 1 537  MET 537  534  534  MET MET A . n 
A 1 538  GLU 538  535  535  GLU GLU A . n 
A 1 539  HIS 539  536  536  HIS HIS A . n 
A 1 540  GLU 540  537  537  GLU GLU A . n 
A 1 541  VAL 541  538  538  VAL VAL A . n 
A 1 542  ALA 542  539  539  ALA ALA A . n 
A 1 543  CYS 543  540  540  CYS CYS A . n 
A 1 544  LEU 544  541  541  LEU LEU A . n 
A 1 545  ASP 545  542  542  ASP ASP A . n 
A 1 546  ILE 546  543  543  ILE ILE A . n 
A 1 547  THR 547  544  544  THR THR A . n 
A 1 548  PRO 548  545  545  PRO PRO A . n 
A 1 549  LEU 549  546  546  LEU LEU A . n 
A 1 550  GLY 550  547  547  GLY GLY A . n 
A 1 551  ASP 551  548  548  ASP ASP A . n 
A 1 552  SER 552  549  549  SER SER A . n 
A 1 553  ASN 553  550  550  ASN ASN A . n 
A 1 554  GLY 554  551  551  GLY GLY A . n 
A 1 555  LEU 555  552  552  LEU LEU A . n 
A 1 556  SER 556  553  553  SER SER A . n 
A 1 557  PRO 557  554  554  PRO PRO A . n 
A 1 558  LEU 558  555  555  LEU LEU A . n 
A 1 559  CYS 559  556  556  CYS CYS A . n 
A 1 560  ALA 560  557  557  ALA ALA A . n 
A 1 561  ILE 561  558  558  ILE ILE A . n 
A 1 562  GLY 562  559  559  GLY GLY A . n 
A 1 563  LEU 563  560  560  LEU LEU A . n 
A 1 564  TRP 564  561  561  TRP TRP A . n 
A 1 565  THR 565  562  562  THR THR A . n 
A 1 566  ASP 566  563  563  ASP ASP A . n 
A 1 567  ILE 567  564  564  ILE ILE A . n 
A 1 568  SER 568  565  565  SER SER A . n 
A 1 569  ALA 569  566  566  ALA ALA A . n 
A 1 570  ARG 570  567  567  ARG ARG A . n 
A 1 571  ILE 571  568  568  ILE ILE A . n 
A 1 572  LEU 572  569  569  LEU LEU A . n 
A 1 573  LYS 573  570  570  LYS LYS A . n 
A 1 574  LEU 574  571  571  LEU LEU A . n 
A 1 575  PRO 575  572  572  PRO PRO A . n 
A 1 576  SER 576  573  573  SER SER A . n 
A 1 577  PHE 577  574  574  PHE PHE A . n 
A 1 578  GLU 578  575  575  GLU GLU A . n 
A 1 579  LEU 579  576  576  LEU LEU A . n 
A 1 580  LEU 580  577  577  LEU LEU A . n 
A 1 581  HIS 581  578  578  HIS HIS A . n 
A 1 582  LYS 582  579  579  LYS LYS A . n 
A 1 583  GLU 583  580  580  GLU GLU A . n 
A 1 584  MET 584  581  581  MET MET A . n 
A 1 585  LEU 585  582  582  LEU LEU A . n 
A 1 586  GLY 586  583  583  GLY GLY A . n 
A 1 587  GLY 587  584  584  GLY GLY A . n 
A 1 588  GLU 588  585  585  GLU GLU A . n 
A 1 589  ILE 589  586  586  ILE ILE A . n 
A 1 590  ILE 590  587  587  ILE ILE A . n 
A 1 591  PRO 591  588  588  PRO PRO A . n 
A 1 592  ARG 592  589  589  ARG ARG A . n 
A 1 593  SER 593  590  590  SER SER A . n 
A 1 594  ILE 594  591  591  ILE ILE A . n 
A 1 595  LEU 595  592  592  LEU LEU A . n 
A 1 596  MET 596  593  593  MET MET A . n 
A 1 597  THR 597  594  594  THR THR A . n 
A 1 598  THR 598  595  595  THR THR A . n 
A 1 599  PHE 599  596  596  PHE PHE A . n 
A 1 600  GLU 600  597  597  GLU GLU A . n 
A 1 601  SER 601  598  598  SER SER A . n 
A 1 602  SER 602  599  599  SER SER A . n 
A 1 603  HIS 603  600  600  HIS HIS A . n 
A 1 604  TYR 604  601  601  TYR TYR A . n 
A 1 605  LEU 605  602  602  LEU LEU A . n 
A 1 606  LEU 606  603  603  LEU LEU A . n 
A 1 607  CYS 607  604  604  CYS CYS A . n 
A 1 608  ALA 608  605  605  ALA ALA A . n 
A 1 609  LEU 609  606  606  LEU LEU A . n 
A 1 610  GLY 610  607  607  GLY GLY A . n 
A 1 611  ASP 611  608  608  ASP ASP A . n 
A 1 612  GLY 612  609  609  GLY GLY A . n 
A 1 613  ALA 613  610  610  ALA ALA A . n 
A 1 614  LEU 614  611  611  LEU LEU A . n 
A 1 615  PHE 615  612  612  PHE PHE A . n 
A 1 616  TYR 616  613  613  TYR TYR A . n 
A 1 617  PHE 617  614  614  PHE PHE A . n 
A 1 618  GLY 618  615  615  GLY GLY A . n 
A 1 619  LEU 619  616  616  LEU LEU A . n 
A 1 620  ASN 620  617  617  ASN ASN A . n 
A 1 621  ILE 621  618  618  ILE ILE A . n 
A 1 622  GLU 622  619  619  GLU GLU A . n 
A 1 623  THR 623  620  620  THR THR A . n 
A 1 624  GLY 624  621  621  GLY GLY A . n 
A 1 625  LEU 625  622  622  LEU LEU A . n 
A 1 626  LEU 626  623  623  LEU LEU A . n 
A 1 627  SER 627  624  624  SER SER A . n 
A 1 628  ASP 628  625  625  ASP ASP A . n 
A 1 629  ARG 629  626  626  ARG ARG A . n 
A 1 630  LYS 630  627  627  LYS LYS A . n 
A 1 631  LYS 631  628  628  LYS LYS A . n 
A 1 632  VAL 632  629  629  VAL VAL A . n 
A 1 633  THR 633  630  630  THR THR A . n 
A 1 634  LEU 634  631  631  LEU LEU A . n 
A 1 635  GLY 635  632  632  GLY GLY A . n 
A 1 636  THR 636  633  633  THR THR A . n 
A 1 637  GLN 637  634  634  GLN GLN A . n 
A 1 638  PRO 638  635  635  PRO PRO A . n 
A 1 639  THR 639  636  636  THR THR A . n 
A 1 640  VAL 640  637  637  VAL VAL A . n 
