data_3I8E
# 
_entry.id   3I8E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I8E         
RCSB  RCSB054093   
WWPDB D_1000054093 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7H 'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX'    unspecified 
PDB 3I7K 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX'    unspecified 
PDB 3I7L 'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2'   unspecified 
PDB 3I7N 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1'  unspecified 
PDB 3I7O 'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1'  unspecified 
PDB 3I7P 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR40A' unspecified 
PDB 3I89 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I8C 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I8E 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I8E 
_cell.length_a           64.138 
_cell.length_b           133.815 
_cell.length_c           183.999 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.45 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I8E 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1'     127399.766 2 ? ? ?                  ? 
2 polymer syn 'WD repeat-containing protein 42A' 1441.633   2 ? ? 'Residues 153-165' ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A,B ? 
2 'polypeptide(L)' no no QALPALRERELGS QALPALRERELGS C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    GLN n 
2 2    ALA n 
2 3    LEU n 
2 4    PRO n 
2 5    ALA n 
2 6    LEU n 
2 7    ARG n 
2 8    GLU n 
2 9    ARG n 
2 10   GLU n 
2 11   LEU n 
2 12   GLY n 
2 13   SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN  Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1   ? 
2 UNP WD42A_HUMAN Q5TAQ9 2 QALPALRERELGS 153 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I8E A 4 ? 1143 ? Q16531 1   ? 1140 ? 1   1140 
2 1 3I8E B 4 ? 1143 ? Q16531 1   ? 1140 ? 1   1140 
3 2 3I8E C 1 ? 13   ? Q5TAQ9 153 ? 165  ? 153 165  
4 2 3I8E D 1 ? 13   ? Q5TAQ9 153 ? 165  ? 153 165  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I8E GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1  
1 3I8E SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2  
1 3I8E HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3  
1 3I8E TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4  
1 3I8E ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5  
1 3I8E VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6  
2 3I8E GLY B 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  7  
2 3I8E SER B 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  8  
2 3I8E HIS B 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   9  
2 3I8E TYR B 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 10 
2 3I8E ASP B 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 11 
2 3I8E VAL B 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I8E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.06 
_exptl_crystal.density_percent_sol   59.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005M DTT , pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I8E 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             49.15 
_reflns.d_resolution_high            3.4 
_reflns.number_obs                   35597 
_reflns.number_all                   38723 
_reflns.percent_possible_obs         91.9 
_reflns.pdbx_Rmerge_I_obs            0.142 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.4 
_reflns_shell.d_res_low              3.488 
_reflns_shell.percent_possible_all   92.6 
_reflns_shell.Rmerge_I_obs           0.541 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2592 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3I8E 
_refine.ls_number_reflns_obs                     35597 
_refine.ls_number_reflns_all                     38723 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.15 
_refine.ls_d_res_high                            3.40 
_refine.ls_percent_reflns_obs                    87.32 
_refine.ls_R_factor_obs                          0.264 
_refine.ls_R_factor_all                          0.304 
_refine.ls_R_factor_R_work                       0.260 
_refine.ls_R_factor_R_free                       0.338 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1826 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.879 
_refine.correlation_coeff_Fo_to_Fc_free          0.804 
_refine.B_iso_mean                               77.285 
_refine.aniso_B[1][1]                            -1.86 
_refine.aniso_B[2][2]                            1.83 
_refine.aniso_B[3][3]                            0.03 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.11 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.861 
_refine.overall_SU_ML                            0.674 
_refine.overall_SU_B                             91.559 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17652 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               17652 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        49.15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.008  0.022  ? 17972 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.264  1.966  ? 24338 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.530  5.000  ? 2244  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   40.396 24.730 ? 816   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   19.966 15.000 ? 3182  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   19.681 15.000 ? 100   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.080  0.200  ? 2804  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.003  0.020  ? 13414 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.220  0.200  ? 7938  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.307  0.200  ? 11855 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.158  0.200  ? 508   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.161  0.200  ? 34    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.209  0.200  ? 5     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.390  1.500  ? 11482 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.701  2.000  ? 18106 'X-RAY DIFFRACTION' ? 
r_scbond_it              0.529  3.000  ? 7219  'X-RAY DIFFRACTION' ? 
r_scangle_it             0.921  4.500  ? 6232  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.400 
_refine_ls_shell.d_res_low                        3.488 
_refine_ls_shell.number_reflns_R_work             2400 
_refine_ls_shell.R_factor_R_work                  0.327 
_refine_ls_shell.percent_reflns_obs               80.40 
_refine_ls_shell.R_factor_R_free                  0.376 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             119 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2400 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3I8E 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, WD repeat-containing protein 42A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I8E 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;DDB1, WDR42A, H326, DCAF8, H-Box Motif, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Ubl conjugation pathway, WD repeat, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 253  ? GLN A 258  ? PRO A 250  GLN A 255  1 ? 6  
HELX_P HELX_P2  2  ALA A 384  ? GLU A 387  ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P3  3  SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P4  4  GLU A 1072 ? ARG A 1077 ? GLU A 1069 ARG A 1074 1 ? 6  
HELX_P HELX_P5  5  GLY A 1094 ? GLU A 1098 ? GLY A 1091 GLU A 1095 1 ? 5  
HELX_P HELX_P6  6  SER A 1099 ? ILE A 1103 ? SER A 1096 ILE A 1100 5 ? 5  
HELX_P HELX_P7  7  SER A 1104 ? VAL A 1112 ? SER A 1101 VAL A 1109 1 ? 9  
HELX_P HELX_P8  8  ASP A 1131 ? VAL A 1136 ? ASP A 1128 VAL A 1133 1 ? 6  
HELX_P HELX_P9  9  PRO B 253  ? GLN B 258  ? PRO B 250  GLN B 255  1 ? 6  
HELX_P HELX_P10 10 ALA B 384  ? GLU B 387  ? ALA B 381  GLU B 384  5 ? 4  
HELX_P HELX_P11 11 SER B 1047 ? ILE B 1065 ? SER B 1044 ILE B 1062 1 ? 19 
HELX_P HELX_P12 12 GLU B 1072 ? ARG B 1077 ? GLU B 1069 ARG B 1074 1 ? 6  
HELX_P HELX_P13 13 GLY B 1094 ? GLU B 1098 ? GLY B 1091 GLU B 1095 1 ? 5  
HELX_P HELX_P14 14 SER B 1099 ? ILE B 1103 ? SER B 1096 ILE B 1100 5 ? 5  
HELX_P HELX_P15 15 SER B 1104 ? VAL B 1111 ? SER B 1101 VAL B 1108 1 ? 8  
HELX_P HELX_P16 16 ASP B 1131 ? VAL B 1136 ? ASP B 1128 VAL B 1133 1 ? 6  
HELX_P HELX_P17 17 GLU B 1137 ? THR B 1140 ? GLU B 1134 THR B 1137 5 ? 4  
HELX_P HELX_P18 18 LEU D 3    ? ARG D 9    ? LEU D 155  ARG D 161  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 316 SG ? ? A CYS 18 A CYS 313 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf2 disulf ? ? B CYS 21 SG ? ? ? 1_555 B CYS 316 SG ? ? B CYS 18 B CYS 313 1_555 ? ? ? ? ? ? ? 2.055 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 4 ? 
C  ? 4 ? 
D  ? 4 ? 
E  ? 4 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 4 ? 
I  ? 4 ? 
J  ? 4 ? 
K  ? 5 ? 
L  ? 4 ? 
M  ? 4 ? 
N  ? 4 ? 
O  ? 4 ? 
P  ? 4 ? 
Q  ? 3 ? 
R  ? 5 ? 
S  ? 4 ? 
T  ? 4 ? 
U  ? 3 ? 
V  ? 4 ? 
W  ? 2 ? 
X  ? 5 ? 
Y  ? 4 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 4 ? 
AF ? 4 ? 
AG ? 4 ? 
AH ? 4 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 2 ? 
AL ? 3 ? 
AM ? 2 ? 
AN ? 4 ? 
AO ? 4 ? 
AP ? 4 ? 
AQ ? 5 ? 
AR ? 3 ? 
AS ? 4 ? 
AT ? 4 ? 
AU ? 3 ? 
AV ? 4 ? 
AW ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? parallel      
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? parallel      
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? parallel      
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? parallel      
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
A  2 GLN A 1028 ? THR A 1035 ? GLN A 1025 THR A 1032 
A  3 ILE A 1040 ? SER A 1045 ? ILE A 1037 SER A 1042 
A  4 ASN A 7    ? GLN A 13   ? ASN A 4    GLN A 10   
A  5 PHE A 1091 ? ASP A 1093 ? PHE A 1088 ASP A 1090 
B  1 GLY A 20   ? GLY A 24   ? GLY A 17   GLY A 21   
B  2 ASN A 33   ? ALA A 37   ? ASN A 30   ALA A 34   
B  3 LEU A 42   ? VAL A 47   ? LEU A 39   VAL A 44   
B  4 LEU A 52   ? VAL A 58   ? LEU A 49   VAL A 55   
C  1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C  2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C  3 ASN A 88   ? GLN A 96   ? ASN A 85   GLN A 93   
C  4 ILE A 101  ? ASN A 110  ? ILE A 98   ASN A 107  
D  1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D  2 MET A 133  ? ARG A 137  ? MET A 130  ARG A 134  
D  3 LEU A 142  ? PRO A 147  ? LEU A 139  PRO A 144  
D  4 PHE A 158  ? ARG A 161  ? PHE A 155  ARG A 158  
E  1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
E  2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
E  3 GLY A 190  ? GLU A 197  ? GLY A 187  GLU A 194  
E  4 GLU A 213  ? ASN A 214  ? GLU A 210  ASN A 211  
F  1 MET A 221  ? ALA A 224  ? MET A 218  ALA A 221  
F  2 ALA A 232  ? ILE A 235  ? ALA A 229  ILE A 232  
F  3 ILE A 240  ? HIS A 243  ? ILE A 237  HIS A 240  
F  4 TYR A 248  ? ILE A 251  ? TYR A 245  ILE A 248  
G  1 HIS A 264  ? ARG A 266  ? HIS A 261  ARG A 263  
G  2 ARG A 273  ? LEU A 276  ? ARG A 270  LEU A 273  
G  3 ARG A 282  ? GLU A 291  ? ARG A 279  GLU A 288  
G  4 THR A 299  ? GLU A 310  ? THR A 296  GLU A 307  
H  1 ALA A 314  ? TYR A 319  ? ALA A 311  TYR A 316  
H  2 VAL A 324  ? SER A 329  ? VAL A 321  SER A 326  
H  3 GLN A 335  ? LEU A 339  ? GLN A 332  LEU A 336  
H  4 VAL A 350  ? THR A 355  ? VAL A 347  THR A 352  
I  1 ASP A 364  ? VAL A 368  ? ASP A 361  VAL A 365  
I  2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
I  3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
I  4 LEU A 713  ? ILE A 715  ? LEU A 710  ILE A 712  
J  1 ASP A 364  ? VAL A 368  ? ASP A 361  VAL A 365  
J  2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
J  3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
J  4 VAL A 718  ? PRO A 719  ? VAL A 715  PRO A 716  
K  1 ILE A 397  ? GLY A 398  ? ILE A 394  GLY A 395  
K  2 SER A 672  ? ASN A 675  ? SER A 669  ASN A 672  
K  3 THR A 660  ? ILE A 662  ? THR A 657  ILE A 659  
K  4 VAL A 652  ? CYS A 655  ? VAL A 649  CYS A 652  
K  5 VAL A 640  ? THR A 643  ? VAL A 637  THR A 640  
L  1 GLY A 412  ? LEU A 416  ? GLY A 409  LEU A 413  
L  2 THR A 427  ? SER A 431  ? THR A 424  SER A 428  
L  3 THR A 436  ? LEU A 441  ? THR A 433  LEU A 438  
L  4 VAL A 446  ? GLU A 447  ? VAL A 443  GLU A 444  
M  1 THR A 460  ? PHE A 462  ? THR A 457  PHE A 459  
M  2 GLN A 470  ? THR A 475  ? GLN A 467  THR A 472  
M  3 VAL A 479  ? SER A 483  ? VAL A 476  SER A 480  
M  4 GLU A 492  ? TRP A 493  ? GLU A 489  TRP A 490  
N  1 ALA A 504  ? CYS A 506  ? ALA A 501  CYS A 503  
N  2 VAL A 511  ? ALA A 514  ? VAL A 508  ALA A 511  
N  3 LEU A 519  ? ILE A 524  ? LEU A 516  ILE A 521  
N  4 LEU A 529  ? GLN A 531  ? LEU A 526  GLN A 528  
O  1 VAL A 541  ? ASP A 545  ? VAL A 538  ASP A 542  
O  2 LEU A 558  ? LEU A 563  ? LEU A 555  LEU A 560  
O  3 SER A 568  ? LYS A 573  ? SER A 565  LYS A 570  
O  4 GLU A 583  ? MET A 584  ? GLU A 580  MET A 581  
P  1 PRO A 591  ? THR A 598  ? PRO A 588  THR A 595  
P  2 HIS A 603  ? LEU A 609  ? HIS A 600  LEU A 606  
P  3 LEU A 614  ? PHE A 617  ? LEU A 611  PHE A 614  
P  4 LYS A 631  ? VAL A 632  ? LYS A 628  VAL A 629  
Q  1 TYR A 681  ? PRO A 684  ? TYR A 678  PRO A 681  
Q  2 LEU A 694  ? ALA A 697  ? LEU A 691  ALA A 694  
Q  3 THR A 703  ? ILE A 704  ? THR A 700  ILE A 701  
R  1 SER A 723  ? GLN A 730  ? SER A 720  GLN A 727  
R  2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
R  3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
R  4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
R  5 SER A 766  ? VAL A 768  ? SER A 763  VAL A 765  
S  1 GLU A 814  ? VAL A 820  ? GLU A 811  VAL A 817  
S  2 PHE A 832  ? MET A 838  ? PHE A 829  MET A 835  
S  3 ILE A 851  ? TYR A 856  ? ILE A 848  TYR A 853  
S  4 LEU A 861  ? ALA A 865  ? LEU A 858  ALA A 862  
T  1 MET A 876  ? GLU A 878  ? MET A 873  GLU A 875  
T  2 LEU A 883  ? SER A 886  ? LEU A 880  SER A 883  
T  3 VAL A 891  ? TRP A 896  ? VAL A 888  TRP A 893  
T  4 VAL A 902  ? ARG A 903  ? VAL A 899  ARG A 900  
U  1 ILE A 924  ? VAL A 926  ? ILE A 921  VAL A 923  
U  2 LEU A 934  ? LYS A 939  ? LEU A 931  LYS A 936  
U  3 ASN A 944  ? ARG A 950  ? ASN A 941  ARG A 947  
V  1 MET A 957  ? ILE A 962  ? MET A 954  ILE A 959  
V  2 PHE A 968  ? GLU A 972  ? PHE A 965  GLU A 969  
V  3 ASN A 976  ? LYS A 982  ? ASN A 973  LYS A 979  
V  4 LEU A 995  ? PHE A 1001 ? LEU A 992  PHE A 998  
W  1 PHE A 1079 ? THR A 1081 ? PHE A 1076 THR A 1078 
W  2 LYS A 1084 ? GLU A 1086 ? LYS A 1081 GLU A 1083 
X  1 VAL B 1007 ? HIS B 1012 ? VAL B 1004 HIS B 1009 
X  2 GLN B 1028 ? THR B 1035 ? GLN B 1025 THR B 1032 
X  3 ILE B 1040 ? SER B 1045 ? ILE B 1037 SER B 1042 
X  4 ASN B 7    ? GLN B 13   ? ASN B 4    GLN B 10   
X  5 ILE B 1092 ? ASP B 1093 ? ILE B 1089 ASP B 1090 
Y  1 THR B 23   ? GLY B 24   ? THR B 20   GLY B 21   
Y  2 ASN B 33   ? ALA B 37   ? ASN B 30   ALA B 34   
Y  3 ARG B 41   ? VAL B 47   ? ARG B 38   VAL B 44   
Y  4 LEU B 52   ? GLY B 59   ? LEU B 49   GLY B 56   
Z  1 ILE B 64   ? PHE B 70   ? ILE B 61   PHE B 67   
Z  2 LEU B 79   ? THR B 84   ? LEU B 76   THR B 81   
Z  3 ASN B 88   ? SER B 97   ? ASN B 85   SER B 94   
Z  4 SER B 100  ? ASN B 110  ? SER B 97   ASN B 107  
AA 1 ILE B 124  ? ILE B 127  ? ILE B 121  ILE B 124  
AA 2 ILE B 134  ? ARG B 137  ? ILE B 131  ARG B 134  
AA 3 LEU B 142  ? ILE B 146  ? LEU B 139  ILE B 143  
AA 4 PHE B 158  ? ARG B 161  ? PHE B 155  ARG B 158  
AB 1 VAL B 167  ? PHE B 172  ? VAL B 164  PHE B 169  
AB 2 THR B 180  ? TYR B 185  ? THR B 177  TYR B 182  
AB 3 HIS B 192  ? GLU B 197  ? HIS B 189  GLU B 194  
AB 4 GLU B 213  ? ASN B 214  ? GLU B 210  ASN B 211  
AC 1 MET B 221  ? ALA B 224  ? MET B 218  ALA B 221  
AC 2 ALA B 232  ? ILE B 235  ? ALA B 229  ILE B 232  
AC 3 ILE B 240  ? HIS B 243  ? ILE B 237  HIS B 240  
AC 4 TYR B 248  ? ILE B 251  ? TYR B 245  ILE B 248  
AD 1 ILE B 261  ? ARG B 266  ? ILE B 258  ARG B 263  
AD 2 ARG B 273  ? ASP B 278  ? ARG B 270  ASP B 275  
AD 3 ARG B 282  ? GLU B 289  ? ARG B 279  GLU B 286  
AD 4 ASP B 302  ? GLU B 310  ? ASP B 299  GLU B 307  
AE 1 ALA B 314  ? TYR B 319  ? ALA B 311  TYR B 316  
AE 2 VAL B 324  ? SER B 329  ? VAL B 321  SER B 326  
AE 3 SER B 334  ? LEU B 339  ? SER B 331  LEU B 336  
AE 4 VAL B 350  ? PHE B 356  ? VAL B 347  PHE B 353  
AF 1 ILE B 362  ? VAL B 368  ? ILE B 359  VAL B 365  
AF 2 GLN B 377  ? SER B 382  ? GLN B 374  SER B 379  
AF 3 SER B 389  ? ASN B 395  ? SER B 386  ASN B 392  
AF 4 LEU B 713  ? ILE B 715  ? LEU B 710  ILE B 712  
AG 1 ILE B 362  ? VAL B 368  ? ILE B 359  VAL B 365  
AG 2 GLN B 377  ? SER B 382  ? GLN B 374  SER B 379  
AG 3 SER B 389  ? ASN B 395  ? SER B 386  ASN B 392  
AG 4 VAL B 718  ? PRO B 719  ? VAL B 715  PRO B 716  
AH 1 ILE B 399  ? ILE B 405  ? ILE B 396  ILE B 402  
AH 2 THR B 701  ? ILE B 707  ? THR B 698  ILE B 704  
AH 3 LEU B 694  ? ASN B 698  ? LEU B 691  ASN B 695  
AH 4 TYR B 681  ? PRO B 684  ? TYR B 678  PRO B 681  
AI 1 LEU B 413  ? PRO B 415  ? LEU B 410  PRO B 412  
AI 2 LEU B 428  ? LEU B 430  ? LEU B 425  LEU B 427  
AJ 1 ASN B 465  ? VAL B 466  ? ASN B 462  VAL B 463  
AJ 2 GLN B 470  ? LEU B 471  ? GLN B 467  LEU B 468  
AK 1 GLN B 473  ? ILE B 474  ? GLN B 470  ILE B 471  
AK 2 VAL B 479  ? ARG B 480  ? VAL B 476  ARG B 477  
AL 1 GLN B 510  ? VAL B 511  ? GLN B 507  VAL B 508  
AL 2 LEU B 522  ? HIS B 525  ? LEU B 519  HIS B 522  
AL 3 GLU B 528  ? LEU B 529  ? GLU B 525  LEU B 526  
AM 1 ALA B 518  ? LEU B 519  ? ALA B 515  LEU B 516  
AM 2 THR B 535  ? GLU B 536  ? THR B 532  GLU B 533  
AN 1 VAL B 541  ? ASP B 545  ? VAL B 538  ASP B 542  
AN 2 CYS B 559  ? LEU B 563  ? CYS B 556  LEU B 560  
AN 3 SER B 568  ? LEU B 572  ? SER B 565  LEU B 569  
AN 4 LEU B 579  ? MET B 584  ? LEU B 576  MET B 581  
AO 1 PRO B 591  ? THR B 598  ? PRO B 588  THR B 595  
AO 2 HIS B 603  ? LEU B 609  ? HIS B 600  LEU B 606  
AO 3 ALA B 613  ? GLY B 618  ? ALA B 610  GLY B 615  
AO 4 LYS B 630  ? THR B 633  ? LYS B 627  THR B 630  
AP 1 VAL B 640  ? THR B 643  ? VAL B 637  THR B 640  
AP 2 VAL B 652  ? CYS B 655  ? VAL B 649  CYS B 652  
AP 3 THR B 660  ? ILE B 662  ? THR B 657  ILE B 659  
AP 4 SER B 672  ? ASN B 673  ? SER B 669  ASN B 670  
AQ 1 SER B 723  ? GLN B 730  ? SER B 720  GLN B 727  
AQ 2 CYS B 735  ? VAL B 745  ? CYS B 732  VAL B 742  
AQ 3 GLU B 788  ? ASP B 798  ? GLU B 785  ASP B 795  
AQ 4 VAL B 804  ? GLN B 809  ? VAL B 801  GLN B 806  
AQ 5 SER B 766  ? VAL B 768  ? SER B 763  VAL B 765  
AR 1 GLU B 814  ? ALA B 816  ? GLU B 811  ALA B 813  
AR 2 TYR B 831  ? MET B 838  ? TYR B 828  MET B 835  
AR 3 VAL B 820  ? CYS B 822  ? VAL B 817  CYS B 819  
AS 1 GLU B 814  ? ALA B 816  ? GLU B 811  ALA B 813  
AS 2 TYR B 831  ? MET B 838  ? TYR B 828  MET B 835  
AS 3 ARG B 850  ? TYR B 856  ? ARG B 847  TYR B 853  
AS 4 LEU B 861  ? GLU B 868  ? LEU B 858  GLU B 865  
AT 1 VAL B 873  ? GLU B 878  ? VAL B 870  GLU B 875  
AT 2 LEU B 883  ? ILE B 887  ? LEU B 880  ILE B 884  
AT 3 VAL B 891  ? TRP B 896  ? VAL B 888  TRP B 893  
AT 4 VAL B 902  ? HIS B 908  ? VAL B 899  HIS B 905  
AU 1 ILE B 924  ? LEU B 925  ? ILE B 921  LEU B 922  
AU 2 LEU B 934  ? TYR B 938  ? LEU B 931  TYR B 935  
AU 3 PHE B 945  ? ARG B 950  ? PHE B 942  ARG B 947  
AV 1 MET B 957  ? ILE B 962  ? MET B 954  ILE B 959  
AV 2 ASN B 967  ? GLU B 972  ? ASN B 964  GLU B 969  
AV 3 ASN B 976  ? GLN B 981  ? ASN B 973  GLN B 978  
AV 4 GLU B 997  ? GLY B 999  ? GLU B 994  GLY B 996  
AW 1 PHE B 1079 ? THR B 1081 ? PHE B 1076 THR B 1078 
AW 2 LYS B 1084 ? GLU B 1086 ? LYS B 1081 GLU B 1083 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N VAL A 1009 ? N VAL A 1006 O GLY A 1034 ? O GLY A 1031 
A  2 3 N VAL A 1031 ? N VAL A 1028 O VAL A 1043 ? O VAL A 1040 
A  3 4 O THR A 1044 ? O THR A 1041 N TYR A 8    ? N TYR A 5    
A  4 5 N ASN A 7    ? N ASN A 4    O ILE A 1092 ? O ILE A 1089 
B  1 2 N VAL A 22   ? N VAL A 19   O LEU A 35   ? O LEU A 32   
B  2 3 N LEU A 34   ? N LEU A 31   O TYR A 45   ? O TYR A 42   
B  3 4 N VAL A 46   ? N VAL A 43   O ARG A 53   ? O ARG A 50   
C  1 2 N PHE A 70   ? N PHE A 67   O LEU A 79   ? O LEU A 76   
C  2 3 N LEU A 80   ? N LEU A 77   O LEU A 92   ? O LEU A 89   
C  3 4 N LYS A 95   ? N LYS A 92   O ASP A 102  ? O ASP A 99   
D  1 2 N ILE A 126  ? N ILE A 123  O GLY A 135  ? O GLY A 132  
D  2 3 N LEU A 136  ? N LEU A 133  O LYS A 144  ? O LYS A 141  
D  3 4 N VAL A 145  ? N VAL A 142  O PHE A 158  ? O PHE A 155  
E  1 2 N ILE A 168  ? N ILE A 165  O VAL A 184  ? O VAL A 181  
E  2 3 N ILE A 181  ? N ILE A 178  O TYR A 196  ? O TYR A 193  
E  3 4 N VAL A 193  ? N VAL A 190  O GLU A 213  ? O GLU A 210  
F  1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
F  2 3 N ALA A 232  ? N ALA A 229  O HIS A 243  ? O HIS A 240  
F  3 4 N TYR A 242  ? N TYR A 239  O LEU A 249  ? O LEU A 246  
G  1 2 N ASN A 265  ? N ASN A 262  O LEU A 275  ? O LEU A 272  
G  2 3 N LEU A 276  ? N LEU A 273  O PHE A 284  ? O PHE A 281  
G  3 4 N GLU A 289  ? N GLU A 286  O ASP A 302  ? O ASP A 299  
H  1 2 N GLU A 315  ? N GLU A 312  O GLY A 328  ? O GLY A 325  
H  2 3 N VAL A 325  ? N VAL A 322  O VAL A 337  ? O VAL A 334  
H  3 4 N LEU A 336  ? N LEU A 333  O GLU A 354  ? O GLU A 351  
I  1 2 N ASP A 364  ? N ASP A 361  O CYS A 381  ? O CYS A 378  
I  2 3 N SER A 382  ? N SER A 379  O SER A 389  ? O SER A 386  
I  3 4 N ARG A 394  ? N ARG A 391  O HIS A 714  ? O HIS A 711  
J  1 2 N ASP A 364  ? N ASP A 361  O CYS A 381  ? O CYS A 378  
J  2 3 N SER A 382  ? N SER A 379  O SER A 389  ? O SER A 386  
J  3 4 N LEU A 390  ? N LEU A 387  O VAL A 718  ? O VAL A 715  
K  1 2 N ILE A 397  ? N ILE A 394  O ASN A 675  ? O ASN A 672  
K  2 3 O SER A 672  ? O SER A 669  N VAL A 661  ? N VAL A 658  
K  3 4 O THR A 660  ? O THR A 657  N ALA A 654  ? N ALA A 651  
K  4 5 O CYS A 655  ? O CYS A 652  N VAL A 640  ? N VAL A 637  
L  1 2 N LEU A 416  ? N LEU A 413  O THR A 427  ? O THR A 424  
L  2 3 N LEU A 428  ? N LEU A 425  O LEU A 439  ? O LEU A 436  
L  3 4 N MET A 440  ? N MET A 437  O GLU A 447  ? O GLU A 444  
M  1 2 N PHE A 461  ? N PHE A 458  O ILE A 474  ? O ILE A 471  
M  2 3 N LEU A 471  ? N LEU A 468  O VAL A 482  ? O VAL A 479  
M  3 4 N VAL A 479  ? N VAL A 476  O TRP A 493  ? O TRP A 490  
N  1 2 N SER A 505  ? N SER A 502  O VAL A 512  ? O VAL A 509  
N  2 3 N VAL A 511  ? N VAL A 508  O LEU A 522  ? O LEU A 519  
N  3 4 N GLN A 523  ? N GLN A 520  O ARG A 530  ? O ARG A 527  
O  1 2 N CYS A 543  ? N CYS A 540  O GLY A 562  ? O GLY A 559  
O  2 3 N ILE A 561  ? N ILE A 558  O ARG A 570  ? O ARG A 567  
O  3 4 N ALA A 569  ? N ALA A 566  O GLU A 583  ? O GLU A 580  
P  1 2 N SER A 593  ? N SER A 590  O ALA A 608  ? O ALA A 605  
P  2 3 N LEU A 605  ? N LEU A 602  O PHE A 617  ? O PHE A 614  
P  3 4 N LEU A 614  ? N LEU A 611  O VAL A 632  ? O VAL A 629  
Q  1 2 N CYS A 683  ? N CYS A 680  O ALA A 695  ? O ALA A 692  
Q  2 3 N LEU A 696  ? N LEU A 693  O THR A 703  ? O THR A 700  
R  1 2 N ARG A 725  ? N ARG A 722  O LEU A 739  ? O LEU A 736  
R  2 3 N ARG A 742  ? N ARG A 739  O VAL A 791  ? O VAL A 788  
R  3 4 N ILE A 796  ? N ILE A 793  O HIS A 806  ? O HIS A 803  
R  4 5 O GLN A 809  ? O GLN A 806  N SER A 767  ? N SER A 764  
S  1 2 N TYR A 815  ? N TYR A 812  O ALA A 837  ? O ALA A 834  
S  2 3 N PHE A 832  ? N PHE A 829  O PHE A 854  ? O PHE A 851  
S  3 4 N GLN A 855  ? N GLN A 852  O GLN A 862  ? O GLN A 859  
T  1 2 N VAL A 877  ? N VAL A 874  O LEU A 884  ? O LEU A 881  
T  2 3 N LEU A 883  ? N LEU A 880  O TYR A 894  ? O TYR A 891  
T  3 4 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
U  1 2 N LEU A 925  ? N LEU A 922  O LEU A 936  ? O LEU A 933  
U  2 3 N ALA A 937  ? N ALA A 934  O GLU A 946  ? O GLU A 943  
V  1 2 N GLU A 961  ? N GLU A 958  O LEU A 969  ? O LEU A 966  
V  2 3 N PHE A 968  ? N PHE A 965  O CYS A 980  ? O CYS A 977  
V  3 4 N LEU A 977  ? N LEU A 974  O PHE A 1001 ? O PHE A 998  
W  1 2 N PHE A 1079 ? N PHE A 1076 O GLU A 1086 ? O GLU A 1083 
X  1 2 N VAL B 1009 ? N VAL B 1006 O GLY B 1034 ? O GLY B 1031 
X  2 3 N PHE B 1033 ? N PHE B 1030 O GLY B 1041 ? O GLY B 1038 
X  3 4 O THR B 1044 ? O THR B 1041 N TYR B 8    ? N TYR B 5    
X  4 5 N VAL B 9    ? N VAL B 6    O ILE B 1092 ? O ILE B 1089 
Y  1 2 N GLY B 24   ? N GLY B 21   O ASN B 33   ? O ASN B 30   
Y  2 3 N LEU B 34   ? N LEU B 31   O TYR B 45   ? O TYR B 42   
Y  3 4 N VAL B 46   ? N VAL B 43   O ARG B 53   ? O ARG B 50   
Z  1 2 N PHE B 70   ? N PHE B 67   O LEU B 79   ? O LEU B 76   
Z  2 3 N LEU B 80   ? N LEU B 77   O LEU B 92   ? O LEU B 89   
Z  3 4 N LYS B 95   ? N LYS B 92   O ASP B 102  ? O ASP B 99   
AA 1 2 N ILE B 126  ? N ILE B 123  O GLY B 135  ? O GLY B 132  
AA 2 3 N ILE B 134  ? N ILE B 131  O ILE B 146  ? O ILE B 143  
AA 3 4 N VAL B 145  ? N VAL B 142  O PHE B 158  ? O PHE B 155  
AB 1 2 N ILE B 168  ? N ILE B 165  O VAL B 184  ? O VAL B 181  
AB 2 3 N TYR B 185  ? N TYR B 182  O HIS B 192  ? O HIS B 189  
AB 3 4 N VAL B 193  ? N VAL B 190  O GLU B 213  ? O GLU B 210  
AC 1 2 N ILE B 223  ? N ILE B 220  O ILE B 233  ? O ILE B 230  
AC 2 3 N ALA B 232  ? N ALA B 229  O HIS B 243  ? O HIS B 240  
AC 3 4 N ILE B 240  ? N ILE B 237  O ILE B 251  ? O ILE B 248  
AD 1 2 N CYS B 263  ? N CYS B 260  O GLY B 277  ? O GLY B 274  
AD 2 3 N TYR B 274  ? N TYR B 271  O LEU B 286  ? O LEU B 283  
AD 3 4 N GLU B 289  ? N GLU B 286  O ASP B 302  ? O ASP B 299  
AE 1 2 N GLU B 315  ? N GLU B 312  O GLY B 328  ? O GLY B 325  
AE 2 3 N VAL B 325  ? N VAL B 322  O VAL B 337  ? O VAL B 334  
AE 3 4 N LYS B 338  ? N LYS B 335  O VAL B 351  ? O VAL B 348  
AF 1 2 N ASP B 364  ? N ASP B 361  O CYS B 381  ? O CYS B 378  
AF 2 3 N LEU B 378  ? N LEU B 375  O ILE B 393  ? O ILE B 390  
AF 3 4 N ARG B 394  ? N ARG B 391  O HIS B 714  ? O HIS B 711  
AG 1 2 N ASP B 364  ? N ASP B 361  O CYS B 381  ? O CYS B 378  
AG 2 3 N LEU B 378  ? N LEU B 375  O ILE B 393  ? O ILE B 390  
AG 3 4 N LEU B 390  ? N LEU B 387  O VAL B 718  ? O VAL B 715  
AH 1 2 N ILE B 405  ? N ILE B 402  O LEU B 702  ? O LEU B 699  
AH 2 3 O THR B 703  ? O THR B 700  N LEU B 696  ? N LEU B 693  
AH 3 4 O ALA B 695  ? O ALA B 692  N CYS B 683  ? N CYS B 680  
AI 1 2 N TRP B 414  ? N TRP B 411  O VAL B 429  ? O VAL B 426  
AJ 1 2 N VAL B 466  ? N VAL B 463  O GLN B 470  ? O GLN B 467  
AK 1 2 N GLN B 473  ? N GLN B 470  O ARG B 480  ? O ARG B 477  
AL 1 2 N VAL B 511  ? N VAL B 508  O LEU B 522  ? O LEU B 519  
AL 2 3 N HIS B 525  ? N HIS B 522  O GLU B 528  ? O GLU B 525  
AM 1 2 N LEU B 519  ? N LEU B 516  O THR B 535  ? O THR B 532  
AN 1 2 N CYS B 543  ? N CYS B 540  O GLY B 562  ? O GLY B 559  
AN 2 3 N CYS B 559  ? N CYS B 556  O LEU B 572  ? O LEU B 569  
AN 3 4 N ILE B 571  ? N ILE B 568  O HIS B 581  ? O HIS B 578  
AO 1 2 N SER B 593  ? N SER B 590  O ALA B 608  ? O ALA B 605  
AO 2 3 N LEU B 609  ? N LEU B 606  O ALA B 613  ? O ALA B 610  
AO 3 4 N LEU B 614  ? N LEU B 611  O VAL B 632  ? O VAL B 629  
AP 1 2 N ARG B 642  ? N ARG B 639  O PHE B 653  ? O PHE B 650  
AP 2 3 N ALA B 654  ? N ALA B 651  O THR B 660  ? O THR B 657  
AP 3 4 N VAL B 661  ? N VAL B 658  O SER B 672  ? O SER B 669  
AQ 1 2 N ARG B 725  ? N ARG B 722  O LEU B 739  ? O LEU B 736  
AQ 2 3 N ARG B 742  ? N ARG B 739  O VAL B 791  ? O VAL B 788  
AQ 3 4 N ILE B 796  ? N ILE B 793  O HIS B 806  ? O HIS B 803  
AQ 4 5 O GLN B 809  ? O GLN B 806  N SER B 767  ? N SER B 764  
AR 1 2 N TYR B 815  ? N TYR B 812  O ALA B 837  ? O ALA B 834  
AR 2 3 O TYR B 831  ? O TYR B 828  N CYS B 822  ? N CYS B 819  
AS 1 2 N TYR B 815  ? N TYR B 812  O ALA B 837  ? O ALA B 834  
AS 2 3 N PHE B 832  ? N PHE B 829  O PHE B 854  ? O PHE B 851  
AS 3 4 N GLN B 855  ? N GLN B 852  O GLN B 862  ? O GLN B 859  
AT 1 2 N TYR B 874  ? N TYR B 871  O SER B 886  ? O SER B 883  
AT 2 3 N LEU B 883  ? N LEU B 880  O TYR B 894  ? O TYR B 891  
AT 3 4 N VAL B 891  ? N VAL B 888  O HIS B 908  ? O HIS B 905  
AU 1 2 N LEU B 925  ? N LEU B 922  O LEU B 936  ? O LEU B 933  
AU 2 3 N LEU B 935  ? N LEU B 932  O ALA B 949  ? O ALA B 946  
AV 1 2 N GLU B 961  ? N GLU B 958  O LEU B 969  ? O LEU B 966  
AV 2 3 N PHE B 968  ? N PHE B 965  O CYS B 980  ? O CYS B 977  
AV 3 4 N VAL B 979  ? N VAL B 976  O GLY B 999  ? O GLY B 996  
AW 1 2 N PHE B 1079 ? N PHE B 1076 O GLU B 1086 ? O GLU B 1083 
# 
_database_PDB_matrix.entry_id          3I8E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I8E 
_atom_sites.fract_transf_matrix[1][1]   0.015591 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000124 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007473 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005435 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . MET A 1 4    ? 8.647   44.787  57.450  1.00 64.72  ? 1    MET A N   1 
ATOM 2     C CA  . MET A 1 4    ? 8.914   43.514  56.712  1.00 64.62  ? 1    MET A CA  1 
ATOM 3     C C   . MET A 1 4    ? 10.265  42.892  57.103  1.00 64.26  ? 1    MET A C   1 
ATOM 4     O O   . MET A 1 4    ? 11.330  43.386  56.707  1.00 64.17  ? 1    MET A O   1 
ATOM 5     C CB  . MET A 1 4    ? 8.795   43.722  55.188  1.00 64.70  ? 1    MET A CB  1 
ATOM 6     C CG  . MET A 1 4    ? 9.329   45.056  54.657  1.00 64.85  ? 1    MET A CG  1 
ATOM 7     S SD  . MET A 1 4    ? 9.136   45.220  52.868  1.00 64.98  ? 1    MET A SD  1 
ATOM 8     C CE  . MET A 1 4    ? 9.286   46.996  52.655  1.00 64.79  ? 1    MET A CE  1 
ATOM 9     N N   . SER A 1 5    ? 10.199  41.813  57.890  1.00 63.83  ? 2    SER A N   1 
ATOM 10    C CA  . SER A 1 5    ? 11.391  41.117  58.407  1.00 63.38  ? 2    SER A CA  1 
ATOM 11    C C   . SER A 1 5    ? 11.358  39.614  58.126  1.00 62.84  ? 2    SER A C   1 
ATOM 12    O O   . SER A 1 5    ? 10.757  38.833  58.880  1.00 62.78  ? 2    SER A O   1 
ATOM 13    C CB  . SER A 1 5    ? 11.562  41.371  59.913  1.00 63.55  ? 2    SER A CB  1 
ATOM 14    O OG  . SER A 1 5    ? 12.260  40.312  60.559  1.00 63.69  ? 2    SER A OG  1 
ATOM 15    N N   . TYR A 1 6    ? 12.040  39.220  57.055  1.00 61.99  ? 3    TYR A N   1 
ATOM 16    C CA  . TYR A 1 6    ? 12.002  37.840  56.578  1.00 61.05  ? 3    TYR A CA  1 
ATOM 17    C C   . TYR A 1 6    ? 13.111  36.987  57.200  1.00 60.13  ? 3    TYR A C   1 
ATOM 18    O O   . TYR A 1 6    ? 14.298  37.205  56.936  1.00 60.00  ? 3    TYR A O   1 
ATOM 19    C CB  . TYR A 1 6    ? 12.076  37.816  55.048  1.00 61.31  ? 3    TYR A CB  1 
ATOM 20    C CG  . TYR A 1 6    ? 11.202  38.853  54.362  1.00 61.22  ? 3    TYR A CG  1 
ATOM 21    C CD1 . TYR A 1 6    ? 9.815   38.876  54.553  1.00 60.91  ? 3    TYR A CD1 1 
ATOM 22    C CD2 . TYR A 1 6    ? 11.765  39.803  53.510  1.00 61.28  ? 3    TYR A CD2 1 
ATOM 23    C CE1 . TYR A 1 6    ? 9.015   39.829  53.915  1.00 61.51  ? 3    TYR A CE1 1 
ATOM 24    C CE2 . TYR A 1 6    ? 10.976  40.758  52.864  1.00 61.63  ? 3    TYR A CE2 1 
ATOM 25    C CZ  . TYR A 1 6    ? 9.604   40.767  53.066  1.00 61.70  ? 3    TYR A CZ  1 
ATOM 26    O OH  . TYR A 1 6    ? 8.834   41.718  52.421  1.00 61.55  ? 3    TYR A OH  1 
ATOM 27    N N   . ASN A 1 7    ? 12.712  36.021  58.028  1.00 58.93  ? 4    ASN A N   1 
ATOM 28    C CA  . ASN A 1 7    ? 13.670  35.211  58.784  1.00 57.77  ? 4    ASN A CA  1 
ATOM 29    C C   . ASN A 1 7    ? 13.513  33.700  58.685  1.00 56.98  ? 4    ASN A C   1 
ATOM 30    O O   . ASN A 1 7    ? 12.410  33.173  58.499  1.00 56.90  ? 4    ASN A O   1 
ATOM 31    C CB  . ASN A 1 7    ? 13.694  35.641  60.242  1.00 57.69  ? 4    ASN A CB  1 
ATOM 32    C CG  . ASN A 1 7    ? 14.341  36.987  60.425  1.00 57.89  ? 4    ASN A CG  1 
ATOM 33    O OD1 . ASN A 1 7    ? 15.540  37.153  60.182  1.00 57.89  ? 4    ASN A OD1 1 
ATOM 34    N ND2 . ASN A 1 7    ? 13.550  37.970  60.850  1.00 58.12  ? 4    ASN A ND2 1 
ATOM 35    N N   . TYR A 1 8    ? 14.647  33.021  58.826  1.00 55.78  ? 5    TYR A N   1 
ATOM 36    C CA  . TYR A 1 8    ? 14.742  31.593  58.621  1.00 54.62  ? 5    TYR A CA  1 
ATOM 37    C C   . TYR A 1 8    ? 15.529  30.991  59.764  1.00 54.05  ? 5    TYR A C   1 
ATOM 38    O O   . TYR A 1 8    ? 16.711  31.284  59.914  1.00 53.94  ? 5    TYR A O   1 
ATOM 39    C CB  . TYR A 1 8    ? 15.442  31.332  57.292  1.00 54.23  ? 5    TYR A CB  1 
ATOM 40    C CG  . TYR A 1 8    ? 15.783  29.887  56.991  1.00 54.03  ? 5    TYR A CG  1 
ATOM 41    C CD1 . TYR A 1 8    ? 14.837  29.022  56.455  1.00 53.83  ? 5    TYR A CD1 1 
