data_3I8C
# 
_entry.id   3I8C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I8C         
RCSB  RCSB054091   
WWPDB D_1000054091 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7H 'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX'    unspecified 
PDB 3I7K 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX'    unspecified 
PDB 3I7L 'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2'   unspecified 
PDB 3I7N 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1'  unspecified 
PDB 3I7O 'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1'  unspecified 
PDB 3I7P 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR40A' unspecified 
PDB 3I89 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I8E 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I8C 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I8C 
_cell.length_a           64.107 
_cell.length_b           134.468 
_cell.length_c           183.595 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I8C 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1'     127399.766 1 ? ? ?                  ? 
2 polymer syn 'WD repeat-containing protein 21A' 1440.669   1 ? ? 'Residues 124-136' ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no NASSMLRKSQLGF NASSMLRKSQLGF B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    ASN n 
2 2    ALA n 
2 3    SER n 
2 4    SER n 
2 5    MET n 
2 6    LEU n 
2 7    ARG n 
2 8    LYS n 
2 9    SER n 
2 10   GLN n 
2 11   LEU n 
2 12   GLY n 
2 13   PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN  Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1   ? 
2 UNP WD21A_HUMAN Q8WV16 2 NASSMLRKSQLGF 124 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I8C A 4 ? 1143 ? Q16531 1   ? 1140 ? 1   1140 
2 2 3I8C B 1 ? 13   ? Q8WV16 124 ? 136  ? 124 136  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I8C GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1 
1 3I8C SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2 
1 3I8C HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3 
1 3I8C TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4 
1 3I8C ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5 
1 3I8C VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I8C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.07 
_exptl_crystal.density_percent_sol   59.95 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005M DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I8C 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             45.88 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   30771 
_reflns.number_all                   32691 
_reflns.percent_possible_obs         94.1 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.873 
_reflns_shell.percent_possible_all   94.6 
_reflns_shell.Rmerge_I_obs           0.382 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3I8C 
_refine.ls_number_reflns_obs                     30771 
_refine.ls_number_reflns_all                     32691 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.88 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    80.92 
_refine.ls_R_factor_obs                          0.25369 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.25098 
_refine.ls_R_factor_R_free                       0.30769 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1549 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.910 
_refine.correlation_coeff_Fo_to_Fc_free          0.850 
_refine.B_iso_mean                               79.286 
_refine.aniso_B[1][1]                            -1.03 
_refine.aniso_B[2][2]                            0.12 
_refine.aniso_B[3][3]                            0.91 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.099 
_refine.pdbx_overall_ESU_R_Free                  0.503 
_refine.overall_SU_ML                            0.375 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             19.205 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8825 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8825 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        45.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 8985  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.787  1.965  ? 12165 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.963  5.000  ? 1122  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.582 24.742 ? 407   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       21.764 15.000 ? 1593  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.884 15.000 ? 49    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.114  0.200  ? 1401  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 6701  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.276  0.200  ? 4483  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.327  0.200  ? 6039  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.218  0.200  ? 334   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.210  0.200  ? 27    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.128  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.number_reflns_R_work             1207 
_refine_ls_shell.R_factor_R_work                  0.454 
_refine_ls_shell.percent_reflns_obs               44.13 
_refine_ls_shell.R_factor_R_free                  0.473 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3I8C 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3I8C 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, WD repeat-containing protein 21A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I8C 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;DDB1, WDR21A, DCAF4, H-Box Motif, Cytoplasm, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, Alternative splicing, WD repeat, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 253  ? GLN A 258  ? PRO A 250  GLN A 255  1 ? 6  
HELX_P HELX_P2 2 ALA A 384  ? GLY A 388  ? ALA A 381  GLY A 385  5 ? 5  
HELX_P HELX_P3 3 SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P4 4 GLU A 1072 ? ARG A 1077 ? GLU A 1069 ARG A 1074 1 ? 6  
HELX_P HELX_P5 5 GLY A 1094 ? PHE A 1100 ? GLY A 1091 PHE A 1097 1 ? 7  
HELX_P HELX_P6 6 LEU A 1101 ? ILE A 1103 ? LEU A 1098 ILE A 1100 5 ? 3  
HELX_P HELX_P7 7 SER A 1104 ? VAL A 1111 ? SER A 1101 VAL A 1108 1 ? 8  
HELX_P HELX_P8 8 ASP A 1130 ? ARG A 1141 ? ASP A 1127 ARG A 1138 1 ? 12 
HELX_P HELX_P9 9 ALA B 2    ? GLY B 12   ? ALA B 125  GLY B 135  1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            21 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            316 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             18 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             313 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.043 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 2 ? 
K ? 3 ? 
L ? 2 ? 
M ? 4 ? 
N ? 3 ? 
O ? 4 ? 
P ? 2 ? 
Q ? 5 ? 
R ? 4 ? 
S ? 4 ? 
T ? 4 ? 
U ? 4 ? 
V ? 3 ? 
W ? 4 ? 
X ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
Q 4 5 ? parallel      
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
X 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
A 2 GLN A 1028 ? THR A 1035 ? GLN A 1025 THR A 1032 
A 3 ILE A 1040 ? SER A 1045 ? ILE A 1037 SER A 1042 
A 4 ASN A 7    ? GLN A 13   ? ASN A 4    GLN A 10   
A 5 PHE A 1091 ? ASP A 1093 ? PHE A 1088 ASP A 1090 
B 1 GLY A 20   ? GLY A 24   ? GLY A 17   GLY A 21   
B 2 ASN A 33   ? ALA A 37   ? ASN A 30   ALA A 34   
B 3 ARG A 41   ? VAL A 47   ? ARG A 38   VAL A 44   
B 4 LEU A 52   ? GLY A 59   ? LEU A 49   GLY A 56   
C 1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C 2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C 3 ASN A 88   ? SER A 97   ? ASN A 85   SER A 94   
C 4 SER A 100  ? ASN A 110  ? SER A 97   ASN A 107  
D 1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D 2 MET A 133  ? ARG A 137  ? MET A 130  ARG A 134  
D 3 LYS A 144  ? PRO A 147  ? LYS A 141  PRO A 144  
E 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
E 2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
E 3 GLY A 190  ? GLU A 197  ? GLY A 187  GLU A 194  
E 4 GLU A 213  ? VAL A 215  ? GLU A 210  VAL A 212  
F 1 MET A 221  ? ALA A 224  ? MET A 218  ALA A 221  
F 2 ALA A 232  ? ILE A 235  ? ALA A 229  ILE A 232  
F 3 ILE A 240  ? ASN A 244  ? ILE A 237  ASN A 241  
F 4 LYS A 247  ? ILE A 251  ? LYS A 244  ILE A 248  
G 1 ILE A 261  ? ARG A 266  ? ILE A 258  ARG A 263  
G 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
G 3 ARG A 282  ? GLN A 293  ? ARG A 279  GLN A 290  
G 4 GLY A 296  ? GLU A 310  ? GLY A 293  GLU A 307  
H 1 CYS A 316  ? TYR A 319  ? CYS A 313  TYR A 316  
H 2 VAL A 324  ? GLY A 328  ? VAL A 321  GLY A 325  
H 3 SER A 334  ? LEU A 339  ? SER A 331  LEU A 336  
H 4 VAL A 350  ? PHE A 356  ? VAL A 347  PHE A 353  
I 1 ILE A 362  ? VAL A 367  ? ILE A 359  VAL A 364  
I 2 LEU A 378  ? SER A 382  ? LEU A 375  SER A 379  
I 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
I 4 LEU A 713  ? ILE A 715  ? LEU A 710  ILE A 712  
J 1 LEU A 430  ? SER A 431  ? LEU A 427  SER A 428  
J 2 THR A 436  ? ARG A 437  ? THR A 433  ARG A 434  
K 1 GLN A 470  ? LEU A 471  ? GLN A 467  LEU A 468  
K 2 ARG A 480  ? SER A 483  ? ARG A 477  SER A 480  
K 3 SER A 491  ? GLU A 492  ? SER A 488  GLU A 489  
L 1 LEU A 522  ? GLN A 523  ? LEU A 519  GLN A 520  
L 2 ARG A 530  ? GLN A 531  ? ARG A 527  GLN A 528  
M 1 VAL A 541  ? ASP A 545  ? VAL A 538  ASP A 542  
M 2 CYS A 559  ? LEU A 563  ? CYS A 556  LEU A 560  
M 3 ALA A 569  ? LEU A 572  ? ALA A 566  LEU A 569  
M 4 LYS A 582  ? GLU A 583  ? LYS A 579  GLU A 580  
N 1 MET A 596  ? THR A 598  ? MET A 593  THR A 595  
N 2 HIS A 603  ? ALA A 608  ? HIS A 600  ALA A 605  
N 3 LEU A 614  ? LEU A 619  ? LEU A 611  LEU A 616  
O 1 VAL A 640  ? THR A 643  ? VAL A 637  THR A 640  
O 2 VAL A 652  ? CYS A 655  ? VAL A 649  CYS A 652  
O 3 THR A 660  ? ILE A 662  ? THR A 657  ILE A 659  
O 4 SER A 672  ? ASN A 673  ? SER A 669  ASN A 670  
P 1 TYR A 681  ? CYS A 683  ? TYR A 678  CYS A 680  
P 2 ALA A 695  ? ALA A 697  ? ALA A 692  ALA A 694  
Q 1 SER A 723  ? GLN A 730  ? SER A 720  GLN A 727  
Q 2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
Q 3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
Q 4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
Q 5 SER A 765  ? VAL A 768  ? SER A 762  VAL A 765  
R 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
R 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
R 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
R 4 LEU A 861  ? ALA A 865  ? LEU A 858  ALA A 862  
S 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
S 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
S 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
S 4 GLU A 868  ? VAL A 869  ? GLU A 865  VAL A 866  
T 1 VAL A 873  ? GLU A 878  ? VAL A 870  GLU A 875  
T 2 LEU A 883  ? ILE A 887  ? LEU A 880  ILE A 884  
T 3 VAL A 891  ? TRP A 896  ? VAL A 888  TRP A 893  
T 4 VAL A 902  ? ARG A 903  ? VAL A 899  ARG A 900  
U 1 VAL A 873  ? GLU A 878  ? VAL A 870  GLU A 875  
U 2 LEU A 883  ? ILE A 887  ? LEU A 880  ILE A 884  
U 3 VAL A 891  ? TRP A 896  ? VAL A 888  TRP A 893  
U 4 ASN A 907  ? HIS A 908  ? ASN A 904  HIS A 905  
V 1 ILE A 924  ? VAL A 926  ? ILE A 921  VAL A 923  
V 2 LEU A 934  ? LYS A 939  ? LEU A 931  LYS A 936  
V 3 ASN A 944  ? ARG A 950  ? ASN A 941  ARG A 947  
W 1 MET A 957  ? ILE A 962  ? MET A 954  ILE A 959  
W 2 PHE A 968  ? GLU A 972  ? PHE A 965  GLU A 969  
W 3 ASN A 976  ? LYS A 982  ? ASN A 973  LYS A 979  
W 4 LEU A 995  ? HIS A 1002 ? LEU A 992  HIS A 999  
X 1 PHE A 1079 ? THR A 1081 ? PHE A 1076 THR A 1078 
X 2 LYS A 1084 ? GLU A 1086 ? LYS A 1081 GLU A 1083 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 1011 ? N CYS A 1008 O LEU A 1032 ? O LEU A 1029 
A 2 3 N VAL A 1031 ? N VAL A 1028 O VAL A 1043 ? O VAL A 1040 
A 3 4 O ILE A 1040 ? O ILE A 1037 N ALA A 12   ? N ALA A 9    
A 4 5 N VAL A 9    ? N VAL A 6    O ILE A 1092 ? O ILE A 1089 
B 1 2 N GLY A 20   ? N GLY A 17   O ALA A 37   ? O ALA A 34   
B 2 3 N ILE A 36   ? N ILE A 33   O GLU A 43   ? O GLU A 40   
B 3 4 N VAL A 46   ? N VAL A 43   O ARG A 53   ? O ARG A 50   
C 1 2 N GLU A 68   ? N GLU A 65   O PHE A 81   ? O PHE A 78   
C 2 3 N LEU A 80   ? N LEU A 77   O LEU A 92   ? O LEU A 89   
C 3 4 N ALA A 89   ? N ALA A 86   O GLY A 109  ? O GLY A 106  
D 1 2 N ILE A 126  ? N ILE A 123  O GLY A 135  ? O GLY A 132  
D 2 3 N ILE A 134  ? N ILE A 131  O ILE A 146  ? O ILE A 143  
E 1 2 N ILE A 168  ? N ILE A 165  O VAL A 184  ? O VAL A 181  
E 2 3 N ASP A 187  ? N ASP A 184  O GLY A 190  ? O GLY A 187  
E 3 4 N VAL A 193  ? N VAL A 190  O GLU A 213  ? O GLU A 210  
F 1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
F 2 3 N ALA A 232  ? N ALA A 229  O HIS A 243  ? O HIS A 240  
F 3 4 N ILE A 240  ? N ILE A 237  O ILE A 251  ? O ILE A 248  
G 1 2 N ASN A 265  ? N ASN A 262  O LEU A 275  ? O LEU A 272  
G 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
G 3 4 N GLU A 289  ? N GLU A 286  O LYS A 301  ? O LYS A 298  
H 1 2 N CYS A 316  ? N CYS A 313  O GLY A 328  ? O GLY A 325  
H 2 3 N VAL A 325  ? N VAL A 322  O VAL A 337  ? O VAL A 334  
H 3 4 N SER A 334  ? N SER A 331  O PHE A 356  ? O PHE A 353  
I 1 2 N VAL A 363  ? N VAL A 360  O CYS A 381  ? O CYS A 378  
I 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
I 3 4 N ARG A 394  ? N ARG A 391  O HIS A 714  ? O HIS A 711  
J 1 2 N LEU A 430  ? N LEU A 427  O ARG A 437  ? O ARG A 434  
K 1 2 N LEU A 471  ? N LEU A 468  O VAL A 482  ? O VAL A 479  
K 2 3 N LEU A 481  ? N LEU A 478  O SER A 491  ? O SER A 488  
L 1 2 N GLN A 523  ? N GLN A 520  O ARG A 530  ? O ARG A 527  
M 1 2 N ALA A 542  ? N ALA A 539  O GLY A 562  ? O GLY A 559  
M 2 3 N CYS A 559  ? N CYS A 556  O LEU A 572  ? O LEU A 569  
M 3 4 N ALA A 569  ? N ALA A 566  O GLU A 583  ? O GLU A 580  
N 1 2 N THR A 597  ? N THR A 594  O TYR A 604  ? O TYR A 601  
N 2 3 N HIS A 603  ? N HIS A 600  O LEU A 619  ? O LEU A 616  
O 1 2 N VAL A 640  ? N VAL A 637  O CYS A 655  ? O CYS A 652  
O 2 3 N VAL A 652  ? N VAL A 649  O ILE A 662  ? O ILE A 659  
O 3 4 N VAL A 661  ? N VAL A 658  O SER A 672  ? O SER A 669  
P 1 2 N CYS A 683  ? N CYS A 680  O ALA A 695  ? O ALA A 692  
Q 1 2 N CYS A 728  ? N CYS A 725  O GLY A 737  ? O GLY A 734  
Q 2 3 N VAL A 738  ? N VAL A 735  O LEU A 795  ? O LEU A 792  
Q 3 4 N ILE A 796  ? N ILE A 793  O LEU A 805  ? O LEU A 802  
Q 4 5 O ALA A 807  ? O ALA A 804  N SER A 767  ? N SER A 764  
R 1 2 N CYS A 822  ? N CYS A 819  O TYR A 831  ? O TYR A 828  
R 2 3 N THR A 836  ? N THR A 833  O ARG A 850  ? O ARG A 847  
R 3 4 N VAL A 853  ? N VAL A 850  O ALA A 865  ? O ALA A 862  
S 1 2 N CYS A 822  ? N CYS A 819  O TYR A 831  ? O TYR A 828  
S 2 3 N THR A 836  ? N THR A 833  O ARG A 850  ? O ARG A 847  
S 3 4 N GLY A 849  ? N GLY A 846  O VAL A 869  ? O VAL A 866  
T 1 2 N SER A 875  ? N SER A 872  O SER A 886  ? O SER A 883  
T 2 3 N LEU A 883  ? N LEU A 880  O TYR A 894  ? O TYR A 891  
T 3 4 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
U 1 2 N SER A 875  ? N SER A 872  O SER A 886  ? O SER A 883  
U 2 3 N LEU A 883  ? N LEU A 880  O TYR A 894  ? O TYR A 891  
U 3 4 N VAL A 891  ? N VAL A 888  O HIS A 908  ? O HIS A 905  
V 1 2 N LEU A 925  ? N LEU A 922  O LEU A 936  ? O LEU A 933  
V 2 3 N LYS A 939  ? N LYS A 936  O ASN A 944  ? O ASN A 941  
W 1 2 N GLU A 961  ? N GLU A 958  O LEU A 969  ? O LEU A 966  
W 2 3 N PHE A 968  ? N PHE A 965  O CYS A 980  ? O CYS A 977  
W 3 4 N LEU A 977  ? N LEU A 974  O PHE A 1001 ? O PHE A 998  
X 1 2 N THR A 1081 ? N THR A 1078 O LYS A 1084 ? O LYS A 1081 
# 
_database_PDB_matrix.entry_id          3I8C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I8C 
_atom_sites.fract_transf_matrix[1][1]   0.015599 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007437 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005447 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 4    ? -7.541  40.850  -11.180 1.00 77.43  ? 1    MET A N   1 
ATOM 2    C CA  . MET A 1 4    ? -8.527  40.313  -10.192 1.00 77.43  ? 1    MET A CA  1 
ATOM 3    C C   . MET A 1 4    ? -9.901  39.906  -10.811 1.00 77.43  ? 1    MET A C   1 
ATOM 4    O O   . MET A 1 4    ? -10.947 40.531  -10.544 1.00 77.43  ? 1    MET A O   1 
ATOM 5    C CB  . MET A 1 4    ? -8.686  41.271  -8.981  1.00 127.77 ? 1    MET A CB  1 
ATOM 6    C CG  . MET A 1 4    ? -9.196  42.700  -9.296  1.00 127.77 ? 1    MET A CG  1 
ATOM 7    S SD  . MET A 1 4    ? -10.072 43.477  -7.905  1.00 127.77 ? 1    MET A SD  1 
ATOM 8    C CE  . MET A 1 4    ? -10.615 45.048  -8.603  1.00 127.77 ? 1    MET A CE  1 
ATOM 9    N N   . SER A 1 5    ? -9.872  38.848  -11.629 1.00 156.85 ? 2    SER A N   1 
ATOM 10   C CA  . SER A 1 5    ? -11.068 38.220  -12.214 1.00 156.85 ? 2    SER A CA  1 
ATOM 11   C C   . SER A 1 5    ? -11.251 36.825  -11.626 1.00 156.85 ? 2    SER A C   1 
ATOM 12   O O   . SER A 1 5    ? -10.281 36.082  -11.512 1.00 156.85 ? 2    SER A O   1 
ATOM 13   C CB  . SER A 1 5    ? -10.909 38.115  -13.725 1.00 115.72 ? 2    SER A CB  1 
ATOM 14   O OG  . SER A 1 5    ? -11.770 37.138  -14.279 1.00 115.72 ? 2    SER A OG  1 
ATOM 15   N N   . TYR A 1 6    ? -12.477 36.457  -11.265 1.00 66.90  ? 3    TYR A N   1 
ATOM 16   C CA  . TYR A 1 6    ? -12.691 35.196  -10.536 1.00 66.90  ? 3    TYR A CA  1 
ATOM 17   C C   . TYR A 1 6    ? -13.811 34.294  -11.066 1.00 66.90  ? 3    TYR A C   1 
ATOM 18   O O   . TYR A 1 6    ? -14.954 34.388  -10.615 1.00 66.90  ? 3    TYR A O   1 
ATOM 19   C CB  . TYR A 1 6    ? -12.916 35.449  -9.037  1.00 101.55 ? 3    TYR A CB  1 
ATOM 20   C CG  . TYR A 1 6    ? -11.864 36.297  -8.362  1.00 101.55 ? 3    TYR A CG  1 
ATOM 21   C CD1 . TYR A 1 6    ? -10.515 35.929  -8.377  1.00 101.55 ? 3    TYR A CD1 1 
ATOM 22   C CD2 . TYR A 1 6    ? -12.216 37.467  -7.694  1.00 101.55 ? 3    TYR A CD2 1 
ATOM 23   C CE1 . TYR A 1 6    ? -9.540  36.719  -7.757  1.00 101.55 ? 3    TYR A CE1 1 
ATOM 24   C CE2 . TYR A 1 6    ? -11.252 38.261  -7.068  1.00 101.55 ? 3    TYR A CE2 1 
ATOM 25   C CZ  . TYR A 1 6    ? -9.918  37.882  -7.099  1.00 101.55 ? 3    TYR A CZ  1 
ATOM 26   O OH  . TYR A 1 6    ? -8.967  38.667  -6.475  1.00 101.55 ? 3    TYR A OH  1 
ATOM 27   N N   . ASN A 1 7    ? -13.473 33.400  -11.999 1.00 58.26  ? 4    ASN A N   1 
ATOM 28   C CA  . ASN A 1 7    ? -14.471 32.530  -12.621 1.00 58.26  ? 4    ASN A CA  1 
ATOM 29   C C   . ASN A 1 7    ? -14.149 31.068  -12.577 1.00 58.26  ? 4    ASN A C   1 
ATOM 30   O O   . ASN A 1 7    ? -12.991 30.661  -12.454 1.00 58.26  ? 4    ASN A O   1 
ATOM 31   C CB  . ASN A 1 7    ? -14.663 32.883  -14.073 1.00 44.66  ? 4    ASN A CB  1 
ATOM 32   C CG  . ASN A 1 7    ? -15.050 34.300  -14.266 1.00 44.66  ? 4    ASN A CG  1 
ATOM 33   O OD1 . ASN A 1 7    ? -16.196 34.705  -13.976 1.00 44.66  ? 4    ASN A OD1 1 
ATOM 34   N ND2 . ASN A 1 7    ? -14.100 35.093  -14.778 1.00 44.66  ? 4    ASN A ND2 1 
ATOM 35   N N   . TYR A 1 8    ? -15.206 30.296  -12.777 1.00 49.97  ? 5    TYR A N   1 
ATOM 36   C CA  . TYR A 1 8    ? -15.255 28.882  -12.531 1.00 49.97  ? 5    TYR A CA  1 
ATOM 37   C C   . TYR A 1 8    ? -15.989 28.299  -13.716 1.00 49.97  ? 5    TYR A C   1 
ATOM 38   O O   . TYR A 1 8    ? -17.073 28.788  -14.029 1.00 49.97  ? 5    TYR A O   1 
ATOM 39   C CB  . TYR A 1 8    ? -16.083 28.678  -11.287 1.00 46.44  ? 5    TYR A CB  1 
ATOM 40   C CG  . TYR A 1 8    ? -16.295 27.260  -10.880 1.00 46.44  ? 5    TYR A CG  1 
ATOM 41   C CD1 . TYR A 1 8    ? -15.532 26.706  -9.863  1.00 46.44  ? 5    TYR A CD1 1 
ATOM 42   C CD2 . TYR A 1 8    ? -17.275 26.472  -11.464 1.00 46.44  ? 5    TYR A CD2 1 
ATOM 43   C CE1 . TYR A 1 8    ? -15.709 25.386  -9.444  1.00 46.44  ? 5    TYR A CE1 1 
ATOM 44   C CE2 . TYR A 1 8    ? -17.468 25.153  -11.045 1.00 46.44  ? 5    TYR A CE2 1 
ATOM 45   C CZ  . TYR A 1 8    ? -16.676 24.627  -10.030 1.00 46.44  ? 5    TYR A CZ  1 
ATOM 46   O OH  . TYR A 1 8    ? -16.825 23.344  -9.583  1.00 46.44  ? 5    TYR A OH  1 
ATOM 47   N N   . VAL A 1 9    ? -15.401 27.285  -14.371 1.00 43.80  ? 6    VAL A N   1 
ATOM 48   C CA  . VAL A 1 9    ? -16.014 26.552  -15.479 1.00 43.80  ? 6    VAL A CA  1 
ATOM 49   C C   . VAL A 1 9    ? -16.124 25.076  -15.140 1.00 43.80  ? 6    VAL A C   1 
ATOM 50   O O   . VAL A 1 9    ? -15.168 24.478  -14.591 1.00 43.80  ? 6    VAL A O   1 
ATOM 51   C CB  . VAL A 1 9    ? -15.232 26.689  -16.794 1.00 45.75  ? 6    VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 9    ? -15.298 28.053  -17.267 1.00 45.75  ? 6    VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 9    ? -13.783 26.369  -16.603 1.00 45.75  ? 6    VAL A CG2 1 
ATOM 54   N N   . VAL A 1 10   ? -17.297 24.506  -15.462 1.00 33.15  ? 7    VAL A N   1 
ATOM 55   C CA  . VAL A 1 10   ? -17.553 23.055  -15.385 1.00 33.15  ? 7    VAL A CA  1 
ATOM 56   C C   . VAL A 1 10   ? -18.308 22.509  -16.595 1.00 33.15  ? 7    VAL A C   1 
ATOM 57   O O   . VAL A 1 10   ? -19.046 23.233  -17.275 1.00 33.15  ? 7    VAL A O   1 
ATOM 58   C CB  . VAL A 1 10   ? -18.421 22.674  -14.203 1.00 37.25  ? 7    VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 10   ? -17.781 21.485  -13.459 1.00 37.25  ? 7    VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 10   ? -18.675 23.854  -13.314 1.00 37.25  ? 7    VAL A CG2 1 
ATOM 61   N N   . THR A 1 11   ? -18.149 21.212  -16.818 1.00 33.99  ? 8    THR A N   1 
ATOM 62   C CA  . THR A 1 11   ? -18.861 20.515  -17.880 1.00 33.99  ? 8    THR A CA  1 
ATOM 63   C C   . THR A 1 11   ? -20.228 20.077  -17.387 1.00 33.99  ? 8    THR A C   1 
ATOM 64   O O   . THR A 1 11   ? -20.352 19.579  -16.266 1.00 33.99  ? 8    THR A O   1 
ATOM 65   C CB  . THR A 1 11   ? -18.077 19.286  -18.328 1.00 50.48  ? 8    THR A CB  1 
ATOM 66   O OG1 . THR A 1 11   ? -16.793 19.704  -18.816 1.00 50.48  ? 8    THR A OG1 1 
ATOM 67   C CG2 . THR A 1 11   ? -18.837 18.533  -19.386 1.00 50.48  ? 8    THR A CG2 1 
ATOM 68   N N   . ALA A 1 12   ? -21.256 20.291  -18.202 1.00 51.52  ? 9    ALA A N   1 
ATOM 69   C CA  . ALA A 1 12   ? -22.612 19.877  -17.855 1.00 51.52  ? 9    ALA A CA  1 
ATOM 70   C C   . ALA A 1 12   ? -22.985 18.657  -18.661 1.00 51.52  ? 9    ALA A C   1 
ATOM 71   O O   . ALA A 1 12   ? -23.819 17.833  -18.238 1.00 51.52  ? 9    ALA A O   1 
ATOM 72   C CB  . ALA A 1 12   ? -23.584 20.972  -18.164 1.00 17.34  ? 9    ALA A CB  1 
ATOM 73   N N   . GLN A 1 13   ? -22.400 18.569  -19.846 1.00 38.49  ? 10   GLN A N   1 
ATOM 74   C CA  . GLN A 1 13   ? -22.636 17.465  -20.716 1.00 38.49  ? 10   GLN A CA  1 
ATOM 75   C C   . GLN A 1 13   ? -21.359 17.256  -21.430 1.00 38.49  ? 10   GLN A C   1 
ATOM 76   O O   . GLN A 1 13   ? -20.820 18.208  -22.038 1.00 38.49  ? 10   GLN A O   1 
ATOM 77   C CB  . GLN A 1 13   ? -23.734 17.829  -21.709 1.00 41.83  ? 10   GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13   ? -23.757 16.986  -22.977 1.00 41.83  ? 10   GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13   ? -23.873 15.526  -22.659 1.00 41.83  ? 10   GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13   ? -24.730 15.114  -21.847 1.00 41.83  ? 10   GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13   ? -23.003 14.723  -23.266 1.00 41.83  ? 10   GLN A NE2 1 
ATOM 82   N N   . LYS A 1 14   ? -20.851 16.032  -21.360 1.00 39.44  ? 11   LYS A N   1 
ATOM 83   C CA  . LYS A 1 14   ? -19.543 15.756  -21.930 1.00 39.44  ? 11   LYS A CA  1 
ATOM 84   C C   . LYS A 1 14   ? -19.697 15.790  -23.444 1.00 39.44  ? 11   LYS A C   1 
ATOM 85   O O   . LYS A 1 14   ? -20.787 15.547  -23.941 1.00 39.44  ? 11   LYS A O   1 
ATOM 86   C CB  . LYS A 1 14   ? -19.040 14.403  -21.484 1.00 52.23  ? 11   LYS A CB  1 
ATOM 87   C CG  . LYS A 1 14   ? -18.561 14.313  -20.053 1.00 52.23  ? 11   LYS A CG  1 
ATOM 88   C CD  . LYS A 1 14   ? -18.233 12.835  -19.816 1.00 52.23  ? 11   LYS A CD  1 
ATOM 89   C CE  . LYS A 1 14   ? -17.386 12.516  -18.591 1.00 52.23  ? 11   LYS A CE  1 
ATOM 90   N NZ  . LYS A 1 14   ? -16.857 11.078  -18.699 1.00 52.23  ? 11   LYS A NZ  1 
ATOM 91   N N   . PRO A 1 15   ? -18.625 16.106  -24.187 1.00 41.33  ? 12   PRO A N   1 
ATOM 92   C CA  . PRO A 1 15   ? -18.794 16.080  -25.639 1.00 41.33  ? 12   PRO A CA  1 
ATOM 93   C C   . PRO A 1 15   ? -19.399 14.754  -26.126 1.00 41.33  ? 12   PRO A C   1 
ATOM 94   O O   . PRO A 1 15   ? -19.208 13.724  -25.503 1.00 41.33  ? 12   PRO A O   1 
ATOM 95   C CB  . PRO A 1 15   ? -17.370 16.297  -26.182 1.00 41.09  ? 12   PRO A CB  1 
ATOM 96   C CG  . PRO A 1 15   ? -16.470 16.160  -25.015 1.00 41.09  ? 12   PRO A CG  1 
ATOM 97   C CD  . PRO A 1 15   ? -17.266 16.479  -23.792 1.00 41.09  ? 12   PRO A CD  1 
ATOM 98   N N   . THR A 1 16   ? -20.157 14.787  -27.209 1.00 40.09  ? 13   THR A N   1 
ATOM 99   C CA  . THR A 1 16   ? -20.832 13.593  -27.688 1.00 40.09  ? 13   THR A CA  1 
ATOM 100  C C   . THR A 1 16   ? -20.456 13.305  -29.123 1.00 40.09  ? 13   THR A C   1 
ATOM 101  O O   . THR A 1 16   ? -20.831 12.275  -29.658 1.00 40.09  ? 13   THR A O   1 
ATOM 102  C CB  . THR A 1 16   ? -22.347 13.761  -27.667 1.00 34.90  ? 13   THR A CB  1 
ATOM 103  O OG1 . THR A 1 16   ? -22.673 15.000  -28.306 1.00 34.90  ? 13   THR A OG1 1 
ATOM 104  C CG2 . THR A 1 16   ? -22.911 13.797  -26.241 1.00 34.90  ? 13   THR A CG2 1 
ATOM 105  N N   . ALA A 1 17   ? -19.744 14.215  -29.775 1.00 45.01  ? 14   ALA A N   1 
ATOM 106  C CA  . ALA A 1 17   ? -19.339 13.937  -31.142 1.00 45.01  ? 14   ALA A CA  1 
ATOM 107  C C   . ALA A 1 17   ? -18.183 12.991  -31.087 1.00 45.01  ? 14   ALA A C   1 
ATOM 108  O O   . ALA A 1 17   ? -17.443 12.983  -30.115 1.00 45.01  ? 14   ALA A O   1 
ATOM 109  C CB  . ALA A 1 17   ? -18.969 15.170  -31.876 1.00 25.38  ? 14   ALA A CB  1 
ATOM 110  N N   . VAL A 1 18   ? -18.076 12.175  -32.126 1.00 29.91  ? 15   VAL A N   1 
ATOM 111  C CA  . VAL A 1 18   ? -17.042 11.174  -32.271 1.00 29.91  ? 15   VAL A CA  1 
ATOM 112  C C   . VAL A 1 18   ? -16.056 11.682  -33.275 1.00 29.91  ? 15   VAL A C   1 
ATOM 113  O O   . VAL A 1 18   ? -16.378 11.851  -34.464 1.00 29.91  ? 15   VAL A O   1 
ATOM 114  C CB  . VAL A 1 18   ? -17.587 9.833   -32.798 1.00 16.75  ? 15   VAL A CB  1 
ATOM 115  C CG1 . VAL A 1 18   ? -16.451 9.008   -33.443 1.00 16.75  ? 15   VAL A CG1 1 
ATOM 116  C CG2 . VAL A 1 18   ? -18.250 9.044   -31.666 1.00 16.75  ? 15   VAL A CG2 1 
ATOM 117  N N   . ASN A 1 19   ? -14.845 11.915  -32.792 1.00 44.50  ? 16   ASN A N   1 
ATOM 118  C CA  . ASN A 1 19   ? -13.825 12.485  -33.651 1.00 44.50  ? 16   ASN A CA  1 
ATOM 119  C C   . ASN A 1 19   ? -12.971 11.391  -34.249 1.00 44.50  ? 16   ASN A C   1 
ATOM 120  O O   . ASN A 1 19   ? -12.484 11.522  -35.357 1.00 44.50  ? 16   ASN A O   1 
ATOM 121  C CB  . ASN A 1 19   ? -13.050 13.591  -32.906 1.00 41.74  ? 16   ASN A CB  1 
ATOM 122  C CG  . ASN A 1 19   ? -13.927 14.884  -32.686 1.00 41.74  ? 16   ASN A CG  1 
ATOM 123  O OD1 . ASN A 1 19   ? -14.928 15.155  -33.418 1.00 41.74  ? 16   ASN A OD1 1 
ATOM 124  N ND2 . ASN A 1 19   ? -13.565 15.660  -31.659 1.00 41.74  ? 16   ASN A ND2 1 
ATOM 125  N N   . GLY A 1 20   ? -12.874 10.276  -33.528 1.00 33.12  ? 17   GLY A N   1 
ATOM 126  C CA  . GLY A 1 20   ? -12.026 9.158   -33.910 1.00 33.12  ? 17   GLY A CA  1 
ATOM 127  C C   . GLY A 1 20   ? -12.402 7.848   -33.255 1.00 33.12  ? 17   GLY A C   1 
ATOM 128  O O   . GLY A 1 20   ? -12.960 7.819   -32.156 1.00 33.12  ? 17   GLY A O   1 
ATOM 129  N N   . CYS A 1 21   ? -12.111 6.743   -33.926 1.00 41.09  ? 18   CYS A N   1 
ATOM 130  C CA  . CYS A 1 21   ? -12.454 5.438   -33.376 1.00 41.09  ? 18   CYS A CA  1 
ATOM 131  C C   . CYS A 1 21   ? -11.625 4.432   -34.111 1.00 41.09  ? 18   CYS A C   1 
ATOM 132  O O   . CYS A 1 21   ? -11.301 4.659   -35.269 1.00 41.09  ? 18   CYS A O   1 
ATOM 133  C CB  . CYS A 1 21   ? -13.956 5.140   -33.463 1.00 53.09  ? 18   CYS A CB  1 
ATOM 134  S SG  . CYS A 1 21   ? -14.755 5.302   -35.105 1.00 53.09  ? 18   CYS A SG  1 
ATOM 135  N N   . VAL A 1 22   ? -11.242 3.349   -33.434 1.00 36.16  ? 19   VAL A N   1 
ATOM 136  C CA  . VAL A 1 22   ? -10.174 2.462   -33.902 1.00 36.16  ? 19   VAL A CA  1 
ATOM 137  C C   . VAL A 1 22   ? -10.501 1.103   -33.277 1.00 36.16  ? 19   VAL A C   1 
ATOM 138  O O   . VAL A 1 22   ? -11.125 1.041   -32.189 1.00 36.16  ? 19   VAL A O   1 
ATOM 139  C CB  . VAL A 1 22   ? -8.800  3.021   -33.396 1.00 37.35  ? 19   VAL A CB  1 
ATOM 140  C CG1 . VAL A 1 22   ? -8.640  2.831   -31.867 1.00 37.35  ? 19   VAL A CG1 1 
ATOM 141  C CG2 . VAL A 1 22   ? -7.601  2.439   -34.142 1.00 37.35  ? 19   VAL A CG2 1 
ATOM 142  N N   . THR A 1 23   ? -10.121 0.016   -33.945 1.00 45.49  ? 20   THR A N   1 
ATOM 143  C CA  . THR A 1 23   ? -10.446 -1.333  -33.450 1.00 45.49  ? 20   THR A CA  1 
ATOM 144  C C   . THR A 1 23   ? -9.231  -2.269  -33.294 1.00 45.49  ? 20   THR A C   1 
ATOM 145  O O   . THR A 1 23   ? -8.238  -2.169  -34.037 1.00 45.49  ? 20   THR A O   1 
ATOM 146  C CB  . THR A 1 23   ? -11.479 -2.008  -34.342 1.00 59.84  ? 20   THR A CB  1 
ATOM 147  O OG1 . THR A 1 23   ? -12.156 -3.008  -33.586 1.00 59.84  ? 20   THR A OG1 1 
ATOM 148  C CG2 . THR A 1 23   ? -10.823 -2.643  -35.566 1.00 59.84  ? 20   THR A CG2 1 
ATOM 149  N N   . GLY A 1 24   ? -9.309  -3.174  -32.325 1.00 68.99  ? 21   GLY A N   1 
ATOM 150  C CA  . GLY A 1 24   ? -8.245  -4.151  -32.133 1.00 68.99  ? 21   GLY A CA  1 
ATOM 151  C C   . GLY A 1 24   ? -8.299  -4.809  -30.774 1.00 68.99  ? 21   GLY A C   1 
ATOM 152  O O   . GLY A 1 24   ? -9.289  -4.662  -30.041 1.00 68.99  ? 21   GLY A O   1 
ATOM 153  N N   . HIS A 1 25   ? -7.216  -5.516  -30.439 1.00 54.61  ? 22   HIS A N   1 
ATOM 154  C CA  . HIS A 1 25   ? -7.102  -6.321  -29.211 1.00 54.61  ? 22   HIS A CA  1 
ATOM 155  C C   . HIS A 1 25   ? -6.263  -5.620  -28.136 1.00 54.61  ? 22   HIS A C   1 
ATOM 156  O O   . HIS A 1 25   ? -5.067  -5.825  -28.080 1.00 54.61  ? 22   HIS A O   1 
ATOM 157  C CB  . HIS A 1 25   ? -6.498  -7.679  -29.581 1.00 60.13  ? 22   HIS A CB  1 
ATOM 158  C CG  . HIS A 1 25   ? -7.146  -8.310  -30.777 1.00 60.13  ? 22   HIS A CG  1 
ATOM 159  N ND1 . HIS A 1 25   ? -6.746  -8.041  -32.069 1.00 60.13  ? 22   HIS A ND1 1 
ATOM 160  C CD2 . HIS A 1 25   ? -8.180  -9.184  -30.879 1.00 60.13  ? 22   HIS A CD2 1 
ATOM 161  C CE1 . HIS A 1 25   ? -7.492  -8.734  -32.914 1.00 60.13  ? 22   HIS A CE1 1 
ATOM 162  N NE2 . HIS A 1 25   ? -8.373  -9.434  -32.219 1.00 60.13  ? 22   HIS A NE2 1 
ATOM 163  N N   . PHE A 1 26   ? -6.882  -4.796  -27.297 1.00 62.72  ? 23   PHE A N   1 
ATOM 164  C CA  . PHE A 1 26   ? -6.139  -3.866  -26.432 1.00 62.72  ? 23   PHE A CA  1 
ATOM 165  C C   . PHE A 1 26   ? -6.268  -4.311  -24.993 1.00 62.72  ? 23   PHE A C   1 
ATOM 166  O O   . PHE A 1 26   ? -5.380  -4.084  -24.179 1.00 62.72  ? 23   PHE A O   1 
ATOM 167  C CB  . PHE A 1 26   ? -6.679  -2.415  -26.628 1.00 31.57  ? 23   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 26   ? -6.058  -1.345  -25.693 1.00 31.57  ? 23   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 26   ? -4.737  -0.903  -25.855 1.00 31.57  ? 23   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 26   ? -6.821  -0.751  -24.681 1.00 31.57  ? 23   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 26   ? -4.178  0.091   -25.018 1.00 31.57  ? 23   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 26   ? -6.251  0.255   -23.819 1.00 31.57  ? 23   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 26   ? -4.926  0.661   -24.005 1.00 31.57  ? 23   PHE A CZ  1 
ATOM 174  N N   . THR A 1 27   ? -7.400  -4.946  -24.717 1.00 64.71  ? 24   THR A N   1 
ATOM 175  C CA  . THR A 1 27   ? -7.777  -5.511  -23.418 1.00 64.71  ? 24   THR A CA  1 
ATOM 176  C C   . THR A 1 27   ? -7.162  -6.928  -23.176 1.00 64.71  ? 24   THR A C   1 
ATOM 177  O O   . THR A 1 27   ? -6.483  -7.150  -22.166 1.00 64.71  ? 24   THR A O   1 
ATOM 178  C CB  . THR A 1 27   ? -9.326  -5.531  -23.329 1.00 57.52  ? 24   THR A CB  1 
ATOM 179  O OG1 . THR A 1 27   ? -9.815  -4.206  -23.488 1.00 57.52  ? 24   THR A OG1 1 
ATOM 180  C CG2 . THR A 1 27   ? -9.822  -6.035  -21.990 1.00 57.52  ? 24   THR A CG2 1 
ATOM 181  N N   . SER A 1 28   ? -7.412  -7.848  -24.115 1.00 87.56  ? 25   SER A N   1 
ATOM 182  C CA  . SER A 1 28   ? -6.780  -9.173  -24.177 1.00 87.56  ? 25   SER A CA  1 
ATOM 183  C C   . SER A 1 28   ? -6.315  -9.418  -25.600 1.00 87.56  ? 25   SER A C   1 
ATOM 184  O O   . SER A 1 28   ? -6.697  -8.681  -26.497 1.00 87.56  ? 25   SER A O   1 
ATOM 185  C CB  . SER A 1 28   ? -7.772  -10.286 -23.828 1.00 91.18  ? 25   SER A CB  1 
ATOM 186  O OG  . SER A 1 28   ? -8.851  -9.831  -23.039 1.00 91.18  ? 25   SER A OG  1 
ATOM 187  N N   . ALA A 1 29   ? -5.517  -10.463 -25.820 1.00 68.39  ? 26   ALA A N   1 
ATOM 188  C CA  . ALA A 1 29   ? -5.080  -10.827 -27.188 1.00 68.39  ? 26   ALA A CA  1 
ATOM 189  C C   . ALA A 1 29   ? -6.193  -11.575 -27.919 1.00 68.39  ? 26   ALA A C   1 
ATOM 190  O O   . ALA A 1 29   ? -6.259  -11.598 -29.153 1.00 68.39  ? 26   ALA A O   1 
ATOM 191  C CB  . ALA A 1 29   ? -3.779  -11.637 -27.167 1.00 89.16  ? 26   ALA A CB  1 
ATOM 192  N N   . GLU A 1 30   ? -7.058  -12.198 -27.134 1.00 72.42  ? 27   GLU A N   1 
ATOM 193  C CA  . GLU A 1 30   ? -8.376  -12.586 -27.604 1.00 72.42  ? 27   GLU A CA  1 
ATOM 194  C C   . GLU A 1 30   ? -9.378  -11.623 -26.965 1.00 72.42  ? 27   GLU A C   1 
ATOM 195  O O   . GLU A 1 30   ? -9.553  -11.598 -25.748 1.00 72.42  ? 27   GLU A O   1 
ATOM 196  C CB  . GLU A 1 30   ? -8.700  -14.062 -27.299 1.00 103.52 ? 27   GLU A CB  1 
ATOM 197  C CG  . GLU A 1 30   ? -7.857  -14.722 -26.200 1.00 103.52 ? 27   GLU A CG  1 
ATOM 198  C CD  . GLU A 1 30   ? -8.090  -14.115 -24.828 1.00 103.52 ? 27   GLU A CD  1 
ATOM 199  O OE1 . GLU A 1 30   ? -7.112  -13.581 -24.257 1.00 103.52 ? 27   GLU A OE1 1 
ATOM 200  O OE2 . GLU A 1 30   ? -9.245  -14.157 -24.334 1.00 103.52 ? 27   GLU A OE2 1 
ATOM 201  N N   . ASP A 1 31   ? -9.993  -10.812 -27.820 1.00 66.20  ? 28   ASP A N   1 
ATOM 202  C CA  . ASP A 1 31   ? -10.845 -9.693  -27.451 1.00 66.20  ? 28   ASP A CA  1 
ATOM 203  C C   . ASP A 1 31   ? -10.847 -8.769  -28.618 1.00 66.20  ? 28   ASP A C   1 
ATOM 204  O O   . ASP A 1 31   ? -9.785  -8.393  -29.104 1.00 66.20  ? 28   ASP A O   1 
ATOM 205  C CB  . ASP A 1 31   ? -10.271 -8.898  -26.305 1.00 59.04  ? 28   ASP A CB  1 
ATOM 206  C CG  . ASP A 1 31   ? -10.973 -9.165  -25.012 1.00 59.04  ? 28   ASP A CG  1 
ATOM 207  O OD1 . ASP A 1 31   ? -11.624 -10.234 -24.881 1.00 59.04  ? 28   ASP A OD1 1 
ATOM 208  O OD2 . ASP A 1 31   ? -10.846 -8.299  -24.112 1.00 59.04  ? 28   ASP A OD2 1 
ATOM 209  N N   . LEU A 1 32   ? -12.042 -8.405  -29.068 1.00 60.82  ? 29   LEU A N   1 
ATOM 210  C CA  . LEU A 1 32   ? -12.181 -7.339  -30.032 1.00 60.82  ? 29   LEU A CA  1 
ATOM 211  C C   . LEU A 1 32   ? -12.672 -6.087  -29.301 1.00 60.82  ? 29   LEU A C   1 
ATOM 212  O O   . LEU A 1 32   ? -13.763 -6.084  -28.713 1.00 60.82  ? 29   LEU A O   1 
ATOM 213  C CB  . LEU A 1 32   ? -13.122 -7.770  -31.147 1.00 44.08  ? 29   LEU A CB  1 
ATOM 214  C CG  . LEU A 1 32   ? -13.022 -6.984  -32.444 1.00 44.08  ? 29   LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 32   ? -11.797 -7.378  -33.216 1.00 44.08  ? 29   LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 32   ? -14.263 -7.185  -33.271 1.00 44.08  ? 29   LEU A CD2 1 
ATOM 217  N N   . ASN A 1 33   ? -11.828 -5.054  -29.298 1.00 51.64  ? 30   ASN A N   1 
ATOM 218  C CA  . ASN A 1 33   ? -12.167 -3.768  -28.679 1.00 51.64  ? 30   ASN A CA  1 
ATOM 219  C C   . ASN A 1 33   ? -12.524 -2.677  -29.681 1.00 51.64  ? 30   ASN A C   1 
ATOM 220  O O   . ASN A 1 33   ? -11.923 -2.553  -30.759 1.00 51.64  ? 30   ASN A O   1 
ATOM 221  C CB  . ASN A 1 33   ? -11.030 -3.240  -27.792 1.00 53.06  ? 30   ASN A CB  1 
ATOM 222  C CG  . ASN A 1 33   ? -10.807 -4.080  -26.531 1.00 53.06  ? 30   ASN A CG  1 
ATOM 223  O OD1 . ASN A 1 33   ? -11.731 -4.278  -25.711 1.00 53.06  ? 30   ASN A OD1 1 
ATOM 224  N ND2 . ASN A 1 33   ? -9.568  -4.572  -26.360 1.00 53.06  ? 30   ASN A ND2 1 
ATOM 225  N N   . LEU A 1 34   ? -13.502 -1.869  -29.307 1.00 49.78  ? 31   LEU A N   1 
ATOM 226  C CA  . LEU A 1 34   ? -13.741 -0.651  -30.022 1.00 49.78  ? 31   LEU A CA  1 
ATOM 227  C C   . LEU A 1 34   ? -13.207 0.450   -29.139 1.00 49.78  ? 31   LEU A C   1 
ATOM 228  O O   . LEU A 1 34   ? -13.525 0.523   -27.936 1.00 49.78  ? 31   LEU A O   1 
ATOM 229  C CB  . LEU A 1 34   ? -15.224 -0.468  -30.275 1.00 52.81  ? 31   LEU A CB  1 
ATOM 230  C CG  . LEU A 1 34   ? -15.670 0.897   -30.772 1.00 52.81  ? 31   LEU A CG  1 
ATOM 231  C CD1 . LEU A 1 34   ? -15.293 1.132   -32.237 1.00 52.81  ? 31   LEU A CD1 1 
ATOM 232  C CD2 . LEU A 1 34   ? -17.155 1.021   -30.582 1.00 52.81  ? 31   LEU A CD2 1 
ATOM 233  N N   . LEU A 1 35   ? -12.354 1.271   -29.737 1.00 40.26  ? 32   LEU A N   1 
ATOM 234  C CA  . LEU A 1 35   ? -11.847 2.483   -29.088 1.00 40.26  ? 32   LEU A CA  1 
ATOM 235  C C   . LEU A 1 35   ? -12.481 3.701   -29.718 1.00 40.26  ? 32   LEU A C   1 
ATOM 236  O O   . LEU A 1 35   ? -12.423 3.826   -30.929 1.00 40.26  ? 32   LEU A O   1 
ATOM 237  C CB  . LEU A 1 35   ? -10.338 2.540   -29.232 1.00 61.74  ? 32   LEU A CB  1 
ATOM 238  C CG  . LEU A 1 35   ? -9.578  2.185   -27.955 1.00 61.74  ? 32   LEU A CG  1 
ATOM 239  C CD1 . LEU A 1 35   ? -10.279 1.158   -27.094 1.00 61.74  ? 32   LEU A CD1 1 
ATOM 240  C CD2 . LEU A 1 35   ? -8.191  1.724   -28.280 1.00 61.74  ? 32   LEU A CD2 1 
ATOM 241  N N   . ILE A 1 36   ? -13.116 4.560   -28.926 1.00 41.27  ? 33   ILE A N   1 
ATOM 242  C CA  . ILE A 1 36   ? -13.746 5.766   -29.464 1.00 41.27  ? 33   ILE A CA  1 
ATOM 243  C C   . ILE A 1 36   ? -13.203 6.992   -28.768 1.00 41.27  ? 33   ILE A C   1 
ATOM 244  O O   . ILE A 1 36   ? -13.224 7.095   -27.533 1.00 41.27  ? 33   ILE A O   1 
ATOM 245  C CB  . ILE A 1 36   ? -15.284 5.784   -29.276 1.00 31.12  ? 33   ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 36   ? -15.976 4.749   -30.171 1.00 31.12  ? 33   ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 36   ? -15.883 7.183   -29.562 1.00 31.12  ? 33   ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 36   ? -17.352 4.368   -29.655 1.00 31.12  ? 33   ILE A CD1 1 
ATOM 249  N N   . ALA A 1 37   ? -12.719 7.923   -29.580 1.00 54.13  ? 34   ALA A N   1 
ATOM 250  C CA  . ALA A 1 37   ? -12.216 9.183   -29.106 1.00 54.13  ? 34   ALA A CA  1 
ATOM 251  C C   . ALA A 1 37   ? -13.298 10.240  -29.261 1.00 54.13  ? 34   ALA A C   1 
ATOM 252  O O   . ALA A 1 37   ? -13.807 10.469  -30.356 1.00 54.13  ? 34   ALA A O   1 
ATOM 253  C CB  . ALA A 1 37   ? -10.994 9.553   -29.887 1.00 34.46  ? 34   ALA A CB  1 
ATOM 254  N N   . LYS A 1 38   ? -13.670 10.859  -28.145 1.00 56.14  ? 35   LYS A N   1 
ATOM 255  C CA  . LYS A 1 38   ? -14.504 12.054  -28.170 1.00 56.14  ? 35   LYS A CA  1 
ATOM 256  C C   . LYS A 1 38   ? -13.656 13.312  -28.377 1.00 56.14  ? 35   LYS A C   1 
ATOM 257  O O   . LYS A 1 38   ? -13.222 13.642  -29.504 1.00 56.14  ? 35   LYS A O   1 
ATOM 258  C CB  . LYS A 1 38   ? -15.321 12.175  -26.908 1.00 37.93  ? 35   LYS A CB  1 
ATOM 259  C CG  . LYS A 1 38   ? -16.757 11.590  -27.033 1.00 37.93  ? 35   LYS A CG  1 
ATOM 260  C CD  . LYS A 1 38   ? -16.801 10.175  -27.578 1.00 37.93  ? 35   LYS A CD  1 
ATOM 261  C CE  . LYS A 1 38   ? -18.252 9.595   -27.660 1.00 37.93  ? 35   LYS A CE  1 
ATOM 262  N NZ  . LYS A 1 38   ? -18.825 8.975   -26.399 1.00 37.93  ? 35   LYS A NZ  1 
ATOM 263  N N   . ASN A 1 39   ? -13.379 14.052  -27.332 1.00 42.79  ? 36   ASN A N   1 
ATOM 264  C CA  . ASN A 1 39   ? -12.473 15.140  -27.622 1.00 42.79  ? 36   ASN A CA  1 
ATOM 265  C C   . ASN A 1 39   ? -11.303 14.860  -26.742 1.00 42.79  ? 36   ASN A C   1 
ATOM 266  O O   . ASN A 1 39   ? -10.269 14.417  -27.198 1.00 42.79  ? 36   ASN A O   1 
ATOM 267  C CB  . ASN A 1 39   ? -13.160 16.472  -27.315 1.00 30.23  ? 36   ASN A CB  1 
ATOM 268  C CG  . ASN A 1 39   ? -12.342 17.642  -27.677 1.00 30.23  ? 36   ASN A CG  1 
ATOM 269  O OD1 . ASN A 1 39   ? -11.314 17.527  -28.386 1.00 30.23  ? 36   ASN A OD1 1 
ATOM 270  N ND2 . ASN A 1 39   ? -12.752 18.795  -27.197 1.00 30.23  ? 36   ASN A ND2 1 
ATOM 271  N N   . THR A 1 40   ? -11.550 15.050  -25.457 1.00 36.90  ? 37   THR A N   1 
ATOM 272  C CA  . THR A 1 40   ? -10.656 14.766  -24.375 1.00 36.90  ? 37   THR A CA  1 
ATOM 273  C C   . THR A 1 40   ? -11.125 13.547  -23.583 1.00 36.90  ? 37   THR A C   1 
ATOM 274  O O   . THR A 1 40   ? -10.967 13.510  -22.370 1.00 36.90  ? 37   THR A O   1 
ATOM 275  C CB  . THR A 1 40   ? -10.757 15.916  -23.408 1.00 42.73  ? 37   THR A CB  1 
ATOM 276  O OG1 . THR A 1 40   ? -12.124 16.067  -22.993 1.00 42.73  ? 37   THR A OG1 1 
ATOM 277  C CG2 . THR A 1 40   ? -10.272 17.196  -24.066 1.00 42.73  ? 37   THR A CG2 1 
ATOM 278  N N   . ARG A 1 41   ? -11.761 12.584  -24.244 1.00 44.28  ? 38   ARG A N   1 
ATOM 279  C CA  . ARG A 1 41   ? -12.414 11.451  -23.584 1.00 44.28  ? 38   ARG A CA  1 
ATOM 280  C C   . ARG A 1 41   ? -12.167 10.217  -24.410 1.00 44.28  ? 38   ARG A C   1 
ATOM 281  O O   . ARG A 1 41   ? -12.235 10.243  -25.649 1.00 44.28  ? 38   ARG A O   1 
ATOM 282  C CB  . ARG A 1 41   ? -13.906 11.682  -23.459 1.00 68.78  ? 38   ARG A CB  1 
ATOM 283  C CG  . ARG A 1 41   ? -14.289 12.552  -22.305 1.00 68.78  ? 38   ARG A CG  1 
ATOM 284  C CD  . ARG A 1 41   ? -14.481 11.724  -21.084 1.00 68.78  ? 38   ARG A CD  1 
ATOM 285  N NE  . ARG A 1 41   ? -14.049 12.442  -19.901 1.00 68.78  ? 38   ARG A NE  1 
ATOM 286  C CZ  . ARG A 1 41   ? -13.713 11.854  -18.764 1.00 68.78  ? 38   ARG A CZ  1 
ATOM 287  N NH1 . ARG A 1 41   ? -13.772 10.541  -18.671 1.00 68.78  ? 38   ARG A NH1 1 
ATOM 288  N NH2 . ARG A 1 41   ? -13.311 12.574  -17.727 1.00 68.78  ? 38   ARG A NH2 1 
ATOM 289  N N   . LEU A 1 42   ? -11.856 9.123   -23.735 1.00 41.30  ? 39   LEU A N   1 
ATOM 290  C CA  . LEU A 1 42   ? -11.461 7.939   -24.457 1.00 41.30  ? 39   LEU A CA  1 
ATOM 291  C C   . LEU A 1 42   ? -12.340 6.802   -24.042 1.00 41.30  ? 39   LEU A C   1 
ATOM 292  O O   . LEU A 1 42   ? -12.397 6.497   -22.856 1.00 41.30  ? 39   LEU A O   1 
ATOM 293  C CB  . LEU A 1 42   ? -10.005 7.612   -24.145 1.00 48.56  ? 39   LEU A CB  1 
ATOM 294  C CG  . LEU A 1 42   ? -9.471  6.357   -24.846 1.00 48.56  ? 39   LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 42   ? -9.549  6.444   -26.402 1.00 48.56  ? 39   LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 42   ? -8.044  6.132   -24.403 1.00 48.56  ? 39   LEU A CD2 1 
ATOM 297  N N   . GLU A 1 43   ? -13.023 6.172   -24.993 1.00 42.52  ? 40   GLU A N   1 
ATOM 298  C CA  . GLU A 1 43   ? -13.965 5.096   -24.648 1.00 42.52  ? 40   GLU A CA  1 
ATOM 299  C C   . GLU A 1 43   ? -13.495 3.768   -25.152 1.00 42.52  ? 40   GLU A C   1 
ATOM 300  O O   . GLU A 1 43   ? -13.014 3.641   -26.284 1.00 42.52  ? 40   GLU A O   1 
ATOM 301  C CB  . GLU A 1 43   ? -15.372 5.398   -25.146 1.00 38.90  ? 40   GLU A CB  1 
ATOM 302  C CG  . GLU A 1 43   ? -16.244 6.040   -24.108 1.00 38.90  ? 40   GLU A CG  1 
ATOM 303  C CD  . GLU A 1 43   ? -17.426 6.820   -24.690 1.00 38.90  ? 40   GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 43   ? -18.063 6.303   -25.649 1.00 38.90  ? 40   GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 43   ? -17.739 7.952   -24.180 1.00 38.90  ? 40   GLU A OE2 1 
ATOM 306  N N   . ILE A 1 44   ? -13.624 2.777   -24.283 1.00 46.37  ? 41   ILE A N   1 
ATOM 307  C CA  . ILE A 1 44   ? -13.136 1.416   -24.548 1.00 46.37  ? 41   ILE A CA  1 
ATOM 308  C C   . ILE A 1 44   ? -14.258 0.413   -24.415 1.00 46.37  ? 41   ILE A C   1 
ATOM 309  O O   . ILE A 1 44   ? -14.888 0.290   -23.340 1.00 46.37  ? 41   ILE A O   1 
ATOM 310  C CB  . ILE A 1 44   ? -12.032 0.985   -23.561 1.00 41.31  ? 41   ILE A CB  1 
ATOM 311  C CG1 . ILE A 1 44   ? -10.888 1.974   -23.570 1.00 41.31  ? 41   ILE A CG1 1 
ATOM 312  C CG2 . ILE A 1 44   ? -11.507 -0.398  -23.921 1.00 41.31  ? 41   ILE A CG2 1 
ATOM 313  C CD1 . ILE A 1 44   ? -10.029 1.817   -22.419 1.00 41.31  ? 41   ILE A CD1 1 
ATOM 314  N N   . TYR A 1 45   ? -14.497 -0.318  -25.495 1.00 35.52  ? 42   TYR A N   1 
ATOM 315  C CA  . TYR A 1 45   ? -15.608 -1.247  -25.474 1.00 35.52  ? 42   TYR A CA  1 
ATOM 316  C C   . TYR A 1 45   ? -15.118 -2.659  -25.761 1.00 35.52  ? 42   TYR A C   1 
ATOM 317  O O   . TYR A 1 45   ? -14.032 -2.816  -26.335 1.00 35.52  ? 42   TYR A O   1 
ATOM 318  C CB  . TYR A 1 45   ? -16.672 -0.810  -26.495 1.00 43.08  ? 42   TYR A CB  1 
ATOM 319  C CG  . TYR A 1 45   ? -17.400 0.467   -26.128 1.00 43.08  ? 42   TYR A CG  1 
ATOM 320  C CD1 . TYR A 1 45   ? -16.980 1.711   -26.614 1.00 43.08  ? 42   TYR A CD1 1 
ATOM 321  C CD2 . TYR A 1 45   ? -18.490 0.425   -25.283 1.00 43.08  ? 42   TYR A CD2 1 
ATOM 322  C CE1 . TYR A 1 45   ? -17.624 2.869   -26.260 1.00 43.08  ? 42   TYR A CE1 1 
ATOM 323  C CE2 . TYR A 1 45   ? -19.138 1.579   -24.913 1.00 43.08  ? 42   TYR A CE2 1 
ATOM 324  C CZ  . TYR A 1 45   ? -18.716 2.795   -25.408 1.00 43.08  ? 42   TYR A CZ  1 
ATOM 325  O OH  . TYR A 1 45   ? -19.416 3.915   -25.033 1.00 43.08  ? 42   TYR A OH  1 
ATOM 326  N N   . VAL A 1 46   ? -15.888 -3.681  -25.370 1.00 52.47  ? 43   VAL A N   1 
ATOM 327  C CA  . VAL A 1 46   ? -15.623 -5.030  -25.866 1.00 52.47  ? 43   VAL A CA  1 
ATOM 328  C C   . VAL A 1 46   ? -16.789 -5.420  -26.714 1.00 52.47  ? 43   VAL A C   1 
ATOM 329  O O   . VAL A 1 46   ? -17.931 -5.296  -26.292 1.00 52.47  ? 43   VAL A O   1 
ATOM 330  C CB  . VAL A 1 46   ? -15.428 -6.082  -24.750 1.00 69.73  ? 43   VAL A CB  1 
ATOM 331  C CG1 . VAL A 1 46   ? -15.205 -7.456  -25.355 1.00 69.73  ? 43   VAL A CG1 1 
ATOM 332  C CG2 . VAL A 1 46   ? -14.235 -5.736  -23.870 1.00 69.73  ? 43   VAL A CG2 1 
ATOM 333  N N   . VAL A 1 47   ? -16.488 -5.878  -27.920 1.00 54.76  ? 44   VAL A N   1 
ATOM 334  C CA  . VAL A 1 47   ? -17.504 -6.268  -28.912 1.00 54.76  ? 44   VAL A CA  1 
ATOM 335  C C   . VAL A 1 47   ? -18.064 -7.651  -28.585 1.00 54.76  ? 44   VAL A C   1 
ATOM 336  O O   . VAL A 1 47   ? -17.300 -8.549  -28.242 1.00 54.76  ? 44   VAL A O   1 
ATOM 337  C CB  . VAL A 1 47   ? -16.888 -6.285  -30.346 1.00 44.45  ? 44   VAL A CB  1 
ATOM 338  C CG1 . VAL A 1 47   ? -17.972 -6.331  -31.427 1.00 44.45  ? 44   VAL A CG1 1 
ATOM 339  C CG2 . VAL A 1 47   ? -16.046 -5.064  -30.563 1.00 44.45  ? 44   VAL A CG2 1 
ATOM 340  N N   . THR A 1 48   ? -19.382 -7.818  -28.695 1.00 85.55  ? 45   THR A N   1 
ATOM 341  C CA  . THR A 1 48   ? -20.052 -9.095  -28.415 1.00 85.55  ? 45   THR A CA  1 
ATOM 342  C C   . THR A 1 48   ? -21.268 -9.258  -29.306 1.00 85.55  ? 45   THR A C   1 
ATOM 343  O O   . THR A 1 48   ? -21.645 -8.335  -30.028 1.00 85.55  ? 45   THR A O   1 
ATOM 344  C CB  . THR A 1 48   ? -20.622 -9.155  -26.984 1.00 80.50  ? 45   THR A CB  1 
ATOM 345  O OG1 . THR A 1 48   ? -21.464 -8.013  -26.771 1.00 80.50  ? 45   THR A OG1 1 
ATOM 346  C CG2 . THR A 1 48   ? -19.527 -9.226  -25.922 1.00 80.50  ? 45   THR A CG2 1 
ATOM 347  N N   . ALA A 1 49   ? -21.895 -10.432 -29.197 1.00 95.51  ? 46   ALA A N   1 
ATOM 348  C CA  . ALA A 1 49   ? -23.157 -10.776 -29.865 1.00 95.51  ? 46   ALA A CA  1 
ATOM 349  C C   . ALA A 1 49   ? -24.222 -9.666  -29.856 1.00 95.51  ? 46   ALA A C   1 
ATOM 350  O O   . ALA A 1 49   ? -24.795 -9.339  -30.898 1.00 95.51  ? 46   ALA A O   1 
ATOM 351  C CB  . ALA A 1 49   ? -23.715 -12.050 -29.252 1.00 52.40  ? 46   ALA A CB  1 
ATOM 352  N N   . GLU A 1 50   ? -24.487 -9.092  -28.689 1.00 117.44 ? 47   GLU A N   1 
ATOM 353  C CA  . GLU A 1 50   ? -25.440 -7.990  -28.583 1.00 117.44 ? 47   GLU A CA  1 
ATOM 354  C C   . GLU A 1 50   ? -24.900 -6.739  -29.283 1.00 117.44 ? 47   GLU A C   1 
ATOM 355  O O   . GLU A 1 50   ? -25.656 -5.946  -29.854 1.00 117.44 ? 47   GLU A O   1 
ATOM 356  C CB  . GLU A 1 50   ? -25.743 -7.713  -27.106 1.00 141.53 ? 47   GLU A CB  1 
ATOM 357  C CG  . GLU A 1 50   ? -26.825 -6.664  -26.835 1.00 141.53 ? 47   GLU A CG  1 
ATOM 358  C CD  . GLU A 1 50   ? -26.262 -5.272  -26.551 1.00 141.53 ? 47   GLU A CD  1 
ATOM 359  O OE1 . GLU A 1 50   ? -26.924 -4.493  -25.827 1.00 141.53 ? 47   GLU A OE1 1 
ATOM 360  O OE2 . GLU A 1 50   ? -25.160 -4.949  -27.044 1.00 141.53 ? 47   GLU A OE2 1 
ATOM 361  N N   . GLY A 1 51   ? -23.580 -6.596  -29.254 1.00 68.94  ? 48   GLY A N   1 
ATOM 362  C CA  . GLY A 1 51   ? -22.902 -5.356  -29.628 1.00 68.94  ? 48   GLY A CA  1 
ATOM 363  C C   . GLY A 1 51   ? -21.793 -5.025  -28.625 1.00 68.94  ? 48   GLY A C   1 
ATOM 364  O O   . GLY A 1 51   ? -20.984 -5.888  -28.269 1.00 68.94  ? 48   GLY A O   1 
ATOM 365  N N   . LEU A 1 52   ? -21.785 -3.785  -28.144 1.00 52.11  ? 49   LEU A N   1 
ATOM 366  C CA  . LEU A 1 52   ? -20.704 -3.264  -27.305 1.00 52.11  ? 49   LEU A CA  1 
ATOM 367  C C   . LEU A 1 52   ? -20.816 -3.483  -25.766 1.00 52.11  ? 49   LEU A C   1 
ATOM 368  O O   . LEU A 1 52   ? -21.760 -3.000  -25.131 1.00 52.11  ? 49   LEU A O   1 
ATOM 369  C CB  . LEU A 1 52   ? -20.591 -1.771  -27.609 1.00 40.17  ? 49   LEU A CB  1 
ATOM 370  C CG  . LEU A 1 52   ? -19.824 -1.247  -28.850 1.00 40.17  ? 49   LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 52   ? -19.126 -2.284  -29.759 1.00 40.17  ? 49   LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 52   ? -20.712 -0.336  -29.654 1.00 40.17  ? 49   LEU A CD2 1 
ATOM 373  N N   . ARG A 1 53   ? -19.863 -4.198  -25.166 1.00 53.58  ? 50   ARG A N   1 
ATOM 374  C CA  . ARG A 1 53   ? -19.777 -4.238  -23.709 1.00 53.58  ? 50   ARG A CA  1 
ATOM 375  C C   . ARG A 1 53   ? -18.790 -3.169  -23.315 1.00 53.58  ? 50   ARG A C   1 
ATOM 376  O O   . ARG A 1 53   ? -17.642 -3.236  -23.753 1.00 53.58  ? 50   ARG A O   1 
ATOM 377  C CB  . ARG A 1 53   ? -19.286 -5.586  -23.182 1.00 133.87 ? 50   ARG A CB  1 
ATOM 378  C CG  . ARG A 1 53   ? -19.488 -5.746  -21.662 1.00 133.87 ? 50   ARG A CG  1 
ATOM 379  C CD  . ARG A 1 53   ? -18.395 -6.570  -20.969 1.00 133.87 ? 50   ARG A CD  1 
ATOM 380  N NE  . ARG A 1 53   ? -18.012 -7.782  -21.711 1.00 133.87 ? 50   ARG A NE  1 
ATOM 381  C CZ  . ARG A 1 53   ? -18.772 -8.881  -21.841 1.00 133.87 ? 50   ARG A CZ  1 
ATOM 382  N NH1 . ARG A 1 53   ? -19.984 -8.944  -21.282 1.00 133.87 ? 50   ARG A NH1 1 
ATOM 383  N NH2 . ARG A 1 53   ? -18.321 -9.924  -22.543 1.00 133.87 ? 50   ARG A NH2 1 
ATOM 384  N N   . PRO A 1 54   ? -19.230 -2.172  -22.513 1.00 50.07  ? 51   PRO A N   1 
ATOM 385  C CA  . PRO A 1 54   ? -18.400 -1.092  -21.969 1.00 50.07  ? 51   PRO A CA  1 
ATOM 386  C C   . PRO A 1 54   ? -17.406 -1.529  -20.894 1.00 50.07  ? 51   PRO A C   1 
ATOM 387  O O   . PRO A 1 54   ? -17.638 -2.465  -20.135 1.00 50.07  ? 51   PRO A O   1 
ATOM 388  C CB  . PRO A 1 54   ? -19.427 -0.119  -21.364 1.00 51.87  ? 51   PRO A CB  1 
ATOM 389  C CG  . PRO A 1 54   ? -20.676 -0.484  -21.942 1.00 51.87  ? 51   PRO A CG  1 
ATOM 390  C CD  . PRO A 1 54   ? -20.619 -1.973  -22.108 1.00 51.87  ? 51   PRO A CD  1 
ATOM 391  N N   . VAL A 1 55   ? -16.293 -0.830  -20.826 1.00 56.16  ? 52   VAL A N   1 
ATOM 392  C CA  . VAL A 1 55   ? -15.196 -1.325  -20.024 1.00 56.16  ? 52   VAL A CA  1 
ATOM 393  C C   . VAL A 1 55   ? -14.377 -0.271  -19.330 1.00 56.16  ? 52   VAL A C   1 
ATOM 394  O O   . VAL A 1 55   ? -14.023 -0.439  -18.167 1.00 56.16  ? 52   VAL A O   1 
ATOM 395  C CB  . VAL A 1 55   ? -14.250 -2.163  -20.866 1.00 38.88  ? 52   VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 55   ? -12.998 -2.437  -20.079 1.00 38.88  ? 52   VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 55   ? -14.970 -3.459  -21.285 1.00 38.88  ? 52   VAL A CG2 1 
ATOM 398  N N   . LYS A 1 56   ? -14.042 0.797   -20.049 1.00 62.97  ? 53   LYS A N   1 
ATOM 399  C CA  . LYS A 1 56   ? -13.274 1.868   -19.444 1.00 62.97  ? 53   LYS A CA  1 
ATOM 400  C C   . LYS A 1 56   ? -13.333 3.142   -20.241 1.00 62.97  ? 53   LYS A C   1 
ATOM 401  O O   . LYS A 1 56   ? -12.893 3.202   -21.386 1.00 62.97  ? 53   LYS A O   1 
ATOM 402  C CB  . LYS A 1 56   ? -11.828 1.435   -19.211 1.00 63.10  ? 53   LYS A CB  1 
ATOM 403  C CG  . LYS A 1 56   ? -11.036 2.345   -18.315 1.00 63.10  ? 53   LYS A CG  1 
ATOM 404  C CD  . LYS A 1 56   ? -11.530 2.377   -16.887 1.00 63.10  ? 53   LYS A CD  1 
ATOM 405  C CE  . LYS A 1 56   ? -10.392 2.920   -16.017 1.00 63.10  ? 53   LYS A CE  1 
ATOM 406  N NZ  . LYS A 1 56   ? -10.824 3.842   -14.923 1.00 63.10  ? 53   LYS A NZ  1 
ATOM 407  N N   . GLU A 1 57   ? -13.887 4.157   -19.594 1.00 51.34  ? 54   GLU A N   1 
ATOM 408  C CA  . GLU A 1 57   ? -13.998 5.497   -20.141 1.00 51.34  ? 54   GLU A CA  1 
ATOM 409  C C   . GLU A 1 57   ? -13.038 6.360   -19.341 1.00 51.34  ? 54   GLU A C   1 
ATOM 410  O O   . GLU A 1 57   ? -13.322 6.661   -18.178 1.00 51.34  ? 54   GLU A O   1 
ATOM 411  C CB  . GLU A 1 57   ? -15.437 6.023   -19.952 1.00 54.14  ? 54   GLU A CB  1 
ATOM 412  C CG  . GLU A 1 57   ? -15.877 7.184   -20.843 1.00 54.14  ? 54   GLU A CG  1 
ATOM 413  C CD  . GLU A 1 57   ? -15.688 8.600   -20.232 1.00 54.14  ? 54   GLU A CD  1 
ATOM 414  O OE1 . GLU A 1 57   ? -16.128 9.603   -20.852 1.00 54.14  ? 54   GLU A OE1 1 
ATOM 415  O OE2 . GLU A 1 57   ? -15.112 8.730   -19.133 1.00 54.14  ? 54   GLU A OE2 1 
ATOM 416  N N   . VAL A 1 58   ? -11.919 6.759   -19.943 1.00 62.97  ? 55   VAL A N   1 
ATOM 417  C CA  . VAL A 1 58   ? -11.062 7.777   -19.309 1.00 62.97  ? 55   VAL A CA  1 
ATOM 418  C C   . VAL A 1 58   ? -10.990 9.106   -20.050 1.00 62.97  ? 55   VAL A C   1 
ATOM 419  O O   . VAL A 1 58   ? -11.272 9.171   -21.265 1.00 62.97  ? 55   VAL A O   1 
ATOM 420  C CB  . VAL A 1 58   ? -9.637  7.275   -19.064 1.00 57.01  ? 55   VAL A CB  1 
ATOM 421  C CG1 . VAL A 1 58   ? -9.654  6.266   -17.950 1.00 57.01  ? 55   VAL A CG1 1 
ATOM 422  C CG2 . VAL A 1 58   ? -9.040  6.678   -20.337 1.00 57.01  ? 55   VAL A CG2 1 
ATOM 423  N N   . GLY A 1 59   ? -10.623 10.156  -19.298 1.00 50.12  ? 56   GLY A N   1 
ATOM 424  C CA  . GLY A 1 59   ? -10.319 11.496  -19.857 1.00 50.12  ? 56   GLY A CA  1 
ATOM 425  C C   . GLY A 1 59   ? -8.824  11.823  -20.006 1.00 50.12  ? 56   GLY A C   1 
ATOM 426  O O   . GLY A 1 59   ? -7.968  11.322  -19.247 1.00 50.12  ? 56   GLY A O   1 
ATOM 427  N N   . MET A 1 60   ? -8.506  12.670  -20.986 1.00 55.09  ? 57   MET A N   1 
ATOM 428  C CA  . MET A 1 60   ? -7.144  13.170  -21.188 1.00 55.09  ? 57   MET A CA  1 
ATOM 429  C C   . MET A 1 60   ? -7.085  14.687  -21.101 1.00 55.09  ? 57   MET A C   1 
ATOM 430  O O   . MET A 1 60   ? -8.110  15.354  -21.249 1.00 55.09  ? 57   MET A O   1 
ATOM 431  C CB  . MET A 1 60   ? -6.610  12.728  -22.530 1.00 52.92  ? 57   MET A CB  1 
ATOM 432  C CG  . MET A 1 60   ? -6.233  11.290  -22.601 1.00 52.92  ? 57   MET A CG  1 
ATOM 433  S SD  . MET A 1 60   ? -5.050  11.164  -23.961 1.00 52.92  ? 57   MET A SD  1 
ATOM 434  C CE  . MET A 1 60   ? -3.524  11.788  -23.240 1.00 52.92  ? 57   MET A CE  1 
ATOM 435  N N   . TYR A 1 61   ? -5.881  15.212  -20.856 1.00 45.82  ? 58   TYR A N   1 
ATOM 436  C CA  . TYR A 1 61   ? -5.635  16.651  -20.809 1.00 45.82  ? 58   TYR A CA  1 
ATOM 437  C C   . TYR A 1 61   ? -5.144  17.151  -22.140 1.00 45.82  ? 58   TYR A C   1 
ATOM 438  O O   . TYR A 1 61   ? -4.101  17.781  -22.231 1.00 45.82  ? 58   TYR A O   1 
ATOM 439  C CB  . TYR A 1 61   ? -4.628  17.048  -19.720 1.00 47.98  ? 58   TYR A CB  1 
ATOM 440  C CG  . TYR A 1 61   ? -5.107  16.846  -18.322 1.00 47.98  ? 58   TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 61   ? -6.459  16.829  -18.032 1.00 47.98  ? 58   TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 61   ? -4.191  16.692  -17.270 1.00 47.98  ? 58   TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 61   ? -6.919  16.635  -16.738 1.00 47.98  ? 58   TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 61   ? -4.631  16.491  -15.943 1.00 47.98  ? 58   TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 61   ? -6.015  16.461  -15.680 1.00 47.98  ? 58   TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 61   ? -6.500  16.259  -14.383 1.00 47.98  ? 58   TYR A OH  1 
ATOM 447  N N   . GLY A 1 62   ? -5.914  16.887  -23.175 1.00 38.56  ? 59   GLY A N   1 
ATOM 448  C CA  . GLY A 1 62   ? -5.624  17.402  -24.510 1.00 38.56  ? 59   GLY A CA  1 
ATOM 449  C C   . GLY A 1 62   ? -6.731  16.925  -25.399 1.00 38.56  ? 59   GLY A C   1 
ATOM 450  O O   . GLY A 1 62   ? -7.565  16.111  -25.006 1.00 38.56  ? 59   GLY A O   1 
ATOM 451  N N   . LYS A 1 63   ? -6.748  17.442  -26.605 1.00 38.53  ? 60   LYS A N   1 
ATOM 452  C CA  . LYS A 1 63   ? -7.740  17.018  -27.546 1.00 38.53  ? 60   LYS A CA  1 
ATOM 453  C C   . LYS A 1 63   ? -7.073  15.946  -28.358 1.00 38.53  ? 60   LYS A C   1 
ATOM 454  O O   . LYS A 1 63   ? -6.080  16.229  -29.014 1.00 38.53  ? 60   LYS A O   1 
ATOM 455  C CB  . LYS A 1 63   ? -8.144  18.176  -28.427 1.00 36.94  ? 60   LYS A CB  1 
ATOM 456  C CG  . LYS A 1 63   ? -8.778  19.286  -27.657 1.00 36.94  ? 60   LYS A CG  1 
ATOM 457  C CD  . LYS A 1 63   ? -8.734  20.613  -28.423 1.00 36.94  ? 60   LYS A CD  1 
ATOM 458  C CE  . LYS A 1 63   ? -9.551  20.559  -29.718 1.00 36.94  ? 60   LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 63   ? -10.915 20.021  -29.436 1.00 36.94  ? 60   LYS A NZ  1 
ATOM 460  N N   . ILE A 1 64   ? -7.588  14.721  -28.302 1.00 34.71  ? 61   ILE A N   1 
ATOM 461  C CA  . ILE A 1 64   ? -7.000  13.632  -29.086 1.00 34.71  ? 61   ILE A CA  1 
ATOM 462  C C   . ILE A 1 64   ? -6.983  13.933  -30.592 1.00 34.71  ? 61   ILE A C   1 
ATOM 463  O O   . ILE A 1 64   ? -8.025  14.229  -31.199 1.00 34.71  ? 61   ILE A O   1 
ATOM 464  C CB  . ILE A 1 64   ? -7.726  12.318  -28.810 1.00 27.72  ? 61   ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 64   ? -8.000  12.226  -27.306 1.00 27.72  ? 61   ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 64   ? -6.962  11.140  -29.384 1.00 27.72  ? 61   ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 64   ? -8.322  10.888  -26.840 1.00 27.72  ? 61   ILE A CD1 1 
ATOM 468  N N   . ALA A 1 65   ? -5.804  13.890  -31.186 1.00 35.19  ? 62   ALA A N   1 
ATOM 469  C CA  . ALA A 1 65   ? -5.685  14.236  -32.592 1.00 35.19  ? 62   ALA A CA  1 
ATOM 470  C C   . ALA A 1 65   ? -5.263  13.044  -33.482 1.00 35.19  ? 62   ALA A C   1 
ATOM 471  O O   . ALA A 1 65   ? -5.532  13.032  -34.677 1.00 35.19  ? 62   ALA A O   1 
ATOM 472  C CB  . ALA A 1 65   ? -4.731  15.362  -32.740 1.00 16.28  ? 62   ALA A CB  1 
ATOM 473  N N   . VAL A 1 66   ? -4.566  12.084  -32.880 1.00 42.56  ? 63   VAL A N   1 
ATOM 474  C CA  . VAL A 1 66   ? -4.138  10.860  -33.508 1.00 42.56  ? 63   VAL A CA  1 
ATOM 475  C C   . VAL A 1 66   ? -4.368  9.779   -32.476 1.00 42.56  ? 63   VAL A C   1 
ATOM 476  O O   . VAL A 1 66   ? -4.030  9.970   -31.311 1.00 42.56  ? 63   VAL A O   1 
ATOM 477  C CB  . VAL A 1 66   ? -2.634  10.868  -33.813 1.00 36.82  ? 63   VAL A CB  1 
ATOM 478  C CG1 . VAL A 1 66   ? -2.232  9.550   -34.448 1.00 36.82  ? 63   VAL A CG1 1 
ATOM 479  C CG2 . VAL A 1 66   ? -2.252  12.001  -34.718 1.00 36.82  ? 63   VAL A CG2 1 
ATOM 480  N N   . MET A 1 67   ? -4.949  8.659   -32.911 1.00 45.25  ? 64   MET A N   1 
ATOM 481  C CA  . MET A 1 67   ? -5.211  7.504   -32.057 1.00 45.25  ? 64   MET A CA  1 
ATOM 482  C C   . MET A 1 67   ? -4.953  6.199   -32.808 1.00 45.25  ? 64   MET A C   1 
ATOM 483  O O   . MET A 1 67   ? -5.725  5.841   -33.673 1.00 45.25  ? 64   MET A O   1 
ATOM 484  C CB  . MET A 1 67   ? -6.634  7.553   -31.517 1.00 34.26  ? 64   MET A CB  1 
ATOM 485  C CG  . MET A 1 67   ? -7.055  6.288   -30.745 1.00 34.26  ? 64   MET A CG  1 
ATOM 486  S SD  . MET A 1 67   ? -8.513  6.545   -29.652 1.00 34.26  ? 64   MET A SD  1 
ATOM 487  C CE  . MET A 1 67   ? -9.845  6.746   -30.890 1.00 34.26  ? 64   MET A CE  1 
ATOM 488  N N   . GLU A 1 68   ? -3.862  5.496   -32.495 1.00 52.35  ? 65   GLU A N   1 
ATOM 489  C CA  . GLU A 1 68   ? -3.558  4.240   -33.186 1.00 52.35  ? 65   GLU A CA  1 
ATOM 490  C C   . GLU A 1 68   ? -3.293  3.086   -32.247 1.00 52.35  ? 65   GLU A C   1 
ATOM 491  O O   . GLU A 1 68   ? -2.750  3.284   -31.185 1.00 52.35  ? 65   GLU A O   1 
ATOM 492  C CB  . GLU A 1 68   ? -2.373  4.403   -34.121 1.00 62.95  ? 65   GLU A CB  1 
ATOM 493  C CG  . GLU A 1 68   ? -2.642  5.242   -35.354 1.00 62.95  ? 65   GLU A CG  1 
ATOM 494  C CD  . GLU A 1 68   ? -3.877  4.800   -36.145 1.00 62.95  ? 65   GLU A CD  1 
ATOM 495  O OE1 . GLU A 1 68   ? -4.562  5.702   -36.697 1.00 62.95  ? 65   GLU A OE1 1 
ATOM 496  O OE2 . GLU A 1 68   ? -4.155  3.567   -36.229 1.00 62.95  ? 65   GLU A OE2 1 
ATOM 497  N N   . LEU A 1 69   ? -3.705  1.883   -32.636 1.00 69.72  ? 66   LEU A N   1 
ATOM 498  C CA  . LEU A 1 69   ? -3.348  0.659   -31.913 1.00 69.72  ? 66   LEU A CA  1 
ATOM 499  C C   . LEU A 1 69   ? -2.289  -0.061  -32.702 1.00 69.72  ? 66   LEU A C   1 
ATOM 500  O O   . LEU A 1 69   ? -2.361  -0.116  -33.932 1.00 69.72  ? 66   LEU A O   1 
ATOM 501  C CB  . LEU A 1 69   ? -4.557  -0.264  -31.700 1.00 46.26  ? 66   LEU A CB  1 
ATOM 502  C CG  . LEU A 1 69   ? -5.437  0.022   -30.471 1.00 46.26  ? 66   LEU A CG  1 
ATOM 503  C CD1 . LEU A 1 69   ? -6.634  -0.907  -30.416 1.00 46.26  ? 66   LEU A CD1 1 
ATOM 504  C CD2 . LEU A 1 69   ? -4.677  -0.079  -29.158 1.00 46.26  ? 66   LEU A CD2 1 
ATOM 505  N N   . PHE A 1 70   ? -1.296  -0.602  -32.005 1.00 52.34  ? 67   PHE A N   1 
ATOM 506  C CA  . PHE A 1 70   ? -0.202  -1.286  -32.681 1.00 52.34  ? 67   PHE A CA  1 
ATOM 507  C C   . PHE A 1 70   ? 0.487   -2.281  -31.762 1.00 52.34  ? 67   PHE A C   1 
ATOM 508  O O   . PHE A 1 70   ? 0.264   -2.294  -30.534 1.00 52.34  ? 67   PHE A O   1 
ATOM 509  C CB  . PHE A 1 70   ? 0.819   -0.269  -33.199 1.00 53.80  ? 67   PHE A CB  1 
ATOM 510  C CG  . PHE A 1 70   ? 1.701   0.300   -32.119 1.00 53.80  ? 67   PHE A CG  1 
ATOM 511  C CD1 . PHE A 1 70   ? 3.048   -0.003  -32.081 1.00 53.80  ? 67   PHE A CD1 1 
ATOM 512  C CD2 . PHE A 1 70   ? 1.169   1.108   -31.117 1.00 53.80  ? 67   PHE A CD2 1 
ATOM 513  C CE1 . PHE A 1 70   ? 3.858   0.493   -31.078 1.00 53.80  ? 67   PHE A CE1 1 
ATOM 514  C CE2 . PHE A 1 70   ? 1.972   1.606   -30.107 1.00 53.80  ? 67   PHE A CE2 1 
ATOM 515  C CZ  . PHE A 1 70   ? 3.321   1.302   -30.090 1.00 53.80  ? 67   PHE A CZ  1 
ATOM 516  N N   . ARG A 1 71   ? 1.346   -3.100  -32.368 1.00 72.19  ? 68   ARG A N   1 
ATOM 517  C CA  . ARG A 1 71   ? 2.041   -4.150  -31.641 1.00 72.19  ? 68   ARG A CA  1 
ATOM 518  C C   . ARG A 1 71   ? 3.413   -4.366  -32.236 1.00 72.19  ? 68   ARG A C   1 
ATOM 519  O O   . ARG A 1 71   ? 3.521   -4.689  -33.417 1.00 72.19  ? 68   ARG A O   1 
ATOM 520  C CB  . ARG A 1 71   ? 1.237   -5.448  -31.689 1.00 93.82  ? 68   ARG A CB  1 
ATOM 521  C CG  . ARG A 1 71   ? 1.738   -6.524  -30.764 1.00 93.82  ? 68   ARG A CG  1 
ATOM 522  C CD  . ARG A 1 71   ? 0.594   -7.191  -30.012 1.00 93.82  ? 68   ARG A CD  1 
ATOM 523  N NE  . ARG A 1 71   ? -0.489  -7.613  -30.899 1.00 93.82  ? 68   ARG A NE  1 
ATOM 524  C CZ  . ARG A 1 71   ? -1.430  -8.508  -30.594 1.00 93.82  ? 68   ARG A CZ  1 
ATOM 525  N NH1 . ARG A 1 71   ? -1.448  -9.109  -29.412 1.00 93.82  ? 68   ARG A NH1 1 
ATOM 526  N NH2 . ARG A 1 71   ? -2.362  -8.811  -31.484 1.00 93.82  ? 68   ARG A NH2 1 
ATOM 527  N N   . PRO A 1 72   ? 4.468   -4.152  -31.433 1.00 107.58 ? 69   PRO A N   1 
ATOM 528  C CA  . PRO A 1 72   ? 5.812   -4.541  -31.835 1.00 107.58 ? 69   PRO A CA  1 
ATOM 529  C C   . PRO A 1 72   ? 6.141   -5.946  -31.314 1.00 107.58 ? 69   PRO A C   1 
ATOM 530  O O   . PRO A 1 72   ? 5.260   -6.632  -30.782 1.00 107.58 ? 69   PRO A O   1 
ATOM 531  C CB  . PRO A 1 72   ? 6.697   -3.461  -31.191 1.00 60.07  ? 69   PRO A CB  1 
ATOM 532  C CG  . PRO A 1 72   ? 5.849   -2.866  -30.043 1.00 60.07  ? 69   PRO A CG  1 
ATOM 533  C CD  . PRO A 1 72   ? 4.466   -3.507  -30.109 1.00 60.07  ? 69   PRO A CD  1 
ATOM 534  N N   . LYS A 1 73   ? 7.392   -6.362  -31.469 1.00 74.27  ? 70   LYS A N   1 
ATOM 535  C CA  . LYS A 1 73   ? 7.778   -7.762  -31.268 1.00 74.27  ? 70   LYS A CA  1 
ATOM 536  C C   . LYS A 1 73   ? 7.814   -8.200  -29.802 1.00 74.27  ? 70   LYS A C   1 
ATOM 537  O O   . LYS A 1 73   ? 8.236   -7.441  -28.917 1.00 74.27  ? 70   LYS A O   1 
ATOM 538  C CB  . LYS A 1 73   ? 9.131   -8.053  -31.943 1.00 167.01 ? 70   LYS A CB  1 
ATOM 539  C CG  . LYS A 1 73   ? 9.273   -7.513  -33.370 1.00 167.01 ? 70   LYS A CG  1 
ATOM 540  C CD  . LYS A 1 73   ? 8.399   -8.261  -34.371 1.00 167.01 ? 70   LYS A CD  1 
ATOM 541  C CE  . LYS A 1 73   ? 7.978   -7.356  -35.517 1.00 167.01 ? 70   LYS A CE  1 
ATOM 542  N NZ  . LYS A 1 73   ? 7.008   -6.318  -35.057 1.00 167.01 ? 70   LYS A NZ  1 
ATOM 543  N N   . GLY A 1 74   ? 7.372   -9.435  -29.562 1.00 141.10 ? 71   GLY A N   1 
ATOM 544  C CA  . GLY A 1 74   ? 7.408   -10.038 -28.232 1.00 141.10 ? 71   GLY A CA  1 
ATOM 545  C C   . GLY A 1 74   ? 6.398   -9.433  -27.281 1.00 141.10 ? 71   GLY A C   1 
ATOM 546  O O   . GLY A 1 74   ? 6.392   -9.742  -26.088 1.00 141.10 ? 71   GLY A O   1 
ATOM 547  N N   . GLU A 1 75   ? 5.548   -8.562  -27.825 1.00 76.03  ? 72   GLU A N   1 
ATOM 548  C CA  . GLU A 1 75   ? 4.462   -7.918  -27.091 1.00 76.03  ? 72   GLU A CA  1 
ATOM 549  C C   . GLU A 1 75   ? 3.225   -8.802  -27.094 1.00 76.03  ? 72   GLU A C   1 
ATOM 550  O O   . GLU A 1 75   ? 2.783   -9.239  -28.146 1.00 76.03  ? 72   GLU A O   1 
ATOM 551  C CB  . GLU A 1 75   ? 4.143   -6.567  -27.724 1.00 70.45  ? 72   GLU A CB  1 
ATOM 552  C CG  . GLU A 1 75   ? 5.047   -5.448  -27.274 1.00 70.45  ? 72   GLU A CG  1 
ATOM 553  C CD  . GLU A 1 75   ? 4.819   -5.075  -25.814 1.00 70.45  ? 72   GLU A CD  1 
ATOM 554  O OE1 . GLU A 1 75   ? 5.512   -4.146  -25.316 1.00 70.45  ? 72   GLU A OE1 1 
ATOM 555  O OE2 . GLU A 1 75   ? 3.949   -5.711  -25.169 1.00 70.45  ? 72   GLU A OE2 1 
ATOM 556  N N   . SER A 1 76   ? 2.679   -9.062  -25.911 1.00 82.09  ? 73   SER A N   1 
ATOM 557  C CA  . SER A 1 76   ? 1.548   -9.970  -25.768 1.00 82.09  ? 73   SER A CA  1 
ATOM 558  C C   . SER A 1 76   ? 0.299   -9.461  -26.476 1.00 82.09  ? 73   SER A C   1 
ATOM 559  O O   . SER A 1 76   ? -0.288  -10.194 -27.265 1.00 82.09  ? 73   SER A O   1 
ATOM 560  C CB  . SER A 1 76   ? 1.257   -10.260 -24.291 1.00 71.95  ? 73   SER A CB  1 
ATOM 561  O OG  . SER A 1 76   ? 1.550   -9.135  -23.475 1.00 71.95  ? 73   SER A OG  1 
ATOM 562  N N   . LYS A 1 77   ? -0.086  -8.210  -26.193 1.00 78.60  ? 74   LYS A N   1 
ATOM 563  C CA  . LYS A 1 77   ? -1.278  -7.559  -26.767 1.00 78.60  ? 74   LYS A CA  1 
ATOM 564  C C   . LYS A 1 77   ? -0.989  -6.127  -27.218 1.00 78.60  ? 74   LYS A C   1 
ATOM 565  O O   . LYS A 1 77   ? 0.116   -5.629  -27.015 1.00 78.60  ? 74   LYS A O   1 
ATOM 566  C CB  . LYS A 1 77   ? -2.427  -7.559  -25.774 1.00 50.51  ? 74   LYS A CB  1 
ATOM 567  C CG  . LYS A 1 77   ? -2.206  -6.674  -24.589 1.00 50.51  ? 74   LYS A CG  1 
ATOM 568  C CD  . LYS A 1 77   ? -3.035  -7.148  -23.417 1.00 50.51  ? 74   LYS A CD  1 
ATOM 569  C CE  . LYS A 1 77   ? -3.086  -6.134  -22.290 1.00 50.51  ? 74   LYS A CE  1 
ATOM 570  N NZ  . LYS A 1 77   ? -1.744  -5.792  -21.705 1.00 50.51  ? 74   LYS A NZ  1 
ATOM 571  N N   . ASP A 1 78   ? -1.989  -5.480  -27.819 1.00 57.93  ? 75   ASP A N   1 
ATOM 572  C CA  . ASP A 1 78   ? -1.834  -4.155  -28.448 1.00 57.93  ? 75   ASP A CA  1 
ATOM 573  C C   . ASP A 1 78   ? -1.576  -3.010  -27.481 1.00 57.93  ? 75   ASP A C   1 
ATOM 574  O O   . ASP A 1 78   ? -1.995  -3.008  -26.311 1.00 57.93  ? 75   ASP A O   1 
ATOM 575  C CB  . ASP A 1 78   ? -3.068  -3.778  -29.282 1.00 69.37  ? 75   ASP A CB  1 
ATOM 576  C CG  . ASP A 1 78   ? -3.141  -4.491  -30.618 1.00 69.37  ? 75   ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 78   ? -4.119  -4.250  -31.340 1.00 69.37  ? 75   ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 78   ? -2.244  -5.278  -30.961 1.00 69.37  ? 75   ASP A OD2 1 
ATOM 579  N N   . LEU A 1 79   ? -0.906  -2.010  -28.011 1.00 48.67  ? 76   LEU A N   1 
ATOM 580  C CA  . LEU A 1 79   ? -0.593  -0.821  -27.255 1.00 48.67  ? 76   LEU A CA  1 
ATOM 581  C C   . LEU A 1 79   ? -1.236  0.384   -27.934 1.00 48.67  ? 76   LEU A C   1 
ATOM 582  O O   . LEU A 1 79   ? -1.465  0.374   -29.168 1.00 48.67  ? 76   LEU A O   1 
ATOM 583  C CB  . LEU A 1 79   ? 0.930   -0.640  -27.202 1.00 46.84  ? 76   LEU A CB  1 
ATOM 584  C CG  . LEU A 1 79   ? 1.722   -1.642  -26.349 1.00 46.84  ? 76   LEU A CG  1 
ATOM 585  C CD1 . LEU A 1 79   ? 3.207   -1.448  -26.605 1.00 46.84  ? 76   LEU A CD1 1 
ATOM 586  C CD2 . LEU A 1 79   ? 1.375   -1.499  -24.849 1.00 46.84  ? 76   LEU A CD2 1 
ATOM 587  N N   . LEU A 1 80   ? -1.503  1.432   -27.161 1.00 49.24  ? 77   LEU A N   1 
ATOM 588  C CA  . LEU A 1 80   ? -2.192  2.588   -27.724 1.00 49.24  ? 77   LEU A CA  1 
ATOM 589  C C   . LEU A 1 80   ? -1.296  3.798   -27.946 1.00 49.24  ? 77   LEU A C   1 
ATOM 590  O O   . LEU A 1 80   ? -0.631  4.272   -27.035 1.00 49.24  ? 77   LEU A O   1 
ATOM 591  C CB  . LEU A 1 80   ? -3.415  2.951   -26.878 1.00 49.16  ? 77   LEU A CB  1 
ATOM 592  C CG  . LEU A 1 80   ? -4.360  4.044   -27.401 1.00 49.16  ? 77   LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 80   ? -4.652  3.866   -28.889 1.00 49.16  ? 77   LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 80   ? -5.661  4.101   -26.592 1.00 49.16  ? 77   LEU A CD2 1 
ATOM 595  N N   . PHE A 1 81   ? -1.271  4.279   -29.176 1.00 52.31  ? 78   PHE A N   1 
ATOM 596  C CA  . PHE A 1 81   ? -0.604  5.521   -29.466 1.00 52.31  ? 78   PHE A CA  1 
ATOM 597  C C   . PHE A 1 81   ? -1.581  6.696   -29.506 1.00 52.31  ? 78   PHE A C   1 
ATOM 598  O O   . PHE A 1 81   ? -2.612  6.639   -30.202 1.00 52.31  ? 78   PHE A O   1 
ATOM 599  C CB  . PHE A 1 81   ? 0.173   5.477   -30.777 1.00 42.39  ? 78   PHE A CB  1 
ATOM 600  C CG  . PHE A 1 81   ? 0.839   6.790   -31.091 1.00 42.39  ? 78   PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 81   ? 1.898   7.257   -30.297 1.00 42.39  ? 78   PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 81   ? 0.365   7.611   -32.118 1.00 42.39  ? 78   PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 81   ? 2.506   8.494   -30.557 1.00 42.39  ? 78   PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 81   ? 0.972   8.858   -32.381 1.00 42.39  ? 78   PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 81   ? 2.042   9.293   -31.611 1.00 42.39  ? 78   PHE A CZ  1 
ATOM 606  N N   . ILE A 1 82   ? -1.234  7.761   -28.780 1.00 56.82  ? 79   ILE A N   1 
ATOM 607  C CA  . ILE A 1 82   ? -2.073  8.944   -28.699 1.00 56.82  ? 79   ILE A CA  1 
ATOM 608  C C   . ILE A 1 82   ? -1.271  10.206  -28.864 1.00 56.82  ? 79   ILE A C   1 
ATOM 609  O O   . ILE A 1 82   ? -0.327  10.439  -28.094 1.00 56.82  ? 79   ILE A O   1 
ATOM 610  C CB  . ILE A 1 82   ? -2.767  9.072   -27.346 1.00 35.67  ? 79   ILE A CB  1 
ATOM 611  C CG1 . ILE A 1 82   ? -3.718  7.908   -27.111 1.00 35.67  ? 79   ILE A CG1 1 
ATOM 612  C CG2 . ILE A 1 82   ? -3.600  10.343  -27.306 1.00 35.67  ? 79   ILE A CG2 1 
ATOM 613  C CD1 . ILE A 1 82   ? -5.092  8.062   -27.856 1.00 35.67  ? 79   ILE A CD1 1 
ATOM 614  N N   . LEU A 1 83   ? -1.676  11.023  -29.843 1.00 36.99  ? 80   LEU A N   1 
ATOM 615  C CA  . LEU A 1 83   ? -1.163  12.366  -30.005 1.00 36.99  ? 80   LEU A CA  1 
ATOM 616  C C   . LEU A 1 83   ? -2.201  13.463  -29.818 1.00 36.99  ? 80   LEU A C   1 
ATOM 617  O O   . LEU A 1 83   ? -3.236  13.457  -30.441 1.00 36.99  ? 80   LEU A O   1 
ATOM 618  C CB  . LEU A 1 83   ? -0.503  12.540  -31.363 1.00 21.70  ? 80   LEU A CB  1 
ATOM 619  C CG  . LEU A 1 83   ? -0.009  13.999  -31.396 1.00 21.70  ? 80   LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 83   ? 1.169   14.162  -30.403 1.00 21.70  ? 80   LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 83   ? 0.385   14.391  -32.774 1.00 21.70  ? 80   LEU A CD2 1 
ATOM 622  N N   . THR A 1 84   ? -1.880  14.420  -28.971 1.00 37.82  ? 81   THR A N   1 
ATOM 623  C CA  . THR A 1 84   ? -2.669  15.623  -28.718 1.00 37.82  ? 81   THR A CA  1 
ATOM 624  C C   . THR A 1 84   ? -2.432  16.795  -29.672 1.00 37.82  ? 81   THR A C   1 
ATOM 625  O O   . THR A 1 84   ? -1.354  16.965  -30.272 1.00 37.82  ? 81   THR A O   1 
ATOM 626  C CB  . THR A 1 84   ? -2.334  16.093  -27.330 1.00 23.66  ? 81   THR A CB  1 
ATOM 627  O OG1 . THR A 1 84   ? -3.056  15.265  -26.443 1.00 23.66  ? 81   THR A OG1 1 
ATOM 628  C CG2 . THR A 1 84   ? -2.745  17.471  -27.091 1.00 23.66  ? 81   THR A CG2 1 
ATOM 629  N N   . ALA A 1 85   ? -3.467  17.607  -29.786 1.00 34.64  ? 82   ALA A N   1 
ATOM 630  C CA  . ALA A 1 85   ? -3.431  18.851  -30.491 1.00 34.64  ? 82   ALA A CA  1 
ATOM 631  C C   . ALA A 1 85   ? -2.357  19.848  -29.986 1.00 34.64  ? 82   ALA A C   1 
ATOM 632  O O   . ALA A 1 85   ? -2.008  20.773  -30.714 1.00 34.64  ? 82   ALA A O   1 
ATOM 633  C CB  . ALA A 1 85   ? -4.789  19.475  -30.402 1.00 16.65  ? 82   ALA A CB  1 
ATOM 634  N N   . LYS A 1 86   ? -1.872  19.728  -28.754 1.00 56.59  ? 83   LYS A N   1 
ATOM 635  C CA  . LYS A 1 86   ? -0.786  20.583  -28.288 1.00 56.59  ? 83   LYS A CA  1 
ATOM 636  C C   . LYS A 1 86   ? 0.463   19.746  -28.231 1.00 56.59  ? 83   LYS A C   1 
ATOM 637  O O   . LYS A 1 86   ? 1.368   20.008  -27.425 1.00 56.59  ? 83   LYS A O   1 
ATOM 638  C CB  . LYS A 1 86   ? -1.043  21.126  -26.899 1.00 26.13  ? 83   LYS A CB  1 
ATOM 639  C CG  . LYS A 1 86   ? -2.204  22.095  -26.742 1.00 26.13  ? 83   LYS A CG  1 
ATOM 640  C CD  . LYS A 1 86   ? -2.364  22.511  -25.293 1.00 26.13  ? 83   LYS A CD  1 
ATOM 641  C CE  . LYS A 1 86   ? -2.850  23.931  -25.310 1.00 26.13  ? 83   LYS A CE  1 
ATOM 642  N NZ  . LYS A 1 86   ? -3.088  24.519  -23.954 1.00 26.13  ? 83   LYS A NZ  1 
ATOM 643  N N   . TYR A 1 87   ? 0.482   18.714  -29.070 1.00 37.67  ? 84   TYR A N   1 
ATOM 644  C CA  . TYR A 1 87   ? 1.677   17.956  -29.365 1.00 37.67  ? 84   TYR A CA  1 
ATOM 645  C C   . TYR A 1 87   ? 2.212   17.149  -28.168 1.00 37.67  ? 84   TYR A C   1 
ATOM 646  O O   . TYR A 1 87   ? 3.346   16.691  -28.203 1.00 37.67  ? 84   TYR A O   1 
ATOM 647  C CB  . TYR A 1 87   ? 2.743   18.849  -30.048 1.00 35.84  ? 84   TYR A CB  1 
ATOM 648  C CG  . TYR A 1 87   ? 2.199   19.711  -31.170 1.00 35.84  ? 84   TYR A CG  1 
ATOM 649  C CD1 . TYR A 1 87   ? 1.643   20.942  -30.900 1.00 35.84  ? 84   TYR A CD1 1 
ATOM 650  C CD2 . TYR A 1 87   ? 2.194   19.281  -32.484 1.00 35.84  ? 84   TYR A CD2 1 
ATOM 651  C CE1 . TYR A 1 87   ? 1.083   21.741  -31.901 1.00 35.84  ? 84   TYR A CE1 1 
ATOM 652  C CE2 . TYR A 1 87   ? 1.637   20.080  -33.511 1.00 35.84  ? 84   TYR A CE2 1 
ATOM 653  C CZ  . TYR A 1 87   ? 1.096   21.313  -33.194 1.00 35.84  ? 84   TYR A CZ  1 
ATOM 654  O OH  . TYR A 1 87   ? 0.542   22.147  -34.129 1.00 35.84  ? 84   TYR A OH  1 
ATOM 655  N N   . ASN A 1 88   ? 1.387   16.937  -27.135 1.00 43.57  ? 85   ASN A N   1 
ATOM 656  C CA  . ASN A 1 88   ? 1.618   15.856  -26.147 1.00 43.57  ? 85   ASN A CA  1 
ATOM 657  C C   . ASN A 1 88   ? 1.485   14.497  -26.809 1.00 43.57  ? 85   ASN A C   1 
ATOM 658  O O   . ASN A 1 88   ? 0.446   14.190  -27.369 1.00 43.57  ? 85   ASN A O   1 
ATOM 659  C CB  . ASN A 1 88   ? 0.606   15.900  -25.015 1.00 48.83  ? 85   ASN A CB  1 
ATOM 660  C CG  . ASN A 1 88   ? 0.529   17.255  -24.345 1.00 48.83  ? 85   ASN A CG  1 
ATOM 661  O OD1 . ASN A 1 88   ? -0.343  18.086  -24.660 1.00 48.83  ? 85   ASN A OD1 1 
ATOM 662  N ND2 . ASN A 1 88   ? 1.438   17.493  -23.408 1.00 48.83  ? 85   ASN A ND2 1 
ATOM 663  N N   . ALA A 1 89   ? 2.525   13.678  -26.759 1.00 38.26  ? 86   ALA A N   1 
ATOM 664  C CA  . ALA A 1 89   ? 2.449   12.342  -27.339 1.00 38.26  ? 86   ALA A CA  1 
ATOM 665  C C   . ALA A 1 89   ? 2.544   11.347  -26.207 1.00 38.26  ? 86   ALA A C   1 
ATOM 666  O O   . ALA A 1 89   ? 3.106   11.679  -25.160 1.00 38.26  ? 86   ALA A O   1 
ATOM 667  C CB  . ALA A 1 89   ? 3.564   12.137  -28.282 1.00 29.96  ? 86   ALA A CB  1 
ATOM 668  N N   . CYS A 1 90   ? 1.977   10.150  -26.390 1.00 44.27  ? 87   CYS A N   1 
ATOM 669  C CA  . CYS A 1 90   ? 2.091   9.082   -25.372 1.00 44.27  ? 87   CYS A CA  1 
ATOM 670  C C   . CYS A 1 90   ? 1.743   7.675   -25.865 1.00 44.27  ? 87   CYS A C   1 
ATOM 671  O O   . CYS A 1 90   ? 1.029   7.511   -26.852 1.00 44.27  ? 87   CYS A O   1 
ATOM 672  C CB  . CYS A 1 90   ? 1.225   9.417   -24.159 1.00 45.60  ? 87   CYS A CB  1 
ATOM 673  S SG  . CYS A 1 90   ? -0.546  9.313   -24.498 1.00 45.60  ? 87   CYS A SG  1 
ATOM 674  N N   . ILE A 1 91   ? 2.245   6.660   -25.170 1.00 49.94  ? 88   ILE A N   1 
ATOM 675  C CA  . ILE A 1 91   ? 1.883   5.271   -25.443 1.00 49.94  ? 88   ILE A CA  1 
ATOM 676  C C   . ILE A 1 91   ? 1.150   4.657   -24.272 1.00 49.94  ? 88   ILE A C   1 
ATOM 677  O O   . ILE A 1 91   ? 1.558   4.819   -23.117 1.00 49.94  ? 88   ILE A O   1 
ATOM 678  C CB  . ILE A 1 91   ? 3.094   4.400   -25.631 1.00 38.72  ? 88   ILE A CB  1 
ATOM 679  C CG1 . ILE A 1 91   ? 3.811   4.739   -26.940 1.00 38.72  ? 88   ILE A CG1 1 
ATOM 680  C CG2 . ILE A 1 91   ? 2.669   2.944   -25.577 1.00 38.72  ? 88   ILE A CG2 1 
ATOM 681  C CD1 . ILE A 1 91   ? 4.791   3.690   -27.328 1.00 38.72  ? 88   ILE A CD1 1 
ATOM 682  N N   . LEU A 1 92   ? 0.093   3.909   -24.562 1.00 36.13  ? 89   LEU A N   1 
ATOM 683  C CA  . LEU A 1 92   ? -0.773  3.436   -23.484 1.00 36.13  ? 89   LEU A CA  1 
ATOM 684  C C   . LEU A 1 92   ? -0.913  1.908   -23.482 1.00 36.13  ? 89   LEU A C   1 
ATOM 685  O O   . LEU A 1 92   ? -0.902  1.275   -24.559 1.00 36.13  ? 89   LEU A O   1 
ATOM 686  C CB  . LEU A 1 92   ? -2.130  4.178   -23.518 1.00 30.86  ? 89   LEU A CB  1 
ATOM 687  C CG  . LEU A 1 92   ? -2.147  5.727   -23.566 1.00 30.86  ? 89   LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 92   ? -3.575  6.321   -23.518 1.00 30.86  ? 89   LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 92   ? -1.296  6.455   -22.514 1.00 30.86  ? 89   LEU A CD2 1 
ATOM 690  N N   . GLU A 1 93   ? -1.005  1.335   -22.274 1.00 58.81  ? 90   GLU A N   1 
ATOM 691  C CA  . GLU A 1 93   ? -1.140  -0.111  -22.067 1.00 58.81  ? 90   GLU A CA  1 
ATOM 692  C C   . GLU A 1 93   ? -2.347  -0.356  -21.199 1.00 58.81  ? 90   GLU A C   1 
ATOM 693  O O   . GLU A 1 93   ? -2.562  0.360   -20.204 1.00 58.81  ? 90   GLU A O   1 
ATOM 694  C CB  . GLU A 1 93   ? 0.099   -0.690  -21.364 1.00 74.20  ? 90   GLU A CB  1 
ATOM 695  C CG  . GLU A 1 93   ? 0.291   -2.213  -21.551 1.00 74.20  ? 90   GLU A CG  1 
ATOM 696  C CD  . GLU A 1 93   ? 1.165   -2.903  -20.467 1.00 74.20  ? 90   GLU A CD  1 
ATOM 697  O OE1 . GLU A 1 93   ? 2.316   -2.469  -20.208 1.00 74.20  ? 90   GLU A OE1 1 
ATOM 698  O OE2 . GLU A 1 93   ? 0.704   -3.921  -19.890 1.00 74.20  ? 90   GLU A OE2 1 
ATOM 699  N N   . TYR A 1 94   ? -3.127  -1.372  -21.566 1.00 88.22  ? 91   TYR A N   1 
ATOM 700  C CA  . TYR A 1 94   ? -4.308  -1.710  -20.799 1.00 88.22  ? 91   TYR A CA  1 
ATOM 701  C C   . TYR A 1 94   ? -4.004  -2.700  -19.711 1.00 88.22  ? 91   TYR A C   1 
ATOM 702  O O   . TYR A 1 94   ? -3.578  -3.819  -19.988 1.00 88.22  ? 91   TYR A O   1 
ATOM 703  C CB  . TYR A 1 94   ? -5.421  -2.255  -21.673 1.00 80.08  ? 91   TYR A CB  1 
ATOM 704  C CG  . TYR A 1 94   ? -6.664  -2.466  -20.853 1.00 80.08  ? 91   TYR A CG  1 
ATOM 705  C CD1 . TYR A 1 94   ? -7.396  -1.378  -20.382 1.00 80.08  ? 91   TYR A CD1 1 
ATOM 706  C CD2 . TYR A 1 94   ? -7.082  -3.739  -20.502 1.00 80.08  ? 91   TYR A CD2 1 
ATOM 707  C CE1 . TYR A 1 94   ? -8.529  -1.551  -19.601 1.00 80.08  ? 91   TYR A CE1 1 
ATOM 708  C CE2 . TYR A 1 94   ? -8.217  -3.930  -19.722 1.00 80.08  ? 91   TYR A CE2 1 
ATOM 709  C CZ  . TYR A 1 94   ? -8.940  -2.831  -19.273 1.00 80.08  ? 91   TYR A CZ  1 
ATOM 710  O OH  . TYR A 1 94   ? -10.069 -3.019  -18.489 1.00 80.08  ? 91   TYR A OH  1 
ATOM 711  N N   . LYS A 1 95   ? -4.261  -2.309  -18.471 1.00 59.92  ? 92   LYS A N   1 
ATOM 712  C CA  . LYS A 1 95   ? -3.812  -3.118  -17.342 1.00 59.92  ? 92   LYS A CA  1 
ATOM 713  C C   . LYS A 1 95   ? -4.911  -3.416  -16.355 1.00 59.92  ? 92   LYS A C   1 
ATOM 714  O O   . LYS A 1 95   ? -5.354  -2.518  -15.650 1.00 59.92  ? 92   LYS A O   1 
ATOM 715  C CB  . LYS A 1 95   ? -2.678  -2.392  -16.627 1.00 75.28  ? 92   LYS A CB  1 
ATOM 716  C CG  . LYS A 1 95   ? -2.191  -3.052  -15.341 1.00 75.28  ? 92   LYS A CG  1 
ATOM 717  C CD  . LYS A 1 95   ? -0.846  -3.756  -15.561 1.00 75.28  ? 92   LYS A CD  1 
ATOM 718  C CE  . LYS A 1 95   ? -0.001  -3.772  -14.284 1.00 75.28  ? 92   LYS A CE  1 
ATOM 719  N NZ  . LYS A 1 95   ? 0.605   -2.441  -13.986 1.00 75.28  ? 92   LYS A NZ  1 
ATOM 720  N N   . GLN A 1 96   ? -5.360  -4.665  -16.293 1.00 71.64  ? 93   GLN A N   1 
ATOM 721  C CA  . GLN A 1 96   ? -6.342  -5.033  -15.271 1.00 71.64  ? 93   GLN A CA  1 
ATOM 722  C C   . GLN A 1 96   ? -5.687  -5.770  -14.097 1.00 71.64  ? 93   GLN A C   1 
ATOM 723  O O   . GLN A 1 96   ? -5.219  -6.907  -14.248 1.00 71.64  ? 93   GLN A O   1 
ATOM 724  C CB  . GLN A 1 96   ? -7.539  -5.811  -15.847 1.00 92.81  ? 93   GLN A CB  1 
ATOM 725  C CG  . GLN A 1 96   ? -8.559  -6.188  -14.761 1.00 92.81  ? 93   GLN A CG  1 
ATOM 726  C CD  . GLN A 1 96   ? -10.006 -6.295  -15.231 1.00 92.81  ? 93   GLN A CD  1 
ATOM 727  O OE1 . GLN A 1 96   ? -10.296 -6.379  -16.425 1.00 92.81  ? 93   GLN A OE1 1 
ATOM 728  N NE2 . GLN A 1 96   ? -10.926 -6.307  -14.270 1.00 92.81  ? 93   GLN A NE2 1 
ATOM 729  N N   . SER A 1 97   ? -5.638  -5.116  -12.939 1.00 147.32 ? 94   SER A N   1 
ATOM 730  C CA  . SER A 1 97   ? -5.175  -5.758  -11.713 1.00 147.32 ? 94   SER A CA  1 
ATOM 731  C C   . SER A 1 97   ? -6.299  -6.599  -11.129 1.00 147.32 ? 94   SER A C   1 
ATOM 732  O O   . SER A 1 97   ? -6.805  -6.315  -10.039 1.00 147.32 ? 94   SER A O   1 
ATOM 733  C CB  . SER A 1 97   ? -4.703  -4.722  -10.697 1.00 116.67 ? 94   SER A CB  1 
ATOM 734  O OG  . SER A 1 97   ? -3.541  -4.066  -11.154 1.00 116.67 ? 94   SER A OG  1 
ATOM 735  N N   . GLY A 1 98   ? -6.691  -7.629  -11.883 1.00 75.03  ? 95   GLY A N   1 
ATOM 736  C CA  . GLY A 1 98   ? -7.727  -8.585  -11.477 1.00 75.03  ? 95   GLY A CA  1 
ATOM 737  C C   . GLY A 1 98   ? -9.129  -7.997  -11.466 1.00 75.03  ? 95   GLY A C   1 
ATOM 738  O O   . GLY A 1 98   ? -9.970  -8.352  -12.299 1.00 75.03  ? 95   GLY A O   1 
ATOM 739  N N   . GLU A 1 99   ? -9.380  -7.104  -10.514 1.00 69.33  ? 96   GLU A N   1 
ATOM 740  C CA  . GLU A 1 99   ? -10.659 -6.414  -10.417 1.00 69.33  ? 96   GLU A CA  1 
ATOM 741  C C   . GLU A 1 99   ? -10.481 -4.926  -10.769 1.00 69.33  ? 96   GLU A C   1 
ATOM 742  O O   . GLU A 1 99   ? -11.464 -4.197  -10.982 1.00 69.33  ? 96   GLU A O   1 
ATOM 743  C CB  . GLU A 1 99   ? -11.250 -6.589  -9.002  1.00 134.95 ? 96   GLU A CB  1 
ATOM 744  C CG  . GLU A 1 99   ? -10.966 -5.462  -7.971  1.00 134.95 ? 96   GLU A CG  1 
ATOM 745  C CD  . GLU A 1 99   ? -9.507  -5.346  -7.516  1.00 134.95 ? 96   GLU A CD  1 
ATOM 746  O OE1 . GLU A 1 99   ? -8.659  -6.164  -7.928  1.00 134.95 ? 96   GLU A OE1 1 
ATOM 747  O OE2 . GLU A 1 99   ? -9.211  -4.419  -6.733  1.00 134.95 ? 96   GLU A OE2 1 
ATOM 748  N N   . SER A 1 100  ? -9.226  -4.470  -10.796 1.00 94.00  ? 97   SER A N   1 
ATOM 749  C CA  . SER A 1 100  ? -8.953  -3.064  -11.062 1.00 94.00  ? 97   SER A CA  1 
ATOM 750  C C   . SER A 1 100  ? -8.324  -2.791  -12.397 1.00 94.00  ? 97   SER A C   1 
ATOM 751  O O   . SER A 1 100  ? -7.625  -3.614  -12.976 1.00 94.00  ? 97   SER A O   1 
ATOM 752  C CB  . SER A 1 100  ? -8.176  -2.394  -9.939  1.00 81.46  ? 97   SER A CB  1 
ATOM 753  O OG  . SER A 1 100  ? -9.112  -1.736  -9.109  1.00 81.46  ? 97   SER A OG  1 
ATOM 754  N N   . ILE A 1 101  ? -8.597  -1.590  -12.867 1.00 70.40  ? 98   ILE A N   1 
ATOM 755  C CA  . ILE A 1 101  ? -8.336  -1.199  -14.234 1.00 70.40  ? 98   ILE A CA  1 
ATOM 756  C C   . ILE A 1 101  ? -7.493  0.057   -14.178 1.00 70.40  ? 98   ILE A C   1 
ATOM 757  O O   . ILE A 1 101  ? -7.733  0.965   -13.375 1.00 70.40  ? 98   ILE A O   1 
ATOM 758  C CB  . ILE A 1 101  ? -9.671  -0.961  -14.984 1.00 68.33  ? 98   ILE A CB  1 
ATOM 759  C CG1 . ILE A 1 101  ? -10.678 -0.156  -14.117 1.00 68.33  ? 98   ILE A CG1 1 
ATOM 760  C CG2 . ILE A 1 101  ? -10.285 -2.291  -15.471 1.00 68.33  ? 98   ILE A CG2 1 
ATOM 761  C CD1 . ILE A 1 101  ? -11.096 -0.749  -12.744 1.00 68.33  ? 98   ILE A CD1 1 
ATOM 762  N N   . ASP A 1 102  ? -6.458  0.058   -15.002 1.00 68.17  ? 99   ASP A N   1 
ATOM 763  C CA  . ASP A 1 102  ? -5.548  1.186   -15.131 1.00 68.17  ? 99   ASP A CA  1 
ATOM 764  C C   . ASP A 1 102  ? -5.107  1.273   -16.561 1.00 68.17  ? 99   ASP A C   1 
ATOM 765  O O   . ASP A 1 102  ? -4.745  0.254   -17.170 1.00 68.17  ? 99   ASP A O   1 
ATOM 766  C CB  . ASP A 1 102  ? -4.302  0.983   -14.278 1.00 88.26  ? 99   ASP A CB  1 
ATOM 767  C CG  . ASP A 1 102  ? -4.597  1.052   -12.810 1.00 88.26  ? 99   ASP A CG  1 
ATOM 768  O OD1 . ASP A 1 102  ? -4.955  2.159   -12.334 1.00 88.26  ? 99   ASP A OD1 1 
ATOM 769  O OD2 . ASP A 1 102  ? -4.471  -0.003  -12.145 1.00 88.26  ? 99   ASP A OD2 1 
ATOM 770  N N   . ILE A 1 103  ? -5.141  2.476   -17.116 1.00 69.35  ? 100  ILE A N   1 
ATOM 771  C CA  . ILE A 1 103  ? -4.447  2.670   -18.371 1.00 69.35  ? 100  ILE A CA  1 
ATOM 772  C C   . ILE A 1 103  ? -3.095  3.245   -18.017 1.00 69.35  ? 100  ILE A C   1 
ATOM 773  O O   . ILE A 1 103  ? -3.022  4.282   -17.357 1.00 69.35  ? 100  ILE A O   1 
ATOM 774  C CB  . ILE A 1 103  ? -5.226  3.554   -19.339 1.00 65.40  ? 100  ILE A CB  1 
ATOM 775  C CG1 . ILE A 1 103  ? -6.343  2.738   -19.992 1.00 65.40  ? 100  ILE A CG1 1 
ATOM 776  C CG2 . ILE A 1 103  ? -4.315  4.060   -20.441 1.00 65.40  ? 100  ILE A CG2 1 
ATOM 777  C CD1 . ILE A 1 103  ? -7.699  2.918   -19.353 1.00 65.40  ? 100  ILE A CD1 1 
ATOM 778  N N   . ILE A 1 104  ? -2.021  2.563   -18.408 1.00 57.04  ? 101  ILE A N   1 
ATOM 779  C CA  . ILE A 1 104  ? -0.702  3.019   -17.975 1.00 57.04  ? 101  ILE A CA  1 
ATOM 780  C C   . ILE A 1 104  ? 0.119   3.645   -19.096 1.00 57.04  ? 101  ILE A C   1 
ATOM 781  O O   . ILE A 1 104  ? 0.002   3.275   -20.277 1.00 57.04  ? 101  ILE A O   1 
ATOM 782  C CB  . ILE A 1 104  ? 0.106   1.933   -17.184 1.00 76.92  ? 101  ILE A CB  1 
ATOM 783  C CG1 . ILE A 1 104  ? 0.910   2.622   -16.064 1.00 76.92  ? 101  ILE A CG1 1 
ATOM 784  C CG2 . ILE A 1 104  ? 0.988   1.093   -18.120 1.00 76.92  ? 101  ILE A CG2 1 
ATOM 785  C CD1 . ILE A 1 104  ? 2.065   1.804   -15.424 1.00 76.92  ? 101  ILE A CD1 1 
ATOM 786  N N   . THR A 1 105  ? 0.945   4.606   -18.709 1.00 51.49  ? 102  THR A N   1 
ATOM 787  C CA  . THR A 1 105  ? 1.778   5.332   -19.650 1.00 51.49  ? 102  THR A CA  1 
ATOM 788  C C   . THR A 1 105  ? 3.168   4.722   -19.799 1.00 51.49  ? 102  THR A C   1 
ATOM 789  O O   . THR A 1 105  ? 4.058   4.956   -18.969 1.00 51.49  ? 102  THR A O   1 
ATOM 790  C CB  . THR A 1 105  ? 1.916   6.778   -19.227 1.00 48.45  ? 102  THR A CB  1 
ATOM 791  O OG1 . THR A 1 105  ? 0.612   7.303   -18.914 1.00 48.45  ? 102  THR A OG1 1 
ATOM 792  C CG2 . THR A 1 105  ? 2.574   7.582   -20.342 1.00 48.45  ? 102  THR A CG2 1 
ATOM 793  N N   . ARG A 1 106  ? 3.329   3.962   -20.883 1.00 53.32  ? 103  ARG A N   1 
ATOM 794  C CA  . ARG A 1 106  ? 4.570   3.278   -21.216 1.00 53.32  ? 103  ARG A CA  1 
ATOM 795  C C   . ARG A 1 106  ? 5.632   4.217   -21.720 1.00 53.32  ? 103  ARG A C   1 
ATOM 796  O O   . ARG A 1 106  ? 6.824   3.938   -21.560 1.00 53.32  ? 103  ARG A O   1 
ATOM 797  C CB  . ARG A 1 106  ? 4.326   2.150   -22.204 1.00 45.18  ? 103  ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106  ? 3.674   0.981   -21.524 1.00 45.18  ? 103  ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106  ? 4.695   0.069   -20.818 1.00 45.18  ? 103  ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106  ? 4.799   -1.256  -21.456 1.00 45.18  ? 103  ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106  ? 5.365   -1.508  -22.643 1.00 45.18  ? 103  ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106  ? 5.892   -0.522  -23.370 1.00 45.18  ? 103  ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106  ? 5.374   -2.749  -23.125 1.00 45.18  ? 103  ARG A NH2 1 
ATOM 804  N N   . ALA A 1 107  ? 5.206   5.334   -22.302 1.00 47.83  ? 104  ALA A N   1 
ATOM 805  C CA  . ALA A 1 107  ? 6.133   6.370   -22.780 1.00 47.83  ? 104  ALA A CA  1 
ATOM 806  C C   . ALA A 1 107  ? 5.406   7.677   -23.067 1.00 47.83  ? 104  ALA A C   1 
ATOM 807  O O   . ALA A 1 107  ? 4.187   7.687   -23.222 1.00 47.83  ? 104  ALA A O   1 
ATOM 808  C CB  . ALA A 1 107  ? 6.862   5.908   -24.010 1.00 15.81  ? 104  ALA A CB  1 
ATOM 809  N N   . HIS A 1 108  ? 6.161   8.772   -23.145 1.00 46.57  ? 105  HIS A N   1 
ATOM 810  C CA  . HIS A 1 108  ? 5.570   10.066  -23.438 1.00 46.57  ? 105  HIS A CA  1 
ATOM 811  C C   . HIS A 1 108  ? 6.556   11.216  -23.615 1.00 46.57  ? 105  HIS A C   1 
ATOM 812  O O   . HIS A 1 108  ? 7.652   11.235  -23.045 1.00 46.57  ? 105  HIS A O   1 
ATOM 813  C CB  . HIS A 1 108  ? 4.615   10.446  -22.329 1.00 65.82  ? 105  HIS A CB  1 
ATOM 814  C CG  . HIS A 1 108  ? 5.305   10.934  -21.110 1.00 65.82  ? 105  HIS A CG  1 
ATOM 815  N ND1 . HIS A 1 108  ? 6.141   10.134  -20.370 1.00 65.82  ? 105  HIS A ND1 1 
ATOM 816  C CD2 . HIS A 1 108  ? 5.304   12.145  -20.511 1.00 65.82  ? 105  HIS A CD2 1 
ATOM 817  C CE1 . HIS A 1 108  ? 6.612   10.827  -19.354 1.00 65.82  ? 105  HIS A CE1 1 
ATOM 818  N NE2 . HIS A 1 108  ? 6.116   12.050  -19.412 1.00 65.82  ? 105  HIS A NE2 1 
ATOM 819  N N   . GLY A 1 109  ? 6.134   12.206  -24.379 1.00 44.69  ? 106  GLY A N   1 
ATOM 820  C CA  . GLY A 1 109  ? 6.859   13.440  -24.456 1.00 44.69  ? 106  GLY A CA  1 
ATOM 821  C C   . GLY A 1 109  ? 6.047   14.386  -25.293 1.00 44.69  ? 106  GLY A C   1 
ATOM 822  O O   . GLY A 1 109  ? 4.998   13.997  -25.814 1.00 44.69  ? 106  GLY A O   1 
ATOM 823  N N   . ASN A 1 110  ? 6.535   15.618  -25.417 1.00 44.35  ? 107  ASN A N   1 
ATOM 824  C CA  . ASN A 1 110  ? 5.920   16.616  -26.248 1.00 44.35  ? 107  ASN A CA  1 
ATOM 825  C C   . ASN A 1 110  ? 6.706   16.841  -27.544 1.00 44.35  ? 107  ASN A C   1 
ATOM 826  O O   . ASN A 1 110  ? 7.909   17.165  -27.509 1.00 44.35  ? 107  ASN A O   1 
ATOM 827  C CB  . ASN A 1 110  ? 5.737   17.897  -25.461 1.00 39.83  ? 107  ASN A CB  1 
ATOM 828  C CG  . ASN A 1 110  ? 5.014   18.966  -26.262 1.00 39.83  ? 107  ASN A CG  1 
ATOM 829  O OD1 . ASN A 1 110  ? 5.489   19.364  -27.343 1.00 39.83  ? 107  ASN A OD1 1 
ATOM 830  N ND2 . ASN A 1 110  ? 3.853   19.439  -25.745 1.00 39.83  ? 107  ASN A ND2 1 
ATOM 831  N N   . VAL A 1 111  ? 6.024   16.699  -28.682 1.00 42.60  ? 108  VAL A N   1 
ATOM 832  C CA  . VAL A 1 111  ? 6.717   16.736  -29.973 1.00 42.60  ? 108  VAL A CA  1 
ATOM 833  C C   . VAL A 1 111  ? 6.604   18.001  -30.842 1.00 42.60  ? 108  VAL A C   1 
ATOM 834  O O   . VAL A 1 111  ? 7.012   18.013  -32.004 1.00 42.60  ? 108  VAL A O   1 
ATOM 835  C CB  . VAL A 1 111  ? 6.467   15.478  -30.791 1.00 26.03  ? 108  VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 111  ? 6.844   14.314  -29.957 1.00 26.03  ? 108  VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 111  ? 4.991   15.360  -31.201 1.00 26.03  ? 108  VAL A CG2 1 
ATOM 838  N N   . GLN A 1 112  ? 6.093   19.076  -30.272 1.00 49.61  ? 109  GLN A N   1 
ATOM 839  C CA  . GLN A 1 112  ? 6.019   20.308  -31.014 1.00 49.61  ? 109  GLN A CA  1 
ATOM 840  C C   . GLN A 1 112  ? 7.416   20.789  -31.299 1.00 49.61  ? 109  GLN A C   1 
ATOM 841  O O   . GLN A 1 112  ? 8.380   20.291  -30.720 1.00 49.61  ? 109  GLN A O   1 
ATOM 842  C CB  . GLN A 1 112  ? 5.311   21.348  -30.195 1.00 67.11  ? 109  GLN A CB  1 
ATOM 843  C CG  . GLN A 1 112  ? 5.933   21.524  -28.855 1.00 67.11  ? 109  GLN A CG  1 
ATOM 844  C CD  . GLN A 1 112  ? 5.786   22.904  -28.380 1.00 67.11  ? 109  GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 112  ? 5.608   23.140  -27.187 1.00 67.11  ? 109  GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 112  ? 5.842   23.856  -29.312 1.00 67.11  ? 109  GLN A NE2 1 
ATOM 847  N N   . ASP A 1 113  ? 7.510   21.774  -32.187 1.00 64.66  ? 110  ASP A N   1 
ATOM 848  C CA  . ASP A 1 113  ? 8.758   22.398  -32.570 1.00 64.66  ? 110  ASP A CA  1 
ATOM 849  C C   . ASP A 1 113  ? 8.506   23.892  -32.468 1.00 64.66  ? 110  ASP A C   1 
ATOM 850  O O   . ASP A 1 113  ? 7.337   24.321  -32.550 1.00 64.66  ? 110  ASP A O   1 
ATOM 851  C CB  . ASP A 1 113  ? 9.094   21.976  -33.996 1.00 53.53  ? 110  ASP A CB  1 
ATOM 852  C CG  . ASP A 1 113  ? 9.338   20.463  -34.108 1.00 53.53  ? 110  ASP A CG  1 
ATOM 853  O OD1 . ASP A 1 113  ? 9.983   19.891  -33.200 1.00 53.53  ? 110  ASP A OD1 1 
ATOM 854  O OD2 . ASP A 1 113  ? 8.892   19.813  -35.083 1.00 53.53  ? 110  ASP A OD2 1 
ATOM 855  N N   . ARG A 1 114  ? 9.564   24.694  -32.261 1.00 71.75  ? 111  ARG A N   1 
ATOM 856  C CA  . ARG A 1 114  ? 9.410   26.160  -32.124 1.00 71.75  ? 111  ARG A CA  1 
ATOM 857  C C   . ARG A 1 114  ? 9.163   26.730  -33.503 1.00 71.75  ? 111  ARG A C   1 
ATOM 858  O O   . ARG A 1 114  ? 8.419   27.689  -33.674 1.00 71.75  ? 111  ARG A O   1 
ATOM 859  C CB  . ARG A 1 114  ? 10.674  26.774  -31.524 1.00 159.74 ? 111  ARG A CB  1 
ATOM 860  C CG  . ARG A 1 114  ? 10.486  28.164  -30.934 1.00 159.74 ? 111  ARG A CG  1 
ATOM 861  C CD  . ARG A 1 114  ? 9.737   28.131  -29.609 1.00 159.74 ? 111  ARG A CD  1 
ATOM 862  N NE  . ARG A 1 114  ? 10.404  27.296  -28.607 1.00 159.74 ? 111  ARG A NE  1 
ATOM 863  C CZ  . ARG A 1 114  ? 9.969   26.099  -28.214 1.00 159.74 ? 111  ARG A CZ  1 
ATOM 864  N NH1 . ARG A 1 114  ? 8.860   25.582  -28.732 1.00 159.74 ? 111  ARG A NH1 1 
ATOM 865  N NH2 . ARG A 1 114  ? 10.645  25.418  -27.298 1.00 159.74 ? 111  ARG A NH2 1 
ATOM 866  N N   . ILE A 1 115  ? 9.824   26.114  -34.476 1.00 117.54 ? 112  ILE A N   1 
ATOM 867  C CA  . ILE A 1 115  ? 9.591   26.333  -35.888 1.00 117.54 ? 112  ILE A CA  1 
ATOM 868  C C   . ILE A 1 115  ? 8.409   25.471  -36.261 1.00 117.54 ? 112  ILE A C   1 
ATOM 869  O O   . ILE A 1 115  ? 8.006   24.579  -35.518 1.00 117.54 ? 112  ILE A O   1 
ATOM 870  C CB  . ILE A 1 115  ? 10.810  25.863  -36.720 1.00 63.08  ? 112  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 115  ? 12.078  26.568  -36.254 1.00 63.08  ? 112  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 115  ? 10.575  26.051  -38.244 1.00 63.08  ? 112  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 115  ? 12.514  26.145  -34.868 1.00 63.08  ? 112  ILE A CD1 1 
ATOM 874  N N   . GLY A 1 116  ? 7.851   25.736  -37.427 1.00 74.20  ? 113  GLY A N   1 
ATOM 875  C CA  . GLY A 1 116  ? 6.735   24.954  -37.908 1.00 74.20  ? 113  GLY A CA  1 
ATOM 876  C C   . GLY A 1 116  ? 5.470   25.773  -38.004 1.00 74.20  ? 113  GLY A C   1 
ATOM 877  O O   . GLY A 1 116  ? 4.918   26.223  -36.985 1.00 74.20  ? 113  GLY A O   1 
ATOM 878  N N   . ARG A 1 117  ? 5.044   25.984  -39.251 1.00 65.44  ? 114  ARG A N   1 
ATOM 879  C CA  . ARG A 1 117  ? 3.758   26.585  -39.573 1.00 65.44  ? 114  ARG A CA  1 
ATOM 880  C C   . ARG A 1 117  ? 2.774   25.434  -39.775 1.00 65.44  ? 114  ARG A C   1 
ATOM 881  O O   . ARG A 1 117  ? 2.895   24.733  -40.796 1.00 65.44  ? 114  ARG A O   1 
ATOM 882  C CB  . ARG A 1 117  ? 3.893   27.404  -40.854 1.00 106.10 ? 114  ARG A CB  1 
ATOM 883  C CG  . ARG A 1 117  ? 2.803   28.444  -41.060 1.00 106.10 ? 114  ARG A CG  1 
ATOM 884  C CD  . ARG A 1 117  ? 2.757   28.896  -42.503 1.00 106.10 ? 114  ARG A CD  1 
ATOM 885  N NE  . ARG A 1 117  ? 3.019   27.780  -43.412 1.00 106.10 ? 114  ARG A NE  1 
ATOM 886  C CZ  . ARG A 1 117  ? 2.742   27.783  -44.713 1.00 106.10 ? 114  ARG A CZ  1 
ATOM 887  N NH1 . ARG A 1 117  ? 2.177   28.846  -45.286 1.00 106.10 ? 114  ARG A NH1 1 
ATOM 888  N NH2 . ARG A 1 117  ? 3.022   26.712  -45.445 1.00 106.10 ? 114  ARG A NH2 1 
ATOM 889  N N   . PRO A 1 118  ? 1.782   25.254  -38.833 1.00 63.09  ? 115  PRO A N   1 
ATOM 890  C CA  . PRO A 1 118  ? 0.986   24.006  -38.734 1.00 63.09  ? 115  PRO A CA  1 
ATOM 891  C C   . PRO A 1 118  ? 0.261   23.762  -40.053 1.00 63.09  ? 115  PRO A C   1 
ATOM 892  O O   . PRO A 1 118  ? -0.294  24.697  -40.621 1.00 63.09  ? 115  PRO A O   1 
ATOM 893  C CB  . PRO A 1 118  ? -0.012  24.301  -37.607 1.00 44.04  ? 115  PRO A CB  1 
ATOM 894  C CG  . PRO A 1 118  ? 0.552   25.428  -36.846 1.00 44.04  ? 115  PRO A CG  1 
ATOM 895  C CD  . PRO A 1 118  ? 1.279   26.263  -37.872 1.00 44.04  ? 115  PRO A CD  1 
ATOM 896  N N   . SER A 1 119  ? 0.292   22.537  -40.558 1.00 54.15  ? 116  SER A N   1 
ATOM 897  C CA  . SER A 1 119  ? 0.125   22.357  -41.996 1.00 54.15  ? 116  SER A CA  1 
ATOM 898  C C   . SER A 1 119  ? -1.314  22.449  -42.540 1.00 54.15  ? 116  SER A C   1 
ATOM 899  O O   . SER A 1 119  ? -2.287  22.579  -41.788 1.00 54.15  ? 116  SER A O   1 
ATOM 900  C CB  . SER A 1 119  ? 0.863   21.080  -42.465 1.00 42.45  ? 116  SER A CB  1 
ATOM 901  O OG  . SER A 1 119  ? 0.027   19.939  -42.502 1.00 42.45  ? 116  SER A OG  1 
ATOM 902  N N   . GLU A 1 120  ? -1.424  22.394  -43.864 1.00 155.69 ? 117  GLU A N   1 
ATOM 903  C CA  . GLU A 1 120  ? -2.701  22.203  -44.527 1.00 155.69 ? 117  GLU A CA  1 
ATOM 904  C C   . GLU A 1 120  ? -3.128  20.758  -44.320 1.00 155.69 ? 117  GLU A C   1 
ATOM 905  O O   . GLU A 1 120  ? -2.361  19.841  -44.627 1.00 155.69 ? 117  GLU A O   1 
ATOM 906  C CB  . GLU A 1 120  ? -2.564  22.499  -46.021 1.00 113.00 ? 117  GLU A CB  1 
ATOM 907  C CG  . GLU A 1 120  ? -3.864  22.350  -46.826 1.00 113.00 ? 117  GLU A CG  1 
ATOM 908  C CD  . GLU A 1 120  ? -4.921  23.421  -46.518 1.00 113.00 ? 117  GLU A CD  1 
ATOM 909  O OE1 . GLU A 1 120  ? -4.963  23.922  -45.369 1.00 113.00 ? 117  GLU A OE1 1 
ATOM 910  O OE2 . GLU A 1 120  ? -5.720  23.745  -47.429 1.00 113.00 ? 117  GLU A OE2 1 
ATOM 911  N N   . THR A 1 121  ? -4.347  20.562  -43.813 1.00 73.85  ? 118  THR A N   1 
ATOM 912  C CA  . THR A 1 121  ? -4.887  19.222  -43.489 1.00 73.85  ? 118  THR A CA  1 
ATOM 913  C C   . THR A 1 121  ? -4.496  18.692  -42.105 1.00 73.85  ? 118  THR A C   1 
ATOM 914  O O   . THR A 1 121  ? -4.562  17.483  -41.865 1.00 73.85  ? 118  THR A O   1 
ATOM 915  C CB  . THR A 1 121  ? -4.542  18.111  -44.545 1.00 101.67 ? 118  THR A CB  1 
ATOM 916  O OG1 . THR A 1 121  ? -4.278  18.692  -45.824 1.00 101.67 ? 118  THR A OG1 1 
ATOM 917  C CG2 . THR A 1 121  ? -5.689  17.086  -44.670 1.00 101.67 ? 118  THR A CG2 1 
ATOM 918  N N   . GLY A 1 122  ? -4.075  19.586  -41.213 1.00 55.44  ? 119  GLY A N   1 
ATOM 919  C CA  . GLY A 1 122  ? -3.810  19.254  -39.808 1.00 55.44  ? 119  GLY A CA  1 
ATOM 920  C C   . GLY A 1 122  ? -2.883  18.081  -39.511 1.00 55.44  ? 119  GLY A C   1 
ATOM 921  O O   . GLY A 1 122  ? -2.189  17.550  -40.398 1.00 55.44  ? 119  GLY A O   1 
ATOM 922  N N   . ILE A 1 123  ? -2.870  17.671  -38.246 1.00 32.34  ? 120  ILE A N   1 
ATOM 923  C CA  . ILE A 1 123  ? -1.912  16.660  -37.782 1.00 32.34  ? 120  ILE A CA  1 
ATOM 924  C C   . ILE A 1 123  ? -2.292  15.359  -38.456 1.00 32.34  ? 120  ILE A C   1 
ATOM 925  O O   . ILE A 1 123  ? -3.438  15.118  -38.628 1.00 32.34  ? 120  ILE A O   1 
ATOM 926  C CB  . ILE A 1 123  ? -1.953  16.485  -36.223 1.00 28.70  ? 120  ILE A CB  1 
ATOM 927  C CG1 . ILE A 1 123  ? -1.407  17.707  -35.515 1.00 28.70  ? 120  ILE A CG1 1 
ATOM 928  C CG2 . ILE A 1 123  ? -1.127  15.313  -35.786 1.00 28.70  ? 120  ILE A CG2 1 
ATOM 929  C CD1 . ILE A 1 123  ? -2.227  18.190  -34.313 1.00 28.70  ? 120  ILE A CD1 1 
ATOM 930  N N   . ILE A 1 124  ? -1.312  14.579  -38.886 1.00 47.04  ? 121  ILE A N   1 
ATOM 931  C CA  . ILE A 1 124  ? -1.466  13.206  -39.359 1.00 47.04  ? 121  ILE A CA  1 
ATOM 932  C C   . ILE A 1 124  ? -0.398  12.451  -38.600 1.00 47.04  ? 121  ILE A C   1 
ATOM 933  O O   . ILE A 1 124  ? 0.735   12.894  -38.540 1.00 47.04  ? 121  ILE A O   1 
ATOM 934  C CB  . ILE A 1 124  ? -1.135  13.080  -40.854 1.00 46.10  ? 121  ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 124  ? -2.057  13.976  -41.690 1.00 46.10  ? 121  ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 124  ? -1.181  11.643  -41.312 1.00 46.10  ? 121  ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 124  ? -1.548  14.250  -43.141 1.00 46.10  ? 121  ILE A CD1 1 
ATOM 938  N N   . GLY A 1 125  ? -0.748  11.332  -37.989 1.00 44.93  ? 122  GLY A N   1 
ATOM 939  C CA  . GLY A 1 125  ? 0.249   10.481  -37.365 1.00 44.93  ? 122  GLY A CA  1 
ATOM 940  C C   . GLY A 1 125  ? 0.120   9.115   -37.976 1.00 44.93  ? 122  GLY A C   1 
ATOM 941  O O   . GLY A 1 125  ? -0.989  8.633   -38.120 1.00 44.93  ? 122  GLY A O   1 
ATOM 942  N N   . ILE A 1 126  ? 1.224   8.477   -38.366 1.00 38.64  ? 123  ILE A N   1 
ATOM 943  C CA  . ILE A 1 126  ? 1.120   7.107   -38.895 1.00 38.64  ? 123  ILE A CA  1 
ATOM 944  C C   . ILE A 1 126  ? 2.111   6.131   -38.233 1.00 38.64  ? 123  ILE A C   1 
ATOM 945  O O   . ILE A 1 126  ? 3.109   6.592   -37.693 1.00 38.64  ? 123  ILE A O   1 
ATOM 946  C CB  . ILE A 1 126  ? 1.199   7.108   -40.435 1.00 34.30  ? 123  ILE A CB  1 
ATOM 947  C CG1 . ILE A 1 126  ? 2.558   7.672   -40.876 1.00 34.30  ? 123  ILE A CG1 1 
ATOM 948  C CG2 . ILE A 1 126  ? 0.010   7.893   -41.011 1.00 34.30  ? 123  ILE A CG2 1 
ATOM 949  C CD1 . ILE A 1 126  ? 2.559   8.202   -42.306 1.00 34.30  ? 123  ILE A CD1 1 
ATOM 950  N N   . ILE A 1 127  ? 1.823   4.821   -38.254 1.00 48.65  ? 124  ILE A N   1 
ATOM 951  C CA  . ILE A 1 127  ? 2.732   3.797   -37.715 1.00 48.65  ? 124  ILE A CA  1 
ATOM 952  C C   . ILE A 1 127  ? 3.101   2.668   -38.702 1.00 48.65  ? 124  ILE A C   1 
ATOM 953  O O   . ILE A 1 127  ? 2.223   2.085   -39.328 1.00 48.65  ? 124  ILE A O   1 
ATOM 954  C CB  . ILE A 1 127  ? 2.179   3.182   -36.416 1.00 31.97  ? 124  ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127  ? 2.279   4.199   -35.290 1.00 31.97  ? 124  ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127  ? 2.932   1.881   -36.009 1.00 31.97  ? 124  ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127  ? 1.454   3.809   -34.050 1.00 31.97  ? 124  ILE A CD1 1 
ATOM 958  N N   . ASP A 1 128  ? 4.396   2.342   -38.795 1.00 60.31  ? 125  ASP A N   1 
ATOM 959  C CA  . ASP A 1 128  ? 4.921   1.328   -39.724 1.00 60.31  ? 125  ASP A CA  1 
ATOM 960  C C   . ASP A 1 128  ? 4.395   -0.074  -39.400 1.00 60.31  ? 125  ASP A C   1 
ATOM 961  O O   . ASP A 1 128  ? 4.350   -0.442  -38.217 1.00 60.31  ? 125  ASP A O   1 
ATOM 962  C CB  . ASP A 1 128  ? 6.461   1.370   -39.722 1.00 116.14 ? 125  ASP A CB  1 
ATOM 963  C CG  . ASP A 1 128  ? 7.098   0.151   -40.374 1.00 116.14 ? 125  ASP A CG  1 
ATOM 964  O OD1 . ASP A 1 128  ? 7.398   0.202   -41.589 1.00 116.14 ? 125  ASP A OD1 1 
ATOM 965  O OD2 . ASP A 1 128  ? 7.302   -0.862  -39.667 1.00 116.14 ? 125  ASP A OD2 1 
ATOM 966  N N   . PRO A 1 129  ? 4.013   -0.867  -40.447 1.00 56.43  ? 126  PRO A N   1 
ATOM 967  C CA  . PRO A 1 129  ? 3.494   -2.238  -40.285 1.00 56.43  ? 126  PRO A CA  1 
ATOM 968  C C   . PRO A 1 129  ? 4.370   -3.148  -39.388 1.00 56.43  ? 126  PRO A C   1 
ATOM 969  O O   . PRO A 1 129  ? 3.831   -3.984  -38.633 1.00 56.43  ? 126  PRO A O   1 
ATOM 970  C CB  . PRO A 1 129  ? 3.478   -2.776  -41.719 1.00 59.53  ? 126  PRO A CB  1 
ATOM 971  C CG  . PRO A 1 129  ? 3.379   -1.607  -42.570 1.00 59.53  ? 126  PRO A CG  1 
ATOM 972  C CD  . PRO A 1 129  ? 4.087   -0.496  -41.877 1.00 59.53  ? 126  PRO A CD  1 
ATOM 973  N N   . GLU A 1 130  ? 5.699   -2.995  -39.480 1.00 68.38  ? 127  GLU A N   1 
ATOM 974  C CA  . GLU A 1 130  ? 6.611   -3.746  -38.605 1.00 68.38  ? 127  GLU A CA  1 
ATOM 975  C C   . GLU A 1 130  ? 6.684   -3.170  -37.181 1.00 68.38  ? 127  GLU A C   1 
ATOM 976  O O   . GLU A 1 130  ? 6.905   -3.914  -36.215 1.00 68.38  ? 127  GLU A O   1 
ATOM 977  C CB  . GLU A 1 130  ? 8.006   -3.843  -39.214 1.00 109.27 ? 127  GLU A CB  1 
ATOM 978  C CG  . GLU A 1 130  ? 8.139   -4.895  -40.293 1.00 109.27 ? 127  GLU A CG  1 
ATOM 979  C CD  . GLU A 1 130  ? 9.225   -4.554  -41.303 1.00 109.27 ? 127  GLU A CD  1 
ATOM 980  O OE1 . GLU A 1 130  ? 9.069   -4.950  -42.484 1.00 109.27 ? 127  GLU A OE1 1 
ATOM 981  O OE2 . GLU A 1 130  ? 10.223  -3.881  -40.932 1.00 109.27 ? 127  GLU A OE2 1 
ATOM 982  N N   . CYS A 1 131  ? 6.478   -1.858  -37.061 1.00 49.82  ? 128  CYS A N   1 
ATOM 983  C CA  . CYS A 1 131  ? 6.641   -1.138  -35.800 1.00 49.82  ? 128  CYS A CA  1 
ATOM 984  C C   . CYS A 1 131  ? 8.061   -0.666  -35.528 1.00 49.82  ? 128  CYS A C   1 
ATOM 985  O O   . CYS A 1 131  ? 8.463   -0.499  -34.373 1.00 49.82  ? 128  CYS A O   1 
ATOM 986  C CB  . CYS A 1 131  ? 6.154   -1.948  -34.619 1.00 65.28  ? 128  CYS A CB  1 
ATOM 987  S SG  . CYS A 1 131  ? 4.438   -1.859  -34.546 1.00 65.28  ? 128  CYS A SG  1 
ATOM 988  N N   . ARG A 1 132  ? 8.822   -0.427  -36.578 1.00 118.03 ? 129  ARG A N   1 
ATOM 989  C CA  . ARG A 1 132  ? 10.115  0.183   -36.375 1.00 118.03 ? 129  ARG A CA  1 
ATOM 990  C C   . ARG A 1 132  ? 9.902   1.544   -35.704 1.00 118.03 ? 129  ARG A C   1 
ATOM 991  O O   . ARG A 1 132  ? 10.672  1.946   -34.832 1.00 118.03 ? 129  ARG A O   1 
ATOM 992  C CB  . ARG A 1 132  ? 10.857  0.299   -37.707 1.00 134.81 ? 129  ARG A CB  1 
ATOM 993  C CG  . ARG A 1 132  ? 11.342  -1.049  -38.282 1.00 134.81 ? 129  ARG A CG  1 
ATOM 994  C CD  . ARG A 1 132  ? 12.803  -1.339  -37.911 1.00 134.81 ? 129  ARG A CD  1 
ATOM 995  N NE  . ARG A 1 132  ? 13.723  -0.499  -38.682 1.00 134.81 ? 129  ARG A NE  1 
ATOM 996  C CZ  . ARG A 1 132  ? 14.536  -0.936  -39.641 1.00 134.81 ? 129  ARG A CZ  1 
ATOM 997  N NH1 . ARG A 1 132  ? 14.585  -2.231  -39.956 1.00 134.81 ? 129  ARG A NH1 1 
ATOM 998  N NH2 . ARG A 1 132  ? 15.311  -0.069  -40.279 1.00 134.81 ? 129  ARG A NH2 1 
ATOM 999  N N   . MET A 1 133  ? 8.806   2.208   -36.071 1.00 97.00  ? 130  MET A N   1 
ATOM 1000 C CA  . MET A 1 133  ? 8.609   3.623   -35.747 1.00 97.00  ? 130  MET A CA  1 
ATOM 1001 C C   . MET A 1 133  ? 7.181   4.184   -35.798 1.00 97.00  ? 130  MET A C   1 
ATOM 1002 O O   . MET A 1 133  ? 6.182   3.473   -35.884 1.00 97.00  ? 130  MET A O   1 
ATOM 1003 C CB  . MET A 1 133  ? 9.460   4.477   -36.692 1.00 61.81  ? 130  MET A CB  1 
ATOM 1004 C CG  . MET A 1 133  ? 9.537   3.942   -38.109 1.00 61.81  ? 130  MET A CG  1 
ATOM 1005 S SD  . MET A 1 133  ? 9.603   5.270   -39.334 1.00 61.81  ? 130  MET A SD  1 
ATOM 1006 C CE  . MET A 1 133  ? 11.045  4.722   -40.237 1.00 61.81  ? 130  MET A CE  1 
ATOM 1007 N N   . ILE A 1 134  ? 7.147   5.509   -35.738 1.00 42.52  ? 131  ILE A N   1 
ATOM 1008 C CA  . ILE A 1 134  ? 5.963   6.336   -35.867 1.00 42.52  ? 131  ILE A CA  1 
ATOM 1009 C C   . ILE A 1 134  ? 6.366   7.560   -36.714 1.00 42.52  ? 131  ILE A C   1 
ATOM 1010 O O   . ILE A 1 134  ? 7.423   8.177   -36.483 1.00 42.52  ? 131  ILE A O   1 
ATOM 1011 C CB  . ILE A 1 134  ? 5.473   6.840   -34.491 1.00 51.09  ? 131  ILE A CB  1 
ATOM 1012 C CG1 . ILE A 1 134  ? 5.233   5.657   -33.542 1.00 51.09  ? 131  ILE A CG1 1 
ATOM 1013 C CG2 . ILE A 1 134  ? 4.264   7.743   -34.665 1.00 51.09  ? 131  ILE A CG2 1 
ATOM 1014 C CD1 . ILE A 1 134  ? 4.594   6.003   -32.229 1.00 51.09  ? 131  ILE A CD1 1 
ATOM 1015 N N   . GLY A 1 135  ? 5.538   7.902   -37.696 1.00 39.37  ? 132  GLY A N   1 
ATOM 1016 C CA  . GLY A 1 135  ? 5.786   9.081   -38.516 1.00 39.37  ? 132  GLY A CA  1 
ATOM 1017 C C   . GLY A 1 135  ? 4.650   10.075  -38.327 1.00 39.37  ? 132  GLY A C   1 
ATOM 1018 O O   . GLY A 1 135  ? 3.472   9.685   -38.320 1.00 39.37  ? 132  GLY A O   1 
ATOM 1019 N N   . LEU A 1 136  ? 5.005   11.351  -38.211 1.00 51.66  ? 133  LEU A N   1 
ATOM 1020 C CA  . LEU A 1 136  ? 4.094   12.399  -37.845 1.00 51.66  ? 133  LEU A CA  1 
ATOM 1021 C C   . LEU A 1 136  ? 4.246   13.566  -38.804 1.00 51.66  ? 133  LEU A C   1 
ATOM 1022 O O   . LEU A 1 136  ? 5.321   13.796  -39.336 1.00 51.66  ? 133  LEU A O   1 