A 1 641  LEU 641  638  638  LEU LEU A . n 
A 1 642  ARG 642  639  639  ARG ARG A . n 
A 1 643  THR 643  640  640  THR THR A . n 
A 1 644  PHE 644  641  641  PHE PHE A . n 
A 1 645  ARG 645  642  642  ARG ARG A . n 
A 1 646  SER 646  643  643  SER SER A . n 
A 1 647  LEU 647  644  644  LEU LEU A . n 
A 1 648  SER 648  645  645  SER SER A . n 
A 1 649  THR 649  646  646  THR THR A . n 
A 1 650  THR 650  647  647  THR THR A . n 
A 1 651  ASN 651  648  648  ASN ASN A . n 
A 1 652  VAL 652  649  649  VAL VAL A . n 
A 1 653  PHE 653  650  650  PHE PHE A . n 
A 1 654  ALA 654  651  651  ALA ALA A . n 
A 1 655  CYS 655  652  652  CYS CYS A . n 
A 1 656  SER 656  653  653  SER SER A . n 
A 1 657  ASP 657  654  654  ASP ASP A . n 
A 1 658  ARG 658  655  655  ARG ARG A . n 
A 1 659  PRO 659  656  656  PRO PRO A . n 
A 1 660  THR 660  657  657  THR THR A . n 
A 1 661  VAL 661  658  658  VAL VAL A . n 
A 1 662  ILE 662  659  659  ILE ILE A . n 
A 1 663  TYR 663  660  660  TYR TYR A . n 
A 1 664  SER 664  661  661  SER SER A . n 
A 1 665  SER 665  662  662  SER SER A . n 
A 1 666  ASN 666  663  663  ASN ASN A . n 
A 1 667  HIS 667  664  664  HIS HIS A . n 
A 1 668  LYS 668  665  665  LYS LYS A . n 
A 1 669  LEU 669  666  666  LEU LEU A . n 
A 1 670  VAL 670  667  667  VAL VAL A . n 
A 1 671  PHE 671  668  668  PHE PHE A . n 
A 1 672  SER 672  669  669  SER SER A . n 
A 1 673  ASN 673  670  670  ASN ASN A . n 
A 1 674  VAL 674  671  671  VAL VAL A . n 
A 1 675  ASN 675  672  672  ASN ASN A . n 
A 1 676  LEU 676  673  673  LEU LEU A . n 
A 1 677  LYS 677  674  674  LYS LYS A . n 
A 1 678  GLU 678  675  675  GLU GLU A . n 
A 1 679  VAL 679  676  676  VAL VAL A . n 
A 1 680  ASN 680  677  677  ASN ASN A . n 
A 1 681  TYR 681  678  678  TYR TYR A . n 
A 1 682  MET 682  679  679  MET MET A . n 
A 1 683  CYS 683  680  680  CYS CYS A . n 
A 1 684  PRO 684  681  681  PRO PRO A . n 
A 1 685  LEU 685  682  682  LEU LEU A . n 
A 1 686  ASN 686  683  683  ASN ASN A . n 
A 1 687  SER 687  684  684  SER SER A . n 
A 1 688  ASP 688  685  685  ASP ASP A . n 
A 1 689  GLY 689  686  686  GLY GLY A . n 
A 1 690  TYR 690  687  687  TYR TYR A . n 
A 1 691  PRO 691  688  688  PRO PRO A . n 
A 1 692  ASP 692  689  689  ASP ASP A . n 
A 1 693  SER 693  690  690  SER SER A . n 
A 1 694  LEU 694  691  691  LEU LEU A . n 
A 1 695  ALA 695  692  692  ALA ALA A . n 
A 1 696  LEU 696  693  693  LEU LEU A . n 
A 1 697  ALA 697  694  694  ALA ALA A . n 
A 1 698  ASN 698  695  695  ASN ASN A . n 
A 1 699  ASN 699  696  696  ASN ASN A . n 
A 1 700  SER 700  697  697  SER SER A . n 
A 1 701  THR 701  698  698  THR THR A . n 
A 1 702  LEU 702  699  699  LEU LEU A . n 
A 1 703  THR 703  700  700  THR THR A . n 
A 1 704  ILE 704  701  701  ILE ILE A . n 
A 1 705  GLY 705  702  702  GLY GLY A . n 
A 1 706  THR 706  703  703  THR THR A . n 
A 1 707  ILE 707  704  704  ILE ILE A . n 
A 1 708  ASP 708  705  705  ASP ASP A . n 
A 1 709  GLU 709  706  706  GLU GLU A . n 
A 1 710  ILE 710  707  707  ILE ILE A . n 
A 1 711  GLN 711  708  708  GLN GLN A . n 
A 1 712  LYS 712  709  709  LYS LYS A . n 
A 1 713  LEU 713  710  710  LEU LEU A . n 
A 1 714  HIS 714  711  711  HIS HIS A . n 
A 1 715  ILE 715  712  712  ILE ILE A . n 
A 1 716  ARG 716  713  713  ARG ARG A . n 
A 1 717  THR 717  714  714  THR THR A . n 
A 1 718  VAL 718  715  715  VAL VAL A . n 
A 1 719  PRO 719  716  716  PRO PRO A . n 
A 1 720  LEU 720  717  717  LEU LEU A . n 
A 1 721  TYR 721  718  718  TYR TYR A . n 
A 1 722  GLU 722  719  719  GLU GLU A . n 
A 1 723  SER 723  720  720  SER SER A . n 
A 1 724  PRO 724  721  721  PRO PRO A . n 
A 1 725  ARG 725  722  722  ARG ARG A . n 
A 1 726  LYS 726  723  723  LYS LYS A . n 
A 1 727  ILE 727  724  724  ILE ILE A . n 
A 1 728  CYS 728  725  725  CYS CYS A . n 
A 1 729  TYR 729  726  726  TYR TYR A . n 
A 1 730  GLN 730  727  727  GLN GLN A . n 
A 1 731  GLU 731  728  728  GLU GLU A . n 
A 1 732  VAL 732  729  729  VAL VAL A . n 
A 1 733  SER 733  730  730  SER SER A . n 
A 1 734  GLN 734  731  731  GLN GLN A . n 
A 1 735  CYS 735  732  732  CYS CYS A . n 
A 1 736  PHE 736  733  733  PHE PHE A . n 
A 1 737  GLY 737  734  734  GLY GLY A . n 
A 1 738  VAL 738  735  735  VAL VAL A . n 
A 1 739  LEU 739  736  736  LEU LEU A . n 
A 1 740  SER 740  737  737  SER SER A . n 
A 1 741  SER 741  738  738  SER SER A . n 
A 1 742  ARG 742  739  739  ARG ARG A . n 
A 1 743  ILE 743  740  740  ILE ILE A . n 