ATOM 42    C CD2 . TYR A 1 8    ? 17.071  29.397  57.192  1.00 53.89  ? 5    TYR A CD2 1 
ATOM 43    C CE1 . TYR A 1 8    ? 15.164  27.700  56.151  1.00 53.27  ? 5    TYR A CE1 1 
ATOM 44    C CE2 . TYR A 1 8    ? 17.400  28.079  56.888  1.00 53.10  ? 5    TYR A CE2 1 
ATOM 45    C CZ  . TYR A 1 8    ? 16.443  27.239  56.376  1.00 52.97  ? 5    TYR A CZ  1 
ATOM 46    O OH  . TYR A 1 8    ? 16.769  25.938  56.085  1.00 53.13  ? 5    TYR A OH  1 
ATOM 47    N N   . VAL A 1 9    ? 14.863  30.167  60.573  1.00 53.45  ? 6    VAL A N   1 
ATOM 48    C CA  . VAL A 1 9    ? 15.518  29.432  61.667  1.00 52.90  ? 6    VAL A CA  1 
ATOM 49    C C   . VAL A 1 9    ? 15.745  27.953  61.350  1.00 52.64  ? 6    VAL A C   1 
ATOM 50    O O   . VAL A 1 9    ? 14.922  27.309  60.696  1.00 52.71  ? 6    VAL A O   1 
ATOM 51    C CB  . VAL A 1 9    ? 14.758  29.545  63.005  1.00 52.75  ? 6    VAL A CB  1 
ATOM 52    C CG1 . VAL A 1 9    ? 15.013  30.892  63.636  1.00 52.70  ? 6    VAL A CG1 1 
ATOM 53    C CG2 . VAL A 1 9    ? 13.267  29.293  62.814  1.00 52.52  ? 6    VAL A CG2 1 
ATOM 54    N N   . VAL A 1 10   ? 16.870  27.425  61.823  1.00 52.10  ? 7    VAL A N   1 
ATOM 55    C CA  . VAL A 1 10   ? 17.212  26.032  61.602  1.00 51.69  ? 7    VAL A CA  1 
ATOM 56    C C   . VAL A 1 10   ? 17.786  25.372  62.845  1.00 51.78  ? 7    VAL A C   1 
ATOM 57    O O   . VAL A 1 10   ? 18.578  25.967  63.579  1.00 51.91  ? 7    VAL A O   1 
ATOM 58    C CB  . VAL A 1 10   ? 18.265  25.873  60.519  1.00 51.51  ? 7    VAL A CB  1 
ATOM 59    C CG1 . VAL A 1 10   ? 17.856  24.752  59.583  1.00 51.57  ? 7    VAL A CG1 1 
ATOM 60    C CG2 . VAL A 1 10   ? 18.474  27.172  59.779  1.00 51.01  ? 7    VAL A CG2 1 
ATOM 61    N N   . THR A 1 11   ? 17.399  24.124  63.060  1.00 51.63  ? 8    THR A N   1 
ATOM 62    C CA  . THR A 1 11   ? 17.988  23.324  64.107  1.00 51.63  ? 8    THR A CA  1 
ATOM 63    C C   . THR A 1 11   ? 19.304  22.749  63.586  1.00 51.63  ? 8    THR A C   1 
ATOM 64    O O   . THR A 1 11   ? 19.304  21.785  62.825  1.00 51.56  ? 8    THR A O   1 
ATOM 65    C CB  . THR A 1 11   ? 17.013  22.213  64.563  1.00 51.69  ? 8    THR A CB  1 
ATOM 66    O OG1 . THR A 1 11   ? 15.757  22.806  64.925  1.00 51.76  ? 8    THR A OG1 1 
ATOM 67    C CG2 . THR A 1 11   ? 17.566  21.431  65.756  1.00 51.68  ? 8    THR A CG2 1 
ATOM 68    N N   . ALA A 1 12   ? 20.417  23.367  63.985  1.00 51.81  ? 9    ALA A N   1 
ATOM 69    C CA  . ALA A 1 12   ? 21.769  22.876  63.665  1.00 52.02  ? 9    ALA A CA  1 
ATOM 70    C C   . ALA A 1 12   ? 22.200  21.671  64.526  1.00 52.14  ? 9    ALA A C   1 
ATOM 71    O O   . ALA A 1 12   ? 23.192  21.001  64.229  1.00 52.17  ? 9    ALA A O   1 
ATOM 72    C CB  . ALA A 1 12   ? 22.793  24.009  63.784  1.00 51.88  ? 9    ALA A CB  1 
ATOM 73    N N   . GLN A 1 13   ? 21.447  21.409  65.589  1.00 52.25  ? 10   GLN A N   1 
ATOM 74    C CA  . GLN A 1 13   ? 21.748  20.353  66.538  1.00 52.28  ? 10   GLN A CA  1 
ATOM 75    C C   . GLN A 1 13   ? 20.548  20.178  67.443  1.00 52.65  ? 10   GLN A C   1 
ATOM 76    O O   . GLN A 1 13   ? 20.135  21.125  68.122  1.00 52.71  ? 10   GLN A O   1 
ATOM 77    C CB  . GLN A 1 13   ? 22.959  20.734  67.377  1.00 52.16  ? 10   GLN A CB  1 
ATOM 78    C CG  . GLN A 1 13   ? 22.995  20.109  68.752  1.00 51.85  ? 10   GLN A CG  1 
ATOM 79    C CD  . GLN A 1 13   ? 23.228  18.618  68.728  1.00 51.46  ? 10   GLN A CD  1 
ATOM 80    O OE1 . GLN A 1 13   ? 23.686  18.059  67.732  1.00 51.97  ? 10   GLN A OE1 1 
ATOM 81    N NE2 . GLN A 1 13   ? 22.925  17.965  69.838  1.00 51.13  ? 10   GLN A NE2 1 
ATOM 82    N N   . LYS A 1 14   ? 20.009  18.959  67.455  1.00 52.99  ? 11   LYS A N   1 
ATOM 83    C CA  . LYS A 1 14   ? 18.793  18.624  68.193  1.00 53.24  ? 11   LYS A CA  1 
ATOM 84    C C   . LYS A 1 14   ? 19.005  18.739  69.704  1.00 53.34  ? 11   LYS A C   1 
ATOM 85    O O   . LYS A 1 14   ? 20.119  18.524  70.173  1.00 53.64  ? 11   LYS A O   1 
ATOM 86    C CB  . LYS A 1 14   ? 18.356  17.207  67.840  1.00 53.32  ? 11   LYS A CB  1 
ATOM 87    C CG  . LYS A 1 14   ? 18.403  16.884  66.360  1.00 53.78  ? 11   LYS A CG  1 
ATOM 88    C CD  . LYS A 1 14   ? 17.683  15.581  66.098  1.00 55.49  ? 11   LYS A CD  1 
ATOM 89    C CE  . LYS A 1 14   ? 18.154  14.943  64.803  1.00 57.30  ? 11   LYS A CE  1 
ATOM 90    N NZ  . LYS A 1 14   ? 17.647  13.540  64.660  1.00 58.24  ? 11   LYS A NZ  1 
ATOM 91    N N   . PRO A 1 15   ? 17.944  19.077  70.467  1.00 53.35  ? 12   PRO A N   1 
ATOM 92    C CA  . PRO A 1 15   ? 18.025  19.154  71.928  1.00 53.47  ? 12   PRO A CA  1 
ATOM 93    C C   . PRO A 1 15   ? 18.487  17.830  72.523  1.00 53.72  ? 12   PRO A C   1 
ATOM 94    O O   . PRO A 1 15   ? 17.910  16.776  72.208  1.00 53.90  ? 12   PRO A O   1 
ATOM 95    C CB  . PRO A 1 15   ? 16.580  19.412  72.362  1.00 53.48  ? 12   PRO A CB  1 
ATOM 96    C CG  . PRO A 1 15   ? 15.851  19.813  71.176  1.00 53.51  ? 12   PRO A CG  1 
ATOM 97    C CD  . PRO A 1 15   ? 16.597  19.391  69.964  1.00 53.51  ? 12   PRO A CD  1 
ATOM 98    N N   . THR A 1 16   ? 19.514  17.881  73.370  1.00 53.80  ? 13   THR A N   1 
ATOM 99    C CA  . THR A 1 16   ? 20.094  16.657  73.932  1.00 54.03  ? 13   THR A CA  1 
ATOM 100   C C   . THR A 1 16   ? 19.633  16.337  75.354  1.00 54.30  ? 13   THR A C   1 
ATOM 101   O O   . THR A 1 16   ? 19.939  15.267  75.878  1.00 54.23  ? 13   THR A O   1 
ATOM 102   C CB  . THR A 1 16   ? 21.639  16.661  73.896  1.00 53.90  ? 13   THR A CB  1 
ATOM 103   O OG1 . THR A 1 16   ? 22.135  17.841  74.541  1.00 54.18  ? 13   THR A OG1 1 
ATOM 104   C CG2 . THR A 1 16   ? 22.147  16.591  72.469  1.00 53.27  ? 13   THR A CG2 1 
ATOM 105   N N   . ALA A 1 17   ? 18.912  17.261  75.980  1.00 54.73  ? 14   ALA A N   1 
ATOM 106   C CA  . ALA A 1 17   ? 18.442  17.040  77.336  1.00 55.15  ? 14   ALA A CA  1 
ATOM 107   C C   . ALA A 1 17   ? 17.275  16.075  77.322  1.00 55.56  ? 14   ALA A C   1 
ATOM 108   O O   . ALA A 1 17   ? 16.305  16.268  76.584  1.00 55.67  ? 14   ALA A O   1 
ATOM 109   C CB  . ALA A 1 17   ? 18.040  18.333  77.974  1.00 55.29  ? 14   ALA A CB  1 
ATOM 110   N N   . VAL A 1 18   ? 17.397  15.019  78.122  1.00 56.02  ? 15   VAL A N   1 
ATOM 111   C CA  . VAL A 1 18   ? 16.318  14.063  78.323  1.00 56.21  ? 15   VAL A CA  1 
ATOM 112   C C   . VAL A 1 18   ? 15.370  14.724  79.294  1.00 56.58  ? 15   VAL A C   1 
ATOM 113   O O   . VAL A 1 18   ? 15.776  15.163  80.377  1.00 56.48  ? 15   VAL A O   1 
ATOM 114   C CB  . VAL A 1 18   ? 16.828  12.730  78.906  1.00 56.10  ? 15   VAL A CB  1 
ATOM 115   C CG1 . VAL A 1 18   ? 15.671  11.859  79.374  1.00 56.55  ? 15   VAL A CG1 1 
ATOM 116   C CG2 . VAL A 1 18   ? 17.646  11.989  77.888  1.00 55.87  ? 15   VAL A CG2 1 
ATOM 117   N N   . ASN A 1 19   ? 14.114  14.818  78.882  1.00 57.10  ? 16   ASN A N   1 
ATOM 118   C CA  . ASN A 1 19   ? 13.101  15.507  79.657  1.00 57.89  ? 16   ASN A CA  1 
ATOM 119   C C   . ASN A 1 19   ? 12.146  14.510  80.284  1.00 57.99  ? 16   ASN A C   1 
ATOM 120   O O   . ASN A 1 19   ? 11.396  14.846  81.199  1.00 58.20  ? 16   ASN A O   1 
ATOM 121   C CB  . ASN A 1 19   ? 12.363  16.525  78.773  1.00 58.20  ? 16   ASN A CB  1 
ATOM 122   C CG  . ASN A 1 19   ? 13.227  17.763  78.439  1.00 59.84  ? 16   ASN A CG  1 
ATOM 123   O OD1 . ASN A 1 19   ? 13.848  18.374  79.329  1.00 62.13  ? 16   ASN A OD1 1 
ATOM 124   N ND2 . ASN A 1 19   ? 13.257  18.140  77.157  1.00 59.72  ? 16   ASN A ND2 1 
ATOM 125   N N   . GLY A 1 20   ? 12.208  13.274  79.794  1.00 58.19  ? 17   GLY A N   1 
ATOM 126   C CA  . GLY A 1 20   ? 11.373  12.180  80.271  1.00 58.39  ? 17   GLY A CA  1 
ATOM 127   C C   . GLY A 1 20   ? 11.659  10.883  79.536  1.00 58.66  ? 17   GLY A C   1 
ATOM 128   O O   . GLY A 1 20   ? 12.050  10.879  78.370  1.00 58.47  ? 17   GLY A O   1 
ATOM 129   N N   . CYS A 1 21   ? 11.457  9.773   80.230  1.00 59.11  ? 18   CYS A N   1 
ATOM 130   C CA  . CYS A 1 21   ? 11.701  8.449   79.672  1.00 59.85  ? 18   CYS A CA  1 
ATOM 131   C C   . CYS A 1 21   ? 10.863  7.393   80.380  1.00 59.57  ? 18   CYS A C   1 
ATOM 132   O O   . CYS A 1 21   ? 10.457  7.578   81.533  1.00 59.51  ? 18   CYS A O   1 
ATOM 133   C CB  . CYS A 1 21   ? 13.197  8.090   79.691  1.00 60.26  ? 18   CYS A CB  1 
ATOM 134   S SG  . CYS A 1 21   ? 14.064  8.143   81.306  1.00 63.34  ? 18   CYS A SG  1 
ATOM 135   N N   . VAL A 1 22   ? 10.590  6.300   79.670  1.00 59.55  ? 19   VAL A N   1 
ATOM 136   C CA  . VAL A 1 22   ? 9.729   5.231   80.176  1.00 59.64  ? 19   VAL A CA  1 
ATOM 137   C C   . VAL A 1 22   ? 10.087  3.873   79.567  1.00 59.58  ? 19   VAL A C   1 
ATOM 138   O O   . VAL A 1 22   ? 10.721  3.805   78.511  1.00 59.58  ? 19   VAL A O   1 
ATOM 139   C CB  . VAL A 1 22   ? 8.216   5.569   79.979  1.00 59.63  ? 19   VAL A CB  1 
ATOM 140   C CG1 . VAL A 1 22   ? 7.748   5.280   78.555  1.00 59.27  ? 19   VAL A CG1 1 
ATOM 141   C CG2 . VAL A 1 22   ? 7.360   4.826   81.004  1.00 60.26  ? 19   VAL A CG2 1 
ATOM 142   N N   . THR A 1 23   ? 9.700   2.802   80.255  1.00 59.64  ? 20   THR A N   1 
ATOM 143   C CA  . THR A 1 23   ? 9.907   1.444   79.758  1.00 59.79  ? 20   THR A CA  1 
ATOM 144   C C   . THR A 1 23   ? 8.576   0.715   79.526  1.00 59.78  ? 20   THR A C   1 
ATOM 145   O O   . THR A 1 23   ? 7.530   1.126   80.045  1.00 59.74  ? 20   THR A O   1 
ATOM 146   C CB  . THR A 1 23   ? 10.878  0.612   80.660  1.00 59.90  ? 20   THR A CB  1 
ATOM 147   O OG1 . THR A 1 23   ? 11.339  -0.529  79.932  1.00 60.18  ? 20   THR A OG1 1 
ATOM 148   C CG2 . THR A 1 23   ? 10.218  0.148   81.984  1.00 60.12  ? 20   THR A CG2 1 
ATOM 149   N N   . GLY A 1 24   ? 8.629   -0.356  78.733  1.00 59.77  ? 21   GLY A N   1 
ATOM 150   C CA  . GLY A 1 24   ? 7.440   -1.133  78.373  1.00 59.71  ? 21   GLY A CA  1 
ATOM 151   C C   . GLY A 1 24   ? 7.548   -1.819  77.017  1.00 59.62  ? 21   GLY A C   1 
ATOM 152   O O   . GLY A 1 24   ? 8.604   -1.791  76.377  1.00 59.71  ? 21   GLY A O   1 
ATOM 153   N N   . HIS A 1 25   ? 6.446   -2.426  76.579  1.00 59.32  ? 22   HIS A N   1 
ATOM 154   C CA  . HIS A 1 25   ? 6.419   -3.214  75.348  1.00 58.97  ? 22   HIS A CA  1 
ATOM 155   C C   . HIS A 1 25   ? 5.572   -2.485  74.316  1.00 58.53  ? 22   HIS A C   1 
ATOM 156   O O   . HIS A 1 25   ? 4.374   -2.725  74.181  1.00 58.45  ? 22   HIS A O   1 
ATOM 157   C CB  . HIS A 1 25   ? 5.875   -4.621  75.630  1.00 59.21  ? 22   HIS A CB  1 
ATOM 158   C CG  . HIS A 1 25   ? 6.404   -5.233  76.892  1.00 59.50  ? 22   HIS A CG  1 
ATOM 159   N ND1 . HIS A 1 25   ? 6.172   -4.690  78.139  1.00 60.06  ? 22   HIS A ND1 1 
ATOM 160   C CD2 . HIS A 1 25   ? 7.144   -6.347  77.101  1.00 59.81  ? 22   HIS A CD2 1 
ATOM 161   C CE1 . HIS A 1 25   ? 6.754   -5.437  79.059  1.00 60.28  ? 22   HIS A CE1 1 
ATOM 162   N NE2 . HIS A 1 25   ? 7.351   -6.449  78.455  1.00 60.38  ? 22   HIS A NE2 1 
ATOM 163   N N   . PHE A 1 26   ? 6.217   -1.574  73.603  1.00 58.15  ? 23   PHE A N   1 
ATOM 164   C CA  . PHE A 1 26   ? 5.546   -0.664  72.687  1.00 57.92  ? 23   PHE A CA  1 
ATOM 165   C C   . PHE A 1 26   ? 5.787   -1.112  71.258  1.00 57.90  ? 23   PHE A C   1 
ATOM 166   O O   . PHE A 1 26   ? 4.926   -0.939  70.393  1.00 57.98  ? 23   PHE A O   1 
ATOM 167   C CB  . PHE A 1 26   ? 6.051   0.767   72.915  1.00 57.73  ? 23   PHE A CB  1 
ATOM 168   C CG  . PHE A 1 26   ? 5.513   1.774   71.942  1.00 57.49  ? 23   PHE A CG  1 
ATOM 169   C CD1 . PHE A 1 26   ? 4.179   2.156   71.975  1.00 57.80  ? 23   PHE A CD1 1 
ATOM 170   C CD2 . PHE A 1 26   ? 6.350   2.356   71.002  1.00 57.52  ? 23   PHE A CD2 1 
ATOM 171   C CE1 . PHE A 1 26   ? 3.680   3.092   71.074  1.00 57.34  ? 23   PHE A CE1 1 
ATOM 172   C CE2 . PHE A 1 26   ? 5.863   3.293   70.102  1.00 57.47  ? 23   PHE A CE2 1 
ATOM 173   C CZ  . PHE A 1 26   ? 4.523   3.663   70.141  1.00 57.26  ? 23   PHE A CZ  1 
ATOM 174   N N   . THR A 1 27   ? 6.962   -1.693  71.029  1.00 57.78  ? 24   THR A N   1 
ATOM 175   C CA  . THR A 1 27   ? 7.323   -2.282  69.748  1.00 57.73  ? 24   THR A CA  1 
ATOM 176   C C   . THR A 1 27   ? 6.662   -3.660  69.601  1.00 57.95  ? 24   THR A C   1 
ATOM 177   O O   . THR A 1 27   ? 5.901   -3.881  68.656  1.00 57.92  ? 24   THR A O   1 
ATOM 178   C CB  . THR A 1 27   ? 8.869   -2.356  69.580  1.00 57.64  ? 24   THR A CB  1 
ATOM 179   O OG1 . THR A 1 27   ? 9.398   -1.036  69.436  1.00 56.77  ? 24   THR A OG1 1 
ATOM 180   C CG2 . THR A 1 27   ? 9.269   -3.173  68.358  1.00 58.06  ? 24   THR A CG2 1 
ATOM 181   N N   . SER A 1 28   ? 6.946   -4.570  70.540  1.00 58.18  ? 25   SER A N   1 
ATOM 182   C CA  . SER A 1 28   ? 6.383   -5.934  70.527  1.00 58.34  ? 25   SER A CA  1 
ATOM 183   C C   . SER A 1 28   ? 6.039   -6.442  71.929  1.00 58.40  ? 25   SER A C   1 
ATOM 184   O O   . SER A 1 28   ? 6.785   -6.205  72.878  1.00 58.36  ? 25   SER A O   1 
ATOM 185   C CB  . SER A 1 28   ? 7.334   -6.906  69.829  1.00 58.25  ? 25   SER A CB  1 
ATOM 186   O OG  . SER A 1 28   ? 7.586   -6.492  68.496  1.00 58.33  ? 25   SER A OG  1 
ATOM 187   N N   . ALA A 1 29   ? 4.909   -7.144  72.047  1.00 58.51  ? 26   ALA A N   1 
ATOM 188   C CA  . ALA A 1 29   ? 4.400   -7.609  73.347  1.00 58.52  ? 26   ALA A CA  1 
ATOM 189   C C   . ALA A 1 29   ? 5.459   -8.407  74.094  1.00 58.41  ? 26   ALA A C   1 
ATOM 190   O O   . ALA A 1 29   ? 5.420   -8.524  75.319  1.00 58.38  ? 26   ALA A O   1 
ATOM 191   C CB  . ALA A 1 29   ? 3.132   -8.439  73.162  1.00 58.60  ? 26   ALA A CB  1 
ATOM 192   N N   . GLU A 1 30   ? 6.399   -8.940  73.319  1.00 58.33  ? 27   GLU A N   1 
ATOM 193   C CA  . GLU A 1 30   ? 7.577   -9.652  73.801  1.00 58.20  ? 27   GLU A CA  1 
ATOM 194   C C   . GLU A 1 30   ? 8.829   -8.918  73.320  1.00 57.82  ? 27   GLU A C   1 
ATOM 195   O O   . GLU A 1 30   ? 9.640   -9.457  72.563  1.00 57.86  ? 27   GLU A O   1 
ATOM 196   C CB  . GLU A 1 30   ? 7.570   -11.119 73.332  1.00 58.43  ? 27   GLU A CB  1 
ATOM 197   C CG  . GLU A 1 30   ? 6.495   -11.483 72.282  1.00 59.22  ? 27   GLU A CG  1 
ATOM 198   C CD  . GLU A 1 30   ? 6.553   -10.622 71.024  1.00 60.05  ? 27   GLU A CD  1 
ATOM 199   O OE1 . GLU A 1 30   ? 5.677   -9.737  70.869  1.00 59.90  ? 27   GLU A OE1 1 
ATOM 200   O OE2 . GLU A 1 30   ? 7.480   -10.822 70.207  1.00 60.62  ? 27   GLU A OE2 1 
ATOM 201   N N   . ASP A 1 31   ? 8.942   -7.669  73.761  1.00 57.37  ? 28   ASP A N   1 
ATOM 202   C CA  . ASP A 1 31   ? 10.070  -6.778  73.500  1.00 56.97  ? 28   ASP A CA  1 
ATOM 203   C C   . ASP A 1 31   ? 10.165  -5.838  74.696  1.00 56.50  ? 28   ASP A C   1 
ATOM 204   O O   . ASP A 1 31   ? 9.148   -5.510  75.306  1.00 56.61  ? 28   ASP A O   1 
ATOM 205   C CB  . ASP A 1 31   ? 9.807   -5.927  72.248  1.00 57.13  ? 28   ASP A CB  1 
ATOM 206   C CG  . ASP A 1 31   ? 10.679  -6.312  71.051  1.00 57.75  ? 28   ASP A CG  1 
ATOM 207   O OD1 . ASP A 1 31   ? 11.464  -7.287  71.136  1.00 58.70  ? 28   ASP A OD1 1 
ATOM 208   O OD2 . ASP A 1 31   ? 10.576  -5.614  70.012  1.00 57.66  ? 28   ASP A OD2 1 
ATOM 209   N N   . LEU A 1 32   ? 11.368  -5.396  75.039  1.00 55.87  ? 29   LEU A N   1 
ATOM 210   C CA  . LEU A 1 32   ? 11.498  -4.337  76.036  1.00 55.17  ? 29   LEU A CA  1 
ATOM 211   C C   . LEU A 1 32   ? 11.930  -3.049  75.351  1.00 55.05  ? 29   LEU A C   1 
ATOM 212   O O   . LEU A 1 32   ? 12.879  -3.039  74.558  1.00 55.05  ? 29   LEU A O   1 
ATOM 213   C CB  . LEU A 1 32   ? 12.457  -4.729  77.165  1.00 55.10  ? 29   LEU A CB  1 
ATOM 214   C CG  . LEU A 1 32   ? 12.447  -3.906  78.457  1.00 54.47  ? 29   LEU A CG  1 
ATOM 215   C CD1 . LEU A 1 32   ? 11.049  -3.725  79.026  1.00 53.86  ? 29   LEU A CD1 1 
ATOM 216   C CD2 . LEU A 1 32   ? 13.357  -4.543  79.489  1.00 54.76  ? 29   LEU A CD2 1 
ATOM 217   N N   . ASN A 1 33   ? 11.207  -1.972  75.644  1.00 54.65  ? 30   ASN A N   1 
ATOM 218   C CA  . ASN A 1 33   ? 11.435  -0.692  74.991  1.00 54.24  ? 30   ASN A CA  1 
ATOM 219   C C   . ASN A 1 33   ? 11.868  0.376   75.953  1.00 53.91  ? 30   ASN A C   1 
ATOM 220   O O   . ASN A 1 33   ? 11.382  0.455   77.082  1.00 54.03  ? 30   ASN A O   1 
ATOM 221   C CB  . ASN A 1 33   ? 10.183  -0.222  74.256  1.00 54.20  ? 30   ASN A CB  1 
ATOM 222   C CG  . ASN A 1 33   ? 9.859   -1.086  73.066  1.00 54.41  ? 30   ASN A CG  1 
ATOM 223   O OD1 . ASN A 1 33   ? 10.515  -1.001  72.028  1.00 54.65  ? 30   ASN A OD1 1 
ATOM 224   N ND2 . ASN A 1 33   ? 8.849   -1.935  73.210  1.00 54.20  ? 30   ASN A ND2 1 
ATOM 225   N N   . LEU A 1 34   ? 12.801  1.194   75.496  1.00 53.31  ? 31   LEU A N   1 
ATOM 226   C CA  . LEU A 1 34   ? 13.134  2.400   76.193  1.00 52.72  ? 31   LEU A CA  1 
ATOM 227   C C   . LEU A 1 34   ? 12.548  3.523   75.365  1.00 52.48  ? 31   LEU A C   1 
ATOM 228   O O   . LEU A 1 34   ? 12.859  3.658   74.174  1.00 52.61  ? 31   LEU A O   1 
ATOM 229   C CB  . LEU A 1 34   ? 14.642  2.529   76.331  1.00 52.63  ? 31   LEU A CB  1 
ATOM 230   C CG  . LEU A 1 34   ? 15.158  3.615   77.269  1.00 53.03  ? 31   LEU A CG  1 
ATOM 231   C CD1 . LEU A 1 34   ? 14.409  3.678   78.600  1.00 53.44  ? 31   LEU A CD1 1 
ATOM 232   C CD2 . LEU A 1 34   ? 16.624  3.384   77.504  1.00 53.67  ? 31   LEU A CD2 1 
ATOM 233   N N   . LEU A 1 35   ? 11.660  4.293   75.988  1.00 51.97  ? 32   LEU A N   1 
ATOM 234   C CA  . LEU A 1 35   ? 11.027  5.427   75.332  1.00 51.53  ? 32   LEU A CA  1 
ATOM 235   C C   . LEU A 1 35   ? 11.502  6.725   75.924  1.00 51.38  ? 32   LEU A C   1 
ATOM 236   O O   . LEU A 1 35   ? 10.951  7.188   76.911  1.00 51.49  ? 32   LEU A O   1 
ATOM 237   C CB  . LEU A 1 35   ? 9.514   5.340   75.444  1.00 51.28  ? 32   LEU A CB  1 
ATOM 238   C CG  . LEU A 1 35   ? 8.801   5.063   74.132  1.00 51.44  ? 32   LEU A CG  1 
ATOM 239   C CD1 . LEU A 1 35   ? 9.348   3.809   73.444  1.00 51.89  ? 32   LEU A CD1 1 
ATOM 240   C CD2 . LEU A 1 35   ? 7.314   4.950   74.392  1.00 51.64  ? 32   LEU A CD2 1 
ATOM 241   N N   . ILE A 1 36   ? 12.520  7.311   75.304  1.00 51.25  ? 33   ILE A N   1 
ATOM 242   C CA  . ILE A 1 36   ? 13.135  8.540   75.788  1.00 51.08  ? 33   ILE A CA  1 
ATOM 243   C C   . ILE A 1 36   ? 12.608  9.754   75.032  1.00 51.44  ? 33   ILE A C   1 
ATOM 244   O O   . ILE A 1 36   ? 12.851  9.902   73.832  1.00 51.75  ? 33   ILE A O   1 
ATOM 245   C CB  . ILE A 1 36   ? 14.650  8.477   75.615  1.00 50.74  ? 33   ILE A CB  1 
ATOM 246   C CG1 . ILE A 1 36   ? 15.183  7.197   76.241  1.00 50.34  ? 33   ILE A CG1 1 
ATOM 247   C CG2 . ILE A 1 36   ? 15.295  9.687   76.234  1.00 50.47  ? 33   ILE A CG2 1 
ATOM 248   C CD1 . ILE A 1 36   ? 16.516  6.789   75.722  1.00 50.65  ? 33   ILE A CD1 1 
ATOM 249   N N   . ALA A 1 37   ? 11.880  10.618  75.730  1.00 51.58  ? 34   ALA A N   1 
ATOM 250   C CA  . ALA A 1 37   ? 11.452  11.879  75.144  1.00 51.87  ? 34   ALA A CA  1 
ATOM 251   C C   . ALA A 1 37   ? 12.555  12.917  75.341  1.00 52.22  ? 34   ALA A C   1 
ATOM 252   O O   . ALA A 1 37   ? 13.047  13.081  76.461  1.00 52.52  ? 34   ALA A O   1 
ATOM 253   C CB  . ALA A 1 37   ? 10.159  12.356  75.797  1.00 51.63  ? 34   ALA A CB  1 
ATOM 254   N N   . LYS A 1 38   ? 12.959  13.613  74.276  1.00 52.41  ? 35   LYS A N   1 
ATOM 255   C CA  . LYS A 1 38   ? 13.735  14.847  74.469  1.00 52.76  ? 35   LYS A CA  1 
ATOM 256   C C   . LYS A 1 38   ? 12.773  16.027  74.663  1.00 53.22  ? 35   LYS A C   1 
ATOM 257   O O   . LYS A 1 38   ? 11.813  15.930  75.432  1.00 53.82  ? 35   LYS A O   1 
ATOM 258   C CB  . LYS A 1 38   ? 14.733  15.098  73.343  1.00 52.57  ? 35   LYS A CB  1 
ATOM 259   C CG  . LYS A 1 38   ? 15.747  13.985  73.157  1.00 52.24  ? 35   LYS A CG  1 
ATOM 260   C CD  . LYS A 1 38   ? 16.632  13.777  74.360  1.00 50.68  ? 35   LYS A CD  1 
ATOM 261   C CE  . LYS A 1 38   ? 17.177  12.365  74.352  1.00 50.07  ? 35   LYS A CE  1 
ATOM 262   N NZ  . LYS A 1 38   ? 17.964  12.059  73.132  1.00 49.34  ? 35   LYS A NZ  1 
ATOM 263   N N   . ASN A 1 39   ? 13.006  17.154  74.011  1.00 53.31  ? 36   ASN A N   1 
ATOM 264   C CA  . ASN A 1 39   ? 12.029  18.213  74.148  1.00 53.27  ? 36   ASN A CA  1 
ATOM 265   C C   . ASN A 1 39   ? 10.861  17.859  73.257  1.00 53.41  ? 36   ASN A C   1 
ATOM 266   O O   . ASN A 1 39   ? 9.750   17.611  73.726  1.00 53.25  ? 36   ASN A O   1 
ATOM 267   C CB  . ASN A 1 39   ? 12.613  19.572  73.770  1.00 53.19  ? 36   ASN A CB  1 
ATOM 268   C CG  . ASN A 1 39   ? 11.610  20.694  73.935  1.00 53.10  ? 36   ASN A CG  1 
ATOM 269   O OD1 . ASN A 1 39   ? 10.827  20.708  74.885  1.00 53.02  ? 36   ASN A OD1 1 
ATOM 270   N ND2 . ASN A 1 39   ? 11.624  21.641  73.008  1.00 53.20  ? 36   ASN A ND2 1 
ATOM 271   N N   . THR A 1 40   ? 11.175  17.789  71.966  1.00 53.81  ? 37   THR A N   1 
ATOM 272   C CA  . THR A 1 40   ? 10.227  17.643  70.872  1.00 53.72  ? 37   THR A CA  1 
ATOM 273   C C   . THR A 1 40   ? 10.503  16.330  70.165  1.00 53.76  ? 37   THR A C   1 
ATOM 274   O O   . THR A 1 40   ? 9.619   15.761  69.535  1.00 53.63  ? 37   THR A O   1 
ATOM 275   C CB  . THR A 1 40   ? 10.396  18.793  69.868  1.00 53.73  ? 37   THR A CB  1 
ATOM 276   O OG1 . THR A 1 40   ? 11.793  18.992  69.605  1.00 53.87  ? 37   THR A OG1 1 
ATOM 277   C CG2 . THR A 1 40   ? 9.824   20.086  70.426  1.00 53.53  ? 37   THR A CG2 1 
ATOM 278   N N   . ARG A 1 41   ? 11.740  15.852  70.283  1.00 54.06  ? 38   ARG A N   1 
ATOM 279   C CA  . ARG A 1 41   ? 12.112  14.542  69.754  1.00 54.58  ? 38   ARG A CA  1 
ATOM 280   C C   . ARG A 1 41   ? 11.574  13.397  70.617  1.00 54.76  ? 38   ARG A C   1 
ATOM 281   O O   . ARG A 1 41   ? 11.179  13.600  71.758  1.00 55.17  ? 38   ARG A O   1 
ATOM 282   C CB  . ARG A 1 41   ? 13.634  14.427  69.581  1.00 54.48  ? 38   ARG A CB  1 
ATOM 283   C CG  . ARG A 1 41   ? 14.221  15.226  68.418  1.00 55.04  ? 38   ARG A CG  1 
ATOM 284   C CD  . ARG A 1 41   ? 13.212  15.417  67.277  1.00 56.27  ? 38   ARG A CD  1 
ATOM 285   N NE  . ARG A 1 41   ? 13.846  15.581  65.974  1.00 56.35  ? 38   ARG A NE  1 
ATOM 286   C CZ  . ARG A 1 41   ? 13.837  14.651  65.029  1.00 56.21  ? 38   ARG A CZ  1 
ATOM 287   N NH1 . ARG A 1 41   ? 13.211  13.507  65.258  1.00 55.64  ? 38   ARG A NH1 1 
ATOM 288   N NH2 . ARG A 1 41   ? 14.444  14.864  63.862  1.00 55.86  ? 38   ARG A NH2 1 
ATOM 289   N N   . LEU A 1 42   ? 11.555  12.194  70.068  1.00 54.91  ? 39   LEU A N   1 
ATOM 290   C CA  . LEU A 1 42   ? 11.123  11.046  70.823  1.00 55.39  ? 39   LEU A CA  1 
ATOM 291   C C   . LEU A 1 42   ? 11.911  9.826   70.367  1.00 55.90  ? 39   LEU A C   1 
ATOM 292   O O   . LEU A 1 42   ? 11.580  9.203   69.355  1.00 56.17  ? 39   LEU A O   1 
ATOM 293   C CB  . LEU A 1 42   ? 9.627   10.837  70.621  1.00 55.37  ? 39   LEU A CB  1 
ATOM 294   C CG  . LEU A 1 42   ? 9.005   9.573   71.214  1.00 55.60  ? 39   LEU A CG  1 
ATOM 295   C CD1 . LEU A 1 42   ? 8.194   9.875   72.476  1.00 55.11  ? 39   LEU A CD1 1 
ATOM 296   C CD2 . LEU A 1 42   ? 8.145   8.923   70.149  1.00 55.36  ? 39   LEU A CD2 1 
ATOM 297   N N   . GLU A 1 43   ? 12.966  9.494   71.103  1.00 56.28  ? 40   GLU A N   1 
ATOM 298   C CA  . GLU A 1 43   ? 13.776  8.333   70.770  1.00 56.81  ? 40   GLU A CA  1 
ATOM 299   C C   . GLU A 1 43   ? 13.067  7.039   71.140  1.00 57.08  ? 40   GLU A C   1 
ATOM 300   O O   . GLU A 1 43   ? 12.458  6.931   72.208  1.00 57.02  ? 40   GLU A O   1 
ATOM 301   C CB  . GLU A 1 43   ? 15.154  8.423   71.420  1.00 56.77  ? 40   GLU A CB  1 
ATOM 302   C CG  . GLU A 1 43   ? 16.251  8.754   70.425  1.00 58.20  ? 40   GLU A CG  1 
ATOM 303   C CD  . GLU A 1 43   ? 17.300  9.729   70.963  1.00 60.17  ? 40   GLU A CD  1 
ATOM 304   O OE1 . GLU A 1 43   ? 18.053  9.354   71.892  1.00 61.16  ? 40   GLU A OE1 1 
ATOM 305   O OE2 . GLU A 1 43   ? 17.388  10.868  70.437  1.00 60.29  ? 40   GLU A OE2 1 
ATOM 306   N N   . ILE A 1 44   ? 13.130  6.068   70.234  1.00 57.49  ? 41   ILE A N   1 
ATOM 307   C CA  . ILE A 1 44   ? 12.551  4.751   70.474  1.00 57.95  ? 41   ILE A CA  1 
ATOM 308   C C   . ILE A 1 44   ? 13.632  3.673   70.395  1.00 58.19  ? 41   ILE A C   1 
ATOM 309   O O   . ILE A 1 44   ? 14.273  3.499   69.355  1.00 58.06  ? 41   ILE A O   1 
ATOM 310   C CB  . ILE A 1 44   ? 11.365  4.454   69.510  1.00 58.00  ? 41   ILE A CB  1 
ATOM 311   C CG1 . ILE A 1 44   ? 10.236  5.473   69.731  1.00 58.05  ? 41   ILE A CG1 1 
ATOM 312   C CG2 . ILE A 1 44   ? 10.857  3.015   69.682  1.00 58.10  ? 41   ILE A CG2 1 
ATOM 313   C CD1 . ILE A 1 44   ? 8.929   5.122   69.058  1.00 57.93  ? 41   ILE A CD1 1 
ATOM 314   N N   . TYR A 1 45   ? 13.828  2.968   71.509  1.00 58.63  ? 42   TYR A N   1 
ATOM 315   C CA  . TYR A 1 45   ? 14.853  1.932   71.620  1.00 59.16  ? 42   TYR A CA  1 
ATOM 316   C C   . TYR A 1 45   ? 14.271  0.571   71.982  1.00 59.72  ? 42   TYR A C   1 
ATOM 317   O O   . TYR A 1 45   ? 13.157  0.481   72.514  1.00 59.71  ? 42   TYR A O   1 
ATOM 318   C CB  . TYR A 1 45   ? 15.887  2.318   72.681  1.00 59.07  ? 42   TYR A CB  1 
ATOM 319   C CG  . TYR A 1 45   ? 16.717  3.519   72.323  1.00 59.08  ? 42   TYR A CG  1 
ATOM 320   C CD1 . TYR A 1 45   ? 16.325  4.795   72.705  1.00 59.10  ? 42   TYR A CD1 1 
ATOM 321   C CD2 . TYR A 1 45   ? 17.896  3.382   71.598  1.00 59.18  ? 42   TYR A CD2 1 
ATOM 322   C CE1 . TYR A 1 45   ? 17.081  5.908   72.369  1.00 58.99  ? 42   TYR A CE1 1 
ATOM 323   C CE2 . TYR A 1 45   ? 18.662  4.491   71.260  1.00 59.37  ? 42   TYR A CE2 1 
ATOM 324   C CZ  . TYR A 1 45   ? 18.244  5.752   71.649  1.00 59.15  ? 42   TYR A CZ  1 
ATOM 325   O OH  . TYR A 1 45   ? 18.991  6.857   71.321  1.00 59.30  ? 42   TYR A OH  1 
ATOM 326   N N   . VAL A 1 46   ? 15.040  -0.478  71.679  1.00 60.38  ? 43   VAL A N   1 
ATOM 327   C CA  . VAL A 1 46   ? 14.805  -1.830  72.195  1.00 60.99  ? 43   VAL A CA  1 
ATOM 328   C C   . VAL A 1 46   ? 16.063  -2.287  72.925  1.00 61.31  ? 43   VAL A C   1 
ATOM 329   O O   . VAL A 1 46   ? 17.177  -2.080  72.443  1.00 61.20  ? 43   VAL A O   1 
ATOM 330   C CB  . VAL A 1 46   ? 14.429  -2.838  71.078  1.00 61.06  ? 43   VAL A CB  1 
ATOM 331   C CG1 . VAL A 1 46   ? 14.458  -4.279  71.596  1.00 61.50  ? 43   VAL A CG1 1 
ATOM 332   C CG2 . VAL A 1 46   ? 13.048  -2.528  70.519  1.00 61.44  ? 43   VAL A CG2 1 
ATOM 333   N N   . VAL A 1 47   ? 15.869  -2.906  74.086  1.00 62.01  ? 44   VAL A N   1 
ATOM 334   C CA  . VAL A 1 47   ? 16.970  -3.300  74.970  1.00 62.80  ? 44   VAL A CA  1 
ATOM 335   C C   . VAL A 1 47   ? 17.641  -4.607  74.525  1.00 63.36  ? 44   VAL A C   1 
ATOM 336   O O   . VAL A 1 47   ? 16.974  -5.541  74.069  1.00 63.56  ? 44   VAL A O   1 
ATOM 337   C CB  . VAL A 1 47   ? 16.507  -3.427  76.447  1.00 62.74  ? 44   VAL A CB  1 
ATOM 338   C CG1 . VAL A 1 47   ? 17.680  -3.248  77.392  1.00 62.82  ? 44   VAL A CG1 1 
ATOM 339   C CG2 . VAL A 1 47   ? 15.439  -2.397  76.771  1.00 62.96  ? 44   VAL A CG2 1 
ATOM 340   N N   . THR A 1 48   ? 18.963  -4.659  74.674  1.00 63.97  ? 45   THR A N   1 
ATOM 341   C CA  . THR A 1 48   ? 19.773  -5.790  74.240  1.00 64.65  ? 45   THR A CA  1 
ATOM 342   C C   . THR A 1 48   ? 20.761  -6.232  75.319  1.00 65.11  ? 45   THR A C   1 
ATOM 343   O O   . THR A 1 48   ? 20.867  -5.605  76.375  1.00 65.16  ? 45   THR A O   1 
ATOM 344   C CB  . THR A 1 48   ? 20.591  -5.429  72.983  1.00 64.81  ? 45   THR A CB  1 
ATOM 345   O OG1 . THR A 1 48   ? 21.347  -4.231  73.227  1.00 64.67  ? 45   THR A OG1 1 
ATOM 346   C CG2 . THR A 1 48   ? 19.679  -5.237  71.763  1.00 64.87  ? 45   THR A CG2 1 
ATOM 347   N N   . ALA A 1 49   ? 21.485  -7.314  75.036  1.00 65.75  ? 46   ALA A N   1 
ATOM 348   C CA  . ALA A 1 49   ? 22.598  -7.756  75.870  1.00 66.29  ? 46   ALA A CA  1 
ATOM 349   C C   . ALA A 1 49   ? 23.628  -6.639  76.010  1.00 66.70  ? 46   ALA A C   1 
ATOM 350   O O   . ALA A 1 49   ? 24.192  -6.440  77.084  1.00 66.63  ? 46   ALA A O   1 
ATOM 351   C CB  . ALA A 1 49   ? 23.242  -9.013  75.285  1.00 66.24  ? 46   ALA A CB  1 
ATOM 352   N N   . GLU A 1 50   ? 23.864  -5.911  74.921  1.00 67.39  ? 47   GLU A N   1 
ATOM 353   C CA  . GLU A 1 50   ? 24.762  -4.757  74.948  1.00 68.27  ? 47   GLU A CA  1 
ATOM 354   C C   . GLU A 1 50   ? 24.131  -3.597  75.726  1.00 68.50  ? 47   GLU A C   1 
ATOM 355   O O   . GLU A 1 50   ? 24.767  -3.001  76.616  1.00 68.65  ? 47   GLU A O   1 
ATOM 356   C CB  . GLU A 1 50   ? 25.120  -4.310  73.518  1.00 68.50  ? 47   GLU A CB  1 
ATOM 357   C CG  . GLU A 1 50   ? 25.989  -3.036  73.421  1.00 69.28  ? 47   GLU A CG  1 
ATOM 358   C CD  . GLU A 1 50   ? 25.247  -1.751  73.821  1.00 70.40  ? 47   GLU A CD  1 
ATOM 359   O OE1 . GLU A 1 50   ? 24.149  -1.479  73.282  1.00 70.87  ? 47   GLU A OE1 1 
ATOM 360   O OE2 . GLU A 1 50   ? 25.768  -1.014  74.687  1.00 70.81  ? 47   GLU A OE2 1 
ATOM 361   N N   . GLY A 1 51   ? 22.884  -3.283  75.372  1.00 68.53  ? 48   GLY A N   1 
ATOM 362   C CA  . GLY A 1 51   ? 22.190  -2.116  75.899  1.00 68.37  ? 48   GLY A CA  1 
ATOM 363   C C   . GLY A 1 51   ? 21.012  -1.747  75.018  1.00 68.30  ? 48   GLY A C   1 
ATOM 364   O O   . GLY A 1 51   ? 19.976  -2.405  75.064  1.00 68.56  ? 48   GLY A O   1 
ATOM 365   N N   . LEU A 1 52   ? 21.173  -0.713  74.196  1.00 67.90  ? 49   LEU A N   1 
ATOM 366   C CA  . LEU A 1 52   ? 20.048  -0.153  73.454  1.00 67.39  ? 49   LEU A CA  1 
ATOM 367   C C   . LEU A 1 52   ? 20.203  -0.266  71.945  1.00 67.30  ? 49   LEU A C   1 
ATOM 368   O O   . LEU A 1 52   ? 21.137  0.297   71.376  1.00 67.42  ? 49   LEU A O   1 
ATOM 369   C CB  . LEU A 1 52   ? 19.870  1.314   73.841  1.00 67.27  ? 49   LEU A CB  1 
ATOM 370   C CG  . LEU A 1 52   ? 19.081  1.749   75.086  1.00 66.98  ? 49   LEU A CG  1 
ATOM 371   C CD1 . LEU A 1 52   ? 18.683  0.617   76.044  1.00 66.34  ? 49   LEU A CD1 1 
ATOM 372   C CD2 . LEU A 1 52   ? 19.861  2.826   75.813  1.00 66.21  ? 49   LEU A CD2 1 
ATOM 373   N N   . ARG A 1 53   ? 19.288  -0.992  71.303  1.00 67.13  ? 50   ARG A N   1 
ATOM 374   C CA  . ARG A 1 53   ? 19.172  -0.980  69.840  1.00 67.10  ? 50   ARG A CA  1 
ATOM 375   C C   . ARG A 1 53   ? 18.202  0.113   69.407  1.00 66.52  ? 50   ARG A C   1 
ATOM 376   O O   . ARG A 1 53   ? 17.000  0.004   69.672  1.00 66.51  ? 50   ARG A O   1 
ATOM 377   C CB  . ARG A 1 53   ? 18.679  -2.324  69.301  1.00 67.10  ? 50   ARG A CB  1 
ATOM 378   C CG  . ARG A 1 53   ? 18.457  -2.348  67.769  1.00 67.82  ? 50   ARG A CG  1 
ATOM 379   C CD  . ARG A 1 53   ? 17.611  -3.547  67.315  1.00 68.17  ? 50   ARG A CD  1 
ATOM 380   N NE  . ARG A 1 53   ? 17.977  -4.765  68.039  1.00 71.23  ? 50   ARG A NE  1 
ATOM 381   C CZ  . ARG A 1 53   ? 19.017  -5.546  67.738  1.00 72.74  ? 50   ARG A CZ  1 
ATOM 382   N NH1 . ARG A 1 53   ? 19.803  -5.259  66.704  1.00 73.39  ? 50   ARG A NH1 1 
ATOM 383   N NH2 . ARG A 1 53   ? 19.269  -6.626  68.471  1.00 73.55  ? 50   ARG A NH2 1 
ATOM 384   N N   . PRO A 1 54   ? 18.715  1.173   68.746  1.00 66.03  ? 51   PRO A N   1 
ATOM 385   C CA  . PRO A 1 54   ? 17.824  2.205   68.236  1.00 65.64  ? 51   PRO A CA  1 
ATOM 386   C C   . PRO A 1 54   ? 16.858  1.611   67.223  1.00 65.34  ? 51   PRO A C   1 
ATOM 387   O O   . PRO A 1 54   ? 17.180  0.626   66.551  1.00 65.22  ? 51   PRO A O   1 
ATOM 388   C CB  . PRO A 1 54   ? 18.776  3.202   67.572  1.00 65.59  ? 51   PRO A CB  1 
ATOM 389   C CG  . PRO A 1 54   ? 20.085  2.957   68.219  1.00 65.80  ? 51   PRO A CG  1 
ATOM 390   C CD  . PRO A 1 54   ? 20.123  1.485   68.451  1.00 66.01  ? 51   PRO A CD  1 
ATOM 391   N N   . VAL A 1 55   ? 15.675  2.208   67.135  1.00 65.00  ? 52   VAL A N   1 
ATOM 392   C CA  . VAL A 1 55   ? 14.564  1.610   66.412  1.00 64.56  ? 52   VAL A CA  1 
ATOM 393   C C   . VAL A 1 55   ? 13.847  2.643   65.542  1.00 64.35  ? 52   VAL A C   1 
ATOM 394   O O   . VAL A 1 55   ? 13.601  2.390   64.352  1.00 64.48  ? 52   VAL A O   1 
ATOM 395   C CB  . VAL A 1 55   ? 13.598  0.896   67.407  1.00 64.50  ? 52   VAL A CB  1 
ATOM 396   C CG1 . VAL A 1 55   ? 12.176  0.816   66.879  1.00 64.55  ? 52   VAL A CG1 1 
ATOM 397   C CG2 . VAL A 1 55   ? 14.122  -0.484  67.738  1.00 64.48  ? 52   VAL A CG2 1 
ATOM 398   N N   . LYS A 1 56   ? 13.532  3.798   66.137  1.00 63.78  ? 53   LYS A N   1 
ATOM 399   C CA  . LYS A 1 56   ? 12.789  4.866   65.468  1.00 63.32  ? 53   LYS A CA  1 
ATOM 400   C C   . LYS A 1 56   ? 12.925  6.161   66.237  1.00 62.84  ? 53   LYS A C   1 