ATOM 1023 C CB  . LEU A 1 136  ? 4.458   12.860  -36.443 1.00 43.43  ? 133  LEU A CB  1 
ATOM 1024 C CG  . LEU A 1 136  ? 3.719   12.336  -35.211 1.00 43.43  ? 133  LEU A CG  1 
ATOM 1025 C CD1 . LEU A 1 136  ? 3.263   10.893  -35.288 1.00 43.43  ? 133  LEU A CD1 1 
ATOM 1026 C CD2 . LEU A 1 136  ? 4.582   12.562  -33.999 1.00 43.43  ? 133  LEU A CD2 1 
ATOM 1027 N N   . ARG A 1 137  ? 3.179   14.321  -39.019 1.00 50.76  ? 134  ARG A N   1 
ATOM 1028 C CA  . ARG A 1 137  ? 3.259   15.432  -39.932 1.00 50.76  ? 134  ARG A CA  1 
ATOM 1029 C C   . ARG A 1 137  ? 2.571   16.587  -39.284 1.00 50.76  ? 134  ARG A C   1 
ATOM 1030 O O   . ARG A 1 137  ? 1.391   16.825  -39.508 1.00 50.76  ? 134  ARG A O   1 
ATOM 1031 C CB  . ARG A 1 137  ? 2.634   15.106  -41.287 1.00 46.23  ? 134  ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 137  ? 3.176   15.952  -42.433 1.00 46.23  ? 134  ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 137  ? 2.595   17.376  -42.462 1.00 46.23  ? 134  ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 137  ? 1.139   17.334  -42.392 1.00 46.23  ? 134  ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 137  ? 0.305   17.648  -43.381 1.00 46.23  ? 134  ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 137  ? 0.776   18.115  -44.547 1.00 46.23  ? 134  ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 137  ? -1.007  17.528  -43.170 1.00 46.23  ? 134  ARG A NH2 1 
ATOM 1038 N N   . LEU A 1 138  ? 3.323   17.307  -38.469 1.00 50.56  ? 135  LEU A N   1 
ATOM 1039 C CA  . LEU A 1 138  ? 2.786   18.416  -37.735 1.00 50.56  ? 135  LEU A CA  1 
ATOM 1040 C C   . LEU A 1 138  ? 3.012   19.699  -38.494 1.00 50.56  ? 135  LEU A C   1 
ATOM 1041 O O   . LEU A 1 138  ? 2.287   20.670  -38.283 1.00 50.56  ? 135  LEU A O   1 
ATOM 1042 C CB  . LEU A 1 138  ? 3.422   18.518  -36.354 1.00 41.14  ? 135  LEU A CB  1 
ATOM 1043 C CG  . LEU A 1 138  ? 3.553   17.296  -35.449 1.00 41.14  ? 135  LEU A CG  1 
ATOM 1044 C CD1 . LEU A 1 138  ? 2.191   16.726  -35.109 1.00 41.14  ? 135  LEU A CD1 1 
ATOM 1045 C CD2 . LEU A 1 138  ? 4.426   16.211  -36.074 1.00 41.14  ? 135  LEU A CD2 1 
ATOM 1046 N N   . TYR A 1 139  ? 4.005   19.738  -39.370 1.00 57.22  ? 136  TYR A N   1 
ATOM 1047 C CA  . TYR A 1 139  ? 4.351   21.004  -39.983 1.00 57.22  ? 136  TYR A CA  1 
ATOM 1048 C C   . TYR A 1 139  ? 4.599   20.867  -41.460 1.00 57.22  ? 136  TYR A C   1 
ATOM 1049 O O   . TYR A 1 139  ? 4.946   19.792  -41.933 1.00 57.22  ? 136  TYR A O   1 
ATOM 1050 C CB  . TYR A 1 139  ? 5.573   21.572  -39.274 1.00 48.95  ? 136  TYR A CB  1 
ATOM 1051 C CG  . TYR A 1 139  ? 5.360   21.775  -37.785 1.00 48.95  ? 136  TYR A CG  1 
ATOM 1052 C CD1 . TYR A 1 139  ? 6.082   21.046  -36.839 1.00 48.95  ? 136  TYR A CD1 1 
ATOM 1053 C CD2 . TYR A 1 139  ? 4.409   22.687  -37.324 1.00 48.95  ? 136  TYR A CD2 1 
ATOM 1054 C CE1 . TYR A 1 139  ? 5.876   21.239  -35.481 1.00 48.95  ? 136  TYR A CE1 1 
ATOM 1055 C CE2 . TYR A 1 139  ? 4.204   22.875  -35.978 1.00 48.95  ? 136  TYR A CE2 1 
ATOM 1056 C CZ  . TYR A 1 139  ? 4.939   22.149  -35.074 1.00 48.95  ? 136  TYR A CZ  1 
ATOM 1057 O OH  . TYR A 1 139  ? 4.686   22.370  -33.760 1.00 48.95  ? 136  TYR A OH  1 
ATOM 1058 N N   . ASP A 1 140  ? 4.398   21.949  -42.199 1.00 41.12  ? 137  ASP A N   1 
ATOM 1059 C CA  . ASP A 1 140  ? 4.858   21.988  -43.582 1.00 41.12  ? 137  ASP A CA  1 
ATOM 1060 C C   . ASP A 1 140  ? 6.377   21.940  -43.624 1.00 41.12  ? 137  ASP A C   1 
ATOM 1061 O O   . ASP A 1 140  ? 7.043   22.313  -42.642 1.00 41.12  ? 137  ASP A O   1 
ATOM 1062 C CB  . ASP A 1 140  ? 4.352   23.236  -44.293 1.00 59.02  ? 137  ASP A CB  1 
ATOM 1063 C CG  . ASP A 1 140  ? 2.863   23.168  -44.563 1.00 59.02  ? 137  ASP A CG  1 
ATOM 1064 O OD1 . ASP A 1 140  ? 2.381   22.019  -44.800 1.00 59.02  ? 137  ASP A OD1 1 
ATOM 1065 O OD2 . ASP A 1 140  ? 2.184   24.234  -44.519 1.00 59.02  ? 137  ASP A OD2 1 
ATOM 1066 N N   . GLY A 1 141  ? 6.921   21.451  -44.734 1.00 57.87  ? 138  GLY A N   1 
ATOM 1067 C CA  . GLY A 1 141  ? 8.365   21.312  -44.907 1.00 57.87  ? 138  GLY A CA  1 
ATOM 1068 C C   . GLY A 1 141  ? 8.946   20.181  -44.085 1.00 57.87  ? 138  GLY A C   1 
ATOM 1069 O O   . GLY A 1 141  ? 9.926   19.557  -44.462 1.00 57.87  ? 138  GLY A O   1 
ATOM 1070 N N   . LEU A 1 142  ? 8.332   19.887  -42.957 1.00 43.83  ? 139  LEU A N   1 
ATOM 1071 C CA  . LEU A 1 142  ? 8.923   18.913  -42.052 1.00 43.83  ? 139  LEU A CA  1 
ATOM 1072 C C   . LEU A 1 142  ? 8.243   17.558  -41.911 1.00 43.83  ? 139  LEU A C   1 
ATOM 1073 O O   . LEU A 1 142  ? 7.051   17.417  -42.184 1.00 43.83  ? 139  LEU A O   1 
ATOM 1074 C CB  . LEU A 1 142  ? 9.121   19.557  -40.677 1.00 37.63  ? 139  LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 142  ? 10.408  20.384  -40.587 1.00 37.63  ? 139  LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 142  ? 10.231  21.336  -39.422 1.00 37.63  ? 139  LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 142  ? 11.598  19.425  -40.451 1.00 37.63  ? 139  LEU A CD2 1 
ATOM 1078 N N   . PHE A 1 143  ? 9.013   16.573  -41.477 1.00 50.39  ? 140  PHE A N   1 
ATOM 1079 C CA  . PHE A 1 143  ? 8.478   15.271  -41.210 1.00 50.39  ? 140  PHE A CA  1 
ATOM 1080 C C   . PHE A 1 143  ? 9.197   14.617  -40.049 1.00 50.39  ? 140  PHE A C   1 
ATOM 1081 O O   . PHE A 1 143  ? 10.285  14.081  -40.191 1.00 50.39  ? 140  PHE A O   1 
ATOM 1082 C CB  . PHE A 1 143  ? 8.495   14.377  -42.450 1.00 47.64  ? 140  PHE A CB  1 
ATOM 1083 C CG  . PHE A 1 143  ? 7.896   13.011  -42.214 1.00 47.64  ? 140  PHE A CG  1 
ATOM 1084 C CD1 . PHE A 1 143  ? 6.517   12.841  -42.157 1.00 47.64  ? 140  PHE A CD1 1 
ATOM 1085 C CD2 . PHE A 1 143  ? 8.716   11.885  -42.031 1.00 47.64  ? 140  PHE A CD2 1 
ATOM 1086 C CE1 . PHE A 1 143  ? 5.975   11.584  -41.910 1.00 47.64  ? 140  PHE A CE1 1 
ATOM 1087 C CE2 . PHE A 1 143  ? 8.165   10.607  -41.784 1.00 47.64  ? 140  PHE A CE2 1 
ATOM 1088 C CZ  . PHE A 1 143  ? 6.806   10.464  -41.724 1.00 47.64  ? 140  PHE A CZ  1 
ATOM 1089 N N   . LYS A 1 144  ? 8.540   14.651  -38.898 1.00 41.57  ? 141  LYS A N   1 
ATOM 1090 C CA  . LYS A 1 144  ? 9.042   14.119  -37.626 1.00 41.57  ? 141  LYS A CA  1 
ATOM 1091 C C   . LYS A 1 144  ? 8.978   12.584  -37.608 1.00 41.57  ? 141  LYS A C   1 
ATOM 1092 O O   . LYS A 1 144  ? 8.139   12.004  -38.285 1.00 41.57  ? 141  LYS A O   1 
ATOM 1093 C CB  . LYS A 1 144  ? 8.226   14.721  -36.474 1.00 36.98  ? 141  LYS A CB  1 
ATOM 1094 C CG  . LYS A 1 144  ? 8.617   14.303  -35.075 1.00 36.98  ? 141  LYS A CG  1 
ATOM 1095 C CD  . LYS A 1 144  ? 9.417   15.400  -34.361 1.00 36.98  ? 141  LYS A CD  1 
ATOM 1096 C CE  . LYS A 1 144  ? 8.630   16.707  -34.267 1.00 36.98  ? 141  LYS A CE  1 
ATOM 1097 N NZ  . LYS A 1 144  ? 9.071   17.523  -33.112 1.00 36.98  ? 141  LYS A NZ  1 
ATOM 1098 N N   . VAL A 1 145  ? 9.878   11.963  -36.848 1.00 52.77  ? 142  VAL A N   1 
ATOM 1099 C CA  . VAL A 1 145  ? 10.003  10.527  -36.766 1.00 52.77  ? 142  VAL A CA  1 
ATOM 1100 C C   . VAL A 1 145  ? 10.434  10.117  -35.369 1.00 52.77  ? 142  VAL A C   1 
ATOM 1101 O O   . VAL A 1 145  ? 11.449  10.596  -34.834 1.00 52.77  ? 142  VAL A O   1 
ATOM 1102 C CB  . VAL A 1 145  ? 11.098  9.987   -37.681 1.00 47.00  ? 142  VAL A CB  1 
ATOM 1103 C CG1 . VAL A 1 145  ? 11.256  8.481   -37.501 1.00 47.00  ? 142  VAL A CG1 1 
ATOM 1104 C CG2 . VAL A 1 145  ? 10.855  10.370  -39.102 1.00 47.00  ? 142  VAL A CG2 1 
ATOM 1105 N N   . ILE A 1 146  ? 9.687   9.173   -34.812 1.00 39.56  ? 143  ILE A N   1 
ATOM 1106 C CA  . ILE A 1 146  ? 9.912   8.707   -33.478 1.00 39.56  ? 143  ILE A CA  1 
ATOM 1107 C C   . ILE A 1 146  ? 10.166  7.236   -33.592 1.00 39.56  ? 143  ILE A C   1 
ATOM 1108 O O   . ILE A 1 146  ? 9.225   6.491   -33.751 1.00 39.56  ? 143  ILE A O   1 
ATOM 1109 C CB  . ILE A 1 146  ? 8.662   8.919   -32.650 1.00 39.72  ? 143  ILE A CB  1 
ATOM 1110 C CG1 . ILE A 1 146  ? 8.324   10.418  -32.602 1.00 39.72  ? 143  ILE A CG1 1 
ATOM 1111 C CG2 . ILE A 1 146  ? 8.825   8.285   -31.292 1.00 39.72  ? 143  ILE A CG2 1 
ATOM 1112 C CD1 . ILE A 1 146  ? 7.043   10.793  -31.782 1.00 39.72  ? 143  ILE A CD1 1 
ATOM 1113 N N   . PRO A 1 147  ? 11.435  6.797   -33.474 1.00 57.34  ? 144  PRO A N   1 
ATOM 1114 C CA  . PRO A 1 147  ? 11.760  5.357   -33.566 1.00 57.34  ? 144  PRO A CA  1 
ATOM 1115 C C   . PRO A 1 147  ? 11.280  4.617   -32.313 1.00 57.34  ? 144  PRO A C   1 
ATOM 1116 O O   . PRO A 1 147  ? 11.516  5.092   -31.189 1.00 57.34  ? 144  PRO A O   1 
ATOM 1117 C CB  . PRO A 1 147  ? 13.283  5.334   -33.624 1.00 77.48  ? 144  PRO A CB  1 
ATOM 1118 C CG  . PRO A 1 147  ? 13.721  6.774   -33.731 1.00 77.48  ? 144  PRO A CG  1 
ATOM 1119 C CD  . PRO A 1 147  ? 12.627  7.611   -33.183 1.00 77.48  ? 144  PRO A CD  1 
ATOM 1120 N N   . LEU A 1 148  ? 10.586  3.496   -32.496 1.00 70.04  ? 145  LEU A N   1 
ATOM 1121 C CA  . LEU A 1 148  ? 10.190  2.677   -31.352 1.00 70.04  ? 145  LEU A CA  1 
ATOM 1122 C C   . LEU A 1 148  ? 11.264  1.666   -30.977 1.00 70.04  ? 145  LEU A C   1 
ATOM 1123 O O   . LEU A 1 148  ? 11.849  0.990   -31.840 1.00 70.04  ? 145  LEU A O   1 
ATOM 1124 C CB  . LEU A 1 148  ? 8.859   1.980   -31.588 1.00 64.13  ? 145  LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 148  ? 7.619   2.877   -31.704 1.00 64.13  ? 145  LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 148  ? 6.559   2.088   -32.407 1.00 64.13  ? 145  LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 148  ? 7.085   3.414   -30.376 1.00 64.13  ? 145  LEU A CD2 1 
ATOM 1128 N N   . ASP A 1 149  ? 11.529  1.600   -29.676 1.00 108.42 ? 146  ASP A N   1 
ATOM 1129 C CA  . ASP A 1 149  ? 12.546  0.740   -29.091 1.00 108.42 ? 146  ASP A CA  1 
ATOM 1130 C C   . ASP A 1 149  ? 12.072  0.409   -27.704 1.00 108.42 ? 146  ASP A C   1 
ATOM 1131 O O   . ASP A 1 149  ? 10.964  0.788   -27.325 1.00 108.42 ? 146  ASP A O   1 
ATOM 1132 C CB  . ASP A 1 149  ? 13.884  1.466   -29.008 1.00 111.05 ? 146  ASP A CB  1 
ATOM 1133 C CG  . ASP A 1 149  ? 14.519  1.647   -30.354 1.00 111.05 ? 146  ASP A CG  1 
ATOM 1134 O OD1 . ASP A 1 149  ? 14.557  2.797   -30.829 1.00 111.05 ? 146  ASP A OD1 1 
ATOM 1135 O OD2 . ASP A 1 149  ? 14.951  0.635   -30.947 1.00 111.05 ? 146  ASP A OD2 1 
ATOM 1136 N N   . ARG A 1 150  ? 12.902  -0.285  -26.932 1.00 80.26  ? 147  ARG A N   1 
ATOM 1137 C CA  . ARG A 1 150  ? 12.502  -0.661  -25.593 1.00 80.26  ? 147  ARG A CA  1 
ATOM 1138 C C   . ARG A 1 150  ? 12.551  0.606   -24.768 1.00 80.26  ? 147  ARG A C   1 
ATOM 1139 O O   . ARG A 1 150  ? 11.748  0.810   -23.862 1.00 80.26  ? 147  ARG A O   1 
ATOM 1140 C CB  . ARG A 1 150  ? 13.435  -1.723  -25.021 1.00 170.17 ? 147  ARG A CB  1 
ATOM 1141 C CG  . ARG A 1 150  ? 12.712  -2.954  -24.491 1.00 170.17 ? 147  ARG A CG  1 
ATOM 1142 C CD  . ARG A 1 150  ? 11.820  -2.635  -23.298 1.00 170.17 ? 147  ARG A CD  1 
ATOM 1143 N NE  . ARG A 1 150  ? 11.136  -3.824  -22.795 1.00 170.17 ? 147  ARG A NE  1 
ATOM 1144 C CZ  . ARG A 1 150  ? 11.671  -4.703  -21.948 1.00 170.17 ? 147  ARG A CZ  1 
ATOM 1145 N NH1 . ARG A 1 150  ? 12.908  -4.540  -21.496 1.00 170.17 ? 147  ARG A NH1 1 
ATOM 1146 N NH2 . ARG A 1 150  ? 10.965  -5.753  -21.551 1.00 170.17 ? 147  ARG A NH2 1 
ATOM 1147 N N   . ASP A 1 151  ? 13.481  1.473   -25.131 1.00 176.78 ? 148  ASP A N   1 
ATOM 1148 C CA  . ASP A 1 151  ? 13.715  2.713   -24.434 1.00 176.78 ? 148  ASP A CA  1 
ATOM 1149 C C   . ASP A 1 151  ? 12.827  3.785   -25.042 1.00 176.78 ? 148  ASP A C   1 
ATOM 1150 O O   . ASP A 1 151  ? 11.601  3.687   -24.975 1.00 176.78 ? 148  ASP A O   1 
ATOM 1151 C CB  . ASP A 1 151  ? 15.181  3.071   -24.586 1.00 176.17 ? 148  ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 151  ? 16.001  1.890   -25.048 1.00 176.17 ? 148  ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 151  ? 16.806  1.381   -24.249 1.00 176.17 ? 148  ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 151  ? 15.804  1.443   -26.200 1.00 176.17 ? 148  ASP A OD2 1 
ATOM 1155 N N   . ASN A 1 152  ? 13.454  4.785   -25.656 1.00 90.48  ? 149  ASN A N   1 
ATOM 1156 C CA  . ASN A 1 152  ? 12.787  5.985   -26.173 1.00 90.48  ? 149  ASN A CA  1 
ATOM 1157 C C   . ASN A 1 152  ? 11.631  6.447   -25.292 1.00 90.48  ? 149  ASN A C   1 
ATOM 1158 O O   . ASN A 1 152  ? 10.690  7.051   -25.770 1.00 90.48  ? 149  ASN A O   1 
ATOM 1159 C CB  . ASN A 1 152  ? 12.334  5.773   -27.620 1.00 73.40  ? 149  ASN A CB  1 
ATOM 1160 C CG  . ASN A 1 152  ? 12.352  7.061   -28.439 1.00 73.40  ? 149  ASN A CG  1 
ATOM 1161 O OD1 . ASN A 1 152  ? 12.394  8.159   -27.896 1.00 73.40  ? 149  ASN A OD1 1 
ATOM 1162 N ND2 . ASN A 1 152  ? 12.326  6.922   -29.759 1.00 73.40  ? 149  ASN A ND2 1 
ATOM 1163 N N   . LYS A 1 153  ? 11.733  6.170   -23.996 1.00 50.87  ? 150  LYS A N   1 
ATOM 1164 C CA  . LYS A 1 153  ? 10.653  6.374   -23.022 1.00 50.87  ? 150  LYS A CA  1 
ATOM 1165 C C   . LYS A 1 153  ? 10.132  7.807   -22.944 1.00 50.87  ? 150  LYS A C   1 
ATOM 1166 O O   . LYS A 1 153  ? 9.034   8.056   -22.396 1.00 50.87  ? 150  LYS A O   1 
ATOM 1167 C CB  . LYS A 1 153  ? 11.076  5.893   -21.633 1.00 86.99  ? 150  LYS A CB  1 
ATOM 1168 C CG  . LYS A 1 153  ? 10.956  4.415   -21.456 1.00 86.99  ? 150  LYS A CG  1 
ATOM 1169 C CD  . LYS A 1 153  ? 10.559  4.081   -20.034 1.00 86.99  ? 150  LYS A CD  1 
ATOM 1170 C CE  . LYS A 1 153  ? 10.239  2.589   -19.893 1.00 86.99  ? 150  LYS A CE  1 
ATOM 1171 N NZ  . LYS A 1 153  ? 11.351  1.693   -20.378 1.00 86.99  ? 150  LYS A NZ  1 
ATOM 1172 N N   . GLU A 1 154  ? 10.937  8.732   -23.472 1.00 55.58  ? 151  GLU A N   1 
ATOM 1173 C CA  . GLU A 1 154  ? 10.522  10.110  -23.644 1.00 55.58  ? 151  GLU A CA  1 
ATOM 1174 C C   . GLU A 1 154  ? 10.358  10.449  -25.129 1.00 55.58  ? 151  GLU A C   1 
ATOM 1175 O O   . GLU A 1 154  ? 10.428  11.618  -25.516 1.00 55.58  ? 151  GLU A O   1 
ATOM 1176 C CB  . GLU A 1 154  ? 11.514  11.084  -23.009 1.00 85.11  ? 151  GLU A CB  1 
ATOM 1177 C CG  . GLU A 1 154  ? 11.895  10.824  -21.568 1.00 85.11  ? 151  GLU A CG  1 
ATOM 1178 C CD  . GLU A 1 154  ? 13.329  11.274  -21.290 1.00 85.11  ? 151  GLU A CD  1 
ATOM 1179 O OE1 . GLU A 1 154  ? 13.528  12.418  -20.802 1.00 85.11  ? 151  GLU A OE1 1 
ATOM 1180 O OE2 . GLU A 1 154  ? 14.255  10.485  -21.601 1.00 85.11  ? 151  GLU A OE2 1 
ATOM 1181 N N   . LEU A 1 155  ? 10.159  9.435   -25.960 1.00 57.40  ? 152  LEU A N   1 
ATOM 1182 C CA  . LEU A 1 155  ? 9.789   9.632   -27.369 1.00 57.40  ? 152  LEU A CA  1 
ATOM 1183 C C   . LEU A 1 155  ? 10.583  10.724  -28.100 1.00 57.40  ? 152  LEU A C   1 
ATOM 1184 O O   . LEU A 1 155  ? 10.036  11.694  -28.644 1.00 57.40  ? 152  LEU A O   1 
ATOM 1185 C CB  . LEU A 1 155  ? 8.263   9.836   -27.489 1.00 47.21  ? 152  LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 155  ? 7.415   8.670   -26.986 1.00 47.21  ? 152  LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 155  ? 6.015   9.113   -26.720 1.00 47.21  ? 152  LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 155  ? 7.463   7.551   -27.995 1.00 47.21  ? 152  LEU A CD2 1 
ATOM 1189 N N   . LYS A 1 156  ? 11.891  10.565  -28.092 1.00 52.39  ? 153  LYS A N   1 
ATOM 1190 C CA  . LYS A 1 156  ? 12.757  11.547  -28.721 1.00 52.39  ? 153  LYS A CA  1 
ATOM 1191 C C   . LYS A 1 156  ? 12.669  11.354  -30.226 1.00 52.39  ? 153  LYS A C   1 
ATOM 1192 O O   . LYS A 1 156  ? 12.654  10.232  -30.728 1.00 52.39  ? 153  LYS A O   1 
ATOM 1193 C CB  . LYS A 1 156  ? 14.206  11.447  -28.210 1.00 77.46  ? 153  LYS A CB  1 
ATOM 1194 C CG  . LYS A 1 156  ? 14.381  11.538  -26.685 1.00 77.46  ? 153  LYS A CG  1 
ATOM 1195 C CD  . LYS A 1 156  ? 14.123  12.946  -26.099 1.00 77.46  ? 153  LYS A CD  1 
ATOM 1196 C CE  . LYS A 1 156  ? 14.240  12.960  -24.553 1.00 77.46  ? 153  LYS A CE  1 
ATOM 1197 N NZ  . LYS A 1 156  ? 14.525  14.293  -23.965 1.00 77.46  ? 153  LYS A NZ  1 
ATOM 1198 N N   . ALA A 1 157  ? 12.591  12.458  -30.944 1.00 64.18  ? 154  ALA A N   1 
ATOM 1199 C CA  . ALA A 1 157  ? 12.324  12.383  -32.351 1.00 64.18  ? 154  ALA A CA  1 
ATOM 1200 C C   . ALA A 1 157  ? 13.212  13.286  -33.172 1.00 64.18  ? 154  ALA A C   1 
ATOM 1201 O O   . ALA A 1 157  ? 13.461  14.426  -32.803 1.00 64.18  ? 154  ALA A O   1 
ATOM 1202 C CB  . ALA A 1 157  ? 10.894  12.728  -32.592 1.00 42.23  ? 154  ALA A CB  1 
ATOM 1203 N N   . PHE A 1 158  ? 13.676  12.790  -34.301 1.00 64.20  ? 155  PHE A N   1 
ATOM 1204 C CA  . PHE A 1 158  ? 14.269  13.702  -35.238 1.00 64.20  ? 155  PHE A CA  1 
ATOM 1205 C C   . PHE A 1 158  ? 13.224  14.152  -36.253 1.00 64.20  ? 155  PHE A C   1 
ATOM 1206 O O   . PHE A 1 158  ? 12.199  13.504  -36.404 1.00 64.20  ? 155  PHE A O   1 
ATOM 1207 C CB  . PHE A 1 158  ? 15.498  13.100  -35.910 1.00 64.38  ? 155  PHE A CB  1 
ATOM 1208 C CG  . PHE A 1 158  ? 15.215  11.853  -36.666 1.00 64.38  ? 155  PHE A CG  1 
ATOM 1209 C CD1 . PHE A 1 158  ? 15.077  11.889  -38.054 1.00 64.38  ? 155  PHE A CD1 1 
ATOM 1210 C CD2 . PHE A 1 158  ? 15.083  10.639  -35.997 1.00 64.38  ? 155  PHE A CD2 1 
ATOM 1211 C CE1 . PHE A 1 158  ? 14.826  10.736  -38.754 1.00 64.38  ? 155  PHE A CE1 1 
ATOM 1212 C CE2 . PHE A 1 158  ? 14.824  9.471   -36.688 1.00 64.38  ? 155  PHE A CE2 1 
ATOM 1213 C CZ  . PHE A 1 158  ? 14.697  9.517   -38.066 1.00 64.38  ? 155  PHE A CZ  1 
ATOM 1214 N N   . ASN A 1 159  ? 13.500  15.283  -36.899 1.00 50.96  ? 156  ASN A N   1 
ATOM 1215 C CA  . ASN A 1 159  ? 12.738  15.836  -37.990 1.00 50.96  ? 156  ASN A CA  1 
ATOM 1216 C C   . ASN A 1 159  ? 13.564  15.571  -39.253 1.00 50.96  ? 156  ASN A C   1 
ATOM 1217 O O   . ASN A 1 159  ? 14.752  15.309  -39.168 1.00 50.96  ? 156  ASN A O   1 
ATOM 1218 C CB  . ASN A 1 159  ? 12.598  17.339  -37.771 1.00 73.57  ? 156  ASN A CB  1 
ATOM 1219 C CG  . ASN A 1 159  ? 11.232  17.749  -37.241 1.00 73.57  ? 156  ASN A CG  1 
ATOM 1220 O OD1 . ASN A 1 159  ? 10.282  17.840  -37.999 1.00 73.57  ? 156  ASN A OD1 1 
ATOM 1221 N ND2 . ASN A 1 159  ? 11.143  18.056  -35.959 1.00 73.57  ? 156  ASN A ND2 1 
ATOM 1222 N N   . ILE A 1 160  ? 12.936  15.623  -40.421 1.00 69.57  ? 157  ILE A N   1 
ATOM 1223 C CA  . ILE A 1 160  ? 13.604  15.456  -41.704 1.00 69.57  ? 157  ILE A CA  1 
ATOM 1224 C C   . ILE A 1 160  ? 13.028  16.467  -42.681 1.00 69.57  ? 157  ILE A C   1 
ATOM 1225 O O   . ILE A 1 160  ? 11.872  16.833  -42.555 1.00 69.57  ? 157  ILE A O   1 
ATOM 1226 C CB  . ILE A 1 160  ? 13.287  14.116  -42.267 1.00 39.58  ? 157  ILE A CB  1 
ATOM 1227 C CG1 . ILE A 1 160  ? 13.823  13.018  -41.358 1.00 39.58  ? 157  ILE A CG1 1 
ATOM 1228 C CG2 . ILE A 1 160  ? 13.829  13.996  -43.676 1.00 39.58  ? 157  ILE A CG2 1 
ATOM 1229 C CD1 . ILE A 1 160  ? 13.615  11.655  -41.915 1.00 39.58  ? 157  ILE A CD1 1 
ATOM 1230 N N   . ARG A 1 161  ? 13.809  16.929  -43.657 1.00 75.70  ? 158  ARG A N   1 
ATOM 1231 C CA  . ARG A 1 161  ? 13.289  17.935  -44.586 1.00 75.70  ? 158  ARG A CA  1 
ATOM 1232 C C   . ARG A 1 161  ? 12.555  17.325  -45.769 1.00 75.70  ? 158  ARG A C   1 
ATOM 1233 O O   . ARG A 1 161  ? 12.995  16.365  -46.382 1.00 75.70  ? 158  ARG A O   1 
ATOM 1234 C CB  . ARG A 1 161  ? 14.344  18.948  -45.039 1.00 111.08 ? 158  ARG A CB  1 
ATOM 1235 C CG  . ARG A 1 161  ? 13.765  20.362  -45.122 1.00 111.08 ? 158  ARG A CG  1 
ATOM 1236 C CD  . ARG A 1 161  ? 13.863  20.968  -46.522 1.00 111.08 ? 158  ARG A CD  1 
ATOM 1237 N NE  . ARG A 1 161  ? 15.051  21.810  -46.700 1.00 111.08 ? 158  ARG A NE  1 
ATOM 1238 C CZ  . ARG A 1 161  ? 16.228  21.365  -47.164 1.00 111.08 ? 158  ARG A CZ  1 
ATOM 1239 N NH1 . ARG A 1 161  ? 16.392  20.076  -47.510 1.00 111.08 ? 158  ARG A NH1 1 
ATOM 1240 N NH2 . ARG A 1 161  ? 17.245  22.214  -47.287 1.00 111.08 ? 158  ARG A NH2 1 
ATOM 1241 N N   . LEU A 1 162  ? 11.409  17.918  -46.047 1.00 48.97  ? 159  LEU A N   1 
ATOM 1242 C CA  . LEU A 1 162  ? 10.523  17.533  -47.111 1.00 48.97  ? 159  LEU A CA  1 
ATOM 1243 C C   . LEU A 1 162  ? 10.551  18.610  -48.167 1.00 48.97  ? 159  LEU A C   1 
ATOM 1244 O O   . LEU A 1 162  ? 10.151  19.749  -47.900 1.00 48.97  ? 159  LEU A O   1 
ATOM 1245 C CB  . LEU A 1 162  ? 9.100   17.475  -46.554 1.00 53.49  ? 159  LEU A CB  1 
ATOM 1246 C CG  . LEU A 1 162  ? 8.299   16.176  -46.706 1.00 53.49  ? 159  LEU A CG  1 
ATOM 1247 C CD1 . LEU A 1 162  ? 7.045   16.232  -45.790 1.00 53.49  ? 159  LEU A CD1 1 
ATOM 1248 C CD2 . LEU A 1 162  ? 7.948   15.891  -48.186 1.00 53.49  ? 159  LEU A CD2 1 
ATOM 1249 N N   . GLU A 1 163  ? 11.012  18.266  -49.368 1.00 52.74  ? 160  GLU A N   1 
ATOM 1250 C CA  . GLU A 1 163  ? 10.951  19.198  -50.496 1.00 52.74  ? 160  GLU A CA  1 
ATOM 1251 C C   . GLU A 1 163  ? 9.542   19.723  -50.598 1.00 52.74  ? 160  GLU A C   1 
ATOM 1252 O O   . GLU A 1 163  ? 9.325   20.905  -50.872 1.00 52.74  ? 160  GLU A O   1 
ATOM 1253 C CB  . GLU A 1 163  ? 11.309  18.494  -51.808 1.00 139.72 ? 160  GLU A CB  1 
ATOM 1254 C CG  . GLU A 1 163  ? 12.748  18.049  -51.915 1.00 139.72 ? 160  GLU A CG  1 
ATOM 1255 C CD  . GLU A 1 163  ? 13.710  19.134  -51.492 1.00 139.72 ? 160  GLU A CD  1 
ATOM 1256 O OE1 . GLU A 1 163  ? 13.467  20.318  -51.818 1.00 139.72 ? 160  GLU A OE1 1 
ATOM 1257 O OE2 . GLU A 1 163  ? 14.706  18.799  -50.822 1.00 139.72 ? 160  GLU A OE2 1 
ATOM 1258 N N   . GLU A 1 164  ? 8.589   18.828  -50.327 1.00 54.14  ? 161  GLU A N   1 
ATOM 1259 C CA  . GLU A 1 164  ? 7.190   19.071  -50.629 1.00 54.14  ? 161  GLU A CA  1 
ATOM 1260 C C   . GLU A 1 164  ? 6.384   19.759  -49.504 1.00 54.14  ? 161  GLU A C   1 
ATOM 1261 O O   . GLU A 1 164  ? 6.108   19.171  -48.449 1.00 54.14  ? 161  GLU A O   1 
ATOM 1262 C CB  . GLU A 1 164  ? 6.570   17.784  -51.128 1.00 70.03  ? 161  GLU A CB  1 
ATOM 1263 C CG  . GLU A 1 164  ? 7.096   17.387  -52.510 1.00 70.03  ? 161  GLU A CG  1 
ATOM 1264 C CD  . GLU A 1 164  ? 8.345   16.487  -52.493 1.00 70.03  ? 161  GLU A CD  1 
ATOM 1265 O OE1 . GLU A 1 164  ? 8.589   15.798  -51.484 1.00 70.03  ? 161  GLU A OE1 1 
ATOM 1266 O OE2 . GLU A 1 164  ? 9.074   16.449  -53.516 1.00 70.03  ? 161  GLU A OE2 1 
ATOM 1267 N N   . LEU A 1 165  ? 6.028   21.020  -49.763 1.00 68.28  ? 162  LEU A N   1 
ATOM 1268 C CA  . LEU A 1 165  ? 5.437   21.934  -48.781 1.00 68.28  ? 162  LEU A CA  1 
ATOM 1269 C C   . LEU A 1 165  ? 3.930   21.836  -48.595 1.00 68.28  ? 162  LEU A C   1 
ATOM 1270 O O   . LEU A 1 165  ? 3.419   22.393  -47.635 1.00 68.28  ? 162  LEU A O   1 
ATOM 1271 C CB  . LEU A 1 165  ? 5.734   23.405  -49.151 1.00 38.01  ? 162  LEU A CB  1 
ATOM 1272 C CG  . LEU A 1 165  ? 7.099   24.140  -49.004 1.00 38.01  ? 162  LEU A CG  1 
ATOM 1273 C CD1 . LEU A 1 165  ? 6.914   25.663  -49.284 1.00 38.01  ? 162  LEU A CD1 1 
ATOM 1274 C CD2 . LEU A 1 165  ? 7.854   23.884  -47.662 1.00 38.01  ? 162  LEU A CD2 1 
ATOM 1275 N N   . HIS A 1 166  ? 3.211   21.194  -49.521 1.00 61.83  ? 163  HIS A N   1 
ATOM 1276 C CA  . HIS A 1 166  ? 1.734   21.088  -49.433 1.00 61.83  ? 163  HIS A CA  1 
ATOM 1277 C C   . HIS A 1 166  ? 1.260   19.614  -49.532 1.00 61.83  ? 163  HIS A C   1 
ATOM 1278 O O   . HIS A 1 166  ? 0.623   19.205  -50.505 1.00 61.83  ? 163  HIS A O   1 
ATOM 1279 C CB  . HIS A 1 166  ? 1.074   22.006  -50.491 1.00 69.83  ? 163  HIS A CB  1 
ATOM 1280 C CG  . HIS A 1 166  ? -0.388  22.298  -50.254 1.00 69.83  ? 163  HIS A CG  1 
ATOM 1281 N ND1 . HIS A 1 166  ? -1.371  21.328  -50.317 1.00 69.83  ? 163  HIS A ND1 1 
ATOM 1282 C CD2 . HIS A 1 166  ? -1.037  23.471  -50.011 1.00 69.83  ? 163  HIS A CD2 1 
ATOM 1283 C CE1 . HIS A 1 166  ? -2.553  21.881  -50.092 1.00 69.83  ? 163  HIS A CE1 1 
ATOM 1284 N NE2 . HIS A 1 166  ? -2.380  23.180  -49.903 1.00 69.83  ? 163  HIS A NE2 1 
ATOM 1285 N N   . VAL A 1 167  ? 1.612   18.815  -48.527 1.00 43.81  ? 164  VAL A N   1 
ATOM 1286 C CA  . VAL A 1 167  ? 1.201   17.407  -48.447 1.00 43.81  ? 164  VAL A CA  1 
ATOM 1287 C C   . VAL A 1 167  ? -0.268  17.281  -48.031 1.00 43.81  ? 164  VAL A C   1 
ATOM 1288 O O   . VAL A 1 167  ? -0.773  18.103  -47.262 1.00 43.81  ? 164  VAL A O   1 
ATOM 1289 C CB  . VAL A 1 167  ? 2.105   16.609  -47.467 1.00 32.35  ? 164  VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 167  ? 1.488   15.243  -47.083 1.00 32.35  ? 164  VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 167  ? 3.445   16.407  -48.085 1.00 32.35  ? 164  VAL A CG2 1 
ATOM 1292 N N   . ILE A 1 168  ? -0.929  16.259  -48.573 1.00 44.39  ? 165  ILE A N   1 
ATOM 1293 C CA  . ILE A 1 168  ? -2.381  16.033  -48.405 1.00 44.39  ? 165  ILE A CA  1 
ATOM 1294 C C   . ILE A 1 168  ? -2.730  14.858  -47.457 1.00 44.39  ? 165  ILE A C   1 
ATOM 1295 O O   . ILE A 1 168  ? -3.530  15.043  -46.514 1.00 44.39  ? 165  ILE A O   1 
ATOM 1296 C CB  . ILE A 1 168  ? -3.111  15.826  -49.773 1.00 34.42  ? 165  ILE A CB  1 
ATOM 1297 C CG1 . ILE A 1 168  ? -2.809  16.979  -50.737 1.00 34.42  ? 165  ILE A CG1 1 
ATOM 1298 C CG2 . ILE A 1 168  ? -4.624  15.657  -49.554 1.00 34.42  ? 165  ILE A CG2 1 
ATOM 1299 C CD1 . ILE A 1 168  ? -3.245  18.296  -50.254 1.00 34.42  ? 165  ILE A CD1 1 
ATOM 1300 N N   . ASP A 1 169  ? -2.136  13.684  -47.742 1.00 34.26  ? 166  ASP A N   1 
ATOM 1301 C CA  . ASP A 1 169  ? -2.272  12.472  -46.913 1.00 34.26  ? 166  ASP A CA  1 
ATOM 1302 C C   . ASP A 1 169  ? -1.077  11.501  -47.155 1.00 34.26  ? 166  ASP A C   1 
ATOM 1303 O O   . ASP A 1 169  ? -0.466  11.518  -48.209 1.00 34.26  ? 166  ASP A O   1 
ATOM 1304 C CB  . ASP A 1 169  ? -3.643  11.782  -47.143 1.00 48.24  ? 166  ASP A CB  1 
ATOM 1305 C CG  . ASP A 1 169  ? -3.951  10.643  -46.127 1.00 48.24  ? 166  ASP A CG  1 
ATOM 1306 O OD1 . ASP A 1 169  ? -3.256  10.494  -45.060 1.00 48.24  ? 166  ASP A OD1 1 
ATOM 1307 O OD2 . ASP A 1 169  ? -4.924  9.889   -46.418 1.00 48.24  ? 166  ASP A OD2 1 
ATOM 1308 N N   . VAL A 1 170  ? -0.770  10.678  -46.157 1.00 53.74  ? 167  VAL A N   1 
ATOM 1309 C CA  . VAL A 1 170  ? 0.434   9.890   -46.081 1.00 53.74  ? 167  VAL A CA  1 
ATOM 1310 C C   . VAL A 1 170  ? 0.067   8.638   -45.325 1.00 53.74  ? 167  VAL A C   1 
ATOM 1311 O O   . VAL A 1 170  ? -0.775  8.689   -44.422 1.00 53.74  ? 167  VAL A O   1 
ATOM 1312 C CB  . VAL A 1 170  ? 1.516   10.557  -45.178 1.00 43.30  ? 167  VAL A CB  1 
ATOM 1313 C CG1 . VAL A 1 170  ? 2.894   10.098  -45.574 1.00 43.30  ? 167  VAL A CG1 1 
ATOM 1314 C CG2 . VAL A 1 170  ? 1.477   12.051  -45.252 1.00 43.30  ? 167  VAL A CG2 1 
ATOM 1315 N N   . LYS A 1 171  ? 0.679   7.517   -45.700 1.00 45.60  ? 168  LYS A N   1 
ATOM 1316 C CA  . LYS A 1 171  ? 0.695   6.297   -44.919 1.00 45.60  ? 168  LYS A CA  1 
ATOM 1317 C C   . LYS A 1 171  ? 1.986   5.608   -45.320 1.00 45.60  ? 168  LYS A C   1 
ATOM 1318 O O   . LYS A 1 171  ? 2.580   5.954   -46.358 1.00 45.60  ? 168  LYS A O   1 
ATOM 1319 C CB  . LYS A 1 171  ? -0.429  5.342   -45.297 1.00 33.27  ? 168  LYS A CB  1 
ATOM 1320 C CG  . LYS A 1 171  ? -1.864  5.854   -45.316 1.00 33.27  ? 168  LYS A CG  1 
ATOM 1321 C CD  . LYS A 1 171  ? -2.597  5.715   -43.974 1.00 33.27  ? 168  LYS A CD  1 
ATOM 1322 C CE  . LYS A 1 171  ? -4.090  5.976   -44.199 1.00 33.27  ? 168  LYS A CE  1 
ATOM 1323 N NZ  . LYS A 1 171  ? -4.273  7.303   -44.940 1.00 33.27  ? 168  LYS A NZ  1 
ATOM 1324 N N   . PHE A 1 172  ? 2.405   4.654   -44.479 1.00 46.15  ? 169  PHE A N   1 
ATOM 1325 C CA  . PHE A 1 172  ? 3.410   3.650   -44.759 1.00 46.15  ? 169  PHE A CA  1 
ATOM 1326 C C   . PHE A 1 172  ? 2.844   2.493   -45.585 1.00 46.15  ? 169  PHE A C   1 
ATOM 1327 O O   . PHE A 1 172  ? 1.729   2.026   -45.353 1.00 46.15  ? 169  PHE A O   1 
ATOM 1328 C CB  . PHE A 1 172  ? 3.907   3.046   -43.454 1.00 58.48  ? 169  PHE A CB  1 
ATOM 1329 C CG  . PHE A 1 172  ? 4.814   3.927   -42.682 1.00 58.48  ? 169  PHE A CG  1 
ATOM 1330 C CD1 . PHE A 1 172  ? 4.479   4.313   -41.391 1.00 58.48  ? 169  PHE A CD1 1 
ATOM 1331 C CD2 . PHE A 1 172  ? 6.013   4.360   -43.224 1.00 58.48  ? 169  PHE A CD2 1 
ATOM 1332 C CE1 . PHE A 1 172  ? 5.325   5.127   -40.637 1.00 58.48  ? 169  PHE A CE1 1 
ATOM 1333 C CE2 . PHE A 1 172  ? 6.865   5.168   -42.486 1.00 58.48  ? 169  PHE A CE2 1 
ATOM 1334 C CZ  . PHE A 1 172  ? 6.525   5.549   -41.189 1.00 58.48  ? 169  PHE A CZ  1 
ATOM 1335 N N   . LEU A 1 173  ? 3.655   1.996   -46.514 1.00 49.72  ? 170  LEU A N   1 
ATOM 1336 C CA  . LEU A 1 173  ? 3.258   0.895   -47.383 1.00 49.72  ? 170  LEU A CA  1 
ATOM 1337 C C   . LEU A 1 173  ? 3.563   -0.442  -46.757 1.00 49.72  ? 170  LEU A C   1 
ATOM 1338 O O   . LEU A 1 173  ? 4.632   -0.623  -46.162 1.00 49.72  ? 170  LEU A O   1 
ATOM 1339 C CB  . LEU A 1 173  ? 3.975   0.989   -48.727 1.00 51.21  ? 170  LEU A CB  1 
ATOM 1340 C CG  . LEU A 1 173  ? 3.749   2.296   -49.489 1.00 51.21  ? 170  LEU A CG  1 
ATOM 1341 C CD1 . LEU A 1 173  ? 4.724   2.444   -50.632 1.00 51.21  ? 170  LEU A CD1 1 
ATOM 1342 C CD2 . LEU A 1 173  ? 2.313   2.345   -49.990 1.00 51.21  ? 170  LEU A CD2 1 
ATOM 1343 N N   . TYR A 1 174  ? 2.622   -1.373  -46.912 1.00 66.73  ? 171  TYR A N   1 
ATOM 1344 C CA  . TYR A 1 174  ? 2.826   -2.769  -46.587 1.00 66.73  ? 171  TYR A CA  1 
ATOM 1345 C C   . TYR A 1 174  ? 3.752   -3.437  -47.590 1.00 66.73  ? 171  TYR A C   1 
ATOM 1346 O O   . TYR A 1 174  ? 3.912   -2.973  -48.745 1.00 66.73  ? 171  TYR A O   1 
ATOM 1347 C CB  . TYR A 1 174  ? 1.506   -3.495  -46.640 1.00 52.20  ? 171  TYR A CB  1 
ATOM 1348 C CG  . TYR A 1 174  ? 0.620   -3.296  -45.432 1.00 52.20  ? 171  TYR A CG  1 
ATOM 1349 C CD1 . TYR A 1 174  ? -0.370  -2.302  -45.411 1.00 52.20  ? 171  TYR A CD1 1 
ATOM 1350 C CD2 . TYR A 1 174  ? 0.742   -4.125  -44.319 1.00 52.20  ? 171  TYR A CD2 1 
ATOM 1351 C CE1 . TYR A 1 174  ? -1.198  -2.141  -44.318 1.00 52.20  ? 171  TYR A CE1 1 
ATOM 1352 C CE2 . TYR A 1 174  ? -0.084  -3.975  -43.224 1.00 52.20  ? 171  TYR A CE2 1 
ATOM 1353 C CZ  . TYR A 1 174  ? -1.055  -2.980  -43.224 1.00 52.20  ? 171  TYR A CZ  1 
ATOM 1354 O OH  . TYR A 1 174  ? -1.874  -2.847  -42.113 1.00 52.20  ? 171  TYR A OH  1 
ATOM 1355 N N   . GLY A 1 175  ? 4.344   -4.538  -47.123 1.00 84.56  ? 172  GLY A N   1 
ATOM 1356 C CA  . GLY A 1 175  ? 5.237   -5.410  -47.900 1.00 84.56  ? 172  GLY A CA  1 
ATOM 1357 C C   . GLY A 1 175  ? 6.497   -4.701  -48.331 1.00 84.56  ? 172  GLY A C   1 
ATOM 1358 O O   . GLY A 1 175  ? 6.799   -4.622  -49.513 1.00 84.56  ? 172  GLY A O   1 
ATOM 1359 N N   . CYS A 1 176  ? 7.237   -4.176  -47.368 1.00 125.38 ? 173  CYS A N   1 
ATOM 1360 C CA  . CYS A 1 176  ? 8.335   -3.304  -47.708 1.00 125.38 ? 173  CYS A CA  1 
ATOM 1361 C C   . CYS A 1 176  ? 9.636   -3.700  -47.063 1.00 125.38 ? 173  CYS A C   1 
ATOM 1362 O O   . CYS A 1 176  ? 9.662   -4.150  -45.911 1.00 125.38 ? 173  CYS A O   1 
ATOM 1363 C CB  . CYS A 1 176  ? 7.980   -1.859  -47.372 1.00 69.25  ? 173  CYS A CB  1 
ATOM 1364 S SG  . CYS A 1 176  ? 7.211   -1.030  -48.775 1.00 69.25  ? 173  CYS A SG  1 
ATOM 1365 N N   . GLN A 1 177  ? 10.710  -3.538  -47.833 1.00 77.60  ? 174  GLN A N   1 
ATOM 1366 C CA  . GLN A 1 177  ? 12.062  -3.729  -47.324 1.00 77.60  ? 174  GLN A CA  1 
ATOM 1367 C C   . GLN A 1 177  ? 12.228  -2.667  -46.259 1.00 77.60  ? 174  GLN A C   1 
ATOM 1368 O O   . GLN A 1 177  ? 11.949  -2.890  -45.068 1.00 77.60  ? 174  GLN A O   1 
ATOM 1369 C CB  . GLN A 1 177  ? 13.117  -3.537  -48.430 1.00 133.86 ? 174  GLN A CB  1 
ATOM 1370 C CG  . GLN A 1 177  ? 12.821  -4.233  -49.764 1.00 133.86 ? 174  GLN A CG  1 
ATOM 1371 C CD  . GLN A 1 177  ? 12.467  -5.711  -49.613 1.00 133.86 ? 174  GLN A CD  1 
ATOM 1372 O OE1 . GLN A 1 177  ? 13.164  -6.475  -48.921 1.00 133.86 ? 174  GLN A OE1 1 
ATOM 1373 N NE2 . GLN A 1 177  ? 11.376  -6.118  -50.268 1.00 133.86 ? 174  GLN A NE2 1 
ATOM 1374 N N   . ALA A 1 178  ? 12.632  -1.486  -46.706 1.00 77.01  ? 175  ALA A N   1 
ATOM 1375 C CA  . ALA A 1 178  ? 12.755  -0.368  -45.797 1.00 77.01  ? 175  ALA A CA  1 
ATOM 1376 C C   . ALA A 1 178  ? 11.382  0.262   -45.543 1.00 77.01  ? 175  ALA A C   1 
ATOM 1377 O O   . ALA A 1 178  ? 10.524  0.256   -46.436 1.00 77.01  ? 175  ALA A O   1 
ATOM 1378 C CB  . ALA A 1 178  ? 13.731  0.653   -46.350 1.00 60.20  ? 175  ALA A CB  1 
ATOM 1379 N N   . PRO A 1 179  ? 11.147  0.746   -44.301 1.00 58.89  ? 176  PRO A N   1 
ATOM 1380 C CA  . PRO A 1 179  ? 10.143  1.766   -44.019 1.00 58.89  ? 176  PRO A CA  1 
ATOM 1381 C C   . PRO A 1 179  ? 9.889   2.650   -45.227 1.00 58.89  ? 176  PRO A C   1 
ATOM 1382 O O   . PRO A 1 179  ? 10.839  3.180   -45.810 1.00 58.89  ? 176  PRO A O   1 
ATOM 1383 C CB  . PRO A 1 179  ? 10.816  2.562   -42.911 1.00 74.03  ? 176  PRO A CB  1 
ATOM 1384 C CG  . PRO A 1 179  ? 11.592  1.498   -42.131 1.00 74.03  ? 176  PRO A CG  1 
ATOM 1385 C CD  . PRO A 1 179  ? 11.794  0.308   -43.048 1.00 74.03  ? 176  PRO A CD  1 
ATOM 1386 N N   . THR A 1 180  ? 8.626   2.754   -45.635 1.00 61.45  ? 177  THR A N   1 
ATOM 1387 C CA  . THR A 1 180  ? 8.297   3.568   -46.806 1.00 61.45  ? 177  THR A CA  1 
ATOM 1388 C C   . THR A 1 180  ? 6.971   4.302   -46.705 1.00 61.45  ? 177  THR A C   1 
ATOM 1389 O O   . THR A 1 180  ? 5.916   3.701   -46.575 1.00 61.45  ? 177  THR A O   1 
ATOM 1390 C CB  . THR A 1 180  ? 8.349   2.771   -48.136 1.00 50.74  ? 177  THR A CB  1 
ATOM 1391 O OG1 . THR A 1 180  ? 9.284   1.703   -48.013 1.00 50.74  ? 177  THR A OG1 1 
ATOM 1392 C CG2 . THR A 1 180  ? 8.803   3.668   -49.250 1.00 50.74  ? 177  THR A CG2 1 
ATOM 1393 N N   . ILE A 1 181  ? 7.048   5.621   -46.785 1.00 67.82  ? 178  ILE A N   1 
ATOM 1394 C CA  . ILE A 1 181  ? 5.860   6.436   -46.787 1.00 67.82  ? 178  ILE A CA  1 
ATOM 1395 C C   . ILE A 1 181  ? 5.373   6.545   -48.212 1.00 67.82  ? 178  ILE A C   1 
ATOM 1396 O O   . ILE A 1 181  ? 6.047   6.103   -49.145 1.00 67.82  ? 178  ILE A O   1 
ATOM 1397 C CB  . ILE A 1 181  ? 6.102   7.834   -46.174 1.00 68.79  ? 178  ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 181  ? 7.149   8.609   -46.978 1.00 68.79  ? 178  ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 181  ? 6.531   7.705   -44.729 1.00 68.79  ? 178  ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 181  ? 7.117   10.118  -46.778 1.00 68.79  ? 178  ILE A CD1 1 
ATOM 1401 N N   . CYS A 1 182  ? 4.191   7.130   -48.363 1.00 68.21  ? 179  CYS A N   1 
ATOM 1402 C CA  . CYS A 1 182  ? 3.586   7.331   -49.664 1.00 68.21  ? 179  CYS A CA  1 
ATOM 1403 C C   . CYS A 1 182  ? 2.513   8.388   -49.521 1.00 68.21  ? 179  CYS A C   1 
ATOM 1404 O O   . CYS A 1 182  ? 1.622   8.243   -48.688 1.00 68.21  ? 179  CYS A O   1 
ATOM 1405 C CB  . CYS A 1 182  ? 2.985   6.021   -50.159 1.00 51.76  ? 179  CYS A CB  1 
ATOM 1406 S SG  . CYS A 1 182  ? 1.875   6.181   -51.559 1.00 51.76  ? 179  CYS A SG  1 
ATOM 1407 N N   . PHE A 1 183  ? 2.592   9.425   -50.352 1.00 52.56  ? 180  PHE A N   1 
ATOM 1408 C CA  . PHE A 1 183  ? 1.832   10.650  -50.146 1.00 52.56  ? 180  PHE A CA  1 
ATOM 1409 C C   . PHE A 1 183  ? 1.388   11.375  -51.415 1.00 52.56  ? 180  PHE A C   1 
ATOM 1410 O O   . PHE A 1 183  ? 2.055   11.374  -52.433 1.00 52.56  ? 180  PHE A O   1 
ATOM 1411 C CB  . PHE A 1 183  ? 2.590   11.627  -49.203 1.00 51.35  ? 180  PHE A CB  1 
ATOM 1412 C CG  . PHE A 1 183  ? 3.936   12.157  -49.752 1.00 51.35  ? 180  PHE A CG  1 
ATOM 1413 C CD1 . PHE A 1 183  ? 4.049   13.463  -50.213 1.00 51.35  ? 180  PHE A CD1 1 
ATOM 1414 C CD2 . PHE A 1 183  ? 5.100   11.344  -49.774 1.00 51.35  ? 180  PHE A CD2 1 
ATOM 1415 C CE1 . PHE A 1 183  ? 5.282   13.923  -50.705 1.00 51.35  ? 180  PHE A CE1 1 
ATOM 1416 C CE2 . PHE A 1 183  ? 6.313   11.801  -50.257 1.00 51.35  ? 180  PHE A CE2 1 
ATOM 1417 C CZ  . PHE A 1 183  ? 6.407   13.080  -50.717 1.00 51.35  ? 180  PHE A CZ  1 
ATOM 1418 N N   . VAL A 1 184  ? 0.235   11.996  -51.337 1.00 59.92  ? 181  VAL A N   1 
ATOM 1419 C CA  . VAL A 1 184  ? -0.205  12.917  -52.352 1.00 59.92  ? 181  VAL A CA  1 
ATOM 1420 C C   . VAL A 1 184  ? 0.158   14.292  -51.797 1.00 59.92  ? 181  VAL A C   1 
ATOM 1421 O O   . VAL A 1 184  ? -0.204  14.622  -50.664 1.00 59.92  ? 181  VAL A O   1 
ATOM 1422 C CB  . VAL A 1 184  ? -1.771  12.778  -52.584 1.00 22.15  ? 181  VAL A CB  1 
ATOM 1423 C CG1 . VAL A 1 184  ? -2.375  13.853  -53.578 1.00 22.15  ? 181  VAL A CG1 1 
ATOM 1424 C CG2 . VAL A 1 184  ? -2.118  11.398  -53.026 1.00 22.15  ? 181  VAL A CG2 1 
ATOM 1425 N N   . TYR A 1 185  ? 0.906   15.073  -52.571 1.00 54.14  ? 182  TYR A N   1 
ATOM 1426 C CA  . TYR A 1 185  ? 1.141   16.495  -52.258 1.00 54.14  ? 182  TYR A CA  1 
ATOM 1427 C C   . TYR A 1 185  ? 0.653   17.320  -53.433 1.00 54.14  ? 182  TYR A C   1 
ATOM 1428 O O   . TYR A 1 185  ? 0.497   16.779  -54.523 1.00 54.14  ? 182  TYR A O   1 
ATOM 1429 C CB  . TYR A 1 185  ? 2.622   16.753  -52.033 1.00 66.36  ? 182  TYR A CB  1 
ATOM 1430 C CG  . TYR A 1 185  ? 3.476   16.474  -53.255 1.00 66.36  ? 182  TYR A CG  1 
ATOM 1431 C CD1 . TYR A 1 185  ? 3.805   17.502  -54.165 1.00 66.36  ? 182  TYR A CD1 1 
ATOM 1432 C CD2 . TYR A 1 185  ? 3.957   15.189  -53.505 1.00 66.36  ? 182  TYR A CD2 1 
ATOM 1433 C CE1 . TYR A 1 185  ? 4.579   17.255  -55.283 1.00 66.36  ? 182  TYR A CE1 1 
ATOM 1434 C CE2 . TYR A 1 185  ? 4.739   14.929  -54.618 1.00 66.36  ? 182  TYR A CE2 1 
ATOM 1435 C CZ  . TYR A 1 185  ? 5.048   15.967  -55.507 1.00 66.36  ? 182  TYR A CZ  1 
ATOM 1436 O OH  . TYR A 1 185  ? 5.829   15.683  -56.608 1.00 66.36  ? 182  TYR A OH  1 
ATOM 1437 N N   . GLN A 1 186  ? 0.395   18.608  -53.213 1.00 64.26  ? 183  GLN A N   1 
ATOM 1438 C CA  . GLN A 1 186  ? 0.024   19.543  -54.295 1.00 64.26  ? 183  GLN A CA  1 
ATOM 1439 C C   . GLN A 1 186  ? 1.149   20.556  -54.597 1.00 64.26  ? 183  GLN A C   1 
ATOM 1440 O O   . GLN A 1 186  ? 1.787   21.086  -53.688 1.00 64.26  ? 183  GLN A O   1 
ATOM 1441 C CB  . GLN A 1 186  ? -1.271  20.291  -53.955 1.00 65.75  ? 183  GLN A CB  1 
ATOM 1442 C CG  . GLN A 1 186  ? -1.719  21.257  -55.050 1.00 65.75  ? 183  GLN A CG  1 
ATOM 1443 C CD  . GLN A 1 186  ? -2.755  22.300  -54.598 1.00 65.75  ? 183  GLN A CD  1 
ATOM 1444 O OE1 . GLN A 1 186  ? -3.760  21.965  -53.962 1.00 65.75  ? 183  GLN A OE1 1 
ATOM 1445 N NE2 . GLN A 1 186  ? -2.524  23.566  -54.962 1.00 65.75  ? 183  GLN A NE2 1 
ATOM 1446 N N   . ASP A 1 187  ? 1.400   20.809  -55.876 1.00 74.76  ? 184  ASP A N   1 
ATOM 1447 C CA  . ASP A 1 187  ? 2.196   21.967  -56.298 1.00 74.76  ? 184  ASP A CA  1 
ATOM 1448 C C   . ASP A 1 187  ? 1.451   22.649  -57.437 1.00 74.76  ? 184  ASP A C   1 
ATOM 1449 O O   . ASP A 1 187  ? 0.375   22.184  -57.847 1.00 74.76  ? 184  ASP A O   1 
ATOM 1450 C CB  . ASP A 1 187  ? 3.598   21.548  -56.741 1.00 61.20  ? 184  ASP A CB  1 
ATOM 1451 C CG  . ASP A 1 187  ? 3.576   20.467  -57.807 1.00 61.20  ? 184  ASP A CG  1 
ATOM 1452 O OD1 . ASP A 1 187  ? 2.759   20.586  -58.739 1.00 61.20  ? 184  ASP A OD1 1 
ATOM 1453 O OD2 . ASP A 1 187  ? 4.378   19.505  -57.720 1.00 61.20  ? 184  ASP A OD2 1 
ATOM 1454 N N   . PRO A 1 188  ? 1.996   23.756  -57.958 1.00 99.29  ? 185  PRO A N   1 
ATOM 1455 C CA  . PRO A 1 188  ? 1.347   24.242  -59.174 1.00 99.29  ? 185  PRO A CA  1 
ATOM 1456 C C   . PRO A 1 188  ? 0.576   23.470  -60.224 1.00 99.29  ? 185  PRO A C   1 
ATOM 1457 O O   . PRO A 1 188  ? -0.580  23.796  -60.455 1.00 99.29  ? 185  PRO A O   1 
ATOM 1458 C CB  . PRO A 1 188  ? 2.056   25.566  -59.443 1.00 55.10  ? 185  PRO A CB  1 
ATOM 1459 C CG  . PRO A 1 188  ? 3.429   25.397  -58.794 1.00 55.10  ? 185  PRO A CG  1 
ATOM 1460 C CD  . PRO A 1 188  ? 3.152   24.581  -57.555 1.00 55.10  ? 185  PRO A CD  1 
ATOM 1461 N N   . GLN A 1 189  ? 1.222   22.494  -60.866 1.00 118.56 ? 186  GLN A N   1 
ATOM 1462 C CA  . GLN A 1 189  ? 0.719   21.784  -62.074 1.00 118.56 ? 186  GLN A CA  1 
ATOM 1463 C C   . GLN A 1 189  ? -0.338  20.738  -61.727 1.00 118.56 ? 186  GLN A C   1 
ATOM 1464 O O   . GLN A 1 189  ? -0.962  20.152  -62.619 1.00 118.56 ? 186  GLN A O   1 
ATOM 1465 C CB  . GLN A 1 189  ? 2.086   21.099  -62.159 1.00 92.69  ? 186  GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 189  ? 3.122   21.872  -62.949 1.00 92.69  ? 186  GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 189  ? 4.365   22.131  -62.126 1.00 92.69  ? 186  GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 189  ? 5.040   21.202  -61.679 1.00 92.69  ? 186  GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 189  ? 4.655   23.407  -61.886 1.00 92.69  ? 186  GLN A NE2 1 
ATOM 1470 N N   . GLY A 1 190  ? -0.515  20.498  -60.427 1.00 97.71  ? 187  GLY A N   1 
ATOM 1471 C CA  . GLY A 1 190  ? -1.566  19.621  -59.926 1.00 97.71  ? 187  GLY A CA  1 
ATOM 1472 C C   . GLY A 1 190  ? -1.186  18.915  -58.644 1.00 97.71  ? 187  GLY A C   1 
ATOM 1473 O O   . GLY A 1 190  ? -0.536  19.494  -57.779 1.00 97.71  ? 187  GLY A O   1 
ATOM 1474 N N   . ARG A 1 191  ? -1.614  17.662  -58.527 1.00 55.85  ? 188  ARG A N   1 
ATOM 1475 C CA  . ARG A 1 191  ? -1.288  16.806  -57.388 1.00 55.85  ? 188  ARG A CA  1 
ATOM 1476 C C   . ARG A 1 191  ? -0.624  15.549  -57.896 1.00 55.85  ? 188  ARG A C   1 
ATOM 1477 O O   . ARG A 1 191  ? -0.845  15.116  -59.027 1.00 55.85  ? 188  ARG A O   1 
ATOM 1478 C CB  . ARG A 1 191  ? -2.528  16.412  -56.572 1.00 62.90  ? 188  ARG A CB  1 
ATOM 1479 C CG  . ARG A 1 191  ? -3.088  17.480  -55.655 1.00 62.90  ? 188  ARG A CG  1 
ATOM 1480 C CD  . ARG A 1 191  ? -4.549  17.139  -55.329 1.00 62.90  ? 188  ARG A CD  1 
ATOM 1481 N NE  . ARG A 1 191  ? -4.977  17.629  -54.021 1.00 62.90  ? 188  ARG A NE  1 
ATOM 1482 C CZ  . ARG A 1 191  ? -5.401  18.868  -53.775 1.00 62.90  ? 188  ARG A CZ  1 
ATOM 1483 N NH1 . ARG A 1 191  ? -5.469  19.791  -54.732 1.00 62.90  ? 188  ARG A NH1 1 
ATOM 1484 N NH2 . ARG A 1 191  ? -5.748  19.191  -52.548 1.00 62.90  ? 188  ARG A NH2 1 
ATOM 1485 N N   . HIS A 1 192  ? 0.187   14.966  -57.035 1.00 67.90  ? 189  HIS A N   1 
ATOM 1486 C CA  . HIS A 1 192  ? 1.117   13.969  -57.453 1.00 67.90  ? 189  HIS A CA  1 
ATOM 1487 C C   . HIS A 1 192  ? 1.284   13.055  -56.283 1.00 67.90  ? 189  HIS A C   1 
ATOM 1488 O O   . HIS A 1 192  ? 0.950   13.424  -55.153 1.00 67.90  ? 189  HIS A O   1 
ATOM 1489 C CB  . HIS A 1 192  ? 2.479   14.604  -57.788 1.00 70.43  ? 189  HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 192  ? 2.404   15.740  -58.756 1.00 70.43  ? 189  HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 192  ? 2.098   17.029  -58.369 1.00 70.43  ? 189  HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 192  ? 2.599   15.782  -60.096 1.00 70.43  ? 189  HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 192  ? 2.098   17.814  -59.432 1.00 70.43  ? 189  HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 192  ? 2.400   17.084  -60.491 1.00 70.43  ? 189  HIS A NE2 1 
ATOM 1495 N N   . VAL A 1 193  ? 1.833   11.878  -56.560 1.00 59.40  ? 190  VAL A N   1 
ATOM 1496 C CA  . VAL A 1 193  ? 2.003   10.856  -55.572 1.00 59.40  ? 190  VAL A CA  1 
ATOM 1497 C C   . VAL A 1 193  ? 3.513   10.492  -55.503 1.00 59.40  ? 190  VAL A C   1 
ATOM 1498 O O   . VAL A 1 193  ? 4.196   10.481  -56.523 1.00 59.40  ? 190  VAL A O   1 
ATOM 1499 C CB  . VAL A 1 193  ? 1.104   9.672   -55.928 1.00 49.92  ? 190  VAL A CB  1 
ATOM 1500 C CG1 . VAL A 1 193  ? 1.557   9.020   -57.223 1.00 49.92  ? 190  VAL A CG1 1 
ATOM 1501 C CG2 . VAL A 1 193  ? 1.113   8.638   -54.836 1.00 49.92  ? 190  VAL A CG2 1 
ATOM 1502 N N   . LYS A 1 194  ? 4.033   10.213  -54.306 1.00 49.75  ? 191  LYS A N   1 
ATOM 1503 C CA  . LYS A 1 194  ? 5.462   10.050  -54.151 1.00 49.75  ? 191  LYS A CA  1 
ATOM 1504 C C   . LYS A 1 194  ? 5.821   9.117   -53.003 1.00 49.75  ? 191  LYS A C   1 
ATOM 1505 O O   . LYS A 1 194  ? 5.027   8.919   -52.082 1.00 49.75  ? 191  LYS A O   1 
ATOM 1506 C CB  . LYS A 1 194  ? 6.097   11.418  -53.959 1.00 66.92  ? 191  LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 194  ? 7.489   11.554  -54.545 1.00 66.92  ? 191  LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 194  ? 7.742   13.011  -54.981 1.00 66.92  ? 191  LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 194  ? 9.232   13.365  -54.949 1.00 66.92  ? 191  LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 194  ? 9.802   13.204  -53.586 1.00 66.92  ? 191  LYS A NZ  1 
ATOM 1511 N N   . THR A 1 195  ? 7.010   8.530   -53.066 1.00 48.86  ? 192  THR A N   1 
ATOM 1512 C CA  . THR A 1 195  ? 7.426   7.581   -52.049 1.00 48.86  ? 192  THR A CA  1 
ATOM 1513 C C   . THR A 1 195  ? 8.817   7.895   -51.524 1.00 48.86  ? 192  THR A C   1 
ATOM 1514 O O   . THR A 1 195  ? 9.565   8.660   -52.164 1.00 48.86  ? 192  THR A O   1 
ATOM 1515 C CB  . THR A 1 195  ? 7.427   6.183   -52.627 1.00 43.81  ? 192  THR A CB  1 
ATOM 1516 O OG1 . THR A 1 195  ? 7.994   6.233   -53.945 1.00 43.81  ? 192  THR A OG1 1 
ATOM 1517 C CG2 . THR A 1 195  ? 5.991   5.709   -52.729 1.00 43.81  ? 192  THR A CG2 1 
ATOM 1518 N N   . TYR A 1 196  ? 9.160   7.336   -50.363 1.00 52.18  ? 193  TYR A N   1 
ATOM 1519 C CA  . TYR A 1 196  ? 10.511  7.495   -49.785 1.00 52.18  ? 193  TYR A CA  1 
ATOM 1520 C C   . TYR A 1 196  ? 10.705  6.383   -48.802 1.00 52.18  ? 193  TYR A C   1 
ATOM 1521 O O   . TYR A 1 196  ? 9.820   6.137   -47.965 1.00 52.18  ? 193  TYR A O   1 
ATOM 1522 C CB  . TYR A 1 196  ? 10.689  8.779   -48.961 1.00 55.87  ? 193  TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 196  ? 10.701  10.129  -49.657 1.00 55.87  ? 193  TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 196  ? 9.855   11.142  -49.207 1.00 55.87  ? 193  TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 196  ? 11.587  10.427  -50.703 1.00 55.87  ? 193  TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 196  ? 9.865   12.410  -49.792 1.00 55.87  ? 193  TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 196  ? 11.601  11.695  -51.300 1.00 55.87  ? 193  TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 196  ? 10.729  12.681  -50.832 1.00 55.87  ? 193  TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 196  ? 10.666  13.945  -51.381 1.00 55.87  ? 193  TYR A OH  1 
ATOM 1530 N N   . GLU A 1 197  ? 11.858  5.729   -48.849 1.00 53.42  ? 194  GLU A N   1 
ATOM 1531 C CA  . GLU A 1 197  ? 12.212  4.819   -47.757 1.00 53.42  ? 194  GLU A CA  1 
ATOM 1532 C C   . GLU A 1 197  ? 12.569  5.728   -46.589 1.00 53.42  ? 194  GLU A C   1 
ATOM 1533 O O   . GLU A 1 197  ? 12.549  6.847   -46.609 1.00 53.42  ? 194  GLU A O   1 
ATOM 1534 C CB  . GLU A 1 197  ? 13.390  3.923   -48.138 1.00 94.70  ? 194  GLU A CB  1 
ATOM 1535 C CG  . GLU A 1 197  ? 13.056  2.950   -49.259 1.00 94.70  ? 194  GLU A CG  1 
ATOM 1536 C CD  . GLU A 1 197  ? 14.142  1.918   -49.521 1.00 94.70  ? 194  GLU A CD  1 
ATOM 1537 O OE1 . GLU A 1 197  ? 13.786  0.717   -49.630 1.00 94.70  ? 194  GLU A OE1 1 
ATOM 1538 O OE2 . GLU A 1 197  ? 15.334  2.304   -49.618 1.00 94.70  ? 194  GLU A OE2 1 
ATOM 1539 N N   . VAL A 1 198  ? 12.550  5.195   -45.379 1.00 93.12  ? 195  VAL A N   1 
ATOM 1540 C CA  . VAL A 1 198  ? 13.109  5.955   -44.286 1.00 93.12  ? 195  VAL A CA  1 
ATOM 1541 C C   . VAL A 1 198  ? 14.169  5.121   -43.615 1.00 93.12  ? 195  VAL A C   1 
ATOM 1542 O O   . VAL A 1 198  ? 13.877  4.073   -43.008 1.00 93.12  ? 195  VAL A O   1 
ATOM 1543 C CB  . VAL A 1 198  ? 12.055  6.529   -43.292 1.00 62.25  ? 195  VAL A CB  1 
ATOM 1544 C CG1 . VAL A 1 198  ? 12.731  7.213   -42.117 1.00 62.25  ? 195  VAL A CG1 1 
ATOM 1545 C CG2 . VAL A 1 198  ? 11.207  7.558   -43.976 1.00 62.25  ? 195  VAL A CG2 1 
ATOM 1546 N N   . SER A 1 199  ? 15.407  5.580   -43.799 1.00 83.67  ? 196  SER A N   1 
ATOM 1547 C CA  . SER A 1 199  ? 16.567  5.020   -43.141 1.00 83.67  ? 196  SER A CA  1 
ATOM 1548 C C   . SER A 1 199  ? 16.840  5.954   -41.994 1.00 83.67  ? 196  SER A C   1 
ATOM 1549 O O   . SER A 1 199  ? 17.124  7.137   -42.192 1.00 83.67  ? 196  SER A O   1 
ATOM 1550 C CB  . SER A 1 199  ? 17.760  4.944   -44.095 1.00 127.06 ? 196  SER A CB  1 
ATOM 1551 O OG  . SER A 1 199  ? 18.697  3.963   -43.671 1.00 127.06 ? 196  SER A OG  1 
ATOM 1552 N N   . LEU A 1 200  ? 16.703  5.401   -40.795 1.00 110.01 ? 197  LEU A N   1 
ATOM 1553 C CA  . LEU A 1 200  ? 16.816  6.149   -39.553 1.00 110.01 ? 197  LEU A CA  1 
ATOM 1554 C C   . LEU A 1 200  ? 18.251  6.171   -39.049 1.00 110.01 ? 197  LEU A C   1 
ATOM 1555 O O   . LEU A 1 200  ? 18.652  7.070   -38.303 1.00 110.01 ? 197  LEU A O   1 
ATOM 1556 C CB  . LEU A 1 200  ? 15.855  5.593   -38.497 1.00 60.22  ? 197  LEU A CB  1 
ATOM 1557 C CG  . LEU A 1 200  ? 15.566  4.100   -38.397 1.00 60.22  ? 197  LEU A CG  1 
ATOM 1558 C CD1 . LEU A 1 200  ? 14.555  3.852   -37.267 1.00 60.22  ? 197  LEU A CD1 1 
ATOM 1559 C CD2 . LEU A 1 200  ? 15.065  3.500   -39.733 1.00 60.22  ? 197  LEU A CD2 1 
ATOM 1560 N N   . ARG A 1 201  ? 19.039  5.216   -39.512 1.00 153.47 ? 198  ARG A N   1 
ATOM 1561 C CA  . ARG A 1 201  ? 20.422  5.183   -39.134 1.00 153.47 ? 198  ARG A CA  1 
ATOM 1562 C C   . ARG A 1 201  ? 20.952  6.571   -39.454 1.00 153.47 ? 198  ARG A C   1 
ATOM 1563 O O   . ARG A 1 201  ? 21.605  7.185   -38.622 1.00 153.47 ? 198  ARG A O   1 
ATOM 1564 C CB  . ARG A 1 201  ? 21.178  4.170   -39.983 1.00 137.85 ? 198  ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 201  ? 21.949  3.114   -39.217 1.00 137.85 ? 198  ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 201  ? 21.993  1.839   -40.029 1.00 137.85 ? 198  ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 201  ? 22.532  0.702   -39.295 1.00 137.85 ? 198  ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 201  ? 23.369  0.800   -38.268 1.00 137.85 ? 198  ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 201  ? 23.760  1.994   -37.838 1.00 137.85 ? 198  ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 201  ? 23.812  -0.300  -37.670 1.00 137.85 ? 198  ARG A NH2 1 
ATOM 1571 N N   . GLU A 1 202  ? 20.680  7.074   -40.653 1.00 73.12  ? 199  GLU A N   1 
ATOM 1572 C CA  . GLU A 1 202  ? 21.176  8.388   -41.008 1.00 73.12  ? 199  GLU A CA  1 
ATOM 1573 C C   . GLU A 1 202  ? 20.149  9.469   -41.085 1.00 73.12  ? 199  GLU A C   1 
ATOM 1574 O O   . GLU A 1 202  ? 20.440  10.569  -41.501 1.00 73.12  ? 199  GLU A O   1 
ATOM 1575 C CB  . GLU A 1 202  ? 22.004  8.367   -42.276 1.00 148.77 ? 199  GLU A CB  1 
ATOM 1576 C CG  . GLU A 1 202  ? 21.250  8.188   -43.534 1.00 148.77 ? 199  GLU A CG  1 
ATOM 1577 C CD  . GLU A 1 202  ? 20.815  6.778   -43.695 1.00 148.77 ? 199  GLU A CD  1 
ATOM 1578 O OE1 . GLU A 1 202  ? 21.113  6.143   -44.729 1.00 148.77 ? 199  GLU A OE1 1 
ATOM 1579 O OE2 . GLU A 1 202  ? 20.177  6.302   -42.752 1.00 148.77 ? 199  GLU A OE2 1 
ATOM 1580 N N   . LYS A 1 203  ? 18.953  9.156   -40.637 1.00 81.78  ? 200  LYS A N   1 
ATOM 1581 C CA  . LYS A 1 203  ? 17.870  10.113  -40.621 1.00 81.78  ? 200  LYS A CA  1 
ATOM 1582 C C   . LYS A 1 203  ? 17.666  10.953  -41.846 1.00 81.78  ? 200  LYS A C   1 
ATOM 1583 O O   . LYS A 1 203  ? 17.572  12.153  -41.760 1.00 81.78  ? 200  LYS A O   1 
ATOM 1584 C CB  . LYS A 1 203  ? 18.036  11.030  -39.438 1.00 90.54  ? 200  LYS A CB  1 
ATOM 1585 C CG  . LYS A 1 203  ? 17.721  10.342  -38.168 1.00 90.54  ? 200  LYS A CG  1 
ATOM 1586 C CD  . LYS A 1 203  ? 18.915  9.660   -37.632 1.00 90.54  ? 200  LYS A CD  1 
ATOM 1587 C CE  . LYS A 1 203  ? 19.698  10.648  -36.841 1.00 90.54  ? 200  LYS A CE  1 
ATOM 1588 N NZ  . LYS A 1 203  ? 19.093  11.976  -37.024 1.00 90.54  ? 200  LYS A NZ  1 
ATOM 1589 N N   . GLU A 1 204  ? 17.600  10.301  -43.002 1.00 86.34  ? 201  GLU A N   1 
ATOM 1590 C CA  . GLU A 1 204  ? 17.405  11.000  -44.267 1.00 86.34  ? 201  GLU A CA  1 
ATOM 1591 C C   . GLU A 1 204  ? 16.025  10.715  -44.850 1.00 86.34  ? 201  GLU A C   1 
ATOM 1592 O O   . GLU A 1 204  ? 15.005  11.058  -44.252 1.00 86.34  ? 201  GLU A O   1 
ATOM 1593 C CB  . GLU A 1 204  ? 18.491  10.607  -45.270 1.00 114.63 ? 201  GLU A CB  1 
ATOM 1594 C CG  . GLU A 1 204  ? 19.321  9.405   -44.847 1.00 114.63 ? 201  GLU A CG  1 
ATOM 1595 C CD  . GLU A 1 204  ? 20.575  9.242   -45.682 1.00 114.63 ? 201  GLU A CD  1 
ATOM 1596 O OE1 . GLU A 1 204  ? 20.513  8.554   -46.723 1.00 114.63 ? 201  GLU A OE1 1 
ATOM 1597 O OE2 . GLU A 1 204  ? 21.624  9.800   -45.298 1.00 114.63 ? 201  GLU A OE2 1 
ATOM 1598 N N   . PHE A 1 205  ? 15.918  10.141  -46.000 1.00 94.62  ? 202  PHE A N   1 
ATOM 1599 C CA  . PHE A 1 205  ? 14.717  9.725   -46.661 1.00 94.62  ? 202  PHE A CA  1 
ATOM 1600 C C   . PHE A 1 205  ? 15.001  8.633   -47.727 1.00 94.62  ? 202  PHE A C   1 
ATOM 1601 O O   . PHE A 1 205  ? 14.127  7.638   -48.094 1.00 94.62  ? 202  PHE A O   1 
ATOM 1602 C CB  . PHE A 1 205  ? 14.078  10.881  -47.404 1.00 63.83  ? 202  PHE A CB  1 
ATOM 1603 C CG  . PHE A 1 205  ? 12.802  11.339  -46.797 1.00 63.83  ? 202  PHE A CG  1 
ATOM 1604 C CD1 . PHE A 1 205  ? 12.235  12.519  -47.161 1.00 63.83  ? 202  PHE A CD1 1 
ATOM 1605 C CD2 . PHE A 1 205  ? 12.179  10.588  -45.850 1.00 63.83  ? 202  PHE A CD2 1 
ATOM 1606 C CE1 . PHE A 1 205  ? 11.079  12.927  -46.601 1.00 63.83  ? 202  PHE A CE1 1 
ATOM 1607 C CE2 . PHE A 1 205  ? 11.032  10.998  -45.294 1.00 63.83  ? 202  PHE A CE2 1 
ATOM 1608 C CZ  . PHE A 1 205  ? 10.479  12.166  -45.668 1.00 63.83  ? 202  PHE A CZ  1 
ATOM 1609 N N   . ASN A 1 206  ? 16.035  8.845   -48.431 1.00 66.64  ? 203  ASN A N   1 
ATOM 1610 C CA  . ASN A 1 206  ? 16.387  7.860   -49.496 1.00 66.64  ? 203  ASN A CA  1 
ATOM 1611 C C   . ASN A 1 206  ? 15.370  7.812   -50.588 1.00 66.64  ? 203  ASN A C   1 
ATOM 1612 O O   . ASN A 1 206  ? 14.654  8.751   -50.760 1.00 66.64  ? 203  ASN A O   1 
ATOM 1613 C CB  . ASN A 1 206  ? 16.584  6.506   -48.852 1.00 64.20  ? 203  ASN A CB  1 
ATOM 1614 C CG  . ASN A 1 206  ? 18.016  6.247   -48.508 1.00 64.20  ? 203  ASN A CG  1 
ATOM 1615 O OD1 . ASN A 1 206  ? 18.523  6.747   -47.518 1.00 64.20  ? 203  ASN A OD1 1 
ATOM 1616 N ND2 . ASN A 1 206  ? 18.687  5.465   -49.332 1.00 64.20  ? 203  ASN A ND2 1 
ATOM 1617 N N   . LYS A 1 207  ? 15.307  6.741   -51.353 1.00 85.86  ? 204  LYS A N   1 
ATOM 1618 C CA  . LYS A 1 207  ? 14.457  6.789   -52.514 1.00 85.86  ? 204  LYS A CA  1 
ATOM 1619 C C   . LYS A 1 207  ? 13.458  5.690   -52.556 1.00 85.86  ? 204  LYS A C   1 
ATOM 1620 O O   . LYS A 1 207  ? 13.770  4.551   -52.312 1.00 85.86  ? 204  LYS A O   1 
ATOM 1621 C CB  . LYS A 1 207  ? 15.332  6.681   -53.754 1.00 172.11 ? 204  LYS A CB  1 
ATOM 1622 C CG  . LYS A 1 207  ? 15.109  7.754   -54.805 1.00 172.11 ? 204  LYS A CG  1 
ATOM 1623 C CD  . LYS A 1 207  ? 16.164  7.664   -55.890 1.00 172.11 ? 204  LYS A CD  1 
ATOM 1624 C CE  . LYS A 1 207  ? 16.879  8.992   -56.100 1.00 172.11 ? 204  LYS A CE  1 
ATOM 1625 N NZ  . LYS A 1 207  ? 18.345  8.920   -55.856 1.00 172.11 ? 204  LYS A NZ  1 
ATOM 1626 N N   . GLY A 1 208  ? 12.251  6.050   -52.937 1.00 87.22  ? 205  GLY A N   1 
ATOM 1627 C CA  . GLY A 1 208  ? 11.133  5.126   -52.933 1.00 87.22  ? 205  GLY A CA  1 
ATOM 1628 C C   . GLY A 1 208  ? 11.152  4.230   -54.133 1.00 87.22  ? 205  GLY A C   1 
ATOM 1629 O O   . GLY A 1 208  ? 11.791  4.529   -55.114 1.00 87.22  ? 205  GLY A O   1 
ATOM 1630 N N   . PRO A 1 209  ? 10.442  3.127   -54.060 1.00 73.98  ? 206  PRO A N   1 
ATOM 1631 C CA  . PRO A 1 209  ? 10.425  2.182   -55.154 1.00 73.98  ? 206  PRO A CA  1 
ATOM 1632 C C   . PRO A 1 209  ? 9.563   2.520   -56.329 1.00 73.98  ? 206  PRO A C   1 
ATOM 1633 O O   . PRO A 1 209  ? 9.654   1.828   -57.305 1.00 73.98  ? 206  PRO A O   1 
ATOM 1634 C CB  . PRO A 1 209  ? 9.850   0.932   -54.496 1.00 89.93  ? 206  PRO A CB  1 
ATOM 1635 C CG  . PRO A 1 209  ? 9.653   1.253   -53.075 1.00 89.93  ? 206  PRO A CG  1 
ATOM 1636 C CD  . PRO A 1 209  ? 9.582   2.696   -52.965 1.00 89.93  ? 206  PRO A CD  1 
ATOM 1637 N N   . TRP A 1 210  ? 8.831   3.601   -56.306 1.00 61.61  ? 207  TRP A N   1 
ATOM 1638 C CA  . TRP A 1 210  ? 8.115   3.876   -57.510 1.00 61.61  ? 207  TRP A CA  1 
ATOM 1639 C C   . TRP A 1 210  ? 8.014   5.317   -57.906 1.00 61.61  ? 207  TRP A C   1 
ATOM 1640 O O   . TRP A 1 210  ? 7.730   6.176   -57.114 1.00 61.61  ? 207  TRP A O   1 
ATOM 1641 C CB  . TRP A 1 210  ? 6.854   3.071   -57.693 1.00 81.53  ? 207  TRP A CB  1 
ATOM 1642 C CG  . TRP A 1 210  ? 5.783   3.252   -56.748 1.00 81.53  ? 207  TRP A CG  1 
ATOM 1643 C CD1 . TRP A 1 210  ? 4.900   4.267   -56.709 1.00 81.53  ? 207  TRP A CD1 1 
ATOM 1644 C CD2 . TRP A 1 210  ? 5.383   2.328   -55.757 1.00 81.53  ? 207  TRP A CD2 1 
ATOM 1645 N NE1 . TRP A 1 210  ? 3.986   4.057   -55.718 1.00 81.53  ? 207  TRP A NE1 1 
ATOM 1646 C CE2 . TRP A 1 210  ? 4.267   2.866   -55.116 1.00 81.53  ? 207  TRP A CE2 1 
ATOM 1647 C CE3 . TRP A 1 210  ? 5.875   1.108   -55.335 1.00 81.53  ? 207  TRP A CE3 1 
ATOM 1648 C CZ2 . TRP A 1 210  ? 3.640   2.233   -54.080 1.00 81.53  ? 207  TRP A CZ2 1 
ATOM 1649 C CZ3 . TRP A 1 210  ? 5.262   0.486   -54.319 1.00 81.53  ? 207  TRP A CZ3 1 
ATOM 1650 C CH2 . TRP A 1 210  ? 4.149   1.039   -53.696 1.00 81.53  ? 207  TRP A CH2 1 
ATOM 1651 N N   . LYS A 1 211  ? 8.284   5.542   -59.175 1.00 58.28  ? 208  LYS A N   1 
ATOM 1652 C CA  . LYS A 1 211  ? 8.259   6.848   -59.754 1.00 58.28  ? 208  LYS A CA  1 
ATOM 1653 C C   . LYS A 1 211  ? 7.094   7.589   -59.228 1.00 58.28  ? 208  LYS A C   1 
ATOM 1654 O O   . LYS A 1 211  ? 6.225   7.033   -58.620 1.00 58.28  ? 208  LYS A O   1 
ATOM 1655 C CB  . LYS A 1 211  ? 8.230   6.784   -61.269 1.00 95.33  ? 208  LYS A CB  1 
ATOM 1656 C CG  . LYS A 1 211  ? 9.518   7.236   -61.924 1.00 95.33  ? 208  LYS A CG  1 
ATOM 1657 C CD  . LYS A 1 211  ? 10.285  6.054   -62.484 1.00 95.33  ? 208  LYS A CD  1 
ATOM 1658 C CE  . LYS A 1 211  ? 11.785  6.290   -62.478 1.00 95.33  ? 208  LYS A CE  1 
ATOM 1659 N NZ  . LYS A 1 211  ? 12.555  5.027   -62.518 1.00 95.33  ? 208  LYS A NZ  1 
ATOM 1660 N N   . GLN A 1 212  ? 7.099   8.873   -59.487 1.00 76.36  ? 209  GLN A N   1 
ATOM 1661 C CA  . GLN A 1 212  ? 6.087   9.763   -59.018 1.00 76.36  ? 209  GLN A CA  1 
ATOM 1662 C C   . GLN A 1 212  ? 5.150   9.890   -60.133 1.00 76.36  ? 209  GLN A C   1 
ATOM 1663 O O   . GLN A 1 212  ? 5.503   10.300  -61.213 1.00 76.36  ? 209  GLN A O   1 
ATOM 1664 C CB  . GLN A 1 212  ? 6.633   11.140  -58.755 1.00 136.20 ? 209  GLN A CB  1 
ATOM 1665 C CG  . GLN A 1 212  ? 6.008   12.153  -59.675 1.00 136.20 ? 209  GLN A CG  1 
ATOM 1666 C CD  . GLN A 1 212  ? 6.523   13.558  -59.460 1.00 136.20 ? 209  GLN A CD  1 
ATOM 1667 O OE1 . GLN A 1 212  ? 7.144   13.857  -58.444 1.00 136.20 ? 209  GLN A OE1 1 
ATOM 1668 N NE2 . GLN A 1 212  ? 6.266   14.433  -60.424 1.00 136.20 ? 209  GLN A NE2 1 
ATOM 1669 N N   . GLU A 1 213  ? 3.927   9.533   -59.865 1.00 85.53  ? 210  GLU A N   1 
ATOM 1670 C CA  . GLU A 1 213  ? 2.920   9.627   -60.909 1.00 85.53  ? 210  GLU A CA  1 
ATOM 1671 C C   . GLU A 1 213  ? 1.985   10.785  -60.569 1.00 85.53  ? 210  GLU A C   1 
ATOM 1672 O O   . GLU A 1 213  ? 2.047   11.306  -59.459 1.00 85.53  ? 210  GLU A O   1 
ATOM 1673 C CB  . GLU A 1 213  ? 2.152   8.306   -61.033 1.00 122.94 ? 210  GLU A CB  1 
ATOM 1674 C CG  . GLU A 1 213  ? 3.025   7.034   -61.022 1.00 122.94 ? 210  GLU A CG  1 
ATOM 1675 C CD  . GLU A 1 213  ? 3.893   6.838   -62.275 1.00 122.94 ? 210  GLU A CD  1 
ATOM 1676 O OE1 . GLU A 1 213  ? 3.774   7.621   -63.247 1.00 122.94 ? 210  GLU A OE1 1 
ATOM 1677 O OE2 . GLU A 1 213  ? 4.698   5.879   -62.283 1.00 122.94 ? 210  GLU A OE2 1 
ATOM 1678 N N   . ASN A 1 214  ? 1.146   11.206  -61.517 1.00 108.90 ? 211  ASN A N   1 
ATOM 1679 C CA  . ASN A 1 214  ? 0.067   12.148  -61.207 1.00 108.90 ? 211  ASN A CA  1 
ATOM 1680 C C   . ASN A 1 214  ? -1.098  11.454  -60.505 1.00 108.90 ? 211  ASN A C   1 
ATOM 1681 O O   . ASN A 1 214  ? -1.185  10.229  -60.501 1.00 108.90 ? 211  ASN A O   1 
ATOM 1682 C CB  . ASN A 1 214  ? -0.468  12.832  -62.470 1.00 69.91  ? 211  ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 214  ? 0.579   13.689  -63.184 1.00 69.91  ? 211  ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 214  ? 1.091   14.667  -62.638 1.00 69.91  ? 211  ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 214  ? 0.857   13.343  -64.434 1.00 69.91  ? 211  ASN A ND2 1 
ATOM 1686 N N   . VAL A 1 215  ? -1.973  12.256  -59.903 1.00 44.92  ? 212  VAL A N   1 
ATOM 1687 C CA  . VAL A 1 215  ? -3.272  11.829  -59.366 1.00 44.92  ? 212  VAL A CA  1 
ATOM 1688 C C   . VAL A 1 215  ? -4.189  13.035  -59.502 1.00 44.92  ? 212  VAL A C   1 
ATOM 1689 O O   . VAL A 1 215  ? -3.702  14.133  -59.717 1.00 44.92  ? 212  VAL A O   1 
ATOM 1690 C CB  . VAL A 1 215  ? -3.175  11.403  -57.893 1.00 75.25  ? 212  VAL A CB  1 
ATOM 1691 C CG1 . VAL A 1 215  ? -2.417  10.095  -57.756 1.00 75.25  ? 212  VAL A CG1 1 
ATOM 1692 C CG2 . VAL A 1 215  ? -2.517  12.491  -57.061 1.00 75.25  ? 212  VAL A CG2 1 
ATOM 1693 N N   . GLU A 1 216  ? -5.503  12.883  -59.369 1.00 48.04  ? 213  GLU A N   1 
ATOM 1694 C CA  . GLU A 1 216  ? -6.396  14.064  -59.619 1.00 48.04  ? 213  GLU A CA  1 
ATOM 1695 C C   . GLU A 1 216  ? -6.335  15.342  -58.719 1.00 48.04  ? 213  GLU A C   1 
ATOM 1696 O O   . GLU A 1 216  ? -6.062  15.304  -57.506 1.00 48.04  ? 213  GLU A O   1 
ATOM 1697 C CB  . GLU A 1 216  ? -7.854  13.637  -59.767 1.00 48.04  ? 213  GLU A CB  1 
ATOM 1698 C CG  . GLU A 1 216  ? -8.281  12.674  -58.716 1.00 48.04  ? 213  GLU A CG  1 
ATOM 1699 C CD  . GLU A 1 216  ? -9.790  12.612  -58.544 1.00 48.04  ? 213  GLU A CD  1 
ATOM 1700 O OE1 . GLU A 1 216  ? -10.312 11.469  -58.535 1.00 48.04  ? 213  GLU A OE1 1 
ATOM 1701 O OE2 . GLU A 1 216  ? -10.426 13.695  -58.382 1.00 48.04  ? 213  GLU A OE2 1 
ATOM 1702 N N   . ALA A 1 217  ? -6.617  16.460  -59.380 1.00 57.39  ? 214  ALA A N   1 
ATOM 1703 C CA  . ALA A 1 217  ? -7.050  17.699  -58.751 1.00 57.39  ? 214  ALA A CA  1 
ATOM 1704 C C   . ALA A 1 217  ? -7.689  17.554  -57.362 1.00 57.39  ? 214  ALA A C   1 
ATOM 1705 O O   . ALA A 1 217  ? -7.440  18.392  -56.496 1.00 57.39  ? 214  ALA A O   1 
ATOM 1706 C CB  . ALA A 1 217  ? -8.008  18.442  -59.667 1.00 36.73  ? 214  ALA A CB  1 
ATOM 1707 N N   . GLU A 1 218  ? -8.516  16.537  -57.117 1.00 63.34  ? 215  GLU A N   1 
ATOM 1708 C CA  . GLU A 1 218  ? -9.087  16.435  -55.783 1.00 63.34  ? 215  GLU A CA  1 
ATOM 1709 C C   . GLU A 1 218  ? -8.700  15.201  -55.008 1.00 63.34  ? 215  GLU A C   1 
ATOM 1710 O O   . GLU A 1 218  ? -9.356  14.841  -54.043 1.00 63.34  ? 215  GLU A O   1 
ATOM 1711 C CB  . GLU A 1 218  ? -10.586 16.680  -55.791 1.00 84.30  ? 215  GLU A CB  1 
ATOM 1712 C CG  . GLU A 1 218  ? -10.975 18.089  -56.234 1.00 84.30  ? 215  GLU A CG  1 
ATOM 1713 C CD  . GLU A 1 218  ? -10.357 19.212  -55.392 1.00 84.30  ? 215  GLU A CD  1 
ATOM 1714 O OE1 . GLU A 1 218  ? -10.048 18.994  -54.188 1.00 84.30  ? 215  GLU A OE1 1 
ATOM 1715 O OE2 . GLU A 1 218  ? -10.195 20.331  -55.945 1.00 84.30  ? 215  GLU A OE2 1 
ATOM 1716 N N   . ALA A 1 219  ? -7.620  14.559  -55.409 1.00 65.29  ? 216  ALA A N   1 
ATOM 1717 C CA  . ALA A 1 219  ? -7.075  13.460  -54.625 1.00 65.29  ? 216  ALA A CA  1 
ATOM 1718 C C   . ALA A 1 219  ? -6.910  13.825  -53.125 1.00 65.29  ? 216  ALA A C   1 
ATOM 1719 O O   . ALA A 1 219  ? -6.221  14.810  -52.802 1.00 65.29  ? 216  ALA A O   1 
ATOM 1720 C CB  . ALA A 1 219  ? -5.753  13.046  -55.209 1.00 40.51  ? 216  ALA A CB  1 
ATOM 1721 N N   . SER A 1 220  ? -7.531  13.040  -52.224 1.00 40.84  ? 217  SER A N   1 
ATOM 1722 C CA  . SER A 1 220  ? -7.504  13.350  -50.787 1.00 40.84  ? 217  SER A CA  1 
ATOM 1723 C C   . SER A 1 220  ? -7.236  12.222  -49.789 1.00 40.84  ? 217  SER A C   1 
ATOM 1724 O O   . SER A 1 220  ? -6.977  12.476  -48.618 1.00 40.84  ? 217  SER A O   1 
ATOM 1725 C CB  . SER A 1 220  ? -8.806  13.998  -50.391 1.00 33.99  ? 217  SER A CB  1 
ATOM 1726 O OG  . SER A 1 220  ? -9.761  12.987  -50.090 1.00 33.99  ? 217  SER A OG  1 
ATOM 1727 N N   . MET A 1 221  ? -7.321  10.979  -50.213 1.00 37.27  ? 218  MET A N   1 
ATOM 1728 C CA  . MET A 1 221  ? -7.123  9.899   -49.272 1.00 37.27  ? 218  MET A CA  1 
ATOM 1729 C C   . MET A 1 221  ? -6.168  8.894   -49.832 1.00 37.27  ? 218  MET A C   1 
ATOM 1730 O O   . MET A 1 221  ? -6.246  8.547   -51.015 1.00 37.27  ? 218  MET A O   1 
ATOM 1731 C CB  . MET A 1 221  ? -8.441  9.200   -48.967 1.00 90.18  ? 218  MET A CB  1 
ATOM 1732 C CG  . MET A 1 221  ? -9.555  10.122  -48.586 1.00 90.18  ? 218  MET A CG  1 
ATOM 1733 S SD  . MET A 1 221  ? -10.298 9.547   -47.069 1.00 90.18  ? 218  MET A SD  1 
ATOM 1734 C CE  . MET A 1 221  ? -8.963  9.876   -45.900 1.00 90.18  ? 218  MET A CE  1 
ATOM 1735 N N   . VAL A 1 222  ? -5.285  8.409   -48.968 1.00 51.26  ? 219  VAL A N   1 
ATOM 1736 C CA  . VAL A 1 222  ? -4.336  7.368   -49.315 1.00 51.26  ? 219  VAL A CA  1 
ATOM 1737 C C   . VAL A 1 222  ? -4.665  6.121   -48.511 1.00 51.26  ? 219  VAL A C   1 
ATOM 1738 O O   . VAL A 1 222  ? -4.566  6.157   -47.284 1.00 51.26  ? 219  VAL A O   1 
ATOM 1739 C CB  . VAL A 1 222  ? -2.886  7.776   -48.950 1.00 37.56  ? 219  VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 222  ? -1.868  6.610   -49.246 1.00 37.56  ? 219  VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 222  ? -2.458  9.083   -49.651 1.00 37.56  ? 219  VAL A CG2 1 
ATOM 1742 N N   . ILE A 1 223  ? -5.032  5.021   -49.177 1.00 60.48  ? 220  ILE A N   1 
ATOM 1743 C CA  . ILE A 1 223  ? -5.204  3.744   -48.470 1.00 60.48  ? 220  ILE A CA  1 
ATOM 1744 C C   . ILE A 1 223  ? -4.075  2.769   -48.780 1.00 60.48  ? 220  ILE A C   1 
ATOM 1745 O O   . ILE A 1 223  ? -3.701  2.606   -49.940 1.00 60.48  ? 220  ILE A O   1 
ATOM 1746 C CB  . ILE A 1 223  ? -6.556  3.097   -48.763 1.00 48.42  ? 220  ILE A CB  1 
ATOM 1747 C CG1 . ILE A 1 223  ? -7.695  4.022   -48.320 1.00 48.42  ? 220  ILE A CG1 1 
ATOM 1748 C CG2 . ILE A 1 223  ? -6.656  1.734   -48.059 1.00 48.42  ? 220  ILE A CG2 1 
ATOM 1749 C CD1 . ILE A 1 223  ? -9.086  3.511   -48.677 1.00 48.42  ? 220  ILE A CD1 1 
ATOM 1750 N N   . ALA A 1 224  ? -3.541  2.136   -47.733 1.00 58.03  ? 221  ALA A N   1 
ATOM 1751 C CA  . ALA A 1 224  ? -2.384  1.215   -47.850 1.00 58.03  ? 221  ALA A CA  1 
ATOM 1752 C C   . ALA A 1 224  ? -2.810  -0.252  -47.763 1.00 58.03  ? 221  ALA A C   1 
ATOM 1753 O O   . ALA A 1 224  ? -3.200  -0.744  -46.696 1.00 58.03  ? 221  ALA A O   1 
ATOM 1754 C CB  . ALA A 1 224  ? -1.302  1.509   -46.772 1.00 37.67  ? 221  ALA A CB  1 
ATOM 1755 N N   . VAL A 1 225  ? -2.711  -0.953  -48.884 1.00 68.88  ? 222  VAL A N   1 
ATOM 1756 C CA  . VAL A 1 225  ? -3.303  -2.265  -49.003 1.00 68.88  ? 222  VAL A CA  1 
ATOM 1757 C C   . VAL A 1 225  ? -2.378  -3.332  -48.413 1.00 68.88  ? 222  VAL A C   1 
ATOM 1758 O O   . VAL A 1 225  ? -1.205  -3.421  -48.768 1.00 68.88  ? 222  VAL A O   1 
ATOM 1759 C CB  . VAL A 1 225  ? -3.666  -2.540  -50.457 1.00 80.07  ? 222  VAL A CB  1 
ATOM 1760 C CG1 . VAL A 1 225  ? -4.761  -3.574  -50.532 1.00 80.07  ? 222  VAL A CG1 1 
ATOM 1761 C CG2 . VAL A 1 225  ? -4.127  -1.251  -51.114 1.00 80.07  ? 222  VAL A CG2 1 
ATOM 1762 N N   . PRO A 1 226  ? -2.903  -4.136  -47.485 1.00 47.68  ? 223  PRO A N   1 
ATOM 1763 C CA  . PRO A 1 226  ? -2.076  -5.039  -46.674 1.00 47.68  ? 223  PRO A CA  1 
ATOM 1764 C C   . PRO A 1 226  ? -1.403  -6.142  -47.472 1.00 47.68  ? 223  PRO A C   1 
ATOM 1765 O O   . PRO A 1 226  ? -1.852  -6.474  -48.578 1.00 47.68  ? 223  PRO A O   1 
ATOM 1766 C CB  . PRO A 1 226  ? -3.087  -5.650  -45.695 1.00 71.90  ? 223  PRO A CB  1 
ATOM 1767 C CG  . PRO A 1 226  ? -4.352  -5.589  -46.412 1.00 71.90  ? 223  PRO A CG  1 
ATOM 1768 C CD  . PRO A 1 226  ? -4.322  -4.262  -47.124 1.00 71.90  ? 223  PRO A CD  1 
ATOM 1769 N N   . GLU A 1 227  ? -0.382  -6.732  -46.850 1.00 209.00 ? 224  GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227  ? 0.621   -7.608  -47.481 1.00 209.00 ? 224  GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227  ? 0.226   -8.434  -48.720 1.00 209.00 ? 224  GLU A C   1 
ATOM 1772 O O   . GLU A 1 227  ? 0.839   -8.256  -49.772 1.00 209.00 ? 224  GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227  ? 1.323   -8.489  -46.436 1.00 114.32 ? 224  GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227  ? 2.822   -8.729  -46.742 1.00 114.32 ? 224  GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227  ? 3.381   -10.020 -46.114 1.00 114.32 ? 224  GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227  ? 4.627   -10.172 -46.087 1.00 114.32 ? 224  GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227  ? 2.586   -10.879 -45.656 1.00 114.32 ? 224  GLU A OE2 1 
ATOM 1778 N N   . PRO A 1 228  ? -0.788  -9.324  -48.620 1.00 96.59  ? 225  PRO A N   1 
ATOM 1779 C CA  . PRO A 1 228  ? -1.034  -10.210 -49.780 1.00 96.59  ? 225  PRO A CA  1 
ATOM 1780 C C   . PRO A 1 228  ? -1.223  -9.425  -51.080 1.00 96.59  ? 225  PRO A C   1 
ATOM 1781 O O   . PRO A 1 228  ? -0.911  -9.921  -52.159 1.00 96.59  ? 225  PRO A O   1 
ATOM 1782 C CB  . PRO A 1 228  ? -2.331  -10.936 -49.407 1.00 108.77 ? 225  PRO A CB  1 
ATOM 1783 C CG  . PRO A 1 228  ? -2.926  -10.133 -48.279 1.00 108.77 ? 225  PRO A CG  1 
ATOM 1784 C CD  . PRO A 1 228  ? -1.766  -9.556  -47.542 1.00 108.77 ? 225  PRO A CD  1 
ATOM 1785 N N   . PHE A 1 229  ? -1.700  -8.191  -50.954 1.00 99.70  ? 226  PHE A N   1 
ATOM 1786 C CA  . PHE A 1 229  ? -1.927  -7.319  -52.088 1.00 99.70  ? 226  PHE A CA  1 
ATOM 1787 C C   . PHE A 1 229  ? -0.787  -6.322  -52.261 1.00 99.70  ? 226  PHE A C   1 
ATOM 1788 O O   . PHE A 1 229  ? -0.244  -6.184  -53.352 1.00 99.70  ? 226  PHE A O   1 
ATOM 1789 C CB  . PHE A 1 229  ? -3.230  -6.546  -51.891 1.00 142.52 ? 226  PHE A CB  1 
ATOM 1790 C CG  . PHE A 1 229  ? -4.460  -7.410  -51.808 1.00 142.52 ? 226  PHE A CG  1 
ATOM 1791 C CD1 . PHE A 1 229  ? -4.603  -8.356  -50.798 1.00 142.52 ? 226  PHE A CD1 1 
ATOM 1792 C CD2 . PHE A 1 229  ? -5.498  -7.247  -52.722 1.00 142.52 ? 226  PHE A CD2 1 
ATOM 1793 C CE1 . PHE A 1 229  ? -5.740  -9.145  -50.718 1.00 142.52 ? 226  PHE A CE1 1 
ATOM 1794 C CE2 . PHE A 1 229  ? -6.639  -8.027  -52.647 1.00 142.52 ? 226  PHE A CE2 1 
ATOM 1795 C CZ  . PHE A 1 229  ? -6.761  -8.975  -51.641 1.00 142.52 ? 226  PHE A CZ  1 
ATOM 1796 N N   . GLY A 1 230  ? -0.445  -5.621  -51.176 1.00 58.04  ? 227  GLY A N   1 
ATOM 1797 C CA  . GLY A 1 230  ? 0.503   -4.518  -51.200 1.00 58.04  ? 227  GLY A CA  1 
ATOM 1798 C C   . GLY A 1 230  ? -0.052  -3.349  -51.977 1.00 58.04  ? 227  GLY A C   1 
ATOM 1799 O O   . GLY A 1 230  ? -1.089  -3.450  -52.611 1.00 58.04  ? 227  GLY A O   1 
ATOM 1800 N N   . GLY A 1 231  ? 0.644   -2.228  -51.945 1.00 48.61  ? 228  GLY A N   1 
ATOM 1801 C CA  . GLY A 1 231  ? 0.244   -1.061  -52.749 1.00 48.61  ? 228  GLY A CA  1 
ATOM 1802 C C   . GLY A 1 231  ? -0.622  0.019   -52.091 1.00 48.61  ? 228  GLY A C   1 
ATOM 1803 O O   . GLY A 1 231  ? -0.798  0.038   -50.862 1.00 48.61  ? 228  GLY A O   1 
ATOM 1804 N N   . ALA A 1 232  ? -1.165  0.899   -52.939 1.00 60.95  ? 229  ALA A N   1 
ATOM 1805 C CA  . ALA A 1 232  ? -1.911  2.058   -52.489 1.00 60.95  ? 229  ALA A CA  1 
ATOM 1806 C C   . ALA A 1 232  ? -3.157  2.479   -53.299 1.00 60.95  ? 229  ALA A C   1 
ATOM 1807 O O   . ALA A 1 232  ? -3.162  2.529   -54.527 1.00 60.95  ? 229  ALA A O   1 
ATOM 1808 C CB  . ALA A 1 232  ? -0.981  3.217   -52.354 1.00 42.32  ? 229  ALA A CB  1 
ATOM 1809 N N   . ILE A 1 233  ? -4.203  2.839   -52.577 1.00 49.13  ? 230  ILE A N   1 
ATOM 1810 C CA  . ILE A 1 233  ? -5.418  3.251   -53.207 1.00 49.13  ? 230  ILE A CA  1 
ATOM 1811 C C   . ILE A 1 233  ? -5.591  4.742   -52.997 1.00 49.13  ? 230  ILE A C   1 
ATOM 1812 O O   . ILE A 1 233  ? -5.491  5.196   -51.877 1.00 49.13  ? 230  ILE A O   1 
ATOM 1813 C CB  . ILE A 1 233  ? -6.581  2.475   -52.619 1.00 68.62  ? 230  ILE A CB  1 
ATOM 1814 C CG1 . ILE A 1 233  ? -6.492  1.021   -53.087 1.00 68.62  ? 230  ILE A CG1 1 
ATOM 1815 C CG2 . ILE A 1 233  ? -7.887  3.075   -53.053 1.00 68.62  ? 230  ILE A CG2 1 
ATOM 1816 C CD1 . ILE A 1 233  ? -7.245  0.030   -52.206 1.00 68.62  ? 230  ILE A CD1 1 
ATOM 1817 N N   . ILE A 1 234  ? -5.838  5.494   -54.066 1.00 45.77  ? 231  ILE A N   1 
ATOM 1818 C CA  . ILE A 1 234  ? -6.056  6.924   -53.959 1.00 45.77  ? 231  ILE A CA  1 
ATOM 1819 C C   . ILE A 1 234  ? -7.492  7.344   -54.323 1.00 45.77  ? 231  ILE A C   1 
ATOM 1820 O O   . ILE A 1 234  ? -8.018  6.974   -55.370 1.00 45.77  ? 231  ILE A O   1 
ATOM 1821 C CB  . ILE A 1 234  ? -5.089  7.710   -54.872 1.00 37.28  ? 231  ILE A CB  1 
ATOM 1822 C CG1 . ILE A 1 234  ? -3.602  7.521   -54.469 1.00 37.28  ? 231  ILE A CG1 1 
ATOM 1823 C CG2 . ILE A 1 234  ? -5.455  9.212   -54.847 1.00 37.28  ? 231  ILE A CG2 1 
ATOM 1824 C CD1 . ILE A 1 234  ? -3.188  6.070   -54.310 1.00 37.28  ? 231  ILE A CD1 1 
ATOM 1825 N N   . ILE A 1 235  ? -8.122  8.146   -53.482 1.00 54.69  ? 232  ILE A N   1 
ATOM 1826 C CA  . ILE A 1 235  ? -9.497  8.521   -53.747 1.00 54.69  ? 232  ILE A CA  1 
ATOM 1827 C C   . ILE A 1 235  ? -9.604  9.997   -54.028 1.00 54.69  ? 232  ILE A C   1 
ATOM 1828 O O   . ILE A 1 235  ? -9.087  10.813  -53.268 1.00 54.69  ? 232  ILE A O   1 
ATOM 1829 C CB  . ILE A 1 235  ? -10.413 8.171   -52.548 1.00 53.90  ? 232  ILE A CB  1 
ATOM 1830 C CG1 . ILE A 1 235  ? -10.449 6.646   -52.310 1.00 53.90  ? 232  ILE A CG1 1 
ATOM 1831 C CG2 . ILE A 1 235  ? -11.816 8.742   -52.761 1.00 53.90  ? 232  ILE A CG2 1 
ATOM 1832 C CD1 . ILE A 1 235  ? -10.688 6.249   -50.869 1.00 53.90  ? 232  ILE A CD1 1 
ATOM 1833 N N   . GLY A 1 236  ? -10.283 10.327  -55.114 1.00 44.64  ? 233  GLY A N   1 
ATOM 1834 C CA  . GLY A 1 236  ? -10.547 11.699  -55.489 1.00 44.64  ? 233  GLY A CA  1 
ATOM 1835 C C   . GLY A 1 236  ? -12.033 11.971  -55.515 1.00 44.64  ? 233  GLY A C   1 
ATOM 1836 O O   . GLY A 1 236  ? -12.785 11.185  -54.931 1.00 44.64  ? 233  GLY A O   1 
ATOM 1837 N N   . GLN A 1 237  ? -12.469 13.072  -56.138 1.00 60.77  ? 234  GLN A N   1 
ATOM 1838 C CA  . GLN A 1 237  ? -13.892 13.233  -56.452 1.00 60.77  ? 234  GLN A CA  1 
ATOM 1839 C C   . GLN A 1 237  ? -14.270 12.437  -57.718 1.00 60.77  ? 234  GLN A C   1 
ATOM 1840 O O   . GLN A 1 237  ? -13.433 12.218  -58.577 1.00 60.77  ? 234  GLN A O   1 
ATOM 1841 C CB  . GLN A 1 237  ? -14.261 14.708  -56.580 1.00 76.97  ? 234  GLN A CB  1 
ATOM 1842 C CG  . GLN A 1 237  ? -14.980 15.299  -55.335 1.00 76.97  ? 234  GLN A CG  1 
ATOM 1843 C CD  . GLN A 1 237  ? -16.462 14.856  -55.204 1.00 76.97  ? 234  GLN A CD  1 
ATOM 1844 O OE1 . GLN A 1 237  ? -16.789 13.649  -55.137 1.00 76.97  ? 234  GLN A OE1 1 
ATOM 1845 N NE2 . GLN A 1 237  ? -17.357 15.841  -55.157 1.00 76.97  ? 234  GLN A NE2 1 
ATOM 1846 N N   . GLU A 1 238  ? -15.493 11.938  -57.835 1.00 127.27 ? 235  GLU A N   1 
ATOM 1847 C CA  . GLU A 1 238  ? -15.870 11.124  -59.024 1.00 127.27 ? 235  GLU A CA  1 
ATOM 1848 C C   . GLU A 1 238  ? -14.921 9.984   -59.478 1.00 127.27 ? 235  GLU A C   1 
ATOM 1849 O O   . GLU A 1 238  ? -15.251 9.260   -60.421 1.00 127.27 ? 235  GLU A O   1 
ATOM 1850 C CB  . GLU A 1 238  ? -16.248 12.002  -60.240 1.00 114.21 ? 235  GLU A CB  1 
ATOM 1851 C CG  . GLU A 1 238  ? -15.392 13.254  -60.499 1.00 114.21 ? 235  GLU A CG  1 
ATOM 1852 C CD  . GLU A 1 238  ? -14.132 12.985  -61.316 1.00 114.21 ? 235  GLU A CD  1 
ATOM 1853 O OE1 . GLU A 1 238  ? -13.736 11.807  -61.467 1.00 114.21 ? 235  GLU A OE1 1 
ATOM 1854 O OE2 . GLU A 1 238  ? -13.531 13.970  -61.803 1.00 114.21 ? 235  GLU A OE2 1 
ATOM 1855 N N   . SER A 1 239  ? -13.765 9.830   -58.829 1.00 81.04  ? 236  SER A N   1 
ATOM 1856 C CA  . SER A 1 239  ? -12.802 8.792   -59.212 1.00 81.04  ? 236  SER A CA  1 
ATOM 1857 C C   . SER A 1 239  ? -11.983 8.132   -58.104 1.00 81.04  ? 236  SER A C   1 
ATOM 1858 O O   . SER A 1 239  ? -11.708 8.744   -57.086 1.00 81.04  ? 236  SER A O   1 
ATOM 1859 C CB  . SER A 1 239  ? -11.810 9.354   -60.202 1.00 41.66  ? 236  SER A CB  1 
ATOM 1860 O OG  . SER A 1 239  ? -10.509 8.835   -59.910 1.00 41.66  ? 236  SER A OG  1 
ATOM 1861 N N   . ILE A 1 240  ? -11.558 6.893   -58.357 1.00 60.70  ? 237  ILE A N   1 
ATOM 1862 C CA  . ILE A 1 240  ? -10.687 6.123   -57.473 1.00 60.70  ? 237  ILE A CA  1 
ATOM 1863 C C   . ILE A 1 240  ? -9.567  5.507   -58.311 1.00 60.70  ? 237  ILE A C   1 
ATOM 1864 O O   . ILE A 1 240  ? -9.762  5.291   -59.520 1.00 60.70  ? 237  ILE A O   1 
ATOM 1865 C CB  . ILE A 1 240  ? -11.418 4.945   -56.839 1.00 47.79  ? 237  ILE A CB  1 
ATOM 1866 C CG1 . ILE A 1 240  ? -12.421 5.406   -55.789 1.00 47.79  ? 237  ILE A CG1 1 
ATOM 1867 C CG2 . ILE A 1 240  ? -10.436 3.992   -56.183 1.00 47.79  ? 237  ILE A CG2 1 
ATOM 1868 C CD1 . ILE A 1 240  ? -12.871 4.273   -54.890 1.00 47.79  ? 237  ILE A CD1 1 
ATOM 1869 N N   . THR A 1 241  ? -8.424  5.208   -57.677 1.00 93.75  ? 238  THR A N   1 
ATOM 1870 C CA  . THR A 1 241  ? -7.251  4.638   -58.355 1.00 93.75  ? 238  THR A CA  1 
ATOM 1871 C C   . THR A 1 241  ? -6.393  3.771   -57.453 1.00 93.75  ? 238  THR A C   1 
ATOM 1872 O O   . THR A 1 241  ? -6.458  3.850   -56.231 1.00 93.75  ? 238  THR A O   1 
ATOM 1873 C CB  . THR A 1 241  ? -6.305  5.720   -58.908 1.00 74.33  ? 238  THR A CB  1 
ATOM 1874 O OG1 . THR A 1 241  ? -6.068  6.711   -57.897 1.00 74.33  ? 238  THR A OG1 1 
ATOM 1875 C CG2 . THR A 1 241  ? -6.874  6.389   -60.148 1.00 74.33  ? 238  THR A CG2 1 
ATOM 1876 N N   . TYR A 1 242  ? -5.557  2.967   -58.093 1.00 81.37  ? 239  TYR A N   1 
ATOM 1877 C CA  . TYR A 1 242  ? -4.661  2.064   -57.415 1.00 81.37  ? 239  TYR A CA  1 
ATOM 1878 C C   . TYR A 1 242  ? -3.295  2.134   -58.046 1.00 81.37  ? 239  TYR A C   1 
ATOM 1879 O O   . TYR A 1 242  ? -3.144  2.167   -59.271 1.00 81.37  ? 239  TYR A O   1 
ATOM 1880 C CB  . TYR A 1 242  ? -5.160  0.639   -57.507 1.00 60.21  ? 239  TYR A CB  1 
ATOM 1881 C CG  . TYR A 1 242  ? -4.249  -0.408  -56.904 1.00 60.21  ? 239  TYR A CG  1 
ATOM 1882 C CD1 . TYR A 1 242  ? -4.365  -0.769  -55.572 1.00 60.21  ? 239  TYR A CD1 1 
ATOM 1883 C CD2 . TYR A 1 242  ? -3.287  -1.049  -57.674 1.00 60.21  ? 239  TYR A CD2 1 
ATOM 1884 C CE1 . TYR A 1 242  ? -3.536  -1.734  -55.010 1.00 60.21  ? 239  TYR A CE1 1 
ATOM 1885 C CE2 . TYR A 1 242  ? -2.449  -2.031  -57.119 1.00 60.21  ? 239  TYR A CE2 1 
ATOM 1886 C CZ  . TYR A 1 242  ? -2.574  -2.373  -55.781 1.00 60.21  ? 239  TYR A CZ  1 
ATOM 1887 O OH  . TYR A 1 242  ? -1.753  -3.346  -55.212 1.00 60.21  ? 239  TYR A OH  1 
ATOM 1888 N N   . HIS A 1 243  ? -2.310  2.135   -57.158 1.00 52.97  ? 240  HIS A N   1 
ATOM 1889 C CA  . HIS A 1 243  ? -0.923  2.226   -57.492 1.00 52.97  ? 240  HIS A CA  1 
ATOM 1890 C C   . HIS A 1 243  ? -0.172  1.142   -56.760 1.00 52.97  ? 240  HIS A C   1 
ATOM 1891 O O   . HIS A 1 243  ? -0.495  0.776   -55.617 1.00 52.97  ? 240  HIS A O   1 
ATOM 1892 C CB  . HIS A 1 243  ? -0.408  3.585   -57.065 1.00 64.81  ? 240  HIS A CB  1 
ATOM 1893 C CG  . HIS A 1 243  ? -1.097  4.723   -57.744 1.00 64.81  ? 240  HIS A CG  1 
ATOM 1894 N ND1 . HIS A 1 243  ? -0.534  5.410   -58.800 1.00 64.81  ? 240  HIS A ND1 1 
ATOM 1895 C CD2 . HIS A 1 243  ? -2.308  5.291   -57.527 1.00 64.81  ? 240  HIS A CD2 1 
ATOM 1896 C CE1 . HIS A 1 243  ? -1.369  6.357   -59.201 1.00 64.81  ? 240  HIS A CE1 1 
ATOM 1897 N NE2 . HIS A 1 243  ? -2.451  6.307   -58.443 1.00 64.81  ? 240  HIS A NE2 1 
ATOM 1898 N N   . ASN A 1 244  ? 0.824   0.627   -57.465 1.00 95.02  ? 241  ASN A N   1 
ATOM 1899 C CA  . ASN A 1 244  ? 1.842   -0.262  -56.945 1.00 95.02  ? 241  ASN A CA  1 
ATOM 1900 C C   . ASN A 1 244  ? 2.764   -0.420  -58.126 1.00 95.02  ? 241  ASN A C   1 
ATOM 1901 O O   . ASN A 1 244  ? 2.323   -0.193  -59.249 1.00 95.02  ? 241  ASN A O   1 
ATOM 1902 C CB  . ASN A 1 244  ? 1.253   -1.605  -56.550 1.00 81.67  ? 241  ASN A CB  1 
ATOM 1903 C CG  . ASN A 1 244  ? 2.273   -2.515  -55.943 1.00 81.67  ? 241  ASN A CG  1 
ATOM 1904 O OD1 . ASN A 1 244  ? 3.473   -2.327  -56.131 1.00 81.67  ? 241  ASN A OD1 1 
ATOM 1905 N ND2 . ASN A 1 244  ? 1.812   -3.514  -55.206 1.00 81.67  ? 241  ASN A ND2 1 
ATOM 1906 N N   . GLY A 1 245  ? 4.029   -0.779  -57.890 1.00 114.86 ? 242  GLY A N   1 
ATOM 1907 C CA  . GLY A 1 245  ? 5.010   -0.997  -58.966 1.00 114.86 ? 242  GLY A CA  1 
ATOM 1908 C C   . GLY A 1 245  ? 4.708   -0.244  -60.256 1.00 114.86 ? 242  GLY A C   1 
ATOM 1909 O O   . GLY A 1 245  ? 4.655   0.992   -60.273 1.00 114.86 ? 242  GLY A O   1 
ATOM 1910 N N   . ASP A 1 246  ? 4.488   -0.994  -61.335 1.00 95.88  ? 243  ASP A N   1 
ATOM 1911 C CA  . ASP A 1 246  ? 4.102   -0.407  -62.624 1.00 95.88  ? 243  ASP A CA  1 
ATOM 1912 C C   . ASP A 1 246  ? 2.600   -0.544  -62.862 1.00 95.88  ? 243  ASP A C   1 
ATOM 1913 O O   . ASP A 1 246  ? 2.084   -0.244  -63.948 1.00 95.88  ? 243  ASP A O   1 
ATOM 1914 C CB  . ASP A 1 246  ? 4.892   -1.062  -63.761 1.00 184.02 ? 243  ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 246  ? 6.397   -0.901  -63.596 1.00 184.02 ? 243  ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 246  ? 7.107   -1.930  -63.559 1.00 184.02 ? 243  ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 246  ? 6.872   0.252   -63.496 1.00 184.02 ? 243  ASP A OD2 1 
ATOM 1918 N N   . LYS A 1 247  ? 1.913   -0.984  -61.815 1.00 57.61  ? 244  LYS A N   1 
ATOM 1919 C CA  . LYS A 1 247  ? 0.506   -1.329  -61.855 1.00 57.61  ? 244  LYS A CA  1 
ATOM 1920 C C   . LYS A 1 247  ? -0.347  -0.115  -61.550 1.00 57.61  ? 244  LYS A C   1 
ATOM 1921 O O   . LYS A 1 247  ? -0.219  0.485   -60.489 1.00 57.61  ? 244  LYS A O   1 
ATOM 1922 C CB  . LYS A 1 247  ? 0.224   -2.405  -60.814 1.00 54.46  ? 244  LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 247  ? -0.961  -3.308  -61.168 1.00 54.46  ? 244  LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 247  ? -0.532  -4.662  -61.790 1.00 54.46  ? 244  LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 247  ? -1.741  -5.488  -62.273 1.00 54.46  ? 244  LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 247  ? -2.731  -4.629  -63.033 1.00 54.46  ? 244  LYS A NZ  1 
ATOM 1927 N N   . TYR A 1 248  ? -1.219  0.236   -62.485 1.00 52.36  ? 245  TYR A N   1 
ATOM 1928 C CA  . TYR A 1 248  ? -2.111  1.354   -62.313 1.00 52.36  ? 245  TYR A CA  1 
ATOM 1929 C C   . TYR A 1 248  ? -3.536  0.943   -62.723 1.00 52.36  ? 245  TYR A C   1 
ATOM 1930 O O   . TYR A 1 248  ? -3.805  0.696   -63.892 1.00 52.36  ? 245  TYR A O   1 
ATOM 1931 C CB  . TYR A 1 248  ? -1.595  2.528   -63.124 1.00 75.13  ? 245  TYR A CB  1 
ATOM 1932 C CG  . TYR A 1 248  ? -2.610  3.608   -63.311 1.00 75.13  ? 245  TYR A CG  1 
ATOM 1933 C CD1 . TYR A 1 248  ? -2.866  4.547   -62.296 1.00 75.13  ? 245  TYR A CD1 1 
ATOM 1934 C CD2 . TYR A 1 248  ? -3.327  3.704   -64.498 1.00 75.13  ? 245  TYR A CD2 1 
ATOM 1935 C CE1 . TYR A 1 248  ? -3.827  5.569   -62.478 1.00 75.13  ? 245  TYR A CE1 1 
ATOM 1936 C CE2 . TYR A 1 248  ? -4.280  4.712   -64.692 1.00 75.13  ? 245  TYR A CE2 1 
ATOM 1937 C CZ  . TYR A 1 248  ? -4.529  5.629   -63.682 1.00 75.13  ? 245  TYR A CZ  1 
ATOM 1938 O OH  . TYR A 1 248  ? -5.483  6.587   -63.899 1.00 75.13  ? 245  TYR A OH  1 
ATOM 1939 N N   . LEU A 1 249  ? -4.440  0.843   -61.753 1.00 62.36  ? 246  LEU A N   1 
ATOM 1940 C CA  . LEU A 1 249  ? -5.828  0.473   -62.027 1.00 62.36  ? 246  LEU A CA  1 
ATOM 1941 C C   . LEU A 1 249  ? -6.735  1.624   -61.669 1.00 62.36  ? 246  LEU A C   1 
ATOM 1942 O O   . LEU A 1 249  ? -6.577  2.203   -60.614 1.00 62.36  ? 246  LEU A O   1 
ATOM 1943 C CB  . LEU A 1 249  ? -6.222  -0.776  -61.228 1.00 82.22  ? 246  LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 249  ? -6.048  -2.165  -61.876 1.00 82.22  ? 246  LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 249  ? -6.312  -3.293  -60.864 1.00 82.22  ? 246  LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 249  ? -6.921  -2.353  -63.137 1.00 82.22  ? 246  LEU A CD2 1 
ATOM 1947 N N   . ALA A 1 250  ? -7.690  1.965   -62.526 1.00 65.82  ? 247  ALA A N   1 
ATOM 1948 C CA  . ALA A 1 250  ? -8.515  3.149   -62.262 1.00 65.82  ? 247  ALA A CA  1 
ATOM 1949 C C   . ALA A 1 250  ? -9.994  3.042   -62.642 1.00 65.82  ? 247  ALA A C   1 
ATOM 1950 O O   . ALA A 1 250  ? -10.352 2.447   -63.661 1.00 65.82  ? 247  ALA A O   1 
ATOM 1951 C CB  . ALA A 1 250  ? -7.898  4.347   -62.931 1.00 26.92  ? 247  ALA A CB  1 
ATOM 1952 N N   . ILE A 1 251  ? -10.852 3.643   -61.821 1.00 81.06  ? 248  ILE A N   1 
ATOM 1953 C CA  . ILE A 1 251  ? -12.289 3.628   -62.078 1.00 81.06  ? 248  ILE A CA  1 
ATOM 1954 C C   . ILE A 1 251  ? -12.889 5.001   -61.862 1.00 81.06  ? 248  ILE A C   1 
ATOM 1955 O O   . ILE A 1 251  ? -12.462 5.725   -60.958 1.00 81.06  ? 248  ILE A O   1 
ATOM 1956 C CB  . ILE A 1 251  ? -13.024 2.659   -61.143 1.00 61.16  ? 248  ILE A CB  1 
ATOM 1957 C CG1 . ILE A 1 251  ? -13.209 3.308   -59.769 1.00 61.16  ? 248  ILE A CG1 1 
ATOM 1958 C CG2 . ILE A 1 251  ? -12.267 1.329   -61.007 1.00 61.16  ? 248  ILE A CG2 1 
ATOM 1959 C CD1 . ILE A 1 251  ? -14.403 2.739   -58.955 1.00 61.16  ? 248  ILE A CD1 1 
ATOM 1960 N N   . ALA A 1 252  ? -13.897 5.340   -62.667 1.00 66.97  ? 249  ALA A N   1 
ATOM 1961 C CA  . ALA A 1 252  ? -14.598 6.609   -62.531 1.00 66.97  ? 249  ALA A CA  1 
ATOM 1962 C C   . ALA A 1 252  ? -16.130 6.462   -62.461 1.00 66.97  ? 249  ALA A C   1 
ATOM 1963 O O   . ALA A 1 252  ? -16.820 6.916   -63.388 1.00 66.97  ? 249  ALA A O   1 
ATOM 1964 C CB  . ALA A 1 252  ? -14.206 7.531   -63.659 1.00 41.18  ? 249  ALA A CB  1 
ATOM 1965 N N   . PRO A 1 253  ? -16.670 5.898   -61.335 1.00 52.06  ? 250  PRO A N   1 
ATOM 1966 C CA  . PRO A 1 253  ? -18.069 5.459   -61.250 1.00 52.06  ? 250  PRO A CA  1 
ATOM 1967 C C   . PRO A 1 253  ? -18.903 6.678   -60.976 1.00 52.06  ? 250  PRO A C   1 
ATOM 1968 O O   . PRO A 1 253  ? -18.623 7.407   -60.007 1.00 52.06  ? 250  PRO A O   1 
ATOM 1969 C CB  . PRO A 1 253  ? -18.080 4.564   -60.021 1.00 63.08  ? 250  PRO A CB  1 
ATOM 1970 C CG  . PRO A 1 253  ? -17.076 5.164   -59.138 1.00 63.08  ? 250  PRO A CG  1 
ATOM 1971 C CD  . PRO A 1 253  ? -15.998 5.747   -60.028 1.00 63.08  ? 250  PRO A CD  1 
ATOM 1972 N N   . PRO A 1 254  ? -19.904 6.940   -61.822 1.00 86.43  ? 251  PRO A N   1 
ATOM 1973 C CA  . PRO A 1 254  ? -20.571 8.223   -61.700 1.00 86.43  ? 251  PRO A CA  1 
ATOM 1974 C C   . PRO A 1 254  ? -21.117 8.379   -60.293 1.00 86.43  ? 251  PRO A C   1 
ATOM 1975 O O   . PRO A 1 254  ? -21.187 9.485   -59.786 1.00 86.43  ? 251  PRO A O   1 
ATOM 1976 C CB  . PRO A 1 254  ? -21.709 8.120   -62.721 1.00 65.01  ? 251  PRO A CB  1 
ATOM 1977 C CG  . PRO A 1 254  ? -21.261 7.116   -63.698 1.00 65.01  ? 251  PRO A CG  1 
ATOM 1978 C CD  . PRO A 1 254  ? -20.479 6.112   -62.887 1.00 65.01  ? 251  PRO A CD  1 
ATOM 1979 N N   . ILE A 1 255  ? -21.436 7.255   -59.662 1.00 78.04  ? 252  ILE A N   1 
ATOM 1980 C CA  . ILE A 1 255  ? -22.140 7.208   -58.379 1.00 78.04  ? 252  ILE A CA  1 
ATOM 1981 C C   . ILE A 1 255  ? -21.438 7.894   -57.177 1.00 78.04  ? 252  ILE A C   1 
ATOM 1982 O O   . ILE A 1 255  ? -22.109 8.431   -56.281 1.00 78.04  ? 252  ILE A O   1 
ATOM 1983 C CB  . ILE A 1 255  ? -22.498 5.749   -58.047 1.00 41.81  ? 252  ILE A CB  1 
ATOM 1984 C CG1 . ILE A 1 255  ? -23.677 5.641   -57.056 1.00 41.81  ? 252  ILE A CG1 1 
ATOM 1985 C CG2 . ILE A 1 255  ? -21.256 4.963   -57.617 1.00 41.81  ? 252  ILE A CG2 1 
ATOM 1986 C CD1 . ILE A 1 255  ? -23.798 4.200   -56.392 1.00 41.81  ? 252  ILE A CD1 1 
ATOM 1987 N N   . ILE A 1 256  ? -20.107 7.898   -57.158 1.00 52.04  ? 253  ILE A N   1 
ATOM 1988 C CA  . ILE A 1 256  ? -19.376 8.604   -56.103 1.00 52.04  ? 253  ILE A CA  1 
ATOM 1989 C C   . ILE A 1 256  ? -19.174 10.073  -56.425 1.00 52.04  ? 253  ILE A C   1 
ATOM 1990 O O   . ILE A 1 256  ? -18.691 10.821  -55.581 1.00 52.04  ? 253  ILE A O   1 
ATOM 1991 C CB  . ILE A 1 256  ? -18.006 7.960   -55.838 1.00 43.66  ? 253  ILE A CB  1 
ATOM 1992 C CG1 . ILE A 1 256  ? -16.980 8.423   -56.900 1.00 43.66  ? 253  ILE A CG1 1 
ATOM 1993 C CG2 . ILE A 1 256  ? -18.156 6.425   -55.754 1.00 43.66  ? 253  ILE A CG2 1 
ATOM 1994 C CD1 . ILE A 1 256  ? -15.561 7.776   -56.784 1.00 43.66  ? 253  ILE A CD1 1 
ATOM 1995 N N   . LYS A 1 257  ? -19.525 10.487  -57.641 1.00 61.89  ? 254  LYS A N   1 
ATOM 1996 C CA  . LYS A 1 257  ? -19.316 11.867  -58.063 1.00 61.89  ? 254  LYS A CA  1 
ATOM 1997 C C   . LYS A 1 257  ? -20.158 12.807  -57.240 1.00 61.89  ? 254  LYS A C   1 
ATOM 1998 O O   . LYS A 1 257  ? -19.740 13.922  -56.982 1.00 61.89  ? 254  LYS A O   1 
ATOM 1999 C CB  . LYS A 1 257  ? -19.611 12.049  -59.558 1.00 90.74  ? 254  LYS A CB  1 
ATOM 2000 C CG  . LYS A 1 257  ? -19.333 13.447  -60.111 1.00 90.74  ? 254  LYS A CG  1 
ATOM 2001 C CD  . LYS A 1 257  ? -19.011 13.433  -61.608 1.00 90.74  ? 254  LYS A CD  1 
ATOM 2002 C CE  . LYS A 1 257  ? -18.654 14.840  -62.107 1.00 90.74  ? 254  LYS A CE  1 
ATOM 2003 N NZ  . LYS A 1 257  ? -17.540 15.514  -61.348 1.00 90.74  ? 254  LYS A NZ  1 
ATOM 2004 N N   . GLN A 1 258  ? -21.329 12.328  -56.820 1.00 55.66  ? 255  GLN A N   1 
ATOM 2005 C CA  . GLN A 1 258  ? -22.370 13.113  -56.110 1.00 55.66  ? 255  GLN A CA  1 
ATOM 2006 C C   . GLN A 1 258  ? -21.892 13.935  -54.900 1.00 55.66  ? 255  GLN A C   1 
ATOM 2007 O O   . GLN A 1 258  ? -22.382 15.029  -54.639 1.00 55.66  ? 255  GLN A O   1 
ATOM 2008 C CB  . GLN A 1 258  ? -23.458 12.158  -55.640 1.00 114.59 ? 255  GLN A CB  1 
ATOM 2009 C CG  . GLN A 1 258  ? -24.827 12.772  -55.444 1.00 114.59 ? 255  GLN A CG  1 
ATOM 2010 C CD  . GLN A 1 258  ? -25.877 12.142  -56.344 1.00 114.59 ? 255  GLN A CD  1 
ATOM 2011 O OE1 . GLN A 1 258  ? -25.558 11.385  -57.270 1.00 114.59 ? 255  GLN A OE1 1 
ATOM 2012 N NE2 . GLN A 1 258  ? -27.141 12.446  -56.070 1.00 114.59 ? 255  GLN A NE2 1 
ATOM 2013 N N   . SER A 1 259  ? -20.951 13.374  -54.157 1.00 58.30  ? 256  SER A N   1 
ATOM 2014 C CA  . SER A 1 259  ? -20.435 13.974  -52.950 1.00 58.30  ? 256  SER A CA  1 
ATOM 2015 C C   . SER A 1 259  ? -19.138 13.297  -52.610 1.00 58.30  ? 256  SER A C   1 
ATOM 2016 O O   . SER A 1 259  ? -18.846 12.208  -53.109 1.00 58.30  ? 256  SER A O   1 
ATOM 2017 C CB  . SER A 1 259  ? -21.419 13.810  -51.804 1.00 56.56  ? 256  SER A CB  1 
ATOM 2018 O OG  . SER A 1 259  ? -20.777 13.881  -50.537 1.00 56.56  ? 256  SER A OG  1 
ATOM 2019 N N   . THR A 1 260  ? -18.370 13.947  -51.741 1.00 63.10  ? 257  THR A N   1 
ATOM 2020 C CA  . THR A 1 260  ? -16.984 13.572  -51.507 1.00 63.10  ? 257  THR A CA  1 
ATOM 2021 C C   . THR A 1 260  ? -16.928 12.404  -50.574 1.00 63.10  ? 257  THR A C   1 
ATOM 2022 O O   . THR A 1 260  ? -17.681 12.355  -49.597 1.00 63.10  ? 257  THR A O   1 
ATOM 2023 C CB  . THR A 1 260  ? -16.179 14.726  -50.863 1.00 59.37  ? 257  THR A CB  1 
ATOM 2024 O OG1 . THR A 1 260  ? -16.495 15.970  -51.505 1.00 59.37  ? 257  THR A OG1 1 
ATOM 2025 C CG2 . THR A 1 260  ? -14.696 14.469  -50.952 1.00 59.37  ? 257  THR A CG2 1 
ATOM 2026 N N   . ILE A 1 261  ? -16.042 11.463  -50.879 1.00 44.70  ? 258  ILE A N   1 
ATOM 2027 C CA  . ILE A 1 261  ? -15.639 10.474  -49.872 1.00 44.70  ? 258  ILE A CA  1 
ATOM 2028 C C   . ILE A 1 261  ? -14.689 11.086  -48.842 1.00 44.70  ? 258  ILE A C   1 
ATOM 2029 O O   . ILE A 1 261  ? -14.045 12.119  -49.083 1.00 44.70  ? 258  ILE A O   1 
ATOM 2030 C CB  . ILE A 1 261  ? -15.064 9.234   -50.490 1.00 37.06  ? 258  ILE A CB  1 
ATOM 2031 C CG1 . ILE A 1 261  ? -16.149 8.582   -51.356 1.00 37.06  ? 258  ILE A CG1 1 
ATOM 2032 C CG2 . ILE A 1 261  ? -14.632 8.272   -49.430 1.00 37.06  ? 258  ILE A CG2 1 
ATOM 2033 C CD1 . ILE A 1 261  ? -15.591 7.670   -52.479 1.00 37.06  ? 258  ILE A CD1 1 
ATOM 2034 N N   . VAL A 1 262  ? -14.614 10.468  -47.674 1.00 42.16  ? 259  VAL A N   1 
ATOM 2035 C CA  . VAL A 1 262  ? -14.229 11.235  -46.513 1.00 42.16  ? 259  VAL A CA  1 
ATOM 2036 C C   . VAL A 1 262  ? -13.798 10.427  -45.319 1.00 42.16  ? 259  VAL A C   1 
ATOM 2037 O O   . VAL A 1 262  ? -13.128 10.939  -44.445 1.00 42.16  ? 259  VAL A O   1 
ATOM 2038 C CB  . VAL A 1 262  ? -15.357 12.188  -46.202 1.00 31.94  ? 259  VAL A CB  1 
ATOM 2039 C CG1 . VAL A 1 262  ? -16.065 11.888  -44.898 1.00 31.94  ? 259  VAL A CG1 1 
ATOM 2040 C CG2 . VAL A 1 262  ? -14.853 13.590  -46.332 1.00 31.94  ? 259  VAL A CG2 1 
ATOM 2041 N N   . CYS A 1 263  ? -14.188 9.156   -45.295 1.00 55.87  ? 260  CYS A N   1 
ATOM 2042 C CA  . CYS A 1 263  ? -13.611 8.190   -44.384 1.00 55.87  ? 260  CYS A CA  1 
ATOM 2043 C C   . CYS A 1 263  ? -13.677 6.818   -45.018 1.00 55.87  ? 260  CYS A C   1 
ATOM 2044 O O   . CYS A 1 263  ? -14.349 6.636   -46.019 1.00 55.87  ? 260  CYS A O   1 
ATOM 2045 C CB  . CYS A 1 263  ? -14.323 8.182   -43.052 1.00 41.21  ? 260  CYS A CB  1 
ATOM 2046 S SG  . CYS A 1 263  ? -16.093 8.384   -43.194 1.00 41.21  ? 260  CYS A SG  1 
ATOM 2047 N N   . HIS A 1 264  ? -12.957 5.866   -44.422 1.00 38.73  ? 261  HIS A N   1 
ATOM 2048 C CA  . HIS A 1 264  ? -12.793 4.526   -44.961 1.00 38.73  ? 261  HIS A CA  1 
ATOM 2049 C C   . HIS A 1 264  ? -12.334 3.524   -43.913 1.00 38.73  ? 261  HIS A C   1 
ATOM 2050 O O   . HIS A 1 264  ? -11.941 3.902   -42.827 1.00 38.73  ? 261  HIS A O   1 
ATOM 2051 C CB  . HIS A 1 264  ? -11.826 4.520   -46.146 1.00 50.32  ? 261  HIS A CB  1 
ATOM 2052 C CG  . HIS A 1 264  ? -10.477 5.090   -45.847 1.00 50.32  ? 261  HIS A CG  1 
ATOM 2053 N ND1 . HIS A 1 264  ? -9.488  4.365   -45.220 1.00 50.32  ? 261  HIS A ND1 1 
ATOM 2054 C CD2 . HIS A 1 264  ? -9.938  6.299   -46.140 1.00 50.32  ? 261  HIS A CD2 1 
ATOM 2055 C CE1 . HIS A 1 264  ? -8.400  5.110   -45.127 1.00 50.32  ? 261  HIS A CE1 1 
ATOM 2056 N NE2 . HIS A 1 264  ? -8.649  6.290   -45.672 1.00 50.32  ? 261  HIS A NE2 1 
ATOM 2057 N N   . ASN A 1 265  ? -12.376 2.241   -44.240 1.00 39.95  ? 262  ASN A N   1 
ATOM 2058 C CA  . ASN A 1 265  ? -12.078 1.252   -43.245 1.00 39.95  ? 262  ASN A CA  1 
ATOM 2059 C C   . ASN A 1 265  ? -11.933 -0.117  -43.880 1.00 39.95  ? 262  ASN A C   1 
ATOM 2060 O O   . ASN A 1 265  ? -12.799 -0.539  -44.660 1.00 39.95  ? 262  ASN A O   1 
ATOM 2061 C CB  . ASN A 1 265  ? -13.202 1.205   -42.232 1.00 55.17  ? 262  ASN A CB  1 
ATOM 2062 C CG  . ASN A 1 265  ? -12.987 0.145   -41.195 1.00 55.17  ? 262  ASN A CG  1 
ATOM 2063 O OD1 . ASN A 1 265  ? -12.169 0.323   -40.282 1.00 55.17  ? 262  ASN A OD1 1 
ATOM 2064 N ND2 . ASN A 1 265  ? -13.684 -0.985  -41.340 1.00 55.17  ? 262  ASN A ND2 1 
ATOM 2065 N N   . ARG A 1 266  ? -10.838 -0.806  -43.545 1.00 43.85  ? 263  ARG A N   1 
ATOM 2066 C CA  . ARG A 1 266  ? -10.569 -2.140  -44.039 1.00 43.85  ? 263  ARG A CA  1 
ATOM 2067 C C   . ARG A 1 266  ? -11.547 -3.111  -43.414 1.00 43.85  ? 263  ARG A C   1 
ATOM 2068 O O   . ARG A 1 266  ? -11.669 -3.161  -42.196 1.00 43.85  ? 263  ARG A O   1 
ATOM 2069 C CB  . ARG A 1 266  ? -9.142  -2.525  -43.692 1.00 52.08  ? 263  ARG A CB  1 
ATOM 2070 C CG  . ARG A 1 266  ? -8.879  -4.017  -43.763 1.00 52.08  ? 263  ARG A CG  1 
ATOM 2071 C CD  . ARG A 1 266  ? -7.628  -4.363  -44.561 1.00 52.08  ? 263  ARG A CD  1 
ATOM 2072 N NE  . ARG A 1 266  ? -6.462  -3.707  -44.001 1.00 52.08  ? 263  ARG A NE  1 
ATOM 2073 C CZ  . ARG A 1 266  ? -6.042  -3.839  -42.744 1.00 52.08  ? 263  ARG A CZ  1 
ATOM 2074 N NH1 . ARG A 1 266  ? -6.703  -4.608  -41.881 1.00 52.08  ? 263  ARG A NH1 1 
ATOM 2075 N NH2 . ARG A 1 266  ? -4.961  -3.176  -42.347 1.00 52.08  ? 263  ARG A NH2 1 
ATOM 2076 N N   . VAL A 1 267  ? -12.251 -3.875  -44.242 1.00 44.91  ? 264  VAL A N   1 
ATOM 2077 C CA  . VAL A 1 267  ? -13.157 -4.915  -43.717 1.00 44.91  ? 264  VAL A CA  1 
ATOM 2078 C C   . VAL A 1 267  ? -12.467 -6.279  -43.501 1.00 44.91  ? 264  VAL A C   1 
ATOM 2079 O O   . VAL A 1 267  ? -12.389 -6.772  -42.379 1.00 44.91  ? 264  VAL A O   1 
ATOM 2080 C CB  . VAL A 1 267  ? -14.418 -5.081  -44.588 1.00 63.31  ? 264  VAL A CB  1 
ATOM 2081 C CG1 . VAL A 1 267  ? -15.368 -6.071  -43.950 1.00 63.31  ? 264  VAL A CG1 1 
ATOM 2082 C CG2 . VAL A 1 267  ? -15.097 -3.751  -44.752 1.00 63.31  ? 264  VAL A CG2 1 
ATOM 2083 N N   . ASP A 1 268  ? -11.995 -6.890  -44.573 1.00 66.75  ? 265  ASP A N   1 
ATOM 2084 C CA  . ASP A 1 268  ? -11.308 -8.154  -44.456 1.00 66.75  ? 265  ASP A CA  1 
ATOM 2085 C C   . ASP A 1 268  ? -9.803  -7.894  -44.293 1.00 66.75  ? 265  ASP A C   1 
ATOM 2086 O O   . ASP A 1 268  ? -9.219  -7.115  -45.048 1.00 66.75  ? 265  ASP A O   1 
ATOM 2087 C CB  . ASP A 1 268  ? -11.597 -9.021  -45.685 1.00 62.62  ? 265  ASP A CB  1 
ATOM 2088 C CG  . ASP A 1 268  ? -13.100 -9.327  -45.866 1.00 62.62  ? 265  ASP A CG  1 
ATOM 2089 O OD1 . ASP A 1 268  ? -13.728 -9.932  -44.950 1.00 62.62  ? 265  ASP A OD1 1 
ATOM 2090 O OD2 . ASP A 1 268  ? -13.643 -8.978  -46.944 1.00 62.62  ? 265  ASP A OD2 1 
ATOM 2091 N N   . PRO A 1 269  ? -9.167  -8.527  -43.286 1.00 60.39  ? 266  PRO A N   1 
ATOM 2092 C CA  . PRO A 1 269  ? -7.728  -8.311  -43.062 1.00 60.39  ? 266  PRO A CA  1 
ATOM 2093 C C   . PRO A 1 269  ? -6.879  -8.324  -44.326 1.00 60.39  ? 266  PRO A C   1 
ATOM 2094 O O   . PRO A 1 269  ? -5.892  -7.604  -44.396 1.00 60.39  ? 266  PRO A O   1 
ATOM 2095 C CB  . PRO A 1 269  ? -7.332  -9.479  -42.166 1.00 41.06  ? 266  PRO A CB  1 
ATOM 2096 C CG  . PRO A 1 269  ? -8.574  -9.731  -41.368 1.00 41.06  ? 266  PRO A CG  1 
ATOM 2097 C CD  . PRO A 1 269  ? -9.751  -9.443  -42.284 1.00 41.06  ? 266  PRO A CD  1 
ATOM 2098 N N   . ASN A 1 270  ? -7.242  -9.140  -45.308 1.00 49.47  ? 267  ASN A N   1 
ATOM 2099 C CA  . ASN A 1 270  ? -6.493  -9.190  -46.545 1.00 49.47  ? 267  ASN A CA  1 
ATOM 2100 C C   . ASN A 1 270  ? -6.842  -7.960  -47.357 1.00 49.47  ? 267  ASN A C   1 
ATOM 2101 O O   . ASN A 1 270  ? -6.045  -7.469  -48.142 1.00 49.47  ? 267  ASN A O   1 
ATOM 2102 C CB  . ASN A 1 270  ? -6.857  -10.431 -47.339 1.00 71.48  ? 267  ASN A CB  1 
ATOM 2103 C CG  . ASN A 1 270  ? -8.228  -10.328 -47.911 1.00 71.48  ? 267  ASN A CG  1 
ATOM 2104 O OD1 . ASN A 1 270  ? -9.211  -10.308 -47.173 1.00 71.48  ? 267  ASN A OD1 1 
ATOM 2105 N ND2 . ASN A 1 270  ? -8.312  -10.182 -49.221 1.00 71.48  ? 267  ASN A ND2 1 
ATOM 2106 N N   . GLY A 1 271  ? -8.045  -7.451  -47.166 1.00 50.90  ? 268  GLY A N   1 
ATOM 2107 C CA  . GLY A 1 271  ? -8.418  -6.233  -47.843 1.00 50.90  ? 268  GLY A CA  1 
ATOM 2108 C C   . GLY A 1 271  ? -8.836  -6.457  -49.277 1.00 50.90  ? 268  GLY A C   1 
ATOM 2109 O O   . GLY A 1 271  ? -8.409  -5.742  -50.189 1.00 50.90  ? 268  GLY A O   1 
ATOM 2110 N N   . SER A 1 272  ? -9.664  -7.472  -49.475 1.00 75.07  ? 269  SER A N   1 
ATOM 2111 C CA  . SER A 1 272  ? -10.425 -7.583  -50.692 1.00 75.07  ? 269  SER A CA  1 
ATOM 2112 C C   . SER A 1 272  ? -11.493 -6.499  -50.640 1.00 75.07  ? 269  SER A C   1 
ATOM 2113 O O   . SER A 1 272  ? -11.892 -5.985  -51.682 1.00 75.07  ? 269  SER A O   1 
ATOM 2114 C CB  . SER A 1 272  ? -11.085 -8.944  -50.739 1.00 85.83  ? 269  SER A CB  1 
ATOM 2115 O OG  . SER A 1 272  ? -11.629 -9.236  -49.463 1.00 85.83  ? 269  SER A OG  1 
ATOM 2116 N N   . ARG A 1 273  ? -11.933 -6.156  -49.418 1.00 62.87  ? 270  ARG A N   1 
ATOM 2117 C CA  . ARG A 1 273  ? -13.062 -5.237  -49.189 1.00 62.87  ? 270  ARG A CA  1 
ATOM 2118 C C   . ARG A 1 273  ? -12.759 -4.087  -48.215 1.00 62.87  ? 270  ARG A C   1 
ATOM 2119 O O   . ARG A 1 273  ? -12.128 -4.310  -47.168 1.00 62.87  ? 270  ARG A O   1 
ATOM 2120 C CB  . ARG A 1 273  ? -14.286 -5.996  -48.651 1.00 55.36  ? 270  ARG A CB  1 
ATOM 2121 C CG  . ARG A 1 273  ? -14.819 -7.115  -49.542 1.00 55.36  ? 270  ARG A CG  1 
ATOM 2122 C CD  . ARG A 1 273  ? -16.105 -7.736  -49.018 1.00 55.36  ? 270  ARG A CD  1 
ATOM 2123 N NE  . ARG A 1 273  ? -16.010 -8.231  -47.646 1.00 55.36  ? 270  ARG A NE  1 
ATOM 2124 C CZ  . ARG A 1 273  ? -17.028 -8.761  -46.965 1.00 55.36  ? 270  ARG A CZ  1 
ATOM 2125 N NH1 . ARG A 1 273  ? -18.229 -8.874  -47.526 1.00 55.36  ? 270  ARG A NH1 1 
ATOM 2126 N NH2 . ARG A 1 273  ? -16.854 -9.183  -45.713 1.00 55.36  ? 270  ARG A NH2 1 
ATOM 2127 N N   . TYR A 1 274  ? -13.243 -2.880  -48.559 1.00 42.16  ? 271  TYR A N   1 
ATOM 2128 C CA  . TYR A 1 274  ? -13.201 -1.686  -47.678 1.00 42.16  ? 271  TYR A CA  1 
ATOM 2129 C C   . TYR A 1 274  ? -14.506 -0.940  -47.708 1.00 42.16  ? 271  TYR A C   1 
ATOM 2130 O O   . TYR A 1 274  ? -15.205 -0.963  -48.716 1.00 42.16  ? 271  TYR A O   1 
ATOM 2131 C CB  . TYR A 1 274  ? -12.168 -0.690  -48.155 1.00 58.87  ? 271  TYR A CB  1 
ATOM 2132 C CG  . TYR A 1 274  ? -10.739 -1.062  -47.942 1.00 58.87  ? 271  TYR A CG  1 
ATOM 2133 C CD1 . TYR A 1 274  ? -10.133 -2.031  -48.718 1.00 58.87  ? 271  TYR A CD1 1 
ATOM 2134 C CD2 . TYR A 1 274  ? -9.972  -0.405  -46.997 1.00 58.87  ? 271  TYR A CD2 1 
ATOM 2135 C CE1 . TYR A 1 274  ? -8.808  -2.351  -48.536 1.00 58.87  ? 271  TYR A CE1 1 
ATOM 2136 C CE2 . TYR A 1 274  ? -8.654  -0.725  -46.806 1.00 58.87  ? 271  TYR A CE2 1 
ATOM 2137 C CZ  . TYR A 1 274  ? -8.078  -1.695  -47.578 1.00 58.87  ? 271  TYR A CZ  1 
ATOM 2138 O OH  . TYR A 1 274  ? -6.766  -2.023  -47.413 1.00 58.87  ? 271  TYR A OH  1 
ATOM 2139 N N   . LEU A 1 275  ? -14.798 -0.252  -46.603 1.00 42.15  ? 272  LEU A N   1 
ATOM 2140 C CA  . LEU A 1 275  ? -15.987 0.604   -46.417 1.00 42.15  ? 272  LEU A CA  1 
ATOM 2141 C C   . LEU A 1 275  ? -15.675 2.067   -46.762 1.00 42.15  ? 272  LEU A C   1 
ATOM 2142 O O   . LEU A 1 275  ? -14.570 2.524   -46.480 1.00 42.15  ? 272  LEU A O   1 
ATOM 2143 C CB  . LEU A 1 275  ? -16.459 0.518   -44.958 1.00 42.81  ? 272  LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 275  ? -17.154 -0.787  -44.520 1.00 42.81  ? 272  LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 275  ? -17.341 -0.929  -43.000 1.00 42.81  ? 272  LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 275  ? -18.485 -0.945  -45.223 1.00 42.81  ? 272  LEU A CD2 1 
ATOM 2147 N N   . LEU A 1 276  ? -16.615 2.810   -47.359 1.00 45.79  ? 273  LEU A N   1 
ATOM 2148 C CA  . LEU A 1 276  ? -16.353 4.213   -47.723 1.00 45.79  ? 273  LEU A CA  1 
ATOM 2149 C C   . LEU A 1 276  ? -17.465 5.187   -47.322 1.00 45.79  ? 273  LEU A C   1 
ATOM 2150 O O   . LEU A 1 276  ? -18.625 4.982   -47.669 1.00 45.79  ? 273  LEU A O   1 
ATOM 2151 C CB  . LEU A 1 276  ? -16.080 4.335   -49.231 1.00 58.42  ? 273  LEU A CB  1 
ATOM 2152 C CG  . LEU A 1 276  ? -15.004 3.497   -49.968 1.00 58.42  ? 273  LEU A CG  1 
ATOM 2153 C CD1 . LEU A 1 276  ? -14.763 4.024   -51.387 1.00 58.42  ? 273  LEU A CD1 1 
ATOM 2154 C CD2 . LEU A 1 276  ? -13.685 3.413   -49.225 1.00 58.42  ? 273  LEU A CD2 1 
ATOM 2155 N N   . GLY A 1 277  ? -17.113 6.262   -46.613 1.00 46.18  ? 274  GLY A N   1 
ATOM 2156 C CA  . GLY A 1 277  ? -18.082 7.276   -46.171 1.00 46.18  ? 274  GLY A CA  1 
ATOM 2157 C C   . GLY A 1 277  ? -18.089 8.588   -46.940 1.00 46.18  ? 274  GLY A C   1 
ATOM 2158 O O   . GLY A 1 277  ? -17.065 9.266   -47.070 1.00 46.18  ? 274  GLY A O   1 
ATOM 2159 N N   . ASP A 1 278  ? -19.271 8.924   -47.434 1.00 41.46  ? 275  ASP A N   1 
ATOM 2160 C CA  . ASP A 1 278  ? -19.648 10.175  -48.100 1.00 41.46  ? 275  ASP A CA  1 
ATOM 2161 C C   . ASP A 1 278  ? -20.061 11.337  -47.125 1.00 41.46  ? 275  ASP A C   1 
ATOM 2162 O O   . ASP A 1 278  ? -20.520 11.097  -45.993 1.00 41.46  ? 275  ASP A O   1 
ATOM 2163 C CB  . ASP A 1 278  ? -20.919 9.834   -48.888 1.00 82.45  ? 275  ASP A CB  1 
ATOM 2164 C CG  . ASP A 1 278  ? -21.025 10.555  -50.198 1.00 82.45  ? 275  ASP A CG  1 
ATOM 2165 O OD1 . ASP A 1 278  ? -22.074 10.402  -50.851 1.00 82.45  ? 275  ASP A OD1 1 
ATOM 2166 O OD2 . ASP A 1 278  ? -20.070 11.253  -50.590 1.00 82.45  ? 275  ASP A OD2 1 
ATOM 2167 N N   . MET A 1 279  ? -19.989 12.591  -47.590 1.00 36.81  ? 276  MET A N   1 
ATOM 2168 C CA  . MET A 1 279  ? -20.480 13.723  -46.803 1.00 36.81  ? 276  MET A CA  1 
ATOM 2169 C C   . MET A 1 279  ? -22.002 13.662  -46.709 1.00 36.81  ? 276  MET A C   1 
ATOM 2170 O O   . MET A 1 279  ? -22.604 14.350  -45.869 1.00 36.81  ? 276  MET A O   1 
ATOM 2171 C CB  . MET A 1 279  ? -20.021 15.045  -47.418 1.00 96.81  ? 276  MET A CB  1 
ATOM 2172 C CG  . MET A 1 279  ? -19.959 16.223  -46.440 1.00 96.81  ? 276  MET A CG  1 
ATOM 2173 S SD  . MET A 1 279  ? -21.534 16.782  -45.687 1.00 96.81  ? 276  MET A SD  1 
ATOM 2174 C CE  . MET A 1 279  ? -22.577 17.320  -47.095 1.00 96.81  ? 276  MET A CE  1 
ATOM 2175 N N   . GLU A 1 280  ? -22.616 12.835  -47.573 1.00 50.28  ? 277  GLU A N   1 
ATOM 2176 C CA  . GLU A 1 280  ? -24.080 12.698  -47.696 1.00 50.28  ? 277  GLU A CA  1 
ATOM 2177 C C   . GLU A 1 280  ? -24.653 11.793  -46.615 1.00 50.28  ? 277  GLU A C   1 
ATOM 2178 O O   . GLU A 1 280  ? -25.818 11.924  -46.249 1.00 50.28  ? 277  GLU A O   1 
ATOM 2179 C CB  . GLU A 1 280  ? -24.450 12.079  -49.041 1.00 122.13 ? 277  GLU A CB  1 
ATOM 2180 C CG  . GLU A 1 280  ? -23.970 12.810  -50.259 1.00 122.13 ? 277  GLU A CG  1 
ATOM 2181 C CD  . GLU A 1 280  ? -24.934 13.861  -50.731 1.00 122.13 ? 277  GLU A CD  1 
ATOM 2182 O OE1 . GLU A 1 280  ? -25.098 14.873  -50.023 1.00 122.13 ? 277  GLU A OE1 1 
ATOM 2183 O OE2 . GLU A 1 280  ? -25.515 13.676  -51.824 1.00 122.13 ? 277  GLU A OE2 1 
ATOM 2184 N N   . GLY A 1 281  ? -23.841 10.852  -46.131 1.00 44.91  ? 278  GLY A N   1 
ATOM 2185 C CA  . GLY A 1 281  ? -24.313 9.788   -45.221 1.00 44.91  ? 278  GLY A CA  1 
ATOM 2186 C C   . GLY A 1 281  ? -24.281 8.414   -45.883 1.00 44.91  ? 278  GLY A C   1 
ATOM 2187 O O   . GLY A 1 281  ? -24.522 7.398   -45.221 1.00 44.91  ? 278  GLY A O   1 
ATOM 2188 N N   . ARG A 1 282  ? -23.947 8.391   -47.186 1.00 32.17  ? 279  ARG A N   1 
ATOM 2189 C CA  . ARG A 1 282  ? -24.025 7.168   -48.031 1.00 32.17  ? 279  ARG A CA  1 
ATOM 2190 C C   . ARG A 1 282  ? -22.907 6.263   -47.656 1.00 32.17  ? 279  ARG A C   1 
ATOM 2191 O O   . ARG A 1 282  ? -21.877 6.742   -47.185 1.00 32.17  ? 279  ARG A O   1 
ATOM 2192 C CB  . ARG A 1 282  ? -23.977 7.482   -49.532 1.00 62.85  ? 279  ARG A CB  1 
ATOM 2193 C CG  . ARG A 1 282  ? -25.234 8.191   -50.006 1.00 62.85  ? 279  ARG A CG  1 
ATOM 2194 C CD  . ARG A 1 282  ? -25.354 8.209   -51.499 1.00 62.85  ? 279  ARG A CD  1 
ATOM 2195 N NE  . ARG A 1 282  ? -24.433 9.148   -52.121 1.00 62.85  ? 279  ARG A NE  1 
ATOM 2196 C CZ  . ARG A 1 282  ? -24.121 9.132   -53.413 1.00 62.85  ? 279  ARG A CZ  1 
ATOM 2197 N NH1 . ARG A 1 282  ? -24.660 8.222   -54.213 1.00 62.85  ? 279  ARG A NH1 1 
ATOM 2198 N NH2 . ARG A 1 282  ? -23.249 10.006  -53.904 1.00 62.85  ? 279  ARG A NH2 1 
ATOM 2199 N N   . LEU A 1 283  ? -23.106 4.956   -47.789 1.00 45.74  ? 280  LEU A N   1 
ATOM 2200 C CA  . LEU A 1 283  ? -22.069 4.023   -47.371 1.00 45.74  ? 280  LEU A CA  1 
ATOM 2201 C C   . LEU A 1 283  ? -21.720 3.166   -48.563 1.00 45.74  ? 280  LEU A C   1 
ATOM 2202 O O   . LEU A 1 283  ? -22.595 2.560   -49.146 1.00 45.74  ? 280  LEU A O   1 
ATOM 2203 C CB  . LEU A 1 283  ? -22.526 3.190   -46.182 1.00 37.64  ? 280  LEU A CB  1 
ATOM 2204 C CG  . LEU A 1 283  ? -21.487 2.175   -45.707 1.00 37.64  ? 280  LEU A CG  1 
ATOM 2205 C CD1 . LEU A 1 283  ? -20.126 2.815   -45.495 1.00 37.64  ? 280  LEU A CD1 1 
ATOM 2206 C CD2 . LEU A 1 283  ? -21.871 1.440   -44.442 1.00 37.64  ? 280  LEU A CD2 1 
ATOM 2207 N N   . PHE A 1 284  ? -20.454 3.145   -48.955 1.00 56.11  ? 281  PHE A N   1 
ATOM 2208 C CA  . PHE A 1 284  ? -20.056 2.346   -50.103 1.00 56.11  ? 281  PHE A CA  1 
ATOM 2209 C C   . PHE A 1 284  ? -19.204 1.181   -49.662 1.00 56.11  ? 281  PHE A C   1 
ATOM 2210 O O   . PHE A 1 284  ? -18.675 1.174   -48.550 1.00 56.11  ? 281  PHE A O   1 
ATOM 2211 C CB  . PHE A 1 284  ? -19.295 3.173   -51.159 1.00 53.75  ? 281  PHE A CB  1 
ATOM 2212 C CG  . PHE A 1 284  ? -20.100 4.298   -51.767 1.00 53.75  ? 281  PHE A CG  1 
ATOM 2213 C CD1 . PHE A 1 284  ? -19.988 5.595   -51.279 1.00 53.75  ? 281  PHE A CD1 1 
ATOM 2214 C CD2 . PHE A 1 284  ? -20.958 4.062   -52.833 1.00 53.75  ? 281  PHE A CD2 1 
ATOM 2215 C CE1 . PHE A 1 284  ? -20.706 6.630   -51.832 1.00 53.75  ? 281  PHE A CE1 1 
ATOM 2216 C CE2 . PHE A 1 284  ? -21.686 5.092   -53.411 1.00 53.75  ? 281  PHE A CE2 1 
ATOM 2217 C CZ  . PHE A 1 284  ? -21.558 6.378   -52.909 1.00 53.75  ? 281  PHE A CZ  1 
ATOM 2218 N N   . MET A 1 285  ? -19.108 0.191   -50.554 1.00 40.15  ? 282  MET A N   1 
ATOM 2219 C CA  . MET A 1 285  ? -18.163 -0.906  -50.455 1.00 40.15  ? 282  MET A CA  1 
ATOM 2220 C C   . MET A 1 285  ? -17.224 -0.914  -51.658 1.00 40.15  ? 282  MET A C   1 
ATOM 2221 O O   . MET A 1 285  ? -17.648 -0.816  -52.807 1.00 40.15  ? 282  MET A O   1 