A 1 744  GLU 744  741  741  GLU GLU A . n 
A 1 745  VAL 745  742  742  VAL VAL A . n 
A 1 746  GLN 746  743  743  GLN GLN A . n 
A 1 747  ASP 747  744  744  ASP ASP A . n 
A 1 748  THR 748  745  745  THR THR A . n 
A 1 749  SER 749  746  746  SER SER A . n 
A 1 750  GLY 750  747  747  GLY GLY A . n 
A 1 751  GLY 751  748  748  GLY GLY A . n 
A 1 752  THR 752  749  749  THR THR A . n 
A 1 753  THR 753  750  750  THR THR A . n 
A 1 754  ALA 754  751  751  ALA ALA A . n 
A 1 755  LEU 755  752  752  LEU LEU A . n 
A 1 756  ARG 756  753  753  ARG ARG A . n 
A 1 757  PRO 757  754  754  PRO PRO A . n 
A 1 758  SER 758  755  755  SER SER A . n 
A 1 759  ALA 759  756  756  ALA ALA A . n 
A 1 760  SER 760  757  757  SER SER A . n 
A 1 761  THR 761  758  758  THR THR A . n 
A 1 762  GLN 762  759  759  GLN GLN A . n 
A 1 763  ALA 763  760  760  ALA ALA A . n 
A 1 764  LEU 764  761  761  LEU LEU A . n 
A 1 765  SER 765  762  762  SER SER A . n 
A 1 766  SER 766  763  763  SER SER A . n 
A 1 767  SER 767  764  764  SER SER A . n 
A 1 768  VAL 768  765  765  VAL VAL A . n 
A 1 769  SER 769  766  766  SER SER A . n 
A 1 770  SER 770  767  767  SER SER A . n 
A 1 771  SER 771  768  768  SER SER A . n 
A 1 772  LYS 772  769  769  LYS LYS A . n 
A 1 773  LEU 773  770  770  LEU LEU A . n 
A 1 774  PHE 774  771  771  PHE PHE A . n 
A 1 775  SER 775  772  772  SER SER A . n 
A 1 776  SER 776  773  773  SER SER A . n 
A 1 777  SER 777  774  ?    ?   ?   A . n 
A 1 778  THR 778  775  ?    ?   ?   A . n 
A 1 779  ALA 779  776  ?    ?   ?   A . n 
A 1 780  PRO 780  777  ?    ?   ?   A . n 
A 1 781  HIS 781  778  ?    ?   ?   A . n 
A 1 782  GLU 782  779  ?    ?   ?   A . n 
A 1 783  THR 783  780  ?    ?   ?   A . n 
A 1 784  SER 784  781  ?    ?   ?   A . n 
A 1 785  PHE 785  782  ?    ?   ?   A . n 
A 1 786  GLY 786  783  783  GLY GLY A . n 
A 1 787  GLU 787  784  784  GLU GLU A . n 
A 1 788  GLU 788  785  785  GLU GLU A . n 
A 1 789  VAL 789  786  786  VAL VAL A . n 
A 1 790  GLU 790  787  787  GLU GLU A . n 
A 1 791  VAL 791  788  788  VAL VAL A . n 
A 1 792  HIS 792  789  789  HIS HIS A . n 
A 1 793  ASN 793  790  790  ASN ASN A . n 
A 1 794  LEU 794  791  791  LEU LEU A . n 
A 1 795  LEU 795  792  792  LEU LEU A . n 
A 1 796  ILE 796  793  793  ILE ILE A . n 
A 1 797  ILE 797  794  794  ILE ILE A . n 
A 1 798  ASP 798  795  795  ASP ASP A . n 
A 1 799  GLN 799  796  796  GLN GLN A . n 
A 1 800  HIS 800  797  797  HIS HIS A . n 
A 1 801  THR 801  798  798  THR THR A . n 
A 1 802  PHE 802  799  799  PHE PHE A . n 
A 1 803  GLU 803  800  800  GLU GLU A . n 
A 1 804  VAL 804  801  801  VAL VAL A . n 
A 1 805  LEU 805  802  802  LEU LEU A . n 
A 1 806  HIS 806  803  803  HIS HIS A . n 
A 1 807  ALA 807  804  804  ALA ALA A . n 
A 1 808  HIS 808  805  805  HIS HIS A . n 
A 1 809  GLN 809  806  806  GLN GLN A . n 
A 1 810  PHE 810  807  807  PHE PHE A . n 
A 1 811  LEU 811  808  808  LEU LEU A . n 
A 1 812  GLN 812  809  809  GLN GLN A . n 
A 1 813  ASN 813  810  810  ASN ASN A . n 
A 1 814  GLU 814  811  811  GLU GLU A . n 
A 1 815  TYR 815  812  812  TYR TYR A . n 
A 1 816  ALA 816  813  813  ALA ALA A . n 
A 1 817  LEU 817  814  814  LEU LEU A . n 
A 1 818  SER 818  815  815  SER SER A . n 
A 1 819  LEU 819  816  816  LEU LEU A . n 
A 1 820  VAL 820  817  817  VAL VAL A . n 
A 1 821  SER 821  818  818  SER SER A . n 
A 1 822  CYS 822  819  819  CYS CYS A . n 
A 1 823  LYS 823  820  820  LYS LYS A . n 
A 1 824  LEU 824  821  821  LEU LEU A . n 
A 1 825  GLY 825  822  822  GLY GLY A . n 
A 1 826  LYS 826  823  823  LYS LYS A . n 
A 1 827  ASP 827  824  824  ASP ASP A . n 
A 1 828  PRO 828  825  825  PRO PRO A . n 
A 1 829  ASN 829  826  826  ASN ASN A . n 
A 1 830  THR 830  827  827  THR THR A . n 
A 1 831  TYR 831  828  828  TYR TYR A . n 
A 1 832  PHE 832  829  829  PHE PHE A . n 
A 1 833  ILE 833  830  830  ILE ILE A . n 
A 1 834  VAL 834  831  831  VAL VAL A . n 
A 1 835  GLY 835  832  832  GLY GLY A . n 
A 1 836  THR 836  833  833  THR THR A . n 
A 1 837  ALA 837  834  834  ALA ALA A . n 
A 1 838  MET 838  835  835  MET MET A . n 
A 1 839  VAL 839  836  836  VAL VAL A . n 
A 1 840  TYR 840  837  837  TYR TYR A . n 
A 1 841  PRO 841  838  838  PRO PRO A . n 
A 1 842  GLU 842  839  839  GLU GLU A . n 
A 1 843  GLU 843  840  840  GLU GLU A . n 
A 1 844  ALA 844  841  841  ALA ALA A . n 
A 1 845  GLU 845  842  842  GLU GLU A . n 
A 1 846  PRO 846  843  843  PRO PRO A . n 
A 1 847  LYS 847  844  844  LYS LYS A . n 