ATOM 401   O O   . LYS A 1 56   ? 12.675  6.201   67.442  1.00 63.00  ? 53   LYS A O   1 
ATOM 402   C CB  . LYS A 1 56   ? 11.299  4.511   65.352  1.00 63.47  ? 53   LYS A CB  1 
ATOM 403   C CG  . LYS A 1 56   ? 10.469  5.494   64.523  1.00 64.18  ? 53   LYS A CG  1 
ATOM 404   C CD  . LYS A 1 56   ? 10.837  5.411   63.039  1.00 65.96  ? 53   LYS A CD  1 
ATOM 405   C CE  . LYS A 1 56   ? 10.031  6.376   62.178  1.00 66.27  ? 53   LYS A CE  1 
ATOM 406   N NZ  . LYS A 1 56   ? 10.417  6.247   60.746  1.00 66.15  ? 53   LYS A NZ  1 
ATOM 407   N N   . GLU A 1 57   ? 13.307  7.224   65.539  1.00 62.15  ? 54   GLU A N   1 
ATOM 408   C CA  . GLU A 1 57   ? 13.423  8.537   66.161  1.00 61.55  ? 54   GLU A CA  1 
ATOM 409   C C   . GLU A 1 57   ? 12.540  9.491   65.391  1.00 60.93  ? 54   GLU A C   1 
ATOM 410   O O   . GLU A 1 57   ? 12.691  9.637   64.179  1.00 60.99  ? 54   GLU A O   1 
ATOM 411   C CB  . GLU A 1 57   ? 14.886  9.004   66.159  1.00 61.74  ? 54   GLU A CB  1 
ATOM 412   C CG  . GLU A 1 57   ? 15.201  10.195  67.071  1.00 62.21  ? 54   GLU A CG  1 
ATOM 413   C CD  . GLU A 1 57   ? 15.167  11.547  66.358  1.00 63.00  ? 54   GLU A CD  1 
ATOM 414   O OE1 . GLU A 1 57   ? 15.343  12.590  67.033  1.00 62.61  ? 54   GLU A OE1 1 
ATOM 415   O OE2 . GLU A 1 57   ? 14.972  11.573  65.121  1.00 63.52  ? 54   GLU A OE2 1 
ATOM 416   N N   . VAL A 1 58   ? 11.598  10.113  66.091  1.00 60.23  ? 55   VAL A N   1 
ATOM 417   C CA  . VAL A 1 58   ? 10.666  11.069  65.477  1.00 59.62  ? 55   VAL A CA  1 
ATOM 418   C C   . VAL A 1 58   ? 10.583  12.372  66.273  1.00 59.30  ? 55   VAL A C   1 
ATOM 419   O O   . VAL A 1 58   ? 10.803  12.382  67.490  1.00 59.66  ? 55   VAL A O   1 
ATOM 420   C CB  . VAL A 1 58   ? 9.233   10.481  65.297  1.00 59.46  ? 55   VAL A CB  1 
ATOM 421   C CG1 . VAL A 1 58   ? 9.257   9.300   64.349  1.00 59.55  ? 55   VAL A CG1 1 
ATOM 422   C CG2 . VAL A 1 58   ? 8.608   10.091  66.640  1.00 58.77  ? 55   VAL A CG2 1 
ATOM 423   N N   . GLY A 1 59   ? 10.283  13.467  65.579  1.00 58.55  ? 56   GLY A N   1 
ATOM 424   C CA  . GLY A 1 59   ? 9.986   14.737  66.233  1.00 57.37  ? 56   GLY A CA  1 
ATOM 425   C C   . GLY A 1 59   ? 8.496   14.835  66.500  1.00 56.59  ? 56   GLY A C   1 
ATOM 426   O O   . GLY A 1 59   ? 7.738   13.918  66.173  1.00 56.48  ? 56   GLY A O   1 
ATOM 427   N N   . MET A 1 60   ? 8.086   15.940  67.119  1.00 55.76  ? 57   MET A N   1 
ATOM 428   C CA  . MET A 1 60   ? 6.674   16.280  67.302  1.00 54.85  ? 57   MET A CA  1 
ATOM 429   C C   . MET A 1 60   ? 6.506   17.777  67.205  1.00 53.87  ? 57   MET A C   1 
ATOM 430   O O   . MET A 1 60   ? 7.490   18.515  67.163  1.00 53.73  ? 57   MET A O   1 
ATOM 431   C CB  . MET A 1 60   ? 6.137   15.782  68.641  1.00 54.68  ? 57   MET A CB  1 
ATOM 432   C CG  . MET A 1 60   ? 5.659   14.349  68.587  1.00 54.97  ? 57   MET A CG  1 
ATOM 433   S SD  . MET A 1 60   ? 4.788   13.846  70.081  1.00 55.96  ? 57   MET A SD  1 
ATOM 434   C CE  . MET A 1 60   ? 3.078   14.257  69.697  1.00 55.33  ? 57   MET A CE  1 
ATOM 435   N N   . TYR A 1 61   ? 5.258   18.219  67.144  1.00 52.94  ? 58   TYR A N   1 
ATOM 436   C CA  . TYR A 1 61   ? 4.961   19.642  67.117  1.00 51.92  ? 58   TYR A CA  1 
ATOM 437   C C   . TYR A 1 61   ? 4.524   20.098  68.500  1.00 51.64  ? 58   TYR A C   1 
ATOM 438   O O   . TYR A 1 61   ? 3.349   20.374  68.750  1.00 51.74  ? 58   TYR A O   1 
ATOM 439   C CB  . TYR A 1 61   ? 3.920   19.962  66.055  1.00 51.33  ? 58   TYR A CB  1 
ATOM 440   C CG  . TYR A 1 61   ? 4.429   19.806  64.645  1.00 50.54  ? 58   TYR A CG  1 
ATOM 441   C CD1 . TYR A 1 61   ? 5.774   20.015  64.330  1.00 49.58  ? 58   TYR A CD1 1 
ATOM 442   C CD2 . TYR A 1 61   ? 3.561   19.484  63.617  1.00 50.07  ? 58   TYR A CD2 1 
ATOM 443   C CE1 . TYR A 1 61   ? 6.239   19.887  63.027  1.00 49.19  ? 58   TYR A CE1 1 
ATOM 444   C CE2 . TYR A 1 61   ? 4.012   19.361  62.317  1.00 50.49  ? 58   TYR A CE2 1 
ATOM 445   C CZ  . TYR A 1 61   ? 5.349   19.561  62.024  1.00 50.12  ? 58   TYR A CZ  1 
ATOM 446   O OH  . TYR A 1 61   ? 5.773   19.417  60.721  1.00 50.55  ? 58   TYR A OH  1 
ATOM 447   N N   . GLY A 1 62   ? 5.498   20.162  69.399  1.00 51.05  ? 59   GLY A N   1 
ATOM 448   C CA  . GLY A 1 62   ? 5.225   20.480  70.776  1.00 50.22  ? 59   GLY A CA  1 
ATOM 449   C C   . GLY A 1 62   ? 6.292   19.954  71.697  1.00 49.70  ? 59   GLY A C   1 
ATOM 450   O O   . GLY A 1 62   ? 7.087   19.085  71.329  1.00 49.47  ? 59   GLY A O   1 
ATOM 451   N N   . LYS A 1 63   ? 6.307   20.513  72.896  1.00 49.24  ? 60   LYS A N   1 
ATOM 452   C CA  . LYS A 1 63   ? 7.141   20.027  73.954  1.00 48.91  ? 60   LYS A CA  1 
ATOM 453   C C   . LYS A 1 63   ? 6.313   18.947  74.600  1.00 49.21  ? 60   LYS A C   1 
ATOM 454   O O   . LYS A 1 63   ? 5.173   19.189  74.996  1.00 49.44  ? 60   LYS A O   1 
ATOM 455   C CB  . LYS A 1 63   ? 7.426   21.141  74.961  1.00 49.03  ? 60   LYS A CB  1 
ATOM 456   C CG  . LYS A 1 63   ? 8.041   22.417  74.354  1.00 48.82  ? 60   LYS A CG  1 
ATOM 457   C CD  . LYS A 1 63   ? 8.142   23.571  75.362  1.00 48.20  ? 60   LYS A CD  1 
ATOM 458   C CE  . LYS A 1 63   ? 9.410   23.505  76.204  1.00 46.42  ? 60   LYS A CE  1 
ATOM 459   N NZ  . LYS A 1 63   ? 10.640  23.487  75.381  1.00 45.10  ? 60   LYS A NZ  1 
ATOM 460   N N   . ILE A 1 64   ? 6.862   17.743  74.670  1.00 49.30  ? 61   ILE A N   1 
ATOM 461   C CA  . ILE A 1 64   ? 6.271   16.675  75.467  1.00 49.24  ? 61   ILE A CA  1 
ATOM 462   C C   . ILE A 1 64   ? 6.351   17.053  76.951  1.00 49.52  ? 61   ILE A C   1 
ATOM 463   O O   . ILE A 1 64   ? 7.356   17.603  77.414  1.00 49.62  ? 61   ILE A O   1 
ATOM 464   C CB  . ILE A 1 64   ? 6.994   15.359  75.205  1.00 49.07  ? 61   ILE A CB  1 
ATOM 465   C CG1 . ILE A 1 64   ? 6.996   15.071  73.706  1.00 48.70  ? 61   ILE A CG1 1 
ATOM 466   C CG2 . ILE A 1 64   ? 6.344   14.224  75.969  1.00 49.32  ? 61   ILE A CG2 1 
ATOM 467   C CD1 . ILE A 1 64   ? 8.265   14.446  73.216  1.00 48.60  ? 61   ILE A CD1 1 
ATOM 468   N N   . ALA A 1 65   ? 5.275   16.791  77.681  1.00 49.93  ? 62   ALA A N   1 
ATOM 469   C CA  . ALA A 1 65   ? 5.193   17.136  79.095  1.00 50.55  ? 62   ALA A CA  1 
ATOM 470   C C   . ALA A 1 65   ? 4.620   15.957  79.860  1.00 50.93  ? 62   ALA A C   1 
ATOM 471   O O   . ALA A 1 65   ? 4.884   15.770  81.050  1.00 51.08  ? 62   ALA A O   1 
ATOM 472   C CB  . ALA A 1 65   ? 4.331   18.369  79.291  1.00 50.55  ? 62   ALA A CB  1 
ATOM 473   N N   . VAL A 1 66   ? 3.811   15.174  79.165  1.00 51.32  ? 63   VAL A N   1 
ATOM 474   C CA  . VAL A 1 66   ? 3.337   13.919  79.691  1.00 51.94  ? 63   VAL A CA  1 
ATOM 475   C C   . VAL A 1 66   ? 3.694   12.874  78.647  1.00 52.34  ? 63   VAL A C   1 
ATOM 476   O O   . VAL A 1 66   ? 3.551   13.112  77.445  1.00 52.27  ? 63   VAL A O   1 
ATOM 477   C CB  . VAL A 1 66   ? 1.805   13.936  79.954  1.00 52.06  ? 63   VAL A CB  1 
ATOM 478   C CG1 . VAL A 1 66   ? 1.349   12.662  80.673  1.00 51.66  ? 63   VAL A CG1 1 
ATOM 479   C CG2 . VAL A 1 66   ? 1.412   15.155  80.765  1.00 52.12  ? 63   VAL A CG2 1 
ATOM 480   N N   . MET A 1 67   ? 4.189   11.733  79.116  1.00 52.95  ? 64   MET A N   1 
ATOM 481   C CA  . MET A 1 67   ? 4.456   10.581  78.262  1.00 53.31  ? 64   MET A CA  1 
ATOM 482   C C   . MET A 1 67   ? 4.259   9.296   79.072  1.00 54.13  ? 64   MET A C   1 
ATOM 483   O O   . MET A 1 67   ? 5.055   8.978   79.956  1.00 54.28  ? 64   MET A O   1 
ATOM 484   C CB  . MET A 1 67   ? 5.869   10.667  77.680  1.00 53.16  ? 64   MET A CB  1 
ATOM 485   C CG  . MET A 1 67   ? 6.266   9.481   76.834  1.00 52.86  ? 64   MET A CG  1 
ATOM 486   S SD  . MET A 1 67   ? 7.933   9.635   76.213  1.00 52.25  ? 64   MET A SD  1 
ATOM 487   C CE  . MET A 1 67   ? 8.802   9.611   77.766  1.00 53.32  ? 64   MET A CE  1 
ATOM 488   N N   . GLU A 1 68   ? 3.183   8.572   78.790  1.00 54.85  ? 65   GLU A N   1 
ATOM 489   C CA  . GLU A 1 68   ? 2.897   7.356   79.530  1.00 55.88  ? 65   GLU A CA  1 
ATOM 490   C C   . GLU A 1 68   ? 2.620   6.215   78.576  1.00 56.38  ? 65   GLU A C   1 
ATOM 491   O O   . GLU A 1 68   ? 2.022   6.422   77.514  1.00 56.53  ? 65   GLU A O   1 
ATOM 492   C CB  . GLU A 1 68   ? 1.693   7.548   80.456  1.00 55.93  ? 65   GLU A CB  1 
ATOM 493   C CG  . GLU A 1 68   ? 1.757   8.757   81.392  1.00 57.52  ? 65   GLU A CG  1 
ATOM 494   C CD  . GLU A 1 68   ? 2.729   8.588   82.559  1.00 59.55  ? 65   GLU A CD  1 
ATOM 495   O OE1 . GLU A 1 68   ? 2.335   8.884   83.716  1.00 59.84  ? 65   GLU A OE1 1 
ATOM 496   O OE2 . GLU A 1 68   ? 3.886   8.167   82.322  1.00 60.68  ? 65   GLU A OE2 1 
ATOM 497   N N   . LEU A 1 69   ? 3.064   5.014   78.951  1.00 56.96  ? 66   LEU A N   1 
ATOM 498   C CA  . LEU A 1 69   ? 2.637   3.791   78.271  1.00 57.41  ? 66   LEU A CA  1 
ATOM 499   C C   . LEU A 1 69   ? 1.502   3.143   79.051  1.00 57.71  ? 66   LEU A C   1 
ATOM 500   O O   . LEU A 1 69   ? 1.474   3.204   80.286  1.00 57.84  ? 66   LEU A O   1 
ATOM 501   C CB  . LEU A 1 69   ? 3.792   2.805   78.086  1.00 57.36  ? 66   LEU A CB  1 
ATOM 502   C CG  . LEU A 1 69   ? 4.799   3.050   76.958  1.00 57.45  ? 66   LEU A CG  1 
ATOM 503   C CD1 . LEU A 1 69   ? 5.837   1.950   76.974  1.00 57.51  ? 66   LEU A CD1 1 
ATOM 504   C CD2 . LEU A 1 69   ? 4.143   3.124   75.583  1.00 57.36  ? 66   LEU A CD2 1 
ATOM 505   N N   . PHE A 1 70   ? 0.562   2.547   78.320  1.00 58.00  ? 67   PHE A N   1 
ATOM 506   C CA  . PHE A 1 70   ? -0.612  1.904   78.902  1.00 58.43  ? 67   PHE A CA  1 
ATOM 507   C C   . PHE A 1 70   ? -1.139  0.863   77.940  1.00 58.54  ? 67   PHE A C   1 
ATOM 508   O O   . PHE A 1 70   ? -0.950  0.974   76.726  1.00 58.46  ? 67   PHE A O   1 
ATOM 509   C CB  . PHE A 1 70   ? -1.706  2.929   79.209  1.00 58.59  ? 67   PHE A CB  1 
ATOM 510   C CG  . PHE A 1 70   ? -2.341  3.526   77.986  1.00 59.32  ? 67   PHE A CG  1 
ATOM 511   C CD1 . PHE A 1 70   ? -3.599  3.098   77.562  1.00 60.05  ? 67   PHE A CD1 1 
ATOM 512   C CD2 . PHE A 1 70   ? -1.681  4.514   77.245  1.00 59.64  ? 67   PHE A CD2 1 
ATOM 513   C CE1 . PHE A 1 70   ? -4.195  3.649   76.416  1.00 60.10  ? 67   PHE A CE1 1 
ATOM 514   C CE2 . PHE A 1 70   ? -2.267  5.071   76.101  1.00 59.50  ? 67   PHE A CE2 1 
ATOM 515   C CZ  . PHE A 1 70   ? -3.526  4.640   75.687  1.00 59.47  ? 67   PHE A CZ  1 
ATOM 516   N N   . ARG A 1 71   ? -1.801  -0.149  78.488  1.00 58.89  ? 68   ARG A N   1 
ATOM 517   C CA  . ARG A 1 71   ? -2.343  -1.242  77.689  1.00 59.21  ? 68   ARG A CA  1 
ATOM 518   C C   . ARG A 1 71   ? -3.666  -1.680  78.282  1.00 59.12  ? 68   ARG A C   1 
ATOM 519   O O   . ARG A 1 71   ? -3.698  -2.308  79.335  1.00 59.05  ? 68   ARG A O   1 
ATOM 520   C CB  . ARG A 1 71   ? -1.354  -2.414  77.594  1.00 59.23  ? 68   ARG A CB  1 
ATOM 521   C CG  . ARG A 1 71   ? -1.918  -3.638  76.903  1.00 60.33  ? 68   ARG A CG  1 
ATOM 522   C CD  . ARG A 1 71   ? -0.840  -4.491  76.262  1.00 62.67  ? 68   ARG A CD  1 
ATOM 523   N NE  . ARG A 1 71   ? 0.032   -5.153  77.231  1.00 64.75  ? 68   ARG A NE  1 
ATOM 524   C CZ  . ARG A 1 71   ? 0.946   -6.077  76.927  1.00 65.82  ? 68   ARG A CZ  1 
ATOM 525   N NH1 . ARG A 1 71   ? 1.134   -6.476  75.670  1.00 65.56  ? 68   ARG A NH1 1 
ATOM 526   N NH2 . ARG A 1 71   ? 1.683   -6.609  77.894  1.00 66.91  ? 68   ARG A NH2 1 
ATOM 527   N N   . PRO A 1 72   ? -4.771  -1.339  77.610  1.00 59.33  ? 69   PRO A N   1 
ATOM 528   C CA  . PRO A 1 72   ? -6.051  -1.695  78.178  1.00 59.62  ? 69   PRO A CA  1 
ATOM 529   C C   . PRO A 1 72   ? -6.365  -3.165  77.920  1.00 59.96  ? 69   PRO A C   1 
ATOM 530   O O   . PRO A 1 72   ? -5.582  -3.871  77.272  1.00 60.03  ? 69   PRO A O   1 
ATOM 531   C CB  . PRO A 1 72   ? -7.024  -0.789  77.418  1.00 59.52  ? 69   PRO A CB  1 
ATOM 532   C CG  . PRO A 1 72   ? -6.400  -0.623  76.090  1.00 59.29  ? 69   PRO A CG  1 
ATOM 533   C CD  . PRO A 1 72   ? -4.914  -0.637  76.321  1.00 59.31  ? 69   PRO A CD  1 
ATOM 534   N N   . LYS A 1 73   ? -7.498  -3.614  78.450  1.00 60.22  ? 70   LYS A N   1 
ATOM 535   C CA  . LYS A 1 73   ? -8.073  -4.894  78.082  1.00 60.42  ? 70   LYS A CA  1 
ATOM 536   C C   . LYS A 1 73   ? -8.363  -4.862  76.577  1.00 60.36  ? 70   LYS A C   1 
ATOM 537   O O   . LYS A 1 73   ? -8.586  -3.786  76.007  1.00 60.15  ? 70   LYS A O   1 
ATOM 538   C CB  . LYS A 1 73   ? -9.365  -5.138  78.873  1.00 60.61  ? 70   LYS A CB  1 
ATOM 539   C CG  . LYS A 1 73   ? -9.342  -4.685  80.345  1.00 61.12  ? 70   LYS A CG  1 
ATOM 540   C CD  . LYS A 1 73   ? -8.779  -5.751  81.286  1.00 62.36  ? 70   LYS A CD  1 
ATOM 541   C CE  . LYS A 1 73   ? -9.316  -5.592  82.717  1.00 62.98  ? 70   LYS A CE  1 
ATOM 542   N NZ  . LYS A 1 73   ? -8.883  -4.317  83.368  1.00 63.61  ? 70   LYS A NZ  1 
ATOM 543   N N   . GLY A 1 74   ? -8.329  -6.033  75.938  1.00 60.40  ? 71   GLY A N   1 
ATOM 544   C CA  . GLY A 1 74   ? -8.623  -6.164  74.502  1.00 60.31  ? 71   GLY A CA  1 
ATOM 545   C C   . GLY A 1 74   ? -7.618  -5.521  73.551  1.00 60.16  ? 71   GLY A C   1 
ATOM 546   O O   . GLY A 1 74   ? -7.917  -5.316  72.370  1.00 60.18  ? 71   GLY A O   1 
ATOM 547   N N   . GLU A 1 75   ? -6.436  -5.196  74.073  1.00 59.90  ? 72   GLU A N   1 
ATOM 548   C CA  . GLU A 1 75   ? -5.319  -4.682  73.279  1.00 59.57  ? 72   GLU A CA  1 
ATOM 549   C C   . GLU A 1 75   ? -4.123  -5.640  73.304  1.00 59.09  ? 72   GLU A C   1 
ATOM 550   O O   . GLU A 1 75   ? -3.847  -6.275  74.331  1.00 59.03  ? 72   GLU A O   1 
ATOM 551   C CB  . GLU A 1 75   ? -4.894  -3.302  73.790  1.00 59.73  ? 72   GLU A CB  1 
ATOM 552   C CG  . GLU A 1 75   ? -5.303  -2.145  72.893  1.00 60.54  ? 72   GLU A CG  1 
ATOM 553   C CD  . GLU A 1 75   ? -4.600  -2.166  71.537  1.00 61.43  ? 72   GLU A CD  1 
ATOM 554   O OE1 . GLU A 1 75   ? -5.292  -2.007  70.504  1.00 61.57  ? 72   GLU A OE1 1 
ATOM 555   O OE2 . GLU A 1 75   ? -3.362  -2.350  71.503  1.00 61.41  ? 72   GLU A OE2 1 
ATOM 556   N N   . SER A 1 76   ? -3.413  -5.731  72.180  1.00 58.46  ? 73   SER A N   1 
ATOM 557   C CA  . SER A 1 76   ? -2.258  -6.629  72.071  1.00 57.97  ? 73   SER A CA  1 
ATOM 558   C C   . SER A 1 76   ? -1.015  -6.124  72.826  1.00 57.62  ? 73   SER A C   1 
ATOM 559   O O   . SER A 1 76   ? -0.630  -6.703  73.842  1.00 57.70  ? 73   SER A O   1 
ATOM 560   C CB  . SER A 1 76   ? -1.935  -6.953  70.600  1.00 57.99  ? 73   SER A CB  1 
ATOM 561   O OG  . SER A 1 76   ? -1.743  -5.783  69.822  1.00 57.72  ? 73   SER A OG  1 
ATOM 562   N N   . LYS A 1 77   ? -0.396  -5.058  72.322  1.00 57.07  ? 74   LYS A N   1 
ATOM 563   C CA  . LYS A 1 77   ? 0.796   -4.459  72.935  1.00 56.46  ? 74   LYS A CA  1 
ATOM 564   C C   . LYS A 1 77   ? 0.448   -3.086  73.515  1.00 56.24  ? 74   LYS A C   1 
ATOM 565   O O   . LYS A 1 77   ? -0.656  -2.578  73.288  1.00 56.44  ? 74   LYS A O   1 
ATOM 566   C CB  . LYS A 1 77   ? 1.935   -4.344  71.911  1.00 56.35  ? 74   LYS A CB  1 
ATOM 567   C CG  . LYS A 1 77   ? 1.640   -3.409  70.734  1.00 56.00  ? 74   LYS A CG  1 
ATOM 568   C CD  . LYS A 1 77   ? 2.237   -3.938  69.437  1.00 55.50  ? 74   LYS A CD  1 
ATOM 569   C CE  . LYS A 1 77   ? 1.946   -3.020  68.249  1.00 55.26  ? 74   LYS A CE  1 
ATOM 570   N NZ  . LYS A 1 77   ? 0.519   -2.954  67.833  1.00 54.25  ? 74   LYS A NZ  1 
ATOM 571   N N   . ASP A 1 78   ? 1.381   -2.497  74.265  1.00 55.62  ? 75   ASP A N   1 
ATOM 572   C CA  . ASP A 1 78   ? 1.173   -1.190  74.891  1.00 54.75  ? 75   ASP A CA  1 
ATOM 573   C C   . ASP A 1 78   ? 1.064   -0.074  73.850  1.00 53.99  ? 75   ASP A C   1 
ATOM 574   O O   . ASP A 1 78   ? 1.707   -0.124  72.795  1.00 53.66  ? 75   ASP A O   1 
ATOM 575   C CB  . ASP A 1 78   ? 2.297   -0.885  75.892  1.00 55.01  ? 75   ASP A CB  1 
ATOM 576   C CG  . ASP A 1 78   ? 2.245   -1.772  77.141  1.00 55.40  ? 75   ASP A CG  1 
ATOM 577   O OD1 . ASP A 1 78   ? 2.476   -1.239  78.253  1.00 56.33  ? 75   ASP A OD1 1 
ATOM 578   O OD2 . ASP A 1 78   ? 1.982   -2.991  77.023  1.00 54.98  ? 75   ASP A OD2 1 
ATOM 579   N N   . LEU A 1 79   ? 0.223   0.913   74.153  1.00 53.28  ? 76   LEU A N   1 
ATOM 580   C CA  . LEU A 1 79   ? 0.060   2.110   73.322  1.00 52.80  ? 76   LEU A CA  1 
ATOM 581   C C   . LEU A 1 79   ? 0.686   3.301   74.046  1.00 52.46  ? 76   LEU A C   1 
ATOM 582   O O   . LEU A 1 79   ? 0.878   3.257   75.254  1.00 52.63  ? 76   LEU A O   1 
ATOM 583   C CB  . LEU A 1 79   ? -1.428  2.392   73.041  1.00 52.77  ? 76   LEU A CB  1 
ATOM 584   C CG  . LEU A 1 79   ? -2.388  1.302   72.529  1.00 52.32  ? 76   LEU A CG  1 
ATOM 585   C CD1 . LEU A 1 79   ? -3.833  1.788   72.541  1.00 51.53  ? 76   LEU A CD1 1 
ATOM 586   C CD2 . LEU A 1 79   ? -2.010  0.820   71.141  1.00 51.78  ? 76   LEU A CD2 1 
ATOM 587   N N   . LEU A 1 80   ? 1.000   4.366   73.323  1.00 52.03  ? 77   LEU A N   1 
ATOM 588   C CA  . LEU A 1 80   ? 1.623   5.520   73.956  1.00 51.82  ? 77   LEU A CA  1 
ATOM 589   C C   . LEU A 1 80   ? 0.666   6.695   74.066  1.00 51.62  ? 77   LEU A C   1 
ATOM 590   O O   . LEU A 1 80   ? -0.114  6.951   73.156  1.00 51.73  ? 77   LEU A O   1 
ATOM 591   C CB  . LEU A 1 80   ? 2.883   5.936   73.192  1.00 52.05  ? 77   LEU A CB  1 
ATOM 592   C CG  . LEU A 1 80   ? 3.721   7.116   73.703  1.00 52.22  ? 77   LEU A CG  1 
ATOM 593   C CD1 . LEU A 1 80   ? 4.255   6.835   75.105  1.00 53.29  ? 77   LEU A CD1 1 
ATOM 594   C CD2 . LEU A 1 80   ? 4.868   7.443   72.752  1.00 51.79  ? 77   LEU A CD2 1 
ATOM 595   N N   . PHE A 1 81   ? 0.735   7.406   75.186  1.00 51.29  ? 78   PHE A N   1 
ATOM 596   C CA  . PHE A 1 81   ? -0.068  8.603   75.391  1.00 51.06  ? 78   PHE A CA  1 
ATOM 597   C C   . PHE A 1 81   ? 0.834   9.821   75.601  1.00 50.83  ? 78   PHE A C   1 
ATOM 598   O O   . PHE A 1 81   ? 1.638   9.846   76.531  1.00 51.00  ? 78   PHE A O   1 
ATOM 599   C CB  . PHE A 1 81   ? -1.024  8.405   76.575  1.00 51.25  ? 78   PHE A CB  1 
ATOM 600   C CG  . PHE A 1 81   ? -1.647  9.675   77.068  1.00 51.55  ? 78   PHE A CG  1 
ATOM 601   C CD1 . PHE A 1 81   ? -2.626  10.319  76.323  1.00 51.86  ? 78   PHE A CD1 1 
ATOM 602   C CD2 . PHE A 1 81   ? -1.246  10.234  78.274  1.00 52.47  ? 78   PHE A CD2 1 
ATOM 603   C CE1 . PHE A 1 81   ? -3.192  11.501  76.764  1.00 52.49  ? 78   PHE A CE1 1 
ATOM 604   C CE2 . PHE A 1 81   ? -1.809  11.421  78.732  1.00 52.96  ? 78   PHE A CE2 1 
ATOM 605   C CZ  . PHE A 1 81   ? -2.787  12.056  77.977  1.00 52.60  ? 78   PHE A CZ  1 
ATOM 606   N N   . ILE A 1 82   ? 0.693   10.824  74.736  1.00 50.40  ? 79   ILE A N   1 
ATOM 607   C CA  . ILE A 1 82   ? 1.523   12.031  74.788  1.00 50.02  ? 79   ILE A CA  1 
ATOM 608   C C   . ILE A 1 82   ? 0.677   13.280  74.961  1.00 49.91  ? 79   ILE A C   1 
ATOM 609   O O   . ILE A 1 82   ? -0.394  13.391  74.352  1.00 50.10  ? 79   ILE A O   1 
ATOM 610   C CB  . ILE A 1 82   ? 2.362   12.197  73.502  1.00 49.95  ? 79   ILE A CB  1 
ATOM 611   C CG1 . ILE A 1 82   ? 3.204   10.951  73.252  1.00 50.29  ? 79   ILE A CG1 1 
ATOM 612   C CG2 . ILE A 1 82   ? 3.266   13.427  73.579  1.00 49.38  ? 79   ILE A CG2 1 
ATOM 613   C CD1 . ILE A 1 82   ? 4.302   10.755  74.257  1.00 51.11  ? 79   ILE A CD1 1 
ATOM 614   N N   . LEU A 1 83   ? 1.169   14.216  75.776  1.00 49.49  ? 80   LEU A N   1 
ATOM 615   C CA  . LEU A 1 83   ? 0.524   15.519  75.949  1.00 49.11  ? 80   LEU A CA  1 
ATOM 616   C C   . LEU A 1 83   ? 1.467   16.721  75.800  1.00 49.25  ? 80   LEU A C   1 
ATOM 617   O O   . LEU A 1 83   ? 2.272   17.014  76.688  1.00 49.70  ? 80   LEU A O   1 
ATOM 618   C CB  . LEU A 1 83   ? -0.217  15.583  77.284  1.00 48.78  ? 80   LEU A CB  1 
ATOM 619   C CG  . LEU A 1 83   ? -0.787  16.940  77.693  1.00 47.99  ? 80   LEU A CG  1 
ATOM 620   C CD1 . LEU A 1 83   ? -1.878  17.421  76.758  1.00 46.11  ? 80   LEU A CD1 1 
ATOM 621   C CD2 . LEU A 1 83   ? -1.296  16.846  79.108  1.00 48.25  ? 80   LEU A CD2 1 
ATOM 622   N N   . THR A 1 84   ? 1.336   17.422  74.681  1.00 49.04  ? 81   THR A N   1 
ATOM 623   C CA  . THR A 1 84   ? 2.079   18.645  74.414  1.00 49.09  ? 81   THR A CA  1 
ATOM 624   C C   . THR A 1 84   ? 1.828   19.737  75.455  1.00 49.18  ? 81   THR A C   1 
ATOM 625   O O   . THR A 1 84   ? 0.720   19.873  75.962  1.00 49.52  ? 81   THR A O   1 
ATOM 626   C CB  . THR A 1 84   ? 1.671   19.178  73.043  1.00 49.20  ? 81   THR A CB  1 
ATOM 627   O OG1 . THR A 1 84   ? 1.896   18.155  72.067  1.00 49.44  ? 81   THR A OG1 1 
ATOM 628   C CG2 . THR A 1 84   ? 2.430   20.462  72.656  1.00 49.48  ? 81   THR A CG2 1 
ATOM 629   N N   . ALA A 1 85   ? 2.867   20.516  75.751  1.00 49.18  ? 82   ALA A N   1 
ATOM 630   C CA  . ALA A 1 85   ? 2.789   21.690  76.631  1.00 49.03  ? 82   ALA A CA  1 
ATOM 631   C C   . ALA A 1 85   ? 1.761   22.741  76.197  1.00 49.06  ? 82   ALA A C   1 
ATOM 632   O O   . ALA A 1 85   ? 1.341   23.567  77.011  1.00 49.03  ? 82   ALA A O   1 
ATOM 633   C CB  . ALA A 1 85   ? 4.156   22.328  76.754  1.00 49.02  ? 82   ALA A CB  1 
ATOM 634   N N   . LYS A 1 86   ? 1.383   22.721  74.917  1.00 49.15  ? 83   LYS A N   1 
ATOM 635   C CA  . LYS A 1 86   ? 0.275   23.542  74.405  1.00 49.21  ? 83   LYS A CA  1 
ATOM 636   C C   . LYS A 1 86   ? -1.048  22.789  74.511  1.00 49.20  ? 83   LYS A C   1 
ATOM 637   O O   . LYS A 1 86   ? -1.990  23.045  73.751  1.00 49.06  ? 83   LYS A O   1 
ATOM 638   C CB  . LYS A 1 86   ? 0.523   23.976  72.955  1.00 49.30  ? 83   LYS A CB  1 
ATOM 639   C CG  . LYS A 1 86   ? 1.349   25.246  72.813  1.00 49.00  ? 83   LYS A CG  1 
ATOM 640   C CD  . LYS A 1 86   ? 1.516   25.630  71.358  1.00 48.41  ? 83   LYS A CD  1 
ATOM 641   C CE  . LYS A 1 86   ? 2.220   26.962  71.228  1.00 48.43  ? 83   LYS A CE  1 
ATOM 642   N NZ  . LYS A 1 86   ? 2.070   27.527  69.855  1.00 49.40  ? 83   LYS A NZ  1 
ATOM 643   N N   . TYR A 1 87   ? -1.084  21.854  75.459  1.00 49.21  ? 84   TYR A N   1 
ATOM 644   C CA  . TYR A 1 87   ? -2.260  21.074  75.799  1.00 49.42  ? 84   TYR A CA  1 
ATOM 645   C C   . TYR A 1 87   ? -2.775  20.238  74.619  1.00 49.83  ? 84   TYR A C   1 
ATOM 646   O O   . TYR A 1 87   ? -3.968  20.253  74.295  1.00 49.92  ? 84   TYR A O   1 
ATOM 647   C CB  . TYR A 1 87   ? -3.321  21.976  76.445  1.00 49.37  ? 84   TYR A CB  1 
ATOM 648   C CG  . TYR A 1 87   ? -2.807  22.627  77.713  1.00 49.50  ? 84   TYR A CG  1 
ATOM 649   C CD1 . TYR A 1 87   ? -2.204  23.888  77.685  1.00 50.18  ? 84   TYR A CD1 1 
ATOM 650   C CD2 . TYR A 1 87   ? -2.882  21.965  78.940  1.00 49.70  ? 84   TYR A CD2 1 
ATOM 651   C CE1 . TYR A 1 87   ? -1.700  24.485  78.865  1.00 50.40  ? 84   TYR A CE1 1 
ATOM 652   C CE2 . TYR A 1 87   ? -2.383  22.545  80.120  1.00 49.80  ? 84   TYR A CE2 1 
ATOM 653   C CZ  . TYR A 1 87   ? -1.795  23.802  80.078  1.00 50.07  ? 84   TYR A CZ  1 
ATOM 654   O OH  . TYR A 1 87   ? -1.304  24.361  81.244  1.00 49.61  ? 84   TYR A OH  1 
ATOM 655   N N   . ASN A 1 88   ? -1.845  19.506  73.993  1.00 50.28  ? 85   ASN A N   1 
ATOM 656   C CA  . ASN A 1 88   ? -2.130  18.534  72.913  1.00 50.62  ? 85   ASN A CA  1 
ATOM 657   C C   . ASN A 1 88   ? -2.150  17.072  73.379  1.00 50.96  ? 85   ASN A C   1 
ATOM 658   O O   . ASN A 1 88   ? -1.093  16.449  73.502  1.00 51.24  ? 85   ASN A O   1 
ATOM 659   C CB  . ASN A 1 88   ? -1.069  18.627  71.811  1.00 50.33  ? 85   ASN A CB  1 
ATOM 660   C CG  . ASN A 1 88   ? -1.402  19.629  70.753  1.00 50.12  ? 85   ASN A CG  1 
ATOM 661   O OD1 . ASN A 1 88   ? -0.702  20.630  70.589  1.00 49.86  ? 85   ASN A OD1 1 
ATOM 662   N ND2 . ASN A 1 88   ? -2.462  19.362  70.002  1.00 50.18  ? 85   ASN A ND2 1 
ATOM 663   N N   . ALA A 1 89   ? -3.328  16.515  73.619  1.00 51.14  ? 86   ALA A N   1 
ATOM 664   C CA  . ALA A 1 89   ? -3.412  15.103  73.943  1.00 51.72  ? 86   ALA A CA  1 
ATOM 665   C C   . ALA A 1 89   ? -3.340  14.295  72.658  1.00 52.31  ? 86   ALA A C   1 
ATOM 666   O O   . ALA A 1 89   ? -3.663  14.817  71.590  1.00 52.59  ? 86   ALA A O   1 
ATOM 667   C CB  . ALA A 1 89   ? -4.692  14.815  74.676  1.00 51.85  ? 86   ALA A CB  1 
ATOM 668   N N   . CYS A 1 90   ? -2.903  13.039  72.757  1.00 52.92  ? 87   CYS A N   1 
ATOM 669   C CA  . CYS A 1 90   ? -2.925  12.100  71.628  1.00 53.87  ? 87   CYS A CA  1 
ATOM 670   C C   . CYS A 1 90   ? -2.448  10.727  72.055  1.00 54.25  ? 87   CYS A C   1 
ATOM 671   O O   . CYS A 1 90   ? -1.575  10.608  72.908  1.00 54.55  ? 87   CYS A O   1 
ATOM 672   C CB  . CYS A 1 90   ? -2.066  12.591  70.456  1.00 53.95  ? 87   CYS A CB  1 
ATOM 673   S SG  . CYS A 1 90   ? -0.265  12.488  70.699  1.00 56.07  ? 87   CYS A SG  1 
ATOM 674   N N   . ILE A 1 91   ? -3.020  9.695   71.443  1.00 54.91  ? 88   ILE A N   1 
ATOM 675   C CA  . ILE A 1 91   ? -2.674  8.298   71.731  1.00 55.39  ? 88   ILE A CA  1 
ATOM 676   C C   . ILE A 1 91   ? -1.931  7.684   70.539  1.00 56.12  ? 88   ILE A C   1 
ATOM 677   O O   . ILE A 1 91   ? -2.435  7.686   69.406  1.00 56.47  ? 88   ILE A O   1 
ATOM 678   C CB  . ILE A 1 91   ? -3.935  7.459   72.091  1.00 55.06  ? 88   ILE A CB  1 
ATOM 679   C CG1 . ILE A 1 91   ? -4.443  7.857   73.475  1.00 54.70  ? 88   ILE A CG1 1 
ATOM 680   C CG2 . ILE A 1 91   ? -3.635  5.967   72.045  1.00 54.84  ? 88   ILE A CG2 1 
ATOM 681   C CD1 . ILE A 1 91   ? -5.866  7.478   73.757  1.00 54.55  ? 88   ILE A CD1 1 
ATOM 682   N N   . LEU A 1 92   ? -0.738  7.159   70.797  1.00 56.62  ? 89   LEU A N   1 
ATOM 683   C CA  . LEU A 1 92   ? 0.102   6.633   69.737  1.00 57.16  ? 89   LEU A CA  1 
ATOM 684   C C   . LEU A 1 92   ? 0.175   5.107   69.765  1.00 57.78  ? 89   LEU A C   1 
ATOM 685   O O   . LEU A 1 92   ? -0.181  4.477   70.768  1.00 57.74  ? 89   LEU A O   1 
ATOM 686   C CB  . LEU A 1 92   ? 1.499   7.260   69.804  1.00 57.12  ? 89   LEU A CB  1 
ATOM 687   C CG  . LEU A 1 92   ? 1.641   8.787   69.932  1.00 57.12  ? 89   LEU A CG  1 
ATOM 688   C CD1 . LEU A 1 92   ? 3.106   9.191   69.879  1.00 56.94  ? 89   LEU A CD1 1 
ATOM 689   C CD2 . LEU A 1 92   ? 0.861   9.540   68.865  1.00 57.49  ? 89   LEU A CD2 1 
ATOM 690   N N   . GLU A 1 93   ? 0.617   4.533   68.641  1.00 58.64  ? 90   GLU A N   1 
ATOM 691   C CA  . GLU A 1 93   ? 0.791   3.081   68.458  1.00 59.32  ? 90   GLU A CA  1 
ATOM 692   C C   . GLU A 1 93   ? 1.866   2.777   67.409  1.00 59.55  ? 90   GLU A C   1 
ATOM 693   O O   . GLU A 1 93   ? 1.947   3.444   66.375  1.00 59.31  ? 90   GLU A O   1 
ATOM 694   C CB  . GLU A 1 93   ? -0.523  2.416   68.042  1.00 59.35  ? 90   GLU A CB  1 
ATOM 695   C CG  . GLU A 1 93   ? -0.437  0.898   67.959  1.00 60.21  ? 90   GLU A CG  1 
ATOM 696   C CD  . GLU A 1 93   ? -1.494  0.281   67.063  1.00 61.29  ? 90   GLU A CD  1 
ATOM 697   O OE1 . GLU A 1 93   ? -2.674  0.701   67.130  1.00 61.52  ? 90   GLU A OE1 1 
ATOM 698   O OE2 . GLU A 1 93   ? -1.135  -0.642  66.296  1.00 61.65  ? 90   GLU A OE2 1 
ATOM 699   N N   . TYR A 1 94   ? 2.680   1.760   67.682  1.00 60.13  ? 91   TYR A N   1 
ATOM 700   C CA  . TYR A 1 94   ? 3.762   1.373   66.781  1.00 60.76  ? 91   TYR A CA  1 
ATOM 701   C C   . TYR A 1 94   ? 3.322   0.241   65.865  1.00 61.13  ? 91   TYR A C   1 
ATOM 702   O O   . TYR A 1 94   ? 2.786   -0.772  66.321  1.00 61.13  ? 91   TYR A O   1 
ATOM 703   C CB  . TYR A 1 94   ? 5.008   0.986   67.573  1.00 60.85  ? 91   TYR A CB  1 
ATOM 704   C CG  . TYR A 1 94   ? 6.219   0.656   66.729  1.00 60.99  ? 91   TYR A CG  1 
ATOM 705   C CD1 . TYR A 1 94   ? 6.999   1.665   66.157  1.00 60.96  ? 91   TYR A CD1 1 
ATOM 706   C CD2 . TYR A 1 94   ? 6.599   -0.667  66.525  1.00 60.99  ? 91   TYR A CD2 1 
ATOM 707   C CE1 . TYR A 1 94   ? 8.122   1.355   65.388  1.00 60.74  ? 91   TYR A CE1 1 
ATOM 708   C CE2 . TYR A 1 94   ? 7.716   -0.985  65.767  1.00 61.08  ? 91   TYR A CE2 1 
ATOM 709   C CZ  . TYR A 1 94   ? 8.471   0.025   65.201  1.00 60.88  ? 91   TYR A CZ  1 
ATOM 710   O OH  . TYR A 1 94   ? 9.570   -0.318  64.449  1.00 61.00  ? 91   TYR A OH  1 
ATOM 711   N N   . LYS A 1 95   ? 3.559   0.428   64.570  1.00 61.55  ? 92   LYS A N   1 
ATOM 712   C CA  . LYS A 1 95   ? 2.947   -0.403  63.552  1.00 62.05  ? 92   LYS A CA  1 
ATOM 713   C C   . LYS A 1 95   ? 3.940   -0.634  62.441  1.00 62.49  ? 92   LYS A C   1 
ATOM 714   O O   . LYS A 1 95   ? 4.318   0.298   61.732  1.00 62.63  ? 92   LYS A O   1 
ATOM 715   C CB  . LYS A 1 95   ? 1.701   0.295   63.008  1.00 62.00  ? 92   LYS A CB  1 
ATOM 716   C CG  . LYS A 1 95   ? 0.634   -0.628  62.440  1.00 62.19  ? 92   LYS A CG  1 
ATOM 717   C CD  . LYS A 1 95   ? -0.752  -0.006  62.636  1.00 62.39  ? 92   LYS A CD  1 
ATOM 718   C CE  . LYS A 1 95   ? -1.810  -0.625  61.726  1.00 62.39  ? 92   LYS A CE  1 
ATOM 719   N NZ  . LYS A 1 95   ? -1.767  -0.080  60.339  1.00 61.67  ? 92   LYS A NZ  1 
ATOM 720   N N   . GLN A 1 96   ? 4.370   -1.882  62.301  1.00 63.07  ? 93   GLN A N   1 
ATOM 721   C CA  . GLN A 1 96   ? 5.312   -2.252  61.260  1.00 63.72  ? 93   GLN A CA  1 
ATOM 722   C C   . GLN A 1 96   ? 4.611   -3.029  60.146  1.00 64.13  ? 93   GLN A C   1 
ATOM 723   O O   . GLN A 1 96   ? 3.791   -3.920  60.404  1.00 64.24  ? 93   GLN A O   1 
ATOM 724   C CB  . GLN A 1 96   ? 6.465   -3.060  61.852  1.00 63.68  ? 93   GLN A CB  1 
ATOM 725   C CG  . GLN A 1 96   ? 7.736   -3.031  61.015  1.00 64.64  ? 93   GLN A CG  1 
ATOM 726   C CD  . GLN A 1 96   ? 8.990   -3.415  61.805  1.00 65.92  ? 93   GLN A CD  1 
ATOM 727   O OE1 . GLN A 1 96   ? 9.115   -3.104  62.997  1.00 66.12  ? 93   GLN A OE1 1 
ATOM 728   N NE2 . GLN A 1 96   ? 9.934   -4.078  61.131  1.00 65.91  ? 93   GLN A NE2 1 
ATOM 729   N N   . SER A 1 97   ? 4.926   -2.669  58.904  1.00 64.52  ? 94   SER A N   1 
ATOM 730   C CA  . SER A 1 97   ? 4.429   -3.390  57.738  1.00 64.80  ? 94   SER A CA  1 
ATOM 731   C C   . SER A 1 97   ? 5.490   -4.358  57.224  1.00 65.06  ? 94   SER A C   1 
ATOM 732   O O   . SER A 1 97   ? 5.529   -4.680  56.034  1.00 65.13  ? 94   SER A O   1 
ATOM 733   C CB  . SER A 1 97   ? 4.009   -2.414  56.639  1.00 64.74  ? 94   SER A CB  1 
ATOM 734   O OG  . SER A 1 97   ? 2.828   -1.725  57.000  1.00 64.94  ? 94   SER A OG  1 
ATOM 735   N N   . GLY A 1 98   ? 6.345   -4.820  58.135  1.00 65.38  ? 95   GLY A N   1 
ATOM 736   C CA  . GLY A 1 98   ? 7.420   -5.754  57.807  1.00 65.72  ? 95   GLY A CA  1 
ATOM 737   C C   . GLY A 1 98   ? 8.790   -5.106  57.883  1.00 65.93  ? 95   GLY A C   1 
ATOM 738   O O   . GLY A 1 98   ? 9.627   -5.502  58.698  1.00 66.02  ? 95   GLY A O   1 
ATOM 739   N N   . GLU A 1 99   ? 9.011   -4.104  57.034  1.00 65.96  ? 96   GLU A N   1 
ATOM 740   C CA  . GLU A 1 99   ? 10.292  -3.403  56.952  1.00 66.04  ? 96   GLU A CA  1 
ATOM 741   C C   . GLU A 1 99   ? 10.109  -1.886  56.986  1.00 65.95  ? 96   GLU A C   1 
ATOM 742   O O   . GLU A 1 99   ? 11.068  -1.143  57.210  1.00 66.08  ? 96   GLU A O   1 
ATOM 743   C CB  . GLU A 1 99   ? 11.040  -3.808  55.680  1.00 66.11  ? 96   GLU A CB  1 
ATOM 744   C CG  . GLU A 1 99   ? 10.571  -3.105  54.396  1.00 66.99  ? 96   GLU A CG  1 
ATOM 745   C CD  . GLU A 1 99   ? 9.152   -3.483  53.966  1.00 67.69  ? 96   GLU A CD  1 
ATOM 746   O OE1 . GLU A 1 99   ? 8.999   -4.083  52.876  1.00 68.38  ? 96   GLU A OE1 1 
ATOM 747   O OE2 . GLU A 1 99   ? 8.194   -3.179  54.711  1.00 67.28  ? 96   GLU A OE2 1 
ATOM 748   N N   . SER A 1 100  ? 8.879   -1.434  56.742  1.00 65.70  ? 97   SER A N   1 
ATOM 749   C CA  . SER A 1 100  ? 8.544   -0.014  56.801  1.00 65.34  ? 97   SER A CA  1 
ATOM 750   C C   . SER A 1 100  ? 7.848   0.269   58.127  1.00 65.14  ? 97   SER A C   1 
ATOM 751   O O   . SER A 1 100  ? 6.753   -0.239  58.385  1.00 65.24  ? 97   SER A O   1 
ATOM 752   C CB  . SER A 1 100  ? 7.657   0.384   55.617  1.00 65.37  ? 97   SER A CB  1 
ATOM 753   O OG  . SER A 1 100  ? 8.263   0.044   54.376  1.00 65.24  ? 97   SER A OG  1 
ATOM 754   N N   . ILE A 1 101  ? 8.493   1.073   58.967  1.00 64.77  ? 98   ILE A N   1 
ATOM 755   C CA  . ILE A 1 101  ? 8.035   1.310   60.340  1.00 64.39  ? 98   ILE A CA  1 
ATOM 756   C C   . ILE A 1 101  ? 7.224   2.602   60.491  1.00 64.23  ? 98   ILE A C   1 
ATOM 757   O O   . ILE A 1 101  ? 7.603   3.651   59.958  1.00 64.22  ? 98   ILE A O   1 
ATOM 758   C CB  . ILE A 1 101  ? 9.215   1.270   61.356  1.00 64.42  ? 98   ILE A CB  1 
ATOM 759   C CG1 . ILE A 1 101  ? 10.265  2.371   61.081  1.00 64.68  ? 98   ILE A CG1 1 