ATOM 2222 C CB  . MET A 1 285  ? -18.877 -2.214  -50.391 1.00 59.35  ? 282  MET A CB  1 
ATOM 2223 C CG  . MET A 1 285  ? -17.916 -3.342  -50.300 1.00 59.35  ? 282  MET A CG  1 
ATOM 2224 S SD  . MET A 1 285  ? -17.376 -3.598  -48.604 1.00 59.35  ? 282  MET A SD  1 
ATOM 2225 C CE  . MET A 1 285  ? -18.914 -3.963  -47.740 1.00 59.35  ? 282  MET A CE  1 
ATOM 2226 N N   . LEU A 1 286  ? -15.937 -1.029  -51.372 1.00 53.61  ? 283  LEU A N   1 
ATOM 2227 C CA  . LEU A 1 286  ? -14.912 -0.980  -52.396 1.00 53.61  ? 283  LEU A CA  1 
ATOM 2228 C C   . LEU A 1 286  ? -14.323 -2.354  -52.451 1.00 53.61  ? 283  LEU A C   1 
ATOM 2229 O O   . LEU A 1 286  ? -13.890 -2.878  -51.423 1.00 53.61  ? 283  LEU A O   1 
ATOM 2230 C CB  . LEU A 1 286  ? -13.818 0.003   -51.992 1.00 48.54  ? 283  LEU A CB  1 
ATOM 2231 C CG  . LEU A 1 286  ? -12.873 0.611   -53.040 1.00 48.54  ? 283  LEU A CG  1 
ATOM 2232 C CD1 . LEU A 1 286  ? -11.518 0.916   -52.377 1.00 48.54  ? 283  LEU A CD1 1 
ATOM 2233 C CD2 . LEU A 1 286  ? -12.690 -0.265  -54.323 1.00 48.54  ? 283  LEU A CD2 1 
ATOM 2234 N N   . LEU A 1 287  ? -14.322 -2.944  -53.640 1.00 53.71  ? 284  LEU A N   1 
ATOM 2235 C CA  . LEU A 1 287  ? -13.917 -4.345  -53.757 1.00 53.71  ? 284  LEU A CA  1 
ATOM 2236 C C   . LEU A 1 287  ? -12.745 -4.511  -54.695 1.00 53.71  ? 284  LEU A C   1 
ATOM 2237 O O   . LEU A 1 287  ? -12.642 -3.845  -55.726 1.00 53.71  ? 284  LEU A O   1 
ATOM 2238 C CB  . LEU A 1 287  ? -15.075 -5.295  -54.127 1.00 60.74  ? 284  LEU A CB  1 
ATOM 2239 C CG  . LEU A 1 287  ? -16.271 -5.230  -53.175 1.00 60.74  ? 284  LEU A CG  1 
ATOM 2240 C CD1 . LEU A 1 287  ? -17.463 -4.628  -53.889 1.00 60.74  ? 284  LEU A CD1 1 
ATOM 2241 C CD2 . LEU A 1 287  ? -16.626 -6.567  -52.570 1.00 60.74  ? 284  LEU A CD2 1 
ATOM 2242 N N   . LEU A 1 288  ? -11.874 -5.424  -54.300 1.00 66.49  ? 285  LEU A N   1 
ATOM 2243 C CA  . LEU A 1 288  ? -10.656 -5.676  -54.985 1.00 66.49  ? 285  LEU A CA  1 
ATOM 2244 C C   . LEU A 1 288  ? -10.702 -7.094  -55.518 1.00 66.49  ? 285  LEU A C   1 
ATOM 2245 O O   . LEU A 1 288  ? -10.569 -8.068  -54.760 1.00 66.49  ? 285  LEU A O   1 
ATOM 2246 C CB  . LEU A 1 288  ? -9.512  -5.523  -53.993 1.00 67.89  ? 285  LEU A CB  1 
ATOM 2247 C CG  . LEU A 1 288  ? -9.338  -4.199  -53.244 1.00 67.89  ? 285  LEU A CG  1 
ATOM 2248 C CD1 . LEU A 1 288  ? -7.973  -4.202  -52.628 1.00 67.89  ? 285  LEU A CD1 1 
ATOM 2249 C CD2 . LEU A 1 288  ? -9.487  -2.967  -54.154 1.00 67.89  ? 285  LEU A CD2 1 
ATOM 2250 N N   . GLU A 1 289  ? -10.897 -7.231  -56.823 1.00 70.52  ? 286  GLU A N   1 
ATOM 2251 C CA  . GLU A 1 289  ? -10.901 -8.562  -57.389 1.00 70.52  ? 286  GLU A CA  1 
ATOM 2252 C C   . GLU A 1 289  ? -9.470  -9.100  -57.513 1.00 70.52  ? 286  GLU A C   1 
ATOM 2253 O O   . GLU A 1 289  ? -8.703  -8.641  -58.373 1.00 70.52  ? 286  GLU A O   1 
ATOM 2254 C CB  . GLU A 1 289  ? -11.654 -8.609  -58.719 1.00 90.74  ? 286  GLU A CB  1 
ATOM 2255 C CG  . GLU A 1 289  ? -12.575 -9.834  -58.830 1.00 90.74  ? 286  GLU A CG  1 
ATOM 2256 C CD  . GLU A 1 289  ? -12.609 -10.445 -60.230 1.00 90.74  ? 286  GLU A CD  1 
ATOM 2257 O OE1 . GLU A 1 289  ? -12.117 -11.595 -60.384 1.00 90.74  ? 286  GLU A OE1 1 
ATOM 2258 O OE2 . GLU A 1 289  ? -13.115 -9.774  -61.169 1.00 90.74  ? 286  GLU A OE2 1 
ATOM 2259 N N   . LYS A 1 290  ? -9.137  -10.053 -56.624 1.00 74.02  ? 287  LYS A N   1 
ATOM 2260 C CA  . LYS A 1 290  ? -7.862  -10.802 -56.616 1.00 74.02  ? 287  LYS A CA  1 
ATOM 2261 C C   . LYS A 1 290  ? -7.681  -11.625 -57.871 1.00 74.02  ? 287  LYS A C   1 
ATOM 2262 O O   . LYS A 1 290  ? -8.519  -11.601 -58.764 1.00 74.02  ? 287  LYS A O   1 
ATOM 2263 C CB  . LYS A 1 290  ? -7.767  -11.775 -55.423 1.00 82.19  ? 287  LYS A CB  1 
ATOM 2264 C CG  . LYS A 1 290  ? -8.074  -11.191 -54.047 1.00 82.19  ? 287  LYS A CG  1 
ATOM 2265 C CD  . LYS A 1 290  ? -7.830  -12.212 -52.913 1.00 82.19  ? 287  LYS A CD  1 
ATOM 2266 C CE  . LYS A 1 290  ? -8.919  -12.093 -51.830 1.00 82.19  ? 287  LYS A CE  1 
ATOM 2267 N NZ  . LYS A 1 290  ? -8.520  -12.595 -50.486 1.00 82.19  ? 287  LYS A NZ  1 
ATOM 2268 N N   . GLU A 1 291  ? -6.577  -12.376 -57.917 1.00 168.73 ? 288  GLU A N   1 
ATOM 2269 C CA  . GLU A 1 291  ? -6.200  -13.188 -59.076 1.00 168.73 ? 288  GLU A CA  1 
ATOM 2270 C C   . GLU A 1 291  ? -5.011  -14.072 -58.742 1.00 168.73 ? 288  GLU A C   1 
ATOM 2271 O O   . GLU A 1 291  ? -3.929  -13.573 -58.441 1.00 168.73 ? 288  GLU A O   1 
ATOM 2272 C CB  . GLU A 1 291  ? -5.823  -12.287 -60.244 1.00 111.03 ? 288  GLU A CB  1 
ATOM 2273 C CG  . GLU A 1 291  ? -5.811  -12.972 -61.572 1.00 111.03 ? 288  GLU A CG  1 
ATOM 2274 C CD  . GLU A 1 291  ? -6.178  -12.017 -62.678 1.00 111.03 ? 288  GLU A CD  1 
ATOM 2275 O OE1 . GLU A 1 291  ? -5.351  -11.130 -62.999 1.00 111.03 ? 288  GLU A OE1 1 
ATOM 2276 O OE2 . GLU A 1 291  ? -7.300  -12.147 -63.215 1.00 111.03 ? 288  GLU A OE2 1 
ATOM 2277 N N   . GLU A 1 292  ? -5.204  -15.382 -58.800 1.00 197.35 ? 289  GLU A N   1 
ATOM 2278 C CA  . GLU A 1 292  ? -4.102  -16.282 -58.503 1.00 197.35 ? 289  GLU A CA  1 
ATOM 2279 C C   . GLU A 1 292  ? -3.359  -16.705 -59.766 1.00 197.35 ? 289  GLU A C   1 
ATOM 2280 O O   . GLU A 1 292  ? -3.968  -16.931 -60.816 1.00 197.35 ? 289  GLU A O   1 
ATOM 2281 C CB  . GLU A 1 292  ? -4.564  -17.502 -57.695 1.00 195.47 ? 289  GLU A CB  1 
ATOM 2282 C CG  . GLU A 1 292  ? -3.417  -18.198 -56.942 1.00 195.47 ? 289  GLU A CG  1 
ATOM 2283 C CD  . GLU A 1 292  ? -3.875  -19.174 -55.863 1.00 195.47 ? 289  GLU A CD  1 
ATOM 2284 O OE1 . GLU A 1 292  ? -4.728  -20.044 -56.154 1.00 195.47 ? 289  GLU A OE1 1 
ATOM 2285 O OE2 . GLU A 1 292  ? -3.357  -19.083 -54.725 1.00 195.47 ? 289  GLU A OE2 1 
ATOM 2286 N N   . GLN A 1 293  ? -2.034  -16.751 -59.649 1.00 203.03 ? 290  GLN A N   1 
ATOM 2287 C CA  . GLN A 1 293  ? -1.184  -17.481 -60.583 1.00 203.03 ? 290  GLN A CA  1 
ATOM 2288 C C   . GLN A 1 293  ? -0.387  -18.525 -59.772 1.00 203.03 ? 290  GLN A C   1 
ATOM 2289 O O   . GLN A 1 293  ? 0.235   -18.187 -58.762 1.00 203.03 ? 290  GLN A O   1 
ATOM 2290 C CB  . GLN A 1 293  ? -0.315  -16.527 -61.439 1.00 102.30 ? 290  GLN A CB  1 
ATOM 2291 C CG  . GLN A 1 293  ? 1.182   -16.458 -61.124 1.00 102.30 ? 290  GLN A CG  1 
ATOM 2292 C CD  . GLN A 1 293  ? 2.055   -16.806 -62.342 1.00 102.30 ? 290  GLN A CD  1 
ATOM 2293 O OE1 . GLN A 1 293  ? 1.694   -17.654 -63.171 1.00 102.30 ? 290  GLN A OE1 1 
ATOM 2294 N NE2 . GLN A 1 293  ? 3.218   -16.162 -62.438 1.00 102.30 ? 290  GLN A NE2 1 
ATOM 2295 N N   . MET A 1 294  ? -0.441  -19.784 -60.227 1.00 209.00 ? 291  MET A N   1 
ATOM 2296 C CA  . MET A 1 294  ? -0.032  -21.003 -59.472 1.00 209.00 ? 291  MET A CA  1 
ATOM 2297 C C   . MET A 1 294  ? 0.998   -20.895 -58.321 1.00 209.00 ? 291  MET A C   1 
ATOM 2298 O O   . MET A 1 294  ? 0.617   -20.610 -57.181 1.00 209.00 ? 291  MET A O   1 
ATOM 2299 C CB  . MET A 1 294  ? 0.353   -22.137 -60.437 1.00 165.69 ? 291  MET A CB  1 
ATOM 2300 C CG  . MET A 1 294  ? -0.830  -22.910 -61.006 1.00 165.69 ? 291  MET A CG  1 
ATOM 2301 S SD  . MET A 1 294  ? -0.328  -24.405 -61.891 1.00 165.69 ? 291  MET A SD  1 
ATOM 2302 C CE  . MET A 1 294  ? 0.067   -25.533 -60.549 1.00 165.69 ? 291  MET A CE  1 
ATOM 2303 N N   . ASP A 1 295  ? 2.278   -21.159 -58.605 1.00 163.93 ? 292  ASP A N   1 
ATOM 2304 C CA  . ASP A 1 295  ? 3.348   -20.926 -57.624 1.00 163.93 ? 292  ASP A CA  1 
ATOM 2305 C C   . ASP A 1 295  ? 3.825   -19.463 -57.663 1.00 163.93 ? 292  ASP A C   1 
ATOM 2306 O O   . ASP A 1 295  ? 4.943   -19.152 -58.101 1.00 163.93 ? 292  ASP A O   1 
ATOM 2307 C CB  . ASP A 1 295  ? 4.500   -21.955 -57.754 1.00 209.00 ? 292  ASP A CB  1 
ATOM 2308 C CG  . ASP A 1 295  ? 5.355   -21.760 -59.006 1.00 209.00 ? 292  ASP A CG  1 
ATOM 2309 O OD1 . ASP A 1 295  ? 4.789   -21.520 -60.109 1.00 209.00 ? 292  ASP A OD1 1 
ATOM 2310 O OD2 . ASP A 1 295  ? 6.606   -21.872 -58.887 1.00 209.00 ? 292  ASP A OD2 1 
ATOM 2311 N N   . GLY A 1 296  ? 2.941   -18.573 -57.205 1.00 184.82 ? 293  GLY A N   1 
ATOM 2312 C CA  . GLY A 1 296  ? 3.174   -17.126 -57.189 1.00 184.82 ? 293  GLY A CA  1 
ATOM 2313 C C   . GLY A 1 296  ? 2.178   -16.374 -56.317 1.00 184.82 ? 293  GLY A C   1 
ATOM 2314 O O   . GLY A 1 296  ? 1.023   -16.789 -56.177 1.00 184.82 ? 293  GLY A O   1 
ATOM 2315 N N   . THR A 1 297  ? 2.636   -15.261 -55.739 1.00 209.00 ? 294  THR A N   1 
ATOM 2316 C CA  . THR A 1 297  ? 1.835   -14.426 -54.830 1.00 209.00 ? 294  THR A CA  1 
ATOM 2317 C C   . THR A 1 297  ? 0.640   -13.794 -55.556 1.00 209.00 ? 294  THR A C   1 
ATOM 2318 O O   . THR A 1 297  ? 0.708   -13.519 -56.757 1.00 209.00 ? 294  THR A O   1 
ATOM 2319 C CB  . THR A 1 297  ? 2.703   -13.316 -54.149 1.00 126.74 ? 294  THR A CB  1 
ATOM 2320 O OG1 . THR A 1 297  ? 3.964   -13.860 -53.745 1.00 126.74 ? 294  THR A OG1 1 
ATOM 2321 C CG2 . THR A 1 297  ? 2.012   -12.736 -52.919 1.00 126.74 ? 294  THR A CG2 1 
ATOM 2322 N N   . VAL A 1 298  ? -0.445  -13.577 -54.812 1.00 158.59 ? 295  VAL A N   1 
ATOM 2323 C CA  . VAL A 1 298  ? -1.691  -13.026 -55.351 1.00 158.59 ? 295  VAL A CA  1 
ATOM 2324 C C   . VAL A 1 298  ? -1.527  -11.646 -55.999 1.00 158.59 ? 295  VAL A C   1 
ATOM 2325 O O   . VAL A 1 298  ? -0.852  -10.767 -55.457 1.00 158.59 ? 295  VAL A O   1 
ATOM 2326 C CB  . VAL A 1 298  ? -2.820  -12.976 -54.273 1.00 138.88 ? 295  VAL A CB  1 
ATOM 2327 C CG1 . VAL A 1 298  ? -3.637  -14.258 -54.275 1.00 138.88 ? 295  VAL A CG1 1 
ATOM 2328 C CG2 . VAL A 1 298  ? -2.256  -12.694 -52.876 1.00 138.88 ? 295  VAL A CG2 1 
ATOM 2329 N N   . THR A 1 299  ? -2.142  -11.485 -57.168 1.00 108.86 ? 296  THR A N   1 
ATOM 2330 C CA  . THR A 1 299  ? -2.200  -10.198 -57.880 1.00 108.86 ? 296  THR A CA  1 
ATOM 2331 C C   . THR A 1 299  ? -3.618  -9.587  -57.804 1.00 108.86 ? 296  THR A C   1 
ATOM 2332 O O   . THR A 1 299  ? -4.438  -10.026 -57.004 1.00 108.86 ? 296  THR A O   1 
ATOM 2333 C CB  . THR A 1 299  ? -1.684  -10.324 -59.360 1.00 113.85 ? 296  THR A CB  1 
ATOM 2334 O OG1 . THR A 1 299  ? -2.040  -9.157  -60.114 1.00 113.85 ? 296  THR A OG1 1 
ATOM 2335 C CG2 . THR A 1 299  ? -2.251  -11.553 -60.054 1.00 113.85 ? 296  THR A CG2 1 
ATOM 2336 N N   . LEU A 1 300  ? -3.898  -8.565  -58.604 1.00 122.23 ? 297  LEU A N   1 
ATOM 2337 C CA  . LEU A 1 300  ? -5.255  -8.040  -58.699 1.00 122.23 ? 297  LEU A CA  1 
ATOM 2338 C C   . LEU A 1 300  ? -5.693  -7.908  -60.142 1.00 122.23 ? 297  LEU A C   1 
ATOM 2339 O O   . LEU A 1 300  ? -4.870  -7.730  -61.047 1.00 122.23 ? 297  LEU A O   1 
ATOM 2340 C CB  . LEU A 1 300  ? -5.383  -6.689  -57.997 1.00 209.00 ? 297  LEU A CB  1 
ATOM 2341 C CG  . LEU A 1 300  ? -5.534  -6.709  -56.477 1.00 209.00 ? 297  LEU A CG  1 
ATOM 2342 C CD1 . LEU A 1 300  ? -4.167  -6.660  -55.812 1.00 209.00 ? 297  LEU A CD1 1 
ATOM 2343 C CD2 . LEU A 1 300  ? -6.374  -5.525  -56.044 1.00 209.00 ? 297  LEU A CD2 1 
ATOM 2344 N N   . LYS A 1 301  ? -6.996  -7.991  -60.367 1.00 83.08  ? 298  LYS A N   1 
ATOM 2345 C CA  . LYS A 1 301  ? -7.477  -7.809  -61.709 1.00 83.08  ? 298  LYS A CA  1 
ATOM 2346 C C   . LYS A 1 301  ? -8.222  -6.503  -61.808 1.00 83.08  ? 298  LYS A C   1 
ATOM 2347 O O   . LYS A 1 301  ? -7.924  -5.678  -62.669 1.00 83.08  ? 298  LYS A O   1 
ATOM 2348 C CB  . LYS A 1 301  ? -8.335  -8.999  -62.176 1.00 135.99 ? 298  LYS A CB  1 
ATOM 2349 C CG  . LYS A 1 301  ? -8.858  -8.935  -63.646 1.00 135.99 ? 298  LYS A CG  1 
ATOM 2350 C CD  . LYS A 1 301  ? -7.932  -8.199  -64.659 1.00 135.99 ? 298  LYS A CD  1 
ATOM 2351 C CE  . LYS A 1 301  ? -6.666  -8.980  -65.033 1.00 135.99 ? 298  LYS A CE  1 
ATOM 2352 N NZ  . LYS A 1 301  ? -6.952  -10.136 -65.944 1.00 135.99 ? 298  LYS A NZ  1 
ATOM 2353 N N   . ASP A 1 302  ? -9.185  -6.308  -60.924 1.00 69.25  ? 299  ASP A N   1 
ATOM 2354 C CA  . ASP A 1 302  ? -10.097 -5.186  -61.082 1.00 69.25  ? 299  ASP A CA  1 
ATOM 2355 C C   . ASP A 1 302  ? -10.617 -4.762  -59.718 1.00 69.25  ? 299  ASP A C   1 
ATOM 2356 O O   . ASP A 1 302  ? -10.523 -5.537  -58.748 1.00 69.25  ? 299  ASP A O   1 
ATOM 2357 C CB  . ASP A 1 302  ? -11.253 -5.606  -61.997 1.00 74.29  ? 299  ASP A CB  1 
ATOM 2358 C CG  . ASP A 1 302  ? -12.185 -4.471  -62.317 1.00 74.29  ? 299  ASP A CG  1 
ATOM 2359 O OD1 . ASP A 1 302  ? -11.703 -3.328  -62.457 1.00 74.29  ? 299  ASP A OD1 1 
ATOM 2360 O OD2 . ASP A 1 302  ? -13.406 -4.718  -62.429 1.00 74.29  ? 299  ASP A OD2 1 
ATOM 2361 N N   . LEU A 1 303  ? -11.150 -3.541  -59.640 1.00 67.18  ? 300  LEU A N   1 
ATOM 2362 C CA  . LEU A 1 303  ? -11.848 -3.074  -58.437 1.00 67.18  ? 300  LEU A CA  1 
ATOM 2363 C C   . LEU A 1 303  ? -13.177 -2.391  -58.748 1.00 67.18  ? 300  LEU A C   1 
ATOM 2364 O O   . LEU A 1 303  ? -13.261 -1.623  -59.704 1.00 67.18  ? 300  LEU A O   1 
ATOM 2365 C CB  . LEU A 1 303  ? -10.939 -2.184  -57.553 1.00 79.89  ? 300  LEU A CB  1 
ATOM 2366 C CG  . LEU A 1 303  ? -10.382 -0.794  -57.893 1.00 79.89  ? 300  LEU A CG  1 
ATOM 2367 C CD1 . LEU A 1 303  ? -9.865  -0.163  -56.638 1.00 79.89  ? 300  LEU A CD1 1 
ATOM 2368 C CD2 . LEU A 1 303  ? -9.256  -0.830  -58.905 1.00 79.89  ? 300  LEU A CD2 1 
ATOM 2369 N N   . ARG A 1 304  ? -14.214 -2.669  -57.949 1.00 62.40  ? 301  ARG A N   1 
ATOM 2370 C CA  . ARG A 1 304  ? -15.510 -1.969  -58.126 1.00 62.40  ? 301  ARG A CA  1 
ATOM 2371 C C   . ARG A 1 304  ? -16.134 -1.415  -56.851 1.00 62.40  ? 301  ARG A C   1 
ATOM 2372 O O   . ARG A 1 304  ? -15.758 -1.772  -55.743 1.00 62.40  ? 301  ARG A O   1 
ATOM 2373 C CB  . ARG A 1 304  ? -16.532 -2.856  -58.869 1.00 59.39  ? 301  ARG A CB  1 
ATOM 2374 C CG  . ARG A 1 304  ? -17.258 -3.840  -57.975 1.00 59.39  ? 301  ARG A CG  1 
ATOM 2375 C CD  . ARG A 1 304  ? -17.394 -5.206  -58.619 1.00 59.39  ? 301  ARG A CD  1 
ATOM 2376 N NE  . ARG A 1 304  ? -17.393 -6.249  -57.587 1.00 59.39  ? 301  ARG A NE  1 
ATOM 2377 C CZ  . ARG A 1 304  ? -18.463 -6.596  -56.862 1.00 59.39  ? 301  ARG A CZ  1 
ATOM 2378 N NH1 . ARG A 1 304  ? -19.632 -5.979  -57.077 1.00 59.39  ? 301  ARG A NH1 1 
ATOM 2379 N NH2 . ARG A 1 304  ? -18.366 -7.564  -55.927 1.00 59.39  ? 301  ARG A NH2 1 
ATOM 2380 N N   . VAL A 1 305  ? -17.126 -0.562  -57.045 1.00 50.48  ? 302  VAL A N   1 
ATOM 2381 C CA  . VAL A 1 305  ? -17.793 0.127   -55.954 1.00 50.48  ? 302  VAL A CA  1 
ATOM 2382 C C   . VAL A 1 305  ? -19.303 -0.151  -55.874 1.00 50.48  ? 302  VAL A C   1 
ATOM 2383 O O   . VAL A 1 305  ? -20.062 0.056   -56.827 1.00 50.48  ? 302  VAL A O   1 
ATOM 2384 C CB  . VAL A 1 305  ? -17.529 1.646   -56.073 1.00 39.72  ? 302  VAL A CB  1 
ATOM 2385 C CG1 . VAL A 1 305  ? -18.671 2.467   -55.472 1.00 39.72  ? 302  VAL A CG1 1 
ATOM 2386 C CG2 . VAL A 1 305  ? -16.196 1.985   -55.408 1.00 39.72  ? 302  VAL A CG2 1 
ATOM 2387 N N   . GLU A 1 306  ? -19.739 -0.601  -54.714 1.00 47.20  ? 303  GLU A N   1 
ATOM 2388 C CA  . GLU A 1 306  ? -21.129 -0.934  -54.524 1.00 47.20  ? 303  GLU A CA  1 
ATOM 2389 C C   . GLU A 1 306  ? -21.786 -0.046  -53.478 1.00 47.20  ? 303  GLU A C   1 
ATOM 2390 O O   . GLU A 1 306  ? -21.364 -0.030  -52.333 1.00 47.20  ? 303  GLU A O   1 
ATOM 2391 C CB  . GLU A 1 306  ? -21.252 -2.408  -54.123 1.00 77.83  ? 303  GLU A CB  1 
ATOM 2392 C CG  . GLU A 1 306  ? -21.214 -3.399  -55.303 1.00 77.83  ? 303  GLU A CG  1 
ATOM 2393 C CD  . GLU A 1 306  ? -21.482 -4.863  -54.889 1.00 77.83  ? 303  GLU A CD  1 
ATOM 2394 O OE1 . GLU A 1 306  ? -21.264 -5.225  -53.694 1.00 77.83  ? 303  GLU A OE1 1 
ATOM 2395 O OE2 . GLU A 1 306  ? -21.905 -5.650  -55.779 1.00 77.83  ? 303  GLU A OE2 1 
ATOM 2396 N N   . LEU A 1 307  ? -22.843 0.667   -53.857 1.00 62.62  ? 304  LEU A N   1 
ATOM 2397 C CA  . LEU A 1 307  ? -23.654 1.396   -52.888 1.00 62.62  ? 304  LEU A CA  1 
ATOM 2398 C C   . LEU A 1 307  ? -24.404 0.465   -51.979 1.00 62.62  ? 304  LEU A C   1 
ATOM 2399 O O   . LEU A 1 307  ? -25.114 -0.429  -52.410 1.00 62.62  ? 304  LEU A O   1 
ATOM 2400 C CB  . LEU A 1 307  ? -24.642 2.291   -53.585 1.00 46.44  ? 304  LEU A CB  1 
ATOM 2401 C CG  . LEU A 1 307  ? -25.643 3.045   -52.726 1.00 46.44  ? 304  LEU A CG  1 
ATOM 2402 C CD1 . LEU A 1 307  ? -25.021 3.846   -51.578 1.00 46.44  ? 304  LEU A CD1 1 
ATOM 2403 C CD2 . LEU A 1 307  ? -26.365 3.963   -53.663 1.00 46.44  ? 304  LEU A CD2 1 
ATOM 2404 N N   . LEU A 1 308  ? -24.237 0.692   -50.698 1.00 50.42  ? 305  LEU A N   1 
ATOM 2405 C CA  . LEU A 1 308  ? -24.762 -0.195  -49.717 1.00 50.42  ? 305  LEU A CA  1 
ATOM 2406 C C   . LEU A 1 308  ? -25.932 0.338   -48.958 1.00 50.42  ? 305  LEU A C   1 
ATOM 2407 O O   . LEU A 1 308  ? -26.654 -0.438  -48.331 1.00 50.42  ? 305  LEU A O   1 
ATOM 2408 C CB  . LEU A 1 308  ? -23.717 -0.490  -48.691 1.00 40.62  ? 305  LEU A CB  1 
ATOM 2409 C CG  . LEU A 1 308  ? -22.679 -1.472  -49.120 1.00 40.62  ? 305  LEU A CG  1 
ATOM 2410 C CD1 . LEU A 1 308  ? -22.400 -2.320  -47.911 1.00 40.62  ? 305  LEU A CD1 1 
ATOM 2411 C CD2 . LEU A 1 308  ? -23.187 -2.285  -50.251 1.00 40.62  ? 305  LEU A CD2 1 
ATOM 2412 N N   . GLY A 1 309  ? -26.112 1.646   -48.938 1.00 41.57  ? 306  GLY A N   1 
ATOM 2413 C CA  . GLY A 1 309  ? -27.098 2.178   -48.024 1.00 41.57  ? 306  GLY A CA  1 
ATOM 2414 C C   . GLY A 1 309  ? -26.791 3.561   -47.520 1.00 41.57  ? 306  GLY A C   1 
ATOM 2415 O O   . GLY A 1 309  ? -26.214 4.367   -48.238 1.00 41.57  ? 306  GLY A O   1 
ATOM 2416 N N   . GLU A 1 310  ? -27.159 3.822   -46.272 1.00 57.96  ? 307  GLU A N   1 
ATOM 2417 C CA  . GLU A 1 310  ? -27.186 5.168   -45.758 1.00 57.96  ? 307  GLU A CA  1 
ATOM 2418 C C   . GLU A 1 310  ? -27.063 5.131   -44.261 1.00 57.96  ? 307  GLU A C   1 
ATOM 2419 O O   . GLU A 1 310  ? -27.824 4.464   -43.589 1.00 57.96  ? 307  GLU A O   1 
ATOM 2420 C CB  . GLU A 1 310  ? -28.497 5.828   -46.180 1.00 57.94  ? 307  GLU A CB  1 
ATOM 2421 C CG  . GLU A 1 310  ? -29.092 6.798   -45.182 1.00 57.94  ? 307  GLU A CG  1 
ATOM 2422 C CD  . GLU A 1 310  ? -29.681 8.022   -45.871 1.00 57.94  ? 307  GLU A CD  1 
ATOM 2423 O OE1 . GLU A 1 310  ? -29.261 8.263   -47.035 1.00 57.94  ? 307  GLU A OE1 1 
ATOM 2424 O OE2 . GLU A 1 310  ? -30.540 8.737   -45.265 1.00 57.94  ? 307  GLU A OE2 1 
ATOM 2425 N N   . THR A 1 311  ? -26.089 5.856   -43.746 1.00 38.13  ? 308  THR A N   1 
ATOM 2426 C CA  . THR A 1 311  ? -25.833 5.934   -42.327 1.00 38.13  ? 308  THR A CA  1 
ATOM 2427 C C   . THR A 1 311  ? -26.018 7.381   -41.918 1.00 38.13  ? 308  THR A C   1 
ATOM 2428 O O   . THR A 1 311  ? -26.560 8.179   -42.694 1.00 38.13  ? 308  THR A O   1 
ATOM 2429 C CB  . THR A 1 311  ? -24.403 5.520   -42.039 1.00 33.42  ? 308  THR A CB  1 
ATOM 2430 O OG1 . THR A 1 311  ? -23.491 6.347   -42.802 1.00 33.42  ? 308  THR A OG1 1 
ATOM 2431 C CG2 . THR A 1 311  ? -24.185 4.050   -42.401 1.00 33.42  ? 308  THR A CG2 1 
ATOM 2432 N N   . SER A 1 312  ? -25.587 7.730   -40.709 1.00 41.95  ? 309  SER A N   1 
ATOM 2433 C CA  . SER A 1 312  ? -25.474 9.132   -40.344 1.00 41.95  ? 309  SER A CA  1 
ATOM 2434 C C   . SER A 1 312  ? -24.236 9.575   -41.080 1.00 41.95  ? 309  SER A C   1 
ATOM 2435 O O   . SER A 1 312  ? -23.415 8.728   -41.480 1.00 41.95  ? 309  SER A O   1 
ATOM 2436 C CB  . SER A 1 312  ? -25.239 9.340   -38.845 1.00 31.46  ? 309  SER A CB  1 
ATOM 2437 O OG  . SER A 1 312  ? -25.633 8.225   -38.048 1.00 31.46  ? 309  SER A OG  1 
ATOM 2438 N N   . ILE A 1 313  ? -24.079 10.886  -41.253 1.00 47.58  ? 310  ILE A N   1 
ATOM 2439 C CA  . ILE A 1 313  ? -22.825 11.421  -41.773 1.00 47.58  ? 310  ILE A CA  1 
ATOM 2440 C C   . ILE A 1 313  ? -21.677 10.880  -40.922 1.00 47.58  ? 310  ILE A C   1 
ATOM 2441 O O   . ILE A 1 313  ? -21.620 11.066  -39.711 1.00 47.58  ? 310  ILE A O   1 
ATOM 2442 C CB  . ILE A 1 313  ? -22.803 12.929  -41.831 1.00 42.66  ? 310  ILE A CB  1 
ATOM 2443 C CG1 . ILE A 1 313  ? -24.190 13.472  -42.167 1.00 42.66  ? 310  ILE A CG1 1 
ATOM 2444 C CG2 . ILE A 1 313  ? -21.872 13.346  -42.874 1.00 42.66  ? 310  ILE A CG2 1 
ATOM 2445 C CD1 . ILE A 1 313  ? -24.459 13.679  -43.633 1.00 42.66  ? 310  ILE A CD1 1 
ATOM 2446 N N   . ALA A 1 314  ? -20.798 10.153  -41.587 1.00 27.70  ? 311  ALA A N   1 
ATOM 2447 C CA  . ALA A 1 314  ? -19.746 9.444   -40.926 1.00 27.70  ? 311  ALA A CA  1 
ATOM 2448 C C   . ALA A 1 314  ? -18.536 10.305  -40.838 1.00 27.70  ? 311  ALA A C   1 
ATOM 2449 O O   . ALA A 1 314  ? -18.035 10.758  -41.894 1.00 27.70  ? 311  ALA A O   1 
ATOM 2450 C CB  . ALA A 1 314  ? -19.375 8.192   -41.711 1.00 10.00  ? 311  ALA A CB  1 
ATOM 2451 N N   . GLU A 1 315  ? -18.016 10.504  -39.624 1.00 45.86  ? 312  GLU A N   1 
ATOM 2452 C CA  . GLU A 1 315  ? -16.638 10.946  -39.535 1.00 45.86  ? 312  GLU A CA  1 
ATOM 2453 C C   . GLU A 1 315  ? -15.737 9.764   -39.594 1.00 45.86  ? 312  GLU A C   1 
ATOM 2454 O O   . GLU A 1 315  ? -14.764 9.795   -40.328 1.00 45.86  ? 312  GLU A O   1 
ATOM 2455 C CB  . GLU A 1 315  ? -16.349 11.773  -38.296 1.00 53.37  ? 312  GLU A CB  1 
ATOM 2456 C CG  . GLU A 1 315  ? -16.138 13.239  -38.655 1.00 53.37  ? 312  GLU A CG  1 
ATOM 2457 C CD  . GLU A 1 315  ? -14.717 13.715  -38.451 1.00 53.37  ? 312  GLU A CD  1 
ATOM 2458 O OE1 . GLU A 1 315  ? -13.870 12.997  -37.855 1.00 53.37  ? 312  GLU A OE1 1 
ATOM 2459 O OE2 . GLU A 1 315  ? -14.459 14.858  -38.880 1.00 53.37  ? 312  GLU A OE2 1 
ATOM 2460 N N   . CYS A 1 316  ? -16.154 8.712   -38.887 1.00 46.57  ? 313  CYS A N   1 
ATOM 2461 C CA  . CYS A 1 316  ? -15.344 7.613   -38.376 1.00 46.57  ? 313  CYS A CA  1 
ATOM 2462 C C   . CYS A 1 316  ? -16.116 6.340   -38.737 1.00 46.57  ? 313  CYS A C   1 
ATOM 2463 O O   . CYS A 1 316  ? -17.316 6.251   -38.435 1.00 46.57  ? 313  CYS A O   1 
ATOM 2464 C CB  . CYS A 1 316  ? -15.304 7.746   -36.852 1.00 180.88 ? 313  CYS A CB  1 
ATOM 2465 S SG  . CYS A 1 316  ? -13.951 6.955   -35.996 1.00 180.88 ? 313  CYS A SG  1 
ATOM 2466 N N   . LEU A 1 317  ? -15.428 5.361   -39.345 1.00 54.74  ? 314  LEU A N   1 
ATOM 2467 C CA  . LEU A 1 317  ? -15.962 4.011   -39.658 1.00 54.74  ? 314  LEU A CA  1 
ATOM 2468 C C   . LEU A 1 317  ? -15.070 2.817   -39.217 1.00 54.74  ? 314  LEU A C   1 
ATOM 2469 O O   . LEU A 1 317  ? -13.862 2.804   -39.453 1.00 54.74  ? 314  LEU A O   1 
ATOM 2470 C CB  . LEU A 1 317  ? -16.166 3.903   -41.154 1.00 35.96  ? 314  LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 317  ? -17.505 4.065   -41.843 1.00 35.96  ? 314  LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 317  ? -18.479 4.937   -41.044 1.00 35.96  ? 314  LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 317  ? -17.362 4.590   -43.272 1.00 35.96  ? 314  LEU A CD2 1 
ATOM 2474 N N   . THR A 1 318  ? -15.676 1.804   -38.605 1.00 41.48  ? 315  THR A N   1 
ATOM 2475 C CA  . THR A 1 318  ? -14.960 0.625   -38.099 1.00 41.48  ? 315  THR A CA  1 
ATOM 2476 C C   . THR A 1 318  ? -15.811 -0.629  -38.290 1.00 41.48  ? 315  THR A C   1 
ATOM 2477 O O   . THR A 1 318  ? -16.851 -0.760  -37.636 1.00 41.48  ? 315  THR A O   1 
ATOM 2478 C CB  . THR A 1 318  ? -14.694 0.726   -36.559 1.00 51.34  ? 315  THR A CB  1 
ATOM 2479 O OG1 . THR A 1 318  ? -13.919 1.895   -36.258 1.00 51.34  ? 315  THR A OG1 1 
ATOM 2480 C CG2 . THR A 1 318  ? -13.949 -0.515  -36.020 1.00 51.34  ? 315  THR A CG2 1 
ATOM 2481 N N   . TYR A 1 319  ? -15.370 -1.543  -39.164 1.00 33.52  ? 316  TYR A N   1 
ATOM 2482 C CA  . TYR A 1 319  ? -16.005 -2.841  -39.292 1.00 33.52  ? 316  TYR A CA  1 
ATOM 2483 C C   . TYR A 1 319  ? -15.765 -3.571  -37.984 1.00 33.52  ? 316  TYR A C   1 
ATOM 2484 O O   . TYR A 1 319  ? -14.634 -3.534  -37.475 1.00 33.52  ? 316  TYR A O   1 
ATOM 2485 C CB  . TYR A 1 319  ? -15.427 -3.658  -40.454 1.00 59.18  ? 316  TYR A CB  1 
ATOM 2486 C CG  . TYR A 1 319  ? -16.124 -4.995  -40.551 1.00 59.18  ? 316  TYR A CG  1 
ATOM 2487 C CD1 . TYR A 1 319  ? -17.469 -5.070  -40.921 1.00 59.18  ? 316  TYR A CD1 1 
ATOM 2488 C CD2 . TYR A 1 319  ? -15.473 -6.175  -40.228 1.00 59.18  ? 316  TYR A CD2 1 
ATOM 2489 C CE1 . TYR A 1 319  ? -18.141 -6.285  -40.984 1.00 59.18  ? 316  TYR A CE1 1 
ATOM 2490 C CE2 . TYR A 1 319  ? -16.143 -7.403  -40.280 1.00 59.18  ? 316  TYR A CE2 1 
ATOM 2491 C CZ  . TYR A 1 319  ? -17.480 -7.444  -40.662 1.00 59.18  ? 316  TYR A CZ  1 
ATOM 2492 O OH  . TYR A 1 319  ? -18.165 -8.636  -40.728 1.00 59.18  ? 316  TYR A OH  1 
ATOM 2493 N N   . LEU A 1 320  ? -16.789 -4.208  -37.422 1.00 49.58  ? 317  LEU A N   1 
ATOM 2494 C CA  . LEU A 1 320  ? -16.612 -4.945  -36.179 1.00 49.58  ? 317  LEU A CA  1 
ATOM 2495 C C   . LEU A 1 320  ? -16.688 -6.442  -36.449 1.00 49.58  ? 317  LEU A C   1 
ATOM 2496 O O   . LEU A 1 320  ? -15.999 -6.945  -37.336 1.00 49.58  ? 317  LEU A O   1 
ATOM 2497 C CB  . LEU A 1 320  ? -17.672 -4.563  -35.146 1.00 51.31  ? 317  LEU A CB  1 
ATOM 2498 C CG  . LEU A 1 320  ? -17.672 -3.222  -34.432 1.00 51.31  ? 317  LEU A CG  1 
ATOM 2499 C CD1 . LEU A 1 320  ? -18.451 -3.387  -33.144 1.00 51.31  ? 317  LEU A CD1 1 
ATOM 2500 C CD2 . LEU A 1 320  ? -16.254 -2.728  -34.143 1.00 51.31  ? 317  LEU A CD2 1 
ATOM 2501 N N   . ASP A 1 321  ? -17.553 -7.142  -35.703 1.00 91.52  ? 318  ASP A N   1 
ATOM 2502 C CA  . ASP A 1 321  ? -17.730 -8.598  -35.808 1.00 91.52  ? 318  ASP A CA  1 
ATOM 2503 C C   . ASP A 1 321  ? -18.199 -9.058  -37.184 1.00 91.52  ? 318  ASP A C   1 
ATOM 2504 O O   . ASP A 1 321  ? -17.430 -9.097  -38.137 1.00 91.52  ? 318  ASP A O   1 
ATOM 2505 C CB  . ASP A 1 321  ? -18.697 -9.116  -34.723 1.00 150.55 ? 318  ASP A CB  1 
ATOM 2506 C CG  . ASP A 1 321  ? -17.994 -9.896  -33.615 1.00 150.55 ? 318  ASP A CG  1 
ATOM 2507 O OD1 . ASP A 1 321  ? -18.585 -10.028 -32.519 1.00 150.55 ? 318  ASP A OD1 1 
ATOM 2508 O OD2 . ASP A 1 321  ? -16.868 -10.394 -33.833 1.00 150.55 ? 318  ASP A OD2 1 
ATOM 2509 N N   . ASN A 1 322  ? -19.470 -9.415  -37.270 1.00 48.22  ? 319  ASN A N   1 
ATOM 2510 C CA  . ASN A 1 322  ? -19.986 -10.106 -38.427 1.00 48.22  ? 319  ASN A CA  1 
ATOM 2511 C C   . ASN A 1 322  ? -21.093 -9.285  -38.981 1.00 48.22  ? 319  ASN A C   1 
ATOM 2512 O O   . ASN A 1 322  ? -22.232 -9.394  -38.517 1.00 48.22  ? 319  ASN A O   1 
ATOM 2513 C CB  . ASN A 1 322  ? -20.517 -11.464 -38.010 1.00 93.51  ? 319  ASN A CB  1 
ATOM 2514 C CG  . ASN A 1 322  ? -19.440 -12.342 -37.457 1.00 93.51  ? 319  ASN A CG  1 
ATOM 2515 O OD1 . ASN A 1 322  ? -18.630 -12.891 -38.209 1.00 93.51  ? 319  ASN A OD1 1 
ATOM 2516 N ND2 . ASN A 1 322  ? -19.405 -12.472 -36.133 1.00 93.51  ? 319  ASN A ND2 1 
ATOM 2517 N N   . GLY A 1 323  ? -20.736 -8.433  -39.943 1.00 68.98  ? 320  GLY A N   1 
ATOM 2518 C CA  . GLY A 1 323  ? -21.657 -7.486  -40.530 1.00 68.98  ? 320  GLY A CA  1 
ATOM 2519 C C   . GLY A 1 323  ? -22.064 -6.335  -39.620 1.00 68.98  ? 320  GLY A C   1 
ATOM 2520 O O   . GLY A 1 323  ? -22.881 -5.512  -40.012 1.00 68.98  ? 320  GLY A O   1 
ATOM 2521 N N   . VAL A 1 324  ? -21.529 -6.263  -38.403 1.00 50.71  ? 321  VAL A N   1 
ATOM 2522 C CA  . VAL A 1 324  ? -21.721 -5.039  -37.589 1.00 50.71  ? 321  VAL A CA  1 
ATOM 2523 C C   . VAL A 1 324  ? -20.716 -3.946  -37.934 1.00 50.71  ? 321  VAL A C   1 
ATOM 2524 O O   . VAL A 1 324  ? -19.493 -4.184  -38.007 1.00 50.71  ? 321  VAL A O   1 
ATOM 2525 C CB  . VAL A 1 324  ? -21.602 -5.245  -36.071 1.00 62.27  ? 321  VAL A CB  1 
ATOM 2526 C CG1 . VAL A 1 324  ? -22.967 -5.106  -35.393 1.00 62.27  ? 321  VAL A CG1 1 
ATOM 2527 C CG2 . VAL A 1 324  ? -20.867 -6.555  -35.752 1.00 62.27  ? 321  VAL A CG2 1 
ATOM 2528 N N   . VAL A 1 325  ? -21.237 -2.744  -38.135 1.00 35.29  ? 322  VAL A N   1 
ATOM 2529 C CA  . VAL A 1 325  ? -20.404 -1.610  -38.440 1.00 35.29  ? 322  VAL A CA  1 
ATOM 2530 C C   . VAL A 1 325  ? -20.738 -0.499  -37.460 1.00 35.29  ? 322  VAL A C   1 
ATOM 2531 O O   . VAL A 1 325  ? -21.931 -0.147  -37.283 1.00 35.29  ? 322  VAL A O   1 
ATOM 2532 C CB  . VAL A 1 325  ? -20.627 -1.193  -39.884 1.00 38.03  ? 322  VAL A CB  1 
ATOM 2533 C CG1 . VAL A 1 325  ? -19.961 0.126   -40.177 1.00 38.03  ? 322  VAL A CG1 1 
ATOM 2534 C CG2 . VAL A 1 325  ? -20.093 -2.286  -40.799 1.00 38.03  ? 322  VAL A CG2 1 
ATOM 2535 N N   . PHE A 1 326  ? -19.699 0.009   -36.789 1.00 42.06  ? 323  PHE A N   1 
ATOM 2536 C CA  . PHE A 1 326  ? -19.860 1.186   -35.936 1.00 42.06  ? 323  PHE A CA  1 
ATOM 2537 C C   . PHE A 1 326  ? -19.685 2.419   -36.780 1.00 42.06  ? 323  PHE A C   1 
ATOM 2538 O O   . PHE A 1 326  ? -18.807 2.459   -37.614 1.00 42.06  ? 323  PHE A O   1 
ATOM 2539 C CB  . PHE A 1 326  ? -18.878 1.212   -34.774 1.00 37.79  ? 323  PHE A CB  1 
ATOM 2540 C CG  . PHE A 1 326  ? -18.985 2.452   -33.954 1.00 37.79  ? 323  PHE A CG  1 
ATOM 2541 C CD1 . PHE A 1 326  ? -20.029 2.614   -33.066 1.00 37.79  ? 323  PHE A CD1 1 
ATOM 2542 C CD2 . PHE A 1 326  ? -18.084 3.475   -34.107 1.00 37.79  ? 323  PHE A CD2 1 
ATOM 2543 C CE1 . PHE A 1 326  ? -20.159 3.760   -32.333 1.00 37.79  ? 323  PHE A CE1 1 
ATOM 2544 C CE2 . PHE A 1 326  ? -18.195 4.595   -33.378 1.00 37.79  ? 323  PHE A CE2 1 
ATOM 2545 C CZ  . PHE A 1 326  ? -19.238 4.741   -32.482 1.00 37.79  ? 323  PHE A CZ  1 
ATOM 2546 N N   . VAL A 1 327  ? -20.555 3.402   -36.570 1.00 37.94  ? 324  VAL A N   1 
ATOM 2547 C CA  . VAL A 1 327  ? -20.593 4.629   -37.373 1.00 37.94  ? 324  VAL A CA  1 
ATOM 2548 C C   . VAL A 1 327  ? -20.470 5.829   -36.448 1.00 37.94  ? 324  VAL A C   1 
ATOM 2549 O O   . VAL A 1 327  ? -21.458 6.198   -35.760 1.00 37.94  ? 324  VAL A O   1 
ATOM 2550 C CB  . VAL A 1 327  ? -21.902 4.786   -38.146 1.00 36.86  ? 324  VAL A CB  1 
ATOM 2551 C CG1 . VAL A 1 327  ? -21.922 6.088   -38.846 1.00 36.86  ? 324  VAL A CG1 1 
ATOM 2552 C CG2 . VAL A 1 327  ? -22.046 3.716   -39.183 1.00 36.86  ? 324  VAL A CG2 1 
ATOM 2553 N N   . GLY A 1 328  ? -19.255 6.411   -36.413 1.00 37.49  ? 325  GLY A N   1 
ATOM 2554 C CA  . GLY A 1 328  ? -18.934 7.534   -35.551 1.00 37.49  ? 325  GLY A CA  1 
ATOM 2555 C C   . GLY A 1 328  ? -19.284 8.769   -36.330 1.00 37.49  ? 325  GLY A C   1 
ATOM 2556 O O   . GLY A 1 328  ? -18.759 8.973   -37.431 1.00 37.49  ? 325  GLY A O   1 
ATOM 2557 N N   . SER A 1 329  ? -20.190 9.578   -35.780 1.00 35.38  ? 326  SER A N   1 
ATOM 2558 C CA  . SER A 1 329  ? -20.675 10.754  -36.460 1.00 35.38  ? 326  SER A CA  1 
ATOM 2559 C C   . SER A 1 329  ? -20.455 11.995  -35.605 1.00 35.38  ? 326  SER A C   1 
ATOM 2560 O O   . SER A 1 329  ? -20.374 11.908  -34.380 1.00 35.38  ? 326  SER A O   1 
ATOM 2561 C CB  . SER A 1 329  ? -22.153 10.580  -36.754 1.00 36.76  ? 326  SER A CB  1 
ATOM 2562 O OG  . SER A 1 329  ? -22.745 11.788  -37.213 1.00 36.76  ? 326  SER A OG  1 
ATOM 2563 N N   . ARG A 1 330  ? -20.339 13.156  -36.242 1.00 37.73  ? 327  ARG A N   1 
ATOM 2564 C CA  . ARG A 1 330  ? -20.288 14.404  -35.470 1.00 37.73  ? 327  ARG A CA  1 
ATOM 2565 C C   . ARG A 1 330  ? -21.277 15.483  -35.964 1.00 37.73  ? 327  ARG A C   1 
ATOM 2566 O O   . ARG A 1 330  ? -21.733 16.337  -35.197 1.00 37.73  ? 327  ARG A O   1 
ATOM 2567 C CB  . ARG A 1 330  ? -18.855 14.919  -35.322 1.00 47.99  ? 327  ARG A CB  1 
ATOM 2568 C CG  . ARG A 1 330  ? -18.139 15.162  -36.613 1.00 47.99  ? 327  ARG A CG  1 
ATOM 2569 C CD  . ARG A 1 330  ? -17.066 16.282  -36.523 1.00 47.99  ? 327  ARG A CD  1 
ATOM 2570 N NE  . ARG A 1 330  ? -16.701 16.615  -37.883 1.00 47.99  ? 327  ARG A NE  1 
ATOM 2571 C CZ  . ARG A 1 330  ? -17.112 17.700  -38.527 1.00 47.99  ? 327  ARG A CZ  1 
ATOM 2572 N NH1 . ARG A 1 330  ? -17.839 18.645  -37.902 1.00 47.99  ? 327  ARG A NH1 1 
ATOM 2573 N NH2 . ARG A 1 330  ? -16.742 17.856  -39.793 1.00 47.99  ? 327  ARG A NH2 1 
ATOM 2574 N N   . LEU A 1 331  ? -21.642 15.421  -37.233 1.00 32.91  ? 328  LEU A N   1 
ATOM 2575 C CA  . LEU A 1 331  ? -22.759 16.243  -37.672 1.00 32.91  ? 328  LEU A CA  1 
ATOM 2576 C C   . LEU A 1 331  ? -24.060 15.678  -37.115 1.00 32.91  ? 328  LEU A C   1 
ATOM 2577 O O   . LEU A 1 331  ? -25.055 16.417  -37.022 1.00 32.91  ? 328  LEU A O   1 
ATOM 2578 C CB  . LEU A 1 331  ? -22.815 16.405  -39.193 1.00 28.14  ? 328  LEU A CB  1 
ATOM 2579 C CG  . LEU A 1 331  ? -21.547 17.034  -39.792 1.00 28.14  ? 328  LEU A CG  1 
ATOM 2580 C CD1 . LEU A 1 331  ? -21.684 17.524  -41.218 1.00 28.14  ? 328  LEU A CD1 1 
ATOM 2581 C CD2 . LEU A 1 331  ? -21.061 18.170  -38.912 1.00 28.14  ? 328  LEU A CD2 1 
ATOM 2582 N N   . GLY A 1 332  ? -24.032 14.397  -36.707 1.00 25.75  ? 329  GLY A N   1 
ATOM 2583 C CA  . GLY A 1 332  ? -25.258 13.673  -36.291 1.00 25.75  ? 329  GLY A CA  1 
ATOM 2584 C C   . GLY A 1 332  ? -25.086 12.593  -35.231 1.00 25.75  ? 329  GLY A C   1 
ATOM 2585 O O   . GLY A 1 332  ? -23.980 12.393  -34.723 1.00 25.75  ? 329  GLY A O   1 
ATOM 2586 N N   . ASP A 1 333  ? -26.158 11.862  -34.913 1.00 36.71  ? 330  ASP A N   1 
ATOM 2587 C CA  . ASP A 1 333  ? -26.057 10.817  -33.904 1.00 36.71  ? 330  ASP A CA  1 
ATOM 2588 C C   . ASP A 1 333  ? -25.178 9.638   -34.382 1.00 36.71  ? 330  ASP A C   1 
ATOM 2589 O O   . ASP A 1 333  ? -25.313 9.181   -35.527 1.00 36.71  ? 330  ASP A O   1 
ATOM 2590 C CB  . ASP A 1 333  ? -27.418 10.264  -33.591 1.00 24.31  ? 330  ASP A CB  1 
ATOM 2591 C CG  . ASP A 1 333  ? -28.279 11.151  -32.607 1.00 24.31  ? 330  ASP A CG  1 
ATOM 2592 O OD1 . ASP A 1 333  ? -27.964 12.252  -32.036 1.00 24.31  ? 330  ASP A OD1 1 
ATOM 2593 O OD2 . ASP A 1 333  ? -29.410 10.660  -32.406 1.00 24.31  ? 330  ASP A OD2 1 
ATOM 2594 N N   . SER A 1 334  ? -24.298 9.140   -33.504 1.00 40.96  ? 331  SER A N   1 
ATOM 2595 C CA  . SER A 1 334  ? -23.521 7.930   -33.800 1.00 40.96  ? 331  SER A CA  1 
ATOM 2596 C C   . SER A 1 334  ? -24.403 6.708   -33.742 1.00 40.96  ? 331  SER A C   1 
ATOM 2597 O O   . SER A 1 334  ? -25.422 6.704   -33.028 1.00 40.96  ? 331  SER A O   1 
ATOM 2598 C CB  . SER A 1 334  ? -22.339 7.765   -32.847 1.00 47.03  ? 331  SER A CB  1 
ATOM 2599 O OG  . SER A 1 334  ? -21.152 8.320   -33.402 1.00 47.03  ? 331  SER A OG  1 
ATOM 2600 N N   . GLN A 1 335  ? -24.025 5.660   -34.469 1.00 41.81  ? 332  GLN A N   1 
ATOM 2601 C CA  . GLN A 1 335  ? -24.891 4.503   -34.489 1.00 41.81  ? 332  GLN A CA  1 
ATOM 2602 C C   . GLN A 1 335  ? -24.225 3.144   -34.747 1.00 41.81  ? 332  GLN A C   1 
ATOM 2603 O O   . GLN A 1 335  ? -23.142 3.067   -35.334 1.00 41.81  ? 332  GLN A O   1 
ATOM 2604 C CB  . GLN A 1 335  ? -26.035 4.740   -35.486 1.00 34.57  ? 332  GLN A CB  1 
ATOM 2605 C CG  . GLN A 1 335  ? -25.677 4.361   -36.909 1.00 34.57  ? 332  GLN A CG  1 
ATOM 2606 C CD  . GLN A 1 335  ? -26.495 5.138   -37.940 1.00 34.57  ? 332  GLN A CD  1 
ATOM 2607 O OE1 . GLN A 1 335  ? -27.689 5.406   -37.734 1.00 34.57  ? 332  GLN A OE1 1 
ATOM 2608 N NE2 . GLN A 1 335  ? -25.847 5.498   -39.064 1.00 34.57  ? 332  GLN A NE2 1 
ATOM 2609 N N   . LEU A 1 336  ? -24.905 2.072   -34.319 1.00 47.30  ? 333  LEU A N   1 
ATOM 2610 C CA  . LEU A 1 336  ? -24.484 0.706   -34.614 1.00 47.30  ? 333  LEU A CA  1 
ATOM 2611 C C   . LEU A 1 336  ? -25.330 0.148   -35.732 1.00 47.30  ? 333  LEU A C   1 
ATOM 2612 O O   . LEU A 1 336  ? -26.531 0.328   -35.728 1.00 47.30  ? 333  LEU A O   1 
ATOM 2613 C CB  . LEU A 1 336  ? -24.619 -0.154  -33.377 1.00 58.06  ? 333  LEU A CB  1 
ATOM 2614 C CG  . LEU A 1 336  ? -23.647 -1.304  -33.275 1.00 58.06  ? 333  LEU A CG  1 
ATOM 2615 C CD1 . LEU A 1 336  ? -22.401 -1.013  -34.069 1.00 58.06  ? 333  LEU A CD1 1 
ATOM 2616 C CD2 . LEU A 1 336  ? -23.322 -1.457  -31.835 1.00 58.06  ? 333  LEU A CD2 1 
ATOM 2617 N N   . VAL A 1 337  ? -24.696 -0.540  -36.679 1.00 39.33  ? 334  VAL A N   1 
ATOM 2618 C CA  . VAL A 1 337  ? -25.326 -0.871  -37.971 1.00 39.33  ? 334  VAL A CA  1 
ATOM 2619 C C   . VAL A 1 337  ? -25.051 -2.310  -38.452 1.00 39.33  ? 334  VAL A C   1 
ATOM 2620 O O   . VAL A 1 337  ? -23.926 -2.802  -38.327 1.00 39.33  ? 334  VAL A O   1 
ATOM 2621 C CB  . VAL A 1 337  ? -24.896 0.180   -39.035 1.00 36.99  ? 334  VAL A CB  1 
ATOM 2622 C CG1 . VAL A 1 337  ? -24.663 -0.405  -40.385 1.00 36.99  ? 334  VAL A CG1 1 
ATOM 2623 C CG2 . VAL A 1 337  ? -25.902 1.250   -39.109 1.00 36.99  ? 334  VAL A CG2 1 
ATOM 2624 N N   . LYS A 1 338  ? -26.075 -2.972  -39.004 1.00 54.65  ? 335  LYS A N   1 
ATOM 2625 C CA  . LYS A 1 338  ? -25.940 -4.322  -39.581 1.00 54.65  ? 335  LYS A CA  1 
ATOM 2626 C C   . LYS A 1 338  ? -25.904 -4.322  -41.108 1.00 54.65  ? 335  LYS A C   1 
ATOM 2627 O O   . LYS A 1 338  ? -26.754 -3.696  -41.755 1.00 54.65  ? 335  LYS A O   1 
ATOM 2628 C CB  . LYS A 1 338  ? -27.058 -5.243  -39.091 1.00 52.02  ? 335  LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 338  ? -27.009 -6.633  -39.669 1.00 52.02  ? 335  LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 338  ? -26.101 -7.546  -38.872 1.00 52.02  ? 335  LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 338  ? -25.516 -8.655  -39.770 1.00 52.02  ? 335  LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 338  ? -25.668 -10.019 -39.155 1.00 52.02  ? 335  LYS A NZ  1 
ATOM 2633 N N   . LEU A 1 339  ? -24.924 -5.036  -41.661 1.00 54.48  ? 336  LEU A N   1 
ATOM 2634 C CA  . LEU A 1 339  ? -24.741 -5.213  -43.101 1.00 54.48  ? 336  LEU A CA  1 
ATOM 2635 C C   . LEU A 1 339  ? -25.157 -6.615  -43.537 1.00 54.48  ? 336  LEU A C   1 
ATOM 2636 O O   . LEU A 1 339  ? -24.655 -7.623  -43.047 1.00 54.48  ? 336  LEU A O   1 
ATOM 2637 C CB  . LEU A 1 339  ? -23.272 -5.057  -43.477 1.00 29.27  ? 336  LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 339  ? -22.476 -3.741  -43.555 1.00 29.27  ? 336  LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 339  ? -21.017 -4.110  -43.959 1.00 29.27  ? 336  LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 339  ? -23.063 -2.771  -44.553 1.00 29.27  ? 336  LEU A CD2 1 
ATOM 2641 N N   . ASN A 1 340  ? -26.054 -6.674  -44.495 1.00 40.52  ? 337  ASN A N   1 
ATOM 2642 C CA  . ASN A 1 340  ? -26.606 -7.935  -44.888 1.00 40.52  ? 337  ASN A CA  1 
ATOM 2643 C C   . ASN A 1 340  ? -26.285 -8.248  -46.304 1.00 40.52  ? 337  ASN A C   1 
ATOM 2644 O O   . ASN A 1 340  ? -26.116 -7.345  -47.129 1.00 40.52  ? 337  ASN A O   1 
ATOM 2645 C CB  . ASN A 1 340  ? -28.104 -7.909  -44.703 1.00 37.91  ? 337  ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 340  ? -28.473 -7.758  -43.283 1.00 37.91  ? 337  ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 340  ? -29.183 -6.844  -42.924 1.00 37.91  ? 337  ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 340  ? -27.950 -8.639  -42.433 1.00 37.91  ? 337  ASN A ND2 1 
ATOM 2649 N N   . VAL A 1 341  ? -26.211 -9.543  -46.579 1.00 62.36  ? 338  VAL A N   1 
ATOM 2650 C CA  . VAL A 1 341  ? -26.033 -10.050 -47.923 1.00 62.36  ? 338  VAL A CA  1 
ATOM 2651 C C   . VAL A 1 341  ? -27.236 -9.680  -48.791 1.00 62.36  ? 338  VAL A C   1 
ATOM 2652 O O   . VAL A 1 341  ? -27.116 -9.545  -50.016 1.00 62.36  ? 338  VAL A O   1 
ATOM 2653 C CB  . VAL A 1 341  ? -25.894 -11.569 -47.882 1.00 90.45  ? 338  VAL A CB  1 
ATOM 2654 C CG1 . VAL A 1 341  ? -25.154 -12.069 -49.109 1.00 90.45  ? 338  VAL A CG1 1 
ATOM 2655 C CG2 . VAL A 1 341  ? -25.177 -11.982 -46.598 1.00 90.45  ? 338  VAL A CG2 1 
ATOM 2656 N N   . ASP A 1 342  ? -28.390 -9.505  -48.145 1.00 58.19  ? 339  ASP A N   1 
ATOM 2657 C CA  . ASP A 1 342  ? -29.624 -9.225  -48.860 1.00 58.19  ? 339  ASP A CA  1 
ATOM 2658 C C   . ASP A 1 342  ? -30.196 -7.844  -48.582 1.00 58.19  ? 339  ASP A C   1 
ATOM 2659 O O   . ASP A 1 342  ? -30.377 -7.464  -47.429 1.00 58.19  ? 339  ASP A O   1 
ATOM 2660 C CB  . ASP A 1 342  ? -30.645 -10.307 -48.529 1.00 76.74  ? 339  ASP A CB  1 
ATOM 2661 C CG  . ASP A 1 342  ? -30.215 -11.683 -49.036 1.00 76.74  ? 339  ASP A CG  1 
ATOM 2662 O OD1 . ASP A 1 342  ? -29.945 -11.830 -50.265 1.00 76.74  ? 339  ASP A OD1 1 
ATOM 2663 O OD2 . ASP A 1 342  ? -30.139 -12.613 -48.196 1.00 76.74  ? 339  ASP A OD2 1 
ATOM 2664 N N   . SER A 1 343  ? -30.492 -7.094  -49.638 1.00 65.96  ? 340  SER A N   1 
ATOM 2665 C CA  . SER A 1 343  ? -31.160 -5.813  -49.478 1.00 65.96  ? 340  SER A CA  1 
ATOM 2666 C C   . SER A 1 343  ? -32.549 -5.970  -48.879 1.00 65.96  ? 340  SER A C   1 
ATOM 2667 O O   . SER A 1 343  ? -33.137 -7.044  -48.932 1.00 65.96  ? 340  SER A O   1 
ATOM 2668 C CB  . SER A 1 343  ? -31.274 -5.128  -50.827 1.00 68.42  ? 340  SER A CB  1 
ATOM 2669 O OG  . SER A 1 343  ? -32.190 -5.808  -51.649 1.00 68.42  ? 340  SER A OG  1 
ATOM 2670 N N   . ASN A 1 344  ? -33.080 -4.909  -48.292 1.00 76.17  ? 341  ASN A N   1 
ATOM 2671 C CA  . ASN A 1 344  ? -34.506 -4.903  -47.968 1.00 76.17  ? 341  ASN A CA  1 
ATOM 2672 C C   . ASN A 1 344  ? -35.286 -4.239  -49.106 1.00 76.17  ? 341  ASN A C   1 
ATOM 2673 O O   . ASN A 1 344  ? -34.822 -4.219  -50.254 1.00 76.17  ? 341  ASN A O   1 
ATOM 2674 C CB  . ASN A 1 344  ? -34.782 -4.226  -46.618 1.00 48.17  ? 341  ASN A CB  1 
ATOM 2675 C CG  . ASN A 1 344  ? -34.209 -2.806  -46.534 1.00 48.17  ? 341  ASN A CG  1 
ATOM 2676 O OD1 . ASN A 1 344  ? -34.467 -1.939  -47.398 1.00 48.17  ? 341  ASN A OD1 1 
ATOM 2677 N ND2 . ASN A 1 344  ? -33.419 -2.565  -45.478 1.00 48.17  ? 341  ASN A ND2 1 
ATOM 2678 N N   . GLU A 1 345  ? -36.470 -3.722  -48.782 1.00 94.81  ? 342  GLU A N   1 
ATOM 2679 C CA  . GLU A 1 345  ? -37.250 -2.887  -49.701 1.00 94.81  ? 342  GLU A CA  1 
ATOM 2680 C C   . GLU A 1 345  ? -36.790 -1.411  -49.645 1.00 94.81  ? 342  GLU A C   1 
ATOM 2681 O O   . GLU A 1 345  ? -36.701 -0.798  -48.562 1.00 94.81  ? 342  GLU A O   1 
ATOM 2682 C CB  . GLU A 1 345  ? -38.758 -3.019  -49.432 1.00 134.34 ? 342  GLU A CB  1 
ATOM 2683 C CG  . GLU A 1 345  ? -39.156 -3.097  -47.951 1.00 134.34 ? 342  GLU A CG  1 
ATOM 2684 C CD  . GLU A 1 345  ? -38.879 -4.460  -47.340 1.00 134.34 ? 342  GLU A CD  1 
ATOM 2685 O OE1 . GLU A 1 345  ? -39.025 -5.477  -48.055 1.00 134.34 ? 342  GLU A OE1 1 
ATOM 2686 O OE2 . GLU A 1 345  ? -38.509 -4.513  -46.149 1.00 134.34 ? 342  GLU A OE2 1 
ATOM 2687 N N   . GLN A 1 346  ? -36.526 -0.851  -50.829 1.00 80.49  ? 343  GLN A N   1 
ATOM 2688 C CA  . GLN A 1 346  ? -35.741 0.376   -50.991 1.00 80.49  ? 343  GLN A CA  1 
ATOM 2689 C C   . GLN A 1 346  ? -34.334 -0.007  -51.447 1.00 80.49  ? 343  GLN A C   1 
ATOM 2690 O O   . GLN A 1 346  ? -33.653 0.764   -52.133 1.00 80.49  ? 343  GLN A O   1 
ATOM 2691 C CB  . GLN A 1 346  ? -35.684 1.214   -49.711 1.00 176.82 ? 343  GLN A CB  1 
ATOM 2692 C CG  . GLN A 1 346  ? -35.247 2.653   -49.930 1.00 176.82 ? 343  GLN A CG  1 
ATOM 2693 C CD  . GLN A 1 346  ? -35.629 3.566   -48.780 1.00 176.82 ? 343  GLN A CD  1 
ATOM 2694 O OE1 . GLN A 1 346  ? -34.846 4.434   -48.382 1.00 176.82 ? 343  GLN A OE1 1 
ATOM 2695 N NE2 . GLN A 1 346  ? -36.835 3.380   -48.241 1.00 176.82 ? 343  GLN A NE2 1 
ATOM 2696 N N   . GLY A 1 347  ? -33.910 -1.204  -51.058 1.00 51.72  ? 344  GLY A N   1 
ATOM 2697 C CA  . GLY A 1 347  ? -32.677 -1.781  -51.593 1.00 51.72  ? 344  GLY A CA  1 
ATOM 2698 C C   . GLY A 1 347  ? -31.460 -1.343  -50.821 1.00 51.72  ? 344  GLY A C   1 
ATOM 2699 O O   . GLY A 1 347  ? -30.420 -1.039  -51.393 1.00 51.72  ? 344  GLY A O   1 
ATOM 2700 N N   . SER A 1 348  ? -31.624 -1.315  -49.508 1.00 50.11  ? 345  SER A N   1 
ATOM 2701 C CA  . SER A 1 348  ? -30.597 -0.904  -48.595 1.00 50.11  ? 345  SER A CA  1 
ATOM 2702 C C   . SER A 1 348  ? -30.037 -2.182  -47.954 1.00 50.11  ? 345  SER A C   1 
ATOM 2703 O O   . SER A 1 348  ? -30.789 -2.953  -47.346 1.00 50.11  ? 345  SER A O   1 
ATOM 2704 C CB  . SER A 1 348  ? -31.216 0.026   -47.545 1.00 42.65  ? 345  SER A CB  1 
ATOM 2705 O OG  . SER A 1 348  ? -30.266 0.385   -46.563 1.00 42.65  ? 345  SER A OG  1 
ATOM 2706 N N   . TYR A 1 349  ? -28.738 -2.422  -48.111 1.00 52.08  ? 346  TYR A N   1 
ATOM 2707 C CA  . TYR A 1 349  ? -28.088 -3.522  -47.440 1.00 52.08  ? 346  TYR A CA  1 
ATOM 2708 C C   . TYR A 1 349  ? -27.763 -3.195  -45.995 1.00 52.08  ? 346  TYR A C   1 
ATOM 2709 O O   . TYR A 1 349  ? -27.178 -4.016  -45.269 1.00 52.08  ? 346  TYR A O   1 
ATOM 2710 C CB  . TYR A 1 349  ? -26.827 -3.867  -48.166 1.00 62.14  ? 346  TYR A CB  1 
ATOM 2711 C CG  . TYR A 1 349  ? -27.086 -4.403  -49.528 1.00 62.14  ? 346  TYR A CG  1 
ATOM 2712 C CD1 . TYR A 1 349  ? -27.094 -3.553  -50.625 1.00 62.14  ? 346  TYR A CD1 1 
ATOM 2713 C CD2 . TYR A 1 349  ? -27.321 -5.758  -49.734 1.00 62.14  ? 346  TYR A CD2 1 
ATOM 2714 C CE1 . TYR A 1 349  ? -27.328 -4.027  -51.899 1.00 62.14  ? 346  TYR A CE1 1 
ATOM 2715 C CE2 . TYR A 1 349  ? -27.552 -6.251  -51.008 1.00 62.14  ? 346  TYR A CE2 1 
ATOM 2716 C CZ  . TYR A 1 349  ? -27.557 -5.374  -52.086 1.00 62.14  ? 346  TYR A CZ  1 
ATOM 2717 O OH  . TYR A 1 349  ? -27.782 -5.813  -53.364 1.00 62.14  ? 346  TYR A OH  1 
ATOM 2718 N N   . VAL A 1 350  ? -28.161 -1.999  -45.563 1.00 60.79  ? 347  VAL A N   1 
ATOM 2719 C CA  . VAL A 1 350  ? -27.809 -1.493  -44.242 1.00 60.79  ? 347  VAL A CA  1 
ATOM 2720 C C   . VAL A 1 350  ? -29.027 -1.442  -43.367 1.00 60.79  ? 347  VAL A C   1 
ATOM 2721 O O   . VAL A 1 350  ? -30.067 -0.971  -43.783 1.00 60.79  ? 347  VAL A O   1 
ATOM 2722 C CB  . VAL A 1 350  ? -27.193 -0.087  -44.327 1.00 66.80  ? 347  VAL A CB  1 
ATOM 2723 C CG1 . VAL A 1 350  ? -27.092 0.534   -42.954 1.00 66.80  ? 347  VAL A CG1 1 
ATOM 2724 C CG2 . VAL A 1 350  ? -25.827 -0.133  -44.982 1.00 66.80  ? 347  VAL A CG2 1 
ATOM 2725 N N   . VAL A 1 351  ? -28.900 -1.940  -42.153 1.00 49.60  ? 348  VAL A N   1 
ATOM 2726 C CA  . VAL A 1 351  ? -29.992 -1.846  -41.205 1.00 49.60  ? 348  VAL A CA  1 
ATOM 2727 C C   . VAL A 1 351  ? -29.469 -1.316  -39.857 1.00 49.60  ? 348  VAL A C   1 
ATOM 2728 O O   . VAL A 1 351  ? -28.554 -1.907  -39.282 1.00 49.60  ? 348  VAL A O   1 
ATOM 2729 C CB  . VAL A 1 351  ? -30.640 -3.241  -40.989 1.00 40.64  ? 348  VAL A CB  1 
ATOM 2730 C CG1 . VAL A 1 351  ? -31.671 -3.209  -39.826 1.00 40.64  ? 348  VAL A CG1 1 
ATOM 2731 C CG2 . VAL A 1 351  ? -31.240 -3.805  -42.295 1.00 40.64  ? 348  VAL A CG2 1 
ATOM 2732 N N   . ALA A 1 352  ? -30.028 -0.238  -39.316 1.00 31.36  ? 349  ALA A N   1 
ATOM 2733 C CA  . ALA A 1 352  ? -29.495 0.252   -38.032 1.00 31.36  ? 349  ALA A CA  1 
ATOM 2734 C C   . ALA A 1 352  ? -29.851 -0.670  -36.889 1.00 31.36  ? 349  ALA A C   1 
ATOM 2735 O O   . ALA A 1 352  ? -30.945 -1.182  -36.872 1.00 31.36  ? 349  ALA A O   1 
ATOM 2736 C CB  . ALA A 1 352  ? -29.970 1.689   -37.707 1.00 10.00  ? 349  ALA A CB  1 
ATOM 2737 N N   . MET A 1 353  ? -28.936 -0.880  -35.948 1.00 59.90  ? 350  MET A N   1 
ATOM 2738 C CA  . MET A 1 353  ? -29.246 -1.676  -34.778 1.00 59.90  ? 350  MET A CA  1 
ATOM 2739 C C   . MET A 1 353  ? -29.331 -0.819  -33.536 1.00 59.90  ? 350  MET A C   1 
ATOM 2740 O O   . MET A 1 353  ? -30.148 -1.059  -32.652 1.00 59.90  ? 350  MET A O   1 
ATOM 2741 C CB  . MET A 1 353  ? -28.213 -2.752  -34.568 1.00 55.83  ? 350  MET A CB  1 
ATOM 2742 C CG  . MET A 1 353  ? -27.987 -3.668  -35.749 1.00 55.83  ? 350  MET A CG  1 
ATOM 2743 S SD  . MET A 1 353  ? -26.427 -4.607  -35.571 1.00 55.83  ? 350  MET A SD  1 
ATOM 2744 C CE  . MET A 1 353  ? -26.396 -4.983  -33.783 1.00 55.83  ? 350  MET A CE  1 
ATOM 2745 N N   . GLU A 1 354  ? -28.482 0.188   -33.458 1.00 60.52  ? 351  GLU A N   1 
ATOM 2746 C CA  . GLU A 1 354  ? -28.475 1.052   -32.301 1.00 60.52  ? 351  GLU A CA  1 
ATOM 2747 C C   . GLU A 1 354  ? -28.037 2.451   -32.704 1.00 60.52  ? 351  GLU A C   1 
ATOM 2748 O O   . GLU A 1 354  ? -27.279 2.623   -33.650 1.00 60.52  ? 351  GLU A O   1 
ATOM 2749 C CB  . GLU A 1 354  ? -27.544 0.483   -31.252 1.00 74.53  ? 351  GLU A CB  1 
ATOM 2750 C CG  . GLU A 1 354  ? -28.206 0.306   -29.932 1.00 74.53  ? 351  GLU A CG  1 
ATOM 2751 C CD  . GLU A 1 354  ? -27.266 0.607   -28.802 1.00 74.53  ? 351  GLU A CD  1 
ATOM 2752 O OE1 . GLU A 1 354  ? -26.344 -0.199  -28.558 1.00 74.53  ? 351  GLU A OE1 1 
ATOM 2753 O OE2 . GLU A 1 354  ? -27.452 1.669   -28.169 1.00 74.53  ? 351  GLU A OE2 1 
ATOM 2754 N N   . THR A 1 355  ? -28.528 3.437   -31.963 1.00 34.04  ? 352  THR A N   1 
ATOM 2755 C CA  . THR A 1 355  ? -28.340 4.835   -32.256 1.00 34.04  ? 352  THR A CA  1 
ATOM 2756 C C   . THR A 1 355  ? -27.825 5.562   -31.030 1.00 34.04  ? 352  THR A C   1 
ATOM 2757 O O   . THR A 1 355  ? -28.423 5.495   -29.963 1.00 34.04  ? 352  THR A O   1 
ATOM 2758 C CB  . THR A 1 355  ? -29.668 5.407   -32.659 1.00 36.78  ? 352  THR A CB  1 
ATOM 2759 O OG1 . THR A 1 355  ? -29.775 5.319   -34.079 1.00 36.78  ? 352  THR A OG1 1 
ATOM 2760 C CG2 . THR A 1 355  ? -29.803 6.848   -32.235 1.00 36.78  ? 352  THR A CG2 1 
ATOM 2761 N N   . PHE A 1 356  ? -26.720 6.273   -31.146 1.00 44.81  ? 353  PHE A N   1 
ATOM 2762 C CA  . PHE A 1 356  ? -26.242 6.971   -29.973 1.00 44.81  ? 353  PHE A CA  1 
ATOM 2763 C C   . PHE A 1 356  ? -26.436 8.454   -30.175 1.00 44.81  ? 353  PHE A C   1 
ATOM 2764 O O   . PHE A 1 356  ? -26.158 8.963   -31.246 1.00 44.81  ? 353  PHE A O   1 
ATOM 2765 C CB  . PHE A 1 356  ? -24.789 6.621   -29.735 1.00 38.11  ? 353  PHE A CB  1 
ATOM 2766 C CG  . PHE A 1 356  ? -24.493 5.156   -29.863 1.00 38.11  ? 353  PHE A CG  1 
ATOM 2767 C CD1 . PHE A 1 356  ? -23.840 4.672   -30.993 1.00 38.11  ? 353  PHE A CD1 1 
ATOM 2768 C CD2 . PHE A 1 356  ? -24.886 4.276   -28.872 1.00 38.11  ? 353  PHE A CD2 1 
ATOM 2769 C CE1 . PHE A 1 356  ? -23.574 3.348   -31.139 1.00 38.11  ? 353  PHE A CE1 1 
ATOM 2770 C CE2 . PHE A 1 356  ? -24.661 2.946   -29.012 1.00 38.11  ? 353  PHE A CE2 1 
ATOM 2771 C CZ  . PHE A 1 356  ? -23.994 2.463   -30.138 1.00 38.11  ? 353  PHE A CZ  1 
ATOM 2772 N N   . THR A 1 357  ? -26.943 9.148   -29.165 1.00 41.58  ? 354  THR A N   1 
ATOM 2773 C CA  . THR A 1 357  ? -27.270 10.548  -29.353 1.00 41.58  ? 354  THR A CA  1 
ATOM 2774 C C   . THR A 1 357  ? -26.019 11.365  -29.214 1.00 41.58  ? 354  THR A C   1 
ATOM 2775 O O   . THR A 1 357  ? -25.261 11.187  -28.265 1.00 41.58  ? 354  THR A O   1 
ATOM 2776 C CB  . THR A 1 357  ? -28.301 11.068  -28.356 1.00 45.70  ? 354  THR A CB  1 
ATOM 2777 O OG1 . THR A 1 357  ? -27.814 10.831  -27.039 1.00 45.70  ? 354  THR A OG1 1 
ATOM 2778 C CG2 . THR A 1 357  ? -29.673 10.373  -28.535 1.00 45.70  ? 354  THR A CG2 1 
ATOM 2779 N N   . ASN A 1 358  ? -25.812 12.227  -30.212 1.00 30.52  ? 355  ASN A N   1 
ATOM 2780 C CA  . ASN A 1 358  ? -24.773 13.263  -30.285 1.00 30.52  ? 355  ASN A CA  1 
ATOM 2781 C C   . ASN A 1 358  ? -25.505 14.554  -30.179 1.00 30.52  ? 355  ASN A C   1 
ATOM 2782 O O   . ASN A 1 358  ? -26.399 14.747  -30.995 1.00 30.52  ? 355  ASN A O   1 
ATOM 2783 C CB  . ASN A 1 358  ? -24.182 13.261  -31.675 1.00 30.19  ? 355  ASN A CB  1 
ATOM 2784 C CG  . ASN A 1 358  ? -23.076 14.283  -31.838 1.00 30.19  ? 355  ASN A CG  1 
ATOM 2785 O OD1 . ASN A 1 358  ? -22.620 14.889  -30.859 1.00 30.19  ? 355  ASN A OD1 1 
ATOM 2786 N ND2 . ASN A 1 358  ? -22.634 14.496  -33.087 1.00 30.19  ? 355  ASN A ND2 1 
ATOM 2787 N N   . LEU A 1 359  ? -25.189 15.436  -29.215 1.00 32.39  ? 356  LEU A N   1 
ATOM 2788 C CA  . LEU A 1 359  ? -25.792 16.806  -29.214 1.00 32.39  ? 356  LEU A CA  1 
ATOM 2789 C C   . LEU A 1 359  ? -25.227 17.659  -30.345 1.00 32.39  ? 356  LEU A C   1 
ATOM 2790 O O   . LEU A 1 359  ? -25.583 18.832  -30.468 1.00 32.39  ? 356  LEU A O   1 
ATOM 2791 C CB  . LEU A 1 359  ? -25.704 17.547  -27.872 1.00 21.94  ? 356  LEU A CB  1 
ATOM 2792 C CG  . LEU A 1 359  ? -26.438 16.901  -26.682 1.00 21.94  ? 356  LEU A CG  1 
ATOM 2793 C CD1 . LEU A 1 359  ? -26.223 17.718  -25.425 1.00 21.94  ? 356  LEU A CD1 1 
ATOM 2794 C CD2 . LEU A 1 359  ? -28.008 16.617  -26.906 1.00 21.94  ? 356  LEU A CD2 1 
ATOM 2795 N N   . GLY A 1 360  ? -24.360 17.032  -31.150 1.00 73.38  ? 357  GLY A N   1 
ATOM 2796 C CA  . GLY A 1 360  ? -24.106 17.400  -32.536 1.00 73.38  ? 357  GLY A CA  1 
ATOM 2797 C C   . GLY A 1 360  ? -23.290 18.614  -32.420 1.00 73.38  ? 357  GLY A C   1 
ATOM 2798 O O   . GLY A 1 360  ? -22.793 18.860  -31.349 1.00 73.38  ? 357  GLY A O   1 
ATOM 2799 N N   . PRO A 1 361  ? -23.107 19.358  -33.515 1.00 38.38  ? 358  PRO A N   1 
ATOM 2800 C CA  . PRO A 1 361  ? -22.709 20.769  -33.326 1.00 38.38  ? 358  PRO A CA  1 
ATOM 2801 C C   . PRO A 1 361  ? -23.886 21.533  -32.762 1.00 38.38  ? 358  PRO A C   1 
ATOM 2802 O O   . PRO A 1 361  ? -24.901 21.654  -33.422 1.00 38.38  ? 358  PRO A O   1 
ATOM 2803 C CB  . PRO A 1 361  ? -22.362 21.271  -34.743 1.00 25.33  ? 358  PRO A CB  1 
ATOM 2804 C CG  . PRO A 1 361  ? -22.482 20.094  -35.682 1.00 25.33  ? 358  PRO A CG  1 
ATOM 2805 C CD  . PRO A 1 361  ? -23.173 18.950  -34.932 1.00 25.33  ? 358  PRO A CD  1 
ATOM 2806 N N   . ILE A 1 362  ? -23.786 21.994  -31.537 1.00 27.93  ? 359  ILE A N   1 
ATOM 2807 C CA  . ILE A 1 362  ? -24.781 22.878  -30.997 1.00 27.93  ? 359  ILE A CA  1 
ATOM 2808 C C   . ILE A 1 362  ? -24.566 24.251  -31.589 1.00 27.93  ? 359  ILE A C   1 
ATOM 2809 O O   . ILE A 1 362  ? -23.521 24.853  -31.374 1.00 27.93  ? 359  ILE A O   1 
ATOM 2810 C CB  . ILE A 1 362  ? -24.597 23.035  -29.536 1.00 23.20  ? 359  ILE A CB  1 
ATOM 2811 C CG1 . ILE A 1 362  ? -24.782 21.685  -28.859 1.00 23.20  ? 359  ILE A CG1 1 
ATOM 2812 C CG2 . ILE A 1 362  ? -25.509 24.143  -29.015 1.00 23.20  ? 359  ILE A CG2 1 
ATOM 2813 C CD1 . ILE A 1 362  ? -24.569 21.761  -27.360 1.00 23.20  ? 359  ILE A CD1 1 
ATOM 2814 N N   . VAL A 1 363  ? -25.543 24.770  -32.318 1.00 37.95  ? 360  VAL A N   1 
ATOM 2815 C CA  . VAL A 1 363  ? -25.276 25.909  -33.198 1.00 37.95  ? 360  VAL A CA  1 
ATOM 2816 C C   . VAL A 1 363  ? -25.846 27.168  -32.629 1.00 37.95  ? 360  VAL A C   1 
ATOM 2817 O O   . VAL A 1 363  ? -25.299 28.223  -32.824 1.00 37.95  ? 360  VAL A O   1 
ATOM 2818 C CB  . VAL A 1 363  ? -25.752 25.632  -34.618 1.00 43.03  ? 360  VAL A CB  1 
ATOM 2819 C CG1 . VAL A 1 363  ? -26.203 26.862  -35.301 1.00 43.03  ? 360  VAL A CG1 1 
ATOM 2820 C CG2 . VAL A 1 363  ? -24.651 24.965  -35.362 1.00 43.03  ? 360  VAL A CG2 1 
ATOM 2821 N N   . ASP A 1 364  ? -26.925 27.029  -31.897 1.00 29.15  ? 361  ASP A N   1 
ATOM 2822 C CA  . ASP A 1 364  ? -27.500 28.095  -31.102 1.00 29.15  ? 361  ASP A CA  1 
ATOM 2823 C C   . ASP A 1 364  ? -28.348 27.409  -30.049 1.00 29.15  ? 361  ASP A C   1 
ATOM 2824 O O   . ASP A 1 364  ? -28.666 26.226  -30.164 1.00 29.15  ? 361  ASP A O   1 
ATOM 2825 C CB  . ASP A 1 364  ? -28.390 28.993  -31.960 1.00 49.86  ? 361  ASP A CB  1 
ATOM 2826 C CG  . ASP A 1 364  ? -28.791 30.286  -31.236 1.00 49.86  ? 361  ASP A CG  1 
ATOM 2827 O OD1 . ASP A 1 364  ? -29.690 31.002  -31.740 1.00 49.86  ? 361  ASP A OD1 1 
ATOM 2828 O OD2 . ASP A 1 364  ? -28.209 30.605  -30.170 1.00 49.86  ? 361  ASP A OD2 1 
ATOM 2829 N N   . MET A 1 365  ? -28.751 28.115  -29.022 1.00 28.62  ? 362  MET A N   1 
ATOM 2830 C CA  . MET A 1 365  ? -29.575 27.463  -28.023 1.00 28.62  ? 362  MET A CA  1 
ATOM 2831 C C   . MET A 1 365  ? -30.328 28.497  -27.217 1.00 28.62  ? 362  MET A C   1 
ATOM 2832 O O   . MET A 1 365  ? -30.127 29.681  -27.434 1.00 28.62  ? 362  MET A O   1 
ATOM 2833 C CB  . MET A 1 365  ? -28.717 26.523  -27.155 1.00 40.57  ? 362  MET A CB  1 
ATOM 2834 C CG  . MET A 1 365  ? -27.509 27.181  -26.454 1.00 40.57  ? 362  MET A CG  1 
ATOM 2835 S SD  . MET A 1 365  ? -26.510 26.033  -25.462 1.00 40.57  ? 362  MET A SD  1 
ATOM 2836 C CE  . MET A 1 365  ? -26.313 27.039  -23.994 1.00 40.57  ? 362  MET A CE  1 
ATOM 2837 N N   . CYS A 1 366  ? -31.246 28.058  -26.359 1.00 41.00  ? 363  CYS A N   1 
ATOM 2838 C CA  . CYS A 1 366  ? -31.845 28.926  -25.321 1.00 41.00  ? 363  CYS A CA  1 
ATOM 2839 C C   . CYS A 1 366  ? -32.527 28.156  -24.214 1.00 41.00  ? 363  CYS A C   1 
ATOM 2840 O O   . CYS A 1 366  ? -32.676 26.934  -24.303 1.00 41.00  ? 363  CYS A O   1 
ATOM 2841 C CB  . CYS A 1 366  ? -32.830 29.943  -25.893 1.00 41.40  ? 363  CYS A CB  1 
ATOM 2842 S SG  . CYS A 1 366  ? -34.265 29.226  -26.691 1.00 41.40  ? 363  CYS A SG  1 
ATOM 2843 N N   . VAL A 1 367  ? -32.934 28.888  -23.178 1.00 49.67  ? 364  VAL A N   1 
ATOM 2844 C CA  . VAL A 1 367  ? -33.549 28.299  -21.992 1.00 49.67  ? 364  VAL A CA  1 
ATOM 2845 C C   . VAL A 1 367  ? -34.994 28.743  -21.886 1.00 49.67  ? 364  VAL A C   1 
ATOM 2846 O O   . VAL A 1 367  ? -35.288 29.910  -22.015 1.00 49.67  ? 364  VAL A O   1 
ATOM 2847 C CB  . VAL A 1 367  ? -32.820 28.701  -20.698 1.00 40.89  ? 364  VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 367  ? -33.301 27.858  -19.502 1.00 40.89  ? 364  VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 367  ? -31.310 28.576  -20.882 1.00 40.89  ? 364  VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 368  ? -35.888 27.789  -21.650 1.00 73.10  ? 365  VAL A N   1 
ATOM 2851 C CA  . VAL A 1 368  ? -37.311 28.085  -21.527 1.00 73.10  ? 365  VAL A CA  1 
ATOM 2852 C C   . VAL A 1 368  ? -38.015 27.042  -20.667 1.00 73.10  ? 365  VAL A C   1 
ATOM 2853 O O   . VAL A 1 368  ? -38.205 25.901  -21.088 1.00 73.10  ? 365  VAL A O   1 
ATOM 2854 C CB  . VAL A 1 368  ? -37.996 28.147  -22.905 1.00 39.50  ? 365  VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 368  ? -39.489 28.386  -22.744 1.00 39.50  ? 365  VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 368  ? -37.364 29.232  -23.762 1.00 39.50  ? 365  VAL A CG2 1 
ATOM 2857 N N   . ASP A 1 369  ? -38.401 27.440  -19.459 1.00 121.50 ? 366  ASP A N   1 
ATOM 2858 C CA  . ASP A 1 369  ? -39.083 26.541  -18.536 1.00 121.50 ? 366  ASP A CA  1 
ATOM 2859 C C   . ASP A 1 369  ? -40.387 26.021  -19.130 1.00 121.50 ? 366  ASP A C   1 
ATOM 2860 O O   . ASP A 1 369  ? -41.462 26.229  -18.568 1.00 121.50 ? 366  ASP A O   1 
ATOM 2861 C CB  . ASP A 1 369  ? -39.356 27.246  -17.206 1.00 74.84  ? 366  ASP A CB  1 
ATOM 2862 C CG  . ASP A 1 369  ? -38.088 27.736  -16.535 1.00 74.84  ? 366  ASP A CG  1 
ATOM 2863 O OD1 . ASP A 1 369  ? -36.995 27.525  -17.100 1.00 74.84  ? 366  ASP A OD1 1 
ATOM 2864 O OD2 . ASP A 1 369  ? -38.185 28.333  -15.442 1.00 74.84  ? 366  ASP A OD2 1 
ATOM 2865 N N   . LEU A 1 370  ? -40.287 25.342  -20.269 1.00 119.08 ? 367  LEU A N   1 
ATOM 2866 C CA  . LEU A 1 370  ? -41.461 24.791  -20.934 1.00 119.08 ? 367  LEU A CA  1 
ATOM 2867 C C   . LEU A 1 370  ? -42.644 24.731  -19.975 1.00 119.08 ? 367  LEU A C   1 
ATOM 2868 O O   . LEU A 1 370  ? -43.516 25.599  -19.995 1.00 119.08 ? 367  LEU A O   1 
ATOM 2869 C CB  . LEU A 1 370  ? -41.159 23.397  -21.487 1.00 84.39  ? 367  LEU A CB  1 
ATOM 2870 C CG  . LEU A 1 370  ? -40.026 23.303  -22.510 1.00 84.39  ? 367  LEU A CG  1 
ATOM 2871 C CD1 . LEU A 1 370  ? -39.780 21.856  -22.910 1.00 84.39  ? 367  LEU A CD1 1 
ATOM 2872 C CD2 . LEU A 1 370  ? -40.332 24.156  -23.732 1.00 84.39  ? 367  LEU A CD2 1 
ATOM 2873 N N   . GLU A 1 371  ? -42.643 23.724  -19.103 1.00 140.74 ? 368  GLU A N   1 
ATOM 2874 C CA  . GLU A 1 371  ? -43.715 23.517  -18.121 1.00 140.74 ? 368  GLU A CA  1 
ATOM 2875 C C   . GLU A 1 371  ? -43.817 24.564  -16.999 1.00 140.74 ? 368  GLU A C   1 
ATOM 2876 O O   . GLU A 1 371  ? -44.235 24.248  -15.885 1.00 140.74 ? 368  GLU A O   1 
ATOM 2877 C CB  . GLU A 1 371  ? -43.608 22.116  -17.510 1.00 141.86 ? 368  GLU A CB  1 
ATOM 2878 C CG  . GLU A 1 371  ? -42.299 21.851  -16.784 1.00 141.86 ? 368  GLU A CG  1 
ATOM 2879 C CD  . GLU A 1 371  ? -41.102 21.860  -17.715 1.00 141.86 ? 368  GLU A CD  1 
ATOM 2880 O OE1 . GLU A 1 371  ? -41.306 21.860  -18.947 1.00 141.86 ? 368  GLU A OE1 1 
ATOM 2881 O OE2 . GLU A 1 371  ? -39.958 21.864  -17.214 1.00 141.86 ? 368  GLU A OE2 1 
ATOM 2882 N N   . ARG A 1 372  ? -43.443 25.801  -17.303 1.00 181.38 ? 369  ARG A N   1 
ATOM 2883 C CA  . ARG A 1 372  ? -43.519 26.929  -16.353 1.00 181.38 ? 369  ARG A CA  1 
ATOM 2884 C C   . ARG A 1 372  ? -43.211 26.518  -14.908 1.00 181.38 ? 369  ARG A C   1 
ATOM 2885 O O   . ARG A 1 372  ? -44.058 26.643  -14.021 1.00 181.38 ? 369  ARG A O   1 
ATOM 2886 C CB  . ARG A 1 372  ? -44.901 27.601  -16.438 1.00 126.20 ? 369  ARG A CB  1 
ATOM 2887 C CG  . ARG A 1 372  ? -44.986 28.990  -15.795 1.00 126.20 ? 369  ARG A CG  1 
ATOM 2888 C CD  . ARG A 1 372  ? -46.428 29.387  -15.500 1.00 126.20 ? 369  ARG A CD  1 
ATOM 2889 N NE  . ARG A 1 372  ? -47.214 29.591  -16.719 1.00 126.20 ? 369  ARG A NE  1 
ATOM 2890 C CZ  . ARG A 1 372  ? -48.486 29.986  -16.750 1.00 126.20 ? 369  ARG A CZ  1 
ATOM 2891 N NH1 . ARG A 1 372  ? -49.147 30.230  -15.622 1.00 126.20 ? 369  ARG A NH1 1 
ATOM 2892 N NH2 . ARG A 1 372  ? -49.102 30.141  -17.918 1.00 126.20 ? 369  ARG A NH2 1 
ATOM 2893 N N   . GLN A 1 373  ? -41.993 26.037  -14.679 1.00 123.74 ? 370  GLN A N   1 
ATOM 2894 C CA  . GLN A 1 373  ? -41.664 25.385  -13.419 1.00 123.74 ? 370  GLN A CA  1 
ATOM 2895 C C   . GLN A 1 373  ? -40.730 26.120  -12.460 1.00 123.74 ? 370  GLN A C   1 
ATOM 2896 O O   . GLN A 1 373  ? -40.983 26.164  -11.258 1.00 123.74 ? 370  GLN A O   1 
ATOM 2897 C CB  . GLN A 1 373  ? -41.107 23.994  -13.690 1.00 99.12  ? 370  GLN A CB  1 
ATOM 2898 C CG  . GLN A 1 373  ? -42.155 22.916  -13.760 1.00 99.12  ? 370  GLN A CG  1 
ATOM 2899 C CD  . GLN A 1 373  ? -41.546 21.535  -13.759 1.00 99.12  ? 370  GLN A CD  1 
ATOM 2900 O OE1 . GLN A 1 373  ? -41.197 20.984  -12.705 1.00 99.12  ? 370  GLN A OE1 1 
ATOM 2901 N NE2 . GLN A 1 373  ? -41.408 20.960  -14.943 1.00 99.12  ? 370  GLN A NE2 1 
ATOM 2902 N N   . GLY A 1 374  ? -39.652 26.680  -12.994 1.00 64.14  ? 371  GLY A N   1 
ATOM 2903 C CA  . GLY A 1 374  ? -38.558 27.184  -12.182 1.00 64.14  ? 371  GLY A CA  1 
ATOM 2904 C C   . GLY A 1 374  ? -37.271 26.464  -12.561 1.00 64.14  ? 371  GLY A C   1 
ATOM 2905 O O   . GLY A 1 374  ? -36.160 26.923  -12.246 1.00 64.14  ? 371  GLY A O   1 
ATOM 2906 N N   . GLN A 1 375  ? -37.427 25.317  -13.216 1.00 82.79  ? 372  GLN A N   1 
ATOM 2907 C CA  . GLN A 1 375  ? -36.306 24.658  -13.851 1.00 82.79  ? 372  GLN A CA  1 
ATOM 2908 C C   . GLN A 1 375  ? -36.293 25.025  -15.319 1.00 82.79  ? 372  GLN A C   1 
ATOM 2909 O O   . GLN A 1 375  ? -37.294 24.906  -16.018 1.00 82.79  ? 372  GLN A O   1 
ATOM 2910 C CB  . GLN A 1 375  ? -36.318 23.133  -13.644 1.00 113.92 ? 372  GLN A CB  1 
ATOM 2911 C CG  . GLN A 1 375  ? -37.690 22.466  -13.598 1.00 113.92 ? 372  GLN A CG  1 
ATOM 2912 C CD  . GLN A 1 375  ? -38.243 22.076  -14.968 1.00 113.92 ? 372  GLN A CD  1 
ATOM 2913 O OE1 . GLN A 1 375  ? -38.291 20.890  -15.316 1.00 113.92 ? 372  GLN A OE1 1 
ATOM 2914 N NE2 . GLN A 1 375  ? -38.678 23.067  -15.744 1.00 113.92 ? 372  GLN A NE2 1 
ATOM 2915 N N   . GLY A 1 376  ? -35.157 25.519  -15.773 1.00 84.80  ? 373  GLY A N   1 
ATOM 2916 C CA  . GLY A 1 376  ? -34.942 25.656  -17.195 1.00 84.80  ? 373  GLY A CA  1 
ATOM 2917 C C   . GLY A 1 376  ? -34.794 24.297  -17.847 1.00 84.80  ? 373  GLY A C   1 
ATOM 2918 O O   . GLY A 1 376  ? -34.282 23.354  -17.251 1.00 84.80  ? 373  GLY A O   1 
ATOM 2919 N N   . GLN A 1 377  ? -35.305 24.204  -19.062 1.00 41.05  ? 374  GLN A N   1 
ATOM 2920 C CA  . GLN A 1 377  ? -35.065 23.101  -19.949 1.00 41.05  ? 374  GLN A CA  1 
ATOM 2921 C C   . GLN A 1 377  ? -34.234 23.831  -20.938 1.00 41.05  ? 374  GLN A C   1 
ATOM 2922 O O   . GLN A 1 377  ? -34.359 25.042  -21.066 1.00 41.05  ? 374  GLN A O   1 
ATOM 2923 C CB  . GLN A 1 377  ? -36.353 22.655  -20.633 1.00 85.52  ? 374  GLN A CB  1 
ATOM 2924 C CG  . GLN A 1 377  ? -37.372 22.006  -19.720 1.00 85.52  ? 374  GLN A CG  1 
ATOM 2925 C CD  . GLN A 1 377  ? -37.617 20.538  -20.014 1.00 85.52  ? 374  GLN A CD  1 
ATOM 2926 O OE1 . GLN A 1 377  ? -38.447 19.908  -19.370 1.00 85.52  ? 374  GLN A OE1 1 
ATOM 2927 N NE2 . GLN A 1 377  ? -36.905 19.989  -20.984 1.00 85.52  ? 374  GLN A NE2 1 
ATOM 2928 N N   . LEU A 1 378  ? -33.374 23.136  -21.645 1.00 50.66  ? 375  LEU A N   1 
ATOM 2929 C CA  . LEU A 1 378  ? -32.601 23.822  -22.629 1.00 50.66  ? 375  LEU A CA  1 
ATOM 2930 C C   . LEU A 1 378  ? -32.933 23.271  -24.008 1.00 50.66  ? 375  LEU A C   1 
ATOM 2931 O O   . LEU A 1 378  ? -33.118 22.062  -24.179 1.00 50.66  ? 375  LEU A O   1 
ATOM 2932 C CB  . LEU A 1 378  ? -31.112 23.709  -22.283 1.00 37.65  ? 375  LEU A CB  1 
ATOM 2933 C CG  . LEU A 1 378  ? -30.096 24.380  -23.212 1.00 37.65  ? 375  LEU A CG  1 
ATOM 2934 C CD1 . LEU A 1 378  ? -29.983 25.768  -22.777 1.00 37.65  ? 375  LEU A CD1 1 
ATOM 2935 C CD2 . LEU A 1 378  ? -28.773 23.673  -23.132 1.00 37.65  ? 375  LEU A CD2 1 
ATOM 2936 N N   . VAL A 1 379  ? -33.010 24.162  -24.986 1.00 44.32  ? 376  VAL A N   1 
ATOM 2937 C CA  . VAL A 1 379  ? -33.401 23.778  -26.329 1.00 44.32  ? 376  VAL A CA  1 
ATOM 2938 C C   . VAL A 1 379  ? -32.303 24.210  -27.276 1.00 44.32  ? 376  VAL A C   1 
ATOM 2939 O O   . VAL A 1 379  ? -32.002 25.400  -27.355 1.00 44.32  ? 376  VAL A O   1 
ATOM 2940 C CB  . VAL A 1 379  ? -34.743 24.487  -26.721 1.00 29.13  ? 376  VAL A CB  1 
ATOM 2941 C CG1 . VAL A 1 379  ? -35.100 24.296  -28.204 1.00 29.13  ? 376  VAL A CG1 1 
ATOM 2942 C CG2 . VAL A 1 379  ? -35.930 24.045  -25.773 1.00 29.13  ? 376  VAL A CG2 1 
ATOM 2943 N N   . THR A 1 380  ? -31.724 23.257  -28.009 1.00 39.40  ? 377  THR A N   1 
ATOM 2944 C CA  . THR A 1 380  ? -30.579 23.545  -28.887 1.00 39.40  ? 377  THR A CA  1 
ATOM 2945 C C   . THR A 1 380  ? -30.863 23.336  -30.340 1.00 39.40  ? 377  THR A C   1 
ATOM 2946 O O   . THR A 1 380  ? -31.526 22.391  -30.682 1.00 39.40  ? 377  THR A O   1 
ATOM 2947 C CB  . THR A 1 380  ? -29.395 22.555  -28.642 1.00 19.87  ? 377  THR A CB  1 
ATOM 2948 O OG1 . THR A 1 380  ? -29.764 21.250  -29.135 1.00 19.87  ? 377  THR A OG1 1 
ATOM 2949 C CG2 . THR A 1 380  ? -28.945 22.502  -27.144 1.00 19.87  ? 377  THR A CG2 1 
ATOM 2950 N N   . CYS A 1 381  ? -30.288 24.154  -31.207 1.00 24.14  ? 378  CYS A N   1 
ATOM 2951 C CA  . CYS A 1 381  ? -30.240 23.768  -32.618 1.00 24.14  ? 378  CYS A CA  1 
ATOM 2952 C C   . CYS A 1 381  ? -29.080 22.824  -32.849 1.00 24.14  ? 378  CYS A C   1 
ATOM 2953 O O   . CYS A 1 381  ? -27.934 23.243  -32.718 1.00 24.14  ? 378  CYS A O   1 
ATOM 2954 C CB  . CYS A 1 381  ? -30.042 24.956  -33.529 1.00 34.04  ? 378  CYS A CB  1 
ATOM 2955 S SG  . CYS A 1 381  ? -31.328 26.094  -33.376 1.00 34.04  ? 378  CYS A SG  1 
ATOM 2956 N N   . SER A 1 382  ? -29.355 21.584  -33.223 1.00 33.35  ? 379  SER A N   1 
ATOM 2957 C CA  . SER A 1 382  ? -28.271 20.670  -33.426 1.00 33.35  ? 379  SER A CA  1 
ATOM 2958 C C   . SER A 1 382  ? -28.137 20.078  -34.815 1.00 33.35  ? 379  SER A C   1 
ATOM 2959 O O   . SER A 1 382  ? -29.106 20.022  -35.622 1.00 33.35  ? 379  SER A O   1 
ATOM 2960 C CB  . SER A 1 382  ? -28.388 19.554  -32.434 1.00 35.15  ? 379  SER A CB  1 
ATOM 2961 O OG  . SER A 1 382  ? -28.196 20.079  -31.155 1.00 35.15  ? 379  SER A OG  1 
ATOM 2962 N N   . GLY A 1 383  ? -26.930 19.614  -35.077 1.00 27.34  ? 380  GLY A N   1 
ATOM 2963 C CA  . GLY A 1 383  ? -26.713 18.843  -36.249 1.00 27.34  ? 380  GLY A CA  1 
ATOM 2964 C C   . GLY A 1 383  ? -26.551 19.756  -37.426 1.00 27.34  ? 380  GLY A C   1 
ATOM 2965 O O   . GLY A 1 383  ? -26.451 21.004  -37.282 1.00 27.34  ? 380  GLY A O   1 
ATOM 2966 N N   . ALA A 1 384  ? -26.539 19.153  -38.606 1.00 38.25  ? 381  ALA A N   1 
ATOM 2967 C CA  . ALA A 1 384  ? -26.471 19.898  -39.848 1.00 38.25  ? 381  ALA A CA  1 
ATOM 2968 C C   . ALA A 1 384  ? -27.103 19.024  -40.890 1.00 38.25  ? 381  ALA A C   1 
ATOM 2969 O O   . ALA A 1 384  ? -27.205 17.812  -40.700 1.00 38.25  ? 381  ALA A O   1 
ATOM 2970 C CB  . ALA A 1 384  ? -25.026 20.171  -40.217 1.00 39.44  ? 381  ALA A CB  1 
ATOM 2971 N N   . PHE A 1 385  ? -27.532 19.626  -41.991 1.00 41.43  ? 382  PHE A N   1 
ATOM 2972 C CA  . PHE A 1 385  ? -28.123 18.854  -43.078 1.00 41.43  ? 382  PHE A CA  1 
ATOM 2973 C C   . PHE A 1 385  ? -29.112 17.794  -42.558 1.00 41.43  ? 382  PHE A C   1 
ATOM 2974 O O   . PHE A 1 385  ? -29.822 18.041  -41.561 1.00 41.43  ? 382  PHE A O   1 
ATOM 2975 C CB  . PHE A 1 385  ? -27.016 18.232  -43.887 1.00 19.71  ? 382  PHE A CB  1 
ATOM 2976 C CG  . PHE A 1 385  ? -25.776 19.126  -44.021 1.00 19.71  ? 382  PHE A CG  1 
ATOM 2977 C CD1 . PHE A 1 385  ? -24.558 18.757  -43.441 1.00 19.71  ? 382  PHE A CD1 1 
ATOM 2978 C CD2 . PHE A 1 385  ? -25.832 20.352  -44.745 1.00 19.71  ? 382  PHE A CD2 1 
ATOM 2979 C CE1 . PHE A 1 385  ? -23.401 19.581  -43.588 1.00 19.71  ? 382  PHE A CE1 1 
ATOM 2980 C CE2 . PHE A 1 385  ? -24.704 21.204  -44.875 1.00 19.71  ? 382  PHE A CE2 1 
ATOM 2981 C CZ  . PHE A 1 385  ? -23.483 20.816  -44.291 1.00 19.71  ? 382  PHE A CZ  1 
ATOM 2982 N N   . LYS A 1 386  ? -29.170 16.632  -43.198 1.00 44.34  ? 383  LYS A N   1 
ATOM 2983 C CA  . LYS A 1 386  ? -30.214 15.646  -42.832 1.00 44.34  ? 383  LYS A CA  1 
ATOM 2984 C C   . LYS A 1 386  ? -30.229 15.252  -41.310 1.00 44.34  ? 383  LYS A C   1 
ATOM 2985 O O   . LYS A 1 386  ? -31.275 14.911  -40.762 1.00 44.34  ? 383  LYS A O   1 
ATOM 2986 C CB  . LYS A 1 386  ? -30.227 14.426  -43.802 1.00 25.74  ? 383  LYS A CB  1 
ATOM 2987 C CG  . LYS A 1 386  ? -29.359 13.227  -43.381 1.00 25.74  ? 383  LYS A CG  1 
ATOM 2988 C CD  . LYS A 1 386  ? -28.707 12.541  -44.538 1.00 25.74  ? 383  LYS A CD  1 
ATOM 2989 C CE  . LYS A 1 386  ? -28.266 11.042  -44.259 1.00 25.74  ? 383  LYS A CE  1 
ATOM 2990 N NZ  . LYS A 1 386  ? -28.021 10.594  -42.849 1.00 25.74  ? 383  LYS A NZ  1 
ATOM 2991 N N   . GLU A 1 387  ? -29.081 15.360  -40.635 1.00 32.55  ? 384  GLU A N   1 
ATOM 2992 C CA  . GLU A 1 387  ? -29.015 15.173  -39.182 1.00 32.55  ? 384  GLU A CA  1 
ATOM 2993 C C   . GLU A 1 387  ? -29.556 16.318  -38.321 1.00 32.55  ? 384  GLU A C   1 
ATOM 2994 O O   . GLU A 1 387  ? -29.511 16.254  -37.068 1.00 32.55  ? 384  GLU A O   1 
ATOM 2995 C CB  . GLU A 1 387  ? -27.569 14.916  -38.767 1.00 36.30  ? 384  GLU A CB  1 
ATOM 2996 C CG  . GLU A 1 387  ? -26.840 14.044  -39.722 1.00 36.30  ? 384  GLU A CG  1 
ATOM 2997 C CD  . GLU A 1 387  ? -27.482 12.663  -39.839 1.00 36.30  ? 384  GLU A CD  1 
ATOM 2998 O OE1 . GLU A 1 387  ? -28.288 12.340  -38.933 1.00 36.30  ? 384  GLU A OE1 1 
ATOM 2999 O OE2 . GLU A 1 387  ? -27.182 11.906  -40.805 1.00 36.30  ? 384  GLU A OE2 1 
ATOM 3000 N N   . GLY A 1 388  ? -30.014 17.393  -38.948 1.00 16.79  ? 385  GLY A N   1 
ATOM 3001 C CA  . GLY A 1 388  ? -30.330 18.582  -38.141 1.00 16.79  ? 385  GLY A CA  1 
ATOM 3002 C C   . GLY A 1 388  ? -31.408 18.280  -37.133 1.00 16.79  ? 385  GLY A C   1 
ATOM 3003 O O   . GLY A 1 388  ? -32.179 17.378  -37.344 1.00 16.79  ? 385  GLY A O   1 
ATOM 3004 N N   . SER A 1 389  ? -31.462 18.987  -36.018 1.00 29.78  ? 386  SER A N   1 
ATOM 3005 C CA  . SER A 1 389  ? -32.545 18.706  -35.086 1.00 29.78  ? 386  SER A CA  1 
ATOM 3006 C C   . SER A 1 389  ? -32.675 19.751  -34.000 1.00 29.78  ? 386  SER A C   1 
ATOM 3007 O O   . SER A 1 389  ? -31.859 20.667  -33.926 1.00 29.78  ? 386  SER A O   1 
ATOM 3008 C CB  . SER A 1 389  ? -32.333 17.341  -34.473 1.00 35.07  ? 386  SER A CB  1 
ATOM 3009 O OG  . SER A 1 389  ? -31.494 17.450  -33.360 1.00 35.07  ? 386  SER A OG  1 
ATOM 3010 N N   . LEU A 1 390  ? -33.732 19.668  -33.200 1.00 33.10  ? 387  LEU A N   1 
ATOM 3011 C CA  . LEU A 1 390  ? -33.754 20.357  -31.926 1.00 33.10  ? 387  LEU A CA  1 
ATOM 3012 C C   . LEU A 1 390  ? -33.588 19.297  -30.888 1.00 33.10  ? 387  LEU A C   1 
ATOM 3013 O O   . LEU A 1 390  ? -33.942 18.123  -31.115 1.00 33.10  ? 387  LEU A O   1 
ATOM 3014 C CB  . LEU A 1 390  ? -35.081 21.004  -31.639 1.00 19.46  ? 387  LEU A CB  1 
ATOM 3015 C CG  . LEU A 1 390  ? -35.720 22.027  -32.555 1.00 19.46  ? 387  LEU A CG  1 
ATOM 3016 C CD1 . LEU A 1 390  ? -36.867 22.779  -31.793 1.00 19.46  ? 387  LEU A CD1 1 
ATOM 3017 C CD2 . LEU A 1 390  ? -34.686 22.971  -33.001 1.00 19.46  ? 387  LEU A CD2 1 
ATOM 3018 N N   . ARG A 1 391  ? -33.054 19.700  -29.745 1.00 39.50  ? 388  ARG A N   1 
ATOM 3019 C CA  . ARG A 1 391  ? -32.907 18.786  -28.628 1.00 39.50  ? 388  ARG A CA  1 
ATOM 3020 C C   . ARG A 1 391  ? -33.273 19.518  -27.361 1.00 39.50  ? 388  ARG A C   1 
ATOM 3021 O O   . ARG A 1 391  ? -32.698 20.571  -27.060 1.00 39.50  ? 388  ARG A O   1 
ATOM 3022 C CB  . ARG A 1 391  ? -31.485 18.250  -28.522 1.00 31.00  ? 388  ARG A CB  1 
ATOM 3023 C CG  . ARG A 1 391  ? -30.949 17.694  -29.771 1.00 31.00  ? 388  ARG A CG  1 
ATOM 3024 C CD  . ARG A 1 391  ? -31.106 16.194  -29.910 1.00 31.00  ? 388  ARG A CD  1 
ATOM 3025 N NE  . ARG A 1 391  ? -30.648 15.772  -31.235 1.00 31.00  ? 388  ARG A NE  1 
ATOM 3026 C CZ  . ARG A 1 391  ? -30.088 14.598  -31.504 1.00 31.00  ? 388  ARG A CZ  1 
ATOM 3027 N NH1 . ARG A 1 391  ? -29.901 13.695  -30.549 1.00 31.00  ? 388  ARG A NH1 1 
ATOM 3028 N NH2 . ARG A 1 391  ? -29.713 14.294  -32.740 1.00 31.00  ? 388  ARG A NH2 1 
ATOM 3029 N N   . ILE A 1 392  ? -34.254 18.975  -26.643 1.00 49.93  ? 389  ILE A N   1 
ATOM 3030 C CA  . ILE A 1 392  ? -34.750 19.636  -25.450 1.00 49.93  ? 389  ILE A CA  1 
ATOM 3031 C C   . ILE A 1 392  ? -34.103 18.888  -24.310 1.00 49.93  ? 389  ILE A C   1 
ATOM 3032 O O   . ILE A 1 392  ? -34.161 17.657  -24.261 1.00 49.93  ? 389  ILE A O   1 
ATOM 3033 C CB  . ILE A 1 392  ? -36.307 19.621  -25.335 1.00 36.09  ? 389  ILE A CB  1 
ATOM 3034 C CG1 . ILE A 1 392  ? -36.996 20.159  -26.594 1.00 36.09  ? 389  ILE A CG1 1 
ATOM 3035 C CG2 . ILE A 1 392  ? -36.747 20.500  -24.187 1.00 36.09  ? 389  ILE A CG2 1 
ATOM 3036 C CD1 . ILE A 1 392  ? -37.174 19.171  -27.687 1.00 36.09  ? 389  ILE A CD1 1 
ATOM 3037 N N   . ILE A 1 393  ? -33.471 19.624  -23.406 1.00 53.64  ? 390  ILE A N   1 
ATOM 3038 C CA  . ILE A 1 393  ? -32.544 19.009  -22.474 1.00 53.64  ? 390  ILE A CA  1 
ATOM 3039 C C   . ILE A 1 393  ? -32.891 19.309  -21.011 1.00 53.64  ? 390  ILE A C   1 
ATOM 3040 O O   . ILE A 1 393  ? -32.818 20.447  -20.524 1.00 53.64  ? 390  ILE A O   1 
ATOM 3041 C CB  . ILE A 1 393  ? -31.086 19.377  -22.844 1.00 41.43  ? 390  ILE A CB  1 
ATOM 3042 C CG1 . ILE A 1 393  ? -30.819 19.023  -24.315 1.00 41.43  ? 390  ILE A CG1 1 
ATOM 3043 C CG2 . ILE A 1 393  ? -30.103 18.656  -21.952 1.00 41.43  ? 390  ILE A CG2 1 
ATOM 3044 C CD1 . ILE A 1 393  ? -29.476 19.545  -24.891 1.00 41.43  ? 390  ILE A CD1 1 
ATOM 3045 N N   . ARG A 1 394  ? -33.264 18.251  -20.309 1.00 44.37  ? 391  ARG A N   1 
ATOM 3046 C CA  . ARG A 1 394  ? -33.913 18.382  -19.007 1.00 44.37  ? 391  ARG A CA  1 
ATOM 3047 C C   . ARG A 1 394  ? -33.134 17.567  -17.994 1.00 44.37  ? 391  ARG A C   1 
ATOM 3048 O O   . ARG A 1 394  ? -32.998 16.353  -18.137 1.00 44.37  ? 391  ARG A O   1 
ATOM 3049 C CB  . ARG A 1 394  ? -35.349 17.857  -19.124 1.00 79.13  ? 391  ARG A CB  1 
ATOM 3050 C CG  . ARG A 1 394  ? -36.293 18.246  -18.003 1.00 79.13  ? 391  ARG A CG  1 
ATOM 3051 C CD  . ARG A 1 394  ? -36.617 17.104  -16.992 1.00 79.13  ? 391  ARG A CD  1 
ATOM 3052 N NE  . ARG A 1 394  ? -36.889 15.778  -17.564 1.00 79.13  ? 391  ARG A NE  1 
ATOM 3053 C CZ  . ARG A 1 394  ? -37.895 15.482  -18.389 1.00 79.13  ? 391  ARG A CZ  1 
ATOM 3054 N NH1 . ARG A 1 394  ? -38.746 16.421  -18.794 1.00 79.13  ? 391  ARG A NH1 1 
ATOM 3055 N NH2 . ARG A 1 394  ? -38.027 14.242  -18.835 1.00 79.13  ? 391  ARG A NH2 1 
ATOM 3056 N N   . ASN A 1 395  ? -32.614 18.256  -16.988 1.00 59.04  ? 392  ASN A N   1 
ATOM 3057 C CA  . ASN A 1 395  ? -32.031 17.649  -15.810 1.00 59.04  ? 392  ASN A CA  1 
ATOM 3058 C C   . ASN A 1 395  ? -33.133 16.891  -15.083 1.00 59.04  ? 392  ASN A C   1 
ATOM 3059 O O   . ASN A 1 395  ? -34.250 17.380  -14.949 1.00 59.04  ? 392  ASN A O   1 
ATOM 3060 C CB  . ASN A 1 395  ? -31.499 18.758  -14.900 1.00 148.34 ? 392  ASN A CB  1 
ATOM 3061 C CG  . ASN A 1 395  ? -30.392 18.295  -13.971 1.00 148.34 ? 392  ASN A CG  1 
ATOM 3062 O OD1 . ASN A 1 395  ? -29.532 19.095  -13.587 1.00 148.34 ? 392  ASN A OD1 1 
ATOM 3063 N ND2 . ASN A 1 395  ? -30.413 17.015  -13.589 1.00 148.34 ? 392  ASN A ND2 1 
ATOM 3064 N N   . GLY A 1 396  ? -32.840 15.683  -14.646 1.00 45.96  ? 393  GLY A N   1 
ATOM 3065 C CA  . GLY A 1 396  ? -33.663 15.075  -13.654 1.00 45.96  ? 393  GLY A CA  1 
ATOM 3066 C C   . GLY A 1 396  ? -34.683 14.068  -14.100 1.00 45.96  ? 393  GLY A C   1 
ATOM 3067 O O   . GLY A 1 396  ? -35.279 14.162  -15.171 1.00 45.96  ? 393  GLY A O   1 
ATOM 3068 N N   . ILE A 1 397  ? -34.899 13.105  -13.227 1.00 72.19  ? 394  ILE A N   1 
ATOM 3069 C CA  . ILE A 1 397  ? -35.870 12.088  -13.489 1.00 72.19  ? 394  ILE A CA  1 
ATOM 3070 C C   . ILE A 1 397  ? -37.228 12.583  -12.982 1.00 72.19  ? 394  ILE A C   1 
ATOM 3071 O O   . ILE A 1 397  ? -37.392 12.898  -11.801 1.00 72.19  ? 394  ILE A O   1 
ATOM 3072 C CB  . ILE A 1 397  ? -35.415 10.753  -12.881 1.00 41.48  ? 394  ILE A CB  1 
ATOM 3073 C CG1 . ILE A 1 397  ? -33.940 10.543  -13.195 1.00 41.48  ? 394  ILE A CG1 1 
ATOM 3074 C CG2 . ILE A 1 397  ? -36.248 9.599   -13.432 1.00 41.48  ? 394  ILE A CG2 1 
ATOM 3075 C CD1 . ILE A 1 397  ? -33.329 9.508   -12.386 1.00 41.48  ? 394  ILE A CD1 1 
ATOM 3076 N N   . GLY A 1 398  ? -38.177 12.689  -13.911 1.00 57.16  ? 395  GLY A N   1 
ATOM 3077 C CA  . GLY A 1 398  ? -39.477 13.256  -13.622 1.00 57.16  ? 395  GLY A CA  1 
ATOM 3078 C C   . GLY A 1 398  ? -40.525 12.185  -13.519 1.00 57.16  ? 395  GLY A C   1 
ATOM 3079 O O   . GLY A 1 398  ? -40.322 11.081  -14.015 1.00 57.16  ? 395  GLY A O   1 
ATOM 3080 N N   . ILE A 1 399  ? -41.634 12.502  -12.845 1.00 54.92  ? 396  ILE A N   1 
ATOM 3081 C CA  . ILE A 1 399  ? -42.810 11.608  -12.802 1.00 54.92  ? 396  ILE A CA  1 
ATOM 3082 C C   . ILE A 1 399  ? -44.169 12.339  -13.023 1.00 54.92  ? 396  ILE A C   1 
ATOM 3083 O O   . ILE A 1 399  ? -44.313 13.538  -12.705 1.00 54.92  ? 396  ILE A O   1 
ATOM 3084 C CB  . ILE A 1 399  ? -42.825 10.663  -11.501 1.00 72.14  ? 396  ILE A CB  1 
ATOM 3085 C CG1 . ILE A 1 399  ? -43.731 11.199  -10.374 1.00 72.14  ? 396  ILE A CG1 1 
ATOM 3086 C CG2 . ILE A 1 399  ? -41.400 10.309  -10.996 1.00 72.14  ? 396  ILE A CG2 1 
ATOM 3087 C CD1 . ILE A 1 399  ? -43.453 12.628  -9.943  1.00 72.14  ? 396  ILE A CD1 1 
ATOM 3088 N N   . HIS A 1 400  ? -45.157 11.594  -13.539 1.00 81.06  ? 397  HIS A N   1 
ATOM 3089 C CA  . HIS A 1 400  ? -46.479 12.139  -13.941 1.00 81.06  ? 397  HIS A CA  1 
ATOM 3090 C C   . HIS A 1 400  ? -47.630 11.787  -12.956 1.00 81.06  ? 397  HIS A C   1 
ATOM 3091 O O   . HIS A 1 400  ? -48.031 10.626  -12.872 1.00 81.06  ? 397  HIS A O   1 
ATOM 3092 C CB  . HIS A 1 400  ? -46.836 11.666  -15.366 1.00 131.99 ? 397  HIS A CB  1 
ATOM 3093 C CG  . HIS A 1 400  ? -45.647 11.282  -16.204 1.00 131.99 ? 397  HIS A CG  1 
ATOM 3094 N ND1 . HIS A 1 400  ? -45.034 12.157  -17.078 1.00 131.99 ? 397  HIS A ND1 1 
ATOM 3095 C CD2 . HIS A 1 400  ? -44.968 10.115  -16.306 1.00 131.99 ? 397  HIS A CD2 1 
ATOM 3096 C CE1 . HIS A 1 400  ? -44.028 11.546  -17.679 1.00 131.99 ? 397  HIS A CE1 1 
ATOM 3097 N NE2 . HIS A 1 400  ? -43.969 10.305  -17.230 1.00 131.99 ? 397  HIS A NE2 1 
ATOM 3098 N N   . GLU A 1 401  ? -48.165 12.802  -12.259 1.00 93.16  ? 398  GLU A N   1 
ATOM 3099 C CA  . GLU A 1 401  ? -49.115 12.638  -11.106 1.00 93.16  ? 398  GLU A CA  1 
ATOM 3100 C C   . GLU A 1 401  ? -50.601 12.358  -11.417 1.00 93.16  ? 398  GLU A C   1 
ATOM 3101 O O   . GLU A 1 401  ? -51.343 13.236  -11.879 1.00 93.16  ? 398  GLU A O   1 
ATOM 3102 C CB  . GLU A 1 401  ? -49.013 13.818  -10.113 1.00 108.12 ? 398  GLU A CB  1 
ATOM 3103 C CG  . GLU A 1 401  ? -49.437 15.184  -10.653 1.00 108.12 ? 398  GLU A CG  1 
ATOM 3104 C CD  . GLU A 1 401  ? -49.710 16.206  -9.549  1.00 108.12 ? 398  GLU A CD  1 
ATOM 3105 O OE1 . GLU A 1 401  ? -50.781 16.118  -8.897  1.00 108.12 ? 398  GLU A OE1 1 
ATOM 3106 O OE2 . GLU A 1 401  ? -48.865 17.111  -9.343  1.00 108.12 ? 398  GLU A OE2 1 
ATOM 3107 N N   . HIS A 1 402  ? -51.034 11.139  -11.105 1.00 195.16 ? 399  HIS A N   1 
ATOM 3108 C CA  . HIS A 1 402  ? -52.368 10.670  -11.483 1.00 195.16 ? 399  HIS A CA  1 
ATOM 3109 C C   . HIS A 1 402  ? -53.468 11.074  -10.495 1.00 195.16 ? 399  HIS A C   1 
ATOM 3110 O O   . HIS A 1 402  ? -54.399 11.774  -10.890 1.00 195.16 ? 399  HIS A O   1 
ATOM 3111 C CB  . HIS A 1 402  ? -52.347 9.164   -11.775 1.00 94.50  ? 399  HIS A CB  1 
ATOM 3112 C CG  . HIS A 1 402  ? -51.566 8.799   -13.008 1.00 94.50  ? 399  HIS A CG  1 
ATOM 3113 N ND1 . HIS A 1 402  ? -51.618 7.544   -13.581 1.00 94.50  ? 399  HIS A ND1 1 
ATOM 3114 C CD2 . HIS A 1 402  ? -50.733 9.533   -13.789 1.00 94.50  ? 399  HIS A CD2 1 
ATOM 3115 C CE1 . HIS A 1 402  ? -50.839 7.514   -14.649 1.00 94.50  ? 399  HIS A CE1 1 
ATOM 3116 N NE2 . HIS A 1 402  ? -50.293 8.709   -14.799 1.00 94.50  ? 399  HIS A NE2 1 
ATOM 3117 N N   . ALA A 1 403  ? -53.379 10.658  -9.231  1.00 76.42  ? 400  ALA A N   1 
ATOM 3118 C CA  . ALA A 1 403  ? -54.338 11.163  -8.232  1.00 76.42  ? 400  ALA A CA  1 
ATOM 3119 C C   . ALA A 1 403  ? -53.653 12.139  -7.295  1.00 76.42  ? 400  ALA A C   1 
ATOM 3120 O O   . ALA A 1 403  ? -52.461 12.375  -7.433  1.00 76.42  ? 400  ALA A O   1 
ATOM 3121 C CB  . ALA A 1 403  ? -55.026 10.035  -7.464  1.00 38.88  ? 400  ALA A CB  1 
ATOM 3122 N N   . SER A 1 404  ? -54.405 12.721  -6.368  1.00 106.61 ? 401  SER A N   1 
ATOM 3123 C CA  . SER A 1 404  ? -53.848 13.720  -5.455  1.00 106.61 ? 401  SER A CA  1 
ATOM 3124 C C   . SER A 1 404  ? -54.650 13.788  -4.148  1.00 106.61 ? 401  SER A C   1 
ATOM 3125 O O   . SER A 1 404  ? -55.590 14.571  -4.014  1.00 106.61 ? 401  SER A O   1 
ATOM 3126 C CB  . SER A 1 404  ? -53.774 15.095  -6.144  1.00 69.72  ? 401  SER A CB  1 
ATOM 3127 O OG  . SER A 1 404  ? -52.772 15.930  -5.569  1.00 69.72  ? 401  SER A OG  1 
ATOM 3128 N N   . ILE A 1 405  ? -54.265 12.962  -3.186  1.00 199.77 ? 402  ILE A N   1 
ATOM 3129 C CA  . ILE A 1 405  ? -55.047 12.806  -1.971  1.00 199.77 ? 402  ILE A CA  1 
ATOM 3130 C C   . ILE A 1 405  ? -54.307 13.405  -0.767  1.00 199.77 ? 402  ILE A C   1 
ATOM 3131 O O   . ILE A 1 405  ? -53.338 12.814  -0.286  1.00 199.77 ? 402  ILE A O   1 
ATOM 3132 C CB  . ILE A 1 405  ? -55.384 11.309  -1.731  1.00 71.70  ? 402  ILE A CB  1 
ATOM 3133 C CG1 . ILE A 1 405  ? -56.175 10.706  -2.910  1.00 71.70  ? 402  ILE A CG1 1 
ATOM 3134 C CG2 . ILE A 1 405  ? -56.187 11.132  -0.462  1.00 71.70  ? 402  ILE A CG2 1 
ATOM 3135 C CD1 . ILE A 1 405  ? -55.376 9.777   -3.819  1.00 71.70  ? 402  ILE A CD1 1 
ATOM 3136 N N   . ASP A 1 406  ? -54.768 14.567  -0.283  1.00 149.35 ? 403  ASP A N   1 
ATOM 3137 C CA  . ASP A 1 406  ? -54.116 15.283  0.843   1.00 149.35 ? 403  ASP A CA  1 
ATOM 3138 C C   . ASP A 1 406  ? -54.199 14.490  2.139   1.00 149.35 ? 403  ASP A C   1 
ATOM 3139 O O   . ASP A 1 406  ? -55.212 14.552  2.841   1.00 149.35 ? 403  ASP A O   1 
ATOM 3140 C CB  . ASP A 1 406  ? -54.740 16.663  1.110   1.00 137.80 ? 403  ASP A CB  1 
ATOM 3141 C CG  . ASP A 1 406  ? -55.340 17.293  -0.122  1.00 137.80 ? 403  ASP A CG  1 
ATOM 3142 O OD1 . ASP A 1 406  ? -55.219 18.526  -0.264  1.00 137.80 ? 403  ASP A OD1 1 
ATOM 3143 O OD2 . ASP A 1 406  ? -55.947 16.567  -0.937  1.00 137.80 ? 403  ASP A OD2 1 
ATOM 3144 N N   . LEU A 1 407  ? -53.133 13.762  2.463   1.00 195.05 ? 404  LEU A N   1 
ATOM 3145 C CA  . LEU A 1 407  ? -53.125 12.916  3.654   1.00 195.05 ? 404  LEU A CA  1 
ATOM 3146 C C   . LEU A 1 407  ? -51.954 13.215  4.587   1.00 195.05 ? 404  LEU A C   1 
ATOM 3147 O O   . LEU A 1 407  ? -50.931 12.530  4.533   1.00 195.05 ? 404  LEU A O   1 
ATOM 3148 C CB  . LEU A 1 407  ? -53.156 11.430  3.266   1.00 66.79  ? 404  LEU A CB  1 
ATOM 3149 C CG  . LEU A 1 407  ? -54.394 10.935  2.490   1.00 66.79  ? 404  LEU A CG  1 
ATOM 3150 C CD1 . LEU A 1 407  ? -54.348 9.417   2.213   1.00 66.79  ? 404  LEU A CD1 1 
ATOM 3151 C CD2 . LEU A 1 407  ? -55.687 11.355  3.221   1.00 66.79  ? 404  LEU A CD2 1 
ATOM 3152 N N   . PRO A 1 408  ? -52.110 14.240  5.452   1.00 175.68 ? 405  PRO A N   1 
ATOM 3153 C CA  . PRO A 1 408  ? -51.067 14.611  6.407   1.00 175.68 ? 405  PRO A CA  1 
ATOM 3154 C C   . PRO A 1 408  ? -50.868 13.531  7.472   1.00 175.68 ? 405  PRO A C   1 
ATOM 3155 O O   . PRO A 1 408  ? -51.537 13.530  8.512   1.00 175.68 ? 405  PRO A O   1 
ATOM 3156 C CB  . PRO A 1 408  ? -51.593 15.917  7.028   1.00 154.26 ? 405  PRO A CB  1 
ATOM 3157 C CG  . PRO A 1 408  ? -52.723 16.359  6.152   1.00 154.26 ? 405  PRO A CG  1 
ATOM 3158 C CD  . PRO A 1 408  ? -53.290 15.112  5.578   1.00 154.26 ? 405  PRO A CD  1 
ATOM 3159 N N   . GLY A 1 409  ? -49.956 12.606  7.182   1.00 131.02 ? 406  GLY A N   1 
ATOM 3160 C CA  . GLY A 1 409  ? -49.614 11.535  8.100   1.00 131.02 ? 406  GLY A CA  1 
ATOM 3161 C C   . GLY A 1 409  ? -48.780 10.454  7.447   1.00 131.02 ? 406  GLY A C   1 
ATOM 3162 O O   . GLY A 1 409  ? -47.610 10.288  7.780   1.00 131.02 ? 406  GLY A O   1 
ATOM 3163 N N   . ILE A 1 410  ? -49.392 9.748   6.502   1.00 125.36 ? 407  ILE A N   1 
ATOM 3164 C CA  . ILE A 1 410  ? -48.849 8.539   5.881   1.00 125.36 ? 407  ILE A CA  1 
ATOM 3165 C C   . ILE A 1 410  ? -47.421 8.160   6.272   1.00 125.36 ? 407  ILE A C   1 
ATOM 3166 O O   . ILE A 1 410  ? -46.465 8.844   5.906   1.00 125.36 ? 407  ILE A O   1 
ATOM 3167 C CB  . ILE A 1 410  ? -48.942 8.596   4.353   1.00 69.09  ? 407  ILE A CB  1 
ATOM 3168 C CG1 . ILE A 1 410  ? -50.341 9.094   3.913   1.00 69.09  ? 407  ILE A CG1 1 
ATOM 3169 C CG2 . ILE A 1 410  ? -48.558 7.217   3.778   1.00 69.09  ? 407  ILE A CG2 1 
ATOM 3170 C CD1 . ILE A 1 410  ? -50.559 9.265   2.391   1.00 69.09  ? 407  ILE A CD1 1 
ATOM 3171 N N   . LYS A 1 411  ? -47.294 7.050   6.994   1.00 95.43  ? 408  LYS A N   1 
ATOM 3172 C CA  . LYS A 1 411  ? -46.012 6.612   7.539   1.00 95.43  ? 408  LYS A CA  1 
ATOM 3173 C C   . LYS A 1 411  ? -45.569 5.298   6.952   1.00 95.43  ? 408  LYS A C   1 
ATOM 3174 O O   . LYS A 1 411  ? -44.844 4.539   7.576   1.00 95.43  ? 408  LYS A O   1 
ATOM 3175 C CB  . LYS A 1 411  ? -46.075 6.463   9.046   1.00 59.84  ? 408  LYS A CB  1 
ATOM 3176 C CG  . LYS A 1 411  ? -46.500 7.702   9.796   1.00 59.84  ? 408  LYS A CG  1 
ATOM 3177 C CD  . LYS A 1 411  ? -45.416 8.774   9.921   1.00 59.84  ? 408  LYS A CD  1 
ATOM 3178 C CE  . LYS A 1 411  ? -45.870 9.760   11.018  1.00 59.84  ? 408  LYS A CE  1 
ATOM 3179 N NZ  . LYS A 1 411  ? -45.246 11.131  11.069  1.00 59.84  ? 408  LYS A NZ  1 
ATOM 3180 N N   . GLY A 1 412  ? -46.014 5.032   5.740   1.00 62.84  ? 409  GLY A N   1 
ATOM 3181 C CA  . GLY A 1 412  ? -45.554 3.871   4.997   1.00 62.84  ? 409  GLY A CA  1 
ATOM 3182 C C   . GLY A 1 412  ? -46.640 3.509   4.016   1.00 62.84  ? 409  GLY A C   1 
ATOM 3183 O O   . GLY A 1 412  ? -47.670 4.197   3.924   1.00 62.84  ? 409  GLY A O   1 
ATOM 3184 N N   . LEU A 1 413  ? -46.392 2.435   3.281   1.00 64.41  ? 410  LEU A N   1 
ATOM 3185 C CA  . LEU A 1 413  ? -47.347 1.872   2.337   1.00 64.41  ? 410  LEU A CA  1 
ATOM 3186 C C   . LEU A 1 413  ? -46.721 0.746   1.527   1.00 64.41  ? 410  LEU A C   1 
ATOM 3187 O O   . LEU A 1 413  ? -45.641 0.908   0.926   1.00 64.41  ? 410  LEU A O   1 
ATOM 3188 C CB  . LEU A 1 413  ? -47.967 2.937   1.421   1.00 107.01 ? 410  LEU A CB  1 
ATOM 3189 C CG  . LEU A 1 413  ? -47.170 4.085   0.812   1.00 107.01 ? 410  LEU A CG  1 
ATOM 3190 C CD1 . LEU A 1 413  ? -46.571 3.691   -0.512  1.00 107.01 ? 410  LEU A CD1 1 
ATOM 3191 C CD2 . LEU A 1 413  ? -48.103 5.263   0.649   1.00 107.01 ? 410  LEU A CD2 1 
ATOM 3192 N N   . TRP A 1 414  ? -47.436 -0.375  1.470   1.00 112.55 ? 411  TRP A N   1 
ATOM 3193 C CA  . TRP A 1 414  ? -47.032 -1.540  0.692   1.00 112.55 ? 411  TRP A CA  1 
ATOM 3194 C C   . TRP A 1 414  ? -48.152 -1.877  -0.294  1.00 112.55 ? 411  TRP A C   1 
ATOM 3195 O O   . TRP A 1 414  ? -49.249 -1.325  -0.203  1.00 112.55 ? 411  TRP A O   1 
ATOM 3196 C CB  . TRP A 1 414  ? -46.754 -2.731  1.607   1.00 67.08  ? 411  TRP A CB  1 
ATOM 3197 C CG  . TRP A 1 414  ? -45.683 -2.469  2.623   1.00 67.08  ? 411  TRP A CG  1 
ATOM 3198 C CD1 . TRP A 1 414  ? -44.349 -2.714  2.487   1.00 67.08  ? 411  TRP A CD1 1 
ATOM 3199 C CD2 . TRP A 1 414  ? -45.858 -1.911  3.931   1.00 67.08  ? 411  TRP A CD2 1 
ATOM 3200 N NE1 . TRP A 1 414  ? -43.681 -2.343  3.629   1.00 67.08  ? 411  TRP A NE1 1 
ATOM 3201 C CE2 . TRP A 1 414  ? -44.585 -1.848  4.531   1.00 67.08  ? 411  TRP A CE2 1 
ATOM 3202 C CE3 . TRP A 1 414  ? -46.968 -1.459  4.652   1.00 67.08  ? 411  TRP A CE3 1 
ATOM 3203 C CZ2 . TRP A 1 414  ? -44.391 -1.350  5.818   1.00 67.08  ? 411  TRP A CZ2 1 
ATOM 3204 C CZ3 . TRP A 1 414  ? -46.772 -0.966  5.930   1.00 67.08  ? 411  TRP A CZ3 1 
ATOM 3205 C CH2 . TRP A 1 414  ? -45.494 -0.916  6.499   1.00 67.08  ? 411  TRP A CH2 1 
ATOM 3206 N N   . PRO A 1 415  ? -47.868 -2.778  -1.228  1.00 105.10 ? 412  PRO A N   1 
ATOM 3207 C CA  . PRO A 1 415  ? -48.853 -3.186  -2.231  1.00 105.10 ? 412  PRO A CA  1 
ATOM 3208 C C   . PRO A 1 415  ? -50.049 -3.892  -1.601  1.00 105.10 ? 412  PRO A C   1 
ATOM 3209 O O   . PRO A 1 415  ? -50.118 -4.014  -0.378  1.00 105.10 ? 412  PRO A O   1 
ATOM 3210 C CB  . PRO A 1 415  ? -48.050 -4.169  -3.083  1.00 97.57  ? 412  PRO A CB  1 
ATOM 3211 C CG  . PRO A 1 415  ? -46.704 -3.531  -3.094  1.00 97.57  ? 412  PRO A CG  1 
ATOM 3212 C CD  . PRO A 1 415  ? -46.524 -3.241  -1.616  1.00 97.57  ? 412  PRO A CD  1 
ATOM 3213 N N   . LEU A 1 416  ? -50.977 -4.350  -2.434  1.00 162.25 ? 413  LEU A N   1 
ATOM 3214 C CA  . LEU A 1 416  ? -52.166 -5.042  -1.950  1.00 162.25 ? 413  LEU A CA  1 
ATOM 3215 C C   . LEU A 1 416  ? -53.058 -5.481  -3.107  1.00 162.25 ? 413  LEU A C   1 
ATOM 3216 O O   . LEU A 1 416  ? -53.757 -4.666  -3.709  1.00 162.25 ? 413  LEU A O   1 
ATOM 3217 C CB  . LEU A 1 416  ? -52.953 -4.148  -0.990  1.00 155.14 ? 413  LEU A CB  1 
ATOM 3218 C CG  . LEU A 1 416  ? -54.236 -4.744  -0.407  1.00 155.14 ? 413  LEU A CG  1 
ATOM 3219 C CD1 . LEU A 1 416  ? -53.944 -6.050  0.314   1.00 155.14 ? 413  LEU A CD1 1 
ATOM 3220 C CD2 . LEU A 1 416  ? -54.914 -3.752  0.526   1.00 155.14 ? 413  LEU A CD2 1 
ATOM 3221 N N   . ARG A 1 417  ? -53.013 -6.768  -3.438  1.00 144.89 ? 414  ARG A N   1 
ATOM 3222 C CA  . ARG A 1 417  ? -53.870 -7.323  -4.474  1.00 144.89 ? 414  ARG A CA  1 
ATOM 3223 C C   . ARG A 1 417  ? -55.057 -8.005  -3.841  1.00 144.89 ? 414  ARG A C   1 
ATOM 3224 O O   . ARG A 1 417  ? -54.937 -9.028  -3.186  1.00 144.89 ? 414  ARG A O   1 
ATOM 3225 C CB  . ARG A 1 417  ? -53.134 -8.299  -5.394  1.00 68.19  ? 414  ARG A CB  1 
ATOM 3226 C CG  . ARG A 1 417  ? -51.878 -8.877  -4.835  1.00 68.19  ? 414  ARG A CG  1 
ATOM 3227 C CD  . ARG A 1 417  ? -51.748 -10.333 -5.195  1.00 68.19  ? 414  ARG A CD  1 
ATOM 3228 N NE  . ARG A 1 417  ? -50.508 -10.634 -5.898  1.00 68.19  ? 414  ARG A NE  1 
ATOM 3229 C CZ  . ARG A 1 417  ? -49.401 -9.906  -5.845  1.00 68.19  ? 414  ARG A CZ  1 
ATOM 3230 N NH1 . ARG A 1 417  ? -49.339 -8.817  -5.111  1.00 68.19  ? 414  ARG A NH1 1 
ATOM 3231 N NH2 . ARG A 1 417  ? -48.343 -10.275 -6.530  1.00 68.19  ? 414  ARG A NH2 1 
ATOM 3232 N N   . SER A 1 418  ? -56.216 -7.416  -4.044  1.00 125.08 ? 415  SER A N   1 
ATOM 3233 C CA  . SER A 1 418  ? -57.459 -8.006  -3.563  1.00 125.08 ? 415  SER A CA  1 
ATOM 3234 C C   . SER A 1 418  ? -57.835 -9.244  -4.371  1.00 125.08 ? 415  SER A C   1 
ATOM 3235 O O   . SER A 1 418  ? -58.984 -9.404  -4.782  1.00 125.08 ? 415  SER A O   1 
ATOM 3236 C CB  . SER A 1 418  ? -58.594 -6.981  -3.614  1.00 108.54 ? 415  SER A CB  1 
ATOM 3237 O OG  . SER A 1 418  ? -59.809 -7.542  -3.148  1.00 108.54 ? 415  SER A OG  1 
ATOM 3238 N N   . ASP A 1 419  ? -56.859 -10.118 -4.595  1.00 208.66 ? 416  ASP A N   1 
ATOM 3239 C CA  . ASP A 1 419  ? -57.087 -11.344 -5.354  1.00 208.66 ? 416  ASP A CA  1 
ATOM 3240 C C   . ASP A 1 419  ? -55.826 -12.208 -5.505  1.00 208.66 ? 416  ASP A C   1 
ATOM 3241 O O   . ASP A 1 419  ? -54.731 -11.703 -5.755  1.00 208.66 ? 416  ASP A O   1 
ATOM 3242 C CB  . ASP A 1 419  ? -57.666 -11.018 -6.733  1.00 177.00 ? 416  ASP A CB  1 
ATOM 3243 C CG  . ASP A 1 419  ? -58.013 -12.261 -7.528  1.00 177.00 ? 416  ASP A CG  1 
ATOM 3244 O OD1 . ASP A 1 419  ? -57.822 -13.377 -7.003  1.00 177.00 ? 416  ASP A OD1 1 
ATOM 3245 O OD2 . ASP A 1 419  ? -58.478 -12.121 -8.680  1.00 177.00 ? 416  ASP A OD2 1 
ATOM 3246 N N   . PRO A 1 420  ? -56.012 -13.515 -5.351  1.00 164.72 ? 417  PRO A N   1 
ATOM 3247 C CA  . PRO A 1 420  ? -54.952 -14.544 -5.473  1.00 164.72 ? 417  PRO A CA  1 
ATOM 3248 C C   . PRO A 1 420  ? -54.406 -14.863 -6.880  1.00 164.72 ? 417  PRO A C   1 
ATOM 3249 O O   . PRO A 1 420  ? -53.582 -15.775 -7.016  1.00 164.72 ? 417  PRO A O   1 
ATOM 3250 C CB  . PRO A 1 420  ? -55.619 -15.805 -4.897  1.00 135.01 ? 417  PRO A CB  1 
ATOM 3251 C CG  . PRO A 1 420  ? -56.803 -15.311 -4.118  1.00 135.01 ? 417  PRO A CG  1 
ATOM 3252 C CD  . PRO A 1 420  ? -57.265 -14.091 -4.823  1.00 135.01 ? 417  PRO A CD  1 
ATOM 3253 N N   . ASN A 1 421  ? -54.853 -14.138 -7.906  1.00 208.42 ? 418  ASN A N   1 
ATOM 3254 C CA  . ASN A 1 421  ? -54.382 -14.385 -9.278  1.00 208.42 ? 418  ASN A CA  1 
ATOM 3255 C C   . ASN A 1 421  ? -53.746 -13.191 -10.002 1.00 208.42 ? 418  ASN A C   1 
ATOM 3256 O O   . ASN A 1 421  ? -52.546 -13.223 -10.296 1.00 208.42 ? 418  ASN A O   1 
ATOM 3257 C CB  . ASN A 1 421  ? -55.446 -15.093 -10.155 1.00 124.00 ? 418  ASN A CB  1 
ATOM 3258 C CG  . ASN A 1 421  ? -56.719 -14.256 -10.388 1.00 124.00 ? 418  ASN A CG  1 
ATOM 3259 O OD1 . ASN A 1 421  ? -56.641 -13.023 -10.483 1.00 124.00 ? 418  ASN A OD1 1 
ATOM 3260 N ND2 . ASN A 1 421  ? -57.870 -14.915 -10.488 1.00 124.00 ? 418  ASN A ND2 1 
ATOM 3261 N N   . ARG A 1 422  ? -54.543 -12.153 -10.275 1.00 209.00 ? 419  ARG A N   1 
ATOM 3262 C CA  . ARG A 1 422  ? -54.086 -10.954 -10.997 1.00 209.00 ? 419  ARG A CA  1 
ATOM 3263 C C   . ARG A 1 422  ? -52.885 -10.275 -10.325 1.00 209.00 ? 419  ARG A C   1 
ATOM 3264 O O   . ARG A 1 422  ? -52.766 -10.283 -9.096  1.00 209.00 ? 419  ARG A O   1 
ATOM 3265 C CB  . ARG A 1 422  ? -55.242 -9.952  -11.208 1.00 134.92 ? 419  ARG A CB  1 
ATOM 3266 C CG  . ARG A 1 422  ? -56.302 -9.938  -10.096 1.00 134.92 ? 419  ARG A CG  1 
ATOM 3267 C CD  . ARG A 1 422  ? -57.076 -8.604  -9.975  1.00 134.92 ? 419  ARG A CD  1 
ATOM 3268 N NE  . ARG A 1 422  ? -58.193 -8.455  -10.927 1.00 134.92 ? 419  ARG A NE  1 
ATOM 3269 C CZ  . ARG A 1 422  ? -59.185 -7.562  -10.810 1.00 134.92 ? 419  ARG A CZ  1 
ATOM 3270 N NH1 . ARG A 1 422  ? -59.221 -6.724  -9.776  1.00 134.92 ? 419  ARG A NH1 1 
ATOM 3271 N NH2 . ARG A 1 422  ? -60.152 -7.503  -11.728 1.00 134.92 ? 419  ARG A NH2 1 
ATOM 3272 N N   . GLU A 1 423  ? -51.997 -9.703  -11.146 1.00 127.47 ? 420  GLU A N   1 
ATOM 3273 C CA  . GLU A 1 423  ? -50.822 -8.964  -10.663 1.00 127.47 ? 420  GLU A CA  1 
ATOM 3274 C C   . GLU A 1 423  ? -51.251 -7.667  -9.988  1.00 127.47 ? 420  GLU A C   1 
ATOM 3275 O O   . GLU A 1 423  ? -50.480 -7.061  -9.241  1.00 127.47 ? 420  GLU A O   1 
ATOM 3276 C CB  . GLU A 1 423  ? -49.863 -8.645  -11.817 1.00 125.82 ? 420  GLU A CB  1 
ATOM 3277 C CG  . GLU A 1 423  ? -49.623 -9.785  -12.813 1.00 125.82 ? 420  GLU A CG  1 
ATOM 3278 C CD  . GLU A 1 423  ? -48.947 -11.007 -12.200 1.00 125.82 ? 420  GLU A CD  1 
ATOM 3279 O OE1 . GLU A 1 423  ? -48.484 -10.924 -11.044 1.00 125.82 ? 420  GLU A OE1 1 
ATOM 3280 O OE2 . GLU A 1 423  ? -48.874 -12.054 -12.881 1.00 125.82 ? 420  GLU A OE2 1 
ATOM 3281 N N   . THR A 1 424  ? -52.496 -7.268  -10.252 1.00 148.25 ? 421  THR A N   1 
ATOM 3282 C CA  . THR A 1 424  ? -53.047 -5.992  -9.789  1.00 148.25 ? 421  THR A CA  1 
ATOM 3283 C C   . THR A 1 424  ? -53.559 -5.999  -8.336  1.00 148.25 ? 421  THR A C   1 
ATOM 3284 O O   . THR A 1 424  ? -54.094 -6.993  -7.841  1.00 148.25 ? 421  THR A O   1 
ATOM 3285 C CB  . THR A 1 424  ? -54.122 -5.402  -10.772 1.00 129.73 ? 421  THR A CB  1 
ATOM 3286 O OG1 . THR A 1 424  ? -55.428 -5.890  -10.448 1.00 129.73 ? 421  THR A OG1 1 
ATOM 3287 C CG2 . THR A 1 424  ? -53.785 -5.729  -12.234 1.00 129.73 ? 421  THR A CG2 1 
ATOM 3288 N N   . TYR A 1 425  ? -53.380 -4.855  -7.686  1.00 116.14 ? 422  TYR A N   1 
ATOM 3289 C CA  . TYR A 1 425  ? -53.673 -4.644  -6.285  1.00 116.14 ? 422  TYR A CA  1 
ATOM 3290 C C   . TYR A 1 425  ? -54.737 -3.566  -6.250  1.00 116.14 ? 422  TYR A C   1 
ATOM 3291 O O   . TYR A 1 425  ? -54.502 -2.466  -6.736  1.00 116.14 ? 422  TYR A O   1 
ATOM 3292 C CB  . TYR A 1 425  ? -52.406 -4.141  -5.570  1.00 147.93 ? 422  TYR A CB  1 
ATOM 3293 C CG  . TYR A 1 425  ? -51.125 -4.841  -5.992  1.00 147.93 ? 422  TYR A CG  1 
ATOM 3294 C CD1 . TYR A 1 425  ? -50.489 -4.522  -7.191  1.00 147.93 ? 422  TYR A CD1 1 
ATOM 3295 C CD2 . TYR A 1 425  ? -50.542 -5.819  -5.195  1.00 147.93 ? 422  TYR A CD2 1 
ATOM 3296 C CE1 . TYR A 1 425  ? -49.318 -5.160  -7.587  1.00 147.93 ? 422  TYR A CE1 1 
ATOM 3297 C CE2 . TYR A 1 425  ? -49.370 -6.457  -5.580  1.00 147.93 ? 422  TYR A CE2 1 
ATOM 3298 C CZ  . TYR A 1 425  ? -48.770 -6.124  -6.779  1.00 147.93 ? 422  TYR A CZ  1 
ATOM 3299 O OH  . TYR A 1 425  ? -47.615 -6.750  -7.174  1.00 147.93 ? 422  TYR A OH  1 
ATOM 3300 N N   . ASP A 1 426  ? -55.911 -3.866  -5.705  1.00 133.06 ? 423  ASP A N   1 
ATOM 3301 C CA  . ASP A 1 426  ? -56.953 -2.839  -5.615  1.00 133.06 ? 423  ASP A CA  1 
ATOM 3302 C C   . ASP A 1 426  ? -57.063 -2.247  -4.205  1.00 133.06 ? 423  ASP A C   1 
ATOM 3303 O O   . ASP A 1 426  ? -58.103 -1.693  -3.832  1.00 133.06 ? 423  ASP A O   1 
ATOM 3304 C CB  . ASP A 1 426  ? -58.308 -3.358  -6.126  1.00 116.86 ? 423  ASP A CB  1 
ATOM 3305 C CG  . ASP A 1 426  ? -58.875 -4.485  -5.264  1.00 116.86 ? 423  ASP A CG  1 
ATOM 3306 O OD1 . ASP A 1 426  ? -58.311 -4.752  -4.179  1.00 116.86 ? 423  ASP A OD1 1 
ATOM 3307 O OD2 . ASP A 1 426  ? -59.883 -5.106  -5.670  1.00 116.86 ? 423  ASP A OD2 1 
ATOM 3308 N N   . THR A 1 427  ? -55.988 -2.365  -3.427  1.00 94.09  ? 424  THR A N   1 
ATOM 3309 C CA  . THR A 1 427  ? -55.946 -1.783  -2.088  1.00 94.09  ? 424  THR A CA  1 
ATOM 3310 C C   . THR A 1 427  ? -54.550 -1.310  -1.713  1.00 94.09  ? 424  THR A C   1 
ATOM 3311 O O   . THR A 1 427  ? -53.552 -1.903  -2.123  1.00 94.09  ? 424  THR A O   1 
ATOM 3312 C CB  . THR A 1 427  ? -56.439 -2.780  -1.030  1.00 134.94 ? 424  THR A CB  1 
ATOM 3313 O OG1 . THR A 1 427  ? -57.686 -3.340  -1.456  1.00 134.94 ? 424  THR A OG1 1 
ATOM 3314 C CG2 . THR A 1 427  ? -56.632 -2.090  0.318   1.00 134.94 ? 424  THR A CG2 1 
ATOM 3315 N N   . LEU A 1 428  ? -54.479 -0.231  -0.941  1.00 169.63 ? 425  LEU A N   1 
ATOM 3316 C CA  . LEU A 1 428  ? -53.207 0.211   -0.390  1.00 169.63 ? 425  LEU A CA  1 
ATOM 3317 C C   . LEU A 1 428  ? -53.324 0.510   1.090   1.00 169.63 ? 425  LEU A C   1 
ATOM 3318 O O   . LEU A 1 428  ? -53.938 1.502   1.491   1.00 169.63 ? 425  LEU A O   1 
ATOM 3319 C CB  . LEU A 1 428  ? -52.662 1.431   -1.135  1.00 165.84 ? 425  LEU A CB  1 
ATOM 3320 C CG  . LEU A 1 428  ? -51.211 1.770   -0.784  1.00 165.84 ? 425  LEU A CG  1 
ATOM 3321 C CD1 . LEU A 1 428  ? -50.254 0.842   -1.523  1.00 165.84 ? 425  LEU A CD1 1 
ATOM 3322 C CD2 . LEU A 1 428  ? -50.896 3.228   -1.086  1.00 165.84 ? 425  LEU A CD2 1 
ATOM 3323 N N   . VAL A 1 429  ? -52.734 -0.366  1.897   1.00 176.96 ? 426  VAL A N   1 
ATOM 3324 C CA  . VAL A 1 429  ? -52.679 -0.155  3.329   1.00 176.96 ? 426  VAL A CA  1 
ATOM 3325 C C   . VAL A 1 429  ? -51.447 0.674   3.642   1.00 176.96 ? 426  VAL A C   1 
ATOM 3326 O O   . VAL A 1 429  ? -50.329 0.379   3.209   1.00 176.96 ? 426  VAL A O   1 
ATOM 3327 C CB  . VAL A 1 429  ? -52.718 -1.472  4.137   1.00 182.74 ? 426  VAL A CB  1 
ATOM 3328 C CG1 . VAL A 1 429  ? -52.616 -1.193  5.627   1.00 182.74 ? 426  VAL A CG1 1 
ATOM 3329 C CG2 . VAL A 1 429  ? -54.004 -2.226  3.854   1.00 182.74 ? 426  VAL A CG2 1 
ATOM 3330 N N   . LEU A 1 430  ? -51.699 1.732   4.392   1.00 103.30 ? 427  LEU A N   1 
ATOM 3331 C CA  . LEU A 1 430  ? -50.724 2.753   4.676   1.00 103.30 ? 427  LEU A CA  1 
ATOM 3332 C C   . LEU A 1 430  ? -50.569 2.971   6.185   1.00 103.30 ? 427  LEU A C   1 
ATOM 3333 O O   . LEU A 1 430  ? -51.495 3.479   6.854   1.00 103.30 ? 427  LEU A O   1 
ATOM 3334 C CB  . LEU A 1 430  ? -51.167 4.056   3.997   1.00 115.05 ? 427  LEU A CB  1 
ATOM 3335 C CG  . LEU A 1 430  ? -52.606 4.549   4.217   1.00 115.05 ? 427  LEU A CG  1 
ATOM 3336 C CD1 . LEU A 1 430  ? -52.696 5.662   5.263   1.00 115.05 ? 427  LEU A CD1 1 
ATOM 3337 C CD2 . LEU A 1 430  ? -53.178 5.028   2.906   1.00 115.05 ? 427  LEU A CD2 1 
ATOM 3338 N N   . SER A 1 431  ? -49.414 2.594   6.731   1.00 105.57 ? 428  SER A N   1 
ATOM 3339 C CA  . SER A 1 431  ? -49.106 2.995   8.095   1.00 105.57 ? 428  SER A CA  1 
ATOM 3340 C C   . SER A 1 431  ? -49.404 4.491   8.227   1.00 105.57 ? 428  SER A C   1 
ATOM 3341 O O   . SER A 1 431  ? -49.181 5.263   7.287   1.00 105.57 ? 428  SER A O   1 
ATOM 3342 C CB  . SER A 1 431  ? -47.651 2.725   8.429   1.00 154.30 ? 428  SER A CB  1 
ATOM 3343 O OG  . SER A 1 431  ? -47.452 2.779   9.832   1.00 154.30 ? 428  SER A OG  1 
ATOM 3344 N N   . PHE A 1 432  ? -49.918 4.892   9.385   1.00 95.75  ? 429  PHE A N   1 
ATOM 3345 C CA  . PHE A 1 432  ? -50.353 6.273   9.601   1.00 95.75  ? 429  PHE A CA  1 
ATOM 3346 C C   . PHE A 1 432  ? -49.863 6.749   10.971  1.00 95.75  ? 429  PHE A C   1 
ATOM 3347 O O   . PHE A 1 432  ? -49.348 5.956   11.756  1.00 95.75  ? 429  PHE A O   1 
ATOM 3348 C CB  . PHE A 1 432  ? -51.886 6.321   9.537   1.00 133.78 ? 429  PHE A CB  1 
ATOM 3349 C CG  . PHE A 1 432  ? -52.458 7.633   9.058   1.00 133.78 ? 429  PHE A CG  1 
ATOM 3350 C CD1 . PHE A 1 432  ? -52.500 8.750   9.898   1.00 133.78 ? 429  PHE A CD1 1 
ATOM 3351 C CD2 . PHE A 1 432  ? -53.014 7.730   7.783   1.00 133.78 ? 429  PHE A CD2 1 
ATOM 3352 C CE1 . PHE A 1 432  ? -53.048 9.956   9.459   1.00 133.78 ? 429  PHE A CE1 1 
ATOM 3353 C CE2 . PHE A 1 432  ? -53.566 8.929   7.334   1.00 133.78 ? 429  PHE A CE2 1 
ATOM 3354 C CZ  . PHE A 1 432  ? -53.582 10.044  8.174   1.00 133.78 ? 429  PHE A CZ  1 
ATOM 3355 N N   . VAL A 1 433  ? -50.040 8.042   11.245  1.00 169.88 ? 430  VAL A N   1 
ATOM 3356 C CA  . VAL A 1 433  ? -49.737 8.656   12.554  1.00 169.88 ? 430  VAL A CA  1 
ATOM 3357 C C   . VAL A 1 433  ? -50.364 7.863   13.720  1.00 169.88 ? 430  VAL A C   1 
ATOM 3358 O O   . VAL A 1 433  ? -51.347 8.294   14.340  1.00 169.88 ? 430  VAL A O   1 
ATOM 3359 C CB  . VAL A 1 433  ? -50.194 10.161  12.615  1.00 142.15 ? 430  VAL A CB  1 
ATOM 3360 C CG1 . VAL A 1 433  ? -49.703 10.839  13.898  1.00 142.15 ? 430  VAL A CG1 1 
ATOM 3361 C CG2 . VAL A 1 433  ? -49.706 10.939  11.400  1.00 142.15 ? 430  VAL A CG2 1 
ATOM 3362 N N   . GLY A 1 434  ? -49.785 6.698   14.000  1.00 92.46  ? 431  GLY A N   1 
ATOM 3363 C CA  . GLY A 1 434  ? -50.261 5.831   15.069  1.00 92.46  ? 431  GLY A CA  1 
ATOM 3364 C C   . GLY A 1 434  ? -51.502 5.029   14.713  1.00 92.46  ? 431  GLY A C   1 
ATOM 3365 O O   . GLY A 1 434  ? -52.101 4.396   15.584  1.00 92.46  ? 431  GLY A O   1 
ATOM 3366 N N   . GLN A 1 435  ? -51.899 5.051   13.441  1.00 115.87 ? 432  GLN A N   1 
ATOM 3367 C CA  . GLN A 1 435  ? -53.092 4.330   12.988  1.00 115.87 ? 432  GLN A CA  1 
ATOM 3368 C C   . GLN A 1 435  ? -52.797 3.533   11.726  1.00 115.87 ? 432  GLN A C   1 
ATOM 3369 O O   . GLN A 1 435  ? -51.651 3.466   11.266  1.00 115.87 ? 432  GLN A O   1 
ATOM 3370 C CB  . GLN A 1 435  ? -54.259 5.301   12.723  1.00 122.74 ? 432  GLN A CB  1 
ATOM 3371 C CG  . GLN A 1 435  ? -55.067 5.716   13.965  1.00 122.74 ? 432  GLN A CG  1 
ATOM 3372 C CD  . GLN A 1 435  ? -56.331 6.534   13.637  1.00 122.74 ? 432  GLN A CD  1 
ATOM 3373 O OE1 . GLN A 1 435  ? -56.489 7.664   14.109  1.00 122.74 ? 432  GLN A OE1 1 
ATOM 3374 N NE2 . GLN A 1 435  ? -57.231 5.959   12.839  1.00 122.74 ? 432  GLN A NE2 1 
ATOM 3375 N N   . THR A 1 436  ? -53.844 2.924   11.179  1.00 204.91 ? 433  THR A N   1 
ATOM 3376 C CA  . THR A 1 436  ? -53.795 2.303   9.867   1.00 204.91 ? 433  THR A CA  1 
ATOM 3377 C C   . THR A 1 436  ? -55.156 2.488   9.205   1.00 204.91 ? 433  THR A C   1 
ATOM 3378 O O   . THR A 1 436  ? -56.191 2.119   9.769   1.00 204.91 ? 433  THR A O   1 
ATOM 3379 C CB  . THR A 1 436  ? -53.444 0.795   9.946   1.00 69.08  ? 433  THR A CB  1 
ATOM 3380 O OG1 . THR A 1 436  ? -52.237 0.613   10.693  1.00 69.08  ? 433  THR A OG1 1 
ATOM 3381 C CG2 . THR A 1 436  ? -53.276 0.195   8.567   1.00 69.08  ? 433  THR A CG2 1 
ATOM 3382 N N   . ARG A 1 437  ? -55.143 3.098   8.024   1.00 114.61 ? 434  ARG A N   1 
ATOM 3383 C CA  . ARG A 1 437  ? -56.331 3.186   7.178   1.00 114.61 ? 434  ARG A CA  1 
ATOM 3384 C C   . ARG A 1 437  ? -56.151 2.291   5.949   1.00 114.61 ? 434  ARG A C   1 
ATOM 3385 O O   . ARG A 1 437  ? -55.028 1.967   5.558   1.00 114.61 ? 434  ARG A O   1 
ATOM 3386 C CB  . ARG A 1 437  ? -56.628 4.643   6.798   1.00 167.81 ? 434  ARG A CB  1 
ATOM 3387 C CG  . ARG A 1 437  ? -57.255 5.456   7.933   1.00 167.81 ? 434  ARG A CG  1 
ATOM 3388 C CD  . ARG A 1 437  ? -58.781 5.495   7.826   1.00 167.81 ? 434  ARG A CD  1 
ATOM 3389 N NE  . ARG A 1 437  ? -59.463 4.996   9.024   1.00 167.81 ? 434  ARG A NE  1 
ATOM 3390 C CZ  . ARG A 1 437  ? -59.647 5.685   10.147  1.00 167.81 ? 434  ARG A CZ  1 
ATOM 3391 N NH1 . ARG A 1 437  ? -59.190 6.923   10.267  1.00 167.81 ? 434  ARG A NH1 1 
ATOM 3392 N NH2 . ARG A 1 437  ? -60.286 5.125   11.163  1.00 167.81 ? 434  ARG A NH2 1 
ATOM 3393 N N   . VAL A 1 438  ? -57.266 1.870   5.364   1.00 119.31 ? 435  VAL A N   1 
ATOM 3394 C CA  . VAL A 1 438  ? -57.252 0.919   4.259   1.00 119.31 ? 435  VAL A CA  1 
ATOM 3395 C C   . VAL A 1 438  ? -57.836 1.602   3.027   1.00 119.31 ? 435  VAL A C   1 
ATOM 3396 O O   . VAL A 1 438  ? -58.688 2.475   3.153   1.00 119.31 ? 435  VAL A O   1 
ATOM 3397 C CB  . VAL A 1 438  ? -58.088 -0.339  4.600   1.00 125.02 ? 435  VAL A CB  1 
ATOM 3398 C CG1 . VAL A 1 438  ? -57.790 -1.463  3.618   1.00 125.02 ? 435  VAL A CG1 1 
ATOM 3399 C CG2 . VAL A 1 438  ? -57.836 -0.803  6.038   1.00 125.02 ? 435  VAL A CG2 1 
ATOM 3400 N N   . LEU A 1 439  ? -57.383 1.218   1.839   1.00 209.00 ? 436  LEU A N   1 
ATOM 3401 C CA  . LEU A 1 439  ? -57.912 1.839   0.633   1.00 209.00 ? 436  LEU A CA  1 
ATOM 3402 C C   . LEU A 1 439  ? -58.287 0.856   -0.469  1.00 209.00 ? 436  LEU A C   1 
ATOM 3403 O O   . LEU A 1 439  ? -57.515 0.614   -1.396  1.00 209.00 ? 436  LEU A O   1 
ATOM 3404 C CB  . LEU A 1 439  ? -56.967 2.932   0.121   1.00 112.03 ? 436  LEU A CB  1 
ATOM 3405 C CG  . LEU A 1 439  ? -57.093 4.314   0.789   1.00 112.03 ? 436  LEU A CG  1 
ATOM 3406 C CD1 . LEU A 1 439  ? -55.909 5.218   0.441   1.00 112.03 ? 436  LEU A CD1 1 
ATOM 3407 C CD2 . LEU A 1 439  ? -58.407 5.015   0.433   1.00 112.03 ? 436  LEU A CD2 1 
ATOM 3408 N N   . MET A 1 440  ? -59.488 0.295   -0.348  1.00 135.38 ? 437  MET A N   1 
ATOM 3409 C CA  . MET A 1 440  ? -60.066 -0.527  -1.399  1.00 135.38 ? 437  MET A CA  1 
ATOM 3410 C C   . MET A 1 440  ? -60.345 0.400   -2.565  1.00 135.38 ? 437  MET A C   1 
ATOM 3411 O O   . MET A 1 440  ? -60.791 1.524   -2.378  1.00 135.38 ? 437  MET A O   1 
ATOM 3412 C CB  . MET A 1 440  ? -61.364 -1.192  -0.923  1.00 186.58 ? 437  MET A CB  1 
ATOM 3413 C CG  . MET A 1 440  ? -61.198 -2.196  0.226   1.00 186.58 ? 437  MET A CG  1 
ATOM 3414 S SD  . MET A 1 440  ? -61.224 -3.940  -0.254  1.00 186.58 ? 437  MET A SD  1 
ATOM 3415 C CE  . MET A 1 440  ? -62.973 -4.211  -0.531  1.00 186.58 ? 437  MET A CE  1 
ATOM 3416 N N   . LEU A 1 441  ? -60.057 -0.058  -3.770  1.00 208.61 ? 438  LEU A N   1 
ATOM 3417 C CA  . LEU A 1 441  ? -60.279 0.769   -4.933  1.00 208.61 ? 438  LEU A CA  1 
ATOM 3418 C C   . LEU A 1 441  ? -61.341 0.174   -5.821  1.00 208.61 ? 438  LEU A C   1 
ATOM 3419 O O   . LEU A 1 441  ? -61.301 -1.014  -6.143  1.00 208.61 ? 438  LEU A O   1 
ATOM 3420 C CB  . LEU A 1 441  ? -58.988 0.934   -5.720  1.00 73.24  ? 438  LEU A CB  1 
ATOM 3421 C CG  . LEU A 1 441  ? -58.006 2.022   -5.266  1.00 73.24  ? 438  LEU A CG  1 
ATOM 3422 C CD1 . LEU A 1 441  ? -56.540 1.625   -5.510  1.00 73.24  ? 438  LEU A CD1 1 
ATOM 3423 C CD2 . LEU A 1 441  ? -58.313 3.342   -5.960  1.00 73.24  ? 438  LEU A CD2 1 
ATOM 3424 N N   . ASN A 1 442  ? -62.302 1.007   -6.208  1.00 198.44 ? 439  ASN A N   1 
ATOM 3425 C CA  . ASN A 1 442  ? -63.227 0.662   -7.278  1.00 198.44 ? 439  ASN A CA  1 
ATOM 3426 C C   . ASN A 1 442  ? -62.471 0.680   -8.612  1.00 198.44 ? 439  ASN A C   1 
ATOM 3427 O O   . ASN A 1 442  ? -63.051 0.937   -9.667  1.00 198.44 ? 439  ASN A O   1 
ATOM 3428 C CB  . ASN A 1 442  ? -64.413 1.642   -7.309  1.00 156.27 ? 439  ASN A CB  1 
ATOM 3429 C CG  . ASN A 1 442  ? -65.519 1.276   -6.319  1.00 156.27 ? 439  ASN A CG  1 
ATOM 3430 O OD1 . ASN A 1 442  ? -65.951 2.108   -5.521  1.00 156.27 ? 439  ASN A OD1 1 