A 1 848  GLN 848  845  845  GLN GLN A . n 
A 1 849  GLY 849  846  846  GLY GLY A . n 
A 1 850  ARG 850  847  847  ARG ARG A . n 
A 1 851  ILE 851  848  848  ILE ILE A . n 
A 1 852  VAL 852  849  849  VAL VAL A . n 
A 1 853  VAL 853  850  850  VAL VAL A . n 
A 1 854  PHE 854  851  851  PHE PHE A . n 
A 1 855  GLN 855  852  852  GLN GLN A . n 
A 1 856  TYR 856  853  853  TYR TYR A . n 
A 1 857  SER 857  854  854  SER SER A . n 
A 1 858  ASP 858  855  855  ASP ASP A . n 
A 1 859  GLY 859  856  856  GLY GLY A . n 
A 1 860  LYS 860  857  857  LYS LYS A . n 
A 1 861  LEU 861  858  858  LEU LEU A . n 
A 1 862  GLN 862  859  859  GLN GLN A . n 
A 1 863  THR 863  860  860  THR THR A . n 
A 1 864  VAL 864  861  861  VAL VAL A . n 
A 1 865  ALA 865  862  862  ALA ALA A . n 
A 1 866  GLU 866  863  863  GLU GLU A . n 
A 1 867  LYS 867  864  864  LYS LYS A . n 
A 1 868  GLU 868  865  865  GLU GLU A . n 
A 1 869  VAL 869  866  866  VAL VAL A . n 
A 1 870  LYS 870  867  867  LYS LYS A . n 
A 1 871  GLY 871  868  868  GLY GLY A . n 
A 1 872  ALA 872  869  869  ALA ALA A . n 
A 1 873  VAL 873  870  870  VAL VAL A . n 
A 1 874  TYR 874  871  871  TYR TYR A . n 
A 1 875  SER 875  872  872  SER SER A . n 
A 1 876  MET 876  873  873  MET MET A . n 
A 1 877  VAL 877  874  874  VAL VAL A . n 
A 1 878  GLU 878  875  875  GLU GLU A . n 
A 1 879  PHE 879  876  876  PHE PHE A . n 
A 1 880  ASN 880  877  877  ASN ASN A . n 
A 1 881  GLY 881  878  878  GLY GLY A . n 
A 1 882  LYS 882  879  879  LYS LYS A . n 
A 1 883  LEU 883  880  880  LEU LEU A . n 
A 1 884  LEU 884  881  881  LEU LEU A . n 
A 1 885  ALA 885  882  882  ALA ALA A . n 
A 1 886  SER 886  883  883  SER SER A . n 
A 1 887  ILE 887  884  884  ILE ILE A . n 
A 1 888  ASN 888  885  885  ASN ASN A . n 
A 1 889  SER 889  886  886  SER SER A . n 
A 1 890  THR 890  887  887  THR THR A . n 
A 1 891  VAL 891  888  888  VAL VAL A . n 
A 1 892  ARG 892  889  889  ARG ARG A . n 
A 1 893  LEU 893  890  890  LEU LEU A . n 
A 1 894  TYR 894  891  891  TYR TYR A . n 
A 1 895  GLU 895  892  892  GLU GLU A . n 
A 1 896  TRP 896  893  893  TRP TRP A . n 
A 1 897  THR 897  894  894  THR THR A . n 
A 1 898  THR 898  895  895  THR THR A . n 
A 1 899  GLU 899  896  896  GLU GLU A . n 
A 1 900  LYS 900  897  897  LYS LYS A . n 
A 1 901  ASP 901  898  898  ASP ASP A . n 
A 1 902  VAL 902  899  899  VAL VAL A . n 
A 1 903  ARG 903  900  900  ARG ARG A . n 
A 1 904  THR 904  901  901  THR THR A . n 
A 1 905  GLU 905  902  902  GLU GLU A . n 
A 1 906  CYS 906  903  903  CYS CYS A . n 
A 1 907  ASN 907  904  904  ASN ASN A . n 
A 1 908  HIS 908  905  905  HIS HIS A . n 
A 1 909  TYR 909  906  906  TYR TYR A . n 
A 1 910  ASN 910  907  907  ASN ASN A . n 
A 1 911  ASN 911  908  908  ASN ASN A . n 
A 1 912  ILE 912  909  909  ILE ILE A . n 
A 1 913  MET 913  910  910  MET MET A . n 
A 1 914  ALA 914  911  911  ALA ALA A . n 
A 1 915  LEU 915  912  912  LEU LEU A . n 
A 1 916  TYR 916  913  913  TYR TYR A . n 
A 1 917  LEU 917  914  914  LEU LEU A . n 
A 1 918  LYS 918  915  915  LYS LYS A . n 
A 1 919  THR 919  916  916  THR THR A . n 
A 1 920  LYS 920  917  917  LYS LYS A . n 
A 1 921  GLY 921  918  918  GLY GLY A . n 
A 1 922  ASP 922  919  919  ASP ASP A . n 
A 1 923  PHE 923  920  920  PHE PHE A . n 
A 1 924  ILE 924  921  921  ILE ILE A . n 
A 1 925  LEU 925  922  922  LEU LEU A . n 
A 1 926  VAL 926  923  923  VAL VAL A . n 
A 1 927  GLY 927  924  924  GLY GLY A . n 
A 1 928  ASP 928  925  925  ASP ASP A . n 
A 1 929  LEU 929  926  926  LEU LEU A . n 
A 1 930  MET 930  927  927  MET MET A . n 
A 1 931  ARG 931  928  928  ARG ARG A . n 
A 1 932  SER 932  929  929  SER SER A . n 
A 1 933  VAL 933  930  930  VAL VAL A . n 
A 1 934  LEU 934  931  931  LEU LEU A . n 
A 1 935  LEU 935  932  932  LEU LEU A . n 
A 1 936  LEU 936  933  933  LEU LEU A . n 
A 1 937  ALA 937  934  934  ALA ALA A . n 
A 1 938  TYR 938  935  935  TYR TYR A . n 
A 1 939  LYS 939  936  936  LYS LYS A . n 
A 1 940  PRO 940  937  937  PRO PRO A . n 
A 1 941  MET 941  938  938  MET MET A . n 
A 1 942  GLU 942  939  939  GLU GLU A . n 
A 1 943  GLY 943  940  940  GLY GLY A . n 
A 1 944  ASN 944  941  941  ASN ASN A . n 
A 1 945  PHE 945  942  942  PHE PHE A . n 
A 1 946  GLU 946  943  943  GLU GLU A . n 
A 1 947  GLU 947  944  944  GLU GLU A . n 
A 1 948  ILE 948  945  945  ILE ILE A . n 
A 1 949  ALA 949  946  946  ALA ALA A . n 
A 1 950  ARG 950  947  947  ARG ARG A . n 