ATOM 760   C CG2 . ILE A 1 101  ? 9.841   -0.116  61.394  1.00 64.11  ? 98   ILE A CG2 1 
ATOM 761   C CD1 . ILE A 1 101  ? 11.122  2.208   59.810  1.00 65.56  ? 98   ILE A CD1 1 
ATOM 762   N N   . ASP A 1 102  ? 6.110   2.516   61.220  1.00 63.98  ? 99   ASP A N   1 
ATOM 763   C CA  . ASP A 1 102  ? 5.150   3.627   61.337  1.00 63.71  ? 99   ASP A CA  1 
ATOM 764   C C   . ASP A 1 102  ? 4.604   3.811   62.750  1.00 63.41  ? 99   ASP A C   1 
ATOM 765   O O   . ASP A 1 102  ? 4.242   2.830   63.416  1.00 63.51  ? 99   ASP A O   1 
ATOM 766   C CB  . ASP A 1 102  ? 3.961   3.414   60.390  1.00 63.83  ? 99   ASP A CB  1 
ATOM 767   C CG  . ASP A 1 102  ? 4.312   3.656   58.937  1.00 63.92  ? 99   ASP A CG  1 
ATOM 768   O OD1 . ASP A 1 102  ? 4.753   4.782   58.618  1.00 64.56  ? 99   ASP A OD1 1 
ATOM 769   O OD2 . ASP A 1 102  ? 4.127   2.729   58.115  1.00 63.29  ? 99   ASP A OD2 1 
ATOM 770   N N   . ILE A 1 103  ? 4.531   5.071   63.184  1.00 62.81  ? 100  ILE A N   1 
ATOM 771   C CA  . ILE A 1 103  ? 3.899   5.445   64.452  1.00 62.08  ? 100  ILE A CA  1 
ATOM 772   C C   . ILE A 1 103  ? 2.579   6.133   64.133  1.00 61.82  ? 100  ILE A C   1 
ATOM 773   O O   . ILE A 1 103  ? 2.547   7.140   63.425  1.00 61.76  ? 100  ILE A O   1 
ATOM 774   C CB  . ILE A 1 103  ? 4.801   6.357   65.291  1.00 61.91  ? 100  ILE A CB  1 
ATOM 775   C CG1 . ILE A 1 103  ? 6.129   5.662   65.553  1.00 61.86  ? 100  ILE A CG1 1 
ATOM 776   C CG2 . ILE A 1 103  ? 4.149   6.685   66.616  1.00 61.82  ? 100  ILE A CG2 1 
ATOM 777   C CD1 . ILE A 1 103  ? 7.232   6.595   65.909  1.00 62.59  ? 100  ILE A CD1 1 
ATOM 778   N N   . ILE A 1 104  ? 1.495   5.575   64.660  1.00 61.51  ? 101  ILE A N   1 
ATOM 779   C CA  . ILE A 1 104  ? 0.138   5.951   64.255  1.00 61.07  ? 101  ILE A CA  1 
ATOM 780   C C   . ILE A 1 104  ? -0.549  6.843   65.307  1.00 60.64  ? 101  ILE A C   1 
ATOM 781   O O   . ILE A 1 104  ? -0.051  6.992   66.426  1.00 60.39  ? 101  ILE A O   1 
ATOM 782   C CB  . ILE A 1 104  ? -0.700  4.666   63.916  1.00 61.10  ? 101  ILE A CB  1 
ATOM 783   C CG1 . ILE A 1 104  ? -1.495  4.853   62.620  1.00 61.09  ? 101  ILE A CG1 1 
ATOM 784   C CG2 . ILE A 1 104  ? -1.565  4.207   65.113  1.00 60.90  ? 101  ILE A CG2 1 
ATOM 785   C CD1 . ILE A 1 104  ? -2.111  3.568   62.068  1.00 61.18  ? 101  ILE A CD1 1 
ATOM 786   N N   . THR A 1 105  ? -1.678  7.440   64.938  1.00 60.24  ? 102  THR A N   1 
ATOM 787   C CA  . THR A 1 105  ? -2.442  8.277   65.861  1.00 59.90  ? 102  THR A CA  1 
ATOM 788   C C   . THR A 1 105  ? -3.831  7.672   66.112  1.00 59.65  ? 102  THR A C   1 
ATOM 789   O O   . THR A 1 105  ? -4.758  7.844   65.305  1.00 59.54  ? 102  THR A O   1 
ATOM 790   C CB  . THR A 1 105  ? -2.574  9.728   65.340  1.00 59.98  ? 102  THR A CB  1 
ATOM 791   O OG1 . THR A 1 105  ? -1.519  10.017  64.411  1.00 59.78  ? 102  THR A OG1 1 
ATOM 792   C CG2 . THR A 1 105  ? -2.522  10.713  66.495  1.00 60.02  ? 102  THR A CG2 1 
ATOM 793   N N   . ARG A 1 106  ? -3.959  6.961   67.232  1.00 59.24  ? 103  ARG A N   1 
ATOM 794   C CA  . ARG A 1 106  ? -5.177  6.214   67.563  1.00 58.94  ? 103  ARG A CA  1 
ATOM 795   C C   . ARG A 1 106  ? -6.295  7.105   68.100  1.00 58.61  ? 103  ARG A C   1 
ATOM 796   O O   . ARG A 1 106  ? -7.484  6.792   67.944  1.00 58.43  ? 103  ARG A O   1 
ATOM 797   C CB  . ARG A 1 106  ? -4.864  5.088   68.556  1.00 58.99  ? 103  ARG A CB  1 
ATOM 798   C CG  . ARG A 1 106  ? -4.297  3.823   67.911  1.00 59.33  ? 103  ARG A CG  1 
ATOM 799   C CD  . ARG A 1 106  ? -5.410  2.906   67.417  1.00 60.31  ? 103  ARG A CD  1 
ATOM 800   N NE  . ARG A 1 106  ? -5.639  1.717   68.248  1.00 61.67  ? 103  ARG A NE  1 
ATOM 801   C CZ  . ARG A 1 106  ? -6.208  1.707   69.457  1.00 63.00  ? 103  ARG A CZ  1 
ATOM 802   N NH1 . ARG A 1 106  ? -6.600  2.837   70.043  1.00 63.80  ? 103  ARG A NH1 1 
ATOM 803   N NH2 . ARG A 1 106  ? -6.370  0.551   70.099  1.00 62.94  ? 103  ARG A NH2 1 
ATOM 804   N N   . ALA A 1 107  ? -5.895  8.205   68.736  1.00 58.17  ? 104  ALA A N   1 
ATOM 805   C CA  . ALA A 1 107  ? -6.809  9.225   69.244  1.00 57.89  ? 104  ALA A CA  1 
ATOM 806   C C   . ALA A 1 107  ? -6.077  10.556  69.269  1.00 57.78  ? 104  ALA A C   1 
ATOM 807   O O   . ALA A 1 107  ? -4.866  10.591  69.041  1.00 57.98  ? 104  ALA A O   1 
ATOM 808   C CB  . ALA A 1 107  ? -7.275  8.865   70.630  1.00 57.85  ? 104  ALA A CB  1 
ATOM 809   N N   . HIS A 1 108  ? -6.802  11.644  69.536  1.00 57.46  ? 105  HIS A N   1 
ATOM 810   C CA  . HIS A 1 108  ? -6.189  12.960  69.733  1.00 57.11  ? 105  HIS A CA  1 
ATOM 811   C C   . HIS A 1 108  ? -7.222  14.060  69.896  1.00 57.33  ? 105  HIS A C   1 
ATOM 812   O O   . HIS A 1 108  ? -8.329  13.966  69.377  1.00 57.43  ? 105  HIS A O   1 
ATOM 813   C CB  . HIS A 1 108  ? -5.258  13.311  68.569  1.00 56.99  ? 105  HIS A CB  1 
ATOM 814   C CG  . HIS A 1 108  ? -5.966  13.852  67.368  1.00 55.86  ? 105  HIS A CG  1 
ATOM 815   N ND1 . HIS A 1 108  ? -6.759  13.071  66.558  1.00 54.76  ? 105  HIS A ND1 1 
ATOM 816   C CD2 . HIS A 1 108  ? -6.003  15.100  66.844  1.00 54.84  ? 105  HIS A CD2 1 
ATOM 817   C CE1 . HIS A 1 108  ? -7.257  13.816  65.588  1.00 54.56  ? 105  HIS A CE1 1 
ATOM 818   N NE2 . HIS A 1 108  ? -6.813  15.050  65.739  1.00 54.33  ? 105  HIS A NE2 1 
ATOM 819   N N   . GLY A 1 109  ? -6.841  15.114  70.603  1.00 57.55  ? 106  GLY A N   1 
ATOM 820   C CA  . GLY A 1 109  ? -7.678  16.297  70.748  1.00 58.18  ? 106  GLY A CA  1 
ATOM 821   C C   . GLY A 1 109  ? -6.874  17.365  71.448  1.00 58.63  ? 106  GLY A C   1 
ATOM 822   O O   . GLY A 1 109  ? -5.705  17.140  71.769  1.00 58.91  ? 106  GLY A O   1 
ATOM 823   N N   . ASN A 1 110  ? -7.480  18.527  71.677  1.00 58.95  ? 107  ASN A N   1 
ATOM 824   C CA  . ASN A 1 110  ? -6.825  19.564  72.465  1.00 59.25  ? 107  ASN A CA  1 
ATOM 825   C C   . ASN A 1 110  ? -7.518  19.782  73.793  1.00 59.60  ? 107  ASN A C   1 
ATOM 826   O O   . ASN A 1 110  ? -8.674  20.195  73.835  1.00 59.58  ? 107  ASN A O   1 
ATOM 827   C CB  . ASN A 1 110  ? -6.753  20.868  71.700  1.00 59.24  ? 107  ASN A CB  1 
ATOM 828   C CG  . ASN A 1 110  ? -5.838  21.862  72.359  1.00 59.24  ? 107  ASN A CG  1 
ATOM 829   O OD1 . ASN A 1 110  ? -6.289  22.784  73.032  1.00 59.55  ? 107  ASN A OD1 1 
ATOM 830   N ND2 . ASN A 1 110  ? -4.538  21.672  72.184  1.00 59.41  ? 107  ASN A ND2 1 
ATOM 831   N N   . VAL A 1 111  ? -6.789  19.528  74.875  1.00 60.15  ? 108  VAL A N   1 
ATOM 832   C CA  . VAL A 1 111  ? -7.387  19.387  76.206  1.00 60.79  ? 108  VAL A CA  1 
ATOM 833   C C   . VAL A 1 111  ? -7.276  20.583  77.155  1.00 61.54  ? 108  VAL A C   1 
ATOM 834   O O   . VAL A 1 111  ? -7.263  20.414  78.376  1.00 61.78  ? 108  VAL A O   1 
ATOM 835   C CB  . VAL A 1 111  ? -6.823  18.156  76.929  1.00 60.50  ? 108  VAL A CB  1 
ATOM 836   C CG1 . VAL A 1 111  ? -7.466  16.906  76.400  1.00 60.71  ? 108  VAL A CG1 1 
ATOM 837   C CG2 . VAL A 1 111  ? -5.320  18.100  76.783  1.00 60.02  ? 108  VAL A CG2 1 
ATOM 838   N N   . GLN A 1 112  ? -7.219  21.789  76.609  1.00 62.31  ? 109  GLN A N   1 
ATOM 839   C CA  . GLN A 1 112  ? -7.116  22.972  77.445  1.00 63.27  ? 109  GLN A CA  1 
ATOM 840   C C   . GLN A 1 112  ? -8.473  23.641  77.616  1.00 64.25  ? 109  GLN A C   1 
ATOM 841   O O   . GLN A 1 112  ? -9.401  23.379  76.854  1.00 64.41  ? 109  GLN A O   1 
ATOM 842   C CB  . GLN A 1 112  ? -6.120  23.954  76.846  1.00 63.12  ? 109  GLN A CB  1 
ATOM 843   C CG  . GLN A 1 112  ? -6.483  24.382  75.455  1.00 62.64  ? 109  GLN A CG  1 
ATOM 844   C CD  . GLN A 1 112  ? -5.813  25.655  75.035  1.00 62.03  ? 109  GLN A CD  1 
ATOM 845   O OE1 . GLN A 1 112  ? -5.961  26.077  73.896  1.00 62.36  ? 109  GLN A OE1 1 
ATOM 846   N NE2 . GLN A 1 112  ? -5.071  26.280  75.944  1.00 61.62  ? 109  GLN A NE2 1 
ATOM 847   N N   . ASP A 1 113  ? -8.579  24.509  78.619  1.00 65.41  ? 110  ASP A N   1 
ATOM 848   C CA  . ASP A 1 113  ? -9.793  25.285  78.842  1.00 66.44  ? 110  ASP A CA  1 
ATOM 849   C C   . ASP A 1 113  ? -9.451  26.761  78.920  1.00 67.10  ? 110  ASP A C   1 
ATOM 850   O O   . ASP A 1 113  ? -8.336  27.121  79.308  1.00 67.21  ? 110  ASP A O   1 
ATOM 851   C CB  . ASP A 1 113  ? -10.471 24.844  80.132  1.00 66.61  ? 110  ASP A CB  1 
ATOM 852   C CG  . ASP A 1 113  ? -10.628 23.343  80.224  1.00 67.11  ? 110  ASP A CG  1 
ATOM 853   O OD1 . ASP A 1 113  ? -9.620  22.646  80.478  1.00 67.02  ? 110  ASP A OD1 1 
ATOM 854   O OD2 . ASP A 1 113  ? -11.767 22.865  80.045  1.00 68.25  ? 110  ASP A OD2 1 
ATOM 855   N N   . ARG A 1 114  ? -10.410 27.611  78.552  1.00 67.95  ? 111  ARG A N   1 
ATOM 856   C CA  . ARG A 1 114  ? -10.223 29.064  78.599  1.00 68.88  ? 111  ARG A CA  1 
ATOM 857   C C   . ARG A 1 114  ? -9.975  29.565  80.021  1.00 69.08  ? 111  ARG A C   1 
ATOM 858   O O   . ARG A 1 114  ? -9.141  30.446  80.245  1.00 69.11  ? 111  ARG A O   1 
ATOM 859   C CB  . ARG A 1 114  ? -11.414 29.789  77.962  1.00 69.11  ? 111  ARG A CB  1 
ATOM 860   C CG  . ARG A 1 114  ? -11.091 30.399  76.606  1.00 70.60  ? 111  ARG A CG  1 
ATOM 861   C CD  . ARG A 1 114  ? -11.110 29.383  75.464  1.00 72.62  ? 111  ARG A CD  1 
ATOM 862   N NE  . ARG A 1 114  ? -12.135 29.719  74.475  1.00 74.99  ? 111  ARG A NE  1 
ATOM 863   C CZ  . ARG A 1 114  ? -12.069 29.417  73.177  1.00 76.09  ? 111  ARG A CZ  1 
ATOM 864   N NH1 . ARG A 1 114  ? -11.019 28.761  72.686  1.00 76.30  ? 111  ARG A NH1 1 
ATOM 865   N NH2 . ARG A 1 114  ? -13.058 29.775  72.359  1.00 76.17  ? 111  ARG A NH2 1 
ATOM 866   N N   . ILE A 1 115  ? -10.707 28.971  80.962  1.00 69.42  ? 112  ILE A N   1 
ATOM 867   C CA  . ILE A 1 115  ? -10.589 29.225  82.395  1.00 69.66  ? 112  ILE A CA  1 
ATOM 868   C C   . ILE A 1 115  ? -9.456  28.403  82.999  1.00 69.92  ? 112  ILE A C   1 
ATOM 869   O O   . ILE A 1 115  ? -9.196  27.284  82.563  1.00 69.97  ? 112  ILE A O   1 
ATOM 870   C CB  . ILE A 1 115  ? -11.917 28.840  83.101  1.00 69.57  ? 112  ILE A CB  1 
ATOM 871   C CG1 . ILE A 1 115  ? -12.900 30.005  83.060  1.00 69.65  ? 112  ILE A CG1 1 
ATOM 872   C CG2 . ILE A 1 115  ? -11.696 28.411  84.547  1.00 69.83  ? 112  ILE A CG2 1 
ATOM 873   C CD1 . ILE A 1 115  ? -13.652 30.119  81.755  1.00 70.35  ? 112  ILE A CD1 1 
ATOM 874   N N   . GLY A 1 116  ? -8.784  28.953  84.003  1.00 70.28  ? 113  GLY A N   1 
ATOM 875   C CA  . GLY A 1 116  ? -7.860  28.152  84.801  1.00 70.76  ? 113  GLY A CA  1 
ATOM 876   C C   . GLY A 1 116  ? -6.399  28.562  84.787  1.00 71.02  ? 113  GLY A C   1 
ATOM 877   O O   . GLY A 1 116  ? -5.711  28.455  83.767  1.00 70.92  ? 113  GLY A O   1 
ATOM 878   N N   . ARG A 1 117  ? -5.937  29.029  85.943  1.00 71.23  ? 114  ARG A N   1 
ATOM 879   C CA  . ARG A 1 117  ? -4.536  29.322  86.177  1.00 71.51  ? 114  ARG A CA  1 
ATOM 880   C C   . ARG A 1 117  ? -3.769  27.994  86.074  1.00 71.34  ? 114  ARG A C   1 
ATOM 881   O O   . ARG A 1 117  ? -4.182  27.005  86.685  1.00 71.32  ? 114  ARG A O   1 
ATOM 882   C CB  . ARG A 1 117  ? -4.387  29.943  87.577  1.00 71.60  ? 114  ARG A CB  1 
ATOM 883   C CG  . ARG A 1 117  ? -3.217  30.932  87.758  1.00 72.18  ? 114  ARG A CG  1 
ATOM 884   C CD  . ARG A 1 117  ? -3.360  31.815  89.025  1.00 72.02  ? 114  ARG A CD  1 
ATOM 885   N NE  . ARG A 1 117  ? -3.901  31.090  90.182  1.00 73.53  ? 114  ARG A NE  1 
ATOM 886   C CZ  . ARG A 1 117  ? -3.561  31.309  91.455  1.00 74.19  ? 114  ARG A CZ  1 
ATOM 887   N NH1 . ARG A 1 117  ? -2.655  32.231  91.768  1.00 74.41  ? 114  ARG A NH1 1 
ATOM 888   N NH2 . ARG A 1 117  ? -4.119  30.589  92.427  1.00 74.13  ? 114  ARG A NH2 1 
ATOM 889   N N   . PRO A 1 118  ? -2.685  27.948  85.262  1.00 71.16  ? 115  PRO A N   1 
ATOM 890   C CA  . PRO A 1 118  ? -1.807  26.777  85.327  1.00 70.81  ? 115  PRO A CA  1 
ATOM 891   C C   . PRO A 1 118  ? -1.076  26.807  86.661  1.00 70.54  ? 115  PRO A C   1 
ATOM 892   O O   . PRO A 1 118  ? -0.736  27.888  87.148  1.00 70.54  ? 115  PRO A O   1 
ATOM 893   C CB  . PRO A 1 118  ? -0.844  26.984  84.156  1.00 70.82  ? 115  PRO A CB  1 
ATOM 894   C CG  . PRO A 1 118  ? -0.847  28.449  83.907  1.00 70.92  ? 115  PRO A CG  1 
ATOM 895   C CD  . PRO A 1 118  ? -2.220  28.934  84.266  1.00 71.19  ? 115  PRO A CD  1 
ATOM 896   N N   . SER A 1 119  ? -0.858  25.643  87.260  1.00 70.25  ? 116  SER A N   1 
ATOM 897   C CA  . SER A 1 119  ? -0.461  25.594  88.666  1.00 69.94  ? 116  SER A CA  1 
ATOM 898   C C   . SER A 1 119  ? 1.037   25.403  88.900  1.00 69.90  ? 116  SER A C   1 
ATOM 899   O O   . SER A 1 119  ? 1.834   25.348  87.955  1.00 69.91  ? 116  SER A O   1 
ATOM 900   C CB  . SER A 1 119  ? -1.271  24.525  89.409  1.00 69.81  ? 116  SER A CB  1 
ATOM 901   O OG  . SER A 1 119  ? -1.304  23.317  88.676  1.00 69.22  ? 116  SER A OG  1 
ATOM 902   N N   . GLU A 1 120  ? 1.396   25.347  90.183  1.00 69.76  ? 117  GLU A N   1 
ATOM 903   C CA  . GLU A 1 120  ? 2.718   24.939  90.653  1.00 69.56  ? 117  GLU A CA  1 
ATOM 904   C C   . GLU A 1 120  ? 3.018   23.509  90.184  1.00 69.00  ? 117  GLU A C   1 
ATOM 905   O O   . GLU A 1 120  ? 2.112   22.674  90.091  1.00 69.27  ? 117  GLU A O   1 
ATOM 906   C CB  . GLU A 1 120  ? 2.746   24.999  92.187  1.00 69.89  ? 117  GLU A CB  1 
ATOM 907   C CG  . GLU A 1 120  ? 4.141   24.886  92.836  1.00 70.96  ? 117  GLU A CG  1 
ATOM 908   C CD  . GLU A 1 120  ? 4.839   26.231  93.034  1.00 71.26  ? 117  GLU A CD  1 
ATOM 909   O OE1 . GLU A 1 120  ? 4.140   27.231  93.317  1.00 71.16  ? 117  GLU A OE1 1 
ATOM 910   O OE2 . GLU A 1 120  ? 6.089   26.273  92.924  1.00 71.01  ? 117  GLU A OE2 1 
ATOM 911   N N   . THR A 1 121  ? 4.289   23.234  89.895  1.00 68.06  ? 118  THR A N   1 
ATOM 912   C CA  . THR A 1 121  ? 4.736   21.931  89.363  1.00 67.10  ? 118  THR A CA  1 
ATOM 913   C C   . THR A 1 121  ? 4.217   21.679  87.938  1.00 66.36  ? 118  THR A C   1 
ATOM 914   O O   . THR A 1 121  ? 4.644   20.737  87.266  1.00 66.48  ? 118  THR A O   1 
ATOM 915   C CB  . THR A 1 121  ? 4.399   20.723  90.304  1.00 67.14  ? 118  THR A CB  1 
ATOM 916   O OG1 . THR A 1 121  ? 4.322   21.161  91.670  1.00 66.75  ? 118  THR A OG1 1 
ATOM 917   C CG2 . THR A 1 121  ? 5.458   19.614  90.170  1.00 66.99  ? 118  THR A CG2 1 
ATOM 918   N N   . GLY A 1 122  ? 3.313   22.538  87.479  1.00 65.38  ? 119  GLY A N   1 
ATOM 919   C CA  . GLY A 1 122  ? 2.760   22.439  86.135  1.00 64.23  ? 119  GLY A CA  1 
ATOM 920   C C   . GLY A 1 122  ? 1.890   21.211  85.927  1.00 63.35  ? 119  GLY A C   1 
ATOM 921   O O   . GLY A 1 122  ? 1.191   20.758  86.847  1.00 63.39  ? 119  GLY A O   1 
ATOM 922   N N   . ILE A 1 123  ? 1.960   20.672  84.713  1.00 62.19  ? 120  ILE A N   1 
ATOM 923   C CA  . ILE A 1 123  ? 1.117   19.569  84.269  1.00 61.01  ? 120  ILE A CA  1 
ATOM 924   C C   . ILE A 1 123  ? 1.428   18.272  85.008  1.00 60.45  ? 120  ILE A C   1 
ATOM 925   O O   . ILE A 1 123  ? 2.589   17.905  85.165  1.00 60.51  ? 120  ILE A O   1 
ATOM 926   C CB  . ILE A 1 123  ? 1.272   19.348  82.742  1.00 60.95  ? 120  ILE A CB  1 
ATOM 927   C CG1 . ILE A 1 123  ? 0.963   20.641  81.973  1.00 60.96  ? 120  ILE A CG1 1 
ATOM 928   C CG2 . ILE A 1 123  ? 0.370   18.228  82.262  1.00 60.67  ? 120  ILE A CG2 1 
ATOM 929   C CD1 . ILE A 1 123  ? 1.666   20.781  80.625  1.00 60.59  ? 120  ILE A CD1 1 
ATOM 930   N N   . ILE A 1 124  ? 0.380   17.605  85.484  1.00 59.68  ? 121  ILE A N   1 
ATOM 931   C CA  . ILE A 1 124  ? 0.459   16.216  85.930  1.00 58.95  ? 121  ILE A CA  1 
ATOM 932   C C   . ILE A 1 124  ? -0.556  15.389  85.139  1.00 58.54  ? 121  ILE A C   1 
ATOM 933   O O   . ILE A 1 124  ? -1.759  15.646  85.209  1.00 58.49  ? 121  ILE A O   1 
ATOM 934   C CB  . ILE A 1 124  ? 0.177   16.078  87.440  1.00 58.82  ? 121  ILE A CB  1 
ATOM 935   C CG1 . ILE A 1 124  ? 1.264   16.782  88.250  1.00 59.10  ? 121  ILE A CG1 1 
ATOM 936   C CG2 . ILE A 1 124  ? 0.085   14.606  87.850  1.00 58.77  ? 121  ILE A CG2 1 
ATOM 937   C CD1 . ILE A 1 124  ? 1.038   16.772  89.763  1.00 59.12  ? 121  ILE A CD1 1 
ATOM 938   N N   . GLY A 1 125  ? -0.070  14.416  84.375  1.00 58.00  ? 122  GLY A N   1 
ATOM 939   C CA  . GLY A 1 125  ? -0.945  13.475  83.685  1.00 57.79  ? 122  GLY A CA  1 
ATOM 940   C C   . GLY A 1 125  ? -0.813  12.092  84.288  1.00 57.82  ? 122  GLY A C   1 
ATOM 941   O O   . GLY A 1 125  ? 0.284   11.665  84.611  1.00 57.97  ? 122  GLY A O   1 
ATOM 942   N N   . ILE A 1 126  ? -1.926  11.388  84.453  1.00 58.02  ? 123  ILE A N   1 
ATOM 943   C CA  . ILE A 1 126  ? -1.904  10.049  85.041  1.00 58.55  ? 123  ILE A CA  1 
ATOM 944   C C   . ILE A 1 126  ? -2.996  9.119   84.505  1.00 58.96  ? 123  ILE A C   1 
ATOM 945   O O   . ILE A 1 126  ? -4.134  9.531   84.282  1.00 58.94  ? 123  ILE A O   1 
ATOM 946   C CB  . ILE A 1 126  ? -1.972  10.071  86.596  1.00 58.45  ? 123  ILE A CB  1 
ATOM 947   C CG1 . ILE A 1 126  ? -2.840  11.226  87.096  1.00 58.52  ? 123  ILE A CG1 1 
ATOM 948   C CG2 . ILE A 1 126  ? -0.572  10.142  87.203  1.00 58.72  ? 123  ILE A CG2 1 
ATOM 949   C CD1 . ILE A 1 126  ? -3.223  11.118  88.557  1.00 58.81  ? 123  ILE A CD1 1 
ATOM 950   N N   . ILE A 1 127  ? -2.630  7.856   84.310  1.00 59.55  ? 124  ILE A N   1 
ATOM 951   C CA  . ILE A 1 127  ? -3.562  6.832   83.871  1.00 60.13  ? 124  ILE A CA  1 
ATOM 952   C C   . ILE A 1 127  ? -3.879  5.883   85.022  1.00 60.87  ? 124  ILE A C   1 
ATOM 953   O O   . ILE A 1 127  ? -2.981  5.469   85.754  1.00 61.10  ? 124  ILE A O   1 
ATOM 954   C CB  . ILE A 1 127  ? -3.000  6.071   82.662  1.00 59.96  ? 124  ILE A CB  1 
ATOM 955   C CG1 . ILE A 1 127  ? -3.217  6.903   81.399  1.00 59.70  ? 124  ILE A CG1 1 
ATOM 956   C CG2 . ILE A 1 127  ? -3.656  4.704   82.509  1.00 60.26  ? 124  ILE A CG2 1 
ATOM 957   C CD1 . ILE A 1 127  ? -2.702  6.272   80.137  1.00 58.69  ? 124  ILE A CD1 1 
ATOM 958   N N   . ASP A 1 128  ? -5.166  5.570   85.182  1.00 61.63  ? 125  ASP A N   1 
ATOM 959   C CA  . ASP A 1 128  ? -5.658  4.610   86.172  1.00 62.26  ? 125  ASP A CA  1 
ATOM 960   C C   . ASP A 1 128  ? -5.214  3.175   85.834  1.00 62.82  ? 125  ASP A C   1 
ATOM 961   O O   . ASP A 1 128  ? -5.106  2.831   84.654  1.00 62.81  ? 125  ASP A O   1 
ATOM 962   C CB  . ASP A 1 128  ? -7.187  4.778   86.310  1.00 62.32  ? 125  ASP A CB  1 
ATOM 963   C CG  . ASP A 1 128  ? -7.970  3.474   86.147  1.00 62.92  ? 125  ASP A CG  1 
ATOM 964   O OD1 . ASP A 1 128  ? -8.556  2.996   87.148  1.00 63.75  ? 125  ASP A OD1 1 
ATOM 965   O OD2 . ASP A 1 128  ? -8.037  2.946   85.014  1.00 63.08  ? 125  ASP A OD2 1 
ATOM 966   N N   . PRO A 1 129  ? -4.936  2.343   86.866  1.00 63.49  ? 126  PRO A N   1 
ATOM 967   C CA  . PRO A 1 129  ? -4.428  0.964   86.683  1.00 64.02  ? 126  PRO A CA  1 
ATOM 968   C C   . PRO A 1 129  ? -5.285  0.064   85.789  1.00 64.52  ? 126  PRO A C   1 
ATOM 969   O O   . PRO A 1 129  ? -4.751  -0.794  85.086  1.00 64.48  ? 126  PRO A O   1 
ATOM 970   C CB  . PRO A 1 129  ? -4.381  0.400   88.116  1.00 63.88  ? 126  PRO A CB  1 
ATOM 971   C CG  . PRO A 1 129  ? -5.205  1.322   88.937  1.00 63.77  ? 126  PRO A CG  1 
ATOM 972   C CD  . PRO A 1 129  ? -5.081  2.670   88.296  1.00 63.60  ? 126  PRO A CD  1 
ATOM 973   N N   . GLU A 1 130  ? -6.596  0.270   85.815  1.00 65.27  ? 127  GLU A N   1 
ATOM 974   C CA  . GLU A 1 130  ? -7.526  -0.517  85.008  1.00 66.25  ? 127  GLU A CA  1 
ATOM 975   C C   . GLU A 1 130  ? -7.687  0.020   83.571  1.00 66.53  ? 127  GLU A C   1 
ATOM 976   O O   . GLU A 1 130  ? -8.392  -0.590  82.754  1.00 66.80  ? 127  GLU A O   1 
ATOM 977   C CB  . GLU A 1 130  ? -8.894  -0.581  85.698  1.00 66.46  ? 127  GLU A CB  1 
ATOM 978   C CG  . GLU A 1 130  ? -8.847  -0.896  87.195  1.00 67.75  ? 127  GLU A CG  1 
ATOM 979   C CD  . GLU A 1 130  ? -10.078 -0.385  87.934  1.00 69.74  ? 127  GLU A CD  1 
ATOM 980   O OE1 . GLU A 1 130  ? -11.209 -0.795  87.567  1.00 70.45  ? 127  GLU A OE1 1 
ATOM 981   O OE2 . GLU A 1 130  ? -9.913  0.429   88.878  1.00 70.22  ? 127  GLU A OE2 1 
ATOM 982   N N   . CYS A 1 131  ? -7.032  1.149   83.275  1.00 66.66  ? 128  CYS A N   1 
ATOM 983   C CA  . CYS A 1 131  ? -7.144  1.846   81.984  1.00 66.75  ? 128  CYS A CA  1 
ATOM 984   C C   . CYS A 1 131  ? -8.543  2.393   81.730  1.00 66.71  ? 128  CYS A C   1 
ATOM 985   O O   . CYS A 1 131  ? -8.947  2.577   80.579  1.00 66.75  ? 128  CYS A O   1 
ATOM 986   C CB  . CYS A 1 131  ? -6.711  0.948   80.823  1.00 66.71  ? 128  CYS A CB  1 
ATOM 987   S SG  . CYS A 1 131  ? -4.941  0.716   80.719  1.00 67.96  ? 128  CYS A SG  1 
ATOM 988   N N   . ARG A 1 132  ? -9.276  2.651   82.810  1.00 66.77  ? 129  ARG A N   1 
ATOM 989   C CA  . ARG A 1 132  ? -10.657 3.130   82.722  1.00 66.88  ? 129  ARG A CA  1 
ATOM 990   C C   . ARG A 1 132  ? -10.753 4.591   82.298  1.00 66.57  ? 129  ARG A C   1 
ATOM 991   O O   . ARG A 1 132  ? -11.791 5.031   81.792  1.00 66.67  ? 129  ARG A O   1 
ATOM 992   C CB  . ARG A 1 132  ? -11.396 2.911   84.048  1.00 67.11  ? 129  ARG A CB  1 
ATOM 993   C CG  . ARG A 1 132  ? -12.231 1.638   84.096  1.00 67.87  ? 129  ARG A CG  1 
ATOM 994   C CD  . ARG A 1 132  ? -13.589 1.838   83.424  1.00 69.11  ? 129  ARG A CD  1 
ATOM 995   N NE  . ARG A 1 132  ? -14.590 2.382   84.343  1.00 70.05  ? 129  ARG A NE  1 
ATOM 996   C CZ  . ARG A 1 132  ? -15.399 1.645   85.103  1.00 70.53  ? 129  ARG A CZ  1 
ATOM 997   N NH1 . ARG A 1 132  ? -15.335 0.317   85.067  1.00 70.41  ? 129  ARG A NH1 1 
ATOM 998   N NH2 . ARG A 1 132  ? -16.277 2.236   85.905  1.00 71.09  ? 129  ARG A NH2 1 
ATOM 999   N N   . MET A 1 133  ? -9.664  5.330   82.501  1.00 66.01  ? 130  MET A N   1 
ATOM 1000  C CA  . MET A 1 133  ? -9.620  6.757   82.204  1.00 65.65  ? 130  MET A CA  1 
ATOM 1001  C C   . MET A 1 133  ? -8.189  7.285   82.121  1.00 64.99  ? 130  MET A C   1 
ATOM 1002  O O   . MET A 1 133  ? -7.219  6.533   82.259  1.00 65.04  ? 130  MET A O   1 
ATOM 1003  C CB  . MET A 1 133  ? -10.386 7.537   83.270  1.00 65.41  ? 130  MET A CB  1 
ATOM 1004  C CG  . MET A 1 133  ? -9.939  7.210   84.670  1.00 65.85  ? 130  MET A CG  1 
ATOM 1005  S SD  . MET A 1 133  ? -10.633 8.326   85.885  1.00 66.74  ? 130  MET A SD  1 
ATOM 1006  C CE  . MET A 1 133  ? -12.302 7.685   86.003  1.00 67.92  ? 130  MET A CE  1 
ATOM 1007  N N   . ILE A 1 134  ? -8.078  8.588   81.881  1.00 64.19  ? 131  ILE A N   1 
ATOM 1008  C CA  . ILE A 1 134  ? -6.817  9.306   81.966  1.00 63.20  ? 131  ILE A CA  1 
ATOM 1009  C C   . ILE A 1 134  ? -7.092  10.568  82.765  1.00 62.65  ? 131  ILE A C   1 
ATOM 1010  O O   . ILE A 1 134  ? -7.946  11.373  82.398  1.00 62.53  ? 131  ILE A O   1 
ATOM 1011  C CB  . ILE A 1 134  ? -6.263  9.672   80.576  1.00 63.16  ? 131  ILE A CB  1 
ATOM 1012  C CG1 . ILE A 1 134  ? -6.121  8.421   79.706  1.00 62.89  ? 131  ILE A CG1 1 
ATOM 1013  C CG2 . ILE A 1 134  ? -4.933  10.396  80.706  1.00 62.96  ? 131  ILE A CG2 1 
ATOM 1014  C CD1 . ILE A 1 134  ? -5.703  8.702   78.274  1.00 63.24  ? 131  ILE A CD1 1 
ATOM 1015  N N   . GLY A 1 135  ? -6.384  10.718  83.875  1.00 62.12  ? 132  GLY A N   1 
ATOM 1016  C CA  . GLY A 1 135  ? -6.560  11.870  84.752  1.00 61.50  ? 132  GLY A CA  1 
ATOM 1017  C C   . GLY A 1 135  ? -5.476  12.893  84.516  1.00 60.91  ? 132  GLY A C   1 
ATOM 1018  O O   . GLY A 1 135  ? -4.315  12.543  84.347  1.00 61.02  ? 132  GLY A O   1 
ATOM 1019  N N   . LEU A 1 136  ? -5.861  14.159  84.493  1.00 60.43  ? 133  LEU A N   1 
ATOM 1020  C CA  . LEU A 1 136  ? -4.941  15.241  84.183  1.00 59.97  ? 133  LEU A CA  1 
ATOM 1021  C C   . LEU A 1 136  ? -5.156  16.337  85.186  1.00 59.88  ? 133  LEU A C   1 
ATOM 1022  O O   . LEU A 1 136  ? -6.296  16.716  85.459  1.00 60.03  ? 133  LEU A O   1 
ATOM 1023  C CB  . LEU A 1 136  ? -5.231  15.810  82.793  1.00 59.75  ? 133  LEU A CB  1 
ATOM 1024  C CG  . LEU A 1 136  ? -4.535  15.356  81.514  1.00 59.10  ? 133  LEU A CG  1 
ATOM 1025  C CD1 . LEU A 1 136  ? -4.355  13.867  81.415  1.00 59.26  ? 133  LEU A CD1 1 
ATOM 1026  C CD2 . LEU A 1 136  ? -5.364  15.831  80.360  1.00 58.93  ? 133  LEU A CD2 1 
ATOM 1027  N N   . ARG A 1 137  ? -4.070  16.842  85.749  1.00 59.61  ? 134  ARG A N   1 
ATOM 1028  C CA  . ARG A 1 137  ? -4.154  18.080  86.492  1.00 59.48  ? 134  ARG A CA  1 
ATOM 1029  C C   . ARG A 1 137  ? -3.425  19.102  85.652  1.00 59.35  ? 134  ARG A C   1 
ATOM 1030  O O   . ARG A 1 137  ? -2.245  19.375  85.874  1.00 59.53  ? 134  ARG A O   1 
ATOM 1031  C CB  . ARG A 1 137  ? -3.547  17.950  87.894  1.00 59.44  ? 134  ARG A CB  1 
ATOM 1032  C CG  . ARG A 1 137  ? -4.002  19.026  88.896  1.00 59.21  ? 134  ARG A CG  1 
ATOM 1033  C CD  . ARG A 1 137  ? -3.198  20.325  88.792  1.00 59.44  ? 134  ARG A CD  1 
ATOM 1034  N NE  . ARG A 1 137  ? -1.755  20.117  88.953  1.00 59.67  ? 134  ARG A NE  1 
ATOM 1035  C CZ  . ARG A 1 137  ? -1.024  20.593  89.958  1.00 59.66  ? 134  ARG A CZ  1 
ATOM 1036  N NH1 . ARG A 1 137  ? -1.585  21.332  90.911  1.00 60.31  ? 134  ARG A NH1 1 
ATOM 1037  N NH2 . ARG A 1 137  ? 0.278   20.342  90.003  1.00 59.07  ? 134  ARG A NH2 1 
ATOM 1038  N N   . LEU A 1 138  ? -4.121  19.630  84.651  1.00 59.08  ? 135  LEU A N   1 
ATOM 1039  C CA  . LEU A 1 138  ? -3.563  20.702  83.844  1.00 58.90  ? 135  LEU A CA  1 
ATOM 1040  C C   . LEU A 1 138  ? -3.652  21.989  84.633  1.00 58.77  ? 135  LEU A C   1 
ATOM 1041  O O   . LEU A 1 138  ? -2.693  22.755  84.719  1.00 58.58  ? 135  LEU A O   1 
ATOM 1042  C CB  . LEU A 1 138  ? -4.328  20.882  82.526  1.00 58.97  ? 135  LEU A CB  1 
ATOM 1043  C CG  . LEU A 1 138  ? -4.344  19.891  81.355  1.00 58.65  ? 135  LEU A CG  1 
ATOM 1044  C CD1 . LEU A 1 138  ? -3.305  18.790  81.504  1.00 58.54  ? 135  LEU A CD1 1 
ATOM 1045  C CD2 . LEU A 1 138  ? -5.732  19.321  81.180  1.00 58.16  ? 135  LEU A CD2 1 
ATOM 1046  N N   . TYR A 1 139  ? -4.819  22.201  85.226  1.00 58.79  ? 136  TYR A N   1 
ATOM 1047  C CA  . TYR A 1 139  ? -5.184  23.511  85.736  1.00 58.80  ? 136  TYR A CA  1 
ATOM 1048  C C   . TYR A 1 139  ? -5.330  23.581  87.243  1.00 58.84  ? 136  TYR A C   1 
ATOM 1049  O O   . TYR A 1 139  ? -5.544  22.568  87.910  1.00 59.24  ? 136  TYR A O   1 
ATOM 1050  C CB  . TYR A 1 139  ? -6.449  23.999  85.031  1.00 58.62  ? 136  TYR A CB  1 
ATOM 1051  C CG  . TYR A 1 139  ? -6.169  24.357  83.599  1.00 57.99  ? 136  TYR A CG  1 
ATOM 1052  C CD1 . TYR A 1 139  ? -6.544  23.514  82.561  1.00 57.41  ? 136  TYR A CD1 1 
ATOM 1053  C CD2 . TYR A 1 139  ? -5.488  25.527  83.289  1.00 57.53  ? 136  TYR A CD2 1 
ATOM 1054  C CE1 . TYR A 1 139  ? -6.272  23.844  81.241  1.00 57.66  ? 136  TYR A CE1 1 
ATOM 1055  C CE2 . TYR A 1 139  ? -5.210  25.865  81.984  1.00 58.30  ? 136  TYR A CE2 1 
ATOM 1056  C CZ  . TYR A 1 139  ? -5.603  25.024  80.960  1.00 58.18  ? 136  TYR A CZ  1 
ATOM 1057  O OH  . TYR A 1 139  ? -5.311  25.385  79.663  1.00 58.23  ? 136  TYR A OH  1 
ATOM 1058  N N   . ASP A 1 140  ? -5.196  24.786  87.774  1.00 58.59  ? 137  ASP A N   1 
ATOM 1059  C CA  . ASP A 1 140  ? -5.270  24.964  89.200  1.00 58.51  ? 137  ASP A CA  1 
ATOM 1060  C C   . ASP A 1 140  ? -6.722  24.982  89.639  1.00 58.08  ? 137  ASP A C   1 
ATOM 1061  O O   . ASP A 1 140  ? -7.470  25.894  89.292  1.00 58.29  ? 137  ASP A O   1 
ATOM 1062  C CB  . ASP A 1 140  ? -4.570  26.253  89.614  1.00 58.83  ? 137  ASP A CB  1 
ATOM 1063  C CG  . ASP A 1 140  ? -4.255  26.282  91.083  1.00 59.55  ? 137  ASP A CG  1 
ATOM 1064  O OD1 . ASP A 1 140  ? -3.968  25.194  91.638  1.00 60.46  ? 137  ASP A OD1 1 
ATOM 1065  O OD2 . ASP A 1 140  ? -4.300  27.385  91.673  1.00 60.24  ? 137  ASP A OD2 1 
ATOM 1066  N N   . GLY A 1 141  ? -7.119  23.957  90.383  1.00 57.46  ? 138  GLY A N   1 
ATOM 1067  C CA  . GLY A 1 141  ? -8.449  23.915  90.966  1.00 56.74  ? 138  GLY A CA  1 
ATOM 1068  C C   . GLY A 1 141  ? -9.404  22.934  90.323  1.00 56.28  ? 138  GLY A C   1 
ATOM 1069  O O   . GLY A 1 141  ? -10.440 22.611  90.905  1.00 56.41  ? 138  GLY A O   1 
ATOM 1070  N N   . LEU A 1 142  ? -9.078  22.475  89.117  1.00 55.70  ? 139  LEU A N   1 
ATOM 1071  C CA  . LEU A 1 142  ? -9.909  21.483  88.436  1.00 55.10  ? 139  LEU A CA  1 
ATOM 1072  C C   . LEU A 1 142  ? -9.117  20.216  88.196  1.00 54.87  ? 139  LEU A C   1 
ATOM 1073  O O   . LEU A 1 142  ? -7.887  20.228  88.173  1.00 54.89  ? 139  LEU A O   1 
ATOM 1074  C CB  . LEU A 1 142  ? -10.434 21.993  87.087  1.00 54.96  ? 139  LEU A CB  1 
ATOM 1075  C CG  . LEU A 1 142  ? -10.765 23.453  86.790  1.00 54.43  ? 139  LEU A CG  1 
ATOM 1076  C CD1 . LEU A 1 142  ? -11.046 23.588  85.309  1.00 54.03  ? 139  LEU A CD1 1 
ATOM 1077  C CD2 . LEU A 1 142  ? -11.936 23.963  87.614  1.00 54.19  ? 139  LEU A CD2 1 
ATOM 1078  N N   . PHE A 1 143  ? -9.836  19.122  88.007  1.00 54.57  ? 140  PHE A N   1 
ATOM 1079  C CA  . PHE A 1 143  ? -9.223  17.870  87.616  1.00 54.46  ? 140  PHE A CA  1 
ATOM 1080  C C   . PHE A 1 143  ? -9.876  17.422  86.297  1.00 54.64  ? 140  PHE A C   1 
ATOM 1081  O O   . PHE A 1 143  ? -11.105 17.363  86.196  1.00 54.73  ? 140  PHE A O   1 
ATOM 1082  C CB  . PHE A 1 143  ? -9.403  16.852  88.745  1.00 54.12  ? 140  PHE A CB  1 
ATOM 1083  C CG  . PHE A 1 143  ? -8.730  15.532  88.505  1.00 53.62  ? 140  PHE A CG  1 
ATOM 1084  C CD1 . PHE A 1 143  ? -7.342  15.440  88.443  1.00 53.52  ? 140  PHE A CD1 1 
ATOM 1085  C CD2 . PHE A 1 143  ? -9.490  14.367  88.381  1.00 52.67  ? 140  PHE A CD2 1 
ATOM 1086  C CE1 . PHE A 1 143  ? -6.724  14.206  88.233  1.00 53.84  ? 140  PHE A CE1 1 
ATOM 1087  C CE2 . PHE A 1 143  ? -8.887  13.133  88.176  1.00 52.31  ? 140  PHE A CE2 1 
ATOM 1088  C CZ  . PHE A 1 143  ? -7.505  13.048  88.102  1.00 53.38  ? 140  PHE A CZ  1 
ATOM 1089  N N   . LYS A 1 144  ? -9.053  17.155  85.283  1.00 54.70  ? 141  LYS A N   1 
ATOM 1090  C CA  . LYS A 1 144  ? -9.544  16.749  83.964  1.00 54.85  ? 141  LYS A CA  1 
ATOM 1091  C C   . LYS A 1 144  ? -9.593  15.238  83.859  1.00 55.29  ? 141  LYS A C   1 
ATOM 1092  O O   . LYS A 1 144  ? -8.647  14.554  84.237  1.00 55.42  ? 141  LYS A O   1 
ATOM 1093  C CB  . LYS A 1 144  ? -8.644  17.314  82.858  1.00 54.73  ? 141  LYS A CB  1 
ATOM 1094  C CG  . LYS A 1 144  ? -9.162  17.155  81.415  1.00 53.90  ? 141  LYS A CG  1 
ATOM 1095  C CD  . LYS A 1 144  ? -10.193 18.224  81.051  1.00 52.70  ? 141  LYS A CD  1 
ATOM 1096  C CE  . LYS A 1 144  ? -9.561  19.561  80.689  1.00 51.44  ? 141  LYS A CE  1 
ATOM 1097  N NZ  . LYS A 1 144  ? -9.741  19.895  79.253  1.00 50.58  ? 141  LYS A NZ  1 
ATOM 1098  N N   . VAL A 1 145  ? -10.701 14.718  83.348  1.00 55.85  ? 142  VAL A N   1 
ATOM 1099  C CA  . VAL A 1 145  ? -10.821 13.288  83.099  1.00 56.61  ? 142  VAL A CA  1 
ATOM 1100  C C   . VAL A 1 145  ? -11.018 13.028  81.606  1.00 57.46  ? 142  VAL A C   1 
ATOM 1101  O O   . VAL A 1 145  ? -11.875 13.642  80.963  1.00 57.66  ? 142  VAL A O   1 
ATOM 1102  C CB  . VAL A 1 145  ? -11.997 12.661  83.879  1.00 56.33  ? 142  VAL A CB  1 
ATOM 1103  C CG1 . VAL A 1 145  ? -11.942 11.148  83.805  1.00 56.00  ? 142  VAL A CG1 1 
ATOM 1104  C CG2 . VAL A 1 145  ? -11.986 13.109  85.316  1.00 56.40  ? 142  VAL A CG2 1 
ATOM 1105  N N   . ILE A 1 146  ? -10.218 12.123  81.056  1.00 58.26  ? 143  ILE A N   1 
ATOM 1106  C CA  . ILE A 1 146  ? -10.455 11.639  79.712  1.00 59.10  ? 143  ILE A CA  1 
ATOM 1107  C C   . ILE A 1 146  ? -10.954 10.203  79.815  1.00 59.98  ? 143  ILE A C   1 
ATOM 1108  O O   . ILE A 1 146  ? -10.156 9.270   79.887  1.00 59.86  ? 143  ILE A O   1 
ATOM 1109  C CB  . ILE A 1 146  ? -9.203  11.764  78.815  1.00 59.04  ? 143  ILE A CB  1 
ATOM 1110  C CG1 . ILE A 1 146  ? -8.875  13.243  78.579  1.00 58.56  ? 143  ILE A CG1 1 
ATOM 1111  C CG2 . ILE A 1 146  ? -9.413  11.025  77.483  1.00 59.16  ? 143  ILE A CG2 1 
ATOM 1112  C CD1 . ILE A 1 146  ? -7.528  13.503  77.937  1.00 58.12  ? 143  ILE A CD1 1 
ATOM 1113  N N   . PRO A 1 147  ? -12.286 10.030  79.823  1.00 61.14  ? 144  PRO A N   1 
ATOM 1114  C CA  . PRO A 1 147  ? -12.939 8.731   80.028  1.00 62.19  ? 144  PRO A CA  1 
ATOM 1115  C C   . PRO A 1 147  ? -12.574 7.768   78.914  1.00 63.21  ? 144  PRO A C   1 
ATOM 1116  O O   . PRO A 1 147  ? -13.005 7.957   77.773  1.00 63.34  ? 144  PRO A O   1 
ATOM 1117  C CB  . PRO A 1 147  ? -14.433 9.062   79.956  1.00 62.19  ? 144  PRO A CB  1 
ATOM 1118  C CG  . PRO A 1 147  ? -14.523 10.537  80.121  1.00 61.94  ? 144  PRO A CG  1 
ATOM 1119  C CD  . PRO A 1 147  ? -13.261 11.108  79.591  1.00 61.19  ? 144  PRO A CD  1 