ATOM 3431 N ND2 . ASN A 1 442  ? -65.993 0.036   -6.384  1.00 156.27 ? 439  ASN A ND2 1 
ATOM 3432 N N   . GLY A 1 443  ? -61.169 0.397   -8.542  1.00 101.27 ? 440  GLY A N   1 
ATOM 3433 C CA  . GLY A 1 443  ? -60.289 0.402   -9.709  1.00 101.27 ? 440  GLY A CA  1 
ATOM 3434 C C   . GLY A 1 443  ? -59.431 1.652   -9.748  1.00 101.27 ? 440  GLY A C   1 
ATOM 3435 O O   . GLY A 1 443  ? -58.310 1.663   -9.237  1.00 101.27 ? 440  GLY A O   1 
ATOM 3436 N N   . GLU A 1 444  ? -59.977 2.704   -10.360 1.00 90.71  ? 441  GLU A N   1 
ATOM 3437 C CA  . GLU A 1 444  ? -59.331 4.026   -10.413 1.00 90.71  ? 441  GLU A CA  1 
ATOM 3438 C C   . GLU A 1 444  ? -59.957 5.007   -9.416  1.00 90.71  ? 441  GLU A C   1 
ATOM 3439 O O   . GLU A 1 444  ? -59.542 6.168   -9.328  1.00 90.71  ? 441  GLU A O   1 
ATOM 3440 C CB  . GLU A 1 444  ? -59.356 4.598   -11.842 1.00 209.00 ? 441  GLU A CB  1 
ATOM 3441 C CG  . GLU A 1 444  ? -60.700 4.495   -12.576 1.00 209.00 ? 441  GLU A CG  1 
ATOM 3442 C CD  . GLU A 1 444  ? -61.584 5.729   -12.420 1.00 209.00 ? 441  GLU A CD  1 
ATOM 3443 O OE1 . GLU A 1 444  ? -62.697 5.732   -12.986 1.00 209.00 ? 441  GLU A OE1 1 
ATOM 3444 O OE2 . GLU A 1 444  ? -61.172 6.698   -11.748 1.00 209.00 ? 441  GLU A OE2 1 
ATOM 3445 N N   . GLU A 1 445  ? -60.941 4.522   -8.659  1.00 158.95 ? 442  GLU A N   1 
ATOM 3446 C CA  . GLU A 1 445  ? -61.656 5.337   -7.678  1.00 158.95 ? 442  GLU A CA  1 
ATOM 3447 C C   . GLU A 1 445  ? -61.132 5.110   -6.263  1.00 158.95 ? 442  GLU A C   1 
ATOM 3448 O O   . GLU A 1 445  ? -60.937 3.970   -5.836  1.00 158.95 ? 442  GLU A O   1 
ATOM 3449 C CB  . GLU A 1 445  ? -63.160 5.050   -7.727  1.00 122.36 ? 442  GLU A CB  1 
ATOM 3450 C CG  . GLU A 1 445  ? -64.036 6.165   -7.168  1.00 122.36 ? 442  GLU A CG  1 
ATOM 3451 C CD  . GLU A 1 445  ? -65.253 5.633   -6.430  1.00 122.36 ? 442  GLU A CD  1 
ATOM 3452 O OE1 . GLU A 1 445  ? -65.077 4.995   -5.369  1.00 122.36 ? 442  GLU A OE1 1 
ATOM 3453 O OE2 . GLU A 1 445  ? -66.386 5.861   -6.900  1.00 122.36 ? 442  GLU A OE2 1 
ATOM 3454 N N   . VAL A 1 446  ? -60.925 6.214   -5.547  1.00 188.84 ? 443  VAL A N   1 
ATOM 3455 C CA  . VAL A 1 446  ? -60.390 6.205   -4.184  1.00 188.84 ? 443  VAL A CA  1 
ATOM 3456 C C   . VAL A 1 446  ? -61.502 6.023   -3.151  1.00 188.84 ? 443  VAL A C   1 
ATOM 3457 O O   . VAL A 1 446  ? -62.495 6.760   -3.151  1.00 188.84 ? 443  VAL A O   1 
ATOM 3458 C CB  . VAL A 1 446  ? -59.623 7.509   -3.879  1.00 112.25 ? 443  VAL A CB  1 
ATOM 3459 C CG1 . VAL A 1 446  ? -59.119 7.522   -2.431  1.00 112.25 ? 443  VAL A CG1 1 
ATOM 3460 C CG2 . VAL A 1 446  ? -58.466 7.704   -4.873  1.00 112.25 ? 443  VAL A CG2 1 
ATOM 3461 N N   . GLU A 1 447  ? -61.310 5.050   -2.264  1.00 207.84 ? 444  GLU A N   1 
ATOM 3462 C CA  . GLU A 1 447  ? -62.339 4.636   -1.318  1.00 207.84 ? 444  GLU A CA  1 
ATOM 3463 C C   . GLU A 1 447  ? -61.715 3.930   -0.114  1.00 207.84 ? 444  GLU A C   1 
ATOM 3464 O O   . GLU A 1 447  ? -60.925 2.994   -0.273  1.00 207.84 ? 444  GLU A O   1 
ATOM 3465 C CB  . GLU A 1 447  ? -63.323 3.704   -2.028  1.00 125.41 ? 444  GLU A CB  1 
ATOM 3466 C CG  . GLU A 1 447  ? -64.537 3.273   -1.220  1.00 125.41 ? 444  GLU A CG  1 
ATOM 3467 C CD  . GLU A 1 447  ? -65.117 1.947   -1.707  1.00 125.41 ? 444  GLU A CD  1 
ATOM 3468 O OE1 . GLU A 1 447  ? -64.373 0.934   -1.718  1.00 125.41 ? 444  GLU A OE1 1 
ATOM 3469 O OE2 . GLU A 1 447  ? -66.316 1.922   -2.073  1.00 125.41 ? 444  GLU A OE2 1 
ATOM 3470 N N   . GLU A 1 448  ? -62.073 4.377   1.088   1.00 129.21 ? 445  GLU A N   1 
ATOM 3471 C CA  . GLU A 1 448  ? -61.503 3.811   2.311   1.00 129.21 ? 445  GLU A CA  1 
ATOM 3472 C C   . GLU A 1 448  ? -62.507 3.035   3.165   1.00 129.21 ? 445  GLU A C   1 
ATOM 3473 O O   . GLU A 1 448  ? -63.502 3.586   3.655   1.00 129.21 ? 445  GLU A O   1 
ATOM 3474 C CB  . GLU A 1 448  ? -60.776 4.878   3.136   1.00 198.38 ? 445  GLU A CB  1 
ATOM 3475 C CG  . GLU A 1 448  ? -61.654 5.952   3.733   1.00 198.38 ? 445  GLU A CG  1 
ATOM 3476 C CD  . GLU A 1 448  ? -61.156 6.378   5.091   1.00 198.38 ? 445  GLU A CD  1 
ATOM 3477 O OE1 . GLU A 1 448  ? -61.920 6.248   6.069   1.00 198.38 ? 445  GLU A OE1 1 
ATOM 3478 O OE2 . GLU A 1 448  ? -59.993 6.820   5.183   1.00 198.38 ? 445  GLU A OE2 1 
ATOM 3479 N N   . THR A 1 449  ? -62.233 1.742   3.329   1.00 192.43 ? 446  THR A N   1 
ATOM 3480 C CA  . THR A 1 449  ? -63.088 0.865   4.123   1.00 192.43 ? 446  THR A CA  1 
ATOM 3481 C C   . THR A 1 449  ? -62.299 0.093   5.181   1.00 192.43 ? 446  THR A C   1 
ATOM 3482 O O   . THR A 1 449  ? -61.194 0.479   5.565   1.00 192.43 ? 446  THR A O   1 
ATOM 3483 C CB  . THR A 1 449  ? -63.925 -0.133  3.242   1.00 88.09  ? 446  THR A CB  1 
ATOM 3484 O OG1 . THR A 1 449  ? -63.091 -1.193  2.743   1.00 88.09  ? 446  THR A OG1 1 
ATOM 3485 C CG2 . THR A 1 449  ? -64.639 0.586   2.082   1.00 88.09  ? 446  THR A CG2 1 
ATOM 3486 N N   . GLU A 1 450  ? -62.904 -1.002  5.633   1.00 101.36 ? 447  GLU A N   1 
ATOM 3487 C CA  . GLU A 1 450  ? -62.389 -1.865  6.686   1.00 101.36 ? 447  GLU A CA  1 
ATOM 3488 C C   . GLU A 1 450  ? -61.729 -3.114  6.096   1.00 101.36 ? 447  GLU A C   1 
ATOM 3489 O O   . GLU A 1 450  ? -61.737 -3.304  4.874   1.00 101.36 ? 447  GLU A O   1 
ATOM 3490 C CB  . GLU A 1 450  ? -63.544 -2.272  7.612   1.00 168.82 ? 447  GLU A CB  1 
ATOM 3491 C CG  . GLU A 1 450  ? -64.909 -2.354  6.903   1.00 168.82 ? 447  GLU A CG  1 
ATOM 3492 C CD  . GLU A 1 450  ? -65.868 -3.370  7.513   1.00 168.82 ? 447  GLU A CD  1 
ATOM 3493 O OE1 . GLU A 1 450  ? -67.096 -3.206  7.340   1.00 168.82 ? 447  GLU A OE1 1 
ATOM 3494 O OE2 . GLU A 1 450  ? -65.403 -4.338  8.151   1.00 168.82 ? 447  GLU A OE2 1 
ATOM 3495 N N   . LEU A 1 451  ? -61.143 -3.945  6.965   1.00 203.69 ? 448  LEU A N   1 
ATOM 3496 C CA  . LEU A 1 451  ? -60.677 -5.289  6.591   1.00 203.69 ? 448  LEU A CA  1 
ATOM 3497 C C   . LEU A 1 451  ? -60.440 -6.207  7.795   1.00 203.69 ? 448  LEU A C   1 
ATOM 3498 O O   . LEU A 1 451  ? -60.195 -5.741  8.911   1.00 203.69 ? 448  LEU A O   1 
ATOM 3499 C CB  . LEU A 1 451  ? -59.420 -5.229  5.721   1.00 96.59  ? 448  LEU A CB  1 
ATOM 3500 C CG  . LEU A 1 451  ? -59.473 -6.189  4.532   1.00 96.59  ? 448  LEU A CG  1 
ATOM 3501 C CD1 . LEU A 1 451  ? -60.160 -5.546  3.322   1.00 96.59  ? 448  LEU A CD1 1 
ATOM 3502 C CD2 . LEU A 1 451  ? -58.092 -6.658  4.164   1.00 96.59  ? 448  LEU A CD2 1 
ATOM 3503 N N   . MET A 1 452  ? -60.513 -7.514  7.540   1.00 196.50 ? 449  MET A N   1 
ATOM 3504 C CA  . MET A 1 452  ? -60.397 -8.555  8.567   1.00 196.50 ? 449  MET A CA  1 
ATOM 3505 C C   . MET A 1 452  ? -58.974 -8.638  9.107   1.00 196.50 ? 449  MET A C   1 
ATOM 3506 O O   . MET A 1 452  ? -58.020 -8.379  8.374   1.00 196.50 ? 449  MET A O   1 
ATOM 3507 C CB  . MET A 1 452  ? -60.793 -9.921  7.992   1.00 157.54 ? 449  MET A CB  1 
ATOM 3508 C CG  . MET A 1 452  ? -61.731 -9.872  6.788   1.00 157.54 ? 449  MET A CG  1 
ATOM 3509 S SD  . MET A 1 452  ? -63.489 -9.749  7.171   1.00 157.54 ? 449  MET A SD  1 
ATOM 3510 C CE  . MET A 1 452  ? -64.227 -10.225 5.601   1.00 157.54 ? 449  MET A CE  1 
ATOM 3511 N N   . GLY A 1 453  ? -58.844 -8.992  10.385  1.00 199.08 ? 450  GLY A N   1 
ATOM 3512 C CA  . GLY A 1 453  ? -57.545 -9.196  11.043  1.00 199.08 ? 450  GLY A CA  1 
ATOM 3513 C C   . GLY A 1 453  ? -56.479 -8.140  10.792  1.00 199.08 ? 450  GLY A C   1 
ATOM 3514 O O   . GLY A 1 453  ? -55.281 -8.415  10.901  1.00 199.08 ? 450  GLY A O   1 
ATOM 3515 N N   . PHE A 1 454  ? -56.926 -6.933  10.459  1.00 153.94 ? 451  PHE A N   1 
ATOM 3516 C CA  . PHE A 1 454  ? -56.060 -5.810  10.137  1.00 153.94 ? 451  PHE A CA  1 
ATOM 3517 C C   . PHE A 1 454  ? -56.559 -4.619  10.939  1.00 153.94 ? 451  PHE A C   1 
ATOM 3518 O O   . PHE A 1 454  ? -57.651 -4.115  10.683  1.00 153.94 ? 451  PHE A O   1 
ATOM 3519 C CB  . PHE A 1 454  ? -56.134 -5.508  8.635   1.00 151.19 ? 451  PHE A CB  1 
ATOM 3520 C CG  . PHE A 1 454  ? -55.187 -6.323  7.784   1.00 151.19 ? 451  PHE A CG  1 
ATOM 3521 C CD1 . PHE A 1 454  ? -54.897 -7.650  8.081   1.00 151.19 ? 451  PHE A CD1 1 
ATOM 3522 C CD2 . PHE A 1 454  ? -54.603 -5.759  6.654   1.00 151.19 ? 451  PHE A CD2 1 
ATOM 3523 C CE1 . PHE A 1 454  ? -54.026 -8.392  7.285   1.00 151.19 ? 451  PHE A CE1 1 
ATOM 3524 C CE2 . PHE A 1 454  ? -53.731 -6.497  5.848   1.00 151.19 ? 451  PHE A CE2 1 
ATOM 3525 C CZ  . PHE A 1 454  ? -53.444 -7.815  6.165   1.00 151.19 ? 451  PHE A CZ  1 
ATOM 3526 N N   . VAL A 1 455  ? -55.772 -4.176  11.915  1.00 94.00  ? 452  VAL A N   1 
ATOM 3527 C CA  . VAL A 1 455  ? -56.251 -3.184  12.900  1.00 94.00  ? 452  VAL A CA  1 
ATOM 3528 C C   . VAL A 1 455  ? -56.340 -1.752  12.379  1.00 94.00  ? 452  VAL A C   1 
ATOM 3529 O O   . VAL A 1 455  ? -55.487 -1.306  11.632  1.00 94.00  ? 452  VAL A O   1 
ATOM 3530 C CB  . VAL A 1 455  ? -55.456 -3.213  14.241  1.00 99.44  ? 452  VAL A CB  1 
ATOM 3531 C CG1 . VAL A 1 455  ? -56.320 -3.772  15.365  1.00 99.44  ? 452  VAL A CG1 1 
ATOM 3532 C CG2 . VAL A 1 455  ? -54.140 -3.987  14.103  1.00 99.44  ? 452  VAL A CG2 1 
ATOM 3533 N N   . ASP A 1 456  ? -57.391 -1.057  12.802  1.00 89.14  ? 453  ASP A N   1 
ATOM 3534 C CA  . ASP A 1 456  ? -57.691 0.322   12.398  1.00 89.14  ? 453  ASP A CA  1 
ATOM 3535 C C   . ASP A 1 456  ? -57.277 1.373   13.445  1.00 89.14  ? 453  ASP A C   1 
ATOM 3536 O O   . ASP A 1 456  ? -57.059 2.539   13.099  1.00 89.14  ? 453  ASP A O   1 
ATOM 3537 C CB  . ASP A 1 456  ? -59.185 0.471   12.058  1.00 196.90 ? 453  ASP A CB  1 
ATOM 3538 C CG  . ASP A 1 456  ? -60.096 0.233   13.259  1.00 196.90 ? 453  ASP A CG  1 
ATOM 3539 O OD1 . ASP A 1 456  ? -60.275 1.165   14.071  1.00 196.90 ? 453  ASP A OD1 1 
ATOM 3540 O OD2 . ASP A 1 456  ? -60.653 -0.879  13.379  1.00 196.90 ? 453  ASP A OD2 1 
ATOM 3541 N N   . ASP A 1 457  ? -57.188 0.966   14.715  1.00 191.87 ? 454  ASP A N   1 
ATOM 3542 C CA  . ASP A 1 457  ? -56.730 1.858   15.788  1.00 191.87 ? 454  ASP A CA  1 
ATOM 3543 C C   . ASP A 1 457  ? -55.307 1.513   16.238  1.00 191.87 ? 454  ASP A C   1 
ATOM 3544 O O   . ASP A 1 457  ? -54.897 1.840   17.352  1.00 191.87 ? 454  ASP A O   1 
ATOM 3545 C CB  . ASP A 1 457  ? -57.708 1.852   16.974  1.00 168.61 ? 454  ASP A CB  1 
ATOM 3546 C CG  . ASP A 1 457  ? -57.542 0.639   17.878  1.00 168.61 ? 454  ASP A CG  1 
ATOM 3547 O OD1 . ASP A 1 457  ? -57.531 0.826   19.111  1.00 168.61 ? 454  ASP A OD1 1 
ATOM 3548 O OD2 . ASP A 1 457  ? -57.414 -0.494  17.362  1.00 168.61 ? 454  ASP A OD2 1 
ATOM 3549 N N   . GLN A 1 458  ? -54.564 0.854   15.356  1.00 185.61 ? 455  GLN A N   1 
ATOM 3550 C CA  . GLN A 1 458  ? -53.193 0.455   15.633  1.00 185.61 ? 455  GLN A CA  1 
ATOM 3551 C C   . GLN A 1 458  ? -52.309 0.667   14.406  1.00 185.61 ? 455  GLN A C   1 
ATOM 3552 O O   . GLN A 1 458  ? -52.609 0.176   13.317  1.00 185.61 ? 455  GLN A O   1 
ATOM 3553 C CB  . GLN A 1 458  ? -53.150 -1.009  16.076  1.00 129.71 ? 455  GLN A CB  1 
ATOM 3554 C CG  . GLN A 1 458  ? -53.370 -1.237  17.568  1.00 129.71 ? 455  GLN A CG  1 
ATOM 3555 C CD  . GLN A 1 458  ? -52.114 -1.720  18.284  1.00 129.71 ? 455  GLN A CD  1 
ATOM 3556 O OE1 . GLN A 1 458  ? -51.467 -2.684  17.850  1.00 129.71 ? 455  GLN A OE1 1 
ATOM 3557 N NE2 . GLN A 1 458  ? -51.770 -1.060  19.392  1.00 129.71 ? 455  GLN A NE2 1 
ATOM 3558 N N   . GLN A 1 459  ? -51.227 1.415   14.601  1.00 131.53 ? 456  GLN A N   1 
ATOM 3559 C CA  . GLN A 1 459  ? -50.219 1.661   13.575  1.00 131.53 ? 456  GLN A CA  1 
ATOM 3560 C C   . GLN A 1 459  ? -49.678 0.383   12.945  1.00 131.53 ? 456  GLN A C   1 
ATOM 3561 O O   . GLN A 1 459  ? -49.393 -0.580  13.643  1.00 131.53 ? 456  GLN A O   1 
ATOM 3562 C CB  . GLN A 1 459  ? -49.071 2.441   14.196  1.00 122.63 ? 456  GLN A CB  1 
ATOM 3563 C CG  . GLN A 1 459  ? -47.834 2.526   13.339  1.00 122.63 ? 456  GLN A CG  1 
ATOM 3564 C CD  . GLN A 1 459  ? -46.982 3.732   13.674  1.00 122.63 ? 456  GLN A CD  1 
ATOM 3565 O OE1 . GLN A 1 459  ? -46.261 4.239   12.819  1.00 122.63 ? 456  GLN A OE1 1 
ATOM 3566 N NE2 . GLN A 1 459  ? -47.063 4.209   14.919  1.00 122.63 ? 456  GLN A NE2 1 
ATOM 3567 N N   . THR A 1 460  ? -49.525 0.387   11.625  1.00 116.14 ? 457  THR A N   1 
ATOM 3568 C CA  . THR A 1 460  ? -49.054 -0.796  10.907  1.00 116.14 ? 457  THR A CA  1 
ATOM 3569 C C   . THR A 1 460  ? -47.623 -0.605  10.392  1.00 116.14 ? 457  THR A C   1 
ATOM 3570 O O   . THR A 1 460  ? -47.351 0.279   9.585   1.00 116.14 ? 457  THR A O   1 
ATOM 3571 C CB  . THR A 1 460  ? -50.019 -1.180  9.763   1.00 90.15  ? 457  THR A CB  1 
ATOM 3572 O OG1 . THR A 1 460  ? -51.282 -1.560  10.320  1.00 90.15  ? 457  THR A OG1 1 
ATOM 3573 C CG2 . THR A 1 460  ? -49.479 -2.325  8.970   1.00 90.15  ? 457  THR A CG2 1 
ATOM 3574 N N   . PHE A 1 461  ? -46.717 -1.454  10.868  1.00 85.18  ? 458  PHE A N   1 
ATOM 3575 C CA  . PHE A 1 461  ? -45.289 -1.344  10.550  1.00 85.18  ? 458  PHE A CA  1 
ATOM 3576 C C   . PHE A 1 461  ? -44.929 -2.107  9.298   1.00 85.18  ? 458  PHE A C   1 
ATOM 3577 O O   . PHE A 1 461  ? -43.762 -2.139  8.885   1.00 85.18  ? 458  PHE A O   1 
ATOM 3578 C CB  . PHE A 1 461  ? -44.419 -1.849  11.712  1.00 168.44 ? 458  PHE A CB  1 
ATOM 3579 C CG  . PHE A 1 461  ? -44.322 -0.891  12.867  1.00 168.44 ? 458  PHE A CG  1 
ATOM 3580 C CD1 . PHE A 1 461  ? -44.408 0.487   12.669  1.00 168.44 ? 458  PHE A CD1 1 
ATOM 3581 C CD2 . PHE A 1 461  ? -44.111 -1.366  14.155  1.00 168.44 ? 458  PHE A CD2 1 
ATOM 3582 C CE1 . PHE A 1 461  ? -44.312 1.369   13.737  1.00 168.44 ? 458  PHE A CE1 1 
ATOM 3583 C CE2 . PHE A 1 461  ? -44.010 -0.489  15.230  1.00 168.44 ? 458  PHE A CE2 1 
ATOM 3584 C CZ  . PHE A 1 461  ? -44.111 0.880   15.021  1.00 168.44 ? 458  PHE A CZ  1 
ATOM 3585 N N   . PHE A 1 462  ? -45.937 -2.733  8.699   1.00 61.04  ? 459  PHE A N   1 
ATOM 3586 C CA  . PHE A 1 462  ? -45.707 -3.624  7.556   1.00 61.04  ? 459  PHE A CA  1 
ATOM 3587 C C   . PHE A 1 462  ? -46.973 -4.233  6.973   1.00 61.04  ? 459  PHE A C   1 
ATOM 3588 O O   . PHE A 1 462  ? -48.006 -4.222  7.629   1.00 61.04  ? 459  PHE A O   1 
ATOM 3589 C CB  . PHE A 1 462  ? -44.718 -4.733  7.916   1.00 82.59  ? 459  PHE A CB  1 
ATOM 3590 C CG  . PHE A 1 462  ? -43.858 -5.122  6.790   1.00 82.59  ? 459  PHE A CG  1 
ATOM 3591 C CD1 . PHE A 1 462  ? -42.689 -4.417  6.536   1.00 82.59  ? 459  PHE A CD1 1 
ATOM 3592 C CD2 . PHE A 1 462  ? -44.227 -6.171  5.953   1.00 82.59  ? 459  PHE A CD2 1 
ATOM 3593 C CE1 . PHE A 1 462  ? -41.866 -4.776  5.463   1.00 82.59  ? 459  PHE A CE1 1 
ATOM 3594 C CE2 . PHE A 1 462  ? -43.433 -6.538  4.881   1.00 82.59  ? 459  PHE A CE2 1 
ATOM 3595 C CZ  . PHE A 1 462  ? -42.249 -5.846  4.626   1.00 82.59  ? 459  PHE A CZ  1 
ATOM 3596 N N   . CYS A 1 463  ? -46.848 -4.773  5.751   1.00 98.59  ? 460  CYS A N   1 
ATOM 3597 C CA  . CYS A 1 463  ? -47.946 -5.381  4.984   1.00 98.59  ? 460  CYS A CA  1 
ATOM 3598 C C   . CYS A 1 463  ? -47.492 -6.384  3.922   1.00 98.59  ? 460  CYS A C   1 
ATOM 3599 O O   . CYS A 1 463  ? -48.346 -6.922  3.231   1.00 98.59  ? 460  CYS A O   1 
ATOM 3600 C CB  . CYS A 1 463  ? -48.796 -4.306  4.285   1.00 121.76 ? 460  CYS A CB  1 
ATOM 3601 S SG  . CYS A 1 463  ? -50.248 -3.692  5.174   1.00 121.76 ? 460  CYS A SG  1 
ATOM 3602 N N   . GLY A 1 464  ? -46.174 -6.600  3.777   1.00 86.14  ? 461  GLY A N   1 
ATOM 3603 C CA  . GLY A 1 464  ? -45.566 -7.567  2.814   1.00 86.14  ? 461  GLY A CA  1 
ATOM 3604 C C   . GLY A 1 464  ? -46.446 -8.138  1.705   1.00 86.14  ? 461  GLY A C   1 
ATOM 3605 O O   . GLY A 1 464  ? -47.244 -7.409  1.104   1.00 86.14  ? 461  GLY A O   1 
ATOM 3606 N N   . ASN A 1 465  ? -46.284 -9.430  1.407   1.00 209.00 ? 462  ASN A N   1 
ATOM 3607 C CA  . ASN A 1 465  ? -47.186 -10.187 0.506   1.00 209.00 ? 462  ASN A CA  1 
ATOM 3608 C C   . ASN A 1 465  ? -46.975 -11.703 0.637   1.00 209.00 ? 462  ASN A C   1 
ATOM 3609 O O   . ASN A 1 465  ? -46.640 -12.390 -0.338  1.00 209.00 ? 462  ASN A O   1 
ATOM 3610 C CB  . ASN A 1 465  ? -47.078 -9.731  -0.969  1.00 201.13 ? 462  ASN A CB  1 
ATOM 3611 C CG  . ASN A 1 465  ? -48.301 -8.922  -1.444  1.00 201.13 ? 462  ASN A CG  1 
ATOM 3612 O OD1 . ASN A 1 465  ? -48.213 -8.142  -2.397  1.00 201.13 ? 462  ASN A OD1 1 
ATOM 3613 N ND2 . ASN A 1 465  ? -49.441 -9.116  -0.786  1.00 201.13 ? 462  ASN A ND2 1 
ATOM 3614 N N   . VAL A 1 466  ? -47.194 -12.204 1.852   1.00 113.94 ? 463  VAL A N   1 
ATOM 3615 C CA  . VAL A 1 466  ? -46.904 -13.598 2.221   1.00 113.94 ? 463  VAL A CA  1 
ATOM 3616 C C   . VAL A 1 466  ? -47.735 -14.639 1.449   1.00 113.94 ? 463  VAL A C   1 
ATOM 3617 O O   . VAL A 1 466  ? -48.964 -14.572 1.400   1.00 113.94 ? 463  VAL A O   1 
ATOM 3618 C CB  . VAL A 1 466  ? -46.986 -13.817 3.770   1.00 123.83 ? 463  VAL A CB  1 
ATOM 3619 C CG1 . VAL A 1 466  ? -45.846 -13.096 4.479   1.00 123.83 ? 463  VAL A CG1 1 
ATOM 3620 C CG2 . VAL A 1 466  ? -48.328 -13.363 4.330   1.00 123.83 ? 463  VAL A CG2 1 
ATOM 3621 N N   . ALA A 1 467  ? -47.028 -15.589 0.839   1.00 94.89  ? 464  ALA A N   1 
ATOM 3622 C CA  . ALA A 1 467  ? -47.617 -16.684 0.077   1.00 94.89  ? 464  ALA A CA  1 
ATOM 3623 C C   . ALA A 1 467  ? -48.510 -17.579 0.951   1.00 94.89  ? 464  ALA A C   1 
ATOM 3624 O O   . ALA A 1 467  ? -48.652 -17.329 2.152   1.00 94.89  ? 464  ALA A O   1 
ATOM 3625 C CB  . ALA A 1 467  ? -46.507 -17.508 -0.586  1.00 118.52 ? 464  ALA A CB  1 
ATOM 3626 N N   . HIS A 1 468  ? -49.105 -18.610 0.337   1.00 103.34 ? 465  HIS A N   1 
ATOM 3627 C CA  . HIS A 1 468  ? -50.012 -19.573 1.007   1.00 103.34 ? 465  HIS A CA  1 
ATOM 3628 C C   . HIS A 1 468  ? -51.416 -19.006 1.223   1.00 103.34 ? 465  HIS A C   1 
ATOM 3629 O O   . HIS A 1 468  ? -52.120 -19.371 2.172   1.00 103.34 ? 465  HIS A O   1 
ATOM 3630 C CB  . HIS A 1 468  ? -49.404 -20.140 2.307   1.00 135.81 ? 465  HIS A CB  1 
ATOM 3631 C CG  . HIS A 1 468  ? -48.238 -21.056 2.076   1.00 135.81 ? 465  HIS A CG  1 
ATOM 3632 N ND1 . HIS A 1 468  ? -47.116 -20.672 1.367   1.00 135.81 ? 465  HIS A ND1 1 
ATOM 3633 C CD2 . HIS A 1 468  ? -48.019 -22.335 2.461   1.00 135.81 ? 465  HIS A CD2 1 
ATOM 3634 C CE1 . HIS A 1 468  ? -46.259 -21.676 1.324   1.00 135.81 ? 465  HIS A CE1 1 
ATOM 3635 N NE2 . HIS A 1 468  ? -46.782 -22.697 1.981   1.00 135.81 ? 465  HIS A NE2 1 
ATOM 3636 N N   . GLN A 1 469  ? -51.803 -18.120 0.305   1.00 91.79  ? 466  GLN A N   1 
ATOM 3637 C CA  . GLN A 1 469  ? -53.109 -17.463 0.296   1.00 91.79  ? 466  GLN A CA  1 
ATOM 3638 C C   . GLN A 1 469  ? -53.414 -16.757 1.627   1.00 91.79  ? 466  GLN A C   1 
ATOM 3639 O O   . GLN A 1 469  ? -54.427 -17.042 2.276   1.00 91.79  ? 466  GLN A O   1 
ATOM 3640 C CB  . GLN A 1 469  ? -54.220 -18.466 -0.052  1.00 108.64 ? 466  GLN A CB  1 
ATOM 3641 C CG  . GLN A 1 469  ? -54.317 -18.887 -1.514  1.00 108.64 ? 466  GLN A CG  1 
ATOM 3642 C CD  . GLN A 1 469  ? -55.506 -19.823 -1.767  1.00 108.64 ? 466  GLN A CD  1 
ATOM 3643 O OE1 . GLN A 1 469  ? -56.365 -19.533 -2.604  1.00 108.64 ? 466  GLN A OE1 1 
ATOM 3644 N NE2 . GLN A 1 469  ? -55.563 -20.945 -1.037  1.00 108.64 ? 466  GLN A NE2 1 
ATOM 3645 N N   . GLN A 1 470  ? -52.534 -15.842 2.030   1.00 167.70 ? 467  GLN A N   1 
ATOM 3646 C CA  . GLN A 1 470  ? -52.712 -15.072 3.276   1.00 167.70 ? 467  GLN A CA  1 
ATOM 3647 C C   . GLN A 1 470  ? -52.123 -13.647 3.243   1.00 167.70 ? 467  GLN A C   1 
ATOM 3648 O O   . GLN A 1 470  ? -51.106 -13.402 2.589   1.00 167.70 ? 467  GLN A O   1 
ATOM 3649 C CB  . GLN A 1 470  ? -52.227 -15.869 4.512   1.00 114.30 ? 467  GLN A CB  1 
ATOM 3650 C CG  . GLN A 1 470  ? -51.014 -16.769 4.295   1.00 114.30 ? 467  GLN A CG  1 
ATOM 3651 C CD  . GLN A 1 470  ? -51.162 -18.108 4.976   1.00 114.30 ? 467  GLN A CD  1 
ATOM 3652 O OE1 . GLN A 1 470  ? -50.251 -18.577 5.650   1.00 114.30 ? 467  GLN A OE1 1 
ATOM 3653 N NE2 . GLN A 1 470  ? -52.321 -18.735 4.803   1.00 114.30 ? 467  GLN A NE2 1 
ATOM 3654 N N   . LEU A 1 471  ? -52.786 -12.716 3.937   1.00 171.29 ? 468  LEU A N   1 
ATOM 3655 C CA  . LEU A 1 471  ? -52.350 -11.312 4.024   1.00 171.29 ? 468  LEU A CA  1 
ATOM 3656 C C   . LEU A 1 471  ? -51.832 -10.953 5.427   1.00 171.29 ? 468  LEU A C   1 
ATOM 3657 O O   . LEU A 1 471  ? -52.505 -11.215 6.425   1.00 171.29 ? 468  LEU A O   1 
ATOM 3658 C CB  . LEU A 1 471  ? -53.489 -10.345 3.665   1.00 106.03 ? 468  LEU A CB  1 
ATOM 3659 C CG  . LEU A 1 471  ? -54.752 -10.688 2.863   1.00 106.03 ? 468  LEU A CG  1 
ATOM 3660 C CD1 . LEU A 1 471  ? -55.802 -9.576  3.004   1.00 106.03 ? 468  LEU A CD1 1 
ATOM 3661 C CD2 . LEU A 1 471  ? -54.458 -10.944 1.400   1.00 106.03 ? 468  LEU A CD2 1 
ATOM 3662 N N   . ILE A 1 472  ? -50.659 -10.327 5.490   1.00 125.79 ? 469  ILE A N   1 
ATOM 3663 C CA  . ILE A 1 472  ? -49.978 -10.017 6.757   1.00 125.79 ? 469  ILE A CA  1 
ATOM 3664 C C   . ILE A 1 472  ? -50.147 -8.562  7.188   1.00 125.79 ? 469  ILE A C   1 
ATOM 3665 O O   . ILE A 1 472  ? -50.165 -7.659  6.361   1.00 125.79 ? 469  ILE A O   1 
ATOM 3666 C CB  . ILE A 1 472  ? -48.456 -10.403 6.692   1.00 64.26  ? 469  ILE A CB  1 
ATOM 3667 C CG1 . ILE A 1 472  ? -47.796 -10.411 8.089   1.00 64.26  ? 469  ILE A CG1 1 
ATOM 3668 C CG2 . ILE A 1 472  ? -47.703 -9.560  5.647   1.00 64.26  ? 469  ILE A CG2 1 
ATOM 3669 C CD1 . ILE A 1 472  ? -47.160 -9.109  8.505   1.00 64.26  ? 469  ILE A CD1 1 
ATOM 3670 N N   . GLN A 1 473  ? -50.286 -8.351  8.491   1.00 92.58  ? 470  GLN A N   1 
ATOM 3671 C CA  . GLN A 1 473  ? -50.245 -7.010  9.068   1.00 92.58  ? 470  GLN A CA  1 
ATOM 3672 C C   . GLN A 1 473  ? -49.401 -6.970  10.348  1.00 92.58  ? 470  GLN A C   1 
ATOM 3673 O O   . GLN A 1 473  ? -49.920 -7.126  11.450  1.00 92.58  ? 470  GLN A O   1 
ATOM 3674 C CB  . GLN A 1 473  ? -51.649 -6.459  9.340   1.00 103.13 ? 470  GLN A CB  1 
ATOM 3675 C CG  . GLN A 1 473  ? -51.676 -4.953  9.605   1.00 103.13 ? 470  GLN A CG  1 
ATOM 3676 C CD  . GLN A 1 473  ? -52.871 -4.487  10.439  1.00 103.13 ? 470  GLN A CD  1 
ATOM 3677 O OE1 . GLN A 1 473  ? -53.389 -5.225  11.287  1.00 103.13 ? 470  GLN A OE1 1 
ATOM 3678 N NE2 . GLN A 1 473  ? -53.304 -3.245  10.209  1.00 103.13 ? 470  GLN A NE2 1 
ATOM 3679 N N   . ILE A 1 474  ? -48.095 -6.765  10.196  1.00 86.55  ? 471  ILE A N   1 
ATOM 3680 C CA  . ILE A 1 474  ? -47.252 -6.485  11.342  1.00 86.55  ? 471  ILE A CA  1 
ATOM 3681 C C   . ILE A 1 474  ? -47.654 -5.125  11.916  1.00 86.55  ? 471  ILE A C   1 
ATOM 3682 O O   . ILE A 1 474  ? -47.815 -4.137  11.183  1.00 86.55  ? 471  ILE A O   1 
ATOM 3683 C CB  . ILE A 1 474  ? -45.771 -6.493  10.994  1.00 56.85  ? 471  ILE A CB  1 
ATOM 3684 C CG1 . ILE A 1 474  ? -45.422 -7.759  10.200  1.00 56.85  ? 471  ILE A CG1 1 
ATOM 3685 C CG2 . ILE A 1 474  ? -44.971 -6.400  12.271  1.00 56.85  ? 471  ILE A CG2 1 
ATOM 3686 C CD1 . ILE A 1 474  ? -43.904 -8.026  9.919   1.00 56.85  ? 471  ILE A CD1 1 
ATOM 3687 N N   . THR A 1 475  ? -47.852 -5.092  13.225  1.00 80.88  ? 472  THR A N   1 
ATOM 3688 C CA  . THR A 1 475  ? -48.266 -3.866  13.889  1.00 80.88  ? 472  THR A CA  1 
ATOM 3689 C C   . THR A 1 475  ? -47.266 -3.639  15.024  1.00 80.88  ? 472  THR A C   1 
ATOM 3690 O O   . THR A 1 475  ? -46.263 -4.368  15.121  1.00 80.88  ? 472  THR A O   1 
ATOM 3691 C CB  . THR A 1 475  ? -49.809 -3.913  14.313  1.00 113.19 ? 472  THR A CB  1 
ATOM 3692 O OG1 . THR A 1 475  ? -50.276 -2.620  14.715  1.00 113.19 ? 472  THR A OG1 1 
ATOM 3693 C CG2 . THR A 1 475  ? -50.099 -4.922  15.418  1.00 113.19 ? 472  THR A CG2 1 
ATOM 3694 N N   . SER A 1 476  ? -47.513 -2.613  15.836  1.00 96.09  ? 473  SER A N   1 
ATOM 3695 C CA  . SER A 1 476  ? -46.746 -2.377  17.051  1.00 96.09  ? 473  SER A CA  1 
ATOM 3696 C C   . SER A 1 476  ? -46.775 -3.678  17.827  1.00 96.09  ? 473  SER A C   1 
ATOM 3697 O O   . SER A 1 476  ? -45.744 -4.326  18.025  1.00 96.09  ? 473  SER A O   1 
ATOM 3698 C CB  . SER A 1 476  ? -47.375 -1.266  17.904  1.00 112.09 ? 473  SER A CB  1 
ATOM 3699 O OG  . SER A 1 476  ? -47.604 -0.076  17.169  1.00 112.09 ? 473  SER A OG  1 
ATOM 3700 N N   . ALA A 1 477  ? -47.979 -4.074  18.218  1.00 125.84 ? 474  ALA A N   1 
ATOM 3701 C CA  . ALA A 1 477  ? -48.190 -5.272  19.001  1.00 125.84 ? 474  ALA A CA  1 
ATOM 3702 C C   . ALA A 1 477  ? -47.768 -6.558  18.283  1.00 125.84 ? 474  ALA A C   1 
ATOM 3703 O O   . ALA A 1 477  ? -46.653 -7.046  18.477  1.00 125.84 ? 474  ALA A O   1 
ATOM 3704 C CB  . ALA A 1 477  ? -49.639 -5.351  19.430  1.00 49.47  ? 474  ALA A CB  1 
ATOM 3705 N N   . SER A 1 478  ? -48.651 -7.076  17.436  1.00 91.74  ? 475  SER A N   1 
ATOM 3706 C CA  . SER A 1 478  ? -48.608 -8.483  17.069  1.00 91.74  ? 475  SER A CA  1 
ATOM 3707 C C   . SER A 1 478  ? -48.592 -8.711  15.582  1.00 91.74  ? 475  SER A C   1 
ATOM 3708 O O   . SER A 1 478  ? -49.471 -8.202  14.889  1.00 91.74  ? 475  SER A O   1 
ATOM 3709 C CB  . SER A 1 478  ? -49.849 -9.170  17.643  1.00 160.99 ? 475  SER A CB  1 
ATOM 3710 O OG  . SER A 1 478  ? -51.041 -8.560  17.168  1.00 160.99 ? 475  SER A OG  1 
ATOM 3711 N N   . VAL A 1 479  ? -47.624 -9.493  15.098  1.00 88.97  ? 476  VAL A N   1 
ATOM 3712 C CA  . VAL A 1 479  ? -47.632 -9.958  13.693  1.00 88.97  ? 476  VAL A CA  1 
ATOM 3713 C C   . VAL A 1 479  ? -48.894 -10.800 13.386  1.00 88.97  ? 476  VAL A C   1 
ATOM 3714 O O   . VAL A 1 479  ? -48.961 -11.989 13.728  1.00 88.97  ? 476  VAL A O   1 
ATOM 3715 C CB  . VAL A 1 479  ? -46.261 -10.621 13.266  1.00 95.86  ? 476  VAL A CB  1 
ATOM 3716 C CG1 . VAL A 1 479  ? -45.368 -10.828 14.458  1.00 95.86  ? 476  VAL A CG1 1 
ATOM 3717 C CG2 . VAL A 1 479  ? -46.434 -11.928 12.461  1.00 95.86  ? 476  VAL A CG2 1 
ATOM 3718 N N   . ARG A 1 480  ? -49.890 -10.151 12.762  1.00 93.86  ? 477  ARG A N   1 
ATOM 3719 C CA  . ARG A 1 480  ? -51.241 -10.724 12.538  1.00 93.86  ? 477  ARG A CA  1 
ATOM 3720 C C   . ARG A 1 480  ? -51.286 -11.661 11.332  1.00 93.86  ? 477  ARG A C   1 
ATOM 3721 O O   . ARG A 1 480  ? -50.260 -11.889 10.697  1.00 93.86  ? 477  ARG A O   1 
ATOM 3722 C CB  . ARG A 1 480  ? -52.305 -9.622  12.405  1.00 170.80 ? 477  ARG A CB  1 
ATOM 3723 C CG  . ARG A 1 480  ? -52.447 -8.728  13.630  1.00 170.80 ? 477  ARG A CG  1 
ATOM 3724 C CD  . ARG A 1 480  ? -53.637 -7.785  13.514  1.00 170.80 ? 477  ARG A CD  1 
ATOM 3725 N NE  . ARG A 1 480  ? -54.884 -8.426  13.932  1.00 170.80 ? 477  ARG A NE  1 
ATOM 3726 C CZ  . ARG A 1 480  ? -56.073 -7.823  13.999  1.00 170.80 ? 477  ARG A CZ  1 
ATOM 3727 N NH1 . ARG A 1 480  ? -56.205 -6.549  13.661  1.00 170.80 ? 477  ARG A NH1 1 
ATOM 3728 N NH2 . ARG A 1 480  ? -57.140 -8.505  14.396  1.00 170.80 ? 477  ARG A NH2 1 
ATOM 3729 N N   . LEU A 1 481  ? -52.462 -12.230 11.048  1.00 124.49 ? 478  LEU A N   1 
ATOM 3730 C CA  . LEU A 1 481  ? -52.653 -13.110 9.877   1.00 124.49 ? 478  LEU A CA  1 
ATOM 3731 C C   . LEU A 1 481  ? -54.104 -13.103 9.368   1.00 124.49 ? 478  LEU A C   1 
ATOM 3732 O O   . LEU A 1 481  ? -55.045 -13.108 10.160  1.00 124.49 ? 478  LEU A O   1 
ATOM 3733 C CB  . LEU A 1 481  ? -52.169 -14.556 10.147  1.00 84.74  ? 478  LEU A CB  1 
ATOM 3734 C CG  . LEU A 1 481  ? -51.728 -15.407 8.932   1.00 84.74  ? 478  LEU A CG  1 
ATOM 3735 C CD1 . LEU A 1 481  ? -50.427 -14.909 8.311   1.00 84.74  ? 478  LEU A CD1 1 
ATOM 3736 C CD2 . LEU A 1 481  ? -51.584 -16.882 9.267   1.00 84.74  ? 478  LEU A CD2 1 
ATOM 3737 N N   . VAL A 1 482  ? -54.260 -13.079 8.044   1.00 144.86 ? 479  VAL A N   1 
ATOM 3738 C CA  . VAL A 1 482  ? -55.562 -13.117 7.372   1.00 144.86 ? 479  VAL A CA  1 
ATOM 3739 C C   . VAL A 1 482  ? -55.419 -13.993 6.134   1.00 144.86 ? 479  VAL A C   1 
ATOM 3740 O O   . VAL A 1 482  ? -54.321 -14.132 5.612   1.00 144.86 ? 479  VAL A O   1 
ATOM 3741 C CB  . VAL A 1 482  ? -56.029 -11.699 6.968   1.00 102.41 ? 479  VAL A CB  1 
ATOM 3742 C CG1 . VAL A 1 482  ? -57.415 -11.718 6.284   1.00 102.41 ? 479  VAL A CG1 1 
ATOM 3743 C CG2 . VAL A 1 482  ? -56.067 -10.804 8.172   1.00 102.41 ? 479  VAL A CG2 1 
ATOM 3744 N N   . SER A 1 483  ? -56.516 -14.585 5.667   1.00 143.89 ? 480  SER A N   1 
ATOM 3745 C CA  . SER A 1 483  ? -56.442 -15.524 4.552   1.00 143.89 ? 480  SER A CA  1 
ATOM 3746 C C   . SER A 1 483  ? -57.063 -15.027 3.254   1.00 143.89 ? 480  SER A C   1 
ATOM 3747 O O   . SER A 1 483  ? -57.653 -13.946 3.189   1.00 143.89 ? 480  SER A O   1 
ATOM 3748 C CB  . SER A 1 483  ? -57.057 -16.869 4.932   1.00 90.32  ? 480  SER A CB  1 
ATOM 3749 O OG  . SER A 1 483  ? -56.099 -17.741 5.520   1.00 90.32  ? 480  SER A OG  1 
ATOM 3750 N N   . GLN A 1 484  ? -56.888 -15.841 2.220   1.00 209.00 ? 481  GLN A N   1 
ATOM 3751 C CA  . GLN A 1 484  ? -57.538 -15.643 0.938   1.00 209.00 ? 481  GLN A CA  1 
ATOM 3752 C C   . GLN A 1 484  ? -58.746 -16.572 0.854   1.00 209.00 ? 481  GLN A C   1 
ATOM 3753 O O   . GLN A 1 484  ? -59.766 -16.227 0.248   1.00 209.00 ? 481  GLN A O   1 
ATOM 3754 C CB  . GLN A 1 484  ? -56.555 -15.919 -0.202  1.00 112.81 ? 481  GLN A CB  1 
ATOM 3755 C CG  . GLN A 1 484  ? -55.379 -14.955 -0.272  1.00 112.81 ? 481  GLN A CG  1 
ATOM 3756 C CD  . GLN A 1 484  ? -55.758 -13.604 -0.820  1.00 112.81 ? 481  GLN A CD  1 
ATOM 3757 O OE1 . GLN A 1 484  ? -56.588 -12.892 -0.252  1.00 112.81 ? 481  GLN A OE1 1 
ATOM 3758 N NE2 . GLN A 1 484  ? -55.142 -13.235 -1.935  1.00 112.81 ? 481  GLN A NE2 1 
ATOM 3759 N N   . GLU A 1 485  ? -58.619 -17.751 1.468   1.00 184.20 ? 482  GLU A N   1 
ATOM 3760 C CA  . GLU A 1 485  ? -59.745 -18.676 1.635   1.00 184.20 ? 482  GLU A CA  1 
ATOM 3761 C C   . GLU A 1 485  ? -60.625 -18.245 2.836   1.00 184.20 ? 482  GLU A C   1 
ATOM 3762 O O   . GLU A 1 485  ? -61.752 -17.788 2.620   1.00 184.20 ? 482  GLU A O   1 
ATOM 3763 C CB  . GLU A 1 485  ? -59.272 -20.139 1.747   1.00 188.37 ? 482  GLU A CB  1 
ATOM 3764 C CG  . GLU A 1 485  ? -58.315 -20.608 0.646   1.00 188.37 ? 482  GLU A CG  1 
ATOM 3765 C CD  . GLU A 1 485  ? -59.018 -21.053 -0.632  1.00 188.37 ? 482  GLU A CD  1 
ATOM 3766 O OE1 . GLU A 1 485  ? -60.268 -20.998 -0.699  1.00 188.37 ? 482  GLU A OE1 1 
ATOM 3767 O OE2 . GLU A 1 485  ? -58.311 -21.468 -1.579  1.00 188.37 ? 482  GLU A OE2 1 
ATOM 3768 N N   . PRO A 1 486  ? -60.127 -18.395 4.095   1.00 209.00 ? 483  PRO A N   1 
ATOM 3769 C CA  . PRO A 1 486  ? -60.821 -17.829 5.272   1.00 209.00 ? 483  PRO A CA  1 
ATOM 3770 C C   . PRO A 1 486  ? -61.011 -16.306 5.281   1.00 209.00 ? 483  PRO A C   1 
ATOM 3771 O O   . PRO A 1 486  ? -62.146 -15.847 5.428   1.00 209.00 ? 483  PRO A O   1 
ATOM 3772 C CB  . PRO A 1 486  ? -59.936 -18.264 6.452   1.00 178.56 ? 483  PRO A CB  1 
ATOM 3773 C CG  . PRO A 1 486  ? -59.229 -19.477 5.960   1.00 178.56 ? 483  PRO A CG  1 
ATOM 3774 C CD  . PRO A 1 486  ? -58.948 -19.181 4.510   1.00 178.56 ? 483  PRO A CD  1 
ATOM 3775 N N   . LYS A 1 487  ? -59.929 -15.536 5.139   1.00 133.96 ? 484  LYS A N   1 
ATOM 3776 C CA  . LYS A 1 487  ? -60.007 -14.070 5.194   1.00 133.96 ? 484  LYS A CA  1 
ATOM 3777 C C   . LYS A 1 487  ? -60.521 -13.619 6.573   1.00 133.96 ? 484  LYS A C   1 
ATOM 3778 O O   . LYS A 1 487  ? -61.582 -13.010 6.695   1.00 133.96 ? 484  LYS A O   1 
ATOM 3779 C CB  . LYS A 1 487  ? -60.850 -13.523 4.012   1.00 106.48 ? 484  LYS A CB  1 
ATOM 3780 C CG  . LYS A 1 487  ? -61.327 -12.065 4.114   1.00 106.48 ? 484  LYS A CG  1 
ATOM 3781 C CD  . LYS A 1 487  ? -60.217 -11.033 3.923   1.00 106.48 ? 484  LYS A CD  1 
ATOM 3782 C CE  . LYS A 1 487  ? -60.286 -10.395 2.548   1.00 106.48 ? 484  LYS A CE  1 
ATOM 3783 N NZ  . LYS A 1 487  ? -59.577 -9.090  2.515   1.00 106.48 ? 484  LYS A NZ  1 
ATOM 3784 N N   . ALA A 1 488  ? -59.757 -13.950 7.610   1.00 201.86 ? 485  ALA A N   1 
ATOM 3785 C CA  . ALA A 1 488  ? -60.160 -13.670 8.990   1.00 201.86 ? 485  ALA A CA  1 
ATOM 3786 C C   . ALA A 1 488  ? -58.964 -13.621 9.951   1.00 201.86 ? 485  ALA A C   1 
ATOM 3787 O O   . ALA A 1 488  ? -57.952 -12.998 9.644   1.00 201.86 ? 485  ALA A O   1 
ATOM 3788 C CB  . ALA A 1 488  ? -61.202 -14.688 9.457   1.00 139.61 ? 485  ALA A CB  1 
ATOM 3789 N N   . LEU A 1 489  ? -59.096 -14.275 11.106  1.00 162.60 ? 486  LEU A N   1 
ATOM 3790 C CA  . LEU A 1 489  ? -58.071 -14.267 12.156  1.00 162.60 ? 486  LEU A CA  1 
ATOM 3791 C C   . LEU A 1 489  ? -57.305 -15.596 12.155  1.00 162.60 ? 486  LEU A C   1 
ATOM 3792 O O   . LEU A 1 489  ? -57.107 -16.227 13.200  1.00 162.60 ? 486  LEU A O   1 
ATOM 3793 C CB  . LEU A 1 489  ? -58.722 -13.981 13.523  1.00 114.03 ? 486  LEU A CB  1 
ATOM 3794 C CG  . LEU A 1 489  ? -57.975 -13.326 14.699  1.00 114.03 ? 486  LEU A CG  1 
ATOM 3795 C CD1 . LEU A 1 489  ? -57.260 -12.028 14.312  1.00 114.03 ? 486  LEU A CD1 1 
ATOM 3796 C CD2 . LEU A 1 489  ? -58.953 -13.087 15.857  1.00 114.03 ? 486  LEU A CD2 1 
ATOM 3797 N N   . VAL A 1 490  ? -56.886 -15.993 10.952  1.00 138.83 ? 487  VAL A N   1 
ATOM 3798 C CA  . VAL A 1 490  ? -56.110 -17.211 10.676  1.00 138.83 ? 487  VAL A CA  1 
ATOM 3799 C C   . VAL A 1 490  ? -55.060 -17.544 11.744  1.00 138.83 ? 487  VAL A C   1 
ATOM 3800 O O   . VAL A 1 490  ? -54.967 -18.689 12.198  1.00 138.83 ? 487  VAL A O   1 
ATOM 3801 C CB  . VAL A 1 490  ? -55.455 -17.109 9.263   1.00 75.25  ? 487  VAL A CB  1 
ATOM 3802 C CG1 . VAL A 1 490  ? -54.624 -18.342 8.922   1.00 75.25  ? 487  VAL A CG1 1 
ATOM 3803 C CG2 . VAL A 1 490  ? -56.537 -16.887 8.211   1.00 75.25  ? 487  VAL A CG2 1 
ATOM 3804 N N   . SER A 1 491  ? -54.279 -16.539 12.135  1.00 166.81 ? 488  SER A N   1 
ATOM 3805 C CA  . SER A 1 491  ? -53.289 -16.674 13.207  1.00 166.81 ? 488  SER A CA  1 
ATOM 3806 C C   . SER A 1 491  ? -52.967 -15.295 13.817  1.00 166.81 ? 488  SER A C   1 
ATOM 3807 O O   . SER A 1 491  ? -53.515 -14.269 13.382  1.00 166.81 ? 488  SER A O   1 
ATOM 3808 C CB  . SER A 1 491  ? -52.022 -17.367 12.683  1.00 174.45 ? 488  SER A CB  1 
ATOM 3809 O OG  . SER A 1 491  ? -51.519 -18.313 13.612  1.00 174.45 ? 488  SER A OG  1 
ATOM 3810 N N   . GLU A 1 492  ? -52.101 -15.287 14.835  1.00 118.42 ? 489  GLU A N   1 
ATOM 3811 C CA  . GLU A 1 492  ? -51.666 -14.062 15.515  1.00 118.42 ? 489  GLU A CA  1 
ATOM 3812 C C   . GLU A 1 492  ? -50.508 -14.342 16.470  1.00 118.42 ? 489  GLU A C   1 
ATOM 3813 O O   . GLU A 1 492  ? -50.687 -15.002 17.495  1.00 118.42 ? 489  GLU A O   1 
ATOM 3814 C CB  . GLU A 1 492  ? -52.829 -13.401 16.268  1.00 112.09 ? 489  GLU A CB  1 
ATOM 3815 C CG  . GLU A 1 492  ? -52.445 -12.124 17.005  1.00 112.09 ? 489  GLU A CG  1 
ATOM 3816 C CD  . GLU A 1 492  ? -53.492 -11.035 16.882  1.00 112.09 ? 489  GLU A CD  1 
ATOM 3817 O OE1 . GLU A 1 492  ? -54.578 -11.304 16.315  1.00 112.09 ? 489  GLU A OE1 1 
ATOM 3818 O OE2 . GLU A 1 492  ? -53.226 -9.904  17.352  1.00 112.09 ? 489  GLU A OE2 1 
ATOM 3819 N N   . TRP A 1 493  ? -49.327 -13.836 16.125  1.00 209.00 ? 490  TRP A N   1 
ATOM 3820 C CA  . TRP A 1 493  ? -48.157 -13.917 16.992  1.00 209.00 ? 490  TRP A CA  1 
ATOM 3821 C C   . TRP A 1 493  ? -48.226 -12.772 17.985  1.00 209.00 ? 490  TRP A C   1 
ATOM 3822 O O   . TRP A 1 493  ? -48.830 -11.741 17.706  1.00 209.00 ? 490  TRP A O   1 
ATOM 3823 C CB  . TRP A 1 493  ? -46.877 -13.798 16.167  1.00 108.59 ? 490  TRP A CB  1 
ATOM 3824 C CG  . TRP A 1 493  ? -45.635 -14.362 16.805  1.00 108.59 ? 490  TRP A CG  1 
ATOM 3825 C CD1 . TRP A 1 493  ? -45.164 -15.629 16.677  1.00 108.59 ? 490  TRP A CD1 1 
ATOM 3826 C CD2 . TRP A 1 493  ? -44.690 -13.668 17.634  1.00 108.59 ? 490  TRP A CD2 1 
ATOM 3827 N NE1 . TRP A 1 493  ? -43.999 -15.776 17.378  1.00 108.59 ? 490  TRP A NE1 1 
ATOM 3828 C CE2 . TRP A 1 493  ? -43.684 -14.586 17.976  1.00 108.59 ? 490  TRP A CE2 1 
ATOM 3829 C CE3 . TRP A 1 493  ? -44.595 -12.355 18.115  1.00 108.59 ? 490  TRP A CE3 1 
ATOM 3830 C CZ2 . TRP A 1 493  ? -42.597 -14.243 18.783  1.00 108.59 ? 490  TRP A CZ2 1 
ATOM 3831 C CZ3 . TRP A 1 493  ? -43.512 -12.016 18.925  1.00 108.59 ? 490  TRP A CZ3 1 
ATOM 3832 C CH2 . TRP A 1 493  ? -42.532 -12.958 19.253  1.00 108.59 ? 490  TRP A CH2 1 
ATOM 3833 N N   . LYS A 1 494  ? -47.615 -12.960 19.144  1.00 183.72 ? 491  LYS A N   1 
ATOM 3834 C CA  . LYS A 1 494  ? -47.533 -11.918 20.155  1.00 183.72 ? 491  LYS A CA  1 
ATOM 3835 C C   . LYS A 1 494  ? -46.258 -12.126 20.956  1.00 183.72 ? 491  LYS A C   1 
ATOM 3836 O O   . LYS A 1 494  ? -45.849 -13.268 21.178  1.00 183.72 ? 491  LYS A O   1 
ATOM 3837 C CB  . LYS A 1 494  ? -48.742 -11.989 21.079  1.00 101.67 ? 491  LYS A CB  1 
ATOM 3838 C CG  . LYS A 1 494  ? -49.054 -10.699 21.780  1.00 101.67 ? 491  LYS A CG  1 
ATOM 3839 C CD  . LYS A 1 494  ? -50.147 -9.970  21.051  1.00 101.67 ? 491  LYS A CD  1 
ATOM 3840 C CE  . LYS A 1 494  ? -50.119 -8.498  21.387  1.00 101.67 ? 491  LYS A CE  1 
ATOM 3841 N NZ  . LYS A 1 494  ? -51.304 -7.812  20.801  1.00 101.67 ? 491  LYS A NZ  1 
ATOM 3842 N N   . GLU A 1 495  ? -45.624 -11.031 21.375  1.00 107.70 ? 492  GLU A N   1 
ATOM 3843 C CA  . GLU A 1 495  ? -44.363 -11.122 22.116  1.00 107.70 ? 492  GLU A CA  1 
ATOM 3844 C C   . GLU A 1 495  ? -44.606 -11.652 23.527  1.00 107.70 ? 492  GLU A C   1 
ATOM 3845 O O   . GLU A 1 495  ? -45.317 -11.005 24.311  1.00 107.70 ? 492  GLU A O   1 
ATOM 3846 C CB  . GLU A 1 495  ? -43.633 -9.772  22.151  1.00 135.93 ? 492  GLU A CB  1 
ATOM 3847 C CG  . GLU A 1 495  ? -42.149 -9.849  22.552  1.00 135.93 ? 492  GLU A CG  1 
ATOM 3848 C CD  . GLU A 1 495  ? -41.908 -9.758  24.059  1.00 135.93 ? 492  GLU A CD  1 
ATOM 3849 O OE1 . GLU A 1 495  ? -42.744 -9.170  24.770  1.00 135.93 ? 492  GLU A OE1 1 
ATOM 3850 O OE2 . GLU A 1 495  ? -40.870 -10.267 24.534  1.00 135.93 ? 492  GLU A OE2 1 
ATOM 3851 N N   . PRO A 1 496  ? -43.965 -12.758 23.795  1.00 163.31 ? 493  PRO A N   1 
ATOM 3852 C CA  . PRO A 1 496  ? -44.235 -13.427 25.063  1.00 163.31 ? 493  PRO A CA  1 
ATOM 3853 C C   . PRO A 1 496  ? -44.701 -12.399 26.144  1.00 163.31 ? 493  PRO A C   1 
ATOM 3854 O O   . PRO A 1 496  ? -45.926 -12.307 26.237  1.00 163.31 ? 493  PRO A O   1 
ATOM 3855 C CB  . PRO A 1 496  ? -43.025 -14.454 25.220  1.00 79.16  ? 493  PRO A CB  1 
ATOM 3856 C CG  . PRO A 1 496  ? -42.181 -14.208 23.932  1.00 79.16  ? 493  PRO A CG  1 
ATOM 3857 C CD  . PRO A 1 496  ? -43.145 -13.623 22.951  1.00 79.16  ? 493  PRO A CD  1 
ATOM 3858 N N   . GLN A 1 497  ? -43.888 -11.564 26.761  1.00 79.15  ? 494  GLN A N   1 
ATOM 3859 C CA  . GLN A 1 497  ? -44.329 -10.574 27.755  1.00 79.15  ? 494  GLN A CA  1 
ATOM 3860 C C   . GLN A 1 497  ? -45.179 -9.336  27.465  1.00 79.15  ? 494  GLN A C   1 
ATOM 3861 O O   . GLN A 1 497  ? -45.345 -8.487  28.342  1.00 79.15  ? 494  GLN A O   1 
ATOM 3862 C CB  . GLN A 1 497  ? -42.844 -10.185 27.813  1.00 109.43 ? 494  GLN A CB  1 
ATOM 3863 C CG  . GLN A 1 497  ? -42.025 -10.972 28.836  1.00 109.43 ? 494  GLN A CG  1 
ATOM 3864 C CD  . GLN A 1 497  ? -41.909 -10.260 30.163  1.00 109.43 ? 494  GLN A CD  1 
ATOM 3865 O OE1 . GLN A 1 497  ? -42.908 -9.878  30.783  1.00 109.43 ? 494  GLN A OE1 1 
ATOM 3866 N NE2 . GLN A 1 497  ? -40.677 -10.069 30.607  1.00 109.43 ? 494  GLN A NE2 1 
ATOM 3867 N N   . ALA A 1 498  ? -45.715 -9.229  26.251  1.00 175.19 ? 495  ALA A N   1 
ATOM 3868 C CA  . ALA A 1 498  ? -46.488 -8.055  25.854  1.00 175.19 ? 495  ALA A CA  1 
ATOM 3869 C C   . ALA A 1 498  ? -45.581 -6.827  25.696  1.00 175.19 ? 495  ALA A C   1 
ATOM 3870 O O   . ALA A 1 498  ? -45.666 -5.868  26.467  1.00 175.19 ? 495  ALA A O   1 
ATOM 3871 C CB  . ALA A 1 498  ? -47.608 -7.789  26.859  1.00 69.20  ? 495  ALA A CB  1 
ATOM 3872 N N   . LYS A 1 499  ? -44.704 -6.892  24.694  1.00 99.74  ? 496  LYS A N   1 
ATOM 3873 C CA  . LYS A 1 499  ? -43.757 -5.824  24.347  1.00 99.74  ? 496  LYS A CA  1 
ATOM 3874 C C   . LYS A 1 499  ? -43.740 -5.586  22.832  1.00 99.74  ? 496  LYS A C   1 
ATOM 3875 O O   . LYS A 1 499  ? -43.644 -6.537  22.046  1.00 99.74  ? 496  LYS A O   1 
ATOM 3876 C CB  . LYS A 1 499  ? -42.332 -6.176  24.810  1.00 79.28  ? 496  LYS A CB  1 
ATOM 3877 C CG  . LYS A 1 499  ? -41.873 -5.557  26.149  1.00 79.28  ? 496  LYS A CG  1 
ATOM 3878 C CD  . LYS A 1 499  ? -40.460 -6.029  26.524  1.00 79.28  ? 496  LYS A CD  1 
ATOM 3879 C CE  . LYS A 1 499  ? -40.345 -7.533  26.471  1.00 79.28  ? 496  LYS A CE  1 
ATOM 3880 N NZ  . LYS A 1 499  ? -39.000 -7.891  26.012  1.00 79.28  ? 496  LYS A NZ  1 
ATOM 3881 N N   . ASN A 1 500  ? -43.804 -4.313  22.438  1.00 96.24  ? 497  ASN A N   1 
ATOM 3882 C CA  . ASN A 1 500  ? -43.896 -3.909  21.031  1.00 96.24  ? 497  ASN A CA  1 
ATOM 3883 C C   . ASN A 1 500  ? -42.787 -4.452  20.124  1.00 96.24  ? 497  ASN A C   1 
ATOM 3884 O O   . ASN A 1 500  ? -41.622 -4.532  20.525  1.00 96.24  ? 497  ASN A O   1 
ATOM 3885 C CB  . ASN A 1 500  ? -43.924 -2.377  20.927  1.00 102.53 ? 497  ASN A CB  1 
ATOM 3886 C CG  . ASN A 1 500  ? -45.241 -1.764  21.420  1.00 102.53 ? 497  ASN A CG  1 
ATOM 3887 O OD1 . ASN A 1 500  ? -46.324 -2.057  20.896  1.00 102.53 ? 497  ASN A OD1 1 
ATOM 3888 N ND2 . ASN A 1 500  ? -45.147 -0.888  22.413  1.00 102.53 ? 497  ASN A ND2 1 
ATOM 3889 N N   . ILE A 1 501  ? -43.153 -4.839  18.905  1.00 165.99 ? 498  ILE A N   1 
ATOM 3890 C CA  . ILE A 1 501  ? -42.157 -5.034  17.863  1.00 165.99 ? 498  ILE A CA  1 
ATOM 3891 C C   . ILE A 1 501  ? -41.630 -3.639  17.573  1.00 165.99 ? 498  ILE A C   1 
ATOM 3892 O O   . ILE A 1 501  ? -42.410 -2.683  17.499  1.00 165.99 ? 498  ILE A O   1 
ATOM 3893 C CB  . ILE A 1 501  ? -42.752 -5.625  16.567  1.00 122.21 ? 498  ILE A CB  1 
ATOM 3894 C CG1 . ILE A 1 501  ? -43.437 -6.965  16.840  1.00 122.21 ? 498  ILE A CG1 1 
ATOM 3895 C CG2 . ILE A 1 501  ? -41.664 -5.784  15.511  1.00 122.21 ? 498  ILE A CG2 1 
ATOM 3896 C CD1 . ILE A 1 501  ? -44.656 -7.227  15.969  1.00 122.21 ? 498  ILE A CD1 1 
ATOM 3897 N N   . SER A 1 502  ? -40.315 -3.509  17.441  1.00 73.70  ? 499  SER A N   1 
ATOM 3898 C CA  . SER A 1 502  ? -39.740 -2.209  17.142  1.00 73.70  ? 499  SER A CA  1 
ATOM 3899 C C   . SER A 1 502  ? -39.543 -2.038  15.645  1.00 73.70  ? 499  SER A C   1 
ATOM 3900 O O   . SER A 1 502  ? -39.821 -0.959  15.127  1.00 73.70  ? 499  SER A O   1 
ATOM 3901 C CB  . SER A 1 502  ? -38.432 -1.981  17.902  1.00 67.95  ? 499  SER A CB  1 
ATOM 3902 O OG  . SER A 1 502  ? -37.448 -2.943  17.543  1.00 67.95  ? 499  SER A OG  1 
ATOM 3903 N N   . VAL A 1 503  ? -39.016 -3.070  15.003  1.00 81.80  ? 500  VAL A N   1 
ATOM 3904 C CA  . VAL A 1 503  ? -38.583 -3.006  13.630  1.00 81.80  ? 500  VAL A CA  1 
ATOM 3905 C C   . VAL A 1 503  ? -38.900 -4.189  12.750  1.00 81.80  ? 500  VAL A C   1 
ATOM 3906 O O   . VAL A 1 503  ? -38.291 -5.214  12.859  1.00 81.80  ? 500  VAL A O   1 
ATOM 3907 C CB  . VAL A 1 503  ? -37.078 -2.914  13.629  1.00 56.35  ? 500  VAL A CB  1 
ATOM 3908 C CG1 . VAL A 1 503  ? -36.530 -3.452  12.388  1.00 56.35  ? 500  VAL A CG1 1 
ATOM 3909 C CG2 . VAL A 1 503  ? -36.636 -1.532  13.855  1.00 56.35  ? 500  VAL A CG2 1 
ATOM 3910 N N   . ALA A 1 504  ? -39.893 -4.032  11.878  1.00 127.91 ? 501  ALA A N   1 
ATOM 3911 C CA  . ALA A 1 504  ? -40.345 -5.120  11.007  1.00 127.91 ? 501  ALA A CA  1 
ATOM 3912 C C   . ALA A 1 504  ? -39.505 -5.366  9.751   1.00 127.91 ? 501  ALA A C   1 
ATOM 3913 O O   . ALA A 1 504  ? -38.656 -4.555  9.383   1.00 127.91 ? 501  ALA A O   1 
ATOM 3914 C CB  . ALA A 1 504  ? -41.810 -4.916  10.630  1.00 99.17  ? 501  ALA A CB  1 
ATOM 3915 N N   . SER A 1 505  ? -39.753 -6.497  9.099   1.00 165.29 ? 502  SER A N   1 
ATOM 3916 C CA  . SER A 1 505  ? -39.027 -6.858  7.887   1.00 165.29 ? 502  SER A CA  1 
ATOM 3917 C C   . SER A 1 505  ? -39.380 -8.271  7.433   1.00 165.29 ? 502  SER A C   1 
ATOM 3918 O O   . SER A 1 505  ? -39.524 -9.178  8.252   1.00 165.29 ? 502  SER A O   1 
ATOM 3919 C CB  . SER A 1 505  ? -37.518 -6.740  8.111   1.00 61.35  ? 502  SER A CB  1 
ATOM 3920 O OG  . SER A 1 505  ? -37.074 -7.664  9.091   1.00 61.35  ? 502  SER A OG  1 
ATOM 3921 N N   . CYS A 1 506  ? -39.518 -8.449  6.123   1.00 151.53 ? 503  CYS A N   1 
ATOM 3922 C CA  . CYS A 1 506  ? -39.854 -9.750  5.558   1.00 151.53 ? 503  CYS A CA  1 
ATOM 3923 C C   . CYS A 1 506  ? -40.151 -9.646  4.066   1.00 151.53 ? 503  CYS A C   1 
ATOM 3924 O O   . CYS A 1 506  ? -40.156 -8.553  3.500   1.00 151.53 ? 503  CYS A O   1 
ATOM 3925 C CB  . CYS A 1 506  ? -41.051 -10.359 6.291   1.00 133.88 ? 503  CYS A CB  1 
ATOM 3926 S SG  . CYS A 1 506  ? -42.517 -9.302  6.336   1.00 133.88 ? 503  CYS A SG  1 
ATOM 3927 N N   . ASN A 1 507  ? -40.400 -10.789 3.436   1.00 209.00 ? 504  ASN A N   1 
ATOM 3928 C CA  . ASN A 1 507  ? -40.698 -10.828 2.009   1.00 209.00 ? 504  ASN A CA  1 
ATOM 3929 C C   . ASN A 1 507  ? -42.081 -11.406 1.726   1.00 209.00 ? 504  ASN A C   1 
ATOM 3930 O O   . ASN A 1 507  ? -43.098 -10.783 2.027   1.00 209.00 ? 504  ASN A O   1 
ATOM 3931 C CB  . ASN A 1 507  ? -39.631 -11.628 1.260   1.00 84.42  ? 504  ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 507  ? -39.534 -13.063 1.739   1.00 84.42  ? 504  ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 507  ? -40.270 -13.482 2.633   1.00 84.42  ? 504  ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 507  ? -38.624 -13.826 1.145   1.00 84.42  ? 504  ASN A ND2 1 
ATOM 3935 N N   . SER A 1 508  ? -42.110 -12.601 1.145   1.00 169.36 ? 505  SER A N   1 
ATOM 3936 C CA  . SER A 1 508  ? -43.383 -13.273 0.817   1.00 169.36 ? 505  SER A CA  1 
ATOM 3937 C C   . SER A 1 508  ? -43.345 -14.693 1.390   1.00 169.36 ? 505  SER A C   1 
ATOM 3938 O O   . SER A 1 508  ? -44.284 -15.473 1.226   1.00 169.36 ? 505  SER A O   1 
ATOM 3939 C CB  . SER A 1 508  ? -43.625 -13.317 -0.702  1.00 114.46 ? 505  SER A CB  1 
ATOM 3940 O OG  . SER A 1 508  ? -44.439 -12.240 -1.159  1.00 114.46 ? 505  SER A OG  1 
ATOM 3941 N N   . SER A 1 509  ? -42.237 -14.998 2.065   1.00 145.05 ? 506  SER A N   1 
ATOM 3942 C CA  . SER A 1 509  ? -41.946 -16.317 2.628   1.00 145.05 ? 506  SER A CA  1 
ATOM 3943 C C   . SER A 1 509  ? -41.240 -16.214 3.980   1.00 145.05 ? 506  SER A C   1 
ATOM 3944 O O   . SER A 1 509  ? -41.390 -17.092 4.829   1.00 145.05 ? 506  SER A O   1 
ATOM 3945 C CB  . SER A 1 509  ? -41.055 -17.109 1.675   1.00 117.86 ? 506  SER A CB  1 
ATOM 3946 O OG  . SER A 1 509  ? -41.684 -17.305 0.418   1.00 117.86 ? 506  SER A OG  1 
ATOM 3947 N N   . GLN A 1 510  ? -40.466 -15.146 4.162   1.00 209.00 ? 507  GLN A N   1 
ATOM 3948 C CA  . GLN A 1 510  ? -39.674 -14.938 5.376   1.00 209.00 ? 507  GLN A CA  1 
ATOM 3949 C C   . GLN A 1 510  ? -40.274 -13.882 6.301   1.00 209.00 ? 507  GLN A C   1 
ATOM 3950 O O   . GLN A 1 510  ? -41.011 -13.002 5.851   1.00 209.00 ? 507  GLN A O   1 
ATOM 3951 C CB  . GLN A 1 510  ? -38.258 -14.507 5.010   1.00 93.46  ? 507  GLN A CB  1 
ATOM 3952 C CG  . GLN A 1 510  ? -37.199 -15.089 5.892   1.00 93.46  ? 507  GLN A CG  1 
ATOM 3953 C CD  . GLN A 1 510  ? -36.503 -16.220 5.219   1.00 93.46  ? 507  GLN A CD  1 
ATOM 3954 O OE1 . GLN A 1 510  ? -35.283 -16.245 5.150   1.00 93.46  ? 507  GLN A OE1 1 
ATOM 3955 N NE2 . GLN A 1 510  ? -37.271 -17.159 4.684   1.00 93.46  ? 507  GLN A NE2 1 
ATOM 3956 N N   . VAL A 1 511  ? -39.943 -13.979 7.590   1.00 209.00 ? 508  VAL A N   1 
ATOM 3957 C CA  . VAL A 1 511  ? -40.304 -12.972 8.592   1.00 209.00 ? 508  VAL A CA  1 
ATOM 3958 C C   . VAL A 1 511  ? -39.166 -12.830 9.610   1.00 209.00 ? 508  VAL A C   1 
ATOM 3959 O O   . VAL A 1 511  ? -38.587 -13.826 10.047  1.00 209.00 ? 508  VAL A O   1 
ATOM 3960 C CB  . VAL A 1 511  ? -41.642 -13.312 9.340   1.00 127.92 ? 508  VAL A CB  1 
ATOM 3961 C CG1 . VAL A 1 511  ? -41.966 -12.274 10.427  1.00 127.92 ? 508  VAL A CG1 1 
ATOM 3962 C CG2 . VAL A 1 511  ? -42.822 -13.428 8.367   1.00 127.92 ? 508  VAL A CG2 1 
ATOM 3963 N N   . VAL A 1 512  ? -38.839 -11.582 9.942   1.00 115.04 ? 509  VAL A N   1 
ATOM 3964 C CA  . VAL A 1 512  ? -37.945 -11.219 11.050  1.00 115.04 ? 509  VAL A CA  1 
ATOM 3965 C C   . VAL A 1 512  ? -38.432 -9.906  11.666  1.00 115.04 ? 509  VAL A C   1 
ATOM 3966 O O   . VAL A 1 512  ? -38.615 -8.911  10.966  1.00 115.04 ? 509  VAL A O   1 
ATOM 3967 C CB  . VAL A 1 512  ? -36.484 -11.006 10.598  1.00 53.17  ? 509  VAL A CB  1 
ATOM 3968 C CG1 . VAL A 1 512  ? -35.672 -10.318 11.694  1.00 53.17  ? 509  VAL A CG1 1 
ATOM 3969 C CG2 . VAL A 1 512  ? -35.836 -12.334 10.171  1.00 53.17  ? 509  VAL A CG2 1 
ATOM 3970 N N   . VAL A 1 513  ? -38.651 -9.908  12.974  1.00 86.58  ? 510  VAL A N   1 
ATOM 3971 C CA  . VAL A 1 513  ? -38.950 -8.670  13.700  1.00 86.58  ? 510  VAL A CA  1 
ATOM 3972 C C   . VAL A 1 513  ? -37.761 -8.371  14.623  1.00 86.58  ? 510  VAL A C   1 
ATOM 3973 O O   . VAL A 1 513  ? -36.701 -9.002  14.492  1.00 86.58  ? 510  VAL A O   1 
ATOM 3974 C CB  . VAL A 1 513  ? -40.312 -8.747  14.466  1.00 134.71 ? 510  VAL A CB  1 
ATOM 3975 C CG1 . VAL A 1 513  ? -41.479 -8.601  13.510  1.00 134.71 ? 510  VAL A CG1 1 
ATOM 3976 C CG2 . VAL A 1 513  ? -40.438 -10.049 15.230  1.00 134.71 ? 510  VAL A CG2 1 
ATOM 3977 N N   . ALA A 1 514  ? -37.915 -7.393  15.514  1.00 59.15  ? 511  ALA A N   1 
ATOM 3978 C CA  . ALA A 1 514  ? -36.955 -7.177  16.608  1.00 59.15  ? 511  ALA A CA  1 
ATOM 3979 C C   . ALA A 1 514  ? -37.676 -6.391  17.667  1.00 59.15  ? 511  ALA A C   1 
ATOM 3980 O O   . ALA A 1 514  ? -38.620 -5.659  17.336  1.00 59.15  ? 511  ALA A O   1 
ATOM 3981 C CB  . ALA A 1 514  ? -35.703 -6.437  16.140  1.00 66.18  ? 511  ALA A CB  1 
ATOM 3982 N N   . VAL A 1 515  ? -37.261 -6.562  18.925  1.00 83.50  ? 512  VAL A N   1 
ATOM 3983 C CA  . VAL A 1 515  ? -37.894 -5.869  20.064  1.00 83.50  ? 512  VAL A CA  1 
ATOM 3984 C C   . VAL A 1 515  ? -37.016 -4.761  20.641  1.00 83.50  ? 512  VAL A C   1 
ATOM 3985 O O   . VAL A 1 515  ? -37.510 -3.806  21.248  1.00 83.50  ? 512  VAL A O   1 
ATOM 3986 C CB  . VAL A 1 515  ? -38.339 -6.867  21.170  1.00 99.75  ? 512  VAL A CB  1 
ATOM 3987 C CG1 . VAL A 1 515  ? -38.555 -6.179  22.537  1.00 99.75  ? 512  VAL A CG1 1 
ATOM 3988 C CG2 . VAL A 1 515  ? -39.607 -7.581  20.731  1.00 99.75  ? 512  VAL A CG2 1 
ATOM 3989 N N   . GLY A 1 516  ? -35.713 -4.894  20.416  1.00 69.95  ? 513  GLY A N   1 
ATOM 3990 C CA  . GLY A 1 516  ? -34.716 -3.948  20.877  1.00 69.95  ? 513  GLY A CA  1 
ATOM 3991 C C   . GLY A 1 516  ? -33.461 -4.514  20.275  1.00 69.95  ? 513  GLY A C   1 
ATOM 3992 O O   . GLY A 1 516  ? -33.080 -4.151  19.157  1.00 69.95  ? 513  GLY A O   1 
ATOM 3993 N N   . ARG A 1 517  ? -32.793 -5.376  21.025  1.00 91.98  ? 514  ARG A N   1 
ATOM 3994 C CA  . ARG A 1 517  ? -31.511 -5.946  20.605  1.00 91.98  ? 514  ARG A CA  1 
ATOM 3995 C C   . ARG A 1 517  ? -32.005 -7.348  20.352  1.00 91.98  ? 514  ARG A C   1 
ATOM 3996 O O   . ARG A 1 517  ? -31.320 -8.159  19.736  1.00 91.98  ? 514  ARG A O   1 
ATOM 3997 C CB  . ARG A 1 517  ? -30.923 -5.850  22.029  1.00 83.42  ? 514  ARG A CB  1 
ATOM 3998 C CG  . ARG A 1 517  ? -30.728 -4.426  22.572  1.00 83.42  ? 514  ARG A CG  1 
ATOM 3999 C CD  . ARG A 1 517  ? -29.819 -4.398  23.792  1.00 83.42  ? 514  ARG A CD  1 
ATOM 4000 N NE  . ARG A 1 517  ? -30.214 -5.366  24.821  1.00 83.42  ? 514  ARG A NE  1 
ATOM 4001 C CZ  . ARG A 1 517  ? -31.045 -5.101  25.830  1.00 83.42  ? 514  ARG A CZ  1 
ATOM 4002 N NH1 . ARG A 1 517  ? -31.584 -3.886  25.972  1.00 83.42  ? 514  ARG A NH1 1 
ATOM 4003 N NH2 . ARG A 1 517  ? -31.332 -6.058  26.699  1.00 83.42  ? 514  ARG A NH2 1 
ATOM 4004 N N   . ALA A 1 518  ? -33.214 -7.614  20.830  1.00 79.53  ? 515  ALA A N   1 
ATOM 4005 C CA  . ALA A 1 518  ? -33.822 -8.937  20.756  1.00 79.53  ? 515  ALA A CA  1 
ATOM 4006 C C   . ALA A 1 518  ? -34.195 -9.289  19.314  1.00 79.53  ? 515  ALA A C   1 
ATOM 4007 O O   . ALA A 1 518  ? -34.841 -8.497  18.602  1.00 79.53  ? 515  ALA A O   1 
ATOM 4008 C CB  . ALA A 1 518  ? -35.049 -9.017  21.677  1.00 128.14 ? 515  ALA A CB  1 
ATOM 4009 N N   . LEU A 1 519  ? -33.777 -10.475 18.889  1.00 141.29 ? 516  LEU A N   1 
ATOM 4010 C CA  . LEU A 1 519  ? -34.033 -10.930 17.533  1.00 141.29 ? 516  LEU A CA  1 
ATOM 4011 C C   . LEU A 1 519  ? -34.720 -12.271 17.515  1.00 141.29 ? 516  LEU A C   1 
ATOM 4012 O O   . LEU A 1 519  ? -34.161 -13.269 17.964  1.00 141.29 ? 516  LEU A O   1 
ATOM 4013 C CB  . LEU A 1 519  ? -32.738 -10.992 16.725  1.00 80.84  ? 516  LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 519  ? -32.160 -9.623  16.365  1.00 80.84  ? 516  LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 519  ? -30.906 -9.766  15.527  1.00 80.84  ? 516  LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 519  ? -33.212 -8.799  15.629  1.00 80.84  ? 516  LEU A CD2 1 
ATOM 4017 N N   . TYR A 1 520  ? -35.946 -12.278 17.006  1.00 95.54  ? 517  TYR A N   1 
ATOM 4018 C CA  . TYR A 1 520  ? -36.666 -13.517 16.777  1.00 95.54  ? 517  TYR A CA  1 
ATOM 4019 C C   . TYR A 1 520  ? -36.457 -14.011 15.331  1.00 95.54  ? 517  TYR A C   1 
ATOM 4020 O O   . TYR A 1 520  ? -35.381 -13.797 14.728  1.00 95.54  ? 517  TYR A O   1 
ATOM 4021 C CB  . TYR A 1 520  ? -38.157 -13.365 17.142  1.00 129.60 ? 517  TYR A CB  1 
ATOM 4022 C CG  . TYR A 1 520  ? -38.404 -13.128 18.623  1.00 129.60 ? 517  TYR A CG  1 
ATOM 4023 C CD1 . TYR A 1 520  ? -38.832 -11.885 19.090  1.00 129.60 ? 517  TYR A CD1 1 
ATOM 4024 C CD2 . TYR A 1 520  ? -38.193 -14.146 19.564  1.00 129.60 ? 517  TYR A CD2 1 
ATOM 4025 C CE1 . TYR A 1 520  ? -39.054 -11.660 20.457  1.00 129.60 ? 517  TYR A CE1 1 
ATOM 4026 C CE2 . TYR A 1 520  ? -38.412 -13.929 20.936  1.00 129.60 ? 517  TYR A CE2 1 
ATOM 4027 C CZ  . TYR A 1 520  ? -38.841 -12.684 21.373  1.00 129.60 ? 517  TYR A CZ  1 
ATOM 4028 O OH  . TYR A 1 520  ? -39.056 -12.454 22.719  1.00 129.60 ? 517  TYR A OH  1 
ATOM 4029 N N   . TYR A 1 521  ? -37.483 -14.704 14.827  1.00 209.00 ? 518  TYR A N   1 
ATOM 4030 C CA  . TYR A 1 521  ? -37.605 -15.244 13.464  1.00 209.00 ? 518  TYR A CA  1 
ATOM 4031 C C   . TYR A 1 521  ? -38.831 -16.167 13.478  1.00 209.00 ? 518  TYR A C   1 
ATOM 4032 O O   . TYR A 1 521  ? -38.869 -17.140 14.235  1.00 209.00 ? 518  TYR A O   1 
ATOM 4033 C CB  . TYR A 1 521  ? -36.346 -16.027 13.019  1.00 102.94 ? 518  TYR A CB  1 
ATOM 4034 C CG  . TYR A 1 521  ? -36.485 -16.808 11.718  1.00 102.94 ? 518  TYR A CG  1 
ATOM 4035 C CD1 . TYR A 1 521  ? -35.369 -17.170 10.982  1.00 102.94 ? 518  TYR A CD1 1 
ATOM 4036 C CD2 . TYR A 1 521  ? -37.737 -17.180 11.224  1.00 102.94 ? 518  TYR A CD2 1 
ATOM 4037 C CE1 . TYR A 1 521  ? -35.508 -17.898 9.792   1.00 102.94 ? 518  TYR A CE1 1 
ATOM 4038 C CE2 . TYR A 1 521  ? -37.887 -17.891 10.051  1.00 102.94 ? 518  TYR A CE2 1 
ATOM 4039 C CZ  . TYR A 1 521  ? -36.778 -18.253 9.335   1.00 102.94 ? 518  TYR A CZ  1 
ATOM 4040 O OH  . TYR A 1 521  ? -36.942 -18.974 8.164   1.00 102.94 ? 518  TYR A OH  1 
ATOM 4041 N N   . LEU A 1 522  ? -39.833 -15.847 12.658  1.00 206.49 ? 519  LEU A N   1 
ATOM 4042 C CA  . LEU A 1 522  ? -40.995 -16.731 12.449  1.00 206.49 ? 519  LEU A CA  1 
ATOM 4043 C C   . LEU A 1 522  ? -41.300 -16.983 10.958  1.00 206.49 ? 519  LEU A C   1 
ATOM 4044 O O   . LEU A 1 522  ? -40.720 -16.335 10.087  1.00 206.49 ? 519  LEU A O   1 
ATOM 4045 C CB  . LEU A 1 522  ? -42.241 -16.238 13.216  1.00 135.11 ? 519  LEU A CB  1 
ATOM 4046 C CG  . LEU A 1 522  ? -42.363 -14.824 13.794  1.00 135.11 ? 519  LEU A CG  1 
ATOM 4047 C CD1 . LEU A 1 522  ? -43.809 -14.349 13.748  1.00 135.11 ? 519  LEU A CD1 1 
ATOM 4048 C CD2 . LEU A 1 522  ? -41.809 -14.772 15.212  1.00 135.11 ? 519  LEU A CD2 1 
ATOM 4049 N N   . GLN A 1 523  ? -42.183 -17.943 10.675  1.00 169.91 ? 520  GLN A N   1 
ATOM 4050 C CA  . GLN A 1 523  ? -42.582 -18.280 9.302   1.00 169.91 ? 520  GLN A CA  1 
ATOM 4051 C C   . GLN A 1 523  ? -44.096 -18.455 9.237   1.00 169.91 ? 520  GLN A C   1 
ATOM 4052 O O   . GLN A 1 523  ? -44.692 -19.070 10.124  1.00 169.91 ? 520  GLN A O   1 
ATOM 4053 C CB  . GLN A 1 523  ? -41.926 -19.584 8.835   1.00 123.36 ? 520  GLN A CB  1 
ATOM 4054 C CG  . GLN A 1 523  ? -40.693 -20.017 9.594   1.00 123.36 ? 520  GLN A CG  1 
ATOM 4055 C CD  . GLN A 1 523  ? -40.844 -21.410 10.181  1.00 123.36 ? 520  GLN A CD  1 
ATOM 4056 O OE1 . GLN A 1 523  ? -41.417 -21.592 11.261  1.00 123.36 ? 520  GLN A OE1 1 
ATOM 4057 N NE2 . GLN A 1 523  ? -40.315 -22.405 9.477   1.00 123.36 ? 520  GLN A NE2 1 
ATOM 4058 N N   . ILE A 1 524  ? -44.709 -17.931 8.177   1.00 174.86 ? 521  ILE A N   1 
ATOM 4059 C CA  . ILE A 1 524  ? -46.162 -18.033 7.982   1.00 174.86 ? 521  ILE A CA  1 
ATOM 4060 C C   . ILE A 1 524  ? -46.538 -19.382 7.338   1.00 174.86 ? 521  ILE A C   1 
ATOM 4061 O O   . ILE A 1 524  ? -47.092 -19.428 6.231   1.00 174.86 ? 521  ILE A O   1 
ATOM 4062 C CB  . ILE A 1 524  ? -46.730 -16.847 7.123   1.00 117.74 ? 521  ILE A CB  1 
ATOM 4063 C CG1 . ILE A 1 524  ? -45.842 -15.578 7.222   1.00 117.74 ? 521  ILE A CG1 1 
ATOM 4064 C CG2 . ILE A 1 524  ? -48.226 -16.614 7.427   1.00 117.74 ? 521  ILE A CG2 1 
ATOM 4065 C CD1 . ILE A 1 524  ? -46.400 -14.403 8.041   1.00 117.74 ? 521  ILE A CD1 1 
ATOM 4066 N N   . HIS A 1 525  ? -46.240 -20.477 8.035   1.00 184.91 ? 522  HIS A N   1 
ATOM 4067 C CA  . HIS A 1 525  ? -46.488 -21.818 7.501   1.00 184.91 ? 522  HIS A CA  1 
ATOM 4068 C C   . HIS A 1 525  ? -47.969 -22.164 7.452   1.00 184.91 ? 522  HIS A C   1 
ATOM 4069 O O   . HIS A 1 525  ? -48.745 -21.646 8.253   1.00 184.91 ? 522  HIS A O   1 
ATOM 4070 C CB  . HIS A 1 525  ? -45.668 -22.862 8.242   1.00 110.63 ? 522  HIS A CB  1 
ATOM 4071 C CG  . HIS A 1 525  ? -44.308 -23.058 7.654   1.00 110.63 ? 522  HIS A CG  1 
ATOM 4072 N ND1 . HIS A 1 525  ? -44.103 -23.713 6.458   1.00 110.63 ? 522  HIS A ND1 1 
ATOM 4073 C CD2 . HIS A 1 525  ? -43.087 -22.659 8.078   1.00 110.63 ? 522  HIS A CD2 1 
ATOM 4074 C CE1 . HIS A 1 525  ? -42.812 -23.723 6.178   1.00 110.63 ? 522  HIS A CE1 1 
ATOM 4075 N NE2 . HIS A 1 525  ? -42.171 -23.089 7.145   1.00 110.63 ? 522  HIS A NE2 1 
ATOM 4076 N N   . PRO A 1 526  ? -48.362 -23.064 6.524   1.00 171.69 ? 523  PRO A N   1 
ATOM 4077 C CA  . PRO A 1 526  ? -49.750 -23.099 6.038   1.00 171.69 ? 523  PRO A CA  1 
ATOM 4078 C C   . PRO A 1 526  ? -50.804 -22.638 7.060   1.00 171.69 ? 523  PRO A C   1 
ATOM 4079 O O   . PRO A 1 526  ? -51.159 -23.389 7.973   1.00 171.69 ? 523  PRO A O   1 
ATOM 4080 C CB  . PRO A 1 526  ? -49.943 -24.563 5.649   1.00 67.64  ? 523  PRO A CB  1 
ATOM 4081 C CG  . PRO A 1 526  ? -48.536 -25.023 5.221   1.00 67.64  ? 523  PRO A CG  1 
ATOM 4082 C CD  . PRO A 1 526  ? -47.533 -24.132 5.920   1.00 67.64  ? 523  PRO A CD  1 
ATOM 4083 N N   . GLN A 1 527  ? -51.260 -21.393 6.899   1.00 109.83 ? 524  GLN A N   1 
ATOM 4084 C CA  . GLN A 1 527  ? -52.353 -20.797 7.687   1.00 109.83 ? 524  GLN A CA  1 
ATOM 4085 C C   . GLN A 1 527  ? -52.037 -20.607 9.172   1.00 109.83 ? 524  GLN A C   1 
ATOM 4086 O O   . GLN A 1 527  ? -52.930 -20.662 10.022  1.00 109.83 ? 524  GLN A O   1 
ATOM 4087 C CB  . GLN A 1 527  ? -53.663 -21.583 7.521   1.00 117.03 ? 524  GLN A CB  1 
ATOM 4088 C CG  . GLN A 1 527  ? -54.274 -21.551 6.120   1.00 117.03 ? 524  GLN A CG  1 
ATOM 4089 C CD  . GLN A 1 527  ? -55.586 -22.336 6.036   1.00 117.03 ? 524  GLN A CD  1 
ATOM 4090 O OE1 . GLN A 1 527  ? -56.597 -21.953 6.640   1.00 117.03 ? 524  GLN A OE1 1 
ATOM 4091 N NE2 . GLN A 1 527  ? -55.576 -23.435 5.277   1.00 117.03 ? 524  GLN A NE2 1 
ATOM 4092 N N   . GLU A 1 528  ? -50.768 -20.377 9.484   1.00 95.29  ? 525  GLU A N   1 
ATOM 4093 C CA  . GLU A 1 528  ? -50.352 -20.142 10.866  1.00 95.29  ? 525  GLU A CA  1 
ATOM 4094 C C   . GLU A 1 528  ? -48.908 -19.664 10.952  1.00 95.29  ? 525  GLU A C   1 
ATOM 4095 O O   . GLU A 1 528  ? -48.096 -19.957 10.078  1.00 95.29  ? 525  GLU A O   1 
ATOM 4096 C CB  . GLU A 1 528  ? -50.558 -21.395 11.740  1.00 173.32 ? 525  GLU A CB  1 
ATOM 4097 C CG  . GLU A 1 528  ? -50.103 -22.727 11.121  1.00 173.32 ? 525  GLU A CG  1 
ATOM 4098 C CD  . GLU A 1 528  ? -48.616 -22.994 11.271  1.00 173.32 ? 525  GLU A CD  1 
ATOM 4099 O OE1 . GLU A 1 528  ? -48.018 -23.549 10.326  1.00 173.32 ? 525  GLU A OE1 1 
ATOM 4100 O OE2 . GLU A 1 528  ? -48.045 -22.660 12.330  1.00 173.32 ? 525  GLU A OE2 1 
ATOM 4101 N N   . LEU A 1 529  ? -48.596 -18.957 12.033  1.00 94.20  ? 526  LEU A N   1 
ATOM 4102 C CA  . LEU A 1 529  ? -47.261 -18.418 12.253  1.00 94.20  ? 526  LEU A CA  1 
ATOM 4103 C C   . LEU A 1 529  ? -46.392 -19.253 13.205  1.00 94.20  ? 526  LEU A C   1 
ATOM 4104 O O   . LEU A 1 529  ? -46.475 -19.085 14.430  1.00 94.20  ? 526  LEU A O   1 
ATOM 4105 C CB  . LEU A 1 529  ? -47.374 -16.997 12.802  1.00 86.49  ? 526  LEU A CB  1 
ATOM 4106 C CG  . LEU A 1 529  ? -48.493 -16.133 12.228  1.00 86.49  ? 526  LEU A CG  1 
ATOM 4107 C CD1 . LEU A 1 529  ? -49.042 -15.235 13.327  1.00 86.49  ? 526  LEU A CD1 1 
ATOM 4108 C CD2 . LEU A 1 529  ? -48.012 -15.322 11.015  1.00 86.49  ? 526  LEU A CD2 1 
ATOM 4109 N N   . ARG A 1 530  ? -45.539 -20.118 12.649  1.00 158.50 ? 527  ARG A N   1 
ATOM 4110 C CA  . ARG A 1 530  ? -44.622 -20.940 13.456  1.00 158.50 ? 527  ARG A CA  1 
ATOM 4111 C C   . ARG A 1 530  ? -43.275 -20.262 13.691  1.00 158.50 ? 527  ARG A C   1 
ATOM 4112 O O   . ARG A 1 530  ? -42.631 -19.828 12.741  1.00 158.50 ? 527  ARG A O   1 
ATOM 4113 C CB  . ARG A 1 530  ? -44.394 -22.309 12.811  1.00 104.98 ? 527  ARG A CB  1 
ATOM 4114 C CG  . ARG A 1 530  ? -43.829 -23.347 13.779  1.00 104.98 ? 527  ARG A CG  1 
ATOM 4115 C CD  . ARG A 1 530  ? -43.712 -24.730 13.152  1.00 104.98 ? 527  ARG A CD  1 
ATOM 4116 N NE  . ARG A 1 530  ? -44.958 -25.196 12.532  1.00 104.98 ? 527  ARG A NE  1 
ATOM 4117 C CZ  . ARG A 1 530  ? -45.129 -25.350 11.221  1.00 104.98 ? 527  ARG A CZ  1 
ATOM 4118 N NH1 . ARG A 1 530  ? -44.140 -25.077 10.386  1.00 104.98 ? 527  ARG A NH1 1 
ATOM 4119 N NH2 . ARG A 1 530  ? -46.290 -25.781 10.748  1.00 104.98 ? 527  ARG A NH2 1 
ATOM 4120 N N   . GLN A 1 531  ? -42.854 -20.206 14.956  1.00 136.31 ? 528  GLN A N   1 
ATOM 4121 C CA  . GLN A 1 531  ? -41.611 -19.521 15.371  1.00 136.31 ? 528  GLN A CA  1 
ATOM 4122 C C   . GLN A 1 531  ? -40.338 -20.378 15.196  1.00 136.31 ? 528  GLN A C   1 
ATOM 4123 O O   . GLN A 1 531  ? -40.420 -21.597 15.023  1.00 136.31 ? 528  GLN A O   1 
ATOM 4124 C CB  . GLN A 1 531  ? -41.740 -19.039 16.831  1.00 128.31 ? 528  GLN A CB  1 
ATOM 4125 C CG  . GLN A 1 531  ? -40.913 -17.786 17.187  1.00 128.31 ? 528  GLN A CG  1 
ATOM 4126 C CD  . GLN A 1 531  ? -40.838 -17.516 18.686  1.00 128.31 ? 528  GLN A CD  1 
ATOM 4127 O OE1 . GLN A 1 531  ? -41.856 -17.300 19.345  1.00 128.31 ? 528  GLN A OE1 1 
ATOM 4128 N NE2 . GLN A 1 531  ? -39.622 -17.518 19.226  1.00 128.31 ? 528  GLN A NE2 1 
ATOM 4129 N N   . ILE A 1 532  ? -39.172 -19.730 15.227  1.00 103.21 ? 529  ILE A N   1 
ATOM 4130 C CA  . ILE A 1 532  ? -37.886 -20.426 15.200  1.00 103.21 ? 529  ILE A CA  1 
ATOM 4131 C C   . ILE A 1 532  ? -36.838 -19.801 16.134  1.00 103.21 ? 529  ILE A C   1 
ATOM 4132 O O   . ILE A 1 532  ? -36.969 -19.908 17.344  1.00 103.21 ? 529  ILE A O   1 
ATOM 4133 C CB  . ILE A 1 532  ? -37.311 -20.540 13.778  1.00 47.69  ? 529  ILE A CB  1 
ATOM 4134 C CG1 . ILE A 1 532  ? -38.386 -21.023 12.757  1.00 47.69  ? 529  ILE A CG1 1 
ATOM 4135 C CG2 . ILE A 1 532  ? -35.981 -21.384 13.768  1.00 47.69  ? 529  ILE A CG2 1 
ATOM 4136 C CD1 . ILE A 1 532  ? -37.811 -21.694 11.408  1.00 47.69  ? 529  ILE A CD1 1 
ATOM 4137 N N   . SER A 1 533  ? -35.816 -19.148 15.576  1.00 99.29  ? 530  SER A N   1 
ATOM 4138 C CA  . SER A 1 533  ? -34.590 -18.795 16.321  1.00 99.29  ? 530  SER A CA  1 
ATOM 4139 C C   . SER A 1 533  ? -34.740 -17.671 17.341  1.00 99.29  ? 530  SER A C   1 
ATOM 4140 O O   . SER A 1 533  ? -35.822 -17.105 17.502  1.00 99.29  ? 530  SER A O   1 
ATOM 4141 C CB  . SER A 1 533  ? -33.450 -18.452 15.349  1.00 64.01  ? 530  SER A CB  1 
ATOM 4142 O OG  . SER A 1 533  ? -32.973 -19.614 14.697  1.00 64.01  ? 530  SER A OG  1 
ATOM 4143 N N   . HIS A 1 534  ? -33.640 -17.374 18.037  1.00 115.65 ? 531  HIS A N   1 
ATOM 4144 C CA  . HIS A 1 534  ? -33.530 -16.181 18.886  1.00 115.65 ? 531  HIS A CA  1 
ATOM 4145 C C   . HIS A 1 534  ? -32.078 -15.747 19.131  1.00 115.65 ? 531  HIS A C   1 
ATOM 4146 O O   . HIS A 1 534  ? -31.153 -16.563 19.045  1.00 115.65 ? 531  HIS A O   1 
ATOM 4147 C CB  . HIS A 1 534  ? -34.266 -16.361 20.218  1.00 145.33 ? 531  HIS A CB  1 
ATOM 4148 C CG  . HIS A 1 534  ? -34.387 -15.095 21.010  1.00 145.33 ? 531  HIS A CG  1 
ATOM 4149 N ND1 . HIS A 1 534  ? -35.202 -14.053 20.626  1.00 145.33 ? 531  HIS A ND1 1 
ATOM 4150 C CD2 . HIS A 1 534  ? -33.781 -14.700 22.154  1.00 145.33 ? 531  HIS A CD2 1 
ATOM 4151 C CE1 . HIS A 1 534  ? -35.103 -13.073 21.505  1.00 145.33 ? 531  HIS A CE1 1 
ATOM 4152 N NE2 . HIS A 1 534  ? -34.247 -13.439 22.443  1.00 145.33 ? 531  HIS A NE2 1 
ATOM 4153 N N   . THR A 1 535  ? -31.905 -14.454 19.417  1.00 123.27 ? 532  THR A N   1 
ATOM 4154 C CA  . THR A 1 535  ? -30.617 -13.848 19.781  1.00 123.27 ? 532  THR A CA  1 
ATOM 4155 C C   . THR A 1 535  ? -30.832 -12.424 20.275  1.00 123.27 ? 532  THR A C   1 
ATOM 4156 O O   . THR A 1 535  ? -31.800 -11.768 19.900  1.00 123.27 ? 532  THR A O   1 
ATOM 4157 C CB  . THR A 1 535  ? -29.597 -13.875 18.603  1.00 71.36  ? 532  THR A CB  1 
ATOM 4158 O OG1 . THR A 1 535  ? -29.195 -15.231 18.376  1.00 71.36  ? 532  THR A OG1 1 
ATOM 4159 C CG2 . THR A 1 535  ? -28.338 -13.022 18.888  1.00 71.36  ? 532  THR A CG2 1 
ATOM 4160 N N   . GLU A 1 536  ? -29.928 -11.974 21.139  1.00 71.26  ? 533  GLU A N   1 
ATOM 4161 C CA  . GLU A 1 536  ? -29.900 -10.600 21.643  1.00 71.26  ? 533  GLU A CA  1 
ATOM 4162 C C   . GLU A 1 536  ? -28.690 -9.856  21.044  1.00 71.26  ? 533  GLU A C   1 
ATOM 4163 O O   . GLU A 1 536  ? -27.731 -10.503 20.582  1.00 71.26  ? 533  GLU A O   1 
ATOM 4164 C CB  . GLU A 1 536  ? -29.836 -10.608 23.172  1.00 159.54 ? 533  GLU A CB  1 
ATOM 4165 C CG  . GLU A 1 536  ? -30.411 -9.370  23.835  1.00 159.54 ? 533  GLU A CG  1 
ATOM 4166 C CD  . GLU A 1 536  ? -30.046 -9.275  25.302  1.00 159.54 ? 533  GLU A CD  1 
ATOM 4167 O OE1 . GLU A 1 536  ? -29.668 -8.166  25.746  1.00 159.54 ? 533  GLU A OE1 1 
ATOM 4168 O OE2 . GLU A 1 536  ? -30.127 -10.309 26.006  1.00 159.54 ? 533  GLU A OE2 1 
ATOM 4169 N N   . MET A 1 537  ? -28.724 -8.517  21.034  1.00 61.35  ? 534  MET A N   1 
ATOM 4170 C CA  . MET A 1 537  ? -27.653 -7.754  20.382  1.00 61.35  ? 534  MET A CA  1 
ATOM 4171 C C   . MET A 1 537  ? -27.025 -6.724  21.302  1.00 61.35  ? 534  MET A C   1 
ATOM 4172 O O   . MET A 1 537  ? -27.707 -6.155  22.166  1.00 61.35  ? 534  MET A O   1 
ATOM 4173 C CB  . MET A 1 537  ? -28.161 -7.064  19.110  1.00 84.85  ? 534  MET A CB  1 
ATOM 4174 C CG  . MET A 1 537  ? -28.752 -7.975  18.012  1.00 84.85  ? 534  MET A CG  1 
ATOM 4175 S SD  . MET A 1 537  ? -27.644 -8.782  16.819  1.00 84.85  ? 534  MET A SD  1 
ATOM 4176 C CE  . MET A 1 537  ? -26.158 -7.776  16.877  1.00 84.85  ? 534  MET A CE  1 
ATOM 4177 N N   . GLU A 1 538  ? -25.724 -6.491  21.104  1.00 76.17  ? 535  GLU A N   1 
ATOM 4178 C CA  . GLU A 1 538  ? -24.963 -5.467  21.812  1.00 76.17  ? 535  GLU A CA  1 
ATOM 4179 C C   . GLU A 1 538  ? -25.856 -4.306  22.237  1.00 76.17  ? 535  GLU A C   1 
ATOM 4180 O O   . GLU A 1 538  ? -26.028 -4.052  23.433  1.00 76.17  ? 535  GLU A O   1 
ATOM 4181 C CB  . GLU A 1 538  ? -23.864 -4.936  20.896  1.00 128.29 ? 535  GLU A CB  1 
ATOM 4182 C CG  . GLU A 1 538  ? -22.697 -5.863  20.684  1.00 128.29 ? 535  GLU A CG  1 
ATOM 4183 C CD  . GLU A 1 538  ? -21.567 -5.575  21.638  1.00 128.29 ? 535  GLU A CD  1 
ATOM 4184 O OE1 . GLU A 1 538  ? -21.193 -6.500  22.383  1.00 128.29 ? 535  GLU A OE1 1 
ATOM 4185 O OE2 . GLU A 1 538  ? -21.064 -4.428  21.652  1.00 128.29 ? 535  GLU A OE2 1 
ATOM 4186 N N   . HIS A 1 539  ? -26.435 -3.633  21.231  1.00 66.60  ? 536  HIS A N   1 
ATOM 4187 C CA  . HIS A 1 539  ? -27.247 -2.404  21.381  1.00 66.60  ? 536  HIS A CA  1 
ATOM 4188 C C   . HIS A 1 539  ? -28.575 -2.471  20.628  1.00 66.60  ? 536  HIS A C   1 
ATOM 4189 O O   . HIS A 1 539  ? -28.827 -3.410  19.890  1.00 66.60  ? 536  HIS A O   1 
ATOM 4190 C CB  . HIS A 1 539  ? -26.490 -1.183  20.860  1.00 98.17  ? 536  HIS A CB  1 
ATOM 4191 C CG  . HIS A 1 539  ? -25.015 -1.246  21.075  1.00 98.17  ? 536  HIS A CG  1 
ATOM 4192 N ND1 . HIS A 1 539  ? -24.398 -0.661  22.161  1.00 98.17  ? 536  HIS A ND1 1 
ATOM 4193 C CD2 . HIS A 1 539  ? -24.030 -1.815  20.341  1.00 98.17  ? 536  HIS A CD2 1 
ATOM 4194 C CE1 . HIS A 1 539  ? -23.097 -0.872  22.086  1.00 98.17  ? 536  HIS A CE1 1 
ATOM 4195 N NE2 . HIS A 1 539  ? -22.847 -1.576  20.996  1.00 98.17  ? 536  HIS A NE2 1 
ATOM 4196 N N   . GLU A 1 540  ? -29.410 -1.451  20.803  1.00 65.57  ? 537  GLU A N   1 
ATOM 4197 C CA  . GLU A 1 540  ? -30.701 -1.349  20.091  1.00 65.57  ? 537  GLU A CA  1 
ATOM 4198 C C   . GLU A 1 540  ? -30.583 -1.574  18.581  1.00 65.57  ? 537  GLU A C   1 
ATOM 4199 O O   . GLU A 1 540  ? -29.744 -0.960  17.909  1.00 65.57  ? 537  GLU A O   1 
ATOM 4200 C CB  . GLU A 1 540  ? -31.323 0.026   20.326  1.00 75.51  ? 537  GLU A CB  1 
ATOM 4201 C CG  . GLU A 1 540  ? -32.311 0.159   21.469  1.00 75.51  ? 537  GLU A CG  1 
ATOM 4202 C CD  . GLU A 1 540  ? -33.009 1.520   21.431  1.00 75.51  ? 537  GLU A CD  1 
ATOM 4203 O OE1 . GLU A 1 540  ? -32.429 2.549   21.873  1.00 75.51  ? 537  GLU A OE1 1 
ATOM 4204 O OE2 . GLU A 1 540  ? -34.148 1.554   20.930  1.00 75.51  ? 537  GLU A OE2 1 
ATOM 4205 N N   . VAL A 1 541  ? -31.434 -2.441  18.049  1.00 60.47  ? 538  VAL A N   1 
ATOM 4206 C CA  . VAL A 1 541  ? -31.505 -2.652  16.603  1.00 60.47  ? 538  VAL A CA  1 
ATOM 4207 C C   . VAL A 1 541  ? -32.204 -1.460  15.953  1.00 60.47  ? 538  VAL A C   1 
ATOM 4208 O O   . VAL A 1 541  ? -33.385 -1.227  16.231  1.00 60.47  ? 538  VAL A O   1 
ATOM 4209 C CB  . VAL A 1 541  ? -32.299 -3.929  16.274  1.00 77.42  ? 538  VAL A CB  1 
ATOM 4210 C CG1 . VAL A 1 541  ? -32.549 -4.040  14.773  1.00 77.42  ? 538  VAL A CG1 1 
ATOM 4211 C CG2 . VAL A 1 541  ? -31.583 -5.147  16.808  1.00 77.42  ? 538  VAL A CG2 1 
ATOM 4212 N N   . ALA A 1 542  ? -31.477 -0.709  15.117  1.00 60.98  ? 539  ALA A N   1 
ATOM 4213 C CA  . ALA A 1 542  ? -32.035 0.469   14.408  1.00 60.98  ? 539  ALA A CA  1 
ATOM 4214 C C   . ALA A 1 542  ? -32.822 0.070   13.188  1.00 60.98  ? 539  ALA A C   1 
ATOM 4215 O O   . ALA A 1 542  ? -33.913 0.592   12.990  1.00 60.98  ? 539  ALA A O   1 
ATOM 4216 C CB  . ALA A 1 542  ? -30.953 1.477   14.019  1.00 48.01  ? 539  ALA A CB  1 
ATOM 4217 N N   . CYS A 1 543  ? -32.280 -0.840  12.374  1.00 67.02  ? 540  CYS A N   1 
ATOM 4218 C CA  . CYS A 1 543  ? -32.987 -1.307  11.167  1.00 67.02  ? 540  CYS A CA  1 
ATOM 4219 C C   . CYS A 1 543  ? -32.452 -2.620  10.624  1.00 67.02  ? 540  CYS A C   1 
ATOM 4220 O O   . CYS A 1 543  ? -31.321 -2.997  10.920  1.00 67.02  ? 540  CYS A O   1 
ATOM 4221 C CB  . CYS A 1 543  ? -32.949 -0.241  10.053  1.00 54.98  ? 540  CYS A CB  1 
ATOM 4222 S SG  . CYS A 1 543  ? -31.285 0.402   9.761   1.00 54.98  ? 540  CYS A SG  1 
ATOM 4223 N N   . LEU A 1 544  ? -33.270 -3.276  9.803   1.00 102.98 ? 541  LEU A N   1 
ATOM 4224 C CA  . LEU A 1 544  ? -33.008 -4.620  9.288   1.00 102.98 ? 541  LEU A CA  1 
ATOM 4225 C C   . LEU A 1 544  ? -33.421 -4.721  7.829   1.00 102.98 ? 541  LEU A C   1 
ATOM 4226 O O   . LEU A 1 544  ? -34.345 -4.025  7.409   1.00 102.98 ? 541  LEU A O   1 
ATOM 4227 C CB  . LEU A 1 544  ? -33.884 -5.614  10.046  1.00 54.69  ? 541  LEU A CB  1 
ATOM 4228 C CG  . LEU A 1 544  ? -33.602 -6.044  11.483  1.00 54.69  ? 541  LEU A CG  1 
ATOM 4229 C CD1 . LEU A 1 544  ? -34.929 -6.214  12.215  1.00 54.69  ? 541  LEU A CD1 1 
ATOM 4230 C CD2 . LEU A 1 544  ? -32.821 -7.348  11.459  1.00 54.69  ? 541  LEU A CD2 1 
ATOM 4231 N N   . ASP A 1 545  ? -32.780 -5.601  7.062   1.00 204.75 ? 542  ASP A N   1 
ATOM 4232 C CA  . ASP A 1 545  ? -33.297 -5.936  5.729   1.00 204.75 ? 542  ASP A CA  1 
ATOM 4233 C C   . ASP A 1 545  ? -33.159 -7.402  5.367   1.00 204.75 ? 542  ASP A C   1 
ATOM 4234 O O   . ASP A 1 545  ? -32.068 -7.961  5.434   1.00 204.75 ? 542  ASP A O   1 
ATOM 4235 C CB  . ASP A 1 545  ? -32.654 -5.087  4.628   1.00 153.53 ? 542  ASP A CB  1 
ATOM 4236 C CG  . ASP A 1 545  ? -33.192 -5.431  3.239   1.00 153.53 ? 542  ASP A CG  1 
ATOM 4237 O OD1 . ASP A 1 545  ? -34.384 -5.790  3.119   1.00 153.53 ? 542  ASP A OD1 1 
ATOM 4238 O OD2 . ASP A 1 545  ? -32.425 -5.342  2.264   1.00 153.53 ? 542  ASP A OD2 1 
ATOM 4239 N N   . ILE A 1 546  ? -34.283 -8.000  4.964   1.00 184.40 ? 543  ILE A N   1 
ATOM 4240 C CA  . ILE A 1 546  ? -34.303 -9.343  4.369   1.00 184.40 ? 543  ILE A CA  1 
ATOM 4241 C C   . ILE A 1 546  ? -35.090 -9.413  3.069   1.00 184.40 ? 543  ILE A C   1 
ATOM 4242 O O   . ILE A 1 546  ? -36.172 -8.838  2.947   1.00 184.40 ? 543  ILE A O   1 
ATOM 4243 C CB  . ILE A 1 546  ? -34.820 -10.441 5.340   1.00 90.73  ? 543  ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 546  ? -36.160 -10.064 5.998   1.00 90.73  ? 543  ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 546  ? -33.752 -10.756 6.380   1.00 90.73  ? 543  ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 546  ? -37.379 -10.590 5.276   1.00 90.73  ? 543  ILE A CD1 1 
ATOM 4247 N N   . THR A 1 547  ? -34.520 -10.124 2.100   1.00 140.97 ? 544  THR A N   1 
ATOM 4248 C CA  . THR A 1 547  ? -35.147 -10.384 0.806   1.00 140.97 ? 544  THR A CA  1 
ATOM 4249 C C   . THR A 1 547  ? -34.327 -11.482 0.107   1.00 140.97 ? 544  THR A C   1 
ATOM 4250 O O   . THR A 1 547  ? -33.096 -11.372 0.005   1.00 140.97 ? 544  THR A O   1 
ATOM 4251 C CB  . THR A 1 547  ? -35.227 -9.104  -0.095  1.00 115.42 ? 544  THR A CB  1 
ATOM 4252 O OG1 . THR A 1 547  ? -35.095 -7.914  0.704   1.00 115.42 ? 544  THR A OG1 1 
ATOM 4253 C CG2 . THR A 1 547  ? -36.544 -9.060  -0.880  1.00 115.42 ? 544  THR A CG2 1 
ATOM 4254 N N   . PRO A 1 548  ? -34.999 -12.559 -0.355  1.00 209.00 ? 545  PRO A N   1 
ATOM 4255 C CA  . PRO A 1 548  ? -34.302 -13.687 -0.970  1.00 209.00 ? 545  PRO A CA  1 
ATOM 4256 C C   . PRO A 1 548  ? -33.703 -13.272 -2.306  1.00 209.00 ? 545  PRO A C   1 
ATOM 4257 O O   . PRO A 1 548  ? -34.420 -12.816 -3.202  1.00 209.00 ? 545  PRO A O   1 
ATOM 4258 C CB  . PRO A 1 548  ? -35.409 -14.733 -1.150  1.00 164.48 ? 545  PRO A CB  1 
ATOM 4259 C CG  . PRO A 1 548  ? -36.665 -13.954 -1.213  1.00 164.48 ? 545  PRO A CG  1 
ATOM 4260 C CD  . PRO A 1 548  ? -36.458 -12.758 -0.341  1.00 164.48 ? 545  PRO A CD  1 
ATOM 4261 N N   . LEU A 1 549  ? -32.388 -13.419 -2.423  1.00 129.85 ? 546  LEU A N   1 
ATOM 4262 C CA  . LEU A 1 549  ? -31.663 -12.846 -3.549  1.00 129.85 ? 546  LEU A CA  1 
ATOM 4263 C C   . LEU A 1 549  ? -31.629 -13.744 -4.801  1.00 129.85 ? 546  LEU A C   1 
ATOM 4264 O O   . LEU A 1 549  ? -32.678 -14.028 -5.379  1.00 129.85 ? 546  LEU A O   1 
ATOM 4265 C CB  . LEU A 1 549  ? -30.286 -12.320 -3.091  1.00 75.62  ? 546  LEU A CB  1 
ATOM 4266 C CG  . LEU A 1 549  ? -30.413 -11.014 -2.269  1.00 75.62  ? 546  LEU A CG  1 
ATOM 4267 C CD1 . LEU A 1 549  ? -29.217 -10.766 -1.335  1.00 75.62  ? 546  LEU A CD1 1 
ATOM 4268 C CD2 . LEU A 1 549  ? -30.735 -9.768  -3.155  1.00 75.62  ? 546  LEU A CD2 1 
ATOM 4269 N N   . GLY A 1 550  ? -30.447 -14.193 -5.215  1.00 159.52 ? 547  GLY A N   1 
ATOM 4270 C CA  . GLY A 1 550  ? -30.305 -14.917 -6.480  1.00 159.52 ? 547  GLY A CA  1 
ATOM 4271 C C   . GLY A 1 550  ? -30.632 -16.400 -6.446  1.00 159.52 ? 547  GLY A C   1 
ATOM 4272 O O   . GLY A 1 550  ? -31.493 -16.877 -7.195  1.00 159.52 ? 547  GLY A O   1 
ATOM 4273 N N   . ASP A 1 551  ? -29.944 -17.123 -5.566  1.00 202.48 ? 548  ASP A N   1 
ATOM 4274 C CA  . ASP A 1 551  ? -29.946 -18.585 -5.564  1.00 202.48 ? 548  ASP A CA  1 
ATOM 4275 C C   . ASP A 1 551  ? -30.928 -19.228 -4.579  1.00 202.48 ? 548  ASP A C   1 
ATOM 4276 O O   . ASP A 1 551  ? -30.836 -20.430 -4.306  1.00 202.48 ? 548  ASP A O   1 
ATOM 4277 C CB  . ASP A 1 551  ? -28.526 -19.097 -5.294  1.00 147.95 ? 548  ASP A CB  1 
ATOM 4278 C CG  . ASP A 1 551  ? -27.840 -18.350 -4.159  1.00 147.95 ? 548  ASP A CG  1 
ATOM 4279 O OD1 . ASP A 1 551  ? -26.791 -17.720 -4.422  1.00 147.95 ? 548  ASP A OD1 1 
ATOM 4280 O OD2 . ASP A 1 551  ? -28.353 -18.375 -3.017  1.00 147.95 ? 548  ASP A OD2 1 
ATOM 4281 N N   . SER A 1 552  ? -31.865 -18.438 -4.055  1.00 148.50 ? 549  SER A N   1 
ATOM 4282 C CA  . SER A 1 552  ? -32.859 -18.951 -3.106  1.00 148.50 ? 549  SER A CA  1 
ATOM 4283 C C   . SER A 1 552  ? -34.204 -18.241 -3.221  1.00 148.50 ? 549  SER A C   1 
ATOM 4284 O O   . SER A 1 552  ? -34.292 -17.024 -3.060  1.00 148.50 ? 549  SER A O   1 
ATOM 4285 C CB  . SER A 1 552  ? -32.331 -18.860 -1.672  1.00 142.47 ? 549  SER A CB  1 
ATOM 4286 O OG  . SER A 1 552  ? -31.824 -17.565 -1.410  1.00 142.47 ? 549  SER A OG  1 
ATOM 4287 N N   . ASN A 1 553  ? -35.249 -19.014 -3.503  1.00 137.87 ? 550  ASN A N   1 
ATOM 4288 C CA  . ASN A 1 553  ? -36.603 -18.483 -3.630  1.00 137.87 ? 550  ASN A CA  1 
ATOM 4289 C C   . ASN A 1 553  ? -37.298 -18.424 -2.265  1.00 137.87 ? 550  ASN A C   1 
ATOM 4290 O O   . ASN A 1 553  ? -37.477 -19.461 -1.613  1.00 137.87 ? 550  ASN A O   1 
ATOM 4291 C CB  . ASN A 1 553  ? -37.441 -19.351 -4.579  1.00 185.15 ? 550  ASN A CB  1 
ATOM 4292 C CG  . ASN A 1 553  ? -36.679 -19.770 -5.818  1.00 185.15 ? 550  ASN A CG  1 
ATOM 4293 O OD1 . ASN A 1 553  ? -36.857 -19.188 -6.885  1.00 185.15 ? 550  ASN A OD1 1 
ATOM 4294 N ND2 . ASN A 1 553  ? -35.831 -20.790 -5.683  1.00 185.15 ? 550  ASN A ND2 1 
ATOM 4295 N N   . GLY A 1 554  ? -37.680 -17.219 -1.835  1.00 166.44 ? 551  GLY A N   1 
ATOM 4296 C CA  . GLY A 1 554  ? -38.422 -17.025 -0.579  1.00 166.44 ? 551  GLY A CA  1 
ATOM 4297 C C   . GLY A 1 554  ? -37.621 -17.180 0.709   1.00 166.44 ? 551  GLY A C   1 
ATOM 4298 O O   . GLY A 1 554  ? -37.523 -16.240 1.501   1.00 166.44 ? 551  GLY A O   1 
ATOM 4299 N N   . LEU A 1 555  ? -37.078 -18.378 0.923   1.00 131.82 ? 552  LEU A N   1 
ATOM 4300 C CA  . LEU A 1 555  ? -36.222 -18.690 2.065   1.00 131.82 ? 552  LEU A CA  1 
ATOM 4301 C C   . LEU A 1 555  ? -34.898 -17.954 1.890   1.00 131.82 ? 552  LEU A C   1 
ATOM 4302 O O   . LEU A 1 555  ? -34.134 -18.264 0.971   1.00 131.82 ? 552  LEU A O   1 
ATOM 4303 C CB  . LEU A 1 555  ? -35.978 -20.203 2.137   1.00 103.57 ? 552  LEU A CB  1 
ATOM 4304 C CG  . LEU A 1 555  ? -35.691 -20.864 3.493   1.00 103.57 ? 552  LEU A CG  1 
ATOM 4305 C CD1 . LEU A 1 555  ? -37.012 -21.252 4.181   1.00 103.57 ? 552  LEU A CD1 1 
ATOM 4306 C CD2 . LEU A 1 555  ? -34.754 -22.082 3.359   1.00 103.57 ? 552  LEU A CD2 1 
ATOM 4307 N N   . SER A 1 556  ? -34.626 -16.999 2.776   1.00 117.23 ? 553  SER A N   1 
ATOM 4308 C CA  . SER A 1 556  ? -33.543 -16.022 2.576   1.00 117.23 ? 553  SER A CA  1 
ATOM 4309 C C   . SER A 1 556  ? -32.257 -16.305 3.384   1.00 117.23 ? 553  SER A C   1 
ATOM 4310 O O   . SER A 1 556  ? -32.327 -16.455 4.603   1.00 117.23 ? 553  SER A O   1 
ATOM 4311 C CB  . SER A 1 556  ? -34.074 -14.612 2.877   1.00 104.26 ? 553  SER A CB  1 
ATOM 4312 O OG  . SER A 1 556  ? -33.334 -13.621 2.192   1.00 104.26 ? 553  SER A OG  1 
ATOM 4313 N N   . PRO A 1 557  ? -31.088 -16.403 2.694   1.00 182.68 ? 554  PRO A N   1 
ATOM 4314 C CA  . PRO A 1 557  ? -29.714 -16.521 3.251   1.00 182.68 ? 554  PRO A CA  1 
ATOM 4315 C C   . PRO A 1 557  ? -29.266 -15.422 4.252   1.00 182.68 ? 554  PRO A C   1 
ATOM 4316 O O   . PRO A 1 557  ? -30.057 -15.026 5.112   1.00 182.68 ? 554  PRO A O   1 
ATOM 4317 C CB  . PRO A 1 557  ? -28.825 -16.537 1.991   1.00 114.87 ? 554  PRO A CB  1 
ATOM 4318 C CG  . PRO A 1 557  ? -29.719 -17.093 0.931   1.00 114.87 ? 554  PRO A CG  1 
ATOM 4319 C CD  . PRO A 1 557  ? -31.063 -16.480 1.219   1.00 114.87 ? 554  PRO A CD  1 
ATOM 4320 N N   . LEU A 1 558  ? -28.015 -14.950 4.148   1.00 146.02 ? 555  LEU A N   1 
ATOM 4321 C CA  . LEU A 1 558  ? -27.410 -14.069 5.180   1.00 146.02 ? 555  LEU A CA  1 
ATOM 4322 C C   . LEU A 1 558  ? -28.039 -12.683 5.315   1.00 146.02 ? 555  LEU A C   1 
ATOM 4323 O O   . LEU A 1 558  ? -28.949 -12.339 4.565   1.00 146.02 ? 555  LEU A O   1 
ATOM 4324 C CB  . LEU A 1 558  ? -25.889 -13.950 5.019   1.00 112.98 ? 555  LEU A CB  1 
ATOM 4325 C CG  . LEU A 1 558  ? -25.290 -13.411 3.722   1.00 112.98 ? 555  LEU A CG  1 
ATOM 4326 C CD1 . LEU A 1 558  ? -24.197 -12.382 4.001   1.00 112.98 ? 555  LEU A CD1 1 
ATOM 4327 C CD2 . LEU A 1 558  ? -24.759 -14.582 2.898   1.00 112.98 ? 555  LEU A CD2 1 
ATOM 4328 N N   . CYS A 1 559  ? -27.550 -11.891 6.275   1.00 133.57 ? 556  CYS A N   1 
ATOM 4329 C CA  . CYS A 1 559  ? -28.176 -10.594 6.584   1.00 133.57 ? 556  CYS A CA  1 
ATOM 4330 C C   . CYS A 1 559  ? -27.300 -9.444  7.127   1.00 133.57 ? 556  CYS A C   1 
ATOM 4331 O O   . CYS A 1 559  ? -26.099 -9.597  7.366   1.00 133.57 ? 556  CYS A O   1 
ATOM 4332 C CB  . CYS A 1 559  ? -29.391 -10.790 7.500   1.00 153.88 ? 556  CYS A CB  1 
ATOM 4333 S SG  . CYS A 1 559  ? -30.531 -9.392  7.455   1.00 153.88 ? 556  CYS A SG  1 
ATOM 4334 N N   . ALA A 1 560  ? -27.958 -8.294  7.306   1.00 108.42 ? 557  ALA A N   1 
ATOM 4335 C CA  . ALA A 1 560  ? -27.340 -7.032  7.687   1.00 108.42 ? 557  ALA A CA  1 
ATOM 4336 C C   . ALA A 1 560  ? -28.275 -6.187  8.567   1.00 108.42 ? 557  ALA A C   1 
ATOM 4337 O O   . ALA A 1 560  ? -29.508 -6.211  8.412   1.00 108.42 ? 557  ALA A O   1 
ATOM 4338 C CB  . ALA A 1 560  ? -26.938 -6.263  6.451   1.00 205.19 ? 557  ALA A CB  1 
ATOM 4339 N N   . ILE A 1 561  ? -27.668 -5.417  9.468   1.00 66.14  ? 558  ILE A N   1 
ATOM 4340 C CA  . ILE A 1 561  ? -28.396 -4.760  10.536  1.00 66.14  ? 558  ILE A CA  1 
ATOM 4341 C C   . ILE A 1 561  ? -27.720 -3.453  10.969  1.00 66.14  ? 558  ILE A C   1 
ATOM 4342 O O   . ILE A 1 561  ? -26.490 -3.317  10.895  1.00 66.14  ? 558  ILE A O   1 
ATOM 4343 C CB  . ILE A 1 561  ? -28.506 -5.727  11.733  1.00 91.90  ? 558  ILE A CB  1 
ATOM 4344 C CG1 . ILE A 1 561  ? -29.565 -5.277  12.737  1.00 91.90  ? 558  ILE A CG1 1 
ATOM 4345 C CG2 . ILE A 1 561  ? -27.133 -5.944  12.391  1.00 91.90  ? 558  ILE A CG2 1 
ATOM 4346 C CD1 . ILE A 1 561  ? -30.029 -6.395  13.620  1.00 91.90  ? 558  ILE A CD1 1 
ATOM 4347 N N   . GLY A 1 562  ? -28.523 -2.493  11.430  1.00 52.39  ? 559  GLY A N   1 
ATOM 4348 C CA  . GLY A 1 562  ? -27.961 -1.251  11.980  1.00 52.39  ? 559  GLY A CA  1 
ATOM 4349 C C   . GLY A 1 562  ? -28.261 -1.052  13.457  1.00 52.39  ? 559  GLY A C   1 
ATOM 4350 O O   . GLY A 1 562  ? -29.417 -1.160  13.865  1.00 52.39  ? 559  GLY A O   1 
ATOM 4351 N N   . LEU A 1 563  ? -27.226 -0.776  14.236  1.00 69.55  ? 560  LEU A N   1 
ATOM 4352 C CA  . LEU A 1 563  ? -27.349 -0.630  15.675  1.00 69.55  ? 560  LEU A CA  1 
ATOM 4353 C C   . LEU A 1 563  ? -27.442 0.799   16.145  1.00 69.55  ? 560  LEU A C   1 
ATOM 4354 O O   . LEU A 1 563  ? -27.473 1.694   15.374  1.00 69.55  ? 560  LEU A O   1 
ATOM 4355 C CB  . LEU A 1 563  ? -26.217 -1.340  16.389  1.00 81.62  ? 560  LEU A CB  1 
ATOM 4356 C CG  . LEU A 1 563  ? -26.250 -2.849  16.286  1.00 81.62  ? 560  LEU A CG  1 
ATOM 4357 C CD1 . LEU A 1 563  ? -26.158 -3.389  17.651  1.00 81.62  ? 560  LEU A CD1 1 
ATOM 4358 C CD2 . LEU A 1 563  ? -27.516 -3.297  15.665  1.00 81.62  ? 560  LEU A CD2 1 
ATOM 4359 N N   . TRP A 1 564  ? -27.475 1.007   17.437  1.00 76.94  ? 561  TRP A N   1 
ATOM 4360 C CA  . TRP A 1 564  ? -28.003 2.237   17.968  1.00 76.94  ? 561  TRP A CA  1 
ATOM 4361 C C   . TRP A 1 564  ? -27.171 3.065   18.928  1.00 76.94  ? 561  TRP A C   1 
ATOM 4362 O O   . TRP A 1 564  ? -27.726 3.987   19.492  1.00 76.94  ? 561  TRP A O   1 
ATOM 4363 C CB  . TRP A 1 564  ? -29.248 1.886   18.746  1.00 71.58  ? 561  TRP A CB  1 
ATOM 4364 C CG  . TRP A 1 564  ? -30.491 2.460   18.313  1.00 71.58  ? 561  TRP A CG  1 
ATOM 4365 C CD1 . TRP A 1 564  ? -31.421 1.877   17.553  1.00 71.58  ? 561  TRP A CD1 1 
ATOM 4366 C CD2 . TRP A 1 564  ? -31.000 3.715   18.676  1.00 71.58  ? 561  TRP A CD2 1 
ATOM 4367 N NE1 . TRP A 1 564  ? -32.484 2.694   17.393  1.00 71.58  ? 561  TRP A NE1 1 
ATOM 4368 C CE2 . TRP A 1 564  ? -32.247 3.842   18.083  1.00 71.58  ? 561  TRP A CE2 1 
ATOM 4369 C CE3 . TRP A 1 564  ? -30.519 4.755   19.446  1.00 71.58  ? 561  TRP A CE3 1 
ATOM 4370 C CZ2 . TRP A 1 564  ? -33.017 4.965   18.218  1.00 71.58  ? 561  TRP A CZ2 1 
ATOM 4371 C CZ3 . TRP A 1 564  ? -31.289 5.870   19.580  1.00 71.58  ? 561  TRP A CZ3 1 
ATOM 4372 C CH2 . TRP A 1 564  ? -32.523 5.968   18.972  1.00 71.58  ? 561  TRP A CH2 1 
ATOM 4373 N N   . THR A 1 565  ? -25.907 2.773   19.183  1.00 87.70  ? 562  THR A N   1 
ATOM 4374 C CA  . THR A 1 565  ? -25.234 3.582   20.191  1.00 87.70  ? 562  THR A CA  1 
ATOM 4375 C C   . THR A 1 565  ? -23.834 3.826   19.820  1.00 87.70  ? 562  THR A C   1 
ATOM 4376 O O   . THR A 1 565  ? -23.252 4.869   20.018  1.00 87.70  ? 562  THR A O   1 
ATOM 4377 C CB  . THR A 1 565  ? -25.147 2.867   21.494  1.00 78.44  ? 562  THR A CB  1 
ATOM 4378 O OG1 . THR A 1 565  ? -26.115 3.410   22.377  1.00 78.44  ? 562  THR A OG1 1 
ATOM 4379 C CG2 . THR A 1 565  ? -23.832 3.129   22.086  1.00 78.44  ? 562  THR A CG2 1 
ATOM 4380 N N   . ASP A 1 566  ? -23.295 2.761   19.333  1.00 84.66  ? 563  ASP A N   1 
ATOM 4381 C CA  . ASP A 1 566  ? -22.030 2.677   18.652  1.00 84.66  ? 563  ASP A CA  1 
ATOM 4382 C C   . ASP A 1 566  ? -22.174 3.117   17.201  1.00 84.66  ? 563  ASP A C   1 
ATOM 4383 O O   . ASP A 1 566  ? -21.191 3.122   16.467  1.00 84.66  ? 563  ASP A O   1 
ATOM 4384 C CB  . ASP A 1 566  ? -21.556 1.243   18.679  1.00 77.98  ? 563  ASP A CB  1 
ATOM 4385 C CG  . ASP A 1 566  ? -22.355 0.374   17.757  1.00 77.98  ? 563  ASP A CG  1 
ATOM 4386 O OD1 . ASP A 1 566  ? -23.426 0.814   17.295  1.00 77.98  ? 563  ASP A OD1 1 
ATOM 4387 O OD2 . ASP A 1 566  ? -21.913 -0.752  17.484  1.00 77.98  ? 563  ASP A OD2 1 
ATOM 4388 N N   . ILE A 1 567  ? -23.398 3.460   16.791  1.00 127.96 ? 564  ILE A N   1 
ATOM 4389 C CA  . ILE A 1 567  ? -23.709 3.813   15.396  1.00 127.96 ? 564  ILE A CA  1 
ATOM 4390 C C   . ILE A 1 567  ? -22.944 2.896   14.436  1.00 127.96 ? 564  ILE A C   1 
ATOM 4391 O O   . ILE A 1 567  ? -21.830 3.205   14.006  1.00 127.96 ? 564  ILE A O   1 
ATOM 4392 C CB  . ILE A 1 567  ? -23.463 5.342   15.083  1.00 64.51  ? 564  ILE A CB  1 
ATOM 4393 C CG1 . ILE A 1 567  ? -24.529 6.225   15.765  1.00 64.51  ? 564  ILE A CG1 1 
ATOM 4394 C CG2 . ILE A 1 567  ? -23.442 5.607   13.557  1.00 64.51  ? 564  ILE A CG2 1 
ATOM 4395 C CD1 . ILE A 1 567  ? -24.116 6.829   17.106  1.00 64.51  ? 564  ILE A CD1 1 
ATOM 4396 N N   . SER A 1 568  ? -23.534 1.754   14.117  1.00 54.73  ? 565  SER A N   1 
ATOM 4397 C CA  . SER A 1 568  ? -22.794 0.766   13.353  1.00 54.73  ? 565  SER A CA  1 
ATOM 4398 C C   . SER A 1 568  ? -23.657 -0.181  12.559  1.00 54.73  ? 565  SER A C   1 
ATOM 4399 O O   . SER A 1 568  ? -24.797 -0.458  12.948  1.00 54.73  ? 565  SER A O   1 
ATOM 4400 C CB  . SER A 1 568  ? -21.951 -0.090  14.294  1.00 74.46  ? 565  SER A CB  1 
ATOM 4401 O OG  . SER A 1 568  ? -22.588 -1.342  14.517  1.00 74.46  ? 565  SER A OG  1 
ATOM 4402 N N   . ALA A 1 569  ? -23.080 -0.715  11.476  1.00 67.08  ? 566  ALA A N   1 
ATOM 4403 C CA  . ALA A 1 569  ? -23.707 -1.753  10.650  1.00 67.08  ? 566  ALA A CA  1 
ATOM 4404 C C   . ALA A 1 569  ? -22.774 -2.959  10.364  1.00 67.08  ? 566  ALA A C   1 
ATOM 4405 O O   . ALA A 1 569  ? -21.548 -2.814  10.194  1.00 67.08  ? 566  ALA A O   1 
ATOM 4406 C CB  . ALA A 1 569  ? -24.249 -1.157  9.366   1.00 101.03 ? 566  ALA A CB  1 
ATOM 4407 N N   . ARG A 1 570  ? -23.388 -4.146  10.293  1.00 80.14  ? 567  ARG A N   1 
ATOM 4408 C CA  . ARG A 1 570  ? -22.673 -5.426  10.402  1.00 80.14  ? 567  ARG A CA  1 
ATOM 4409 C C   . ARG A 1 570  ? -23.379 -6.569  9.677   1.00 80.14  ? 567  ARG A C   1 
ATOM 4410 O O   . ARG A 1 570  ? -24.602 -6.512  9.505   1.00 80.14  ? 567  ARG A O   1 
ATOM 4411 C CB  . ARG A 1 570  ? -22.482 -5.791  11.886  1.00 108.45 ? 567  ARG A CB  1 
ATOM 4412 C CG  . ARG A 1 570  ? -23.691 -5.497  12.778  1.00 108.45 ? 567  ARG A CG  1 
ATOM 4413 C CD  . ARG A 1 570  ? -23.309 -4.582  13.940  1.00 108.45 ? 567  ARG A CD  1 
ATOM 4414 N NE  . ARG A 1 570  ? -22.677 -5.299  15.049  1.00 108.45 ? 567  ARG A NE  1 
ATOM 4415 C CZ  . ARG A 1 570  ? -22.196 -4.729  16.152  1.00 108.45 ? 567  ARG A CZ  1 
ATOM 4416 N NH1 . ARG A 1 570  ? -22.257 -3.415  16.329  1.00 108.45 ? 567  ARG A NH1 1 
ATOM 4417 N NH2 . ARG A 1 570  ? -21.650 -5.482  17.092  1.00 108.45 ? 567  ARG A NH2 1 
ATOM 4418 N N   . ILE A 1 571  ? -22.609 -7.605  9.299   1.00 132.38 ? 568  ILE A N   1 
ATOM 4419 C CA  . ILE A 1 571  ? -23.067 -8.741  8.461   1.00 132.38 ? 568  ILE A CA  1 
ATOM 4420 C C   . ILE A 1 571  ? -23.264 -10.046 9.260   1.00 132.38 ? 568  ILE A C   1 
ATOM 4421 O O   . ILE A 1 571  ? -22.417 -10.389 10.084  1.00 132.38 ? 568  ILE A O   1 
ATOM 4422 C CB  . ILE A 1 571  ? -22.054 -9.047  7.311   1.00 195.54 ? 568  ILE A CB  1 
ATOM 4423 C CG1 . ILE A 1 571  ? -21.172 -7.831  6.958   1.00 195.54 ? 568  ILE A CG1 1 
ATOM 4424 C CG2 . ILE A 1 571  ? -22.772 -9.641  6.100   1.00 195.54 ? 568  ILE A CG2 1 
ATOM 4425 C CD1 . ILE A 1 571  ? -21.843 -6.722  6.153   1.00 195.54 ? 568  ILE A CD1 1 
ATOM 4426 N N   . LEU A 1 572  ? -24.360 -10.775 8.999   1.00 199.57 ? 569  LEU A N   1 
ATOM 4427 C CA  . LEU A 1 572  ? -24.753 -11.973 9.793   1.00 199.57 ? 569  LEU A CA  1 
ATOM 4428 C C   . LEU A 1 572  ? -25.456 -13.095 8.977   1.00 199.57 ? 569  LEU A C   1 
ATOM 4429 O O   . LEU A 1 572  ? -25.612 -12.948 7.765   1.00 199.57 ? 569  LEU A O   1 
ATOM 4430 C CB  . LEU A 1 572  ? -25.634 -11.552 10.984  1.00 163.47 ? 569  LEU A CB  1 
ATOM 4431 C CG  . LEU A 1 572  ? -25.009 -10.805 12.175  1.00 163.47 ? 569  LEU A CG  1 
ATOM 4432 C CD1 . LEU A 1 572  ? -24.961 -9.292  11.963  1.00 163.47 ? 569  LEU A CD1 1 
ATOM 4433 C CD2 . LEU A 1 572  ? -25.778 -11.119 13.446  1.00 163.47 ? 569  LEU A CD2 1 
ATOM 4434 N N   . LYS A 1 573  ? -25.861 -14.199 9.635   1.00 145.61 ? 570  LYS A N   1 
ATOM 4435 C CA  . LYS A 1 573  ? -26.617 -15.322 8.985   1.00 145.61 ? 570  LYS A CA  1 
ATOM 4436 C C   . LYS A 1 573  ? -28.056 -15.544 9.529   1.00 145.61 ? 570  LYS A C   1 
ATOM 4437 O O   . LYS A 1 573  ? -28.557 -14.709 10.279  1.00 145.61 ? 570  LYS A O   1 
ATOM 4438 C CB  . LYS A 1 573  ? -25.821 -16.641 8.998   1.00 73.76  ? 570  LYS A CB  1 
ATOM 4439 C CG  . LYS A 1 573  ? -26.241 -17.618 7.881   1.00 73.76  ? 570  LYS A CG  1 
ATOM 4440 C CD  . LYS A 1 573  ? -25.900 -19.082 8.195   1.00 73.76  ? 570  LYS A CD  1 
ATOM 4441 C CE  . LYS A 1 573  ? -27.148 -19.952 8.468   1.00 73.76  ? 570  LYS A CE  1 
ATOM 4442 N NZ  . LYS A 1 573  ? -27.718 -19.776 9.837   1.00 73.76  ? 570  LYS A NZ  1 
ATOM 4443 N N   . LEU A 1 574  ? -28.689 -16.674 9.164   1.00 209.00 ? 571  LEU A N   1 
ATOM 4444 C CA  . LEU A 1 574  ? -30.151 -16.908 9.356   1.00 209.00 ? 571  LEU A CA  1 
ATOM 4445 C C   . LEU A 1 574  ? -30.649 -17.443 10.730  1.00 209.00 ? 571  LEU A C   1 
ATOM 4446 O O   . LEU A 1 574  ? -30.971 -16.636 11.604  1.00 209.00 ? 571  LEU A O   1 
ATOM 4447 C CB  . LEU A 1 574  ? -30.757 -17.713 8.182   1.00 110.29 ? 571  LEU A CB  1 
ATOM 4448 C CG  . LEU A 1 574  ? -32.287 -17.878 8.162   1.00 110.29 ? 571  LEU A CG  1 
ATOM 4449 C CD1 . LEU A 1 574  ? -33.014 -16.525 8.080   1.00 110.29 ? 571  LEU A CD1 1 
ATOM 4450 C CD2 . LEU A 1 574  ? -32.695 -18.814 7.024   1.00 110.29 ? 571  LEU A CD2 1 
ATOM 4451 N N   . PRO A 1 575  ? -30.765 -18.785 10.919  1.00 198.00 ? 572  PRO A N   1 
ATOM 4452 C CA  . PRO A 1 575  ? -31.212 -19.175 12.259  1.00 198.00 ? 572  PRO A CA  1 
ATOM 4453 C C   . PRO A 1 575  ? -30.100 -19.056 13.309  1.00 198.00 ? 572  PRO A C   1 
ATOM 4454 O O   . PRO A 1 575  ? -30.383 -19.051 14.508  1.00 198.00 ? 572  PRO A O   1 
ATOM 4455 C CB  . PRO A 1 575  ? -31.637 -20.644 12.083  1.00 186.94 ? 572  PRO A CB  1 
ATOM 4456 C CG  . PRO A 1 575  ? -31.585 -20.916 10.611  1.00 186.94 ? 572  PRO A CG  1 
ATOM 4457 C CD  . PRO A 1 575  ? -30.575 -19.970 10.067  1.00 186.94 ? 572  PRO A CD  1 
ATOM 4458 N N   . SER A 1 576  ? -28.857 -18.934 12.846  1.00 148.52 ? 573  SER A N   1 
ATOM 4459 C CA  . SER A 1 576  ? -27.680 -18.891 13.712  1.00 148.52 ? 573  SER A CA  1 
ATOM 4460 C C   . SER A 1 576  ? -27.404 -17.508 14.313  1.00 148.52 ? 573  SER A C   1 
ATOM 4461 O O   . SER A 1 576  ? -27.304 -17.371 15.539  1.00 148.52 ? 573  SER A O   1 
ATOM 4462 C CB  . SER A 1 576  ? -26.450 -19.391 12.948  1.00 136.88 ? 573  SER A CB  1 
ATOM 4463 O OG  . SER A 1 576  ? -26.186 -18.575 11.820  1.00 136.88 ? 573  SER A OG  1 
ATOM 4464 N N   . PHE A 1 577  ? -27.286 -16.498 13.444  1.00 127.25 ? 574  PHE A N   1 
ATOM 4465 C CA  . PHE A 1 577  ? -27.021 -15.095 13.824  1.00 127.25 ? 574  PHE A CA  1 
ATOM 4466 C C   . PHE A 1 577  ? -25.525 -14.833 14.087  1.00 127.25 ? 574  PHE A C   1 
ATOM 4467 O O   . PHE A 1 577  ? -25.158 -14.029 14.944  1.00 127.25 ? 574  PHE A O   1 
ATOM 4468 C CB  . PHE A 1 577  ? -27.883 -14.644 15.027  1.00 105.57 ? 574  PHE A CB  1 
ATOM 4469 C CG  . PHE A 1 577  ? -29.382 -14.714 14.787  1.00 105.57 ? 574  PHE A CG  1 
ATOM 4470 C CD1 . PHE A 1 577  ? -30.097 -15.891 15.041  1.00 105.57 ? 574  PHE A CD1 1 
ATOM 4471 C CD2 . PHE A 1 577  ? -30.086 -13.592 14.337  1.00 105.57 ? 574  PHE A CD2 1 
ATOM 4472 C CE1 . PHE A 1 577  ? -31.482 -15.954 14.827  1.00 105.57 ? 574  PHE A CE1 1 
ATOM 4473 C CE2 . PHE A 1 577  ? -31.477 -13.644 14.126  1.00 105.57 ? 574  PHE A CE2 1 
ATOM 4474 C CZ  . PHE A 1 577  ? -32.175 -14.821 14.368  1.00 105.57 ? 574  PHE A CZ  1 
ATOM 4475 N N   . GLU A 1 578  ? -24.664 -15.511 13.339  1.00 142.47 ? 575  GLU A N   1 
ATOM 4476 C CA  . GLU A 1 578  ? -23.222 -15.374 13.526  1.00 142.47 ? 575  GLU A CA  1 
ATOM 4477 C C   . GLU A 1 578  ? -22.658 -14.118 12.856  1.00 142.47 ? 575  GLU A C   1 
ATOM 4478 O O   . GLU A 1 578  ? -22.866 -13.879 11.667  1.00 142.47 ? 575  GLU A O   1 
ATOM 4479 C CB  . GLU A 1 578  ? -22.493 -16.645 13.068  1.00 145.07 ? 575  GLU A CB  1 
ATOM 4480 C CG  . GLU A 1 578  ? -23.109 -17.316 11.834  1.00 145.07 ? 575  GLU A CG  1 
ATOM 4481 C CD  . GLU A 1 578  ? -23.251 -18.827 11.978  1.00 145.07 ? 575  GLU A CD  1 
ATOM 4482 O OE1 . GLU A 1 578  ? -23.198 -19.331 13.125  1.00 145.07 ? 575  GLU A OE1 1 
ATOM 4483 O OE2 . GLU A 1 578  ? -23.444 -19.514 10.946  1.00 145.07 ? 575  GLU A OE2 1 
ATOM 4484 N N   . LEU A 1 579  ? -21.949 -13.327 13.654  1.00 92.07  ? 576  LEU A N   1 
ATOM 4485 C CA  . LEU A 1 579  ? -21.385 -12.030 13.250  1.00 92.07  ? 576  LEU A CA  1 
ATOM 4486 C C   . LEU A 1 579  ? -20.108 -12.148 12.399  1.00 92.07  ? 576  LEU A C   1 
ATOM 4487 O O   . LEU A 1 579  ? -19.140 -12.788 12.804  1.00 92.07  ? 576  LEU A O   1 
ATOM 4488 C CB  . LEU A 1 579  ? -21.128 -11.167 14.510  1.00 108.41 ? 576  LEU A CB  1 
ATOM 4489 C CG  . LEU A 1 579  ? -20.398 -9.797  14.582  1.00 108.41 ? 576  LEU A CG  1 
ATOM 4490 C CD1 . LEU A 1 579  ? -18.879 -9.920  14.843  1.00 108.41 ? 576  LEU A CD1 1 
ATOM 4491 C CD2 . LEU A 1 579  ? -20.685 -8.846  13.390  1.00 108.41 ? 576  LEU A CD2 1 
ATOM 4492 N N   . LEU A 1 580  ? -20.107 -11.502 11.234  1.00 202.90 ? 577  LEU A N   1 
ATOM 4493 C CA  . LEU A 1 580  ? -18.968 -11.548 10.311  1.00 202.90 ? 577  LEU A CA  1 
ATOM 4494 C C   . LEU A 1 580  ? -18.103 -10.284 10.396  1.00 202.90 ? 577  LEU A C   1 
ATOM 4495 O O   . LEU A 1 580  ? -17.856 -9.764  11.489  1.00 202.90 ? 577  LEU A O   1 
ATOM 4496 C CB  . LEU A 1 580  ? -19.464 -11.769 8.877   1.00 110.69 ? 577  LEU A CB  1 
ATOM 4497 C CG  . LEU A 1 580  ? -20.082 -13.129 8.522   1.00 110.69 ? 577  LEU A CG  1 
ATOM 4498 C CD1 . LEU A 1 580  ? -21.558 -13.235 8.896   1.00 110.69 ? 577  LEU A CD1 1 
ATOM 4499 C CD2 . LEU A 1 580  ? -19.907 -13.401 7.039   1.00 110.69 ? 577  LEU A CD2 1 
ATOM 4500 N N   . HIS A 1 581  ? -17.623 -9.812  9.245   1.00 105.60 ? 578  HIS A N   1 
ATOM 4501 C CA  . HIS A 1 581  ? -17.010 -8.484  9.128   1.00 105.60 ? 578  HIS A CA  1 
ATOM 4502 C C   . HIS A 1 581  ? -18.048 -7.370  9.387   1.00 105.60 ? 578  HIS A C   1 
ATOM 4503 O O   . HIS A 1 581  ? -19.266 -7.614  9.403   1.00 105.60 ? 578  HIS A O   1 
ATOM 4504 C CB  . HIS A 1 581  ? -16.352 -8.316  7.747   1.00 136.18 ? 578  HIS A CB  1 
ATOM 4505 C CG  . HIS A 1 581  ? -16.082 -6.890  7.375   1.00 136.18 ? 578  HIS A CG  1 
ATOM 4506 N ND1 . HIS A 1 581  ? -14.968 -6.206  7.811   1.00 136.18 ? 578  HIS A ND1 1 
ATOM 4507 C CD2 . HIS A 1 581  ? -16.795 -6.012  6.629   1.00 136.18 ? 578  HIS A CD2 1 
ATOM 4508 C CE1 . HIS A 1 581  ? -14.997 -4.973  7.341   1.00 136.18 ? 578  HIS A CE1 1 
ATOM 4509 N NE2 . HIS A 1 581  ? -16.101 -4.826  6.629   1.00 136.18 ? 578  HIS A NE2 1 
ATOM 4510 N N   . LYS A 1 582  ? -17.557 -6.152  9.601   1.00 107.53 ? 579  LYS A N   1 
ATOM 4511 C CA  . LYS A 1 582  ? -18.422 -4.997  9.868   1.00 107.53 ? 579  LYS A CA  1 
ATOM 4512 C C   . LYS A 1 582  ? -17.793 -3.620  9.509   1.00 107.53 ? 579  LYS A C   1 
ATOM 4513 O O   . LYS A 1 582  ? -16.652 -3.526  9.016   1.00 107.53 ? 579  LYS A O   1 
ATOM 4514 C CB  . LYS A 1 582  ? -18.897 -5.024  11.335  1.00 77.56  ? 579  LYS A CB  1 
ATOM 4515 C CG  . LYS A 1 582  ? -17.782 -5.240  12.374  1.00 77.56  ? 579  LYS A CG  1 
ATOM 4516 C CD  . LYS A 1 582  ? -18.122 -4.609  13.718  1.00 77.56  ? 579  LYS A CD  1 
ATOM 4517 C CE  . LYS A 1 582  ? -18.045 -3.076  13.651  1.00 77.56  ? 579  LYS A CE  1 
ATOM 4518 N NZ  . LYS A 1 582  ? -18.396 -2.410  14.957  1.00 77.56  ? 579  LYS A NZ  1 
ATOM 4519 N N   . GLU A 1 583  ? -18.566 -2.560  9.755   1.00 111.63 ? 580  GLU A N   1 
ATOM 4520 C CA  . GLU A 1 583  ? -18.090 -1.191  9.610   1.00 111.63 ? 580  GLU A CA  1 
ATOM 4521 C C   . GLU A 1 583  ? -18.524 -0.394  10.831  1.00 111.63 ? 580  GLU A C   1 
ATOM 4522 O O   . GLU A 1 583  ? -19.636 -0.566  11.325  1.00 111.63 ? 580  GLU A O   1 
ATOM 4523 C CB  . GLU A 1 583  ? -18.658 -0.571  8.330   1.00 126.43 ? 580  GLU A CB  1 
ATOM 4524 C CG  . GLU A 1 583  ? -17.987 0.731   7.889   1.00 126.43 ? 580  GLU A CG  1 
ATOM 4525 C CD  . GLU A 1 583  ? -16.501 0.575   7.643   1.00 126.43 ? 580  GLU A CD  1 
ATOM 4526 O OE1 . GLU A 1 583  ? -16.088 -0.407  6.978   1.00 126.43 ? 580  GLU A OE1 1 
ATOM 4527 O OE2 . GLU A 1 583  ? -15.746 1.446   8.123   1.00 126.43 ? 580  GLU A OE2 1 
ATOM 4528 N N   . MET A 1 584  ? -17.645 0.472   11.320  1.00 143.76 ? 581  MET A N   1 
ATOM 4529 C CA  . MET A 1 584  ? -17.955 1.285   12.495  1.00 143.76 ? 581  MET A CA  1 
ATOM 4530 C C   . MET A 1 584  ? -18.105 2.773   12.128  1.00 143.76 ? 581  MET A C   1 
ATOM 4531 O O   . MET A 1 584  ? -17.314 3.610   12.579  1.00 143.76 ? 581  MET A O   1 
ATOM 4532 C CB  . MET A 1 584  ? -16.890 1.078   13.594  1.00 97.38  ? 581  MET A CB  1 
ATOM 4533 C CG  . MET A 1 584  ? -17.320 1.498   15.023  1.00 97.38  ? 581  MET A CG  1 
ATOM 4534 S SD  . MET A 1 584  ? -18.017 0.147   16.020  1.00 97.38  ? 581  MET A SD  1 
ATOM 4535 C CE  . MET A 1 584  ? -16.513 -0.530  16.772  1.00 97.38  ? 581  MET A CE  1 
ATOM 4536 N N   . LEU A 1 585  ? -19.124 3.089   11.318  1.00 74.09  ? 582  LEU A N   1 
ATOM 4537 C CA  . LEU A 1 585  ? -19.434 4.484   10.895  1.00 74.09  ? 582  LEU A CA  1 
ATOM 4538 C C   . LEU A 1 585  ? -19.434 5.464   12.078  1.00 74.09  ? 582  LEU A C   1 
ATOM 4539 O O   . LEU A 1 585  ? -19.607 5.060   13.244  1.00 74.09  ? 582  LEU A O   1 
ATOM 4540 C CB  . LEU A 1 585  ? -20.789 4.561   10.168  1.00 45.76  ? 582  LEU A CB  1 
ATOM 4541 C CG  . LEU A 1 585  ? -21.471 3.223   9.807   1.00 45.76  ? 582  LEU A CG  1 
ATOM 4542 C CD1 . LEU A 1 585  ? -23.037 3.255   9.919   1.00 45.76  ? 582  LEU A CD1 1 
ATOM 4543 C CD2 . LEU A 1 585  ? -21.028 2.657   8.456   1.00 45.76  ? 582  LEU A CD2 1 
ATOM 4544 N N   . GLY A 1 586  ? -19.247 6.747   11.780  1.00 77.20  ? 583  GLY A N   1 
ATOM 4545 C CA  . GLY A 1 586  ? -19.054 7.744   12.829  1.00 77.20  ? 583  GLY A CA  1 
ATOM 4546 C C   . GLY A 1 586  ? -20.305 8.450   13.323  1.00 77.20  ? 583  GLY A C   1 
ATOM 4547 O O   . GLY A 1 586  ? -21.419 7.968   13.152  1.00 77.20  ? 583  GLY A O   1 
ATOM 4548 N N   . GLY A 1 587  ? -20.112 9.606   13.950  1.00 96.97  ? 584  GLY A N   1 
ATOM 4549 C CA  . GLY A 1 587  ? -21.216 10.451  14.390  1.00 96.97  ? 584  GLY A CA  1 
ATOM 4550 C C   . GLY A 1 587  ? -22.086 9.925   15.522  1.00 96.97  ? 584  GLY A C   1 
ATOM 4551 O O   . GLY A 1 587  ? -21.835 8.852   16.096  1.00 96.97  ? 584  GLY A O   1 
ATOM 4552 N N   . GLU A 1 588  ? -23.118 10.708  15.822  1.00 161.29 ? 585  GLU A N   1 
ATOM 4553 C CA  . GLU A 1 588  ? -24.059 10.429  16.898  1.00 161.29 ? 585  GLU A CA  1 
ATOM 4554 C C   . GLU A 1 588  ? -25.480 10.245  16.327  1.00 161.29 ? 585  GLU A C   1 
ATOM 4555 O O   . GLU A 1 588  ? -26.446 10.075  17.074  1.00 161.29 ? 585  GLU A O   1 
ATOM 4556 C CB  . GLU A 1 588  ? -24.007 11.552  17.957  1.00 106.90 ? 585  GLU A CB  1 
ATOM 4557 C CG  . GLU A 1 588  ? -22.616 12.227  18.145  1.00 106.90 ? 585  GLU A CG  1 
ATOM 4558 C CD  . GLU A 1 588  ? -21.616 11.420  19.003  1.00 106.90 ? 585  GLU A CD  1 
ATOM 4559 O OE1 . GLU A 1 588  ? -21.628 10.164  18.981  1.00 106.90 ? 585  GLU A OE1 1 
ATOM 4560 O OE2 . GLU A 1 588  ? -20.793 12.064  19.698  1.00 106.90 ? 585  GLU A OE2 1 
ATOM 4561 N N   . ILE A 1 589  ? -25.581 10.272  14.995  1.00 84.94  ? 586  ILE A N   1 
ATOM 4562 C CA  . ILE A 1 589  ? -26.843 10.090  14.266  1.00 84.94  ? 586  ILE A CA  1 
ATOM 4563 C C   . ILE A 1 589  ? -26.886 8.656   13.749  1.00 84.94  ? 586  ILE A C   1 
ATOM 4564 O O   . ILE A 1 589  ? -25.892 8.181   13.192  1.00 84.94  ? 586  ILE A O   1 
ATOM 4565 C CB  . ILE A 1 589  ? -26.971 11.130  13.079  1.00 83.42  ? 586  ILE A CB  1 
ATOM 4566 C CG1 . ILE A 1 589  ? -27.402 12.526  13.590  1.00 83.42  ? 586  ILE A CG1 1 
ATOM 4567 C CG2 . ILE A 1 589  ? -27.887 10.610  11.960  1.00 83.42  ? 586  ILE A CG2 1 
ATOM 4568 C CD1 . ILE A 1 589  ? -28.887 12.667  14.029  1.00 83.42  ? 586  ILE A CD1 1 
ATOM 4569 N N   . ILE A 1 590  ? -27.995 7.959   13.975  1.00 85.59  ? 587  ILE A N   1 
ATOM 4570 C CA  . ILE A 1 590  ? -28.105 6.551   13.597  1.00 85.59  ? 587  ILE A CA  1 
ATOM 4571 C C   . ILE A 1 590  ? -28.569 6.280   12.170  1.00 85.59  ? 587  ILE A C   1 
ATOM 4572 O O   . ILE A 1 590  ? -29.117 7.154   11.498  1.00 85.59  ? 587  ILE A O   1 
ATOM 4573 C CB  . ILE A 1 590  ? -29.030 5.786   14.567  1.00 58.60  ? 587  ILE A CB  1 
ATOM 4574 C CG1 . ILE A 1 590  ? -30.450 6.353   14.509  1.00 58.60  ? 587  ILE A CG1 1 
ATOM 4575 C CG2 . ILE A 1 590  ? -28.483 5.846   15.985  1.00 58.60  ? 587  ILE A CG2 1 
ATOM 4576 C CD1 . ILE A 1 590  ? -31.423 5.659   15.436  1.00 58.60  ? 587  ILE A CD1 1 
ATOM 4577 N N   . PRO A 1 591  ? -28.354 5.050   11.713  1.00 59.97  ? 588  PRO A N   1 
ATOM 4578 C CA  . PRO A 1 591  ? -28.765 4.646   10.365  1.00 59.97  ? 588  PRO A CA  1 
ATOM 4579 C C   . PRO A 1 591  ? -30.265 4.374   10.308  1.00 59.97  ? 588  PRO A C   1 
ATOM 4580 O O   . PRO A 1 591  ? -30.724 3.349   10.811  1.00 59.97  ? 588  PRO A O   1 
ATOM 4581 C CB  . PRO A 1 591  ? -27.986 3.351   10.140  1.00 59.13  ? 588  PRO A CB  1 
ATOM 4582 C CG  . PRO A 1 591  ? -27.775 2.789   11.508  1.00 59.13  ? 588  PRO A CG  1 
ATOM 4583 C CD  . PRO A 1 591  ? -27.827 3.921   12.500  1.00 59.13  ? 588  PRO A CD  1 
ATOM 4584 N N   . ARG A 1 592  ? -31.015 5.289   9.702   1.00 68.28  ? 589  ARG A N   1 
ATOM 4585 C CA  . ARG A 1 592  ? -32.463 5.149   9.596   1.00 68.28  ? 589  ARG A CA  1 
ATOM 4586 C C   . ARG A 1 592  ? -32.872 4.009   8.666   1.00 68.28  ? 589  ARG A C   1 
ATOM 4587 O O   . ARG A 1 592  ? -33.972 3.469   8.782   1.00 68.28  ? 589  ARG A O   1 
ATOM 4588 C CB  . ARG A 1 592  ? -33.093 6.462   9.122   1.00 122.07 ? 589  ARG A CB  1 
ATOM 4589 C CG  . ARG A 1 592  ? -34.605 6.407   8.975   1.00 122.07 ? 589  ARG A CG  1 
ATOM 4590 C CD  . ARG A 1 592  ? -35.023 5.359   7.956   1.00 122.07 ? 589  ARG A CD  1 
ATOM 4591 N NE  . ARG A 1 592  ? -36.473 5.297   7.799   1.00 122.07 ? 589  ARG A NE  1 
ATOM 4592 C CZ  . ARG A 1 592  ? -37.100 4.471   6.968   1.00 122.07 ? 589  ARG A CZ  1 
ATOM 4593 N NH1 . ARG A 1 592  ? -36.403 3.630   6.215   1.00 122.07 ? 589  ARG A NH1 1 
ATOM 4594 N NH2 . ARG A 1 592  ? -38.423 4.483   6.890   1.00 122.07 ? 589  ARG A NH2 1 
ATOM 4595 N N   . SER A 1 593  ? -31.985 3.648   7.745   1.00 55.65  ? 590  SER A N   1 
ATOM 4596 C CA  . SER A 1 593  ? -32.268 2.576   6.797   1.00 55.65  ? 590  SER A CA  1 
ATOM 4597 C C   . SER A 1 593  ? -31.041 1.710   6.528   1.00 55.65  ? 590  SER A C   1 
ATOM 4598 O O   . SER A 1 593  ? -29.926 2.054   6.921   1.00 55.65  ? 590  SER A O   1 
ATOM 4599 C CB  . SER A 1 593  ? -32.801 3.152   5.482   1.00 83.84  ? 590  SER A CB  1 
ATOM 4600 O OG  . SER A 1 593  ? -33.080 2.122   4.550   1.00 83.84  ? 590  SER A OG  1 
ATOM 4601 N N   . ILE A 1 594  ? -31.258 0.584   5.856   1.00 80.57  ? 591  ILE A N   1 
ATOM 4602 C CA  . ILE A 1 594  ? -30.178 -0.338  5.527   1.00 80.57  ? 591  ILE A CA  1 
ATOM 4603 C C   . ILE A 1 594  ? -30.715 -1.615  4.889   1.00 80.57  ? 591  ILE A C   1 
ATOM 4604 O O   . ILE A 1 594  ? -30.961 -2.607  5.575   1.00 80.57  ? 591  ILE A O   1 
ATOM 4605 C CB  . ILE A 1 594  ? -29.351 -0.707  6.773   1.00 87.98  ? 591  ILE A CB  1 
ATOM 4606 C CG1 . ILE A 1 594  ? -28.183 -1.617  6.388   1.00 87.98  ? 591  ILE A CG1 1 
ATOM 4607 C CG2 . ILE A 1 594  ? -30.231 -1.374  7.818   1.00 87.98  ? 591  ILE A CG2 1 
ATOM 4608 C CD1 . ILE A 1 594  ? -27.225 -0.995  5.396   1.00 87.98  ? 591  ILE A CD1 1 
ATOM 4609 N N   . LEU A 1 595  ? -30.894 -1.583  3.572   1.00 82.74  ? 592  LEU A N   1 
ATOM 4610 C CA  . LEU A 1 595  ? -31.401 -2.737  2.839   1.00 82.74  ? 592  LEU A CA  1 
ATOM 4611 C C   . LEU A 1 595  ? -30.390 -3.215  1.803   1.00 82.74  ? 592  LEU A C   1 
ATOM 4612 O O   . LEU A 1 595  ? -29.426 -2.514  1.493   1.00 82.74  ? 592  LEU A O   1 
ATOM 4613 C CB  . LEU A 1 595  ? -32.730 -2.399  2.160   1.00 142.22 ? 592  LEU A CB  1 
ATOM 4614 C CG  . LEU A 1 595  ? -33.905 -2.086  3.089   1.00 142.22 ? 592  LEU A CG  1 
ATOM 4615 C CD1 . LEU A 1 595  ? -35.115 -1.627  2.291   1.00 142.22 ? 592  LEU A CD1 1 
ATOM 4616 C CD2 . LEU A 1 595  ? -34.250 -3.296  3.945   1.00 142.22 ? 592  LEU A CD2 1 
ATOM 4617 N N   . MET A 1 596  ? -30.615 -4.412  1.269   1.00 131.05 ? 593  MET A N   1 
ATOM 4618 C CA  . MET A 1 596  ? -29.722 -4.982  0.268   1.00 131.05 ? 593  MET A CA  1 
ATOM 4619 C C   . MET A 1 596  ? -30.444 -5.199  -1.057  1.00 131.05 ? 593  MET A C   1 
ATOM 4620 O O   . MET A 1 596  ? -31.674 -5.194  -1.113  1.00 131.05 ? 593  MET A O   1 
ATOM 4621 C CB  . MET A 1 596  ? -29.130 -6.301  0.767   1.00 113.12 ? 593  MET A CB  1 
ATOM 4622 C CG  . MET A 1 596  ? -30.167 -7.367  1.081   1.00 113.12 ? 593  MET A CG  1 
ATOM 4623 S SD  . MET A 1 596  ? -29.429 -8.905  1.666   1.00 113.12 ? 593  MET A SD  1 
ATOM 4624 C CE  . MET A 1 596  ? -28.572 -8.333  3.131   1.00 113.12 ? 593  MET A CE  1 
ATOM 4625 N N   . THR A 1 597  ? -29.672 -5.390  -2.122  1.00 180.18 ? 594  THR A N   1 
ATOM 4626 C CA  . THR A 1 597  ? -30.238 -5.610  -3.452  1.00 180.18 ? 594  THR A CA  1 
ATOM 4627 C C   . THR A 1 597  ? -29.173 -5.971  -4.491  1.00 180.18 ? 594  THR A C   1 
ATOM 4628 O O   . THR A 1 597  ? -27.987 -6.058  -4.175  1.00 180.18 ? 594  THR A O   1 
ATOM 4629 C CB  . THR A 1 597  ? -31.016 -4.375  -3.946  1.00 78.90  ? 594  THR A CB  1 
ATOM 4630 O OG1 . THR A 1 597  ? -30.140 -3.242  -3.993  1.00 78.90  ? 594  THR A OG1 1 
ATOM 4631 C CG2 . THR A 1 597  ? -32.181 -4.071  -3.016  1.00 78.90  ? 594  THR A CG2 1 
ATOM 4632 N N   . THR A 1 598  ? -29.611 -6.179  -5.731  1.00 95.95  ? 595  THR A N   1 
ATOM 4633 C CA  . THR A 1 598  ? -28.712 -6.529  -6.829  1.00 95.95  ? 595  THR A CA  1 
ATOM 4634 C C   . THR A 1 598  ? -29.209 -5.940  -8.149  1.00 95.95  ? 595  THR A C   1 
ATOM 4635 O O   . THR A 1 598  ? -30.004 -5.000  -8.152  1.00 95.95  ? 595  THR A O   1 
ATOM 4636 C CB  . THR A 1 598  ? -28.568 -8.054  -6.978  1.00 182.85 ? 595  THR A CB  1 
ATOM 4637 O OG1 . THR A 1 598  ? -28.049 -8.609  -5.763  1.00 182.85 ? 595  THR A OG1 1 
ATOM 4638 C CG2 . THR A 1 598  ? -27.628 -8.391  -8.125  1.00 182.85 ? 595  THR A CG2 1 
ATOM 4639 N N   . PHE A 1 599  ? -28.744 -6.491  -9.268  1.00 160.50 ? 596  PHE A N   1 
ATOM 4640 C CA  . PHE A 1 599  ? -29.166 -5.995  -10.586 1.00 160.50 ? 596  PHE A CA  1 
ATOM 4641 C C   . PHE A 1 599  ? -28.859 -6.937  -11.755 1.00 160.50 ? 596  PHE A C   1 