A 1 951  ASP 951  948  948  ASP ASP A . n 
A 1 952  PHE 952  949  949  PHE PHE A . n 
A 1 953  ASN 953  950  950  ASN ASN A . n 
A 1 954  PRO 954  951  951  PRO PRO A . n 
A 1 955  ASN 955  952  952  ASN ASN A . n 
A 1 956  TRP 956  953  953  TRP TRP A . n 
A 1 957  MET 957  954  954  MET MET A . n 
A 1 958  SER 958  955  955  SER SER A . n 
A 1 959  ALA 959  956  956  ALA ALA A . n 
A 1 960  VAL 960  957  957  VAL VAL A . n 
A 1 961  GLU 961  958  958  GLU GLU A . n 
A 1 962  ILE 962  959  959  ILE ILE A . n 
A 1 963  LEU 963  960  960  LEU LEU A . n 
A 1 964  ASP 964  961  961  ASP ASP A . n 
A 1 965  ASP 965  962  962  ASP ASP A . n 
A 1 966  ASP 966  963  963  ASP ASP A . n 
A 1 967  ASN 967  964  964  ASN ASN A . n 
A 1 968  PHE 968  965  965  PHE PHE A . n 
A 1 969  LEU 969  966  966  LEU LEU A . n 
A 1 970  GLY 970  967  967  GLY GLY A . n 
A 1 971  ALA 971  968  968  ALA ALA A . n 
A 1 972  GLU 972  969  969  GLU GLU A . n 
A 1 973  ASN 973  970  970  ASN ASN A . n 
A 1 974  ALA 974  971  971  ALA ALA A . n 
A 1 975  PHE 975  972  972  PHE PHE A . n 
A 1 976  ASN 976  973  973  ASN ASN A . n 
A 1 977  LEU 977  974  974  LEU LEU A . n 
A 1 978  PHE 978  975  975  PHE PHE A . n 
A 1 979  VAL 979  976  976  VAL VAL A . n 
A 1 980  CYS 980  977  977  CYS CYS A . n 
A 1 981  GLN 981  978  978  GLN GLN A . n 
A 1 982  LYS 982  979  979  LYS LYS A . n 
A 1 983  ASP 983  980  980  ASP ASP A . n 
A 1 984  SER 984  981  981  SER SER A . n 
A 1 985  ALA 985  982  982  ALA ALA A . n 
A 1 986  ALA 986  983  983  ALA ALA A . n 
A 1 987  THR 987  984  984  THR THR A . n 
A 1 988  THR 988  985  985  THR THR A . n 
A 1 989  ASP 989  986  986  ASP ASP A . n 
A 1 990  GLU 990  987  987  GLU GLU A . n 
A 1 991  GLU 991  988  988  GLU GLU A . n 
A 1 992  ARG 992  989  989  ARG ARG A . n 
A 1 993  GLN 993  990  990  GLN GLN A . n 
A 1 994  HIS 994  991  991  HIS HIS A . n 
A 1 995  LEU 995  992  992  LEU LEU A . n 
A 1 996  GLN 996  993  993  GLN GLN A . n 
A 1 997  GLU 997  994  994  GLU GLU A . n 
A 1 998  VAL 998  995  995  VAL VAL A . n 
A 1 999  GLY 999  996  996  GLY GLY A . n 
A 1 1000 LEU 1000 997  997  LEU LEU A . n 
A 1 1001 PHE 1001 998  998  PHE PHE A . n 
A 1 1002 HIS 1002 999  999  HIS HIS A . n 
A 1 1003 LEU 1003 1000 1000 LEU LEU A . n 
A 1 1004 GLY 1004 1001 1001 GLY GLY A . n 
A 1 1005 GLU 1005 1002 1002 GLU GLU A . n 
A 1 1006 PHE 1006 1003 1003 PHE PHE A . n 
A 1 1007 VAL 1007 1004 1004 VAL VAL A . n 
A 1 1008 ASN 1008 1005 1005 ASN ASN A . n 
A 1 1009 VAL 1009 1006 1006 VAL VAL A . n 
A 1 1010 PHE 1010 1007 1007 PHE PHE A . n 
A 1 1011 CYS 1011 1008 1008 CYS CYS A . n 
A 1 1012 HIS 1012 1009 1009 HIS HIS A . n 
A 1 1013 GLY 1013 1010 1010 GLY GLY A . n 
A 1 1014 SER 1014 1011 1011 SER SER A . n 
A 1 1015 LEU 1015 1012 1012 LEU LEU A . n 
A 1 1016 VAL 1016 1013 1013 VAL VAL A . n 
A 1 1017 MET 1017 1014 1014 MET MET A . n 
A 1 1018 GLN 1018 1015 1015 GLN GLN A . n 
A 1 1019 ASN 1019 1016 ?    ?   ?   A . n 
A 1 1020 LEU 1020 1017 ?    ?   ?   A . n 
A 1 1021 GLY 1021 1018 ?    ?   ?   A . n 
A 1 1022 GLU 1022 1019 ?    ?   ?   A . n 
A 1 1023 THR 1023 1020 ?    ?   ?   A . n 
A 1 1024 SER 1024 1021 ?    ?   ?   A . n 
A 1 1025 THR 1025 1022 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1023 1023 PRO PRO A . n 
A 1 1027 THR 1027 1024 1024 THR THR A . n 
A 1 1028 GLN 1028 1025 1025 GLN GLN A . n 
A 1 1029 GLY 1029 1026 1026 GLY GLY A . n 
A 1 1030 SER 1030 1027 1027 SER SER A . n 
A 1 1031 VAL 1031 1028 1028 VAL VAL A . n 
A 1 1032 LEU 1032 1029 1029 LEU LEU A . n 
A 1 1033 PHE 1033 1030 1030 PHE PHE A . n 
A 1 1034 GLY 1034 1031 1031 GLY GLY A . n 
A 1 1035 THR 1035 1032 1032 THR THR A . n 
A 1 1036 VAL 1036 1033 1033 VAL VAL A . n 
A 1 1037 ASN 1037 1034 1034 ASN ASN A . n 
A 1 1038 GLY 1038 1035 1035 GLY GLY A . n 
A 1 1039 MET 1039 1036 1036 MET MET A . n 
A 1 1040 ILE 1040 1037 1037 ILE ILE A . n 
A 1 1041 GLY 1041 1038 1038 GLY GLY A . n 
A 1 1042 LEU 1042 1039 1039 LEU LEU A . n 
A 1 1043 VAL 1043 1040 1040 VAL VAL A . n 
A 1 1044 THR 1044 1041 1041 THR THR A . n 
A 1 1045 SER 1045 1042 1042 SER SER A . n 
A 1 1046 LEU 1046 1043 1043 LEU LEU A . n 
A 1 1047 SER 1047 1044 1044 SER SER A . n 
A 1 1048 GLU 1048 1045 1045 GLU GLU A . n 
A 1 1049 SER 1049 1046 1046 SER SER A . n 
A 1 1050 TRP 1050 1047 1047 TRP TRP A . n 
A 1 1051 TYR 1051 1048 1048 TYR TYR A . n 
A 1 1052 ASN 1052 1049 1049 ASN ASN A . n 
A 1 1053 LEU 1053 1050 1050 LEU LEU A . n 
A 1 1054 LEU 1054 1051 1051 LEU LEU A . n 