ATOM 1120  N N   . LEU A 1 148  ? -11.782 6.751   79.245  1.00 64.37  ? 145  LEU A N   1 
ATOM 1121  C CA  . LEU A 1 148  ? -11.237 5.854   78.231  1.00 65.59  ? 145  LEU A CA  1 
ATOM 1122  C C   . LEU A 1 148  ? -12.251 4.858   77.696  1.00 66.33  ? 145  LEU A C   1 
ATOM 1123  O O   . LEU A 1 148  ? -12.676 3.935   78.396  1.00 66.71  ? 145  LEU A O   1 
ATOM 1124  C CB  . LEU A 1 148  ? -9.965  5.155   78.717  1.00 65.61  ? 145  LEU A CB  1 
ATOM 1125  C CG  . LEU A 1 148  ? -8.656  5.864   78.348  1.00 66.15  ? 145  LEU A CG  1 
ATOM 1126  C CD1 . LEU A 1 148  ? -7.494  5.107   78.939  1.00 66.86  ? 145  LEU A CD1 1 
ATOM 1127  C CD2 . LEU A 1 148  ? -8.470  6.006   76.829  1.00 66.14  ? 145  LEU A CD2 1 
ATOM 1128  N N   . ASP A 1 149  ? -12.625 5.064   76.439  1.00 67.12  ? 146  ASP A N   1 
ATOM 1129  C CA  . ASP A 1 149  ? -13.582 4.216   75.752  1.00 67.85  ? 146  ASP A CA  1 
ATOM 1130  C C   . ASP A 1 149  ? -12.967 3.704   74.466  1.00 68.20  ? 146  ASP A C   1 
ATOM 1131  O O   . ASP A 1 149  ? -11.818 4.018   74.135  1.00 68.32  ? 146  ASP A O   1 
ATOM 1132  C CB  . ASP A 1 149  ? -14.844 5.013   75.415  1.00 67.94  ? 146  ASP A CB  1 
ATOM 1133  C CG  . ASP A 1 149  ? -15.551 5.540   76.644  1.00 68.63  ? 146  ASP A CG  1 
ATOM 1134  O OD1 . ASP A 1 149  ? -15.873 6.749   76.652  1.00 69.34  ? 146  ASP A OD1 1 
ATOM 1135  O OD2 . ASP A 1 149  ? -15.786 4.753   77.595  1.00 69.22  ? 146  ASP A OD2 1 
ATOM 1136  N N   . ARG A 1 150  ? -13.743 2.910   73.740  1.00 68.58  ? 147  ARG A N   1 
ATOM 1137  C CA  . ARG A 1 150  ? -13.360 2.505   72.410  1.00 68.98  ? 147  ARG A CA  1 
ATOM 1138  C C   . ARG A 1 150  ? -13.627 3.675   71.461  1.00 69.11  ? 147  ARG A C   1 
ATOM 1139  O O   . ARG A 1 150  ? -12.916 3.846   70.463  1.00 69.06  ? 147  ARG A O   1 
ATOM 1140  C CB  . ARG A 1 150  ? -14.136 1.254   71.985  1.00 69.14  ? 147  ARG A CB  1 
ATOM 1141  C CG  . ARG A 1 150  ? -13.255 0.111   71.451  1.00 69.62  ? 147  ARG A CG  1 
ATOM 1142  C CD  . ARG A 1 150  ? -12.235 0.587   70.404  1.00 70.01  ? 147  ARG A CD  1 
ATOM 1143  N NE  . ARG A 1 150  ? -11.471 -0.514  69.821  1.00 69.74  ? 147  ARG A NE  1 
ATOM 1144  C CZ  . ARG A 1 150  ? -11.804 -1.152  68.703  1.00 69.46  ? 147  ARG A CZ  1 
ATOM 1145  N NH1 . ARG A 1 150  ? -12.895 -0.800  68.031  1.00 69.63  ? 147  ARG A NH1 1 
ATOM 1146  N NH2 . ARG A 1 150  ? -11.045 -2.141  68.253  1.00 69.14  ? 147  ARG A NH2 1 
ATOM 1147  N N   . ASP A 1 151  ? -14.643 4.478   71.793  1.00 69.26  ? 148  ASP A N   1 
ATOM 1148  C CA  . ASP A 1 151  ? -14.984 5.689   71.035  1.00 69.36  ? 148  ASP A CA  1 
ATOM 1149  C C   . ASP A 1 151  ? -13.931 6.755   71.324  1.00 69.02  ? 148  ASP A C   1 
ATOM 1150  O O   . ASP A 1 151  ? -12.723 6.493   71.229  1.00 69.24  ? 148  ASP A O   1 
ATOM 1151  C CB  . ASP A 1 151  ? -16.370 6.249   71.419  1.00 69.61  ? 148  ASP A CB  1 
ATOM 1152  C CG  . ASP A 1 151  ? -17.339 5.183   71.922  1.00 70.64  ? 148  ASP A CG  1 
ATOM 1153  O OD1 . ASP A 1 151  ? -17.049 4.526   72.950  1.00 71.79  ? 148  ASP A OD1 1 
ATOM 1154  O OD2 . ASP A 1 151  ? -18.418 5.034   71.305  1.00 71.35  ? 148  ASP A OD2 1 
ATOM 1155  N N   . ASN A 1 152  ? -14.398 7.954   71.674  1.00 68.29  ? 149  ASN A N   1 
ATOM 1156  C CA  . ASN A 1 152  ? -13.537 9.007   72.194  1.00 67.36  ? 149  ASN A CA  1 
ATOM 1157  C C   . ASN A 1 152  ? -12.244 9.155   71.403  1.00 66.86  ? 149  ASN A C   1 
ATOM 1158  O O   . ASN A 1 152  ? -11.167 9.253   71.990  1.00 66.86  ? 149  ASN A O   1 
ATOM 1159  C CB  . ASN A 1 152  ? -13.213 8.726   73.662  1.00 67.20  ? 149  ASN A CB  1 
ATOM 1160  C CG  . ASN A 1 152  ? -13.116 9.983   74.482  1.00 67.11  ? 149  ASN A CG  1 
ATOM 1161  O OD1 . ASN A 1 152  ? -13.476 11.062  74.021  1.00 67.45  ? 149  ASN A OD1 1 
ATOM 1162  N ND2 . ASN A 1 152  ? -12.648 9.852   75.715  1.00 67.02  ? 149  ASN A ND2 1 
ATOM 1163  N N   . LYS A 1 153  ? -12.359 9.146   70.074  1.00 66.10  ? 150  LYS A N   1 
ATOM 1164  C CA  . LYS A 1 153  ? -11.209 9.301   69.188  1.00 65.42  ? 150  LYS A CA  1 
ATOM 1165  C C   . LYS A 1 153  ? -10.707 10.741  69.173  1.00 65.07  ? 150  LYS A C   1 
ATOM 1166  O O   . LYS A 1 153  ? -9.630  11.025  68.651  1.00 64.70  ? 150  LYS A O   1 
ATOM 1167  C CB  . LYS A 1 153  ? -11.555 8.842   67.770  1.00 65.59  ? 150  LYS A CB  1 
ATOM 1168  C CG  . LYS A 1 153  ? -11.266 7.370   67.486  1.00 65.49  ? 150  LYS A CG  1 
ATOM 1169  C CD  . LYS A 1 153  ? -11.824 6.935   66.123  1.00 65.24  ? 150  LYS A CD  1 
ATOM 1170  C CE  . LYS A 1 153  ? -11.592 5.444   65.874  1.00 64.63  ? 150  LYS A CE  1 
ATOM 1171  N NZ  . LYS A 1 153  ? -12.726 4.781   65.165  1.00 63.54  ? 150  LYS A NZ  1 
ATOM 1172  N N   . GLU A 1 154  ? -11.503 11.639  69.747  1.00 64.96  ? 151  GLU A N   1 
ATOM 1173  C CA  . GLU A 1 154  ? -11.125 13.040  69.928  1.00 65.04  ? 151  GLU A CA  1 
ATOM 1174  C C   . GLU A 1 154  ? -10.989 13.386  71.408  1.00 64.76  ? 151  GLU A C   1 
ATOM 1175  O O   . GLU A 1 154  ? -11.006 14.560  71.789  1.00 64.78  ? 151  GLU A O   1 
ATOM 1176  C CB  . GLU A 1 154  ? -12.145 13.968  69.278  1.00 65.23  ? 151  GLU A CB  1 
ATOM 1177  C CG  . GLU A 1 154  ? -12.370 13.705  67.809  1.00 66.33  ? 151  GLU A CG  1 
ATOM 1178  C CD  . GLU A 1 154  ? -13.808 13.933  67.400  1.00 67.66  ? 151  GLU A CD  1 
ATOM 1179  O OE1 . GLU A 1 154  ? -14.023 14.578  66.349  1.00 68.48  ? 151  GLU A OE1 1 
ATOM 1180  O OE2 . GLU A 1 154  ? -14.718 13.471  68.130  1.00 68.05  ? 151  GLU A OE2 1 
ATOM 1181  N N   . LEU A 1 155  ? -10.870 12.349  72.232  1.00 64.46  ? 152  LEU A N   1 
ATOM 1182  C CA  . LEU A 1 155  ? -10.570 12.477  73.659  1.00 64.19  ? 152  LEU A CA  1 
ATOM 1183  C C   . LEU A 1 155  ? -11.397 13.523  74.404  1.00 64.18  ? 152  LEU A C   1 
ATOM 1184  O O   . LEU A 1 155  ? -10.872 14.283  75.218  1.00 64.08  ? 152  LEU A O   1 
ATOM 1185  C CB  . LEU A 1 155  ? -9.072  12.698  73.873  1.00 63.99  ? 152  LEU A CB  1 
ATOM 1186  C CG  . LEU A 1 155  ? -8.202  11.570  73.331  1.00 63.77  ? 152  LEU A CG  1 
ATOM 1187  C CD1 . LEU A 1 155  ? -6.743  11.935  73.475  1.00 64.35  ? 152  LEU A CD1 1 
ATOM 1188  C CD2 . LEU A 1 155  ? -8.508  10.252  74.032  1.00 63.33  ? 152  LEU A CD2 1 
ATOM 1189  N N   . LYS A 1 156  ? -12.697 13.554  74.122  1.00 64.24  ? 153  LYS A N   1 
ATOM 1190  C CA  . LYS A 1 156  ? -13.619 14.402  74.869  1.00 64.19  ? 153  LYS A CA  1 
ATOM 1191  C C   . LYS A 1 156  ? -13.339 14.205  76.353  1.00 64.18  ? 153  LYS A C   1 
ATOM 1192  O O   . LYS A 1 156  ? -13.167 13.073  76.817  1.00 64.09  ? 153  LYS A O   1 
ATOM 1193  C CB  . LYS A 1 156  ? -15.083 14.065  74.541  1.00 64.15  ? 153  LYS A CB  1 
ATOM 1194  C CG  . LYS A 1 156  ? -15.449 14.097  73.053  1.00 63.80  ? 153  LYS A CG  1 
ATOM 1195  C CD  . LYS A 1 156  ? -15.354 15.492  72.430  1.00 63.42  ? 153  LYS A CD  1 
ATOM 1196  C CE  . LYS A 1 156  ? -15.397 15.395  70.904  1.00 63.53  ? 153  LYS A CE  1 
ATOM 1197  N NZ  . LYS A 1 156  ? -15.113 16.679  70.202  1.00 63.28  ? 153  LYS A NZ  1 
ATOM 1198  N N   . ALA A 1 157  ? -13.268 15.314  77.084  1.00 64.25  ? 154  ALA A N   1 
ATOM 1199  C CA  . ALA A 1 157  ? -12.884 15.290  78.492  1.00 64.23  ? 154  ALA A CA  1 
ATOM 1200  C C   . ALA A 1 157  ? -13.760 16.191  79.341  1.00 64.13  ? 154  ALA A C   1 
ATOM 1201  O O   . ALA A 1 157  ? -13.982 17.357  79.004  1.00 64.27  ? 154  ALA A O   1 
ATOM 1202  C CB  . ALA A 1 157  ? -11.432 15.694  78.640  1.00 64.42  ? 154  ALA A CB  1 
ATOM 1203  N N   . PHE A 1 158  ? -14.254 15.651  80.446  1.00 63.93  ? 155  PHE A N   1 
ATOM 1204  C CA  . PHE A 1 158  ? -14.995 16.462  81.400  1.00 63.77  ? 155  PHE A CA  1 
ATOM 1205  C C   . PHE A 1 158  ? -14.086 16.886  82.547  1.00 63.54  ? 155  PHE A C   1 
ATOM 1206  O O   . PHE A 1 158  ? -13.110 16.206  82.861  1.00 63.37  ? 155  PHE A O   1 
ATOM 1207  C CB  . PHE A 1 158  ? -16.259 15.743  81.899  1.00 63.80  ? 155  PHE A CB  1 
ATOM 1208  C CG  . PHE A 1 158  ? -15.991 14.550  82.783  1.00 63.80  ? 155  PHE A CG  1 
ATOM 1209  C CD1 . PHE A 1 158  ? -16.090 14.659  84.168  1.00 63.82  ? 155  PHE A CD1 1 
ATOM 1210  C CD2 . PHE A 1 158  ? -15.664 13.310  82.231  1.00 63.57  ? 155  PHE A CD2 1 
ATOM 1211  C CE1 . PHE A 1 158  ? -15.857 13.554  84.990  1.00 63.77  ? 155  PHE A CE1 1 
ATOM 1212  C CE2 . PHE A 1 158  ? -15.426 12.203  83.044  1.00 63.25  ? 155  PHE A CE2 1 
ATOM 1213  C CZ  . PHE A 1 158  ? -15.521 12.325  84.425  1.00 63.66  ? 155  PHE A CZ  1 
ATOM 1214  N N   . ASN A 1 159  ? -14.399 18.033  83.138  1.00 63.43  ? 156  ASN A N   1 
ATOM 1215  C CA  . ASN A 1 159  ? -13.694 18.525  84.308  1.00 63.34  ? 156  ASN A CA  1 
ATOM 1216  C C   . ASN A 1 159  ? -14.530 18.304  85.561  1.00 63.39  ? 156  ASN A C   1 
ATOM 1217  O O   . ASN A 1 159  ? -15.759 18.279  85.496  1.00 63.36  ? 156  ASN A O   1 
ATOM 1218  C CB  . ASN A 1 159  ? -13.349 20.008  84.146  1.00 63.25  ? 156  ASN A CB  1 
ATOM 1219  C CG  . ASN A 1 159  ? -12.030 20.231  83.420  1.00 62.99  ? 156  ASN A CG  1 
ATOM 1220  O OD1 . ASN A 1 159  ? -11.003 19.661  83.779  1.00 62.72  ? 156  ASN A OD1 1 
ATOM 1221  N ND2 . ASN A 1 159  ? -12.051 21.085  82.410  1.00 62.96  ? 156  ASN A ND2 1 
ATOM 1222  N N   . ILE A 1 160  ? -13.855 18.113  86.690  1.00 63.42  ? 157  ILE A N   1 
ATOM 1223  C CA  . ILE A 1 160  ? -14.516 18.015  87.984  1.00 63.66  ? 157  ILE A CA  1 
ATOM 1224  C C   . ILE A 1 160  ? -13.903 19.075  88.893  1.00 64.11  ? 157  ILE A C   1 
ATOM 1225  O O   . ILE A 1 160  ? -12.693 19.333  88.819  1.00 64.23  ? 157  ILE A O   1 
ATOM 1226  C CB  . ILE A 1 160  ? -14.350 16.615  88.621  1.00 63.59  ? 157  ILE A CB  1 
ATOM 1227  C CG1 . ILE A 1 160  ? -14.568 15.515  87.577  1.00 63.38  ? 157  ILE A CG1 1 
ATOM 1228  C CG2 . ILE A 1 160  ? -15.307 16.442  89.812  1.00 63.59  ? 157  ILE A CG2 1 
ATOM 1229  C CD1 . ILE A 1 160  ? -14.161 14.130  88.026  1.00 63.48  ? 157  ILE A CD1 1 
ATOM 1230  N N   . ARG A 1 161  ? -14.735 19.696  89.732  1.00 64.44  ? 158  ARG A N   1 
ATOM 1231  C CA  . ARG A 1 161  ? -14.257 20.710  90.670  1.00 64.72  ? 158  ARG A CA  1 
ATOM 1232  C C   . ARG A 1 161  ? -13.413 20.070  91.773  1.00 64.84  ? 158  ARG A C   1 
ATOM 1233  O O   . ARG A 1 161  ? -13.713 18.965  92.239  1.00 64.87  ? 158  ARG A O   1 
ATOM 1234  C CB  . ARG A 1 161  ? -15.424 21.482  91.293  1.00 64.82  ? 158  ARG A CB  1 
ATOM 1235  C CG  . ARG A 1 161  ? -15.014 22.829  91.908  1.00 65.18  ? 158  ARG A CG  1 
ATOM 1236  C CD  . ARG A 1 161  ? -15.581 23.035  93.314  1.00 65.41  ? 158  ARG A CD  1 
ATOM 1237  N NE  . ARG A 1 161  ? -16.994 23.408  93.312  1.00 66.20  ? 158  ARG A NE  1 
ATOM 1238  C CZ  . ARG A 1 161  ? -17.710 23.666  94.407  1.00 67.01  ? 158  ARG A CZ  1 
ATOM 1239  N NH1 . ARG A 1 161  ? -17.156 23.591  95.614  1.00 67.65  ? 158  ARG A NH1 1 
ATOM 1240  N NH2 . ARG A 1 161  ? -18.988 23.999  94.300  1.00 67.00  ? 158  ARG A NH2 1 
ATOM 1241  N N   . LEU A 1 162  ? -12.357 20.770  92.177  1.00 64.93  ? 159  LEU A N   1 
ATOM 1242  C CA  . LEU A 1 162  ? -11.538 20.354  93.307  1.00 65.06  ? 159  LEU A CA  1 
ATOM 1243  C C   . LEU A 1 162  ? -11.646 21.393  94.426  1.00 65.12  ? 159  LEU A C   1 
ATOM 1244  O O   . LEU A 1 162  ? -11.472 22.593  94.196  1.00 65.06  ? 159  LEU A O   1 
ATOM 1245  C CB  . LEU A 1 162  ? -10.080 20.200  92.870  1.00 65.13  ? 159  LEU A CB  1 
ATOM 1246  C CG  . LEU A 1 162  ? -9.257  18.984  93.311  1.00 65.45  ? 159  LEU A CG  1 
ATOM 1247  C CD1 . LEU A 1 162  ? -7.925  18.977  92.555  1.00 65.32  ? 159  LEU A CD1 1 
ATOM 1248  C CD2 . LEU A 1 162  ? -9.031  18.924  94.831  1.00 65.92  ? 159  LEU A CD2 1 
ATOM 1249  N N   . GLU A 1 163  ? -11.935 20.924  95.636  1.00 65.18  ? 160  GLU A N   1 
ATOM 1250  C CA  . GLU A 1 163  ? -11.998 21.795  96.805  1.00 65.28  ? 160  GLU A CA  1 
ATOM 1251  C C   . GLU A 1 163  ? -10.614 22.336  97.192  1.00 65.26  ? 160  GLU A C   1 
ATOM 1252  O O   . GLU A 1 163  ? -10.511 23.378  97.848  1.00 65.43  ? 160  GLU A O   1 
ATOM 1253  C CB  . GLU A 1 163  ? -12.651 21.052  97.980  1.00 65.44  ? 160  GLU A CB  1 
ATOM 1254  C CG  . GLU A 1 163  ? -12.629 21.780  99.341  1.00 65.86  ? 160  GLU A CG  1 
ATOM 1255  C CD  . GLU A 1 163  ? -13.527 23.014  99.407  1.00 66.35  ? 160  GLU A CD  1 
ATOM 1256  O OE1 . GLU A 1 163  ? -13.475 23.709  100.448 1.00 66.66  ? 160  GLU A OE1 1 
ATOM 1257  O OE2 . GLU A 1 163  ? -14.281 23.290  98.441  1.00 66.11  ? 160  GLU A OE2 1 
ATOM 1258  N N   . GLU A 1 164  ? -9.560  21.635  96.773  1.00 65.01  ? 161  GLU A N   1 
ATOM 1259  C CA  . GLU A 1 164  ? -8.194  22.015  97.111  1.00 64.80  ? 161  GLU A CA  1 
ATOM 1260  C C   . GLU A 1 164  ? -7.449  22.560  95.898  1.00 64.51  ? 161  GLU A C   1 
ATOM 1261  O O   . GLU A 1 164  ? -7.266  21.855  94.907  1.00 64.23  ? 161  GLU A O   1 
ATOM 1262  C CB  . GLU A 1 164  ? -7.458  20.830  97.728  1.00 64.94  ? 161  GLU A CB  1 
ATOM 1263  C CG  . GLU A 1 164  ? -7.902  20.493  99.169  1.00 66.05  ? 161  GLU A CG  1 
ATOM 1264  C CD  . GLU A 1 164  ? -9.223  19.709  99.260  1.00 67.03  ? 161  GLU A CD  1 
ATOM 1265  O OE1 . GLU A 1 164  ? -9.650  19.114  98.237  1.00 67.38  ? 161  GLU A OE1 1 
ATOM 1266  O OE2 . GLU A 1 164  ? -9.825  19.686  100.367 1.00 66.30  ? 161  GLU A OE2 1 
ATOM 1267  N N   . LEU A 1 165  ? -7.033  23.824  95.991  1.00 64.44  ? 162  LEU A N   1 
ATOM 1268  C CA  . LEU A 1 165  ? -6.384  24.539  94.880  1.00 64.29  ? 162  LEU A CA  1 
ATOM 1269  C C   . LEU A 1 165  ? -4.873  24.703  95.089  1.00 64.33  ? 162  LEU A C   1 
ATOM 1270  O O   . LEU A 1 165  ? -4.357  25.828  95.080  1.00 64.46  ? 162  LEU A O   1 
ATOM 1271  C CB  . LEU A 1 165  ? -7.001  25.933  94.670  1.00 64.14  ? 162  LEU A CB  1 
ATOM 1272  C CG  . LEU A 1 165  ? -8.281  26.416  95.355  1.00 63.87  ? 162  LEU A CG  1 
ATOM 1273  C CD1 . LEU A 1 165  ? -8.117  27.890  95.704  1.00 63.90  ? 162  LEU A CD1 1 
ATOM 1274  C CD2 . LEU A 1 165  ? -9.531  26.186  94.502  1.00 63.24  ? 162  LEU A CD2 1 
ATOM 1275  N N   . HIS A 1 166  ? -4.180  23.588  95.304  1.00 64.14  ? 163  HIS A N   1 
ATOM 1276  C CA  . HIS A 1 166  ? -2.716  23.550  95.333  1.00 64.08  ? 163  HIS A CA  1 
ATOM 1277  C C   . HIS A 1 166  ? -2.294  22.107  95.530  1.00 63.65  ? 163  HIS A C   1 
ATOM 1278  O O   . HIS A 1 166  ? -2.032  21.677  96.647  1.00 63.76  ? 163  HIS A O   1 
ATOM 1279  C CB  . HIS A 1 166  ? -2.111  24.444  96.439  1.00 64.35  ? 163  HIS A CB  1 
ATOM 1280  C CG  . HIS A 1 166  ? -0.659  24.792  96.224  1.00 65.50  ? 163  HIS A CG  1 
ATOM 1281  N ND1 . HIS A 1 166  ? 0.341   23.842  96.151  1.00 65.90  ? 163  HIS A ND1 1 
ATOM 1282  C CD2 . HIS A 1 166  ? -0.041  25.993  96.085  1.00 66.21  ? 163  HIS A CD2 1 
ATOM 1283  C CE1 . HIS A 1 166  ? 1.505   24.440  95.964  1.00 66.02  ? 163  HIS A CE1 1 
ATOM 1284  N NE2 . HIS A 1 166  ? 1.302   25.745  95.921  1.00 66.04  ? 163  HIS A NE2 1 
ATOM 1285  N N   . VAL A 1 167  ? -2.246  21.355  94.440  1.00 63.10  ? 164  VAL A N   1 
ATOM 1286  C CA  . VAL A 1 167  ? -1.800  19.974  94.514  1.00 62.54  ? 164  VAL A CA  1 
ATOM 1287  C C   . VAL A 1 167  ? -0.334  19.869  94.101  1.00 62.22  ? 164  VAL A C   1 
ATOM 1288  O O   . VAL A 1 167  ? 0.149   20.632  93.255  1.00 62.11  ? 164  VAL A O   1 
ATOM 1289  C CB  . VAL A 1 167  ? -2.677  19.035  93.664  1.00 62.57  ? 164  VAL A CB  1 
ATOM 1290  C CG1 . VAL A 1 167  ? -2.315  17.585  93.936  1.00 62.57  ? 164  VAL A CG1 1 
ATOM 1291  C CG2 . VAL A 1 167  ? -4.145  19.263  93.964  1.00 62.43  ? 164  VAL A CG2 1 
ATOM 1292  N N   . ILE A 1 168  ? 0.360   18.911  94.711  1.00 61.75  ? 165  ILE A N   1 
ATOM 1293  C CA  . ILE A 1 168  ? 1.793   18.745  94.530  1.00 61.27  ? 165  ILE A CA  1 
ATOM 1294  C C   . ILE A 1 168  ? 2.097   17.490  93.707  1.00 61.14  ? 165  ILE A C   1 
ATOM 1295  O O   . ILE A 1 168  ? 2.898   17.545  92.769  1.00 61.19  ? 165  ILE A O   1 
ATOM 1296  C CB  . ILE A 1 168  ? 2.534   18.767  95.893  1.00 61.15  ? 165  ILE A CB  1 
ATOM 1297  C CG1 . ILE A 1 168  ? 2.468   20.160  96.531  1.00 60.96  ? 165  ILE A CG1 1 
ATOM 1298  C CG2 . ILE A 1 168  ? 3.991   18.481  95.715  1.00 61.31  ? 165  ILE A CG2 1 
ATOM 1299  C CD1 . ILE A 1 168  ? 1.101   20.626  96.983  1.00 60.27  ? 165  ILE A CD1 1 
ATOM 1300  N N   . ASP A 1 169  ? 1.455   16.371  94.044  1.00 61.03  ? 166  ASP A N   1 
ATOM 1301  C CA  . ASP A 1 169  ? 1.525   15.156  93.211  1.00 61.17  ? 166  ASP A CA  1 
ATOM 1302  C C   . ASP A 1 169  ? 0.306   14.260  93.388  1.00 61.04  ? 166  ASP A C   1 
ATOM 1303  O O   . ASP A 1 169  ? -0.290  14.215  94.455  1.00 61.13  ? 166  ASP A O   1 
ATOM 1304  C CB  . ASP A 1 169  ? 2.812   14.352  93.462  1.00 61.33  ? 166  ASP A CB  1 
ATOM 1305  C CG  . ASP A 1 169  ? 3.271   13.558  92.228  1.00 61.51  ? 166  ASP A CG  1 
ATOM 1306  O OD1 . ASP A 1 169  ? 2.555   13.574  91.195  1.00 60.70  ? 166  ASP A OD1 1 
ATOM 1307  O OD2 . ASP A 1 169  ? 4.358   12.925  92.296  1.00 61.73  ? 166  ASP A OD2 1 
ATOM 1308  N N   . VAL A 1 170  ? -0.053  13.551  92.322  1.00 60.95  ? 167  VAL A N   1 
ATOM 1309  C CA  . VAL A 1 170  ? -1.252  12.728  92.292  1.00 60.85  ? 167  VAL A CA  1 
ATOM 1310  C C   . VAL A 1 170  ? -0.966  11.433  91.565  1.00 61.15  ? 167  VAL A C   1 
ATOM 1311  O O   . VAL A 1 170  ? -0.335  11.432  90.504  1.00 61.50  ? 167  VAL A O   1 
ATOM 1312  C CB  . VAL A 1 170  ? -2.395  13.392  91.507  1.00 60.62  ? 167  VAL A CB  1 
ATOM 1313  C CG1 . VAL A 1 170  ? -3.722  12.845  91.978  1.00 60.87  ? 167  VAL A CG1 1 
ATOM 1314  C CG2 . VAL A 1 170  ? -2.364  14.899  91.631  1.00 60.34  ? 167  VAL A CG2 1 
ATOM 1315  N N   . LYS A 1 171  ? -1.441  10.329  92.123  1.00 61.32  ? 168  LYS A N   1 
ATOM 1316  C CA  . LYS A 1 171  ? -1.382  9.047   91.434  1.00 61.55  ? 168  LYS A CA  1 
ATOM 1317  C C   . LYS A 1 171  ? -2.743  8.374   91.505  1.00 61.99  ? 168  LYS A C   1 
ATOM 1318  O O   . LYS A 1 171  ? -3.641  8.848   92.205  1.00 62.20  ? 168  LYS A O   1 
ATOM 1319  C CB  . LYS A 1 171  ? -0.313  8.142   92.055  1.00 61.41  ? 168  LYS A CB  1 
ATOM 1320  C CG  . LYS A 1 171  ? 1.106   8.665   91.929  1.00 60.86  ? 168  LYS A CG  1 
ATOM 1321  C CD  . LYS A 1 171  ? 1.753   8.259   90.616  1.00 60.37  ? 168  LYS A CD  1 
ATOM 1322  C CE  . LYS A 1 171  ? 2.664   9.353   90.079  1.00 60.15  ? 168  LYS A CE  1 
ATOM 1323  N NZ  . LYS A 1 171  ? 3.698   9.802   91.055  1.00 59.70  ? 168  LYS A NZ  1 
ATOM 1324  N N   . PHE A 1 172  ? -2.906  7.290   90.756  1.00 62.35  ? 169  PHE A N   1 
ATOM 1325  C CA  . PHE A 1 172  ? -4.043  6.411   90.944  1.00 62.62  ? 169  PHE A CA  1 
ATOM 1326  C C   . PHE A 1 172  ? -3.552  5.253   91.781  1.00 62.94  ? 169  PHE A C   1 
ATOM 1327  O O   . PHE A 1 172  ? -2.378  4.893   91.702  1.00 62.80  ? 169  PHE A O   1 
ATOM 1328  C CB  . PHE A 1 172  ? -4.593  5.921   89.610  1.00 62.56  ? 169  PHE A CB  1 
ATOM 1329  C CG  . PHE A 1 172  ? -5.623  6.835   88.998  1.00 62.55  ? 169  PHE A CG  1 
ATOM 1330  C CD1 . PHE A 1 172  ? -5.272  7.727   87.990  1.00 62.50  ? 169  PHE A CD1 1 
ATOM 1331  C CD2 . PHE A 1 172  ? -6.949  6.793   89.420  1.00 62.35  ? 169  PHE A CD2 1 
ATOM 1332  C CE1 . PHE A 1 172  ? -6.224  8.566   87.413  1.00 61.92  ? 169  PHE A CE1 1 
ATOM 1333  C CE2 . PHE A 1 172  ? -7.906  7.626   88.849  1.00 61.90  ? 169  PHE A CE2 1 
ATOM 1334  C CZ  . PHE A 1 172  ? -7.540  8.515   87.844  1.00 62.03  ? 169  PHE A CZ  1 
ATOM 1335  N N   . LEU A 1 173  ? -4.449  4.690   92.588  1.00 63.63  ? 170  LEU A N   1 
ATOM 1336  C CA  . LEU A 1 173  ? -4.109  3.645   93.557  1.00 64.27  ? 170  LEU A CA  1 
ATOM 1337  C C   . LEU A 1 173  ? -4.589  2.288   93.090  1.00 64.88  ? 170  LEU A C   1 
ATOM 1338  O O   . LEU A 1 173  ? -5.705  2.150   92.598  1.00 65.00  ? 170  LEU A O   1 
ATOM 1339  C CB  . LEU A 1 173  ? -4.739  3.940   94.920  1.00 64.10  ? 170  LEU A CB  1 
ATOM 1340  C CG  . LEU A 1 173  ? -4.392  5.241   95.639  1.00 63.96  ? 170  LEU A CG  1 
ATOM 1341  C CD1 . LEU A 1 173  ? -5.538  5.638   96.543  1.00 64.04  ? 170  LEU A CD1 1 
ATOM 1342  C CD2 . LEU A 1 173  ? -3.103  5.104   96.425  1.00 63.82  ? 170  LEU A CD2 1 
ATOM 1343  N N   . TYR A 1 174  ? -3.738  1.287   93.253  1.00 65.79  ? 171  TYR A N   1 
ATOM 1344  C CA  . TYR A 1 174  ? -4.099  -0.077  92.927  1.00 66.81  ? 171  TYR A CA  1 
ATOM 1345  C C   . TYR A 1 174  ? -5.056  -0.593  93.993  1.00 67.66  ? 171  TYR A C   1 
ATOM 1346  O O   . TYR A 1 174  ? -4.997  -0.152  95.146  1.00 67.79  ? 171  TYR A O   1 
ATOM 1347  C CB  . TYR A 1 174  ? -2.854  -0.959  92.902  1.00 66.73  ? 171  TYR A CB  1 
ATOM 1348  C CG  . TYR A 1 174  ? -1.898  -0.733  91.745  1.00 66.82  ? 171  TYR A CG  1 
ATOM 1349  C CD1 . TYR A 1 174  ? -1.158  0.446   91.631  1.00 66.64  ? 171  TYR A CD1 1 
ATOM 1350  C CD2 . TYR A 1 174  ? -1.698  -1.727  90.787  1.00 67.15  ? 171  TYR A CD2 1 
ATOM 1351  C CE1 . TYR A 1 174  ? -0.268  0.638   90.573  1.00 66.53  ? 171  TYR A CE1 1 
ATOM 1352  C CE2 . TYR A 1 174  ? -0.807  -1.549  89.733  1.00 66.91  ? 171  TYR A CE2 1 
ATOM 1353  C CZ  . TYR A 1 174  ? -0.097  -0.368  89.631  1.00 66.71  ? 171  TYR A CZ  1 
ATOM 1354  O OH  . TYR A 1 174  ? 0.781   -0.208  88.584  1.00 66.51  ? 171  TYR A OH  1 
ATOM 1355  N N   . GLY A 1 175  ? -5.938  -1.514  93.599  1.00 68.69  ? 172  GLY A N   1 
ATOM 1356  C CA  . GLY A 1 175  ? -6.807  -2.247  94.536  1.00 69.82  ? 172  GLY A CA  1 
ATOM 1357  C C   . GLY A 1 175  ? -7.965  -1.473  95.149  1.00 70.62  ? 172  GLY A C   1 
ATOM 1358  O O   . GLY A 1 175  ? -8.450  -1.820  96.235  1.00 70.61  ? 172  GLY A O   1 
ATOM 1359  N N   . CYS A 1 176  ? -8.405  -0.423  94.456  1.00 71.37  ? 173  CYS A N   1 
ATOM 1360  C CA  . CYS A 1 176  ? -9.534  0.391   94.905  1.00 72.13  ? 173  CYS A CA  1 
ATOM 1361  C C   . CYS A 1 176  ? -10.749 0.106   94.026  1.00 72.28  ? 173  CYS A C   1 
ATOM 1362  O O   . CYS A 1 176  ? -10.621 0.025   92.796  1.00 72.35  ? 173  CYS A O   1 
ATOM 1363  C CB  . CYS A 1 176  ? -9.176  1.884   94.867  1.00 72.30  ? 173  CYS A CB  1 
ATOM 1364  S SG  . CYS A 1 176  ? -7.845  2.412   96.013  1.00 73.32  ? 173  CYS A SG  1 
ATOM 1365  N N   . GLN A 1 177  ? -11.912 -0.050  94.663  1.00 72.39  ? 174  GLN A N   1 
ATOM 1366  C CA  . GLN A 1 177  ? -13.160 -0.394  93.973  1.00 72.56  ? 174  GLN A CA  1 
ATOM 1367  C C   . GLN A 1 177  ? -13.332 0.442   92.703  1.00 72.41  ? 174  GLN A C   1 
ATOM 1368  O O   . GLN A 1 177  ? -13.256 -0.072  91.581  1.00 72.42  ? 174  GLN A O   1 
ATOM 1369  C CB  . GLN A 1 177  ? -14.372 -0.207  94.900  1.00 72.70  ? 174  GLN A CB  1 
ATOM 1370  C CG  . GLN A 1 177  ? -14.206 -0.742  96.333  1.00 73.81  ? 174  GLN A CG  1 
ATOM 1371  C CD  . GLN A 1 177  ? -14.325 -2.265  96.446  1.00 75.15  ? 174  GLN A CD  1 
ATOM 1372  O OE1 . GLN A 1 177  ? -15.276 -2.786  97.041  1.00 75.13  ? 174  GLN A OE1 1 
ATOM 1373  N NE2 . GLN A 1 177  ? -13.351 -2.982  95.884  1.00 75.63  ? 174  GLN A NE2 1 
ATOM 1374  N N   . ALA A 1 178  ? -13.539 1.740   92.892  1.00 72.20  ? 175  ALA A N   1 
ATOM 1375  C CA  . ALA A 1 178  ? -13.652 2.671   91.780  1.00 71.87  ? 175  ALA A CA  1 
ATOM 1376  C C   . ALA A 1 178  ? -12.253 3.037   91.262  1.00 71.51  ? 175  ALA A C   1 
ATOM 1377  O O   . ALA A 1 178  ? -11.249 2.496   91.739  1.00 71.61  ? 175  ALA A O   1 
ATOM 1378  C CB  . ALA A 1 178  ? -14.429 3.927   92.228  1.00 71.88  ? 175  ALA A CB  1 
ATOM 1379  N N   . PRO A 1 179  ? -12.177 3.915   90.248  1.00 71.05  ? 176  PRO A N   1 
ATOM 1380  C CA  . PRO A 1 179  ? -10.903 4.592   90.052  1.00 70.60  ? 176  PRO A CA  1 
ATOM 1381  C C   . PRO A 1 179  ? -10.692 5.555   91.211  1.00 70.02  ? 176  PRO A C   1 
ATOM 1382  O O   . PRO A 1 179  ? -11.593 6.330   91.526  1.00 69.87  ? 176  PRO A O   1 
ATOM 1383  C CB  . PRO A 1 179  ? -11.112 5.368   88.745  1.00 70.73  ? 176  PRO A CB  1 
ATOM 1384  C CG  . PRO A 1 179  ? -12.313 4.734   88.093  1.00 71.02  ? 176  PRO A CG  1 
ATOM 1385  C CD  . PRO A 1 179  ? -13.169 4.295   89.226  1.00 71.11  ? 176  PRO A CD  1 
ATOM 1386  N N   . THR A 1 180  ? -9.529  5.491   91.853  1.00 69.49  ? 177  THR A N   1 
ATOM 1387  C CA  . THR A 1 180  ? -9.249  6.364   92.993  1.00 69.00  ? 177  THR A CA  1 
ATOM 1388  C C   . THR A 1 180  ? -7.914  7.105   92.881  1.00 68.64  ? 177  THR A C   1 
ATOM 1389  O O   . THR A 1 180  ? -6.880  6.497   92.613  1.00 68.60  ? 177  THR A O   1 
ATOM 1390  C CB  . THR A 1 180  ? -9.325  5.586   94.315  1.00 68.97  ? 177  THR A CB  1 
ATOM 1391  O OG1 . THR A 1 180  ? -10.616 4.974   94.423  1.00 68.79  ? 177  THR A OG1 1 
ATOM 1392  C CG2 . THR A 1 180  ? -9.107  6.513   95.508  1.00 68.97  ? 177  THR A CG2 1 
ATOM 1393  N N   . ILE A 1 181  ? -7.957  8.421   93.086  1.00 68.20  ? 178  ILE A N   1 
ATOM 1394  C CA  . ILE A 1 181  ? -6.749  9.249   93.087  1.00 67.85  ? 178  ILE A CA  1 
ATOM 1395  C C   . ILE A 1 181  ? -6.181  9.455   94.492  1.00 67.48  ? 178  ILE A C   1 
ATOM 1396  O O   . ILE A 1 181  ? -6.886  9.278   95.491  1.00 67.49  ? 178  ILE A O   1 
ATOM 1397  C CB  . ILE A 1 181  ? -6.963  10.631  92.398  1.00 67.97  ? 178  ILE A CB  1 
ATOM 1398  C CG1 . ILE A 1 181  ? -8.021  11.477  93.128  1.00 67.93  ? 178  ILE A CG1 1 
ATOM 1399  C CG2 . ILE A 1 181  ? -7.313  10.445  90.929  1.00 68.35  ? 178  ILE A CG2 1 
ATOM 1400  C CD1 . ILE A 1 181  ? -7.992  12.965  92.760  1.00 67.63  ? 178  ILE A CD1 1 
ATOM 1401  N N   . CYS A 1 182  ? -4.901  9.823   94.552  1.00 66.94  ? 179  CYS A N   1 
ATOM 1402  C CA  . CYS A 1 182  ? -4.220  10.100  95.813  1.00 66.28  ? 179  CYS A CA  1 
ATOM 1403  C C   . CYS A 1 182  ? -3.220  11.243  95.675  1.00 65.64  ? 179  CYS A C   1 
ATOM 1404  O O   . CYS A 1 182  ? -2.366  11.226  94.786  1.00 65.48  ? 179  CYS A O   1 
ATOM 1405  C CB  . CYS A 1 182  ? -3.508  8.858   96.324  1.00 66.28  ? 179  CYS A CB  1 
ATOM 1406  S SG  . CYS A 1 182  ? -2.683  9.168   97.883  1.00 67.33  ? 179  CYS A SG  1 
ATOM 1407  N N   . PHE A 1 183  ? -3.316  12.222  96.575  1.00 64.92  ? 180  PHE A N   1 
ATOM 1408  C CA  . PHE A 1 183  ? -2.595  13.481  96.398  1.00 64.22  ? 180  PHE A CA  1 
ATOM 1409  C C   . PHE A 1 183  ? -2.157  14.214  97.666  1.00 63.95  ? 180  PHE A C   1 
ATOM 1410  O O   . PHE A 1 183  ? -2.725  14.041  98.746  1.00 63.95  ? 180  PHE A O   1 
ATOM 1411  C CB  . PHE A 1 183  ? -3.369  14.426  95.452  1.00 64.05  ? 180  PHE A CB  1 
ATOM 1412  C CG  . PHE A 1 183  ? -4.696  14.924  95.995  1.00 63.76  ? 180  PHE A CG  1 
ATOM 1413  C CD1 . PHE A 1 183  ? -4.883  16.277  96.262  1.00 63.51  ? 180  PHE A CD1 1 
ATOM 1414  C CD2 . PHE A 1 183  ? -5.767  14.053  96.200  1.00 63.38  ? 180  PHE A CD2 1 
ATOM 1415  C CE1 . PHE A 1 183  ? -6.105  16.749  96.741  1.00 63.09  ? 180  PHE A CE1 1 
ATOM 1416  C CE2 . PHE A 1 183  ? -6.985  14.518  96.683  1.00 62.59  ? 180  PHE A CE2 1 
ATOM 1417  C CZ  . PHE A 1 183  ? -7.152  15.868  96.953  1.00 62.92  ? 180  PHE A CZ  1 
ATOM 1418  N N   . VAL A 1 184  ? -1.122  15.029  97.493  1.00 63.60  ? 181  VAL A N   1 
ATOM 1419  C CA  . VAL A 1 184  ? -0.608  15.919  98.517  1.00 63.28  ? 181  VAL A CA  1 
ATOM 1420  C C   . VAL A 1 184  ? -1.034  17.345  98.142  1.00 63.50  ? 181  VAL A C   1 
ATOM 1421  O O   . VAL A 1 184  ? -0.604  17.873  97.116  1.00 63.64  ? 181  VAL A O   1 
ATOM 1422  C CB  . VAL A 1 184  ? 0.940   15.834  98.587  1.00 62.95  ? 181  VAL A CB  1 
ATOM 1423  C CG1 . VAL A 1 184  ? 1.487   16.721  99.681  1.00 62.84  ? 181  VAL A CG1 1 
ATOM 1424  C CG2 . VAL A 1 184  ? 1.383   14.416  98.805  1.00 62.40  ? 181  VAL A CG2 1 
ATOM 1425  N N   . TYR A 1 185  ? -1.896  17.958  98.946  1.00 63.64  ? 182  TYR A N   1 
ATOM 1426  C CA  . TYR A 1 185  ? -2.250  19.359  98.717  1.00 63.85  ? 182  TYR A CA  1 
ATOM 1427  C C   . TYR A 1 185  ? -1.667  20.305  99.780  1.00 64.11  ? 182  TYR A C   1 
ATOM 1428  O O   . TYR A 1 185  ? -1.033  19.861  100.740 1.00 64.02  ? 182  TYR A O   1 
ATOM 1429  C CB  . TYR A 1 185  ? -3.770  19.538  98.568  1.00 63.72  ? 182  TYR A CB  1 
ATOM 1430  C CG  . TYR A 1 185  ? -4.569  19.163  99.793  1.00 63.60  ? 182  TYR A CG  1 
ATOM 1431  C CD1 . TYR A 1 185  ? -4.718  20.056  100.855 1.00 63.47  ? 182  TYR A CD1 1 
ATOM 1432  C CD2 . TYR A 1 185  ? -5.183  17.916  99.887  1.00 63.36  ? 182  TYR A CD2 1 
ATOM 1433  C CE1 . TYR A 1 185  ? -5.449  19.712  101.981 1.00 63.70  ? 182  TYR A CE1 1 
ATOM 1434  C CE2 . TYR A 1 185  ? -5.923  17.565  101.004 1.00 63.44  ? 182  TYR A CE2 1 
ATOM 1435  C CZ  . TYR A 1 185  ? -6.052  18.463  102.050 1.00 63.69  ? 182  TYR A CZ  1 
ATOM 1436  O OH  . TYR A 1 185  ? -6.776  18.109  103.167 1.00 63.62  ? 182  TYR A OH  1 
ATOM 1437  N N   . GLN A 1 186  ? -1.878  21.606  99.583  1.00 64.52  ? 183  GLN A N   1 
ATOM 1438  C CA  . GLN A 1 186  ? -1.436  22.637  100.518 1.00 65.13  ? 183  GLN A CA  1 
ATOM 1439  C C   . GLN A 1 186  ? -2.567  23.574  100.939 1.00 65.66  ? 183  GLN A C   1 
ATOM 1440  O O   . GLN A 1 186  ? -3.523  23.791  100.189 1.00 66.12  ? 183  GLN A O   1 
ATOM 1441  C CB  . GLN A 1 186  ? -0.307  23.462  99.915  1.00 64.89  ? 183  GLN A CB  1 
ATOM 1442  C CG  . GLN A 1 186  ? 1.046   23.233  100.559 1.00 65.52  ? 183  GLN A CG  1 
ATOM 1443  C CD  . GLN A 1 186  ? 2.053   24.316  100.193 1.00 66.68  ? 183  GLN A CD  1 
ATOM 1444  O OE1 . GLN A 1 186  ? 3.268   24.102  100.250 1.00 66.89  ? 183  GLN A OE1 1 
ATOM 1445  N NE2 . GLN A 1 186  ? 1.550   25.488  99.809  1.00 67.14  ? 183  GLN A NE2 1 
ATOM 1446  N N   . ASP A 1 187  ? -2.445  24.117  102.149 1.00 66.13  ? 184  ASP A N   1 
ATOM 1447  C CA  . ASP A 1 187  ? -3.341  25.150  102.668 1.00 66.44  ? 184  ASP A CA  1 
ATOM 1448  C C   . ASP A 1 187  ? -2.671  25.836  103.875 1.00 66.49  ? 184  ASP A C   1 
ATOM 1449  O O   . ASP A 1 187  ? -1.566  25.441  104.262 1.00 66.36  ? 184  ASP A O   1 
ATOM 1450  C CB  . ASP A 1 187  ? -4.732  24.566  102.998 1.00 66.64  ? 184  ASP A CB  1 
ATOM 1451  C CG  . ASP A 1 187  ? -4.700  23.520  104.108 1.00 67.40  ? 184  ASP A CG  1 
ATOM 1452  O OD1 . ASP A 1 187  ? -3.866  23.633  105.034 1.00 68.24  ? 184  ASP A OD1 1 
ATOM 1453  O OD2 . ASP A 1 187  ? -5.534  22.589  104.066 1.00 68.07  ? 184  ASP A OD2 1 
ATOM 1454  N N   . PRO A 1 188  ? -3.321  26.867  104.465 1.00 66.68  ? 185  PRO A N   1 
ATOM 1455  C CA  . PRO A 1 188  ? -2.724  27.573  105.610 1.00 66.80  ? 185  PRO A CA  1 
ATOM 1456  C C   . PRO A 1 188  ? -2.397  26.712  106.851 1.00 66.91  ? 185  PRO A C   1 
ATOM 1457  O O   . PRO A 1 188  ? -1.624  27.154  107.712 1.00 66.99  ? 185  PRO A O   1 
ATOM 1458  C CB  . PRO A 1 188  ? -3.773  28.647  105.955 1.00 66.85  ? 185  PRO A CB  1 
ATOM 1459  C CG  . PRO A 1 188  ? -5.048  28.170  105.342 1.00 66.74  ? 185  PRO A CG  1 
ATOM 1460  C CD  . PRO A 1 188  ? -4.623  27.458  104.093 1.00 66.84  ? 185  PRO A CD  1 
ATOM 1461  N N   . GLN A 1 189  ? -2.971  25.510  106.950 1.00 66.81  ? 186  GLN A N   1 
ATOM 1462  C CA  . GLN A 1 189  ? -2.618  24.587  108.038 1.00 66.71  ? 186  GLN A CA  1 
ATOM 1463  C C   . GLN A 1 189  ? -1.346  23.804  107.711 1.00 66.62  ? 186  GLN A C   1 
ATOM 1464  O O   . GLN A 1 189  ? -0.652  23.325  108.614 1.00 66.62  ? 186  GLN A O   1 
ATOM 1465  C CB  . GLN A 1 189  ? -3.763  23.622  108.360 1.00 66.73  ? 186  GLN A CB  1 
ATOM 1466  C CG  . GLN A 1 189  ? -5.009  24.281  108.938 1.00 66.97  ? 186  GLN A CG  1 
ATOM 1467  C CD  . GLN A 1 189  ? -6.010  24.690  107.868 1.00 67.67  ? 186  GLN A CD  1 
ATOM 1468  O OE1 . GLN A 1 189  ? -6.206  23.981  106.875 1.00 67.96  ? 186  GLN A OE1 1 
ATOM 1469  N NE2 . GLN A 1 189  ? -6.658  25.834  108.071 1.00 67.58  ? 186  GLN A NE2 1 
ATOM 1470  N N   . GLY A 1 190  ? -1.051  23.685  106.415 1.00 66.51  ? 187  GLY A N   1 
ATOM 1471  C CA  . GLY A 1 190  ? 0.136   22.979  105.933 1.00 66.11  ? 187  GLY A CA  1 
ATOM 1472  C C   . GLY A 1 190  ? -0.211  21.940  104.889 1.00 65.79  ? 187  GLY A C   1 
ATOM 1473  O O   . GLY A 1 190  ? -1.185  22.098  104.155 1.00 65.51  ? 187  GLY A O   1 
ATOM 1474  N N   . ARG A 1 191  ? 0.584   20.871  104.837 1.00 65.73  ? 188  ARG A N   1 
ATOM 1475  C CA  . ARG A 1 191  ? 0.413   19.813  103.839 1.00 65.68  ? 188  ARG A CA  1 
ATOM 1476  C C   . ARG A 1 191  ? -0.390  18.626  104.348 1.00 65.60  ? 188  ARG A C   1 
ATOM 1477  O O   . ARG A 1 191  ? -0.211  18.183  105.485 1.00 65.52  ? 188  ARG A O   1 
ATOM 1478  C CB  . ARG A 1 191  ? 1.762   19.344  103.303 1.00 65.66  ? 188  ARG A CB  1 