ATOM 4642 O O   . PHE A 1 599  ? -29.775 -7.428  -12.427 1.00 160.50 ? 596  PHE A O   1 
ATOM 4643 C CB  . PHE A 1 599  ? -28.592 -4.596  -10.828 1.00 115.50 ? 596  PHE A CB  1 
ATOM 4644 C CG  . PHE A 1 599  ? -29.276 -3.529  -10.021 1.00 115.50 ? 596  PHE A CG  1 
ATOM 4645 C CD1 . PHE A 1 599  ? -28.738 -3.101  -8.801  1.00 115.50 ? 596  PHE A CD1 1 
ATOM 4646 C CD2 . PHE A 1 599  ? -30.486 -2.976  -10.456 1.00 115.50 ? 596  PHE A CD2 1 
ATOM 4647 C CE1 . PHE A 1 599  ? -29.382 -2.124  -8.040  1.00 115.50 ? 596  PHE A CE1 1 
ATOM 4648 C CE2 . PHE A 1 599  ? -31.129 -1.998  -9.707  1.00 115.50 ? 596  PHE A CE2 1 
ATOM 4649 C CZ  . PHE A 1 599  ? -30.581 -1.570  -8.499  1.00 115.50 ? 596  PHE A CZ  1 
ATOM 4650 N N   . GLU A 1 600  ? -27.574 -7.162  -12.009 1.00 180.52 ? 597  GLU A N   1 
ATOM 4651 C CA  . GLU A 1 600  ? -27.147 -8.117  -13.024 1.00 180.52 ? 597  GLU A CA  1 
ATOM 4652 C C   . GLU A 1 600  ? -26.074 -9.031  -12.428 1.00 180.52 ? 597  GLU A C   1 
ATOM 4653 O O   . GLU A 1 600  ? -26.313 -10.228 -12.237 1.00 180.52 ? 597  GLU A O   1 
ATOM 4654 C CB  . GLU A 1 600  ? -26.616 -7.420  -14.293 1.00 152.63 ? 597  GLU A CB  1 
ATOM 4655 C CG  . GLU A 1 600  ? -27.133 -5.994  -14.561 1.00 152.63 ? 597  GLU A CG  1 
ATOM 4656 C CD  . GLU A 1 600  ? -26.184 -4.893  -14.051 1.00 152.63 ? 597  GLU A CD  1 
ATOM 4657 O OE1 . GLU A 1 600  ? -24.975 -5.171  -13.841 1.00 152.63 ? 597  GLU A OE1 1 
ATOM 4658 O OE2 . GLU A 1 600  ? -26.647 -3.737  -13.875 1.00 152.63 ? 597  GLU A OE2 1 
ATOM 4659 N N   . SER A 1 601  ? -24.912 -8.452  -12.116 1.00 189.45 ? 598  SER A N   1 
ATOM 4660 C CA  . SER A 1 601  ? -23.758 -9.212  -11.629 1.00 189.45 ? 598  SER A CA  1 
ATOM 4661 C C   . SER A 1 601  ? -23.059 -8.551  -10.434 1.00 189.45 ? 598  SER A C   1 
ATOM 4662 O O   . SER A 1 601  ? -21.869 -8.225  -10.500 1.00 189.45 ? 598  SER A O   1 
ATOM 4663 C CB  . SER A 1 601  ? -22.755 -9.461  -12.765 1.00 143.92 ? 598  SER A CB  1 
ATOM 4664 O OG  . SER A 1 601  ? -23.328 -10.229 -13.808 1.00 143.92 ? 598  SER A OG  1 
ATOM 4665 N N   . SER A 1 602  ? -23.814 -8.355  -9.354  1.00 207.83 ? 599  SER A N   1 
ATOM 4666 C CA  . SER A 1 602  ? -23.276 -7.921  -8.059  1.00 207.83 ? 599  SER A CA  1 
ATOM 4667 C C   . SER A 1 602  ? -24.425 -7.849  -7.051  1.00 207.83 ? 599  SER A C   1 
ATOM 4668 O O   . SER A 1 602  ? -25.520 -7.385  -7.382  1.00 207.83 ? 599  SER A O   1 
ATOM 4669 C CB  . SER A 1 602  ? -22.544 -6.565  -8.164  1.00 131.22 ? 599  SER A CB  1 
ATOM 4670 O OG  . SER A 1 602  ? -21.515 -6.424  -7.192  1.00 131.22 ? 599  SER A OG  1 
ATOM 4671 N N   . HIS A 1 603  ? -24.187 -8.346  -5.839  1.00 207.82 ? 600  HIS A N   1 
ATOM 4672 C CA  . HIS A 1 603  ? -25.103 -8.120  -4.724  1.00 207.82 ? 600  HIS A CA  1 
ATOM 4673 C C   . HIS A 1 603  ? -24.644 -6.868  -3.972  1.00 207.82 ? 600  HIS A C   1 
ATOM 4674 O O   . HIS A 1 603  ? -23.448 -6.563  -3.934  1.00 207.82 ? 600  HIS A O   1 
ATOM 4675 C CB  . HIS A 1 603  ? -25.177 -9.340  -3.797  1.00 93.80  ? 600  HIS A CB  1 
ATOM 4676 C CG  . HIS A 1 603  ? -25.783 -10.549 -4.438  1.00 93.80  ? 600  HIS A CG  1 
ATOM 4677 N ND1 . HIS A 1 603  ? -27.100 -10.911 -4.247  1.00 93.80  ? 600  HIS A ND1 1 
ATOM 4678 C CD2 . HIS A 1 603  ? -25.254 -11.475 -5.275  1.00 93.80  ? 600  HIS A CD2 1 
ATOM 4679 C CE1 . HIS A 1 603  ? -27.354 -12.010 -4.937  1.00 93.80  ? 600  HIS A CE1 1 
ATOM 4680 N NE2 . HIS A 1 603  ? -26.252 -12.374 -5.568  1.00 93.80  ? 600  HIS A NE2 1 
ATOM 4681 N N   . TYR A 1 604  ? -25.596 -6.144  -3.388  1.00 106.88 ? 601  TYR A N   1 
ATOM 4682 C CA  . TYR A 1 604  ? -25.328 -4.820  -2.822  1.00 106.88 ? 601  TYR A CA  1 
ATOM 4683 C C   . TYR A 1 604  ? -25.894 -4.598  -1.400  1.00 106.88 ? 601  TYR A C   1 
ATOM 4684 O O   . TYR A 1 604  ? -26.990 -5.069  -1.055  1.00 106.88 ? 601  TYR A O   1 
ATOM 4685 C CB  . TYR A 1 604  ? -25.892 -3.728  -3.744  1.00 125.74 ? 601  TYR A CB  1 
ATOM 4686 C CG  . TYR A 1 604  ? -25.391 -3.689  -5.185  1.00 125.74 ? 601  TYR A CG  1 
ATOM 4687 C CD1 . TYR A 1 604  ? -26.086 -4.343  -6.208  1.00 125.74 ? 601  TYR A CD1 1 
ATOM 4688 C CD2 . TYR A 1 604  ? -24.263 -2.936  -5.538  1.00 125.74 ? 601  TYR A CD2 1 
ATOM 4689 C CE1 . TYR A 1 604  ? -25.653 -4.272  -7.543  1.00 125.74 ? 601  TYR A CE1 1 
ATOM 4690 C CE2 . TYR A 1 604  ? -23.820 -2.864  -6.871  1.00 125.74 ? 601  TYR A CE2 1 
ATOM 4691 C CZ  . TYR A 1 604  ? -24.522 -3.534  -7.863  1.00 125.74 ? 601  TYR A CZ  1 
ATOM 4692 O OH  . TYR A 1 604  ? -24.102 -3.473  -9.173  1.00 125.74 ? 601  TYR A OH  1 
ATOM 4693 N N   . LEU A 1 605  ? -25.123 -3.870  -0.591  1.00 137.85 ? 602  LEU A N   1 
ATOM 4694 C CA  . LEU A 1 605  ? -25.601 -3.330  0.679   1.00 137.85 ? 602  LEU A CA  1 
ATOM 4695 C C   . LEU A 1 605  ? -25.399 -1.829  0.735   1.00 137.85 ? 602  LEU A C   1 
ATOM 4696 O O   . LEU A 1 605  ? -24.316 -1.318  0.424   1.00 137.85 ? 602  LEU A O   1 
ATOM 4697 C CB  . LEU A 1 605  ? -24.912 -3.985  1.880   1.00 116.57 ? 602  LEU A CB  1 
ATOM 4698 C CG  . LEU A 1 605  ? -24.762 -3.146  3.166   1.00 116.57 ? 602  LEU A CG  1 
ATOM 4699 C CD1 . LEU A 1 605  ? -25.179 -3.920  4.398   1.00 116.57 ? 602  LEU A CD1 1 
ATOM 4700 C CD2 . LEU A 1 605  ? -23.348 -2.556  3.321   1.00 116.57 ? 602  LEU A CD2 1 
ATOM 4701 N N   . LEU A 1 606  ? -26.449 -1.127  1.150   1.00 112.83 ? 603  LEU A N   1 
ATOM 4702 C CA  . LEU A 1 606  ? -26.371 0.312   1.346   1.00 112.83 ? 603  LEU A CA  1 
ATOM 4703 C C   . LEU A 1 606  ? -26.989 0.670   2.677   1.00 112.83 ? 603  LEU A C   1 
ATOM 4704 O O   . LEU A 1 606  ? -27.871 -0.035  3.187   1.00 112.83 ? 603  LEU A O   1 
ATOM 4705 C CB  . LEU A 1 606  ? -27.087 1.075   0.229   1.00 106.84 ? 603  LEU A CB  1 
ATOM 4706 C CG  . LEU A 1 606  ? -27.418 0.389   -1.100  1.00 106.84 ? 603  LEU A CG  1 
ATOM 4707 C CD1 . LEU A 1 606  ? -28.676 -0.485  -0.991  1.00 106.84 ? 603  LEU A CD1 1 
ATOM 4708 C CD2 . LEU A 1 606  ? -27.596 1.440   -2.169  1.00 106.84 ? 603  LEU A CD2 1 
ATOM 4709 N N   . CYS A 1 607  ? -26.521 1.782   3.225   1.00 47.71  ? 604  CYS A N   1 
ATOM 4710 C CA  . CYS A 1 607  ? -26.960 2.208   4.535   1.00 47.71  ? 604  CYS A CA  1 
ATOM 4711 C C   . CYS A 1 607  ? -27.216 3.727   4.702   1.00 47.71  ? 604  CYS A C   1 
ATOM 4712 O O   . CYS A 1 607  ? -26.269 4.533   4.815   1.00 47.71  ? 604  CYS A O   1 
ATOM 4713 C CB  . CYS A 1 607  ? -25.966 1.732   5.601   1.00 77.83  ? 604  CYS A CB  1 
ATOM 4714 S SG  . CYS A 1 607  ? -26.407 2.286   7.268   1.00 77.83  ? 604  CYS A SG  1 
ATOM 4715 N N   . ALA A 1 608  ? -28.495 4.109   4.767   1.00 67.44  ? 605  ALA A N   1 
ATOM 4716 C CA  . ALA A 1 608  ? -28.857 5.517   4.969   1.00 67.44  ? 605  ALA A CA  1 
ATOM 4717 C C   . ALA A 1 608  ? -28.744 5.870   6.427   1.00 67.44  ? 605  ALA A C   1 
ATOM 4718 O O   . ALA A 1 608  ? -29.093 5.058   7.276   1.00 67.44  ? 605  ALA A O   1 
ATOM 4719 C CB  . ALA A 1 608  ? -30.267 5.762   4.504   1.00 56.54  ? 605  ALA A CB  1 
ATOM 4720 N N   . LEU A 1 609  ? -28.264 7.076   6.711   1.00 63.69  ? 606  LEU A N   1 
ATOM 4721 C CA  . LEU A 1 609  ? -28.390 7.654   8.051   1.00 63.69  ? 606  LEU A CA  1 
ATOM 4722 C C   . LEU A 1 609  ? -29.381 8.789   8.108   1.00 63.69  ? 606  LEU A C   1 
ATOM 4723 O O   . LEU A 1 609  ? -29.937 9.222   7.098   1.00 63.69  ? 606  LEU A O   1 
ATOM 4724 C CB  . LEU A 1 609  ? -27.084 8.241   8.566   1.00 60.24  ? 606  LEU A CB  1 
ATOM 4725 C CG  . LEU A 1 609  ? -25.739 7.576   8.423   1.00 60.24  ? 606  LEU A CG  1 
ATOM 4726 C CD1 . LEU A 1 609  ? -24.846 8.455   9.247   1.00 60.24  ? 606  LEU A CD1 1 
ATOM 4727 C CD2 . LEU A 1 609  ? -25.769 6.131   8.927   1.00 60.24  ? 606  LEU A CD2 1 
ATOM 4728 N N   . GLY A 1 610  ? -29.532 9.317   9.307   1.00 51.11  ? 607  GLY A N   1 
ATOM 4729 C CA  . GLY A 1 610  ? -30.547 10.311  9.575   1.00 51.11  ? 607  GLY A CA  1 
ATOM 4730 C C   . GLY A 1 610  ? -30.080 11.734  9.328   1.00 51.11  ? 607  GLY A C   1 
ATOM 4731 O O   . GLY A 1 610  ? -30.889 12.662  9.382   1.00 51.11  ? 607  GLY A O   1 
ATOM 4732 N N   . ASP A 1 611  ? -28.790 11.924  9.068   1.00 99.64  ? 608  ASP A N   1 
ATOM 4733 C CA  . ASP A 1 611  ? -28.295 13.261  8.764   1.00 99.64  ? 608  ASP A CA  1 
ATOM 4734 C C   . ASP A 1 611  ? -28.434 13.524  7.273   1.00 99.64  ? 608  ASP A C   1 
ATOM 4735 O O   . ASP A 1 611  ? -28.031 14.572  6.777   1.00 99.64  ? 608  ASP A O   1 
ATOM 4736 C CB  . ASP A 1 611  ? -26.837 13.412  9.188   1.00 97.40  ? 608  ASP A CB  1 
ATOM 4737 C CG  . ASP A 1 611  ? -25.912 12.478  8.424   1.00 97.40  ? 608  ASP A CG  1 
ATOM 4738 O OD1 . ASP A 1 611  ? -24.705 12.788  8.334   1.00 97.40  ? 608  ASP A OD1 1 
ATOM 4739 O OD2 . ASP A 1 611  ? -26.392 11.433  7.913   1.00 97.40  ? 608  ASP A OD2 1 
ATOM 4740 N N   . GLY A 1 612  ? -28.996 12.558  6.560   1.00 86.82  ? 609  GLY A N   1 
ATOM 4741 C CA  . GLY A 1 612  ? -29.172 12.679  5.125   1.00 86.82  ? 609  GLY A CA  1 
ATOM 4742 C C   . GLY A 1 612  ? -28.132 11.906  4.345   1.00 86.82  ? 609  GLY A C   1 
ATOM 4743 O O   . GLY A 1 612  ? -28.424 11.318  3.297   1.00 86.82  ? 609  GLY A O   1 
ATOM 4744 N N   . ALA A 1 613  ? -26.913 11.895  4.866   1.00 61.19  ? 610  ALA A N   1 
ATOM 4745 C CA  . ALA A 1 613  ? -25.783 11.235  4.201   1.00 61.19  ? 610  ALA A CA  1 
ATOM 4746 C C   . ALA A 1 613  ? -25.973 9.724   3.986   1.00 61.19  ? 610  ALA A C   1 
ATOM 4747 O O   . ALA A 1 613  ? -26.901 9.127   4.534   1.00 61.19  ? 610  ALA A O   1 
ATOM 4748 C CB  . ALA A 1 613  ? -24.473 11.531  4.956   1.00 101.90 ? 610  ALA A CB  1 
ATOM 4749 N N   . LEU A 1 614  ? -25.100 9.126   3.177   1.00 88.25  ? 611  LEU A N   1 
ATOM 4750 C CA  . LEU A 1 614  ? -25.194 7.715   2.850   1.00 88.25  ? 611  LEU A CA  1 
ATOM 4751 C C   . LEU A 1 614  ? -23.848 7.041   2.551   1.00 88.25  ? 611  LEU A C   1 
ATOM 4752 O O   . LEU A 1 614  ? -23.003 7.598   1.842   1.00 88.25  ? 611  LEU A O   1 
ATOM 4753 C CB  . LEU A 1 614  ? -26.128 7.528   1.667   1.00 60.55  ? 611  LEU A CB  1 
ATOM 4754 C CG  . LEU A 1 614  ? -26.270 6.085   1.193   1.00 60.55  ? 611  LEU A CG  1 
ATOM 4755 C CD1 . LEU A 1 614  ? -27.671 5.845   0.617   1.00 60.55  ? 611  LEU A CD1 1 
ATOM 4756 C CD2 . LEU A 1 614  ? -25.165 5.678   0.202   1.00 60.55  ? 611  LEU A CD2 1 
ATOM 4757 N N   . PHE A 1 615  ? -23.685 5.825   3.076   1.00 85.53  ? 612  PHE A N   1 
ATOM 4758 C CA  . PHE A 1 615  ? -22.493 5.010   2.865   1.00 85.53  ? 612  PHE A CA  1 
ATOM 4759 C C   . PHE A 1 615  ? -22.857 3.803   2.007   1.00 85.53  ? 612  PHE A C   1 
ATOM 4760 O O   . PHE A 1 615  ? -23.925 3.210   2.197   1.00 85.53  ? 612  PHE A O   1 
ATOM 4761 C CB  . PHE A 1 615  ? -21.919 4.554   4.208   1.00 83.03  ? 612  PHE A CB  1 
ATOM 4762 C CG  . PHE A 1 615  ? -21.522 5.681   5.121   1.00 83.03  ? 612  PHE A CG  1 
ATOM 4763 C CD1 . PHE A 1 615  ? -22.405 6.159   6.078   1.00 83.03  ? 612  PHE A CD1 1 
ATOM 4764 C CD2 . PHE A 1 615  ? -20.256 6.254   5.039   1.00 83.03  ? 612  PHE A CD2 1 
ATOM 4765 C CE1 . PHE A 1 615  ? -22.037 7.206   6.942   1.00 83.03  ? 612  PHE A CE1 1 
ATOM 4766 C CE2 . PHE A 1 615  ? -19.875 7.300   5.898   1.00 83.03  ? 612  PHE A CE2 1 
ATOM 4767 C CZ  . PHE A 1 615  ? -20.770 7.780   6.849   1.00 83.03  ? 612  PHE A CZ  1 
ATOM 4768 N N   . TYR A 1 616  ? -21.973 3.439   1.077   1.00 145.07 ? 613  TYR A N   1 
ATOM 4769 C CA  . TYR A 1 616  ? -22.311 2.434   0.061   1.00 145.07 ? 613  TYR A CA  1 
ATOM 4770 C C   . TYR A 1 616  ? -21.289 1.324   -0.164  1.00 145.07 ? 613  TYR A C   1 
ATOM 4771 O O   . TYR A 1 616  ? -20.083 1.584   -0.189  1.00 145.07 ? 613  TYR A O   1 
ATOM 4772 C CB  . TYR A 1 616  ? -22.674 3.094   -1.273  1.00 151.51 ? 613  TYR A CB  1 
ATOM 4773 C CG  . TYR A 1 616  ? -21.850 4.301   -1.693  1.00 151.51 ? 613  TYR A CG  1 
ATOM 4774 C CD1 . TYR A 1 616  ? -22.037 5.547   -1.087  1.00 151.51 ? 613  TYR A CD1 1 
ATOM 4775 C CD2 . TYR A 1 616  ? -20.931 4.212   -2.741  1.00 151.51 ? 613  TYR A CD2 1 
ATOM 4776 C CE1 . TYR A 1 616  ? -21.317 6.660   -1.486  1.00 151.51 ? 613  TYR A CE1 1 
ATOM 4777 C CE2 . TYR A 1 616  ? -20.204 5.326   -3.152  1.00 151.51 ? 613  TYR A CE2 1 
ATOM 4778 C CZ  . TYR A 1 616  ? -20.408 6.544   -2.518  1.00 151.51 ? 613  TYR A CZ  1 
ATOM 4779 O OH  . TYR A 1 616  ? -19.700 7.652   -2.909  1.00 151.51 ? 613  TYR A OH  1 
ATOM 4780 N N   . PHE A 1 617  ? -21.800 0.100   -0.355  1.00 102.98 ? 614  PHE A N   1 
ATOM 4781 C CA  . PHE A 1 617  ? -20.991 -1.128  -0.395  1.00 102.98 ? 614  PHE A CA  1 
ATOM 4782 C C   . PHE A 1 617  ? -21.617 -2.279  -1.242  1.00 102.98 ? 614  PHE A C   1 
ATOM 4783 O O   . PHE A 1 617  ? -22.837 -2.494  -1.228  1.00 102.98 ? 614  PHE A O   1 
ATOM 4784 C CB  . PHE A 1 617  ? -20.705 -1.641  1.047   1.00 99.31  ? 614  PHE A CB  1 
ATOM 4785 C CG  . PHE A 1 617  ? -19.977 -0.637  1.953   1.00 99.31  ? 614  PHE A CG  1 
ATOM 4786 C CD1 . PHE A 1 617  ? -20.666 0.043   2.969   1.00 99.31  ? 614  PHE A CD1 1 
ATOM 4787 C CD2 . PHE A 1 617  ? -18.606 -0.383  1.796   1.00 99.31  ? 614  PHE A CD2 1 
ATOM 4788 C CE1 . PHE A 1 617  ? -20.007 0.973   3.803   1.00 99.31  ? 614  PHE A CE1 1 
ATOM 4789 C CE2 . PHE A 1 617  ? -17.945 0.529   2.625   1.00 99.31  ? 614  PHE A CE2 1 
ATOM 4790 C CZ  . PHE A 1 617  ? -18.647 1.212   3.630   1.00 99.31  ? 614  PHE A CZ  1 
ATOM 4791 N N   . GLY A 1 618  ? -20.757 -3.018  -1.954  1.00 118.47 ? 615  GLY A N   1 
ATOM 4792 C CA  . GLY A 1 618  ? -21.118 -4.268  -2.647  1.00 118.47 ? 615  GLY A CA  1 
ATOM 4793 C C   . GLY A 1 618  ? -20.780 -5.538  -1.865  1.00 118.47 ? 615  GLY A C   1 
ATOM 4794 O O   . GLY A 1 618  ? -19.806 -5.594  -1.109  1.00 118.47 ? 615  GLY A O   1 
ATOM 4795 N N   . LEU A 1 619  ? -21.582 -6.581  -2.057  1.00 209.00 ? 616  LEU A N   1 
ATOM 4796 C CA  . LEU A 1 619  ? -21.481 -7.776  -1.214  1.00 209.00 ? 616  LEU A CA  1 
ATOM 4797 C C   . LEU A 1 619  ? -21.276 -9.095  -1.970  1.00 209.00 ? 616  LEU A C   1 
ATOM 4798 O O   . LEU A 1 619  ? -21.002 -9.110  -3.175  1.00 209.00 ? 616  LEU A O   1 
ATOM 4799 C CB  . LEU A 1 619  ? -22.698 -7.864  -0.279  1.00 180.08 ? 616  LEU A CB  1 
ATOM 4800 C CG  . LEU A 1 619  ? -22.574 -8.676  1.021   1.00 180.08 ? 616  LEU A CG  1 
ATOM 4801 C CD1 . LEU A 1 619  ? -21.425 -8.162  1.899   1.00 180.08 ? 616  LEU A CD1 1 
ATOM 4802 C CD2 . LEU A 1 619  ? -23.896 -8.686  1.786   1.00 180.08 ? 616  LEU A CD2 1 
ATOM 4803 N N   . ASN A 1 620  ? -21.404 -10.198 -1.232  1.00 125.14 ? 617  ASN A N   1 
ATOM 4804 C CA  . ASN A 1 620  ? -21.116 -11.533 -1.723  1.00 125.14 ? 617  ASN A CA  1 
ATOM 4805 C C   . ASN A 1 620  ? -22.083 -12.504 -1.097  1.00 125.14 ? 617  ASN A C   1 
ATOM 4806 O O   . ASN A 1 620  ? -22.071 -12.673 0.126   1.00 125.14 ? 617  ASN A O   1 
ATOM 4807 C CB  . ASN A 1 620  ? -19.712 -11.940 -1.306  1.00 93.28  ? 617  ASN A CB  1 
ATOM 4808 C CG  . ASN A 1 620  ? -18.741 -10.796 -1.369  1.00 93.28  ? 617  ASN A CG  1 
ATOM 4809 O OD1 . ASN A 1 620  ? -18.395 -10.328 -2.455  1.00 93.28  ? 617  ASN A OD1 1 
ATOM 4810 N ND2 . ASN A 1 620  ? -18.309 -10.314 -0.204  1.00 93.28  ? 617  ASN A ND2 1 
ATOM 4811 N N   . ILE A 1 621  ? -22.911 -13.135 -1.931  1.00 204.78 ? 618  ILE A N   1 
ATOM 4812 C CA  . ILE A 1 621  ? -23.895 -14.135 -1.484  1.00 204.78 ? 618  ILE A CA  1 
ATOM 4813 C C   . ILE A 1 621  ? -23.284 -15.290 -0.678  1.00 204.78 ? 618  ILE A C   1 
ATOM 4814 O O   . ILE A 1 621  ? -23.939 -15.851 0.204   1.00 204.78 ? 618  ILE A O   1 
ATOM 4815 C CB  . ILE A 1 621  ? -24.742 -14.711 -2.668  1.00 156.26 ? 618  ILE A CB  1 
ATOM 4816 C CG1 . ILE A 1 621  ? -24.058 -14.444 -4.024  1.00 156.26 ? 618  ILE A CG1 1 
ATOM 4817 C CG2 . ILE A 1 621  ? -26.172 -14.158 -2.617  1.00 156.26 ? 618  ILE A CG2 1 
ATOM 4818 C CD1 . ILE A 1 621  ? -24.567 -15.297 -5.188  1.00 156.26 ? 618  ILE A CD1 1 
ATOM 4819 N N   . GLU A 1 622  ? -22.032 -15.630 -0.985  1.00 188.91 ? 619  GLU A N   1 
ATOM 4820 C CA  . GLU A 1 622  ? -21.323 -16.726 -0.323  1.00 188.91 ? 619  GLU A CA  1 
ATOM 4821 C C   . GLU A 1 622  ? -20.605 -16.220 0.921   1.00 188.91 ? 619  GLU A C   1 
ATOM 4822 O O   . GLU A 1 622  ? -21.019 -16.497 2.048   1.00 188.91 ? 619  GLU A O   1 
ATOM 4823 C CB  . GLU A 1 622  ? -20.286 -17.357 -1.263  1.00 175.69 ? 619  GLU A CB  1 
ATOM 4824 C CG  . GLU A 1 622  ? -20.478 -17.088 -2.752  1.00 175.69 ? 619  GLU A CG  1 
ATOM 4825 C CD  . GLU A 1 622  ? -21.323 -18.137 -3.441  1.00 175.69 ? 619  GLU A CD  1 
ATOM 4826 O OE1 . GLU A 1 622  ? -22.511 -18.286 -3.082  1.00 175.69 ? 619  GLU A OE1 1 
ATOM 4827 O OE2 . GLU A 1 622  ? -20.797 -18.806 -4.354  1.00 175.69 ? 619  GLU A OE2 1 
ATOM 4828 N N   . THR A 1 623  ? -19.527 -15.470 0.687   1.00 195.44 ? 620  THR A N   1 
ATOM 4829 C CA  . THR A 1 623  ? -18.602 -15.045 1.732   1.00 195.44 ? 620  THR A CA  1 
ATOM 4830 C C   . THR A 1 623  ? -19.226 -14.128 2.776   1.00 195.44 ? 620  THR A C   1 
ATOM 4831 O O   . THR A 1 623  ? -19.732 -14.601 3.791   1.00 195.44 ? 620  THR A O   1 
ATOM 4832 C CB  . THR A 1 623  ? -17.299 -14.412 1.150   1.00 89.92  ? 620  THR A CB  1 
ATOM 4833 O OG1 . THR A 1 623  ? -16.877 -13.323 1.981   1.00 89.92  ? 620  THR A OG1 1 
ATOM 4834 C CG2 . THR A 1 623  ? -17.497 -13.906 -0.286  1.00 89.92  ? 620  THR A CG2 1 
ATOM 4835 N N   . GLY A 1 624  ? -19.196 -12.823 2.514   1.00 206.92 ? 621  GLY A N   1 
ATOM 4836 C CA  . GLY A 1 624  ? -19.523 -11.816 3.517   1.00 206.92 ? 621  GLY A CA  1 
ATOM 4837 C C   . GLY A 1 624  ? -18.281 -11.018 3.872   1.00 206.92 ? 621  GLY A C   1 
ATOM 4838 O O   . GLY A 1 624  ? -17.534 -11.383 4.784   1.00 206.92 ? 621  GLY A O   1 
ATOM 4839 N N   . LEU A 1 625  ? -18.067 -9.929  3.140   1.00 163.39 ? 622  LEU A N   1 
ATOM 4840 C CA  . LEU A 1 625  ? -16.874 -9.092  3.266   1.00 163.39 ? 622  LEU A CA  1 
ATOM 4841 C C   . LEU A 1 625  ? -17.241 -7.600  3.205   1.00 163.39 ? 622  LEU A C   1 
ATOM 4842 O O   . LEU A 1 625  ? -18.417 -7.256  3.082   1.00 163.39 ? 622  LEU A O   1 
ATOM 4843 C CB  . LEU A 1 625  ? -15.866 -9.455  2.157   1.00 91.09  ? 622  LEU A CB  1 
ATOM 4844 C CG  . LEU A 1 625  ? -14.607 -10.313 2.419   1.00 91.09  ? 622  LEU A CG  1 
ATOM 4845 C CD1 . LEU A 1 625  ? -14.881 -11.758 2.907   1.00 91.09  ? 622  LEU A CD1 1 
ATOM 4846 C CD2 . LEU A 1 625  ? -13.705 -10.315 1.169   1.00 91.09  ? 622  LEU A CD2 1 
ATOM 4847 N N   . LEU A 1 626  ? -16.235 -6.727  3.296   1.00 120.49 ? 623  LEU A N   1 
ATOM 4848 C CA  . LEU A 1 626  ? -16.412 -5.271  3.153   1.00 120.49 ? 623  LEU A CA  1 
ATOM 4849 C C   . LEU A 1 626  ? -16.690 -4.921  1.682   1.00 120.49 ? 623  LEU A C   1 
ATOM 4850 O O   . LEU A 1 626  ? -17.211 -5.751  0.926   1.00 120.49 ? 623  LEU A O   1 
ATOM 4851 C CB  . LEU A 1 626  ? -15.153 -4.529  3.653   1.00 158.60 ? 623  LEU A CB  1 
ATOM 4852 C CG  . LEU A 1 626  ? -15.162 -3.159  4.372   1.00 158.60 ? 623  LEU A CG  1 
ATOM 4853 C CD1 . LEU A 1 626  ? -13.781 -2.855  4.936   1.00 158.60 ? 623  LEU A CD1 1 
ATOM 4854 C CD2 . LEU A 1 626  ? -15.625 -1.994  3.516   1.00 158.60 ? 623  LEU A CD2 1 
ATOM 4855 N N   . SER A 1 627  ? -16.345 -3.684  1.303   1.00 170.90 ? 624  SER A N   1 
ATOM 4856 C CA  . SER A 1 627  ? -16.366 -3.173  -0.079  1.00 170.90 ? 624  SER A CA  1 
ATOM 4857 C C   . SER A 1 627  ? -15.786 -1.759  -0.173  1.00 170.90 ? 624  SER A C   1 
ATOM 4858 O O   . SER A 1 627  ? -14.663 -1.519  0.288   1.00 170.90 ? 624  SER A O   1 
ATOM 4859 C CB  . SER A 1 627  ? -17.772 -3.190  -0.672  1.00 82.55  ? 624  SER A CB  1 
ATOM 4860 O OG  . SER A 1 627  ? -18.625 -2.312  0.042   1.00 82.55  ? 624  SER A OG  1 
ATOM 4861 N N   . ASP A 1 628  ? -16.562 -0.832  -0.755  1.00 126.38 ? 625  ASP A N   1 
ATOM 4862 C CA  . ASP A 1 628  ? -16.078 0.524   -1.074  1.00 126.38 ? 625  ASP A CA  1 
ATOM 4863 C C   . ASP A 1 628  ? -16.649 1.653   -0.205  1.00 126.38 ? 625  ASP A C   1 
ATOM 4864 O O   . ASP A 1 628  ? -17.774 2.112   -0.429  1.00 126.38 ? 625  ASP A O   1 
ATOM 4865 C CB  . ASP A 1 628  ? -16.322 0.839   -2.557  1.00 180.53 ? 625  ASP A CB  1 
ATOM 4866 C CG  . ASP A 1 628  ? -15.233 0.289   -3.461  1.00 180.53 ? 625  ASP A CG  1 
ATOM 4867 O OD1 . ASP A 1 628  ? -14.846 -0.890  -3.295  1.00 180.53 ? 625  ASP A OD1 1 
ATOM 4868 O OD2 . ASP A 1 628  ? -14.763 1.038   -4.343  1.00 180.53 ? 625  ASP A OD2 1 
ATOM 4869 N N   . ARG A 1 629  ? -15.862 2.117   0.764   1.00 151.08 ? 626  ARG A N   1 
ATOM 4870 C CA  . ARG A 1 629  ? -16.333 3.161   1.670   1.00 151.08 ? 626  ARG A CA  1 
ATOM 4871 C C   . ARG A 1 629  ? -16.305 4.538   1.041   1.00 151.08 ? 626  ARG A C   1 
ATOM 4872 O O   . ARG A 1 629  ? -15.238 5.082   0.755   1.00 151.08 ? 626  ARG A O   1 
ATOM 4873 C CB  . ARG A 1 629  ? -15.553 3.183   2.987   1.00 133.13 ? 626  ARG A CB  1 
ATOM 4874 C CG  . ARG A 1 629  ? -16.102 4.181   4.008   1.00 133.13 ? 626  ARG A CG  1 
ATOM 4875 C CD  . ARG A 1 629  ? -15.120 4.396   5.151   1.00 133.13 ? 626  ARG A CD  1 
ATOM 4876 N NE  . ARG A 1 629  ? -15.589 5.369   6.142   1.00 133.13 ? 626  ARG A NE  1 
ATOM 4877 C CZ  . ARG A 1 629  ? -16.382 5.081   7.175   1.00 133.13 ? 626  ARG A CZ  1 
ATOM 4878 N NH1 . ARG A 1 629  ? -16.824 3.844   7.363   1.00 133.13 ? 626  ARG A NH1 1 
ATOM 4879 N NH2 . ARG A 1 629  ? -16.746 6.039   8.019   1.00 133.13 ? 626  ARG A NH2 1 
ATOM 4880 N N   . LYS A 1 630  ? -17.498 5.082   0.823   1.00 78.42  ? 627  LYS A N   1 
ATOM 4881 C CA  . LYS A 1 630  ? -17.674 6.497   0.482   1.00 78.42  ? 627  LYS A CA  1 
ATOM 4882 C C   . LYS A 1 630  ? -18.995 7.054   1.081   1.00 78.42  ? 627  LYS A C   1 
ATOM 4883 O O   . LYS A 1 630  ? -19.863 6.291   1.521   1.00 78.42  ? 627  LYS A O   1 
ATOM 4884 C CB  . LYS A 1 630  ? -17.581 6.740   -1.039  1.00 90.73  ? 627  LYS A CB  1 
ATOM 4885 C CG  . LYS A 1 630  ? -16.501 5.958   -1.804  1.00 90.73  ? 627  LYS A CG  1 
ATOM 4886 C CD  . LYS A 1 630  ? -16.546 6.255   -3.291  1.00 90.73  ? 627  LYS A CD  1 
ATOM 4887 C CE  . LYS A 1 630  ? -16.102 7.694   -3.578  1.00 90.73  ? 627  LYS A CE  1 
ATOM 4888 N NZ  . LYS A 1 630  ? -14.680 7.945   -3.153  1.00 90.73  ? 627  LYS A NZ  1 
ATOM 4889 N N   . LYS A 1 631  ? -19.123 8.383   1.079   1.00 76.89  ? 628  LYS A N   1 
ATOM 4890 C CA  . LYS A 1 631  ? -20.129 9.091   1.857   1.00 76.89  ? 628  LYS A CA  1 
ATOM 4891 C C   . LYS A 1 631  ? -20.779 10.255  1.070   1.00 76.89  ? 628  LYS A C   1 
ATOM 4892 O O   . LYS A 1 631  ? -20.292 11.390  1.110   1.00 76.89  ? 628  LYS A O   1 
ATOM 4893 C CB  . LYS A 1 631  ? -19.485 9.608   3.151   1.00 71.54  ? 628  LYS A CB  1 
ATOM 4894 C CG  . LYS A 1 631  ? -20.455 10.116  4.194   1.00 71.54  ? 628  LYS A CG  1 
ATOM 4895 C CD  . LYS A 1 631  ? -19.763 10.884  5.321   1.00 71.54  ? 628  LYS A CD  1 
ATOM 4896 C CE  . LYS A 1 631  ? -20.801 11.689  6.154   1.00 71.54  ? 628  LYS A CE  1 
ATOM 4897 N NZ  . LYS A 1 631  ? -20.201 12.813  6.967   1.00 71.54  ? 628  LYS A NZ  1 
ATOM 4898 N N   . VAL A 1 632  ? -21.890 9.966   0.380   1.00 101.66 ? 629  VAL A N   1 
ATOM 4899 C CA  . VAL A 1 632  ? -22.664 10.983  -0.364  1.00 101.66 ? 629  VAL A CA  1 
ATOM 4900 C C   . VAL A 1 632  ? -23.419 11.950  0.547   1.00 101.66 ? 629  VAL A C   1 
ATOM 4901 O O   . VAL A 1 632  ? -23.048 12.148  1.711   1.00 101.66 ? 629  VAL A O   1 
ATOM 4902 C CB  . VAL A 1 632  ? -23.668 10.361  -1.372  1.00 67.90  ? 629  VAL A CB  1 
ATOM 4903 C CG1 . VAL A 1 632  ? -23.030 10.154  -2.718  1.00 67.90  ? 629  VAL A CG1 1 
ATOM 4904 C CG2 . VAL A 1 632  ? -24.174 9.071   -0.858  1.00 67.90  ? 629  VAL A CG2 1 
ATOM 4905 N N   . THR A 1 633  ? -24.468 12.571  0.016   1.00 85.64  ? 630  THR A N   1 
ATOM 4906 C CA  . THR A 1 633  ? -25.213 13.544  0.814   1.00 85.64  ? 630  THR A CA  1 
ATOM 4907 C C   . THR A 1 633  ? -26.736 13.604  0.617   1.00 85.64  ? 630  THR A C   1 
ATOM 4908 O O   . THR A 1 633  ? -27.467 13.874  1.578   1.00 85.64  ? 630  THR A O   1 
ATOM 4909 C CB  . THR A 1 633  ? -24.630 14.949  0.694   1.00 89.73  ? 630  THR A CB  1 
ATOM 4910 O OG1 . THR A 1 633  ? -25.259 15.784  1.670   1.00 89.73  ? 630  THR A OG1 1 
ATOM 4911 C CG2 . THR A 1 633  ? -24.855 15.521  -0.711  1.00 89.73  ? 630  THR A CG2 1 
ATOM 4912 N N   . LEU A 1 634  ? -27.211 13.361  -0.600  1.00 67.43  ? 631  LEU A N   1 
ATOM 4913 C CA  . LEU A 1 634  ? -28.652 13.381  -0.883  1.00 67.43  ? 631  LEU A CA  1 
ATOM 4914 C C   . LEU A 1 634  ? -29.407 14.461  -0.069  1.00 67.43  ? 631  LEU A C   1 
ATOM 4915 O O   . LEU A 1 634  ? -29.073 15.656  -0.164  1.00 67.43  ? 631  LEU A O   1 
ATOM 4916 C CB  . LEU A 1 634  ? -29.256 11.983  -0.715  1.00 60.78  ? 631  LEU A CB  1 
ATOM 4917 C CG  . LEU A 1 634  ? -28.555 10.788  -1.411  1.00 60.78  ? 631  LEU A CG  1 
ATOM 4918 C CD1 . LEU A 1 634  ? -29.572 9.705   -1.700  1.00 60.78  ? 631  LEU A CD1 1 
ATOM 4919 C CD2 . LEU A 1 634  ? -27.786 11.110  -2.706  1.00 60.78  ? 631  LEU A CD2 1 
ATOM 4920 N N   . GLY A 1 635  ? -30.396 14.070  0.732   1.00 75.84  ? 632  GLY A N   1 
ATOM 4921 C CA  . GLY A 1 635  ? -31.158 15.067  1.484   1.00 75.84  ? 632  GLY A CA  1 
ATOM 4922 C C   . GLY A 1 635  ? -30.416 15.557  2.708   1.00 75.84  ? 632  GLY A C   1 
ATOM 4923 O O   . GLY A 1 635  ? -29.255 15.218  2.917   1.00 75.84  ? 632  GLY A O   1 
ATOM 4924 N N   . THR A 1 636  ? -31.089 16.372  3.516   1.00 83.88  ? 633  THR A N   1 
ATOM 4925 C CA  . THR A 1 636  ? -30.607 16.701  4.856   1.00 83.88  ? 633  THR A CA  1 
ATOM 4926 C C   . THR A 1 636  ? -31.273 15.765  5.866   1.00 83.88  ? 633  THR A C   1 
ATOM 4927 O O   . THR A 1 636  ? -30.714 15.479  6.923   1.00 83.88  ? 633  THR A O   1 
ATOM 4928 C CB  . THR A 1 636  ? -30.921 18.153  5.237   1.00 102.24 ? 633  THR A CB  1 
ATOM 4929 O OG1 . THR A 1 636  ? -32.192 18.215  5.897   1.00 102.24 ? 633  THR A OG1 1 
ATOM 4930 C CG2 . THR A 1 636  ? -30.934 19.049  4.003   1.00 102.24 ? 633  THR A CG2 1 
ATOM 4931 N N   . GLN A 1 637  ? -32.475 15.302  5.511   1.00 88.52  ? 634  GLN A N   1 
ATOM 4932 C CA  . GLN A 1 637  ? -33.311 14.420  6.337   1.00 88.52  ? 634  GLN A CA  1 
ATOM 4933 C C   . GLN A 1 637  ? -33.008 12.930  6.132   1.00 88.52  ? 634  GLN A C   1 
ATOM 4934 O O   . GLN A 1 637  ? -32.418 12.552  5.106   1.00 88.52  ? 634  GLN A O   1 
ATOM 4935 C CB  . GLN A 1 637  ? -34.799 14.666  6.032   1.00 95.82  ? 634  GLN A CB  1 
ATOM 4936 C CG  . GLN A 1 637  ? -35.298 16.063  6.364   1.00 95.82  ? 634  GLN A CG  1 
ATOM 4937 C CD  . GLN A 1 637  ? -35.011 16.469  7.799   1.00 95.82  ? 634  GLN A CD  1 
ATOM 4938 O OE1 . GLN A 1 637  ? -35.592 15.926  8.739   1.00 95.82  ? 634  GLN A OE1 1 
ATOM 4939 N NE2 . GLN A 1 637  ? -34.105 17.432  7.972   1.00 95.82  ? 634  GLN A NE2 1 
ATOM 4940 N N   . PRO A 1 638  ? -33.424 12.075  7.102   1.00 83.33  ? 635  PRO A N   1 
ATOM 4941 C CA  . PRO A 1 638  ? -33.407 10.627  6.951   1.00 83.33  ? 635  PRO A CA  1 
ATOM 4942 C C   . PRO A 1 638  ? -33.808 10.203  5.550   1.00 83.33  ? 635  PRO A C   1 
ATOM 4943 O O   . PRO A 1 638  ? -34.459 10.944  4.833   1.00 83.33  ? 635  PRO A O   1 
ATOM 4944 C CB  . PRO A 1 638  ? -34.465 10.157  7.953   1.00 99.66  ? 635  PRO A CB  1 
ATOM 4945 C CG  . PRO A 1 638  ? -34.909 11.374  8.716   1.00 99.66  ? 635  PRO A CG  1 
ATOM 4946 C CD  . PRO A 1 638  ? -33.933 12.448  8.432   1.00 99.66  ? 635  PRO A CD  1 
ATOM 4947 N N   . THR A 1 639  ? -33.426 9.007   5.170   1.00 60.84  ? 636  THR A N   1 
ATOM 4948 C CA  . THR A 1 639  ? -33.550 8.579   3.797   1.00 60.84  ? 636  THR A CA  1 
ATOM 4949 C C   . THR A 1 639  ? -34.044 7.156   3.802   1.00 60.84  ? 636  THR A C   1 
ATOM 4950 O O   . THR A 1 639  ? -33.428 6.270   4.417   1.00 60.84  ? 636  THR A O   1 
ATOM 4951 C CB  . THR A 1 639  ? -32.199 8.637   3.111   1.00 66.11  ? 636  THR A CB  1 
ATOM 4952 O OG1 . THR A 1 639  ? -31.748 10.006  3.096   1.00 66.11  ? 636  THR A OG1 1 
ATOM 4953 C CG2 . THR A 1 639  ? -32.285 8.082   1.702   1.00 66.11  ? 636  THR A CG2 1 
ATOM 4954 N N   . VAL A 1 640  ? -35.166 6.935   3.132   1.00 50.77  ? 637  VAL A N   1 
ATOM 4955 C CA  . VAL A 1 640  ? -35.799 5.629   3.145   1.00 50.77  ? 637  VAL A CA  1 
ATOM 4956 C C   . VAL A 1 640  ? -35.625 4.964   1.810   1.00 50.77  ? 637  VAL A C   1 
ATOM 4957 O O   . VAL A 1 640  ? -36.195 5.401   0.805   1.00 50.77  ? 637  VAL A O   1 
ATOM 4958 C CB  . VAL A 1 640  ? -37.269 5.743   3.487   1.00 51.50  ? 637  VAL A CB  1 
ATOM 4959 C CG1 . VAL A 1 640  ? -37.711 4.479   4.175   1.00 51.50  ? 637  VAL A CG1 1 
ATOM 4960 C CG2 . VAL A 1 640  ? -37.481 7.000   4.376   1.00 51.50  ? 637  VAL A CG2 1 
ATOM 4961 N N   . LEU A 1 641  ? -34.817 3.913   1.822   1.00 70.67  ? 638  LEU A N   1 
ATOM 4962 C CA  . LEU A 1 641  ? -34.439 3.185   0.635   1.00 70.67  ? 638  LEU A CA  1 
ATOM 4963 C C   . LEU A 1 641  ? -35.499 2.185   0.210   1.00 70.67  ? 638  LEU A C   1 
ATOM 4964 O O   . LEU A 1 641  ? -36.079 1.487   1.033   1.00 70.67  ? 638  LEU A O   1 
ATOM 4965 C CB  . LEU A 1 641  ? -33.133 2.468   0.911   1.00 62.15  ? 638  LEU A CB  1 
ATOM 4966 C CG  . LEU A 1 641  ? -32.019 3.432   1.310   1.00 62.15  ? 638  LEU A CG  1 
ATOM 4967 C CD1 . LEU A 1 641  ? -30.974 2.774   2.223   1.00 62.15  ? 638  LEU A CD1 1 
ATOM 4968 C CD2 . LEU A 1 641  ? -31.381 4.069   0.057   1.00 62.15  ? 638  LEU A CD2 1 
ATOM 4969 N N   . ARG A 1 642  ? -35.767 2.121   -1.086  1.00 71.12  ? 639  ARG A N   1 
ATOM 4970 C CA  . ARG A 1 642  ? -36.727 1.153   -1.613  1.00 71.12  ? 639  ARG A CA  1 
ATOM 4971 C C   . ARG A 1 642  ? -36.290 0.657   -2.992  1.00 71.12  ? 639  ARG A C   1 
ATOM 4972 O O   . ARG A 1 642  ? -35.160 0.933   -3.431  1.00 71.12  ? 639  ARG A O   1 
ATOM 4973 C CB  . ARG A 1 642  ? -38.158 1.712   -1.612  1.00 176.27 ? 639  ARG A CB  1 
ATOM 4974 C CG  . ARG A 1 642  ? -39.228 0.685   -1.975  1.00 176.27 ? 639  ARG A CG  1 
ATOM 4975 C CD  . ARG A 1 642  ? -39.296 -0.482  -0.993  1.00 176.27 ? 639  ARG A CD  1 
ATOM 4976 N NE  . ARG A 1 642  ? -40.555 -0.483  -0.255  1.00 176.27 ? 639  ARG A NE  1 
ATOM 4977 C CZ  . ARG A 1 642  ? -41.676 -1.056  -0.687  1.00 176.27 ? 639  ARG A CZ  1 
ATOM 4978 N NH1 . ARG A 1 642  ? -41.699 -1.684  -1.859  1.00 176.27 ? 639  ARG A NH1 1 
ATOM 4979 N NH2 . ARG A 1 642  ? -42.777 -1.000  0.052   1.00 176.27 ? 639  ARG A NH2 1 
ATOM 4980 N N   . THR A 1 643  ? -37.167 -0.097  -3.650  1.00 118.17 ? 640  THR A N   1 
ATOM 4981 C CA  . THR A 1 643  ? -36.841 -0.758  -4.902  1.00 118.17 ? 640  THR A CA  1 
ATOM 4982 C C   . THR A 1 643  ? -38.070 -0.887  -5.809  1.00 118.17 ? 640  THR A C   1 
ATOM 4983 O O   . THR A 1 643  ? -39.130 -1.347  -5.378  1.00 118.17 ? 640  THR A O   1 
ATOM 4984 C CB  . THR A 1 643  ? -36.072 -2.068  -4.633  1.00 70.02  ? 640  THR A CB  1 
ATOM 4985 O OG1 . THR A 1 643  ? -34.660 -1.793  -4.709  1.00 70.02  ? 640  THR A OG1 1 
ATOM 4986 C CG2 . THR A 1 643  ? -36.456 -3.188  -5.625  1.00 70.02  ? 640  THR A CG2 1 
ATOM 4987 N N   . PHE A 1 644  ? -37.916 -0.452  -7.058  1.00 138.28 ? 641  PHE A N   1 
ATOM 4988 C CA  . PHE A 1 644  ? -39.057 -0.244  -7.951  1.00 138.28 ? 641  PHE A CA  1 
ATOM 4989 C C   . PHE A 1 644  ? -39.023 -1.127  -9.207  1.00 138.28 ? 641  PHE A C   1 
ATOM 4990 O O   . PHE A 1 644  ? -37.948 -1.511  -9.681  1.00 138.28 ? 641  PHE A O   1 
ATOM 4991 C CB  . PHE A 1 644  ? -39.238 1.267   -8.304  1.00 81.20  ? 641  PHE A CB  1 
ATOM 4992 C CG  . PHE A 1 644  ? -37.989 1.946   -8.873  1.00 81.20  ? 641  PHE A CG  1 
ATOM 4993 C CD1 . PHE A 1 644  ? -37.821 2.087   -10.252 1.00 81.20  ? 641  PHE A CD1 1 
ATOM 4994 C CD2 . PHE A 1 644  ? -36.996 2.453   -8.025  1.00 81.20  ? 641  PHE A CD2 1 
ATOM 4995 C CE1 . PHE A 1 644  ? -36.668 2.695   -10.785 1.00 81.20  ? 641  PHE A CE1 1 
ATOM 4996 C CE2 . PHE A 1 644  ? -35.846 3.075   -8.539  1.00 81.20  ? 641  PHE A CE2 1 
ATOM 4997 C CZ  . PHE A 1 644  ? -35.681 3.197   -9.923  1.00 81.20  ? 641  PHE A CZ  1 
ATOM 4998 N N   . ARG A 1 645  ? -40.211 -1.456  -9.714  1.00 192.49 ? 642  ARG A N   1 
ATOM 4999 C CA  . ARG A 1 645  ? -40.369 -2.093  -11.023 1.00 192.49 ? 642  ARG A CA  1 
ATOM 5000 C C   . ARG A 1 645  ? -40.065 -1.063  -12.119 1.00 192.49 ? 642  ARG A C   1 
ATOM 5001 O O   . ARG A 1 645  ? -40.789 -0.069  -12.257 1.00 192.49 ? 642  ARG A O   1 
ATOM 5002 C CB  . ARG A 1 645  ? -41.788 -2.709  -11.164 1.00 112.64 ? 642  ARG A CB  1 
ATOM 5003 C CG  . ARG A 1 645  ? -42.443 -2.655  -12.579 1.00 112.64 ? 642  ARG A CG  1 
ATOM 5004 C CD  . ARG A 1 645  ? -43.578 -3.695  -12.848 1.00 112.64 ? 642  ARG A CD  1 
ATOM 5005 N NE  . ARG A 1 645  ? -44.811 -3.493  -12.071 1.00 112.64 ? 642  ARG A NE  1 
ATOM 5006 C CZ  . ARG A 1 645  ? -45.950 -4.169  -12.245 1.00 112.64 ? 642  ARG A CZ  1 
ATOM 5007 N NH1 . ARG A 1 645  ? -46.060 -5.099  -13.185 1.00 112.64 ? 642  ARG A NH1 1 
ATOM 5008 N NH2 . ARG A 1 645  ? -46.988 -3.914  -11.465 1.00 112.64 ? 642  ARG A NH2 1 
ATOM 5009 N N   . SER A 1 646  ? -38.974 -1.277  -12.860 1.00 209.00 ? 643  SER A N   1 
ATOM 5010 C CA  . SER A 1 646  ? -38.680 -0.465  -14.052 1.00 209.00 ? 643  SER A CA  1 
ATOM 5011 C C   . SER A 1 646  ? -38.669 -1.333  -15.318 1.00 209.00 ? 643  SER A C   1 
ATOM 5012 O O   . SER A 1 646  ? -39.725 -1.761  -15.788 1.00 209.00 ? 643  SER A O   1 
ATOM 5013 C CB  . SER A 1 646  ? -37.391 0.377   -13.891 1.00 98.56  ? 643  SER A CB  1 
ATOM 5014 O OG  . SER A 1 646  ? -36.207 -0.351  -14.196 1.00 98.56  ? 643  SER A OG  1 
ATOM 5015 N N   . LEU A 1 647  ? -37.485 -1.593  -15.865 1.00 152.17 ? 644  LEU A N   1 
ATOM 5016 C CA  . LEU A 1 647  ? -37.348 -2.499  -16.999 1.00 152.17 ? 644  LEU A CA  1 
ATOM 5017 C C   . LEU A 1 647  ? -36.642 -3.774  -16.522 1.00 152.17 ? 644  LEU A C   1 
ATOM 5018 O O   . LEU A 1 647  ? -37.028 -4.341  -15.495 1.00 152.17 ? 644  LEU A O   1 
ATOM 5019 C CB  . LEU A 1 647  ? -36.650 -1.806  -18.189 1.00 93.51  ? 644  LEU A CB  1 
ATOM 5020 C CG  . LEU A 1 647  ? -35.144 -1.483  -18.237 1.00 93.51  ? 644  LEU A CG  1 
ATOM 5021 C CD1 . LEU A 1 647  ? -34.783 -0.815  -19.550 1.00 93.51  ? 644  LEU A CD1 1 
ATOM 5022 C CD2 . LEU A 1 647  ? -34.648 -0.640  -17.060 1.00 93.51  ? 644  LEU A CD2 1 
ATOM 5023 N N   . SER A 1 648  ? -35.615 -4.213  -17.246 1.00 164.75 ? 645  SER A N   1 
ATOM 5024 C CA  . SER A 1 648  ? -34.868 -5.422  -16.896 1.00 164.75 ? 645  SER A CA  1 
ATOM 5025 C C   . SER A 1 648  ? -34.171 -5.326  -15.536 1.00 164.75 ? 645  SER A C   1 
ATOM 5026 O O   . SER A 1 648  ? -34.055 -6.325  -14.819 1.00 164.75 ? 645  SER A O   1 
ATOM 5027 C CB  . SER A 1 648  ? -33.844 -5.757  -17.988 1.00 160.32 ? 645  SER A CB  1 
ATOM 5028 O OG  . SER A 1 648  ? -32.912 -4.704  -18.166 1.00 160.32 ? 645  SER A OG  1 
ATOM 5029 N N   . THR A 1 649  ? -33.726 -4.124  -15.182 1.00 209.00 ? 646  THR A N   1 
ATOM 5030 C CA  . THR A 1 649  ? -32.873 -3.938  -14.010 1.00 209.00 ? 646  THR A CA  1 
ATOM 5031 C C   . THR A 1 649  ? -33.553 -3.170  -12.869 1.00 209.00 ? 646  THR A C   1 
ATOM 5032 O O   . THR A 1 649  ? -32.921 -2.343  -12.222 1.00 209.00 ? 646  THR A O   1 
ATOM 5033 C CB  . THR A 1 649  ? -31.523 -3.256  -14.392 1.00 97.88  ? 646  THR A CB  1 
ATOM 5034 O OG1 . THR A 1 649  ? -31.645 -1.830  -14.320 1.00 97.88  ? 646  THR A OG1 1 
ATOM 5035 C CG2 . THR A 1 649  ? -31.068 -3.663  -15.802 1.00 97.88  ? 646  THR A CG2 1 
ATOM 5036 N N   . THR A 1 650  ? -34.832 -3.462  -12.629 1.00 161.87 ? 647  THR A N   1 
ATOM 5037 C CA  . THR A 1 650  ? -35.662 -2.834  -11.574 1.00 161.87 ? 647  THR A CA  1 
ATOM 5038 C C   . THR A 1 650  ? -34.858 -2.293  -10.366 1.00 161.87 ? 647  THR A C   1 
ATOM 5039 O O   . THR A 1 650  ? -34.125 -3.054  -9.735  1.00 161.87 ? 647  THR A O   1 
ATOM 5040 C CB  . THR A 1 650  ? -36.708 -3.841  -11.091 1.00 88.87  ? 647  THR A CB  1 
ATOM 5041 O OG1 . THR A 1 650  ? -36.211 -4.540  -9.946  1.00 88.87  ? 647  THR A OG1 1 
ATOM 5042 C CG2 . THR A 1 650  ? -37.014 -4.869  -12.189 1.00 88.87  ? 647  THR A CG2 1 
ATOM 5043 N N   . ASN A 1 651  ? -35.020 -1.008  -10.025 1.00 139.94 ? 648  ASN A N   1 
ATOM 5044 C CA  . ASN A 1 651  ? -33.945 -0.257  -9.321  1.00 139.94 ? 648  ASN A CA  1 
ATOM 5045 C C   . ASN A 1 651  ? -34.160 0.229   -7.874  1.00 139.94 ? 648  ASN A C   1 
ATOM 5046 O O   . ASN A 1 651  ? -35.129 -0.175  -7.232  1.00 139.94 ? 648  ASN A O   1 
ATOM 5047 C CB  . ASN A 1 651  ? -33.472 0.926   -10.178 1.00 176.59 ? 648  ASN A CB  1 
ATOM 5048 C CG  . ASN A 1 651  ? -33.050 0.517   -11.574 1.00 176.59 ? 648  ASN A CG  1 
ATOM 5049 O OD1 . ASN A 1 651  ? -31.858 0.390   -11.855 1.00 176.59 ? 648  ASN A OD1 1 
ATOM 5050 N ND2 . ASN A 1 651  ? -34.023 0.317   -12.462 1.00 176.59 ? 648  ASN A ND2 1 
ATOM 5051 N N   . VAL A 1 652  ? -33.241 1.097   -7.395  1.00 93.92  ? 649  VAL A N   1 
ATOM 5052 C CA  . VAL A 1 652  ? -33.240 1.663   -6.016  1.00 93.92  ? 649  VAL A CA  1 
ATOM 5053 C C   . VAL A 1 652  ? -33.647 3.142   -5.896  1.00 93.92  ? 649  VAL A C   1 
ATOM 5054 O O   . VAL A 1 652  ? -32.926 4.032   -6.365  1.00 93.92  ? 649  VAL A O   1 
ATOM 5055 C CB  . VAL A 1 652  ? -31.840 1.561   -5.345  1.00 112.88 ? 649  VAL A CB  1 
ATOM 5056 C CG1 . VAL A 1 652  ? -31.903 2.001   -3.875  1.00 112.88 ? 649  VAL A CG1 1 
ATOM 5057 C CG2 . VAL A 1 652  ? -31.278 0.162   -5.455  1.00 112.88 ? 649  VAL A CG2 1 
ATOM 5058 N N   . PHE A 1 653  ? -34.758 3.402   -5.211  1.00 57.19  ? 650  PHE A N   1 
ATOM 5059 C CA  . PHE A 1 653  ? -35.238 4.769   -5.011  1.00 57.19  ? 650  PHE A CA  1 
ATOM 5060 C C   . PHE A 1 653  ? -34.950 5.322   -3.608  1.00 57.19  ? 650  PHE A C   1 
ATOM 5061 O O   . PHE A 1 653  ? -35.228 4.657   -2.620  1.00 57.19  ? 650  PHE A O   1 
ATOM 5062 C CB  . PHE A 1 653  ? -36.738 4.797   -5.279  1.00 79.02  ? 650  PHE A CB  1 
ATOM 5063 C CG  . PHE A 1 653  ? -37.382 6.146   -5.072  1.00 79.02  ? 650  PHE A CG  1 
ATOM 5064 C CD1 . PHE A 1 653  ? -37.763 6.921   -6.165  1.00 79.02  ? 650  PHE A CD1 1 
ATOM 5065 C CD2 . PHE A 1 653  ? -37.652 6.626   -3.790  1.00 79.02  ? 650  PHE A CD2 1 
ATOM 5066 C CE1 . PHE A 1 653  ? -38.383 8.162   -5.992  1.00 79.02  ? 650  PHE A CE1 1 
ATOM 5067 C CE2 . PHE A 1 653  ? -38.271 7.866   -3.615  1.00 79.02  ? 650  PHE A CE2 1 
ATOM 5068 C CZ  . PHE A 1 653  ? -38.638 8.627   -4.721  1.00 79.02  ? 650  PHE A CZ  1 
ATOM 5069 N N   . ALA A 1 654  ? -34.441 6.553   -3.520  1.00 51.89  ? 651  ALA A N   1 
ATOM 5070 C CA  . ALA A 1 654  ? -34.114 7.178   -2.225  1.00 51.89  ? 651  ALA A CA  1 
ATOM 5071 C C   . ALA A 1 654  ? -35.132 8.240   -1.737  1.00 51.89  ? 651  ALA A C   1 
ATOM 5072 O O   . ALA A 1 654  ? -35.311 9.305   -2.371  1.00 51.89  ? 651  ALA A O   1 
ATOM 5073 C CB  . ALA A 1 654  ? -32.739 7.760   -2.277  1.00 67.25  ? 651  ALA A CB  1 
ATOM 5074 N N   . CYS A 1 655  ? -35.791 7.960   -0.608  1.00 58.26  ? 652  CYS A N   1 
ATOM 5075 C CA  . CYS A 1 655  ? -36.810 8.875   -0.102  1.00 58.26  ? 652  CYS A CA  1 
ATOM 5076 C C   . CYS A 1 655  ? -36.165 9.877   0.813   1.00 58.26  ? 652  CYS A C   1 
ATOM 5077 O O   . CYS A 1 655  ? -35.642 9.516   1.853   1.00 58.26  ? 652  CYS A O   1 
ATOM 5078 C CB  . CYS A 1 655  ? -37.945 8.133   0.599   1.00 71.70  ? 652  CYS A CB  1 
ATOM 5079 S SG  . CYS A 1 655  ? -39.090 7.253   -0.553  1.00 71.70  ? 652  CYS A SG  1 
ATOM 5080 N N   . SER A 1 656  ? -36.190 11.140  0.399   1.00 54.82  ? 653  SER A N   1 
ATOM 5081 C CA  . SER A 1 656  ? -35.462 12.219  1.063   1.00 54.82  ? 653  SER A CA  1 
ATOM 5082 C C   . SER A 1 656  ? -36.184 13.528  0.787   1.00 54.82  ? 653  SER A C   1 
ATOM 5083 O O   . SER A 1 656  ? -37.151 13.562  -0.012  1.00 54.82  ? 653  SER A O   1 
ATOM 5084 C CB  . SER A 1 656  ? -34.067 12.300  0.464   1.00 60.10  ? 653  SER A CB  1 
ATOM 5085 O OG  . SER A 1 656  ? -33.283 13.220  1.215   1.00 60.10  ? 653  SER A OG  1 
ATOM 5086 N N   . ASP A 1 657  ? -35.731 14.609  1.427   1.00 72.77  ? 654  ASP A N   1 
ATOM 5087 C CA  . ASP A 1 657  ? -36.196 15.963  1.055   1.00 72.77  ? 654  ASP A CA  1 
ATOM 5088 C C   . ASP A 1 657  ? -35.714 16.312  -0.357  1.00 72.77  ? 654  ASP A C   1 
ATOM 5089 O O   . ASP A 1 657  ? -36.248 17.207  -0.999  1.00 72.77  ? 654  ASP A O   1 
ATOM 5090 C CB  . ASP A 1 657  ? -35.827 17.052  2.094   1.00 105.63 ? 654  ASP A CB  1 
ATOM 5091 C CG  . ASP A 1 657  ? -34.378 16.975  2.576   1.00 105.63 ? 654  ASP A CG  1 
ATOM 5092 O OD1 . ASP A 1 657  ? -33.983 15.941  3.145   1.00 105.63 ? 654  ASP A OD1 1 
ATOM 5093 O OD2 . ASP A 1 657  ? -33.633 17.964  2.418   1.00 105.63 ? 654  ASP A OD2 1 
ATOM 5094 N N   . ARG A 1 658  ? -34.704 15.580  -0.822  1.00 56.00  ? 655  ARG A N   1 
ATOM 5095 C CA  . ARG A 1 658  ? -34.233 15.647  -2.186  1.00 56.00  ? 655  ARG A CA  1 
ATOM 5096 C C   . ARG A 1 658  ? -34.278 14.229  -2.753  1.00 56.00  ? 655  ARG A C   1 
ATOM 5097 O O   . ARG A 1 658  ? -33.290 13.482  -2.656  1.00 56.00  ? 655  ARG A O   1 
ATOM 5098 C CB  . ARG A 1 658  ? -32.808 16.201  -2.240  1.00 114.96 ? 655  ARG A CB  1 
ATOM 5099 C CG  . ARG A 1 658  ? -32.223 16.303  -3.655  1.00 114.96 ? 655  ARG A CG  1 
ATOM 5100 C CD  . ARG A 1 658  ? -30.773 15.802  -3.708  1.00 114.96 ? 655  ARG A CD  1 
ATOM 5101 N NE  . ARG A 1 658  ? -29.959 16.350  -2.626  1.00 114.96 ? 655  ARG A NE  1 
ATOM 5102 C CZ  . ARG A 1 658  ? -29.354 17.529  -2.667  1.00 114.96 ? 655  ARG A CZ  1 
ATOM 5103 N NH1 . ARG A 1 658  ? -29.458 18.298  -3.743  1.00 114.96 ? 655  ARG A NH1 1 
ATOM 5104 N NH2 . ARG A 1 658  ? -28.641 17.937  -1.624  1.00 114.96 ? 655  ARG A NH2 1 
ATOM 5105 N N   . PRO A 1 659  ? -35.435 13.853  -3.331  1.00 46.88  ? 656  PRO A N   1 
ATOM 5106 C CA  . PRO A 1 659  ? -35.694 12.510  -3.837  1.00 46.88  ? 656  PRO A CA  1 
ATOM 5107 C C   . PRO A 1 659  ? -34.679 12.150  -4.913  1.00 46.88  ? 656  PRO A C   1 
ATOM 5108 O O   . PRO A 1 659  ? -34.336 12.995  -5.766  1.00 46.88  ? 656  PRO A O   1 
ATOM 5109 C CB  . PRO A 1 659  ? -37.092 12.618  -4.423  1.00 58.31  ? 656  PRO A CB  1 
ATOM 5110 C CG  . PRO A 1 659  ? -37.296 14.068  -4.644  1.00 58.31  ? 656  PRO A CG  1 
ATOM 5111 C CD  . PRO A 1 659  ? -36.582 14.742  -3.543  1.00 58.31  ? 656  PRO A CD  1 
ATOM 5112 N N   . THR A 1 660  ? -34.174 10.921  -4.835  1.00 45.77  ? 657  THR A N   1 
ATOM 5113 C CA  . THR A 1 660  ? -33.044 10.497  -5.633  1.00 45.77  ? 657  THR A CA  1 
ATOM 5114 C C   . THR A 1 660  ? -33.320 9.102   -6.144  1.00 45.77  ? 657  THR A C   1 
ATOM 5115 O O   . THR A 1 660  ? -33.893 8.274   -5.444  1.00 45.77  ? 657  THR A O   1 
ATOM 5116 C CB  . THR A 1 660  ? -31.703 10.462  -4.794  1.00 52.20  ? 657  THR A CB  1 
ATOM 5117 O OG1 . THR A 1 660  ? -31.389 11.766  -4.288  1.00 52.20  ? 657  THR A OG1 1 
ATOM 5118 C CG2 . THR A 1 660  ? -30.525 10.000  -5.640  1.00 52.20  ? 657  THR A CG2 1 
ATOM 5119 N N   . VAL A 1 661  ? -32.903 8.834   -7.365  1.00 53.18  ? 658  VAL A N   1 
ATOM 5120 C CA  . VAL A 1 661  ? -32.880 7.481   -7.818  1.00 53.18  ? 658  VAL A CA  1 
ATOM 5121 C C   . VAL A 1 661  ? -31.472 6.966   -7.913  1.00 53.18  ? 658  VAL A C   1 
ATOM 5122 O O   . VAL A 1 661  ? -30.566 7.695   -8.323  1.00 53.18  ? 658  VAL A O   1 
ATOM 5123 C CB  . VAL A 1 661  ? -33.474 7.361   -9.164  1.00 38.75  ? 658  VAL A CB  1 
ATOM 5124 C CG1 . VAL A 1 661  ? -32.721 6.318   -9.937  1.00 38.75  ? 658  VAL A CG1 1 
ATOM 5125 C CG2 . VAL A 1 661  ? -34.900 6.963   -9.015  1.00 38.75  ? 658  VAL A CG2 1 
ATOM 5126 N N   . ILE A 1 662  ? -31.311 5.700   -7.532  1.00 130.23 ? 659  ILE A N   1 
ATOM 5127 C CA  . ILE A 1 662  ? -30.083 4.961   -7.765  1.00 130.23 ? 659  ILE A CA  1 
ATOM 5128 C C   . ILE A 1 662  ? -30.316 3.839   -8.793  1.00 130.23 ? 659  ILE A C   1 
ATOM 5129 O O   . ILE A 1 662  ? -31.009 2.851   -8.512  1.00 130.23 ? 659  ILE A O   1 
ATOM 5130 C CB  . ILE A 1 662  ? -29.487 4.422   -6.461  1.00 102.70 ? 659  ILE A CB  1 
ATOM 5131 C CG1 . ILE A 1 662  ? -29.469 5.518   -5.391  1.00 102.70 ? 659  ILE A CG1 1 
ATOM 5132 C CG2 . ILE A 1 662  ? -28.079 3.950   -6.712  1.00 102.70 ? 659  ILE A CG2 1 
ATOM 5133 C CD1 . ILE A 1 662  ? -29.226 5.024   -3.989  1.00 102.70 ? 659  ILE A CD1 1 
ATOM 5134 N N   . TYR A 1 663  ? -29.735 4.027   -9.984  1.00 153.77 ? 660  TYR A N   1 
ATOM 5135 C CA  . TYR A 1 663  ? -29.899 3.130   -11.145 1.00 153.77 ? 660  TYR A CA  1 
ATOM 5136 C C   . TYR A 1 663  ? -28.664 2.227   -11.329 1.00 153.77 ? 660  TYR A C   1 
ATOM 5137 O O   . TYR A 1 663  ? -28.250 1.539   -10.398 1.00 153.77 ? 660  TYR A O   1 
ATOM 5138 C CB  . TYR A 1 663  ? -30.117 3.939   -12.444 1.00 153.84 ? 660  TYR A CB  1 
ATOM 5139 C CG  . TYR A 1 663  ? -31.384 4.781   -12.575 1.00 153.84 ? 660  TYR A CG  1 
ATOM 5140 C CD1 . TYR A 1 663  ? -32.568 4.221   -13.066 1.00 153.84 ? 660  TYR A CD1 1 
ATOM 5141 C CD2 . TYR A 1 663  ? -31.422 6.110   -12.148 1.00 153.84 ? 660  TYR A CD2 1 
ATOM 5142 C CE1 . TYR A 1 663  ? -33.749 4.978   -13.175 1.00 153.84 ? 660  TYR A CE1 1 
ATOM 5143 C CE2 . TYR A 1 663  ? -32.606 6.876   -12.251 1.00 153.84 ? 660  TYR A CE2 1 
ATOM 5144 C CZ  . TYR A 1 663  ? -33.762 6.296   -12.767 1.00 153.84 ? 660  TYR A CZ  1 
ATOM 5145 O OH  . TYR A 1 663  ? -34.926 7.031   -12.876 1.00 153.84 ? 660  TYR A OH  1 
ATOM 5146 N N   . SER A 1 664  ? -28.090 2.245   -12.539 1.00 209.00 ? 661  SER A N   1 
ATOM 5147 C CA  . SER A 1 664  ? -26.910 1.443   -12.906 1.00 209.00 ? 661  SER A CA  1 
ATOM 5148 C C   . SER A 1 664  ? -26.046 2.114   -13.978 1.00 209.00 ? 661  SER A C   1 
ATOM 5149 O O   . SER A 1 664  ? -26.549 2.530   -15.026 1.00 209.00 ? 661  SER A O   1 
ATOM 5150 C CB  . SER A 1 664  ? -27.325 0.054   -13.396 1.00 103.66 ? 661  SER A CB  1 
ATOM 5151 O OG  . SER A 1 664  ? -28.046 -0.641  -12.398 1.00 103.66 ? 661  SER A OG  1 
ATOM 5152 N N   . SER A 1 665  ? -24.744 2.199   -13.714 1.00 157.74 ? 662  SER A N   1 
ATOM 5153 C CA  . SER A 1 665  ? -23.800 2.804   -14.652 1.00 157.74 ? 662  SER A CA  1 
ATOM 5154 C C   . SER A 1 665  ? -23.150 1.747   -15.573 1.00 157.74 ? 662  SER A C   1 
ATOM 5155 O O   . SER A 1 665  ? -23.863 0.968   -16.219 1.00 157.74 ? 662  SER A O   1 
ATOM 5156 C CB  . SER A 1 665  ? -22.765 3.638   -13.889 1.00 77.15  ? 662  SER A CB  1 
ATOM 5157 O OG  . SER A 1 665  ? -21.897 4.301   -14.783 1.00 77.15  ? 662  SER A OG  1 
ATOM 5158 N N   . ASN A 1 666  ? -21.813 1.729   -15.637 1.00 189.92 ? 663  ASN A N   1 
ATOM 5159 C CA  . ASN A 1 666  ? -21.058 0.731   -16.420 1.00 189.92 ? 663  ASN A CA  1 
ATOM 5160 C C   . ASN A 1 666  ? -21.489 -0.692  -16.074 1.00 189.92 ? 663  ASN A C   1 
ATOM 5161 O O   . ASN A 1 666  ? -21.739 -1.526  -16.950 1.00 189.92 ? 663  ASN A O   1 
ATOM 5162 C CB  . ASN A 1 666  ? -19.537 0.907   -16.223 1.00 161.38 ? 663  ASN A CB  1 
ATOM 5163 C CG  . ASN A 1 666  ? -19.144 1.167   -14.762 1.00 161.38 ? 663  ASN A CG  1 
ATOM 5164 O OD1 . ASN A 1 666  ? -19.241 0.282   -13.907 1.00 161.38 ? 663  ASN A OD1 1 
ATOM 5165 N ND2 . ASN A 1 666  ? -18.682 2.383   -14.482 1.00 161.38 ? 663  ASN A ND2 1 
ATOM 5166 N N   . HIS A 1 667  ? -21.575 -0.920  -14.767 1.00 88.77  ? 664  HIS A N   1 
ATOM 5167 C CA  . HIS A 1 667  ? -22.069 -2.126  -14.125 1.00 88.77  ? 664  HIS A CA  1 
ATOM 5168 C C   . HIS A 1 667  ? -22.323 -1.573  -12.743 1.00 88.77  ? 664  HIS A C   1 
ATOM 5169 O O   . HIS A 1 667  ? -22.729 -2.299  -11.838 1.00 88.77  ? 664  HIS A O   1 
ATOM 5170 C CB  . HIS A 1 667  ? -20.996 -3.226  -14.093 1.00 128.20 ? 664  HIS A CB  1 
ATOM 5171 C CG  . HIS A 1 667  ? -21.352 -4.408  -13.237 1.00 128.20 ? 664  HIS A CG  1 
ATOM 5172 N ND1 . HIS A 1 667  ? -21.091 -4.449  -11.883 1.00 128.20 ? 664  HIS A ND1 1 
ATOM 5173 C CD2 . HIS A 1 667  ? -21.930 -5.594  -13.545 1.00 128.20 ? 664  HIS A CD2 1 
ATOM 5174 C CE1 . HIS A 1 667  ? -21.505 -5.601  -11.388 1.00 128.20 ? 664  HIS A CE1 1 
ATOM 5175 N NE2 . HIS A 1 667  ? -22.017 -6.314  -12.377 1.00 128.20 ? 664  HIS A NE2 1 
ATOM 5176 N N   . LYS A 1 668  ? -22.080 -0.262  -12.628 1.00 209.00 ? 665  LYS A N   1 
ATOM 5177 C CA  . LYS A 1 668  ? -22.192 0.543   -11.407 1.00 209.00 ? 665  LYS A CA  1 
ATOM 5178 C C   . LYS A 1 668  ? -23.637 0.890   -11.013 1.00 209.00 ? 665  LYS A C   1 
ATOM 5179 O O   . LYS A 1 668  ? -24.537 0.060   -11.141 1.00 209.00 ? 665  LYS A O   1 
ATOM 5180 C CB  . LYS A 1 668  ? -21.411 1.849   -11.591 1.00 85.90  ? 665  LYS A CB  1 
ATOM 5181 C CG  . LYS A 1 668  ? -19.995 1.915   -11.026 1.00 85.90  ? 665  LYS A CG  1 
ATOM 5182 C CD  . LYS A 1 668  ? -19.675 3.382   -10.738 1.00 85.90  ? 665  LYS A CD  1 
ATOM 5183 C CE  . LYS A 1 668  ? -18.197 3.664   -10.820 1.00 85.90  ? 665  LYS A CE  1 
ATOM 5184 N NZ  . LYS A 1 668  ? -17.934 5.121   -10.661 1.00 85.90  ? 665  LYS A NZ  1 
ATOM 5185 N N   . LEU A 1 669  ? -23.842 2.127   -10.549 1.00 88.03  ? 666  LEU A N   1 
ATOM 5186 C CA  . LEU A 1 669  ? -25.094 2.572   -9.910  1.00 88.03  ? 666  LEU A CA  1 
ATOM 5187 C C   . LEU A 1 669  ? -25.269 4.076   -10.082 1.00 88.03  ? 666  LEU A C   1 
ATOM 5188 O O   . LEU A 1 669  ? -24.387 4.824   -9.654  1.00 88.03  ? 666  LEU A O   1 
ATOM 5189 C CB  . LEU A 1 669  ? -25.069 2.262   -8.398  1.00 111.13 ? 666  LEU A CB  1 
ATOM 5190 C CG  . LEU A 1 669  ? -25.088 0.854   -7.757  1.00 111.13 ? 666  LEU A CG  1 
ATOM 5191 C CD1 . LEU A 1 669  ? -24.581 0.919   -6.323  1.00 111.13 ? 666  LEU A CD1 1 
ATOM 5192 C CD2 . LEU A 1 669  ? -26.458 0.173   -7.782  1.00 111.13 ? 666  LEU A CD2 1 
ATOM 5193 N N   . VAL A 1 670  ? -26.389 4.520   -10.676 1.00 140.94 ? 667  VAL A N   1 
ATOM 5194 C CA  . VAL A 1 670  ? -26.626 5.966   -10.956 1.00 140.94 ? 667  VAL A CA  1 
ATOM 5195 C C   . VAL A 1 670  ? -27.145 6.716   -9.727  1.00 140.94 ? 667  VAL A C   1 
ATOM 5196 O O   . VAL A 1 670  ? -27.649 6.103   -8.789  1.00 140.94 ? 667  VAL A O   1 
ATOM 5197 C CB  . VAL A 1 670  ? -27.561 6.243   -12.197 1.00 81.23  ? 667  VAL A CB  1 
ATOM 5198 C CG1 . VAL A 1 670  ? -27.540 7.709   -12.591 1.00 81.23  ? 667  VAL A CG1 1 
ATOM 5199 C CG2 . VAL A 1 670  ? -27.104 5.488   -13.392 1.00 81.23  ? 667  VAL A CG2 1 
ATOM 5200 N N   . PHE A 1 671  ? -27.009 8.043   -9.757  1.00 147.13 ? 668  PHE A N   1 
ATOM 5201 C CA  . PHE A 1 671  ? -27.334 8.924   -8.638  1.00 147.13 ? 668  PHE A CA  1 
ATOM 5202 C C   . PHE A 1 671  ? -27.974 10.245  -9.081  1.00 147.13 ? 668  PHE A C   1 
ATOM 5203 O O   . PHE A 1 671  ? -27.470 11.325  -8.768  1.00 147.13 ? 668  PHE A O   1 
ATOM 5204 C CB  . PHE A 1 671  ? -26.060 9.213   -7.846  1.00 139.19 ? 668  PHE A CB  1 
ATOM 5205 C CG  . PHE A 1 671  ? -25.990 8.497   -6.545  1.00 139.19 ? 668  PHE A CG  1 
ATOM 5206 C CD1 . PHE A 1 671  ? -26.043 7.110   -6.493  1.00 139.19 ? 668  PHE A CD1 1 
ATOM 5207 C CD2 . PHE A 1 671  ? -25.866 9.213   -5.360  1.00 139.19 ? 668  PHE A CD2 1 
ATOM 5208 C CE1 . PHE A 1 671  ? -25.984 6.449   -5.284  1.00 139.19 ? 668  PHE A CE1 1 
ATOM 5209 C CE2 . PHE A 1 671  ? -25.802 8.560   -4.144  1.00 139.19 ? 668  PHE A CE2 1 
ATOM 5210 C CZ  . PHE A 1 671  ? -25.862 7.174   -4.103  1.00 139.19 ? 668  PHE A CZ  1 
ATOM 5211 N N   . SER A 1 672  ? -29.091 10.153  -9.796  1.00 57.78  ? 669  SER A N   1 
ATOM 5212 C CA  . SER A 1 672  ? -29.699 11.327  -10.409 1.00 57.78  ? 669  SER A CA  1 
ATOM 5213 C C   . SER A 1 672  ? -30.877 11.845  -9.599  1.00 57.78  ? 669  SER A C   1 
ATOM 5214 O O   . SER A 1 672  ? -31.576 11.066  -8.952  1.00 57.78  ? 669  SER A O   1 
ATOM 5215 C CB  . SER A 1 672  ? -30.159 11.016  -11.830 1.00 190.22 ? 669  SER A CB  1 
ATOM 5216 O OG  . SER A 1 672  ? -29.099 10.486  -12.602 1.00 190.22 ? 669  SER A OG  1 
ATOM 5217 N N   . ASN A 1 673  ? -31.079 13.162  -9.638  1.00 45.34  ? 670  ASN A N   1 
ATOM 5218 C CA  . ASN A 1 673  ? -32.251 13.790  -9.059  1.00 45.34  ? 670  ASN A CA  1 
ATOM 5219 C C   . ASN A 1 673  ? -33.603 13.314  -9.607  1.00 45.34  ? 670  ASN A C   1 
ATOM 5220 O O   . ASN A 1 673  ? -33.774 12.939  -10.795 1.00 45.34  ? 670  ASN A O   1 
ATOM 5221 C CB  . ASN A 1 673  ? -32.176 15.301  -9.223  1.00 68.64  ? 670  ASN A CB  1 
ATOM 5222 C CG  . ASN A 1 673  ? -31.232 15.965  -8.230  1.00 68.64  ? 670  ASN A CG  1 
ATOM 5223 O OD1 . ASN A 1 673  ? -31.383 15.849  -7.012  1.00 68.64  ? 670  ASN A OD1 1 
ATOM 5224 N ND2 . ASN A 1 673  ? -30.280 16.709  -8.756  1.00 68.64  ? 670  ASN A ND2 1 
ATOM 5225 N N   . VAL A 1 674  ? -34.571 13.330  -8.699  1.00 55.33  ? 671  VAL A N   1 
ATOM 5226 C CA  . VAL A 1 674  ? -35.952 13.103  -9.037  1.00 55.33  ? 671  VAL A CA  1 
ATOM 5227 C C   . VAL A 1 674  ? -36.657 14.433  -8.928  1.00 55.33  ? 671  VAL A C   1 
ATOM 5228 O O   . VAL A 1 674  ? -36.586 15.083  -7.903  1.00 55.33  ? 671  VAL A O   1 
ATOM 5229 C CB  . VAL A 1 674  ? -36.588 12.073  -8.105  1.00 42.34  ? 671  VAL A CB  1 
ATOM 5230 C CG1 . VAL A 1 674  ? -38.110 11.998  -8.343  1.00 42.34  ? 671  VAL A CG1 1 
ATOM 5231 C CG2 . VAL A 1 674  ? -35.962 10.736  -8.335  1.00 42.34  ? 671  VAL A CG2 1 
ATOM 5232 N N   . ASN A 1 675  ? -37.322 14.832  -10.003 1.00 64.75  ? 672  ASN A N   1 
ATOM 5233 C CA  . ASN A 1 675  ? -37.905 16.167  -10.078 1.00 64.75  ? 672  ASN A CA  1 
ATOM 5234 C C   . ASN A 1 675  ? -39.202 16.246  -9.323  1.00 64.75  ? 672  ASN A C   1 
ATOM 5235 O O   . ASN A 1 675  ? -40.281 16.311  -9.898  1.00 64.75  ? 672  ASN A O   1 
ATOM 5236 C CB  . ASN A 1 675  ? -38.059 16.633  -11.523 1.00 43.50  ? 672  ASN A CB  1 
ATOM 5237 C CG  . ASN A 1 675  ? -36.716 16.827  -12.211 1.00 43.50  ? 672  ASN A CG  1 
ATOM 5238 O OD1 . ASN A 1 675  ? -35.685 17.112  -11.573 1.00 43.50  ? 672  ASN A OD1 1 
ATOM 5239 N ND2 . ASN A 1 675  ? -36.717 16.652  -13.524 1.00 43.50  ? 672  ASN A ND2 1 
ATOM 5240 N N   . LEU A 1 676  ? -39.068 16.221  -8.009  1.00 61.44  ? 673  LEU A N   1 
ATOM 5241 C CA  . LEU A 1 676  ? -40.191 16.153  -7.123  1.00 61.44  ? 673  LEU A CA  1 
ATOM 5242 C C   . LEU A 1 676  ? -39.966 16.994  -5.907  1.00 61.44  ? 673  LEU A C   1 
ATOM 5243 O O   . LEU A 1 676  ? -38.834 17.244  -5.478  1.00 61.44  ? 673  LEU A O   1 
ATOM 5244 C CB  . LEU A 1 676  ? -40.453 14.728  -6.694  1.00 52.22  ? 673  LEU A CB  1 
ATOM 5245 C CG  . LEU A 1 676  ? -41.379 13.937  -7.600  1.00 52.22  ? 673  LEU A CG  1 
ATOM 5246 C CD1 . LEU A 1 676  ? -41.545 12.493  -7.086  1.00 52.22  ? 673  LEU A CD1 1 
ATOM 5247 C CD2 . LEU A 1 676  ? -42.721 14.641  -7.649  1.00 52.22  ? 673  LEU A CD2 1 
ATOM 5248 N N   . LYS A 1 677  ? -41.105 17.441  -5.395  1.00 86.23  ? 674  LYS A N   1 
ATOM 5249 C CA  . LYS A 1 677  ? -41.230 18.282  -4.233  1.00 86.23  ? 674  LYS A CA  1 
ATOM 5250 C C   . LYS A 1 677  ? -40.394 17.628  -3.127  1.00 86.23  ? 674  LYS A C   1 
ATOM 5251 O O   . LYS A 1 677  ? -39.320 18.127  -2.783  1.00 86.23  ? 674  LYS A O   1 
ATOM 5252 C CB  . LYS A 1 677  ? -42.744 18.392  -3.897  1.00 89.90  ? 674  LYS A CB  1 
ATOM 5253 C CG  . LYS A 1 677  ? -43.168 19.299  -2.726  1.00 89.90  ? 674  LYS A CG  1 
ATOM 5254 C CD  . LYS A 1 677  ? -43.360 20.766  -3.121  1.00 89.90  ? 674  LYS A CD  1 
ATOM 5255 C CE  . LYS A 1 677  ? -43.659 21.593  -1.876  1.00 89.90  ? 674  LYS A CE  1 
ATOM 5256 N NZ  . LYS A 1 677  ? -44.025 23.006  -2.173  1.00 89.90  ? 674  LYS A NZ  1 
ATOM 5257 N N   . GLU A 1 678  ? -40.874 16.492  -2.621  1.00 70.39  ? 675  GLU A N   1 
ATOM 5258 C CA  . GLU A 1 678  ? -40.242 15.750  -1.541  1.00 70.39  ? 675  GLU A CA  1 
ATOM 5259 C C   . GLU A 1 678  ? -41.048 14.495  -1.356  1.00 70.39  ? 675  GLU A C   1 
ATOM 5260 O O   . GLU A 1 678  ? -42.244 14.516  -1.520  1.00 70.39  ? 675  GLU A O   1 
ATOM 5261 C CB  . GLU A 1 678  ? -40.252 16.533  -0.240  1.00 137.01 ? 675  GLU A CB  1 
ATOM 5262 C CG  . GLU A 1 678  ? -39.424 15.875  0.822   1.00 137.01 ? 675  GLU A CG  1 
ATOM 5263 C CD  . GLU A 1 678  ? -39.792 16.326  2.200   1.00 137.01 ? 675  GLU A CD  1 
ATOM 5264 O OE1 . GLU A 1 678  ? -40.925 16.834  2.370   1.00 137.01 ? 675  GLU A OE1 1 
ATOM 5265 O OE2 . GLU A 1 678  ? -38.950 16.163  3.116   1.00 137.01 ? 675  GLU A OE2 1 
ATOM 5266 N N   . VAL A 1 679  ? -40.394 13.396  -1.026  1.00 72.02  ? 676  VAL A N   1 
ATOM 5267 C CA  . VAL A 1 679  ? -41.061 12.123  -0.954  1.00 72.02  ? 676  VAL A CA  1 
ATOM 5268 C C   . VAL A 1 679  ? -40.662 11.457  0.352   1.00 72.02  ? 676  VAL A C   1 
ATOM 5269 O O   . VAL A 1 679  ? -39.453 11.328  0.634   1.00 72.02  ? 676  VAL A O   1 
ATOM 5270 C CB  . VAL A 1 679  ? -40.621 11.230  -2.115  1.00 58.15  ? 676  VAL A CB  1 
ATOM 5271 C CG1 . VAL A 1 679  ? -41.454 9.991   -2.153  1.00 58.15  ? 676  VAL A CG1 1 
ATOM 5272 C CG2 . VAL A 1 679  ? -40.733 11.953  -3.418  1.00 58.15  ? 676  VAL A CG2 1 
ATOM 5273 N N   . ASN A 1 680  ? -41.663 11.042  1.138   1.00 73.75  ? 677  ASN A N   1 
ATOM 5274 C CA  . ASN A 1 680  ? -41.431 10.362  2.422   1.00 73.75  ? 677  ASN A CA  1 
ATOM 5275 C C   . ASN A 1 680  ? -41.284 8.861   2.294   1.00 73.75  ? 677  ASN A C   1 
ATOM 5276 O O   . ASN A 1 680  ? -40.269 8.310   2.731   1.00 73.75  ? 677  ASN A O   1 
ATOM 5277 C CB  . ASN A 1 680  ? -42.506 10.719  3.435   1.00 108.42 ? 677  ASN A CB  1 
ATOM 5278 C CG  . ASN A 1 680  ? -42.381 12.138  3.925   1.00 108.42 ? 677  ASN A CG  1 
ATOM 5279 O OD1 . ASN A 1 680  ? -41.350 12.537  4.466   1.00 108.42 ? 677  ASN A OD1 1 
ATOM 5280 N ND2 . ASN A 1 680  ? -43.433 12.913  3.744   1.00 108.42 ? 677  ASN A ND2 1 
ATOM 5281 N N   . TYR A 1 681  ? -42.292 8.211   1.692   1.00 57.30  ? 678  TYR A N   1 
ATOM 5282 C CA  . TYR A 1 681  ? -42.267 6.750   1.367   1.00 57.30  ? 678  TYR A CA  1 
ATOM 5283 C C   . TYR A 1 681  ? -42.800 6.513   -0.050  1.00 57.30  ? 678  TYR A C   1 
ATOM 5284 O O   . TYR A 1 681  ? -43.447 7.413   -0.628  1.00 57.30  ? 678  TYR A O   1 
ATOM 5285 C CB  . TYR A 1 681  ? -43.049 5.932   2.403   1.00 71.07  ? 678  TYR A CB  1 
ATOM 5286 C CG  . TYR A 1 681  ? -42.812 6.428   3.813   1.00 71.07  ? 678  TYR A CG  1 
ATOM 5287 C CD1 . TYR A 1 681  ? -43.669 7.363   4.396   1.00 71.07  ? 678  TYR A CD1 1 
ATOM 5288 C CD2 . TYR A 1 681  ? -41.686 6.019   4.538   1.00 71.07  ? 678  TYR A CD2 1 
ATOM 5289 C CE1 . TYR A 1 681  ? -43.433 7.844   5.668   1.00 71.07  ? 678  TYR A CE1 1 
ATOM 5290 C CE2 . TYR A 1 681  ? -41.448 6.496   5.810   1.00 71.07  ? 678  TYR A CE2 1 
ATOM 5291 C CZ  . TYR A 1 681  ? -42.329 7.396   6.364   1.00 71.07  ? 678  TYR A CZ  1 
ATOM 5292 O OH  . TYR A 1 681  ? -42.109 7.861   7.626   1.00 71.07  ? 678  TYR A OH  1 
ATOM 5293 N N   . MET A 1 682  ? -42.525 5.333   -0.608  1.00 77.19  ? 679  MET A N   1 
ATOM 5294 C CA  . MET A 1 682  ? -42.817 5.050   -2.009  1.00 77.19  ? 679  MET A CA  1 
ATOM 5295 C C   . MET A 1 682  ? -42.761 3.560   -2.336  1.00 77.19  ? 679  MET A C   1 
ATOM 5296 O O   . MET A 1 682  ? -41.854 2.873   -1.873  1.00 77.19  ? 679  MET A O   1 
ATOM 5297 C CB  . MET A 1 682  ? -41.814 5.790   -2.889  1.00 90.70  ? 679  MET A CB  1 
ATOM 5298 C CG  . MET A 1 682  ? -41.469 5.074   -4.181  1.00 90.70  ? 679  MET A CG  1 
ATOM 5299 S SD  . MET A 1 682  ? -40.375 3.682   -3.850  1.00 90.70  ? 679  MET A SD  1 
ATOM 5300 C CE  . MET A 1 682  ? -40.729 2.538   -5.182  1.00 90.70  ? 679  MET A CE  1 
ATOM 5301 N N   . CYS A 1 683  ? -43.694 3.063   -3.154  1.00 131.79 ? 680  CYS A N   1 
ATOM 5302 C CA  . CYS A 1 683  ? -43.650 1.654   -3.604  1.00 131.79 ? 680  CYS A CA  1 
ATOM 5303 C C   . CYS A 1 683  ? -44.272 1.387   -4.981  1.00 131.79 ? 680  CYS A C   1 
ATOM 5304 O O   . CYS A 1 683  ? -45.150 2.138   -5.417  1.00 131.79 ? 680  CYS A O   1 
ATOM 5305 C CB  . CYS A 1 683  ? -44.284 0.732   -2.561  1.00 105.53 ? 680  CYS A CB  1 
ATOM 5306 S SG  . CYS A 1 683  ? -45.874 1.289   -1.975  1.00 105.53 ? 680  CYS A SG  1 
ATOM 5307 N N   . PRO A 1 684  ? -43.806 0.317   -5.673  1.00 115.76 ? 681  PRO A N   1 
ATOM 5308 C CA  . PRO A 1 684  ? -44.434 -0.166  -6.906  1.00 115.76 ? 681  PRO A CA  1 
ATOM 5309 C C   . PRO A 1 684  ? -45.921 -0.438  -6.716  1.00 115.76 ? 681  PRO A C   1 
ATOM 5310 O O   . PRO A 1 684  ? -46.374 -0.587  -5.581  1.00 115.76 ? 681  PRO A O   1 
ATOM 5311 C CB  . PRO A 1 684  ? -43.699 -1.484  -7.184  1.00 84.96  ? 681  PRO A CB  1 
ATOM 5312 C CG  . PRO A 1 684  ? -42.355 -1.285  -6.587  1.00 84.96  ? 681  PRO A CG  1 
ATOM 5313 C CD  . PRO A 1 684  ? -42.614 -0.484  -5.330  1.00 84.96  ? 681  PRO A CD  1 
ATOM 5314 N N   . LEU A 1 685  ? -46.666 -0.497  -7.822  1.00 208.33 ? 682  LEU A N   1 
ATOM 5315 C CA  . LEU A 1 685  ? -48.126 -0.688  -7.811  1.00 208.33 ? 682  LEU A CA  1 
ATOM 5316 C C   . LEU A 1 685  ? -48.628 -0.972  -9.235  1.00 208.33 ? 682  LEU A C   1 
ATOM 5317 O O   . LEU A 1 685  ? -47.848 -0.865  -10.185 1.00 208.33 ? 682  LEU A O   1 
ATOM 5318 C CB  . LEU A 1 685  ? -48.820 0.547   -7.226  1.00 81.86  ? 682  LEU A CB  1 
ATOM 5319 C CG  . LEU A 1 685  ? -50.185 0.397   -6.539  1.00 81.86  ? 682  LEU A CG  1 
ATOM 5320 C CD1 . LEU A 1 685  ? -50.029 0.019   -5.060  1.00 81.86  ? 682  LEU A CD1 1 
ATOM 5321 C CD2 . LEU A 1 685  ? -51.015 1.676   -6.681  1.00 81.86  ? 682  LEU A CD2 1 
ATOM 5322 N N   . ASN A 1 686  ? -49.913 -1.321  -9.391  1.00 155.63 ? 683  ASN A N   1 
ATOM 5323 C CA  . ASN A 1 686  ? -50.401 -1.877  -10.668 1.00 155.63 ? 683  ASN A CA  1 
ATOM 5324 C C   . ASN A 1 686  ? -51.921 -2.059  -10.894 1.00 155.63 ? 683  ASN A C   1 
ATOM 5325 O O   . ASN A 1 686  ? -52.319 -2.797  -11.806 1.00 155.63 ? 683  ASN A O   1 
ATOM 5326 C CB  . ASN A 1 686  ? -49.699 -3.218  -10.922 1.00 112.70 ? 683  ASN A CB  1 
ATOM 5327 C CG  . ASN A 1 686  ? -49.696 -3.615  -12.377 1.00 112.70 ? 683  ASN A CG  1 
ATOM 5328 O OD1 . ASN A 1 686  ? -49.613 -2.772  -13.271 1.00 112.70 ? 683  ASN A OD1 1 
ATOM 5329 N ND2 . ASN A 1 686  ? -49.773 -4.914  -12.624 1.00 112.70 ? 683  ASN A ND2 1 
ATOM 5330 N N   . SER A 1 687  ? -52.761 -1.390  -10.104 1.00 159.14 ? 684  SER A N   1 
ATOM 5331 C CA  . SER A 1 687  ? -54.229 -1.575  -10.171 1.00 159.14 ? 684  SER A CA  1 
ATOM 5332 C C   . SER A 1 687  ? -54.865 -1.436  -11.565 1.00 159.14 ? 684  SER A C   1 
ATOM 5333 O O   . SER A 1 687  ? -54.272 -0.863  -12.483 1.00 159.14 ? 684  SER A O   1 
ATOM 5334 C CB  . SER A 1 687  ? -54.935 -0.618  -9.204  1.00 126.48 ? 684  SER A CB  1 
ATOM 5335 O OG  . SER A 1 687  ? -56.326 -0.898  -9.147  1.00 126.48 ? 684  SER A OG  1 
ATOM 5336 N N   . ASP A 1 688  ? -56.079 -1.963  -11.711 1.00 175.52 ? 685  ASP A N   1 
ATOM 5337 C CA  . ASP A 1 688  ? -56.870 -1.719  -12.915 1.00 175.52 ? 685  ASP A CA  1 
ATOM 5338 C C   . ASP A 1 688  ? -57.552 -0.354  -12.802 1.00 175.52 ? 685  ASP A C   1 
ATOM 5339 O O   . ASP A 1 688  ? -58.710 -0.227  -12.402 1.00 175.52 ? 685  ASP A O   1 
ATOM 5340 C CB  . ASP A 1 688  ? -57.857 -2.859  -13.201 1.00 90.35  ? 685  ASP A CB  1 
ATOM 5341 C CG  . ASP A 1 688  ? -58.718 -3.219  -12.008 1.00 90.35  ? 685  ASP A CG  1 
ATOM 5342 O OD1 . ASP A 1 688  ? -58.822 -2.429  -11.044 1.00 90.35  ? 685  ASP A OD1 1 
ATOM 5343 O OD2 . ASP A 1 688  ? -59.316 -4.312  -12.046 1.00 90.35  ? 685  ASP A OD2 1 
ATOM 5344 N N   . GLY A 1 689  ? -56.791 0.665   -13.168 1.00 81.21  ? 686  GLY A N   1 
ATOM 5345 C CA  . GLY A 1 689  ? -57.138 2.062   -12.939 1.00 81.21  ? 686  GLY A CA  1 
ATOM 5346 C C   . GLY A 1 689  ? -55.861 2.893   -12.785 1.00 81.21  ? 686  GLY A C   1 
ATOM 5347 O O   . GLY A 1 689  ? -55.914 4.132   -12.831 1.00 81.21  ? 686  GLY A O   1 
ATOM 5348 N N   . TYR A 1 690  ? -54.738 2.181   -12.650 1.00 73.74  ? 687  TYR A N   1 
ATOM 5349 C CA  . TYR A 1 690  ? -53.445 2.729   -12.286 1.00 73.74  ? 687  TYR A CA  1 
ATOM 5350 C C   . TYR A 1 690  ? -52.299 1.741   -12.465 1.00 73.74  ? 687  TYR A C   1 
ATOM 5351 O O   . TYR A 1 690  ? -51.620 1.408   -11.525 1.00 73.74  ? 687  TYR A O   1 
ATOM 5352 C CB  . TYR A 1 690  ? -53.487 3.131   -10.834 1.00 95.28  ? 687  TYR A CB  1 
ATOM 5353 C CG  . TYR A 1 690  ? -54.240 4.396   -10.584 1.00 95.28  ? 687  TYR A CG  1 
ATOM 5354 C CD1 . TYR A 1 690  ? -53.702 5.619   -10.919 1.00 95.28  ? 687  TYR A CD1 1 
ATOM 5355 C CD2 . TYR A 1 690  ? -55.479 4.377   -10.006 1.00 95.28  ? 687  TYR A CD2 1 
ATOM 5356 C CE1 . TYR A 1 690  ? -54.376 6.784   -10.686 1.00 95.28  ? 687  TYR A CE1 1 
ATOM 5357 C CE2 . TYR A 1 690  ? -56.169 5.540   -9.769  1.00 95.28  ? 687  TYR A CE2 1 
ATOM 5358 C CZ  . TYR A 1 690  ? -55.610 6.741   -10.112 1.00 95.28  ? 687  TYR A CZ  1 
ATOM 5359 O OH  . TYR A 1 690  ? -56.291 7.906   -9.879  1.00 95.28  ? 687  TYR A OH  1 
ATOM 5360 N N   . PRO A 1 691  ? -52.065 1.298   -13.681 1.00 115.69 ? 688  PRO A N   1 
ATOM 5361 C CA  . PRO A 1 691  ? -51.079 0.255   -13.965 1.00 115.69 ? 688  PRO A CA  1 
ATOM 5362 C C   . PRO A 1 691  ? -49.662 0.570   -13.520 1.00 115.69 ? 688  PRO A C   1 
ATOM 5363 O O   . PRO A 1 691  ? -49.523 1.350   -12.603 1.00 115.69 ? 688  PRO A O   1 
ATOM 5364 C CB  . PRO A 1 691  ? -51.154 0.145   -15.474 1.00 90.33  ? 688  PRO A CB  1 
ATOM 5365 C CG  . PRO A 1 691  ? -52.567 0.421   -15.758 1.00 90.33  ? 688  PRO A CG  1 
ATOM 5366 C CD  . PRO A 1 691  ? -53.106 1.339   -14.705 1.00 90.33  ? 688  PRO A CD  1 
ATOM 5367 N N   . ASP A 1 692  ? -48.633 0.025   -14.172 1.00 105.19 ? 689  ASP A N   1 
ATOM 5368 C CA  . ASP A 1 692  ? -47.231 0.282   -13.784 1.00 105.19 ? 689  ASP A CA  1 
ATOM 5369 C C   . ASP A 1 692  ? -46.948 1.662   -13.208 1.00 105.19 ? 689  ASP A C   1 
ATOM 5370 O O   . ASP A 1 692  ? -46.402 2.531   -13.838 1.00 105.19 ? 689  ASP A O   1 
ATOM 5371 C CB  . ASP A 1 692  ? -46.239 -0.012  -14.908 1.00 102.89 ? 689  ASP A CB  1 
ATOM 5372 C CG  . ASP A 1 692  ? -44.803 0.307   -14.509 1.00 102.89 ? 689  ASP A CG  1 
ATOM 5373 O OD1 . ASP A 1 692  ? -43.864 -0.217  -15.130 1.00 102.89 ? 689  ASP A OD1 1 
ATOM 5374 O OD2 . ASP A 1 692  ? -44.619 1.104   -13.575 1.00 102.89 ? 689  ASP A OD2 1 
ATOM 5375 N N   . SER A 1 693  ? -47.264 1.764   -11.944 1.00 198.15 ? 690  SER A N   1 
ATOM 5376 C CA  . SER A 1 693  ? -47.419 2.913   -11.145 1.00 198.15 ? 690  SER A CA  1 
ATOM 5377 C C   . SER A 1 693  ? -46.202 2.923   -10.253 1.00 198.15 ? 690  SER A C   1 
ATOM 5378 O O   . SER A 1 693  ? -45.184 2.323   -10.555 1.00 198.15 ? 690  SER A O   1 
ATOM 5379 C CB  . SER A 1 693  ? -48.657 3.113   -10.280 1.00 91.99  ? 690  SER A CB  1 
ATOM 5380 O OG  . SER A 1 693  ? -49.483 4.126   -10.793 1.00 91.99  ? 690  SER A OG  1 
ATOM 5381 N N   . LEU A 1 694  ? -46.332 3.652   -9.127  1.00 59.55  ? 691  LEU A N   1 
ATOM 5382 C CA  . LEU A 1 694  ? -45.321 3.807   -8.133  1.00 59.55  ? 691  LEU A CA  1 
ATOM 5383 C C   . LEU A 1 694  ? -46.065 4.701   -7.231  1.00 59.55  ? 691  LEU A C   1 
ATOM 5384 O O   . LEU A 1 694  ? -46.487 5.749   -7.641  1.00 59.55  ? 691  LEU A O   1 
ATOM 5385 C CB  . LEU A 1 694  ? -44.139 4.524   -8.710  1.00 61.07  ? 691  LEU A CB  1 
ATOM 5386 C CG  . LEU A 1 694  ? -43.279 3.648   -9.602  1.00 61.07  ? 691  LEU A CG  1 
ATOM 5387 C CD1 . LEU A 1 694  ? -41.854 4.127   -9.569  1.00 61.07  ? 691  LEU A CD1 1 
ATOM 5388 C CD2 . LEU A 1 694  ? -43.342 2.224   -9.158  1.00 61.07  ? 691  LEU A CD2 1 
ATOM 5389 N N   . ALA A 1 695  ? -46.263 4.277   -6.000  1.00 95.43  ? 692  ALA A N   1 
ATOM 5390 C CA  . ALA A 1 695  ? -47.005 5.094   -5.069  1.00 95.43  ? 692  ALA A CA  1 
ATOM 5391 C C   . ALA A 1 695  ? -46.007 5.990   -4.438  1.00 95.43  ? 692  ALA A C   1 
ATOM 5392 O O   . ALA A 1 695  ? -44.869 5.623   -4.346  1.00 95.43  ? 692  ALA A O   1 
ATOM 5393 C CB  . ALA A 1 695  ? -47.658 4.244   -4.057  1.00 121.20 ? 692  ALA A CB  1 
ATOM 5394 N N   . LEU A 1 696  ? -46.416 7.161   -4.003  1.00 74.37  ? 693  LEU A N   1 
ATOM 5395 C CA  . LEU A 1 696  ? -45.462 8.072   -3.410  1.00 74.37  ? 693  LEU A CA  1 
ATOM 5396 C C   . LEU A 1 696  ? -46.119 9.082   -2.513  1.00 74.37  ? 693  LEU A C   1 
ATOM 5397 O O   . LEU A 1 696  ? -46.884 9.927   -2.979  1.00 74.37  ? 693  LEU A O   1 
ATOM 5398 C CB  . LEU A 1 696  ? -44.686 8.825   -4.500  1.00 65.43  ? 693  LEU A CB  1 
ATOM 5399 C CG  . LEU A 1 696  ? -43.530 8.195   -5.298  1.00 65.43  ? 693  LEU A CG  1 
ATOM 5400 C CD1 . LEU A 1 696  ? -43.928 7.635   -6.678  1.00 65.43  ? 693  LEU A CD1 1 
ATOM 5401 C CD2 . LEU A 1 696  ? -42.496 9.259   -5.498  1.00 65.43  ? 693  LEU A CD2 1 
ATOM 5402 N N   . ALA A 1 697  ? -45.783 9.036   -1.227  1.00 68.40  ? 694  ALA A N   1 
ATOM 5403 C CA  . ALA A 1 697  ? -46.439 9.906   -0.254  1.00 68.40  ? 694  ALA A CA  1 
ATOM 5404 C C   . ALA A 1 697  ? -45.504 10.942  0.300   1.00 68.40  ? 694  ALA A C   1 
ATOM 5405 O O   . ALA A 1 697  ? -44.322 10.667  0.525   1.00 68.40  ? 694  ALA A O   1 
ATOM 5406 C CB  . ALA A 1 697  ? -47.029 9.086   0.876   1.00 161.62 ? 694  ALA A CB  1 
ATOM 5407 N N   . ASN A 1 698  ? -46.034 12.132  0.534   1.00 98.65  ? 695  ASN A N   1 
ATOM 5408 C CA  . ASN A 1 698  ? -45.242 13.191  1.113   1.00 98.65  ? 695  ASN A CA  1 
ATOM 5409 C C   . ASN A 1 698  ? -45.952 13.816  2.303   1.00 98.65  ? 695  ASN A C   1 
ATOM 5410 O O   . ASN A 1 698  ? -46.970 13.294  2.771   1.00 98.65  ? 695  ASN A O   1 
ATOM 5411 C CB  . ASN A 1 698  ? -44.913 14.250  0.062   1.00 134.03 ? 695  ASN A CB  1 
ATOM 5412 C CG  . ASN A 1 698  ? -46.116 15.070  -0.337  1.00 134.03 ? 695  ASN A CG  1 
ATOM 5413 O OD1 . ASN A 1 698  ? -47.012 14.586  -1.028  1.00 134.03 ? 695  ASN A OD1 1 
ATOM 5414 N ND2 . ASN A 1 698  ? -46.139 16.324  0.094   1.00 134.03 ? 695  ASN A ND2 1 
ATOM 5415 N N   . ASN A 1 699  ? -45.391 14.927  2.781   1.00 103.55 ? 696  ASN A N   1 
ATOM 5416 C CA  . ASN A 1 699  ? -45.952 15.730  3.855   1.00 103.55 ? 696  ASN A CA  1 
ATOM 5417 C C   . ASN A 1 699  ? -47.451 15.547  3.955   1.00 103.55 ? 696  ASN A C   1 
ATOM 5418 O O   . ASN A 1 699  ? -47.955 15.216  5.022   1.00 103.55 ? 696  ASN A O   1 
ATOM 5419 C CB  . ASN A 1 699  ? -45.617 17.204  3.629   1.00 173.72 ? 696  ASN A CB  1 
ATOM 5420 C CG  . ASN A 1 699  ? -45.546 17.987  4.920   1.00 173.72 ? 696  ASN A CG  1 
ATOM 5421 O OD1 . ASN A 1 699  ? -44.749 17.677  5.807   1.00 173.72 ? 696  ASN A OD1 1 
ATOM 5422 N ND2 . ASN A 1 699  ? -46.370 19.018  5.028   1.00 173.72 ? 696  ASN A ND2 1 
ATOM 5423 N N   . SER A 1 700  ? -48.133 15.743  2.898   1.00 91.70  ? 697  SER A N   1 
ATOM 5424 C CA  . SER A 1 700  ? -49.568 15.480  2.865   1.00 91.70  ? 697  SER A CA  1 
ATOM 5425 C C   . SER A 1 700  ? -50.071 15.205  1.449   1.00 91.70  ? 697  SER A C   1 
ATOM 5426 O O   . SER A 1 700  ? -50.165 16.147  0.872   1.00 91.70  ? 697  SER A O   1 
ATOM 5427 C CB  . SER A 1 700  ? -50.340 16.652  3.477   1.00 139.36 ? 697  SER A CB  1 
ATOM 5428 O OG  . SER A 1 700  ? -50.579 17.758  2.817   1.00 139.36 ? 697  SER A OG  1 
ATOM 5429 N N   . THR A 1 701  ? -50.266 13.887  1.040   1.00 91.35  ? 698  THR A N   1 
ATOM 5430 C CA  . THR A 1 701  ? -50.797 13.576  -0.276  1.00 91.35  ? 698  THR A CA  1 
ATOM 5431 C C   . THR A 1 701  ? -50.189 12.331  -0.899  1.00 91.35  ? 698  THR A C   1 
ATOM 5432 O O   . THR A 1 701  ? -48.972 12.152  -0.927  1.00 91.35  ? 698  THR A O   1 
ATOM 5433 C CB  . THR A 1 701  ? -50.610 14.758  -1.249  1.00 148.75 ? 698  THR A CB  1 
ATOM 5434 O OG1 . THR A 1 701  ? -51.627 15.739  -1.015  1.00 148.75 ? 698  THR A OG1 1 
ATOM 5435 C CG2 . THR A 1 701  ? -50.693 14.280  -2.690  1.00 148.75 ? 698  THR A CG2 1 
ATOM 5436 N N   . LEU A 1 702  ? -51.070 11.480  -1.404  1.00 91.60  ? 699  LEU A N   1 
ATOM 5437 C CA  . LEU A 1 702  ? -50.692 10.290  -2.141  1.00 91.60  ? 699  LEU A CA  1 
ATOM 5438 C C   . LEU A 1 702  ? -50.674 10.632  -3.631  1.00 91.60  ? 699  LEU A C   1 
ATOM 5439 O O   . LEU A 1 702  ? -51.423 11.509  -4.085  1.00 91.60  ? 699  LEU A O   1 
ATOM 5440 C CB  . LEU A 1 702  ? -51.612 9.098   -1.868  1.00 59.29  ? 699  LEU A CB  1 
ATOM 5441 C CG  . LEU A 1 702  ? -51.055 7.849   -2.573  1.00 59.29  ? 699  LEU A CG  1 
ATOM 5442 C CD1 . LEU A 1 702  ? -50.282 6.992   -1.599  1.00 59.29  ? 699  LEU A CD1 1 
ATOM 5443 C CD2 . LEU A 1 702  ? -52.109 7.038   -3.282  1.00 59.29  ? 699  LEU A CD2 1 
ATOM 5444 N N   . THR A 1 703  ? -49.798 9.941   -4.365  1.00 107.33 ? 700  THR A N   1 
ATOM 5445 C CA  . THR A 1 703  ? -49.605 10.111  -5.799  1.00 107.33 ? 700  THR A CA  1 
ATOM 5446 C C   . THR A 1 703  ? -49.049 8.819   -6.405  1.00 107.33 ? 700  THR A C   1 
ATOM 5447 O O   . THR A 1 703  ? -48.560 7.939   -5.698  1.00 107.33 ? 700  THR A O   1 
ATOM 5448 C CB  . THR A 1 703  ? -48.635 11.272  -6.129  1.00 96.43  ? 700  THR A CB  1 
ATOM 5449 O OG1 . THR A 1 703  ? -47.391 11.054  -5.453  1.00 96.43  ? 700  THR A OG1 1 
ATOM 5450 C CG2 . THR A 1 703  ? -49.209 12.646  -5.727  1.00 96.43  ? 700  THR A CG2 1 
ATOM 5451 N N   . ILE A 1 704  ? -49.117 8.735   -7.727  1.00 86.33  ? 701  ILE A N   1 
ATOM 5452 C CA  . ILE A 1 704  ? -48.874 7.516   -8.485  1.00 86.33  ? 701  ILE A CA  1 
ATOM 5453 C C   . ILE A 1 704  ? -48.543 7.855   -9.956  1.00 86.33  ? 701  ILE A C   1 
ATOM 5454 O O   . ILE A 1 704  ? -49.231 8.688   -10.557 1.00 86.33  ? 701  ILE A O   1 
ATOM 5455 C CB  . ILE A 1 704  ? -50.133 6.613   -8.449  1.00 99.18  ? 701  ILE A CB  1 
ATOM 5456 C CG1 . ILE A 1 704  ? -51.437 7.450   -8.526  1.00 99.18  ? 701  ILE A CG1 1 
ATOM 5457 C CG2 . ILE A 1 704  ? -50.104 5.680   -7.250  1.00 99.18  ? 701  ILE A CG2 1 
ATOM 5458 C CD1 . ILE A 1 704  ? -51.997 8.021   -7.205  1.00 99.18  ? 701  ILE A CD1 1 
ATOM 5459 N N   . GLY A 1 705  ? -47.508 7.231   -10.531 1.00 54.87  ? 702  GLY A N   1 
ATOM 5460 C CA  . GLY A 1 705  ? -47.107 7.524   -11.915 1.00 54.87  ? 702  GLY A CA  1 
ATOM 5461 C C   . GLY A 1 705  ? -45.902 6.743   -12.426 1.00 54.87  ? 702  GLY A C   1 
ATOM 5462 O O   . GLY A 1 705  ? -45.249 6.009   -11.666 1.00 54.87  ? 702  GLY A O   1 
ATOM 5463 N N   . THR A 1 706  ? -45.577 6.875   -13.712 1.00 68.97  ? 703  THR A N   1 
ATOM 5464 C CA  . THR A 1 706  ? -44.380 6.179   -14.239 1.00 68.97  ? 703  THR A CA  1 
ATOM 5465 C C   . THR A 1 706  ? -43.127 7.062   -14.124 1.00 68.97  ? 703  THR A C   1 
ATOM 5466 O O   . THR A 1 706  ? -43.182 8.180   -13.593 1.00 68.97  ? 703  THR A O   1 
ATOM 5467 C CB  . THR A 1 706  ? -44.543 5.595   -15.701 1.00 111.14 ? 703  THR A CB  1 
ATOM 5468 O OG1 . THR A 1 706  ? -44.582 6.655   -16.670 1.00 111.14 ? 703  THR A OG1 1 
ATOM 5469 C CG2 . THR A 1 706  ? -45.789 4.729   -15.829 1.00 111.14 ? 703  THR A CG2 1 
ATOM 5470 N N   . ILE A 1 707  ? -42.010 6.544   -14.630 1.00 77.25  ? 704  ILE A N   1 
ATOM 5471 C CA  . ILE A 1 707  ? -40.701 7.143   -14.447 1.00 77.25  ? 704  ILE A CA  1 
ATOM 5472 C C   . ILE A 1 707  ? -40.048 7.371   -15.810 1.00 77.25  ? 704  ILE A C   1 
ATOM 5473 O O   . ILE A 1 707  ? -40.382 6.679   -16.775 1.00 77.25  ? 704  ILE A O   1 
ATOM 5474 C CB  . ILE A 1 707  ? -39.841 6.192   -13.573 1.00 81.78  ? 704  ILE A CB  1 
ATOM 5475 C CG1 . ILE A 1 707  ? -40.572 5.884   -12.271 1.00 81.78  ? 704  ILE A CG1 1 
ATOM 5476 C CG2 . ILE A 1 707  ? -38.460 6.764   -13.259 1.00 81.78  ? 704  ILE A CG2 1 
ATOM 5477 C CD1 . ILE A 1 707  ? -40.920 7.129   -11.415 1.00 81.78  ? 704  ILE A CD1 1 
ATOM 5478 N N   . ASP A 1 708  ? -39.145 8.321   -15.854 1.00 54.49  ? 705  ASP A N   1 
ATOM 5479 C CA  . ASP A 1 708  ? -38.487 8.673   -17.064 1.00 54.49  ? 705  ASP A CA  1 
ATOM 5480 C C   . ASP A 1 708  ? -37.251 7.812   -17.202 1.00 54.49  ? 705  ASP A C   1 
ATOM 5481 O O   . ASP A 1 708  ? -36.987 6.982   -16.388 1.00 54.49  ? 705  ASP A O   1 
ATOM 5482 C CB  . ASP A 1 708  ? -38.163 10.165  -17.011 1.00 118.87 ? 705  ASP A CB  1 
ATOM 5483 C CG  . ASP A 1 708  ? -39.422 11.051  -17.136 1.00 118.87 ? 705  ASP A CG  1 
ATOM 5484 O OD1 . ASP A 1 708  ? -40.452 10.482  -17.546 1.00 118.87 ? 705  ASP A OD1 1 
ATOM 5485 O OD2 . ASP A 1 708  ? -39.399 12.295  -16.850 1.00 118.87 ? 705  ASP A OD2 1 
ATOM 5486 N N   . GLU A 1 709  ? -36.507 8.001   -18.266 1.00 123.16 ? 706  GLU A N   1 
ATOM 5487 C CA  . GLU A 1 709  ? -35.294 7.241   -18.477 1.00 123.16 ? 706  GLU A CA  1 
ATOM 5488 C C   . GLU A 1 709  ? -34.479 7.214   -17.214 1.00 123.16 ? 706  GLU A C   1 
ATOM 5489 O O   . GLU A 1 709  ? -34.759 6.446   -16.323 1.00 123.16 ? 706  GLU A O   1 
ATOM 5490 C CB  . GLU A 1 709  ? -34.456 7.827   -19.625 1.00 142.91 ? 706  GLU A CB  1 
ATOM 5491 C CG  . GLU A 1 709  ? -33.642 6.802   -20.412 1.00 142.91 ? 706  GLU A CG  1 
ATOM 5492 C CD  . GLU A 1 709  ? -34.083 6.679   -21.850 1.00 142.91 ? 706  GLU A CD  1 
ATOM 5493 O OE1 . GLU A 1 709  ? -33.623 7.476   -22.682 1.00 142.91 ? 706  GLU A OE1 1 
ATOM 5494 O OE2 . GLU A 1 709  ? -34.893 5.785   -22.155 1.00 142.91 ? 706  GLU A OE2 1 
ATOM 5495 N N   . ILE A 1 710  ? -33.441 8.047   -17.151 1.00 53.54  ? 707  ILE A N   1 
ATOM 5496 C CA  . ILE A 1 710  ? -32.550 8.070   -15.990 1.00 53.54  ? 707  ILE A CA  1 
ATOM 5497 C C   . ILE A 1 710  ? -31.443 9.131   -16.065 1.00 53.54  ? 707  ILE A C   1 
ATOM 5498 O O   . ILE A 1 710  ? -31.479 10.121  -15.335 1.00 53.54  ? 707  ILE A O   1 
ATOM 5499 C CB  . ILE A 1 710  ? -31.901 6.692   -15.755 1.00 89.78  ? 707  ILE A CB  1 
ATOM 5500 C CG1 . ILE A 1 710  ? -31.059 6.286   -16.966 1.00 89.78  ? 707  ILE A CG1 1 
ATOM 5501 C CG2 . ILE A 1 710  ? -32.964 5.645   -15.463 1.00 89.78  ? 707  ILE A CG2 1 
ATOM 5502 C CD1 . ILE A 1 710  ? -30.215 5.051   -16.737 1.00 89.78  ? 707  ILE A CD1 1 
ATOM 5503 N N   . GLN A 1 711  ? -30.459 8.906   -16.934 1.00 51.52  ? 708  GLN A N   1 
ATOM 5504 C CA  . GLN A 1 711  ? -29.302 9.798   -17.081 1.00 51.52  ? 708  GLN A CA  1 
ATOM 5505 C C   . GLN A 1 711  ? -29.485 11.158  -16.406 1.00 51.52  ? 708  GLN A C   1 
ATOM 5506 O O   . GLN A 1 711  ? -30.520 11.805  -16.570 1.00 51.52  ? 708  GLN A O   1 
ATOM 5507 C CB  . GLN A 1 711  ? -28.965 9.992   -18.562 1.00 148.27 ? 708  GLN A CB  1 
ATOM 5508 C CG  . GLN A 1 711  ? -27.693 10.785  -18.811 1.00 148.27 ? 708  GLN A CG  1 
ATOM 5509 C CD  . GLN A 1 711  ? -27.301 10.812  -20.275 1.00 148.27 ? 708  GLN A CD  1 
ATOM 5510 O OE1 . GLN A 1 711  ? -27.928 10.161  -21.110 1.00 148.27 ? 708  GLN A OE1 1 
ATOM 5511 N NE2 . GLN A 1 711  ? -26.258 11.570  -20.594 1.00 148.27 ? 708  GLN A NE2 1 
ATOM 5512 N N   . LYS A 1 712  ? -28.473 11.599  -15.659 1.00 73.76  ? 709  LYS A N   1 
ATOM 5513 C CA  . LYS A 1 712  ? -28.599 12.826  -14.899 1.00 73.76  ? 709  LYS A CA  1 
ATOM 5514 C C   . LYS A 1 712  ? -29.567 13.696  -15.691 1.00 73.76  ? 709  LYS A C   1 
ATOM 5515 O O   . LYS A 1 712  ? -30.410 14.391  -15.120 1.00 73.76  ? 709  LYS A O   1 
ATOM 5516 C CB  . LYS A 1 712  ? -27.240 13.519  -14.739 1.00 126.82 ? 709  LYS A CB  1 
ATOM 5517 C CG  . LYS A 1 712  ? -27.257 14.724  -13.799 1.00 126.82 ? 709  LYS A CG  1 
ATOM 5518 C CD  . LYS A 1 712  ? -25.850 15.219  -13.478 1.00 126.82 ? 709  LYS A CD  1 
ATOM 5519 C CE  . LYS A 1 712  ? -25.891 16.504  -12.664 1.00 126.82 ? 709  LYS A CE  1 
ATOM 5520 N NZ  . LYS A 1 712  ? -26.742 16.367  -11.449 1.00 126.82 ? 709  LYS A NZ  1 
ATOM 5521 N N   . LEU A 1 713  ? -29.450 13.631  -17.016 1.00 55.89  ? 710  LEU A N   1 
ATOM 5522 C CA  . LEU A 1 713  ? -30.323 14.388  -17.915 1.00 55.89  ? 710  LEU A CA  1 
ATOM 5523 C C   . LEU A 1 713  ? -31.159 13.570  -18.901 1.00 55.89  ? 710  LEU A C   1 
ATOM 5524 O O   . LEU A 1 713  ? -30.718 12.590  -19.463 1.00 55.89  ? 710  LEU A O   1 
ATOM 5525 C CB  . LEU A 1 713  ? -29.527 15.399  -18.742 1.00 54.76  ? 710  LEU A CB  1 
ATOM 5526 C CG  . LEU A 1 713  ? -28.235 16.049  -18.280 1.00 54.76  ? 710  LEU A CG  1 
ATOM 5527 C CD1 . LEU A 1 713  ? -27.494 16.549  -19.534 1.00 54.76  ? 710  LEU A CD1 1 
ATOM 5528 C CD2 . LEU A 1 713  ? -28.451 17.169  -17.273 1.00 54.76  ? 710  LEU A CD2 1 
ATOM 5529 N N   . HIS A 1 714  ? -32.367 14.049  -19.139 1.00 72.12  ? 711  HIS A N   1 
ATOM 5530 C CA  . HIS A 1 714  ? -33.161 13.574  -20.234 1.00 72.12  ? 711  HIS A CA  1 
ATOM 5531 C C   . HIS A 1 714  ? -32.957 14.465  -21.449 1.00 72.12  ? 711  HIS A C   1 
ATOM 5532 O O   . HIS A 1 714  ? -32.981 15.690  -21.349 1.00 72.12  ? 711  HIS A O   1 
ATOM 5533 C CB  . HIS A 1 714  ? -34.627 13.540  -19.847 1.00 86.99  ? 711  HIS A CB  1 
ATOM 5534 C CG  . HIS A 1 714  ? -35.494 12.963  -20.912 1.00 86.99  ? 711  HIS A CG  1 
ATOM 5535 N ND1 . HIS A 1 714  ? -35.326 11.678  -21.384 1.00 86.99  ? 711  HIS A ND1 1 
ATOM 5536 C CD2 . HIS A 1 714  ? -36.504 13.504  -21.631 1.00 86.99  ? 711  HIS A CD2 1 
ATOM 5537 C CE1 . HIS A 1 714  ? -36.211 11.446  -22.338 1.00 86.99  ? 711  HIS A CE1 1 
ATOM 5538 N NE2 . HIS A 1 714  ? -36.939 12.535  -22.503 1.00 86.99  ? 711  HIS A NE2 1 
ATOM 5539 N N   . ILE A 1 715  ? -32.842 13.842  -22.599 1.00 58.97  ? 712  ILE A N   1 
ATOM 5540 C CA  . ILE A 1 715  ? -32.789 14.557  -23.832 1.00 58.97  ? 712  ILE A CA  1 
ATOM 5541 C C   . ILE A 1 715  ? -33.914 14.177  -24.727 1.00 58.97  ? 712  ILE A C   1 
ATOM 5542 O O   . ILE A 1 715  ? -33.946 13.098  -25.234 1.00 58.97  ? 712  ILE A O   1 
ATOM 5543 C CB  . ILE A 1 715  ? -31.558 14.219  -24.589 1.00 58.60  ? 712  ILE A CB  1 
ATOM 5544 C CG1 . ILE A 1 715  ? -30.354 14.640  -23.794 1.00 58.60  ? 712  ILE A CG1 1 
ATOM 5545 C CG2 . ILE A 1 715  ? -31.563 14.937  -25.888 1.00 58.60  ? 712  ILE A CG2 1 
ATOM 5546 C CD1 . ILE A 1 715  ? -29.155 13.981  -24.210 1.00 58.60  ? 712  ILE A CD1 1 
ATOM 5547 N N   . ARG A 1 716  ? -34.833 15.090  -24.947 1.00 68.41  ? 713  ARG A N   1 
ATOM 5548 C CA  . ARG A 1 716  ? -35.895 14.836  -25.879 1.00 68.41  ? 713  ARG A CA  1 
ATOM 5549 C C   . ARG A 1 716  ? -35.342 14.976  -27.256 1.00 68.41  ? 713  ARG A C   1 
ATOM 5550 O O   . ARG A 1 716  ? -34.218 15.258  -27.452 1.00 68.41  ? 713  ARG A O   1 
ATOM 5551 C CB  . ARG A 1 716  ? -37.043 15.808  -25.669 1.00 55.10  ? 713  ARG A CB  1 
ATOM 5552 C CG  . ARG A 1 716  ? -38.288 15.545  -26.476 1.00 55.10  ? 713  ARG A CG  1 
ATOM 5553 C CD  . ARG A 1 716  ? -39.462 16.041  -25.692 1.00 55.10  ? 713  ARG A CD  1 
ATOM 5554 N NE  . ARG A 1 716  ? -40.680 16.267  -26.456 1.00 55.10  ? 713  ARG A NE  1 
ATOM 5555 C CZ  . ARG A 1 716  ? -40.917 15.798  -27.668 1.00 55.10  ? 713  ARG A CZ  1 
ATOM 5556 N NH1 . ARG A 1 716  ? -40.012 15.066  -28.284 1.00 55.10  ? 713  ARG A NH1 1 
ATOM 5557 N NH2 . ARG A 1 716  ? -42.071 16.058  -28.255 1.00 55.10  ? 713  ARG A NH2 1 
ATOM 5558 N N   . THR A 1 717  ? -36.179 14.768  -28.217 1.00 36.74  ? 714  THR A N   1 
ATOM 5559 C CA  . THR A 1 717  ? -35.795 14.636  -29.618 1.00 36.74  ? 714  THR A CA  1 
ATOM 5560 C C   . THR A 1 717  ? -36.696 15.457  -30.536 1.00 36.74  ? 714  THR A C   1 
ATOM 5561 O O   . THR A 1 717  ? -37.817 15.812  -30.172 1.00 36.74  ? 714  THR A O   1 
ATOM 5562 C CB  . THR A 1 717  ? -35.821 13.165  -30.074 1.00 27.78  ? 714  THR A CB  1 
ATOM 5563 O OG1 . THR A 1 717  ? -34.914 12.398  -29.273 1.00 27.78  ? 714  THR A OG1 1 
ATOM 5564 C CG2 . THR A 1 717  ? -35.419 13.053  -31.536 1.00 27.78  ? 714  THR A CG2 1 
ATOM 5565 N N   . VAL A 1 718  ? -36.192 15.752  -31.730 1.00 37.04  ? 715  VAL A N   1 
ATOM 5566 C CA  . VAL A 1 718  ? -36.930 16.526  -32.720 1.00 37.04  ? 715  VAL A CA  1 
ATOM 5567 C C   . VAL A 1 718  ? -36.145 16.561  -34.025 1.00 37.04  ? 715  VAL A C   1 
ATOM 5568 O O   . VAL A 1 718  ? -35.422 17.518  -34.301 1.00 37.04  ? 715  VAL A O   1 
ATOM 5569 C CB  . VAL A 1 718  ? -37.180 17.967  -32.242 1.00 49.57  ? 715  VAL A CB  1 
ATOM 5570 C CG1 . VAL A 1 718  ? -37.880 18.772  -33.326 1.00 49.57  ? 715  VAL A CG1 1 
ATOM 5571 C CG2 . VAL A 1 718  ? -37.996 17.966  -30.959 1.00 49.57  ? 715  VAL A CG2 1 
ATOM 5572 N N   . PRO A 1 719  ? -36.288 15.508  -34.823 1.00 27.66  ? 716  PRO A N   1 
ATOM 5573 C CA  . PRO A 1 719  ? -35.565 15.405  -36.102 1.00 27.66  ? 716  PRO A CA  1 
ATOM 5574 C C   . PRO A 1 719  ? -36.062 16.453  -37.043 1.00 27.66  ? 716  PRO A C   1 
ATOM 5575 O O   . PRO A 1 719  ? -37.218 16.477  -37.299 1.00 27.66  ? 716  PRO A O   1 
ATOM 5576 C CB  . PRO A 1 719  ? -36.039 14.080  -36.679 1.00 18.81  ? 716  PRO A CB  1 
ATOM 5577 C CG  . PRO A 1 719  ? -36.426 13.263  -35.450 1.00 18.81  ? 716  PRO A CG  1 
ATOM 5578 C CD  . PRO A 1 719  ? -37.061 14.289  -34.522 1.00 18.81  ? 716  PRO A CD  1 
ATOM 5579 N N   . LEU A 1 720  ? -35.220 17.341  -37.532 1.00 36.25  ? 717  LEU A N   1 
ATOM 5580 C CA  . LEU A 1 720  ? -35.661 18.405  -38.428 1.00 36.25  ? 717  LEU A CA  1 
ATOM 5581 C C   . LEU A 1 720  ? -35.430 18.057  -39.879 1.00 36.25  ? 717  LEU A C   1 
ATOM 5582 O O   . LEU A 1 720  ? -36.070 18.653  -40.728 1.00 36.25  ? 717  LEU A O   1 
ATOM 5583 C CB  . LEU A 1 720  ? -34.911 19.696  -38.130 1.00 33.13  ? 717  LEU A CB  1 
ATOM 5584 C CG  . LEU A 1 720  ? -35.405 20.409  -36.881 1.00 33.13  ? 717  LEU A CG  1 
ATOM 5585 C CD1 . LEU A 1 720  ? -34.653 21.733  -36.681 1.00 33.13  ? 717  LEU A CD1 1 
ATOM 5586 C CD2 . LEU A 1 720  ? -36.859 20.649  -37.078 1.00 33.13  ? 717  LEU A CD2 1 
ATOM 5587 N N   . TYR A 1 721  ? -34.504 17.126  -40.151 1.00 37.14  ? 718  TYR A N   1 
ATOM 5588 C CA  . TYR A 1 721  ? -34.148 16.705  -41.506 1.00 37.14  ? 718  TYR A CA  1 
ATOM 5589 C C   . TYR A 1 721  ? -33.447 17.740  -42.363 1.00 37.14  ? 718  TYR A C   1 
ATOM 5590 O O   . TYR A 1 721  ? -33.023 17.444  -43.502 1.00 37.14  ? 718  TYR A O   1 
ATOM 5591 C CB  . TYR A 1 721  ? -35.326 16.069  -42.249 1.00 26.72  ? 718  TYR A CB  1 
ATOM 5592 C CG  . TYR A 1 721  ? -35.810 14.884  -41.502 1.00 26.72  ? 718  TYR A CG  1 
ATOM 5593 C CD1 . TYR A 1 721  ? -37.011 14.926  -40.794 1.00 26.72  ? 718  TYR A CD1 1 
ATOM 5594 C CD2 . TYR A 1 721  ? -34.993 13.750  -41.395 1.00 26.72  ? 718  TYR A CD2 1 
ATOM 5595 C CE1 . TYR A 1 721  ? -37.382 13.850  -40.029 1.00 26.72  ? 718  TYR A CE1 1 
ATOM 5596 C CE2 . TYR A 1 721  ? -35.342 12.709  -40.651 1.00 26.72  ? 718  TYR A CE2 1 
ATOM 5597 C CZ  . TYR A 1 721  ? -36.532 12.754  -39.988 1.00 26.72  ? 718  TYR A CZ  1 
ATOM 5598 O OH  . TYR A 1 721  ? -36.880 11.647  -39.287 1.00 26.72  ? 718  TYR A OH  1 
ATOM 5599 N N   . GLU A 1 722  ? -33.282 18.934  -41.818 1.00 78.15  ? 719  GLU A N   1 
ATOM 5600 C CA  . GLU A 1 722  ? -32.397 19.920  -42.401 1.00 78.15  ? 719  GLU A CA  1 
ATOM 5601 C C   . GLU A 1 722  ? -31.584 20.533  -41.232 1.00 78.15  ? 719  GLU A C   1 
ATOM 5602 O O   . GLU A 1 722  ? -31.569 19.971  -40.136 1.00 78.15  ? 719  GLU A O   1 
ATOM 5603 C CB  . GLU A 1 722  ? -33.215 20.924  -43.215 1.00 40.88  ? 719  GLU A CB  1 
ATOM 5604 C CG  . GLU A 1 722  ? -33.933 21.934  -42.355 1.00 40.88  ? 719  GLU A CG  1 
ATOM 5605 C CD  . GLU A 1 722  ? -35.226 22.417  -42.943 1.00 40.88  ? 719  GLU A CD  1 
ATOM 5606 O OE1 . GLU A 1 722  ? -35.813 23.347  -42.354 1.00 40.88  ? 719  GLU A OE1 1 
ATOM 5607 O OE2 . GLU A 1 722  ? -35.691 21.864  -43.971 1.00 40.88  ? 719  GLU A OE2 1 
ATOM 5608 N N   . SER A 1 723  ? -30.911 21.660  -41.441 1.00 25.88  ? 720  SER A N   1 
ATOM 5609 C CA  . SER A 1 723  ? -30.051 22.196  -40.417 1.00 25.88  ? 720  SER A CA  1 
ATOM 5610 C C   . SER A 1 723  ? -30.544 23.471  -39.795 1.00 25.88  ? 720  SER A C   1 
ATOM 5611 O O   . SER A 1 723  ? -30.501 24.484  -40.440 1.00 25.88  ? 720  SER A O   1 
ATOM 5612 C CB  . SER A 1 723  ? -28.684 22.483  -41.024 1.00 36.90  ? 720  SER A CB  1 
ATOM 5613 O OG  . SER A 1 723  ? -28.818 22.748  -42.390 1.00 36.90  ? 720  SER A OG  1 
ATOM 5614 N N   . PRO A 1 724  ? -30.884 23.465  -38.504 1.00 20.31  ? 721  PRO A N   1 
ATOM 5615 C CA  . PRO A 1 724  ? -31.449 24.647  -37.849 1.00 20.31  ? 721  PRO A CA  1 
ATOM 5616 C C   . PRO A 1 724  ? -30.301 25.614  -37.638 1.00 20.31  ? 721  PRO A C   1 
ATOM 5617 O O   . PRO A 1 724  ? -29.134 25.184  -37.654 1.00 20.31  ? 721  PRO A O   1 
ATOM 5618 C CB  . PRO A 1 724  ? -31.836 24.118  -36.490 1.00 24.04  ? 721  PRO A CB  1 
ATOM 5619 C CG  . PRO A 1 724  ? -30.837 23.002  -36.237 1.00 24.04  ? 721  PRO A CG  1 
ATOM 5620 C CD  . PRO A 1 724  ? -30.615 22.355  -37.570 1.00 24.04  ? 721  PRO A CD  1 
ATOM 5621 N N   . ARG A 1 725  ? -30.578 26.896  -37.391 1.00 44.44  ? 722  ARG A N   1 
ATOM 5622 C CA  . ARG A 1 725  ? -29.500 27.906  -37.333 1.00 44.44  ? 722  ARG A CA  1 
ATOM 5623 C C   . ARG A 1 725  ? -29.647 28.870  -36.159 1.00 44.44  ? 722  ARG A C   1 
ATOM 5624 O O   . ARG A 1 725  ? -28.660 29.181  -35.458 1.00 44.44  ? 722  ARG A O   1 
ATOM 5625 C CB  . ARG A 1 725  ? -29.446 28.710  -38.644 1.00 28.83  ? 722  ARG A CB  1 
ATOM 5626 C CG  . ARG A 1 725  ? -29.173 27.886  -39.986 1.00 28.83  ? 722  ARG A CG  1 
ATOM 5627 C CD  . ARG A 1 725  ? -27.660 27.877  -40.322 1.00 28.83  ? 722  ARG A CD  1 
ATOM 5628 N NE  . ARG A 1 725  ? -27.396 27.212  -41.611 1.00 28.83  ? 722  ARG A NE  1 
ATOM 5629 C CZ  . ARG A 1 725  ? -26.850 27.795  -42.692 1.00 28.83  ? 722  ARG A CZ  1 
ATOM 5630 N NH1 . ARG A 1 725  ? -26.443 29.075  -42.702 1.00 28.83  ? 722  ARG A NH1 1 
ATOM 5631 N NH2 . ARG A 1 725  ? -26.694 27.056  -43.785 1.00 28.83  ? 722  ARG A NH2 1 
ATOM 5632 N N   . LYS A 1 726  ? -30.865 29.364  -35.938 1.00 28.00  ? 723  LYS A N   1 
ATOM 5633 C CA  . LYS A 1 726  ? -31.093 30.210  -34.758 1.00 28.00  ? 723  LYS A CA  1 
ATOM 5634 C C   . LYS A 1 726  ? -32.351 29.841  -33.985 1.00 28.00  ? 723  LYS A C   1 
ATOM 5635 O O   . LYS A 1 726  ? -33.239 29.131  -34.517 1.00 28.00  ? 723  LYS A O   1 
ATOM 5636 C CB  . LYS A 1 726  ? -31.103 31.669  -35.156 1.00 37.85  ? 723  LYS A CB  1 
ATOM 5637 C CG  . LYS A 1 726  ? -29.708 32.201  -35.563 1.00 37.85  ? 723  LYS A CG  1 
ATOM 5638 C CD  . LYS A 1 726  ? -28.736 32.120  -34.384 1.00 37.85  ? 723  LYS A CD  1 
ATOM 5639 C CE  . LYS A 1 726  ? -27.751 33.269  -34.336 1.00 37.85  ? 723  LYS A CE  1 
ATOM 5640 N NZ  . LYS A 1 726  ? -26.680 33.121  -35.354 1.00 37.85  ? 723  LYS A NZ  1 
ATOM 5641 N N   . ILE A 1 727  ? -32.486 30.287  -32.740 1.00 26.68  ? 724  ILE A N   1 
ATOM 5642 C CA  . ILE A 1 727  ? -33.695 29.866  -32.085 1.00 26.68  ? 724  ILE A CA  1 
ATOM 5643 C C   . ILE A 1 727  ? -34.240 30.843  -31.061 1.00 26.68  ? 724  ILE A C   1 
ATOM 5644 O O   . ILE A 1 727  ? -33.486 31.325  -30.218 1.00 26.68  ? 724  ILE A O   1 
ATOM 5645 C CB  . ILE A 1 727  ? -33.546 28.451  -31.529 1.00 23.12  ? 724  ILE A CB  1 
ATOM 5646 C CG1 . ILE A 1 727  ? -34.903 27.940  -31.057 1.00 23.12  ? 724  ILE A CG1 1 
ATOM 5647 C CG2 . ILE A 1 727  ? -32.621 28.450  -30.365 1.00 23.12  ? 724  ILE A CG2 1 
ATOM 5648 C CD1 . ILE A 1 727  ? -35.006 26.449  -30.927 1.00 23.12  ? 724  ILE A CD1 1 
ATOM 5649 N N   . CYS A 1 728  ? -35.551 31.123  -31.157 1.00 41.03  ? 725  CYS A N   1 
ATOM 5650 C CA  . CYS A 1 728  ? -36.283 32.103  -30.299 1.00 41.03  ? 725  CYS A CA  1 
ATOM 5651 C C   . CYS A 1 728  ? -37.565 31.626  -29.638 1.00 41.03  ? 725  CYS A C   1 
ATOM 5652 O O   . CYS A 1 728  ? -38.463 31.076  -30.299 1.00 41.03  ? 725  CYS A O   1 
ATOM 5653 C CB  . CYS A 1 728  ? -36.696 33.289  -31.110 1.00 70.99  ? 725  CYS A CB  1 
ATOM 5654 S SG  . CYS A 1 728  ? -35.374 34.232  -31.174 1.00 70.99  ? 725  CYS A SG  1 
ATOM 5655 N N   . TYR A 1 729  ? -37.660 31.907  -28.345 1.00 58.34  ? 726  TYR A N   1 
ATOM 5656 C CA  . TYR A 1 729  ? -38.863 31.631  -27.630 1.00 58.34  ? 726  TYR A CA  1 
ATOM 5657 C C   . TYR A 1 729  ? -39.725 32.891  -27.496 1.00 58.34  ? 726  TYR A C   1 
ATOM 5658 O O   . TYR A 1 729  ? -39.318 33.857  -26.879 1.00 58.34  ? 726  TYR A O   1 
ATOM 5659 C CB  . TYR A 1 729  ? -38.553 30.986  -26.291 1.00 48.40  ? 726  TYR A CB  1 
ATOM 5660 C CG  . TYR A 1 729  ? -39.791 30.556  -25.563 1.00 48.40  ? 726  TYR A CG  1 
ATOM 5661 C CD1 . TYR A 1 729  ? -40.721 29.713  -26.170 1.00 48.40  ? 726  TYR A CD1 1 
ATOM 5662 C CD2 . TYR A 1 729  ? -40.055 31.016  -24.270 1.00 48.40  ? 726  TYR A CD2 1 
ATOM 5663 C CE1 . TYR A 1 729  ? -41.878 29.323  -25.505 1.00 48.40  ? 726  TYR A CE1 1 
ATOM 5664 C CE2 . TYR A 1 729  ? -41.199 30.629  -23.590 1.00 48.40  ? 726  TYR A CE2 1 
ATOM 5665 C CZ  . TYR A 1 729  ? -42.122 29.788  -24.210 1.00 48.40  ? 726  TYR A CZ  1 
ATOM 5666 O OH  . TYR A 1 729  ? -43.287 29.416  -23.536 1.00 48.40  ? 726  TYR A OH  1 
ATOM 5667 N N   . GLN A 1 730  ? -40.908 32.864  -28.115 1.00 36.63  ? 727  GLN A N   1 
ATOM 5668 C CA  . GLN A 1 730  ? -41.952 33.888  -27.989 1.00 36.63  ? 727  GLN A CA  1 
ATOM 5669 C C   . GLN A 1 730  ? -43.146 33.323  -27.149 1.00 36.63  ? 727  GLN A C   1 
ATOM 5670 O O   . GLN A 1 730  ? -44.067 32.579  -27.648 1.00 36.63  ? 727  GLN A O   1 
ATOM 5671 C CB  . GLN A 1 730  ? -42.376 34.284  -29.384 1.00 53.36  ? 727  GLN A CB  1 
ATOM 5672 C CG  . GLN A 1 730  ? -43.312 35.421  -29.472 1.00 53.36  ? 727  GLN A CG  1 
ATOM 5673 C CD  . GLN A 1 730  ? -43.412 35.905  -30.905 1.00 53.36  ? 727  GLN A CD  1 
ATOM 5674 O OE1 . GLN A 1 730  ? -42.442 36.466  -31.467 1.00 53.36  ? 727  GLN A OE1 1 
ATOM 5675 N NE2 . GLN A 1 730  ? -44.580 35.680  -31.521 1.00 53.36  ? 727  GLN A NE2 1 
ATOM 5676 N N   . GLU A 1 731  ? -43.110 33.646  -25.859 1.00 62.47  ? 728  GLU A N   1 
ATOM 5677 C CA  . GLU A 1 731  ? -43.945 32.947  -24.895 1.00 62.47  ? 728  GLU A CA  1 
ATOM 5678 C C   . GLU A 1 731  ? -45.430 33.286  -25.040 1.00 62.47  ? 728  GLU A C   1 
ATOM 5679 O O   . GLU A 1 731  ? -46.271 32.400  -24.983 1.00 62.47  ? 728  GLU A O   1 
ATOM 5680 C CB  . GLU A 1 731  ? -43.413 33.208  -23.492 1.00 93.65  ? 728  GLU A CB  1 
ATOM 5681 C CG  . GLU A 1 731  ? -44.354 32.904  -22.378 1.00 93.65  ? 728  GLU A CG  1 
ATOM 5682 C CD  . GLU A 1 731  ? -44.986 34.158  -21.873 1.00 93.65  ? 728  GLU A CD  1 
ATOM 5683 O OE1 . GLU A 1 731  ? -45.328 34.182  -20.674 1.00 93.65  ? 728  GLU A OE1 1 
ATOM 5684 O OE2 . GLU A 1 731  ? -45.120 35.126  -22.663 1.00 93.65  ? 728  GLU A OE2 1 
ATOM 5685 N N   . VAL A 1 732  ? -45.750 34.559  -25.256 1.00 59.89  ? 729  VAL A N   1 
ATOM 5686 C CA  . VAL A 1 732  ? -47.141 34.970  -25.513 1.00 59.89  ? 729  VAL A CA  1 
ATOM 5687 C C   . VAL A 1 732  ? -47.837 34.112  -26.578 1.00 59.89  ? 729  VAL A C   1 
ATOM 5688 O O   . VAL A 1 732  ? -49.007 33.757  -26.408 1.00 59.89  ? 729  VAL A O   1 
ATOM 5689 C CB  . VAL A 1 732  ? -47.284 36.479  -25.865 1.00 48.25  ? 729  VAL A CB  1 
ATOM 5690 C CG1 . VAL A 1 732  ? -46.540 37.342  -24.837 1.00 48.25  ? 729  VAL A CG1 1 
ATOM 5691 C CG2 . VAL A 1 732  ? -46.815 36.759  -27.284 1.00 48.25  ? 729  VAL A CG2 1 
ATOM 5692 N N   . SER A 1 733  ? -47.109 33.767  -27.647 1.00 46.42  ? 730  SER A N   1 
ATOM 5693 C CA  . SER A 1 733  ? -47.607 32.869  -28.696 1.00 46.42  ? 730  SER A CA  1 
ATOM 5694 C C   . SER A 1 733  ? -47.288 31.410  -28.433 1.00 46.42  ? 730  SER A C   1 
ATOM 5695 O O   . SER A 1 733  ? -47.582 30.579  -29.277 1.00 46.42  ? 730  SER A O   1 
ATOM 5696 C CB  . SER A 1 733  ? -46.998 33.210  -30.045 1.00 57.50  ? 730  SER A CB  1 
ATOM 5697 O OG  . SER A 1 733  ? -46.339 34.459  -30.010 1.00 57.50  ? 730  SER A OG  1 
ATOM 5698 N N   . GLN A 1 734  ? -46.663 31.093  -27.301 1.00 59.98  ? 731  GLN A N   1 
ATOM 5699 C CA  . GLN A 1 734  ? -46.322 29.699  -26.932 1.00 59.98  ? 731  GLN A CA  1 
ATOM 5700 C C   . GLN A 1 734  ? -45.618 28.885  -28.020 1.00 59.98  ? 731  GLN A C   1 
ATOM 5701 O O   . GLN A 1 734  ? -45.894 27.705  -28.199 1.00 59.98  ? 731  GLN A O   1 
ATOM 5702 C CB  . GLN A 1 734  ? -47.556 28.929  -26.457 1.00 60.81  ? 731  GLN A CB  1 
ATOM 5703 C CG  . GLN A 1 734  ? -48.251 29.507  -25.280 1.00 60.81  ? 731  GLN A CG  1 
ATOM 5704 C CD  . GLN A 1 734  ? -47.535 29.195  -24.002 1.00 60.81  ? 731  GLN A CD  1 
ATOM 5705 O OE1 . GLN A 1 734  ? -47.748 28.138  -23.386 1.00 60.81  ? 731  GLN A OE1 1 
ATOM 5706 N NE2 . GLN A 1 734  ? -46.670 30.113  -23.579 1.00 60.81  ? 731  GLN A NE2 1 
ATOM 5707 N N   . CYS A 1 735  ? -44.701 29.513  -28.737 1.00 43.72  ? 732  CYS A N   1 
ATOM 5708 C CA  . CYS A 1 735  ? -43.946 28.809  -29.765 1.00 43.72  ? 732  CYS A CA  1 
ATOM 5709 C C   . CYS A 1 735  ? -42.470 29.246  -29.903 1.00 43.72  ? 732  CYS A C   1 
ATOM 5710 O O   . CYS A 1 735  ? -41.990 30.175  -29.224 1.00 43.72  ? 732  CYS A O   1 
ATOM 5711 C CB  . CYS A 1 735  ? -44.657 28.956  -31.100 1.00 75.53  ? 732  CYS A CB  1 
ATOM 5712 S SG  . CYS A 1 735  ? -44.990 30.660  -31.499 1.00 75.53  ? 732  CYS A SG  1 
ATOM 5713 N N   . PHE A 1 736  ? -41.767 28.559  -30.796 1.00 48.08  ? 733  PHE A N   1 
ATOM 5714 C CA  . PHE A 1 736  ? -40.371 28.847  -31.072 1.00 48.08  ? 733  PHE A CA  1 
ATOM 5715 C C   . PHE A 1 736  ? -40.253 29.310  -32.489 1.00 48.08  ? 733  PHE A C   1 
ATOM 5716 O O   . PHE A 1 736  ? -40.941 28.801  -33.365 1.00 48.08  ? 733  PHE A O   1 
ATOM 5717 C CB  . PHE A 1 736  ? -39.491 27.596  -30.906 1.00 35.85  ? 733  PHE A CB  1 
ATOM 5718 C CG  . PHE A 1 736  ? -39.276 27.182  -29.473 1.00 35.85  ? 733  PHE A CG  1 
ATOM 5719 C CD1 . PHE A 1 736  ? -39.674 25.928  -29.030 1.00 35.85  ? 733  PHE A CD1 1 
ATOM 5720 C CD2 . PHE A 1 736  ? -38.705 28.046  -28.564 1.00 35.85  ? 733  PHE A CD2 1 
ATOM 5721 C CE1 . PHE A 1 736  ? -39.489 25.540  -27.708 1.00 35.85  ? 733  PHE A CE1 1 
ATOM 5722 C CE2 . PHE A 1 736  ? -38.526 27.663  -27.235 1.00 35.85  ? 733  PHE A CE2 1 
ATOM 5723 C CZ  . PHE A 1 736  ? -38.913 26.403  -26.814 1.00 35.85  ? 733  PHE A CZ  1 
ATOM 5724 N N   . GLY A 1 737  ? -39.383 30.281  -32.715 1.00 33.89  ? 734  GLY A N   1 
ATOM 5725 C CA  . GLY A 1 737  ? -39.040 30.684  -34.058 1.00 33.89  ? 734  GLY A CA  1 
ATOM 5726 C C   . GLY A 1 737  ? -37.712 30.042  -34.283 1.00 33.89  ? 734  GLY A C   1 
ATOM 5727 O O   . GLY A 1 737  ? -36.844 30.042  -33.390 1.00 33.89  ? 734  GLY A O   1 
ATOM 5728 N N   . VAL A 1 738  ? -37.532 29.448  -35.449 1.00 28.52  ? 735  VAL A N   1 
ATOM 5729 C CA  . VAL A 1 738  ? -36.270 28.773  -35.725 1.00 28.52  ? 735  VAL A CA  1 
ATOM 5730 C C   . VAL A 1 738  ? -35.893 29.034  -37.163 1.00 28.52  ? 735  VAL A C   1 
ATOM 5731 O O   . VAL A 1 738  ? -36.725 28.828  -38.077 1.00 28.52  ? 735  VAL A O   1 
ATOM 5732 C CB  . VAL A 1 738  ? -36.427 27.293  -35.506 1.00 21.42  ? 735  VAL A CB  1 
ATOM 5733 C CG1 . VAL A 1 738  ? -35.416 26.449  -36.316 1.00 21.42  ? 735  VAL A CG1 1 
ATOM 5734 C CG2 . VAL A 1 738  ? -36.353 27.026  -34.044 1.00 21.42  ? 735  VAL A CG2 1 
ATOM 5735 N N   . LEU A 1 739  ? -34.672 29.527  -37.376 1.00 31.65  ? 736  LEU A N   1 
ATOM 5736 C CA  . LEU A 1 739  ? -34.245 29.771  -38.712 1.00 31.65  ? 736  LEU A CA  1 
ATOM 5737 C C   . LEU A 1 739  ? -33.672 28.442  -39.109 1.00 31.65  ? 736  LEU A C   1 
ATOM 5738 O O   . LEU A 1 739  ? -33.115 27.771  -38.259 1.00 31.65  ? 736  LEU A O   1 
ATOM 5739 C CB  . LEU A 1 739  ? -33.212 30.879  -38.745 1.00 44.98  ? 736  LEU A CB  1 
ATOM 5740 C CG  . LEU A 1 739  ? -33.647 32.223  -38.167 1.00 44.98  ? 736  LEU A CG  1 
ATOM 5741 C CD1 . LEU A 1 739  ? -32.603 33.297  -38.444 1.00 44.98  ? 736  LEU A CD1 1 
ATOM 5742 C CD2 . LEU A 1 739  ? -34.969 32.603  -38.729 1.00 44.98  ? 736  LEU A CD2 1 
ATOM 5743 N N   . SER A 1 740  ? -33.841 28.047  -40.365 1.00 30.87  ? 737  SER A N   1 
ATOM 5744 C CA  . SER A 1 740  ? -33.427 26.752  -40.871 1.00 30.87  ? 737  SER A CA  1 
ATOM 5745 C C   . SER A 1 740  ? -32.966 26.903  -42.315 1.00 30.87  ? 737  SER A C   1 
ATOM 5746 O O   . SER A 1 740  ? -33.224 27.939  -42.943 1.00 30.87  ? 737  SER A O   1 
ATOM 5747 C CB  . SER A 1 740  ? -34.581 25.761  -40.808 1.00 66.48  ? 737  SER A CB  1 
ATOM 5748 O OG  . SER A 1 740  ? -35.626 26.128  -41.687 1.00 66.48  ? 737  SER A OG  1 
ATOM 5749 N N   . SER A 1 741  ? -32.306 25.887  -42.854 1.00 30.70  ? 738  SER A N   1 
ATOM 5750 C CA  . SER A 1 741  ? -31.695 26.009  -44.144 1.00 30.70  ? 738  SER A CA  1 
ATOM 5751 C C   . SER A 1 741  ? -31.740 24.611  -44.727 1.00 30.70  ? 738  SER A C   1 
ATOM 5752 O O   . SER A 1 741  ? -31.483 23.605  -44.013 1.00 30.70  ? 738  SER A O   1 
ATOM 5753 C CB  . SER A 1 741  ? -30.252 26.553  -44.001 1.00 42.86  ? 738  SER A CB  1 
ATOM 5754 O OG  . SER A 1 741  ? -29.218 25.698  -44.524 1.00 42.86  ? 738  SER A OG  1 
ATOM 5755 N N   . ARG A 1 742  ? -32.101 24.513  -46.004 1.00 25.37  ? 739  ARG A N   1 
ATOM 5756 C CA  . ARG A 1 742  ? -32.083 23.221  -46.675 1.00 25.37  ? 739  ARG A CA  1 
ATOM 5757 C C   . ARG A 1 742  ? -31.293 23.409  -47.966 1.00 25.37  ? 739  ARG A C   1 
ATOM 5758 O O   . ARG A 1 742  ? -31.170 24.523  -48.481 1.00 25.37  ? 739  ARG A O   1 
ATOM 5759 C CB  . ARG A 1 742  ? -33.504 22.680  -46.897 1.00 52.60  ? 739  ARG A CB  1 
ATOM 5760 C CG  . ARG A 1 742  ? -34.412 23.440  -47.906 1.00 52.60  ? 739  ARG A CG  1 
ATOM 5761 C CD  . ARG A 1 742  ? -35.808 22.795  -47.899 1.00 52.60  ? 739  ARG A CD  1 
ATOM 5762 N NE  . ARG A 1 742  ? -36.699 23.223  -48.983 1.00 52.60  ? 739  ARG A NE  1 
ATOM 5763 C CZ  . ARG A 1 742  ? -37.559 24.253  -48.942 1.00 52.60  ? 739  ARG A CZ  1 
ATOM 5764 N NH1 . ARG A 1 742  ? -37.683 25.046  -47.869 1.00 52.60  ? 739  ARG A NH1 1 
ATOM 5765 N NH2 . ARG A 1 742  ? -38.308 24.495  -50.008 1.00 52.60  ? 739  ARG A NH2 1 
ATOM 5766 N N   . ILE A 1 743  ? -30.715 22.333  -48.442 1.00 46.30  ? 740  ILE A N   1 
ATOM 5767 C CA  . ILE A 1 743  ? -29.952 22.371  -49.644 1.00 46.30  ? 740  ILE A CA  1 
ATOM 5768 C C   . ILE A 1 743  ? -30.917 21.943  -50.740 1.00 46.30  ? 740  ILE A C   1 
ATOM 5769 O O   . ILE A 1 743  ? -31.871 21.228  -50.478 1.00 46.30  ? 740  ILE A O   1 
ATOM 5770 C CB  . ILE A 1 743  ? -28.701 21.464  -49.458 1.00 36.24  ? 740  ILE A CB  1 
ATOM 5771 C CG1 . ILE A 1 743  ? -27.543 22.300  -48.909 1.00 36.24  ? 740  ILE A CG1 1 
ATOM 5772 C CG2 . ILE A 1 743  ? -28.278 20.753  -50.756 1.00 36.24  ? 740  ILE A CG2 1 
ATOM 5773 C CD1 . ILE A 1 743  ? -26.643 21.552  -48.046 1.00 36.24  ? 740  ILE A CD1 1 
ATOM 5774 N N   . GLU A 1 744  ? -30.752 22.447  -51.951 1.00 57.17  ? 741  GLU A N   1 
ATOM 5775 C CA  . GLU A 1 744  ? -31.547 21.969  -53.079 1.00 57.17  ? 741  GLU A CA  1 
ATOM 5776 C C   . GLU A 1 744  ? -30.584 21.906  -54.229 1.00 57.17  ? 741  GLU A C   1 
ATOM 5777 O O   . GLU A 1 744  ? -29.458 22.388  -54.111 1.00 57.17  ? 741  GLU A O   1 
ATOM 5778 C CB  . GLU A 1 744  ? -32.747 22.871  -53.371 1.00 60.03  ? 741  GLU A CB  1 
ATOM 5779 C CG  . GLU A 1 744  ? -33.992 22.538  -52.523 1.00 60.03  ? 741  GLU A CG  1 
ATOM 5780 C CD  . GLU A 1 744  ? -35.211 23.515  -52.700 1.00 60.03  ? 741  GLU A CD  1 
ATOM 5781 O OE1 . GLU A 1 744  ? -35.150 24.520  -53.472 1.00 60.03  ? 741  GLU A OE1 1 
ATOM 5782 O OE2 . GLU A 1 744  ? -36.254 23.259  -52.033 1.00 60.03  ? 741  GLU A OE2 1 
ATOM 5783 N N   . VAL A 1 745  ? -30.981 21.267  -55.322 1.00 60.89  ? 742  VAL A N   1 
ATOM 5784 C CA  . VAL A 1 745  ? -30.101 21.216  -56.492 1.00 60.89  ? 742  VAL A CA  1 
ATOM 5785 C C   . VAL A 1 745  ? -30.786 21.849  -57.685 1.00 60.89  ? 742  VAL A C   1 
ATOM 5786 O O   . VAL A 1 745  ? -32.037 21.839  -57.763 1.00 60.89  ? 742  VAL A O   1 
ATOM 5787 C CB  . VAL A 1 745  ? -29.654 19.788  -56.827 1.00 62.83  ? 742  VAL A CB  1 
ATOM 5788 C CG1 . VAL A 1 745  ? -28.905 19.191  -55.643 1.00 62.83  ? 742  VAL A CG1 1 
ATOM 5789 C CG2 . VAL A 1 745  ? -30.858 18.938  -57.183 1.00 62.83  ? 742  VAL A CG2 1 
ATOM 5790 N N   . GLN A 1 746  ? -29.963 22.415  -58.576 1.00 97.99  ? 743  GLN A N   1 
ATOM 5791 C CA  . GLN A 1 746  ? -30.379 22.860  -59.913 1.00 97.99  ? 743  GLN A CA  1 
ATOM 5792 C C   . GLN A 1 746  ? -31.266 21.788  -60.559 1.00 97.99  ? 743  GLN A C   1 
ATOM 5793 O O   . GLN A 1 746  ? -31.252 20.616  -60.145 1.00 97.99  ? 743  GLN A O   1 
ATOM 5794 C CB  . GLN A 1 746  ? -29.149 23.126  -60.814 1.00 87.03  ? 743  GLN A CB  1 
ATOM 5795 C CG  . GLN A 1 746  ? -28.836 22.018  -61.885 1.00 87.03  ? 743  GLN A CG  1 
ATOM 5796 C CD  . GLN A 1 746  ? -27.552 22.273  -62.696 1.00 87.03  ? 743  GLN A CD  1 
ATOM 5797 O OE1 . GLN A 1 746  ? -26.439 22.060  -62.201 1.00 87.03  ? 743  GLN A OE1 1 
ATOM 5798 N NE2 . GLN A 1 746  ? -27.707 22.718  -63.952 1.00 87.03  ? 743  GLN A NE2 1 
ATOM 5799 N N   . ASP A 1 747  ? -32.029 22.178  -61.572 1.00 142.74 ? 744  ASP A N   1 
ATOM 5800 C CA  . ASP A 1 747  ? -32.854 21.221  -62.293 1.00 142.74 ? 744  ASP A CA  1 
ATOM 5801 C C   . ASP A 1 747  ? -32.339 20.937  -63.700 1.00 142.74 ? 744  ASP A C   1 
ATOM 5802 O O   . ASP A 1 747  ? -31.125 20.900  -63.961 1.00 142.74 ? 744  ASP A O   1 
ATOM 5803 C CB  . ASP A 1 747  ? -34.295 21.723  -62.370 1.00 102.43 ? 744  ASP A CB  1 
ATOM 5804 C CG  . ASP A 1 747  ? -35.180 21.124  -61.305 1.00 102.43 ? 744  ASP A CG  1 
ATOM 5805 O OD1 . ASP A 1 747  ? -34.811 20.077  -60.735 1.00 102.43 ? 744  ASP A OD1 1 
ATOM 5806 O OD2 . ASP A 1 747  ? -36.256 21.703  -61.049 1.00 102.43 ? 744  ASP A OD2 1 
ATOM 5807 N N   . THR A 1 748  ? -33.295 20.697  -64.590 1.00 94.58  ? 745  THR A N   1 
ATOM 5808 C CA  . THR A 1 748  ? -33.075 20.785  -66.019 1.00 94.58  ? 745  THR A CA  1 
ATOM 5809 C C   . THR A 1 748  ? -34.016 21.888  -66.520 1.00 94.58  ? 745  THR A C   1 
ATOM 5810 O O   . THR A 1 748  ? -33.962 22.316  -67.680 1.00 94.58  ? 745  THR A O   1 
ATOM 5811 C CB  . THR A 1 748  ? -33.311 19.428  -66.701 1.00 82.61  ? 745  THR A CB  1 
ATOM 5812 O OG1 . THR A 1 748  ? -34.546 18.858  -66.226 1.00 82.61  ? 745  THR A OG1 1 
ATOM 5813 C CG2 . THR A 1 748  ? -32.122 18.478  -66.407 1.00 82.61  ? 745  THR A CG2 1 
ATOM 5814 N N   . SER A 1 749  ? -34.875 22.341  -65.606 1.00 91.25  ? 746  SER A N   1 
ATOM 5815 C CA  . SER A 1 749  ? -35.537 23.632  -65.707 1.00 91.25  ? 746  SER A CA  1 
ATOM 5816 C C   . SER A 1 749  ? -34.603 24.673  -65.088 1.00 91.25  ? 746  SER A C   1 
ATOM 5817 O O   . SER A 1 749  ? -34.955 25.852  -64.953 1.00 91.25  ? 746  SER A O   1 
ATOM 5818 C CB  . SER A 1 749  ? -36.857 23.612  -64.934 1.00 132.13 ? 746  SER A CB  1 
ATOM 5819 O OG  . SER A 1 749  ? -36.628 23.663  -63.529 1.00 132.13 ? 746  SER A OG  1 
ATOM 5820 N N   . GLY A 1 750  ? -33.416 24.216  -64.694 1.00 88.71  ? 747  GLY A N   1 
ATOM 5821 C CA  . GLY A 1 750  ? -32.452 25.050  -63.980 1.00 88.71  ? 747  GLY A CA  1 
ATOM 5822 C C   . GLY A 1 750  ? -32.870 25.223  -62.528 1.00 88.71  ? 747  GLY A C   1 
ATOM 5823 O O   . GLY A 1 750  ? -32.021 25.137  -61.620 1.00 88.71  ? 747  GLY A O   1 
ATOM 5824 N N   . GLY A 1 751  ? -34.179 25.448  -62.326 1.00 121.45 ? 748  GLY A N   1 
ATOM 5825 C CA  . GLY A 1 751  ? -34.792 25.672  -61.012 1.00 121.45 ? 748  GLY A CA  1 
ATOM 5826 C C   . GLY A 1 751  ? -34.415 24.653  -59.951 1.00 121.45 ? 748  GLY A C   1 
ATOM 5827 O O   . GLY A 1 751  ? -33.954 23.558  -60.269 1.00 121.45 ? 748  GLY A O   1 
ATOM 5828 N N   . THR A 1 752  ? -34.600 25.005  -58.681 1.00 75.11  ? 749  THR A N   1 
ATOM 5829 C CA  . THR A 1 752  ? -34.173 24.113  -57.586 1.00 75.11  ? 749  THR A CA  1 
ATOM 5830 C C   . THR A 1 752  ? -35.291 23.239  -57.010 1.00 75.11  ? 749  THR A C   1 
ATOM 5831 O O   . THR A 1 752  ? -36.435 23.679  -56.842 1.00 75.11  ? 749  THR A O   1 
ATOM 5832 C CB  . THR A 1 752  ? -33.334 24.838  -56.451 1.00 45.03  ? 749  THR A CB  1 
ATOM 5833 O OG1 . THR A 1 752  ? -33.902 26.113  -56.104 1.00 45.03  ? 749  THR A OG1 1 
ATOM 5834 C CG2 . THR A 1 752  ? -31.870 25.033  -56.893 1.00 45.03  ? 749  THR A CG2 1 
ATOM 5835 N N   . THR A 1 753  ? -34.931 21.997  -56.710 1.00 115.75 ? 750  THR A N   1 
ATOM 5836 C CA  . THR A 1 753  ? -35.898 20.987  -56.308 1.00 115.75 ? 750  THR A CA  1 
ATOM 5837 C C   . THR A 1 753  ? -35.840 20.631  -54.824 1.00 115.75 ? 750  THR A C   1 
ATOM 5838 O O   . THR A 1 753  ? -36.674 21.109  -54.062 1.00 115.75 ? 750  THR A O   1 
ATOM 5839 C CB  . THR A 1 753  ? -35.762 19.730  -57.175 1.00 108.53 ? 750  THR A CB  1 
ATOM 5840 O OG1 . THR A 1 753  ? -34.449 19.711  -57.752 1.00 108.53 ? 750  THR A OG1 1 
ATOM 5841 C CG2 . THR A 1 753  ? -36.802 19.753  -58.289 1.00 108.53 ? 750  THR A CG2 1 
ATOM 5842 N N   . ALA A 1 754  ? -34.856 19.821  -54.422 1.00 88.29  ? 751  ALA A N   1 
ATOM 5843 C CA  . ALA A 1 754  ? -34.765 19.239  -53.063 1.00 88.29  ? 751  ALA A CA  1 
ATOM 5844 C C   . ALA A 1 754  ? -34.289 17.791  -53.119 1.00 88.29  ? 751  ALA A C   1 
ATOM 5845 O O   . ALA A 1 754  ? -34.338 17.152  -54.174 1.00 88.29  ? 751  ALA A O   1 
ATOM 5846 C CB  . ALA A 1 754  ? -36.100 19.290  -52.334 1.00 45.16  ? 751  ALA A CB  1 
ATOM 5847 N N   . LEU A 1 755  ? -33.865 17.261  -51.972 1.00 50.58  ? 752  LEU A N   1 
ATOM 5848 C CA  . LEU A 1 755  ? -33.280 15.918  -51.934 1.00 50.58  ? 752  LEU A CA  1 
ATOM 5849 C C   . LEU A 1 755  ? -34.041 14.955  -51.007 1.00 50.58  ? 752  LEU A C   1 
ATOM 5850 O O   . LEU A 1 755  ? -33.921 13.728  -51.172 1.00 50.58  ? 752  LEU A O   1 
ATOM 5851 C CB  . LEU A 1 755  ? -31.779 15.994  -51.619 1.00 67.81  ? 752  LEU A CB  1 
ATOM 5852 C CG  . LEU A 1 755  ? -31.020 17.041  -52.474 1.00 67.81  ? 752  LEU A CG  1 
ATOM 5853 C CD1 . LEU A 1 755  ? -29.635 17.403  -51.916 1.00 67.81  ? 752  LEU A CD1 1 