A 1 1055 LEU 1055 1052 1052 LEU LEU A . n 
A 1 1056 ASP 1056 1053 1053 ASP ASP A . n 
A 1 1057 MET 1057 1054 1054 MET MET A . n 
A 1 1058 GLN 1058 1055 1055 GLN GLN A . n 
A 1 1059 ASN 1059 1056 1056 ASN ASN A . n 
A 1 1060 ARG 1060 1057 1057 ARG ARG A . n 
A 1 1061 LEU 1061 1058 1058 LEU LEU A . n 
A 1 1062 ASN 1062 1059 1059 ASN ASN A . n 
A 1 1063 LYS 1063 1060 1060 LYS LYS A . n 
A 1 1064 VAL 1064 1061 1061 VAL VAL A . n 
A 1 1065 ILE 1065 1062 1062 ILE ILE A . n 
A 1 1066 LYS 1066 1063 1063 LYS LYS A . n 
A 1 1067 SER 1067 1064 1064 SER SER A . n 
A 1 1068 VAL 1068 1065 1065 VAL VAL A . n 
A 1 1069 GLY 1069 1066 1066 GLY GLY A . n 
A 1 1070 LYS 1070 1067 1067 LYS LYS A . n 
A 1 1071 ILE 1071 1068 1068 ILE ILE A . n 
A 1 1072 GLU 1072 1069 1069 GLU GLU A . n 
A 1 1073 HIS 1073 1070 1070 HIS HIS A . n 
A 1 1074 SER 1074 1071 1071 SER SER A . n 
A 1 1075 PHE 1075 1072 1072 PHE PHE A . n 
A 1 1076 TRP 1076 1073 1073 TRP TRP A . n 
A 1 1077 ARG 1077 1074 1074 ARG ARG A . n 
A 1 1078 SER 1078 1075 1075 SER SER A . n 
A 1 1079 PHE 1079 1076 1076 PHE PHE A . n 
A 1 1080 HIS 1080 1077 1077 HIS HIS A . n 
A 1 1081 THR 1081 1078 1078 THR THR A . n 
A 1 1082 GLU 1082 1079 1079 GLU GLU A . n 
A 1 1083 ARG 1083 1080 1080 ARG ARG A . n 
A 1 1084 LYS 1084 1081 1081 LYS LYS A . n 
A 1 1085 THR 1085 1082 1082 THR THR A . n 
A 1 1086 GLU 1086 1083 1083 GLU GLU A . n 
A 1 1087 PRO 1087 1084 1084 PRO PRO A . n 
A 1 1088 ALA 1088 1085 1085 ALA ALA A . n 
A 1 1089 THR 1089 1086 1086 THR THR A . n 
A 1 1090 GLY 1090 1087 1087 GLY GLY A . n 
A 1 1091 PHE 1091 1088 1088 PHE PHE A . n 
A 1 1092 ILE 1092 1089 1089 ILE ILE A . n 
A 1 1093 ASP 1093 1090 1090 ASP ASP A . n 
A 1 1094 GLY 1094 1091 1091 GLY GLY A . n 
A 1 1095 ASP 1095 1092 1092 ASP ASP A . n 
A 1 1096 LEU 1096 1093 1093 LEU LEU A . n 
A 1 1097 ILE 1097 1094 1094 ILE ILE A . n 
A 1 1098 GLU 1098 1095 1095 GLU GLU A . n 
A 1 1099 SER 1099 1096 1096 SER SER A . n 
A 1 1100 PHE 1100 1097 1097 PHE PHE A . n 
A 1 1101 LEU 1101 1098 1098 LEU LEU A . n 
A 1 1102 ASP 1102 1099 1099 ASP ASP A . n 
A 1 1103 ILE 1103 1100 1100 ILE ILE A . n 
A 1 1104 SER 1104 1101 1101 SER SER A . n 
A 1 1105 ARG 1105 1102 1102 ARG ARG A . n 
A 1 1106 PRO 1106 1103 1103 PRO PRO A . n 
A 1 1107 LYS 1107 1104 1104 LYS LYS A . n 
A 1 1108 MET 1108 1105 1105 MET MET A . n 
A 1 1109 GLN 1109 1106 1106 GLN GLN A . n 
A 1 1110 GLU 1110 1107 1107 GLU GLU A . n 
A 1 1111 VAL 1111 1108 1108 VAL VAL A . n 
A 1 1112 VAL 1112 1109 1109 VAL VAL A . n 
A 1 1113 ALA 1113 1110 1110 ALA ALA A . n 
A 1 1114 ASN 1114 1111 1111 ASN ASN A . n 
A 1 1115 LEU 1115 1112 ?    ?   ?   A . n 
A 1 1116 GLN 1116 1113 ?    ?   ?   A . n 
A 1 1117 TYR 1117 1114 ?    ?   ?   A . n 
A 1 1118 ASP 1118 1115 ?    ?   ?   A . n 
A 1 1119 ASP 1119 1116 ?    ?   ?   A . n 
A 1 1120 GLY 1120 1117 ?    ?   ?   A . n 
A 1 1121 SER 1121 1118 ?    ?   ?   A . n 
A 1 1122 GLY 1122 1119 ?    ?   ?   A . n 
A 1 1123 MET 1123 1120 ?    ?   ?   A . n 
A 1 1124 LYS 1124 1121 ?    ?   ?   A . n 
A 1 1125 ARG 1125 1122 1122 ARG ARG A . n 
A 1 1126 GLU 1126 1123 1123 GLU GLU A . n 
A 1 1127 ALA 1127 1124 1124 ALA ALA A . n 
A 1 1128 THR 1128 1125 1125 THR THR A . n 
A 1 1129 ALA 1129 1126 1126 ALA ALA A . n 
A 1 1130 ASP 1130 1127 1127 ASP ASP A . n 
A 1 1131 ASP 1131 1128 1128 ASP ASP A . n 
A 1 1132 LEU 1132 1129 1129 LEU LEU A . n 
A 1 1133 ILE 1133 1130 1130 ILE ILE A . n 
A 1 1134 LYS 1134 1131 1131 LYS LYS A . n 
A 1 1135 VAL 1135 1132 1132 VAL VAL A . n 
A 1 1136 VAL 1136 1133 1133 VAL VAL A . n 
A 1 1137 GLU 1137 1134 1134 GLU GLU A . n 
A 1 1138 GLU 1138 1135 1135 GLU GLU A . n 
A 1 1139 LEU 1139 1136 1136 LEU LEU A . n 
A 1 1140 THR 1140 1137 1137 THR THR A . n 
A 1 1141 ARG 1141 1138 1138 ARG ARG A . n 
A 1 1142 ILE 1142 1139 1139 ILE ILE A . n 
A 1 1143 HIS 1143 1140 1140 HIS HIS A . n 
B 2 1    SER 1    13   13   SER SER B . n 
B 2 2    VAL 2    14   14   VAL VAL B . n 
B 2 3    VAL 3    15   15   VAL VAL B . n 
B 2 4    GLY 4    16   16   GLY GLY B . n 
B 2 5    PHE 5    17   17   PHE PHE B . n 
B 2 6    LEU 6    18   18   LEU LEU B . n 
B 2 7    SER 7    19   19   SER SER B . n 
B 2 8    GLN 8    20   20   GLN GLN B . n 
B 2 9    ARG 9    21   21   ARG ARG B . n 
B 2 10   GLY 10   22   22   GLY GLY B . n 
B 2 11   LEU 11   23   23   LEU LEU B . n 
B 2 12   HIS 12   24   24   HIS HIS B . n 
B 2 13   GLY 13   25   25   GLY GLY B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1370  ? 