ATOM 1479  C CG  . ARG A 1 191  ? 2.240   20.137  102.108 1.00 65.80  ? 188  ARG A CG  1 
ATOM 1480  C CD  . ARG A 1 191  ? 3.393   19.430  101.419 1.00 66.69  ? 188  ARG A CD  1 
ATOM 1481  N NE  . ARG A 1 191  ? 3.734   20.015  100.121 1.00 66.97  ? 188  ARG A NE  1 
ATOM 1482  C CZ  . ARG A 1 191  ? 4.386   21.164  99.959  1.00 67.33  ? 188  ARG A CZ  1 
ATOM 1483  N NH1 . ARG A 1 191  ? 4.759   21.877  101.014 1.00 67.95  ? 188  ARG A NH1 1 
ATOM 1484  N NH2 . ARG A 1 191  ? 4.657   21.611  98.740  1.00 67.13  ? 188  ARG A NH2 1 
ATOM 1485  N N   . HIS A 1 192  ? -1.269  18.114  103.486 1.00 65.50  ? 189  HIS A N   1 
ATOM 1486  C CA  . HIS A 1 192  ? -2.165  17.011  103.841 1.00 65.44  ? 189  HIS A CA  1 
ATOM 1487  C C   . HIS A 1 192  ? -2.284  15.971  102.721 1.00 65.36  ? 189  HIS A C   1 
ATOM 1488  O O   . HIS A 1 192  ? -1.973  16.253  101.563 1.00 65.35  ? 189  HIS A O   1 
ATOM 1489  C CB  . HIS A 1 192  ? -3.560  17.542  104.211 1.00 65.43  ? 189  HIS A CB  1 
ATOM 1490  C CG  . HIS A 1 192  ? -3.546  18.649  105.220 1.00 65.22  ? 189  HIS A CG  1 
ATOM 1491  N ND1 . HIS A 1 192  ? -3.551  19.981  104.864 1.00 64.91  ? 189  HIS A ND1 1 
ATOM 1492  C CD2 . HIS A 1 192  ? -3.521  18.622  106.574 1.00 64.85  ? 189  HIS A CD2 1 
ATOM 1493  C CE1 . HIS A 1 192  ? -3.532  20.726  105.955 1.00 64.72  ? 189  HIS A CE1 1 
ATOM 1494  N NE2 . HIS A 1 192  ? -3.513  19.926  107.005 1.00 64.71  ? 189  HIS A NE2 1 
ATOM 1495  N N   . VAL A 1 193  ? -2.733  14.770  103.082 1.00 65.27  ? 190  VAL A N   1 
ATOM 1496  C CA  . VAL A 1 193  ? -3.010  13.705  102.116 1.00 65.22  ? 190  VAL A CA  1 
ATOM 1497  C C   . VAL A 1 193  ? -4.512  13.406  102.068 1.00 65.20  ? 190  VAL A C   1 
ATOM 1498  O O   . VAL A 1 193  ? -5.193  13.442  103.089 1.00 65.05  ? 190  VAL A O   1 
ATOM 1499  C CB  . VAL A 1 193  ? -2.176  12.421  102.404 1.00 65.27  ? 190  VAL A CB  1 
ATOM 1500  C CG1 . VAL A 1 193  ? -2.363  11.938  103.844 1.00 65.38  ? 190  VAL A CG1 1 
ATOM 1501  C CG2 . VAL A 1 193  ? -2.507  11.311  101.410 1.00 65.26  ? 190  VAL A CG2 1 
ATOM 1502  N N   . LYS A 1 194  ? -5.014  13.118  100.872 1.00 65.27  ? 191  LYS A N   1 
ATOM 1503  C CA  . LYS A 1 194  ? -6.444  12.946  100.639 1.00 65.30  ? 191  LYS A CA  1 
ATOM 1504  C C   . LYS A 1 194  ? -6.670  11.958  99.496  1.00 65.41  ? 191  LYS A C   1 
ATOM 1505  O O   . LYS A 1 194  ? -5.825  11.821  98.605  1.00 65.28  ? 191  LYS A O   1 
ATOM 1506  C CB  . LYS A 1 194  ? -7.072  14.310  100.315 1.00 65.27  ? 191  LYS A CB  1 
ATOM 1507  C CG  . LYS A 1 194  ? -8.551  14.314  99.914  1.00 65.38  ? 191  LYS A CG  1 
ATOM 1508  C CD  . LYS A 1 194  ? -9.488  14.513  101.096 1.00 65.34  ? 191  LYS A CD  1 
ATOM 1509  C CE  . LYS A 1 194  ? -10.811 15.119  100.650 1.00 64.71  ? 191  LYS A CE  1 
ATOM 1510  N NZ  . LYS A 1 194  ? -10.650 16.546  100.247 1.00 64.23  ? 191  LYS A NZ  1 
ATOM 1511  N N   . THR A 1 195  ? -7.800  11.255  99.541  1.00 65.59  ? 192  THR A N   1 
ATOM 1512  C CA  . THR A 1 195  ? -8.221  10.397  98.438  1.00 65.79  ? 192  THR A CA  1 
ATOM 1513  C C   . THR A 1 195  ? -9.656  10.675  98.020  1.00 66.18  ? 192  THR A C   1 
ATOM 1514  O O   . THR A 1 195  ? -10.527 10.943  98.856  1.00 65.89  ? 192  THR A O   1 
ATOM 1515  C CB  . THR A 1 195  ? -8.078  8.910   98.766  1.00 65.65  ? 192  THR A CB  1 
ATOM 1516  O OG1 . THR A 1 195  ? -8.658  8.651   100.047 1.00 65.48  ? 192  THR A OG1 1 
ATOM 1517  C CG2 . THR A 1 195  ? -6.614  8.508   98.781  1.00 65.68  ? 192  THR A CG2 1 
ATOM 1518  N N   . TYR A 1 196  ? -9.872  10.619  96.706  1.00 66.82  ? 193  TYR A N   1 
ATOM 1519  C CA  . TYR A 1 196  ? -11.191 10.724  96.095  1.00 67.41  ? 193  TYR A CA  1 
ATOM 1520  C C   . TYR A 1 196  ? -11.432 9.500   95.217  1.00 68.00  ? 193  TYR A C   1 
ATOM 1521  O O   . TYR A 1 196  ? -10.566 9.128   94.424  1.00 68.01  ? 193  TYR A O   1 
ATOM 1522  C CB  . TYR A 1 196  ? -11.289 11.972  95.212  1.00 67.19  ? 193  TYR A CB  1 
ATOM 1523  C CG  . TYR A 1 196  ? -11.436 13.302  95.922  1.00 66.91  ? 193  TYR A CG  1 
ATOM 1524  C CD1 . TYR A 1 196  ? -10.389 14.220  95.943  1.00 66.56  ? 193  TYR A CD1 1 
ATOM 1525  C CD2 . TYR A 1 196  ? -12.633 13.662  96.533  1.00 67.23  ? 193  TYR A CD2 1 
ATOM 1526  C CE1 . TYR A 1 196  ? -10.522 15.456  96.573  1.00 66.77  ? 193  TYR A CE1 1 
ATOM 1527  C CE2 . TYR A 1 196  ? -12.777 14.898  97.173  1.00 67.42  ? 193  TYR A CE2 1 
ATOM 1528  C CZ  . TYR A 1 196  ? -11.718 15.789  97.188  1.00 67.09  ? 193  TYR A CZ  1 
ATOM 1529  O OH  . TYR A 1 196  ? -11.862 17.009  97.817  1.00 66.97  ? 193  TYR A OH  1 
ATOM 1530  N N   . GLU A 1 197  ? -12.600 8.878   95.369  1.00 68.80  ? 194  GLU A N   1 
ATOM 1531  C CA  . GLU A 1 197  ? -13.066 7.846   94.445  1.00 69.61  ? 194  GLU A CA  1 
ATOM 1532  C C   . GLU A 1 197  ? -13.693 8.546   93.245  1.00 69.92  ? 194  GLU A C   1 
ATOM 1533  O O   . GLU A 1 197  ? -14.614 9.341   93.408  1.00 70.05  ? 194  GLU A O   1 
ATOM 1534  C CB  . GLU A 1 197  ? -14.110 6.945   95.117  1.00 69.67  ? 194  GLU A CB  1 
ATOM 1535  C CG  . GLU A 1 197  ? -13.552 5.859   96.047  1.00 70.11  ? 194  GLU A CG  1 
ATOM 1536  C CD  . GLU A 1 197  ? -14.645 4.976   96.664  1.00 70.10  ? 194  GLU A CD  1 
ATOM 1537  O OE1 . GLU A 1 197  ? -15.562 4.537   95.926  1.00 70.58  ? 194  GLU A OE1 1 
ATOM 1538  O OE2 . GLU A 1 197  ? -14.575 4.714   97.889  1.00 70.31  ? 194  GLU A OE2 1 
ATOM 1539  N N   . VAL A 1 198  ? -13.205 8.256   92.043  1.00 70.48  ? 195  VAL A N   1 
ATOM 1540  C CA  . VAL A 1 198  ? -13.670 8.965   90.846  1.00 71.16  ? 195  VAL A CA  1 
ATOM 1541  C C   . VAL A 1 198  ? -14.686 8.154   90.024  1.00 71.84  ? 195  VAL A C   1 
ATOM 1542  O O   . VAL A 1 198  ? -14.316 7.372   89.138  1.00 71.89  ? 195  VAL A O   1 
ATOM 1543  C CB  . VAL A 1 198  ? -12.487 9.475   89.970  1.00 71.00  ? 195  VAL A CB  1 
ATOM 1544  C CG1 . VAL A 1 198  ? -12.989 10.280  88.786  1.00 70.67  ? 195  VAL A CG1 1 
ATOM 1545  C CG2 . VAL A 1 198  ? -11.558 10.340  90.798  1.00 71.22  ? 195  VAL A CG2 1 
ATOM 1546  N N   . SER A 1 199  ? -15.968 8.346   90.346  1.00 72.61  ? 196  SER A N   1 
ATOM 1547  C CA  . SER A 1 199  ? -17.073 7.788   89.570  1.00 73.14  ? 196  SER A CA  1 
ATOM 1548  C C   . SER A 1 199  ? -17.305 8.672   88.369  1.00 73.49  ? 196  SER A C   1 
ATOM 1549  O O   . SER A 1 199  ? -17.526 9.874   88.514  1.00 73.46  ? 196  SER A O   1 
ATOM 1550  C CB  . SER A 1 199  ? -18.353 7.724   90.401  1.00 73.21  ? 196  SER A CB  1 
ATOM 1551  O OG  . SER A 1 199  ? -19.498 7.774   89.562  1.00 73.36  ? 196  SER A OG  1 
ATOM 1552  N N   . LEU A 1 200  ? -17.260 8.068   87.189  1.00 74.08  ? 197  LEU A N   1 
ATOM 1553  C CA  . LEU A 1 200  ? -17.394 8.812   85.941  1.00 74.85  ? 197  LEU A CA  1 
ATOM 1554  C C   . LEU A 1 200  ? -18.821 8.770   85.399  1.00 75.31  ? 197  LEU A C   1 
ATOM 1555  O O   . LEU A 1 200  ? -19.161 9.465   84.440  1.00 75.38  ? 197  LEU A O   1 
ATOM 1556  C CB  . LEU A 1 200  ? -16.367 8.329   84.905  1.00 74.79  ? 197  LEU A CB  1 
ATOM 1557  C CG  . LEU A 1 200  ? -16.354 6.901   84.346  1.00 75.06  ? 197  LEU A CG  1 
ATOM 1558  C CD1 . LEU A 1 200  ? -15.064 6.699   83.559  1.00 74.77  ? 197  LEU A CD1 1 
ATOM 1559  C CD2 . LEU A 1 200  ? -16.505 5.815   85.421  1.00 75.54  ? 197  LEU A CD2 1 
ATOM 1560  N N   . ARG A 1 201  ? -19.648 7.949   86.032  1.00 75.98  ? 198  ARG A N   1 
ATOM 1561  C CA  . ARG A 1 201  ? -21.071 7.911   85.741  1.00 76.67  ? 198  ARG A CA  1 
ATOM 1562  C C   . ARG A 1 201  ? -21.727 9.235   86.148  1.00 76.84  ? 198  ARG A C   1 
ATOM 1563  O O   . ARG A 1 201  ? -22.425 9.856   85.345  1.00 76.92  ? 198  ARG A O   1 
ATOM 1564  C CB  . ARG A 1 201  ? -21.717 6.715   86.455  1.00 76.86  ? 198  ARG A CB  1 
ATOM 1565  C CG  . ARG A 1 201  ? -23.243 6.691   86.450  1.00 77.73  ? 198  ARG A CG  1 
ATOM 1566  C CD  . ARG A 1 201  ? -23.764 5.265   86.392  1.00 79.29  ? 198  ARG A CD  1 
ATOM 1567  N NE  . ARG A 1 201  ? -23.484 4.650   85.091  1.00 80.16  ? 198  ARG A NE  1 
ATOM 1568  C CZ  . ARG A 1 201  ? -24.344 4.591   84.075  1.00 80.40  ? 198  ARG A CZ  1 
ATOM 1569  N NH1 . ARG A 1 201  ? -25.568 5.099   84.186  1.00 80.51  ? 198  ARG A NH1 1 
ATOM 1570  N NH2 . ARG A 1 201  ? -23.979 4.013   82.939  1.00 80.28  ? 198  ARG A NH2 1 
ATOM 1571  N N   . GLU A 1 202  ? -21.478 9.670   87.382  1.00 77.05  ? 199  GLU A N   1 
ATOM 1572  C CA  . GLU A 1 202  ? -22.133 10.856  87.930  1.00 77.34  ? 199  GLU A CA  1 
ATOM 1573  C C   . GLU A 1 202  ? -21.283 12.116  87.745  1.00 77.44  ? 199  GLU A C   1 
ATOM 1574  O O   . GLU A 1 202  ? -21.709 13.214  88.122  1.00 77.56  ? 199  GLU A O   1 
ATOM 1575  C CB  . GLU A 1 202  ? -22.464 10.653  89.417  1.00 77.40  ? 199  GLU A CB  1 
ATOM 1576  C CG  . GLU A 1 202  ? -22.982 9.249   89.802  1.00 77.85  ? 199  GLU A CG  1 
ATOM 1577  C CD  . GLU A 1 202  ? -24.414 8.951   89.342  1.00 78.06  ? 199  GLU A CD  1 
ATOM 1578  O OE1 . GLU A 1 202  ? -24.780 7.753   89.284  1.00 77.49  ? 199  GLU A OE1 1 
ATOM 1579  O OE2 . GLU A 1 202  ? -25.171 9.904   89.045  1.00 78.30  ? 199  GLU A OE2 1 
ATOM 1580  N N   . LYS A 1 203  ? -20.100 11.940  87.145  1.00 77.44  ? 200  LYS A N   1 
ATOM 1581  C CA  . LYS A 1 203  ? -19.055 12.982  87.010  1.00 77.42  ? 200  LYS A CA  1 
ATOM 1582  C C   . LYS A 1 203  ? -18.680 13.659  88.342  1.00 77.40  ? 200  LYS A C   1 
ATOM 1583  O O   . LYS A 1 203  ? -18.385 14.857  88.392  1.00 77.34  ? 200  LYS A O   1 
ATOM 1584  C CB  . LYS A 1 203  ? -19.416 14.029  85.948  1.00 77.39  ? 200  LYS A CB  1 
ATOM 1585  C CG  . LYS A 1 203  ? -19.833 13.472  84.601  1.00 77.61  ? 200  LYS A CG  1 
ATOM 1586  C CD  . LYS A 1 203  ? -19.624 14.515  83.509  1.00 78.34  ? 200  LYS A CD  1 
ATOM 1587  C CE  . LYS A 1 203  ? -20.917 14.845  82.762  1.00 79.05  ? 200  LYS A CE  1 
ATOM 1588  N NZ  . LYS A 1 203  ? -21.635 13.658  82.206  1.00 79.69  ? 200  LYS A NZ  1 
ATOM 1589  N N   . GLU A 1 204  ? -18.681 12.872  89.412  1.00 77.39  ? 201  GLU A N   1 
ATOM 1590  C CA  . GLU A 1 204  ? -18.433 13.385  90.751  1.00 77.42  ? 201  GLU A CA  1 
ATOM 1591  C C   . GLU A 1 204  ? -17.102 12.890  91.305  1.00 77.26  ? 201  GLU A C   1 
ATOM 1592  O O   . GLU A 1 204  ? -16.387 12.121  90.656  1.00 77.10  ? 201  GLU A O   1 
ATOM 1593  C CB  . GLU A 1 204  ? -19.580 12.997  91.695  1.00 77.46  ? 201  GLU A CB  1 
ATOM 1594  C CG  . GLU A 1 204  ? -20.937 13.573  91.304  1.00 77.58  ? 201  GLU A CG  1 
ATOM 1595  C CD  . GLU A 1 204  ? -21.958 13.515  92.427  1.00 77.73  ? 201  GLU A CD  1 
ATOM 1596  O OE1 . GLU A 1 204  ? -21.558 13.459  93.612  1.00 78.17  ? 201  GLU A OE1 1 
ATOM 1597  O OE2 . GLU A 1 204  ? -23.169 13.539  92.120  1.00 78.13  ? 201  GLU A OE2 1 
ATOM 1598  N N   . PHE A 1 205  ? -16.792 13.337  92.519  1.00 77.13  ? 202  PHE A N   1 
ATOM 1599  C CA  . PHE A 1 205  ? -15.545 13.001  93.184  1.00 76.97  ? 202  PHE A CA  1 
ATOM 1600  C C   . PHE A 1 205  ? -15.725 12.087  94.386  1.00 76.83  ? 202  PHE A C   1 
ATOM 1601  O O   . PHE A 1 205  ? -14.746 11.540  94.902  1.00 76.87  ? 202  PHE A O   1 
ATOM 1602  C CB  . PHE A 1 205  ? -14.817 14.278  93.596  1.00 77.02  ? 202  PHE A CB  1 
ATOM 1603  C CG  . PHE A 1 205  ? -13.521 14.501  92.866  1.00 77.25  ? 202  PHE A CG  1 
ATOM 1604  C CD1 . PHE A 1 205  ? -12.578 15.396  93.362  1.00 77.56  ? 202  PHE A CD1 1 
ATOM 1605  C CD2 . PHE A 1 205  ? -13.229 13.799  91.699  1.00 77.17  ? 202  PHE A CD2 1 
ATOM 1606  C CE1 . PHE A 1 205  ? -11.375 15.605  92.700  1.00 77.43  ? 202  PHE A CE1 1 
ATOM 1607  C CE2 . PHE A 1 205  ? -12.030 14.000  91.033  1.00 77.20  ? 202  PHE A CE2 1 
ATOM 1608  C CZ  . PHE A 1 205  ? -11.101 14.904  91.534  1.00 77.32  ? 202  PHE A CZ  1 
ATOM 1609  N N   . ASN A 1 206  ? -16.973 11.922  94.823  1.00 76.61  ? 203  ASN A N   1 
ATOM 1610  C CA  . ASN A 1 206  ? -17.302 11.101  95.995  1.00 76.29  ? 203  ASN A CA  1 
ATOM 1611  C C   . ASN A 1 206  ? -16.294 11.272  97.142  1.00 75.99  ? 203  ASN A C   1 
ATOM 1612  O O   . ASN A 1 206  ? -15.888 12.396  97.454  1.00 76.00  ? 203  ASN A O   1 
ATOM 1613  C CB  . ASN A 1 206  ? -17.477 9.625   95.596  1.00 76.27  ? 203  ASN A CB  1 
ATOM 1614  C CG  . ASN A 1 206  ? -18.699 9.396   94.709  1.00 76.26  ? 203  ASN A CG  1 
ATOM 1615  O OD1 . ASN A 1 206  ? -18.591 8.829   93.621  1.00 75.94  ? 203  ASN A OD1 1 
ATOM 1616  N ND2 . ASN A 1 206  ? -19.864 9.840   95.173  1.00 76.21  ? 203  ASN A ND2 1 
ATOM 1617  N N   . LYS A 1 207  ? -15.893 10.168  97.764  1.00 75.57  ? 204  LYS A N   1 
ATOM 1618  C CA  . LYS A 1 207  ? -14.906 10.216  98.839  1.00 75.17  ? 204  LYS A CA  1 
ATOM 1619  C C   . LYS A 1 207  ? -14.017 8.982   98.775  1.00 74.58  ? 204  LYS A C   1 
ATOM 1620  O O   . LYS A 1 207  ? -14.502 7.869   98.560  1.00 74.54  ? 204  LYS A O   1 
ATOM 1621  C CB  . LYS A 1 207  ? -15.588 10.332  100.209 1.00 75.17  ? 204  LYS A CB  1 
ATOM 1622  C CG  . LYS A 1 207  ? -14.673 10.861  101.314 1.00 75.51  ? 204  LYS A CG  1 
ATOM 1623  C CD  . LYS A 1 207  ? -15.337 10.787  102.688 1.00 75.58  ? 204  LYS A CD  1 
ATOM 1624  C CE  . LYS A 1 207  ? -14.311 10.936  103.817 1.00 76.09  ? 204  LYS A CE  1 
ATOM 1625  N NZ  . LYS A 1 207  ? -14.943 10.938  105.177 1.00 76.04  ? 204  LYS A NZ  1 
ATOM 1626  N N   . GLY A 1 208  ? -12.716 9.190   98.960  1.00 73.94  ? 205  GLY A N   1 
ATOM 1627  C CA  . GLY A 1 208  ? -11.739 8.111   98.862  1.00 73.22  ? 205  GLY A CA  1 
ATOM 1628  C C   . GLY A 1 208  ? -11.818 7.066   99.963  1.00 72.68  ? 205  GLY A C   1 
ATOM 1629  O O   . GLY A 1 208  ? -12.517 7.258   100.962 1.00 72.77  ? 205  GLY A O   1 
ATOM 1630  N N   . PRO A 1 209  ? -11.089 5.951   99.789  1.00 72.11  ? 206  PRO A N   1 
ATOM 1631  C CA  . PRO A 1 209  ? -11.122 4.814   100.695 1.00 71.55  ? 206  PRO A CA  1 
ATOM 1632  C C   . PRO A 1 209  ? -10.539 5.057   102.089 1.00 71.03  ? 206  PRO A C   1 
ATOM 1633  O O   . PRO A 1 209  ? -10.766 4.238   102.979 1.00 71.11  ? 206  PRO A O   1 
ATOM 1634  C CB  . PRO A 1 209  ? -10.300 3.749   99.953  1.00 71.63  ? 206  PRO A CB  1 
ATOM 1635  C CG  . PRO A 1 209  ? -10.220 4.217   98.546  1.00 71.82  ? 206  PRO A CG  1 
ATOM 1636  C CD  . PRO A 1 209  ? -10.180 5.700   98.660  1.00 72.10  ? 206  PRO A CD  1 
ATOM 1637  N N   . TRP A 1 210  ? -9.802  6.146   102.299 1.00 70.40  ? 207  TRP A N   1 
ATOM 1638  C CA  . TRP A 1 210  ? -9.336  6.448   103.659 1.00 69.98  ? 207  TRP A CA  1 
ATOM 1639  C C   . TRP A 1 210  ? -9.179  7.907   104.015 1.00 69.51  ? 207  TRP A C   1 
ATOM 1640  O O   . TRP A 1 210  ? -8.819  8.728   103.174 1.00 69.35  ? 207  TRP A O   1 
ATOM 1641  C CB  . TRP A 1 210  ? -8.063  5.672   104.023 1.00 70.25  ? 207  TRP A CB  1 
ATOM 1642  C CG  . TRP A 1 210  ? -6.955  5.744   103.018 1.00 70.28  ? 207  TRP A CG  1 
ATOM 1643  C CD1 . TRP A 1 210  ? -6.003  6.719   102.909 1.00 70.34  ? 207  TRP A CD1 1 
ATOM 1644  C CD2 . TRP A 1 210  ? -6.661  4.778   102.003 1.00 70.12  ? 207  TRP A CD2 1 
ATOM 1645  N NE1 . TRP A 1 210  ? -5.143  6.426   101.878 1.00 70.48  ? 207  TRP A NE1 1 
ATOM 1646  C CE2 . TRP A 1 210  ? -5.524  5.241   101.304 1.00 70.48  ? 207  TRP A CE2 1 
ATOM 1647  C CE3 . TRP A 1 210  ? -7.251  3.568   101.613 1.00 69.82  ? 207  TRP A CE3 1 
ATOM 1648  C CZ2 . TRP A 1 210  ? -4.968  4.537   100.227 1.00 70.61  ? 207  TRP A CZ2 1 
ATOM 1649  C CZ3 . TRP A 1 210  ? -6.702  2.869   100.545 1.00 70.11  ? 207  TRP A CZ3 1 
ATOM 1650  C CH2 . TRP A 1 210  ? -5.571  3.355   99.865  1.00 70.35  ? 207  TRP A CH2 1 
ATOM 1651  N N   . LYS A 1 211  ? -9.432  8.196   105.291 1.00 69.01  ? 208  LYS A N   1 
ATOM 1652  C CA  . LYS A 1 211  ? -9.492  9.552   105.824 1.00 68.64  ? 208  LYS A CA  1 
ATOM 1653  C C   . LYS A 1 211  ? -8.230  10.360  105.588 1.00 68.60  ? 208  LYS A C   1 
ATOM 1654  O O   . LYS A 1 211  ? -7.118  9.839   105.655 1.00 68.53  ? 208  LYS A O   1 
ATOM 1655  C CB  . LYS A 1 211  ? -9.814  9.528   107.320 1.00 68.69  ? 208  LYS A CB  1 
ATOM 1656  C CG  . LYS A 1 211  ? -11.289 9.339   107.645 1.00 68.57  ? 208  LYS A CG  1 
ATOM 1657  C CD  . LYS A 1 211  ? -11.507 9.088   109.134 1.00 68.25  ? 208  LYS A CD  1 
ATOM 1658  C CE  . LYS A 1 211  ? -12.974 8.853   109.458 1.00 67.29  ? 208  LYS A CE  1 
ATOM 1659  N NZ  . LYS A 1 211  ? -13.533 7.654   108.774 1.00 66.79  ? 208  LYS A NZ  1 
ATOM 1660  N N   . GLN A 1 212  ? -8.435  11.640  105.303 1.00 68.59  ? 209  GLN A N   1 
ATOM 1661  C CA  . GLN A 1 212  ? -7.364  12.597  105.104 1.00 68.69  ? 209  GLN A CA  1 
ATOM 1662  C C   . GLN A 1 212  ? -6.459  12.594  106.325 1.00 68.41  ? 209  GLN A C   1 
ATOM 1663  O O   . GLN A 1 212  ? -6.899  12.869  107.437 1.00 68.37  ? 209  GLN A O   1 
ATOM 1664  C CB  . GLN A 1 212  ? -7.958  13.993  104.835 1.00 68.96  ? 209  GLN A CB  1 
ATOM 1665  C CG  . GLN A 1 212  ? -7.031  15.194  105.088 1.00 69.86  ? 209  GLN A CG  1 
ATOM 1666  C CD  . GLN A 1 212  ? -7.786  16.417  105.607 1.00 70.64  ? 209  GLN A CD  1 
ATOM 1667  O OE1 . GLN A 1 212  ? -8.733  16.895  104.973 1.00 70.66  ? 209  GLN A OE1 1 
ATOM 1668  N NE2 . GLN A 1 212  ? -7.369  16.925  106.770 1.00 70.58  ? 209  GLN A NE2 1 
ATOM 1669  N N   . GLU A 1 213  ? -5.200  12.244  106.109 1.00 68.33  ? 210  GLU A N   1 
ATOM 1670  C CA  . GLU A 1 213  ? -4.214  12.257  107.178 1.00 68.30  ? 210  GLU A CA  1 
ATOM 1671  C C   . GLU A 1 213  ? -3.320  13.492  107.042 1.00 68.29  ? 210  GLU A C   1 
ATOM 1672  O O   . GLU A 1 213  ? -3.741  14.499  106.469 1.00 68.25  ? 210  GLU A O   1 
ATOM 1673  C CB  . GLU A 1 213  ? -3.409  10.944  107.201 1.00 68.33  ? 210  GLU A CB  1 
ATOM 1674  C CG  . GLU A 1 213  ? -4.253  9.646   107.321 1.00 67.92  ? 210  GLU A CG  1 
ATOM 1675  C CD  . GLU A 1 213  ? -5.032  9.506   108.640 1.00 67.04  ? 210  GLU A CD  1 
ATOM 1676  O OE1 . GLU A 1 213  ? -4.765  10.253  109.609 1.00 66.52  ? 210  GLU A OE1 1 
ATOM 1677  O OE2 . GLU A 1 213  ? -5.920  8.629   108.706 1.00 66.51  ? 210  GLU A OE2 1 
ATOM 1678  N N   . ASN A 1 214  ? -2.104  13.423  107.580 1.00 68.39  ? 211  ASN A N   1 
ATOM 1679  C CA  . ASN A 1 214  ? -1.168  14.550  107.543 1.00 68.46  ? 211  ASN A CA  1 
ATOM 1680  C C   . ASN A 1 214  ? 0.229   14.152  107.071 1.00 68.46  ? 211  ASN A C   1 
ATOM 1681  O O   . ASN A 1 214  ? 0.856   13.252  107.644 1.00 68.72  ? 211  ASN A O   1 
ATOM 1682  C CB  . ASN A 1 214  ? -1.066  15.222  108.919 1.00 68.39  ? 211  ASN A CB  1 
ATOM 1683  C CG  . ASN A 1 214  ? -2.362  15.875  109.349 1.00 68.36  ? 211  ASN A CG  1 
ATOM 1684  O OD1 . ASN A 1 214  ? -2.584  17.059  109.100 1.00 68.19  ? 211  ASN A OD1 1 
ATOM 1685  N ND2 . ASN A 1 214  ? -3.230  15.102  109.993 1.00 68.36  ? 211  ASN A ND2 1 
ATOM 1686  N N   . VAL A 1 215  ? 0.714   14.831  106.035 1.00 68.17  ? 212  VAL A N   1 
ATOM 1687  C CA  . VAL A 1 215  ? 2.088   14.637  105.570 1.00 67.93  ? 212  VAL A CA  1 
ATOM 1688  C C   . VAL A 1 215  ? 2.956   15.858  105.888 1.00 67.86  ? 212  VAL A C   1 
ATOM 1689  O O   . VAL A 1 215  ? 2.450   16.890  106.338 1.00 67.90  ? 212  VAL A O   1 
ATOM 1690  C CB  . VAL A 1 215  ? 2.147   14.282  104.074 1.00 67.94  ? 212  VAL A CB  1 
ATOM 1691  C CG1 . VAL A 1 215  ? 1.637   12.862  103.853 1.00 67.74  ? 212  VAL A CG1 1 
ATOM 1692  C CG2 . VAL A 1 215  ? 1.356   15.298  103.237 1.00 68.12  ? 212  VAL A CG2 1 
ATOM 1693  N N   . GLU A 1 216  ? 4.258   15.737  105.654 1.00 67.70  ? 213  GLU A N   1 
ATOM 1694  C CA  . GLU A 1 216  ? 5.212   16.752  106.090 1.00 67.62  ? 213  GLU A CA  1 
ATOM 1695  C C   . GLU A 1 216  ? 5.191   18.036  105.248 1.00 67.58  ? 213  GLU A C   1 
ATOM 1696  O O   . GLU A 1 216  ? 4.712   18.046  104.117 1.00 67.57  ? 213  GLU A O   1 
ATOM 1697  C CB  . GLU A 1 216  ? 6.621   16.162  106.133 1.00 67.56  ? 213  GLU A CB  1 
ATOM 1698  C CG  . GLU A 1 216  ? 7.357   16.295  104.831 1.00 67.51  ? 213  GLU A CG  1 
ATOM 1699  C CD  . GLU A 1 216  ? 8.812   15.958  104.948 1.00 67.36  ? 213  GLU A CD  1 
ATOM 1700  O OE1 . GLU A 1 216  ? 9.153   14.774  104.742 1.00 67.33  ? 213  GLU A OE1 1 
ATOM 1701  O OE2 . GLU A 1 216  ? 9.607   16.882  105.224 1.00 67.36  ? 213  GLU A OE2 1 
ATOM 1702  N N   . ALA A 1 217  ? 5.741   19.107  105.818 1.00 67.68  ? 214  ALA A N   1 
ATOM 1703  C CA  . ALA A 1 217  ? 5.742   20.440  105.219 1.00 67.72  ? 214  ALA A CA  1 
ATOM 1704  C C   . ALA A 1 217  ? 6.761   20.568  104.094 1.00 67.78  ? 214  ALA A C   1 
ATOM 1705  O O   . ALA A 1 217  ? 7.299   21.650  103.847 1.00 67.78  ? 214  ALA A O   1 
ATOM 1706  C CB  . ALA A 1 217  ? 6.001   21.495  106.298 1.00 67.77  ? 214  ALA A CB  1 
ATOM 1707  N N   . GLU A 1 218  ? 7.014   19.454  103.415 1.00 67.93  ? 215  GLU A N   1 
ATOM 1708  C CA  . GLU A 1 218  ? 7.963   19.389  102.304 1.00 68.04  ? 215  GLU A CA  1 
ATOM 1709  C C   . GLU A 1 218  ? 7.657   18.204  101.389 1.00 67.78  ? 215  GLU A C   1 
ATOM 1710  O O   . GLU A 1 218  ? 8.454   17.872  100.519 1.00 67.64  ? 215  GLU A O   1 
ATOM 1711  C CB  . GLU A 1 218  ? 9.400   19.281  102.837 1.00 68.31  ? 215  GLU A CB  1 
ATOM 1712  C CG  . GLU A 1 218  ? 10.155  20.601  102.937 1.00 69.25  ? 215  GLU A CG  1 
ATOM 1713  C CD  . GLU A 1 218  ? 10.631  21.104  101.579 1.00 70.54  ? 215  GLU A CD  1 
ATOM 1714  O OE1 . GLU A 1 218  ? 11.711  20.663  101.117 1.00 70.64  ? 215  GLU A OE1 1 
ATOM 1715  O OE2 . GLU A 1 218  ? 9.929   21.947  100.980 1.00 71.14  ? 215  GLU A OE2 1 
ATOM 1716  N N   . ALA A 1 219  ? 6.505   17.569  101.597 1.00 67.77  ? 216  ALA A N   1 
ATOM 1717  C CA  . ALA A 1 219  ? 6.090   16.403  100.818 1.00 67.98  ? 216  ALA A CA  1 
ATOM 1718  C C   . ALA A 1 219  ? 5.917   16.769  99.344  1.00 68.39  ? 216  ALA A C   1 
ATOM 1719  O O   . ALA A 1 219  ? 5.276   17.782  99.018  1.00 68.69  ? 216  ALA A O   1 
ATOM 1720  C CB  . ALA A 1 219  ? 4.810   15.825  101.381 1.00 67.80  ? 216  ALA A CB  1 
ATOM 1721  N N   . SER A 1 220  ? 6.484   15.947  98.456  1.00 68.44  ? 217  SER A N   1 
ATOM 1722  C CA  . SER A 1 220  ? 6.592   16.315  97.044  1.00 68.44  ? 217  SER A CA  1 
ATOM 1723  C C   . SER A 1 220  ? 6.483   15.168  96.040  1.00 68.51  ? 217  SER A C   1 
ATOM 1724  O O   . SER A 1 220  ? 6.750   15.355  94.855  1.00 68.62  ? 217  SER A O   1 
ATOM 1725  C CB  . SER A 1 220  ? 7.897   17.076  96.814  1.00 68.50  ? 217  SER A CB  1 
ATOM 1726  O OG  . SER A 1 220  ? 9.010   16.286  97.198  1.00 68.96  ? 217  SER A OG  1 
ATOM 1727  N N   . MET A 1 221  ? 6.093   13.988  96.500  1.00 68.68  ? 218  MET A N   1 
ATOM 1728  C CA  . MET A 1 221  ? 5.942   12.834  95.619  1.00 69.13  ? 218  MET A CA  1 
ATOM 1729  C C   . MET A 1 221  ? 4.959   11.835  96.196  1.00 68.74  ? 218  MET A C   1 
ATOM 1730  O O   . MET A 1 221  ? 5.064   11.451  97.360  1.00 68.77  ? 218  MET A O   1 
ATOM 1731  C CB  . MET A 1 221  ? 7.267   12.099  95.442  1.00 69.01  ? 218  MET A CB  1 
ATOM 1732  C CG  . MET A 1 221  ? 8.331   12.806  94.651  1.00 69.74  ? 218  MET A CG  1 
ATOM 1733  S SD  . MET A 1 221  ? 9.088   11.637  93.508  1.00 71.13  ? 218  MET A SD  1 
ATOM 1734  C CE  . MET A 1 221  ? 8.087   11.935  92.030  1.00 71.23  ? 218  MET A CE  1 
ATOM 1735  N N   . VAL A 1 222  ? 4.013   11.405  95.377  1.00 68.55  ? 219  VAL A N   1 
ATOM 1736  C CA  . VAL A 1 222  ? 3.172   10.283  95.731  1.00 68.44  ? 219  VAL A CA  1 
ATOM 1737  C C   . VAL A 1 222  ? 3.602   9.117   94.871  1.00 68.58  ? 219  VAL A C   1 
ATOM 1738  O O   . VAL A 1 222  ? 3.608   9.222   93.647  1.00 68.79  ? 219  VAL A O   1 
ATOM 1739  C CB  . VAL A 1 222  ? 1.695   10.572  95.456  1.00 68.39  ? 219  VAL A CB  1 
ATOM 1740  C CG1 . VAL A 1 222  ? 0.841   9.341   95.758  1.00 68.37  ? 219  VAL A CG1 1 
ATOM 1741  C CG2 . VAL A 1 222  ? 1.232   11.754  96.273  1.00 68.59  ? 219  VAL A CG2 1 
ATOM 1742  N N   . ILE A 1 223  ? 3.985   8.013   95.501  1.00 68.68  ? 220  ILE A N   1 
ATOM 1743  C CA  . ILE A 1 223  ? 4.224   6.780   94.761  1.00 68.80  ? 220  ILE A CA  1 
ATOM 1744  C C   . ILE A 1 223  ? 3.138   5.767   95.091  1.00 69.13  ? 220  ILE A C   1 
ATOM 1745  O O   . ILE A 1 223  ? 2.968   5.383   96.251  1.00 69.39  ? 220  ILE A O   1 
ATOM 1746  C CB  . ILE A 1 223  ? 5.612   6.189   95.040  1.00 68.63  ? 220  ILE A CB  1 
ATOM 1747  C CG1 . ILE A 1 223  ? 6.698   7.118   94.485  1.00 68.40  ? 220  ILE A CG1 1 
ATOM 1748  C CG2 . ILE A 1 223  ? 5.721   4.789   94.433  1.00 68.33  ? 220  ILE A CG2 1 
ATOM 1749  C CD1 . ILE A 1 223  ? 8.103   6.758   94.926  1.00 68.00  ? 220  ILE A CD1 1 
ATOM 1750  N N   . ALA A 1 224  ? 2.393   5.361   94.064  1.00 69.31  ? 221  ALA A N   1 
ATOM 1751  C CA  . ALA A 1 224  ? 1.389   4.312   94.196  1.00 69.46  ? 221  ALA A CA  1 
ATOM 1752  C C   . ALA A 1 224  ? 2.084   2.955   94.158  1.00 69.58  ? 221  ALA A C   1 
ATOM 1753  O O   . ALA A 1 224  ? 3.165   2.822   93.571  1.00 69.56  ? 221  ALA A O   1 
ATOM 1754  C CB  . ALA A 1 224  ? 0.364   4.419   93.087  1.00 69.48  ? 221  ALA A CB  1 
ATOM 1755  N N   . VAL A 1 225  ? 1.464   1.958   94.788  1.00 69.68  ? 222  VAL A N   1 
ATOM 1756  C CA  . VAL A 1 225  ? 2.073   0.633   94.935  1.00 69.76  ? 222  VAL A CA  1 
ATOM 1757  C C   . VAL A 1 225  ? 1.123   -0.477  94.452  1.00 69.96  ? 222  VAL A C   1 
ATOM 1758  O O   . VAL A 1 225  ? -0.086  -0.391  94.677  1.00 69.92  ? 222  VAL A O   1 
ATOM 1759  C CB  . VAL A 1 225  ? 2.522   0.378   96.390  1.00 69.68  ? 222  VAL A CB  1 
ATOM 1760  C CG1 . VAL A 1 225  ? 3.860   -0.330  96.404  1.00 69.60  ? 222  VAL A CG1 1 
ATOM 1761  C CG2 . VAL A 1 225  ? 2.651   1.689   97.154  1.00 69.57  ? 222  VAL A CG2 1 
ATOM 1762  N N   . PRO A 1 226  ? 1.670   -1.524  93.798  1.00 70.19  ? 223  PRO A N   1 
ATOM 1763  C CA  . PRO A 1 226  ? 0.868   -2.479  93.041  1.00 70.50  ? 223  PRO A CA  1 
ATOM 1764  C C   . PRO A 1 226  ? 0.082   -3.507  93.867  1.00 70.87  ? 223  PRO A C   1 
ATOM 1765  O O   . PRO A 1 226  ? -0.047  -3.372  95.088  1.00 70.95  ? 223  PRO A O   1 
ATOM 1766  C CB  . PRO A 1 226  ? 1.917   -3.182  92.178  1.00 70.51  ? 223  PRO A CB  1 
ATOM 1767  C CG  . PRO A 1 226  ? 3.098   -3.214  93.039  1.00 70.38  ? 223  PRO A CG  1 
ATOM 1768  C CD  . PRO A 1 226  ? 3.099   -1.880  93.732  1.00 70.30  ? 223  PRO A CD  1 
ATOM 1769  N N   . GLU A 1 227  ? -0.395  -4.543  93.169  1.00 71.13  ? 224  GLU A N   1 
ATOM 1770  C CA  . GLU A 1 227  ? -1.422  -5.482  93.645  1.00 71.31  ? 224  GLU A CA  1 
ATOM 1771  C C   . GLU A 1 227  ? -1.193  -6.258  94.952  1.00 71.34  ? 224  GLU A C   1 
ATOM 1772  O O   . GLU A 1 227  ? -2.156  -6.488  95.693  1.00 71.56  ? 224  GLU A O   1 
ATOM 1773  C CB  . GLU A 1 227  ? -1.815  -6.462  92.525  1.00 71.41  ? 224  GLU A CB  1 
ATOM 1774  C CG  . GLU A 1 227  ? -3.024  -6.028  91.696  1.00 71.81  ? 224  GLU A CG  1 
ATOM 1775  C CD  . GLU A 1 227  ? -4.308  -5.933  92.516  1.00 72.40  ? 224  GLU A CD  1 
ATOM 1776  O OE1 . GLU A 1 227  ? -4.828  -4.802  92.669  1.00 72.63  ? 224  GLU A OE1 1 
ATOM 1777  O OE2 . GLU A 1 227  ? -4.789  -6.980  93.012  1.00 72.09  ? 224  GLU A OE2 1 
ATOM 1778  N N   . PRO A 1 228  ? 0.052   -6.695  95.236  1.00 71.26  ? 225  PRO A N   1 
ATOM 1779  C CA  . PRO A 1 228  ? 0.217   -7.419  96.510  1.00 71.13  ? 225  PRO A CA  1 
ATOM 1780  C C   . PRO A 1 228  ? 0.041   -6.514  97.734  1.00 70.96  ? 225  PRO A C   1 
ATOM 1781  O O   . PRO A 1 228  ? -0.430  -6.972  98.777  1.00 70.80  ? 225  PRO A O   1 
ATOM 1782  C CB  . PRO A 1 228  ? 1.660   -7.941  96.443  1.00 71.15  ? 225  PRO A CB  1 
ATOM 1783  C CG  . PRO A 1 228  ? 2.082   -7.777  95.006  1.00 71.36  ? 225  PRO A CG  1 
ATOM 1784  C CD  . PRO A 1 228  ? 1.319   -6.605  94.489  1.00 71.19  ? 225  PRO A CD  1 
ATOM 1785  N N   . PHE A 1 229  ? 0.392   -5.236  97.577  1.00 70.81  ? 226  PHE A N   1 
ATOM 1786  C CA  . PHE A 1 229  ? 0.429   -4.272  98.676  1.00 70.55  ? 226  PHE A CA  1 
ATOM 1787  C C   . PHE A 1 229  ? -0.730  -3.273  98.642  1.00 69.96  ? 226  PHE A C   1 
ATOM 1788  O O   . PHE A 1 229  ? -1.638  -3.334  99.475  1.00 69.90  ? 226  PHE A O   1 
ATOM 1789  C CB  . PHE A 1 229  ? 1.772   -3.521  98.675  1.00 70.94  ? 226  PHE A CB  1 
ATOM 1790  C CG  . PHE A 1 229  ? 2.978   -4.427  98.735  1.00 71.94  ? 226  PHE A CG  1 
ATOM 1791  C CD1 . PHE A 1 229  ? 3.640   -4.812  97.568  1.00 72.71  ? 226  PHE A CD1 1 
ATOM 1792  C CD2 . PHE A 1 229  ? 3.450   -4.903  99.962  1.00 72.86  ? 226  PHE A CD2 1 
ATOM 1793  C CE1 . PHE A 1 229  ? 4.756   -5.659  97.627  1.00 73.00  ? 226  PHE A CE1 1 
ATOM 1794  C CE2 . PHE A 1 229  ? 4.565   -5.747  100.030 1.00 72.92  ? 226  PHE A CE2 1 
ATOM 1795  C CZ  . PHE A 1 229  ? 5.217   -6.125  98.860  1.00 72.74  ? 226  PHE A CZ  1 
ATOM 1796  N N   . GLY A 1 230  ? -0.690  -2.355  97.680  1.00 69.25  ? 227  GLY A N   1 
ATOM 1797  C CA  . GLY A 1 230  ? -1.603  -1.224  97.666  1.00 68.36  ? 227  GLY A CA  1 
ATOM 1798  C C   . GLY A 1 230  ? -1.191  -0.220  98.725  1.00 67.75  ? 227  GLY A C   1 
ATOM 1799  O O   . GLY A 1 230  ? -0.611  -0.583  99.745  1.00 67.54  ? 227  GLY A O   1 
ATOM 1800  N N   . GLY A 1 231  ? -1.493  1.049   98.480  1.00 67.32  ? 228  GLY A N   1 
ATOM 1801  C CA  . GLY A 1 231  ? -1.120  2.123   99.396  1.00 66.71  ? 228  GLY A CA  1 
ATOM 1802  C C   . GLY A 1 231  ? -0.329  3.203   98.688  1.00 66.26  ? 228  GLY A C   1 
ATOM 1803  O O   . GLY A 1 231  ? -0.087  3.111   97.481  1.00 66.36  ? 228  GLY A O   1 
ATOM 1804  N N   . ALA A 1 232  ? 0.081   4.224   99.434  1.00 65.69  ? 229  ALA A N   1 
ATOM 1805  C CA  . ALA A 1 232  ? 0.803   5.352   98.851  1.00 65.07  ? 229  ALA A CA  1 
ATOM 1806  C C   . ALA A 1 232  ? 2.075   5.675   99.608  1.00 64.66  ? 229  ALA A C   1 
ATOM 1807  O O   . ALA A 1 232  ? 2.038   5.998   100.791 1.00 64.78  ? 229  ALA A O   1 
ATOM 1808  C CB  . ALA A 1 232  ? -0.093  6.576   98.784  1.00 65.14  ? 229  ALA A CB  1 
ATOM 1809  N N   . ILE A 1 233  ? 3.204   5.582   98.921  1.00 64.14  ? 230  ILE A N   1 
ATOM 1810  C CA  . ILE A 1 233  ? 4.467   6.001   99.495  1.00 63.81  ? 230  ILE A CA  1 
ATOM 1811  C C   . ILE A 1 233  ? 4.639   7.479   99.206  1.00 63.72  ? 230  ILE A C   1 
ATOM 1812  O O   . ILE A 1 233  ? 4.605   7.887   98.050  1.00 63.74  ? 230  ILE A O   1 
ATOM 1813  C CB  . ILE A 1 233  ? 5.644   5.195   98.922  1.00 63.75  ? 230  ILE A CB  1 
ATOM 1814  C CG1 . ILE A 1 233  ? 5.675   3.803   99.549  1.00 63.31  ? 230  ILE A CG1 1 
ATOM 1815  C CG2 . ILE A 1 233  ? 6.974   5.922   99.155  1.00 63.68  ? 230  ILE A CG2 1 
ATOM 1816  C CD1 . ILE A 1 233  ? 6.477   2.797   98.759  1.00 63.27  ? 230  ILE A CD1 1 
ATOM 1817  N N   . ILE A 1 234  ? 4.812   8.271   100.261 1.00 63.67  ? 231  ILE A N   1 
ATOM 1818  C CA  . ILE A 1 234  ? 4.966   9.718   100.135 1.00 63.75  ? 231  ILE A CA  1 
ATOM 1819  C C   . ILE A 1 234  ? 6.368   10.177  100.544 1.00 63.94  ? 231  ILE A C   1 
ATOM 1820  O O   . ILE A 1 234  ? 6.852   9.843   101.626 1.00 63.81  ? 231  ILE A O   1 
ATOM 1821  C CB  . ILE A 1 234  ? 3.868   10.479  100.924 1.00 63.66  ? 231  ILE A CB  1 
ATOM 1822  C CG1 . ILE A 1 234  ? 2.543   10.453  100.159 1.00 63.45  ? 231  ILE A CG1 1 
ATOM 1823  C CG2 . ILE A 1 234  ? 4.267   11.929  101.179 1.00 63.72  ? 231  ILE A CG2 1 
ATOM 1824  C CD1 . ILE A 1 234  ? 1.627   9.319   100.537 1.00 63.48  ? 231  ILE A CD1 1 
ATOM 1825  N N   . ILE A 1 235  ? 7.009   10.948  99.671  1.00 64.31  ? 232  ILE A N   1 
ATOM 1826  C CA  . ILE A 1 235  ? 8.378   11.394  99.904  1.00 64.82  ? 232  ILE A CA  1 
ATOM 1827  C C   . ILE A 1 235  ? 8.476   12.903  100.074 1.00 65.24  ? 232  ILE A C   1 
ATOM 1828  O O   . ILE A 1 235  ? 7.997   13.668  99.235  1.00 65.19  ? 232  ILE A O   1 
ATOM 1829  C CB  . ILE A 1 235  ? 9.318   10.972  98.758  1.00 64.81  ? 232  ILE A CB  1 
ATOM 1830  C CG1 . ILE A 1 235  ? 8.961   9.575   98.248  1.00 64.82  ? 232  ILE A CG1 1 
ATOM 1831  C CG2 . ILE A 1 235  ? 10.784  11.037  99.211  1.00 64.82  ? 232  ILE A CG2 1 
ATOM 1832  C CD1 . ILE A 1 235  ? 9.364   9.353   96.814  1.00 65.55  ? 232  ILE A CD1 1 
ATOM 1833  N N   . GLY A 1 236  ? 9.105   13.320  101.169 1.00 65.86  ? 233  GLY A N   1 
ATOM 1834  C CA  . GLY A 1 236  ? 9.398   14.731  101.404 1.00 66.59  ? 233  GLY A CA  1 
ATOM 1835  C C   . GLY A 1 236  ? 10.893  14.965  101.479 1.00 67.08  ? 233  GLY A C   1 
ATOM 1836  O O   . GLY A 1 236  ? 11.670  14.342  100.746 1.00 67.26  ? 233  GLY A O   1 
ATOM 1837  N N   . GLN A 1 237  ? 11.294  15.891  102.341 1.00 67.35  ? 234  GLN A N   1 