ATOM 5854 C CD2 . LEU A 1 755  ? -30.916 16.668  -53.978 1.00 67.81  ? 752  LEU A CD2 1 
ATOM 5855 N N   . ARG A 1 756  ? -34.842 15.518  -50.086 1.00 37.30  ? 753  ARG A N   1 
ATOM 5856 C CA  . ARG A 1 756  ? -35.709 14.765  -49.192 1.00 37.30  ? 753  ARG A CA  1 
ATOM 5857 C C   . ARG A 1 756  ? -36.740 15.682  -48.522 1.00 37.30  ? 753  ARG A C   1 
ATOM 5858 O O   . ARG A 1 756  ? -36.611 16.896  -48.588 1.00 37.30  ? 753  ARG A O   1 
ATOM 5859 C CB  . ARG A 1 756  ? -34.883 14.063  -48.119 1.00 57.63  ? 753  ARG A CB  1 
ATOM 5860 C CG  . ARG A 1 756  ? -34.493 14.968  -46.960 1.00 57.63  ? 753  ARG A CG  1 
ATOM 5861 C CD  . ARG A 1 756  ? -33.507 14.311  -45.990 1.00 57.63  ? 753  ARG A CD  1 
ATOM 5862 N NE  . ARG A 1 756  ? -32.312 13.731  -46.636 1.00 57.63  ? 753  ARG A NE  1 
ATOM 5863 C CZ  . ARG A 1 756  ? -31.362 14.406  -47.298 1.00 57.63  ? 753  ARG A CZ  1 
ATOM 5864 N NH1 . ARG A 1 756  ? -31.449 15.720  -47.475 1.00 57.63  ? 753  ARG A NH1 1 
ATOM 5865 N NH2 . ARG A 1 756  ? -30.328 13.741  -47.815 1.00 57.63  ? 753  ARG A NH2 1 
ATOM 5866 N N   . PRO A 1 757  ? -37.744 15.103  -47.838 1.00 49.55  ? 754  PRO A N   1 
ATOM 5867 C CA  . PRO A 1 757  ? -38.756 15.962  -47.218 1.00 49.55  ? 754  PRO A CA  1 
ATOM 5868 C C   . PRO A 1 757  ? -38.231 16.515  -45.904 1.00 49.55  ? 754  PRO A C   1 
ATOM 5869 O O   . PRO A 1 757  ? -37.848 15.742  -45.022 1.00 49.55  ? 754  PRO A O   1 
ATOM 5870 C CB  . PRO A 1 757  ? -39.929 15.020  -46.940 1.00 36.68  ? 754  PRO A CB  1 
ATOM 5871 C CG  . PRO A 1 757  ? -39.403 13.613  -47.136 1.00 36.68  ? 754  PRO A CG  1 
ATOM 5872 C CD  . PRO A 1 757  ? -37.949 13.672  -47.531 1.00 36.68  ? 754  PRO A CD  1 
ATOM 5873 N N   . SER A 1 758  ? -38.193 17.839  -45.790 1.00 49.07  ? 755  SER A N   1 
ATOM 5874 C CA  . SER A 1 758  ? -37.585 18.525  -44.645 1.00 49.07  ? 755  SER A CA  1 
ATOM 5875 C C   . SER A 1 758  ? -38.668 18.855  -43.635 1.00 49.07  ? 755  SER A C   1 
ATOM 5876 O O   . SER A 1 758  ? -39.776 18.337  -43.727 1.00 49.07  ? 755  SER A O   1 
ATOM 5877 C CB  . SER A 1 758  ? -36.951 19.813  -45.152 1.00 37.92  ? 755  SER A CB  1 
ATOM 5878 O OG  . SER A 1 758  ? -36.183 19.557  -46.324 1.00 37.92  ? 755  SER A OG  1 
ATOM 5879 N N   . ALA A 1 759  ? -38.375 19.722  -42.679 1.00 43.00  ? 756  ALA A N   1 
ATOM 5880 C CA  . ALA A 1 759  ? -39.448 20.308  -41.897 1.00 43.00  ? 756  ALA A CA  1 
ATOM 5881 C C   . ALA A 1 759  ? -40.021 21.539  -42.578 1.00 43.00  ? 756  ALA A C   1 
ATOM 5882 O O   . ALA A 1 759  ? -41.116 21.965  -42.256 1.00 43.00  ? 756  ALA A O   1 
ATOM 5883 C CB  . ALA A 1 759  ? -38.972 20.679  -40.552 1.00 10.00  ? 756  ALA A CB  1 
ATOM 5884 N N   . SER A 1 760  ? -39.264 22.166  -43.462 1.00 46.33  ? 757  SER A N   1 
ATOM 5885 C CA  . SER A 1 760  ? -39.736 23.368  -44.151 1.00 46.33  ? 757  SER A CA  1 
ATOM 5886 C C   . SER A 1 760  ? -40.797 23.012  -45.223 1.00 46.33  ? 757  SER A C   1 
ATOM 5887 O O   . SER A 1 760  ? -41.720 23.781  -45.510 1.00 46.33  ? 757  SER A O   1 
ATOM 5888 C CB  . SER A 1 760  ? -38.540 24.091  -44.782 1.00 37.83  ? 757  SER A CB  1 
ATOM 5889 O OG  . SER A 1 760  ? -37.567 23.171  -45.239 1.00 37.83  ? 757  SER A OG  1 
ATOM 5890 N N   . THR A 1 761  ? -40.665 21.815  -45.773 1.00 40.96  ? 758  THR A N   1 
ATOM 5891 C CA  . THR A 1 761  ? -41.488 21.362  -46.852 1.00 40.96  ? 758  THR A CA  1 
ATOM 5892 C C   . THR A 1 761  ? -42.642 20.501  -46.331 1.00 40.96  ? 758  THR A C   1 
ATOM 5893 O O   . THR A 1 761  ? -43.664 20.394  -47.004 1.00 40.96  ? 758  THR A O   1 
ATOM 5894 C CB  . THR A 1 761  ? -40.694 20.469  -47.787 1.00 40.04  ? 758  THR A CB  1 
ATOM 5895 O OG1 . THR A 1 761  ? -40.539 19.195  -47.158 1.00 40.04  ? 758  THR A OG1 1 
ATOM 5896 C CG2 . THR A 1 761  ? -39.355 21.032  -48.085 1.00 40.04  ? 758  THR A CG2 1 
ATOM 5897 N N   . GLN A 1 762  ? -42.465 19.854  -45.176 1.00 41.40  ? 759  GLN A N   1 
ATOM 5898 C CA  . GLN A 1 762  ? -43.554 19.072  -44.525 1.00 41.40  ? 759  GLN A CA  1 
ATOM 5899 C C   . GLN A 1 762  ? -44.318 19.915  -43.499 1.00 41.40  ? 759  GLN A C   1 
ATOM 5900 O O   . GLN A 1 762  ? -45.079 19.379  -42.685 1.00 41.40  ? 759  GLN A O   1 
ATOM 5901 C CB  . GLN A 1 762  ? -43.048 17.780  -43.880 1.00 79.34  ? 759  GLN A CB  1 
ATOM 5902 C CG  . GLN A 1 762  ? -42.330 16.840  -44.828 1.00 79.34  ? 759  GLN A CG  1 
ATOM 5903 C CD  . GLN A 1 762  ? -42.987 16.751  -46.188 1.00 79.34  ? 759  GLN A CD  1 
ATOM 5904 O OE1 . GLN A 1 762  ? -42.507 17.336  -47.173 1.00 79.34  ? 759  GLN A OE1 1 
ATOM 5905 N NE2 . GLN A 1 762  ? -44.088 16.021  -46.256 1.00 79.34  ? 759  GLN A NE2 1 
ATOM 5906 N N   . ALA A 1 763  ? -44.106 21.229  -43.562 1.00 44.22  ? 760  ALA A N   1 
ATOM 5907 C CA  . ALA A 1 763  ? -44.758 22.202  -42.690 1.00 44.22  ? 760  ALA A CA  1 
ATOM 5908 C C   . ALA A 1 763  ? -46.312 22.114  -42.700 1.00 44.22  ? 760  ALA A C   1 
ATOM 5909 O O   . ALA A 1 763  ? -46.893 21.832  -43.740 1.00 44.22  ? 760  ALA A O   1 
ATOM 5910 C CB  . ALA A 1 763  ? -44.305 23.589  -43.109 1.00 50.23  ? 760  ALA A CB  1 
ATOM 5911 N N   . LEU A 1 764  ? -46.982 22.379  -41.578 1.00 72.65  ? 761  LEU A N   1 
ATOM 5912 C CA  . LEU A 1 764  ? -48.453 22.293  -41.557 1.00 72.65  ? 761  LEU A CA  1 
ATOM 5913 C C   . LEU A 1 764  ? -49.137 23.341  -42.460 1.00 72.65  ? 761  LEU A C   1 
ATOM 5914 O O   . LEU A 1 764  ? -50.229 23.105  -42.991 1.00 72.65  ? 761  LEU A O   1 
ATOM 5915 C CB  . LEU A 1 764  ? -49.025 22.298  -40.120 1.00 55.34  ? 761  LEU A CB  1 
ATOM 5916 C CG  . LEU A 1 764  ? -48.608 21.138  -39.186 1.00 55.34  ? 761  LEU A CG  1 
ATOM 5917 C CD1 . LEU A 1 764  ? -49.282 21.178  -37.842 1.00 55.34  ? 761  LEU A CD1 1 
ATOM 5918 C CD2 . LEU A 1 764  ? -48.790 19.754  -39.798 1.00 55.34  ? 761  LEU A CD2 1 
ATOM 5919 N N   . SER A 1 765  ? -48.474 24.483  -42.644 1.00 77.42  ? 762  SER A N   1 
ATOM 5920 C CA  . SER A 1 765  ? -48.926 25.562  -43.541 1.00 77.42  ? 762  SER A CA  1 
ATOM 5921 C C   . SER A 1 765  ? -47.706 26.394  -43.957 1.00 77.42  ? 762  SER A C   1 
ATOM 5922 O O   . SER A 1 765  ? -46.595 26.103  -43.501 1.00 77.42  ? 762  SER A O   1 
ATOM 5923 C CB  . SER A 1 765  ? -49.924 26.445  -42.832 1.00 59.52  ? 762  SER A CB  1 
ATOM 5924 O OG  . SER A 1 765  ? -49.275 27.127  -41.788 1.00 59.52  ? 762  SER A OG  1 
ATOM 5925 N N   . SER A 1 766  ? -47.882 27.415  -44.802 1.00 65.38  ? 763  SER A N   1 
ATOM 5926 C CA  . SER A 1 766  ? -46.694 28.000  -45.444 1.00 65.38  ? 763  SER A CA  1 
ATOM 5927 C C   . SER A 1 766  ? -46.767 29.329  -46.265 1.00 65.38  ? 763  SER A C   1 
ATOM 5928 O O   . SER A 1 766  ? -47.760 29.621  -46.945 1.00 65.38  ? 763  SER A O   1 
ATOM 5929 C CB  . SER A 1 766  ? -45.972 26.903  -46.252 1.00 38.42  ? 763  SER A CB  1 
ATOM 5930 O OG  . SER A 1 766  ? -46.325 26.968  -47.618 1.00 38.42  ? 763  SER A OG  1 
ATOM 5931 N N   . SER A 1 767  ? -45.673 30.094  -46.200 1.00 39.69  ? 764  SER A N   1 
ATOM 5932 C CA  . SER A 1 767  ? -45.501 31.331  -46.959 1.00 39.69  ? 764  SER A CA  1 
ATOM 5933 C C   . SER A 1 767  ? -44.298 31.285  -47.835 1.00 39.69  ? 764  SER A C   1 
ATOM 5934 O O   . SER A 1 767  ? -43.432 30.452  -47.628 1.00 39.69  ? 764  SER A O   1 
ATOM 5935 C CB  . SER A 1 767  ? -45.253 32.488  -46.033 1.00 38.08  ? 764  SER A CB  1 
ATOM 5936 O OG  . SER A 1 767  ? -46.100 32.390  -44.931 1.00 38.08  ? 764  SER A OG  1 
ATOM 5937 N N   . VAL A 1 768  ? -44.242 32.167  -48.820 1.00 53.36  ? 765  VAL A N   1 
ATOM 5938 C CA  . VAL A 1 768  ? -42.970 32.521  -49.388 1.00 53.36  ? 765  VAL A CA  1 
ATOM 5939 C C   . VAL A 1 768  ? -42.824 34.007  -49.232 1.00 53.36  ? 765  VAL A C   1 
ATOM 5940 O O   . VAL A 1 768  ? -43.804 34.708  -49.002 1.00 53.36  ? 765  VAL A O   1 
ATOM 5941 C CB  . VAL A 1 768  ? -42.857 32.227  -50.851 1.00 39.26  ? 765  VAL A CB  1 
ATOM 5942 C CG1 . VAL A 1 768  ? -43.782 33.172  -51.645 1.00 39.26  ? 765  VAL A CG1 1 
ATOM 5943 C CG2 . VAL A 1 768  ? -41.410 32.509  -51.301 1.00 39.26  ? 765  VAL A CG2 1 
ATOM 5944 N N   . SER A 1 769  ? -41.592 34.490  -49.342 1.00 58.91  ? 766  SER A N   1 
ATOM 5945 C CA  . SER A 1 769  ? -41.358 35.915  -49.333 1.00 58.91  ? 766  SER A CA  1 
ATOM 5946 C C   . SER A 1 769  ? -41.836 36.452  -50.700 1.00 58.91  ? 766  SER A C   1 
ATOM 5947 O O   . SER A 1 769  ? -41.581 35.830  -51.765 1.00 58.91  ? 766  SER A O   1 
ATOM 5948 C CB  . SER A 1 769  ? -39.879 36.225  -49.032 1.00 52.06  ? 766  SER A CB  1 
ATOM 5949 O OG  . SER A 1 769  ? -39.757 37.443  -48.295 1.00 52.06  ? 766  SER A OG  1 
ATOM 5950 N N   . SER A 1 770  ? -42.574 37.563  -50.658 1.00 65.44  ? 767  SER A N   1 
ATOM 5951 C CA  . SER A 1 770  ? -43.133 38.136  -51.878 1.00 65.44  ? 767  SER A CA  1 
ATOM 5952 C C   . SER A 1 770  ? -42.425 39.445  -52.276 1.00 65.44  ? 767  SER A C   1 
ATOM 5953 O O   . SER A 1 770  ? -41.944 39.563  -53.412 1.00 65.44  ? 767  SER A O   1 
ATOM 5954 C CB  . SER A 1 770  ? -44.658 38.282  -51.767 1.00 52.90  ? 767  SER A CB  1 
ATOM 5955 O OG  . SER A 1 770  ? -44.997 39.512  -51.179 1.00 52.90  ? 767  SER A OG  1 
ATOM 5956 N N   . SER A 1 771  ? -42.374 40.404  -51.346 1.00 64.75  ? 768  SER A N   1 
ATOM 5957 C CA  . SER A 1 771  ? -41.423 41.546  -51.364 1.00 64.75  ? 768  SER A CA  1 
ATOM 5958 C C   . SER A 1 771  ? -40.452 41.705  -52.578 1.00 64.75  ? 768  SER A C   1 
ATOM 5959 O O   . SER A 1 771  ? -39.832 40.744  -53.027 1.00 64.75  ? 768  SER A O   1 
ATOM 5960 C CB  . SER A 1 771  ? -40.624 41.561  -50.046 1.00 59.25  ? 768  SER A CB  1 
ATOM 5961 O OG  . SER A 1 771  ? -39.373 42.219  -50.226 1.00 59.25  ? 768  SER A OG  1 
ATOM 5962 N N   . LYS A 1 772  ? -40.301 42.931  -53.073 1.00 81.47  ? 769  LYS A N   1 
ATOM 5963 C CA  . LYS A 1 772  ? -39.677 43.147  -54.381 1.00 81.47  ? 769  LYS A CA  1 
ATOM 5964 C C   . LYS A 1 772  ? -38.529 44.152  -54.359 1.00 81.47  ? 769  LYS A C   1 
ATOM 5965 O O   . LYS A 1 772  ? -38.298 44.866  -55.351 1.00 81.47  ? 769  LYS A O   1 
ATOM 5966 C CB  . LYS A 1 772  ? -40.743 43.577  -55.407 1.00 102.97 ? 769  LYS A CB  1 
ATOM 5967 C CG  . LYS A 1 772  ? -41.594 42.448  -56.015 1.00 102.97 ? 769  LYS A CG  1 
ATOM 5968 C CD  . LYS A 1 772  ? -40.864 41.750  -57.169 1.00 102.97 ? 769  LYS A CD  1 
ATOM 5969 C CE  . LYS A 1 772  ? -41.721 40.657  -57.838 1.00 102.97 ? 769  LYS A CE  1 
ATOM 5970 N NZ  . LYS A 1 772  ? -41.794 39.372  -57.078 1.00 102.97 ? 769  LYS A NZ  1 
ATOM 5971 N N   . LEU A 1 773  ? -37.799 44.173  -53.240 1.00 84.49  ? 770  LEU A N   1 
ATOM 5972 C CA  . LEU A 1 773  ? -36.725 45.154  -52.956 1.00 84.49  ? 770  LEU A CA  1 
ATOM 5973 C C   . LEU A 1 773  ? -35.470 45.103  -53.821 1.00 84.49  ? 770  LEU A C   1 
ATOM 5974 O O   . LEU A 1 773  ? -34.665 46.042  -53.800 1.00 84.49  ? 770  LEU A O   1 
ATOM 5975 C CB  . LEU A 1 773  ? -36.297 45.066  -51.497 1.00 76.66  ? 770  LEU A CB  1 
ATOM 5976 C CG  . LEU A 1 773  ? -37.155 45.842  -50.516 1.00 76.66  ? 770  LEU A CG  1 
ATOM 5977 C CD1 . LEU A 1 773  ? -36.429 45.931  -49.213 1.00 76.66  ? 770  LEU A CD1 1 
ATOM 5978 C CD2 . LEU A 1 773  ? -37.429 47.225  -51.034 1.00 76.66  ? 770  LEU A CD2 1 
ATOM 5979 N N   . PHE A 1 774  ? -35.296 44.017  -54.563 1.00 88.24  ? 771  PHE A N   1 
ATOM 5980 C CA  . PHE A 1 774  ? -34.086 43.830  -55.346 1.00 88.24  ? 771  PHE A CA  1 
ATOM 5981 C C   . PHE A 1 774  ? -34.420 43.555  -56.822 1.00 88.24  ? 771  PHE A C   1 
ATOM 5982 O O   . PHE A 1 774  ? -35.581 43.272  -57.160 1.00 88.24  ? 771  PHE A O   1 
ATOM 5983 C CB  . PHE A 1 774  ? -33.168 42.777  -54.677 1.00 75.60  ? 771  PHE A CB  1 
ATOM 5984 C CG  . PHE A 1 774  ? -32.914 43.044  -53.178 1.00 75.60  ? 771  PHE A CG  1 
ATOM 5985 C CD1 . PHE A 1 774  ? -33.382 42.163  -52.200 1.00 75.60  ? 771  PHE A CD1 1 
ATOM 5986 C CD2 . PHE A 1 774  ? -32.242 44.199  -52.751 1.00 75.60  ? 771  PHE A CD2 1 
ATOM 5987 C CE1 . PHE A 1 774  ? -33.179 42.422  -50.829 1.00 75.60  ? 771  PHE A CE1 1 
ATOM 5988 C CE2 . PHE A 1 774  ? -32.034 44.463  -51.387 1.00 75.60  ? 771  PHE A CE2 1 
ATOM 5989 C CZ  . PHE A 1 774  ? -32.504 43.574  -50.429 1.00 75.60  ? 771  PHE A CZ  1 
ATOM 5990 N N   . SER A 1 775  ? -33.413 43.668  -57.693 1.00 209.00 ? 772  SER A N   1 
ATOM 5991 C CA  . SER A 1 775  ? -33.630 43.730  -59.148 1.00 209.00 ? 772  SER A CA  1 
ATOM 5992 C C   . SER A 1 775  ? -32.721 42.859  -60.022 1.00 209.00 ? 772  SER A C   1 
ATOM 5993 O O   . SER A 1 775  ? -33.176 41.875  -60.612 1.00 209.00 ? 772  SER A O   1 
ATOM 5994 C CB  . SER A 1 775  ? -33.543 45.179  -59.628 1.00 71.75  ? 772  SER A CB  1 
ATOM 5995 O OG  . SER A 1 775  ? -34.830 45.746  -59.685 1.00 71.75  ? 772  SER A OG  1 
ATOM 5996 N N   . SER A 1 776  ? -31.450 43.253  -60.121 1.00 196.92 ? 773  SER A N   1 
ATOM 5997 C CA  . SER A 1 776  ? -30.506 42.645  -61.056 1.00 196.92 ? 773  SER A CA  1 
ATOM 5998 C C   . SER A 1 776  ? -29.582 41.623  -60.370 1.00 196.92 ? 773  SER A C   1 
ATOM 5999 O O   . SER A 1 776  ? -28.565 41.211  -60.939 1.00 196.92 ? 773  SER A O   1 
ATOM 6000 C CB  . SER A 1 776  ? -29.672 43.746  -61.722 1.00 90.49  ? 773  SER A CB  1 
ATOM 6001 O OG  . SER A 1 776  ? -28.860 44.406  -60.746 1.00 90.49  ? 773  SER A OG  1 
ATOM 6002 N N   . GLY A 1 786  ? -27.812 19.493  -60.369 1.00 119.74 ? 783  GLY A N   1 
ATOM 6003 C CA  . GLY A 1 786  ? -26.376 19.658  -60.171 1.00 119.74 ? 783  GLY A CA  1 
ATOM 6004 C C   . GLY A 1 786  ? -26.035 20.654  -59.073 1.00 119.74 ? 783  GLY A C   1 
ATOM 6005 O O   . GLY A 1 786  ? -25.867 20.278  -57.910 1.00 119.74 ? 783  GLY A O   1 
ATOM 6006 N N   . GLU A 1 787  ? -25.940 21.928  -59.453 1.00 78.82  ? 784  GLU A N   1 
ATOM 6007 C CA  . GLU A 1 787  ? -25.513 23.013  -58.544 1.00 78.82  ? 784  GLU A CA  1 
ATOM 6008 C C   . GLU A 1 787  ? -26.334 23.089  -57.247 1.00 78.82  ? 784  GLU A C   1 
ATOM 6009 O O   . GLU A 1 787  ? -27.543 22.797  -57.229 1.00 78.82  ? 784  GLU A O   1 
ATOM 6010 C CB  . GLU A 1 787  ? -25.511 24.359  -59.283 1.00 119.73 ? 784  GLU A CB  1 
ATOM 6011 C CG  . GLU A 1 787  ? -24.507 24.423  -60.447 1.00 119.73 ? 784  GLU A CG  1 
ATOM 6012 C CD  . GLU A 1 787  ? -25.085 25.051  -61.719 1.00 119.73 ? 784  GLU A CD  1 
ATOM 6013 O OE1 . GLU A 1 787  ? -24.315 25.671  -62.486 1.00 119.73 ? 784  GLU A OE1 1 
ATOM 6014 O OE2 . GLU A 1 787  ? -26.306 24.921  -61.960 1.00 119.73 ? 784  GLU A OE2 1 
ATOM 6015 N N   . GLU A 1 788  ? -25.659 23.474  -56.168 1.00 73.63  ? 785  GLU A N   1 
ATOM 6016 C CA  . GLU A 1 788  ? -26.235 23.393  -54.832 1.00 73.63  ? 785  GLU A CA  1 
ATOM 6017 C C   . GLU A 1 788  ? -26.528 24.755  -54.225 1.00 73.63  ? 785  GLU A C   1 
ATOM 6018 O O   . GLU A 1 788  ? -25.602 25.529  -53.966 1.00 73.63  ? 785  GLU A O   1 
ATOM 6019 C CB  . GLU A 1 788  ? -25.285 22.647  -53.896 1.00 70.78  ? 785  GLU A CB  1 
ATOM 6020 C CG  . GLU A 1 788  ? -25.398 21.152  -53.924 1.00 70.78  ? 785  GLU A CG  1 
ATOM 6021 C CD  . GLU A 1 788  ? -24.703 20.492  -52.724 1.00 70.78  ? 785  GLU A CD  1 
ATOM 6022 O OE1 . GLU A 1 788  ? -24.006 21.196  -51.939 1.00 70.78  ? 785  GLU A OE1 1 
ATOM 6023 O OE2 . GLU A 1 788  ? -24.855 19.250  -52.573 1.00 70.78  ? 785  GLU A OE2 1 
ATOM 6024 N N   . VAL A 1 789  ? -27.806 25.032  -53.975 1.00 50.74  ? 786  VAL A N   1 
ATOM 6025 C CA  . VAL A 1 789  ? -28.213 26.257  -53.297 1.00 50.74  ? 786  VAL A CA  1 
ATOM 6026 C C   . VAL A 1 789  ? -28.828 25.929  -51.924 1.00 50.74  ? 786  VAL A C   1 
ATOM 6027 O O   . VAL A 1 789  ? -29.290 24.833  -51.708 1.00 50.74  ? 786  VAL A O   1 
ATOM 6028 C CB  . VAL A 1 789  ? -29.234 27.048  -54.158 1.00 65.78  ? 786  VAL A CB  1 
ATOM 6029 C CG1 . VAL A 1 789  ? -30.702 26.601  -53.864 1.00 65.78  ? 786  VAL A CG1 1 
ATOM 6030 C CG2 . VAL A 1 789  ? -29.061 28.575  -53.961 1.00 65.78  ? 786  VAL A CG2 1 
ATOM 6031 N N   . GLU A 1 790  ? -28.805 26.890  -51.012 1.00 34.35  ? 787  GLU A N   1 
ATOM 6032 C CA  . GLU A 1 790  ? -29.425 26.797  -49.723 1.00 34.35  ? 787  GLU A CA  1 
ATOM 6033 C C   . GLU A 1 790  ? -30.741 27.515  -49.858 1.00 34.35  ? 787  GLU A C   1 
ATOM 6034 O O   . GLU A 1 790  ? -30.837 28.556  -50.552 1.00 34.35  ? 787  GLU A O   1 
ATOM 6035 C CB  . GLU A 1 790  ? -28.575 27.505  -48.662 1.00 31.81  ? 787  GLU A CB  1 
ATOM 6036 C CG  . GLU A 1 790  ? -27.439 26.638  -48.145 1.00 31.81  ? 787  GLU A CG  1 
ATOM 6037 C CD  . GLU A 1 790  ? -26.592 27.236  -46.976 1.00 31.81  ? 787  GLU A CD  1 
ATOM 6038 O OE1 . GLU A 1 790  ? -25.364 26.922  -46.954 1.00 31.81  ? 787  GLU A OE1 1 
ATOM 6039 O OE2 . GLU A 1 790  ? -27.110 27.995  -46.078 1.00 31.81  ? 787  GLU A OE2 1 
ATOM 6040 N N   . VAL A 1 791  ? -31.764 26.986  -49.197 1.00 47.57  ? 788  VAL A N   1 
ATOM 6041 C CA  . VAL A 1 791  ? -33.023 27.685  -49.105 1.00 47.57  ? 788  VAL A CA  1 
ATOM 6042 C C   . VAL A 1 791  ? -33.340 27.893  -47.643 1.00 47.57  ? 788  VAL A C   1 
ATOM 6043 O O   . VAL A 1 791  ? -33.307 26.964  -46.856 1.00 47.57  ? 788  VAL A O   1 
ATOM 6044 C CB  . VAL A 1 791  ? -34.140 26.900  -49.785 1.00 35.26  ? 788  VAL A CB  1 
ATOM 6045 C CG1 . VAL A 1 791  ? -35.430 27.686  -49.754 1.00 35.26  ? 788  VAL A CG1 1 
ATOM 6046 C CG2 . VAL A 1 791  ? -33.753 26.581  -51.226 1.00 35.26  ? 788  VAL A CG2 1 
ATOM 6047 N N   . HIS A 1 792  ? -33.665 29.109  -47.278 1.00 50.65  ? 789  HIS A N   1 
ATOM 6048 C CA  . HIS A 1 792  ? -33.750 29.459  -45.883 1.00 50.65  ? 789  HIS A CA  1 
ATOM 6049 C C   . HIS A 1 792  ? -35.167 29.698  -45.403 1.00 50.65  ? 789  HIS A C   1 
ATOM 6050 O O   . HIS A 1 792  ? -35.962 30.264  -46.126 1.00 50.65  ? 789  HIS A O   1 
ATOM 6051 C CB  . HIS A 1 792  ? -32.936 30.723  -45.665 1.00 40.88  ? 789  HIS A CB  1 
ATOM 6052 C CG  . HIS A 1 792  ? -31.492 30.476  -45.416 1.00 40.88  ? 789  HIS A CG  1 
ATOM 6053 N ND1 . HIS A 1 792  ? -30.868 30.876  -44.256 1.00 40.88  ? 789  HIS A ND1 1 
ATOM 6054 C CD2 . HIS A 1 792  ? -30.548 29.872  -46.172 1.00 40.88  ? 789  HIS A CD2 1 
ATOM 6055 C CE1 . HIS A 1 792  ? -29.592 30.536  -44.312 1.00 40.88  ? 789  HIS A CE1 1 
ATOM 6056 N NE2 . HIS A 1 792  ? -29.370 29.926  -45.465 1.00 40.88  ? 789  HIS A NE2 1 
ATOM 6057 N N   . ASN A 1 793  ? -35.486 29.299  -44.175 1.00 41.08  ? 790  ASN A N   1 
ATOM 6058 C CA  . ASN A 1 793  ? -36.863 29.440  -43.696 1.00 41.08  ? 790  ASN A CA  1 
ATOM 6059 C C   . ASN A 1 793  ? -36.917 29.880  -42.279 1.00 41.08  ? 790  ASN A C   1 
ATOM 6060 O O   . ASN A 1 793  ? -36.008 29.617  -41.516 1.00 41.08  ? 790  ASN A O   1 
ATOM 6061 C CB  . ASN A 1 793  ? -37.617 28.118  -43.763 1.00 52.12  ? 790  ASN A CB  1 
ATOM 6062 C CG  . ASN A 1 793  ? -37.749 27.583  -45.167 1.00 52.12  ? 790  ASN A CG  1 
ATOM 6063 O OD1 . ASN A 1 793  ? -38.794 27.757  -45.801 1.00 52.12  ? 790  ASN A OD1 1 
ATOM 6064 N ND2 . ASN A 1 793  ? -36.709 26.909  -45.661 1.00 52.12  ? 790  ASN A ND2 1 
ATOM 6065 N N   . LEU A 1 794  ? -38.002 30.546  -41.927 1.00 44.27  ? 791  LEU A N   1 
ATOM 6066 C CA  . LEU A 1 794  ? -38.348 30.770  -40.543 1.00 44.27  ? 791  LEU A CA  1 
ATOM 6067 C C   . LEU A 1 794  ? -39.474 29.755  -40.190 1.00 44.27  ? 791  LEU A C   1 
ATOM 6068 O O   . LEU A 1 794  ? -40.548 29.757  -40.814 1.00 44.27  ? 791  LEU A O   1 
ATOM 6069 C CB  . LEU A 1 794  ? -38.795 32.211  -40.356 1.00 29.98  ? 791  LEU A CB  1 
ATOM 6070 C CG  . LEU A 1 794  ? -39.471 32.415  -39.012 1.00 29.98  ? 791  LEU A CG  1 
ATOM 6071 C CD1 . LEU A 1 794  ? -38.471 32.021  -37.896 1.00 29.98  ? 791  LEU A CD1 1 
ATOM 6072 C CD2 . LEU A 1 794  ? -40.036 33.837  -38.813 1.00 29.98  ? 791  LEU A CD2 1 
ATOM 6073 N N   . LEU A 1 795  ? -39.217 28.884  -39.211 1.00 35.51  ? 792  LEU A N   1 
ATOM 6074 C CA  . LEU A 1 795  ? -40.165 27.846  -38.802 1.00 35.51  ? 792  LEU A CA  1 
ATOM 6075 C C   . LEU A 1 795  ? -40.928 28.324  -37.612 1.00 35.51  ? 792  LEU A C   1 
ATOM 6076 O O   . LEU A 1 795  ? -40.416 29.113  -36.832 1.00 35.51  ? 792  LEU A O   1 
ATOM 6077 C CB  . LEU A 1 795  ? -39.422 26.587  -38.430 1.00 29.74  ? 792  LEU A CB  1 
ATOM 6078 C CG  . LEU A 1 795  ? -38.492 26.150  -39.548 1.00 29.74  ? 792  LEU A CG  1 
ATOM 6079 C CD1 . LEU A 1 795  ? -37.923 24.846  -39.204 1.00 29.74  ? 792  LEU A CD1 1 
ATOM 6080 C CD2 . LEU A 1 795  ? -39.220 26.046  -40.870 1.00 29.74  ? 792  LEU A CD2 1 
ATOM 6081 N N   . ILE A 1 796  ? -42.170 27.891  -37.474 1.00 34.94  ? 793  ILE A N   1 
ATOM 6082 C CA  . ILE A 1 796  ? -42.868 28.177  -36.230 1.00 34.94  ? 793  ILE A CA  1 
ATOM 6083 C C   . ILE A 1 796  ? -43.284 26.899  -35.527 1.00 34.94  ? 793  ILE A C   1 
ATOM 6084 O O   . ILE A 1 796  ? -44.170 26.163  -36.007 1.00 34.94  ? 793  ILE A O   1 
ATOM 6085 C CB  . ILE A 1 796  ? -44.044 29.139  -36.398 1.00 46.33  ? 793  ILE A CB  1 
ATOM 6086 C CG1 . ILE A 1 796  ? -43.564 30.494  -36.924 1.00 46.33  ? 793  ILE A CG1 1 
ATOM 6087 C CG2 . ILE A 1 796  ? -44.749 29.354  -35.033 1.00 46.33  ? 793  ILE A CG2 1 
ATOM 6088 C CD1 . ILE A 1 796  ? -42.777 31.348  -35.886 1.00 46.33  ? 793  ILE A CD1 1 
ATOM 6089 N N   . ILE A 1 797  ? -42.642 26.643  -34.392 1.00 37.26  ? 794  ILE A N   1 
ATOM 6090 C CA  . ILE A 1 797  ? -42.704 25.335  -33.751 1.00 37.26  ? 794  ILE A CA  1 
ATOM 6091 C C   . ILE A 1 797  ? -43.562 25.417  -32.511 1.00 37.26  ? 794  ILE A C   1 
ATOM 6092 O O   . ILE A 1 797  ? -43.341 26.267  -31.634 1.00 37.26  ? 794  ILE A O   1 
ATOM 6093 C CB  . ILE A 1 797  ? -41.278 24.805  -33.342 1.00 39.25  ? 794  ILE A CB  1 
ATOM 6094 C CG1 . ILE A 1 797  ? -40.570 24.102  -34.497 1.00 39.25  ? 794  ILE A CG1 1 
ATOM 6095 C CG2 . ILE A 1 797  ? -41.403 23.796  -32.232 1.00 39.25  ? 794  ILE A CG2 1 
ATOM 6096 C CD1 . ILE A 1 797  ? -40.136 24.991  -35.532 1.00 39.25  ? 794  ILE A CD1 1 
ATOM 6097 N N   . ASP A 1 798  ? -44.528 24.517  -32.424 1.00 33.91  ? 795  ASP A N   1 
ATOM 6098 C CA  . ASP A 1 798  ? -45.355 24.444  -31.231 1.00 33.91  ? 795  ASP A CA  1 
ATOM 6099 C C   . ASP A 1 798  ? -44.501 24.035  -30.004 1.00 33.91  ? 795  ASP A C   1 
ATOM 6100 O O   . ASP A 1 798  ? -43.781 22.998  -30.004 1.00 33.91  ? 795  ASP A O   1 
ATOM 6101 C CB  . ASP A 1 798  ? -46.488 23.452  -31.479 1.00 49.84  ? 795  ASP A CB  1 
ATOM 6102 C CG  . ASP A 1 798  ? -47.424 23.332  -30.299 1.00 49.84  ? 795  ASP A CG  1 
ATOM 6103 O OD1 . ASP A 1 798  ? -47.366 22.284  -29.591 1.00 49.84  ? 795  ASP A OD1 1 
ATOM 6104 O OD2 . ASP A 1 798  ? -48.215 24.286  -30.081 1.00 49.84  ? 795  ASP A OD2 1 
ATOM 6105 N N   . GLN A 1 799  ? -44.576 24.813  -28.941 1.00 47.57  ? 796  GLN A N   1 
ATOM 6106 C CA  . GLN A 1 799  ? -43.787 24.426  -27.798 1.00 47.57  ? 796  GLN A CA  1 
ATOM 6107 C C   . GLN A 1 799  ? -44.227 23.113  -27.196 1.00 47.57  ? 796  GLN A C   1 
ATOM 6108 O O   . GLN A 1 799  ? -43.422 22.428  -26.604 1.00 47.57  ? 796  GLN A O   1 
ATOM 6109 C CB  . GLN A 1 799  ? -43.719 25.515  -26.750 1.00 58.09  ? 796  GLN A CB  1 
ATOM 6110 C CG  . GLN A 1 799  ? -44.949 25.664  -25.944 1.00 58.09  ? 796  GLN A CG  1 
ATOM 6111 C CD  . GLN A 1 799  ? -44.718 26.516  -24.719 1.00 58.09  ? 796  GLN A CD  1 
ATOM 6112 O OE1 . GLN A 1 799  ? -44.615 25.993  -23.619 1.00 58.09  ? 796  GLN A OE1 1 
ATOM 6113 N NE2 . GLN A 1 799  ? -44.623 27.831  -24.905 1.00 58.09  ? 796  GLN A NE2 1 
ATOM 6114 N N   . HIS A 1 800  ? -45.480 22.723  -27.365 1.00 49.53  ? 797  HIS A N   1 
ATOM 6115 C CA  . HIS A 1 800  ? -45.958 21.482  -26.760 1.00 49.53  ? 797  HIS A CA  1 
ATOM 6116 C C   . HIS A 1 800  ? -45.763 20.225  -27.607 1.00 49.53  ? 797  HIS A C   1 
ATOM 6117 O O   . HIS A 1 800  ? -45.268 19.206  -27.107 1.00 49.53  ? 797  HIS A O   1 
ATOM 6118 C CB  . HIS A 1 800  ? -47.413 21.630  -26.343 1.00 51.88  ? 797  HIS A CB  1 
ATOM 6119 C CG  . HIS A 1 800  ? -47.621 22.710  -25.339 1.00 51.88  ? 797  HIS A CG  1 
ATOM 6120 N ND1 . HIS A 1 800  ? -47.282 22.558  -24.014 1.00 51.88  ? 797  HIS A ND1 1 
ATOM 6121 C CD2 . HIS A 1 800  ? -48.105 23.969  -25.470 1.00 51.88  ? 797  HIS A CD2 1 
ATOM 6122 C CE1 . HIS A 1 800  ? -47.552 23.678  -23.368 1.00 51.88  ? 797  HIS A CE1 1 
ATOM 6123 N NE2 . HIS A 1 800  ? -48.058 24.549  -24.226 1.00 51.88  ? 797  HIS A NE2 1 
ATOM 6124 N N   . THR A 1 801  ? -46.169 20.277  -28.870 1.00 47.19  ? 798  THR A N   1 
ATOM 6125 C CA  . THR A 1 801  ? -46.071 19.113  -29.731 1.00 47.19  ? 798  THR A CA  1 
ATOM 6126 C C   . THR A 1 801  ? -44.776 19.058  -30.537 1.00 47.19  ? 798  THR A C   1 
ATOM 6127 O O   . THR A 1 801  ? -44.461 18.031  -31.146 1.00 47.19  ? 798  THR A O   1 
ATOM 6128 C CB  . THR A 1 801  ? -47.252 19.061  -30.716 1.00 45.28  ? 798  THR A CB  1 
ATOM 6129 O OG1 . THR A 1 801  ? -47.239 20.235  -31.548 1.00 45.28  ? 798  THR A OG1 1 
ATOM 6130 C CG2 . THR A 1 801  ? -48.592 18.940  -29.957 1.00 45.28  ? 798  THR A CG2 1 
ATOM 6131 N N   . PHE A 1 802  ? -44.049 20.172  -30.552 1.00 48.18  ? 799  PHE A N   1 
ATOM 6132 C CA  . PHE A 1 802  ? -42.905 20.370  -31.448 1.00 48.18  ? 799  PHE A CA  1 
ATOM 6133 C C   . PHE A 1 802  ? -43.158 20.137  -32.950 1.00 48.18  ? 799  PHE A C   1 
ATOM 6134 O O   . PHE A 1 802  ? -42.307 19.594  -33.646 1.00 48.18  ? 799  PHE A O   1 
ATOM 6135 C CB  . PHE A 1 802  ? -41.655 19.697  -30.879 1.00 44.95  ? 799  PHE A CB  1 
ATOM 6136 C CG  . PHE A 1 802  ? -41.124 20.427  -29.654 1.00 44.95  ? 799  PHE A CG  1 
ATOM 6137 C CD1 . PHE A 1 802  ? -41.373 19.953  -28.369 1.00 44.95  ? 799  PHE A CD1 1 
ATOM 6138 C CD2 . PHE A 1 802  ? -40.428 21.634  -29.788 1.00 44.95  ? 799  PHE A CD2 1 
ATOM 6139 C CE1 . PHE A 1 802  ? -40.911 20.664  -27.266 1.00 44.95  ? 799  PHE A CE1 1 
ATOM 6140 C CE2 . PHE A 1 802  ? -39.993 22.335  -28.698 1.00 44.95  ? 799  PHE A CE2 1 
ATOM 6141 C CZ  . PHE A 1 802  ? -40.232 21.864  -27.444 1.00 44.95  ? 799  PHE A CZ  1 
ATOM 6142 N N   . GLU A 1 803  ? -44.354 20.553  -33.416 1.00 55.71  ? 800  GLU A N   1 
ATOM 6143 C CA  . GLU A 1 803  ? -44.759 20.544  -34.839 1.00 55.71  ? 800  GLU A CA  1 
ATOM 6144 C C   . GLU A 1 803  ? -44.382 21.854  -35.533 1.00 55.71  ? 800  GLU A C   1 
ATOM 6145 O O   . GLU A 1 803  ? -44.546 22.946  -34.963 1.00 55.71  ? 800  GLU A O   1 
ATOM 6146 C CB  . GLU A 1 803  ? -46.260 20.301  -34.987 1.00 102.87 ? 800  GLU A CB  1 
ATOM 6147 C CG  . GLU A 1 803  ? -46.705 18.881  -34.614 1.00 102.87 ? 800  GLU A CG  1 
ATOM 6148 C CD  . GLU A 1 803  ? -48.071 18.452  -35.217 1.00 102.87 ? 800  GLU A CD  1 
ATOM 6149 O OE1 . GLU A 1 803  ? -48.129 17.343  -35.812 1.00 102.87 ? 800  GLU A OE1 1 
ATOM 6150 O OE2 . GLU A 1 803  ? -49.079 19.202  -35.091 1.00 102.87 ? 800  GLU A OE2 1 
ATOM 6151 N N   . VAL A 1 804  ? -43.857 21.760  -36.752 1.00 40.60  ? 801  VAL A N   1 
ATOM 6152 C CA  . VAL A 1 804  ? -43.724 22.959  -37.582 1.00 40.60  ? 801  VAL A CA  1 
ATOM 6153 C C   . VAL A 1 804  ? -45.132 23.514  -37.884 1.00 40.60  ? 801  VAL A C   1 
ATOM 6154 O O   . VAL A 1 804  ? -45.787 23.076  -38.837 1.00 40.60  ? 801  VAL A O   1 
ATOM 6155 C CB  . VAL A 1 804  ? -43.072 22.698  -38.974 1.00 36.69  ? 801  VAL A CB  1 
ATOM 6156 C CG1 . VAL A 1 804  ? -42.579 23.998  -39.563 1.00 36.69  ? 801  VAL A CG1 1 
ATOM 6157 C CG2 . VAL A 1 804  ? -41.962 21.704  -38.907 1.00 36.69  ? 801  VAL A CG2 1 
ATOM 6158 N N   . LEU A 1 805  ? -45.604 24.470  -37.098 1.00 48.22  ? 802  LEU A N   1 
ATOM 6159 C CA  . LEU A 1 805  ? -46.898 25.014  -37.398 1.00 48.22  ? 802  LEU A CA  1 
ATOM 6160 C C   . LEU A 1 805  ? -46.817 25.671  -38.761 1.00 48.22  ? 802  LEU A C   1 
ATOM 6161 O O   . LEU A 1 805  ? -47.470 25.208  -39.713 1.00 48.22  ? 802  LEU A O   1 
ATOM 6162 C CB  . LEU A 1 805  ? -47.392 25.988  -36.327 1.00 46.94  ? 802  LEU A CB  1 
ATOM 6163 C CG  . LEU A 1 805  ? -47.472 25.434  -34.901 1.00 46.94  ? 802  LEU A CG  1 
ATOM 6164 C CD1 . LEU A 1 805  ? -47.669 26.579  -33.941 1.00 46.94  ? 802  LEU A CD1 1 
ATOM 6165 C CD2 . LEU A 1 805  ? -48.519 24.368  -34.707 1.00 46.94  ? 802  LEU A CD2 1 
ATOM 6166 N N   . HIS A 1 806  ? -45.981 26.705  -38.877 1.00 58.58  ? 803  HIS A N   1 
ATOM 6167 C CA  . HIS A 1 806  ? -45.831 27.462  -40.126 1.00 58.58  ? 803  HIS A CA  1 
ATOM 6168 C C   . HIS A 1 806  ? -44.361 27.509  -40.622 1.00 58.58  ? 803  HIS A C   1 
ATOM 6169 O O   . HIS A 1 806  ? -43.411 27.369  -39.843 1.00 58.58  ? 803  HIS A O   1 
ATOM 6170 C CB  . HIS A 1 806  ? -46.444 28.869  -39.950 1.00 50.12  ? 803  HIS A CB  1 
ATOM 6171 C CG  . HIS A 1 806  ? -46.531 29.665  -41.219 1.00 50.12  ? 803  HIS A CG  1 
ATOM 6172 N ND1 . HIS A 1 806  ? -47.188 29.216  -42.346 1.00 50.12  ? 803  HIS A ND1 1 
ATOM 6173 C CD2 . HIS A 1 806  ? -46.033 30.883  -41.541 1.00 50.12  ? 803  HIS A CD2 1 
ATOM 6174 C CE1 . HIS A 1 806  ? -47.084 30.122  -43.303 1.00 50.12  ? 803  HIS A CE1 1 
ATOM 6175 N NE2 . HIS A 1 806  ? -46.384 31.140  -42.840 1.00 50.12  ? 803  HIS A NE2 1 
ATOM 6176 N N   . ALA A 1 807  ? -44.194 27.691  -41.927 1.00 61.78  ? 804  ALA A N   1 
ATOM 6177 C CA  . ALA A 1 807  ? -42.885 27.952  -42.516 1.00 61.78  ? 804  ALA A CA  1 
ATOM 6178 C C   . ALA A 1 807  ? -42.940 29.095  -43.510 1.00 61.78  ? 804  ALA A C   1 
ATOM 6179 O O   . ALA A 1 807  ? -43.753 29.069  -44.429 1.00 61.78  ? 804  ALA A O   1 
ATOM 6180 C CB  . ALA A 1 807  ? -42.354 26.727  -43.194 1.00 36.90  ? 804  ALA A CB  1 
ATOM 6181 N N   . HIS A 1 808  ? -42.069 30.090  -43.321 1.00 42.15  ? 805  HIS A N   1 
ATOM 6182 C CA  . HIS A 1 808  ? -41.884 31.151  -44.301 1.00 42.15  ? 805  HIS A CA  1 
ATOM 6183 C C   . HIS A 1 808  ? -40.608 30.924  -45.061 1.00 42.15  ? 805  HIS A C   1 
ATOM 6184 O O   . HIS A 1 808  ? -39.565 30.768  -44.448 1.00 42.15  ? 805  HIS A O   1 
ATOM 6185 C CB  . HIS A 1 808  ? -41.842 32.496  -43.628 1.00 73.44  ? 805  HIS A CB  1 
ATOM 6186 C CG  . HIS A 1 808  ? -41.851 33.629  -44.593 1.00 73.44  ? 805  HIS A CG  1 
ATOM 6187 N ND1 . HIS A 1 808  ? -43.012 34.108  -45.159 1.00 73.44  ? 805  HIS A ND1 1 
ATOM 6188 C CD2 . HIS A 1 808  ? -40.840 34.366  -45.115 1.00 73.44  ? 805  HIS A CD2 1 
ATOM 6189 C CE1 . HIS A 1 808  ? -42.718 35.102  -45.978 1.00 73.44  ? 805  HIS A CE1 1 
ATOM 6190 N NE2 . HIS A 1 808  ? -41.407 35.277  -45.971 1.00 73.44  ? 805  HIS A NE2 1 
ATOM 6191 N N   . GLN A 1 809  ? -40.664 30.883  -46.385 1.00 56.35  ? 806  GLN A N   1 
ATOM 6192 C CA  . GLN A 1 809  ? -39.462 30.724  -47.178 1.00 56.35  ? 806  GLN A CA  1 
ATOM 6193 C C   . GLN A 1 809  ? -38.953 32.064  -47.678 1.00 56.35  ? 806  GLN A C   1 
ATOM 6194 O O   . GLN A 1 809  ? -39.731 32.916  -48.114 1.00 56.35  ? 806  GLN A O   1 
ATOM 6195 C CB  . GLN A 1 809  ? -39.732 29.837  -48.354 1.00 42.39  ? 806  GLN A CB  1 
ATOM 6196 C CG  . GLN A 1 809  ? -38.679 29.947  -49.407 1.00 42.39  ? 806  GLN A CG  1 
ATOM 6197 C CD  . GLN A 1 809  ? -38.739 28.839  -50.416 1.00 42.39  ? 806  GLN A CD  1 
ATOM 6198 O OE1 . GLN A 1 809  ? -39.294 27.783  -50.162 1.00 42.39  ? 806  GLN A OE1 1 
ATOM 6199 N NE2 . GLN A 1 809  ? -38.145 29.063  -51.568 1.00 42.39  ? 806  GLN A NE2 1 
ATOM 6200 N N   . PHE A 1 810  ? -37.641 32.255  -47.636 1.00 43.66  ? 807  PHE A N   1 
ATOM 6201 C CA  . PHE A 1 810  ? -37.056 33.524  -48.025 1.00 43.66  ? 807  PHE A CA  1 
ATOM 6202 C C   . PHE A 1 810  ? -36.738 33.609  -49.493 1.00 43.66  ? 807  PHE A C   1 
ATOM 6203 O O   . PHE A 1 810  ? -36.979 32.660  -50.223 1.00 43.66  ? 807  PHE A O   1 
ATOM 6204 C CB  . PHE A 1 810  ? -35.846 33.803  -47.183 1.00 29.97  ? 807  PHE A CB  1 
ATOM 6205 C CG  . PHE A 1 810  ? -36.178 34.203  -45.818 1.00 29.97  ? 807  PHE A CG  1 
ATOM 6206 C CD1 . PHE A 1 810  ? -35.963 33.346  -44.766 1.00 29.97  ? 807  PHE A CD1 1 
ATOM 6207 C CD2 . PHE A 1 810  ? -36.732 35.431  -45.574 1.00 29.97  ? 807  PHE A CD2 1 
ATOM 6208 C CE1 . PHE A 1 810  ? -36.306 33.710  -43.459 1.00 29.97  ? 807  PHE A CE1 1 
ATOM 6209 C CE2 . PHE A 1 810  ? -37.082 35.820  -44.280 1.00 29.97  ? 807  PHE A CE2 1 
ATOM 6210 C CZ  . PHE A 1 810  ? -36.869 34.953  -43.215 1.00 29.97  ? 807  PHE A CZ  1 
ATOM 6211 N N   . LEU A 1 811  ? -36.201 34.757  -49.913 1.00 37.08  ? 808  LEU A N   1 
ATOM 6212 C CA  . LEU A 1 811  ? -35.998 35.046  -51.336 1.00 37.08  ? 808  LEU A CA  1 
ATOM 6213 C C   . LEU A 1 811  ? -34.922 34.152  -51.914 1.00 37.08  ? 808  LEU A C   1 
ATOM 6214 O O   . LEU A 1 811  ? -34.188 33.546  -51.174 1.00 37.08  ? 808  LEU A O   1 
ATOM 6215 C CB  . LEU A 1 811  ? -35.737 36.537  -51.582 1.00 66.96  ? 808  LEU A CB  1 
ATOM 6216 C CG  . LEU A 1 811  ? -36.821 37.512  -51.061 1.00 66.96  ? 808  LEU A CG  1 
ATOM 6217 C CD1 . LEU A 1 811  ? -36.434 38.975  -51.271 1.00 66.96  ? 808  LEU A CD1 1 
ATOM 6218 C CD2 . LEU A 1 811  ? -38.241 37.251  -51.598 1.00 66.96  ? 808  LEU A CD2 1 
ATOM 6219 N N   . GLN A 1 812  ? -34.839 34.017  -53.226 1.00 62.04  ? 809  GLN A N   1 
ATOM 6220 C CA  . GLN A 1 812  ? -33.754 33.236  -53.773 1.00 62.04  ? 809  GLN A CA  1 
ATOM 6221 C C   . GLN A 1 812  ? -32.366 33.820  -53.400 1.00 62.04  ? 809  GLN A C   1 
ATOM 6222 O O   . GLN A 1 812  ? -31.985 34.875  -53.882 1.00 62.04  ? 809  GLN A O   1 
ATOM 6223 C CB  . GLN A 1 812  ? -33.924 33.092  -55.274 1.00 76.50  ? 809  GLN A CB  1 
ATOM 6224 C CG  . GLN A 1 812  ? -33.243 31.868  -55.814 1.00 76.50  ? 809  GLN A CG  1 
ATOM 6225 C CD  . GLN A 1 812  ? -33.315 31.787  -57.306 1.00 76.50  ? 809  GLN A CD  1 
ATOM 6226 O OE1 . GLN A 1 812  ? -32.745 30.886  -57.909 1.00 76.50  ? 809  GLN A OE1 1 
ATOM 6227 N NE2 . GLN A 1 812  ? -34.019 32.728  -57.917 1.00 76.50  ? 809  GLN A NE2 1 
ATOM 6228 N N   . ASN A 1 813  ? -31.630 33.120  -52.537 1.00 56.16  ? 810  ASN A N   1 
ATOM 6229 C CA  . ASN A 1 813  ? -30.289 33.514  -52.044 1.00 56.16  ? 810  ASN A CA  1 
ATOM 6230 C C   . ASN A 1 813  ? -30.309 34.481  -50.883 1.00 56.16  ? 810  ASN A C   1 
ATOM 6231 O O   . ASN A 1 813  ? -29.296 35.060  -50.489 1.00 56.16  ? 810  ASN A O   1 
ATOM 6232 C CB  . ASN A 1 813  ? -29.349 33.999  -53.149 1.00 51.43  ? 810  ASN A CB  1 
ATOM 6233 C CG  . ASN A 1 813  ? -29.193 32.987  -54.253 1.00 51.43  ? 810  ASN A CG  1 
ATOM 6234 O OD1 . ASN A 1 813  ? -28.512 31.961  -54.105 1.00 51.43  ? 810  ASN A OD1 1 
ATOM 6235 N ND2 . ASN A 1 813  ? -29.834 33.267  -55.385 1.00 51.43  ? 810  ASN A ND2 1 
ATOM 6236 N N   . GLU A 1 814  ? -31.482 34.657  -50.319 1.00 54.66  ? 811  GLU A N   1 
ATOM 6237 C CA  . GLU A 1 814  ? -31.550 35.289  -49.024 1.00 54.66  ? 811  GLU A CA  1 
ATOM 6238 C C   . GLU A 1 814  ? -31.161 34.284  -47.903 1.00 54.66  ? 811  GLU A C   1 
ATOM 6239 O O   . GLU A 1 814  ? -31.793 33.234  -47.743 1.00 54.66  ? 811  GLU A O   1 
ATOM 6240 C CB  . GLU A 1 814  ? -32.925 35.887  -48.804 1.00 33.97  ? 811  GLU A CB  1 
ATOM 6241 C CG  . GLU A 1 814  ? -32.845 36.995  -47.883 1.00 33.97  ? 811  GLU A CG  1 
ATOM 6242 C CD  . GLU A 1 814  ? -34.157 37.690  -47.730 1.00 33.97  ? 811  GLU A CD  1 
ATOM 6243 O OE1 . GLU A 1 814  ? -35.202 37.095  -48.104 1.00 33.97  ? 811  GLU A OE1 1 
ATOM 6244 O OE2 . GLU A 1 814  ? -34.165 38.839  -47.216 1.00 33.97  ? 811  GLU A OE2 1 
ATOM 6245 N N   . TYR A 1 815  ? -30.092 34.586  -47.169 1.00 55.93  ? 812  TYR A N   1 
ATOM 6246 C CA  . TYR A 1 815  ? -29.749 33.803  -45.999 1.00 55.93  ? 812  TYR A CA  1 
ATOM 6247 C C   . TYR A 1 815  ? -30.240 34.578  -44.798 1.00 55.93  ? 812  TYR A C   1 
ATOM 6248 O O   . TYR A 1 815  ? -29.976 35.766  -44.675 1.00 55.93  ? 812  TYR A O   1 
ATOM 6249 C CB  . TYR A 1 815  ? -28.245 33.537  -45.902 1.00 30.61  ? 812  TYR A CB  1 
ATOM 6250 C CG  . TYR A 1 815  ? -27.672 32.695  -47.027 1.00 30.61  ? 812  TYR A CG  1 
ATOM 6251 C CD1 . TYR A 1 815  ? -28.368 31.580  -47.488 1.00 30.61  ? 812  TYR A CD1 1 
ATOM 6252 C CD2 . TYR A 1 815  ? -26.417 32.996  -47.623 1.00 30.61  ? 812  TYR A CD2 1 
ATOM 6253 C CE1 . TYR A 1 815  ? -27.867 30.751  -48.533 1.00 30.61  ? 812  TYR A CE1 1 
ATOM 6254 C CE2 . TYR A 1 815  ? -25.856 32.161  -48.678 1.00 30.61  ? 812  TYR A CE2 1 
ATOM 6255 C CZ  . TYR A 1 815  ? -26.611 31.032  -49.126 1.00 30.61  ? 812  TYR A CZ  1 
ATOM 6256 O OH  . TYR A 1 815  ? -26.173 30.189  -50.169 1.00 30.61  ? 812  TYR A OH  1 
ATOM 6257 N N   . ALA A 1 816  ? -30.987 33.900  -43.936 1.00 37.05  ? 813  ALA A N   1 
ATOM 6258 C CA  . ALA A 1 816  ? -31.481 34.495  -42.713 1.00 37.05  ? 813  ALA A CA  1 
ATOM 6259 C C   . ALA A 1 816  ? -30.494 34.242  -41.559 1.00 37.05  ? 813  ALA A C   1 
ATOM 6260 O O   . ALA A 1 816  ? -30.310 33.123  -41.118 1.00 37.05  ? 813  ALA A O   1 
ATOM 6261 C CB  . ALA A 1 816  ? -32.812 33.900  -42.388 1.00 32.04  ? 813  ALA A CB  1 
ATOM 6262 N N   . LEU A 1 817  ? -29.882 35.291  -41.049 1.00 37.75  ? 814  LEU A N   1 
ATOM 6263 C CA  . LEU A 1 817  ? -28.682 35.134  -40.257 1.00 37.75  ? 814  LEU A CA  1 
ATOM 6264 C C   . LEU A 1 817  ? -28.937 35.472  -38.784 1.00 37.75  ? 814  LEU A C   1 
ATOM 6265 O O   . LEU A 1 817  ? -28.210 34.999  -37.905 1.00 37.75  ? 814  LEU A O   1 
ATOM 6266 C CB  . LEU A 1 817  ? -27.585 36.054  -40.839 1.00 24.49  ? 814  LEU A CB  1 
ATOM 6267 C CG  . LEU A 1 817  ? -27.078 35.933  -42.302 1.00 24.49  ? 814  LEU A CG  1 
ATOM 6268 C CD1 . LEU A 1 817  ? -26.120 37.027  -42.511 1.00 24.49  ? 814  LEU A CD1 1 
ATOM 6269 C CD2 . LEU A 1 817  ? -26.385 34.598  -42.627 1.00 24.49  ? 814  LEU A CD2 1 
ATOM 6270 N N   . SER A 1 818  ? -29.949 36.289  -38.505 1.00 41.22  ? 815  SER A N   1 
ATOM 6271 C CA  . SER A 1 818  ? -30.246 36.641  -37.125 1.00 41.22  ? 815  SER A CA  1 
ATOM 6272 C C   . SER A 1 818  ? -31.745 36.618  -36.799 1.00 41.22  ? 815  SER A C   1 
ATOM 6273 O O   . SER A 1 818  ? -32.562 36.827  -37.686 1.00 41.22  ? 815  SER A O   1 
ATOM 6274 C CB  . SER A 1 818  ? -29.650 38.006  -36.785 1.00 31.46  ? 815  SER A CB  1 
ATOM 6275 O OG  . SER A 1 818  ? -29.542 38.846  -37.924 1.00 31.46  ? 815  SER A OG  1 
ATOM 6276 N N   . LEU A 1 819  ? -32.103 36.374  -35.537 1.00 26.83  ? 816  LEU A N   1 
ATOM 6277 C CA  . LEU A 1 819  ? -33.504 36.246  -35.167 1.00 26.83  ? 816  LEU A CA  1 
ATOM 6278 C C   . LEU A 1 819  ? -33.848 36.770  -33.758 1.00 26.83  ? 816  LEU A C   1 
ATOM 6279 O O   . LEU A 1 819  ? -33.213 36.404  -32.782 1.00 26.83  ? 816  LEU A O   1 
ATOM 6280 C CB  . LEU A 1 819  ? -33.932 34.791  -35.299 1.00 36.79  ? 816  LEU A CB  1 
ATOM 6281 C CG  . LEU A 1 819  ? -35.283 34.343  -34.766 1.00 36.79  ? 816  LEU A CG  1 
ATOM 6282 C CD1 . LEU A 1 819  ? -36.403 34.975  -35.523 1.00 36.79  ? 816  LEU A CD1 1 
ATOM 6283 C CD2 . LEU A 1 819  ? -35.351 32.862  -34.921 1.00 36.79  ? 816  LEU A CD2 1 
ATOM 6284 N N   . VAL A 1 820  ? -34.852 37.631  -33.629 1.00 48.41  ? 817  VAL A N   1 
ATOM 6285 C CA  . VAL A 1 820  ? -35.308 37.972  -32.287 1.00 48.41  ? 817  VAL A CA  1 
ATOM 6286 C C   . VAL A 1 820  ? -36.818 37.960  -32.107 1.00 48.41  ? 817  VAL A C   1 
ATOM 6287 O O   . VAL A 1 820  ? -37.587 37.883  -33.058 1.00 48.41  ? 817  VAL A O   1 
ATOM 6288 C CB  . VAL A 1 820  ? -34.724 39.299  -31.761 1.00 52.92  ? 817  VAL A CB  1 
ATOM 6289 C CG1 . VAL A 1 820  ? -33.449 39.615  -32.456 1.00 52.92  ? 817  VAL A CG1 1 
ATOM 6290 C CG2 . VAL A 1 820  ? -35.704 40.419  -31.964 1.00 52.92  ? 817  VAL A CG2 1 
ATOM 6291 N N   . SER A 1 821  ? -37.208 38.041  -30.846 1.00 41.74  ? 818  SER A N   1 
ATOM 6292 C CA  . SER A 1 821  ? -38.588 38.033  -30.463 1.00 41.74  ? 818  SER A CA  1 
ATOM 6293 C C   . SER A 1 821  ? -38.850 39.107  -29.401 1.00 41.74  ? 818  SER A C   1 
ATOM 6294 O O   . SER A 1 821  ? -38.676 38.886  -28.204 1.00 41.74  ? 818  SER A O   1 
ATOM 6295 C CB  . SER A 1 821  ? -38.921 36.662  -29.942 1.00 37.66  ? 818  SER A CB  1 
ATOM 6296 O OG  . SER A 1 821  ? -40.195 36.675  -29.373 1.00 37.66  ? 818  SER A OG  1 
ATOM 6297 N N   . CYS A 1 822  ? -39.275 40.276  -29.833 1.00 63.04  ? 819  CYS A N   1 
ATOM 6298 C CA  . CYS A 1 822  ? -39.390 41.379  -28.912 1.00 63.04  ? 819  CYS A CA  1 
ATOM 6299 C C   . CYS A 1 822  ? -40.660 42.183  -29.178 1.00 63.04  ? 819  CYS A C   1 
ATOM 6300 O O   . CYS A 1 822  ? -41.380 41.897  -30.147 1.00 63.04  ? 819  CYS A O   1 
ATOM 6301 C CB  . CYS A 1 822  ? -38.162 42.267  -29.061 1.00 45.51  ? 819  CYS A CB  1 
ATOM 6302 S SG  . CYS A 1 822  ? -37.923 42.957  -30.782 1.00 45.51  ? 819  CYS A SG  1 
ATOM 6303 N N   . LYS A 1 823  ? -40.935 43.160  -28.302 1.00 60.44  ? 820  LYS A N   1 
ATOM 6304 C CA  . LYS A 1 823  ? -41.952 44.195  -28.533 1.00 60.44  ? 820  LYS A CA  1 
ATOM 6305 C C   . LYS A 1 823  ? -41.150 45.410  -28.846 1.00 60.44  ? 820  LYS A C   1 
ATOM 6306 O O   . LYS A 1 823  ? -40.140 45.641  -28.203 1.00 60.44  ? 820  LYS A O   1 
ATOM 6307 C CB  . LYS A 1 823  ? -42.759 44.517  -27.267 1.00 57.06  ? 820  LYS A CB  1 
ATOM 6308 C CG  . LYS A 1 823  ? -43.710 43.438  -26.734 1.00 57.06  ? 820  LYS A CG  1 
ATOM 6309 C CD  . LYS A 1 823  ? -44.111 43.751  -25.270 1.00 57.06  ? 820  LYS A CD  1 
ATOM 6310 C CE  . LYS A 1 823  ? -45.643 43.355  -25.012 1.00 57.06  ? 820  LYS A CE  1 
ATOM 6311 N NZ  . LYS A 1 823  ? -46.057 43.817  -23.611 1.00 57.06  ? 820  LYS A NZ  1 
ATOM 6312 N N   . LEU A 1 824  ? -41.575 46.221  -29.792 1.00 71.97  ? 821  LEU A N   1 
ATOM 6313 C CA  . LEU A 1 824  ? -40.817 47.444  -30.049 1.00 71.97  ? 821  LEU A CA  1 
ATOM 6314 C C   . LEU A 1 824  ? -41.606 48.716  -29.722 1.00 71.97  ? 821  LEU A C   1 
ATOM 6315 O O   . LEU A 1 824  ? -42.831 48.748  -29.885 1.00 71.97  ? 821  LEU A O   1 
ATOM 6316 C CB  . LEU A 1 824  ? -40.296 47.467  -31.488 1.00 60.69  ? 821  LEU A CB  1 
ATOM 6317 C CG  . LEU A 1 824  ? -39.271 46.431  -31.975 1.00 60.69  ? 821  LEU A CG  1 
ATOM 6318 C CD1 . LEU A 1 824  ? -38.904 46.742  -33.402 1.00 60.69  ? 821  LEU A CD1 1 
ATOM 6319 C CD2 . LEU A 1 824  ? -38.007 46.415  -31.113 1.00 60.69  ? 821  LEU A CD2 1 
ATOM 6320 N N   . GLY A 1 825  ? -40.896 49.743  -29.248 1.00 70.42  ? 822  GLY A N   1 
ATOM 6321 C CA  . GLY A 1 825  ? -41.459 51.066  -28.941 1.00 70.42  ? 822  GLY A CA  1 
ATOM 6322 C C   . GLY A 1 825  ? -42.744 51.040  -28.140 1.00 70.42  ? 822  GLY A C   1 
ATOM 6323 O O   . GLY A 1 825  ? -42.953 50.134  -27.322 1.00 70.42  ? 822  GLY A O   1 
ATOM 6324 N N   . LYS A 1 826  ? -43.615 52.015  -28.404 1.00 78.35  ? 823  LYS A N   1 
ATOM 6325 C CA  . LYS A 1 826  ? -44.948 52.074  -27.782 1.00 78.35  ? 823  LYS A CA  1 
ATOM 6326 C C   . LYS A 1 826  ? -45.882 50.893  -28.148 1.00 78.35  ? 823  LYS A C   1 
ATOM 6327 O O   . LYS A 1 826  ? -46.733 50.482  -27.342 1.00 78.35  ? 823  LYS A O   1 
ATOM 6328 C CB  . LYS A 1 826  ? -45.620 53.423  -28.088 1.00 98.91  ? 823  LYS A CB  1 
ATOM 6329 C CG  . LYS A 1 826  ? -45.251 54.583  -27.116 1.00 98.91  ? 823  LYS A CG  1 
ATOM 6330 C CD  . LYS A 1 826  ? -44.025 55.445  -27.553 1.00 98.91  ? 823  LYS A CD  1 
ATOM 6331 C CE  . LYS A 1 826  ? -44.406 56.563  -28.552 1.00 98.91  ? 823  LYS A CE  1 
ATOM 6332 N NZ  . LYS A 1 826  ? -43.675 57.853  -28.335 1.00 98.91  ? 823  LYS A NZ  1 
ATOM 6333 N N   . ASP A 1 827  ? -45.695 50.367  -29.360 1.00 62.11  ? 824  ASP A N   1 
ATOM 6334 C CA  . ASP A 1 827  ? -46.381 49.177  -29.924 1.00 62.11  ? 824  ASP A CA  1 
ATOM 6335 C C   . ASP A 1 827  ? -46.484 47.952  -28.962 1.00 62.11  ? 824  ASP A C   1 
ATOM 6336 O O   . ASP A 1 827  ? -45.441 47.423  -28.526 1.00 62.11  ? 824  ASP A O   1 
ATOM 6337 C CB  . ASP A 1 827  ? -45.610 48.801  -31.196 1.00 58.52  ? 824  ASP A CB  1 
ATOM 6338 C CG  . ASP A 1 827  ? -46.395 47.904  -32.131 1.00 58.52  ? 824  ASP A CG  1 
ATOM 6339 O OD1 . ASP A 1 827  ? -47.241 47.098  -31.640 1.00 58.52  ? 824  ASP A OD1 1 
ATOM 6340 O OD2 . ASP A 1 827  ? -46.140 47.988  -33.375 1.00 58.52  ? 824  ASP A OD2 1 
ATOM 6341 N N   . PRO A 1 828  ? -47.725 47.499  -28.620 1.00 77.89  ? 825  PRO A N   1 
ATOM 6342 C CA  . PRO A 1 828  ? -47.886 46.432  -27.619 1.00 77.89  ? 825  PRO A CA  1 
ATOM 6343 C C   . PRO A 1 828  ? -47.936 45.021  -28.208 1.00 77.89  ? 825  PRO A C   1 
ATOM 6344 O O   . PRO A 1 828  ? -48.226 44.066  -27.496 1.00 77.89  ? 825  PRO A O   1 
ATOM 6345 C CB  . PRO A 1 828  ? -49.225 46.780  -26.968 1.00 117.90 ? 825  PRO A CB  1 
ATOM 6346 C CG  . PRO A 1 828  ? -50.013 47.395  -28.065 1.00 117.90 ? 825  PRO A CG  1 
ATOM 6347 C CD  . PRO A 1 828  ? -49.044 47.956  -29.100 1.00 117.90 ? 825  PRO A CD  1 
ATOM 6348 N N   . ASN A 1 829  ? -47.675 44.900  -29.502 1.00 95.18  ? 826  ASN A N   1 
ATOM 6349 C CA  . ASN A 1 829  ? -47.538 43.607  -30.149 1.00 95.18  ? 826  ASN A CA  1 
ATOM 6350 C C   . ASN A 1 829  ? -46.153 43.037  -29.902 1.00 95.18  ? 826  ASN A C   1 
ATOM 6351 O O   . ASN A 1 829  ? -45.211 43.816  -29.721 1.00 95.18  ? 826  ASN A O   1 
ATOM 6352 C CB  . ASN A 1 829  ? -47.726 43.782  -31.646 1.00 61.11  ? 826  ASN A CB  1 
ATOM 6353 C CG  . ASN A 1 829  ? -49.174 43.727  -32.055 1.00 61.11  ? 826  ASN A CG  1 
ATOM 6354 O OD1 . ASN A 1 829  ? -50.079 43.643  -31.206 1.00 61.11  ? 826  ASN A OD1 1 
ATOM 6355 N ND2 . ASN A 1 829  ? -49.413 43.751  -33.370 1.00 61.11  ? 826  ASN A ND2 1 
ATOM 6356 N N   . THR A 1 830  ? -46.019 41.703  -29.890 1.00 63.36  ? 827  THR A N   1 
ATOM 6357 C CA  . THR A 1 830  ? -44.700 41.055  -29.899 1.00 63.36  ? 827  THR A CA  1 
ATOM 6358 C C   . THR A 1 830  ? -44.368 40.553  -31.300 1.00 63.36  ? 827  THR A C   1 
ATOM 6359 O O   . THR A 1 830  ? -45.158 39.835  -31.913 1.00 63.36  ? 827  THR A O   1 
ATOM 6360 C CB  . THR A 1 830  ? -44.622 39.919  -28.899 1.00 60.95  ? 827  THR A CB  1 
ATOM 6361 O OG1 . THR A 1 830  ? -44.488 40.472  -27.596 1.00 60.95  ? 827  THR A OG1 1 
ATOM 6362 C CG2 . THR A 1 830  ? -43.408 39.076  -29.147 1.00 60.95  ? 827  THR A CG2 1 
ATOM 6363 N N   . TYR A 1 831  ? -43.206 40.946  -31.814 1.00 42.92  ? 828  TYR A N   1 
ATOM 6364 C CA  . TYR A 1 831  ? -42.811 40.534  -33.153 1.00 42.92  ? 828  TYR A CA  1 
ATOM 6365 C C   . TYR A 1 831  ? -41.683 39.474  -33.156 1.00 42.92  ? 828  TYR A C   1 
ATOM 6366 O O   . TYR A 1 831  ? -41.001 39.249  -32.128 1.00 42.92  ? 828  TYR A O   1 
ATOM 6367 C CB  . TYR A 1 831  ? -42.437 41.758  -34.012 1.00 70.96  ? 828  TYR A CB  1 
ATOM 6368 C CG  . TYR A 1 831  ? -43.540 42.799  -34.137 1.00 70.96  ? 828  TYR A CG  1 
ATOM 6369 C CD1 . TYR A 1 831  ? -43.453 44.012  -33.463 1.00 70.96  ? 828  TYR A CD1 1 
ATOM 6370 C CD2 . TYR A 1 831  ? -44.687 42.563  -34.925 1.00 70.96  ? 828  TYR A CD2 1 
ATOM 6371 C CE1 . TYR A 1 831  ? -44.457 44.964  -33.561 1.00 70.96  ? 828  TYR A CE1 1 
ATOM 6372 C CE2 . TYR A 1 831  ? -45.702 43.517  -35.030 1.00 70.96  ? 828  TYR A CE2 1 
ATOM 6373 C CZ  . TYR A 1 831  ? -45.574 44.716  -34.344 1.00 70.96  ? 828  TYR A CZ  1 
ATOM 6374 O OH  . TYR A 1 831  ? -46.562 45.671  -34.418 1.00 70.96  ? 828  TYR A OH  1 
ATOM 6375 N N   . PHE A 1 832  ? -41.547 38.804  -34.310 1.00 40.07  ? 829  PHE A N   1 
ATOM 6376 C CA  . PHE A 1 832  ? -40.381 38.014  -34.684 1.00 40.07  ? 829  PHE A CA  1 
ATOM 6377 C C   . PHE A 1 832  ? -39.575 38.785  -35.709 1.00 40.07  ? 829  PHE A C   1 
ATOM 6378 O O   . PHE A 1 832  ? -40.084 39.042  -36.801 1.00 40.07  ? 829  PHE A O   1 
ATOM 6379 C CB  . PHE A 1 832  ? -40.810 36.734  -35.376 1.00 41.79  ? 829  PHE A CB  1 
ATOM 6380 C CG  . PHE A 1 832  ? -41.039 35.621  -34.460 1.00 41.79  ? 829  PHE A CG  1 
ATOM 6381 C CD1 . PHE A 1 832  ? -40.128 35.345  -33.455 1.00 41.79  ? 829  PHE A CD1 1 
ATOM 6382 C CD2 . PHE A 1 832  ? -42.161 34.819  -34.602 1.00 41.79  ? 829  PHE A CD2 1 
ATOM 6383 C CE1 . PHE A 1 832  ? -40.341 34.278  -32.567 1.00 41.79  ? 829  PHE A CE1 1 
ATOM 6384 C CE2 . PHE A 1 832  ? -42.401 33.764  -33.735 1.00 41.79  ? 829  PHE A CE2 1 
ATOM 6385 C CZ  . PHE A 1 832  ? -41.480 33.481  -32.708 1.00 41.79  ? 829  PHE A CZ  1 
ATOM 6386 N N   . ILE A 1 833  ? -38.326 39.135  -35.407 1.00 58.64  ? 830  ILE A N   1 
ATOM 6387 C CA  . ILE A 1 833  ? -37.537 39.879  -36.396 1.00 58.64  ? 830  ILE A CA  1 
ATOM 6388 C C   . ILE A 1 833  ? -36.334 39.112  -36.935 1.00 58.64  ? 830  ILE A C   1 
ATOM 6389 O O   . ILE A 1 833  ? -35.496 38.645  -36.176 1.00 58.64  ? 830  ILE A O   1 
ATOM 6390 C CB  . ILE A 1 833  ? -37.070 41.222  -35.860 1.00 39.03  ? 830  ILE A CB  1 
ATOM 6391 C CG1 . ILE A 1 833  ? -38.224 41.938  -35.169 1.00 39.03  ? 830  ILE A CG1 1 
ATOM 6392 C CG2 . ILE A 1 833  ? -36.577 42.076  -37.005 1.00 39.03  ? 830  ILE A CG2 1 
ATOM 6393 C CD1 . ILE A 1 833  ? -37.830 43.243  -34.526 1.00 39.03  ? 830  ILE A CD1 1 
ATOM 6394 N N   . VAL A 1 834  ? -36.243 39.029  -38.259 1.00 43.15  ? 831  VAL A N   1 
ATOM 6395 C CA  . VAL A 1 834  ? -35.198 38.276  -38.898 1.00 43.15  ? 831  VAL A CA  1 
ATOM 6396 C C   . VAL A 1 834  ? -34.278 39.170  -39.698 1.00 43.15  ? 831  VAL A C   1 
ATOM 6397 O O   . VAL A 1 834  ? -34.723 39.771  -40.659 1.00 43.15  ? 831  VAL A O   1 
ATOM 6398 C CB  . VAL A 1 834  ? -35.845 37.314  -39.847 1.00 31.06  ? 831  VAL A CB  1 
ATOM 6399 C CG1 . VAL A 1 834  ? -34.790 36.497  -40.673 1.00 31.06  ? 831  VAL A CG1 1 
ATOM 6400 C CG2 . VAL A 1 834  ? -36.757 36.448  -39.070 1.00 31.06  ? 831  VAL A CG2 1 
ATOM 6401 N N   . GLY A 1 835  ? -33.007 39.258  -39.312 1.00 60.71  ? 832  GLY A N   1 
ATOM 6402 C CA  . GLY A 1 835  ? -32.003 39.960  -40.118 1.00 60.71  ? 832  GLY A CA  1 
ATOM 6403 C C   . GLY A 1 835  ? -31.431 39.041  -41.169 1.00 60.71  ? 832  GLY A C   1 
ATOM 6404 O O   . GLY A 1 835  ? -31.122 37.895  -40.878 1.00 60.71  ? 832  GLY A O   1 
ATOM 6405 N N   . THR A 1 836  ? -31.284 39.526  -42.398 1.00 41.66  ? 833  THR A N   1 
ATOM 6406 C CA  . THR A 1 836  ? -30.906 38.636  -43.538 1.00 41.66  ? 833  THR A CA  1 
ATOM 6407 C C   . THR A 1 836  ? -29.703 39.087  -44.357 1.00 41.66  ? 833  THR A C   1 
ATOM 6408 O O   . THR A 1 836  ? -28.999 39.984  -43.979 1.00 41.66  ? 833  THR A O   1 
ATOM 6409 C CB  . THR A 1 836  ? -32.038 38.493  -44.568 1.00 47.31  ? 833  THR A CB  1 
ATOM 6410 O OG1 . THR A 1 836  ? -32.116 39.689  -45.350 1.00 47.31  ? 833  THR A OG1 1 
ATOM 6411 C CG2 . THR A 1 836  ? -33.366 38.225  -43.906 1.00 47.31  ? 833  THR A CG2 1 
ATOM 6412 N N   . ALA A 1 837  ? -29.482 38.478  -45.506 1.00 42.23  ? 834  ALA A N   1 
ATOM 6413 C CA  . ALA A 1 837  ? -28.342 38.851  -46.330 1.00 42.23  ? 834  ALA A CA  1 
ATOM 6414 C C   . ALA A 1 837  ? -28.453 38.253  -47.727 1.00 42.23  ? 834  ALA A C   1 
ATOM 6415 O O   . ALA A 1 837  ? -28.881 37.113  -47.897 1.00 42.23  ? 834  ALA A O   1 
ATOM 6416 C CB  . ALA A 1 837  ? -27.057 38.379  -45.652 1.00 26.75  ? 834  ALA A CB  1 
ATOM 6417 N N   . MET A 1 838  ? -28.096 38.996  -48.753 1.00 41.91  ? 835  MET A N   1 
ATOM 6418 C CA  . MET A 1 838  ? -28.121 38.350  -50.064 1.00 41.91  ? 835  MET A CA  1 
ATOM 6419 C C   . MET A 1 838  ? -26.750 37.719  -50.299 1.00 41.91  ? 835  MET A C   1 
ATOM 6420 O O   . MET A 1 838  ? -25.728 38.264  -49.875 1.00 41.91  ? 835  MET A O   1 
ATOM 6421 C CB  . MET A 1 838  ? -28.559 39.326  -51.164 1.00 39.58  ? 835  MET A CB  1 
ATOM 6422 C CG  . MET A 1 838  ? -29.905 40.040  -50.856 1.00 39.58  ? 835  MET A CG  1 
ATOM 6423 S SD  . MET A 1 838  ? -31.438 38.982  -50.855 1.00 39.58  ? 835  MET A SD  1 
ATOM 6424 C CE  . MET A 1 838  ? -31.138 37.870  -52.258 1.00 39.58  ? 835  MET A CE  1 
ATOM 6425 N N   . VAL A 1 839  ? -26.691 36.549  -50.909 1.00 47.84  ? 836  VAL A N   1 
ATOM 6426 C CA  . VAL A 1 839  ? -25.413 35.852  -50.890 1.00 47.84  ? 836  VAL A CA  1 
ATOM 6427 C C   . VAL A 1 839  ? -25.041 35.257  -52.225 1.00 47.84  ? 836  VAL A C   1 
ATOM 6428 O O   . VAL A 1 839  ? -25.854 34.565  -52.837 1.00 47.84  ? 836  VAL A O   1 
ATOM 6429 C CB  . VAL A 1 839  ? -25.343 34.744  -49.760 1.00 33.91  ? 836  VAL A CB  1 
ATOM 6430 C CG1 . VAL A 1 839  ? -24.007 33.944  -49.827 1.00 33.91  ? 836  VAL A CG1 1 
ATOM 6431 C CG2 . VAL A 1 839  ? -25.450 35.382  -48.414 1.00 33.91  ? 836  VAL A CG2 1 
ATOM 6432 N N   . TYR A 1 840  ? -23.805 35.500  -52.665 1.00 64.88  ? 837  TYR A N   1 
ATOM 6433 C CA  . TYR A 1 840  ? -23.309 34.849  -53.866 1.00 64.88  ? 837  TYR A CA  1 
ATOM 6434 C C   . TYR A 1 840  ? -21.866 34.419  -53.760 1.00 64.88  ? 837  TYR A C   1 
ATOM 6435 O O   . TYR A 1 840  ? -21.051 35.079  -53.108 1.00 64.88  ? 837  TYR A O   1 
ATOM 6436 C CB  . TYR A 1 840  ? -23.485 35.749  -55.065 1.00 32.71  ? 837  TYR A CB  1 
ATOM 6437 C CG  . TYR A 1 840  ? -24.838 36.416  -55.074 1.00 32.71  ? 837  TYR A CG  1 
ATOM 6438 C CD1 . TYR A 1 840  ? -25.097 37.529  -54.244 1.00 32.71  ? 837  TYR A CD1 1 
ATOM 6439 C CD2 . TYR A 1 840  ? -25.874 35.925  -55.883 1.00 32.71  ? 837  TYR A CD2 1 
ATOM 6440 C CE1 . TYR A 1 840  ? -26.355 38.149  -54.231 1.00 32.71  ? 837  TYR A CE1 1 
ATOM 6441 C CE2 . TYR A 1 840  ? -27.128 36.537  -55.896 1.00 32.71  ? 837  TYR A CE2 1 
ATOM 6442 C CZ  . TYR A 1 840  ? -27.353 37.642  -55.065 1.00 32.71  ? 837  TYR A CZ  1 
ATOM 6443 O OH  . TYR A 1 840  ? -28.587 38.244  -55.068 1.00 32.71  ? 837  TYR A OH  1 
ATOM 6444 N N   . PRO A 1 841  ? -21.549 33.293  -54.406 1.00 86.07  ? 838  PRO A N   1 
ATOM 6445 C CA  . PRO A 1 841  ? -20.192 32.766  -54.471 1.00 86.07  ? 838  PRO A CA  1 
ATOM 6446 C C   . PRO A 1 841  ? -19.187 33.827  -54.916 1.00 86.07  ? 838  PRO A C   1 
ATOM 6447 O O   . PRO A 1 841  ? -18.208 34.052  -54.222 1.00 86.07  ? 838  PRO A O   1 
ATOM 6448 C CB  . PRO A 1 841  ? -20.304 31.648  -55.510 1.00 80.51  ? 838  PRO A CB  1 
ATOM 6449 C CG  . PRO A 1 841  ? -21.707 31.215  -55.434 1.00 80.51  ? 838  PRO A CG  1 
ATOM 6450 C CD  . PRO A 1 841  ? -22.517 32.429  -55.104 1.00 80.51  ? 838  PRO A CD  1 
ATOM 6451 N N   . GLU A 1 842  ? -19.447 34.477  -56.050 1.00 80.10  ? 839  GLU A N   1 
ATOM 6452 C CA  . GLU A 1 842  ? -18.568 35.521  -56.599 1.00 80.10  ? 839  GLU A CA  1 
ATOM 6453 C C   . GLU A 1 842  ? -18.169 36.576  -55.583 1.00 80.10  ? 839  GLU A C   1 
ATOM 6454 O O   . GLU A 1 842  ? -16.962 36.874  -55.428 1.00 80.10  ? 839  GLU A O   1 
ATOM 6455 C CB  . GLU A 1 842  ? -19.215 36.236  -57.790 1.00 96.29  ? 839  GLU A CB  1 
ATOM 6456 C CG  . GLU A 1 842  ? -20.720 36.184  -57.802 1.00 96.29  ? 839  GLU A CG  1 
ATOM 6457 C CD  . GLU A 1 842  ? -21.200 34.833  -58.269 1.00 96.29  ? 839  GLU A CD  1 
ATOM 6458 O OE1 . GLU A 1 842  ? -21.124 34.561  -59.489 1.00 96.29  ? 839  GLU A OE1 1 
ATOM 6459 O OE2 . GLU A 1 842  ? -21.623 34.037  -57.408 1.00 96.29  ? 839  GLU A OE2 1 
ATOM 6460 N N   . GLU A 1 843  ? -19.175 37.141  -54.909 1.00 71.32  ? 840  GLU A N   1 
ATOM 6461 C CA  . GLU A 1 843  ? -18.946 38.228  -53.975 1.00 71.32  ? 840  GLU A CA  1 
ATOM 6462 C C   . GLU A 1 843  ? -18.113 37.812  -52.771 1.00 71.32  ? 840  GLU A C   1 
ATOM 6463 O O   . GLU A 1 843  ? -18.200 36.687  -52.324 1.00 71.32  ? 840  GLU A O   1 
ATOM 6464 C CB  . GLU A 1 843  ? -20.262 38.822  -53.540 1.00 70.48  ? 840  GLU A CB  1 
ATOM 6465 C CG  . GLU A 1 843  ? -21.027 39.399  -54.689 1.00 70.48  ? 840  GLU A CG  1 
ATOM 6466 C CD  . GLU A 1 843  ? -22.291 40.104  -54.242 1.00 70.48  ? 840  GLU A CD  1 
ATOM 6467 O OE1 . GLU A 1 843  ? -23.037 40.619  -55.123 1.00 70.48  ? 840  GLU A OE1 1 
ATOM 6468 O OE2 . GLU A 1 843  ? -22.533 40.141  -53.000 1.00 70.48  ? 840  GLU A OE2 1 
ATOM 6469 N N   . ALA A 1 844  ? -17.267 38.721  -52.294 1.00 68.38  ? 841  ALA A N   1 
ATOM 6470 C CA  . ALA A 1 844  ? -16.460 38.498  -51.091 1.00 68.38  ? 841  ALA A CA  1 
ATOM 6471 C C   . ALA A 1 844  ? -17.401 38.483  -49.909 1.00 68.38  ? 841  ALA A C   1 
ATOM 6472 O O   . ALA A 1 844  ? -17.429 37.540  -49.117 1.00 68.38  ? 841  ALA A O   1 
ATOM 6473 C CB  . ALA A 1 844  ? -15.428 39.629  -50.914 1.00 53.90  ? 841  ALA A CB  1 
ATOM 6474 N N   . GLU A 1 845  ? -18.184 39.551  -49.842 1.00 55.50  ? 842  GLU A N   1 
ATOM 6475 C CA  . GLU A 1 845  ? -18.985 39.902  -48.707 1.00 55.50  ? 842  GLU A CA  1 
ATOM 6476 C C   . GLU A 1 845  ? -20.338 40.313  -49.330 1.00 55.50  ? 842  GLU A C   1 
ATOM 6477 O O   . GLU A 1 845  ? -20.392 40.753  -50.492 1.00 55.50  ? 842  GLU A O   1 
ATOM 6478 C CB  . GLU A 1 845  ? -18.315 41.076  -48.012 1.00 56.18  ? 842  GLU A CB  1 
ATOM 6479 C CG  . GLU A 1 845  ? -18.273 41.049  -46.475 1.00 56.18  ? 842  GLU A CG  1 
ATOM 6480 C CD  . GLU A 1 845  ? -17.432 42.243  -45.874 1.00 56.18  ? 842  GLU A CD  1 
ATOM 6481 O OE1 . GLU A 1 845  ? -16.427 42.679  -46.521 1.00 56.18  ? 842  GLU A OE1 1 
ATOM 6482 O OE2 . GLU A 1 845  ? -17.783 42.732  -44.753 1.00 56.18  ? 842  GLU A OE2 1 
ATOM 6483 N N   . PRO A 1 846  ? -21.446 40.113  -48.595 1.00 78.28  ? 843  PRO A N   1 
ATOM 6484 C CA  . PRO A 1 846  ? -22.679 40.669  -49.139 1.00 78.28  ? 843  PRO A CA  1 
ATOM 6485 C C   . PRO A 1 846  ? -22.684 42.173  -48.909 1.00 78.28  ? 843  PRO A C   1 
ATOM 6486 O O   . PRO A 1 846  ? -21.988 42.662  -48.017 1.00 78.28  ? 843  PRO A O   1 
ATOM 6487 C CB  . PRO A 1 846  ? -23.780 39.978  -48.323 1.00 36.60  ? 843  PRO A CB  1 
ATOM 6488 C CG  . PRO A 1 846  ? -23.147 39.617  -47.035 1.00 36.60  ? 843  PRO A CG  1 
ATOM 6489 C CD  . PRO A 1 846  ? -21.655 39.408  -47.317 1.00 36.60  ? 843  PRO A CD  1 
ATOM 6490 N N   . LYS A 1 847  ? -23.458 42.887  -49.722 1.00 71.32  ? 844  LYS A N   1 
ATOM 6491 C CA  . LYS A 1 847  ? -23.517 44.347  -49.684 1.00 71.32  ? 844  LYS A CA  1 
ATOM 6492 C C   . LYS A 1 847  ? -24.964 44.826  -49.675 1.00 71.32  ? 844  LYS A C   1 
ATOM 6493 O O   . LYS A 1 847  ? -25.239 46.019  -49.796 1.00 71.32  ? 844  LYS A O   1 
ATOM 6494 C CB  . LYS A 1 847  ? -22.717 44.963  -50.855 1.00 178.13 ? 844  LYS A CB  1 
ATOM 6495 C CG  . LYS A 1 847  ? -23.313 44.746  -52.253 1.00 178.13 ? 844  LYS A CG  1 
ATOM 6496 C CD  . LYS A 1 847  ? -23.260 43.279  -52.660 1.00 178.13 ? 844  LYS A CD  1 
ATOM 6497 C CE  . LYS A 1 847  ? -24.627 42.789  -53.117 1.00 178.13 ? 844  LYS A CE  1 
ATOM 6498 N NZ  . LYS A 1 847  ? -24.965 41.428  -52.599 1.00 178.13 ? 844  LYS A NZ  1 
ATOM 6499 N N   . GLN A 1 848  ? -25.878 43.872  -49.523 1.00 65.00  ? 845  GLN A N   1 
ATOM 6500 C CA  . GLN A 1 848  ? -27.300 44.144  -49.287 1.00 65.00  ? 845  GLN A CA  1 
ATOM 6501 C C   . GLN A 1 848  ? -27.994 43.027  -48.512 1.00 65.00  ? 845  GLN A C   1 
ATOM 6502 O O   . GLN A 1 848  ? -27.526 41.876  -48.475 1.00 65.00  ? 845  GLN A O   1 
ATOM 6503 C CB  . GLN A 1 848  ? -28.015 44.350  -50.600 1.00 75.03  ? 845  GLN A CB  1 
ATOM 6504 C CG  . GLN A 1 848  ? -27.715 43.281  -51.586 1.00 75.03  ? 845  GLN A CG  1 
ATOM 6505 C CD  . GLN A 1 848  ? -28.347 43.571  -52.919 1.00 75.03  ? 845  GLN A CD  1 
ATOM 6506 O OE1 . GLN A 1 848  ? -28.101 42.869  -53.905 1.00 75.03  ? 845  GLN A OE1 1 
ATOM 6507 N NE2 . GLN A 1 848  ? -29.167 44.617  -52.964 1.00 75.03  ? 845  GLN A NE2 1 
ATOM 6508 N N   . GLY A 1 849  ? -29.122 43.376  -47.904 1.00 43.41  ? 846  GLY A N   1 
ATOM 6509 C CA  . GLY A 1 849  ? -29.858 42.450  -47.059 1.00 43.41  ? 846  GLY A CA  1 
ATOM 6510 C C   . GLY A 1 849  ? -31.005 43.216  -46.481 1.00 43.41  ? 846  GLY A C   1 
ATOM 6511 O O   . GLY A 1 849  ? -31.103 44.424  -46.695 1.00 43.41  ? 846  GLY A O   1 
ATOM 6512 N N   . ARG A 1 850  ? -31.879 42.547  -45.743 1.00 51.41  ? 847  ARG A N   1 
ATOM 6513 C CA  . ARG A 1 850  ? -32.991 43.262  -45.115 1.00 51.41  ? 847  ARG A CA  1 
ATOM 6514 C C   . ARG A 1 850  ? -33.295 42.873  -43.682 1.00 51.41  ? 847  ARG A C   1 
ATOM 6515 O O   . ARG A 1 850  ? -32.846 41.861  -43.184 1.00 51.41  ? 847  ARG A O   1 
ATOM 6516 C CB  . ARG A 1 850  ? -34.247 43.159  -45.983 1.00 65.89  ? 847  ARG A CB  1 
ATOM 6517 C CG  . ARG A 1 850  ? -34.790 41.760  -46.175 1.00 65.89  ? 847  ARG A CG  1 
ATOM 6518 C CD  . ARG A 1 850  ? -35.831 41.734  -47.305 1.00 65.89  ? 847  ARG A CD  1 
ATOM 6519 N NE  . ARG A 1 850  ? -36.180 40.362  -47.712 1.00 65.89  ? 847  ARG A NE  1 
ATOM 6520 C CZ  . ARG A 1 850  ? -37.387 39.821  -47.588 1.00 65.89  ? 847  ARG A CZ  1 
ATOM 6521 N NH1 . ARG A 1 850  ? -38.386 40.526  -47.094 1.00 65.89  ? 847  ARG A NH1 1 
ATOM 6522 N NH2 . ARG A 1 850  ? -37.596 38.577  -47.964 1.00 65.89  ? 847  ARG A NH2 1 
ATOM 6523 N N   . ILE A 1 851  ? -34.052 43.719  -43.019 1.00 48.22  ? 848  ILE A N   1 
ATOM 6524 C CA  . ILE A 1 851  ? -34.652 43.364  -41.757 1.00 48.22  ? 848  ILE A CA  1 
ATOM 6525 C C   . ILE A 1 851  ? -36.161 43.309  -41.992 1.00 48.22  ? 848  ILE A C   1 
ATOM 6526 O O   . ILE A 1 851  ? -36.756 44.275  -42.501 1.00 48.22  ? 848  ILE A O   1 
ATOM 6527 C CB  . ILE A 1 851  ? -34.372 44.430  -40.695 1.00 30.71  ? 848  ILE A CB  1 
ATOM 6528 C CG1 . ILE A 1 851  ? -32.882 44.638  -40.496 1.00 30.71  ? 848  ILE A CG1 1 
ATOM 6529 C CG2 . ILE A 1 851  ? -35.119 44.158  -39.335 1.00 30.71  ? 848  ILE A CG2 1 
ATOM 6530 C CD1 . ILE A 1 851  ? -32.624 46.079  -40.169 1.00 30.71  ? 848  ILE A CD1 1 
ATOM 6531 N N   . VAL A 1 852  ? -36.771 42.189  -41.596 1.00 49.21  ? 849  VAL A N   1 
ATOM 6532 C CA  . VAL A 1 852  ? -38.197 41.944  -41.762 1.00 49.21  ? 849  VAL A CA  1 
ATOM 6533 C C   . VAL A 1 852  ? -38.882 41.781  -40.407 1.00 49.21  ? 849  VAL A C   1 
ATOM 6534 O O   . VAL A 1 852  ? -38.425 41.022  -39.549 1.00 49.21  ? 849  VAL A O   1 
ATOM 6535 C CB  . VAL A 1 852  ? -38.395 40.650  -42.526 1.00 32.70  ? 849  VAL A CB  1 
ATOM 6536 C CG1 . VAL A 1 852  ? -39.872 40.438  -42.875 1.00 32.70  ? 849  VAL A CG1 1 
ATOM 6537 C CG2 . VAL A 1 852  ? -37.503 40.600  -43.751 1.00 32.70  ? 849  VAL A CG2 1 
ATOM 6538 N N   . VAL A 1 853  ? -39.970 42.490  -40.195 1.00 70.18  ? 850  VAL A N   1 
ATOM 6539 C CA  . VAL A 1 853  ? -40.642 42.362  -38.928 1.00 70.18  ? 850  VAL A CA  1 
ATOM 6540 C C   . VAL A 1 853  ? -41.904 41.594  -39.167 1.00 70.18  ? 850  VAL A C   1 
ATOM 6541 O O   . VAL A 1 853  ? -42.593 41.848  -40.138 1.00 70.18  ? 850  VAL A O   1 
ATOM 6542 C CB  . VAL A 1 853  ? -40.942 43.707  -38.302 1.00 33.81  ? 850  VAL A CB  1 
ATOM 6543 C CG1 . VAL A 1 853  ? -41.595 43.535  -36.916 1.00 33.81  ? 850  VAL A CG1 1 
ATOM 6544 C CG2 . VAL A 1 853  ? -39.681 44.503  -38.157 1.00 33.81  ? 850  VAL A CG2 1 
ATOM 6545 N N   . PHE A 1 854  ? -42.187 40.661  -38.262 1.00 52.82  ? 851  PHE A N   1 
ATOM 6546 C CA  . PHE A 1 854  ? -43.093 39.565  -38.485 1.00 52.82  ? 851  PHE A CA  1 
ATOM 6547 C C   . PHE A 1 854  ? -44.008 39.412  -37.277 1.00 52.82  ? 851  PHE A C   1 
ATOM 6548 O O   . PHE A 1 854  ? -43.605 39.632  -36.123 1.00 52.82  ? 851  PHE A O   1 
ATOM 6549 C CB  . PHE A 1 854  ? -42.286 38.277  -38.554 1.00 48.58  ? 851  PHE A CB  1 
ATOM 6550 C CG  . PHE A 1 854  ? -41.781 37.879  -39.931 1.00 48.58  ? 851  PHE A CG  1 
ATOM 6551 C CD1 . PHE A 1 854  ? -40.433 37.753  -40.165 1.00 48.58  ? 851  PHE A CD1 1 
ATOM 6552 C CD2 . PHE A 1 854  ? -42.641 37.506  -40.934 1.00 48.58  ? 851  PHE A CD2 1 
ATOM 6553 C CE1 . PHE A 1 854  ? -39.943 37.341  -41.397 1.00 48.58  ? 851  PHE A CE1 1 
ATOM 6554 C CE2 . PHE A 1 854  ? -42.152 37.075  -42.169 1.00 48.58  ? 851  PHE A CE2 1 
ATOM 6555 C CZ  . PHE A 1 854  ? -40.805 36.996  -42.396 1.00 48.58  ? 851  PHE A CZ  1 
ATOM 6556 N N   . GLN A 1 855  ? -45.245 39.003  -37.539 1.00 74.77  ? 852  GLN A N   1 
ATOM 6557 C CA  . GLN A 1 855  ? -46.122 38.621  -36.452 1.00 74.77  ? 852  GLN A CA  1 
ATOM 6558 C C   . GLN A 1 855  ? -46.829 37.323  -36.718 1.00 74.77  ? 852  GLN A C   1 
ATOM 6559 O O   . GLN A 1 855  ? -47.382 37.101  -37.799 1.00 74.77  ? 852  GLN A O   1 
ATOM 6560 C CB  . GLN A 1 855  ? -47.138 39.693  -36.167 1.00 59.23  ? 852  GLN A CB  1 
ATOM 6561 C CG  . GLN A 1 855  ? -47.911 39.497  -34.881 1.00 59.23  ? 852  GLN A CG  1 
ATOM 6562 C CD  . GLN A 1 855  ? -48.916 40.620  -34.653 1.00 59.23  ? 852  GLN A CD  1 
ATOM 6563 O OE1 . GLN A 1 855  ? -49.327 41.306  -35.603 1.00 59.23  ? 852  GLN A OE1 1 
ATOM 6564 N NE2 . GLN A 1 855  ? -49.309 40.826  -33.389 1.00 59.23  ? 852  GLN A NE2 1 
ATOM 6565 N N   . TYR A 1 856  ? -46.750 36.458  -35.709 1.00 49.05  ? 853  TYR A N   1 
ATOM 6566 C CA  . TYR A 1 856  ? -47.554 35.262  -35.619 1.00 49.05  ? 853  TYR A CA  1 
ATOM 6567 C C   . TYR A 1 856  ? -48.808 35.499  -34.741 1.00 49.05  ? 853  TYR A C   1 
ATOM 6568 O O   . TYR A 1 856  ? -48.716 35.903  -33.557 1.00 49.05  ? 853  TYR A O   1 
ATOM 6569 C CB  . TYR A 1 856  ? -46.723 34.086  -35.083 1.00 54.06  ? 853  TYR A CB  1 
ATOM 6570 C CG  . TYR A 1 856  ? -47.370 32.735  -35.307 1.00 54.06  ? 853  TYR A CG  1 
ATOM 6571 C CD1 . TYR A 1 856  ? -47.583 32.247  -36.600 1.00 54.06  ? 853  TYR A CD1 1 
ATOM 6572 C CD2 . TYR A 1 856  ? -47.790 31.958  -34.235 1.00 54.06  ? 853  TYR A CD2 1 
ATOM 6573 C CE1 . TYR A 1 856  ? -48.189 31.030  -36.816 1.00 54.06  ? 853  TYR A CE1 1 
ATOM 6574 C CE2 . TYR A 1 856  ? -48.405 30.710  -34.452 1.00 54.06  ? 853  TYR A CE2 1 
ATOM 6575 C CZ  . TYR A 1 856  ? -48.591 30.266  -35.746 1.00 54.06  ? 853  TYR A CZ  1 
ATOM 6576 O OH  . TYR A 1 856  ? -49.190 29.056  -35.968 1.00 54.06  ? 853  TYR A OH  1 
ATOM 6577 N N   . SER A 1 857  ? -49.959 35.176  -35.321 1.00 133.09 ? 854  SER A N   1 
ATOM 6578 C CA  . SER A 1 857  ? -51.254 35.568  -34.794 1.00 133.09 ? 854  SER A CA  1 
ATOM 6579 C C   . SER A 1 857  ? -52.002 34.374  -34.199 1.00 133.09 ? 854  SER A C   1 
ATOM 6580 O O   . SER A 1 857  ? -51.542 33.769  -33.225 1.00 133.09 ? 854  SER A O   1 
ATOM 6581 C CB  . SER A 1 857  ? -52.050 36.182  -35.937 1.00 80.23  ? 854  SER A CB  1 
ATOM 6582 O OG  . SER A 1 857  ? -51.173 36.581  -36.990 1.00 80.23  ? 854  SER A OG  1 
ATOM 6583 N N   . ASP A 1 858  ? -53.157 34.050  -34.774 1.00 135.11 ? 855  ASP A N   1 
ATOM 6584 C CA  . ASP A 1 858  ? -53.858 32.824  -34.434 1.00 135.11 ? 855  ASP A CA  1 
ATOM 6585 C C   . ASP A 1 858  ? -53.083 31.670  -35.049 1.00 135.11 ? 855  ASP A C   1 
ATOM 6586 O O   . ASP A 1 858  ? -52.565 30.807  -34.335 1.00 135.11 ? 855  ASP A O   1 
ATOM 6587 C CB  . ASP A 1 858  ? -55.298 32.841  -34.970 1.00 119.98 ? 855  ASP A CB  1 
ATOM 6588 C CG  . ASP A 1 858  ? -56.295 33.502  -34.006 1.00 119.98 ? 855  ASP A CG  1 
ATOM 6589 O OD1 . ASP A 1 858  ? -55.887 33.912  -32.891 1.00 119.98 ? 855  ASP A OD1 1 
ATOM 6590 O OD2 . ASP A 1 858  ? -57.500 33.610  -34.364 1.00 119.98 ? 855  ASP A OD2 1 
ATOM 6591 N N   . GLY A 1 859  ? -52.993 31.684  -36.379 1.00 77.32  ? 856  GLY A N   1 
ATOM 6592 C CA  . GLY A 1 859  ? -52.279 30.660  -37.147 1.00 77.32  ? 856  GLY A CA  1 
ATOM 6593 C C   . GLY A 1 859  ? -51.568 31.295  -38.324 1.00 77.32  ? 856  GLY A C   1 
ATOM 6594 O O   . GLY A 1 859  ? -51.041 30.592  -39.211 1.00 77.32  ? 856  GLY A O   1 
ATOM 6595 N N   . LYS A 1 860  ? -51.533 32.631  -38.299 1.00 59.28  ? 857  LYS A N   1 
ATOM 6596 C CA  . LYS A 1 860  ? -51.026 33.434  -39.419 1.00 59.28  ? 857  LYS A CA  1 
ATOM 6597 C C   . LYS A 1 860  ? -49.630 34.022  -39.144 1.00 59.28  ? 857  LYS A C   1 
ATOM 6598 O O   . LYS A 1 860  ? -49.260 34.259  -37.991 1.00 59.28  ? 857  LYS A O   1 
ATOM 6599 C CB  . LYS A 1 860  ? -52.011 34.571  -39.743 1.00 152.72 ? 857  LYS A CB  1 
ATOM 6600 C CG  . LYS A 1 860  ? -53.367 34.524  -39.014 1.00 152.72 ? 857  LYS A CG  1 
ATOM 6601 C CD  . LYS A 1 860  ? -54.300 33.427  -39.516 1.00 152.72 ? 857  LYS A CD  1 
ATOM 6602 C CE  . LYS A 1 860  ? -55.510 33.306  -38.610 1.00 152.72 ? 857  LYS A CE  1 
ATOM 6603 N NZ  . LYS A 1 860  ? -55.971 31.901  -38.459 1.00 152.72 ? 857  LYS A NZ  1 
ATOM 6604 N N   . LEU A 1 861  ? -48.886 34.270  -40.222 1.00 68.18  ? 858  LEU A N   1 
ATOM 6605 C CA  . LEU A 1 861  ? -47.553 34.868  -40.174 1.00 68.18  ? 858  LEU A CA  1 
ATOM 6606 C C   . LEU A 1 861  ? -47.489 36.087  -41.104 1.00 68.18  ? 858  LEU A C   1 
ATOM 6607 O O   . LEU A 1 861  ? -47.177 35.965  -42.287 1.00 68.18  ? 858  LEU A O   1 
ATOM 6608 C CB  . LEU A 1 861  ? -46.506 33.820  -40.597 1.00 43.10  ? 858  LEU A CB  1 
ATOM 6609 C CG  . LEU A 1 861  ? -45.026 33.809  -40.107 1.00 43.10  ? 858  LEU A CG  1 
ATOM 6610 C CD1 . LEU A 1 861  ? -44.022 34.246  -41.167 1.00 43.10  ? 858  LEU A CD1 1 
ATOM 6611 C CD2 . LEU A 1 861  ? -44.826 34.571  -38.769 1.00 43.10  ? 858  LEU A CD2 1 
ATOM 6612 N N   . GLN A 1 862  ? -47.772 37.264  -40.569 1.00 47.05  ? 859  GLN A N   1 
ATOM 6613 C CA  . GLN A 1 862  ? -47.824 38.483  -41.390 1.00 47.05  ? 859  GLN A CA  1 
ATOM 6614 C C   . GLN A 1 862  ? -46.464 39.246  -41.494 1.00 47.05  ? 859  GLN A C   1 
ATOM 6615 O O   . GLN A 1 862  ? -45.910 39.688  -40.468 1.00 47.05  ? 859  GLN A O   1 
ATOM 6616 C CB  . GLN A 1 862  ? -48.935 39.411  -40.869 1.00 112.62 ? 859  GLN A CB  1 
ATOM 6617 C CG  . GLN A 1 862  ? -49.457 40.434  -41.902 1.00 112.62 ? 859  GLN A CG  1 
ATOM 6618 C CD  . GLN A 1 862  ? -50.400 41.510  -41.318 1.00 112.62 ? 859  GLN A CD  1 
ATOM 6619 O OE1 . GLN A 1 862  ? -50.552 41.650  -40.100 1.00 112.62 ? 859  GLN A OE1 1 
ATOM 6620 N NE2 . GLN A 1 862  ? -51.028 42.273  -42.205 1.00 112.62 ? 859  GLN A NE2 1 
ATOM 6621 N N   . THR A 1 863  ? -45.942 39.384  -42.720 1.00 58.33  ? 860  THR A N   1 
ATOM 6622 C CA  . THR A 1 863  ? -44.836 40.301  -42.995 1.00 58.33  ? 860  THR A CA  1 
ATOM 6623 C C   . THR A 1 863  ? -45.287 41.708  -42.587 1.00 58.33  ? 860  THR A C   1 
ATOM 6624 O O   . THR A 1 863  ? -45.912 42.404  -43.392 1.00 58.33  ? 860  THR A O   1 
ATOM 6625 C CB  . THR A 1 863  ? -44.445 40.341  -44.526 1.00 50.21  ? 860  THR A CB  1 
ATOM 6626 O OG1 . THR A 1 863  ? -44.272 39.018  -45.054 1.00 50.21  ? 860  THR A OG1 1 
ATOM 6627 C CG2 . THR A 1 863  ? -43.146 41.134  -44.760 1.00 50.21  ? 860  THR A CG2 1 
ATOM 6628 N N   . VAL A 1 864  ? -44.991 42.122  -41.349 1.00 51.68  ? 861  VAL A N   1 
ATOM 6629 C CA  . VAL A 1 864  ? -45.440 43.416  -40.794 1.00 51.68  ? 861  VAL A CA  1 
ATOM 6630 C C   . VAL A 1 864  ? -44.701 44.590  -41.415 1.00 51.68  ? 861  VAL A C   1 
ATOM 6631 O O   . VAL A 1 864  ? -45.283 45.651  -41.588 1.00 51.68  ? 861  VAL A O   1 
ATOM 6632 C CB  . VAL A 1 864  ? -45.312 43.481  -39.219 1.00 45.92  ? 861  VAL A CB  1 
ATOM 6633 C CG1 . VAL A 1 864  ? -45.519 44.906  -38.650 1.00 45.92  ? 861  VAL A CG1 1 
ATOM 6634 C CG2 . VAL A 1 864  ? -46.260 42.487  -38.529 1.00 45.92  ? 861  VAL A CG2 1 
ATOM 6635 N N   . ALA A 1 865  ? -43.428 44.429  -41.754 1.00 57.04  ? 862  ALA A N   1 
ATOM 6636 C CA  . ALA A 1 865  ? -42.615 45.589  -42.135 1.00 57.04  ? 862  ALA A CA  1 
ATOM 6637 C C   . ALA A 1 865  ? -41.324 45.126  -42.756 1.00 57.04  ? 862  ALA A C   1 
ATOM 6638 O O   . ALA A 1 865  ? -40.766 44.136  -42.302 1.00 57.04  ? 862  ALA A O   1 
ATOM 6639 C CB  . ALA A 1 865  ? -42.312 46.408  -40.911 1.00 46.44  ? 862  ALA A CB  1 
ATOM 6640 N N   . GLU A 1 866  ? -40.846 45.792  -43.801 1.00 76.17  ? 863  GLU A N   1 
ATOM 6641 C CA  . GLU A 1 866  ? -39.474 45.526  -44.240 1.00 76.17  ? 863  GLU A CA  1 
ATOM 6642 C C   . GLU A 1 866  ? -38.569 46.738  -44.084 1.00 76.17  ? 863  GLU A C   1 
ATOM 6643 O O   . GLU A 1 866  ? -39.027 47.813  -43.660 1.00 76.17  ? 863  GLU A O   1 
ATOM 6644 C CB  . GLU A 1 866  ? -39.351 44.857  -45.625 1.00 68.49  ? 863  GLU A CB  1 
ATOM 6645 C CG  . GLU A 1 866  ? -40.370 45.186  -46.717 1.00 68.49  ? 863  GLU A CG  1 
ATOM 6646 C CD  . GLU A 1 866  ? -39.979 44.576  -48.094 1.00 68.49  ? 863  GLU A CD  1 
ATOM 6647 O OE1 . GLU A 1 866  ? -38.941 43.876  -48.181 1.00 68.49  ? 863  GLU A OE1 1 
ATOM 6648 O OE2 . GLU A 1 866  ? -40.691 44.785  -49.109 1.00 68.49  ? 863  GLU A OE2 1 
ATOM 6649 N N   . LYS A 1 867  ? -37.285 46.536  -44.373 1.00 52.57  ? 864  LYS A N   1 
ATOM 6650 C CA  . LYS A 1 867  ? -36.279 47.590  -44.300 1.00 52.57  ? 864  LYS A CA  1 
ATOM 6651 C C   . LYS A 1 867  ? -35.062 47.104  -45.020 1.00 52.57  ? 864  LYS A C   1 
ATOM 6652 O O   . LYS A 1 867  ? -34.527 46.091  -44.635 1.00 52.57  ? 864  LYS A O   1 
ATOM 6653 C CB  . LYS A 1 867  ? -35.887 47.883  -42.857 1.00 78.23  ? 864  LYS A CB  1 
ATOM 6654 C CG  . LYS A 1 867  ? -35.007 49.130  -42.709 1.00 78.23  ? 864  LYS A CG  1 
ATOM 6655 C CD  . LYS A 1 867  ? -35.829 50.413  -42.833 1.00 78.23  ? 864  LYS A CD  1 
ATOM 6656 C CE  . LYS A 1 867  ? -34.969 51.645  -42.845 1.00 78.23  ? 864  LYS A CE  1 
ATOM 6657 N NZ  . LYS A 1 867  ? -35.844 52.831  -42.660 1.00 78.23  ? 864  LYS A NZ  1 
ATOM 6658 N N   . GLU A 1 868  ? -34.621 47.805  -46.053 1.00 55.70  ? 865  GLU A N   1 
ATOM 6659 C CA  . GLU A 1 868  ? -33.464 47.367  -46.804 1.00 55.70  ? 865  GLU A CA  1 
ATOM 6660 C C   . GLU A 1 868  ? -32.232 47.815  -46.052 1.00 55.70  ? 865  GLU A C   1 
ATOM 6661 O O   . GLU A 1 868  ? -32.288 48.785  -45.270 1.00 55.70  ? 865  GLU A O   1 
ATOM 6662 C CB  . GLU A 1 868  ? -33.465 47.974  -48.194 1.00 64.06  ? 865  GLU A CB  1 
ATOM 6663 C CG  . GLU A 1 868  ? -32.484 47.341  -49.186 1.00 64.06  ? 865  GLU A CG  1 
ATOM 6664 C CD  . GLU A 1 868  ? -32.306 48.190  -50.468 1.00 64.06  ? 865  GLU A CD  1 
ATOM 6665 O OE1 . GLU A 1 868  ? -31.324 47.992  -51.228 1.00 64.06  ? 865  GLU A OE1 1 
ATOM 6666 O OE2 . GLU A 1 868  ? -33.151 49.078  -50.713 1.00 64.06  ? 865  GLU A OE2 1 
ATOM 6667 N N   . VAL A 1 869  ? -31.140 47.077  -46.248 1.00 50.66  ? 866  VAL A N   1 
ATOM 6668 C CA  . VAL A 1 869  ? -29.825 47.477  -45.738 1.00 50.66  ? 866  VAL A CA  1 
ATOM 6669 C C   . VAL A 1 869  ? -28.770 47.168  -46.765 1.00 50.66  ? 866  VAL A C   1 
ATOM 6670 O O   . VAL A 1 869  ? -29.033 46.462  -47.755 1.00 50.66  ? 866  VAL A O   1 
ATOM 6671 C CB  . VAL A 1 869  ? -29.426 46.837  -44.373 1.00 61.90  ? 866  VAL A CB  1 
ATOM 6672 C CG1 . VAL A 1 869  ? -30.047 47.596  -43.221 1.00 61.90  ? 866  VAL A CG1 1 
ATOM 6673 C CG2 . VAL A 1 869  ? -29.779 45.372  -44.310 1.00 61.90  ? 866  VAL A CG2 1 
ATOM 6674 N N   . LYS A 1 870  ? -27.579 47.706  -46.523 1.00 69.84  ? 867  LYS A N   1 
ATOM 6675 C CA  . LYS A 1 870  ? -26.504 47.634  -47.499 1.00 69.84  ? 867  LYS A CA  1 
ATOM 6676 C C   . LYS A 1 870  ? -25.398 46.641  -47.110 1.00 69.84  ? 867  LYS A C   1 
ATOM 6677 O O   . LYS A 1 870  ? -24.224 46.816  -47.463 1.00 69.84  ? 867  LYS A O   1 
ATOM 6678 C CB  . LYS A 1 870  ? -25.976 49.039  -47.806 1.00 71.11  ? 867  LYS A CB  1 
ATOM 6679 C CG  . LYS A 1 870  ? -26.956 49.886  -48.616 1.00 71.11  ? 867  LYS A CG  1 
ATOM 6680 C CD  . LYS A 1 870  ? -26.523 51.352  -48.662 1.00 71.11  ? 867  LYS A CD  1 
ATOM 6681 C CE  . LYS A 1 870  ? -27.107 52.212  -47.505 1.00 71.11  ? 867  LYS A CE  1 
ATOM 6682 N NZ  . LYS A 1 870  ? -26.276 53.438  -47.170 1.00 71.11  ? 867  LYS A NZ  1 
ATOM 6683 N N   . GLY A 1 871  ? -25.811 45.575  -46.424 1.00 71.88  ? 868  GLY A N   1 
ATOM 6684 C CA  . GLY A 1 871  ? -24.925 44.479  -46.029 1.00 71.88  ? 868  GLY A CA  1 
ATOM 6685 C C   . GLY A 1 871  ? -25.646 43.413  -45.219 1.00 71.88  ? 868  GLY A C   1 
ATOM 6686 O O   . GLY A 1 871  ? -26.863 43.478  -45.053 1.00 71.88  ? 868  GLY A O   1 
ATOM 6687 N N   . ALA A 1 872  ? -24.872 42.440  -44.724 1.00 43.90  ? 869  ALA A N   1 
ATOM 6688 C CA  . ALA A 1 872  ? -25.320 41.314  -43.863 1.00 43.90  ? 869  ALA A CA  1 
ATOM 6689 C C   . ALA A 1 872  ? -25.732 41.730  -42.472 1.00 43.90  ? 869  ALA A C   1 
ATOM 6690 O O   . ALA A 1 872  ? -24.947 42.321  -41.730 1.00 43.90  ? 869  ALA A O   1 
ATOM 6691 C CB  . ALA A 1 872  ? -24.202 40.278  -43.723 1.00 34.09  ? 869  ALA A CB  1 
ATOM 6692 N N   . VAL A 1 873  ? -26.940 41.381  -42.074 1.00 52.59  ? 870  VAL A N   1 
ATOM 6693 C CA  . VAL A 1 873  ? -27.307 41.613  -40.703 1.00 52.59  ? 870  VAL A CA  1 
ATOM 6694 C C   . VAL A 1 873  ? -26.863 40.404  -39.894 1.00 52.59  ? 870  VAL A C   1 
ATOM 6695 O O   . VAL A 1 873  ? -27.589 39.403  -39.801 1.00 52.59  ? 870  VAL A O   1 
ATOM 6696 C CB  . VAL A 1 873  ? -28.775 41.810  -40.572 1.00 42.86  ? 870  VAL A CB  1 
ATOM 6697 C CG1 . VAL A 1 873  ? -29.027 42.664  -39.408 1.00 42.86  ? 870  VAL A CG1 1 
ATOM 6698 C CG2 . VAL A 1 873  ? -29.321 42.440  -41.798 1.00 42.86  ? 870  VAL A CG2 1 
ATOM 6699 N N   . TYR A 1 874  ? -25.646 40.479  -39.349 1.00 53.53  ? 871  TYR A N   1 
ATOM 6700 C CA  . TYR A 1 874  ? -25.067 39.350  -38.625 1.00 53.53  ? 871  TYR A CA  1 
ATOM 6701 C C   . TYR A 1 874  ? -25.729 39.124  -37.320 1.00 53.53  ? 871  TYR A C   1 
ATOM 6702 O O   . TYR A 1 874  ? -25.984 37.993  -36.965 1.00 53.53  ? 871  TYR A O   1 
ATOM 6703 C CB  . TYR A 1 874  ? -23.597 39.525  -38.377 1.00 42.45  ? 871  TYR A CB  1 
ATOM 6704 C CG  . TYR A 1 874  ? -22.840 39.379  -39.626 1.00 42.45  ? 871  TYR A CG  1 
ATOM 6705 C CD1 . TYR A 1 874  ? -22.395 40.515  -40.313 1.00 42.45  ? 871  TYR A CD1 1 
ATOM 6706 C CD2 . TYR A 1 874  ? -22.582 38.111  -40.161 1.00 42.45  ? 871  TYR A CD2 1 
ATOM 6707 C CE1 . TYR A 1 874  ? -21.694 40.391  -41.485 1.00 42.45  ? 871  TYR A CE1 1 
ATOM 6708 C CE2 . TYR A 1 874  ? -21.899 37.969  -41.333 1.00 42.45  ? 871  TYR A CE2 1 
ATOM 6709 C CZ  . TYR A 1 874  ? -21.459 39.111  -41.997 1.00 42.45  ? 871  TYR A CZ  1 
ATOM 6710 O OH  . TYR A 1 874  ? -20.755 39.006  -43.190 1.00 42.45  ? 871  TYR A OH  1 
ATOM 6711 N N   . SER A 1 875  ? -26.003 40.177  -36.580 1.00 48.95  ? 872  SER A N   1 
ATOM 6712 C CA  . SER A 1 875  ? -26.740 39.942  -35.380 1.00 48.95  ? 872  SER A CA  1 
ATOM 6713 C C   . SER A 1 875  ? -27.672 41.079  -34.978 1.00 48.95  ? 872  SER A C   1 
ATOM 6714 O O   . SER A 1 875  ? -27.592 42.169  -35.549 1.00 48.95  ? 872  SER A O   1 
ATOM 6715 C CB  . SER A 1 875  ? -25.811 39.407  -34.261 1.00 36.08  ? 872  SER A CB  1 
ATOM 6716 O OG  . SER A 1 875  ? -25.075 40.433  -33.672 1.00 36.08  ? 872  SER A OG  1 
ATOM 6717 N N   . MET A 1 876  ? -28.606 40.794  -34.070 1.00 42.82  ? 873  MET A N   1 
ATOM 6718 C CA  . MET A 1 876  ? -29.472 41.843  -33.517 1.00 42.82  ? 873  MET A CA  1 
ATOM 6719 C C   . MET A 1 876  ? -30.016 41.597  -32.112 1.00 42.82  ? 873  MET A C   1 
ATOM 6720 O O   . MET A 1 876  ? -30.662 40.607  -31.863 1.00 42.82  ? 873  MET A O   1 
ATOM 6721 C CB  . MET A 1 876  ? -30.650 42.167  -34.437 1.00 45.90  ? 873  MET A CB  1 
ATOM 6722 C CG  . MET A 1 876  ? -31.280 41.022  -35.196 1.00 45.90  ? 873  MET A CG  1 
ATOM 6723 S SD  . MET A 1 876  ? -32.503 41.716  -36.376 1.00 45.90  ? 873  MET A SD  1 
ATOM 6724 C CE  . MET A 1 876  ? -31.454 42.634  -37.479 1.00 45.90  ? 873  MET A CE  1 
ATOM 6725 N N   . VAL A 1 877  ? -29.743 42.492  -31.184 1.00 52.86  ? 874  VAL A N   1 
ATOM 6726 C CA  . VAL A 1 877  ? -30.399 42.372  -29.914 1.00 52.86  ? 874  VAL A CA  1 
ATOM 6727 C C   . VAL A 1 877  ? -31.509 43.404  -29.928 1.00 52.86  ? 874  VAL A C   1 
ATOM 6728 O O   . VAL A 1 877  ? -31.552 44.267  -30.822 1.00 52.86  ? 874  VAL A O   1 
ATOM 6729 C CB  . VAL A 1 877  ? -29.434 42.552  -28.710 1.00 45.38  ? 874  VAL A CB  1 
ATOM 6730 C CG1 . VAL A 1 877  ? -28.996 43.986  -28.553 1.00 45.38  ? 874  VAL A CG1 1 
ATOM 6731 C CG2 . VAL A 1 877  ? -30.118 42.121  -27.424 1.00 45.38  ? 874  VAL A CG2 1 
ATOM 6732 N N   . GLU A 1 878  ? -32.420 43.288  -28.973 1.00 66.66  ? 875  GLU A N   1 
ATOM 6733 C CA  . GLU A 1 878  ? -33.409 44.315  -28.716 1.00 66.66  ? 875  GLU A CA  1 
ATOM 6734 C C   . GLU A 1 878  ? -32.774 45.124  -27.631 1.00 66.66  ? 875  GLU A C   1 
ATOM 6735 O O   . GLU A 1 878  ? -32.234 44.553  -26.692 1.00 66.66  ? 875  GLU A O   1 
ATOM 6736 C CB  . GLU A 1 878  ? -34.726 43.679  -28.229 1.00 78.53  ? 875  GLU A CB  1 
ATOM 6737 C CG  . GLU A 1 878  ? -35.775 44.622  -27.606 1.00 78.53  ? 875  GLU A CG  1 
ATOM 6738 C CD  . GLU A 1 878  ? -35.546 44.895  -26.111 1.00 78.53  ? 875  GLU A CD  1 
ATOM 6739 O OE1 . GLU A 1 878  ? -34.792 44.119  -25.469 1.00 78.53  ? 875  GLU A OE1 1 
ATOM 6740 O OE2 . GLU A 1 878  ? -36.128 45.884  -25.580 1.00 78.53  ? 875  GLU A OE2 1 
ATOM 6741 N N   . PHE A 1 879  ? -32.828 46.444  -27.752 1.00 97.48  ? 876  PHE A N   1 
ATOM 6742 C CA  . PHE A 1 879  ? -32.144 47.302  -26.798 1.00 97.48  ? 876  PHE A CA  1 
ATOM 6743 C C   . PHE A 1 879  ? -33.100 47.812  -25.731 1.00 97.48  ? 876  PHE A C   1 
ATOM 6744 O O   . PHE A 1 879  ? -33.297 47.141  -24.715 1.00 97.48  ? 876  PHE A O   1 
ATOM 6745 C CB  . PHE A 1 879  ? -31.407 48.433  -27.525 1.00 61.89  ? 876  PHE A CB  1 
ATOM 6746 C CG  . PHE A 1 879  ? -30.321 49.086  -26.713 1.00 61.89  ? 876  PHE A CG  1 
ATOM 6747 C CD1 . PHE A 1 879  ? -29.469 48.332  -25.908 1.00 61.89  ? 876  PHE A CD1 1 
ATOM 6748 C CD2 . PHE A 1 879  ? -30.135 50.468  -26.771 1.00 61.89  ? 876  PHE A CD2 1 
ATOM 6749 C CE1 . PHE A 1 879  ? -28.452 48.951  -25.150 1.00 61.89  ? 876  PHE A CE1 1 
ATOM 6750 C CE2 . PHE A 1 879  ? -29.134 51.091  -26.028 1.00 61.89  ? 876  PHE A CE2 1 
ATOM 6751 C CZ  . PHE A 1 879  ? -28.285 50.332  -25.220 1.00 61.89  ? 876  PHE A CZ  1 
ATOM 6752 N N   . ASN A 1 880  ? -33.703 48.976  -25.951 1.00 63.94  ? 877  ASN A N   1 
ATOM 6753 C CA  . ASN A 1 880  ? -34.610 49.546  -24.965 1.00 63.94  ? 877  ASN A CA  1 
ATOM 6754 C C   . ASN A 1 880  ? -35.874 49.988  -25.655 1.00 63.94  ? 877  ASN A C   1 
ATOM 6755 O O   . ASN A 1 880  ? -36.117 51.176  -25.826 1.00 63.94  ? 877  ASN A O   1 
ATOM 6756 C CB  . ASN A 1 880  ? -33.959 50.730  -24.257 1.00 55.63  ? 877  ASN A CB  1 
ATOM 6757 C CG  . ASN A 1 880  ? -32.888 50.309  -23.270 1.00 55.63  ? 877  ASN A CG  1 
ATOM 6758 O OD1 . ASN A 1 880  ? -33.158 49.580  -22.308 1.00 55.63  ? 877  ASN A OD1 1 
ATOM 6759 N ND2 . ASN A 1 880  ? -31.654 50.783  -23.497 1.00 55.63  ? 877  ASN A ND2 1 
ATOM 6760 N N   . GLY A 1 881  ? -36.673 49.020  -26.073 1.00 58.13  ? 878  GLY A N   1 
ATOM 6761 C CA  . GLY A 1 881  ? -37.772 49.306  -26.974 1.00 58.13  ? 878  GLY A CA  1 
ATOM 6762 C C   . GLY A 1 881  ? -37.284 49.663  -28.371 1.00 58.13  ? 878  GLY A C   1 
ATOM 6763 O O   . GLY A 1 881  ? -38.091 49.875  -29.285 1.00 58.13  ? 878  GLY A O   1 
ATOM 6764 N N   . LYS A 1 882  ? -35.966 49.752  -28.549 1.00 49.10  ? 879  LYS A N   1 
ATOM 6765 C CA  . LYS A 1 882  ? -35.425 49.972  -29.875 1.00 49.10  ? 879  LYS A CA  1 
ATOM 6766 C C   . LYS A 1 882  ? -34.754 48.695  -30.366 1.00 49.10  ? 879  LYS A C   1 
ATOM 6767 O O   . LYS A 1 882  ? -34.501 47.763  -29.595 1.00 49.10  ? 879  LYS A O   1 
ATOM 6768 C CB  . LYS A 1 882  ? -34.458 51.151  -29.893 1.00 70.73  ? 879  LYS A CB  1 
ATOM 6769 C CG  . LYS A 1 882  ? -34.820 52.283  -28.947 1.00 70.73  ? 879  LYS A CG  1 
ATOM 6770 C CD  . LYS A 1 882  ? -34.173 53.588  -29.378 1.00 70.73  ? 879  LYS A CD  1 
ATOM 6771 C CE  . LYS A 1 882  ? -34.339 54.698  -28.340 1.00 70.73  ? 879  LYS A CE  1 
ATOM 6772 N NZ  . LYS A 1 882  ? -33.556 54.463  -27.078 1.00 70.73  ? 879  LYS A NZ  1 
ATOM 6773 N N   . LEU A 1 883  ? -34.463 48.662  -31.664 1.00 55.40  ? 880  LEU A N   1 
ATOM 6774 C CA  . LEU A 1 883  ? -33.774 47.531  -32.262 1.00 55.40  ? 880  LEU A CA  1 
ATOM 6775 C C   . LEU A 1 883  ? -32.389 47.886  -32.758 1.00 55.40  ? 880  LEU A C   1 
ATOM 6776 O O   . LEU A 1 883  ? -32.205 48.769  -33.572 1.00 55.40  ? 880  LEU A O   1 
ATOM 6777 C CB  . LEU A 1 883  ? -34.585 46.952  -33.394 1.00 41.04  ? 880  LEU A CB  1 
ATOM 6778 C CG  . LEU A 1 883  ? -34.006 45.662  -33.932 1.00 41.04  ? 880  LEU A CG  1 
ATOM 6779 C CD1 . LEU A 1 883  ? -34.484 44.497  -33.068 1.00 41.04  ? 880  LEU A CD1 1 
ATOM 6780 C CD2 . LEU A 1 883  ? -34.425 45.512  -35.372 1.00 41.04  ? 880  LEU A CD2 1 
ATOM 6781 N N   . LEU A 1 884  ? -31.428 47.138  -32.238 1.00 44.71  ? 881  LEU A N   1 
ATOM 6782 C CA  . LEU A 1 884  ? -30.027 47.367  -32.471 1.00 44.71  ? 881  LEU A CA  1 
ATOM 6783 C C   . LEU A 1 884  ? -29.482 46.193  -33.250 1.00 44.71  ? 881  LEU A C   1 
ATOM 6784 O O   . LEU A 1 884  ? -29.738 45.030  -32.902 1.00 44.71  ? 881  LEU A O   1 
ATOM 6785 C CB  . LEU A 1 884  ? -29.321 47.490  -31.133 1.00 63.20  ? 881  LEU A CB  1 
ATOM 6786 C CG  . LEU A 1 884  ? -27.819 47.304  -31.093 1.00 63.20  ? 881  LEU A CG  1 
ATOM 6787 C CD1 . LEU A 1 884  ? -27.132 48.430  -31.797 1.00 63.20  ? 881  LEU A CD1 1 
ATOM 6788 C CD2 . LEU A 1 884  ? -27.439 47.295  -29.669 1.00 63.20  ? 881  LEU A CD2 1 
ATOM 6789 N N   . ALA A 1 885  ? -28.710 46.510  -34.281 1.00 46.55  ? 882  ALA A N   1 
ATOM 6790 C CA  . ALA A 1 885  ? -28.395 45.529  -35.291 1.00 46.55  ? 882  ALA A CA  1 
ATOM 6791 C C   . ALA A 1 885  ? -27.031 45.680  -35.972 1.00 46.55  ? 882  ALA A C   1 
ATOM 6792 O O   . ALA A 1 885  ? -26.694 46.755  -36.460 1.00 46.55  ? 882  ALA A O   1 
ATOM 6793 C CB  . ALA A 1 885  ? -29.455 45.546  -36.295 1.00 35.93  ? 882  ALA A CB  1 
ATOM 6794 N N   . SER A 1 886  ? -26.239 44.609  -36.006 1.00 47.71  ? 883  SER A N   1 
ATOM 6795 C CA  . SER A 1 886  ? -24.953 44.682  -36.677 1.00 47.71  ? 883  SER A CA  1 
ATOM 6796 C C   . SER A 1 886  ? -25.190 44.518  -38.178 1.00 47.71  ? 883  SER A C   1 
ATOM 6797 O O   . SER A 1 886  ? -25.861 43.573  -38.613 1.00 47.71  ? 883  SER A O   1 
ATOM 6798 C CB  . SER A 1 886  ? -23.953 43.660  -36.121 1.00 93.13  ? 883  SER A CB  1 
ATOM 6799 O OG  . SER A 1 886  ? -24.463 42.344  -36.130 1.00 93.13  ? 883  SER A OG  1 
ATOM 6800 N N   . ILE A 1 887  ? -24.641 45.440  -38.962 1.00 52.56  ? 884  ILE A N   1 
ATOM 6801 C CA  . ILE A 1 887  ? -24.799 45.408  -40.411 1.00 52.56  ? 884  ILE A CA  1 
ATOM 6802 C C   . ILE A 1 887  ? -23.487 45.710  -41.130 1.00 52.56  ? 884  ILE A C   1 
ATOM 6803 O O   . ILE A 1 887  ? -23.169 46.867  -41.405 1.00 52.56  ? 884  ILE A O   1 
ATOM 6804 C CB  . ILE A 1 887  ? -25.872 46.410  -40.879 1.00 45.65  ? 884  ILE A CB  1 
ATOM 6805 C CG1 . ILE A 1 887  ? -27.187 46.167  -40.136 1.00 45.65  ? 884  ILE A CG1 1 
ATOM 6806 C CG2 . ILE A 1 887  ? -26.073 46.311  -42.383 1.00 45.65  ? 884  ILE A CG2 1 
ATOM 6807 C CD1 . ILE A 1 887  ? -28.295 47.119  -40.526 1.00 45.65  ? 884  ILE A CD1 1 
ATOM 6808 N N   . ASN A 1 888  ? -22.732 44.659  -41.433 1.00 59.78  ? 885  ASN A N   1 
ATOM 6809 C CA  . ASN A 1 888  ? -21.455 44.795  -42.128 1.00 59.78  ? 885  ASN A CA  1 
ATOM 6810 C C   . ASN A 1 888  ? -20.620 45.976  -41.638 1.00 59.78  ? 885  ASN A C   1 
ATOM 6811 O O   . ASN A 1 888  ? -20.659 47.061  -42.219 1.00 59.78  ? 885  ASN A O   1 
ATOM 6812 C CB  . ASN A 1 888  ? -21.674 44.890  -43.639 1.00 58.72  ? 885  ASN A CB  1 
ATOM 6813 C CG  . ASN A 1 888  ? -22.138 43.579  -44.243 1.00 58.72  ? 885  ASN A CG  1 
ATOM 6814 O OD1 . ASN A 1 888  ? -22.358 43.482  -45.450 1.00 58.72  ? 885  ASN A OD1 1 
ATOM 6815 N ND2 . ASN A 1 888  ? -22.286 42.561  -43.404 1.00 58.72  ? 885  ASN A ND2 1 
ATOM 6816 N N   . SER A 1 889  ? -19.865 45.746  -40.568 1.00 46.53  ? 886  SER A N   1 
ATOM 6817 C CA  . SER A 1 889  ? -19.005 46.770  -39.986 1.00 46.53  ? 886  SER A CA  1 
ATOM 6818 C C   . SER A 1 889  ? -19.709 48.118  -39.890 1.00 46.53  ? 886  SER A C   1 
ATOM 6819 O O   . SER A 1 889  ? -19.189 49.131  -40.358 1.00 46.53  ? 886  SER A O   1 
ATOM 6820 C CB  . SER A 1 889  ? -17.715 46.908  -40.797 1.00 46.65  ? 886  SER A CB  1 
ATOM 6821 O OG  . SER A 1 889  ? -17.985 47.362  -42.112 1.00 46.65  ? 886  SER A OG  1 
ATOM 6822 N N   . THR A 1 890  ? -20.891 48.124  -39.282 1.00 66.43  ? 887  THR A N   1 
ATOM 6823 C CA  . THR A 1 890  ? -21.667 49.348  -39.124 1.00 66.43  ? 887  THR A CA  1 
ATOM 6824 C C   . THR A 1 890  ? -22.858 49.125  -38.198 1.00 66.43  ? 887  THR A C   1 
ATOM 6825 O O   . THR A 1 890  ? -23.923 48.690  -38.636 1.00 66.43  ? 887  THR A O   1 
ATOM 6826 C CB  . THR A 1 890  ? -22.173 49.874  -40.480 1.00 46.89  ? 887  THR A CB  1 
ATOM 6827 O OG1 . THR A 1 890  ? -21.058 50.143  -41.338 1.00 46.89  ? 887  THR A OG1 1 
ATOM 6828 C CG2 . THR A 1 890  ? -22.979 51.150  -40.288 1.00 46.89  ? 887  THR A CG2 1 
ATOM 6829 N N   . VAL A 1 891  ? -22.670 49.426  -36.918 1.00 60.96  ? 888  VAL A N   1 
ATOM 6830 C CA  . VAL A 1 891  ? -23.727 49.257  -35.927 1.00 60.96  ? 888  VAL A CA  1 
ATOM 6831 C C   . VAL A 1 891  ? -24.795 50.336  -36.065 1.00 60.96  ? 888  VAL A C   1 
ATOM 6832 O O   . VAL A 1 891  ? -24.484 51.522  -36.177 1.00 60.96  ? 888  VAL A O   1 
ATOM 6833 C CB  . VAL A 1 891  ? -23.165 49.283  -34.493 1.00 35.24  ? 888  VAL A CB  1 
ATOM 6834 C CG1 . VAL A 1 891  ? -24.295 49.176  -33.480 1.00 35.24  ? 888  VAL A CG1 1 
ATOM 6835 C CG2 . VAL A 1 891  ? -22.156 48.162  -34.298 1.00 35.24  ? 888  VAL A CG2 1 
ATOM 6836 N N   . ARG A 1 892  ? -26.056 49.916  -36.053 1.00 46.24  ? 889  ARG A N   1 
ATOM 6837 C CA  . ARG A 1 892  ? -27.175 50.843  -36.174 1.00 46.24  ? 889  ARG A CA  1 
ATOM 6838 C C   . ARG A 1 892  ? -28.181 50.630  -35.048 1.00 46.24  ? 889  ARG A C   1 
ATOM 6839 O O   . ARG A 1 892  ? -28.328 49.520  -34.536 1.00 46.24  ? 889  ARG A O   1 
ATOM 6840 C CB  . ARG A 1 892  ? -27.862 50.681  -37.531 1.00 46.65  ? 889  ARG A CB  1 
ATOM 6841 C CG  . ARG A 1 892  ? -29.030 51.628  -37.753 1.00 46.65  ? 889  ARG A CG  1 
ATOM 6842 C CD  . ARG A 1 892  ? -29.664 51.411  -39.117 1.00 46.65  ? 889  ARG A CD  1 
ATOM 6843 N NE  . ARG A 1 892  ? -28.710 51.618  -40.203 1.00 46.65  ? 889  ARG A NE  1 
ATOM 6844 C CZ  . ARG A 1 892  ? -28.496 52.787  -40.797 1.00 46.65  ? 889  ARG A CZ  1 
ATOM 6845 N NH1 . ARG A 1 892  ? -29.171 53.862  -40.412 1.00 46.65  ? 889  ARG A NH1 1 
ATOM 6846 N NH2 . ARG A 1 892  ? -27.608 52.883  -41.777 1.00 46.65  ? 889  ARG A NH2 1 
ATOM 6847 N N   . LEU A 1 893  ? -28.872 51.699  -34.665 1.00 61.57  ? 890  LEU A N   1 
ATOM 6848 C CA  . LEU A 1 893  ? -29.868 51.625  -33.591 1.00 61.57  ? 890  LEU A CA  1 
ATOM 6849 C C   . LEU A 1 893  ? -31.221 52.121  -33.979 1.00 61.57  ? 890  LEU A C   1 
ATOM 6850 O O   . LEU A 1 893  ? -31.510 53.273  -33.767 1.00 61.57  ? 890  LEU A O   1 
ATOM 6851 C CB  . LEU A 1 893  ? -29.441 52.399  -32.343 1.00 59.80  ? 890  LEU A CB  1 
ATOM 6852 C CG  . LEU A 1 893  ? -30.506 52.323  -31.237 1.00 59.80  ? 890  LEU A CG  1 
ATOM 6853 C CD1 . LEU A 1 893  ? -30.889 50.877  -30.837 1.00 59.80  ? 890  LEU A CD1 1 
ATOM 6854 C CD2 . LEU A 1 893  ? -30.109 53.116  -30.014 1.00 59.80  ? 890  LEU A CD2 1 
ATOM 6855 N N   . TYR A 1 894  ? -32.079 51.235  -34.462 1.00 58.71  ? 891  TYR A N   1 
ATOM 6856 C CA  . TYR A 1 894  ? -33.359 51.629  -35.033 1.00 58.71  ? 891  TYR A CA  1 
ATOM 6857 C C   . TYR A 1 894  ? -34.460 51.866  -34.016 1.00 58.71  ? 891  TYR A C   1 
ATOM 6858 O O   . TYR A 1 894  ? -34.430 51.410  -32.854 1.00 58.71  ? 891  TYR A O   1 
ATOM 6859 C CB  . TYR A 1 894  ? -33.870 50.581  -35.998 1.00 52.13  ? 891  TYR A CB  1 
ATOM 6860 C CG  . TYR A 1 894  ? -33.007 50.249  -37.188 1.00 52.13  ? 891  TYR A CG  1 
ATOM 6861 C CD1 . TYR A 1 894  ? -31.948 49.351  -37.093 1.00 52.13  ? 891  TYR A CD1 1 
ATOM 6862 C CD2 . TYR A 1 894  ? -33.309 50.762  -38.437 1.00 52.13  ? 891  TYR A CD2 1 
ATOM 6863 C CE1 . TYR A 1 894  ? -31.188 49.018  -38.206 1.00 52.13  ? 891  TYR A CE1 1 
ATOM 6864 C CE2 . TYR A 1 894  ? -32.565 50.417  -39.561 1.00 52.13  ? 891  TYR A CE2 1 
ATOM 6865 C CZ  . TYR A 1 894  ? -31.518 49.550  -39.437 1.00 52.13  ? 891  TYR A CZ  1 
ATOM 6866 O OH  . TYR A 1 894  ? -30.796 49.248  -40.559 1.00 52.13  ? 891  TYR A OH  1 
ATOM 6867 N N   . GLU A 1 895  ? -35.461 52.576  -34.516 1.00 71.19  ? 892  GLU A N   1 
ATOM 6868 C CA  . GLU A 1 895  ? -36.623 52.968  -33.747 1.00 71.19  ? 892  GLU A CA  1 
ATOM 6869 C C   . GLU A 1 895  ? -37.880 52.633  -34.489 1.00 71.19  ? 892  GLU A C   1 
ATOM 6870 O O   . GLU A 1 895  ? -37.953 52.727  -35.721 1.00 71.19  ? 892  GLU A O   1 
ATOM 6871 C CB  . GLU A 1 895  ? -36.606 54.457  -33.484 1.00 64.67  ? 892  GLU A CB  1 
ATOM 6872 C CG  . GLU A 1 895  ? -35.705 54.834  -32.365 1.00 64.67  ? 892  GLU A CG  1 
ATOM 6873 C CD  . GLU A 1 895  ? -35.920 56.260  -31.961 1.00 64.67  ? 892  GLU A CD  1 
ATOM 6874 O OE1 . GLU A 1 895  ? -35.803 57.140  -32.872 1.00 64.67  ? 892  GLU A OE1 1 
ATOM 6875 O OE2 . GLU A 1 895  ? -36.216 56.488  -30.751 1.00 64.67  ? 892  GLU A OE2 1 
ATOM 6876 N N   . TRP A 1 896  ? -38.868 52.253  -33.702 1.00 49.39  ? 893  TRP A N   1 
ATOM 6877 C CA  . TRP A 1 896  ? -40.128 51.855  -34.231 1.00 49.39  ? 893  TRP A CA  1 
ATOM 6878 C C   . TRP A 1 896  ? -41.076 53.057  -34.243 1.00 49.39  ? 893  TRP A C   1 
ATOM 6879 O O   . TRP A 1 896  ? -41.488 53.551  -33.179 1.00 49.39  ? 893  TRP A O   1 
ATOM 6880 C CB  . TRP A 1 896  ? -40.642 50.768  -33.318 1.00 47.19  ? 893  TRP A CB  1 
ATOM 6881 C CG  . TRP A 1 896  ? -41.695 49.891  -33.840 1.00 47.19  ? 893  TRP A CG  1 
ATOM 6882 C CD1 . TRP A 1 896  ? -42.783 49.458  -33.156 1.00 47.19  ? 893  TRP A CD1 1 
ATOM 6883 C CD2 . TRP A 1 896  ? -41.743 49.262  -35.126 1.00 47.19  ? 893  TRP A CD2 1 
ATOM 6884 N NE1 . TRP A 1 896  ? -43.517 48.595  -33.938 1.00 47.19  ? 893  TRP A NE1 1 
ATOM 6885 C CE2 . TRP A 1 896  ? -42.909 48.476  -35.159 1.00 47.19  ? 893  TRP A CE2 1 
ATOM 6886 C CE3 . TRP A 1 896  ? -40.921 49.291  -36.250 1.00 47.19  ? 893  TRP A CE3 1 
ATOM 6887 C CZ2 . TRP A 1 896  ? -43.289 47.745  -36.281 1.00 47.19  ? 893  TRP A CZ2 1 
ATOM 6888 C CZ3 . TRP A 1 896  ? -41.290 48.534  -37.373 1.00 47.19  ? 893  TRP A CZ3 1 
ATOM 6889 C CH2 . TRP A 1 896  ? -42.460 47.779  -37.375 1.00 47.19  ? 893  TRP A CH2 1 
ATOM 6890 N N   . THR A 1 897  ? -41.427 53.537  -35.432 1.00 93.16  ? 894  THR A N   1 
ATOM 6891 C CA  . THR A 1 897  ? -42.394 54.620  -35.521 1.00 93.16  ? 894  THR A CA  1 
ATOM 6892 C C   . THR A 1 897  ? -43.725 54.181  -34.924 1.00 93.16  ? 894  THR A C   1 
ATOM 6893 O O   . THR A 1 897  ? -43.970 52.993  -34.663 1.00 93.16  ? 894  THR A O   1 
ATOM 6894 C CB  . THR A 1 897  ? -42.667 55.073  -36.971 1.00 58.73  ? 894  THR A CB  1 
ATOM 6895 O OG1 . THR A 1 897  ? -43.116 53.956  -37.738 1.00 58.73  ? 894  THR A OG1 1 
ATOM 6896 C CG2 . THR A 1 897  ? -41.431 55.640  -37.623 1.00 58.73  ? 894  THR A CG2 1 
ATOM 6897 N N   . THR A 1 898  ? -44.572 55.170  -34.689 1.00 109.63 ? 895  THR A N   1 
ATOM 6898 C CA  . THR A 1 898  ? -45.963 54.956  -34.371 1.00 109.63 ? 895  THR A CA  1 
ATOM 6899 C C   . THR A 1 898  ? -46.657 54.529  -35.653 1.00 109.63 ? 895  THR A C   1 
ATOM 6900 O O   . THR A 1 898  ? -47.637 53.785  -35.625 1.00 109.63 ? 895  THR A O   1 
ATOM 6901 C CB  . THR A 1 898  ? -46.584 56.255  -33.910 1.00 94.61  ? 895  THR A CB  1 
ATOM 6902 O OG1 . THR A 1 898  ? -46.161 57.297  -34.805 1.00 94.61  ? 895  THR A OG1 1 
ATOM 6903 C CG2 . THR A 1 898  ? -46.149 56.588  -32.473 1.00 94.61  ? 895  THR A CG2 1 
ATOM 6904 N N   . GLU A 1 899  ? -46.127 55.018  -36.774 1.00 78.40  ? 896  GLU A N   1 
ATOM 6905 C CA  . GLU A 1 899  ? -46.569 54.625  -38.117 1.00 78.40  ? 896  GLU A CA  1 
ATOM 6906 C C   . GLU A 1 899  ? -46.165 53.192  -38.474 1.00 78.40  ? 896  GLU A C   1 
ATOM 6907 O O   . GLU A 1 899  ? -46.431 52.756  -39.597 1.00 78.40  ? 896  GLU A O   1 
ATOM 6908 C CB  . GLU A 1 899  ? -45.976 55.553  -39.185 1.00 89.87  ? 896  GLU A CB  1 
ATOM 6909 C CG  . GLU A 1 899  ? -45.719 56.992  -38.736 1.00 89.87  ? 896  GLU A CG  1 
ATOM 6910 C CD  . GLU A 1 899  ? -44.266 57.463  -38.991 1.00 89.87  ? 896  GLU A CD  1 
ATOM 6911 O OE1 . GLU A 1 899  ? -43.578 56.930  -39.901 1.00 89.87  ? 896  GLU A OE1 1 
ATOM 6912 O OE2 . GLU A 1 899  ? -43.813 58.370  -38.252 1.00 89.87  ? 896  GLU A OE2 1 
ATOM 6913 N N   . LYS A 1 900  ? -45.504 52.493  -37.529 1.00 66.88  ? 897  LYS A N   1 
ATOM 6914 C CA  . LYS A 1 900  ? -44.982 51.101  -37.661 1.00 66.88  ? 897  LYS A CA  1 
ATOM 6915 C C   . LYS A 1 900  ? -43.895 50.934  -38.736 1.00 66.88  ? 897  LYS A C   1 
ATOM 6916 O O   . LYS A 1 900  ? -44.104 50.258  -39.744 1.00 66.88  ? 897  LYS A O   1 
ATOM 6917 C CB  . LYS A 1 900  ? -46.108 50.076  -37.887 1.00 61.82  ? 897  LYS A CB  1 
ATOM 6918 C CG  . LYS A 1 900  ? -47.147 49.925  -36.762 1.00 61.82  ? 897  LYS A CG  1 
ATOM 6919 C CD  . LYS A 1 900  ? -47.943 48.628  -37.019 1.00 61.82  ? 897  LYS A CD  1 
ATOM 6920 C CE  . LYS A 1 900  ? -49.266 48.525  -36.249 1.00 61.82  ? 897  LYS A CE  1 
ATOM 6921 N NZ  . LYS A 1 900  ? -49.127 48.438  -34.743 1.00 61.82  ? 897  LYS A NZ  1 
ATOM 6922 N N   . ASP A 1 901  ? -42.738 51.554  -38.527 1.00 51.52  ? 898  ASP A N   1 
ATOM 6923 C CA  . ASP A 1 901  ? -41.623 51.387  -39.461 1.00 51.52  ? 898  ASP A CA  1 
ATOM 6924 C C   . ASP A 1 901  ? -40.250 51.485  -38.767 1.00 51.52  ? 898  ASP A C   1 
ATOM 6925 O O   . ASP A 1 901  ? -40.136 52.175  -37.744 1.00 51.52  ? 898  ASP A O   1 
ATOM 6926 C CB  . ASP A 1 901  ? -41.743 52.393  -40.597 1.00 96.80  ? 898  ASP A CB  1 
ATOM 6927 C CG  . ASP A 1 901  ? -41.413 51.786  -41.933 1.00 96.80  ? 898  ASP A CG  1 
ATOM 6928 O OD1 . ASP A 1 901  ? -41.699 52.441  -42.957 1.00 96.80  ? 898  ASP A OD1 1 
ATOM 6929 O OD2 . ASP A 1 901  ? -40.865 50.655  -41.965 1.00 96.80  ? 898  ASP A OD2 1 
ATOM 6930 N N   . VAL A 1 902  ? -39.229 50.779  -39.272 1.00 58.11  ? 899  VAL A N   1 
ATOM 6931 C CA  . VAL A 1 902  ? -37.896 50.912  -38.626 1.00 58.11  ? 899  VAL A CA  1 
ATOM 6932 C C   . VAL A 1 902  ? -37.061 52.103  -39.170 1.00 58.11  ? 899  VAL A C   1 
ATOM 6933 O O   . VAL A 1 902  ? -36.581 52.074  -40.315 1.00 58.11  ? 899  VAL A O   1 
ATOM 6934 C CB  . VAL A 1 902  ? -37.013 49.545  -38.488 1.00 44.33  ? 899  VAL A CB  1 
ATOM 6935 C CG1 . VAL A 1 902  ? -37.394 48.694  -37.276 1.00 44.33  ? 899  VAL A CG1 1 
ATOM 6936 C CG2 . VAL A 1 902  ? -37.052 48.709  -39.713 1.00 44.33  ? 899  VAL A CG2 1 
ATOM 6937 N N   . ARG A 1 903  ? -36.901 53.148  -38.347 1.00 53.02  ? 900  ARG A N   1 
ATOM 6938 C CA  . ARG A 1 903  ? -36.093 54.312  -38.748 1.00 53.02  ? 900  ARG A CA  1 
ATOM 6939 C C   . ARG A 1 903  ? -34.835 54.559  -37.904 1.00 53.02  ? 900  ARG A C   1 
ATOM 6940 O O   . ARG A 1 903  ? -34.888 54.539  -36.657 1.00 53.02  ? 900  ARG A O   1 
ATOM 6941 C CB  . ARG A 1 903  ? -36.946 55.592  -38.819 1.00 67.60  ? 900  ARG A CB  1 
ATOM 6942 C CG  . ARG A 1 903  ? -37.187 56.330  -37.516 1.00 67.60  ? 900  ARG A CG  1 
ATOM 6943 C CD  . ARG A 1 903  ? -36.587 57.727  -37.517 1.00 67.60  ? 900  ARG A CD  1 
ATOM 6944 N NE  . ARG A 1 903  ? -36.919 58.355  -36.243 1.00 67.60  ? 900  ARG A NE  1 
ATOM 6945 C CZ  . ARG A 1 903  ? -38.102 58.891  -35.946 1.00 67.60  ? 900  ARG A CZ  1 
ATOM 6946 N NH1 . ARG A 1 903  ? -39.080 58.914  -36.836 1.00 67.60  ? 900  ARG A NH1 1 
ATOM 6947 N NH2 . ARG A 1 903  ? -38.305 59.403  -34.748 1.00 67.60  ? 900  ARG A NH2 1 
ATOM 6948 N N   . THR A 1 904  ? -33.725 54.816  -38.610 1.00 61.91  ? 901  THR A N   1 
ATOM 6949 C CA  . THR A 1 904  ? -32.390 54.966  -38.029 1.00 61.91  ? 901  THR A CA  1 
ATOM 6950 C C   . THR A 1 904  ? -32.334 56.027  -36.915 1.00 61.91  ? 901  THR A C   1 
ATOM 6951 O O   . THR A 1 904  ? -33.153 56.934  -36.892 1.00 61.91  ? 901  THR A O   1 
ATOM 6952 C CB  . THR A 1 904  ? -31.412 55.318  -39.149 1.00 74.62  ? 901  THR A CB  1 
ATOM 6953 O OG1 . THR A 1 904  ? -31.585 54.389  -40.217 1.00 74.62  ? 901  THR A OG1 1 
ATOM 6954 C CG2 . THR A 1 904  ? -29.981 55.241  -38.680 1.00 74.62  ? 901  THR A CG2 1 
ATOM 6955 N N   . GLU A 1 905  ? -31.393 55.910  -35.989 1.00 205.00 ? 902  GLU A N   1 
ATOM 6956 C CA  . GLU A 1 905  ? -31.155 56.987  -35.041 1.00 205.00 ? 902  GLU A CA  1 
ATOM 6957 C C   . GLU A 1 905  ? -29.685 57.377  -35.062 1.00 205.00 ? 902  GLU A C   1 
ATOM 6958 O O   . GLU A 1 905  ? -29.348 58.563  -35.031 1.00 205.00 ? 902  GLU A O   1 
ATOM 6959 C CB  . GLU A 1 905  ? -31.598 56.589  -33.633 1.00 136.07 ? 902  GLU A CB  1 
ATOM 6960 C CG  . GLU A 1 905  ? -31.175 57.574  -32.557 1.00 136.07 ? 902  GLU A CG  1 
ATOM 6961 C CD  . GLU A 1 905  ? -31.777 57.286  -31.199 1.00 136.07 ? 902  GLU A CD  1 
ATOM 6962 O OE1 . GLU A 1 905  ? -32.219 56.148  -30.949 1.00 136.07 ? 902  GLU A OE1 1 
ATOM 6963 O OE2 . GLU A 1 905  ? -31.803 58.211  -30.369 1.00 136.07 ? 902  GLU A OE2 1 
ATOM 6964 N N   . CYS A 1 906  ? -28.823 56.365  -35.135 1.00 176.47 ? 903  CYS A N   1 
ATOM 6965 C CA  . CYS A 1 906  ? -27.374 56.547  -35.099 1.00 176.47 ? 903  CYS A CA  1 
ATOM 6966 C C   . CYS A 1 906  ? -26.637 55.285  -35.485 1.00 176.47 ? 903  CYS A C   1 
ATOM 6967 O O   . CYS A 1 906  ? -27.208 54.195  -35.482 1.00 176.47 ? 903  CYS A O   1 
ATOM 6968 C CB  . CYS A 1 906  ? -26.930 56.896  -33.690 1.00 67.97  ? 903  CYS A CB  1 
ATOM 6969 S SG  . CYS A 1 906  ? -27.554 55.748  -32.507 1.00 67.97  ? 903  CYS A SG  1 
ATOM 6970 N N   . ASN A 1 907  ? -25.319 55.463  -35.676 1.00 64.74  ? 904  ASN A N   1 
ATOM 6971 C CA  . ASN A 1 907  ? -24.351 54.420  -36.030 1.00 64.74  ? 904  ASN A CA  1 
ATOM 6972 C C   . ASN A 1 907  ? -22.989 54.499  -35.340 1.00 64.74  ? 904  ASN A C   1 
ATOM 6973 O O   . ASN A 1 907  ? -22.636 55.512  -34.789 1.00 64.74  ? 904  ASN A O   1 
ATOM 6974 C CB  . ASN A 1 907  ? -24.080 54.443  -37.518 1.00 86.43  ? 904  ASN A CB  1 
ATOM 6975 C CG  . ASN A 1 907  ? -25.225 53.959  -38.312 1.00 86.43  ? 904  ASN A CG  1 
ATOM 6976 O OD1 . ASN A 1 907  ? -26.063 53.226  -37.820 1.00 86.43  ? 904  ASN A OD1 1 
ATOM 6977 N ND2 . ASN A 1 907  ? -25.281 54.363  -39.553 1.00 86.43  ? 904  ASN A ND2 1 
ATOM 6978 N N   . HIS A 1 908  ? -22.241 53.402  -35.399 1.00 64.46  ? 905  HIS A N   1 
ATOM 6979 C CA  . HIS A 1 908  ? -20.843 53.314  -35.026 1.00 64.46  ? 905  HIS A CA  1 
ATOM 6980 C C   . HIS A 1 908  ? -20.204 52.552  -36.173 1.00 64.46  ? 905  HIS A C   1 
ATOM 6981 O O   . HIS A 1 908  ? -20.738 51.532  -36.588 1.00 64.46  ? 905  HIS A O   1 
ATOM 6982 C CB  . HIS A 1 908  ? -20.749 52.559  -33.698 1.00 62.63  ? 905  HIS A CB  1 
ATOM 6983 C CG  . HIS A 1 908  ? -19.389 52.015  -33.369 1.00 62.63  ? 905  HIS A CG  1 
ATOM 6984 N ND1 . HIS A 1 908  ? -18.440 52.739  -32.681 1.00 62.63  ? 905  HIS A ND1 1 
ATOM 6985 C CD2 . HIS A 1 908  ? -18.846 50.787  -33.566 1.00 62.63  ? 905  HIS A CD2 1 
ATOM 6986 C CE1 . HIS A 1 908  ? -17.359 51.999  -32.508 1.00 62.63  ? 905  HIS A CE1 1 
ATOM 6987 N NE2 . HIS A 1 908  ? -17.578 50.811  -33.039 1.00 62.63  ? 905  HIS A NE2 1 
ATOM 6988 N N   . TYR A 1 909  ? -19.093 53.060  -36.723 1.00 55.36  ? 906  TYR A N   1 
ATOM 6989 C CA  . TYR A 1 909  ? -18.463 52.438  -37.908 1.00 55.36  ? 906  TYR A CA  1 
ATOM 6990 C C   . TYR A 1 909  ? -17.113 51.820  -37.620 1.00 55.36  ? 906  TYR A C   1 
ATOM 6991 O O   . TYR A 1 909  ? -16.456 51.298  -38.546 1.00 55.36  ? 906  TYR A O   1 
ATOM 6992 C CB  . TYR A 1 909  ? -18.262 53.444  -39.030 1.00 84.61  ? 906  TYR A CB  1 
ATOM 6993 C CG  . TYR A 1 909  ? -19.502 54.146  -39.462 1.00 84.61  ? 906  TYR A CG  1 
ATOM 6994 C CD1 . TYR A 1 909  ? -19.950 55.265  -38.774 1.00 84.61  ? 906  TYR A CD1 1 
ATOM 6995 C CD2 . TYR A 1 909  ? -20.230 53.705  -40.571 1.00 84.61  ? 906  TYR A CD2 1 
ATOM 6996 C CE1 . TYR A 1 909  ? -21.085 55.926  -39.161 1.00 84.61  ? 906  TYR A CE1 1 
ATOM 6997 C CE2 . TYR A 1 909  ? -21.374 54.365  -40.973 1.00 84.61  ? 906  TYR A CE2 1 
ATOM 6998 C CZ  . TYR A 1 909  ? -21.790 55.482  -40.258 1.00 84.61  ? 906  TYR A CZ  1 
ATOM 6999 O OH  . TYR A 1 909  ? -22.924 56.167  -40.615 1.00 84.61  ? 906  TYR A OH  1 
ATOM 7000 N N   . ASN A 1 910  ? -16.693 51.890  -36.357 1.00 69.01  ? 907  ASN A N   1 
ATOM 7001 C CA  . ASN A 1 910  ? -15.354 51.437  -35.958 1.00 69.01  ? 907  ASN A CA  1 
ATOM 7002 C C   . ASN A 1 910  ? -15.187 49.897  -35.793 1.00 69.01  ? 907  ASN A C   1 
ATOM 7003 O O   . ASN A 1 910  ? -14.660 49.408  -34.787 1.00 69.01  ? 907  ASN A O   1 
ATOM 7004 C CB  . ASN A 1 910  ? -14.877 52.227  -34.718 1.00 78.17  ? 907  ASN A CB  1 
ATOM 7005 C CG  . ASN A 1 910  ? -13.367 52.118  -34.482 1.00 78.17  ? 907  ASN A CG  1 
ATOM 7006 O OD1 . ASN A 1 910  ? -12.917 52.009  -33.341 1.00 78.17  ? 907  ASN A OD1 1 
ATOM 7007 N ND2 . ASN A 1 910  ? -12.586 52.136  -35.560 1.00 78.17  ? 907  ASN A ND2 1 
ATOM 7008 N N   . ASN A 1 911  ? -15.625 49.147  -36.803 1.00 76.78  ? 908  ASN A N   1 
ATOM 7009 C CA  . ASN A 1 911  ? -15.593 47.684  -36.757 1.00 76.78  ? 908  ASN A CA  1 
ATOM 7010 C C   . ASN A 1 911  ? -15.114 47.140  -38.068 1.00 76.78  ? 908  ASN A C   1 
ATOM 7011 O O   . ASN A 1 911  ? -15.453 47.667  -39.115 1.00 76.78  ? 908  ASN A O   1 
ATOM 7012 C CB  . ASN A 1 911  ? -16.979 47.094  -36.468 1.00 54.29  ? 908  ASN A CB  1 
ATOM 7013 C CG  . ASN A 1 911  ? -17.732 47.874  -35.415 1.00 54.29  ? 908  ASN A CG  1 
ATOM 7014 O OD1 . ASN A 1 911  ? -17.477 47.731  -34.212 1.00 54.29  ? 908  ASN A OD1 1 
ATOM 7015 N ND2 . ASN A 1 911  ? -18.668 48.725  -35.863 1.00 54.29  ? 908  ASN A ND2 1 
ATOM 7016 N N   . ILE A 1 912  ? -14.324 46.077  -38.002 1.00 79.13  ? 909  ILE A N   1 
ATOM 7017 C CA  . ILE A 1 912  ? -13.888 45.376  -39.182 1.00 79.13  ? 909  ILE A CA  1 
ATOM 7018 C C   . ILE A 1 912  ? -15.060 44.608  -39.757 1.00 79.13  ? 909  ILE A C   1 
ATOM 7019 O O   . ILE A 1 912  ? -15.230 44.576  -40.975 1.00 79.13  ? 909  ILE A O   1 
ATOM 7020 C CB  . ILE A 1 912  ? -12.738 44.432  -38.846 1.00 73.37  ? 909  ILE A CB  1 
ATOM 7021 C CG1 . ILE A 1 912  ? -11.407 45.033  -39.296 1.00 73.37  ? 909  ILE A CG1 1 
ATOM 7022 C CG2 . ILE A 1 912  ? -12.931 43.102  -39.539 1.00 73.37  ? 909  ILE A CG2 1 
ATOM 7023 C CD1 . ILE A 1 912  ? -11.076 46.309  -38.647 1.00 73.37  ? 909  ILE A CD1 1 
ATOM 7024 N N   . MET A 1 913  ? -15.860 44.011  -38.859 1.00 70.80  ? 910  MET A N   1 
ATOM 7025 C CA  . MET A 1 913  ? -17.053 43.195  -39.170 1.00 70.80  ? 910  MET A CA  1 
ATOM 7026 C C   . MET A 1 913  ? -17.717 42.722  -37.881 1.00 70.80  ? 910  MET A C   1 
ATOM 7027 O O   . MET A 1 913  ? -17.253 41.786  -37.243 1.00 70.80  ? 910  MET A O   1 
ATOM 7028 C CB  . MET A 1 913  ? -16.681 41.993  -40.032 1.00 61.15  ? 910  MET A CB  1 
ATOM 7029 C CG  . MET A 1 913  ? -17.818 41.103  -40.409 1.00 61.15  ? 910  MET A CG  1 
ATOM 7030 S SD  . MET A 1 913  ? -17.075 39.815  -41.393 1.00 61.15  ? 910  MET A SD  1 
ATOM 7031 C CE  . MET A 1 913  ? -18.157 38.413  -41.143 1.00 61.15  ? 910  MET A CE  1 
ATOM 7032 N N   . ALA A 1 914  ? -18.819 43.368  -37.518 1.00 48.56  ? 911  ALA A N   1 
ATOM 7033 C CA  . ALA A 1 914  ? -19.479 43.170  -36.208 1.00 48.56  ? 911  ALA A CA  1 
ATOM 7034 C C   . ALA A 1 914  ? -20.307 41.877  -36.163 1.00 48.56  ? 911  ALA A C   1 
ATOM 7035 O O   . ALA A 1 914  ? -21.282 41.720  -36.900 1.00 48.56  ? 911  ALA A O   1 
ATOM 7036 C CB  . ALA A 1 914  ? -20.341 44.392  -35.866 1.00 43.48  ? 911  ALA A CB  1 
ATOM 7037 N N   . LEU A 1 915  ? -19.932 40.933  -35.312 1.00 50.92  ? 912  LEU A N   1 
ATOM 7038 C CA  . LEU A 1 915  ? -20.509 39.596  -35.443 1.00 50.92  ? 912  LEU A CA  1 
ATOM 7039 C C   . LEU A 1 915  ? -21.493 39.261  -34.369 1.00 50.92  ? 912  LEU A C   1 
ATOM 7040 O O   . LEU A 1 915  ? -22.421 38.478  -34.562 1.00 50.92  ? 912  LEU A O   1 
ATOM 7041 C CB  . LEU A 1 915  ? -19.410 38.560  -35.405 1.00 26.63  ? 912  LEU A CB  1 
ATOM 7042 C CG  . LEU A 1 915  ? -18.664 38.311  -36.680 1.00 26.63  ? 912  LEU A CG  1 
ATOM 7043 C CD1 . LEU A 1 915  ? -18.233 36.853  -36.645 1.00 26.63  ? 912  LEU A CD1 1 
ATOM 7044 C CD2 . LEU A 1 915  ? -19.638 38.513  -37.755 1.00 26.63  ? 912  LEU A CD2 1 
ATOM 7045 N N   . TYR A 1 916  ? -21.267 39.841  -33.211 1.00 34.40  ? 913  TYR A N   1 
ATOM 7046 C CA  . TYR A 1 916  ? -21.994 39.445  -32.045 1.00 34.40  ? 913  TYR A CA  1 
ATOM 7047 C C   . TYR A 1 916  ? -22.331 40.723  -31.299 1.00 34.40  ? 913  TYR A C   1 
ATOM 7048 O O   . TYR A 1 916  ? -21.601 41.689  -31.441 1.00 34.40  ? 913  TYR A O   1 
ATOM 7049 C CB  . TYR A 1 916  ? -21.067 38.569  -31.227 1.00 22.62  ? 913  TYR A CB  1 
ATOM 7050 C CG  . TYR A 1 916  ? -20.393 37.499  -32.062 1.00 22.62  ? 913  TYR A CG  1 
ATOM 7051 C CD1 . TYR A 1 916  ? -19.030 37.568  -32.333 1.00 22.62  ? 913  TYR A CD1 1 
ATOM 7052 C CD2 . TYR A 1 916  ? -21.145 36.448  -32.626 1.00 22.62  ? 913  TYR A CD2 1 
ATOM 7053 C CE1 . TYR A 1 916  ? -18.425 36.589  -33.140 1.00 22.62  ? 913  TYR A CE1 1 
ATOM 7054 C CE2 . TYR A 1 916  ? -20.582 35.467  -33.428 1.00 22.62  ? 913  TYR A CE2 1 
ATOM 7055 C CZ  . TYR A 1 916  ? -19.236 35.516  -33.676 1.00 22.62  ? 913  TYR A CZ  1 
ATOM 7056 O OH  . TYR A 1 916  ? -18.645 34.560  -34.464 1.00 22.62  ? 913  TYR A OH  1 
ATOM 7057 N N   . LEU A 1 917  ? -23.432 40.758  -30.560 1.00 31.95  ? 914  LEU A N   1 
ATOM 7058 C CA  . LEU A 1 917  ? -23.690 41.856  -29.665 1.00 31.95  ? 914  LEU A CA  1 
ATOM 7059 C C   . LEU A 1 917  ? -24.422 41.355  -28.427 1.00 31.95  ? 914  LEU A C   1 
ATOM 7060 O O   . LEU A 1 917  ? -25.072 40.301  -28.439 1.00 31.95  ? 914  LEU A O   1 
ATOM 7061 C CB  . LEU A 1 917  ? -24.580 42.881  -30.363 1.00 27.83  ? 914  LEU A CB  1 
ATOM 7062 C CG  . LEU A 1 917  ? -24.248 43.333  -31.794 1.00 27.83  ? 914  LEU A CG  1 
ATOM 7063 C CD1 . LEU A 1 917  ? -25.481 43.909  -32.594 1.00 27.83  ? 914  LEU A CD1 1 
ATOM 7064 C CD2 . LEU A 1 917  ? -23.109 44.335  -31.701 1.00 27.83  ? 914  LEU A CD2 1 
ATOM 7065 N N   . LYS A 1 918  ? -24.353 42.115  -27.352 1.00 47.44  ? 915  LYS A N   1 
ATOM 7066 C CA  . LYS A 1 918  ? -25.072 41.772  -26.155 1.00 47.44  ? 915  LYS A CA  1 