1 MORE         -8    ? 
1 'SSA (A^2)'  48070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3I89 
_pdbx_entry_details.sequence_details     'MUTATIONS OCCURRED DURING THE CLONING OF DDB1' 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 384  ? ? OE1 A GLU 384  ? ? 1.320 1.252 0.068  0.011 N 
2 1 CB A CYS 725  ? ? SG  A CYS 725  ? ? 1.716 1.812 -0.096 0.016 N 
3 1 CD A GLU 939  ? ? OE1 A GLU 939  ? ? 1.375 1.252 0.123  0.011 N 
4 1 CD A GLU 939  ? ? OE2 A GLU 939  ? ? 1.420 1.252 0.168  0.011 N 
5 1 CD A GLU 1135 ? ? OE1 A GLU 1135 ? ? 1.470 1.252 0.218  0.011 N 
6 1 CA B GLY 16   ? ? C   B GLY 16   ? ? 1.661 1.514 0.147  0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A ASP 184 ? ? N  A PRO 185 ? ? CD  A PRO 185 ? ? 111.03 128.40 -17.37 2.10 Y 
2 1 N  A ASN 203 ? ? CA A ASN 203 ? ? C   A ASN 203 ? ? 93.69  111.00 -17.31 2.70 N 
3 1 C  A GLY 205 ? ? N  A PRO 206 ? ? CA  A PRO 206 ? ? 133.23 119.30 13.93  1.50 Y 
4 1 C  A GLY 205 ? ? N  A PRO 206 ? ? CD  A PRO 206 ? ? 114.50 128.40 -13.90 2.10 Y 
5 1 CB A ASP 330 ? ? CG A ASP 330 ? ? OD1 A ASP 330 ? ? 124.01 118.30 5.71   0.90 N 
6 1 N  A TRP 561 ? ? CA A TRP 561 ? ? C   A TRP 561 ? ? 132.38 111.00 21.38  2.70 N 
7 1 C  A ASN 950 ? ? N  A PRO 951 ? ? CD  A PRO 951 ? ? 110.53 128.40 -17.87 2.10 Y 
8 1 CA A LEU 992 ? ? CB A LEU 992 ? ? CG  A LEU 992 ? ? 129.73 115.30 14.43  2.30 N 
9 1 CA B GLY 16  ? ? C  B GLY 16  ? ? O   B GLY 16  ? ? 109.02 120.60 -11.58 1.80 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASP A 28   ? ? 164.36  136.17  
2   1 LYS A 35   ? ? -109.20 -79.24  
3   1 ASN A 36   ? ? -136.60 -58.29  
4   1 ALA A 46   ? ? -29.28  -51.13  
5   1 VAL A 52   ? ? -138.41 -32.47  
6   1 TYR A 58   ? ? -99.89  50.95   
7   1 HIS A 105  ? ? -177.92 146.53  
8   1 SER A 116  ? ? -83.52  -156.30 
9   1 THR A 118  ? ? 92.21   11.52   
10  1 ASP A 148  ? ? -87.32  -114.71 
11  1 ASN A 149  ? ? 37.04   33.04   
12  1 LYS A 150  ? ? -59.91  -2.01   
13  1 LEU A 152  ? ? 35.31   59.28   
14  1 GLN A 174  ? ? -60.29  -75.57  
15  1 PRO A 176  ? ? -22.68  103.34  
16  1 PRO A 185  ? ? -3.52   -100.54 
17  1 GLN A 186  ? ? -21.96  -100.83 
18  1 LYS A 200  ? ? 44.67   80.92   
19  1 GLU A 201  ? ? -148.85 -94.43  
20  1 PHE A 202  ? ? -178.80 -129.64 
21  1 ASN A 203  ? ? 160.37  -152.50 
22  1 PRO A 206  ? ? -32.55  -33.29  
23  1 SER A 217  ? ? -147.07 -22.28  
24  1 GLU A 224  ? ? -7.49   -76.84  
25  1 PRO A 225  ? ? -58.40  -2.20   
26  1 GLU A 235  ? ? 51.15   -14.09  
27  1 ASN A 241  ? ? -175.99 131.08  
28  1 VAL A 259  ? ? -150.05 -22.05  
29  1 LYS A 287  ? ? -68.27  -164.61 
30  1 GLU A 288  ? ? 164.78  142.23  
31  1 MET A 291  ? ? -60.85  -98.15  
32  1 THR A 294  ? ? -69.72  -138.71 
33  1 THR A 296  ? ? -69.54  -157.59 
34  1 GLU A 312  ? ? -90.55  -60.37  
35  1 LEU A 317  ? ? -126.12 -125.43 
36  1 ASP A 318  ? ? -62.54  -175.32 
37  1 ASN A 341  ? ? -62.86  -133.68 
38  1 GLN A 343  ? ? 108.74  1.77    
39  1 TYR A 346  ? ? -57.71  8.89    
40  1 THR A 352  ? ? -160.81 109.12  
41  1 LEU A 356  ? ? -66.88  7.70    
42  1 VAL A 365  ? ? -172.54 130.52  
43  1 ASP A 366  ? ? -88.72  30.40   
44  1 LEU A 367  ? ? 7.79    -92.26  
45  1 GLU A 368  ? ? -62.51  29.47   
46  1 ARG A 369  ? ? 19.19   94.10   
47  1 GLN A 370  ? ? -123.62 -79.30  
48  1 PHE A 382  ? ? 50.26   -145.09 
49  1 SER A 386  ? ? 169.71  172.87  
50  1 HIS A 399  ? ? -99.17  -68.07  
51  1 SER A 401  ? ? -158.26 86.86   
52  1 PRO A 405  ? ? -61.02  70.72   
53  1 ILE A 407  ? ? -16.34  110.00  
54  1 LEU A 410  ? ? -172.40 139.97  
55  1 PRO A 412  ? ? -53.44  -171.54 
56  1 LEU A 413  ? ? 168.43  111.78  
57  1 ASN A 418  ? ? -79.86  -79.71  
58  1 ASP A 423  ? ? -142.79 -3.91   
59  1 VAL A 430  ? ? -55.64  63.78   
60  1 ASN A 439  ? ? -69.47  11.09   
61  1 THR A 446  ? ? -128.66 -119.20 
62  1 PHE A 459  ? ? 179.98  160.42  
63  1 CYS A 460  ? ? -159.79 2.84    
64  1 HIS A 465  ? ? 76.56   31.17   
65  1 ALA A 474  ? ? -72.84  -71.71  
66  1 GLU A 482  ? ? -70.11  -84.83  
67  1 ALA A 485  ? ? -154.10 -137.02 
68  1 GLU A 489  ? ? 177.60  121.94  
69  1 PRO A 493  ? ? -67.89  82.04   
70  1 GLN A 494  ? ? 157.42  -12.90  
71  1 SER A 502  ? ? 167.72  101.36  
72  1 SER A 506  ? ? -159.65 -45.99  
73  1 TYR A 517  ? ? -90.59  -148.77 
74  1 TYR A 518  ? ? 166.27  124.15  
75  1 ILE A 521  ? ? -88.36  46.31   
76  1 PRO A 523  ? ? -21.84  94.30   
77  1 GLN A 524  ? ? 70.86   30.22   
78  1 ILE A 529  ? ? -122.54 -87.71  
79  1 GLU A 535  ? ? -25.94  -62.29  
80  1 HIS A 536  ? ? -127.80 -167.93 