ATOM 1838  C CA  . GLN A 1 237  ? 12.686  16.019  102.720 1.00 67.83  ? 234  GLN A CA  1 
ATOM 1839  C C   . GLN A 1 237  ? 12.861  15.202  103.980 1.00 68.03  ? 234  GLN A C   1 
ATOM 1840  O O   . GLN A 1 237  ? 11.895  14.986  104.704 1.00 68.32  ? 234  GLN A O   1 
ATOM 1841  C CB  . GLN A 1 237  ? 13.049  17.480  102.978 1.00 67.89  ? 234  GLN A CB  1 
ATOM 1842  C CG  . GLN A 1 237  ? 13.774  18.163  101.824 1.00 69.04  ? 234  GLN A CG  1 
ATOM 1843  C CD  . GLN A 1 237  ? 15.240  17.736  101.705 1.00 70.82  ? 234  GLN A CD  1 
ATOM 1844  O OE1 . GLN A 1 237  ? 15.551  16.566  101.439 1.00 71.48  ? 234  GLN A OE1 1 
ATOM 1845  N NE2 . GLN A 1 237  ? 16.148  18.691  101.896 1.00 71.29  ? 234  GLN A NE2 1 
ATOM 1846  N N   . GLU A 1 238  ? 14.080  14.726  104.229 1.00 68.27  ? 235  GLU A N   1 
ATOM 1847  C CA  . GLU A 1 238  ? 14.457  14.045  105.497 1.00 68.36  ? 235  GLU A CA  1 
ATOM 1848  C C   . GLU A 1 238  ? 13.484  13.002  106.100 1.00 68.26  ? 235  GLU A C   1 
ATOM 1849  O O   . GLU A 1 238  ? 13.616  12.634  107.268 1.00 68.21  ? 235  GLU A O   1 
ATOM 1850  C CB  . GLU A 1 238  ? 14.886  15.073  106.574 1.00 68.44  ? 235  GLU A CB  1 
ATOM 1851  C CG  . GLU A 1 238  ? 14.043  16.363  106.680 1.00 68.19  ? 235  GLU A CG  1 
ATOM 1852  C CD  . GLU A 1 238  ? 12.903  16.267  107.684 1.00 67.84  ? 235  GLU A CD  1 
ATOM 1853  O OE1 . GLU A 1 238  ? 12.098  15.313  107.611 1.00 67.21  ? 235  GLU A OE1 1 
ATOM 1854  O OE2 . GLU A 1 238  ? 12.810  17.162  108.549 1.00 68.05  ? 235  GLU A OE2 1 
ATOM 1855  N N   . SER A 1 239  ? 12.537  12.519  105.297 1.00 68.14  ? 236  SER A N   1 
ATOM 1856  C CA  . SER A 1 239  ? 11.503  11.600  105.765 1.00 68.08  ? 236  SER A CA  1 
ATOM 1857  C C   . SER A 1 239  ? 10.817  10.866  104.617 1.00 68.14  ? 236  SER A C   1 
ATOM 1858  O O   . SER A 1 239  ? 10.658  11.419  103.522 1.00 68.22  ? 236  SER A O   1 
ATOM 1859  C CB  . SER A 1 239  ? 10.456  12.360  106.581 1.00 68.06  ? 236  SER A CB  1 
ATOM 1860  O OG  . SER A 1 239  ? 9.156   11.831  106.376 1.00 68.08  ? 236  SER A OG  1 
ATOM 1861  N N   . ILE A 1 240  ? 10.411  9.624   104.881 1.00 68.09  ? 237  ILE A N   1 
ATOM 1862  C CA  . ILE A 1 240  ? 9.587   8.844   103.950 1.00 68.12  ? 237  ILE A CA  1 
ATOM 1863  C C   . ILE A 1 240  ? 8.417   8.204   104.697 1.00 68.32  ? 237  ILE A C   1 
ATOM 1864  O O   . ILE A 1 240  ? 8.614   7.560   105.727 1.00 68.44  ? 237  ILE A O   1 
ATOM 1865  C CB  . ILE A 1 240  ? 10.406  7.754   103.214 1.00 67.98  ? 237  ILE A CB  1 
ATOM 1866  C CG1 . ILE A 1 240  ? 11.330  8.389   102.177 1.00 67.71  ? 237  ILE A CG1 1 
ATOM 1867  C CG2 . ILE A 1 240  ? 9.488   6.733   102.535 1.00 67.66  ? 237  ILE A CG2 1 
ATOM 1868  C CD1 . ILE A 1 240  ? 12.373  7.452   101.641 1.00 67.76  ? 237  ILE A CD1 1 
ATOM 1869  N N   . THR A 1 241  ? 7.207   8.393   104.176 1.00 68.46  ? 238  THR A N   1 
ATOM 1870  C CA  . THR A 1 241  ? 6.002   7.827   104.781 1.00 68.66  ? 238  THR A CA  1 
ATOM 1871  C C   . THR A 1 241  ? 5.310   6.829   103.847 1.00 68.79  ? 238  THR A C   1 
ATOM 1872  O O   . THR A 1 241  ? 5.412   6.925   102.627 1.00 68.86  ? 238  THR A O   1 
ATOM 1873  C CB  . THR A 1 241  ? 4.978   8.927   105.235 1.00 68.73  ? 238  THR A CB  1 
ATOM 1874  O OG1 . THR A 1 241  ? 4.551   9.707   104.110 1.00 69.00  ? 238  THR A OG1 1 
ATOM 1875  C CG2 . THR A 1 241  ? 5.571   9.851   106.305 1.00 68.43  ? 238  THR A CG2 1 
ATOM 1876  N N   . TYR A 1 242  ? 4.615   5.866   104.439 1.00 68.99  ? 239  TYR A N   1 
ATOM 1877  C CA  . TYR A 1 242  ? 3.797   4.911   103.705 1.00 69.22  ? 239  TYR A CA  1 
ATOM 1878  C C   . TYR A 1 242  ? 2.371   5.009   104.245 1.00 69.57  ? 239  TYR A C   1 
ATOM 1879  O O   . TYR A 1 242  ? 2.149   4.847   105.449 1.00 69.78  ? 239  TYR A O   1 
ATOM 1880  C CB  . TYR A 1 242  ? 4.354   3.488   103.880 1.00 69.07  ? 239  TYR A CB  1 
ATOM 1881  C CG  . TYR A 1 242  ? 3.498   2.391   103.278 1.00 68.75  ? 239  TYR A CG  1 
ATOM 1882  C CD1 . TYR A 1 242  ? 3.577   2.085   101.921 1.00 68.57  ? 239  TYR A CD1 1 
ATOM 1883  C CD2 . TYR A 1 242  ? 2.609   1.662   104.065 1.00 68.28  ? 239  TYR A CD2 1 
ATOM 1884  C CE1 . TYR A 1 242  ? 2.792   1.084   101.362 1.00 68.33  ? 239  TYR A CE1 1 
ATOM 1885  C CE2 . TYR A 1 242  ? 1.818   0.659   103.515 1.00 68.20  ? 239  TYR A CE2 1 
ATOM 1886  C CZ  . TYR A 1 242  ? 1.917   0.378   102.165 1.00 68.47  ? 239  TYR A CZ  1 
ATOM 1887  O OH  . TYR A 1 242  ? 1.141   -0.611  101.614 1.00 68.79  ? 239  TYR A OH  1 
ATOM 1888  N N   . HIS A 1 243  ? 1.410   5.279   103.365 1.00 69.78  ? 240  HIS A N   1 
ATOM 1889  C CA  . HIS A 1 243  ? 0.028   5.469   103.794 1.00 70.04  ? 240  HIS A CA  1 
ATOM 1890  C C   . HIS A 1 243  ? -0.928  4.404   103.299 1.00 70.06  ? 240  HIS A C   1 
ATOM 1891  O O   . HIS A 1 243  ? -0.821  3.933   102.166 1.00 69.92  ? 240  HIS A O   1 
ATOM 1892  C CB  . HIS A 1 243  ? -0.476  6.854   103.397 1.00 70.19  ? 240  HIS A CB  1 
ATOM 1893  C CG  . HIS A 1 243  ? -0.078  7.927   104.357 1.00 71.15  ? 240  HIS A CG  1 
ATOM 1894  N ND1 . HIS A 1 243  ? -0.869  8.299   105.424 1.00 71.98  ? 240  HIS A ND1 1 
ATOM 1895  C CD2 . HIS A 1 243  ? 1.039   8.689   104.430 1.00 71.81  ? 240  HIS A CD2 1 
ATOM 1896  C CE1 . HIS A 1 243  ? -0.262  9.256   106.104 1.00 72.31  ? 240  HIS A CE1 1 
ATOM 1897  N NE2 . HIS A 1 243  ? 0.898   9.509   105.524 1.00 72.36  ? 240  HIS A NE2 1 
ATOM 1898  N N   . ASN A 1 244  ? -1.858  4.033   104.177 1.00 70.31  ? 241  ASN A N   1 
ATOM 1899  C CA  . ASN A 1 244  ? -2.944  3.106   103.856 1.00 70.38  ? 241  ASN A CA  1 
ATOM 1900  C C   . ASN A 1 244  ? -4.149  3.280   104.796 1.00 70.60  ? 241  ASN A C   1 
ATOM 1901  O O   . ASN A 1 244  ? -4.101  4.087   105.735 1.00 70.51  ? 241  ASN A O   1 
ATOM 1902  C CB  . ASN A 1 244  ? -2.445  1.658   103.872 1.00 70.19  ? 241  ASN A CB  1 
ATOM 1903  C CG  . ASN A 1 244  ? -3.027  0.832   102.744 1.00 69.85  ? 241  ASN A CG  1 
ATOM 1904  O OD1 . ASN A 1 244  ? -4.215  0.920   102.441 1.00 69.48  ? 241  ASN A OD1 1 
ATOM 1905  N ND2 . ASN A 1 244  ? -2.189  0.025   102.112 1.00 70.08  ? 241  ASN A ND2 1 
ATOM 1906  N N   . GLY A 1 245  ? -5.217  2.521   104.524 1.00 70.84  ? 242  GLY A N   1 
ATOM 1907  C CA  . GLY A 1 245  ? -6.481  2.553   105.280 1.00 71.04  ? 242  GLY A CA  1 
ATOM 1908  C C   . GLY A 1 245  ? -6.366  3.152   106.666 1.00 71.23  ? 242  GLY A C   1 
ATOM 1909  O O   . GLY A 1 245  ? -6.851  4.259   106.914 1.00 71.33  ? 242  GLY A O   1 
ATOM 1910  N N   . ASP A 1 246  ? -5.735  2.401   107.566 1.00 71.32  ? 243  ASP A N   1 
ATOM 1911  C CA  . ASP A 1 246  ? -5.300  2.907   108.871 1.00 71.32  ? 243  ASP A CA  1 
ATOM 1912  C C   . ASP A 1 246  ? -3.866  2.472   109.164 1.00 71.18  ? 243  ASP A C   1 
ATOM 1913  O O   . ASP A 1 246  ? -3.327  2.730   110.246 1.00 71.34  ? 243  ASP A O   1 
ATOM 1914  C CB  . ASP A 1 246  ? -6.244  2.460   109.987 1.00 71.36  ? 243  ASP A CB  1 
ATOM 1915  C CG  . ASP A 1 246  ? -7.072  3.603   110.537 1.00 71.81  ? 243  ASP A CG  1 
ATOM 1916  O OD1 . ASP A 1 246  ? -7.789  4.259   109.747 1.00 72.14  ? 243  ASP A OD1 1 
ATOM 1917  O OD2 . ASP A 1 246  ? -7.004  3.843   111.766 1.00 72.53  ? 243  ASP A OD2 1 
ATOM 1918  N N   . LYS A 1 247  ? -3.259  1.808   108.185 1.00 70.85  ? 244  LYS A N   1 
ATOM 1919  C CA  . LYS A 1 247  ? -1.861  1.440   108.256 1.00 70.47  ? 244  LYS A CA  1 
ATOM 1920  C C   . LYS A 1 247  ? -1.017  2.656   107.881 1.00 70.27  ? 244  LYS A C   1 
ATOM 1921  O O   . LYS A 1 247  ? -1.256  3.303   106.857 1.00 70.11  ? 244  LYS A O   1 
ATOM 1922  C CB  . LYS A 1 247  ? -1.579  0.261   107.322 1.00 70.50  ? 244  LYS A CB  1 
ATOM 1923  C CG  . LYS A 1 247  ? -0.156  -0.276  107.379 1.00 70.46  ? 244  LYS A CG  1 
ATOM 1924  C CD  . LYS A 1 247  ? -0.020  -1.441  108.337 1.00 70.28  ? 244  LYS A CD  1 
ATOM 1925  C CE  . LYS A 1 247  ? 1.444   -1.738  108.620 1.00 70.44  ? 244  LYS A CE  1 
ATOM 1926  N NZ  . LYS A 1 247  ? 2.032   -0.769  109.591 1.00 70.52  ? 244  LYS A NZ  1 
ATOM 1927  N N   . TYR A 1 248  ? -0.047  2.963   108.736 1.00 70.08  ? 245  TYR A N   1 
ATOM 1928  C CA  . TYR A 1 248  ? 0.882   4.071   108.536 1.00 69.96  ? 245  TYR A CA  1 
ATOM 1929  C C   . TYR A 1 248  ? 2.286   3.592   108.889 1.00 69.76  ? 245  TYR A C   1 
ATOM 1930  O O   . TYR A 1 248  ? 2.471   2.942   109.917 1.00 69.89  ? 245  TYR A O   1 
ATOM 1931  C CB  . TYR A 1 248  ? 0.476   5.263   109.420 1.00 70.07  ? 245  TYR A CB  1 
ATOM 1932  C CG  . TYR A 1 248  ? 1.488   6.395   109.496 1.00 70.25  ? 245  TYR A CG  1 
ATOM 1933  C CD1 . TYR A 1 248  ? 1.359   7.531   108.699 1.00 70.65  ? 245  TYR A CD1 1 
ATOM 1934  C CD2 . TYR A 1 248  ? 2.568   6.334   110.378 1.00 70.46  ? 245  TYR A CD2 1 
ATOM 1935  C CE1 . TYR A 1 248  ? 2.290   8.576   108.770 1.00 70.73  ? 245  TYR A CE1 1 
ATOM 1936  C CE2 . TYR A 1 248  ? 3.500   7.367   110.456 1.00 70.51  ? 245  TYR A CE2 1 
ATOM 1937  C CZ  . TYR A 1 248  ? 3.357   8.483   109.653 1.00 70.48  ? 245  TYR A CZ  1 
ATOM 1938  O OH  . TYR A 1 248  ? 4.286   9.499   109.736 1.00 70.38  ? 245  TYR A OH  1 
ATOM 1939  N N   . LEU A 1 249  ? 3.265   3.898   108.038 1.00 69.48  ? 246  LEU A N   1 
ATOM 1940  C CA  . LEU A 1 249  ? 4.669   3.574   108.318 1.00 69.31  ? 246  LEU A CA  1 
ATOM 1941  C C   . LEU A 1 249  ? 5.583   4.727   107.946 1.00 69.20  ? 246  LEU A C   1 
ATOM 1942  O O   . LEU A 1 249  ? 5.392   5.349   106.904 1.00 69.21  ? 246  LEU A O   1 
ATOM 1943  C CB  . LEU A 1 249  ? 5.107   2.307   107.578 1.00 69.28  ? 246  LEU A CB  1 
ATOM 1944  C CG  . LEU A 1 249  ? 4.688   0.950   108.157 1.00 69.47  ? 246  LEU A CG  1 
ATOM 1945  C CD1 . LEU A 1 249  ? 5.250   -0.203  107.328 1.00 69.49  ? 246  LEU A CD1 1 
ATOM 1946  C CD2 . LEU A 1 249  ? 5.110   0.806   109.617 1.00 69.94  ? 246  LEU A CD2 1 
ATOM 1947  N N   . ALA A 1 250  ? 6.579   5.005   108.789 1.00 69.07  ? 247  ALA A N   1 
ATOM 1948  C CA  . ALA A 1 250  ? 7.475   6.148   108.570 1.00 68.96  ? 247  ALA A CA  1 
ATOM 1949  C C   . ALA A 1 250  ? 8.910   5.929   109.035 1.00 68.83  ? 247  ALA A C   1 
ATOM 1950  O O   . ALA A 1 250  ? 9.151   5.255   110.034 1.00 68.82  ? 247  ALA A O   1 
ATOM 1951  C CB  . ALA A 1 250  ? 6.903   7.403   109.223 1.00 69.03  ? 247  ALA A CB  1 
ATOM 1952  N N   . ILE A 1 251  ? 9.852   6.517   108.297 1.00 68.78  ? 248  ILE A N   1 
ATOM 1953  C CA  . ILE A 1 251  ? 11.277  6.529   108.664 1.00 68.73  ? 248  ILE A CA  1 
ATOM 1954  C C   . ILE A 1 251  ? 12.004  7.761   108.132 1.00 68.62  ? 248  ILE A C   1 
ATOM 1955  O O   . ILE A 1 251  ? 11.790  8.185   106.987 1.00 68.47  ? 248  ILE A O   1 
ATOM 1956  C CB  . ILE A 1 251  ? 12.047  5.263   108.187 1.00 68.82  ? 248  ILE A CB  1 
ATOM 1957  C CG1 . ILE A 1 251  ? 11.481  4.737   106.857 1.00 68.58  ? 248  ILE A CG1 1 
ATOM 1958  C CG2 . ILE A 1 251  ? 12.080  4.185   109.286 1.00 68.63  ? 248  ILE A CG2 1 
ATOM 1959  C CD1 . ILE A 1 251  ? 12.145  5.311   105.623 1.00 67.52  ? 248  ILE A CD1 1 
ATOM 1960  N N   . ALA A 1 252  ? 12.875  8.310   108.976 1.00 68.46  ? 249  ALA A N   1 
ATOM 1961  C CA  . ALA A 1 252  ? 13.651  9.504   108.659 1.00 68.32  ? 249  ALA A CA  1 
ATOM 1962  C C   . ALA A 1 252  ? 15.162  9.218   108.732 1.00 68.18  ? 249  ALA A C   1 
ATOM 1963  O O   . ALA A 1 252  ? 15.820  9.559   109.729 1.00 68.10  ? 249  ALA A O   1 
ATOM 1964  C CB  . ALA A 1 252  ? 13.262  10.643  109.598 1.00 68.37  ? 249  ALA A CB  1 
ATOM 1965  N N   . PRO A 1 253  ? 15.719  8.600   107.668 1.00 67.93  ? 250  PRO A N   1 
ATOM 1966  C CA  . PRO A 1 253  ? 17.119  8.186   107.692 1.00 67.64  ? 250  PRO A CA  1 
ATOM 1967  C C   . PRO A 1 253  ? 18.024  9.364   107.360 1.00 67.33  ? 250  PRO A C   1 
ATOM 1968  O O   . PRO A 1 253  ? 17.881  9.962   106.292 1.00 67.43  ? 250  PRO A O   1 
ATOM 1969  C CB  . PRO A 1 253  ? 17.188  7.121   106.597 1.00 67.62  ? 250  PRO A CB  1 
ATOM 1970  C CG  . PRO A 1 253  ? 16.122  7.501   105.627 1.00 67.85  ? 250  PRO A CG  1 
ATOM 1971  C CD  . PRO A 1 253  ? 15.074  8.293   106.376 1.00 67.95  ? 250  PRO A CD  1 
ATOM 1972  N N   . PRO A 1 254  ? 18.942  9.713   108.277 1.00 67.02  ? 251  PRO A N   1 
ATOM 1973  C CA  . PRO A 1 254  ? 19.794  10.885  108.086 1.00 66.70  ? 251  PRO A CA  1 
ATOM 1974  C C   . PRO A 1 254  ? 20.417  10.970  106.694 1.00 66.22  ? 251  PRO A C   1 
ATOM 1975  O O   . PRO A 1 254  ? 20.658  12.075  106.204 1.00 66.18  ? 251  PRO A O   1 
ATOM 1976  C CB  . PRO A 1 254  ? 20.871  10.707  109.159 1.00 66.80  ? 251  PRO A CB  1 
ATOM 1977  C CG  . PRO A 1 254  ? 20.166  9.990   110.250 1.00 66.98  ? 251  PRO A CG  1 
ATOM 1978  C CD  . PRO A 1 254  ? 19.222  9.039   109.558 1.00 67.06  ? 251  PRO A CD  1 
ATOM 1979  N N   . ILE A 1 255  ? 20.652  9.819   106.063 1.00 65.71  ? 252  ILE A N   1 
ATOM 1980  C CA  . ILE A 1 255  ? 21.255  9.782   104.728 1.00 65.30  ? 252  ILE A CA  1 
ATOM 1981  C C   . ILE A 1 255  ? 20.508  10.661  103.703 1.00 65.06  ? 252  ILE A C   1 
ATOM 1982  O O   . ILE A 1 255  ? 21.136  11.467  103.029 1.00 65.23  ? 252  ILE A O   1 
ATOM 1983  C CB  . ILE A 1 255  ? 21.508  8.320   104.217 1.00 65.27  ? 252  ILE A CB  1 
ATOM 1984  C CG1 . ILE A 1 255  ? 22.498  8.314   103.051 1.00 64.73  ? 252  ILE A CG1 1 
ATOM 1985  C CG2 . ILE A 1 255  ? 20.210  7.601   103.851 1.00 65.25  ? 252  ILE A CG2 1 
ATOM 1986  C CD1 . ILE A 1 255  ? 23.275  7.026   102.932 1.00 64.52  ? 252  ILE A CD1 1 
ATOM 1987  N N   . ILE A 1 256  ? 19.183  10.533  103.625 1.00 64.64  ? 253  ILE A N   1 
ATOM 1988  C CA  . ILE A 1 256  ? 18.385  11.237  102.608 1.00 64.32  ? 253  ILE A CA  1 
ATOM 1989  C C   . ILE A 1 256  ? 18.160  12.718  102.900 1.00 64.04  ? 253  ILE A C   1 
ATOM 1990  O O   . ILE A 1 256  ? 17.774  13.480  102.014 1.00 63.98  ? 253  ILE A O   1 
ATOM 1991  C CB  . ILE A 1 256  ? 17.007  10.556  102.354 1.00 64.39  ? 253  ILE A CB  1 
ATOM 1992  C CG1 . ILE A 1 256  ? 15.962  10.984  103.395 1.00 64.37  ? 253  ILE A CG1 1 
ATOM 1993  C CG2 . ILE A 1 256  ? 17.156  9.037   102.288 1.00 64.74  ? 253  ILE A CG2 1 
ATOM 1994  C CD1 . ILE A 1 256  ? 14.535  10.993  102.869 1.00 64.01  ? 253  ILE A CD1 1 
ATOM 1995  N N   . LYS A 1 257  ? 18.391  13.114  104.147 1.00 63.85  ? 254  LYS A N   1 
ATOM 1996  C CA  . LYS A 1 257  ? 18.199  14.496  104.575 1.00 63.60  ? 254  LYS A CA  1 
ATOM 1997  C C   . LYS A 1 257  ? 19.005  15.442  103.686 1.00 63.41  ? 254  LYS A C   1 
ATOM 1998  O O   . LYS A 1 257  ? 18.460  16.400  103.135 1.00 63.39  ? 254  LYS A O   1 
ATOM 1999  C CB  . LYS A 1 257  ? 18.574  14.652  106.058 1.00 63.60  ? 254  LYS A CB  1 
ATOM 2000  C CG  . LYS A 1 257  ? 18.278  16.015  106.668 1.00 63.40  ? 254  LYS A CG  1 
ATOM 2001  C CD  . LYS A 1 257  ? 18.204  15.936  108.192 1.00 63.15  ? 254  LYS A CD  1 
ATOM 2002  C CE  . LYS A 1 257  ? 18.215  17.322  108.827 1.00 62.68  ? 254  LYS A CE  1 
ATOM 2003  N NZ  . LYS A 1 257  ? 17.036  18.154  108.439 1.00 62.18  ? 254  LYS A NZ  1 
ATOM 2004  N N   . GLN A 1 258  ? 20.287  15.128  103.516 1.00 63.15  ? 255  GLN A N   1 
ATOM 2005  C CA  . GLN A 1 258  ? 21.243  15.976  102.788 1.00 63.08  ? 255  GLN A CA  1 
ATOM 2006  C C   . GLN A 1 258  ? 20.706  16.681  101.516 1.00 62.43  ? 255  GLN A C   1 
ATOM 2007  O O   . GLN A 1 258  ? 20.954  17.874  101.314 1.00 62.24  ? 255  GLN A O   1 
ATOM 2008  C CB  . GLN A 1 258  ? 22.550  15.204  102.514 1.00 63.10  ? 255  GLN A CB  1 
ATOM 2009  C CG  . GLN A 1 258  ? 23.381  14.934  103.779 1.00 63.50  ? 255  GLN A CG  1 
ATOM 2010  C CD  . GLN A 1 258  ? 24.317  13.729  103.655 1.00 63.92  ? 255  GLN A CD  1 
ATOM 2011  O OE1 . GLN A 1 258  ? 23.876  12.607  103.389 1.00 64.87  ? 255  GLN A OE1 1 
ATOM 2012  N NE2 . GLN A 1 258  ? 25.614  13.954  103.879 1.00 64.93  ? 255  GLN A NE2 1 
ATOM 2013  N N   . SER A 1 259  ? 19.964  15.956  100.681 1.00 61.90  ? 256  SER A N   1 
ATOM 2014  C CA  . SER A 1 259  ? 19.377  16.558  99.474  1.00 61.46  ? 256  SER A CA  1 
ATOM 2015  C C   . SER A 1 259  ? 18.025  15.946  99.045  1.00 61.03  ? 256  SER A C   1 
ATOM 2016  O O   . SER A 1 259  ? 17.734  14.782  99.329  1.00 61.04  ? 256  SER A O   1 
ATOM 2017  C CB  . SER A 1 259  ? 20.394  16.567  98.321  1.00 61.41  ? 256  SER A CB  1 
ATOM 2018  O OG  . SER A 1 259  ? 20.192  17.671  97.450  1.00 60.96  ? 256  SER A OG  1 
ATOM 2019  N N   . THR A 1 260  ? 17.216  16.750  98.358  1.00 60.39  ? 257  THR A N   1 
ATOM 2020  C CA  . THR A 1 260  ? 15.840  16.403  98.011  1.00 59.88  ? 257  THR A CA  1 
ATOM 2021  C C   . THR A 1 260  ? 15.770  15.268  96.999  1.00 59.69  ? 257  THR A C   1 
ATOM 2022  O O   . THR A 1 260  ? 16.339  15.378  95.911  1.00 59.99  ? 257  THR A O   1 
ATOM 2023  C CB  . THR A 1 260  ? 15.094  17.639  97.433  1.00 59.82  ? 257  THR A CB  1 
ATOM 2024  O OG1 . THR A 1 260  ? 14.875  18.598  98.474  1.00 59.47  ? 257  THR A OG1 1 
ATOM 2025  C CG2 . THR A 1 260  ? 13.748  17.247  96.813  1.00 59.72  ? 257  THR A CG2 1 
ATOM 2026  N N   . ILE A 1 261  ? 15.069  14.187  97.351  1.00 59.07  ? 258  ILE A N   1 
ATOM 2027  C CA  . ILE A 1 261  ? 14.808  13.113  96.391  1.00 58.40  ? 258  ILE A CA  1 
ATOM 2028  C C   . ILE A 1 261  ? 13.822  13.615  95.339  1.00 58.07  ? 258  ILE A C   1 
ATOM 2029  O O   . ILE A 1 261  ? 12.676  13.929  95.661  1.00 58.13  ? 258  ILE A O   1 
ATOM 2030  C CB  . ILE A 1 261  ? 14.333  11.809  97.071  1.00 58.35  ? 258  ILE A CB  1 
ATOM 2031  C CG1 . ILE A 1 261  ? 15.534  11.015  97.584  1.00 58.60  ? 258  ILE A CG1 1 
ATOM 2032  C CG2 . ILE A 1 261  ? 13.601  10.912  96.100  1.00 58.07  ? 258  ILE A CG2 1 
ATOM 2033  C CD1 . ILE A 1 261  ? 16.051  11.453  98.941  1.00 59.12  ? 258  ILE A CD1 1 
ATOM 2034  N N   . VAL A 1 262  ? 14.292  13.690  94.089  1.00 57.60  ? 259  VAL A N   1 
ATOM 2035  C CA  . VAL A 1 262  ? 13.564  14.332  92.973  1.00 56.88  ? 259  VAL A CA  1 
ATOM 2036  C C   . VAL A 1 262  ? 12.779  13.384  92.033  1.00 56.52  ? 259  VAL A C   1 
ATOM 2037  O O   . VAL A 1 262  ? 11.621  13.647  91.710  1.00 56.17  ? 259  VAL A O   1 
ATOM 2038  C CB  . VAL A 1 262  ? 14.495  15.291  92.165  1.00 56.67  ? 259  VAL A CB  1 
ATOM 2039  C CG1 . VAL A 1 262  ? 15.730  14.571  91.622  1.00 56.13  ? 259  VAL A CG1 1 
ATOM 2040  C CG2 . VAL A 1 262  ? 13.728  15.961  91.043  1.00 57.10  ? 259  VAL A CG2 1 
ATOM 2041  N N   . CYS A 1 263  ? 13.409  12.294  91.608  1.00 56.36  ? 260  CYS A N   1 
ATOM 2042  C CA  . CYS A 1 263  ? 12.779  11.328  90.711  1.00 56.18  ? 260  CYS A CA  1 
ATOM 2043  C C   . CYS A 1 263  ? 12.909  9.905   91.265  1.00 56.27  ? 260  CYS A C   1 
ATOM 2044  O O   . CYS A 1 263  ? 13.866  9.601   91.986  1.00 56.31  ? 260  CYS A O   1 
ATOM 2045  C CB  . CYS A 1 263  ? 13.379  11.423  89.303  1.00 56.06  ? 260  CYS A CB  1 
ATOM 2046  S SG  . CYS A 1 263  ? 15.093  10.848  89.157  1.00 55.36  ? 260  CYS A SG  1 
ATOM 2047  N N   . HIS A 1 264  ? 11.943  9.050   90.920  1.00 56.20  ? 261  HIS A N   1 
ATOM 2048  C CA  . HIS A 1 264  ? 11.845  7.685   91.444  1.00 56.02  ? 261  HIS A CA  1 
ATOM 2049  C C   . HIS A 1 264  ? 11.614  6.672   90.322  1.00 56.03  ? 261  HIS A C   1 
ATOM 2050  O O   . HIS A 1 264  ? 11.568  7.056   89.152  1.00 56.21  ? 261  HIS A O   1 
ATOM 2051  C CB  . HIS A 1 264  ? 10.696  7.601   92.443  1.00 55.94  ? 261  HIS A CB  1 
ATOM 2052  C CG  . HIS A 1 264  ? 9.344   7.686   91.811  1.00 56.04  ? 261  HIS A CG  1 
ATOM 2053  N ND1 . HIS A 1 264  ? 8.687   6.583   91.304  1.00 55.66  ? 261  HIS A ND1 1 
ATOM 2054  C CD2 . HIS A 1 264  ? 8.528   8.744   91.593  1.00 55.91  ? 261  HIS A CD2 1 
ATOM 2055  C CE1 . HIS A 1 264  ? 7.522   6.960   90.806  1.00 55.72  ? 261  HIS A CE1 1 
ATOM 2056  N NE2 . HIS A 1 264  ? 7.402   8.266   90.969  1.00 56.05  ? 261  HIS A NE2 1 
ATOM 2057  N N   . ASN A 1 265  ? 11.471  5.393   90.683  1.00 55.98  ? 262  ASN A N   1 
ATOM 2058  C CA  . ASN A 1 265  ? 11.099  4.329   89.741  1.00 56.18  ? 262  ASN A CA  1 
ATOM 2059  C C   . ASN A 1 265  ? 11.097  2.926   90.338  1.00 56.57  ? 262  ASN A C   1 
ATOM 2060  O O   . ASN A 1 265  ? 12.081  2.515   90.956  1.00 56.64  ? 262  ASN A O   1 
ATOM 2061  C CB  . ASN A 1 265  ? 12.015  4.318   88.519  1.00 56.10  ? 262  ASN A CB  1 
ATOM 2062  C CG  . ASN A 1 265  ? 11.403  3.583   87.350  1.00 55.81  ? 262  ASN A CG  1 
ATOM 2063  O OD1 . ASN A 1 265  ? 10.400  4.027   86.785  1.00 55.50  ? 262  ASN A OD1 1 
ATOM 2064  N ND2 . ASN A 1 265  ? 11.997  2.450   86.980  1.00 55.20  ? 262  ASN A ND2 1 
ATOM 2065  N N   . ARG A 1 266  ? 10.001  2.191   90.112  1.00 56.95  ? 263  ARG A N   1 
ATOM 2066  C CA  . ARG A 1 266  ? 9.852   0.791   90.544  1.00 57.10  ? 263  ARG A CA  1 
ATOM 2067  C C   . ARG A 1 266  ? 10.758  -0.156  89.757  1.00 57.39  ? 263  ARG A C   1 
ATOM 2068  O O   . ARG A 1 266  ? 10.825  -0.091  88.527  1.00 57.47  ? 263  ARG A O   1 
ATOM 2069  C CB  . ARG A 1 266  ? 8.384   0.358   90.448  1.00 57.01  ? 263  ARG A CB  1 
ATOM 2070  C CG  . ARG A 1 266  ? 8.155   -1.114  90.130  1.00 57.13  ? 263  ARG A CG  1 
ATOM 2071  C CD  . ARG A 1 266  ? 6.830   -1.647  90.677  1.00 57.46  ? 263  ARG A CD  1 
ATOM 2072  N NE  . ARG A 1 266  ? 5.677   -0.778  90.431  1.00 58.16  ? 263  ARG A NE  1 
ATOM 2073  C CZ  . ARG A 1 266  ? 5.102   -0.585  89.243  1.00 58.52  ? 263  ARG A CZ  1 
ATOM 2074  N NH1 . ARG A 1 266  ? 5.578   -1.177  88.153  1.00 58.86  ? 263  ARG A NH1 1 
ATOM 2075  N NH2 . ARG A 1 266  ? 4.051   0.219   89.142  1.00 58.36  ? 263  ARG A NH2 1 
ATOM 2076  N N   . VAL A 1 267  ? 11.449  -1.032  90.482  1.00 57.74  ? 264  VAL A N   1 
ATOM 2077  C CA  . VAL A 1 267  ? 12.410  -1.961  89.888  1.00 58.15  ? 264  VAL A CA  1 
ATOM 2078  C C   . VAL A 1 267  ? 11.789  -3.347  89.683  1.00 58.61  ? 264  VAL A C   1 
ATOM 2079  O O   . VAL A 1 267  ? 11.871  -3.922  88.594  1.00 58.66  ? 264  VAL A O   1 
ATOM 2080  C CB  . VAL A 1 267  ? 13.692  -2.071  90.751  1.00 58.07  ? 264  VAL A CB  1 
ATOM 2081  C CG1 . VAL A 1 267  ? 14.776  -2.862  90.025  1.00 57.85  ? 264  VAL A CG1 1 
ATOM 2082  C CG2 . VAL A 1 267  ? 14.206  -0.685  91.119  1.00 57.98  ? 264  VAL A CG2 1 
ATOM 2083  N N   . ASP A 1 268  ? 11.176  -3.876  90.737  1.00 59.08  ? 265  ASP A N   1 
ATOM 2084  C CA  . ASP A 1 268  ? 10.502  -5.162  90.677  1.00 59.56  ? 265  ASP A CA  1 
ATOM 2085  C C   . ASP A 1 268  ? 9.002   -4.937  90.606  1.00 59.77  ? 265  ASP A C   1 
ATOM 2086  O O   . ASP A 1 268  ? 8.461   -4.189  91.413  1.00 59.89  ? 265  ASP A O   1 
ATOM 2087  C CB  . ASP A 1 268  ? 10.849  -5.991  91.910  1.00 59.77  ? 265  ASP A CB  1 
ATOM 2088  C CG  . ASP A 1 268  ? 12.340  -6.232  92.046  1.00 60.83  ? 265  ASP A CG  1 
ATOM 2089  O OD1 . ASP A 1 268  ? 12.768  -7.407  91.950  1.00 61.81  ? 265  ASP A OD1 1 
ATOM 2090  O OD2 . ASP A 1 268  ? 13.086  -5.243  92.230  1.00 61.96  ? 265  ASP A OD2 1 
ATOM 2091  N N   . PRO A 1 269  ? 8.322   -5.601  89.654  1.00 59.99  ? 266  PRO A N   1 
ATOM 2092  C CA  . PRO A 1 269  ? 6.889   -5.448  89.370  1.00 60.09  ? 266  PRO A CA  1 
ATOM 2093  C C   . PRO A 1 269  ? 6.014   -5.494  90.622  1.00 60.18  ? 266  PRO A C   1 
ATOM 2094  O O   . PRO A 1 269  ? 5.121   -4.651  90.779  1.00 60.23  ? 266  PRO A O   1 
ATOM 2095  C CB  . PRO A 1 269  ? 6.577   -6.664  88.483  1.00 60.14  ? 266  PRO A CB  1 
ATOM 2096  C CG  . PRO A 1 269  ? 7.780   -7.578  88.622  1.00 60.14  ? 266  PRO A CG  1 
ATOM 2097  C CD  . PRO A 1 269  ? 8.917   -6.629  88.789  1.00 60.04  ? 266  PRO A CD  1 
ATOM 2098  N N   . ASN A 1 270  ? 6.281   -6.468  91.496  1.00 60.04  ? 267  ASN A N   1 
ATOM 2099  C CA  . ASN A 1 270  ? 5.572   -6.618  92.766  1.00 59.91  ? 267  ASN A CA  1 
ATOM 2100  C C   . ASN A 1 270  ? 5.818   -5.451  93.726  1.00 59.65  ? 267  ASN A C   1 
ATOM 2101  O O   . ASN A 1 270  ? 5.463   -5.520  94.901  1.00 59.62  ? 267  ASN A O   1 
ATOM 2102  C CB  . ASN A 1 270  ? 5.965   -7.938  93.433  1.00 60.03  ? 267  ASN A CB  1 
ATOM 2103  C CG  . ASN A 1 270  ? 7.430   -7.970  93.840  1.00 60.66  ? 267  ASN A CG  1 
ATOM 2104  O OD1 . ASN A 1 270  ? 8.270   -7.300  93.229  1.00 60.72  ? 267  ASN A OD1 1 
ATOM 2105  N ND2 . ASN A 1 270  ? 7.746   -8.756  94.877  1.00 61.02  ? 267  ASN A ND2 1 
ATOM 2106  N N   . GLY A 1 271  ? 6.441   -4.393  93.212  1.00 59.40  ? 268  GLY A N   1 
ATOM 2107  C CA  . GLY A 1 271  ? 6.674   -3.160  93.957  1.00 59.01  ? 268  GLY A CA  1 
ATOM 2108  C C   . GLY A 1 271  ? 7.422   -3.339  95.258  1.00 58.77  ? 268  GLY A C   1 
ATOM 2109  O O   . GLY A 1 271  ? 6.999   -2.819  96.285  1.00 58.87  ? 268  GLY A O   1 
ATOM 2110  N N   . SER A 1 272  ? 8.527   -4.079  95.219  1.00 58.42  ? 269  SER A N   1 
ATOM 2111  C CA  . SER A 1 272  ? 9.362   -4.257  96.402  1.00 58.07  ? 269  SER A CA  1 
ATOM 2112  C C   . SER A 1 272  ? 10.529  -3.263  96.432  1.00 58.00  ? 269  SER A C   1 
ATOM 2113  O O   . SER A 1 272  ? 10.846  -2.704  97.486  1.00 58.15  ? 269  SER A O   1 
ATOM 2114  C CB  . SER A 1 272  ? 9.879   -5.693  96.491  1.00 57.97  ? 269  SER A CB  1 
ATOM 2115  O OG  . SER A 1 272  ? 10.692  -6.010  95.377  1.00 57.88  ? 269  SER A OG  1 
ATOM 2116  N N   . ARG A 1 273  ? 11.157  -3.042  95.276  1.00 57.65  ? 270  ARG A N   1 
ATOM 2117  C CA  . ARG A 1 273  ? 12.367  -2.223  95.193  1.00 57.23  ? 270  ARG A CA  1 
ATOM 2118  C C   . ARG A 1 273  ? 12.136  -1.033  94.284  1.00 57.12  ? 270  ARG A C   1 
ATOM 2119  O O   . ARG A 1 273  ? 11.617  -1.187  93.178  1.00 57.18  ? 270  ARG A O   1 
ATOM 2120  C CB  . ARG A 1 273  ? 13.560  -3.045  94.681  1.00 57.16  ? 270  ARG A CB  1 
ATOM 2121  C CG  . ARG A 1 273  ? 13.682  -4.437  95.305  1.00 57.04  ? 270  ARG A CG  1 
ATOM 2122  C CD  . ARG A 1 273  ? 15.073  -5.027  95.170  1.00 56.49  ? 270  ARG A CD  1 
ATOM 2123  N NE  . ARG A 1 273  ? 15.458  -5.251  93.781  1.00 56.00  ? 270  ARG A NE  1 
ATOM 2124  C CZ  . ARG A 1 273  ? 16.373  -6.132  93.389  1.00 55.48  ? 270  ARG A CZ  1 
ATOM 2125  N NH1 . ARG A 1 273  ? 17.000  -6.892  94.281  1.00 54.92  ? 270  ARG A NH1 1 
ATOM 2126  N NH2 . ARG A 1 273  ? 16.654  -6.258  92.098  1.00 55.08  ? 270  ARG A NH2 1 
ATOM 2127  N N   . TYR A 1 274  ? 12.523  0.150   94.758  1.00 56.93  ? 271  TYR A N   1 
ATOM 2128  C CA  . TYR A 1 274  ? 12.381  1.390   93.996  1.00 56.62  ? 271  TYR A CA  1 
ATOM 2129  C C   . TYR A 1 274  ? 13.712  2.122   93.907  1.00 56.62  ? 271  TYR A C   1 
ATOM 2130  O O   . TYR A 1 274  ? 14.548  1.982   94.794  1.00 56.62  ? 271  TYR A O   1 
ATOM 2131  C CB  . TYR A 1 274  ? 11.342  2.296   94.647  1.00 56.44  ? 271  TYR A CB  1 
ATOM 2132  C CG  . TYR A 1 274  ? 9.908   1.882   94.411  1.00 56.33  ? 271  TYR A CG  1 
ATOM 2133  C CD1 . TYR A 1 274  ? 9.323   0.852   95.141  1.00 56.67  ? 271  TYR A CD1 1 
ATOM 2134  C CD2 . TYR A 1 274  ? 9.129   2.539   93.473  1.00 56.26  ? 271  TYR A CD2 1 
ATOM 2135  C CE1 . TYR A 1 274  ? 8.001   0.480   94.923  1.00 56.76  ? 271  TYR A CE1 1 
ATOM 2136  C CE2 . TYR A 1 274  ? 7.813   2.178   93.250  1.00 56.23  ? 271  TYR A CE2 1 
ATOM 2137  C CZ  . TYR A 1 274  ? 7.256   1.153   93.972  1.00 56.52  ? 271  TYR A CZ  1 
ATOM 2138  O OH  . TYR A 1 274  ? 5.949   0.805   93.738  1.00 56.97  ? 271  TYR A OH  1 
ATOM 2139  N N   . LEU A 1 275  ? 13.900  2.887   92.831  1.00 56.69  ? 272  LEU A N   1 
ATOM 2140  C CA  . LEU A 1 275  ? 15.094  3.724   92.628  1.00 56.74  ? 272  LEU A CA  1 
ATOM 2141  C C   . LEU A 1 275  ? 14.788  5.193   92.896  1.00 56.93  ? 272  LEU A C   1 
ATOM 2142  O O   . LEU A 1 275  ? 13.697  5.662   92.596  1.00 56.93  ? 272  LEU A O   1 
ATOM 2143  C CB  . LEU A 1 275  ? 15.628  3.578   91.195  1.00 56.59  ? 272  LEU A CB  1 
ATOM 2144  C CG  . LEU A 1 275  ? 16.502  2.379   90.816  1.00 55.93  ? 272  LEU A CG  1 
ATOM 2145  C CD1 . LEU A 1 275  ? 16.699  2.305   89.309  1.00 54.26  ? 272  LEU A CD1 1 
ATOM 2146  C CD2 . LEU A 1 275  ? 17.839  2.449   91.527  1.00 55.89  ? 272  LEU A CD2 1 
ATOM 2147  N N   . LEU A 1 276  ? 15.753  5.927   93.439  1.00 57.24  ? 273  LEU A N   1 
ATOM 2148  C CA  . LEU A 1 276  ? 15.520  7.330   93.782  1.00 57.53  ? 273  LEU A CA  1 
ATOM 2149  C C   . LEU A 1 276  ? 16.689  8.270   93.434  1.00 57.91  ? 273  LEU A C   1 
ATOM 2150  O O   . LEU A 1 276  ? 17.847  7.989   93.775  1.00 57.76  ? 273  LEU A O   1 
ATOM 2151  C CB  . LEU A 1 276  ? 15.155  7.447   95.265  1.00 57.52  ? 273  LEU A CB  1 
ATOM 2152  C CG  . LEU A 1 276  ? 14.034  6.546   95.800  1.00 57.12  ? 273  LEU A CG  1 
ATOM 2153  C CD1 . LEU A 1 276  ? 14.181  6.291   97.294  1.00 56.98  ? 273  LEU A CD1 1 
ATOM 2154  C CD2 . LEU A 1 276  ? 12.682  7.137   95.491  1.00 56.70  ? 273  LEU A CD2 1 
ATOM 2155  N N   . GLY A 1 277  ? 16.362  9.383   92.766  1.00 58.28  ? 274  GLY A N   1 
ATOM 2156  C CA  . GLY A 1 277  ? 17.337  10.414  92.372  1.00 58.99  ? 274  GLY A CA  1 
ATOM 2157  C C   . GLY A 1 277  ? 17.393  11.637  93.289  1.00 59.56  ? 274  GLY A C   1 
ATOM 2158  O O   . GLY A 1 277  ? 16.433  11.927  94.005  1.00 59.65  ? 274  GLY A O   1 
ATOM 2159  N N   . ASP A 1 278  ? 18.517  12.359  93.244  1.00 59.92  ? 275  ASP A N   1 
ATOM 2160  C CA  . ASP A 1 278  ? 18.820  13.468  94.158  1.00 60.32  ? 275  ASP A CA  1 
ATOM 2161  C C   . ASP A 1 278  ? 19.300  14.679  93.351  1.00 60.16  ? 275  ASP A C   1 
ATOM 2162  O O   . ASP A 1 278  ? 19.490  14.548  92.155  1.00 60.56  ? 275  ASP A O   1 
ATOM 2163  C CB  . ASP A 1 278  ? 19.935  13.011  95.102  1.00 60.72  ? 275  ASP A CB  1 
ATOM 2164  C CG  . ASP A 1 278  ? 19.777  13.555  96.515  1.00 62.45  ? 275  ASP A CG  1 
ATOM 2165  O OD1 . ASP A 1 278  ? 20.529  13.093  97.415  1.00 63.63  ? 275  ASP A OD1 1 
ATOM 2166  O OD2 . ASP A 1 278  ? 18.906  14.437  96.727  1.00 63.78  ? 275  ASP A OD2 1 
ATOM 2167  N N   . MET A 1 279  ? 19.501  15.847  93.968  1.00 60.06  ? 276  MET A N   1 
ATOM 2168  C CA  . MET A 1 279  ? 20.197  16.953  93.271  1.00 60.00  ? 276  MET A CA  1 
ATOM 2169  C C   . MET A 1 279  ? 21.692  16.649  93.233  1.00 59.54  ? 276  MET A C   1 
ATOM 2170  O O   . MET A 1 279  ? 22.442  17.204  92.432  1.00 59.41  ? 276  MET A O   1 
ATOM 2171  C CB  . MET A 1 279  ? 19.934  18.330  93.924  1.00 60.20  ? 276  MET A CB  1 
ATOM 2172  C CG  . MET A 1 279  ? 20.652  19.571  93.247  1.00 60.54  ? 276  MET A CG  1 
ATOM 2173  S SD  . MET A 1 279  ? 22.247  20.221  93.940  1.00 60.89  ? 276  MET A SD  1 
ATOM 2174  C CE  . MET A 1 279  ? 21.674  21.314  95.251  1.00 60.86  ? 276  MET A CE  1 
ATOM 2175  N N   . GLU A 1 280  ? 22.106  15.743  94.106  1.00 59.32  ? 277  GLU A N   1 
ATOM 2176  C CA  . GLU A 1 280  ? 23.499  15.366  94.253  1.00 59.37  ? 277  GLU A CA  1 
ATOM 2177  C C   . GLU A 1 280  ? 23.908  14.383  93.178  1.00 58.92  ? 277  GLU A C   1 
ATOM 2178  O O   . GLU A 1 280  ? 25.092  14.253  92.867  1.00 58.87  ? 277  GLU A O   1 
ATOM 2179  C CB  . GLU A 1 280  ? 23.707  14.703  95.614  1.00 59.78  ? 277  GLU A CB  1 
ATOM 2180  C CG  . GLU A 1 280  ? 23.439  15.597  96.813  1.00 60.99  ? 277  GLU A CG  1 
ATOM 2181  C CD  . GLU A 1 280  ? 24.672  16.344  97.277  1.00 62.43  ? 277  GLU A CD  1 
ATOM 2182  O OE1 . GLU A 1 280  ? 25.357  16.969  96.429  1.00 62.05  ? 277  GLU A OE1 1 
ATOM 2183  O OE2 . GLU A 1 280  ? 24.951  16.299  98.498  1.00 63.77  ? 277  GLU A OE2 1 
ATOM 2184  N N   . GLY A 1 281  ? 22.920  13.680  92.636  1.00 58.52  ? 278  GLY A N   1 
ATOM 2185  C CA  . GLY A 1 281  ? 23.151  12.617  91.673  1.00 58.24  ? 278  GLY A CA  1 
ATOM 2186  C C   . GLY A 1 281  ? 23.256  11.276  92.366  1.00 58.17  ? 278  GLY A C   1 
ATOM 2187  O O   . GLY A 1 281  ? 23.769  10.320  91.796  1.00 58.30  ? 278  GLY A O   1 
ATOM 2188  N N   . ARG A 1 282  ? 22.765  11.209  93.601  1.00 58.05  ? 279  ARG A N   1 
ATOM 2189  C CA  . ARG A 1 282  ? 22.866  9.999   94.411  1.00 57.88  ? 279  ARG A CA  1 
ATOM 2190  C C   . ARG A 1 282  ? 21.719  9.048   94.103  1.00 57.24  ? 279  ARG A C   1 
ATOM 2191  O O   . ARG A 1 282  ? 20.566  9.456   93.997  1.00 57.15  ? 279  ARG A O   1 
ATOM 2192  C CB  . ARG A 1 282  ? 22.934  10.345  95.904  1.00 57.91  ? 279  ARG A CB  1 
ATOM 2193  C CG  . ARG A 1 282  ? 24.217  11.115  96.305  1.00 58.71  ? 279  ARG A CG  1 
ATOM 2194  C CD  . ARG A 1 282  ? 24.355  11.338  97.820  1.00 58.90  ? 279  ARG A CD  1 
ATOM 2195  N NE  . ARG A 1 282  ? 23.177  11.993  98.400  1.00 60.91  ? 279  ARG A NE  1 
ATOM 2196  C CZ  . ARG A 1 282  ? 23.032  12.317  99.686  1.00 60.65  ? 279  ARG A CZ  1 