ATOM 7067 C C   . LYS A 1 918  ? -25.264 43.105  -25.453 1.00 47.44  ? 915  LYS A C   1 
ATOM 7068 O O   . LYS A 1 918  ? -24.569 44.068  -25.750 1.00 47.44  ? 915  LYS A O   1 
ATOM 7069 C CB  . LYS A 1 918  ? -24.219 40.839  -25.294 1.00 32.79  ? 915  LYS A CB  1 
ATOM 7070 C CG  . LYS A 1 918  ? -23.995 39.420  -25.789 1.00 32.79  ? 915  LYS A CG  1 
ATOM 7071 C CD  . LYS A 1 918  ? -25.178 38.577  -25.489 1.00 32.79  ? 915  LYS A CD  1 
ATOM 7072 C CE  . LYS A 1 918  ? -25.290 37.459  -26.443 1.00 32.79  ? 915  LYS A CE  1 
ATOM 7073 N NZ  . LYS A 1 918  ? -24.789 36.211  -25.773 1.00 32.79  ? 915  LYS A NZ  1 
ATOM 7074 N N   . THR A 1 919  ? -26.173 43.161  -24.496 1.00 42.57  ? 916  THR A N   1 
ATOM 7075 C CA  . THR A 1 919  ? -26.640 44.436  -23.994 1.00 42.57  ? 916  THR A CA  1 
ATOM 7076 C C   . THR A 1 919  ? -26.765 44.372  -22.491 1.00 42.57  ? 916  THR A C   1 
ATOM 7077 O O   . THR A 1 919  ? -27.340 43.435  -21.962 1.00 42.57  ? 916  THR A O   1 
ATOM 7078 C CB  . THR A 1 919  ? -27.997 44.764  -24.654 1.00 56.16  ? 916  THR A CB  1 
ATOM 7079 O OG1 . THR A 1 919  ? -27.765 45.398  -25.921 1.00 56.16  ? 916  THR A OG1 1 
ATOM 7080 C CG2 . THR A 1 919  ? -28.906 45.638  -23.745 1.00 56.16  ? 916  THR A CG2 1 
ATOM 7081 N N   . LYS A 1 920  ? -26.196 45.333  -21.779 1.00 80.05  ? 917  LYS A N   1 
ATOM 7082 C CA  . LYS A 1 920  ? -26.289 45.263  -20.334 1.00 80.05  ? 917  LYS A CA  1 
ATOM 7083 C C   . LYS A 1 920  ? -27.352 46.241  -19.936 1.00 80.05  ? 917  LYS A C   1 
ATOM 7084 O O   . LYS A 1 920  ? -27.190 47.453  -20.148 1.00 80.05  ? 917  LYS A O   1 
ATOM 7085 C CB  . LYS A 1 920  ? -24.961 45.571  -19.633 1.00 202.95 ? 917  LYS A CB  1 
ATOM 7086 C CG  . LYS A 1 920  ? -24.656 44.674  -18.415 1.00 202.95 ? 917  LYS A CG  1 
ATOM 7087 C CD  . LYS A 1 920  ? -25.860 44.470  -17.478 1.00 202.95 ? 917  LYS A CD  1 
ATOM 7088 C CE  . LYS A 1 920  ? -25.621 43.315  -16.514 1.00 202.95 ? 917  LYS A CE  1 
ATOM 7089 N NZ  . LYS A 1 920  ? -24.772 43.717  -15.357 1.00 202.95 ? 917  LYS A NZ  1 
ATOM 7090 N N   . GLY A 1 921  ? -28.435 45.677  -19.385 1.00 178.92 ? 918  GLY A N   1 
ATOM 7091 C CA  . GLY A 1 921  ? -29.628 46.375  -18.898 1.00 178.92 ? 918  GLY A CA  1 
ATOM 7092 C C   . GLY A 1 921  ? -29.652 47.854  -19.185 1.00 178.92 ? 918  GLY A C   1 
ATOM 7093 O O   . GLY A 1 921  ? -30.622 48.386  -19.724 1.00 178.92 ? 918  GLY A O   1 
ATOM 7094 N N   . ASP A 1 922  ? -28.884 48.766  -18.894 1.00 97.21  ? 919  ASP A N   1 
ATOM 7095 C CA  . ASP A 1 922  ? -28.526 49.997  -19.154 1.00 97.21  ? 919  ASP A CA  1 
ATOM 7096 C C   . ASP A 1 922  ? -28.213 50.144  -20.645 1.00 97.21  ? 919  ASP A C   1 
ATOM 7097 O O   . ASP A 1 922  ? -28.654 49.348  -21.478 1.00 97.21  ? 919  ASP A O   1 
ATOM 7098 C CB  . ASP A 1 922  ? -27.377 50.545  -18.300 1.00 209.00 ? 919  ASP A CB  1 
ATOM 7099 C CG  . ASP A 1 922  ? -27.534 52.018  -17.980 1.00 209.00 ? 919  ASP A CG  1 
ATOM 7100 O OD1 . ASP A 1 922  ? -28.539 52.386  -17.336 1.00 209.00 ? 919  ASP A OD1 1 
ATOM 7101 O OD2 . ASP A 1 922  ? -26.642 52.805  -18.365 1.00 209.00 ? 919  ASP A OD2 1 
ATOM 7102 N N   . PHE A 1 923  ? -27.246 51.070  -20.948 1.00 82.14  ? 920  PHE A N   1 
ATOM 7103 C CA  . PHE A 1 923  ? -27.098 51.496  -22.310 1.00 82.14  ? 920  PHE A CA  1 
ATOM 7104 C C   . PHE A 1 923  ? -25.814 50.983  -22.920 1.00 82.14  ? 920  PHE A C   1 
ATOM 7105 O O   . PHE A 1 923  ? -25.292 51.591  -23.831 1.00 82.14  ? 920  PHE A O   1 
ATOM 7106 C CB  . PHE A 1 923  ? -27.202 53.019  -22.387 1.00 123.11 ? 920  PHE A CB  1 
ATOM 7107 C CG  . PHE A 1 923  ? -28.478 53.579  -21.791 1.00 123.11 ? 920  PHE A CG  1 
ATOM 7108 C CD1 . PHE A 1 923  ? -29.717 52.995  -22.070 1.00 123.11 ? 920  PHE A CD1 1 
ATOM 7109 C CD2 . PHE A 1 923  ? -28.441 54.710  -20.967 1.00 123.11 ? 920  PHE A CD2 1 
ATOM 7110 C CE1 . PHE A 1 923  ? -30.899 53.515  -21.524 1.00 123.11 ? 920  PHE A CE1 1 
ATOM 7111 C CE2 . PHE A 1 923  ? -29.618 55.245  -20.421 1.00 123.11 ? 920  PHE A CE2 1 
ATOM 7112 C CZ  . PHE A 1 923  ? -30.852 54.642  -20.699 1.00 123.11 ? 920  PHE A CZ  1 
ATOM 7113 N N   . ILE A 1 924  ? -25.348 49.831  -22.444 1.00 48.21  ? 921  ILE A N   1 
ATOM 7114 C CA  . ILE A 1 924  ? -24.029 49.273  -22.812 1.00 48.21  ? 921  ILE A CA  1 
ATOM 7115 C C   . ILE A 1 924  ? -24.087 48.174  -23.920 1.00 48.21  ? 921  ILE A C   1 
ATOM 7116 O O   . ILE A 1 924  ? -25.026 47.409  -23.956 1.00 48.21  ? 921  ILE A O   1 
ATOM 7117 C CB  . ILE A 1 924  ? -23.305 48.723  -21.540 1.00 47.66  ? 921  ILE A CB  1 
ATOM 7118 C CG1 . ILE A 1 924  ? -23.501 49.599  -20.268 1.00 47.66  ? 921  ILE A CG1 1 
ATOM 7119 C CG2 . ILE A 1 924  ? -21.872 48.511  -21.831 1.00 47.66  ? 921  ILE A CG2 1 
ATOM 7120 C CD1 . ILE A 1 924  ? -22.514 50.853  -20.032 1.00 47.66  ? 921  ILE A CD1 1 
ATOM 7121 N N   . LEU A 1 925  ? -23.098 48.105  -24.812 1.00 47.96  ? 922  LEU A N   1 
ATOM 7122 C CA  . LEU A 1 925  ? -23.017 47.051  -25.861 1.00 47.96  ? 922  LEU A CA  1 
ATOM 7123 C C   . LEU A 1 925  ? -21.607 46.462  -25.956 1.00 47.96  ? 922  LEU A C   1 
ATOM 7124 O O   . LEU A 1 925  ? -20.779 46.876  -25.177 1.00 47.96  ? 922  LEU A O   1 
ATOM 7125 C CB  . LEU A 1 925  ? -23.396 47.598  -27.221 1.00 50.90  ? 922  LEU A CB  1 
ATOM 7126 C CG  . LEU A 1 925  ? -24.806 48.151  -27.438 1.00 50.90  ? 922  LEU A CG  1 
ATOM 7127 C CD1 . LEU A 1 925  ? -25.241 49.203  -26.430 1.00 50.90  ? 922  LEU A CD1 1 
ATOM 7128 C CD2 . LEU A 1 925  ? -24.868 48.776  -28.813 1.00 50.90  ? 922  LEU A CD2 1 
ATOM 7129 N N   . VAL A 1 926  ? -21.316 45.541  -26.905 1.00 51.40  ? 923  VAL A N   1 
ATOM 7130 C CA  . VAL A 1 926  ? -20.017 44.801  -26.999 1.00 51.40  ? 923  VAL A CA  1 
ATOM 7131 C C   . VAL A 1 926  ? -19.955 43.990  -28.294 1.00 51.40  ? 923  VAL A C   1 
ATOM 7132 O O   . VAL A 1 926  ? -20.976 43.395  -28.585 1.00 51.40  ? 923  VAL A O   1 
ATOM 7133 C CB  . VAL A 1 926  ? -19.897 43.869  -25.713 1.00 44.68  ? 923  VAL A CB  1 
ATOM 7134 C CG1 . VAL A 1 926  ? -21.228 43.476  -25.252 1.00 44.68  ? 923  VAL A CG1 1 
ATOM 7135 C CG2 . VAL A 1 926  ? -19.035 42.631  -25.861 1.00 44.68  ? 923  VAL A CG2 1 
ATOM 7136 N N   . GLY A 1 927  ? -18.832 43.951  -29.059 1.00 75.37  ? 924  GLY A N   1 
ATOM 7137 C CA  . GLY A 1 927  ? -18.566 42.868  -30.109 1.00 75.37  ? 924  GLY A CA  1 
ATOM 7138 C C   . GLY A 1 927  ? -17.526 43.007  -31.267 1.00 75.37  ? 924  GLY A C   1 
ATOM 7139 O O   . GLY A 1 927  ? -17.157 44.164  -31.562 1.00 75.37  ? 924  GLY A O   1 
ATOM 7140 N N   . ASP A 1 928  ? -17.049 41.881  -31.909 1.00 95.83  ? 925  ASP A N   1 
ATOM 7141 C CA  . ASP A 1 928  ? -16.212 41.844  -33.229 1.00 95.83  ? 925  ASP A CA  1 
ATOM 7142 C C   . ASP A 1 928  ? -15.512 40.545  -33.732 1.00 95.83  ? 925  ASP A C   1 
ATOM 7143 O O   . ASP A 1 928  ? -15.107 39.737  -32.951 1.00 95.83  ? 925  ASP A O   1 
ATOM 7144 C CB  . ASP A 1 928  ? -15.135 42.951  -33.317 1.00 73.04  ? 925  ASP A CB  1 
ATOM 7145 C CG  . ASP A 1 928  ? -14.619 43.199  -34.789 1.00 73.04  ? 925  ASP A CG  1 
ATOM 7146 O OD1 . ASP A 1 928  ? -15.055 44.196  -35.407 1.00 73.04  ? 925  ASP A OD1 1 
ATOM 7147 O OD2 . ASP A 1 928  ? -13.787 42.418  -35.329 1.00 73.04  ? 925  ASP A OD2 1 
ATOM 7148 N N   . LEU A 1 929  ? -15.288 40.428  -35.046 1.00 60.26  ? 926  LEU A N   1 
ATOM 7149 C CA  . LEU A 1 929  ? -14.717 39.238  -35.723 1.00 60.26  ? 926  LEU A CA  1 
ATOM 7150 C C   . LEU A 1 929  ? -13.252 38.919  -35.470 1.00 60.26  ? 926  LEU A C   1 
ATOM 7151 O O   . LEU A 1 929  ? -12.935 37.848  -34.953 1.00 60.26  ? 926  LEU A O   1 
ATOM 7152 C CB  . LEU A 1 929  ? -14.900 39.292  -37.264 1.00 50.38  ? 926  LEU A CB  1 
ATOM 7153 C CG  . LEU A 1 929  ? -13.846 38.626  -38.228 1.00 50.38  ? 926  LEU A CG  1 
ATOM 7154 C CD1 . LEU A 1 929  ? -13.797 37.104  -38.332 1.00 50.38  ? 926  LEU A CD1 1 
ATOM 7155 C CD2 . LEU A 1 929  ? -13.990 39.133  -39.628 1.00 50.38  ? 926  LEU A CD2 1 
ATOM 7156 N N   . MET A 1 930  ? -12.361 39.826  -35.813 1.00 55.54  ? 927  MET A N   1 
ATOM 7157 C CA  . MET A 1 930  ? -10.967 39.554  -35.576 1.00 55.54  ? 927  MET A CA  1 
ATOM 7158 C C   . MET A 1 930  ? -10.233 40.513  -34.665 1.00 55.54  ? 927  MET A C   1 
ATOM 7159 O O   . MET A 1 930  ? -9.049  40.678  -34.832 1.00 55.54  ? 927  MET A O   1 
ATOM 7160 C CB  . MET A 1 930  ? -10.215 39.387  -36.884 1.00 64.76  ? 927  MET A CB  1 
ATOM 7161 C CG  . MET A 1 930  ? -10.272 40.546  -37.827 1.00 64.76  ? 927  MET A CG  1 
ATOM 7162 S SD  . MET A 1 930  ? -9.136  40.311  -39.180 1.00 64.76  ? 927  MET A SD  1 
ATOM 7163 C CE  . MET A 1 930  ? -9.829  41.364  -40.409 1.00 64.76  ? 927  MET A CE  1 
ATOM 7164 N N   . ARG A 1 931  ? -10.928 41.082  -33.682 1.00 44.32  ? 928  ARG A N   1 
ATOM 7165 C CA  . ARG A 1 931  ? -10.357 42.021  -32.717 1.00 44.32  ? 928  ARG A CA  1 
ATOM 7166 C C   . ARG A 1 931  ? -10.414 41.722  -31.192 1.00 44.32  ? 928  ARG A C   1 
ATOM 7167 O O   . ARG A 1 931  ? -9.387  41.526  -30.565 1.00 44.32  ? 928  ARG A O   1 
ATOM 7168 C CB  . ARG A 1 931  ? -10.799 43.422  -33.047 1.00 71.33  ? 928  ARG A CB  1 
ATOM 7169 C CG  . ARG A 1 931  ? -9.771  44.113  -33.930 1.00 71.33  ? 928  ARG A CG  1 
ATOM 7170 C CD  . ARG A 1 931  ? -10.345 44.763  -35.143 1.00 71.33  ? 928  ARG A CD  1 
ATOM 7171 N NE  . ARG A 1 931  ? -11.109 45.943  -34.807 1.00 71.33  ? 928  ARG A NE  1 
ATOM 7172 C CZ  . ARG A 1 931  ? -10.728 47.181  -35.054 1.00 71.33  ? 928  ARG A CZ  1 
ATOM 7173 N NH1 . ARG A 1 931  ? -9.582  47.419  -35.650 1.00 71.33  ? 928  ARG A NH1 1 
ATOM 7174 N NH2 . ARG A 1 931  ? -11.506 48.180  -34.712 1.00 71.33  ? 928  ARG A NH2 1 
ATOM 7175 N N   . SER A 1 932  ? -11.603 41.506  -30.660 1.00 51.34  ? 929  SER A N   1 
ATOM 7176 C CA  . SER A 1 932  ? -11.705 40.966  -29.314 1.00 51.34  ? 929  SER A CA  1 
ATOM 7177 C C   . SER A 1 932  ? -13.050 41.350  -28.776 1.00 51.34  ? 929  SER A C   1 
ATOM 7178 O O   . SER A 1 932  ? -14.026 40.609  -28.902 1.00 51.34  ? 929  SER A O   1 
ATOM 7179 C CB  . SER A 1 932  ? -10.597 41.529  -28.422 1.00 58.52  ? 929  SER A CB  1 
ATOM 7180 O OG  . SER A 1 932  ? -10.685 41.005  -27.108 1.00 58.52  ? 929  SER A OG  1 
ATOM 7181 N N   . VAL A 1 933  ? -13.102 42.532  -28.188 1.00 36.35  ? 930  VAL A N   1 
ATOM 7182 C CA  . VAL A 1 933  ? -14.344 43.118  -27.896 1.00 36.35  ? 930  VAL A CA  1 
ATOM 7183 C C   . VAL A 1 933  ? -14.269 44.615  -27.765 1.00 36.35  ? 930  VAL A C   1 
ATOM 7184 O O   . VAL A 1 933  ? -13.243 45.172  -27.530 1.00 36.35  ? 930  VAL A O   1 
ATOM 7185 C CB  . VAL A 1 933  ? -14.914 42.449  -26.677 1.00 41.05  ? 930  VAL A CB  1 
ATOM 7186 C CG1 . VAL A 1 933  ? -15.371 41.087  -27.034 1.00 41.05  ? 930  VAL A CG1 1 
ATOM 7187 C CG2 . VAL A 1 933  ? -13.882 42.349  -25.644 1.00 41.05  ? 930  VAL A CG2 1 
ATOM 7188 N N   . LEU A 1 934  ? -15.395 45.252  -27.988 1.00 59.62  ? 931  LEU A N   1 
ATOM 7189 C CA  . LEU A 1 934  ? -15.573 46.645  -27.741 1.00 59.62  ? 931  LEU A CA  1 
ATOM 7190 C C   . LEU A 1 934  ? -16.728 46.744  -26.820 1.00 59.62  ? 931  LEU A C   1 
ATOM 7191 O O   . LEU A 1 934  ? -17.652 45.972  -26.846 1.00 59.62  ? 931  LEU A O   1 
ATOM 7192 C CB  . LEU A 1 934  ? -15.981 47.390  -28.991 1.00 62.45  ? 931  LEU A CB  1 
ATOM 7193 C CG  . LEU A 1 934  ? -15.040 47.640  -30.142 1.00 62.45  ? 931  LEU A CG  1 
ATOM 7194 C CD1 . LEU A 1 934  ? -14.751 46.381  -30.896 1.00 62.45  ? 931  LEU A CD1 1 
ATOM 7195 C CD2 . LEU A 1 934  ? -15.686 48.631  -31.037 1.00 62.45  ? 931  LEU A CD2 1 
ATOM 7196 N N   . LEU A 1 935  ? -16.671 47.747  -26.009 1.00 62.69  ? 932  LEU A N   1 
ATOM 7197 C CA  . LEU A 1 935  ? -17.853 48.216  -25.295 1.00 62.69  ? 932  LEU A CA  1 
ATOM 7198 C C   . LEU A 1 935  ? -18.301 49.612  -25.721 1.00 62.69  ? 932  LEU A C   1 
ATOM 7199 O O   . LEU A 1 935  ? -17.480 50.474  -26.035 1.00 62.69  ? 932  LEU A O   1 
ATOM 7200 C CB  . LEU A 1 935  ? -17.609 48.186  -23.784 1.00 45.21  ? 932  LEU A CB  1 
ATOM 7201 C CG  . LEU A 1 935  ? -18.766 48.656  -22.900 1.00 45.21  ? 932  LEU A CG  1 
ATOM 7202 C CD1 . LEU A 1 935  ? -20.021 47.843  -23.179 1.00 45.21  ? 932  LEU A CD1 1 
ATOM 7203 C CD2 . LEU A 1 935  ? -18.386 48.576  -21.429 1.00 45.21  ? 932  LEU A CD2 1 
ATOM 7204 N N   . LEU A 1 936  ? -19.614 49.820  -25.721 1.00 78.75  ? 933  LEU A N   1 
ATOM 7205 C CA  . LEU A 1 936  ? -20.202 51.098  -26.082 1.00 78.75  ? 933  LEU A CA  1 
ATOM 7206 C C   . LEU A 1 936  ? -21.293 51.465  -25.113 1.00 78.75  ? 933  LEU A C   1 
ATOM 7207 O O   . LEU A 1 936  ? -21.808 50.615  -24.402 1.00 78.75  ? 933  LEU A O   1 
ATOM 7208 C CB  . LEU A 1 936  ? -20.775 51.058  -27.498 1.00 61.14  ? 933  LEU A CB  1 
ATOM 7209 C CG  . LEU A 1 936  ? -19.815 51.145  -28.697 1.00 61.14  ? 933  LEU A CG  1 
ATOM 7210 C CD1 . LEU A 1 936  ? -18.961 49.899  -28.846 1.00 61.14  ? 933  LEU A CD1 1 
ATOM 7211 C CD2 . LEU A 1 936  ? -20.561 51.435  -30.008 1.00 61.14  ? 933  LEU A CD2 1 
ATOM 7212 N N   . ALA A 1 937  ? -21.627 52.746  -25.071 1.00 66.32  ? 934  ALA A N   1 
ATOM 7213 C CA  . ALA A 1 937  ? -22.887 53.159  -24.471 1.00 66.32  ? 934  ALA A CA  1 
ATOM 7214 C C   . ALA A 1 937  ? -23.762 53.981  -25.414 1.00 66.32  ? 934  ALA A C   1 
ATOM 7215 O O   . ALA A 1 937  ? -23.305 54.546  -26.408 1.00 66.32  ? 934  ALA A O   1 
ATOM 7216 C CB  . ALA A 1 937  ? -22.696 53.863  -23.106 1.00 28.13  ? 934  ALA A CB  1 
ATOM 7217 N N   . TYR A 1 938  ? -25.046 53.973  -25.108 1.00 88.77  ? 935  TYR A N   1 
ATOM 7218 C CA  . TYR A 1 938  ? -25.981 54.839  -25.744 1.00 88.77  ? 935  TYR A CA  1 
ATOM 7219 C C   . TYR A 1 938  ? -26.070 56.075  -24.886 1.00 88.77  ? 935  TYR A C   1 
ATOM 7220 O O   . TYR A 1 938  ? -26.087 55.988  -23.656 1.00 88.77  ? 935  TYR A O   1 
ATOM 7221 C CB  . TYR A 1 938  ? -27.331 54.173  -25.792 1.00 60.72  ? 935  TYR A CB  1 
ATOM 7222 C CG  . TYR A 1 938  ? -28.384 55.039  -26.388 1.00 60.72  ? 935  TYR A CG  1 
ATOM 7223 C CD1 . TYR A 1 938  ? -28.394 55.292  -27.759 1.00 60.72  ? 935  TYR A CD1 1 
ATOM 7224 C CD2 . TYR A 1 938  ? -29.371 55.625  -25.591 1.00 60.72  ? 935  TYR A CD2 1 
ATOM 7225 C CE1 . TYR A 1 938  ? -29.348 56.081  -28.321 1.00 60.72  ? 935  TYR A CE1 1 
ATOM 7226 C CE2 . TYR A 1 938  ? -30.337 56.433  -26.147 1.00 60.72  ? 935  TYR A CE2 1 
ATOM 7227 C CZ  . TYR A 1 938  ? -30.318 56.643  -27.520 1.00 60.72  ? 935  TYR A CZ  1 
ATOM 7228 O OH  . TYR A 1 938  ? -31.268 57.426  -28.121 1.00 60.72  ? 935  TYR A OH  1 
ATOM 7229 N N   . LYS A 1 939  ? -26.132 57.227  -25.542 1.00 80.87  ? 936  LYS A N   1 
ATOM 7230 C CA  . LYS A 1 939  ? -26.249 58.503  -24.853 1.00 80.87  ? 936  LYS A CA  1 
ATOM 7231 C C   . LYS A 1 939  ? -27.586 59.209  -25.162 1.00 80.87  ? 936  LYS A C   1 
ATOM 7232 O O   . LYS A 1 939  ? -27.734 59.810  -26.232 1.00 80.87  ? 936  LYS A O   1 
ATOM 7233 C CB  . LYS A 1 939  ? -25.064 59.388  -25.226 1.00 60.63  ? 936  LYS A CB  1 
ATOM 7234 C CG  . LYS A 1 939  ? -23.681 58.749  -25.061 1.00 60.63  ? 936  LYS A CG  1 
ATOM 7235 C CD  . LYS A 1 939  ? -23.493 58.099  -23.688 1.00 60.63  ? 936  LYS A CD  1 
ATOM 7236 C CE  . LYS A 1 939  ? -23.428 59.106  -22.553 1.00 60.63  ? 936  LYS A CE  1 
ATOM 7237 N NZ  . LYS A 1 939  ? -22.033 59.416  -22.247 1.00 60.63  ? 936  LYS A NZ  1 
ATOM 7238 N N   . PRO A 1 940  ? -28.567 59.120  -24.235 1.00 68.42  ? 937  PRO A N   1 
ATOM 7239 C CA  . PRO A 1 940  ? -29.826 59.871  -24.312 1.00 68.42  ? 937  PRO A CA  1 
ATOM 7240 C C   . PRO A 1 940  ? -29.540 61.377  -24.379 1.00 68.42  ? 937  PRO A C   1 
ATOM 7241 O O   . PRO A 1 940  ? -30.321 62.215  -23.934 1.00 68.42  ? 937  PRO A O   1 
ATOM 7242 C CB  . PRO A 1 940  ? -30.535 59.509  -23.000 1.00 62.02  ? 937  PRO A CB  1 
ATOM 7243 C CG  . PRO A 1 940  ? -29.967 58.193  -22.610 1.00 62.02  ? 937  PRO A CG  1 
ATOM 7244 C CD  . PRO A 1 940  ? -28.521 58.267  -23.033 1.00 62.02  ? 937  PRO A CD  1 
ATOM 7245 N N   . MET A 1 941  ? -28.380 61.700  -24.914 1.00 106.06 ? 938  MET A N   1 
ATOM 7246 C CA  . MET A 1 941  ? -28.041 63.036  -25.276 1.00 106.06 ? 938  MET A CA  1 
ATOM 7247 C C   . MET A 1 941  ? -28.515 63.080  -26.711 1.00 106.06 ? 938  MET A C   1 
ATOM 7248 O O   . MET A 1 941  ? -29.705 62.926  -26.955 1.00 106.06 ? 938  MET A O   1 
ATOM 7249 C CB  . MET A 1 941  ? -26.534 63.190  -25.131 1.00 137.78 ? 938  MET A CB  1 
ATOM 7250 C CG  . MET A 1 941  ? -25.858 64.207  -26.012 1.00 137.78 ? 938  MET A CG  1 
ATOM 7251 S SD  . MET A 1 941  ? -24.452 63.385  -26.776 1.00 137.78 ? 938  MET A SD  1 
ATOM 7252 C CE  . MET A 1 941  ? -23.515 62.821  -25.347 1.00 137.78 ? 938  MET A CE  1 
ATOM 7253 N N   . GLU A 1 942  ? -27.605 63.229  -27.664 1.00 149.99 ? 939  GLU A N   1 
ATOM 7254 C CA  . GLU A 1 942  ? -28.006 63.338  -29.061 1.00 149.99 ? 939  GLU A CA  1 
ATOM 7255 C C   . GLU A 1 942  ? -28.403 61.980  -29.653 1.00 149.99 ? 939  GLU A C   1 
ATOM 7256 O O   . GLU A 1 942  ? -28.329 61.766  -30.868 1.00 149.99 ? 939  GLU A O   1 
ATOM 7257 C CB  . GLU A 1 942  ? -26.926 64.050  -29.897 1.00 165.66 ? 939  GLU A CB  1 
ATOM 7258 C CG  . GLU A 1 942  ? -25.644 63.253  -30.144 1.00 165.66 ? 939  GLU A CG  1 
ATOM 7259 C CD  . GLU A 1 942  ? -24.970 63.608  -31.459 1.00 165.66 ? 939  GLU A CD  1 
ATOM 7260 O OE1 . GLU A 1 942  ? -24.489 62.684  -32.149 1.00 165.66 ? 939  GLU A OE1 1 
ATOM 7261 O OE2 . GLU A 1 942  ? -24.928 64.806  -31.809 1.00 165.66 ? 939  GLU A OE2 1 
ATOM 7262 N N   . GLY A 1 943  ? -28.849 61.069  -28.794 1.00 148.82 ? 940  GLY A N   1 
ATOM 7263 C CA  . GLY A 1 943  ? -29.202 59.740  -29.246 1.00 148.82 ? 940  GLY A CA  1 
ATOM 7264 C C   . GLY A 1 943  ? -28.064 59.256  -30.103 1.00 148.82 ? 940  GLY A C   1 
ATOM 7265 O O   . GLY A 1 943  ? -28.241 58.947  -31.277 1.00 148.82 ? 940  GLY A O   1 
ATOM 7266 N N   . ASN A 1 944  ? -26.879 59.256  -29.506 1.00 78.42  ? 941  ASN A N   1 
ATOM 7267 C CA  . ASN A 1 944  ? -25.666 58.754  -30.138 1.00 78.42  ? 941  ASN A CA  1 
ATOM 7268 C C   . ASN A 1 944  ? -24.989 57.613  -29.333 1.00 78.42  ? 941  ASN A C   1 
ATOM 7269 O O   . ASN A 1 944  ? -25.294 57.389  -28.149 1.00 78.42  ? 941  ASN A O   1 
ATOM 7270 C CB  . ASN A 1 944  ? -24.689 59.915  -30.348 1.00 167.62 ? 941  ASN A CB  1 
ATOM 7271 C CG  . ASN A 1 944  ? -23.568 59.582  -31.316 1.00 167.62 ? 941  ASN A CG  1 
ATOM 7272 O OD1 . ASN A 1 944  ? -22.462 60.106  -31.196 1.00 167.62 ? 941  ASN A OD1 1 
ATOM 7273 N ND2 . ASN A 1 944  ? -23.847 58.709  -32.283 1.00 167.62 ? 941  ASN A ND2 1 
ATOM 7274 N N   . PHE A 1 945  ? -24.093 56.882  -29.994 1.00 45.71  ? 942  PHE A N   1 
ATOM 7275 C CA  . PHE A 1 945  ? -23.133 56.017  -29.311 1.00 45.71  ? 942  PHE A CA  1 
ATOM 7276 C C   . PHE A 1 945  ? -21.836 56.763  -29.067 1.00 45.71  ? 942  PHE A C   1 
ATOM 7277 O O   . PHE A 1 945  ? -21.307 57.456  -29.951 1.00 45.71  ? 942  PHE A O   1 
ATOM 7278 C CB  . PHE A 1 945  ? -22.762 54.801  -30.151 1.00 43.98  ? 942  PHE A CB  1 
ATOM 7279 C CG  . PHE A 1 945  ? -23.921 53.928  -30.505 1.00 43.98  ? 942  PHE A CG  1 
ATOM 7280 C CD1 . PHE A 1 945  ? -24.190 53.623  -31.839 1.00 43.98  ? 942  PHE A CD1 1 
ATOM 7281 C CD2 . PHE A 1 945  ? -24.732 53.397  -29.516 1.00 43.98  ? 942  PHE A CD2 1 
ATOM 7282 C CE1 . PHE A 1 945  ? -25.221 52.816  -32.161 1.00 43.98  ? 942  PHE A CE1 1 
ATOM 7283 C CE2 . PHE A 1 945  ? -25.778 52.604  -29.848 1.00 43.98  ? 942  PHE A CE2 1 
ATOM 7284 C CZ  . PHE A 1 945  ? -26.019 52.306  -31.166 1.00 43.98  ? 942  PHE A CZ  1 
ATOM 7285 N N   . GLU A 1 946  ? -21.337 56.585  -27.853 1.00 92.93  ? 943  GLU A N   1 
ATOM 7286 C CA  . GLU A 1 946  ? -20.010 56.981  -27.472 1.00 92.93  ? 943  GLU A CA  1 
ATOM 7287 C C   . GLU A 1 946  ? -19.257 55.682  -27.231 1.00 92.93  ? 943  GLU A C   1 
ATOM 7288 O O   . GLU A 1 946  ? -19.716 54.838  -26.466 1.00 92.93  ? 943  GLU A O   1 
ATOM 7289 C CB  . GLU A 1 946  ? -20.104 57.794  -26.196 1.00 89.38  ? 943  GLU A CB  1 
ATOM 7290 C CG  . GLU A 1 946  ? -18.794 58.022  -25.490 1.00 89.38  ? 943  GLU A CG  1 
ATOM 7291 C CD  . GLU A 1 946  ? -18.990 58.528  -24.077 1.00 89.38  ? 943  GLU A CD  1 
ATOM 7292 O OE1 . GLU A 1 946  ? -17.977 58.703  -23.375 1.00 89.38  ? 943  GLU A OE1 1 
ATOM 7293 O OE2 . GLU A 1 946  ? -20.150 58.746  -23.669 1.00 89.38  ? 943  GLU A OE2 1 
ATOM 7294 N N   . GLU A 1 947  ? -18.117 55.513  -27.893 1.00 45.79  ? 944  GLU A N   1 
ATOM 7295 C CA  . GLU A 1 947  ? -17.342 54.266  -27.807 1.00 45.79  ? 944  GLU A CA  1 
ATOM 7296 C C   . GLU A 1 947  ? -16.487 54.201  -26.552 1.00 45.79  ? 944  GLU A C   1 
ATOM 7297 O O   . GLU A 1 947  ? -15.352 54.670  -26.558 1.00 45.79  ? 944  GLU A O   1 
ATOM 7298 C CB  . GLU A 1 947  ? -16.460 54.134  -29.037 1.00 78.73  ? 944  GLU A CB  1 
ATOM 7299 C CG  . GLU A 1 947  ? -15.611 52.910  -29.004 1.00 78.73  ? 944  GLU A CG  1 
ATOM 7300 C CD  . GLU A 1 947  ? -14.724 52.799  -30.209 1.00 78.73  ? 944  GLU A CD  1 
ATOM 7301 O OE1 . GLU A 1 947  ? -13.814 51.928  -30.196 1.00 78.73  ? 944  GLU A OE1 1 
ATOM 7302 O OE2 . GLU A 1 947  ? -14.932 53.581  -31.169 1.00 78.73  ? 944  GLU A OE2 1 
ATOM 7303 N N   . ILE A 1 948  ? -17.008 53.612  -25.488 1.00 55.06  ? 945  ILE A N   1 
ATOM 7304 C CA  . ILE A 1 948  ? -16.309 53.635  -24.195 1.00 55.06  ? 945  ILE A CA  1 
ATOM 7305 C C   . ILE A 1 948  ? -14.917 52.990  -24.105 1.00 55.06  ? 945  ILE A C   1 
ATOM 7306 O O   . ILE A 1 948  ? -14.052 53.540  -23.441 1.00 55.06  ? 945  ILE A O   1 
ATOM 7307 C CB  . ILE A 1 948  ? -17.161 53.055  -23.074 1.00 59.04  ? 945  ILE A CB  1 
ATOM 7308 C CG1 . ILE A 1 948  ? -18.233 54.045  -22.670 1.00 59.04  ? 945  ILE A CG1 1 
ATOM 7309 C CG2 . ILE A 1 948  ? -16.305 52.707  -21.869 1.00 59.04  ? 945  ILE A CG2 1 
ATOM 7310 C CD1 . ILE A 1 948  ? -19.556 53.370  -22.476 1.00 59.04  ? 945  ILE A CD1 1 
ATOM 7311 N N   . ALA A 1 949  ? -14.698 51.829  -24.708 1.00 60.37  ? 946  ALA A N   1 
ATOM 7312 C CA  . ALA A 1 949  ? -13.374 51.166  -24.618 1.00 60.37  ? 946  ALA A CA  1 
ATOM 7313 C C   . ALA A 1 949  ? -13.228 49.951  -25.543 1.00 60.37  ? 946  ALA A C   1 
ATOM 7314 O O   . ALA A 1 949  ? -14.229 49.381  -25.993 1.00 60.37  ? 946  ALA A O   1 
ATOM 7315 C CB  . ALA A 1 949  ? -13.037 50.767  -23.138 1.00 44.04  ? 946  ALA A CB  1 
ATOM 7316 N N   . ARG A 1 950  ? -11.991 49.554  -25.823 1.00 51.53  ? 947  ARG A N   1 
ATOM 7317 C CA  . ARG A 1 950  ? -11.783 48.238  -26.432 1.00 51.53  ? 947  ARG A CA  1 
ATOM 7318 C C   . ARG A 1 950  ? -10.644 47.353  -25.906 1.00 51.53  ? 947  ARG A C   1 
ATOM 7319 O O   . ARG A 1 950  ? -10.027 47.622  -24.865 1.00 51.53  ? 947  ARG A O   1 
ATOM 7320 C CB  . ARG A 1 950  ? -11.774 48.292  -27.953 1.00 64.86  ? 947  ARG A CB  1 
ATOM 7321 C CG  . ARG A 1 950  ? -10.642 48.995  -28.568 1.00 64.86  ? 947  ARG A CG  1 
ATOM 7322 C CD  . ARG A 1 950  ? -10.981 49.165  -30.019 1.00 64.86  ? 947  ARG A CD  1 
ATOM 7323 N NE  . ARG A 1 950  ? -10.364 48.104  -30.807 1.00 64.86  ? 947  ARG A NE  1 
ATOM 7324 C CZ  . ARG A 1 950  ? -9.466  48.344  -31.759 1.00 64.86  ? 947  ARG A CZ  1 
ATOM 7325 N NH1 . ARG A 1 950  ? -9.135  49.608  -32.034 1.00 64.86  ? 947  ARG A NH1 1 
ATOM 7326 N NH2 . ARG A 1 950  ? -8.909  47.336  -32.440 1.00 64.86  ? 947  ARG A NH2 1 
ATOM 7327 N N   . ASP A 1 951  ? -10.427 46.252  -26.615 1.00 47.95  ? 948  ASP A N   1 
ATOM 7328 C CA  . ASP A 1 951  ? -9.399  45.316  -26.268 1.00 47.95  ? 948  ASP A CA  1 
ATOM 7329 C C   . ASP A 1 951  ? -8.574  45.180  -27.508 1.00 47.95  ? 948  ASP A C   1 
ATOM 7330 O O   . ASP A 1 951  ? -9.092  44.979  -28.591 1.00 47.95  ? 948  ASP A O   1 
ATOM 7331 C CB  . ASP A 1 951  ? -9.982  43.991  -25.837 1.00 57.47  ? 948  ASP A CB  1 
ATOM 7332 C CG  . ASP A 1 951  ? -8.918  43.000  -25.435 1.00 57.47  ? 948  ASP A CG  1 
ATOM 7333 O OD1 . ASP A 1 951  ? -7.814  42.990  -26.052 1.00 57.47  ? 948  ASP A OD1 1 
ATOM 7334 O OD2 . ASP A 1 951  ? -9.187  42.223  -24.498 1.00 57.47  ? 948  ASP A OD2 1 
ATOM 7335 N N   . PHE A 1 952  ? -7.275  45.327  -27.341 1.00 54.22  ? 949  PHE A N   1 
ATOM 7336 C CA  . PHE A 1 952  ? -6.398  45.494  -28.482 1.00 54.22  ? 949  PHE A CA  1 
ATOM 7337 C C   . PHE A 1 952  ? -5.584  44.198  -28.686 1.00 54.22  ? 949  PHE A C   1 
ATOM 7338 O O   . PHE A 1 952  ? -4.394  44.243  -28.965 1.00 54.22  ? 949  PHE A O   1 
ATOM 7339 C CB  . PHE A 1 952  ? -5.486  46.742  -28.297 1.00 61.39  ? 949  PHE A CB  1 
ATOM 7340 C CG  . PHE A 1 952  ? -6.233  48.101  -28.220 1.00 61.39  ? 949  PHE A CG  1 
ATOM 7341 C CD1 . PHE A 1 952  ? -6.677  48.615  -27.002 1.00 61.39  ? 949  PHE A CD1 1 
ATOM 7342 C CD2 . PHE A 1 952  ? -6.436  48.888  -29.379 1.00 61.39  ? 949  PHE A CD2 1 
ATOM 7343 C CE1 . PHE A 1 952  ? -7.356  49.870  -26.951 1.00 61.39  ? 949  PHE A CE1 1 
ATOM 7344 C CE2 . PHE A 1 952  ? -7.103  50.139  -29.335 1.00 61.39  ? 949  PHE A CE2 1 
ATOM 7345 C CZ  . PHE A 1 952  ? -7.556  50.631  -28.121 1.00 61.39  ? 949  PHE A CZ  1 
ATOM 7346 N N   . ASN A 1 953  ? -6.236  43.038  -28.522 1.00 47.03  ? 950  ASN A N   1 
ATOM 7347 C CA  . ASN A 1 953  ? -5.582  41.799  -28.862 1.00 47.03  ? 950  ASN A CA  1 
ATOM 7348 C C   . ASN A 1 953  ? -6.272  41.241  -30.100 1.00 47.03  ? 950  ASN A C   1 
ATOM 7349 O O   . ASN A 1 953  ? -7.196  41.691  -30.594 1.00 47.03  ? 950  ASN A O   1 
ATOM 7350 C CB  . ASN A 1 953  ? -5.665  40.824  -27.698 1.00 59.90  ? 950  ASN A CB  1 
ATOM 7351 C CG  . ASN A 1 953  ? -4.770  41.221  -26.536 1.00 59.90  ? 950  ASN A CG  1 
ATOM 7352 O OD1 . ASN A 1 953  ? -5.239  41.740  -25.512 1.00 59.90  ? 950  ASN A OD1 1 
ATOM 7353 N ND2 . ASN A 1 953  ? -3.471  40.971  -26.686 1.00 59.90  ? 950  ASN A ND2 1 
ATOM 7354 N N   . PRO A 1 954  ? -5.601  40.300  -30.799 1.00 55.83  ? 951  PRO A N   1 
ATOM 7355 C CA  . PRO A 1 954  ? -6.152  39.875  -32.083 1.00 55.83  ? 951  PRO A CA  1 
ATOM 7356 C C   . PRO A 1 954  ? -7.002  38.627  -31.956 1.00 55.83  ? 951  PRO A C   1 
ATOM 7357 O O   . PRO A 1 954  ? -6.744  37.610  -32.642 1.00 55.83  ? 951  PRO A O   1 
ATOM 7358 C CB  . PRO A 1 954  ? -4.906  39.577  -32.909 1.00 41.87  ? 951  PRO A CB  1 
ATOM 7359 C CG  . PRO A 1 954  ? -3.802  39.418  -31.888 1.00 41.87  ? 951  PRO A CG  1 
ATOM 7360 C CD  . PRO A 1 954  ? -4.342  39.606  -30.517 1.00 41.87  ? 951  PRO A CD  1 
ATOM 7361 N N   . ASN A 1 955  ? -8.016  38.719  -31.095 1.00 36.34  ? 952  ASN A N   1 
ATOM 7362 C CA  . ASN A 1 955  ? -8.954  37.612  -30.896 1.00 36.34  ? 952  ASN A CA  1 
ATOM 7363 C C   . ASN A 1 955  ? -9.979  37.431  -32.033 1.00 36.34  ? 952  ASN A C   1 
ATOM 7364 O O   . ASN A 1 955  ? -10.892 38.260  -32.177 1.00 36.34  ? 952  ASN A O   1 
ATOM 7365 C CB  . ASN A 1 955  ? -9.627  37.766  -29.525 1.00 43.54  ? 952  ASN A CB  1 
ATOM 7366 C CG  . ASN A 1 955  ? -8.621  37.654  -28.377 1.00 43.54  ? 952  ASN A CG  1 
ATOM 7367 O OD1 . ASN A 1 955  ? -7.640  36.916  -28.488 1.00 43.54  ? 952  ASN A OD1 1 
ATOM 7368 N ND2 . ASN A 1 955  ? -8.867  38.358  -27.272 1.00 43.54  ? 952  ASN A ND2 1 
ATOM 7369 N N   . TRP A 1 956  ? -9.817  36.380  -32.853 1.00 39.30  ? 953  TRP A N   1 
ATOM 7370 C CA  . TRP A 1 956  ? -10.875 35.925  -33.780 1.00 39.30  ? 953  TRP A CA  1 
ATOM 7371 C C   . TRP A 1 956  ? -12.028 35.327  -32.975 1.00 39.30  ? 953  TRP A C   1 
ATOM 7372 O O   . TRP A 1 956  ? -12.060 34.135  -32.700 1.00 39.30  ? 953  TRP A O   1 
ATOM 7373 C CB  . TRP A 1 956  ? -10.343 34.901  -34.763 1.00 62.16  ? 953  TRP A CB  1 
ATOM 7374 C CG  . TRP A 1 956  ? -9.343  35.458  -35.669 1.00 62.16  ? 953  TRP A CG  1 
ATOM 7375 C CD1 . TRP A 1 956  ? -8.128  35.974  -35.332 1.00 62.16  ? 953  TRP A CD1 1 
ATOM 7376 C CD2 . TRP A 1 956  ? -9.452  35.576  -37.088 1.00 62.16  ? 953  TRP A CD2 1 
ATOM 7377 N NE1 . TRP A 1 956  ? -7.478  36.408  -36.448 1.00 62.16  ? 953  TRP A NE1 1 
ATOM 7378 C CE2 . TRP A 1 956  ? -8.266  36.181  -37.543 1.00 62.16  ? 953  TRP A CE2 1 
ATOM 7379 C CE3 . TRP A 1 956  ? -10.443 35.239  -38.023 1.00 62.16  ? 953  TRP A CE3 1 
ATOM 7380 C CZ2 . TRP A 1 956  ? -8.041  36.455  -38.894 1.00 62.16  ? 953  TRP A CZ2 1 
ATOM 7381 C CZ3 . TRP A 1 956  ? -10.217 35.507  -39.360 1.00 62.16  ? 953  TRP A CZ3 1 
ATOM 7382 C CH2 . TRP A 1 956  ? -9.029  36.106  -39.784 1.00 62.16  ? 953  TRP A CH2 1 
ATOM 7383 N N   . MET A 1 957  ? -12.966 36.178  -32.579 1.00 37.84  ? 954  MET A N   1 
ATOM 7384 C CA  . MET A 1 957  ? -14.080 35.801  -31.744 1.00 37.84  ? 954  MET A CA  1 
ATOM 7385 C C   . MET A 1 957  ? -15.021 34.811  -32.398 1.00 37.84  ? 954  MET A C   1 
ATOM 7386 O O   . MET A 1 957  ? -15.084 34.697  -33.620 1.00 37.84  ? 954  MET A O   1 
ATOM 7387 C CB  . MET A 1 957  ? -14.901 37.043  -31.422 1.00 36.23  ? 954  MET A CB  1 
ATOM 7388 C CG  . MET A 1 957  ? -14.119 38.182  -30.862 1.00 36.23  ? 954  MET A CG  1 
ATOM 7389 S SD  . MET A 1 957  ? -13.110 37.500  -29.564 1.00 36.23  ? 954  MET A SD  1 
ATOM 7390 C CE  . MET A 1 957  ? -14.304 37.250  -28.213 1.00 36.23  ? 954  MET A CE  1 
ATOM 7391 N N   . SER A 1 958  ? -15.807 34.158  -31.553 1.00 37.98  ? 955  SER A N   1 
ATOM 7392 C CA  . SER A 1 958  ? -16.795 33.189  -31.960 1.00 37.98  ? 955  SER A CA  1 
ATOM 7393 C C   . SER A 1 958  ? -18.029 33.266  -31.051 1.00 37.98  ? 955  SER A C   1 
ATOM 7394 O O   . SER A 1 958  ? -19.144 32.864  -31.432 1.00 37.98  ? 955  SER A O   1 
ATOM 7395 C CB  . SER A 1 958  ? -16.183 31.800  -31.866 1.00 40.23  ? 955  SER A CB  1 
ATOM 7396 O OG  . SER A 1 958  ? -16.081 31.421  -30.512 1.00 40.23  ? 955  SER A OG  1 
ATOM 7397 N N   . ALA A 1 959  ? -17.834 33.766  -29.844 1.00 30.19  ? 956  ALA A N   1 
ATOM 7398 C CA  . ALA A 1 959  ? -18.984 34.092  -29.020 1.00 30.19  ? 956  ALA A CA  1 
ATOM 7399 C C   . ALA A 1 959  ? -18.582 35.079  -27.965 1.00 30.19  ? 956  ALA A C   1 
ATOM 7400 O O   . ALA A 1 959  ? -17.400 35.253  -27.751 1.00 30.19  ? 956  ALA A O   1 
ATOM 7401 C CB  . ALA A 1 959  ? -19.601 32.848  -28.425 1.00 48.42  ? 956  ALA A CB  1 
ATOM 7402 N N   . VAL A 1 960  ? -19.563 35.712  -27.320 1.00 38.20  ? 957  VAL A N   1 
ATOM 7403 C CA  . VAL A 1 960  ? -19.336 36.895  -26.490 1.00 38.20  ? 957  VAL A CA  1 
ATOM 7404 C C   . VAL A 1 960  ? -20.449 36.969  -25.470 1.00 38.20  ? 957  VAL A C   1 
ATOM 7405 O O   . VAL A 1 960  ? -21.587 36.671  -25.779 1.00 38.20  ? 957  VAL A O   1 
ATOM 7406 C CB  . VAL A 1 960  ? -19.438 38.167  -27.362 1.00 41.90  ? 957  VAL A CB  1 
ATOM 7407 C CG1 . VAL A 1 960  ? -19.916 39.328  -26.577 1.00 41.90  ? 957  VAL A CG1 1 
ATOM 7408 C CG2 . VAL A 1 960  ? -18.139 38.517  -27.994 1.00 41.90  ? 957  VAL A CG2 1 
ATOM 7409 N N   . GLU A 1 961  ? -20.156 37.388  -24.255 1.00 52.68  ? 958  GLU A N   1 
ATOM 7410 C CA  . GLU A 1 961  ? -21.233 37.577  -23.289 1.00 52.68  ? 958  GLU A CA  1 
ATOM 7411 C C   . GLU A 1 961  ? -20.857 38.573  -22.212 1.00 52.68  ? 958  GLU A C   1 
ATOM 7412 O O   . GLU A 1 961  ? -19.677 38.729  -21.870 1.00 52.68  ? 958  GLU A O   1 
ATOM 7413 C CB  . GLU A 1 961  ? -21.623 36.256  -22.643 1.00 49.47  ? 958  GLU A CB  1 
ATOM 7414 C CG  . GLU A 1 961  ? -22.784 36.345  -21.674 1.00 49.47  ? 958  GLU A CG  1 
ATOM 7415 C CD  . GLU A 1 961  ? -24.090 36.663  -22.373 1.00 49.47  ? 958  GLU A CD  1 
ATOM 7416 O OE1 . GLU A 1 961  ? -24.520 37.855  -22.338 1.00 49.47  ? 958  GLU A OE1 1 
ATOM 7417 O OE2 . GLU A 1 961  ? -24.665 35.704  -22.963 1.00 49.47  ? 958  GLU A OE2 1 
ATOM 7418 N N   . ILE A 1 962  ? -21.864 39.253  -21.680 1.00 44.90  ? 959  ILE A N   1 
ATOM 7419 C CA  . ILE A 1 962  ? -21.653 40.121  -20.560 1.00 44.90  ? 959  ILE A CA  1 
ATOM 7420 C C   . ILE A 1 962  ? -21.939 39.321  -19.295 1.00 44.90  ? 959  ILE A C   1 
ATOM 7421 O O   . ILE A 1 962  ? -23.073 38.915  -19.031 1.00 44.90  ? 959  ILE A O   1 
ATOM 7422 C CB  . ILE A 1 962  ? -22.529 41.377  -20.660 1.00 40.64  ? 959  ILE A CB  1 
ATOM 7423 C CG1 . ILE A 1 962  ? -22.215 42.145  -21.957 1.00 40.64  ? 959  ILE A CG1 1 
ATOM 7424 C CG2 . ILE A 1 962  ? -22.284 42.256  -19.485 1.00 40.64  ? 959  ILE A CG2 1 
ATOM 7425 C CD1 . ILE A 1 962  ? -23.292 43.073  -22.424 1.00 40.64  ? 959  ILE A CD1 1 
ATOM 7426 N N   . LEU A 1 963  ? -20.903 39.064  -18.514 1.00 58.88  ? 960  LEU A N   1 
ATOM 7427 C CA  . LEU A 1 963  ? -21.138 38.486  -17.212 1.00 58.88  ? 960  LEU A CA  1 
ATOM 7428 C C   . LEU A 1 963  ? -21.724 39.554  -16.302 1.00 58.88  ? 960  LEU A C   1 
ATOM 7429 O O   . LEU A 1 963  ? -22.589 39.269  -15.495 1.00 58.88  ? 960  LEU A O   1 
ATOM 7430 C CB  . LEU A 1 963  ? -19.871 37.956  -16.587 1.00 37.68  ? 960  LEU A CB  1 
ATOM 7431 C CG  . LEU A 1 963  ? -18.761 37.205  -17.303 1.00 37.68  ? 960  LEU A CG  1 
ATOM 7432 C CD1 . LEU A 1 963  ? -18.033 36.565  -16.139 1.00 37.68  ? 960  LEU A CD1 1 
ATOM 7433 C CD2 . LEU A 1 963  ? -19.226 36.115  -18.278 1.00 37.68  ? 960  LEU A CD2 1 
ATOM 7434 N N   . ASP A 1 964  ? -21.233 40.781  -16.414 1.00 65.51  ? 961  ASP A N   1 
ATOM 7435 C CA  . ASP A 1 964  ? -21.861 41.908  -15.738 1.00 65.51  ? 961  ASP A CA  1 
ATOM 7436 C C   . ASP A 1 964  ? -21.219 43.253  -16.097 1.00 65.51  ? 961  ASP A C   1 
ATOM 7437 O O   . ASP A 1 964  ? -20.286 43.313  -16.916 1.00 65.51  ? 961  ASP A O   1 
ATOM 7438 C CB  . ASP A 1 964  ? -21.883 41.688  -14.223 1.00 76.12  ? 961  ASP A CB  1 
ATOM 7439 C CG  . ASP A 1 964  ? -20.512 41.581  -13.653 1.00 76.12  ? 961  ASP A CG  1 
ATOM 7440 O OD1 . ASP A 1 964  ? -20.230 40.566  -12.985 1.00 76.12  ? 961  ASP A OD1 1 
ATOM 7441 O OD2 . ASP A 1 964  ? -19.712 42.504  -13.894 1.00 76.12  ? 961  ASP A OD2 1 
ATOM 7442 N N   . ASP A 1 965  ? -21.715 44.314  -15.455 1.00 58.14  ? 962  ASP A N   1 
ATOM 7443 C CA  . ASP A 1 965  ? -21.356 45.699  -15.778 1.00 58.14  ? 962  ASP A CA  1 
ATOM 7444 C C   . ASP A 1 965  ? -19.900 45.886  -16.209 1.00 58.14  ? 962  ASP A C   1 
ATOM 7445 O O   . ASP A 1 965  ? -19.592 46.745  -17.042 1.00 58.14  ? 962  ASP A O   1 
ATOM 7446 C CB  . ASP A 1 965  ? -21.678 46.612  -14.605 1.00 113.92 ? 962  ASP A CB  1 
ATOM 7447 C CG  . ASP A 1 965  ? -23.117 46.512  -14.184 1.00 113.92 ? 962  ASP A CG  1 
ATOM 7448 O OD1 . ASP A 1 965  ? -23.503 45.427  -13.692 1.00 113.92 ? 962  ASP A OD1 1 
ATOM 7449 O OD2 . ASP A 1 965  ? -23.850 47.513  -14.349 1.00 113.92 ? 962  ASP A OD2 1 
ATOM 7450 N N   . ASP A 1 966  ? -19.009 45.073  -15.658 1.00 91.24  ? 963  ASP A N   1 
ATOM 7451 C CA  . ASP A 1 966  ? -17.596 45.257  -15.928 1.00 91.24  ? 963  ASP A CA  1 
ATOM 7452 C C   . ASP A 1 966  ? -16.928 44.023  -16.511 1.00 91.24  ? 963  ASP A C   1 
ATOM 7453 O O   . ASP A 1 966  ? -15.928 44.144  -17.209 1.00 91.24  ? 963  ASP A O   1 
ATOM 7454 C CB  . ASP A 1 966  ? -16.883 45.779  -14.675 1.00 119.67 ? 963  ASP A CB  1 
ATOM 7455 C CG  . ASP A 1 966  ? -17.578 47.015  -14.080 1.00 119.67 ? 963  ASP A CG  1 
ATOM 7456 O OD1 . ASP A 1 966  ? -17.065 48.145  -14.251 1.00 119.67 ? 963  ASP A OD1 1 
ATOM 7457 O OD2 . ASP A 1 966  ? -18.655 46.859  -13.459 1.00 119.67 ? 963  ASP A OD2 1 
ATOM 7458 N N   . ASN A 1 967  ? -17.510 42.851  -16.265 1.00 71.53  ? 964  ASN A N   1 
ATOM 7459 C CA  . ASN A 1 967  ? -16.947 41.599  -16.754 1.00 71.53  ? 964  ASN A CA  1 
ATOM 7460 C C   . ASN A 1 967  ? -17.520 41.075  -18.040 1.00 71.53  ? 964  ASN A C   1 
ATOM 7461 O O   . ASN A 1 967  ? -18.667 40.681  -18.126 1.00 71.53  ? 964  ASN A O   1 
ATOM 7462 C CB  . ASN A 1 967  ? -17.007 40.537  -15.682 1.00 78.83  ? 964  ASN A CB  1 
ATOM 7463 C CG  . ASN A 1 967  ? -15.781 40.548  -14.814 1.00 78.83  ? 964  ASN A CG  1 
ATOM 7464 O OD1 . ASN A 1 967  ? -15.201 41.613  -14.545 1.00 78.83  ? 964  ASN A OD1 1 
ATOM 7465 N ND2 . ASN A 1 967  ? -15.350 39.356  -14.385 1.00 78.83  ? 964  ASN A ND2 1 
ATOM 7466 N N   . PHE A 1 968  ? -16.676 41.056  -19.043 1.00 37.65  ? 965  PHE A N   1 
ATOM 7467 C CA  . PHE A 1 968  ? -17.051 40.582  -20.364 1.00 37.65  ? 965  PHE A CA  1 
ATOM 7468 C C   . PHE A 1 968  ? -16.334 39.275  -20.742 1.00 37.65  ? 965  PHE A C   1 
ATOM 7469 O O   . PHE A 1 968  ? -15.104 39.229  -20.791 1.00 37.65  ? 965  PHE A O   1 
ATOM 7470 C CB  . PHE A 1 968  ? -16.772 41.691  -21.387 1.00 36.77  ? 965  PHE A CB  1 
ATOM 7471 C CG  . PHE A 1 968  ? -17.286 43.047  -20.942 1.00 36.77  ? 965  PHE A CG  1 
ATOM 7472 C CD1 . PHE A 1 968  ? -16.401 44.115  -20.724 1.00 36.77  ? 965  PHE A CD1 1 
ATOM 7473 C CD2 . PHE A 1 968  ? -18.643 43.245  -20.702 1.00 36.77  ? 965  PHE A CD2 1 
ATOM 7474 C CE1 . PHE A 1 968  ? -16.845 45.370  -20.282 1.00 36.77  ? 965  PHE A CE1 1 
ATOM 7475 C CE2 . PHE A 1 968  ? -19.112 44.482  -20.266 1.00 36.77  ? 965  PHE A CE2 1 
ATOM 7476 C CZ  . PHE A 1 968  ? -18.199 45.547  -20.049 1.00 36.77  ? 965  PHE A CZ  1 
ATOM 7477 N N   . LEU A 1 969  ? -17.119 38.220  -20.988 1.00 40.19  ? 966  LEU A N   1 
ATOM 7478 C CA  . LEU A 1 969  ? -16.610 36.901  -21.431 1.00 40.19  ? 966  LEU A CA  1 
ATOM 7479 C C   . LEU A 1 969  ? -16.523 36.750  -22.940 1.00 40.19  ? 966  LEU A C   1 
ATOM 7480 O O   . LEU A 1 969  ? -17.348 37.252  -23.663 1.00 40.19  ? 966  LEU A O   1 
ATOM 7481 C CB  . LEU A 1 969  ? -17.541 35.814  -20.943 1.00 38.37  ? 966  LEU A CB  1 
ATOM 7482 C CG  . LEU A 1 969  ? -17.015 34.439  -20.535 1.00 38.37  ? 966  LEU A CG  1 
ATOM 7483 C CD1 . LEU A 1 969  ? -18.133 33.480  -20.863 1.00 38.37  ? 966  LEU A CD1 1 
ATOM 7484 C CD2 . LEU A 1 969  ? -15.744 34.003  -21.185 1.00 38.37  ? 966  LEU A CD2 1 
ATOM 7485 N N   . GLY A 1 970  ? -15.538 36.021  -23.414 1.00 42.07  ? 967  GLY A N   1 
ATOM 7486 C CA  . GLY A 1 970  ? -15.339 35.898  -24.833 1.00 42.07  ? 967  GLY A CA  1 
ATOM 7487 C C   . GLY A 1 970  ? -14.710 34.574  -25.139 1.00 42.07  ? 967  GLY A C   1 
ATOM 7488 O O   . GLY A 1 970  ? -13.837 34.134  -24.411 1.00 42.07  ? 967  GLY A O   1 
ATOM 7489 N N   . ALA A 1 971  ? -15.185 33.942  -26.209 1.00 35.86  ? 968  ALA A N   1 
ATOM 7490 C CA  . ALA A 1 971  ? -14.647 32.692  -26.745 1.00 35.86  ? 968  ALA A CA  1 
ATOM 7491 C C   . ALA A 1 971  ? -14.008 32.944  -28.103 1.00 35.86  ? 968  ALA A C   1 
ATOM 7492 O O   . ALA A 1 971  ? -14.409 33.876  -28.774 1.00 35.86  ? 968  ALA A O   1 
ATOM 7493 C CB  . ALA A 1 971  ? -15.781 31.723  -26.907 1.00 42.27  ? 968  ALA A CB  1 
ATOM 7494 N N   . GLU A 1 972  ? -13.054 32.128  -28.539 1.00 26.24  ? 969  GLU A N   1 
ATOM 7495 C CA  . GLU A 1 972  ? -12.445 32.410  -29.821 1.00 26.24  ? 969  GLU A CA  1 
ATOM 7496 C C   . GLU A 1 972  ? -11.857 31.258  -30.649 1.00 26.24  ? 969  GLU A C   1 
ATOM 7497 O O   . GLU A 1 972  ? -11.447 30.221  -30.115 1.00 26.24  ? 969  GLU A O   1 
ATOM 7498 C CB  . GLU A 1 972  ? -11.443 33.549  -29.667 1.00 53.15  ? 969  GLU A CB  1 
ATOM 7499 C CG  . GLU A 1 972  ? -10.003 33.243  -30.022 1.00 53.15  ? 969  GLU A CG  1 
ATOM 7500 C CD  . GLU A 1 972  ? -9.358  32.277  -29.052 1.00 53.15  ? 969  GLU A CD  1 
ATOM 7501 O OE1 . GLU A 1 972  ? -9.524  32.481  -27.838 1.00 53.15  ? 969  GLU A OE1 1 
ATOM 7502 O OE2 . GLU A 1 972  ? -8.695  31.319  -29.504 1.00 53.15  ? 969  GLU A OE2 1 
ATOM 7503 N N   . ASN A 1 973  ? -11.870 31.435  -31.972 1.00 44.72  ? 970  ASN A N   1 
ATOM 7504 C CA  . ASN A 1 973  ? -11.124 30.629  -32.910 1.00 44.72  ? 970  ASN A CA  1 
ATOM 7505 C C   . ASN A 1 973  ? -10.289 29.495  -32.336 1.00 44.72  ? 970  ASN A C   1 
ATOM 7506 O O   . ASN A 1 973  ? -10.310 28.403  -32.869 1.00 44.72  ? 970  ASN A O   1 
ATOM 7507 C CB  . ASN A 1 973  ? -10.183 31.544  -33.671 1.00 100.39 ? 970  ASN A CB  1 
ATOM 7508 C CG  . ASN A 1 973  ? -10.034 31.156  -35.112 1.00 100.39 ? 970  ASN A CG  1 
ATOM 7509 O OD1 . ASN A 1 973  ? -11.028 30.960  -35.814 1.00 100.39 ? 970  ASN A OD1 1 
ATOM 7510 N ND2 . ASN A 1 973  ? -8.789  31.059  -35.577 1.00 100.39 ? 970  ASN A ND2 1 
ATOM 7511 N N   . ALA A 1 974  ? -9.506  29.746  -31.292 1.00 44.92  ? 971  ALA A N   1 
ATOM 7512 C CA  . ALA A 1 974  ? -8.536  28.731  -30.814 1.00 44.92  ? 971  ALA A CA  1 
ATOM 7513 C C   . ALA A 1 974  ? -8.916  27.967  -29.539 1.00 44.92  ? 971  ALA A C   1 
ATOM 7514 O O   . ALA A 1 974  ? -8.086  27.357  -28.885 1.00 44.92  ? 971  ALA A O   1 
ATOM 7515 C CB  . ALA A 1 974  ? -7.141  29.312  -30.706 1.00 24.33  ? 971  ALA A CB  1 
ATOM 7516 N N   . PHE A 1 975  ? -10.192 27.970  -29.223 1.00 39.00  ? 972  PHE A N   1 
ATOM 7517 C CA  . PHE A 1 975  ? -10.686 27.167  -28.144 1.00 39.00  ? 972  PHE A CA  1 
ATOM 7518 C C   . PHE A 1 975  ? -10.305 27.689  -26.778 1.00 39.00  ? 972  PHE A C   1 
ATOM 7519 O O   . PHE A 1 975  ? -10.185 26.901  -25.847 1.00 39.00  ? 972  PHE A O   1 
ATOM 7520 C CB  . PHE A 1 975  ? -10.200 25.728  -28.283 1.00 25.16  ? 972  PHE A CB  1 
ATOM 7521 C CG  . PHE A 1 975  ? -10.244 25.193  -29.688 1.00 25.16  ? 972  PHE A CG  1 
ATOM 7522 C CD1 . PHE A 1 975  ? -9.084  24.674  -30.279 1.00 25.16  ? 972  PHE A CD1 1 
ATOM 7523 C CD2 . PHE A 1 975  ? -11.447 25.170  -30.415 1.00 25.16  ? 972  PHE A CD2 1 
ATOM 7524 C CE1 . PHE A 1 975  ? -9.091  24.142  -31.563 1.00 25.16  ? 972  PHE A CE1 1 
ATOM 7525 C CE2 . PHE A 1 975  ? -11.473 24.646  -31.745 1.00 25.16  ? 972  PHE A CE2 1 
ATOM 7526 C CZ  . PHE A 1 975  ? -10.277 24.113  -32.300 1.00 25.16  ? 972  PHE A CZ  1 
ATOM 7527 N N   . ASN A 1 976  ? -10.142 29.006  -26.663 1.00 45.03  ? 973  ASN A N   1 
ATOM 7528 C CA  . ASN A 1 976  ? -9.740  29.645  -25.419 1.00 45.03  ? 973  ASN A CA  1 
ATOM 7529 C C   . ASN A 1 976  ? -10.868 30.537  -24.944 1.00 45.03  ? 973  ASN A C   1 
ATOM 7530 O O   . ASN A 1 976  ? -11.559 31.110  -25.740 1.00 45.03  ? 973  ASN A O   1 
ATOM 7531 C CB  . ASN A 1 976  ? -8.452  30.497  -25.603 1.00 30.17  ? 973  ASN A CB  1 
ATOM 7532 C CG  . ASN A 1 976  ? -7.229  29.679  -26.068 1.00 30.17  ? 973  ASN A CG  1 
ATOM 7533 O OD1 . ASN A 1 976  ? -6.945  28.621  -25.516 1.00 30.17  ? 973  ASN A OD1 1 
ATOM 7534 N ND2 . ASN A 1 976  ? -6.497  30.181  -27.053 1.00 30.17  ? 973  ASN A ND2 1 
ATOM 7535 N N   . LEU A 1 977  ? -11.050 30.654  -23.641 1.00 40.28  ? 974  LEU A N   1 
ATOM 7536 C CA  . LEU A 1 977  ? -11.904 31.670  -23.075 1.00 40.28  ? 974  LEU A CA  1 
ATOM 7537 C C   . LEU A 1 977  ? -11.052 32.800  -22.489 1.00 40.28  ? 974  LEU A C   1 
ATOM 7538 O O   . LEU A 1 977  ? -9.877  32.567  -22.099 1.00 40.28  ? 974  LEU A O   1 
ATOM 7539 C CB  . LEU A 1 977  ? -12.693 31.082  -21.939 1.00 52.12  ? 974  LEU A CB  1 
ATOM 7540 C CG  . LEU A 1 977  ? -13.651 29.990  -22.334 1.00 52.12  ? 974  LEU A CG  1 
ATOM 7541 C CD1 . LEU A 1 977  ? -14.354 29.567  -21.092 1.00 52.12  ? 974  LEU A CD1 1 
ATOM 7542 C CD2 . LEU A 1 977  ? -14.621 30.552  -23.357 1.00 52.12  ? 974  LEU A CD2 1 
ATOM 7543 N N   . PHE A 1 978  ? -11.631 34.006  -22.389 1.00 39.78  ? 975  PHE A N   1 
ATOM 7544 C CA  . PHE A 1 978  ? -10.928 35.132  -21.808 1.00 39.78  ? 975  PHE A CA  1 
ATOM 7545 C C   . PHE A 1 978  ? -11.910 36.146  -21.241 1.00 39.78  ? 975  PHE A C   1 
ATOM 7546 O O   . PHE A 1 978  ? -13.025 36.265  -21.734 1.00 39.78  ? 975  PHE A O   1 
ATOM 7547 C CB  . PHE A 1 978  ? -9.985  35.776  -22.831 1.00 39.41  ? 975  PHE A CB  1 
ATOM 7548 C CG  . PHE A 1 978  ? -10.682 36.534  -23.943 1.00 39.41  ? 975  PHE A CG  1 
ATOM 7549 C CD1 . PHE A 1 978  ? -11.005 37.900  -23.791 1.00 39.41  ? 975  PHE A CD1 1 
ATOM 7550 C CD2 . PHE A 1 978  ? -11.009 35.895  -25.151 1.00 39.41  ? 975  PHE A CD2 1 
ATOM 7551 C CE1 . PHE A 1 978  ? -11.677 38.620  -24.825 1.00 39.41  ? 975  PHE A CE1 1 
ATOM 7552 C CE2 . PHE A 1 978  ? -11.683 36.610  -26.199 1.00 39.41  ? 975  PHE A CE2 1 
ATOM 7553 C CZ  . PHE A 1 978  ? -11.998 37.967  -26.034 1.00 39.41  ? 975  PHE A CZ  1 
ATOM 7554 N N   . VAL A 1 979  ? -11.496 36.880  -20.217 1.00 43.80  ? 976  VAL A N   1 
ATOM 7555 C CA  . VAL A 1 979  ? -12.374 37.840  -19.626 1.00 43.80  ? 976  VAL A CA  1 
ATOM 7556 C C   . VAL A 1 979  ? -11.764 39.220  -19.619 1.00 43.80  ? 976  VAL A C   1 
ATOM 7557 O O   . VAL A 1 979  ? -10.578 39.386  -19.424 1.00 43.80  ? 976  VAL A O   1 
ATOM 7558 C CB  . VAL A 1 979  ? -12.760 37.421  -18.232 1.00 30.57  ? 976  VAL A CB  1 
ATOM 7559 C CG1 . VAL A 1 979  ? -13.498 38.545  -17.488 1.00 30.57  ? 976  VAL A CG1 1 
ATOM 7560 C CG2 . VAL A 1 979  ? -13.599 36.216  -18.307 1.00 30.57  ? 976  VAL A CG2 1 
ATOM 7561 N N   . CYS A 1 980  ? -12.617 40.212  -19.838 1.00 46.86  ? 977  CYS A N   1 
ATOM 7562 C CA  . CYS A 1 980  ? -12.227 41.613  -19.921 1.00 46.86  ? 977  CYS A CA  1 
ATOM 7563 C C   . CYS A 1 980  ? -13.012 42.460  -18.961 1.00 46.86  ? 977  CYS A C   1 
ATOM 7564 O O   . CYS A 1 980  ? -14.199 42.235  -18.753 1.00 46.86  ? 977  CYS A O   1 
ATOM 7565 C CB  . CYS A 1 980  ? -12.506 42.137  -21.308 1.00 55.64  ? 977  CYS A CB  1 
ATOM 7566 S SG  . CYS A 1 980  ? -11.346 41.550  -22.437 1.00 55.64  ? 977  CYS A SG  1 
ATOM 7567 N N   . GLN A 1 981  ? -12.314 43.410  -18.353 1.00 65.53  ? 978  GLN A N   1 
ATOM 7568 C CA  . GLN A 1 981  ? -12.943 44.482  -17.600 1.00 65.53  ? 978  GLN A CA  1 
ATOM 7569 C C   . GLN A 1 981  ? -12.219 45.785  -17.879 1.00 65.53  ? 978  GLN A C   1 
ATOM 7570 O O   . GLN A 1 981  ? -11.043 45.773  -18.251 1.00 65.53  ? 978  GLN A O   1 
ATOM 7571 C CB  . GLN A 1 981  ? -12.978 44.176  -16.111 1.00 54.28  ? 978  GLN A CB  1 
ATOM 7572 C CG  . GLN A 1 981  ? -11.673 43.849  -15.493 1.00 54.28  ? 978  GLN A CG  1 
ATOM 7573 C CD  . GLN A 1 981  ? -11.833 43.608  -14.007 1.00 54.28  ? 978  GLN A CD  1 
ATOM 7574 O OE1 . GLN A 1 981  ? -12.642 44.263  -13.355 1.00 54.28  ? 978  GLN A OE1 1 
ATOM 7575 N NE2 . GLN A 1 981  ? -11.066 42.658  -13.458 1.00 54.28  ? 978  GLN A NE2 1 
ATOM 7576 N N   . LYS A 1 982  ? -12.933 46.899  -17.741 1.00 64.48  ? 979  LYS A N   1 
ATOM 7577 C CA  . LYS A 1 982  ? -12.354 48.214  -18.006 1.00 64.48  ? 979  LYS A CA  1 
ATOM 7578 C C   . LYS A 1 982  ? -11.456 48.649  -16.853 1.00 64.48  ? 979  LYS A C   1 
ATOM 7579 O O   . LYS A 1 982  ? -11.843 48.566  -15.684 1.00 64.48  ? 979  LYS A O   1 
ATOM 7580 C CB  . LYS A 1 982  ? -13.431 49.267  -18.301 1.00 97.29  ? 979  LYS A CB  1 
ATOM 7581 C CG  . LYS A 1 982  ? -14.335 49.640  -17.139 1.00 97.29  ? 979  LYS A CG  1 
ATOM 7582 C CD  . LYS A 1 982  ? -15.648 48.914  -17.202 1.00 97.29  ? 979  LYS A CD  1 
ATOM 7583 C CE  . LYS A 1 982  ? -16.800 49.895  -17.058 1.00 97.29  ? 979  LYS A CE  1 
ATOM 7584 N NZ  . LYS A 1 982  ? -16.963 50.714  -18.290 1.00 97.29  ? 979  LYS A NZ  1 
ATOM 7585 N N   . ASP A 1 983  ? -10.257 49.095  -17.196 1.00 160.60 ? 980  ASP A N   1 
ATOM 7586 C CA  . ASP A 1 983  ? -9.308  49.540  -16.204 1.00 160.60 ? 980  ASP A CA  1 
ATOM 7587 C C   . ASP A 1 983  ? -9.958  50.566  -15.275 1.00 160.60 ? 980  ASP A C   1 
ATOM 7588 O O   . ASP A 1 983  ? -10.622 51.497  -15.731 1.00 160.60 ? 980  ASP A O   1 
ATOM 7589 C CB  . ASP A 1 983  ? -8.091  50.133  -16.904 1.00 106.36 ? 980  ASP A CB  1 
ATOM 7590 C CG  . ASP A 1 983  ? -6.938  50.397  -15.962 1.00 106.36 ? 980  ASP A CG  1 
ATOM 7591 O OD1 . ASP A 1 983  ? -7.060  50.085  -14.758 1.00 106.36 ? 980  ASP A OD1 1 
ATOM 7592 O OD2 . ASP A 1 983  ? -5.901  50.919  -16.434 1.00 106.36 ? 980  ASP A OD2 1 
ATOM 7593 N N   . SER A 1 984  ? -9.806  50.354  -13.973 1.00 101.80 ? 981  SER A N   1 
ATOM 7594 C CA  . SER A 1 984  ? -10.149 51.376  -12.988 1.00 101.80 ? 981  SER A CA  1 
ATOM 7595 C C   . SER A 1 984  ? -8.868  52.102  -12.533 1.00 101.80 ? 981  SER A C   1 
ATOM 7596 O O   . SER A 1 984  ? -8.294  51.774  -11.480 1.00 101.80 ? 981  SER A O   1 
ATOM 7597 C CB  . SER A 1 984  ? -10.905 50.776  -11.799 1.00 121.91 ? 981  SER A CB  1 
ATOM 7598 O OG  . SER A 1 984  ? -12.298 50.868  -12.006 1.00 121.91 ? 981  SER A OG  1 
ATOM 7599 N N   . ALA A 1 985  ? -8.424  53.082  -13.337 1.00 77.46  ? 982  ALA A N   1 
ATOM 7600 C CA  . ALA A 1 985  ? -7.156  53.799  -13.107 1.00 77.46  ? 982  ALA A CA  1 
ATOM 7601 C C   . ALA A 1 985  ? -7.155  55.286  -13.535 1.00 77.46  ? 982  ALA A C   1 
ATOM 7602 O O   . ALA A 1 985  ? -7.965  55.720  -14.363 1.00 77.46  ? 982  ALA A O   1 
ATOM 7603 C CB  . ALA A 1 985  ? -5.999  53.048  -13.779 1.00 81.27  ? 982  ALA A CB  1 
ATOM 7604 N N   . ALA A 1 986  ? -6.209  56.041  -12.969 1.00 170.31 ? 983  ALA A N   1 
ATOM 7605 C CA  . ALA A 1 986  ? -5.975  57.459  -13.272 1.00 170.31 ? 983  ALA A CA  1 
ATOM 7606 C C   . ALA A 1 986  ? -5.676  57.722  -14.754 1.00 170.31 ? 983  ALA A C   1 
ATOM 7607 O O   . ALA A 1 986  ? -5.520  56.780  -15.538 1.00 170.31 ? 983  ALA A O   1 
ATOM 7608 C CB  . ALA A 1 986  ? -4.829  57.971  -12.413 1.00 52.34  ? 983  ALA A CB  1 
ATOM 7609 N N   . THR A 1 987  ? -5.591  59.004  -15.125 1.00 84.06  ? 984  THR A N   1 
ATOM 7610 C CA  . THR A 1 987  ? -5.242  59.447  -16.504 1.00 84.06  ? 984  THR A CA  1 
ATOM 7611 C C   . THR A 1 987  ? -6.306  59.014  -17.534 1.00 84.06  ? 984  THR A C   1 
ATOM 7612 O O   . THR A 1 987  ? -6.000  58.648  -18.689 1.00 84.06  ? 984  THR A O   1 
ATOM 7613 C CB  . THR A 1 987  ? -3.791  59.020  -16.943 1.00 166.54 ? 984  THR A CB  1 
ATOM 7614 O OG1 . THR A 1 987  ? -3.756  57.623  -17.264 1.00 166.54 ? 984  THR A OG1 1 
ATOM 7615 C CG2 . THR A 1 987  ? -2.764  59.314  -15.848 1.00 166.54 ? 984  THR A CG2 1 
ATOM 7616 N N   . THR A 1 988  ? -7.559  59.103  -17.094 1.00 163.84 ? 985  THR A N   1 
ATOM 7617 C CA  . THR A 1 988  ? -8.693  58.398  -17.701 1.00 163.84 ? 985  THR A CA  1 
ATOM 7618 C C   . THR A 1 988  ? -9.046  58.786  -19.148 1.00 163.84 ? 985  THR A C   1 
ATOM 7619 O O   . THR A 1 988  ? -10.187 59.165  -19.433 1.00 163.84 ? 985  THR A O   1 
ATOM 7620 C CB  . THR A 1 988  ? -9.962  58.489  -16.802 1.00 136.00 ? 985  THR A CB  1 
ATOM 7621 O OG1 . THR A 1 988  ? -10.467 59.827  -16.813 1.00 136.00 ? 985  THR A OG1 1 
ATOM 7622 C CG2 . THR A 1 988  ? -9.648  58.087  -15.372 1.00 136.00 ? 985  THR A CG2 1 
ATOM 7623 N N   . ASP A 1 989  ? -8.074  58.673  -20.053 1.00 151.81 ? 986  ASP A N   1 
ATOM 7624 C CA  . ASP A 1 989  ? -8.333  58.817  -21.486 1.00 151.81 ? 986  ASP A CA  1 
ATOM 7625 C C   . ASP A 1 989  ? -7.668  57.717  -22.312 1.00 151.81 ? 986  ASP A C   1 
ATOM 7626 O O   . ASP A 1 989  ? -8.284  57.181  -23.235 1.00 151.81 ? 986  ASP A O   1 
ATOM 7627 C CB  . ASP A 1 989  ? -7.959  60.216  -21.995 1.00 106.85 ? 986  ASP A CB  1 
ATOM 7628 C CG  . ASP A 1 989  ? -9.138  61.191  -21.966 1.00 106.85 ? 986  ASP A CG  1 
ATOM 7629 O OD1 . ASP A 1 989  ? -9.944  61.160  -21.015 1.00 106.85 ? 986  ASP A OD1 1 
ATOM 7630 O OD2 . ASP A 1 989  ? -9.257  62.003  -22.907 1.00 106.85 ? 986  ASP A OD2 1 
ATOM 7631 N N   . GLU A 1 990  ? -6.421  57.376  -21.980 1.00 81.40  ? 987  GLU A N   1 
ATOM 7632 C CA  . GLU A 1 990  ? -5.747  56.255  -22.626 1.00 81.40  ? 987  GLU A CA  1 
ATOM 7633 C C   . GLU A 1 990  ? -5.997  54.957  -21.847 1.00 81.40  ? 987  GLU A C   1 
ATOM 7634 O O   . GLU A 1 990  ? -6.530  54.000  -22.398 1.00 81.40  ? 987  GLU A O   1 
ATOM 7635 C CB  . GLU A 1 990  ? -4.248  56.526  -22.776 1.00 191.63 ? 987  GLU A CB  1 
ATOM 7636 C CG  . GLU A 1 990  ? -3.534  55.583  -23.743 1.00 191.63 ? 987  GLU A CG  1 
ATOM 7637 C CD  . GLU A 1 990  ? -3.947  55.794  -25.195 1.00 191.63 ? 987  GLU A CD  1 
ATOM 7638 O OE1 . GLU A 1 990  ? -4.123  56.961  -25.611 1.00 191.63 ? 987  GLU A OE1 1 
ATOM 7639 O OE2 . GLU A 1 990  ? -4.086  54.786  -25.923 1.00 191.63 ? 987  GLU A OE2 1 
ATOM 7640 N N   . GLU A 1 991  ? -5.623  54.941  -20.565 1.00 105.13 ? 988  GLU A N   1 
ATOM 7641 C CA  . GLU A 1 991  ? -5.894  53.810  -19.665 1.00 105.13 ? 988  GLU A CA  1 
ATOM 7642 C C   . GLU A 1 991  ? -7.376  53.463  -19.566 1.00 105.13 ? 988  GLU A C   1 
ATOM 7643 O O   . GLU A 1 991  ? -7.721  52.358  -19.179 1.00 105.13 ? 988  GLU A O   1 
ATOM 7644 C CB  . GLU A 1 991  ? -5.349  54.093  -18.261 1.00 113.10 ? 988  GLU A CB  1 
ATOM 7645 C CG  . GLU A 1 991  ? -3.850  53.858  -18.103 1.00 113.10 ? 988  GLU A CG  1 
ATOM 7646 C CD  . GLU A 1 991  ? -3.307  54.364  -16.774 1.00 113.10 ? 988  GLU A CD  1 
ATOM 7647 O OE1 . GLU A 1 991  ? -3.784  53.900  -15.712 1.00 113.10 ? 988  GLU A OE1 1 
ATOM 7648 O OE2 . GLU A 1 991  ? -2.395  55.219  -16.790 1.00 113.10 ? 988  GLU A OE2 1 
ATOM 7649 N N   . ARG A 1 992  ? -8.243  54.414  -19.900 1.00 105.37 ? 989  ARG A N   1 
ATOM 7650 C CA  . ARG A 1 992  ? -9.681  54.189  -19.873 1.00 105.37 ? 989  ARG A CA  1 
ATOM 7651 C C   . ARG A 1 992  ? -10.168 53.632  -21.201 1.00 105.37 ? 989  ARG A C   1 
ATOM 7652 O O   . ARG A 1 992  ? -11.129 52.872  -21.253 1.00 105.37 ? 989  ARG A O   1 
ATOM 7653 C CB  . ARG A 1 992  ? -10.422 55.486  -19.541 1.00 155.65 ? 989  ARG A CB  1 
ATOM 7654 C CG  . ARG A 1 992  ? -11.907 55.314  -19.257 1.00 155.65 ? 989  ARG A CG  1 
ATOM 7655 C CD  . ARG A 1 992  ? -12.152 54.509  -17.984 1.00 155.65 ? 989  ARG A CD  1 
ATOM 7656 N NE  . ARG A 1 992  ? -11.962 55.311  -16.775 1.00 155.65 ? 989  ARG A NE  1 
ATOM 7657 C CZ  . ARG A 1 992  ? -12.312 54.929  -15.548 1.00 155.65 ? 989  ARG A CZ  1 
ATOM 7658 N NH1 . ARG A 1 992  ? -12.875 53.741  -15.343 1.00 155.65 ? 989  ARG A NH1 1 
ATOM 7659 N NH2 . ARG A 1 992  ? -12.096 55.737  -14.517 1.00 155.65 ? 989  ARG A NH2 1 
ATOM 7660 N N   . GLN A 1 993  ? -9.490  54.008  -22.277 1.00 90.58  ? 990  GLN A N   1 
ATOM 7661 C CA  . GLN A 1 993  ? -9.898  53.592  -23.606 1.00 90.58  ? 990  GLN A CA  1 
ATOM 7662 C C   . GLN A 1 993  ? -9.341  52.212  -23.924 1.00 90.58  ? 990  GLN A C   1 
ATOM 7663 O O   . GLN A 1 993  ? -9.345  51.783  -25.081 1.00 90.58  ? 990  GLN A O   1 
ATOM 7664 C CB  . GLN A 1 993  ? -9.438  54.613  -24.644 1.00 131.04 ? 990  GLN A CB  1 
ATOM 7665 C CG  . GLN A 1 993  ? -10.465 54.906  -25.736 1.00 131.04 ? 990  GLN A CG  1 
ATOM 7666 C CD  . GLN A 1 993  ? -11.607 55.812  -25.276 1.00 131.04 ? 990  GLN A CD  1 
ATOM 7667 O OE1 . GLN A 1 993  ? -12.762 55.614  -25.665 1.00 131.04 ? 990  GLN A OE1 1 
ATOM 7668 N NE2 . GLN A 1 993  ? -11.286 56.809  -24.453 1.00 131.04 ? 990  GLN A NE2 1 
ATOM 7669 N N   . HIS A 1 994  ? -8.849  51.532  -22.891 1.00 85.52  ? 991  HIS A N   1 
ATOM 7670 C CA  . HIS A 1 994  ? -8.372  50.142  -22.986 1.00 85.52  ? 991  HIS A CA  1 
ATOM 7671 C C   . HIS A 1 994  ? -9.062  49.321  -21.875 1.00 85.52  ? 991  HIS A C   1 
ATOM 7672 O O   . HIS A 1 994  ? -9.523  49.891  -20.875 1.00 85.52  ? 991  HIS A O   1 
ATOM 7673 C CB  . HIS A 1 994  ? -6.832  50.069  -22.861 1.00 102.12 ? 991  HIS A CB  1 
ATOM 7674 C CG  . HIS A 1 994  ? -6.078  50.659  -24.026 1.00 102.12 ? 991  HIS A CG  1 
ATOM 7675 N ND1 . HIS A 1 994  ? -4.990  50.034  -24.601 1.00 102.12 ? 991  HIS A ND1 1 
ATOM 7676 C CD2 . HIS A 1 994  ? -6.244  51.818  -24.712 1.00 102.12 ? 991  HIS A CD2 1 
ATOM 7677 C CE1 . HIS A 1 994  ? -4.525  50.776  -25.591 1.00 102.12 ? 991  HIS A CE1 1 
ATOM 7678 N NE2 . HIS A 1 994  ? -5.271  51.862  -25.683 1.00 102.12 ? 991  HIS A NE2 1 
ATOM 7679 N N   . LEU A 1 995  ? -9.182  48.005  -22.059 1.00 70.80  ? 992  LEU A N   1 
ATOM 7680 C CA  . LEU A 1 995  ? -9.729  47.122  -21.010 1.00 70.80  ? 992  LEU A CA  1 
ATOM 7681 C C   . LEU A 1 995  ? -8.865  45.897  -21.005 1.00 70.80  ? 992  LEU A C   1 
ATOM 7682 O O   . LEU A 1 995  ? -8.477  45.410  -22.066 1.00 70.80  ? 992  LEU A O   1 
ATOM 7683 C CB  . LEU A 1 995  ? -11.215 46.758  -21.227 1.00 60.02  ? 992  LEU A CB  1 
ATOM 7684 C CG  . LEU A 1 995  ? -11.836 46.509  -22.619 1.00 60.02  ? 992  LEU A CG  1 
ATOM 7685 C CD1 . LEU A 1 995  ? -11.335 45.221  -23.203 1.00 60.02  ? 992  LEU A CD1 1 
ATOM 7686 C CD2 . LEU A 1 995  ? -13.360 46.514  -22.607 1.00 60.02  ? 992  LEU A CD2 1 
ATOM 7687 N N   . GLN A 1 996  ? -8.520  45.400  -19.831 1.00 51.97  ? 993  GLN A N   1 
ATOM 7688 C CA  . GLN A 1 996  ? -7.426  44.447  -19.801 1.00 51.97  ? 993  GLN A CA  1 
ATOM 7689 C C   . GLN A 1 996  ? -7.921  43.037  -19.775 1.00 51.97  ? 993  GLN A C   1 
ATOM 7690 O O   . GLN A 1 996  ? -8.977  42.780  -19.173 1.00 51.97  ? 993  GLN A O   1 
ATOM 7691 C CB  . GLN A 1 996  ? -6.483  44.697  -18.613 1.00 140.97 ? 993  GLN A CB  1 
ATOM 7692 C CG  . GLN A 1 996  ? -5.335  45.659  -18.900 1.00 140.97 ? 993  GLN A CG  1 
ATOM 7693 C CD  . GLN A 1 996  ? -5.796  47.100  -18.989 1.00 140.97 ? 993  GLN A CD  1 
ATOM 7694 O OE1 . GLN A 1 996  ? -6.648  47.538  -18.209 1.00 140.97 ? 993  GLN A OE1 1 
ATOM 7695 N NE2 . GLN A 1 996  ? -5.241  47.844  -19.945 1.00 140.97 ? 993  GLN A NE2 1 
ATOM 7696 N N   . GLU A 1 997  ? -7.150  42.137  -20.396 1.00 65.27  ? 994  GLU A N   1 
ATOM 7697 C CA  . GLU A 1 997  ? -7.450  40.702  -20.415 1.00 65.27  ? 994  GLU A CA  1 
ATOM 7698 C C   . GLU A 1 997  ? -7.178  40.038  -19.074 1.00 65.27  ? 994  GLU A C   1 
ATOM 7699 O O   . GLU A 1 997  ? -6.184  39.351  -18.902 1.00 65.27  ? 994  GLU A O   1 
ATOM 7700 C CB  . GLU A 1 997  ? -6.715  39.976  -21.548 1.00 56.91  ? 994  GLU A CB  1 
ATOM 7701 C CG  . GLU A 1 997  ? -7.027  40.553  -22.935 1.00 56.91  ? 994  GLU A CG  1 
ATOM 7702 C CD  . GLU A 1 997  ? -7.081  39.530  -24.074 1.00 56.91  ? 994  GLU A CD  1 
ATOM 7703 O OE1 . GLU A 1 997  ? -6.547  38.399  -23.932 1.00 56.91  ? 994  GLU A OE1 1 
ATOM 7704 O OE2 . GLU A 1 997  ? -7.672  39.884  -25.124 1.00 56.91  ? 994  GLU A OE2 1 
ATOM 7705 N N   . VAL A 1 998  ? -8.113  40.230  -18.148 1.00 44.94  ? 995  VAL A N   1 
ATOM 7706 C CA  . VAL A 1 998  ? -7.977  39.835  -16.743 1.00 44.94  ? 995  VAL A CA  1 
ATOM 7707 C C   . VAL A 1 998  ? -8.204  38.361  -16.486 1.00 44.94  ? 995  VAL A C   1 
ATOM 7708 O O   . VAL A 1 998  ? -7.799  37.894  -15.440 1.00 44.94  ? 995  VAL A O   1 
ATOM 7709 C CB  . VAL A 1 998  ? -8.925  40.664  -15.774 1.00 33.23  ? 995  VAL A CB  1 
ATOM 7710 C CG1 . VAL A 1 998  ? -8.769  42.170  -16.003 1.00 33.23  ? 995  VAL A CG1 1 
ATOM 7711 C CG2 . VAL A 1 998  ? -10.391 40.271  -15.956 1.00 33.23  ? 995  VAL A CG2 1 
ATOM 7712 N N   . GLY A 1 999  ? -8.868  37.648  -17.401 1.00 44.78  ? 996  GLY A N   1 
ATOM 7713 C CA  . GLY A 1 999  ? -9.093  36.185  -17.272 1.00 44.78  ? 996  GLY A CA  1 
ATOM 7714 C C   . GLY A 1 999  ? -8.626  35.391  -18.502 1.00 44.78  ? 996  GLY A C   1 
ATOM 7715 O O   . GLY A 1 999  ? -8.966  35.748  -19.632 1.00 44.78  ? 996  GLY A O   1 
ATOM 7716 N N   . LEU A 1 1000 ? -7.839  34.333  -18.316 1.00 46.74  ? 997  LEU A N   1 
ATOM 7717 C CA  . LEU A 1 1000 ? -7.450  33.506  -19.462 1.00 46.74  ? 997  LEU A CA  1 
ATOM 7718 C C   . LEU A 1 1000 ? -7.628  32.047  -19.156 1.00 46.74  ? 997  LEU A C   1 
ATOM 7719 O O   . LEU A 1 1000 ? -7.483  31.658  -18.015 1.00 46.74  ? 997  LEU A O   1 
ATOM 7720 C CB  . LEU A 1 1000 ? -6.003  33.762  -19.886 1.00 29.60  ? 997  LEU A CB  1 
ATOM 7721 C CG  . LEU A 1 1000 ? -5.541  35.180  -20.243 1.00 29.60  ? 997  LEU A CG  1 
ATOM 7722 C CD1 . LEU A 1 1000 ? -4.069  35.179  -20.697 1.00 29.60  ? 997  LEU A CD1 1 
ATOM 7723 C CD2 . LEU A 1 1000 ? -6.467  35.755  -21.350 1.00 29.60  ? 997  LEU A CD2 1 
ATOM 7724 N N   . PHE A 1 1001 ? -7.934  31.248  -20.187 1.00 47.04  ? 998  PHE A N   1 
ATOM 7725 C CA  . PHE A 1 1001 ? -8.223  29.802  -20.050 1.00 47.04  ? 998  PHE A CA  1 
ATOM 7726 C C   . PHE A 1 1001 ? -8.326  29.035  -21.368 1.00 47.04  ? 998  PHE A C   1 
ATOM 7727 O O   . PHE A 1 1001 ? -8.910  29.478  -22.343 1.00 47.04  ? 998  PHE A O   1 
ATOM 7728 C CB  . PHE A 1 1001 ? -9.516  29.634  -19.298 1.00 45.20  ? 998  PHE A CB  1 
ATOM 7729 C CG  . PHE A 1 1001 ? -9.763  28.261  -18.787 1.00 45.20  ? 998  PHE A CG  1 
ATOM 7730 C CD1 . PHE A 1 1001 ? -9.330  27.888  -17.544 1.00 45.20  ? 998  PHE A CD1 1 
ATOM 7731 C CD2 . PHE A 1 1001 ? -10.533 27.365  -19.509 1.00 45.20  ? 998  PHE A CD2 1 
ATOM 7732 C CE1 . PHE A 1 1001 ? -9.617  26.622  -17.047 1.00 45.20  ? 998  PHE A CE1 1 
ATOM 7733 C CE2 . PHE A 1 1001 ? -10.826 26.103  -19.004 1.00 45.20  ? 998  PHE A CE2 1 
ATOM 7734 C CZ  . PHE A 1 1001 ? -10.359 25.737  -17.783 1.00 45.20  ? 998  PHE A CZ  1 
ATOM 7735 N N   . HIS A 1 1002 ? -7.764  27.851  -21.388 1.00 31.94  ? 999  HIS A N   1 
ATOM 7736 C CA  . HIS A 1 1002 ? -7.937  27.000  -22.548 1.00 31.94  ? 999  HIS A CA  1 
ATOM 7737 C C   . HIS A 1 1002 ? -9.009  25.919  -22.294 1.00 31.94  ? 999  HIS A C   1 
ATOM 7738 O O   . HIS A 1 1002 ? -8.792  24.962  -21.542 1.00 31.94  ? 999  HIS A O   1 
ATOM 7739 C CB  . HIS A 1 1002 ? -6.625  26.355  -22.928 1.00 44.77  ? 999  HIS A CB  1 
ATOM 7740 C CG  . HIS A 1 1002 ? -6.694  25.593  -24.205 1.00 44.77  ? 999  HIS A CG  1 
ATOM 7741 N ND1 . HIS A 1 1002 ? -6.528  26.189  -25.429 1.00 44.77  ? 999  HIS A ND1 1 
ATOM 7742 C CD2 . HIS A 1 1002 ? -6.897  24.278  -24.448 1.00 44.77  ? 999  HIS A CD2 1 
ATOM 7743 C CE1 . HIS A 1 1002 ? -6.610  25.272  -26.374 1.00 44.77  ? 999  HIS A CE1 1 
ATOM 7744 N NE2 . HIS A 1 1002 ? -6.814  24.097  -25.804 1.00 44.77  ? 999  HIS A NE2 1 
ATOM 7745 N N   . LEU A 1 1003 ? -10.168 26.101  -22.924 1.00 50.23  ? 1000 LEU A N   1 
ATOM 7746 C CA  . LEU A 1 1003 ? -11.308 25.178  -22.826 1.00 50.23  ? 1000 LEU A CA  1 
ATOM 7747 C C   . LEU A 1 1003 ? -11.070 23.829  -23.517 1.00 50.23  ? 1000 LEU A C   1 
ATOM 7748 O O   . LEU A 1 1003 ? -11.231 22.795  -22.913 1.00 50.23  ? 1000 LEU A O   1 
ATOM 7749 C CB  . LEU A 1 1003 ? -12.520 25.843  -23.459 1.00 28.43  ? 1000 LEU A CB  1 
ATOM 7750 C CG  . LEU A 1 1003 ? -13.866 25.888  -22.767 1.00 28.43  ? 1000 LEU A CG  1 
ATOM 7751 C CD1 . LEU A 1 1003 ? -14.880 25.698  -23.855 1.00 28.43  ? 1000 LEU A CD1 1 
ATOM 7752 C CD2 . LEU A 1 1003 ? -14.010 24.825  -21.733 1.00 28.43  ? 1000 LEU A CD2 1 
ATOM 7753 N N   . GLY A 1 1004 ? -10.695 23.861  -24.789 1.00 37.54  ? 1001 GLY A N   1 
ATOM 7754 C CA  . GLY A 1 1004 ? -10.435 22.651  -25.542 1.00 37.54  ? 1001 GLY A CA  1 
ATOM 7755 C C   . GLY A 1 1004 ? -11.597 22.370  -26.470 1.00 37.54  ? 1001 GLY A C   1 
ATOM 7756 O O   . GLY A 1 1004 ? -11.631 21.350  -27.191 1.00 37.54  ? 1001 GLY A O   1 
ATOM 7757 N N   . GLU A 1 1005 ? -12.554 23.284  -26.451 1.00 39.43  ? 1002 GLU A N   1 
ATOM 7758 C CA  . GLU A 1 1005 ? -13.734 23.161  -27.249 1.00 39.43  ? 1002 GLU A CA  1 
ATOM 7759 C C   . GLU A 1 1005 ? -13.982 24.496  -27.942 1.00 39.43  ? 1002 GLU A C   1 
ATOM 7760 O O   . GLU A 1 1005 ? -13.359 25.467  -27.595 1.00 39.43  ? 1002 GLU A O   1 
ATOM 7761 C CB  . GLU A 1 1005 ? -14.904 22.812  -26.338 1.00 41.27  ? 1002 GLU A CB  1 
ATOM 7762 C CG  . GLU A 1 1005 ? -14.886 21.418  -25.757 1.00 41.27  ? 1002 GLU A CG  1 
ATOM 7763 C CD  . GLU A 1 1005 ? -15.366 20.382  -26.732 1.00 41.27  ? 1002 GLU A CD  1 
ATOM 7764 O OE1 . GLU A 1 1005 ? -15.492 19.230  -26.303 1.00 41.27  ? 1002 GLU A OE1 1 
ATOM 7765 O OE2 . GLU A 1 1005 ? -15.628 20.679  -27.918 1.00 41.27  ? 1002 GLU A OE2 1 
ATOM 7766 N N   . PHE A 1 1006 ? -14.906 24.553  -28.897 1.00 29.83  ? 1003 PHE A N   1 
ATOM 7767 C CA  . PHE A 1 1006 ? -15.143 25.751  -29.677 1.00 29.83  ? 1003 PHE A CA  1 
ATOM 7768 C C   . PHE A 1 1006 ? -16.558 26.288  -29.394 1.00 29.83  ? 1003 PHE A C   1 
ATOM 7769 O O   . PHE A 1 1006 ? -17.557 25.599  -29.625 1.00 29.83  ? 1003 PHE A O   1 
ATOM 7770 C CB  . PHE A 1 1006 ? -15.008 25.371  -31.120 1.00 28.78  ? 1003 PHE A CB  1 
ATOM 7771 C CG  . PHE A 1 1006 ? -15.363 26.458  -32.066 1.00 28.78  ? 1003 PHE A CG  1 
ATOM 7772 C CD1 . PHE A 1 1006 ? -14.371 27.048  -32.853 1.00 28.78  ? 1003 PHE A CD1 1 
ATOM 7773 C CD2 . PHE A 1 1006 ? -16.687 26.885  -32.201 1.00 28.78  ? 1003 PHE A CD2 1 
ATOM 7774 C CE1 . PHE A 1 1006 ? -14.691 28.062  -33.745 1.00 28.78  ? 1003 PHE A CE1 1 
ATOM 7775 C CE2 . PHE A 1 1006 ? -17.017 27.890  -33.067 1.00 28.78  ? 1003 PHE A CE2 1 
ATOM 7776 C CZ  . PHE A 1 1006 ? -16.025 28.490  -33.857 1.00 28.78  ? 1003 PHE A CZ  1 
ATOM 7777 N N   . VAL A 1 1007 ? -16.693 27.498  -28.898 1.00 30.94  ? 1004 VAL A N   1 
ATOM 7778 C CA  . VAL A 1 1007 ? -17.995 27.877  -28.381 1.00 30.94  ? 1004 VAL A CA  1 
ATOM 7779 C C   . VAL A 1 1007 ? -18.877 28.641  -29.411 1.00 30.94  ? 1004 VAL A C   1 
ATOM 7780 O O   . VAL A 1 1007 ? -18.525 29.758  -29.801 1.00 30.94  ? 1004 VAL A O   1 
ATOM 7781 C CB  . VAL A 1 1007 ? -17.858 28.674  -27.069 1.00 22.05  ? 1004 VAL A CB  1 
ATOM 7782 C CG1 . VAL A 1 1007 ? -19.189 29.039  -26.591 1.00 22.05  ? 1004 VAL A CG1 1 
ATOM 7783 C CG2 . VAL A 1 1007 ? -17.179 27.858  -26.020 1.00 22.05  ? 1004 VAL A CG2 1 
ATOM 7784 N N   . ASN A 1 1008 ? -19.989 28.053  -29.866 1.00 27.41  ? 1005 ASN A N   1 
ATOM 7785 C CA  . ASN A 1 1008 ? -20.916 28.774  -30.737 1.00 27.41  ? 1005 ASN A CA  1 
ATOM 7786 C C   . ASN A 1 1008 ? -21.798 29.751  -29.972 1.00 27.41  ? 1005 ASN A C   1 
ATOM 7787 O O   . ASN A 1 1008 ? -22.173 30.762  -30.518 1.00 27.41  ? 1005 ASN A O   1 
ATOM 7788 C CB  . ASN A 1 1008 ? -21.834 27.830  -31.496 1.00 25.66  ? 1005 ASN A CB  1 
ATOM 7789 C CG  . ASN A 1 1008 ? -21.129 27.099  -32.585 1.00 25.66  ? 1005 ASN A CG  1 
ATOM 7790 O OD1 . ASN A 1 1008 ? -20.315 27.724  -33.262 1.00 25.66  ? 1005 ASN A OD1 1 
ATOM 7791 N ND2 . ASN A 1 1008 ? -21.459 25.796  -32.823 1.00 25.66  ? 1005 ASN A ND2 1 
ATOM 7792 N N   . VAL A 1 1009 ? -22.144 29.481  -28.723 1.00 28.56  ? 1006 VAL A N   1 
ATOM 7793 C CA  . VAL A 1 1009 ? -23.181 30.306  -28.125 1.00 28.56  ? 1006 VAL A CA  1 
ATOM 7794 C C   . VAL A 1 1009 ? -23.103 30.449  -26.622 1.00 28.56  ? 1006 VAL A C   1 
ATOM 7795 O O   . VAL A 1 1009 ? -22.980 29.487  -25.902 1.00 28.56  ? 1006 VAL A O   1 
ATOM 7796 C CB  . VAL A 1 1009 ? -24.577 29.822  -28.559 1.00 28.97  ? 1006 VAL A CB  1 
ATOM 7797 C CG1 . VAL A 1 1009 ? -24.593 28.335  -28.714 1.00 28.97  ? 1006 VAL A CG1 1 
ATOM 7798 C CG2 . VAL A 1 1009 ? -25.714 30.286  -27.594 1.00 28.97  ? 1006 VAL A CG2 1 
ATOM 7799 N N   . PHE A 1 1010 ? -23.181 31.653  -26.123 1.00 39.08  ? 1007 PHE A N   1 
ATOM 7800 C CA  . PHE A 1 1010 ? -23.291 31.774  -24.689 1.00 39.08  ? 1007 PHE A CA  1 
ATOM 7801 C C   . PHE A 1 1010 ? -24.755 32.037  -24.395 1.00 39.08  ? 1007 PHE A C   1 
ATOM 7802 O O   . PHE A 1 1010 ? -25.495 32.426  -25.269 1.00 39.08  ? 1007 PHE A O   1 
ATOM 7803 C CB  . PHE A 1 1010 ? -22.413 32.951  -24.164 1.00 28.33  ? 1007 PHE A CB  1 
ATOM 7804 C CG  . PHE A 1 1010 ? -20.945 32.668  -24.162 1.00 28.33  ? 1007 PHE A CG  1 
ATOM 7805 C CD1 . PHE A 1 1010 ? -20.115 33.241  -25.110 1.00 28.33  ? 1007 PHE A CD1 1 
ATOM 7806 C CD2 . PHE A 1 1010 ? -20.380 31.832  -23.187 1.00 28.33  ? 1007 PHE A CD2 1 
ATOM 7807 C CE1 . PHE A 1 1010 ? -18.710 32.967  -25.077 1.00 28.33  ? 1007 PHE A CE1 1 
ATOM 7808 C CE2 . PHE A 1 1010 ? -18.998 31.549  -23.166 1.00 28.33  ? 1007 PHE A CE2 1 
ATOM 7809 C CZ  . PHE A 1 1010 ? -18.179 32.112  -24.109 1.00 28.33  ? 1007 PHE A CZ  1 
ATOM 7810 N N   . CYS A 1 1011 ? -25.182 31.850  -23.165 1.00 50.16  ? 1008 CYS A N   1 
ATOM 7811 C CA  . CYS A 1 1011 ? -26.380 32.541  -22.756 1.00 50.16  ? 1008 CYS A CA  1 
ATOM 7812 C C   . CYS A 1 1011 ? -26.723 32.285  -21.334 1.00 50.16  ? 1008 CYS A C   1 
ATOM 7813 O O   . CYS A 1 1011 ? -26.317 31.301  -20.762 1.00 50.16  ? 1008 CYS A O   1 
ATOM 7814 C CB  . CYS A 1 1011 ? -27.563 32.188  -23.643 1.00 56.48  ? 1008 CYS A CB  1 
ATOM 7815 S SG  . CYS A 1 1011 ? -28.273 30.674  -23.179 1.00 56.48  ? 1008 CYS A SG  1 
ATOM 7816 N N   . HIS A 1 1012 ? -27.488 33.214  -20.787 1.00 52.08  ? 1009 HIS A N   1 
ATOM 7817 C CA  . HIS A 1 1012 ? -27.910 33.175  -19.411 1.00 52.08  ? 1009 HIS A CA  1 
ATOM 7818 C C   . HIS A 1 1012 ? -29.009 32.179  -19.186 1.00 52.08  ? 1009 HIS A C   1 
ATOM 7819 O O   . HIS A 1 1012 ? -29.925 32.076  -19.982 1.00 52.08  ? 1009 HIS A O   1 
ATOM 7820 C CB  . HIS A 1 1012 ? -28.353 34.569  -18.994 1.00 45.10  ? 1009 HIS A CB  1 
ATOM 7821 C CG  . HIS A 1 1012 ? -27.233 35.546  -19.003 1.00 45.10  ? 1009 HIS A CG  1 
ATOM 7822 N ND1 . HIS A 1 1012 ? -26.418 35.742  -17.913 1.00 45.10  ? 1009 HIS A ND1 1 
ATOM 7823 C CD2 . HIS A 1 1012 ? -26.722 36.304  -20.001 1.00 45.10  ? 1009 HIS A CD2 1 
ATOM 7824 C CE1 . HIS A 1 1012 ? -25.482 36.625  -18.223 1.00 45.10  ? 1009 HIS A CE1 1 
ATOM 7825 N NE2 . HIS A 1 1012 ? -25.638 36.977  -19.487 1.00 45.10  ? 1009 HIS A NE2 1 
ATOM 7826 N N   . GLY A 1 1013 ? -28.902 31.438  -18.089 1.00 36.34  ? 1010 GLY A N   1 
ATOM 7827 C CA  . GLY A 1 1013 ? -29.913 30.441  -17.693 1.00 36.34  ? 1010 GLY A CA  1 
ATOM 7828 C C   . GLY A 1 1013 ? -29.247 29.339  -16.889 1.00 36.34  ? 1010 GLY A C   1 
ATOM 7829 O O   . GLY A 1 1013 ? -28.049 29.374  -16.638 1.00 36.34  ? 1010 GLY A O   1 
ATOM 7830 N N   . SER A 1 1014 ? -30.032 28.349  -16.487 1.00 56.23  ? 1011 SER A N   1 
ATOM 7831 C CA  . SER A 1 1014 ? -29.571 27.270  -15.607 1.00 56.23  ? 1011 SER A CA  1 
ATOM 7832 C C   . SER A 1 1014 ? -30.504 26.115  -15.853 1.00 56.23  ? 1011 SER A C   1 
ATOM 7833 O O   . SER A 1 1014 ? -31.590 26.304  -16.363 1.00 56.23  ? 1011 SER A O   1 
ATOM 7834 C CB  . SER A 1 1014 ? -29.642 27.689  -14.128 1.00 44.88  ? 1011 SER A CB  1 
ATOM 7835 O OG  . SER A 1 1014 ? -29.108 26.699  -13.263 1.00 44.88  ? 1011 SER A OG  1 
ATOM 7836 N N   . LEU A 1 1015 ? -30.070 24.922  -15.505 1.00 40.51  ? 1012 LEU A N   1 
ATOM 7837 C CA  . LEU A 1 1015 ? -30.863 23.748  -15.698 1.00 40.51  ? 1012 LEU A CA  1 
ATOM 7838 C C   . LEU A 1 1015 ? -31.394 23.186  -14.376 1.00 40.51  ? 1012 LEU A C   1 
ATOM 7839 O O   . LEU A 1 1015 ? -32.029 22.120  -14.364 1.00 40.51  ? 1012 LEU A O   1 
ATOM 7840 C CB  . LEU A 1 1015 ? -30.038 22.688  -16.413 1.00 68.92  ? 1012 LEU A CB  1 
ATOM 7841 C CG  . LEU A 1 1015 ? -29.584 23.003  -17.825 1.00 68.92  ? 1012 LEU A CG  1 
ATOM 7842 C CD1 . LEU A 1 1015 ? -28.941 21.754  -18.431 1.00 68.92  ? 1012 LEU A CD1 1 
ATOM 7843 C CD2 . LEU A 1 1015 ? -30.752 23.472  -18.662 1.00 68.92  ? 1012 LEU A CD2 1 
ATOM 7844 N N   . VAL A 1 1016 ? -31.161 23.895  -13.280 1.00 68.33  ? 1013 VAL A N   1 
ATOM 7845 C CA  . VAL A 1 1016 ? -31.403 23.322  -11.974 1.00 68.33  ? 1013 VAL A CA  1 
ATOM 7846 C C   . VAL A 1 1016 ? -32.461 24.059  -11.177 1.00 68.33  ? 1013 VAL A C   1 
ATOM 7847 O O   . VAL A 1 1016 ? -33.042 25.023  -11.653 1.00 68.33  ? 1013 VAL A O   1 
ATOM 7848 C CB  . VAL A 1 1016 ? -30.087 23.260  -11.163 1.00 64.49  ? 1013 VAL A CB  1 
ATOM 7849 C CG1 . VAL A 1 1016 ? -29.319 21.995  -11.505 1.00 64.49  ? 1013 VAL A CG1 1 
ATOM 7850 C CG2 . VAL A 1 1016 ? -29.237 24.476  -11.418 1.00 64.49  ? 1013 VAL A CG2 1 
ATOM 7851 N N   . MET A 1 1017 ? -32.701 23.583  -9.961  1.00 86.76  ? 1014 MET A N   1 
ATOM 7852 C CA  . MET A 1 1017 ? -33.427 24.324  -8.911  1.00 86.76  ? 1014 MET A CA  1 
ATOM 7853 C C   . MET A 1 1017 ? -34.934 24.446  -9.150  1.00 86.76  ? 1014 MET A C   1 
ATOM 7854 O O   . MET A 1 1017 ? -35.442 23.984  -10.174 1.00 86.76  ? 1014 MET A O   1 
ATOM 7855 C CB  . MET A 1 1017 ? -32.746 25.670  -8.566  1.00 118.99 ? 1014 MET A CB  1 
ATOM 7856 C CG  . MET A 1 1017 ? -33.180 26.871  -9.378  1.00 118.99 ? 1014 MET A CG  1 
ATOM 7857 S SD  . MET A 1 1017 ? -34.541 27.712  -8.573  1.00 118.99 ? 1014 MET A SD  1 
ATOM 7858 C CE  . MET A 1 1017 ? -35.160 28.773  -9.878  1.00 118.99 ? 1014 MET A CE  1 
ATOM 7859 N N   . GLN A 1 1018 ? -35.618 25.068  -8.187  1.00 89.46  ? 1015 GLN A N   1 
ATOM 7860 C CA  . GLN A 1 1018 ? -37.079 24.980  -8.013  1.00 89.46  ? 1015 GLN A CA  1 
ATOM 7861 C C   . GLN A 1 1018 ? -37.826 24.553  -9.269  1.00 89.46  ? 1015 GLN A C   1 
ATOM 7862 O O   . GLN A 1 1018 ? -37.941 23.359  -9.550  1.00 89.46  ? 1015 GLN A O   1 
ATOM 7863 C CB  . GLN A 1 1018 ? -37.697 26.284  -7.448  1.00 151.48 ? 1015 GLN A CB  1 
ATOM 7864 C CG  . GLN A 1 1018 ? -36.775 27.252  -6.658  1.00 151.48 ? 1015 GLN A CG  1 
ATOM 7865 C CD  . GLN A 1 1018 ? -35.990 26.611  -5.515  1.00 151.48 ? 1015 GLN A CD  1 
ATOM 7866 O OE1 . GLN A 1 1018 ? -36.530 25.837  -4.723  1.00 151.48 ? 1015 GLN A OE1 1 
ATOM 7867 N NE2 . GLN A 1 1018 ? -34.708 26.953  -5.421  1.00 151.48 ? 1015 GLN A NE2 1 
ATOM 7868 N N   . PRO A 1 1026 ? -22.532 31.162  -2.482  1.00 93.61  ? 1023 PRO A N   1 
ATOM 7869 C CA  . PRO A 1 1026 ? -21.382 30.335  -2.918  1.00 93.61  ? 1023 PRO A CA  1 
ATOM 7870 C C   . PRO A 1 1026 ? -20.831 30.819  -4.256  1.00 93.61  ? 1023 PRO A C   1 
ATOM 7871 O O   . PRO A 1 1026 ? -19.617 31.009  -4.408  1.00 93.61  ? 1023 PRO A O   1 
ATOM 7872 C CB  . PRO A 1 1026 ? -21.971 28.923  -3.072  1.00 57.61  ? 1023 PRO A CB  1 
ATOM 7873 C CG  . PRO A 1 1026 ? -23.369 28.998  -2.368  1.00 57.61  ? 1023 PRO A CG  1 
ATOM 7874 C CD  . PRO A 1 1026 ? -23.813 30.430  -2.451  1.00 57.61  ? 1023 PRO A CD  1 
ATOM 7875 N N   . THR A 1 1027 ? -21.737 31.022  -5.211  1.00 67.34  ? 1024 THR A N   1 
ATOM 7876 C CA  . THR A 1 1027 ? -21.385 31.390  -6.574  1.00 67.34  ? 1024 THR A CA  1 
ATOM 7877 C C   . THR A 1 1027 ? -22.442 32.379  -7.059  1.00 67.34  ? 1024 THR A C   1 
ATOM 7878 O O   . THR A 1 1027 ? -23.424 32.643  -6.347  1.00 67.34  ? 1024 THR A O   1 
ATOM 7879 C CB  . THR A 1 1027 ? -21.351 30.155  -7.466  1.00 88.28  ? 1024 THR A CB  1 
ATOM 7880 O OG1 . THR A 1 1027 ? -22.484 29.333  -7.166  1.00 88.28  ? 1024 THR A OG1 1 
ATOM 7881 C CG2 . THR A 1 1027 ? -20.071 29.352  -7.231  1.00 88.28  ? 1024 THR A CG2 1 
ATOM 7882 N N   . GLN A 1 1028 ? -22.229 32.937  -8.249  1.00 57.61  ? 1025 GLN A N   1 
ATOM 7883 C CA  . GLN A 1 1028 ? -23.033 34.047  -8.734  1.00 57.61  ? 1025 GLN A CA  1 
ATOM 7884 C C   . GLN A 1 1028 ? -23.186 33.976  -10.257 1.00 57.61  ? 1025 GLN A C   1 
ATOM 7885 O O   . GLN A 1 1028 ? -22.222 33.742  -10.982 1.00 57.61  ? 1025 GLN A O   1 
ATOM 7886 C CB  . GLN A 1 1028 ? -22.400 35.375  -8.322  1.00 197.26 ? 1025 GLN A CB  1 
ATOM 7887 C CG  . GLN A 1 1028 ? -23.341 36.558  -8.384  1.00 197.26 ? 1025 GLN A CG  1 
ATOM 7888 C CD  . GLN A 1 1028 ? -22.607 37.881  -8.304  1.00 197.26 ? 1025 GLN A CD  1 
ATOM 7889 O OE1 . GLN A 1 1028 ? -21.946 38.303  -9.257  1.00 197.26 ? 1025 GLN A OE1 1 
ATOM 7890 N NE2 . GLN A 1 1028 ? -22.722 38.549  -7.162  1.00 197.26 ? 1025 GLN A NE2 1 
ATOM 7891 N N   . GLY A 1 1029 ? -24.407 34.179  -10.740 1.00 65.15  ? 1026 GLY A N   1 
ATOM 7892 C CA  . GLY A 1 1029 ? -24.693 34.105  -12.164 1.00 65.15  ? 1026 GLY A CA  1 
ATOM 7893 C C   . GLY A 1 1029 ? -24.662 32.663  -12.631 1.00 65.15  ? 1026 GLY A C   1 
ATOM 7894 O O   . GLY A 1 1029 ? -24.430 31.727  -11.855 1.00 65.15  ? 1026 GLY A O   1 
ATOM 7895 N N   . SER A 1 1030 ? -24.921 32.484  -13.915 1.00 46.11  ? 1027 SER A N   1 
ATOM 7896 C CA  . SER A 1 1030 ? -24.808 31.202  -14.567 1.00 46.11  ? 1027 SER A CA  1 
ATOM 7897 C C   . SER A 1 1030 ? -25.001 31.468  -16.058 1.00 46.11  ? 1027 SER A C   1 
ATOM 7898 O O   . SER A 1 1030 ? -26.061 31.946  -16.496 1.00 46.11  ? 1027 SER A O   1 
ATOM 7899 C CB  . SER A 1 1030 ? -25.849 30.234  -14.038 1.00 49.43  ? 1027 SER A CB  1 
ATOM 7900 O OG  . SER A 1 1030 ? -25.756 29.009  -14.732 1.00 49.43  ? 1027 SER A OG  1 
ATOM 7901 N N   . VAL A 1 1031 ? -23.948 31.189  -16.820 1.00 43.30  ? 1028 VAL A N   1 
ATOM 7902 C CA  . VAL A 1 1031 ? -23.930 31.383  -18.261 1.00 43.30  ? 1028 VAL A CA  1 
ATOM 7903 C C   . VAL A 1 1031 ? -23.676 30.051  -18.862 1.00 43.30  ? 1028 VAL A C   1 
ATOM 7904 O O   . VAL A 1 1031 ? -22.712 29.405  -18.492 1.00 43.30  ? 1028 VAL A O   1 
ATOM 7905 C CB  . VAL A 1 1031 ? -22.770 32.275  -18.644 1.00 23.90  ? 1028 VAL A CB  1 
ATOM 7906 C CG1 . VAL A 1 1031 ? -22.422 32.107  -20.118 1.00 23.90  ? 1028 VAL A CG1 1 
ATOM 7907 C CG2 . VAL A 1 1031 ? -23.118 33.718  -18.299 1.00 23.90  ? 1028 VAL A CG2 1 
ATOM 7908 N N   . LEU A 1 1032 ? -24.508 29.607  -19.777 1.00 48.14  ? 1029 LEU A N   1 
ATOM 7909 C CA  . LEU A 1 1032 ? -24.270 28.277  -20.335 1.00 48.14  ? 1029 LEU A CA  1 
ATOM 7910 C C   . LEU A 1 1032 ? -23.663 28.388  -21.717 1.00 48.14  ? 1029 LEU A C   1 
ATOM 7911 O O   . LEU A 1 1032 ? -23.892 29.382  -22.417 1.00 48.14  ? 1029 LEU A O   1 
ATOM 7912 C CB  . LEU A 1 1032 ? -25.566 27.456  -20.395 1.00 33.96  ? 1029 LEU A CB  1 
ATOM 7913 C CG  . LEU A 1 1032 ? -26.358 27.118  -19.123 1.00 33.96  ? 1029 LEU A CG  1 
ATOM 7914 C CD1 . LEU A 1 1032 ? -27.738 26.607  -19.519 1.00 33.96  ? 1029 LEU A CD1 1 
ATOM 7915 C CD2 . LEU A 1 1032 ? -25.594 26.100  -18.263 1.00 33.96  ? 1029 LEU A CD2 1 
ATOM 7916 N N   . PHE A 1 1033 ? -22.897 27.385  -22.129 1.00 36.73  ? 1030 PHE A N   1 
ATOM 7917 C CA  . PHE A 1 1033 ? -22.450 27.410  -23.486 1.00 36.73  ? 1030 PHE A CA  1 
ATOM 7918 C C   . PHE A 1 1033 ? -22.584 26.120  -24.167 1.00 36.73  ? 1030 PHE A C   1 
ATOM 7919 O O   . PHE A 1 1033 ? -22.594 25.071  -23.529 1.00 36.73  ? 1030 PHE A O   1 
ATOM 7920 C CB  . PHE A 1 1033 ? -21.037 27.919  -23.611 1.00 29.01  ? 1030 PHE A CB  1 
ATOM 7921 C CG  . PHE A 1 1033 ? -20.042 27.194  -22.792 1.00 29.01  ? 1030 PHE A CG  1 
ATOM 7922 C CD1 . PHE A 1 1033 ? -19.298 26.175  -23.343 1.00 29.01  ? 1030 PHE A CD1 1 
ATOM 7923 C CD2 . PHE A 1 1033 ? -19.781 27.593  -21.487 1.00 29.01  ? 1030 PHE A CD2 1 
ATOM 7924 C CE1 . PHE A 1 1033 ? -18.349 25.511  -22.573 1.00 29.01  ? 1030 PHE A CE1 1 
ATOM 7925 C CE2 . PHE A 1 1033 ? -18.834 26.949  -20.708 1.00 29.01  ? 1030 PHE A CE2 1 
ATOM 7926 C CZ  . PHE A 1 1033 ? -18.116 25.902  -21.252 1.00 29.01  ? 1030 PHE A CZ  1 
ATOM 7927 N N   . GLY A 1 1034 ? -22.708 26.201  -25.482 1.00 33.44  ? 1031 GLY A N   1 
ATOM 7928 C CA  . GLY A 1 1034 ? -22.744 25.009  -26.321 1.00 33.44  ? 1031 GLY A CA  1 
ATOM 7929 C C   . GLY A 1 1034 ? -21.660 25.124  -27.370 1.00 33.44  ? 1031 GLY A C   1 
ATOM 7930 O O   . GLY A 1 1034 ? -21.381 26.228  -27.854 1.00 33.44  ? 1031 GLY A O   1 
ATOM 7931 N N   . THR A 1 1035 ? -21.115 23.970  -27.743 1.00 26.62  ? 1032 THR A N   1 
ATOM 7932 C CA  . THR A 1 1035 ? -19.860 23.845  -28.440 1.00 26.62  ? 1032 THR A CA  1 
ATOM 7933 C C   . THR A 1 1035 ? -20.087 23.050  -29.719 1.00 26.62  ? 1032 THR A C   1 
ATOM 7934 O O   . THR A 1 1035 ? -21.107 22.396  -29.879 1.00 26.62  ? 1032 THR A O   1 
ATOM 7935 C CB  . THR A 1 1035 ? -18.809 23.133  -27.530 1.00 33.19  ? 1032 THR A CB  1 
ATOM 7936 O OG1 . THR A 1 1035 ? -19.171 21.764  -27.290 1.00 33.19  ? 1032 THR A OG1 1 
ATOM 7937 C CG2 . THR A 1 1035 ? -18.726 23.824  -26.181 1.00 33.19  ? 1032 THR A CG2 1 
ATOM 7938 N N   . VAL A 1 1036 ? -19.158 23.092  -30.652 1.00 29.59  ? 1033 VAL A N   1 
ATOM 7939 C CA  . VAL A 1 1036 ? -19.295 22.300  -31.841 1.00 29.59  ? 1033 VAL A CA  1 
ATOM 7940 C C   . VAL A 1 1036 ? -19.426 20.803  -31.513 1.00 29.59  ? 1033 VAL A C   1 
ATOM 7941 O O   . VAL A 1 1036 ? -19.909 20.026  -32.319 1.00 29.59  ? 1033 VAL A O   1 
ATOM 7942 C CB  . VAL A 1 1036 ? -18.066 22.557  -32.732 1.00 22.06  ? 1033 VAL A CB  1 
ATOM 7943 C CG1 . VAL A 1 1036 ? -17.802 21.481  -33.756 1.00 22.06  ? 1033 VAL A CG1 1 
ATOM 7944 C CG2 . VAL A 1 1036 ? -18.158 23.903  -33.372 1.00 22.06  ? 1033 VAL A CG2 1 
ATOM 7945 N N   . ASN A 1 1037 ? -18.987 20.380  -30.339 1.00 36.35  ? 1034 ASN A N   1 
ATOM 7946 C CA  . ASN A 1 1037 ? -18.670 18.973  -30.101 1.00 36.35  ? 1034 ASN A CA  1 
ATOM 7947 C C   . ASN A 1 1037 ? -19.749 18.253  -29.355 1.00 36.35  ? 1034 ASN A C   1 
ATOM 7948 O O   . ASN A 1 1037 ? -19.745 17.018  -29.271 1.00 36.35  ? 1034 ASN A O   1 
ATOM 7949 C CB  . ASN A 1 1037 ? -17.403 18.858  -29.253 1.00 28.00  ? 1034 ASN A CB  1 
ATOM 7950 C CG  . ASN A 1 1037 ? -16.195 18.474  -30.040 1.00 28.00  ? 1034 ASN A CG  1 
ATOM 7951 O OD1 . ASN A 1 1037 ? -16.289 18.028  -31.215 1.00 28.00  ? 1034 ASN A OD1 1 
ATOM 7952 N ND2 . ASN A 1 1037 ? -15.009 18.622  -29.404 1.00 28.00  ? 1034 ASN A ND2 1 
ATOM 7953 N N   . GLY A 1 1038 ? -20.639 19.027  -28.755 1.00 44.18  ? 1035 GLY A N   1 
ATOM 7954 C CA  . GLY A 1 1038 ? -21.747 18.440  -28.030 1.00 44.18  ? 1035 GLY A CA  1 
ATOM 7955 C C   . GLY A 1 1038 ? -21.687 18.837  -26.599 1.00 44.18  ? 1035 GLY A C   1 
ATOM 7956 O O   . GLY A 1 1038 ? -22.707 18.905  -25.906 1.00 44.18  ? 1035 GLY A O   1 
ATOM 7957 N N   . MET A 1 1039 ? -20.464 19.128  -26.174 1.00 36.71  ? 1036 MET A N   1 
ATOM 7958 C CA  . MET A 1 1039 ? -20.183 19.544  -24.802 1.00 36.71  ? 1036 MET A CA  1 
ATOM 7959 C C   . MET A 1 1039 ? -21.089 20.709  -24.450 1.00 36.71  ? 1036 MET A C   1 
ATOM 7960 O O   . MET A 1 1039 ? -21.302 21.580  -25.269 1.00 36.71  ? 1036 MET A O   1 
ATOM 7961 C CB  . MET A 1 1039 ? -18.691 19.906  -24.708 1.00 40.44  ? 1036 MET A CB  1 
ATOM 7962 C CG  . MET A 1 1039 ? -18.137 20.120  -23.307 1.00 40.44  ? 1036 MET A CG  1 
ATOM 7963 S SD  . MET A 1 1039 ? -18.043 21.872  -22.976 1.00 40.44  ? 1036 MET A SD  1 
ATOM 7964 C CE  . MET A 1 1039 ? -17.489 21.898  -21.263 1.00 40.44  ? 1036 MET A CE  1 
ATOM 7965 N N   . ILE A 1 1040 ? -21.661 20.703  -23.259 1.00 43.09  ? 1037 ILE A N   1 
ATOM 7966 C CA  . ILE A 1 1040 ? -22.313 21.903  -22.746 1.00 43.09  ? 1037 ILE A CA  1 
ATOM 7967 C C   . ILE A 1 1040 ? -21.555 22.276  -21.509 1.00 43.09  ? 1037 ILE A C   1 
ATOM 7968 O O   . ILE A 1 1040 ? -21.514 21.490  -20.570 1.00 43.09  ? 1037 ILE A O   1 
ATOM 7969 C CB  . ILE A 1 1040 ? -23.782 21.660  -22.374 1.00 31.52  ? 1037 ILE A CB  1 
ATOM 7970 C CG1 . ILE A 1 1040 ? -24.606 21.448  -23.643 1.00 31.52  ? 1037 ILE A CG1 1 
ATOM 7971 C CG2 . ILE A 1 1040 ? -24.367 22.830  -21.538 1.00 31.52  ? 1037 ILE A CG2 1 
ATOM 7972 C CD1 . ILE A 1 1040 ? -26.020 20.983  -23.428 1.00 31.52  ? 1037 ILE A CD1 1 
ATOM 7973 N N   . GLY A 1 1041 ? -20.923 23.441  -21.494 1.00 67.46  ? 1038 GLY A N   1 
ATOM 7974 C CA  . GLY A 1 1041 ? -20.293 23.904  -20.278 1.00 67.46  ? 1038 GLY A CA  1 
ATOM 7975 C C   . GLY A 1 1041 ? -21.195 24.854  -19.530 1.00 67.46  ? 1038 GLY A C   1 
ATOM 7976 O O   . GLY A 1 1041 ? -22.318 25.129  -19.950 1.00 67.46  ? 1038 GLY A O   1 
ATOM 7977 N N   . LEU A 1 1042 ? -20.695 25.341  -18.404 1.00 33.27  ? 1039 LEU A N   1 
ATOM 7978 C CA  . LEU A 1 1042 ? -21.327 26.416  -17.628 1.00 33.27  ? 1039 LEU A CA  1 
ATOM 7979 C C   . LEU A 1 1042 ? -20.289 27.367  -16.984 1.00 33.27  ? 1039 LEU A C   1 
ATOM 7980 O O   . LEU A 1 1042 ? -19.309 26.917  -16.431 1.00 33.27  ? 1039 LEU A O   1 
ATOM 7981 C CB  . LEU A 1 1042 ? -22.236 25.801  -16.568 1.00 56.66  ? 1039 LEU A CB  1 
ATOM 7982 C CG  . LEU A 1 1042 ? -22.278 26.308  -15.121 1.00 56.66  ? 1039 LEU A CG  1 
ATOM 7983 C CD1 . LEU A 1 1042 ? -22.860 27.700  -14.940 1.00 56.66  ? 1039 LEU A CD1 1 
ATOM 7984 C CD2 . LEU A 1 1042 ? -23.086 25.324  -14.328 1.00 56.66  ? 1039 LEU A CD2 1 
ATOM 7985 N N   . VAL A 1 1043 ? -20.485 28.673  -17.051 1.00 58.04  ? 1040 VAL A N   1 
ATOM 7986 C CA  . VAL A 1 1043 ? -19.551 29.585  -16.377 1.00 58.04  ? 1040 VAL A CA  1 
ATOM 7987 C C   . VAL A 1 1043 ? -20.204 30.369  -15.237 1.00 58.04  ? 1040 VAL A C   1 
ATOM 7988 O O   . VAL A 1 1043 ? -21.186 31.089  -15.469 1.00 58.04  ? 1040 VAL A O   1 
ATOM 7989 C CB  . VAL A 1 1043 ? -18.875 30.584  -17.360 1.00 33.05  ? 1040 VAL A CB  1 
ATOM 7990 C CG1 . VAL A 1 1043 ? -18.001 31.548  -16.590 1.00 33.05  ? 1040 VAL A CG1 1 
ATOM 7991 C CG2 . VAL A 1 1043 ? -18.037 29.843  -18.359 1.00 33.05  ? 1040 VAL A CG2 1 
ATOM 7992 N N   . THR A 1 1044 ? -19.644 30.243  -14.030 1.00 65.26  ? 1041 THR A N   1 
ATOM 7993 C CA  . THR A 1 1044 ? -20.088 31.042  -12.874 1.00 65.26  ? 1041 THR A CA  1 
ATOM 7994 C C   . THR A 1 1044 ? -19.021 31.971  -12.341 1.00 65.26  ? 1041 THR A C   1 
ATOM 7995 O O   . THR A 1 1044 ? -17.894 31.963  -12.816 1.00 65.26  ? 1041 THR A O   1 
ATOM 7996 C CB  . THR A 1 1044 ? -20.580 30.166  -11.723 1.00 51.27  ? 1041 THR A CB  1 
ATOM 7997 O OG1 . THR A 1 1044 ? -21.392 29.108  -12.250 1.00 51.27  ? 1041 THR A OG1 1 
ATOM 7998 C CG2 . THR A 1 1044 ? -21.422 30.986  -10.783 1.00 51.27  ? 1041 THR A CG2 1 
ATOM 7999 N N   . SER A 1 1045 ? -19.400 32.778  -11.354 1.00 57.20  ? 1042 SER A N   1 
ATOM 8000 C CA  . SER A 1 1045 ? -18.502 33.752  -10.692 1.00 57.20  ? 1042 SER A CA  1 
ATOM 8001 C C   . SER A 1 1045 ? -18.217 33.408  -9.218  1.00 57.20  ? 1042 SER A C   1 
ATOM 8002 O O   . SER A 1 1045 ? -18.995 32.690  -8.576  1.00 57.20  ? 1042 SER A O   1 
ATOM 8003 C CB  . SER A 1 1045 ? -19.079 35.160  -10.813 1.00 73.67  ? 1042 SER A CB  1 
ATOM 8004 O OG  . SER A 1 1045 ? -19.153 35.548  -12.181 1.00 73.67  ? 1042 SER A OG  1 
ATOM 8005 N N   . LEU A 1 1046 ? -17.099 33.912  -8.692  1.00 76.14  ? 1043 LEU A N   1 
ATOM 8006 C CA  . LEU A 1 1046 ? -16.629 33.548  -7.351  1.00 76.14  ? 1043 LEU A CA  1 
ATOM 8007 C C   . LEU A 1 1046 ? -16.306 34.757  -6.506  1.00 76.14  ? 1043 LEU A C   1 
ATOM 8008 O O   . LEU A 1 1046 ? -16.019 35.830  -7.038  1.00 76.14  ? 1043 LEU A O   1 
ATOM 8009 C CB  . LEU A 1 1046 ? -15.342 32.726  -7.448  1.00 38.91  ? 1043 LEU A CB  1 
ATOM 8010 C CG  . LEU A 1 1046 ? -15.355 31.297  -7.988  1.00 38.91  ? 1043 LEU A CG  1 
ATOM 8011 C CD1 . LEU A 1 1046 ? -14.084 31.104  -8.831  1.00 38.91  ? 1043 LEU A CD1 1 
ATOM 8012 C CD2 . LEU A 1 1046 ? -15.481 30.255  -6.881  1.00 38.91  ? 1043 LEU A CD2 1 
ATOM 8013 N N   . SER A 1 1047 ? -16.331 34.556  -5.185  1.00 74.05  ? 1044 SER A N   1 
ATOM 8014 C CA  . SER A 1 1047 ? -15.636 35.423  -4.233  1.00 74.05  ? 1044 SER A CA  1 
ATOM 8015 C C   . SER A 1 1047 ? -14.124 35.168  -4.321  1.00 74.05  ? 1044 SER A C   1 
ATOM 8016 O O   . SER A 1 1047 ? -13.692 34.020  -4.498  1.00 74.05  ? 1044 SER A O   1 
ATOM 8017 C CB  . SER A 1 1047 ? -16.085 35.081  -2.828  1.00 87.59  ? 1044 SER A CB  1 
ATOM 8018 O OG  . SER A 1 1047 ? -15.481 33.861  -2.422  1.00 87.59  ? 1044 SER A OG  1 
ATOM 8019 N N   . GLU A 1 1048 ? -13.325 36.227  -4.179  1.00 59.76  ? 1045 GLU A N   1 
ATOM 8020 C CA  . GLU A 1 1048 ? -11.845 36.143  -4.162  1.00 59.76  ? 1045 GLU A CA  1 
ATOM 8021 C C   . GLU A 1 1048 ? -11.389 35.051  -3.202  1.00 59.76  ? 1045 GLU A C   1 
ATOM 8022 O O   . GLU A 1 1048 ? -10.463 34.298  -3.489  1.00 59.76  ? 1045 GLU A O   1 
ATOM 8023 C CB  . GLU A 1 1048 ? -11.228 37.499  -3.772  1.00 119.18 ? 1045 GLU A CB  1 
ATOM 8024 C CG  . GLU A 1 1048 ? -11.311 37.895  -2.265  1.00 119.18 ? 1045 GLU A CG  1 
ATOM 8025 C CD  . GLU A 1 1048 ? -12.738 38.189  -1.741  1.00 119.18 ? 1045 GLU A CD  1 
ATOM 8026 O OE1 . GLU A 1 1048 ? -13.278 39.287  -2.028  1.00 119.18 ? 1045 GLU A OE1 1 
ATOM 8027 O OE2 . GLU A 1 1048 ? -13.302 37.333  -1.010  1.00 119.18 ? 1045 GLU A OE2 1 
ATOM 8028 N N   . SER A 1 1049 ? -12.067 34.963  -2.064  1.00 54.81  ? 1046 SER A N   1 
ATOM 8029 C CA  . SER A 1 1049 ? -11.756 33.960  -1.061  1.00 54.81  ? 1046 SER A CA  1 
ATOM 8030 C C   . SER A 1 1049 ? -11.958 32.548  -1.611  1.00 54.81  ? 1046 SER A C   1 
ATOM 8031 O O   . SER A 1 1049 ? -11.048 31.705  -1.537  1.00 54.81  ? 1046 SER A O   1 
ATOM 8032 C CB  . SER A 1 1049 ? -12.614 34.176  0.186   1.00 67.05  ? 1046 SER A CB  1 
ATOM 8033 O OG  . SER A 1 1049 ? -13.979 34.027  -0.141  1.00 67.05  ? 1046 SER A OG  1 
ATOM 8034 N N   . TRP A 1 1050 ? -13.145 32.311  -2.160  1.00 69.92  ? 1047 TRP A N   1 
ATOM 8035 C CA  . TRP A 1 1050 ? -13.464 31.044  -2.797  1.00 69.92  ? 1047 TRP A CA  1 
ATOM 8036 C C   . TRP A 1 1050 ? -12.548 30.706  -3.956  1.00 69.92  ? 1047 TRP A C   1 
ATOM 8037 O O   . TRP A 1 1050 ? -12.062 29.573  -4.049  1.00 69.92  ? 1047 TRP A O   1 
ATOM 8038 C CB  . TRP A 1 1050 ? -14.905 31.053  -3.251  1.00 89.46  ? 1047 TRP A CB  1 
ATOM 8039 C CG  . TRP A 1 1050 ? -15.730 30.492  -2.228  1.00 89.46  ? 1047 TRP A CG  1 
ATOM 8040 C CD1 . TRP A 1 1050 ? -15.886 30.954  -0.961  1.00 89.46  ? 1047 TRP A CD1 1 
ATOM 8041 C CD2 . TRP A 1 1050 ? -16.501 29.312  -2.330  1.00 89.46  ? 1047 TRP A CD2 1 
ATOM 8042 N NE1 . TRP A 1 1050 ? -16.725 30.137  -0.264  1.00 89.46  ? 1047 TRP A NE1 1 
ATOM 8043 C CE2 . TRP A 1 1050 ? -17.124 29.114  -1.082  1.00 89.46  ? 1047 TRP A CE2 1 
ATOM 8044 C CE3 . TRP A 1 1050 ? -16.746 28.400  -3.366  1.00 89.46  ? 1047 TRP A CE3 1 
ATOM 8045 C CZ2 . TRP A 1 1050 ? -17.979 28.041  -0.830  1.00 89.46  ? 1047 TRP A CZ2 1 
ATOM 8046 C CZ3 . TRP A 1 1050 ? -17.603 27.324  -3.121  1.00 89.46  ? 1047 TRP A CZ3 1 
ATOM 8047 C CH2 . TRP A 1 1050 ? -18.207 27.154  -1.857  1.00 89.46  ? 1047 TRP A CH2 1 
ATOM 8048 N N   . TYR A 1 1051 ? -12.307 31.685  -4.830  1.00 57.48  ? 1048 TYR A N   1 
ATOM 8049 C CA  . TYR A 1 1051 ? -11.296 31.524  -5.845  1.00 57.48  ? 1048 TYR A CA  1 
ATOM 8050 C C   . TYR A 1 1051 ? -10.087 30.933  -5.169  1.00 57.48  ? 1048 TYR A C   1 
ATOM 8051 O O   . TYR A 1 1051 ? -9.768  29.770  -5.377  1.00 57.48  ? 1048 TYR A O   1 
ATOM 8052 C CB  . TYR A 1 1051 ? -10.929 32.850  -6.498  1.00 70.84  ? 1048 TYR A CB  1 
ATOM 8053 C CG  . TYR A 1 1051 ? -9.862  32.703  -7.550  1.00 70.84  ? 1048 TYR A CG  1 
ATOM 8054 C CD1 . TYR A 1 1051 ? -10.202 32.487  -8.887  1.00 70.84  ? 1048 TYR A CD1 1 
ATOM 8055 C CD2 . TYR A 1 1051 ? -8.511  32.758  -7.216  1.00 70.84  ? 1048 TYR A CD2 1 
ATOM 8056 C CE1 . TYR A 1 1051 ? -9.216  32.344  -9.875  1.00 70.84  ? 1048 TYR A CE1 1 
ATOM 8057 C CE2 . TYR A 1 1051 ? -7.515  32.620  -8.189  1.00 70.84  ? 1048 TYR A CE2 1 
ATOM 8058 C CZ  . TYR A 1 1051 ? -7.871  32.414  -9.522  1.00 70.84  ? 1048 TYR A CZ  1 
ATOM 8059 O OH  . TYR A 1 1051 ? -6.890  32.271  -10.496 1.00 70.84  ? 1048 TYR A OH  1 
ATOM 8060 N N   . ASN A 1 1052 ? -9.452  31.727  -4.309  1.00 40.07  ? 1049 ASN A N   1 
ATOM 8061 C CA  . ASN A 1 1052 ? -8.192  31.326  -3.675  1.00 40.07  ? 1049 ASN A CA  1 
ATOM 8062 C C   . ASN A 1 1052 ? -8.210  29.902  -3.129  1.00 40.07  ? 1049 ASN A C   1 
ATOM 8063 O O   . ASN A 1 1052 ? -7.398  29.075  -3.531  1.00 40.07  ? 1049 ASN A O   1 
ATOM 8064 C CB  . ASN A 1 1052 ? -7.735  32.375  -2.668  1.00 65.70  ? 1049 ASN A CB  1 
ATOM 8065 C CG  . ASN A 1 1052 ? -7.384  33.707  -3.349  1.00 65.70  ? 1049 ASN A CG  1 
ATOM 8066 O OD1 . ASN A 1 1052 ? -6.673  33.738  -4.353  1.00 65.70  ? 1049 ASN A OD1 1 
ATOM 8067 N ND2 . ASN A 1 1052 ? -7.888  34.802  -2.809  1.00 65.70  ? 1049 ASN A ND2 1 
ATOM 8068 N N   . LEU A 1 1053 ? -9.181  29.583  -2.287  1.00 55.20  ? 1050 LEU A N   1 
ATOM 8069 C CA  . LEU A 1 1053 ? -9.260  28.233  -1.770  1.00 55.20  ? 1050 LEU A CA  1 
ATOM 8070 C C   . LEU A 1 1053 ? -9.145  27.248  -2.931  1.00 55.20  ? 1050 LEU A C   1 
ATOM 8071 O O   . LEU A 1 1053 ? -8.394  26.271  -2.881  1.00 55.20  ? 1050 LEU A O   1 
ATOM 8072 C CB  . LEU A 1 1053 ? -10.591 28.038  -1.090  1.00 50.54  ? 1050 LEU A CB  1 
ATOM 8073 C CG  . LEU A 1 1053 ? -10.683 27.124  0.125   1.00 50.54  ? 1050 LEU A CG  1 
ATOM 8074 C CD1 . LEU A 1 1053 ? -12.189 26.939  0.433   1.00 50.54  ? 1050 LEU A CD1 1 
ATOM 8075 C CD2 . LEU A 1 1053 ? -9.983  25.787  -0.016  1.00 50.54  ? 1050 LEU A CD2 1 
ATOM 8076 N N   . LEU A 1 1054 ? -9.874  27.530  -3.996  1.00 67.01  ? 1051 LEU A N   1 
ATOM 8077 C CA  . LEU A 1 1054 ? -9.962  26.595  -5.100  1.00 67.01  ? 1051 LEU A CA  1 
ATOM 8078 C C   . LEU A 1 1054 ? -8.687  26.503  -5.958  1.00 67.01  ? 1051 LEU A C   1 
ATOM 8079 O O   . LEU A 1 1054 ? -8.326  25.401  -6.383  1.00 67.01  ? 1051 LEU A O   1 
ATOM 8080 C CB  . LEU A 1 1054 ? -11.207 26.907  -5.954  1.00 37.01  ? 1051 LEU A CB  1 
ATOM 8081 C CG  . LEU A 1 1054 ? -12.583 26.577  -5.395  1.00 37.01  ? 1051 LEU A CG  1 
ATOM 8082 C CD1 . LEU A 1 1054 ? -13.593 27.251  -6.266  1.00 37.01  ? 1051 LEU A CD1 1 
ATOM 8083 C CD2 . LEU A 1 1054 ? -12.822 25.053  -5.350  1.00 37.01  ? 1051 LEU A CD2 1 
ATOM 8084 N N   . LEU A 1 1055 ? -8.036  27.646  -6.210  1.00 52.71  ? 1052 LEU A N   1 
ATOM 8085 C CA  . LEU A 1 1055 ? -6.735  27.694  -6.905  1.00 52.71  ? 1052 LEU A CA  1 
ATOM 8086 C C   . LEU A 1 1055 ? -5.720  26.908  -6.112  1.00 52.71  ? 1052 LEU A C   1 
ATOM 8087 O O   . LEU A 1 1055 ? -4.936  26.133  -6.666  1.00 52.71  ? 1052 LEU A O   1 
ATOM 8088 C CB  . LEU A 1 1055 ? -6.194  29.126  -7.032  1.00 42.08  ? 1052 LEU A CB  1 
ATOM 8089 C CG  . LEU A 1 1055 ? -5.291  29.424  -8.253  1.00 42.08  ? 1052 LEU A CG  1 
ATOM 8090 C CD1 . LEU A 1 1055 ? -4.807  30.865  -8.314  1.00 42.08  ? 1052 LEU A CD1 1 
ATOM 8091 C CD2 . LEU A 1 1055 ? -4.116  28.508  -8.379  1.00 42.08  ? 1052 LEU A CD2 1 
ATOM 8092 N N   . ASP A 1 1056 ? -5.725  27.124  -4.803  1.00 70.45  ? 1053 ASP A N   1 
ATOM 8093 C CA  . ASP A 1 1056 ? -4.839  26.375  -3.965  1.00 70.45  ? 1053 ASP A CA  1 
ATOM 8094 C C   . ASP A 1 1056 ? -5.136  24.935  -4.275  1.00 70.45  ? 1053 ASP A C   1 
ATOM 8095 O O   . ASP A 1 1056 ? -4.342  24.235  -4.903  1.00 70.45  ? 1053 ASP A O   1 
ATOM 8096 C CB  . ASP A 1 1056 ? -5.095  26.652  -2.492  1.00 97.95  ? 1053 ASP A CB  1 
ATOM 8097 C CG  . ASP A 1 1056 ? -3.992  26.100  -1.615  1.00 97.95  ? 1053 ASP A CG  1 
ATOM 8098 O OD1 . ASP A 1 1056 ? -2.912  26.719  -1.594  1.00 97.95  ? 1053 ASP A OD1 1 
ATOM 8099 O OD2 . ASP A 1 1056 ? -4.182  25.046  -0.966  1.00 97.95  ? 1053 ASP A OD2 1 
ATOM 8100 N N   . MET A 1 1057 ? -6.328  24.526  -3.877  1.00 71.79  ? 1054 MET A N   1 
ATOM 8101 C CA  . MET A 1 1057 ? -6.731  23.137  -3.961  1.00 71.79  ? 1054 MET A CA  1 
ATOM 8102 C C   . MET A 1 1057 ? -6.619  22.494  -5.358  1.00 71.79  ? 1054 MET A C   1 
ATOM 8103 O O   . MET A 1 1057 ? -6.516  21.268  -5.478  1.00 71.79  ? 1054 MET A O   1 
ATOM 8104 C CB  . MET A 1 1057 ? -8.124  23.012  -3.421  1.00 84.33  ? 1054 MET A CB  1 
ATOM 8105 C CG  . MET A 1 1057 ? -8.635  21.620  -3.413  1.00 84.33  ? 1054 MET A CG  1 
ATOM 8106 S SD  . MET A 1 1057 ? -10.335 21.692  -2.895  1.00 84.33  ? 1054 MET A SD  1 
ATOM 8107 C CE  . MET A 1 1057 ? -10.585 23.485  -2.859  1.00 84.33  ? 1054 MET A CE  1 
ATOM 8108 N N   . GLN A 1 1058 ? -6.632  23.337  -6.391  1.00 65.27  ? 1055 GLN A N   1 
ATOM 8109 C CA  . GLN A 1 1058 ? -6.292  22.917  -7.741  1.00 65.27  ? 1055 GLN A CA  1 
ATOM 8110 C C   . GLN A 1 1058 ? -4.868  22.445  -7.821  1.00 65.27  ? 1055 GLN A C   1 
ATOM 8111 O O   . GLN A 1 1058 ? -4.607  21.346  -8.310  1.00 65.27  ? 1055 GLN A O   1 
ATOM 8112 C CB  . GLN A 1 1058 ? -6.440  24.073  -8.692  1.00 65.64  ? 1055 GLN A CB  1 
ATOM 8113 C CG  . GLN A 1 1058 ? -7.672  24.000  -9.553  1.00 65.64  ? 1055 GLN A CG  1 
ATOM 8114 C CD  . GLN A 1 1058 ? -7.535  24.897  -10.754 1.00 65.64  ? 1055 GLN A CD  1 
ATOM 8115 O OE1 . GLN A 1 1058 ? -8.525  25.307  -11.354 1.00 65.64  ? 1055 GLN A OE1 1 
ATOM 8116 N NE2 . GLN A 1 1058 ? -6.288  25.229  -11.103 1.00 65.64  ? 1055 GLN A NE2 1 
ATOM 8117 N N   . ASN A 1 1059 ? -3.956  23.284  -7.326  1.00 47.74  ? 1056 ASN A N   1 
ATOM 8118 C CA  . ASN A 1 1059 ? -2.519  23.011  -7.386  1.00 47.74  ? 1056 ASN A CA  1 
ATOM 8119 C C   . ASN A 1 1059 ? -2.114  21.796  -6.565  1.00 47.74  ? 1056 ASN A C   1 
ATOM 8120 O O   . ASN A 1 1059 ? -1.277  20.993  -7.012  1.00 47.74  ? 1056 ASN A O   1 
ATOM 8121 C CB  . ASN A 1 1059 ? -1.716  24.245  -6.984  1.00 68.52  ? 1056 ASN A CB  1 
ATOM 8122 C CG  . ASN A 1 1059 ? -1.714  25.330  -8.069  1.00 68.52  ? 1056 ASN A CG  1 
ATOM 8123 O OD1 . ASN A 1 1059 ? -1.374  26.487  -7.805  1.00 68.52  ? 1056 ASN A OD1 1 
ATOM 8124 N ND2 . ASN A 1 1059 ? -2.069  24.950  -9.295  1.00 68.52  ? 1056 ASN A ND2 1 
ATOM 8125 N N   . ARG A 1 1060 ? -2.736  21.636  -5.393  1.00 56.37  ? 1057 ARG A N   1 
ATOM 8126 C CA  . ARG A 1 1060 ? -2.469  20.478  -4.531  1.00 56.37  ? 1057 ARG A CA  1 
ATOM 8127 C C   . ARG A 1 1060 ? -2.959  19.231  -5.231  1.00 56.37  ? 1057 ARG A C   1 
ATOM 8128 O O   . ARG A 1 1060 ? -2.258  18.242  -5.273  1.00 56.37  ? 1057 ARG A O   1 
ATOM 8129 C CB  . ARG A 1 1060 ? -3.164  20.595  -3.173  1.00 79.84  ? 1057 ARG A CB  1 
ATOM 8130 C CG  . ARG A 1 1060 ? -3.017  21.919  -2.441  1.00 79.84  ? 1057 ARG A CG  1 
ATOM 8131 C CD  . ARG A 1 1060 ? -2.740  21.630  -0.989  1.00 79.84  ? 1057 ARG A CD  1 
ATOM 8132 N NE  . ARG A 1 1060 ? -3.158  22.683  -0.069  1.00 79.84  ? 1057 ARG A NE  1 
ATOM 8133 C CZ  . ARG A 1 1060 ? -2.866  22.686  1.234   1.00 79.84  ? 1057 ARG A CZ  1 
ATOM 8134 N NH1 . ARG A 1 1060 ? -2.143  21.704  1.770   1.00 79.84  ? 1057 ARG A NH1 1 
ATOM 8135 N NH2 . ARG A 1 1060 ? -3.289  23.673  2.010   1.00 79.84  ? 1057 ARG A NH2 1 
ATOM 8136 N N   . LEU A 1 1061 ? -4.163  19.307  -5.806  1.00 73.92  ? 1058 LEU A N   1 
ATOM 8137 C CA  . LEU A 1 1061 ? -4.823  18.179  -6.475  1.00 73.92  ? 1058 LEU A CA  1 
ATOM 8138 C C   . LEU A 1 1061 ? -4.044  17.631  -7.631  1.00 73.92  ? 1058 LEU A C   1 
ATOM 8139 O O   . LEU A 1 1061 ? -4.209  16.488  -8.007  1.00 73.92  ? 1058 LEU A O   1 
ATOM 8140 C CB  . LEU A 1 1061 ? -6.182  18.602  -7.020  1.00 53.42  ? 1058 LEU A CB  1 
ATOM 8141 C CG  . LEU A 1 1061 ? -7.475  18.088  -6.390  1.00 53.42  ? 1058 LEU A CG  1 
ATOM 8142 C CD1 . LEU A 1 1061 ? -8.658  18.876  -6.902  1.00 53.42  ? 1058 LEU A CD1 1 
ATOM 8143 C CD2 . LEU A 1 1061 ? -7.685  16.601  -6.651  1.00 53.42  ? 1058 LEU A CD2 1 
ATOM 8144 N N   . ASN A 1 1062 ? -3.224  18.468  -8.233  1.00 68.61  ? 1059 ASN A N   1 
ATOM 8145 C CA  . ASN A 1 1062 ? -2.464  18.027  -9.376  1.00 68.61  ? 1059 ASN A CA  1 
ATOM 8146 C C   . ASN A 1 1062 ? -1.319  17.134  -8.994  1.00 68.61  ? 1059 ASN A C   1 
ATOM 8147 O O   . ASN A 1 1062 ? -1.029  16.176  -9.708  1.00 68.61  ? 1059 ASN A O   1 
ATOM 8148 C CB  . ASN A 1 1062 ? -1.991  19.203  -10.192 1.00 62.24  ? 1059 ASN A CB  1 
ATOM 8149 C CG  . ASN A 1 1062 ? -3.120  19.864  -10.916 1.00 62.24  ? 1059 ASN A CG  1 
ATOM 8150 O OD1 . ASN A 1 1062 ? -3.845  19.219  -11.676 1.00 62.24  ? 1059 ASN A OD1 1 
ATOM 8151 N ND2 . ASN A 1 1062 ? -3.299  21.153  -10.669 1.00 62.24  ? 1059 ASN A ND2 1 
ATOM 8152 N N   . LYS A 1 1063 ? -0.689  17.429  -7.860  1.00 65.75  ? 1060 LYS A N   1 
ATOM 8153 C CA  . LYS A 1 1063 ? 0.328   16.536  -7.292  1.00 65.75  ? 1060 LYS A CA  1 
ATOM 8154 C C   . LYS A 1 1063 ? -0.224  15.093  -7.104  1.00 65.75  ? 1060 LYS A C   1 
ATOM 8155 O O   . LYS A 1 1063 ? 0.333   14.114  -7.616  1.00 65.75  ? 1060 LYS A O   1 
ATOM 8156 C CB  . LYS A 1 1063 ? 0.895   17.132  -5.992  1.00 78.33  ? 1060 LYS A CB  1 
ATOM 8157 C CG  . LYS A 1 1063 ? 1.665   18.433  -6.196  1.00 78.33  ? 1060 LYS A CG  1 
ATOM 8158 C CD  . LYS A 1 1063 ? 3.083   18.315  -5.671  1.00 78.33  ? 1060 LYS A CD  1 
ATOM 8159 C CE  . LYS A 1 1063 ? 4.024   19.309  -6.336  1.00 78.33  ? 1060 LYS A CE  1 
ATOM 8160 N NZ  . LYS A 1 1063 ? 3.839   20.675  -5.771  1.00 78.33  ? 1060 LYS A NZ  1 
ATOM 8161 N N   . VAL A 1 1064 ? -1.360  14.986  -6.424  1.00 77.23  ? 1061 VAL A N   1 
ATOM 8162 C CA  . VAL A 1 1064 ? -1.978  13.694  -6.134  1.00 77.23  ? 1061 VAL A CA  1 
ATOM 8163 C C   . VAL A 1 1064 ? -2.433  12.879  -7.357  1.00 77.23  ? 1061 VAL A C   1 
ATOM 8164 O O   . VAL A 1 1064 ? -2.200  11.680  -7.400  1.00 77.23  ? 1061 VAL A O   1 
ATOM 8165 C CB  . VAL A 1 1064 ? -3.108  13.854  -5.106  1.00 90.21  ? 1061 VAL A CB  1 
ATOM 8166 C CG1 . VAL A 1 1064 ? -3.680  12.515  -4.715  1.00 90.21  ? 1061 VAL A CG1 1 
ATOM 8167 C CG2 . VAL A 1 1064 ? -2.577  14.565  -3.883  1.00 90.21  ? 1061 VAL A CG2 1 
ATOM 8168 N N   . ILE A 1 1065 ? -3.062  13.518  -8.343  1.00 83.60  ? 1062 ILE A N   1 
ATOM 8169 C CA  . ILE A 1 1065 ? -3.574  12.803  -9.536  1.00 83.60  ? 1062 ILE A CA  1 
ATOM 8170 C C   . ILE A 1 1065 ? -2.543  12.605  -10.644 1.00 83.60  ? 1062 ILE A C   1 
ATOM 8171 O O   . ILE A 1 1065 ? -1.869  13.554  -11.098 1.00 83.60  ? 1062 ILE A O   1 
ATOM 8172 C CB  . ILE A 1 1065 ? -4.802  13.491  -10.185 1.00 47.73  ? 1062 ILE A CB  1 
ATOM 8173 C CG1 . ILE A 1 1065 ? -6.005  13.449  -9.269  1.00 47.73  ? 1062 ILE A CG1 1 
ATOM 8174 C CG2 . ILE A 1 1065 ? -5.169  12.811  -11.515 1.00 47.73  ? 1062 ILE A CG2 1 
ATOM 8175 C CD1 . ILE A 1 1065 ? -6.837  14.652  -9.441  1.00 47.73  ? 1062 ILE A CD1 1 
ATOM 8176 N N   . LYS A 1 1066 ? -2.465  11.360  -11.092 1.00 80.75  ? 1063 LYS A N   1 
ATOM 8177 C CA  . LYS A 1 1066 ? -1.693  11.006  -12.270 1.00 80.75  ? 1063 LYS A CA  1 
ATOM 8178 C C   . LYS A 1 1066 ? -2.587  11.187  -13.490 1.00 80.75  ? 1063 LYS A C   1 
ATOM 8179 O O   . LYS A 1 1066 ? -3.664  10.589  -13.573 1.00 80.75  ? 1063 LYS A O   1 
ATOM 8180 C CB  . LYS A 1 1066 ? -1.173  9.562   -12.152 1.00 124.62 ? 1063 LYS A CB  1 
ATOM 8181 C CG  . LYS A 1 1066 ? -2.244  8.442   -12.112 1.00 124.62 ? 1063 LYS A CG  1 
ATOM 8182 C CD  . LYS A 1 1066 ? -3.338  8.643   -11.059 1.00 124.62 ? 1063 LYS A CD  1 
ATOM 8183 C CE  . LYS A 1 1066 ? -4.659  8.103   -11.577 1.00 124.62 ? 1063 LYS A CE  1 
ATOM 8184 N NZ  . LYS A 1 1066 ? -5.834  8.713   -10.911 1.00 124.62 ? 1063 LYS A NZ  1 
ATOM 8185 N N   . SER A 1 1067 ? -2.131  12.036  -14.389 1.00 39.37  ? 1064 SER A N   1 
ATOM 8186 C CA  . SER A 1 1067 ? -2.799  12.263  -15.613 1.00 39.37  ? 1064 SER A CA  1 
ATOM 8187 C C   . SER A 1 1067 ? -2.460  11.038  -16.334 1.00 39.37  ? 1064 SER A C   1 
ATOM 8188 O O   . SER A 1 1067 ? -2.151  10.057  -15.718 1.00 39.37  ? 1064 SER A O   1 
ATOM 8189 C CB  . SER A 1 1067 ? -2.136  13.365  -16.342 1.00 58.99  ? 1064 SER A CB  1 
ATOM 8190 O OG  . SER A 1 1067 ? -1.070  12.791  -17.030 1.00 58.99  ? 1064 SER A OG  1 
ATOM 8191 N N   . VAL A 1 1068 ? -2.487  11.092  -17.646 1.00 71.24  ? 1065 VAL A N   1 
ATOM 8192 C CA  . VAL A 1 1068 ? -2.481  9.889   -18.415 1.00 71.24  ? 1065 VAL A CA  1 
ATOM 8193 C C   . VAL A 1 1068 ? -1.452  9.725   -19.490 1.00 71.24  ? 1065 VAL A C   1 
ATOM 8194 O O   . VAL A 1 1068 ? -1.009  8.636   -19.754 1.00 71.24  ? 1065 VAL A O   1 
ATOM 8195 C CB  . VAL A 1 1068 ? -3.834  9.649   -19.036 1.00 47.30  ? 1065 VAL A CB  1 
ATOM 8196 C CG1 . VAL A 1 1068 ? -3.852  8.382   -19.785 1.00 47.30  ? 1065 VAL A CG1 1 
ATOM 8197 C CG2 . VAL A 1 1068 ? -4.824  9.584   -17.992 1.00 47.30  ? 1065 VAL A CG2 1 
ATOM 8198 N N   . GLY A 1 1069 ? -1.106  10.822  -20.147 1.00 45.35  ? 1066 GLY A N   1 
ATOM 8199 C CA  . GLY A 1 1069 ? 0.029   10.827  -21.043 1.00 45.35  ? 1066 GLY A CA  1 
ATOM 8200 C C   . GLY A 1 1069 ? 1.146   11.300  -20.147 1.00 45.35  ? 1066 GLY A C   1 
ATOM 8201 O O   . GLY A 1 1069 ? 2.313   11.366  -20.538 1.00 45.35  ? 1066 GLY A O   1 
ATOM 8202 N N   . LYS A 1 1070 ? 0.745   11.611  -18.916 1.00 59.75  ? 1067 LYS A N   1 
ATOM 8203 C CA  . LYS A 1 1070 ? 1.592   12.245  -17.921 1.00 59.75  ? 1067 LYS A CA  1 
ATOM 8204 C C   . LYS A 1 1070 ? 1.336   13.742  -17.998 1.00 59.75  ? 1067 LYS A C   1 
ATOM 8205 O O   . LYS A 1 1070 ? 1.986   14.539  -17.311 1.00 59.75  ? 1067 LYS A O   1 
ATOM 8206 C CB  . LYS A 1 1070 ? 3.065   11.942  -18.194 1.00 76.25  ? 1067 LYS A CB  1 
ATOM 8207 C CG  . LYS A 1 1070 ? 3.471   10.510  -17.887 1.00 76.25  ? 1067 LYS A CG  1 
ATOM 8208 C CD  . LYS A 1 1070 ? 3.594   10.280  -16.389 1.00 76.25  ? 1067 LYS A CD  1 
ATOM 8209 C CE  . LYS A 1 1070 ? 3.557   8.798   -16.054 1.00 76.25  ? 1067 LYS A CE  1 
ATOM 8210 N NZ  . LYS A 1 1070 ? 4.922   8.203   -16.015 1.00 76.25  ? 1067 LYS A NZ  1 
ATOM 8211 N N   . ILE A 1 1071 ? 0.375   14.120  -18.838 1.00 38.06  ? 1068 ILE A N   1 
ATOM 8212 C CA  . ILE A 1 1071 ? 0.230   15.534  -19.222 1.00 38.06  ? 1068 ILE A CA  1 
ATOM 8213 C C   . ILE A 1 1071 ? 0.040   16.458  -18.007 1.00 38.06  ? 1068 ILE A C   1 
ATOM 8214 O O   . ILE A 1 1071 ? -0.761  16.202  -17.132 1.00 38.06  ? 1068 ILE A O   1 
ATOM 8215 C CB  . ILE A 1 1071 ? -0.892  15.774  -20.325 1.00 35.80  ? 1068 ILE A CB  1 
ATOM 8216 C CG1 . ILE A 1 1071 ? -0.536  15.051  -21.618 1.00 35.80  ? 1068 ILE A CG1 1 
ATOM 8217 C CG2 . ILE A 1 1071 ? -1.091  17.277  -20.675 1.00 35.80  ? 1068 ILE A CG2 1 
ATOM 8218 C CD1 . ILE A 1 1071 ? -1.710  14.826  -22.501 1.00 35.80  ? 1068 ILE A CD1 1 
ATOM 8219 N N   . GLU A 1 1072 ? 0.805   17.539  -17.966 1.00 46.43  ? 1069 GLU A N   1 
ATOM 8220 C CA  . GLU A 1 1072 ? 0.633   18.565  -16.959 1.00 46.43  ? 1069 GLU A CA  1 
ATOM 8221 C C   . GLU A 1 1072 ? -0.725  19.271  -17.162 1.00 46.43  ? 1069 GLU A C   1 
ATOM 8222 O O   . GLU A 1 1072 ? -1.007  19.841  -18.214 1.00 46.43  ? 1069 GLU A O   1 
ATOM 8223 C CB  . GLU A 1 1072 ? 1.796   19.563  -17.041 1.00 156.37 ? 1069 GLU A CB  1 
ATOM 8224 C CG  . GLU A 1 1072 ? 2.040   20.370  -15.771 1.00 156.37 ? 1069 GLU A CG  1 
ATOM 8225 C CD  . GLU A 1 1072 ? 2.872   19.625  -14.727 1.00 156.37 ? 1069 GLU A CD  1 
ATOM 8226 O OE1 . GLU A 1 1072 ? 3.427   20.304  -13.826 1.00 156.37 ? 1069 GLU A OE1 1 
ATOM 8227 O OE2 . GLU A 1 1072 ? 2.979   18.375  -14.802 1.00 156.37 ? 1069 GLU A OE2 1 
ATOM 8228 N N   . HIS A 1 1073 ? -1.552  19.241  -16.130 1.00 39.54  ? 1070 HIS A N   1 
ATOM 8229 C CA  . HIS A 1 1073 ? -2.869  19.821  -16.175 1.00 39.54  ? 1070 HIS A CA  1 
ATOM 8230 C C   . HIS A 1 1073 ? -2.810  21.264  -16.558 1.00 39.54  ? 1070 HIS A C   1 
ATOM 8231 O O   . HIS A 1 1073 ? -3.650  21.760  -17.334 1.00 39.54  ? 1070 HIS A O   1 
ATOM 8232 C CB  . HIS A 1 1073 ? -3.514  19.732  -14.805 1.00 36.79  ? 1070 HIS A CB  1 
ATOM 8233 C CG  . HIS A 1 1073 ? -4.688  20.653  -14.652 1.00 36.79  ? 1070 HIS A CG  1 
ATOM 8234 N ND1 . HIS A 1 1073 ? -5.996  20.217  -14.761 1.00 36.79  ? 1070 HIS A ND1 1 
ATOM 8235 C CD2 . HIS A 1 1073 ? -4.747  21.993  -14.457 1.00 36.79  ? 1070 HIS A CD2 1 
ATOM 8236 C CE1 . HIS A 1 1073 ? -6.807  21.250  -14.616 1.00 36.79  ? 1070 HIS A CE1 1 
ATOM 8237 N NE2 . HIS A 1 1073 ? -6.076  22.334  -14.425 1.00 36.79  ? 1070 HIS A NE2 1 
ATOM 8238 N N   . SER A 1 1074 ? -1.827  21.939  -15.966 1.00 46.18  ? 1071 SER A N   1 
ATOM 8239 C CA  . SER A 1 1074 ? -1.585  23.371  -16.178 1.00 46.18  ? 1071 SER A CA  1 
ATOM 8240 C C   . SER A 1 1074 ? -1.037  23.648  -17.548 1.00 46.18  ? 1071 SER A C   1 
ATOM 8241 O O   . SER A 1 1074 ? -1.204  24.745  -18.021 1.00 46.18  ? 1071 SER A O   1 
ATOM 8242 C CB  . SER A 1 1074 ? -0.669  23.981  -15.101 1.00 61.16  ? 1071 SER A CB  1 
ATOM 8243 O OG  . SER A 1 1074 ? 0.517   23.220  -14.919 1.00 61.16  ? 1071 SER A OG  1 
ATOM 8244 N N   . PHE A 1 1075 ? -0.394  22.680  -18.188 1.00 50.66  ? 1072 PHE A N   1 
ATOM 8245 C CA  . PHE A 1 1075 ? 0.019   22.880  -19.559 1.00 50.66  ? 1072 PHE A CA  1 
ATOM 8246 C C   . PHE A 1 1075 ? -1.191  22.830  -20.509 1.00 50.66  ? 1072 PHE A C   1 
ATOM 8247 O O   . PHE A 1 1075 ? -1.271  23.561  -21.528 1.00 50.66  ? 1072 PHE A O   1 
ATOM 8248 C CB  . PHE A 1 1075 ? 1.014   21.824  -19.944 1.00 33.20  ? 1072 PHE A CB  1 
ATOM 8249 C CG  . PHE A 1 1075 ? 1.352   21.817  -21.403 1.00 33.20  ? 1072 PHE A CG  1 
ATOM 8250 C CD1 . PHE A 1 1075 ? 2.324   22.712  -21.919 1.00 33.20  ? 1072 PHE A CD1 1 
ATOM 8251 C CD2 . PHE A 1 1075 ? 0.717   20.926  -22.265 1.00 33.20  ? 1072 PHE A CD2 1 
ATOM 8252 C CE1 . PHE A 1 1075 ? 2.657   22.706  -23.280 1.00 33.20  ? 1072 PHE A CE1 1 
ATOM 8253 C CE2 . PHE A 1 1075 ? 1.011   20.903  -23.617 1.00 33.20  ? 1072 PHE A CE2 1 
ATOM 8254 C CZ  . PHE A 1 1075 ? 1.984   21.792  -24.142 1.00 33.20  ? 1072 PHE A CZ  1 
ATOM 8255 N N   . TRP A 1 1076 ? -2.125  21.956  -20.142 1.00 47.15  ? 1073 TRP A N   1 
ATOM 8256 C CA  . TRP A 1 1076 ? -3.357  21.763  -20.835 1.00 47.15  ? 1073 TRP A CA  1 
ATOM 8257 C C   . TRP A 1 1076 ? -4.168  23.040  -20.776 1.00 47.15  ? 1073 TRP A C   1 
ATOM 8258 O O   . TRP A 1 1076 ? -4.666  23.486  -21.812 1.00 47.15  ? 1073 TRP A O   1 
ATOM 8259 C CB  . TRP A 1 1076 ? -4.077  20.551  -20.228 1.00 42.13  ? 1073 TRP A CB  1 
ATOM 8260 C CG  . TRP A 1 1076 ? -5.575  20.346  -20.515 1.00 42.13  ? 1073 TRP A CG  1 
ATOM 8261 C CD1 . TRP A 1 1076 ? -6.540  20.110  -19.590 1.00 42.13  ? 1073 TRP A CD1 1 
ATOM 8262 C CD2 . TRP A 1 1076 ? -6.238  20.349  -21.783 1.00 42.13  ? 1073 TRP A CD2 1 
ATOM 8263 N NE1 . TRP A 1 1076 ? -7.758  19.982  -20.188 1.00 42.13  ? 1073 TRP A NE1 1 
ATOM 8264 C CE2 . TRP A 1 1076 ? -7.608  20.126  -21.534 1.00 42.13  ? 1073 TRP A CE2 1 
ATOM 8265 C CE3 . TRP A 1 1076 ? -5.815  20.537  -23.100 1.00 42.13  ? 1073 TRP A CE3 1 
ATOM 8266 C CZ2 . TRP A 1 1076 ? -8.554  20.065  -22.545 1.00 42.13  ? 1073 TRP A CZ2 1 
ATOM 8267 C CZ3 . TRP A 1 1076 ? -6.759  20.468  -24.111 1.00 42.13  ? 1073 TRP A CZ3 1 
ATOM 8268 C CH2 . TRP A 1 1076 ? -8.113  20.234  -23.826 1.00 42.13  ? 1073 TRP A CH2 1 
ATOM 8269 N N   . ARG A 1 1077 ? -4.255  23.662  -19.596 1.00 36.64  ? 1074 ARG A N   1 
ATOM 8270 C CA  . ARG A 1 1077 ? -5.210  24.750  -19.397 1.00 36.64  ? 1074 ARG A CA  1 
ATOM 8271 C C   . ARG A 1 1077 ? -4.770  26.116  -19.881 1.00 36.64  ? 1074 ARG A C   1 
ATOM 8272 O O   . ARG A 1 1077 ? -5.384  27.134  -19.606 1.00 36.64  ? 1074 ARG A O   1 
ATOM 8273 C CB  . ARG A 1 1077 ? -5.567  24.818  -17.939 1.00 41.66  ? 1074 ARG A CB  1 
ATOM 8274 C CG  . ARG A 1 1077 ? -6.532  23.762  -17.579 1.00 41.66  ? 1074 ARG A CG  1 
ATOM 8275 C CD  . ARG A 1 1077 ? -7.620  23.727  -18.636 1.00 41.66  ? 1074 ARG A CD  1 
ATOM 8276 N NE  . ARG A 1 1077 ? -8.745  22.840  -18.320 1.00 41.66  ? 1074 ARG A NE  1 
ATOM 8277 C CZ  . ARG A 1 1077 ? -9.710  22.519  -19.186 1.00 41.66  ? 1074 ARG A CZ  1 
ATOM 8278 N NH1 . ARG A 1 1077 ? -9.712  22.988  -20.425 1.00 41.66  ? 1074 ARG A NH1 1 