81  1 LEU A 546  ? ? -69.87  -87.74  
82  1 ASP A 548  ? ? -90.26  50.52   
83  1 PRO A 554  ? ? -53.06  -136.81 
84  1 LEU A 555  ? ? -71.44  -169.31 
85  1 TRP A 561  ? ? -98.05  -62.72  
86  1 ILE A 564  ? ? 62.20   91.92   
87  1 LYS A 570  ? ? -84.10  -150.88 
88  1 LEU A 571  ? ? -104.52 -97.13  
89  1 PHE A 574  ? ? 77.91   43.83   
90  1 LEU A 577  ? ? -94.67  -92.04  
91  1 PHE A 596  ? ? -139.35 -64.93  
92  1 GLU A 597  ? ? -144.50 -54.68  
93  1 SER A 599  ? ? 173.34  162.10  
94  1 ILE A 618  ? ? -52.99  -3.25   
95  1 GLU A 619  ? ? -110.39 -70.18  
96  1 SER A 624  ? ? -145.79 -98.08  
97  1 LYS A 627  ? ? -153.49 79.62   
98  1 LYS A 628  ? ? -43.44  153.77  
99  1 THR A 630  ? ? -90.88  -83.04  
100 1 LEU A 631  ? ? 68.63   -154.57 
101 1 SER A 643  ? ? -133.52 -131.32 
102 1 LEU A 644  ? ? -75.66  -115.82 
103 1 TYR A 660  ? ? -89.79  -127.97 
104 1 SER A 662  ? ? -87.29  -129.05 
105 1 HIS A 664  ? ? -154.21 11.22   
106 1 LYS A 665  ? ? -85.00  -142.74 
107 1 ASN A 683  ? ? -157.34 -4.50   
108 1 TYR A 687  ? ? -153.39 64.98   
109 1 ASP A 689  ? ? 26.97   33.21   
110 1 ASN A 696  ? ? -33.48  -37.21  
111 1 SER A 697  ? ? -168.77 109.49  
112 1 THR A 698  ? ? 144.57  130.69  
113 1 ASP A 705  ? ? -70.47  -162.54 
114 1 GLU A 706  ? ? -50.41  -134.59 
115 1 ILE A 707  ? ? -134.63 -92.39  
116 1 GLN A 708  ? ? -6.63   146.74  
117 1 ARG A 722  ? ? -124.81 -50.50  
118 1 THR A 750  ? ? -76.37  -93.30  
119 1 ALA A 751  ? ? 150.02  -171.57 
120 1 LEU A 752  ? ? -147.47 -9.38   
121 1 SER A 762  ? ? -113.99 -156.88 
122 1 SER A 763  ? ? 171.34  156.97  
123 1 SER A 768  ? ? 1.36    133.71  
124 1 LEU A 770  ? ? -57.83  -8.00   
125 1 SER A 772  ? ? -146.95 -70.38  
126 1 VAL A 801  ? ? -66.33  83.98   
127 1 LEU A 802  ? ? -55.73  -77.03  
128 1 ASN A 810  ? ? 103.40  38.39   
129 1 ASP A 824  ? ? -26.44  122.70  
130 1 ALA A 834  ? ? -173.27 141.18  
131 1 SER A 854  ? ? -94.93  -114.00 
132 1 THR A 860  ? ? -65.48  76.61   
133 1 LYS A 864  ? ? 175.33  90.70   
134 1 LYS A 867  ? ? -89.64  33.97   
135 1 MET A 873  ? ? -170.81 119.03  
136 1 PHE A 876  ? ? -98.09  -101.96 
137 1 ALA A 882  ? ? -161.14 119.42  
138 1 ASN A 885  ? ? 68.03   -8.37   
139 1 SER A 886  ? ? 151.71  -25.93  
140 1 THR A 901  ? ? -48.47  152.90  
141 1 MET A 910  ? ? -168.31 101.41  
142 1 ASP A 919  ? ? -51.05  -160.32 
143 1 VAL A 923  ? ? 179.95  127.49  
144 1 ARG A 928  ? ? -139.18 -51.91  
145 1 SER A 929  ? ? 153.56  -47.64  
146 1 VAL A 930  ? ? 140.56  131.52  
147 1 PRO A 937  ? ? -56.95  31.49   
148 1 MET A 938  ? ? -88.15  -106.24 
149 1 ASN A 950  ? ? -127.09 -140.86 
150 1 PRO A 951  ? ? -156.62 81.90   
151 1 TRP A 953  ? ? -62.42  92.78   
152 1 ASN A 970  ? ? -7.81   -42.70  
153 1 THR A 984  ? ? 72.04   51.67   
154 1 THR A 985  ? ? -72.65  44.43   
155 1 GLU A 987  ? ? -150.61 -52.36  
156 1 PHE A 998  ? ? -170.93 135.71  
157 1 VAL A 1013 ? ? -122.15 -156.72 
158 1 MET A 1014 ? ? 63.96   -174.82 
159 1 SER A 1027 ? ? -166.91 107.51  
160 1 VAL A 1033 ? ? -49.40  -17.83  
161 1 GLU A 1045 ? ? -26.55  -47.77  
162 1 GLU A 1079 ? ? -78.53  49.06   
163 1 ARG A 1080 ? ? 165.05  24.42   
164 1 LYS A 1081 ? ? -174.43 135.38  
165 1 VAL A 1108 ? ? -58.50  -4.58   
166 1 ALA A 1124 ? ? -169.30 119.25  
167 1 THR A 1125 ? ? -111.73 -127.35 
168 1 ALA A 1126 ? ? -159.55 -32.29  
169 1 GLU A 1135 ? ? -60.78  16.33   
170 1 ARG A 1138 ? ? -60.72  8.99    
171 1 VAL B 15   ? ? -68.91  -82.46  
172 1 ARG B 21   ? ? -69.06  13.69   
173 1 HIS B 24   ? ? 98.42   57.76   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2   ? A GLY 1    
2  1 Y 1 A SER -1   ? A SER 2    
3  1 Y 1 A HIS 0    ? A HIS 3    
4  1 Y 1 A SER 774  ? A SER 777  
5  1 Y 1 A THR 775  ? A THR 778  
6  1 Y 1 A ALA 776  ? A ALA 779  
7  1 Y 1 A PRO 777  ? A PRO 780  
8  1 Y 1 A HIS 778  ? A HIS 781  
9  1 Y 1 A GLU 779  ? A GLU 782  
10 1 Y 1 A THR 780  ? A THR 783  
11 1 Y 1 A SER 781  ? A SER 784  
12 1 Y 1 A PHE 782  ? A PHE 785  
13 1 Y 1 A ASN 1016 ? A ASN 1019 
14 1 Y 1 A LEU 1017 ? A LEU 1020 
15 1 Y 1 A GLY 1018 ? A GLY 1021 
16 1 Y 1 A GLU 1019 ? A GLU 1022 
17 1 Y 1 A THR 1020 ? A THR 1023 
18 1 Y 1 A SER 1021 ? A SER 1024 
19 1 Y 1 A THR 1022 ? A THR 1025 
20 1 Y 1 A LEU 1112 ? A LEU 1115 
21 1 Y 1 A GLN 1113 ? A GLN 1116 
22 1 Y 1 A TYR 1114 ? A TYR 1117 
23 1 Y 1 A ASP 1115 ? A ASP 1118 
24 1 Y 1 A ASP 1116 ? A ASP 1119 
25 1 Y 1 A GLY 1117 ? A GLY 1120 
26 1 Y 1 A SER 1118 ? A SER 1121 
27 1 Y 1 A GLY 1119 ? A GLY 1122 
28 1 Y 1 A MET 1120 ? A MET 1123 
29 1 Y 1 A LYS 1121 ? A LYS 1124 
#