ATOM 8279 N NH2 . ARG A 1 1077 ? -10.672 21.722  -18.817 1.00 41.66  ? 1074 ARG A NH2 1 
ATOM 8280 N N   . SER A 1 1078 ? -3.684  26.149  -20.611 1.00 35.15  ? 1075 SER A N   1 
ATOM 8281 C CA  . SER A 1 1078 ? -2.970  27.401  -20.814 1.00 35.15  ? 1075 SER A CA  1 
ATOM 8282 C C   . SER A 1 1078 ? -3.419  28.071  -22.062 1.00 35.15  ? 1075 SER A C   1 
ATOM 8283 O O   . SER A 1 1078 ? -3.484  27.440  -23.128 1.00 35.15  ? 1075 SER A O   1 
ATOM 8284 C CB  . SER A 1 1078 ? -1.468  27.129  -20.889 1.00 47.20  ? 1075 SER A CB  1 
ATOM 8285 O OG  . SER A 1 1078 ? -0.949  27.129  -19.577 1.00 47.20  ? 1075 SER A OG  1 
ATOM 8286 N N   . PHE A 1 1079 ? -3.734  29.346  -21.932 1.00 47.42  ? 1076 PHE A N   1 
ATOM 8287 C CA  . PHE A 1 1079 ? -4.141  30.131  -23.072 1.00 47.42  ? 1076 PHE A CA  1 
ATOM 8288 C C   . PHE A 1 1079 ? -3.144  29.944  -24.207 1.00 47.42  ? 1076 PHE A C   1 
ATOM 8289 O O   . PHE A 1 1079 ? -1.953  30.166  -24.046 1.00 47.42  ? 1076 PHE A O   1 
ATOM 8290 C CB  . PHE A 1 1079 ? -4.216  31.585  -22.678 1.00 51.70  ? 1076 PHE A CB  1 
ATOM 8291 C CG  . PHE A 1 1079 ? -4.977  32.425  -23.640 1.00 51.70  ? 1076 PHE A CG  1 
ATOM 8292 C CD1 . PHE A 1 1079 ? -6.313  32.776  -23.367 1.00 51.70  ? 1076 PHE A CD1 1 
ATOM 8293 C CD2 . PHE A 1 1079 ? -4.374  32.875  -24.820 1.00 51.70  ? 1076 PHE A CD2 1 
ATOM 8294 C CE1 . PHE A 1 1079 ? -7.033  33.568  -24.258 1.00 51.70  ? 1076 PHE A CE1 1 
ATOM 8295 C CE2 . PHE A 1 1079 ? -5.093  33.656  -25.713 1.00 51.70  ? 1076 PHE A CE2 1 
ATOM 8296 C CZ  . PHE A 1 1079 ? -6.427  34.010  -25.433 1.00 51.70  ? 1076 PHE A CZ  1 
ATOM 8297 N N   . HIS A 1 1080 ? -3.617  29.495  -25.353 1.00 39.15  ? 1077 HIS A N   1 
ATOM 8298 C CA  . HIS A 1 1080 ? -2.677  29.208  -26.395 1.00 39.15  ? 1077 HIS A CA  1 
ATOM 8299 C C   . HIS A 1 1080 ? -3.153  29.532  -27.813 1.00 39.15  ? 1077 HIS A C   1 
ATOM 8300 O O   . HIS A 1 1080 ? -4.237  29.104  -28.261 1.00 39.15  ? 1077 HIS A O   1 
ATOM 8301 C CB  . HIS A 1 1080 ? -2.246  27.757  -26.315 1.00 55.40  ? 1077 HIS A CB  1 
ATOM 8302 C CG  . HIS A 1 1080 ? -1.466  27.313  -27.503 1.00 55.40  ? 1077 HIS A CG  1 
ATOM 8303 N ND1 . HIS A 1 1080 ? -0.110  27.082  -27.458 1.00 55.40  ? 1077 HIS A ND1 1 
ATOM 8304 C CD2 . HIS A 1 1080 ? -1.842  27.097  -28.781 1.00 55.40  ? 1077 HIS A CD2 1 
ATOM 8305 C CE1 . HIS A 1 1080 ? 0.309   26.711  -28.652 1.00 55.40  ? 1077 HIS A CE1 1 
ATOM 8306 N NE2 . HIS A 1 1080 ? -0.721  26.720  -29.475 1.00 55.40  ? 1077 HIS A NE2 1 
ATOM 8307 N N   . THR A 1 1081 ? -2.313  30.260  -28.530 1.00 59.48  ? 1078 THR A N   1 
ATOM 8308 C CA  . THR A 1 1081 ? -2.570  30.529  -29.928 1.00 59.48  ? 1078 THR A CA  1 
ATOM 8309 C C   . THR A 1 1081 ? -1.310  30.236  -30.720 1.00 59.48  ? 1078 THR A C   1 
ATOM 8310 O O   . THR A 1 1081 ? -0.200  30.241  -30.179 1.00 59.48  ? 1078 THR A O   1 
ATOM 8311 C CB  . THR A 1 1081 ? -2.924  32.004  -30.163 1.00 52.10  ? 1078 THR A CB  1 
ATOM 8312 O OG1 . THR A 1 1081 ? -1.780  32.805  -29.852 1.00 52.10  ? 1078 THR A OG1 1 
ATOM 8313 C CG2 . THR A 1 1081 ? -4.100  32.444  -29.301 1.00 52.10  ? 1078 THR A CG2 1 
ATOM 8314 N N   . GLU A 1 1082 ? -1.470  29.991  -32.011 1.00 89.43  ? 1079 GLU A N   1 
ATOM 8315 C CA  . GLU A 1 1082 ? -0.307  29.878  -32.852 1.00 89.43  ? 1079 GLU A CA  1 
ATOM 8316 C C   . GLU A 1 1082 ? 0.286   31.277  -32.919 1.00 89.43  ? 1079 GLU A C   1 
ATOM 8317 O O   . GLU A 1 1082 ? 0.392   31.855  -34.005 1.00 89.43  ? 1079 GLU A O   1 
ATOM 8318 C CB  . GLU A 1 1082 ? -0.657  29.307  -34.232 1.00 209.00 ? 1079 GLU A CB  1 
ATOM 8319 C CG  . GLU A 1 1082 ? 0.545   28.742  -35.007 1.00 209.00 ? 1079 GLU A CG  1 
ATOM 8320 C CD  . GLU A 1 1082 ? 1.408   27.788  -34.182 1.00 209.00 ? 1079 GLU A CD  1 
ATOM 8321 O OE1 . GLU A 1 1082 ? 0.917   26.698  -33.804 1.00 209.00 ? 1079 GLU A OE1 1 
ATOM 8322 O OE2 . GLU A 1 1082 ? 2.588   28.127  -33.919 1.00 209.00 ? 1079 GLU A OE2 1 
ATOM 8323 N N   . ARG A 1 1083 ? 0.611   31.825  -31.733 1.00 57.85  ? 1080 ARG A N   1 
ATOM 8324 C CA  . ARG A 1 1083 ? 1.381   33.083  -31.575 1.00 57.85  ? 1080 ARG A CA  1 
ATOM 8325 C C   . ARG A 1 1083 ? 1.481   33.658  -30.160 1.00 57.85  ? 1080 ARG A C   1 
ATOM 8326 O O   . ARG A 1 1083 ? 1.950   34.783  -30.000 1.00 57.85  ? 1080 ARG A O   1 
ATOM 8327 C CB  . ARG A 1 1083 ? 0.937   34.195  -32.549 1.00 125.10 ? 1080 ARG A CB  1 
ATOM 8328 C CG  . ARG A 1 1083 ? -0.513  34.605  -32.440 1.00 125.10 ? 1080 ARG A CG  1 
ATOM 8329 C CD  . ARG A 1 1083 ? -0.660  36.096  -32.627 1.00 125.10 ? 1080 ARG A CD  1 
ATOM 8330 N NE  . ARG A 1 1083 ? -0.505  36.818  -31.364 1.00 125.10 ? 1080 ARG A NE  1 
ATOM 8331 C CZ  . ARG A 1 1083 ? -1.459  36.941  -30.437 1.00 125.10 ? 1080 ARG A CZ  1 
ATOM 8332 N NH1 . ARG A 1 1083 ? -2.656  36.383  -30.613 1.00 125.10 ? 1080 ARG A NH1 1 
ATOM 8333 N NH2 . ARG A 1 1083 ? -1.215  37.621  -29.323 1.00 125.10 ? 1080 ARG A NH2 1 
ATOM 8334 N N   . LYS A 1 1084 ? 1.072   32.907  -29.142 1.00 68.26  ? 1081 LYS A N   1 
ATOM 8335 C CA  . LYS A 1 1084 ? 1.093   33.414  -27.768 1.00 68.26  ? 1081 LYS A CA  1 
ATOM 8336 C C   . LYS A 1 1084 ? 0.806   32.266  -26.851 1.00 68.26  ? 1081 LYS A C   1 
ATOM 8337 O O   . LYS A 1 1084 ? -0.062  31.451  -27.160 1.00 68.26  ? 1081 LYS A O   1 
ATOM 8338 C CB  . LYS A 1 1084 ? 0.019   34.490  -27.583 1.00 51.50  ? 1081 LYS A CB  1 
ATOM 8339 C CG  . LYS A 1 1084 ? -0.366  34.871  -26.148 1.00 51.50  ? 1081 LYS A CG  1 
ATOM 8340 C CD  . LYS A 1 1084 ? -1.032  36.267  -26.107 1.00 51.50  ? 1081 LYS A CD  1 
ATOM 8341 C CE  . LYS A 1 1084 ? -1.748  36.489  -24.780 1.00 51.50  ? 1081 LYS A CE  1 
ATOM 8342 N NZ  . LYS A 1 1084 ? -2.078  37.914  -24.434 1.00 51.50  ? 1081 LYS A NZ  1 
ATOM 8343 N N   . THR A 1 1085 ? 1.520   32.181  -25.728 1.00 47.92  ? 1082 THR A N   1 
ATOM 8344 C CA  . THR A 1 1085 ? 1.166   31.169  -24.737 1.00 47.92  ? 1082 THR A CA  1 
ATOM 8345 C C   . THR A 1 1085 ? 1.327   31.609  -23.271 1.00 47.92  ? 1082 THR A C   1 
ATOM 8346 O O   . THR A 1 1085 ? 2.439   31.717  -22.773 1.00 47.92  ? 1082 THR A O   1 
ATOM 8347 C CB  . THR A 1 1085 ? 1.842   29.789  -25.043 1.00 44.74  ? 1082 THR A CB  1 
ATOM 8348 O OG1 . THR A 1 1085 ? 1.657   29.447  -26.431 1.00 44.74  ? 1082 THR A OG1 1 
ATOM 8349 C CG2 . THR A 1 1085 ? 1.240   28.699  -24.174 1.00 44.74  ? 1082 THR A CG2 1 
ATOM 8350 N N   . GLU A 1 1086 ? 0.212   31.875  -22.595 1.00 50.68  ? 1083 GLU A N   1 
ATOM 8351 C CA  . GLU A 1 1086 ? 0.232   32.230  -21.184 1.00 50.68  ? 1083 GLU A CA  1 
ATOM 8352 C C   . GLU A 1 1086 ? -0.473  31.181  -20.309 1.00 50.68  ? 1083 GLU A C   1 
ATOM 8353 O O   . GLU A 1 1086 ? -1.346  30.456  -20.786 1.00 50.68  ? 1083 GLU A O   1 
ATOM 8354 C CB  . GLU A 1 1086 ? -0.438  33.589  -20.967 1.00 89.23  ? 1083 GLU A CB  1 
ATOM 8355 C CG  . GLU A 1 1086 ? 0.039   34.682  -21.886 1.00 89.23  ? 1083 GLU A CG  1 
ATOM 8356 C CD  . GLU A 1 1086 ? 1.564   34.819  -21.941 1.00 89.23  ? 1083 GLU A CD  1 
ATOM 8357 O OE1 . GLU A 1 1086 ? 2.081   34.908  -23.076 1.00 89.23  ? 1083 GLU A OE1 1 
ATOM 8358 O OE2 . GLU A 1 1086 ? 2.242   34.848  -20.876 1.00 89.23  ? 1083 GLU A OE2 1 
ATOM 8359 N N   . PRO A 1 1087 ? -0.110  31.091  -19.012 1.00 51.12  ? 1084 PRO A N   1 
ATOM 8360 C CA  . PRO A 1 1087 ? -0.856  30.214  -18.106 1.00 51.12  ? 1084 PRO A CA  1 
ATOM 8361 C C   . PRO A 1 1087 ? -2.204  30.829  -17.780 1.00 51.12  ? 1084 PRO A C   1 
ATOM 8362 O O   . PRO A 1 1087 ? -2.393  32.036  -17.958 1.00 51.12  ? 1084 PRO A O   1 
ATOM 8363 C CB  . PRO A 1 1087 ? 0.007   30.213  -16.851 1.00 39.86  ? 1084 PRO A CB  1 
ATOM 8364 C CG  . PRO A 1 1087 ? 1.369   30.698  -17.326 1.00 39.86  ? 1084 PRO A CG  1 
ATOM 8365 C CD  . PRO A 1 1087 ? 1.011   31.738  -18.310 1.00 39.86  ? 1084 PRO A CD  1 
ATOM 8366 N N   . ALA A 1 1088 ? -3.130  29.997  -17.312 1.00 45.58  ? 1085 ALA A N   1 
ATOM 8367 C CA  . ALA A 1 1088 ? -4.501  30.420  -17.061 1.00 45.58  ? 1085 ALA A CA  1 
ATOM 8368 C C   . ALA A 1 1088 ? -4.563  31.330  -15.854 1.00 45.58  ? 1085 ALA A C   1 
ATOM 8369 O O   . ALA A 1 1088 ? -3.866  31.106  -14.898 1.00 45.58  ? 1085 ALA A O   1 
ATOM 8370 C CB  . ALA A 1 1088 ? -5.407  29.188  -16.845 1.00 14.87  ? 1085 ALA A CB  1 
ATOM 8371 N N   . THR A 1 1089 ? -5.389  32.355  -15.895 1.00 33.17  ? 1086 THR A N   1 
ATOM 8372 C CA  . THR A 1 1089 ? -5.688  33.121  -14.701 1.00 33.17  ? 1086 THR A CA  1 
ATOM 8373 C C   . THR A 1 1089 ? -7.192  33.349  -14.572 1.00 33.17  ? 1086 THR A C   1 
ATOM 8374 O O   . THR A 1 1089 ? -7.901  33.443  -15.579 1.00 33.17  ? 1086 THR A O   1 
ATOM 8375 C CB  . THR A 1 1089 ? -4.967  34.490  -14.713 1.00 49.89  ? 1086 THR A CB  1 
ATOM 8376 O OG1 . THR A 1 1089 ? -5.374  35.273  -15.861 1.00 49.89  ? 1086 THR A OG1 1 
ATOM 8377 C CG2 . THR A 1 1089 ? -3.487  34.271  -14.731 1.00 49.89  ? 1086 THR A CG2 1 
ATOM 8378 N N   . GLY A 1 1090 ? -7.678  33.471  -13.344 1.00 50.00  ? 1087 GLY A N   1 
ATOM 8379 C CA  . GLY A 1 1090 ? -9.093  33.824  -13.137 1.00 50.00  ? 1087 GLY A CA  1 
ATOM 8380 C C   . GLY A 1 1090 ? -10.158 32.836  -13.617 1.00 50.00  ? 1087 GLY A C   1 
ATOM 8381 O O   . GLY A 1 1090 ? -11.349 33.177  -13.679 1.00 50.00  ? 1087 GLY A O   1 
ATOM 8382 N N   . PHE A 1 1091 ? -9.709  31.620  -13.934 1.00 48.57  ? 1088 PHE A N   1 
ATOM 8383 C CA  . PHE A 1 1091 ? -10.569 30.509  -14.282 1.00 48.57  ? 1088 PHE A CA  1 
ATOM 8384 C C   . PHE A 1 1091 ? -10.270 29.207  -13.487 1.00 48.57  ? 1088 PHE A C   1 
ATOM 8385 O O   . PHE A 1 1091 ? -9.109  28.902  -13.186 1.00 48.57  ? 1088 PHE A O   1 
ATOM 8386 C CB  . PHE A 1 1091 ? -10.458 30.247  -15.777 1.00 48.25  ? 1088 PHE A CB  1 
ATOM 8387 C CG  . PHE A 1 1091 ? -11.217 31.216  -16.615 1.00 48.25  ? 1088 PHE A CG  1 
ATOM 8388 C CD1 . PHE A 1 1091 ? -10.597 32.325  -17.158 1.00 48.25  ? 1088 PHE A CD1 1 
ATOM 8389 C CD2 . PHE A 1 1091 ? -12.564 31.020  -16.874 1.00 48.25  ? 1088 PHE A CD2 1 
ATOM 8390 C CE1 . PHE A 1 1091 ? -11.324 33.219  -17.944 1.00 48.25  ? 1088 PHE A CE1 1 
ATOM 8391 C CE2 . PHE A 1 1091 ? -13.267 31.895  -17.640 1.00 48.25  ? 1088 PHE A CE2 1 
ATOM 8392 C CZ  . PHE A 1 1091 ? -12.655 32.991  -18.180 1.00 48.25  ? 1088 PHE A CZ  1 
ATOM 8393 N N   . ILE A 1 1092 ? -11.323 28.427  -13.208 1.00 60.21  ? 1089 ILE A N   1 
ATOM 8394 C CA  . ILE A 1 1092 ? -11.247 27.169  -12.437 1.00 60.21  ? 1089 ILE A CA  1 
ATOM 8395 C C   . ILE A 1 1092 ? -11.997 25.983  -13.113 1.00 60.21  ? 1089 ILE A C   1 
ATOM 8396 O O   . ILE A 1 1092 ? -13.196 26.125  -13.398 1.00 60.21  ? 1089 ILE A O   1 
ATOM 8397 C CB  . ILE A 1 1092 ? -11.855 27.415  -11.023 1.00 68.40  ? 1089 ILE A CB  1 
ATOM 8398 C CG1 . ILE A 1 1092 ? -11.076 28.518  -10.306 1.00 68.40  ? 1089 ILE A CG1 1 
ATOM 8399 C CG2 . ILE A 1 1092 ? -11.898 26.137  -10.208 1.00 68.40  ? 1089 ILE A CG2 1 
ATOM 8400 C CD1 . ILE A 1 1092 ? -11.443 28.713  -8.881  1.00 68.40  ? 1089 ILE A CD1 1 
ATOM 8401 N N   . ASP A 1 1093 ? -11.369 24.818  -13.371 1.00 39.97  ? 1090 ASP A N   1 
ATOM 8402 C CA  . ASP A 1 1093 ? -12.275 23.671  -13.666 1.00 39.97  ? 1090 ASP A CA  1 
ATOM 8403 C C   . ASP A 1 1093 ? -12.734 22.999  -12.434 1.00 39.97  ? 1090 ASP A C   1 
ATOM 8404 O O   . ASP A 1 1093 ? -11.953 22.355  -11.720 1.00 39.97  ? 1090 ASP A O   1 
ATOM 8405 C CB  . ASP A 1 1093 ? -11.912 22.625  -14.763 1.00 43.19  ? 1090 ASP A CB  1 
ATOM 8406 C CG  . ASP A 1 1093 ? -10.506 22.559  -15.034 1.00 43.19  ? 1090 ASP A CG  1 
ATOM 8407 O OD1 . ASP A 1 1093 ? -10.128 21.700  -15.837 1.00 43.19  ? 1090 ASP A OD1 1 
ATOM 8408 O OD2 . ASP A 1 1093 ? -9.796  23.385  -14.460 1.00 43.19  ? 1090 ASP A OD2 1 
ATOM 8409 N N   . GLY A 1 1094 ? -14.031 23.180  -12.214 1.00 45.80  ? 1091 GLY A N   1 
ATOM 8410 C CA  . GLY A 1 1094 ? -14.789 22.321  -11.341 1.00 45.80  ? 1091 GLY A CA  1 
ATOM 8411 C C   . GLY A 1 1094 ? -14.592 20.940  -11.863 1.00 45.80  ? 1091 GLY A C   1 
ATOM 8412 O O   . GLY A 1 1094 ? -14.623 20.012  -11.127 1.00 45.80  ? 1091 GLY A O   1 
ATOM 8413 N N   . ASP A 1 1095 ? -14.325 20.836  -13.150 1.00 46.67  ? 1092 ASP A N   1 
ATOM 8414 C CA  . ASP A 1 1095 ? -14.033 19.578  -13.765 1.00 46.67  ? 1092 ASP A CA  1 
ATOM 8415 C C   . ASP A 1 1095 ? -12.916 18.922  -13.026 1.00 46.67  ? 1092 ASP A C   1 
ATOM 8416 O O   . ASP A 1 1095 ? -13.007 17.756  -12.709 1.00 46.67  ? 1092 ASP A O   1 
ATOM 8417 C CB  . ASP A 1 1095 ? -13.675 19.785  -15.220 1.00 39.42  ? 1092 ASP A CB  1 
ATOM 8418 C CG  . ASP A 1 1095 ? -14.843 19.437  -16.172 1.00 39.42  ? 1092 ASP A CG  1 
ATOM 8419 O OD1 . ASP A 1 1095 ? -16.015 19.473  -15.724 1.00 39.42  ? 1092 ASP A OD1 1 
ATOM 8420 O OD2 . ASP A 1 1095 ? -14.587 19.129  -17.370 1.00 39.42  ? 1092 ASP A OD2 1 
ATOM 8421 N N   . LEU A 1 1096 ? -11.878 19.693  -12.720 1.00 64.55  ? 1093 LEU A N   1 
ATOM 8422 C CA  . LEU A 1 1096 ? -10.746 19.211  -11.931 1.00 64.55  ? 1093 LEU A CA  1 
ATOM 8423 C C   . LEU A 1 1096 ? -11.077 19.237  -10.462 1.00 64.55  ? 1093 LEU A C   1 
ATOM 8424 O O   . LEU A 1 1096 ? -10.784 18.288  -9.745  1.00 64.55  ? 1093 LEU A O   1 
ATOM 8425 C CB  . LEU A 1 1096 ? -9.503  20.066  -12.172 1.00 37.40  ? 1093 LEU A CB  1 
ATOM 8426 C CG  . LEU A 1 1096 ? -8.115  19.667  -11.629 1.00 37.40  ? 1093 LEU A CG  1 
ATOM 8427 C CD1 . LEU A 1 1096 ? -7.696  20.499  -10.410 1.00 37.40  ? 1093 LEU A CD1 1 
ATOM 8428 C CD2 . LEU A 1 1096 ? -7.993  18.211  -11.350 1.00 37.40  ? 1093 LEU A CD2 1 
ATOM 8429 N N   . ILE A 1 1097 ? -11.666 20.333  -10.003 1.00 46.59  ? 1094 ILE A N   1 
ATOM 8430 C CA  . ILE A 1 1097 ? -12.104 20.364  -8.635  1.00 46.59  ? 1094 ILE A CA  1 
ATOM 8431 C C   . ILE A 1 1097 ? -12.888 19.090  -8.385  1.00 46.59  ? 1094 ILE A C   1 
ATOM 8432 O O   . ILE A 1 1097 ? -12.511 18.308  -7.544  1.00 46.59  ? 1094 ILE A O   1 
ATOM 8433 C CB  . ILE A 1 1097 ? -12.971 21.588  -8.305  1.00 37.66  ? 1094 ILE A CB  1 
ATOM 8434 C CG1 . ILE A 1 1097 ? -12.208 22.917  -8.506  1.00 37.66  ? 1094 ILE A CG1 1 
ATOM 8435 C CG2 . ILE A 1 1097 ? -13.558 21.470  -6.910  1.00 37.66  ? 1094 ILE A CG2 1 
ATOM 8436 C CD1 . ILE A 1 1097 ? -10.767 23.037  -7.875  1.00 37.66  ? 1094 ILE A CD1 1 
ATOM 8437 N N   . GLU A 1 1098 ? -13.934 18.845  -9.164  1.00 77.96  ? 1095 GLU A N   1 
ATOM 8438 C CA  . GLU A 1 1098 ? -14.849 17.737  -8.893  1.00 77.96  ? 1095 GLU A CA  1 
ATOM 8439 C C   . GLU A 1 1098 ? -14.149 16.397  -8.775  1.00 77.96  ? 1095 GLU A C   1 
ATOM 8440 O O   . GLU A 1 1098 ? -14.584 15.551  -7.990  1.00 77.96  ? 1095 GLU A O   1 
ATOM 8441 C CB  . GLU A 1 1098 ? -15.966 17.670  -9.934  1.00 65.00  ? 1095 GLU A CB  1 
ATOM 8442 C CG  . GLU A 1 1098 ? -17.132 18.639  -9.649  1.00 65.00  ? 1095 GLU A CG  1 
ATOM 8443 C CD  . GLU A 1 1098 ? -18.240 18.608  -10.720 1.00 65.00  ? 1095 GLU A CD  1 
ATOM 8444 O OE1 . GLU A 1 1098 ? -18.309 17.631  -11.517 1.00 65.00  ? 1095 GLU A OE1 1 
ATOM 8445 O OE2 . GLU A 1 1098 ? -19.043 19.576  -10.765 1.00 65.00  ? 1095 GLU A OE2 1 
ATOM 8446 N N   . SER A 1 1099 ? -13.064 16.226  -9.535  1.00 63.36  ? 1096 SER A N   1 
ATOM 8447 C CA  . SER A 1 1099 ? -12.209 15.035  -9.468  1.00 63.36  ? 1096 SER A CA  1 
ATOM 8448 C C   . SER A 1 1099 ? -11.949 14.615  -8.029  1.00 63.36  ? 1096 SER A C   1 
ATOM 8449 O O   . SER A 1 1099 ? -11.948 13.431  -7.727  1.00 63.36  ? 1096 SER A O   1 
ATOM 8450 C CB  . SER A 1 1099 ? -10.861 15.286  -10.150 1.00 149.87 ? 1096 SER A CB  1 
ATOM 8451 O OG  . SER A 1 1099 ? -10.973 16.185  -11.237 1.00 149.87 ? 1096 SER A OG  1 
ATOM 8452 N N   . PHE A 1 1100 ? -11.728 15.594  -7.150  1.00 70.84  ? 1097 PHE A N   1 
ATOM 8453 C CA  . PHE A 1 1100 ? -11.538 15.355  -5.721  1.00 70.84  ? 1097 PHE A CA  1 
ATOM 8454 C C   . PHE A 1 1100 ? -12.281 14.115  -5.234  1.00 70.84  ? 1097 PHE A C   1 
ATOM 8455 O O   . PHE A 1 1100 ? -11.659 13.113  -4.930  1.00 70.84  ? 1097 PHE A O   1 
ATOM 8456 C CB  . PHE A 1 1100 ? -11.974 16.575  -4.924  1.00 81.23  ? 1097 PHE A CB  1 
ATOM 8457 C CG  . PHE A 1 1100 ? -11.588 16.548  -3.461  1.00 81.23  ? 1097 PHE A CG  1 
ATOM 8458 C CD1 . PHE A 1 1100 ? -10.263 16.717  -3.066  1.00 81.23  ? 1097 PHE A CD1 1 
ATOM 8459 C CD2 . PHE A 1 1100 ? -12.571 16.432  -2.471  1.00 81.23  ? 1097 PHE A CD2 1 
ATOM 8460 C CE1 . PHE A 1 1100 ? -9.920  16.742  -1.718  1.00 81.23  ? 1097 PHE A CE1 1 
ATOM 8461 C CE2 . PHE A 1 1100 ? -12.234 16.455  -1.120  1.00 81.23  ? 1097 PHE A CE2 1 
ATOM 8462 C CZ  . PHE A 1 1100 ? -10.906 16.615  -0.747  1.00 81.23  ? 1097 PHE A CZ  1 
ATOM 8463 N N   . LEU A 1 1101 ? -13.607 14.177  -5.212  1.00 51.49  ? 1098 LEU A N   1 
ATOM 8464 C CA  . LEU A 1 1101 ? -14.463 13.095  -4.720  1.00 51.49  ? 1098 LEU A CA  1 
ATOM 8465 C C   . LEU A 1 1101 ? -14.116 11.685  -5.146  1.00 51.49  ? 1098 LEU A C   1 
ATOM 8466 O O   . LEU A 1 1101 ? -14.321 10.774  -4.366  1.00 51.49  ? 1098 LEU A O   1 
ATOM 8467 C CB  . LEU A 1 1101 ? -15.905 13.345  -5.115  1.00 51.24  ? 1098 LEU A CB  1 
ATOM 8468 C CG  . LEU A 1 1101 ? -16.484 14.733  -4.857  1.00 51.24  ? 1098 LEU A CG  1 
ATOM 8469 C CD1 . LEU A 1 1101 ? -17.766 14.825  -5.619  1.00 51.24  ? 1098 LEU A CD1 1 
ATOM 8470 C CD2 . LEU A 1 1101 ? -16.692 15.032  -3.352  1.00 51.24  ? 1098 LEU A CD2 1 
ATOM 8471 N N   . ASP A 1 1102 ? -13.619 11.475  -6.363  1.00 70.61  ? 1099 ASP A N   1 
ATOM 8472 C CA  . ASP A 1 1102 ? -13.321 10.103  -6.824  1.00 70.61  ? 1099 ASP A CA  1 
ATOM 8473 C C   . ASP A 1 1102 ? -11.935 9.626   -6.395  1.00 70.61  ? 1099 ASP A C   1 
ATOM 8474 O O   . ASP A 1 1102 ? -11.406 8.645   -6.918  1.00 70.61  ? 1099 ASP A O   1 
ATOM 8475 C CB  . ASP A 1 1102 ? -13.474 9.985   -8.343  1.00 106.89 ? 1099 ASP A CB  1 
ATOM 8476 C CG  . ASP A 1 1102 ? -14.801 10.526  -8.842  1.00 106.89 ? 1099 ASP A CG  1 
ATOM 8477 O OD1 . ASP A 1 1102 ? -15.818 10.366  -8.133  1.00 106.89 ? 1099 ASP A OD1 1 
ATOM 8478 O OD2 . ASP A 1 1102 ? -14.822 11.113  -9.948  1.00 106.89 ? 1099 ASP A OD2 1 
ATOM 8479 N N   . ILE A 1 1103 ? -11.357 10.339  -5.438  1.00 93.28  ? 1100 ILE A N   1 
ATOM 8480 C CA  . ILE A 1 1103 ? -10.035 10.055  -4.922  1.00 93.28  ? 1100 ILE A CA  1 
ATOM 8481 C C   . ILE A 1 1103 ? -10.175 9.345   -3.589  1.00 93.28  ? 1100 ILE A C   1 
ATOM 8482 O O   . ILE A 1 1103 ? -11.107 9.598   -2.835  1.00 93.28  ? 1100 ILE A O   1 
ATOM 8483 C CB  . ILE A 1 1103 ? -9.227  11.363  -4.808  1.00 98.79  ? 1100 ILE A CB  1 
ATOM 8484 C CG1 . ILE A 1 1103 ? -8.310  11.512  -6.009  1.00 98.79  ? 1100 ILE A CG1 1 
ATOM 8485 C CG2 . ILE A 1 1103 ? -8.430  11.451  -3.524  1.00 98.79  ? 1100 ILE A CG2 1 
ATOM 8486 C CD1 . ILE A 1 1103 ? -7.595  12.832  -6.045  1.00 98.79  ? 1100 ILE A CD1 1 
ATOM 8487 N N   . SER A 1 1104 ? -9.253  8.430   -3.323  1.00 117.19 ? 1101 SER A N   1 
ATOM 8488 C CA  . SER A 1 1104 ? -9.253  7.646   -2.101  1.00 117.19 ? 1101 SER A CA  1 
ATOM 8489 C C   . SER A 1 1104 ? -8.951  8.558   -0.918  1.00 117.19 ? 1101 SER A C   1 
ATOM 8490 O O   . SER A 1 1104 ? -8.092  9.424   -1.016  1.00 117.19 ? 1101 SER A O   1 
ATOM 8491 C CB  . SER A 1 1104 ? -8.156  6.606   -2.198  1.00 54.90  ? 1101 SER A CB  1 
ATOM 8492 O OG  . SER A 1 1104 ? -6.925  7.282   -2.008  1.00 54.90  ? 1101 SER A OG  1 
ATOM 8493 N N   . ARG A 1 1105 ? -9.632  8.328   0.202   1.00 179.25 ? 1102 ARG A N   1 
ATOM 8494 C CA  . ARG A 1 1105 ? -9.431  9.116   1.425   1.00 179.25 ? 1102 ARG A CA  1 
ATOM 8495 C C   . ARG A 1 1105 ? -7.954  9.355   1.783   1.00 179.25 ? 1102 ARG A C   1 
ATOM 8496 O O   . ARG A 1 1105 ? -7.607  10.446  2.231   1.00 179.25 ? 1102 ARG A O   1 
ATOM 8497 C CB  . ARG A 1 1105 ? -10.194 8.498   2.606   1.00 130.00 ? 1102 ARG A CB  1 
ATOM 8498 C CG  . ARG A 1 1105 ? -10.345 9.408   3.824   1.00 130.00 ? 1102 ARG A CG  1 
ATOM 8499 C CD  . ARG A 1 1105 ? -11.448 8.913   4.771   1.00 130.00 ? 1102 ARG A CD  1 
ATOM 8500 N NE  . ARG A 1 1105 ? -11.432 9.607   6.063   1.00 130.00 ? 1102 ARG A NE  1 
ATOM 8501 C CZ  . ARG A 1 1105 ? -11.927 10.829  6.277   1.00 130.00 ? 1102 ARG A CZ  1 
ATOM 8502 N NH1 . ARG A 1 1105 ? -12.478 11.523  5.288   1.00 130.00 ? 1102 ARG A NH1 1 
ATOM 8503 N NH2 . ARG A 1 1105 ? -11.867 11.369  7.486   1.00 130.00 ? 1102 ARG A NH2 1 
ATOM 8504 N N   . PRO A 1 1106 ? -7.087  8.335   1.607   1.00 99.08  ? 1103 PRO A N   1 
ATOM 8505 C CA  . PRO A 1 1106 ? -5.631  8.536   1.787   1.00 99.08  ? 1103 PRO A CA  1 
ATOM 8506 C C   . PRO A 1 1106 ? -5.022  9.607   0.886   1.00 99.08  ? 1103 PRO A C   1 
ATOM 8507 O O   . PRO A 1 1106 ? -4.399  10.549  1.384   1.00 99.08  ? 1103 PRO A O   1 
ATOM 8508 C CB  . PRO A 1 1106 ? -5.019  7.165   1.453   1.00 86.14  ? 1103 PRO A CB  1 
ATOM 8509 C CG  . PRO A 1 1106 ? -6.123  6.348   0.864   1.00 86.14  ? 1103 PRO A CG  1 
ATOM 8510 C CD  . PRO A 1 1106 ? -7.423  6.930   1.310   1.00 86.14  ? 1103 PRO A CD  1 
ATOM 8511 N N   . LYS A 1 1107 ? -5.203  9.451   -0.425  1.00 98.60  ? 1104 LYS A N   1 
ATOM 8512 C CA  . LYS A 1 1107 ? -4.716  10.414  -1.407  1.00 98.60  ? 1104 LYS A CA  1 
ATOM 8513 C C   . LYS A 1 1107 ? -5.419  11.744  -1.196  1.00 98.60  ? 1104 LYS A C   1 
ATOM 8514 O O   . LYS A 1 1107 ? -4.926  12.796  -1.570  1.00 98.60  ? 1104 LYS A O   1 
ATOM 8515 C CB  . LYS A 1 1107 ? -4.942  9.883   -2.826  1.00 173.14 ? 1104 LYS A CB  1 
ATOM 8516 C CG  . LYS A 1 1107 ? -4.016  8.728   -3.228  1.00 173.14 ? 1104 LYS A CG  1 
ATOM 8517 C CD  . LYS A 1 1107 ? -2.612  9.220   -3.594  1.00 173.14 ? 1104 LYS A CD  1 
ATOM 8518 C CE  . LYS A 1 1107 ? -1.626  8.075   -3.802  1.00 173.14 ? 1104 LYS A CE  1 
ATOM 8519 N NZ  . LYS A 1 1107 ? -1.197  7.433   -2.525  1.00 173.14 ? 1104 LYS A NZ  1 
ATOM 8520 N N   . MET A 1 1108 ? -6.568  11.667  -0.547  1.00 64.81  ? 1105 MET A N   1 
ATOM 8521 C CA  . MET A 1 1108 ? -7.429  12.803  -0.279  1.00 64.81  ? 1105 MET A CA  1 
ATOM 8522 C C   . MET A 1 1108 ? -6.864  13.509  0.915   1.00 64.81  ? 1105 MET A C   1 
ATOM 8523 O O   . MET A 1 1108 ? -6.763  14.728  0.918   1.00 64.81  ? 1105 MET A O   1 
ATOM 8524 C CB  . MET A 1 1108 ? -8.853  12.315  0.002   1.00 77.51  ? 1105 MET A CB  1 
ATOM 8525 C CG  . MET A 1 1108 ? -9.874  13.369  0.373   1.00 77.51  ? 1105 MET A CG  1 
ATOM 8526 S SD  . MET A 1 1108 ? -11.539 12.695  0.693   1.00 77.51  ? 1105 MET A SD  1 
ATOM 8527 C CE  . MET A 1 1108 ? -11.771 11.508  -0.643  1.00 77.51  ? 1105 MET A CE  1 
ATOM 8528 N N   . GLN A 1 1109 ? -6.468  12.732  1.926   1.00 91.87  ? 1106 GLN A N   1 
ATOM 8529 C CA  . GLN A 1 1109 ? -5.810  13.277  3.121   1.00 91.87  ? 1106 GLN A CA  1 
ATOM 8530 C C   . GLN A 1 1109 ? -4.718  14.274  2.779   1.00 91.87  ? 1106 GLN A C   1 
ATOM 8531 O O   . GLN A 1 1109 ? -4.751  15.409  3.260   1.00 91.87  ? 1106 GLN A O   1 
ATOM 8532 C CB  . GLN A 1 1109 ? -5.245  12.157  3.995   1.00 89.06  ? 1106 GLN A CB  1 
ATOM 8533 C CG  . GLN A 1 1109 ? -6.268  11.531  4.907   1.00 89.06  ? 1106 GLN A CG  1 
ATOM 8534 C CD  . GLN A 1 1109 ? -7.125  12.569  5.617   1.00 89.06  ? 1106 GLN A CD  1 
ATOM 8535 O OE1 . GLN A 1 1109 ? -6.665  13.680  5.921   1.00 89.06  ? 1106 GLN A OE1 1 
ATOM 8536 N NE2 . GLN A 1 1109 ? -8.387  12.213  5.884   1.00 89.06  ? 1106 GLN A NE2 1 
ATOM 8537 N N   . GLU A 1 1110 ? -3.790  13.833  1.922   1.00 78.58  ? 1107 GLU A N   1 
ATOM 8538 C CA  . GLU A 1 1110 ? -2.614  14.602  1.483   1.00 78.58  ? 1107 GLU A CA  1 
ATOM 8539 C C   . GLU A 1 1110 ? -2.913  16.025  1.081   1.00 78.58  ? 1107 GLU A C   1 
ATOM 8540 O O   . GLU A 1 1110 ? -2.120  16.931  1.367   1.00 78.58  ? 1107 GLU A O   1 
ATOM 8541 C CB  . GLU A 1 1110 ? -1.968  13.956  0.269   1.00 78.77  ? 1107 GLU A CB  1 
ATOM 8542 C CG  . GLU A 1 1110 ? -1.584  12.508  0.421   1.00 78.77  ? 1107 GLU A CG  1 
ATOM 8543 C CD  . GLU A 1 1110 ? -0.743  12.035  -0.745  1.00 78.77  ? 1107 GLU A CD  1 
ATOM 8544 O OE1 . GLU A 1 1110 ? 0.050   12.866  -1.249  1.00 78.77  ? 1107 GLU A OE1 1 
ATOM 8545 O OE2 . GLU A 1 1110 ? -0.882  10.856  -1.154  1.00 78.77  ? 1107 GLU A OE2 1 
ATOM 8546 N N   . VAL A 1 1111 ? -4.047  16.203  0.403   1.00 105.56 ? 1108 VAL A N   1 
ATOM 8547 C CA  . VAL A 1 1111 ? -4.444  17.484  -0.178  1.00 105.56 ? 1108 VAL A CA  1 
ATOM 8548 C C   . VAL A 1 1111 ? -4.687  18.521  0.914   1.00 105.56 ? 1108 VAL A C   1 
ATOM 8549 O O   . VAL A 1 1111 ? -5.002  19.682  0.651   1.00 105.56 ? 1108 VAL A O   1 
ATOM 8550 C CB  . VAL A 1 1111 ? -5.681  17.338  -1.095  1.00 94.10  ? 1108 VAL A CB  1 
ATOM 8551 C CG1 . VAL A 1 1111 ? -5.681  18.424  -2.135  1.00 94.10  ? 1108 VAL A CG1 1 
ATOM 8552 C CG2 . VAL A 1 1111 ? -5.683  15.989  -1.801  1.00 94.10  ? 1108 VAL A CG2 1 
ATOM 8553 N N   . VAL A 1 1112 ? -4.530  18.085  2.154   1.00 121.15 ? 1109 VAL A N   1 
ATOM 8554 C CA  . VAL A 1 1112 ? -4.422  19.020  3.250   1.00 121.15 ? 1109 VAL A CA  1 
ATOM 8555 C C   . VAL A 1 1112 ? -3.210  18.762  4.132   1.00 121.15 ? 1109 VAL A C   1 
ATOM 8556 O O   . VAL A 1 1112 ? -3.047  17.692  4.722   1.00 121.15 ? 1109 VAL A O   1 
ATOM 8557 C CB  . VAL A 1 1112 ? -5.660  19.045  4.119   1.00 52.41  ? 1109 VAL A CB  1 
ATOM 8558 C CG1 . VAL A 1 1112 ? -5.555  20.247  5.101   1.00 52.41  ? 1109 VAL A CG1 1 
ATOM 8559 C CG2 . VAL A 1 1112 ? -6.949  19.042  3.237   1.00 52.41  ? 1109 VAL A CG2 1 
ATOM 8560 N N   . ALA A 1 1113 ? -2.359  19.774  4.183   1.00 146.92 ? 1110 ALA A N   1 
ATOM 8561 C CA  . ALA A 1 1113 ? -1.274  19.860  5.124   1.00 146.92 ? 1110 ALA A CA  1 
ATOM 8562 C C   . ALA A 1 1113 ? -1.600  21.125  5.906   1.00 146.92 ? 1110 ALA A C   1 
ATOM 8563 O O   . ALA A 1 1113 ? -1.158  21.314  7.037   1.00 146.92 ? 1110 ALA A O   1 
ATOM 8564 C CB  . ALA A 1 1113 ? 0.033   19.982  4.377   1.00 46.41  ? 1110 ALA A CB  1 
ATOM 8565 N N   . ASN A 1 1114 ? -2.389  21.976  5.252   1.00 81.87  ? 1111 ASN A N   1 
ATOM 8566 C CA  . ASN A 1 1114 ? -3.117  23.107  5.853   1.00 81.87  ? 1111 ASN A CA  1 
ATOM 8567 C C   . ASN A 1 1114 ? -4.389  23.469  5.044   1.00 81.87  ? 1111 ASN A C   1 
ATOM 8568 O O   . ASN A 1 1114 ? -4.594  24.611  4.608   1.00 81.87  ? 1111 ASN A O   1 
ATOM 8569 C CB  . ASN A 1 1114 ? -2.211  24.330  6.023   1.00 116.39 ? 1111 ASN A CB  1 
ATOM 8570 C CG  . ASN A 1 1114 ? -1.438  24.658  4.764   1.00 116.39 ? 1111 ASN A CG  1 
ATOM 8571 O OD1 . ASN A 1 1114 ? -0.659  23.840  4.276   1.00 116.39 ? 1111 ASN A OD1 1 
ATOM 8572 N ND2 . ASN A 1 1114 ? -1.645  25.856  4.235   1.00 116.39 ? 1111 ASN A ND2 1 
ATOM 8573 N N   . ARG A 1 1125 ? -9.656  31.403  10.237  1.00 90.12  ? 1122 ARG A N   1 
ATOM 8574 C CA  . ARG A 1 1125 ? -9.214  30.502  9.168   1.00 90.12  ? 1122 ARG A CA  1 
ATOM 8575 C C   . ARG A 1 1125 ? -8.534  29.222  9.702   1.00 90.12  ? 1122 ARG A C   1 
ATOM 8576 O O   . ARG A 1 1125 ? -7.851  29.250  10.737  1.00 90.12  ? 1122 ARG A O   1 
ATOM 8577 C CB  . ARG A 1 1125 ? -8.315  31.244  8.166   1.00 127.75 ? 1122 ARG A CB  1 
ATOM 8578 C CG  . ARG A 1 1125 ? -7.069  31.868  8.772   1.00 127.75 ? 1122 ARG A CG  1 
ATOM 8579 C CD  . ARG A 1 1125 ? -5.942  31.909  7.758   1.00 127.75 ? 1122 ARG A CD  1 
ATOM 8580 N NE  . ARG A 1 1125 ? -4.620  31.951  8.388   1.00 127.75 ? 1122 ARG A NE  1 
ATOM 8581 C CZ  . ARG A 1 1125 ? -3.960  30.889  8.859   1.00 127.75 ? 1122 ARG A CZ  1 
ATOM 8582 N NH1 . ARG A 1 1125 ? -4.492  29.671  8.795   1.00 127.75 ? 1122 ARG A NH1 1 
ATOM 8583 N NH2 . ARG A 1 1125 ? -2.762  31.046  9.406   1.00 127.75 ? 1122 ARG A NH2 1 
ATOM 8584 N N   . GLU A 1 1126 ? -8.713  28.110  8.978   1.00 154.65 ? 1123 GLU A N   1 
ATOM 8585 C CA  . GLU A 1 1126 ? -8.378  26.778  9.495   1.00 154.65 ? 1123 GLU A CA  1 
ATOM 8586 C C   . GLU A 1 1126 ? -7.899  25.768  8.438   1.00 154.65 ? 1123 GLU A C   1 
ATOM 8587 O O   . GLU A 1 1126 ? -7.662  26.122  7.278   1.00 154.65 ? 1123 GLU A O   1 
ATOM 8588 C CB  . GLU A 1 1126 ? -9.602  26.215  10.217  1.00 141.08 ? 1123 GLU A CB  1 
ATOM 8589 C CG  . GLU A 1 1126 ? -9.295  25.310  11.383  1.00 141.08 ? 1123 GLU A CG  1 
ATOM 8590 C CD  . GLU A 1 1126 ? -10.528 24.594  11.868  1.00 141.08 ? 1123 GLU A CD  1 
ATOM 8591 O OE1 . GLU A 1 1126 ? -11.100 23.788  11.090  1.00 141.08 ? 1123 GLU A OE1 1 
ATOM 8592 O OE2 . GLU A 1 1126 ? -10.930 24.837  13.029  1.00 141.08 ? 1123 GLU A OE2 1 
ATOM 8593 N N   . ALA A 1 1127 ? -7.758  24.514  8.871   1.00 152.99 ? 1124 ALA A N   1 
ATOM 8594 C CA  . ALA A 1 1127 ? -7.383  23.384  8.024   1.00 152.99 ? 1124 ALA A CA  1 
ATOM 8595 C C   . ALA A 1 1127 ? -8.218  22.162  8.407   1.00 152.99 ? 1124 ALA A C   1 
ATOM 8596 O O   . ALA A 1 1127 ? -8.423  21.902  9.598   1.00 152.99 ? 1124 ALA A O   1 
ATOM 8597 C CB  . ALA A 1 1127 ? -5.905  23.075  8.181   1.00 116.82 ? 1124 ALA A CB  1 
ATOM 8598 N N   . THR A 1 1128 ? -8.694  21.417  7.405   1.00 113.00 ? 1125 THR A N   1 
ATOM 8599 C CA  . THR A 1 1128 ? -9.569  20.255  7.651   1.00 113.00 ? 1125 THR A CA  1 
ATOM 8600 C C   . THR A 1 1128 ? -9.285  19.083  6.723   1.00 113.00 ? 1125 THR A C   1 
ATOM 8601 O O   . THR A 1 1128 ? -8.125  18.804  6.446   1.00 113.00 ? 1125 THR A O   1 
ATOM 8602 C CB  . THR A 1 1128 ? -11.057 20.610  7.556   1.00 65.95  ? 1125 THR A CB  1 
ATOM 8603 O OG1 . THR A 1 1128 ? -11.279 21.892  8.172   1.00 65.95  ? 1125 THR A OG1 1 
ATOM 8604 C CG2 . THR A 1 1128 ? -11.918 19.510  8.246   1.00 65.95  ? 1125 THR A CG2 1 
ATOM 8605 N N   . ALA A 1 1129 ? -10.348 18.413  6.250   1.00 93.54  ? 1126 ALA A N   1 
ATOM 8606 C CA  . ALA A 1 1129 ? -10.237 17.150  5.505   1.00 93.54  ? 1126 ALA A CA  1 
ATOM 8607 C C   . ALA A 1 1129 ? -11.537 16.719  4.836   1.00 93.54  ? 1126 ALA A C   1 
ATOM 8608 O O   . ALA A 1 1129 ? -11.527 16.171  3.739   1.00 93.54  ? 1126 ALA A O   1 
ATOM 8609 C CB  . ALA A 1 1129 ? -9.732  16.028  6.430   1.00 122.05 ? 1126 ALA A CB  1 
ATOM 8610 N N   . ASP A 1 1130 ? -12.652 16.939  5.520   1.00 88.98  ? 1127 ASP A N   1 
ATOM 8611 C CA  . ASP A 1 1130 ? -13.954 16.474  5.039   1.00 88.98  ? 1127 ASP A CA  1 
ATOM 8612 C C   . ASP A 1 1130 ? -14.859 17.671  4.788   1.00 88.98  ? 1127 ASP A C   1 
ATOM 8613 O O   . ASP A 1 1130 ? -15.893 17.551  4.141   1.00 88.98  ? 1127 ASP A O   1 
ATOM 8614 C CB  . ASP A 1 1130 ? -14.604 15.506  6.041   1.00 136.80 ? 1127 ASP A CB  1 
ATOM 8615 C CG  . ASP A 1 1130 ? -13.586 14.624  6.767   1.00 136.80 ? 1127 ASP A CG  1 
ATOM 8616 O OD1 . ASP A 1 1130 ? -12.703 15.171  7.465   1.00 136.80 ? 1127 ASP A OD1 1 
ATOM 8617 O OD2 . ASP A 1 1130 ? -13.683 13.384  6.659   1.00 136.80 ? 1127 ASP A OD2 1 
ATOM 8618 N N   . ASP A 1 1131 ? -14.462 18.827  5.311   1.00 124.62 ? 1128 ASP A N   1 
ATOM 8619 C CA  . ASP A 1 1131 ? -15.088 20.098  4.955   1.00 124.62 ? 1128 ASP A CA  1 
ATOM 8620 C C   . ASP A 1 1131 ? -15.088 20.249  3.444   1.00 124.62 ? 1128 ASP A C   1 
ATOM 8621 O O   . ASP A 1 1131 ? -16.084 20.649  2.841   1.00 124.62 ? 1128 ASP A O   1 
ATOM 8622 C CB  . ASP A 1 1131 ? -14.303 21.271  5.552   1.00 128.86 ? 1128 ASP A CB  1 
ATOM 8623 C CG  . ASP A 1 1131 ? -14.806 21.696  6.915   1.00 128.86 ? 1128 ASP A CG  1 
ATOM 8624 O OD1 . ASP A 1 1131 ? -14.670 22.893  7.235   1.00 128.86 ? 1128 ASP A OD1 1 
ATOM 8625 O OD2 . ASP A 1 1131 ? -15.322 20.844  7.666   1.00 128.86 ? 1128 ASP A OD2 1 
ATOM 8626 N N   . LEU A 1 1132 ? -13.949 19.912  2.850   1.00 62.25  ? 1129 LEU A N   1 
ATOM 8627 C CA  . LEU A 1 1132 ? -13.709 20.113  1.430   1.00 62.25  ? 1129 LEU A CA  1 
ATOM 8628 C C   . LEU A 1 1132 ? -14.562 19.196  0.585   1.00 62.25  ? 1129 LEU A C   1 
ATOM 8629 O O   . LEU A 1 1132 ? -15.141 19.630  -0.410  1.00 62.25  ? 1129 LEU A O   1 
ATOM 8630 C CB  . LEU A 1 1132 ? -12.218 19.983  1.118   1.00 71.68  ? 1129 LEU A CB  1 
ATOM 8631 C CG  . LEU A 1 1132 ? -11.415 21.224  1.562   1.00 71.68  ? 1129 LEU A CG  1 
ATOM 8632 C CD1 . LEU A 1 1132 ? -11.330 22.204  0.438   1.00 71.68  ? 1129 LEU A CD1 1 
ATOM 8633 C CD2 . LEU A 1 1132 ? -11.943 21.945  2.832   1.00 71.68  ? 1129 LEU A CD2 1 
ATOM 8634 N N   . ILE A 1 1133 ? -14.664 17.938  1.007   1.00 80.16  ? 1130 ILE A N   1 
ATOM 8635 C CA  . ILE A 1 1133 ? -15.653 17.020  0.442   1.00 80.16  ? 1130 ILE A CA  1 
ATOM 8636 C C   . ILE A 1 1133 ? -17.055 17.701  0.358   1.00 80.16  ? 1130 ILE A C   1 
ATOM 8637 O O   . ILE A 1 1133 ? -17.656 17.784  -0.717  1.00 80.16  ? 1130 ILE A O   1 
ATOM 8638 C CB  . ILE A 1 1133 ? -15.627 15.646  1.203   1.00 89.79  ? 1130 ILE A CB  1 
ATOM 8639 C CG1 . ILE A 1 1133 ? -16.012 14.488  0.281   1.00 89.79  ? 1130 ILE A CG1 1 
ATOM 8640 C CG2 . ILE A 1 1133 ? -16.492 15.657  2.445   1.00 89.79  ? 1130 ILE A CG2 1 
ATOM 8641 C CD1 . ILE A 1 1133 ? -15.384 13.163  0.676   1.00 89.79  ? 1130 ILE A CD1 1 
ATOM 8642 N N   . LYS A 1 1134 ? -17.527 18.252  1.476   1.00 83.31  ? 1131 LYS A N   1 
ATOM 8643 C CA  . LYS A 1 1134 ? -18.791 19.000  1.519   1.00 83.31  ? 1131 LYS A CA  1 
ATOM 8644 C C   . LYS A 1 1134 ? -18.797 20.224  0.594   1.00 83.31  ? 1131 LYS A C   1 
ATOM 8645 O O   . LYS A 1 1134 ? -19.839 20.641  0.093   1.00 83.31  ? 1131 LYS A O   1 
ATOM 8646 C CB  . LYS A 1 1134 ? -19.104 19.421  2.967   1.00 142.76 ? 1131 LYS A CB  1 
ATOM 8647 C CG  . LYS A 1 1134 ? -20.094 20.588  3.116   1.00 142.76 ? 1131 LYS A CG  1 
ATOM 8648 C CD  . LYS A 1 1134 ? -20.167 21.116  4.547   1.00 142.76 ? 1131 LYS A CD  1 
ATOM 8649 C CE  . LYS A 1 1134 ? -21.293 20.472  5.349   1.00 142.76 ? 1131 LYS A CE  1 
ATOM 8650 N NZ  . LYS A 1 1134 ? -21.070 19.029  5.631   1.00 142.76 ? 1131 LYS A NZ  1 
ATOM 8651 N N   . VAL A 1 1135 ? -17.629 20.805  0.380   1.00 73.85  ? 1132 VAL A N   1 
ATOM 8652 C CA  . VAL A 1 1135 ? -17.534 22.014  -0.402  1.00 73.85  ? 1132 VAL A CA  1 
ATOM 8653 C C   . VAL A 1 1135 ? -17.621 21.667  -1.880  1.00 73.85  ? 1132 VAL A C   1 
ATOM 8654 O O   . VAL A 1 1135 ? -18.226 22.396  -2.640  1.00 73.85  ? 1132 VAL A O   1 
ATOM 8655 C CB  . VAL A 1 1135 ? -16.262 22.831  -0.025  1.00 79.53  ? 1132 VAL A CB  1 
ATOM 8656 C CG1 . VAL A 1 1135 ? -15.871 23.826  -1.114  1.00 79.53  ? 1132 VAL A CG1 1 
ATOM 8657 C CG2 . VAL A 1 1135 ? -16.478 23.547  1.302   1.00 79.53  ? 1132 VAL A CG2 1 
ATOM 8658 N N   . VAL A 1 1136 ? -17.043 20.540  -2.278  1.00 88.54  ? 1133 VAL A N   1 
ATOM 8659 C CA  . VAL A 1 1136 ? -17.179 20.069  -3.655  1.00 88.54  ? 1133 VAL A CA  1 
ATOM 8660 C C   . VAL A 1 1136 ? -18.611 19.611  -3.934  1.00 88.54  ? 1133 VAL A C   1 
ATOM 8661 O O   . VAL A 1 1136 ? -19.132 19.771  -5.041  1.00 88.54  ? 1133 VAL A O   1 
ATOM 8662 C CB  . VAL A 1 1136 ? -16.202 18.934  -3.956  1.00 53.55  ? 1133 VAL A CB  1 
ATOM 8663 C CG1 . VAL A 1 1136 ? -16.550 18.262  -5.231  1.00 53.55  ? 1133 VAL A CG1 1 
ATOM 8664 C CG2 . VAL A 1 1136 ? -14.813 19.475  -4.065  1.00 53.55  ? 1133 VAL A CG2 1 
ATOM 8665 N N   . GLU A 1 1137 ? -19.238 19.035  -2.914  1.00 78.20  ? 1134 GLU A N   1 
ATOM 8666 C CA  . GLU A 1 1137 ? -20.633 18.655  -2.975  1.00 78.20  ? 1134 GLU A CA  1 
ATOM 8667 C C   . GLU A 1 1137 ? -21.519 19.841  -3.328  1.00 78.20  ? 1134 GLU A C   1 
ATOM 8668 O O   . GLU A 1 1137 ? -22.220 19.811  -4.332  1.00 78.20  ? 1134 GLU A O   1 
ATOM 8669 C CB  . GLU A 1 1137 ? -21.065 18.052  -1.642  1.00 99.08  ? 1134 GLU A CB  1 
ATOM 8670 C CG  . GLU A 1 1137 ? -20.459 16.687  -1.361  1.00 99.08  ? 1134 GLU A CG  1 
ATOM 8671 C CD  . GLU A 1 1137 ? -21.249 15.879  -0.330  1.00 99.08  ? 1134 GLU A CD  1 
ATOM 8672 O OE1 . GLU A 1 1137 ? -21.556 16.407  0.764   1.00 99.08  ? 1134 GLU A OE1 1 
ATOM 8673 O OE2 . GLU A 1 1137 ? -21.552 14.701  -0.617  1.00 99.08  ? 1134 GLU A OE2 1 
ATOM 8674 N N   . GLU A 1 1138 ? -21.470 20.892  -2.517  1.00 97.16  ? 1135 GLU A N   1 
ATOM 8675 C CA  . GLU A 1 1138 ? -22.358 22.017  -2.732  1.00 97.16  ? 1135 GLU A CA  1 
ATOM 8676 C C   . GLU A 1 1138 ? -22.151 22.585  -4.127  1.00 97.16  ? 1135 GLU A C   1 
ATOM 8677 O O   . GLU A 1 1138 ? -22.951 23.385  -4.600  1.00 97.16  ? 1135 GLU A O   1 
ATOM 8678 C CB  . GLU A 1 1138 ? -22.183 23.096  -1.663  1.00 166.60 ? 1135 GLU A CB  1 
ATOM 8679 C CG  . GLU A 1 1138 ? -23.478 23.866  -1.379  1.00 166.60 ? 1135 GLU A CG  1 
ATOM 8680 C CD  . GLU A 1 1138 ? -23.278 25.129  -0.551  1.00 166.60 ? 1135 GLU A CD  1 
ATOM 8681 O OE1 . GLU A 1 1138 ? -24.163 26.008  -0.604  1.00 166.60 ? 1135 GLU A OE1 1 
ATOM 8682 O OE2 . GLU A 1 1138 ? -22.249 25.250  0.148   1.00 166.60 ? 1135 GLU A OE2 1 
ATOM 8683 N N   . LEU A 1 1139 ? -21.091 22.136  -4.792  1.00 76.83  ? 1136 LEU A N   1 
ATOM 8684 C CA  . LEU A 1 1139 ? -20.704 22.659  -6.094  1.00 76.83  ? 1136 LEU A CA  1 
ATOM 8685 C C   . LEU A 1 1139 ? -21.262 21.824  -7.216  1.00 76.83  ? 1136 LEU A C   1 
ATOM 8686 O O   . LEU A 1 1139 ? -21.847 22.349  -8.147  1.00 76.83  ? 1136 LEU A O   1 
ATOM 8687 C CB  . LEU A 1 1139 ? -19.187 22.706  -6.216  1.00 61.41  ? 1136 LEU A CB  1 
ATOM 8688 C CG  . LEU A 1 1139 ? -18.469 23.867  -5.545  1.00 61.41  ? 1136 LEU A CG  1 
ATOM 8689 C CD1 . LEU A 1 1139 ? -17.165 24.130  -6.241  1.00 61.41  ? 1136 LEU A CD1 1 
ATOM 8690 C CD2 . LEU A 1 1139 ? -19.320 25.106  -5.592  1.00 61.41  ? 1136 LEU A CD2 1 
ATOM 8691 N N   . THR A 1 1140 ? -21.065 20.518  -7.117  1.00 67.97  ? 1137 THR A N   1 
ATOM 8692 C CA  . THR A 1 1140 ? -21.569 19.565  -8.089  1.00 67.97  ? 1137 THR A CA  1 
ATOM 8693 C C   . THR A 1 1140 ? -23.021 19.787  -8.369  1.00 67.97  ? 1137 THR A C   1 
ATOM 8694 O O   . THR A 1 1140 ? -23.577 19.139  -9.253  1.00 67.97  ? 1137 THR A O   1 
ATOM 8695 C CB  . THR A 1 1140 ? -21.564 18.167  -7.522  1.00 50.59  ? 1137 THR A CB  1 
ATOM 8696 O OG1 . THR A 1 1140 ? -21.992 18.244  -6.150  1.00 50.59  ? 1137 THR A OG1 1 
ATOM 8697 C CG2 . THR A 1 1140 ? -20.173 17.502  -7.637  1.00 50.59  ? 1137 THR A CG2 1 
ATOM 8698 N N   . ARG A 1 1141 ? -23.639 20.666  -7.588  1.00 66.22  ? 1138 ARG A N   1 
ATOM 8699 C CA  . ARG A 1 1141 ? -25.068 20.871  -7.665  1.00 66.22  ? 1138 ARG A CA  1 
ATOM 8700 C C   . ARG A 1 1141 ? -25.424 22.239  -8.260  1.00 66.22  ? 1138 ARG A C   1 
ATOM 8701 O O   . ARG A 1 1141 ? -26.591 22.669  -8.221  1.00 66.22  ? 1138 ARG A O   1 
ATOM 8702 C CB  . ARG A 1 1141 ? -25.710 20.616  -6.302  1.00 112.68 ? 1138 ARG A CB  1 
ATOM 8703 C CG  . ARG A 1 1141 ? -25.535 19.160  -5.848  1.00 112.68 ? 1138 ARG A CG  1 
ATOM 8704 C CD  . ARG A 1 1141 ? -26.414 18.780  -4.658  1.00 112.68 ? 1138 ARG A CD  1 
ATOM 8705 N NE  . ARG A 1 1141 ? -26.223 19.666  -3.505  1.00 112.68 ? 1138 ARG A NE  1 
ATOM 8706 C CZ  . ARG A 1 1141 ? -25.312 19.490  -2.546  1.00 112.68 ? 1138 ARG A CZ  1 
ATOM 8707 N NH1 . ARG A 1 1141 ? -24.481 18.447  -2.577  1.00 112.68 ? 1138 ARG A NH1 1 
ATOM 8708 N NH2 . ARG A 1 1141 ? -25.226 20.371  -1.549  1.00 112.68 ? 1138 ARG A NH2 1 
ATOM 8709 N N   . ILE A 1 1142 ? -24.407 22.902  -8.825  1.00 58.38  ? 1139 ILE A N   1 
ATOM 8710 C CA  . ILE A 1 1142 ? -24.571 24.152  -9.579  1.00 58.38  ? 1139 ILE A CA  1 
ATOM 8711 C C   . ILE A 1 1142 ? -25.179 23.824  -10.941 1.00 58.38  ? 1139 ILE A C   1 
ATOM 8712 O O   . ILE A 1 1142 ? -25.776 24.659  -11.598 1.00 58.38  ? 1139 ILE A O   1 
ATOM 8713 C CB  . ILE A 1 1142 ? -23.219 24.835  -9.755  1.00 73.91  ? 1139 ILE A CB  1 
ATOM 8714 C CG1 . ILE A 1 1142 ? -22.973 25.841  -8.652  1.00 73.91  ? 1139 ILE A CG1 1 
ATOM 8715 C CG2 . ILE A 1 1142 ? -23.132 25.596  -11.049 1.00 73.91  ? 1139 ILE A CG2 1 
ATOM 8716 C CD1 . ILE A 1 1142 ? -21.791 26.771  -9.003  1.00 73.91  ? 1139 ILE A CD1 1 
ATOM 8717 N N   . HIS A 1 1143 ? -24.999 22.578  -11.346 1.00 53.40  ? 1140 HIS A N   1 
ATOM 8718 C CA  . HIS A 1 1143 ? -25.606 22.019  -12.523 1.00 53.40  ? 1140 HIS A CA  1 
ATOM 8719 C C   . HIS A 1 1143 ? -26.051 20.605  -12.117 1.00 53.40  ? 1140 HIS A C   1 
ATOM 8720 O O   . HIS A 1 1143 ? -25.933 19.625  -12.867 1.00 53.40  ? 1140 HIS A O   1 
ATOM 8721 C CB  . HIS A 1 1143 ? -24.578 21.967  -13.640 1.00 50.70  ? 1140 HIS A CB  1 
ATOM 8722 C CG  . HIS A 1 1143 ? -23.466 20.999  -13.380 1.00 50.70  ? 1140 HIS A CG  1 
ATOM 8723 N ND1 . HIS A 1 1143 ? -22.691 21.044  -12.237 1.00 50.70  ? 1140 HIS A ND1 1 
ATOM 8724 C CD2 . HIS A 1 1143 ? -23.011 19.945  -14.099 1.00 50.70  ? 1140 HIS A CD2 1 
ATOM 8725 C CE1 . HIS A 1 1143 ? -21.807 20.065  -12.265 1.00 50.70  ? 1140 HIS A CE1 1 
ATOM 8726 N NE2 . HIS A 1 1143 ? -21.975 19.388  -13.386 1.00 50.70  ? 1140 HIS A NE2 1 
ATOM 8727 N N   . ASN B 2 1    ? -17.160 34.007  -48.614 1.00 18.65  ? 124  ASN B N   1 
ATOM 8728 C CA  . ASN B 2 1    ? -17.866 35.193  -48.009 1.00 18.65  ? 124  ASN B CA  1 
ATOM 8729 C C   . ASN B 2 1    ? -17.642 35.416  -46.492 1.00 18.65  ? 124  ASN B C   1 
ATOM 8730 O O   . ASN B 2 1    ? -18.269 36.348  -45.833 1.00 45.16  ? 124  ASN B O   1 
ATOM 8731 C CB  . ASN B 2 1    ? -19.409 35.092  -48.226 1.00 18.65  ? 124  ASN B CB  1 
ATOM 8732 C CG  . ASN B 2 1    ? -19.780 34.990  -49.734 1.00 18.65  ? 124  ASN B CG  1 
ATOM 8733 O OD1 . ASN B 2 1    ? -18.942 35.374  -50.630 1.00 18.65  ? 124  ASN B OD1 1 
ATOM 8734 N ND2 . ASN B 2 1    ? -20.992 34.437  -50.041 1.00 18.65  ? 124  ASN B ND2 1 
ATOM 8735 N N   . ALA B 2 2    ? -16.757 34.608  -45.916 1.00 18.65  ? 125  ALA B N   1 
ATOM 8736 C CA  . ALA B 2 2    ? -16.558 34.614  -44.475 1.00 18.65  ? 125  ALA B CA  1 
ATOM 8737 C C   . ALA B 2 2    ? -17.873 34.147  -43.879 1.00 18.65  ? 125  ALA B C   1 
ATOM 8738 O O   . ALA B 2 2    ? -17.960 33.777  -42.708 1.00 42.91  ? 125  ALA B O   1 
ATOM 8739 C CB  . ALA B 2 2    ? -16.213 36.006  -43.988 1.00 18.65  ? 125  ALA B CB  1 
ATOM 8740 N N   . SER B 2 3    ? -18.896 34.172  -44.725 1.00 18.65  ? 126  SER B N   1 
ATOM 8741 C CA  . SER B 2 3    ? -20.227 33.697  -44.392 1.00 18.65  ? 126  SER B CA  1 
ATOM 8742 C C   . SER B 2 3    ? -20.379 32.223  -44.621 1.00 18.65  ? 126  SER B C   1 
ATOM 8743 O O   . SER B 2 3    ? -20.893 31.493  -43.793 1.00 45.27  ? 126  SER B O   1 
ATOM 8744 C CB  . SER B 2 3    ? -21.211 34.347  -45.307 1.00 18.65  ? 126  SER B CB  1 
ATOM 8745 O OG  . SER B 2 3    ? -21.429 33.455  -46.351 1.00 18.65  ? 126  SER B OG  1 
ATOM 8746 N N   . SER B 2 4    ? -19.953 31.786  -45.782 1.00 18.65  ? 127  SER B N   1 
ATOM 8747 C CA  . SER B 2 4    ? -19.608 30.410  -45.987 1.00 18.65  ? 127  SER B CA  1 
ATOM 8748 C C   . SER B 2 4    ? -18.711 30.122  -44.814 1.00 18.65  ? 127  SER B C   1 
ATOM 8749 O O   . SER B 2 4    ? -18.788 29.113  -44.137 1.00 46.88  ? 127  SER B O   1 
ATOM 8750 C CB  . SER B 2 4    ? -18.813 30.338  -47.273 1.00 18.65  ? 127  SER B CB  1 
ATOM 8751 O OG  . SER B 2 4    ? -18.022 29.188  -47.345 1.00 18.65  ? 127  SER B OG  1 
ATOM 8752 N N   . MET B 2 5    ? -17.894 31.116  -44.550 1.00 18.65  ? 128  MET B N   1 
ATOM 8753 C CA  . MET B 2 5    ? -16.850 31.079  -43.571 1.00 18.65  ? 128  MET B CA  1 
ATOM 8754 C C   . MET B 2 5    ? -17.372 30.921  -42.179 1.00 18.65  ? 128  MET B C   1 
ATOM 8755 O O   . MET B 2 5    ? -16.886 30.108  -41.420 1.00 47.02  ? 128  MET B O   1 
ATOM 8756 C CB  . MET B 2 5    ? -16.055 32.358  -43.669 1.00 18.65  ? 128  MET B CB  1 
ATOM 8757 C CG  . MET B 2 5    ? -14.699 32.075  -44.073 1.00 18.65  ? 128  MET B CG  1 
ATOM 8758 S SD  . MET B 2 5    ? -14.735 30.328  -44.068 1.00 18.65  ? 128  MET B SD  1 
ATOM 8759 C CE  . MET B 2 5    ? -13.068 29.953  -43.642 1.00 18.65  ? 128  MET B CE  1 
ATOM 8760 N N   . LEU B 2 6    ? -18.373 31.671  -41.809 1.00 18.65  ? 129  LEU B N   1 
ATOM 8761 C CA  . LEU B 2 6    ? -18.873 31.472  -40.490 1.00 18.65  ? 129  LEU B CA  1 
ATOM 8762 C C   . LEU B 2 6    ? -19.538 30.132  -40.413 1.00 18.65  ? 129  LEU B C   1 
ATOM 8763 O O   . LEU B 2 6    ? -19.307 29.382  -39.496 1.00 35.67  ? 129  LEU B O   1 
ATOM 8764 C CB  . LEU B 2 6    ? -19.843 32.564  -40.161 1.00 18.65  ? 129  LEU B CB  1 
ATOM 8765 C CG  . LEU B 2 6    ? -19.175 33.868  -40.468 1.00 18.65  ? 129  LEU B CG  1 
ATOM 8766 C CD1 . LEU B 2 6    ? -20.124 34.951  -40.307 1.00 18.65  ? 129  LEU B CD1 1 
ATOM 8767 C CD2 . LEU B 2 6    ? -18.005 34.033  -39.579 1.00 18.65  ? 129  LEU B CD2 1 
ATOM 8768 N N   . ARG B 2 7    ? -20.385 29.812  -41.376 1.00 18.65  ? 130  ARG B N   1 
ATOM 8769 C CA  . ARG B 2 7    ? -21.137 28.595  -41.194 1.00 18.65  ? 130  ARG B CA  1 
ATOM 8770 C C   . ARG B 2 7    ? -20.155 27.475  -41.016 1.00 18.65  ? 130  ARG B C   1 
ATOM 8771 O O   . ARG B 2 7    ? -20.456 26.478  -40.414 1.00 38.31  ? 130  ARG B O   1 
ATOM 8772 C CB  . ARG B 2 7    ? -22.132 28.317  -42.334 1.00 18.65  ? 130  ARG B CB  1 
ATOM 8773 C CG  . ARG B 2 7    ? -22.703 29.553  -43.057 1.00 18.65  ? 130  ARG B CG  1 
ATOM 8774 C CD  . ARG B 2 7    ? -24.222 29.589  -43.121 1.00 18.65  ? 130  ARG B CD  1 
ATOM 8775 N NE  . ARG B 2 7    ? -24.773 29.839  -44.451 1.00 18.65  ? 130  ARG B NE  1 
ATOM 8776 C CZ  . ARG B 2 7    ? -25.293 30.992  -44.849 1.00 18.65  ? 130  ARG B CZ  1 
ATOM 8777 N NH1 . ARG B 2 7    ? -25.303 32.013  -44.032 1.00 18.65  ? 130  ARG B NH1 1 
ATOM 8778 N NH2 . ARG B 2 7    ? -25.801 31.137  -46.063 1.00 18.65  ? 130  ARG B NH2 1 
ATOM 8779 N N   . LYS B 2 8    ? -18.959 27.637  -41.539 1.00 18.65  ? 131  LYS B N   1 
ATOM 8780 C CA  . LYS B 2 8    ? -18.066 26.496  -41.620 1.00 18.65  ? 131  LYS B CA  1 
ATOM 8781 C C   . LYS B 2 8    ? -17.183 26.398  -40.428 1.00 18.65  ? 131  LYS B C   1 
ATOM 8782 O O   . LYS B 2 8    ? -17.070 25.383  -39.787 1.00 43.79  ? 131  LYS B O   1 
ATOM 8783 C CB  . LYS B 2 8    ? -17.227 26.549  -42.892 1.00 18.65  ? 131  LYS B CB  1 
ATOM 8784 C CG  . LYS B 2 8    ? -17.745 25.666  -43.994 1.00 18.65  ? 131  LYS B CG  1 
ATOM 8785 C CD  . LYS B 2 8    ? -17.518 26.288  -45.330 1.00 18.65  ? 131  LYS B CD  1 
ATOM 8786 C CE  . LYS B 2 8    ? -18.653 26.037  -46.278 1.00 18.65  ? 131  LYS B CE  1 
ATOM 8787 N NZ  . LYS B 2 8    ? -18.570 26.956  -47.416 1.00 18.65  ? 131  LYS B NZ  1 
ATOM 8788 N N   . SER B 2 9    ? -16.534 27.479  -40.105 1.00 18.65  ? 132  SER B N   1 
ATOM 8789 C CA  . SER B 2 9    ? -15.861 27.394  -38.885 1.00 18.65  ? 132  SER B CA  1 
ATOM 8790 C C   . SER B 2 9    ? -17.045 27.095  -38.056 1.00 18.65  ? 132  SER B C   1 
ATOM 8791 O O   . SER B 2 9    ? -16.908 26.637  -36.953 1.00 33.21  ? 132  SER B O   1 
ATOM 8792 C CB  . SER B 2 9    ? -15.312 28.723  -38.492 1.00 18.65  ? 132  SER B CB  1 
ATOM 8793 O OG  . SER B 2 9    ? -16.378 29.587  -38.306 1.00 18.65  ? 132  SER B OG  1 
ATOM 8794 N N   . GLN B 2 10   ? -18.264 27.359  -38.505 1.00 18.65  ? 133  GLN B N   1 
ATOM 8795 C CA  . GLN B 2 10   ? -19.152 27.075  -37.386 1.00 18.65  ? 133  GLN B CA  1 
ATOM 8796 C C   . GLN B 2 10   ? -19.389 25.575  -37.270 1.00 18.65  ? 133  GLN B C   1 
ATOM 8797 O O   . GLN B 2 10   ? -19.320 25.013  -36.177 1.00 37.73  ? 133  GLN B O   1 
ATOM 8798 C CB  . GLN B 2 10   ? -20.482 27.817  -37.534 1.00 18.65  ? 133  GLN B CB  1 
ATOM 8799 C CG  . GLN B 2 10   ? -20.444 29.260  -37.055 1.00 18.65  ? 133  GLN B CG  1 
ATOM 8800 C CD  . GLN B 2 10   ? -21.774 29.967  -37.232 1.00 18.65  ? 133  GLN B CD  1 
ATOM 8801 O OE1 . GLN B 2 10   ? -22.736 29.387  -37.736 1.00 18.65  ? 133  GLN B OE1 1 
ATOM 8802 N NE2 . GLN B 2 10   ? -21.834 31.226  -36.816 1.00 18.65  ? 133  GLN B NE2 1 
ATOM 8803 N N   . LEU B 2 11   ? -19.687 24.836  -38.305 1.00 18.65  ? 134  LEU B N   1 
ATOM 8804 C CA  . LEU B 2 11   ? -19.914 23.447  -38.011 1.00 18.65  ? 134  LEU B CA  1 
ATOM 8805 C C   . LEU B 2 11   ? -18.666 22.661  -37.809 1.00 18.65  ? 134  LEU B C   1 
ATOM 8806 O O   . LEU B 2 11   ? -18.703 21.464  -37.807 1.00 35.17  ? 134  LEU B O   1 
ATOM 8807 C CB  . LEU B 2 11   ? -20.712 22.807  -39.101 1.00 18.65  ? 134  LEU B CB  1 
ATOM 8808 C CG  . LEU B 2 11   ? -21.906 23.625  -39.472 1.00 18.65  ? 134  LEU B CG  1 
ATOM 8809 C CD1 . LEU B 2 11   ? -22.370 23.175  -40.771 1.00 18.65  ? 134  LEU B CD1 1 
ATOM 8810 C CD2 . LEU B 2 11   ? -22.948 23.461  -38.447 1.00 18.65  ? 134  LEU B CD2 1 
ATOM 8811 N N   . GLY B 2 12   ? -17.547 23.323  -37.660 1.00 18.65  ? 135  GLY B N   1 
ATOM 8812 C CA  . GLY B 2 12   ? -16.332 22.611  -37.414 1.00 18.65  ? 135  GLY B CA  1 
ATOM 8813 C C   . GLY B 2 12   ? -15.536 22.476  -38.660 1.00 18.65  ? 135  GLY B C   1 
ATOM 8814 O O   . GLY B 2 12   ? -15.927 22.902  -39.702 1.00 35.06  ? 135  GLY B O   1 
ATOM 8815 N N   . PHE B 2 13   ? -14.396 21.853  -38.541 1.00 18.65  ? 136  PHE B N   1 
ATOM 8816 C CA  . PHE B 2 13   ? -13.425 21.907  -39.590 1.00 18.65  ? 136  PHE B CA  1 
ATOM 8817 C C   . PHE B 2 13   ? -14.071 21.677  -40.919 1.00 18.65  ? 136  PHE B C   1 
ATOM 8818 O O   . PHE B 2 13   ? -14.561 22.607  -41.523 1.00 169.99 ? 136  PHE B O   1 
ATOM 8819 C CB  . PHE B 2 13   ? -12.301 20.924  -39.308 1.00 18.65  ? 136  PHE B CB  1 
ATOM 8820 C CG  . PHE B 2 13   ? -11.550 21.241  -38.058 1.00 18.65  ? 136  PHE B CG  1 
ATOM 8821 C CD1 . PHE B 2 13   ? -10.406 21.996  -38.092 1.00 18.65  ? 136  PHE B CD1 1 
ATOM 8822 C CD2 . PHE B 2 13   ? -12.017 20.834  -36.833 1.00 18.65  ? 136  PHE B CD2 1 
ATOM 8823 C CE1 . PHE B 2 13   ? -9.733  22.303  -36.932 1.00 18.65  ? 136  PHE B CE1 1 
ATOM 8824 C CE2 . PHE B 2 13   ? -11.333 21.149  -35.680 1.00 18.65  ? 136  PHE B CE2 1 
ATOM 8825 C CZ  . PHE B 2 13   ? -10.199 21.877  -35.737 1.00 18.65  ? 136  PHE B CZ  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    GLY 1    -2   ?    ?   ?   A . n 
A 1 2    SER 2    -1   ?    ?   ?   A . n 
A 1 3    HIS 3    0    ?    ?   ?   A . n 
A 1 4    MET 4    1    1    MET MET A . n 
A 1 5    SER 5    2    2    SER SER A . n 
A 1 6    TYR 6    3    3    TYR TYR A . n 
A 1 7    ASN 7    4    4    ASN ASN A . n 
A 1 8    TYR 8    5    5    TYR TYR A . n 
A 1 9    VAL 9    6    6    VAL VAL A . n 
A 1 10   VAL 10   7    7    VAL VAL A . n 
A 1 11   THR 11   8    8    THR THR A . n 
A 1 12   ALA 12   9    9    ALA ALA A . n 
A 1 13   GLN 13   10   10   GLN GLN A . n 
A 1 14   LYS 14   11   11   LYS LYS A . n 
A 1 15   PRO 15   12   12   PRO PRO A . n 
A 1 16   THR 16   13   13   THR THR A . n 
A 1 17   ALA 17   14   14   ALA ALA A . n 
A 1 18   VAL 18   15   15   VAL VAL A . n 
A 1 19   ASN 19   16   16   ASN ASN A . n 
A 1 20   GLY 20   17   17   GLY GLY A . n 
A 1 21   CYS 21   18   18   CYS CYS A . n 
A 1 22   VAL 22   19   19   VAL VAL A . n 
A 1 23   THR 23   20   20   THR THR A . n 
A 1 24   GLY 24   21   21   GLY GLY A . n 
A 1 25   HIS 25   22   22   HIS HIS A . n 
A 1 26   PHE 26   23   23   PHE PHE A . n 
A 1 27   THR 27   24   24   THR THR A . n 
A 1 28   SER 28   25   25   SER SER A . n 
A 1 29   ALA 29   26   26   ALA ALA A . n 
A 1 30   GLU 30   27   27   GLU GLU A . n 
A 1 31   ASP 31   28   28   ASP ASP A . n 
A 1 32   LEU 32   29   29   LEU LEU A . n 
A 1 33   ASN 33   30   30   ASN ASN A . n 
A 1 34   LEU 34   31   31   LEU LEU A . n 
A 1 35   LEU 35   32   32   LEU LEU A . n 
A 1 36   ILE 36   33   33   ILE ILE A . n 
A 1 37   ALA 37   34   34   ALA ALA A . n 
A 1 38   LYS 38   35   35   LYS LYS A . n 
A 1 39   ASN 39   36   36   ASN ASN A . n 
A 1 40   THR 40   37   37   THR THR A . n 
A 1 41   ARG 41   38   38   ARG ARG A . n 
A 1 42   LEU 42   39   39   LEU LEU A . n 
A 1 43   GLU 43   40   40   GLU GLU A . n 
A 1 44   ILE 44   41   41   ILE ILE A . n 
A 1 45   TYR 45   42   42   TYR TYR A . n 
A 1 46   VAL 46   43   43   VAL VAL A . n 
A 1 47   VAL 47   44   44   VAL VAL A . n 
A 1 48   THR 48   45   45   THR THR A . n 
A 1 49   ALA 49   46   46   ALA ALA A . n 
A 1 50   GLU 50   47   47   GLU GLU A . n 
A 1 51   GLY 51   48   48   GLY GLY A . n 
A 1 52   LEU 52   49   49   LEU LEU A . n 
A 1 53   ARG 53   50   50   ARG ARG A . n 
A 1 54   PRO 54   51   51   PRO PRO A . n 
A 1 55   VAL 55   52   52   VAL VAL A . n 
A 1 56   LYS 56   53   53   LYS LYS A . n 
A 1 57   GLU 57   54   54   GLU GLU A . n 
A 1 58   VAL 58   55   55   VAL VAL A . n 
A 1 59   GLY 59   56   56   GLY GLY A . n 
A 1 60   MET 60   57   57   MET MET A . n 
A 1 61   TYR 61   58   58   TYR TYR A . n 
A 1 62   GLY 62   59   59   GLY GLY A . n 
A 1 63   LYS 63   60   60   LYS LYS A . n 
A 1 64   ILE 64   61   61   ILE ILE A . n 
A 1 65   ALA 65   62   62   ALA ALA A . n 
A 1 66   VAL 66   63   63   VAL VAL A . n 
A 1 67   MET 67   64   64   MET MET A . n 
A 1 68   GLU 68   65   65   GLU GLU A . n 
A 1 69   LEU 69   66   66   LEU LEU A . n 
A 1 70   PHE 70   67   67   PHE PHE A . n 
A 1 71   ARG 71   68   68   ARG ARG A . n 
A 1 72   PRO 72   69   69   PRO PRO A . n 
A 1 73   LYS 73   70   70   LYS LYS A . n 
A 1 74   GLY 74   71   71   GLY GLY A . n 
A 1 75   GLU 75   72   72   GLU GLU A . n 
A 1 76   SER 76   73   73   SER SER A . n 
A 1 77   LYS 77   74   74   LYS LYS A . n 
A 1 78   ASP 78   75   75   ASP ASP A . n 
A 1 79   LEU 79   76   76   LEU LEU A . n 
A 1 80   LEU 80   77   77   LEU LEU A . n 
A 1 81   PHE 81   78   78   PHE PHE A . n 
A 1 82   ILE 82   79   79   ILE ILE A . n 
A 1 83   LEU 83   80   80   LEU LEU A . n 
A 1 84   THR 84   81   81   THR THR A . n 
A 1 85   ALA 85   82   82   ALA ALA A . n 
A 1 86   LYS 86   83   83   LYS LYS A . n 
A 1 87   TYR 87   84   84   TYR TYR A . n 
A 1 88   ASN 88   85   85   ASN ASN A . n 
A 1 89   ALA 89   86   86   ALA ALA A . n 
A 1 90   CYS 90   87   87   CYS CYS A . n 
A 1 91   ILE 91   88   88   ILE ILE A . n 
A 1 92   LEU 92   89   89   LEU LEU A . n 
A 1 93   GLU 93   90   90   GLU GLU A . n 
A 1 94   TYR 94   91   91   TYR TYR A . n 
A 1 95   LYS 95   92   92   LYS LYS A . n 
A 1 96   GLN 96   93   93   GLN GLN A . n 
A 1 97   SER 97   94   94   SER SER A . n 
A 1 98   GLY 98   95   95   GLY GLY A . n 
A 1 99   GLU 99   96   96   GLU GLU A . n 
A 1 100  SER 100  97   97   SER SER A . n 
A 1 101  ILE 101  98   98   ILE ILE A . n 
A 1 102  ASP 102  99   99   ASP ASP A . n 
A 1 103  ILE 103  100  100  ILE ILE A . n 
A 1 104  ILE 104  101  101  ILE ILE A . n 
A 1 105  THR 105  102  102  THR THR A . n 
A 1 106  ARG 106  103  103  ARG ARG A . n 
A 1 107  ALA 107  104  104  ALA ALA A . n 
A 1 108  HIS 108  105  105  HIS HIS A . n 
A 1 109  GLY 109  106  106  GLY GLY A . n 
A 1 110  ASN 110  107  107  ASN ASN A . n 
A 1 111  VAL 111  108  108  VAL VAL A . n 
A 1 112  GLN 112  109  109  GLN GLN A . n 
A 1 113  ASP 113  110  110  ASP ASP A . n 
A 1 114  ARG 114  111  111  ARG ARG A . n 
A 1 115  ILE 115  112  112  ILE ILE A . n 
A 1 116  GLY 116  113  113  GLY GLY A . n 
A 1 117  ARG 117  114  114  ARG ARG A . n 
A 1 118  PRO 118  115  115  PRO PRO A . n 
A 1 119  SER 119  116  116  SER SER A . n 
A 1 120  GLU 120  117  117  GLU GLU A . n 
A 1 121  THR 121  118  118  THR THR A . n 
A 1 122  GLY 122  119  119  GLY GLY A . n 
A 1 123  ILE 123  120  120  ILE ILE A . n 
A 1 124  ILE 124  121  121  ILE ILE A . n 
A 1 125  GLY 125  122  122  GLY GLY A . n 
A 1 126  ILE 126  123  123  ILE ILE A . n 
A 1 127  ILE 127  124  124  ILE ILE A . n 
A 1 128  ASP 128  125  125  ASP ASP A . n 
A 1 129  PRO 129  126  126  PRO PRO A . n 
A 1 130  GLU 130  127  127  GLU GLU A . n 
A 1 131  CYS 131  128  128  CYS CYS A . n 
A 1 132  ARG 132  129  129  ARG ARG A . n 
A 1 133  MET 133  130  130  MET MET A . n 
A 1 134  ILE 134  131  131  ILE ILE A . n 
A 1 135  GLY 135  132  132  GLY GLY A . n 
A 1 136  LEU 136  133  133  LEU LEU A . n 
A 1 137  ARG 137  134  134  ARG ARG A . n 
A 1 138  LEU 138  135  135  LEU LEU A . n 
A 1 139  TYR 139  136  136  TYR TYR A . n 
A 1 140  ASP 140  137  137  ASP ASP A . n 
A 1 141  GLY 141  138  138  GLY GLY A . n 
A 1 142  LEU 142  139  139  LEU LEU A . n 
A 1 143  PHE 143  140  140  PHE PHE A . n 
A 1 144  LYS 144  141  141  LYS LYS A . n 
A 1 145  VAL 145  142  142  VAL VAL A . n 
A 1 146  ILE 146  143  143  ILE ILE A . n 
A 1 147  PRO 147  144  144  PRO PRO A . n 
A 1 148  LEU 148  145  145  LEU LEU A . n 
A 1 149  ASP 149  146  146  ASP ASP A . n 
A 1 150  ARG 150  147  147  ARG ARG A . n 
A 1 151  ASP 151  148  148  ASP ASP A . n 
A 1 152  ASN 152  149  149  ASN ASN A . n 
A 1 153  LYS 153  150  150  LYS LYS A . n 
A 1 154  GLU 154  151  151  GLU GLU A . n 
A 1 155  LEU 155  152  152  LEU LEU A . n 
A 1 156  LYS 156  153  153  LYS LYS A . n 
A 1 157  ALA 157  154  154  ALA ALA A . n 
A 1 158  PHE 158  155  155  PHE PHE A . n 
A 1 159  ASN 159  156  156  ASN ASN A . n 
A 1 160  ILE 160  157  157  ILE ILE A . n 
A 1 161  ARG 161  158  158  ARG ARG A . n 
A 1 162  LEU 162  159  159  LEU LEU A . n 
A 1 163  GLU 163  160  160  GLU GLU A . n 
A 1 164  GLU 164  161  161  GLU GLU A . n 
A 1 165  LEU 165  162  162  LEU LEU A . n 
A 1 166  HIS 166  163  163  HIS HIS A . n 
A 1 167  VAL 167  164  164  VAL VAL A . n 
A 1 168  ILE 168  165  165  ILE ILE A . n 
A 1 169  ASP 169  166  166  ASP ASP A . n 
A 1 170  VAL 170  167  167  VAL VAL A . n 
A 1 171  LYS 171  168  168  LYS LYS A . n 
A 1 172  PHE 172  169  169  PHE PHE A . n 
A 1 173  LEU 173  170  170  LEU LEU A . n 
A 1 174  TYR 174  171  171  TYR TYR A . n 
A 1 175  GLY 175  172  172  GLY GLY A . n 
A 1 176  CYS 176  173  173  CYS CYS A . n 
A 1 177  GLN 177  174  174  GLN GLN A . n 
A 1 178  ALA 178  175  175  ALA ALA A . n 
A 1 179  PRO 179  176  176  PRO PRO A . n 
A 1 180  THR 180  177  177  THR THR A . n 
A 1 181  ILE 181  178  178  ILE ILE A . n 
A 1 182  CYS 182  179  179  CYS CYS A . n 
A 1 183  PHE 183  180  180  PHE PHE A . n 
A 1 184  VAL 184  181  181  VAL VAL A . n 
A 1 185  TYR 185  182  182  TYR TYR A . n 
A 1 186  GLN 186  183  183  GLN GLN A . n 
A 1 187  ASP 187  184  184  ASP ASP A . n 
A 1 188  PRO 188  185  185  PRO PRO A . n 
A 1 189  GLN 189  186  186  GLN GLN A . n 
A 1 190  GLY 190  187  187  GLY GLY A . n 
A 1 191  ARG 191  188  188  ARG ARG A . n 
A 1 192  HIS 192  189  189  HIS HIS A . n 
A 1 193  VAL 193  190  190  VAL VAL A . n 
A 1 194  LYS 194  191  191  LYS LYS A . n 
A 1 195  THR 195  192  192  THR THR A . n 
A 1 196  TYR 196  193  193  TYR TYR A . n 
A 1 197  GLU 197  194  194  GLU GLU A . n 
A 1 198  VAL 198  195  195  VAL VAL A . n 
A 1 199  SER 199  196  196  SER SER A . n 
A 1 200  LEU 200  197  197  LEU LEU A . n 
A 1 201  ARG 201  198  198  ARG ARG A . n 
A 1 202  GLU 202  199  199  GLU GLU A . n 
A 1 203  LYS 203  200  200  LYS LYS A . n 
A 1 204  GLU 204  201  201  GLU GLU A . n 
A 1 205  PHE 205  202  202  PHE PHE A . n 
A 1 206  ASN 206  203  203  ASN ASN A . n 
A 1 207  LYS 207  204  204  LYS LYS A . n 
A 1 208  GLY 208  205  205  GLY GLY A . n 
A 1 209  PRO 209  206  206  PRO PRO A . n 
A 1 210  TRP 210  207  207  TRP TRP A . n 
A 1 211  LYS 211  208  208  LYS LYS A . n 
A 1 212  GLN 212  209  209  GLN GLN A . n 
A 1 213  GLU 213  210  210  GLU GLU A . n 
A 1 214  ASN 214  211  211  ASN ASN A . n 
A 1 215  VAL 215  212  212  VAL VAL A . n 
A 1 216  GLU 216  213  213  GLU GLU A . n 
A 1 217  ALA 217  214  214  ALA ALA A . n 
A 1 218  GLU 218  215  215  GLU GLU A . n 
A 1 219  ALA 219  216  216  ALA ALA A . n 
A 1 220  SER 220  217  217  SER SER A . n 
A 1 221  MET 221  218  218  MET MET A . n 
A 1 222  VAL 222  219  219  VAL VAL A . n 
A 1 223  ILE 223  220  220  ILE ILE A . n 
A 1 224  ALA 224  221  221  ALA ALA A . n 
A 1 225  VAL 225  222  222  VAL VAL A . n 
A 1 226  PRO 226  223  223  PRO PRO A . n 
A 1 227  GLU 227  224  224  GLU GLU A . n 
A 1 228  PRO 228  225  225  PRO PRO A . n 
A 1 229  PHE 229  226  226  PHE PHE A . n 
A 1 230  GLY 230  227  227  GLY GLY A . n 
A 1 231  GLY 231  228  228  GLY GLY A . n 
A 1 232  ALA 232  229  229  ALA ALA A . n 
A 1 233  ILE 233  230  230  ILE ILE A . n 
A 1 234  ILE 234  231  231  ILE ILE A . n 
A 1 235  ILE 235  232  232  ILE ILE A . n 
A 1 236  GLY 236  233  233  GLY GLY A . n 
A 1 237  GLN 237  234  234  GLN GLN A . n 
A 1 238  GLU 238  235  235  GLU GLU A . n 
A 1 239  SER 239  236  236  SER SER A . n 
A 1 240  ILE 240  237  237  ILE ILE A . n 
A 1 241  THR 241  238  238  THR THR A . n 
A 1 242  TYR 242  239  239  TYR TYR A . n 
A 1 243  HIS 243  240  240  HIS HIS A . n 
A 1 244  ASN 244  241  241  ASN ASN A . n 
A 1 245  GLY 245  242  242  GLY GLY A . n 
A 1 246  ASP 246  243  243  ASP ASP A . n 
A 1 247  LYS 247  244  244  LYS LYS A . n 
A 1 248  TYR 248  245  245  TYR TYR A . n 
A 1 249  LEU 249  246  246  LEU LEU A . n 
A 1 250  ALA 250  247  247  ALA ALA A . n 
A 1 251  ILE 251  248  248  ILE ILE A . n 
A 1 252  ALA 252  249  249  ALA ALA A . n 
A 1 253  PRO 253  250  250  PRO PRO A . n 
A 1 254  PRO 254  251  251  PRO PRO A . n 
A 1 255  ILE 255  252  252  ILE ILE A . n 
A 1 256  ILE 256  253  253  ILE ILE A . n 
A 1 257  LYS 257  254  254  LYS LYS A . n 
A 1 258  GLN 258  255  255  GLN GLN A . n 
A 1 259  SER 259  256  256  SER SER A . n 
A 1 260  THR 260  257  257  THR THR A . n 
A 1 261  ILE 261  258  258  ILE ILE A . n 
A 1 262  VAL 262  259  259  VAL VAL A . n 
A 1 263  CYS 263  260  260  CYS CYS A . n 
A 1 264  HIS 264  261  261  HIS HIS A . n 
A 1 265  ASN 265  262  262  ASN ASN A . n 
A 1 266  ARG 266  263  263  ARG ARG A . n 
A 1 267  VAL 267  264  264  VAL VAL A . n 
A 1 268  ASP 268  265  265  ASP ASP A . n 
A 1 269  PRO 269  266  266  PRO PRO A . n 
A 1 270  ASN 270  267  267  ASN ASN A . n 
A 1 271  GLY 271  268  268  GLY GLY A . n 
A 1 272  SER 272  269  269  SER SER A . n 
A 1 273  ARG 273  270  270  ARG ARG A . n 
A 1 274  TYR 274  271  271  TYR TYR A . n 
A 1 275  LEU 275  272  272  LEU LEU A . n 
A 1 276  LEU 276  273  273  LEU LEU A . n 
A 1 277  GLY 277  274  274  GLY GLY A . n 
A 1 278  ASP 278  275  275  ASP ASP A . n 
A 1 279  MET 279  276  276  MET MET A . n 
A 1 280  GLU 280  277  277  GLU GLU A . n 
A 1 281  GLY 281  278  278  GLY GLY A . n 
A 1 282  ARG 282  279  279  ARG ARG A . n 
A 1 283  LEU 283  280  280  LEU LEU A . n 
A 1 284  PHE 284  281  281  PHE PHE A . n 
A 1 285  MET 285  282  282  MET MET A . n 
A 1 286  LEU 286  283  283  LEU LEU A . n 
A 1 287  LEU 287  284  284  LEU LEU A . n 
A 1 288  LEU 288  285  285  LEU LEU A . n 
A 1 289  GLU 289  286  286  GLU GLU A . n 
A 1 290  LYS 290  287  287  LYS LYS A . n 
A 1 291  GLU 291  288  288  GLU GLU A . n 
A 1 292  GLU 292  289  289  GLU GLU A . n 
A 1 293  GLN 293  290  290  GLN GLN A . n 
A 1 294  MET 294  291  291  MET MET A . n 
A 1 295  ASP 295  292  292  ASP ASP A . n 
A 1 296  GLY 296  293  293  GLY GLY A . n 
A 1 297  THR 297  294  294  THR THR A . n 
A 1 298  VAL 298  295  295  VAL VAL A . n 
A 1 299  THR 299  296  296  THR THR A . n 
A 1 300  LEU 300  297  297  LEU LEU A . n 
A 1 301  LYS 301  298  298  LYS LYS A . n 
A 1 302  ASP 302  299  299  ASP ASP A . n 
A 1 303  LEU 303  300  300  LEU LEU A . n 
A 1 304  ARG 304  301  301  ARG ARG A . n 
A 1 305  VAL 305  302  302  VAL VAL A . n 
A 1 306  GLU 306  303  303  GLU GLU A . n 
A 1 307  LEU 307  304  304  LEU LEU A . n 
A 1 308  LEU 308  305  305  LEU LEU A . n 
A 1 309  GLY 309  306  306  GLY GLY A . n 
A 1 310  GLU 310  307  307  GLU GLU A . n 
A 1 311  THR 311  308  308  THR THR A . n 
A 1 312  SER 312  309  309  SER SER A . n 
A 1 313  ILE 313  310  310  ILE ILE A . n 
A 1 314  ALA 314  311  311  ALA ALA A . n 
A 1 315  GLU 315  312  312  GLU GLU A . n 
A 1 316  CYS 316  313  313  CYS CYS A . n 
A 1 317  LEU 317  314  314  LEU LEU A . n 
A 1 318  THR 318  315  315  THR THR A . n 
A 1 319  TYR 319  316  316  TYR TYR A . n 
A 1 320  LEU 320  317  317  LEU LEU A . n 
A 1 321  ASP 321  318  318  ASP ASP A . n 
A 1 322  ASN 322  319  319  ASN ASN A . n 
A 1 323  GLY 323  320  320  GLY GLY A . n 
A 1 324  VAL 324  321  321  VAL VAL A . n 
A 1 325  VAL 325  322  322  VAL VAL A . n 
A 1 326  PHE 326  323  323  PHE PHE A . n 
A 1 327  VAL 327  324  324  VAL VAL A . n 
A 1 328  GLY 328  325  325  GLY GLY A . n 
A 1 329  SER 329  326  326  SER SER A . n 
A 1 330  ARG 330  327  327  ARG ARG A . n 
A 1 331  LEU 331  328  328  LEU LEU A . n 
A 1 332  GLY 332  329  329  GLY GLY A . n 
A 1 333  ASP 333  330  330  ASP ASP A . n 
A 1 334  SER 334  331  331  SER SER A . n 
A 1 335  GLN 335  332  332  GLN GLN A . n 
A 1 336  LEU 336  333  333  LEU LEU A . n 
A 1 337  VAL 337  334  334  VAL VAL A . n 
A 1 338  LYS 338  335  335  LYS LYS A . n 
A 1 339  LEU 339  336  336  LEU LEU A . n 
A 1 340  ASN 340  337  337  ASN ASN A . n 
A 1 341  VAL 341  338  338  VAL VAL A . n 
A 1 342  ASP 342  339  339  ASP ASP A . n 
A 1 343  SER 343  340  340  SER SER A . n 
A 1 344  ASN 344  341  341  ASN ASN A . n 
A 1 345  GLU 345  342  342  GLU GLU A . n 
A 1 346  GLN 346  343  343  GLN GLN A . n 
A 1 347  GLY 347  344  344  GLY GLY A . n 
A 1 348  SER 348  345  345  SER SER A . n 
A 1 349  TYR 349  346  346  TYR TYR A . n 
A 1 350  VAL 350  347  347  VAL VAL A . n 
A 1 351  VAL 351  348  348  VAL VAL A . n 
A 1 352  ALA 352  349  349  ALA ALA A . n 
A 1 353  MET 353  350  350  MET MET A . n 
A 1 354  GLU 354  351  351  GLU GLU A . n 
A 1 355  THR 355  352  352  THR THR A . n 
A 1 356  PHE 356  353  353  PHE PHE A . n 
A 1 357  THR 357  354  354  THR THR A . n 
A 1 358  ASN 358  355  355  ASN ASN A . n 
A 1 359  LEU 359  356  356  LEU LEU A . n 
A 1 360  GLY 360  357  357  GLY GLY A . n 
A 1 361  PRO 361  358  358  PRO PRO A . n 
A 1 362  ILE 362  359  359  ILE ILE A . n 
A 1 363  VAL 363  360  360  VAL VAL A . n 
A 1 364  ASP 364  361  361  ASP ASP A . n 
A 1 365  MET 365  362  362  MET MET A . n 
A 1 366  CYS 366  363  363  CYS CYS A . n 
A 1 367  VAL 367  364  364  VAL VAL A . n 
A 1 368  VAL 368  365  365  VAL VAL A . n 
A 1 369  ASP 369  366  366  ASP ASP A . n 
A 1 370  LEU 370  367  367  LEU LEU A . n 
A 1 371  GLU 371  368  368  GLU GLU A . n 
A 1 372  ARG 372  369  369  ARG ARG A . n 
A 1 373  GLN 373  370  370  GLN GLN A . n 
A 1 374  GLY 374  371  371  GLY GLY A . n 
A 1 375  GLN 375  372  372  GLN GLN A . n 
A 1 376  GLY 376  373  373  GLY GLY A . n 
A 1 377  GLN 377  374  374  GLN GLN A . n 
A 1 378  LEU 378  375  375  LEU LEU A . n 
A 1 379  VAL 379  376  376  VAL VAL A . n 
A 1 380  THR 380  377  377  THR THR A . n 
A 1 381  CYS 381  378  378  CYS CYS A . n 
A 1 382  SER 382  379  379  SER SER A . n 
A 1 383  GLY 383  380  380  GLY GLY A . n 
A 1 384  ALA 384  381  381  ALA ALA A . n 
A 1 385  PHE 385  382  382  PHE PHE A . n 
A 1 386  LYS 386  383  383  LYS LYS A . n 
A 1 387  GLU 387  384  384  GLU GLU A . n 
A 1 388  GLY 388  385  385  GLY GLY A . n 
A 1 389  SER 389  386  386  SER SER A . n 
A 1 390  LEU 390  387  387  LEU LEU A . n 
A 1 391  ARG 391  388  388  ARG ARG A . n 
A 1 392  ILE 392  389  389  ILE ILE A . n 
A 1 393  ILE 393  390  390  ILE ILE A . n 
A 1 394  ARG 394  391  391  ARG ARG A . n 
A 1 395  ASN 395  392  392  ASN ASN A . n 
A 1 396  GLY 396  393  393  GLY GLY A . n 
A 1 397  ILE 397  394  394  ILE ILE A . n 
A 1 398  GLY 398  395  395  GLY GLY A . n 
A 1 399  ILE 399  396  396  ILE ILE A . n 
A 1 400  HIS 400  397  397  HIS HIS A . n 
A 1 401  GLU 401  398  398  GLU GLU A . n 
A 1 402  HIS 402  399  399  HIS HIS A . n 
A 1 403  ALA 403  400  400  ALA ALA A . n 
A 1 404  SER 404  401  401  SER SER A . n 
A 1 405  ILE 405  402  402  ILE ILE A . n 
A 1 406  ASP 406  403  403  ASP ASP A . n 
A 1 407  LEU 407  404  404  LEU LEU A . n 
A 1 408  PRO 408  405  405  PRO PRO A . n 
A 1 409  GLY 409  406  406  GLY GLY A . n 
A 1 410  ILE 410  407  407  ILE ILE A . n 
A 1 411  LYS 411  408  408  LYS LYS A . n 
A 1 412  GLY 412  409  409  GLY GLY A . n 
A 1 413  LEU 413  410  410  LEU LEU A . n 
A 1 414  TRP 414  411  411  TRP TRP A . n 
A 1 415  PRO 415  412  412  PRO PRO A . n 
A 1 416  LEU 416  413  413  LEU LEU A . n 
A 1 417  ARG 417  414  414  ARG ARG A . n 
A 1 418  SER 418  415  415  SER SER A . n 
A 1 419  ASP 419  416  416  ASP ASP A . n 
A 1 420  PRO 420  417  417  PRO PRO A . n 
A 1 421  ASN 421  418  418  ASN ASN A . n 
A 1 422  ARG 422  419  419  ARG ARG A . n 
A 1 423  GLU 423  420  420  GLU GLU A . n 
A 1 424  THR 424  421  421  THR THR A . n 
A 1 425  TYR 425  422  422  TYR TYR A . n 
A 1 426  ASP 426  423  423  ASP ASP A . n 
A 1 427  THR 427  424  424  THR THR A . n 
A 1 428  LEU 428  425  425  LEU LEU A . n 
A 1 429  VAL 429  426  426  VAL VAL A . n 
A 1 430  LEU 430  427  427  LEU LEU A . n 
A 1 431  SER 431  428  428  SER SER A . n 
A 1 432  PHE 432  429  429  PHE PHE A . n 
A 1 433  VAL 433  430  430  VAL VAL A . n 
A 1 434  GLY 434  431  431  GLY GLY A . n 
A 1 435  GLN 435  432  432  GLN GLN A . n 
A 1 436  THR 436  433  433  THR THR A . n 
A 1 437  ARG 437  434  434  ARG ARG A . n 
A 1 438  VAL 438  435  435  VAL VAL A . n 
A 1 439  LEU 439  436  436  LEU LEU A . n 
A 1 440  MET 440  437  437  MET MET A . n 
A 1 441  LEU 441  438  438  LEU LEU A . n 
A 1 442  ASN 442  439  439  ASN ASN A . n 
A 1 443  GLY 443  440  440  GLY GLY A . n 
A 1 444  GLU 444  441  441  GLU GLU A . n 
A 1 445  GLU 445  442  442  GLU GLU A . n 
A 1 446  VAL 446  443  443  VAL VAL A . n 
A 1 447  GLU 447  444  444  GLU GLU A . n 
A 1 448  GLU 448  445  445  GLU GLU A . n 
A 1 449  THR 449  446  446  THR THR A . n 
A 1 450  GLU 450  447  447  GLU GLU A . n 
A 1 451  LEU 451  448  448  LEU LEU A . n 
A 1 452  MET 452  449  449  MET MET A . n 
A 1 453  GLY 453  450  450  GLY GLY A . n 
A 1 454  PHE 454  451  451  PHE PHE A . n 
A 1 455  VAL 455  452  452  VAL VAL A . n 
A 1 456  ASP 456  453  453  ASP ASP A . n 
A 1 457  ASP 457  454  454  ASP ASP A . n 
A 1 458  GLN 458  455  455  GLN GLN A . n 
A 1 459  GLN 459  456  456  GLN GLN A . n 
A 1 460  THR 460  457  457  THR THR A . n 
A 1 461  PHE 461  458  458  PHE PHE A . n 
A 1 462  PHE 462  459  459  PHE PHE A . n 
A 1 463  CYS 463  460  460  CYS CYS A . n 
A 1 464  GLY 464  461  461  GLY GLY A . n 
A 1 465  ASN 465  462  462  ASN ASN A . n 
A 1 466  VAL 466  463  463  VAL VAL A . n 
A 1 467  ALA 467  464  464  ALA ALA A . n 
A 1 468  HIS 468  465  465  HIS HIS A . n 
A 1 469  GLN 469  466  466  GLN GLN A . n 
A 1 470  GLN 470  467  467  GLN GLN A . n 
A 1 471  LEU 471  468  468  LEU LEU A . n 
A 1 472  ILE 472  469  469  ILE ILE A . n 
A 1 473  GLN 473  470  470  GLN GLN A . n 
A 1 474  ILE 474  471  471  ILE ILE A . n 
A 1 475  THR 475  472  472  THR THR A . n 
A 1 476  SER 476  473  473  SER SER A . n 
A 1 477  ALA 477  474  474  ALA ALA A . n 
A 1 478  SER 478  475  475  SER SER A . n 
A 1 479  VAL 479  476  476  VAL VAL A . n 
A 1 480  ARG 480  477  477  ARG ARG A . n 
A 1 481  LEU 481  478  478  LEU LEU A . n 
A 1 482  VAL 482  479  479  VAL VAL A . n 
A 1 483  SER 483  480  480  SER SER A . n 
A 1 484  GLN 484  481  481  GLN GLN A . n 
A 1 485  GLU 485  482  482  GLU GLU A . n 
A 1 486  PRO 486  483  483  PRO PRO A . n 
A 1 487  LYS 487  484  484  LYS LYS A . n 
A 1 488  ALA 488  485  485  ALA ALA A . n 
A 1 489  LEU 489  486  486  LEU LEU A . n 
A 1 490  VAL 490  487  487  VAL VAL A . n 
A 1 491  SER 491  488  488  SER SER A . n 
A 1 492  GLU 492  489  489  GLU GLU A . n 
A 1 493  TRP 493  490  490  TRP TRP A . n 
A 1 494  LYS 494  491  491  LYS LYS A . n 
A 1 495  GLU 495  492  492  GLU GLU A . n 
A 1 496  PRO 496  493  493  PRO PRO A . n 
A 1 497  GLN 497  494  494  GLN GLN A . n 
A 1 498  ALA 498  495  495  ALA ALA A . n 
A 1 499  LYS 499  496  496  LYS LYS A . n 
A 1 500  ASN 500  497  497  ASN ASN A . n 
A 1 501  ILE 501  498  498  ILE ILE A . n 
A 1 502  SER 502  499  499  SER SER A . n 
A 1 503  VAL 503  500  500  VAL VAL A . n 
A 1 504  ALA 504  501  501  ALA ALA A . n 
A 1 505  SER 505  502  502  SER SER A . n 
A 1 506  CYS 506  503  503  CYS CYS A . n 
A 1 507  ASN 507  504  504  ASN ASN A . n 
A 1 508  SER 508  505  505  SER SER A . n 
A 1 509  SER 509  506  506  SER SER A . n 
A 1 510  GLN 510  507  507  GLN GLN A . n 
A 1 511  VAL 511  508  508  VAL VAL A . n 
A 1 512  VAL 512  509  509  VAL VAL A . n 
A 1 513  VAL 513  510  510  VAL VAL A . n 
A 1 514  ALA 514  511  511  ALA ALA A . n 
A 1 515  VAL 515  512  512  VAL VAL A . n 
A 1 516  GLY 516  513  513  GLY GLY A . n 
A 1 517  ARG 517  514  514  ARG ARG A . n 
A 1 518  ALA 518  515  515  ALA ALA A . n 
A 1 519  LEU 519  516  516  LEU LEU A . n 
A 1 520  TYR 520  517  517  TYR TYR A . n 
A 1 521  TYR 521  518  518  TYR TYR A . n 
A 1 522  LEU 522  519  519  LEU LEU A . n 
A 1 523  GLN 523  520  520  GLN GLN A . n 
A 1 524  ILE 524  521  521  ILE ILE A . n 
A 1 525  HIS 525  522  522  HIS HIS A . n 
A 1 526  PRO 526  523  523  PRO PRO A . n 
A 1 527  GLN 527  524  524  GLN GLN A . n 
A 1 528  GLU 528  525  525  GLU GLU A . n 
A 1 529  LEU 529  526  526  LEU LEU A . n 
A 1 530  ARG 530  527  527  ARG ARG A . n 
A 1 531  GLN 531  528  528  GLN GLN A . n 
A 1 532  ILE 532  529  529  ILE ILE A . n 
A 1 533  SER 533  530  530  SER SER A . n 
A 1 534  HIS 534  531  531  HIS HIS A . n 
A 1 535  THR 535  532  532  THR THR A . n 
A 1 536  GLU 536  533  533  GLU GLU A . n 
A 1 537  MET 537  534  534  MET MET A . n 
A 1 538  GLU 538  535  535  GLU GLU A . n 
A 1 539  HIS 539  536  536  HIS HIS A . n 
A 1 540  GLU 540  537  537  GLU GLU A . n 
A 1 541  VAL 541  538  538  VAL VAL A . n 
A 1 542  ALA 542  539  539  ALA ALA A . n 
A 1 543  CYS 543  540  540  CYS CYS A . n 
A 1 544  LEU 544  541  541  LEU LEU A . n 
A 1 545  ASP 545  542  542  ASP ASP A . n 
A 1 546  ILE 546  543  543  ILE ILE A . n 
A 1 547  THR 547  544  544  THR THR A . n 
A 1 548  PRO 548  545  545  PRO PRO A . n 
A 1 549  LEU 549  546  546  LEU LEU A . n 
A 1 550  GLY 550  547  547  GLY GLY A . n 
A 1 551  ASP 551  548  548  ASP ASP A . n 
A 1 552  SER 552  549  549  SER SER A . n 
A 1 553  ASN 553  550  550  ASN ASN A . n 
A 1 554  GLY 554  551  551  GLY GLY A . n 
A 1 555  LEU 555  552  552  LEU LEU A . n 
A 1 556  SER 556  553  553  SER SER A . n 
A 1 557  PRO 557  554  554  PRO PRO A . n 
A 1 558  LEU 558  555  555  LEU LEU A . n 
A 1 559  CYS 559  556  556  CYS CYS A . n 
A 1 560  ALA 560  557  557  ALA ALA A . n 
A 1 561  ILE 561  558  558  ILE ILE A . n 
A 1 562  GLY 562  559  559  GLY GLY A . n 
A 1 563  LEU 563  560  560  LEU LEU A . n 
A 1 564  TRP 564  561  561  TRP TRP A . n 
A 1 565  THR 565  562  562  THR THR A . n 
A 1 566  ASP 566  563  563  ASP ASP A . n 
A 1 567  ILE 567  564  564  ILE ILE A . n 
A 1 568  SER 568  565  565  SER SER A . n 
A 1 569  ALA 569  566  566  ALA ALA A . n 
A 1 570  ARG 570  567  567  ARG ARG A . n 
A 1 571  ILE 571  568  568  ILE ILE A . n 
A 1 572  LEU 572  569  569  LEU LEU A . n 
A 1 573  LYS 573  570  570  LYS LYS A . n 
A 1 574  LEU 574  571  571  LEU LEU A . n 
A 1 575  PRO 575  572  572  PRO PRO A . n 
A 1 576  SER 576  573  573  SER SER A . n 
A 1 577  PHE 577  574  574  PHE PHE A . n 
A 1 578  GLU 578  575  575  GLU GLU A . n 
A 1 579  LEU 579  576  576  LEU LEU A . n 
A 1 580  LEU 580  577  577  LEU LEU A . n 
A 1 581  HIS 581  578  578  HIS HIS A . n 
A 1 582  LYS 582  579  579  LYS LYS A . n 
A 1 583  GLU 583  580  580  GLU GLU A . n 
A 1 584  MET 584  581  581  MET MET A . n 
A 1 585  LEU 585  582  582  LEU LEU A . n 
A 1 586  GLY 586  583  583  GLY GLY A . n 
A 1 587  GLY 587  584  584  GLY GLY A . n 
A 1 588  GLU 588  585  585  GLU GLU A . n 
A 1 589  ILE 589  586  586  ILE ILE A . n 
A 1 590  ILE 590  587  587  ILE ILE A . n 
A 1 591  PRO 591  588  588  PRO PRO A . n 
A 1 592  ARG 592  589  589  ARG ARG A . n 
A 1 593  SER 593  590  590  SER SER A . n 
A 1 594  ILE 594  591  591  ILE ILE A . n 
A 1 595  LEU 595  592  592  LEU LEU A . n 
A 1 596  MET 596  593  593  MET MET A . n 
A 1 597  THR 597  594  594  THR THR A . n 
A 1 598  THR 598  595  595  THR THR A . n 
A 1 599  PHE 599  596  596  PHE PHE A . n 
A 1 600  GLU 600  597  597  GLU GLU A . n 
A 1 601  SER 601  598  598  SER SER A . n 
A 1 602  SER 602  599  599  SER SER A . n 
A 1 603  HIS 603  600  600  HIS HIS A . n 
A 1 604  TYR 604  601  601  TYR TYR A . n 
A 1 605  LEU 605  602  602  LEU LEU A . n 
A 1 606  LEU 606  603  603  LEU LEU A . n 
A 1 607  CYS 607  604  604  CYS CYS A . n 
A 1 608  ALA 608  605  605  ALA ALA A . n 
A 1 609  LEU 609  606  606  LEU LEU A . n 
A 1 610  GLY 610  607  607  GLY GLY A . n 
A 1 611  ASP 611  608  608  ASP ASP A . n 
A 1 612  GLY 612  609  609  GLY GLY A . n 
A 1 613  ALA 613  610  610  ALA ALA A . n 
A 1 614  LEU 614  611  611  LEU LEU A . n 
A 1 615  PHE 615  612  612  PHE PHE A . n 
A 1 616  TYR 616  613  613  TYR TYR A . n 
A 1 617  PHE 617  614  614  PHE PHE A . n 
A 1 618  GLY 618  615  615  GLY GLY A . n 
A 1 619  LEU 619  616  616  LEU LEU A . n 
A 1 620  ASN 620  617  617  ASN ASN A . n 
A 1 621  ILE 621  618  618  ILE ILE A . n 
A 1 622  GLU 622  619  619  GLU GLU A . n 
A 1 623  THR 623  620  620  THR THR A . n 
A 1 624  GLY 624  621  621  GLY GLY A . n 
A 1 625  LEU 625  622  622  LEU LEU A . n 
A 1 626  LEU 626  623  623  LEU LEU A . n 
A 1 627  SER 627  624  624  SER SER A . n 
A 1 628  ASP 628  625  625  ASP ASP A . n 
A 1 629  ARG 629  626  626  ARG ARG A . n 
A 1 630  LYS 630  627  627  LYS LYS A . n 
A 1 631  LYS 631  628  628  LYS LYS A . n 
A 1 632  VAL 632  629  629  VAL VAL A . n 
A 1 633  THR 633  630  630  THR THR A . n 
A 1 634  LEU 634  631  631  LEU LEU A . n 
A 1 635  GLY 635  632  632  GLY GLY A . n 
A 1 636  THR 636  633  633  THR THR A . n 
A 1 637  GLN 637  634  634  GLN GLN A . n 
A 1 638  PRO 638  635  635  PRO PRO A . n 
A 1 639  THR 639  636  636  THR THR A . n 
A 1 640  VAL 640  637  637  VAL VAL A . n 
A 1 641  LEU 641  638  638  LEU LEU A . n 
A 1 642  ARG 642  639  639  ARG ARG A . n 
A 1 643  THR 643  640  640  THR THR A . n 
A 1 644  PHE 644  641  641  PHE PHE A . n 
A 1 645  ARG 645  642  642  ARG ARG A . n 
A 1 646  SER 646  643  643  SER SER A . n 
A 1 647  LEU 647  644  644  LEU LEU A . n 
A 1 648  SER 648  645  645  SER SER A . n 
A 1 649  THR 649  646  646  THR THR A . n 
A 1 650  THR 650  647  647  THR THR A . n 
A 1 651  ASN 651  648  648  ASN ASN A . n 
A 1 652  VAL 652  649  649  VAL VAL A . n 
A 1 653  PHE 653  650  650  PHE PHE A . n 
A 1 654  ALA 654  651  651  ALA ALA A . n 
A 1 655  CYS 655  652  652  CYS CYS A . n 
A 1 656  SER 656  653  653  SER SER A . n 
A 1 657  ASP 657  654  654  ASP ASP A . n 
A 1 658  ARG 658  655  655  ARG ARG A . n 
A 1 659  PRO 659  656  656  PRO PRO A . n 
A 1 660  THR 660  657  657  THR THR A . n 
A 1 661  VAL 661  658  658  VAL VAL A . n 
A 1 662  ILE 662  659  659  ILE ILE A . n 
A 1 663  TYR 663  660  660  TYR TYR A . n 
A 1 664  SER 664  661  661  SER SER A . n 
A 1 665  SER 665  662  662  SER SER A . n 
A 1 666  ASN 666  663  663  ASN ASN A . n 
A 1 667  HIS 667  664  664  HIS HIS A . n 
A 1 668  LYS 668  665  665  LYS LYS A . n 
A 1 669  LEU 669  666  666  LEU LEU A . n 
A 1 670  VAL 670  667  667  VAL VAL A . n 
A 1 671  PHE 671  668  668  PHE PHE A . n 
A 1 672  SER 672  669  669  SER SER A . n 
A 1 673  ASN 673  670  670  ASN ASN A . n 
A 1 674  VAL 674  671  671  VAL VAL A . n 
A 1 675  ASN 675  672  672  ASN ASN A . n 
A 1 676  LEU 676  673  673  LEU LEU A . n 
A 1 677  LYS 677  674  674  LYS LYS A . n 
A 1 678  GLU 678  675  675  GLU GLU A . n 
A 1 679  VAL 679  676  676  VAL VAL A . n 
A 1 680  ASN 680  677  677  ASN ASN A . n 
A 1 681  TYR 681  678  678  TYR TYR A . n 
A 1 682  MET 682  679  679  MET MET A . n 
A 1 683  CYS 683  680  680  CYS CYS A . n 
A 1 684  PRO 684  681  681  PRO PRO A . n 
A 1 685  LEU 685  682  682  LEU LEU A . n 
A 1 686  ASN 686  683  683  ASN ASN A . n 
A 1 687  SER 687  684  684  SER SER A . n 
A 1 688  ASP 688  685  685  ASP ASP A . n 
A 1 689  GLY 689  686  686  GLY GLY A . n 
A 1 690  TYR 690  687  687  TYR TYR A . n 
A 1 691  PRO 691  688  688  PRO PRO A . n 
A 1 692  ASP 692  689  689  ASP ASP A . n 
A 1 693  SER 693  690  690  SER SER A . n 
A 1 694  LEU 694  691  691  LEU LEU A . n 
A 1 695  ALA 695  692  692  ALA ALA A . n 
A 1 696  LEU 696  693  693  LEU LEU A . n 
A 1 697  ALA 697  694  694  ALA ALA A . n 
A 1 698  ASN 698  695  695  ASN ASN A . n 
A 1 699  ASN 699  696  696  ASN ASN A . n 
A 1 700  SER 700  697  697  SER SER A . n 
A 1 701  THR 701  698  698  THR THR A . n 
A 1 702  LEU 702  699  699  LEU LEU A . n 
A 1 703  THR 703  700  700  THR THR A . n 
A 1 704  ILE 704  701  701  ILE ILE A . n 
A 1 705  GLY 705  702  702  GLY GLY A . n 
A 1 706  THR 706  703  703  THR THR A . n 
A 1 707  ILE 707  704  704  ILE ILE A . n 
A 1 708  ASP 708  705  705  ASP ASP A . n 
A 1 709  GLU 709  706  706  GLU GLU A . n 
A 1 710  ILE 710  707  707  ILE ILE A . n 
A 1 711  GLN 711  708  708  GLN GLN A . n 
A 1 712  LYS 712  709  709  LYS LYS A . n 
A 1 713  LEU 713  710  710  LEU LEU A . n 
A 1 714  HIS 714  711  711  HIS HIS A . n 
A 1 715  ILE 715  712  712  ILE ILE A . n 
A 1 716  ARG 716  713  713  ARG ARG A . n 
A 1 717  THR 717  714  714  THR THR A . n 
A 1 718  VAL 718  715  715  VAL VAL A . n 
A 1 719  PRO 719  716  716  PRO PRO A . n 
A 1 720  LEU 720  717  717  LEU LEU A . n 
A 1 721  TYR 721  718  718  TYR TYR A . n 
A 1 722  GLU 722  719  719  GLU GLU A . n 
A 1 723  SER 723  720  720  SER SER A . n 
A 1 724  PRO 724  721  721  PRO PRO A . n 
A 1 725  ARG 725  722  722  ARG ARG A . n 
A 1 726  LYS 726  723  723  LYS LYS A . n 
A 1 727  ILE 727  724  724  ILE ILE A . n 
A 1 728  CYS 728  725  725  CYS CYS A . n 
A 1 729  TYR 729  726  726  TYR TYR A . n 
A 1 730  GLN 730  727  727  GLN GLN A . n 
A 1 731  GLU 731  728  728  GLU GLU A . n 
A 1 732  VAL 732  729  729  VAL VAL A . n 
A 1 733  SER 733  730  730  SER SER A . n 
A 1 734  GLN 734  731  731  GLN GLN A . n 
A 1 735  CYS 735  732  732  CYS CYS A . n 
A 1 736  PHE 736  733  733  PHE PHE A . n 
A 1 737  GLY 737  734  734  GLY GLY A . n 
A 1 738  VAL 738  735  735  VAL VAL A . n 
A 1 739  LEU 739  736  736  LEU LEU A . n 
A 1 740  SER 740  737  737  SER SER A . n 
A 1 741  SER 741  738  738  SER SER A . n 
A 1 742  ARG 742  739  739  ARG ARG A . n 
A 1 743  ILE 743  740  740  ILE ILE A . n 
A 1 744  GLU 744  741  741  GLU GLU A . n 
A 1 745  VAL 745  742  742  VAL VAL A . n 
A 1 746  GLN 746  743  743  GLN GLN A . n 
A 1 747  ASP 747  744  744  ASP ASP A . n 
A 1 748  THR 748  745  745  THR THR A . n 
A 1 749  SER 749  746  746  SER SER A . n 
A 1 750  GLY 750  747  747  GLY GLY A . n 
A 1 751  GLY 751  748  748  GLY GLY A . n 
A 1 752  THR 752  749  749  THR THR A . n 
A 1 753  THR 753  750  750  THR THR A . n 
A 1 754  ALA 754  751  751  ALA ALA A . n 
A 1 755  LEU 755  752  752  LEU LEU A . n 
A 1 756  ARG 756  753  753  ARG ARG A . n 
A 1 757  PRO 757  754  754  PRO PRO A . n 
A 1 758  SER 758  755  755  SER SER A . n 
A 1 759  ALA 759  756  756  ALA ALA A . n 
A 1 760  SER 760  757  757  SER SER A . n 
A 1 761  THR 761  758  758  THR THR A . n 
A 1 762  GLN 762  759  759  GLN GLN A . n 
A 1 763  ALA 763  760  760  ALA ALA A . n 
A 1 764  LEU 764  761  761  LEU LEU A . n 
A 1 765  SER 765  762  762  SER SER A . n 
A 1 766  SER 766  763  763  SER SER A . n 
A 1 767  SER 767  764  764  SER SER A . n 
A 1 768  VAL 768  765  765  VAL VAL A . n 
A 1 769  SER 769  766  766  SER SER A . n 
A 1 770  SER 770  767  767  SER SER A . n 
A 1 771  SER 771  768  768  SER SER A . n 
A 1 772  LYS 772  769  769  LYS LYS A . n 
A 1 773  LEU 773  770  770  LEU LEU A . n 
A 1 774  PHE 774  771  771  PHE PHE A . n 
A 1 775  SER 775  772  772  SER SER A . n 
A 1 776  SER 776  773  773  SER SER A . n 
A 1 777  SER 777  774  ?    ?   ?   A . n 
A 1 778  THR 778  775  ?    ?   ?   A . n 
A 1 779  ALA 779  776  ?    ?   ?   A . n 
A 1 780  PRO 780  777  ?    ?   ?   A . n 
A 1 781  HIS 781  778  ?    ?   ?   A . n 
A 1 782  GLU 782  779  ?    ?   ?   A . n 
A 1 783  THR 783  780  ?    ?   ?   A . n 
A 1 784  SER 784  781  ?    ?   ?   A . n 
A 1 785  PHE 785  782  ?    ?   ?   A . n 
A 1 786  GLY 786  783  783  GLY GLY A . n 
A 1 787  GLU 787  784  784  GLU GLU A . n 
A 1 788  GLU 788  785  785  GLU GLU A . n 
A 1 789  VAL 789  786  786  VAL VAL A . n 
A 1 790  GLU 790  787  787  GLU GLU A . n 
A 1 791  VAL 791  788  788  VAL VAL A . n 
A 1 792  HIS 792  789  789  HIS HIS A . n 
A 1 793  ASN 793  790  790  ASN ASN A . n 
A 1 794  LEU 794  791  791  LEU LEU A . n 
A 1 795  LEU 795  792  792  LEU LEU A . n 
A 1 796  ILE 796  793  793  ILE ILE A . n 
A 1 797  ILE 797  794  794  ILE ILE A . n 
A 1 798  ASP 798  795  795  ASP ASP A . n 
A 1 799  GLN 799  796  796  GLN GLN A . n 
A 1 800  HIS 800  797  797  HIS HIS A . n 
A 1 801  THR 801  798  798  THR THR A . n 
A 1 802  PHE 802  799  799  PHE PHE A . n 
A 1 803  GLU 803  800  800  GLU GLU A . n 
A 1 804  VAL 804  801  801  VAL VAL A . n 
A 1 805  LEU 805  802  802  LEU LEU A . n 
A 1 806  HIS 806  803  803  HIS HIS A . n 
A 1 807  ALA 807  804  804  ALA ALA A . n 
A 1 808  HIS 808  805  805  HIS HIS A . n 
A 1 809  GLN 809  806  806  GLN GLN A . n 
A 1 810  PHE 810  807  807  PHE PHE A . n 
A 1 811  LEU 811  808  808  LEU LEU A . n 
A 1 812  GLN 812  809  809  GLN GLN A . n 
A 1 813  ASN 813  810  810  ASN ASN A . n 
A 1 814  GLU 814  811  811  GLU GLU A . n 
A 1 815  TYR 815  812  812  TYR TYR A . n 
A 1 816  ALA 816  813  813  ALA ALA A . n 
A 1 817  LEU 817  814  814  LEU LEU A . n 
A 1 818  SER 818  815  815  SER SER A . n 
A 1 819  LEU 819  816  816  LEU LEU A . n 
A 1 820  VAL 820  817  817  VAL VAL A . n 
A 1 821  SER 821  818  818  SER SER A . n 
A 1 822  CYS 822  819  819  CYS CYS A . n 
A 1 823  LYS 823  820  820  LYS LYS A . n 
A 1 824  LEU 824  821  821  LEU LEU A . n 
A 1 825  GLY 825  822  822  GLY GLY A . n 
A 1 826  LYS 826  823  823  LYS LYS A . n 
A 1 827  ASP 827  824  824  ASP ASP A . n 
A 1 828  PRO 828  825  825  PRO PRO A . n 
A 1 829  ASN 829  826  826  ASN ASN A . n 
A 1 830  THR 830  827  827  THR THR A . n 
A 1 831  TYR 831  828  828  TYR TYR A . n 
A 1 832  PHE 832  829  829  PHE PHE A . n 
A 1 833  ILE 833  830  830  ILE ILE A . n 
A 1 834  VAL 834  831  831  VAL VAL A . n 
A 1 835  GLY 835  832  832  GLY GLY A . n 
A 1 836  THR 836  833  833  THR THR A . n 
A 1 837  ALA 837  834  834  ALA ALA A . n 
A 1 838  MET 838  835  835  MET MET A . n 
A 1 839  VAL 839  836  836  VAL VAL A . n 
A 1 840  TYR 840  837  837  TYR TYR A . n 
A 1 841  PRO 841  838  838  PRO PRO A . n 
A 1 842  GLU 842  839  839  GLU GLU A . n 
A 1 843  GLU 843  840  840  GLU GLU A . n 
A 1 844  ALA 844  841  841  ALA ALA A . n 
A 1 845  GLU 845  842  842  GLU GLU A . n 
A 1 846  PRO 846  843  843  PRO PRO A . n 
A 1 847  LYS 847  844  844  LYS LYS A . n 
A 1 848  GLN 848  845  845  GLN GLN A . n 
A 1 849  GLY 849  846  846  GLY GLY A . n 
A 1 850  ARG 850  847  847  ARG ARG A . n 
A 1 851  ILE 851  848  848  ILE ILE A . n 
A 1 852  VAL 852  849  849  VAL VAL A . n 
A 1 853  VAL 853  850  850  VAL VAL A . n 
A 1 854  PHE 854  851  851  PHE PHE A . n 
A 1 855  GLN 855  852  852  GLN GLN A . n 
A 1 856  TYR 856  853  853  TYR TYR A . n 
A 1 857  SER 857  854  854  SER SER A . n 
A 1 858  ASP 858  855  855  ASP ASP A . n 
A 1 859  GLY 859  856  856  GLY GLY A . n 
A 1 860  LYS 860  857  857  LYS LYS A . n 
A 1 861  LEU 861  858  858  LEU LEU A . n 
A 1 862  GLN 862  859  859  GLN GLN A . n 
A 1 863  THR 863  860  860  THR THR A . n 
A 1 864  VAL 864  861  861  VAL VAL A . n 
A 1 865  ALA 865  862  862  ALA ALA A . n 
A 1 866  GLU 866  863  863  GLU GLU A . n 
A 1 867  LYS 867  864  864  LYS LYS A . n 
A 1 868  GLU 868  865  865  GLU GLU A . n 
A 1 869  VAL 869  866  866  VAL VAL A . n 
A 1 870  LYS 870  867  867  LYS LYS A . n 
A 1 871  GLY 871  868  868  GLY GLY A . n 
A 1 872  ALA 872  869  869  ALA ALA A . n 
A 1 873  VAL 873  870  870  VAL VAL A . n 
A 1 874  TYR 874  871  871  TYR TYR A . n 
A 1 875  SER 875  872  872  SER SER A . n 
A 1 876  MET 876  873  873  MET MET A . n 
A 1 877  VAL 877  874  874  VAL VAL A . n 
A 1 878  GLU 878  875  875  GLU GLU A . n 
A 1 879  PHE 879  876  876  PHE PHE A . n 
A 1 880  ASN 880  877  877  ASN ASN A . n 
A 1 881  GLY 881  878  878  GLY GLY A . n 
A 1 882  LYS 882  879  879  LYS LYS A . n 
A 1 883  LEU 883  880  880  LEU LEU A . n 
A 1 884  LEU 884  881  881  LEU LEU A . n 
A 1 885  ALA 885  882  882  ALA ALA A . n 
A 1 886  SER 886  883  883  SER SER A . n 
A 1 887  ILE 887  884  884  ILE ILE A . n 
A 1 888  ASN 888  885  885  ASN ASN A . n 
A 1 889  SER 889  886  886  SER SER A . n 
A 1 890  THR 890  887  887  THR THR A . n 
A 1 891  VAL 891  888  888  VAL VAL A . n 
A 1 892  ARG 892  889  889  ARG ARG A . n 
A 1 893  LEU 893  890  890  LEU LEU A . n 
A 1 894  TYR 894  891  891  TYR TYR A . n 
A 1 895  GLU 895  892  892  GLU GLU A . n 
A 1 896  TRP 896  893  893  TRP TRP A . n 
A 1 897  THR 897  894  894  THR THR A . n 
A 1 898  THR 898  895  895  THR THR A . n 
A 1 899  GLU 899  896  896  GLU GLU A . n 
A 1 900  LYS 900  897  897  LYS LYS A . n 
A 1 901  ASP 901  898  898  ASP ASP A . n 
A 1 902  VAL 902  899  899  VAL VAL A . n 
A 1 903  ARG 903  900  900  ARG ARG A . n 
A 1 904  THR 904  901  901  THR THR A . n 
A 1 905  GLU 905  902  902  GLU GLU A . n 
A 1 906  CYS 906  903  903  CYS CYS A . n 
A 1 907  ASN 907  904  904  ASN ASN A . n 
A 1 908  HIS 908  905  905  HIS HIS A . n 
A 1 909  TYR 909  906  906  TYR TYR A . n 
A 1 910  ASN 910  907  907  ASN ASN A . n 
A 1 911  ASN 911  908  908  ASN ASN A . n 
A 1 912  ILE 912  909  909  ILE ILE A . n 
A 1 913  MET 913  910  910  MET MET A . n 
A 1 914  ALA 914  911  911  ALA ALA A . n 
A 1 915  LEU 915  912  912  LEU LEU A . n 
A 1 916  TYR 916  913  913  TYR TYR A . n 
A 1 917  LEU 917  914  914  LEU LEU A . n 
A 1 918  LYS 918  915  915  LYS LYS A . n 
A 1 919  THR 919  916  916  THR THR A . n 
A 1 920  LYS 920  917  917  LYS LYS A . n 
A 1 921  GLY 921  918  918  GLY GLY A . n 
A 1 922  ASP 922  919  919  ASP ASP A . n 
A 1 923  PHE 923  920  920  PHE PHE A . n 
A 1 924  ILE 924  921  921  ILE ILE A . n 
A 1 925  LEU 925  922  922  LEU LEU A . n 
A 1 926  VAL 926  923  923  VAL VAL A . n 
A 1 927  GLY 927  924  924  GLY GLY A . n 
A 1 928  ASP 928  925  925  ASP ASP A . n 
A 1 929  LEU 929  926  926  LEU LEU A . n 
A 1 930  MET 930  927  927  MET MET A . n 
A 1 931  ARG 931  928  928  ARG ARG A . n 
A 1 932  SER 932  929  929  SER SER A . n 
A 1 933  VAL 933  930  930  VAL VAL A . n 
A 1 934  LEU 934  931  931  LEU LEU A . n 
A 1 935  LEU 935  932  932  LEU LEU A . n 
A 1 936  LEU 936  933  933  LEU LEU A . n 
A 1 937  ALA 937  934  934  ALA ALA A . n 
A 1 938  TYR 938  935  935  TYR TYR A . n 
A 1 939  LYS 939  936  936  LYS LYS A . n 
A 1 940  PRO 940  937  937  PRO PRO A . n 
A 1 941  MET 941  938  938  MET MET A . n 
A 1 942  GLU 942  939  939  GLU GLU A . n 
A 1 943  GLY 943  940  940  GLY GLY A . n 
A 1 944  ASN 944  941  941  ASN ASN A . n 
A 1 945  PHE 945  942  942  PHE PHE A . n 
A 1 946  GLU 946  943  943  GLU GLU A . n 
A 1 947  GLU 947  944  944  GLU GLU A . n 
A 1 948  ILE 948  945  945  ILE ILE A . n 
A 1 949  ALA 949  946  946  ALA ALA A . n 
A 1 950  ARG 950  947  947  ARG ARG A . n 
A 1 951  ASP 951  948  948  ASP ASP A . n 
A 1 952  PHE 952  949  949  PHE PHE A . n 
A 1 953  ASN 953  950  950  ASN ASN A . n 
A 1 954  PRO 954  951  951  PRO PRO A . n 
A 1 955  ASN 955  952  952  ASN ASN A . n 
A 1 956  TRP 956  953  953  TRP TRP A . n 
A 1 957  MET 957  954  954  MET MET A . n 
A 1 958  SER 958  955  955  SER SER A . n 
A 1 959  ALA 959  956  956  ALA ALA A . n 
A 1 960  VAL 960  957  957  VAL VAL A . n 
A 1 961  GLU 961  958  958  GLU GLU A . n 
A 1 962  ILE 962  959  959  ILE ILE A . n 
A 1 963  LEU 963  960  960  LEU LEU A . n 
A 1 964  ASP 964  961  961  ASP ASP A . n 
A 1 965  ASP 965  962  962  ASP ASP A . n 
A 1 966  ASP 966  963  963  ASP ASP A . n 
A 1 967  ASN 967  964  964  ASN ASN A . n 
A 1 968  PHE 968  965  965  PHE PHE A . n 
A 1 969  LEU 969  966  966  LEU LEU A . n 
A 1 970  GLY 970  967  967  GLY GLY A . n 
A 1 971  ALA 971  968  968  ALA ALA A . n 
A 1 972  GLU 972  969  969  GLU GLU A . n 
A 1 973  ASN 973  970  970  ASN ASN A . n 
A 1 974  ALA 974  971  971  ALA ALA A . n 
A 1 975  PHE 975  972  972  PHE PHE A . n 
A 1 976  ASN 976  973  973  ASN ASN A . n 
A 1 977  LEU 977  974  974  LEU LEU A . n 
A 1 978  PHE 978  975  975  PHE PHE A . n 
A 1 979  VAL 979  976  976  VAL VAL A . n 
A 1 980  CYS 980  977  977  CYS CYS A . n 
A 1 981  GLN 981  978  978  GLN GLN A . n 
A 1 982  LYS 982  979  979  LYS LYS A . n 
A 1 983  ASP 983  980  980  ASP ASP A . n 
A 1 984  SER 984  981  981  SER SER A . n 
A 1 985  ALA 985  982  982  ALA ALA A . n 
A 1 986  ALA 986  983  983  ALA ALA A . n 
A 1 987  THR 987  984  984  THR THR A . n 
A 1 988  THR 988  985  985  THR THR A . n 
A 1 989  ASP 989  986  986  ASP ASP A . n 
A 1 990  GLU 990  987  987  GLU GLU A . n 
A 1 991  GLU 991  988  988  GLU GLU A . n 
A 1 992  ARG 992  989  989  ARG ARG A . n 
A 1 993  GLN 993  990  990  GLN GLN A . n 
A 1 994  HIS 994  991  991  HIS HIS A . n 
A 1 995  LEU 995  992  992  LEU LEU A . n 
A 1 996  GLN 996  993  993  GLN GLN A . n 
A 1 997  GLU 997  994  994  GLU GLU A . n 
A 1 998  VAL 998  995  995  VAL VAL A . n 
A 1 999  GLY 999  996  996  GLY GLY A . n 
A 1 1000 LEU 1000 997  997  LEU LEU A . n 
A 1 1001 PHE 1001 998  998  PHE PHE A . n 
A 1 1002 HIS 1002 999  999  HIS HIS A . n 
A 1 1003 LEU 1003 1000 1000 LEU LEU A . n 
A 1 1004 GLY 1004 1001 1001 GLY GLY A . n 
A 1 1005 GLU 1005 1002 1002 GLU GLU A . n 
A 1 1006 PHE 1006 1003 1003 PHE PHE A . n 
A 1 1007 VAL 1007 1004 1004 VAL VAL A . n 
A 1 1008 ASN 1008 1005 1005 ASN ASN A . n 
A 1 1009 VAL 1009 1006 1006 VAL VAL A . n 
A 1 1010 PHE 1010 1007 1007 PHE PHE A . n 
A 1 1011 CYS 1011 1008 1008 CYS CYS A . n 
A 1 1012 HIS 1012 1009 1009 HIS HIS A . n 
A 1 1013 GLY 1013 1010 1010 GLY GLY A . n 
A 1 1014 SER 1014 1011 1011 SER SER A . n 
A 1 1015 LEU 1015 1012 1012 LEU LEU A . n 
A 1 1016 VAL 1016 1013 1013 VAL VAL A . n 
A 1 1017 MET 1017 1014 1014 MET MET A . n 
A 1 1018 GLN 1018 1015 1015 GLN GLN A . n 
A 1 1019 ASN 1019 1016 ?    ?   ?   A . n 
A 1 1020 LEU 1020 1017 ?    ?   ?   A . n 
A 1 1021 GLY 1021 1018 ?    ?   ?   A . n 
A 1 1022 GLU 1022 1019 ?    ?   ?   A . n 
A 1 1023 THR 1023 1020 ?    ?   ?   A . n 
A 1 1024 SER 1024 1021 ?    ?   ?   A . n 
A 1 1025 THR 1025 1022 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1023 1023 PRO PRO A . n 
A 1 1027 THR 1027 1024 1024 THR THR A . n 
A 1 1028 GLN 1028 1025 1025 GLN GLN A . n 
A 1 1029 GLY 1029 1026 1026 GLY GLY A . n 
A 1 1030 SER 1030 1027 1027 SER SER A . n 
A 1 1031 VAL 1031 1028 1028 VAL VAL A . n 
A 1 1032 LEU 1032 1029 1029 LEU LEU A . n 
A 1 1033 PHE 1033 1030 1030 PHE PHE A . n 
A 1 1034 GLY 1034 1031 1031 GLY GLY A . n 
A 1 1035 THR 1035 1032 1032 THR THR A . n 
A 1 1036 VAL 1036 1033 1033 VAL VAL A . n 
A 1 1037 ASN 1037 1034 1034 ASN ASN A . n 
A 1 1038 GLY 1038 1035 1035 GLY GLY A . n 
A 1 1039 MET 1039 1036 1036 MET MET A . n 
A 1 1040 ILE 1040 1037 1037 ILE ILE A . n 
A 1 1041 GLY 1041 1038 1038 GLY GLY A . n 
A 1 1042 LEU 1042 1039 1039 LEU LEU A . n 
A 1 1043 VAL 1043 1040 1040 VAL VAL A . n 
A 1 1044 THR 1044 1041 1041 THR THR A . n 
A 1 1045 SER 1045 1042 1042 SER SER A . n 
A 1 1046 LEU 1046 1043 1043 LEU LEU A . n 
A 1 1047 SER 1047 1044 1044 SER SER A . n 
A 1 1048 GLU 1048 1045 1045 GLU GLU A . n 
A 1 1049 SER 1049 1046 1046 SER SER A . n 
A 1 1050 TRP 1050 1047 1047 TRP TRP A . n 
A 1 1051 TYR 1051 1048 1048 TYR TYR A . n 
A 1 1052 ASN 1052 1049 1049 ASN ASN A . n 
A 1 1053 LEU 1053 1050 1050 LEU LEU A . n 
A 1 1054 LEU 1054 1051 1051 LEU LEU A . n 
A 1 1055 LEU 1055 1052 1052 LEU LEU A . n 
A 1 1056 ASP 1056 1053 1053 ASP ASP A . n 
A 1 1057 MET 1057 1054 1054 MET MET A . n 
A 1 1058 GLN 1058 1055 1055 GLN GLN A . n 
A 1 1059 ASN 1059 1056 1056 ASN ASN A . n 
A 1 1060 ARG 1060 1057 1057 ARG ARG A . n 
A 1 1061 LEU 1061 1058 1058 LEU LEU A . n 
A 1 1062 ASN 1062 1059 1059 ASN ASN A . n 
A 1 1063 LYS 1063 1060 1060 LYS LYS A . n 
A 1 1064 VAL 1064 1061 1061 VAL VAL A . n 
A 1 1065 ILE 1065 1062 1062 ILE ILE A . n 
A 1 1066 LYS 1066 1063 1063 LYS LYS A . n 
A 1 1067 SER 1067 1064 1064 SER SER A . n 
A 1 1068 VAL 1068 1065 1065 VAL VAL A . n 
A 1 1069 GLY 1069 1066 1066 GLY GLY A . n 
A 1 1070 LYS 1070 1067 1067 LYS LYS A . n 
A 1 1071 ILE 1071 1068 1068 ILE ILE A . n 
A 1 1072 GLU 1072 1069 1069 GLU GLU A . n 
A 1 1073 HIS 1073 1070 1070 HIS HIS A . n 
A 1 1074 SER 1074 1071 1071 SER SER A . n 
A 1 1075 PHE 1075 1072 1072 PHE PHE A . n 
A 1 1076 TRP 1076 1073 1073 TRP TRP A . n 
A 1 1077 ARG 1077 1074 1074 ARG ARG A . n 
A 1 1078 SER 1078 1075 1075 SER SER A . n 
A 1 1079 PHE 1079 1076 1076 PHE PHE A . n 
A 1 1080 HIS 1080 1077 1077 HIS HIS A . n 
A 1 1081 THR 1081 1078 1078 THR THR A . n 
A 1 1082 GLU 1082 1079 1079 GLU GLU A . n 
A 1 1083 ARG 1083 1080 1080 ARG ARG A . n 
A 1 1084 LYS 1084 1081 1081 LYS LYS A . n 
A 1 1085 THR 1085 1082 1082 THR THR A . n 
A 1 1086 GLU 1086 1083 1083 GLU GLU A . n 
A 1 1087 PRO 1087 1084 1084 PRO PRO A . n 
A 1 1088 ALA 1088 1085 1085 ALA ALA A . n 
A 1 1089 THR 1089 1086 1086 THR THR A . n 
A 1 1090 GLY 1090 1087 1087 GLY GLY A . n 
A 1 1091 PHE 1091 1088 1088 PHE PHE A . n 
A 1 1092 ILE 1092 1089 1089 ILE ILE A . n 
A 1 1093 ASP 1093 1090 1090 ASP ASP A . n 
A 1 1094 GLY 1094 1091 1091 GLY GLY A . n 
A 1 1095 ASP 1095 1092 1092 ASP ASP A . n 
A 1 1096 LEU 1096 1093 1093 LEU LEU A . n 
A 1 1097 ILE 1097 1094 1094 ILE ILE A . n 
A 1 1098 GLU 1098 1095 1095 GLU GLU A . n 
A 1 1099 SER 1099 1096 1096 SER SER A . n 
A 1 1100 PHE 1100 1097 1097 PHE PHE A . n 
A 1 1101 LEU 1101 1098 1098 LEU LEU A . n 
A 1 1102 ASP 1102 1099 1099 ASP ASP A . n 
A 1 1103 ILE 1103 1100 1100 ILE ILE A . n 
A 1 1104 SER 1104 1101 1101 SER SER A . n 
A 1 1105 ARG 1105 1102 1102 ARG ARG A . n 
A 1 1106 PRO 1106 1103 1103 PRO PRO A . n 
A 1 1107 LYS 1107 1104 1104 LYS LYS A . n 
A 1 1108 MET 1108 1105 1105 MET MET A . n 
A 1 1109 GLN 1109 1106 1106 GLN GLN A . n 
A 1 1110 GLU 1110 1107 1107 GLU GLU A . n 
A 1 1111 VAL 1111 1108 1108 VAL VAL A . n 
A 1 1112 VAL 1112 1109 1109 VAL VAL A . n 
A 1 1113 ALA 1113 1110 1110 ALA ALA A . n 
A 1 1114 ASN 1114 1111 1111 ASN ASN A . n 
A 1 1115 LEU 1115 1112 ?    ?   ?   A . n 
A 1 1116 GLN 1116 1113 ?    ?   ?   A . n 
A 1 1117 TYR 1117 1114 ?    ?   ?   A . n 
A 1 1118 ASP 1118 1115 ?    ?   ?   A . n 
A 1 1119 ASP 1119 1116 ?    ?   ?   A . n 
A 1 1120 GLY 1120 1117 ?    ?   ?   A . n 
A 1 1121 SER 1121 1118 ?    ?   ?   A . n 
A 1 1122 GLY 1122 1119 ?    ?   ?   A . n 
A 1 1123 MET 1123 1120 ?    ?   ?   A . n 
A 1 1124 LYS 1124 1121 ?    ?   ?   A . n 
A 1 1125 ARG 1125 1122 1122 ARG ARG A . n 
A 1 1126 GLU 1126 1123 1123 GLU GLU A . n 
A 1 1127 ALA 1127 1124 1124 ALA ALA A . n 
A 1 1128 THR 1128 1125 1125 THR THR A . n 
A 1 1129 ALA 1129 1126 1126 ALA ALA A . n 
A 1 1130 ASP 1130 1127 1127 ASP ASP A . n 
A 1 1131 ASP 1131 1128 1128 ASP ASP A . n 
A 1 1132 LEU 1132 1129 1129 LEU LEU A . n 
A 1 1133 ILE 1133 1130 1130 ILE ILE A . n 
A 1 1134 LYS 1134 1131 1131 LYS LYS A . n 
A 1 1135 VAL 1135 1132 1132 VAL VAL A . n 
A 1 1136 VAL 1136 1133 1133 VAL VAL A . n 
A 1 1137 GLU 1137 1134 1134 GLU GLU A . n 
A 1 1138 GLU 1138 1135 1135 GLU GLU A . n 
A 1 1139 LEU 1139 1136 1136 LEU LEU A . n 
A 1 1140 THR 1140 1137 1137 THR THR A . n 
A 1 1141 ARG 1141 1138 1138 ARG ARG A . n 
A 1 1142 ILE 1142 1139 1139 ILE ILE A . n 
A 1 1143 HIS 1143 1140 1140 HIS HIS A . n 
B 2 1    ASN 1    124  124  ASN ASN B . n 
B 2 2    ALA 2    125  125  ALA ALA B . n 
B 2 3    SER 3    126  126  SER SER B . n 
B 2 4    SER 4    127  127  SER SER B . n 
B 2 5    MET 5    128  128  MET MET B . n 
B 2 6    LEU 6    129  129  LEU LEU B . n 
B 2 7    ARG 7    130  130  ARG ARG B . n 
B 2 8    LYS 8    131  131  LYS LYS B . n 
B 2 9    SER 9    132  132  SER SER B . n 
B 2 10   GLN 10   133  133  GLN GLN B . n 
B 2 11   LEU 11   134  134  LEU LEU B . n 
B 2 12   GLY 12   135  135  GLY GLY B . n 
B 2 13   PHE 13   136  136  PHE PHE B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1220  ? 
1 MORE         -5    ? 
1 'SSA (A^2)'  48930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3I8C 
_pdbx_entry_details.sequence_details     'MUTATIONS OCCURRED DURING THE CLONING OF DDB1' 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    708 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   LEU 
_pdbx_validate_close_contact.auth_seq_id_2    710 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.16 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  A PHE 202 ? ? O  A PHE 202 ? ? 1.374 1.229 0.145  0.019 N 
2 1 CB A SER 697 ? ? OG A SER 697 ? ? 1.310 1.418 -0.108 0.013 N 
3 1 C  A SER 697 ? ? O  A SER 697 ? ? 1.109 1.229 -0.120 0.019 N 
4 1 CB A CYS 725 ? ? SG A CYS 725 ? ? 1.625 1.812 -0.187 0.016 N 
5 1 N  A ASP 919 ? ? CA A ASP 919 ? ? 1.308 1.459 -0.151 0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N  A PRO 185 ? ? CA A PRO 185 ? ? C   A PRO 185 ? ? 129.31 112.10 17.21  2.60 N 
2  1 N  A GLN 186 ? ? CA A GLN 186 ? ? CB  A GLN 186 ? ? 87.52  110.60 -23.08 1.80 N 
3  1 CB A ASP 330 ? ? CG A ASP 330 ? ? OD1 A ASP 330 ? ? 128.81 118.30 10.51  0.90 N 
4  1 CB A ASP 330 ? ? CG A ASP 330 ? ? OD2 A ASP 330 ? ? 111.90 118.30 -6.40  0.90 N 
5  1 CB A PRO 493 ? ? CA A PRO 493 ? ? C   A PRO 493 ? ? 125.57 111.70 13.87  2.10 N 
6  1 N  A GLN 494 ? ? CA A GLN 494 ? ? CB  A GLN 494 ? ? 84.61  110.60 -25.99 1.80 N 
7  1 N  A ARG 514 ? ? CA A ARG 514 ? ? CB  A ARG 514 ? ? 92.56  110.60 -18.04 1.80 N 
8  1 N  A SER 690 ? ? CA A SER 690 ? ? CB  A SER 690 ? ? 121.25 110.50 10.75  1.50 N 
9  1 CA A GLY 918 ? ? C  A GLY 918 ? ? N   A ASP 919 ? ? 132.40 117.20 15.20  2.20 Y 
10 1 O  A GLY 918 ? ? C  A GLY 918 ? ? N   A ASP 919 ? ? 106.01 122.70 -16.69 1.60 Y 
11 1 C  A GLY 918 ? ? N  A ASP 919 ? ? CA  A ASP 919 ? ? 145.43 121.70 23.73  2.50 Y 
12 1 C  B SER 132 ? ? N  B GLN 133 ? ? CA  B GLN 133 ? ? 105.16 121.70 -16.54 2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASP A 28   ? ? 157.12  127.87  
2   1 LYS A 35   ? ? -84.55  -101.12 
3   1 ASN A 36   ? ? -119.43 -70.55  
4   1 VAL A 52   ? ? -145.14 -44.37  
5   1 LYS A 53   ? ? -163.01 117.69  
6   1 TYR A 58   ? ? -95.10  55.49   
7   1 THR A 118  ? ? 84.83   18.98   
8   1 CYS A 128  ? ? 86.46   27.68   
9   1 MET A 130  ? ? -160.81 -168.04 
10  1 ASP A 148  ? ? -89.11  -115.00 
11  1 ASN A 149  ? ? 36.10   29.29   
12  1 GLN A 174  ? ? -63.26  -86.11  
13  1 PRO A 176  ? ? -26.86  125.55  
14  1 PRO A 185  ? ? -27.51  -59.46  
15  1 GLU A 201  ? ? -110.56 -118.88 
16  1 PHE A 202  ? ? -158.58 -42.20  
17  1 ASN A 203  ? ? 65.44   -158.85 
18  1 LYS A 208  ? ? -41.16  167.85  
19  1 ALA A 214  ? ? -22.71  -39.80  
20  1 GLU A 224  ? ? -28.88  -59.43  
21  1 GLU A 235  ? ? 47.83   -3.83   
22  1 VAL A 259  ? ? -163.84 -19.75  
23  1 LYS A 287  ? ? -62.59  -177.34 
24  1 GLU A 288  ? ? -171.83 117.59  
25  1 MET A 291  ? ? -24.44  -96.22  
26  1 THR A 296  ? ? -107.30 -167.38 
27  1 THR A 308  ? ? -118.27 -167.53 
28  1 LEU A 317  ? ? -108.80 -127.27 
29  1 ASP A 318  ? ? -61.08  -104.98 
30  1 ASN A 341  ? ? -94.04  -156.36 
31  1 GLN A 343  ? ? 102.13  -28.35  
32  1 ASP A 366  ? ? -59.70  59.47   
33  1 LEU A 367  ? ? -17.12  -78.37  
34  1 GLU A 368  ? ? -68.47  31.03   
35  1 ARG A 369  ? ? 35.73   62.10   
36  1 PHE A 382  ? ? 43.92   -144.27 
37  1 SER A 401  ? ? -154.92 88.56   
38  1 ASP A 403  ? ? -65.35  97.35   
39  1 PRO A 405  ? ? -67.68  90.85   
40  1 ILE A 407  ? ? -5.97   111.95  
41  1 LEU A 410  ? ? 173.33  130.87  
42  1 PRO A 412  ? ? -64.37  -177.42 
43  1 LEU A 413  ? ? -179.19 102.98  
44  1 SER A 415  ? ? -71.44  46.37   
45  1 ASP A 416  ? ? 179.59  138.15  
46  1 ASN A 418  ? ? -123.02 -65.53  
47  1 VAL A 430  ? ? -49.82  72.68   
48  1 ASN A 439  ? ? -70.76  28.68   
49  1 THR A 446  ? ? -127.82 -159.51 
50  1 CYS A 460  ? ? -157.04 -0.84   
51  1 ASN A 462  ? ? -165.23 60.10   
52  1 HIS A 465  ? ? 77.93   30.30   
53  1 ALA A 474  ? ? -62.69  -82.80  
54  1 VAL A 476  ? ? -60.45  99.29   
55  1 GLU A 482  ? ? -80.53  -70.66  
56  1 LYS A 484  ? ? 61.67   61.88   
57  1 ALA A 485  ? ? -157.74 -134.41 
58  1 LEU A 486  ? ? -103.74 48.14   
59  1 GLU A 489  ? ? -170.44 111.09  
60  1 PRO A 493  ? ? -27.38  -75.45  
61  1 GLN A 494  ? ? -68.77  9.35    
62  1 ALA A 495  ? ? 70.28   66.54   
63  1 SER A 502  ? ? 173.16  140.02  
64  1 CYS A 503  ? ? 171.77  176.55  
65  1 ASN A 504  ? ? -119.31 -110.41 
66  1 SER A 506  ? ? -142.38 -30.17  
67  1 TYR A 517  ? ? -93.65  -149.88 
68  1 TYR A 518  ? ? 169.63  119.21  
69  1 PRO A 523  ? ? -29.88  101.14  
70  1 ILE A 529  ? ? -140.21 -108.94 
71  1 GLU A 535  ? ? -28.08  -62.30  
72  1 LEU A 546  ? ? -86.03  -116.37 
73  1 PRO A 554  ? ? -55.04  -138.81 
74  1 THR A 562  ? ? -142.88 -41.39  
75  1 ILE A 564  ? ? 39.46   87.43   
76  1 LYS A 570  ? ? -116.17 -168.25 
77  1 LEU A 571  ? ? -84.62  -91.56  
78  1 PHE A 574  ? ? 81.60   34.36   
79  1 LEU A 577  ? ? -101.02 -140.91 
80  1 MET A 581  ? ? -111.23 64.61   
81  1 LEU A 582  ? ? -47.33  157.99  
82  1 ILE A 591  ? ? 173.90  86.45   
83  1 THR A 594  ? ? -173.16 -179.61 
84  1 PHE A 596  ? ? -164.44 -64.59  
85  1 GLU A 597  ? ? -131.56 -66.67  
86  1 SER A 599  ? ? -178.12 136.55  
87  1 LEU A 616  ? ? -125.06 -169.42 
88  1 GLU A 619  ? ? -88.60  -72.36  
89  1 THR A 620  ? ? -63.81  -88.43  
90  1 LEU A 623  ? ? -72.31  -154.05 
91  1 SER A 624  ? ? -174.64 -126.03 
92  1 VAL A 629  ? ? -71.19  -157.38 
93  1 THR A 630  ? ? -143.91 -33.76  
94  1 LEU A 631  ? ? 35.73   -121.62 
95  1 PRO A 635  ? ? -38.76  158.77  
96  1 SER A 643  ? ? -117.44 -106.79 
97  1 LEU A 644  ? ? -110.12 -131.18 
98  1 THR A 647  ? ? -26.21  125.03  
99  1 ASN A 648  ? ? -113.79 -168.75 
100 1 TYR A 660  ? ? -102.58 -126.28 
101 1 SER A 662  ? ? -93.83  -127.29 
102 1 HIS A 664  ? ? -162.28 2.67    
103 1 LYS A 665  ? ? -76.51  -140.06 
104 1 PHE A 668  ? ? -142.11 57.59   
105 1 LYS A 674  ? ? -50.03  -70.56  
106 1 GLU A 675  ? ? -175.86 144.64  
107 1 ASN A 683  ? ? -170.30 17.93   
108 1 TYR A 687  ? ? -168.97 61.96   
109 1 PRO A 688  ? ? -58.04  -152.12 
110 1 ASP A 689  ? ? -32.58  80.85   
111 1 SER A 690  ? ? -106.88 -159.06 
112 1 LEU A 691  ? ? 178.98  120.54  
113 1 ASN A 696  ? ? -24.79  -53.89  
114 1 THR A 698  ? ? 143.73  132.15  
115 1 GLU A 706  ? ? -46.51  -101.27 
116 1 ILE A 707  ? ? -177.63 -71.80  
117 1 GLN A 708  ? ? -13.87  133.44  
118 1 LYS A 709  ? ? -29.85  -37.81  
119 1 VAL A 715  ? ? -173.92 82.85   
120 1 TYR A 718  ? ? 67.61   -2.84   
121 1 ARG A 722  ? ? -136.01 -44.85  
122 1 GLN A 743  ? ? -44.34  161.02  
123 1 ASP A 744  ? ? -108.93 -146.40 
124 1 THR A 750  ? ? -107.48 -77.72  
125 1 ALA A 751  ? ? 140.10  164.58  
126 1 SER A 763  ? ? -170.18 146.79  
127 1 SER A 768  ? ? 3.31    136.47  
128 1 SER A 772  ? ? -134.55 -71.57  
129 1 VAL A 801  ? ? -63.49  94.88   
130 1 ASN A 810  ? ? 83.52   11.50   
131 1 THR A 833  ? ? -127.38 -167.85 
132 1 SER A 854  ? ? -108.16 -117.78 
133 1 THR A 860  ? ? -58.27  93.15   
134 1 PHE A 876  ? ? -97.95  -91.87  
135 1 ASN A 885  ? ? 41.13   84.76   
136 1 THR A 887  ? ? -170.51 94.18   
137 1 LYS A 897  ? ? 63.27   65.95   
138 1 ASN A 907  ? ? -79.03  49.83   
139 1 MET A 910  ? ? -178.46 103.14  
140 1 ASP A 919  ? ? -54.27  -148.64 
141 1 VAL A 923  ? ? -172.05 136.89  
142 1 ASP A 925  ? ? 168.94  153.94  
143 1 ARG A 928  ? ? -121.84 -56.23  
144 1 SER A 929  ? ? 156.96  -87.02  
145 1 PRO A 937  ? ? -57.54  27.63   
146 1 MET A 938  ? ? -90.79  -114.57 
147 1 GLU A 939  ? ? -76.20  26.24   
148 1 PHE A 949  ? ? -107.38 40.71   
149 1 PRO A 951  ? ? -95.21  56.66   
150 1 TRP A 953  ? ? -69.11  88.40   
151 1 SER A 955  ? ? -144.64 -24.02  
152 1 ASP A 961  ? ? -174.75 -176.91 
153 1 ASP A 962  ? ? -35.44  -32.27  
154 1 ASN A 970  ? ? 0.91    -47.40  
155 1 ALA A 983  ? ? -57.94  173.26  
156 1 THR A 985  ? ? -63.89  56.43   
157 1 ASP A 986  ? ? -133.87 -42.33  
158 1 PHE A 998  ? ? -170.56 138.66  
159 1 MET A 1014 ? ? 72.63   177.54  
160 1 SER A 1027 ? ? -172.33 116.65  
161 1 SER A 1064 ? ? -74.66  -155.74 
162 1 LYS A 1067 ? ? 94.91   4.65    
163 1 GLU A 1079 ? ? -68.75  57.53   
164 1 ARG A 1080 ? ? 171.41  10.65   
165 1 LYS A 1081 ? ? -170.27 138.68  
166 1 PHE A 1097 ? ? -29.31  -69.04  
167 1 THR A 1125 ? ? -141.63 -139.76 
168 1 ALA A 1126 ? ? -168.60 -38.23  
169 1 THR A 1137 ? ? -49.75  -8.34   
170 1 ALA B 125  ? ? 64.17   -15.11  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2   ? A GLY 1    
2  1 Y 1 A SER -1   ? A SER 2    
3  1 Y 1 A HIS 0    ? A HIS 3    
4  1 Y 1 A SER 774  ? A SER 777  
5  1 Y 1 A THR 775  ? A THR 778  
6  1 Y 1 A ALA 776  ? A ALA 779  
7  1 Y 1 A PRO 777  ? A PRO 780  
8  1 Y 1 A HIS 778  ? A HIS 781  
9  1 Y 1 A GLU 779  ? A GLU 782  
10 1 Y 1 A THR 780  ? A THR 783  
11 1 Y 1 A SER 781  ? A SER 784  
12 1 Y 1 A PHE 782  ? A PHE 785  
13 1 Y 1 A ASN 1016 ? A ASN 1019 
14 1 Y 1 A LEU 1017 ? A LEU 1020 
15 1 Y 1 A GLY 1018 ? A GLY 1021 
16 1 Y 1 A GLU 1019 ? A GLU 1022 
17 1 Y 1 A THR 1020 ? A THR 1023 
18 1 Y 1 A SER 1021 ? A SER 1024 
19 1 Y 1 A THR 1022 ? A THR 1025 
20 1 Y 1 A LEU 1112 ? A LEU 1115 
21 1 Y 1 A GLN 1113 ? A GLN 1116 
22 1 Y 1 A TYR 1114 ? A TYR 1117 
23 1 Y 1 A ASP 1115 ? A ASP 1118 
24 1 Y 1 A ASP 1116 ? A ASP 1119 
25 1 Y 1 A GLY 1117 ? A GLY 1120 
26 1 Y 1 A SER 1118 ? A SER 1121 
27 1 Y 1 A GLY 1119 ? A GLY 1122 
28 1 Y 1 A MET 1120 ? A MET 1123 
29 1 Y 1 A LYS 1121 ? A LYS 1124 
#