ATOM 2197  N NH1 . ARG A 1 282  ? 23.993  12.061  100.568 1.00 59.98  ? 279  ARG A NH1 1 
ATOM 2198  N NH2 . ARG A 1 282  ? 21.910  12.904  100.087 1.00 60.59  ? 279  ARG A NH2 1 
ATOM 2199  N N   . LEU A 1 283  ? 22.059  7.777   93.944  1.00 56.80  ? 280  LEU A N   1 
ATOM 2200  C CA  . LEU A 1 283  ? 21.109  6.766   93.521  1.00 56.45  ? 280  LEU A CA  1 
ATOM 2201  C C   . LEU A 1 283  ? 20.699  5.910   94.706  1.00 56.62  ? 280  LEU A C   1 
ATOM 2202  O O   . LEU A 1 283  ? 21.472  5.071   95.174  1.00 56.47  ? 280  LEU A O   1 
ATOM 2203  C CB  . LEU A 1 283  ? 21.731  5.897   92.428  1.00 56.13  ? 280  LEU A CB  1 
ATOM 2204  C CG  . LEU A 1 283  ? 20.779  5.044   91.600  1.00 55.47  ? 280  LEU A CG  1 
ATOM 2205  C CD1 . LEU A 1 283  ? 20.172  5.858   90.483  1.00 55.12  ? 280  LEU A CD1 1 
ATOM 2206  C CD2 . LEU A 1 283  ? 21.501  3.855   91.038  1.00 55.07  ? 280  LEU A CD2 1 
ATOM 2207  N N   . PHE A 1 284  ? 19.478  6.125   95.187  1.00 56.95  ? 281  PHE A N   1 
ATOM 2208  C CA  . PHE A 1 284  ? 18.989  5.420   96.371  1.00 57.38  ? 281  PHE A CA  1 
ATOM 2209  C C   . PHE A 1 284  ? 18.158  4.200   96.015  1.00 57.86  ? 281  PHE A C   1 
ATOM 2210  O O   . PHE A 1 284  ? 17.584  4.130   94.924  1.00 57.84  ? 281  PHE A O   1 
ATOM 2211  C CB  . PHE A 1 284  ? 18.206  6.368   97.291  1.00 57.16  ? 281  PHE A CB  1 
ATOM 2212  C CG  . PHE A 1 284  ? 19.049  7.453   97.886  1.00 56.69  ? 281  PHE A CG  1 
ATOM 2213  C CD1 . PHE A 1 284  ? 19.077  8.719   97.316  1.00 56.86  ? 281  PHE A CD1 1 
ATOM 2214  C CD2 . PHE A 1 284  ? 19.840  7.203   98.994  1.00 56.05  ? 281  PHE A CD2 1 
ATOM 2215  C CE1 . PHE A 1 284  ? 19.878  9.728   97.853  1.00 56.65  ? 281  PHE A CE1 1 
ATOM 2216  C CE2 . PHE A 1 284  ? 20.641  8.201   99.534  1.00 56.38  ? 281  PHE A CE2 1 
ATOM 2217  C CZ  . PHE A 1 284  ? 20.660  9.467   98.961  1.00 56.37  ? 281  PHE A CZ  1 
ATOM 2218  N N   . MET A 1 285  ? 18.112  3.243   96.940  1.00 58.45  ? 282  MET A N   1 
ATOM 2219  C CA  . MET A 1 285  ? 17.322  2.034   96.780  1.00 59.34  ? 282  MET A CA  1 
ATOM 2220  C C   . MET A 1 285  ? 16.285  1.915   97.889  1.00 60.11  ? 282  MET A C   1 
ATOM 2221  O O   . MET A 1 285  ? 16.616  1.627   99.036  1.00 60.16  ? 282  MET A O   1 
ATOM 2222  C CB  . MET A 1 285  ? 18.229  0.807   96.744  1.00 59.26  ? 282  MET A CB  1 
ATOM 2223  C CG  . MET A 1 285  ? 17.517  -0.516  96.521  1.00 59.36  ? 282  MET A CG  1 
ATOM 2224  S SD  . MET A 1 285  ? 16.506  -0.562  95.030  1.00 59.50  ? 282  MET A SD  1 
ATOM 2225  C CE  . MET A 1 285  ? 17.751  -0.642  93.749  1.00 59.55  ? 282  MET A CE  1 
ATOM 2226  N N   . LEU A 1 286  ? 15.028  2.147   97.530  1.00 61.40  ? 283  LEU A N   1 
ATOM 2227  C CA  . LEU A 1 286  ? 13.913  2.085   98.468  1.00 62.57  ? 283  LEU A CA  1 
ATOM 2228  C C   . LEU A 1 286  ? 13.437  0.638   98.549  1.00 63.67  ? 283  LEU A C   1 
ATOM 2229  O O   . LEU A 1 286  ? 12.965  0.072   97.559  1.00 63.75  ? 283  LEU A O   1 
ATOM 2230  C CB  . LEU A 1 286  ? 12.786  3.030   98.009  1.00 62.42  ? 283  LEU A CB  1 
ATOM 2231  C CG  . LEU A 1 286  ? 11.630  3.583   98.874  1.00 61.76  ? 283  LEU A CG  1 
ATOM 2232  C CD1 . LEU A 1 286  ? 10.364  2.737   98.768  1.00 61.46  ? 283  LEU A CD1 1 
ATOM 2233  C CD2 . LEU A 1 286  ? 12.002  3.830   100.339 1.00 61.89  ? 283  LEU A CD2 1 
ATOM 2234  N N   . LEU A 1 287  ? 13.592  0.037   99.725  1.00 65.00  ? 284  LEU A N   1 
ATOM 2235  C CA  . LEU A 1 287  ? 13.238  -1.361  99.922  1.00 66.52  ? 284  LEU A CA  1 
ATOM 2236  C C   . LEU A 1 287  ? 12.188  -1.488  101.008 1.00 67.68  ? 284  LEU A C   1 
ATOM 2237  O O   . LEU A 1 287  ? 12.439  -1.113  102.153 1.00 67.97  ? 284  LEU A O   1 
ATOM 2238  C CB  . LEU A 1 287  ? 14.477  -2.188  100.300 1.00 66.46  ? 284  LEU A CB  1 
ATOM 2239  C CG  . LEU A 1 287  ? 15.623  -2.342  99.291  1.00 66.63  ? 284  LEU A CG  1 
ATOM 2240  C CD1 . LEU A 1 287  ? 16.762  -3.184  99.854  1.00 66.59  ? 284  LEU A CD1 1 
ATOM 2241  C CD2 . LEU A 1 287  ? 15.106  -2.980  98.029  1.00 66.93  ? 284  LEU A CD2 1 
ATOM 2242  N N   . LEU A 1 288  ? 11.017  -2.014  100.649 1.00 69.11  ? 285  LEU A N   1 
ATOM 2243  C CA  . LEU A 1 288  ? 9.962   -2.295  101.632 1.00 70.54  ? 285  LEU A CA  1 
ATOM 2244  C C   . LEU A 1 288  ? 9.995   -3.742  102.125 1.00 71.65  ? 285  LEU A C   1 
ATOM 2245  O O   . LEU A 1 288  ? 10.190  -4.666  101.336 1.00 71.81  ? 285  LEU A O   1 
ATOM 2246  C CB  . LEU A 1 288  ? 8.570   -1.926  101.098 1.00 70.44  ? 285  LEU A CB  1 
ATOM 2247  C CG  . LEU A 1 288  ? 8.187   -2.155  99.634  1.00 70.44  ? 285  LEU A CG  1 
ATOM 2248  C CD1 . LEU A 1 288  ? 6.770   -2.709  99.521  1.00 70.14  ? 285  LEU A CD1 1 
ATOM 2249  C CD2 . LEU A 1 288  ? 8.333   -0.861  98.848  1.00 70.45  ? 285  LEU A CD2 1 
ATOM 2250  N N   . GLU A 1 289  ? 9.806   -3.931  103.430 1.00 73.16  ? 286  GLU A N   1 
ATOM 2251  C CA  . GLU A 1 289  ? 9.903   -5.256  104.049 1.00 74.85  ? 286  GLU A CA  1 
ATOM 2252  C C   . GLU A 1 289  ? 8.572   -6.011  104.021 1.00 75.67  ? 286  GLU A C   1 
ATOM 2253  O O   . GLU A 1 289  ? 7.541   -5.502  104.470 1.00 75.75  ? 286  GLU A O   1 
ATOM 2254  C CB  . GLU A 1 289  ? 10.442  -5.151  105.483 1.00 74.80  ? 286  GLU A CB  1 
ATOM 2255  C CG  . GLU A 1 289  ? 11.899  -4.663  105.575 1.00 75.53  ? 286  GLU A CG  1 
ATOM 2256  C CD  . GLU A 1 289  ? 12.367  -4.361  107.005 1.00 75.63  ? 286  GLU A CD  1 
ATOM 2257  O OE1 . GLU A 1 289  ? 11.755  -4.871  107.978 1.00 76.44  ? 286  GLU A OE1 1 
ATOM 2258  O OE2 . GLU A 1 289  ? 13.365  -3.613  107.149 1.00 76.55  ? 286  GLU A OE2 1 
ATOM 2259  N N   . LYS A 1 290  ? 8.612   -7.227  103.481 1.00 76.88  ? 287  LYS A N   1 
ATOM 2260  C CA  . LYS A 1 290  ? 7.432   -8.080  103.344 1.00 78.02  ? 287  LYS A CA  1 
ATOM 2261  C C   . LYS A 1 290  ? 7.089   -8.761  104.668 1.00 78.88  ? 287  LYS A C   1 
ATOM 2262  O O   . LYS A 1 290  ? 7.952   -9.380  105.297 1.00 79.11  ? 287  LYS A O   1 
ATOM 2263  C CB  . LYS A 1 290  ? 7.678   -9.129  102.251 1.00 78.05  ? 287  LYS A CB  1 
ATOM 2264  C CG  . LYS A 1 290  ? 6.753   -10.348 102.280 1.00 78.11  ? 287  LYS A CG  1 
ATOM 2265  C CD  . LYS A 1 290  ? 7.520   -11.654 102.017 1.00 78.26  ? 287  LYS A CD  1 
ATOM 2266  C CE  . LYS A 1 290  ? 8.314   -12.121 103.245 1.00 77.98  ? 287  LYS A CE  1 
ATOM 2267  N NZ  . LYS A 1 290  ? 8.946   -13.460 103.049 1.00 77.69  ? 287  LYS A NZ  1 
ATOM 2268  N N   . GLU A 1 291  ? 5.826   -8.646  105.075 1.00 79.94  ? 288  GLU A N   1 
ATOM 2269  C CA  . GLU A 1 291  ? 5.318   -9.288  106.297 1.00 80.95  ? 288  GLU A CA  1 
ATOM 2270  C C   . GLU A 1 291  ? 4.034   -10.068 105.989 1.00 81.57  ? 288  GLU A C   1 
ATOM 2271  O O   . GLU A 1 291  ? 3.196   -9.616  105.205 1.00 81.66  ? 288  GLU A O   1 
ATOM 2272  C CB  . GLU A 1 291  ? 5.070   -8.242  107.387 1.00 80.91  ? 288  GLU A CB  1 
ATOM 2273  C CG  . GLU A 1 291  ? 4.911   -8.805  108.790 1.00 81.00  ? 288  GLU A CG  1 
ATOM 2274  C CD  . GLU A 1 291  ? 4.500   -7.753  109.811 1.00 81.12  ? 288  GLU A CD  1 
ATOM 2275  O OE1 . GLU A 1 291  ? 4.230   -6.593  109.417 1.00 81.05  ? 288  GLU A OE1 1 
ATOM 2276  O OE2 . GLU A 1 291  ? 4.449   -8.097  111.014 1.00 81.23  ? 288  GLU A OE2 1 
ATOM 2277  N N   . GLU A 1 292  ? 3.873   -11.233 106.606 1.00 82.40  ? 289  GLU A N   1 
ATOM 2278  C CA  . GLU A 1 292  ? 2.798   -12.134 106.199 1.00 83.19  ? 289  GLU A CA  1 
ATOM 2279  C C   . GLU A 1 292  ? 1.896   -12.634 107.331 1.00 83.62  ? 289  GLU A C   1 
ATOM 2280  O O   . GLU A 1 292  ? 2.382   -13.141 108.350 1.00 83.56  ? 289  GLU A O   1 
ATOM 2281  C CB  . GLU A 1 292  ? 3.386   -13.314 105.421 1.00 83.22  ? 289  GLU A CB  1 
ATOM 2282  C CG  . GLU A 1 292  ? 2.436   -13.920 104.398 1.00 83.54  ? 289  GLU A CG  1 
ATOM 2283  C CD  . GLU A 1 292  ? 3.147   -14.787 103.374 1.00 83.64  ? 289  GLU A CD  1 
ATOM 2284  O OE1 . GLU A 1 292  ? 4.376   -14.983 103.498 1.00 83.56  ? 289  GLU A OE1 1 
ATOM 2285  O OE2 . GLU A 1 292  ? 2.471   -15.275 102.441 1.00 83.65  ? 289  GLU A OE2 1 
ATOM 2286  N N   . GLN A 1 293  ? 0.585   -12.475 107.133 1.00 84.19  ? 290  GLN A N   1 
ATOM 2287  C CA  . GLN A 1 293  ? -0.427  -13.105 107.985 1.00 84.77  ? 290  GLN A CA  1 
ATOM 2288  C C   . GLN A 1 293  ? -0.974  -14.372 107.318 1.00 85.18  ? 290  GLN A C   1 
ATOM 2289  O O   . GLN A 1 293  ? -1.693  -15.159 107.947 1.00 85.29  ? 290  GLN A O   1 
ATOM 2290  C CB  . GLN A 1 293  ? -1.549  -12.124 108.357 1.00 84.73  ? 290  GLN A CB  1 
ATOM 2291  C CG  . GLN A 1 293  ? -2.593  -12.664 109.370 1.00 85.00  ? 290  GLN A CG  1 
ATOM 2292  C CD  . GLN A 1 293  ? -1.993  -13.521 110.498 1.00 85.19  ? 290  GLN A CD  1 
ATOM 2293  O OE1 . GLN A 1 293  ? -1.114  -13.080 111.241 1.00 85.32  ? 290  GLN A OE1 1 
ATOM 2294  N NE2 . GLN A 1 293  ? -2.483  -14.752 110.624 1.00 84.88  ? 290  GLN A NE2 1 
ATOM 2295  N N   . MET A 1 294  ? -0.625  -14.556 106.043 1.00 85.63  ? 291  MET A N   1 
ATOM 2296  C CA  . MET A 1 294  ? -0.762  -15.849 105.335 1.00 86.07  ? 291  MET A CA  1 
ATOM 2297  C C   . MET A 1 294  ? -2.157  -16.215 104.793 1.00 86.28  ? 291  MET A C   1 
ATOM 2298  O O   . MET A 1 294  ? -2.276  -17.143 103.984 1.00 86.35  ? 291  MET A O   1 
ATOM 2299  C CB  . MET A 1 294  ? -0.196  -17.005 106.184 1.00 86.07  ? 291  MET A CB  1 
ATOM 2300  C CG  . MET A 1 294  ? 1.298   -16.895 106.475 1.00 86.33  ? 291  MET A CG  1 
ATOM 2301  S SD  . MET A 1 294  ? 2.338   -18.145 105.692 1.00 87.05  ? 291  MET A SD  1 
ATOM 2302  C CE  . MET A 1 294  ? 1.861   -18.045 103.966 1.00 86.98  ? 291  MET A CE  1 
ATOM 2303  N N   . ASP A 1 295  ? -3.202  -15.514 105.235 1.00 86.45  ? 292  ASP A N   1 
ATOM 2304  C CA  . ASP A 1 295  ? -4.567  -15.806 104.774 1.00 86.48  ? 292  ASP A CA  1 
ATOM 2305  C C   . ASP A 1 295  ? -5.366  -14.543 104.437 1.00 86.48  ? 292  ASP A C   1 
ATOM 2306  O O   . ASP A 1 295  ? -6.315  -14.181 105.139 1.00 86.53  ? 292  ASP A O   1 
ATOM 2307  C CB  . ASP A 1 295  ? -5.320  -16.684 105.785 1.00 86.48  ? 292  ASP A CB  1 
ATOM 2308  C CG  . ASP A 1 295  ? -4.685  -18.056 105.961 1.00 86.54  ? 292  ASP A CG  1 
ATOM 2309  O OD1 . ASP A 1 295  ? -5.227  -19.037 105.410 1.00 86.78  ? 292  ASP A OD1 1 
ATOM 2310  O OD2 . ASP A 1 295  ? -3.645  -18.160 106.647 1.00 86.34  ? 292  ASP A OD2 1 
ATOM 2311  N N   . GLY A 1 296  ? -4.970  -13.891 103.347 1.00 86.44  ? 293  GLY A N   1 
ATOM 2312  C CA  . GLY A 1 296  ? -5.635  -12.688 102.852 1.00 86.40  ? 293  GLY A CA  1 
ATOM 2313  C C   . GLY A 1 296  ? -4.825  -12.095 101.716 1.00 86.39  ? 293  GLY A C   1 
ATOM 2314  O O   . GLY A 1 296  ? -5.245  -12.132 100.553 1.00 86.41  ? 293  GLY A O   1 
ATOM 2315  N N   . THR A 1 297  ? -3.670  -11.531 102.074 1.00 86.30  ? 294  THR A N   1 
ATOM 2316  C CA  . THR A 1 297  ? -2.623  -11.103 101.131 1.00 86.08  ? 294  THR A CA  1 
ATOM 2317  C C   . THR A 1 297  ? -1.290  -10.990 101.913 1.00 85.77  ? 294  THR A C   1 
ATOM 2318  O O   . THR A 1 297  ? -0.968  -11.877 102.722 1.00 85.78  ? 294  THR A O   1 
ATOM 2319  C CB  . THR A 1 297  ? -2.986  -9.778  100.363 1.00 86.16  ? 294  THR A CB  1 
ATOM 2320  O OG1 . THR A 1 297  ? -4.401  -9.701  100.143 1.00 85.99  ? 294  THR A OG1 1 
ATOM 2321  C CG2 . THR A 1 297  ? -2.273  -9.719  99.006  1.00 86.34  ? 294  THR A CG2 1 
ATOM 2322  N N   . VAL A 1 298  ? -0.531  -9.917  101.674 1.00 85.24  ? 295  VAL A N   1 
ATOM 2323  C CA  . VAL A 1 298  ? 0.722   -9.646  102.396 1.00 84.72  ? 295  VAL A CA  1 
ATOM 2324  C C   . VAL A 1 298  ? 0.808   -8.187  102.876 1.00 84.17  ? 295  VAL A C   1 
ATOM 2325  O O   . VAL A 1 298  ? 0.511   -7.255  102.123 1.00 84.23  ? 295  VAL A O   1 
ATOM 2326  C CB  . VAL A 1 298  ? 1.990   -10.014 101.558 1.00 84.78  ? 295  VAL A CB  1 
ATOM 2327  C CG1 . VAL A 1 298  ? 2.218   -11.520 101.548 1.00 84.70  ? 295  VAL A CG1 1 
ATOM 2328  C CG2 . VAL A 1 298  ? 1.897   -9.468  100.129 1.00 85.06  ? 295  VAL A CG2 1 
ATOM 2329  N N   . THR A 1 299  ? 1.210   -8.004  104.133 1.00 83.39  ? 296  THR A N   1 
ATOM 2330  C CA  . THR A 1 299  ? 1.332   -6.669  104.735 1.00 82.51  ? 296  THR A CA  1 
ATOM 2331  C C   . THR A 1 299  ? 2.776   -6.134  104.667 1.00 81.78  ? 296  THR A C   1 
ATOM 2332  O O   . THR A 1 299  ? 3.544   -6.538  103.792 1.00 81.67  ? 296  THR A O   1 
ATOM 2333  C CB  . THR A 1 299  ? 0.726   -6.627  106.184 1.00 82.65  ? 296  THR A CB  1 
ATOM 2334  O OG1 . THR A 1 299  ? 0.978   -5.352  106.791 1.00 82.63  ? 296  THR A OG1 1 
ATOM 2335  C CG2 . THR A 1 299  ? 1.284   -7.755  107.076 1.00 82.62  ? 296  THR A CG2 1 
ATOM 2336  N N   . LEU A 1 300  ? 3.127   -5.214  105.565 1.00 80.93  ? 297  LEU A N   1 
ATOM 2337  C CA  . LEU A 1 300  ? 4.477   -4.641  105.617 1.00 80.10  ? 297  LEU A CA  1 
ATOM 2338  C C   . LEU A 1 300  ? 4.999   -4.500  107.053 1.00 79.56  ? 297  LEU A C   1 
ATOM 2339  O O   . LEU A 1 300  ? 4.257   -4.117  107.967 1.00 79.59  ? 297  LEU A O   1 
ATOM 2340  C CB  . LEU A 1 300  ? 4.528   -3.283  104.906 1.00 80.05  ? 297  LEU A CB  1 
ATOM 2341  C CG  . LEU A 1 300  ? 4.295   -3.216  103.396 1.00 79.59  ? 297  LEU A CG  1 
ATOM 2342  C CD1 . LEU A 1 300  ? 2.816   -3.123  103.072 1.00 79.44  ? 297  LEU A CD1 1 
ATOM 2343  C CD2 . LEU A 1 300  ? 5.010   -2.010  102.843 1.00 79.69  ? 297  LEU A CD2 1 
ATOM 2344  N N   . LYS A 1 301  ? 6.279   -4.813  107.239 1.00 78.66  ? 298  LYS A N   1 
ATOM 2345  C CA  . LYS A 1 301  ? 6.921   -4.709  108.544 1.00 77.77  ? 298  LYS A CA  1 
ATOM 2346  C C   . LYS A 1 301  ? 7.634   -3.363  108.682 1.00 77.12  ? 298  LYS A C   1 
ATOM 2347  O O   . LYS A 1 301  ? 7.544   -2.714  109.727 1.00 77.05  ? 298  LYS A O   1 
ATOM 2348  C CB  . LYS A 1 301  ? 7.896   -5.877  108.757 1.00 77.79  ? 298  LYS A CB  1 
ATOM 2349  C CG  . LYS A 1 301  ? 8.529   -5.960  110.154 1.00 77.83  ? 298  LYS A CG  1 
ATOM 2350  C CD  . LYS A 1 301  ? 7.638   -6.670  111.181 1.00 77.72  ? 298  LYS A CD  1 
ATOM 2351  C CE  . LYS A 1 301  ? 7.760   -8.191  111.102 1.00 77.57  ? 298  LYS A CE  1 
ATOM 2352  N NZ  . LYS A 1 301  ? 9.110   -8.687  111.490 1.00 77.43  ? 298  LYS A NZ  1 
ATOM 2353  N N   . ASP A 1 302  ? 8.325   -2.952  107.619 1.00 76.24  ? 299  ASP A N   1 
ATOM 2354  C CA  . ASP A 1 302  ? 9.152   -1.742  107.617 1.00 75.47  ? 299  ASP A CA  1 
ATOM 2355  C C   . ASP A 1 302  ? 9.601   -1.434  106.179 1.00 74.75  ? 299  ASP A C   1 
ATOM 2356  O O   . ASP A 1 302  ? 9.140   -2.088  105.241 1.00 74.72  ? 299  ASP A O   1 
ATOM 2357  C CB  . ASP A 1 302  ? 10.365  -1.936  108.542 1.00 75.58  ? 299  ASP A CB  1 
ATOM 2358  C CG  . ASP A 1 302  ? 10.970  -0.624  109.017 1.00 75.93  ? 299  ASP A CG  1 
ATOM 2359  O OD1 . ASP A 1 302  ? 10.213  0.253   109.508 1.00 76.23  ? 299  ASP A OD1 1 
ATOM 2360  O OD2 . ASP A 1 302  ? 12.216  -0.478  108.909 1.00 76.36  ? 299  ASP A OD2 1 
ATOM 2361  N N   . LEU A 1 303  ? 10.482  -0.444  106.011 1.00 73.79  ? 300  LEU A N   1 
ATOM 2362  C CA  . LEU A 1 303  ? 11.051  -0.082  104.704 1.00 72.82  ? 300  LEU A CA  1 
ATOM 2363  C C   . LEU A 1 303  ? 12.339  0.743   104.844 1.00 72.32  ? 300  LEU A C   1 
ATOM 2364  O O   . LEU A 1 303  ? 12.298  1.866   105.344 1.00 72.44  ? 300  LEU A O   1 
ATOM 2365  C CB  . LEU A 1 303  ? 10.012  0.649   103.819 1.00 72.77  ? 300  LEU A CB  1 
ATOM 2366  C CG  . LEU A 1 303  ? 9.389   2.027   104.109 1.00 72.35  ? 300  LEU A CG  1 
ATOM 2367  C CD1 . LEU A 1 303  ? 8.568   2.492   102.916 1.00 71.59  ? 300  LEU A CD1 1 
ATOM 2368  C CD2 . LEU A 1 303  ? 8.529   2.047   105.364 1.00 72.17  ? 300  LEU A CD2 1 
ATOM 2369  N N   . ARG A 1 304  ? 13.478  0.199   104.404 1.00 71.53  ? 301  ARG A N   1 
ATOM 2370  C CA  . ARG A 1 304  ? 14.769  0.904   104.561 1.00 70.75  ? 301  ARG A CA  1 
ATOM 2371  C C   . ARG A 1 304  ? 15.435  1.377   103.247 1.00 70.09  ? 301  ARG A C   1 
ATOM 2372  O O   . ARG A 1 304  ? 15.190  0.821   102.172 1.00 70.00  ? 301  ARG A O   1 
ATOM 2373  C CB  . ARG A 1 304  ? 15.731  0.084   105.436 1.00 70.90  ? 301  ARG A CB  1 
ATOM 2374  C CG  . ARG A 1 304  ? 16.731  -0.789  104.691 1.00 71.25  ? 301  ARG A CG  1 
ATOM 2375  C CD  . ARG A 1 304  ? 16.850  -2.160  105.338 1.00 72.03  ? 301  ARG A CD  1 
ATOM 2376  N NE  . ARG A 1 304  ? 15.902  -3.098  104.741 1.00 72.35  ? 301  ARG A NE  1 
ATOM 2377  C CZ  . ARG A 1 304  ? 16.173  -3.871  103.691 1.00 72.40  ? 301  ARG A CZ  1 
ATOM 2378  N NH1 . ARG A 1 304  ? 17.376  -3.839  103.123 1.00 71.84  ? 301  ARG A NH1 1 
ATOM 2379  N NH2 . ARG A 1 304  ? 15.239  -4.684  103.212 1.00 72.49  ? 301  ARG A NH2 1 
ATOM 2380  N N   . VAL A 1 305  ? 16.276  2.409   103.358 1.00 69.25  ? 302  VAL A N   1 
ATOM 2381  C CA  . VAL A 1 305  ? 16.879  3.085   102.198 1.00 68.33  ? 302  VAL A CA  1 
ATOM 2382  C C   . VAL A 1 305  ? 18.408  2.959   102.161 1.00 67.84  ? 302  VAL A C   1 
ATOM 2383  O O   . VAL A 1 305  ? 19.102  3.356   103.099 1.00 67.74  ? 302  VAL A O   1 
ATOM 2384  C CB  . VAL A 1 305  ? 16.501  4.586   102.163 1.00 68.28  ? 302  VAL A CB  1 
ATOM 2385  C CG1 . VAL A 1 305  ? 16.893  5.208   100.835 1.00 68.34  ? 302  VAL A CG1 1 
ATOM 2386  C CG2 . VAL A 1 305  ? 15.013  4.782   102.414 1.00 68.00  ? 302  VAL A CG2 1 
ATOM 2387  N N   . GLU A 1 306  ? 18.922  2.418   101.062 1.00 67.30  ? 303  GLU A N   1 
ATOM 2388  C CA  . GLU A 1 306  ? 20.359  2.223   100.883 1.00 67.01  ? 303  GLU A CA  1 
ATOM 2389  C C   . GLU A 1 306  ? 20.930  3.073   99.748  1.00 66.55  ? 303  GLU A C   1 
ATOM 2390  O O   . GLU A 1 306  ? 20.309  3.218   98.694  1.00 66.71  ? 303  GLU A O   1 
ATOM 2391  C CB  . GLU A 1 306  ? 20.669  0.750   100.626 1.00 67.08  ? 303  GLU A CB  1 
ATOM 2392  C CG  . GLU A 1 306  ? 20.308  -0.155  101.789 1.00 68.59  ? 303  GLU A CG  1 
ATOM 2393  C CD  . GLU A 1 306  ? 21.302  -1.292  101.994 1.00 70.49  ? 303  GLU A CD  1 
ATOM 2394  O OE1 . GLU A 1 306  ? 21.963  -1.700  101.007 1.00 71.37  ? 303  GLU A OE1 1 
ATOM 2395  O OE2 . GLU A 1 306  ? 21.418  -1.777  103.147 1.00 70.69  ? 303  GLU A OE2 1 
ATOM 2396  N N   . LEU A 1 307  ? 22.116  3.630   99.970  1.00 65.87  ? 304  LEU A N   1 
ATOM 2397  C CA  . LEU A 1 307  ? 22.800  4.419   98.955  1.00 65.34  ? 304  LEU A CA  1 
ATOM 2398  C C   . LEU A 1 307  ? 23.644  3.502   98.066  1.00 65.02  ? 304  LEU A C   1 
ATOM 2399  O O   . LEU A 1 307  ? 24.587  2.856   98.539  1.00 65.05  ? 304  LEU A O   1 
ATOM 2400  C CB  . LEU A 1 307  ? 23.644  5.511   99.620  1.00 65.26  ? 304  LEU A CB  1 
ATOM 2401  C CG  . LEU A 1 307  ? 24.637  6.389   98.849  1.00 65.60  ? 304  LEU A CG  1 
ATOM 2402  C CD1 . LEU A 1 307  ? 24.032  7.006   97.596  1.00 65.98  ? 304  LEU A CD1 1 
ATOM 2403  C CD2 . LEU A 1 307  ? 25.185  7.480   99.761  1.00 65.47  ? 304  LEU A CD2 1 
ATOM 2404  N N   . LEU A 1 308  ? 23.288  3.449   96.783  1.00 64.50  ? 305  LEU A N   1 
ATOM 2405  C CA  . LEU A 1 308  ? 23.928  2.547   95.823  1.00 64.01  ? 305  LEU A CA  1 
ATOM 2406  C C   . LEU A 1 308  ? 25.135  3.137   95.101  1.00 63.87  ? 305  LEU A C   1 
ATOM 2407  O O   . LEU A 1 308  ? 26.017  2.394   94.656  1.00 63.99  ? 305  LEU A O   1 
ATOM 2408  C CB  . LEU A 1 308  ? 22.924  2.076   94.780  1.00 63.85  ? 305  LEU A CB  1 
ATOM 2409  C CG  . LEU A 1 308  ? 21.862  1.069   95.193  1.00 63.55  ? 305  LEU A CG  1 
ATOM 2410  C CD1 . LEU A 1 308  ? 20.845  0.982   94.077  1.00 63.61  ? 305  LEU A CD1 1 
ATOM 2411  C CD2 . LEU A 1 308  ? 22.463  -0.296  95.491  1.00 63.05  ? 305  LEU A CD2 1 
ATOM 2412  N N   . GLY A 1 309  ? 25.166  4.459   94.953  1.00 63.50  ? 306  GLY A N   1 
ATOM 2413  C CA  . GLY A 1 309  ? 26.286  5.102   94.283  1.00 63.06  ? 306  GLY A CA  1 
ATOM 2414  C C   . GLY A 1 309  ? 26.003  6.464   93.696  1.00 62.72  ? 306  GLY A C   1 
ATOM 2415  O O   . GLY A 1 309  ? 25.409  7.324   94.344  1.00 62.69  ? 306  GLY A O   1 
ATOM 2416  N N   . GLU A 1 310  ? 26.435  6.655   92.457  1.00 62.45  ? 307  GLU A N   1 
ATOM 2417  C CA  . GLU A 1 310  ? 26.451  7.976   91.857  1.00 62.29  ? 307  GLU A CA  1 
ATOM 2418  C C   . GLU A 1 310  ? 26.070  7.965   90.379  1.00 62.08  ? 307  GLU A C   1 
ATOM 2419  O O   . GLU A 1 310  ? 26.522  7.117   89.602  1.00 62.19  ? 307  GLU A O   1 
ATOM 2420  C CB  . GLU A 1 310  ? 27.830  8.603   92.053  1.00 62.46  ? 307  GLU A CB  1 
ATOM 2421  C CG  . GLU A 1 310  ? 28.009  9.968   91.427  1.00 62.90  ? 307  GLU A CG  1 
ATOM 2422  C CD  . GLU A 1 310  ? 28.813  10.880  92.310  1.00 63.88  ? 307  GLU A CD  1 
ATOM 2423  O OE1 . GLU A 1 310  ? 28.235  11.379  93.301  1.00 65.00  ? 307  GLU A OE1 1 
ATOM 2424  O OE2 . GLU A 1 310  ? 30.012  11.095  92.024  1.00 63.84  ? 307  GLU A OE2 1 
ATOM 2425  N N   . THR A 1 311  ? 25.229  8.924   90.010  1.00 61.64  ? 308  THR A N   1 
ATOM 2426  C CA  . THR A 1 311  ? 24.776  9.101   88.643  1.00 61.10  ? 308  THR A CA  1 
ATOM 2427  C C   . THR A 1 311  ? 24.899  10.567  88.276  1.00 60.81  ? 308  THR A C   1 
ATOM 2428  O O   . THR A 1 311  ? 25.118  11.409  89.145  1.00 60.78  ? 308  THR A O   1 
ATOM 2429  C CB  . THR A 1 311  ? 23.301  8.669   88.474  1.00 61.25  ? 308  THR A CB  1 
ATOM 2430  O OG1 . THR A 1 311  ? 22.445  9.468   89.309  1.00 60.99  ? 308  THR A OG1 1 
ATOM 2431  C CG2 . THR A 1 311  ? 23.131  7.191   88.818  1.00 61.42  ? 308  THR A CG2 1 
ATOM 2432  N N   . SER A 1 312  ? 24.769  10.865  86.988  1.00 60.45  ? 309  SER A N   1 
ATOM 2433  C CA  . SER A 1 312  ? 24.611  12.230  86.520  1.00 60.16  ? 309  SER A CA  1 
ATOM 2434  C C   . SER A 1 312  ? 23.286  12.705  87.071  1.00 60.09  ? 309  SER A C   1 
ATOM 2435  O O   . SER A 1 312  ? 22.370  11.900  87.226  1.00 60.08  ? 309  SER A O   1 
ATOM 2436  C CB  . SER A 1 312  ? 24.553  12.241  85.007  1.00 60.15  ? 309  SER A CB  1 
ATOM 2437  O OG  . SER A 1 312  ? 25.258  11.136  84.484  1.00 60.00  ? 309  SER A OG  1 
ATOM 2438  N N   . ILE A 1 313  ? 23.172  13.993  87.377  1.00 60.05  ? 310  ILE A N   1 
ATOM 2439  C CA  . ILE A 1 313  ? 21.972  14.497  88.050  1.00 60.27  ? 310  ILE A CA  1 
ATOM 2440  C C   . ILE A 1 313  ? 20.685  14.033  87.344  1.00 60.75  ? 310  ILE A C   1 
ATOM 2441  O O   . ILE A 1 313  ? 20.260  14.592  86.316  1.00 60.80  ? 310  ILE A O   1 
ATOM 2442  C CB  . ILE A 1 313  ? 21.976  16.031  88.204  1.00 60.16  ? 310  ILE A CB  1 
ATOM 2443  C CG1 . ILE A 1 313  ? 23.405  16.584  88.317  1.00 59.68  ? 310  ILE A CG1 1 
ATOM 2444  C CG2 . ILE A 1 313  ? 21.061  16.453  89.358  1.00 59.96  ? 310  ILE A CG2 1 
ATOM 2445  C CD1 . ILE A 1 313  ? 24.139  16.226  89.575  1.00 59.99  ? 310  ILE A CD1 1 
ATOM 2446  N N   . ALA A 1 314  ? 20.079  12.996  87.918  1.00 61.11  ? 311  ALA A N   1 
ATOM 2447  C CA  . ALA A 1 314  ? 18.972  12.280  87.295  1.00 61.44  ? 311  ALA A CA  1 
ATOM 2448  C C   . ALA A 1 314  ? 17.670  13.061  87.333  1.00 61.64  ? 311  ALA A C   1 
ATOM 2449  O O   . ALA A 1 314  ? 17.228  13.506  88.396  1.00 61.66  ? 311  ALA A O   1 
ATOM 2450  C CB  . ALA A 1 314  ? 18.796  10.925  87.953  1.00 61.67  ? 311  ALA A CB  1 
ATOM 2451  N N   . GLU A 1 315  ? 17.072  13.214  86.157  1.00 61.98  ? 312  GLU A N   1 
ATOM 2452  C CA  . GLU A 1 315  ? 15.802  13.911  85.976  1.00 62.42  ? 312  GLU A CA  1 
ATOM 2453  C C   . GLU A 1 315  ? 14.787  12.847  85.648  1.00 62.69  ? 312  GLU A C   1 
ATOM 2454  O O   . GLU A 1 315  ? 13.631  12.933  86.035  1.00 63.06  ? 312  GLU A O   1 
ATOM 2455  C CB  . GLU A 1 315  ? 15.905  14.880  84.799  1.00 62.32  ? 312  GLU A CB  1 
ATOM 2456  C CG  . GLU A 1 315  ? 15.587  16.317  85.125  1.00 62.55  ? 312  GLU A CG  1 
ATOM 2457  C CD  . GLU A 1 315  ? 14.130  16.660  84.941  1.00 63.80  ? 312  GLU A CD  1 
ATOM 2458  O OE1 . GLU A 1 315  ? 13.524  16.249  83.929  1.00 63.84  ? 312  GLU A OE1 1 
ATOM 2459  O OE2 . GLU A 1 315  ? 13.587  17.371  85.811  1.00 65.82  ? 312  GLU A OE2 1 
ATOM 2460  N N   . CYS A 1 316  ? 15.257  11.837  84.926  1.00 63.35  ? 313  CYS A N   1 
ATOM 2461  C CA  . CYS A 1 316  ? 14.457  10.716  84.485  1.00 63.13  ? 313  CYS A CA  1 
ATOM 2462  C C   . CYS A 1 316  ? 15.170  9.445   84.884  1.00 62.80  ? 313  CYS A C   1 
ATOM 2463  O O   . CYS A 1 316  ? 16.402  9.385   84.872  1.00 62.68  ? 313  CYS A O   1 
ATOM 2464  C CB  . CYS A 1 316  ? 14.334  10.736  82.969  1.00 63.42  ? 313  CYS A CB  1 
ATOM 2465  S SG  . CYS A 1 316  ? 13.081  9.590   82.376  1.00 65.38  ? 313  CYS A SG  1 
ATOM 2466  N N   . LEU A 1 317  ? 14.403  8.417   85.217  1.00 62.45  ? 314  LEU A N   1 
ATOM 2467  C CA  . LEU A 1 317  ? 15.003  7.202   85.745  1.00 62.12  ? 314  LEU A CA  1 
ATOM 2468  C C   . LEU A 1 317  ? 14.232  5.982   85.310  1.00 61.90  ? 314  LEU A C   1 
ATOM 2469  O O   . LEU A 1 317  ? 13.004  5.986   85.311  1.00 61.94  ? 314  LEU A O   1 
ATOM 2470  C CB  . LEU A 1 317  ? 15.074  7.270   87.274  1.00 62.09  ? 314  LEU A CB  1 
ATOM 2471  C CG  . LEU A 1 317  ? 16.341  6.728   87.935  1.00 61.98  ? 314  LEU A CG  1 
ATOM 2472  C CD1 . LEU A 1 317  ? 17.579  7.387   87.347  1.00 62.43  ? 314  LEU A CD1 1 
ATOM 2473  C CD2 . LEU A 1 317  ? 16.301  6.936   89.440  1.00 62.03  ? 314  LEU A CD2 1 
ATOM 2474  N N   . THR A 1 318  ? 14.961  4.938   84.924  1.00 61.72  ? 315  THR A N   1 
ATOM 2475  C CA  . THR A 1 318  ? 14.345  3.694   84.479  1.00 61.43  ? 315  THR A CA  1 
ATOM 2476  C C   . THR A 1 318  ? 15.293  2.515   84.574  1.00 60.99  ? 315  THR A C   1 
ATOM 2477  O O   . THR A 1 318  ? 16.391  2.545   84.016  1.00 60.74  ? 315  THR A O   1 
ATOM 2478  C CB  . THR A 1 318  ? 13.848  3.771   83.016  1.00 61.59  ? 315  THR A CB  1 
ATOM 2479  O OG1 . THR A 1 318  ? 13.372  5.095   82.719  1.00 62.21  ? 315  THR A OG1 1 
ATOM 2480  C CG2 . THR A 1 318  ? 12.737  2.757   82.792  1.00 61.49  ? 315  THR A CG2 1 
ATOM 2481  N N   . TYR A 1 319  ? 14.843  1.488   85.292  1.00 60.64  ? 316  TYR A N   1 
ATOM 2482  C CA  . TYR A 1 319  ? 15.466  0.176   85.294  1.00 60.26  ? 316  TYR A CA  1 
ATOM 2483  C C   . TYR A 1 319  ? 15.050  -0.553  84.026  1.00 59.99  ? 316  TYR A C   1 
ATOM 2484  O O   . TYR A 1 319  ? 13.898  -0.451  83.594  1.00 59.97  ? 316  TYR A O   1 
ATOM 2485  C CB  . TYR A 1 319  ? 15.011  -0.604  86.527  1.00 60.42  ? 316  TYR A CB  1 
ATOM 2486  C CG  . TYR A 1 319  ? 15.506  -2.035  86.601  1.00 60.75  ? 316  TYR A CG  1 
ATOM 2487  C CD1 . TYR A 1 319  ? 16.853  -2.323  86.823  1.00 61.13  ? 316  TYR A CD1 1 
ATOM 2488  C CD2 . TYR A 1 319  ? 14.621  -3.103  86.471  1.00 61.08  ? 316  TYR A CD2 1 
ATOM 2489  C CE1 . TYR A 1 319  ? 17.308  -3.641  86.894  1.00 61.15  ? 316  TYR A CE1 1 
ATOM 2490  C CE2 . TYR A 1 319  ? 15.065  -4.426  86.547  1.00 61.23  ? 316  TYR A CE2 1 
ATOM 2491  C CZ  . TYR A 1 319  ? 16.410  -4.689  86.758  1.00 61.13  ? 316  TYR A CZ  1 
ATOM 2492  O OH  . TYR A 1 319  ? 16.848  -5.999  86.838  1.00 60.95  ? 316  TYR A OH  1 
ATOM 2493  N N   . LEU A 1 320  ? 15.991  -1.278  83.428  1.00 59.76  ? 317  LEU A N   1 
ATOM 2494  C CA  . LEU A 1 320  ? 15.733  -2.046  82.205  1.00 59.62  ? 317  LEU A CA  1 
ATOM 2495  C C   . LEU A 1 320  ? 15.759  -3.555  82.471  1.00 59.67  ? 317  LEU A C   1 
ATOM 2496  O O   . LEU A 1 320  ? 15.004  -4.050  83.307  1.00 59.61  ? 317  LEU A O   1 
ATOM 2497  C CB  . LEU A 1 320  ? 16.740  -1.680  81.114  1.00 59.46  ? 317  LEU A CB  1 
ATOM 2498  C CG  . LEU A 1 320  ? 16.965  -0.198  80.832  1.00 59.35  ? 317  LEU A CG  1 
ATOM 2499  C CD1 . LEU A 1 320  ? 18.325  0.023   80.192  1.00 58.93  ? 317  LEU A CD1 1 
ATOM 2500  C CD2 . LEU A 1 320  ? 15.849  0.364   79.964  1.00 59.54  ? 317  LEU A CD2 1 
ATOM 2501  N N   . ASP A 1 321  ? 16.634  -4.275  81.770  1.00 59.74  ? 318  ASP A N   1 
ATOM 2502  C CA  . ASP A 1 321  ? 16.685  -5.736  81.866  1.00 59.92  ? 318  ASP A CA  1 
ATOM 2503  C C   . ASP A 1 321  ? 17.314  -6.238  83.182  1.00 59.79  ? 318  ASP A C   1 
ATOM 2504  O O   . ASP A 1 321  ? 16.594  -6.541  84.143  1.00 59.99  ? 318  ASP A O   1 
ATOM 2505  C CB  . ASP A 1 321  ? 17.378  -6.352  80.632  1.00 60.04  ? 318  ASP A CB  1 
ATOM 2506  C CG  . ASP A 1 321  ? 16.868  -7.764  80.305  1.00 60.61  ? 318  ASP A CG  1 
ATOM 2507  O OD1 . ASP A 1 321  ? 17.702  -8.695  80.184  1.00 61.07  ? 318  ASP A OD1 1 
ATOM 2508  O OD2 . ASP A 1 321  ? 15.634  -7.943  80.165  1.00 60.92  ? 318  ASP A OD2 1 
ATOM 2509  N N   . ASN A 1 322  ? 18.643  -6.322  83.224  1.00 59.36  ? 319  ASN A N   1 
ATOM 2510  C CA  . ASN A 1 322  ? 19.336  -6.917  84.363  1.00 58.69  ? 319  ASN A CA  1 
ATOM 2511  C C   . ASN A 1 322  ? 20.388  -6.012  84.951  1.00 58.24  ? 319  ASN A C   1 
ATOM 2512  O O   . ASN A 1 322  ? 21.539  -6.014  84.515  1.00 58.27  ? 319  ASN A O   1 
ATOM 2513  C CB  . ASN A 1 322  ? 19.949  -8.253  83.974  1.00 58.65  ? 319  ASN A CB  1 
ATOM 2514  C CG  . ASN A 1 322  ? 18.918  -9.330  83.851  1.00 58.76  ? 319  ASN A CG  1 
ATOM 2515  O OD1 . ASN A 1 322  ? 18.298  -9.718  84.840  1.00 59.39  ? 319  ASN A OD1 1 
ATOM 2516  N ND2 . ASN A 1 322  ? 18.711  -9.819  82.634  1.00 58.76  ? 319  ASN A ND2 1 
ATOM 2517  N N   . GLY A 1 323  ? 19.974  -5.239  85.948  1.00 57.68  ? 320  GLY A N   1 
ATOM 2518  C CA  . GLY A 1 323  ? 20.847  -4.277  86.599  1.00 56.92  ? 320  GLY A CA  1 
ATOM 2519  C C   . GLY A 1 323  ? 20.922  -2.985  85.813  1.00 56.34  ? 320  GLY A C   1 
ATOM 2520  O O   . GLY A 1 323  ? 21.093  -1.913  86.398  1.00 56.58  ? 320  GLY A O   1 
ATOM 2521  N N   . VAL A 1 324  ? 20.782  -3.090  84.490  1.00 55.40  ? 321  VAL A N   1 
ATOM 2522  C CA  . VAL A 1 324  ? 20.864  -1.939  83.591  1.00 54.52  ? 321  VAL A CA  1 
ATOM 2523  C C   . VAL A 1 324  ? 19.841  -0.851  83.947  1.00 53.93  ? 321  VAL A C   1 
ATOM 2524  O O   . VAL A 1 324  ? 18.628  -1.077  83.945  1.00 53.94  ? 321  VAL A O   1 
ATOM 2525  C CB  . VAL A 1 324  ? 20.655  -2.341  82.121  1.00 54.54  ? 321  VAL A CB  1 
ATOM 2526  C CG1 . VAL A 1 324  ? 21.628  -1.586  81.233  1.00 54.20  ? 321  VAL A CG1 1 
ATOM 2527  C CG2 . VAL A 1 324  ? 20.812  -3.844  81.940  1.00 54.85  ? 321  VAL A CG2 1 
ATOM 2528  N N   . VAL A 1 325  ? 20.347  0.332   84.259  1.00 52.97  ? 322  VAL A N   1 
ATOM 2529  C CA  . VAL A 1 325  ? 19.506  1.453   84.619  1.00 52.08  ? 322  VAL A CA  1 
ATOM 2530  C C   . VAL A 1 325  ? 19.862  2.621   83.716  1.00 51.52  ? 322  VAL A C   1 
ATOM 2531  O O   . VAL A 1 325  ? 21.029  3.011   83.644  1.00 51.35  ? 322  VAL A O   1 
ATOM 2532  C CB  . VAL A 1 325  ? 19.702  1.831   86.100  1.00 52.19  ? 322  VAL A CB  1 
ATOM 2533  C CG1 . VAL A 1 325  ? 19.067  3.199   86.417  1.00 52.07  ? 322  VAL A CG1 1 
ATOM 2534  C CG2 . VAL A 1 325  ? 19.149  0.728   87.005  1.00 51.91  ? 322  VAL A CG2 1 
ATOM 2535  N N   . PHE A 1 326  ? 18.862  3.151   83.010  1.00 50.87  ? 323  PHE A N   1 
ATOM 2536  C CA  . PHE A 1 326  ? 19.063  4.306   82.147  1.00 50.23  ? 323  PHE A CA  1 
ATOM 2537  C C   . PHE A 1 326  ? 18.792  5.551   82.947  1.00 50.19  ? 323  PHE A C   1 
ATOM 2538  O O   . PHE A 1 326  ? 17.715  5.699   83.519  1.00 50.18  ? 323  PHE A O   1 
ATOM 2539  C CB  . PHE A 1 326  ? 18.143  4.287   80.929  1.00 49.87  ? 323  PHE A CB  1 
ATOM 2540  C CG  . PHE A 1 326  ? 18.223  5.540   80.112  1.00 49.17  ? 323  PHE A CG  1 
ATOM 2541  C CD1 . PHE A 1 326  ? 19.138  5.651   79.079  1.00 48.74  ? 323  PHE A CD1 1 
ATOM 2542  C CD2 . PHE A 1 326  ? 17.408  6.629   80.401  1.00 48.74  ? 323  PHE A CD2 1 
ATOM 2543  C CE1 . PHE A 1 326  ? 19.224  6.824   78.332  1.00 48.81  ? 323  PHE A CE1 1 
ATOM 2544  C CE2 . PHE A 1 326  ? 17.493  7.803   79.667  1.00 48.28  ? 323  PHE A CE2 1 
ATOM 2545  C CZ  . PHE A 1 326  ? 18.401  7.901   78.632  1.00 48.60  ? 323  PHE A CZ  1 
ATOM 2546  N N   . VAL A 1 327  ? 19.766  6.450   82.966  1.00 50.14  ? 324  VAL A N   1 
ATOM 2547  C CA  . VAL A 1 327  ? 19.661  7.658   83.764  1.00 50.24  ? 324  VAL A CA  1 
ATOM 2548  C C   . VAL A 1 327  ? 19.470  8.862   82.852  1.00 50.54  ? 324  VAL A C   1 
ATOM 2549  O O   . VAL A 1 327  ? 20.371  9.228   82.096  1.00 50.63  ? 324  VAL A O   1 
ATOM 2550  C CB  . VAL A 1 327  ? 20.891  7.836   84.683  1.00 50.10  ? 324  VAL A CB  1 
ATOM 2551  C CG1 . VAL A 1 327  ? 20.816  9.145   85.432  1.00 49.97  ? 324  VAL A CG1 1 
ATOM 2552  C CG2 . VAL A 1 327  ? 20.988  6.681   85.670  1.00 49.91  ? 324  VAL A CG2 1 
ATOM 2553  N N   . GLY A 1 328  ? 18.283  9.460   82.918  1.00 50.82  ? 325  GLY A N   1 
ATOM 2554  C CA  . GLY A 1 328  ? 17.972  10.667  82.145  1.00 51.04  ? 325  GLY A CA  1 
ATOM 2555  C C   . GLY A 1 328  ? 18.400  11.956  82.834  1.00 51.08  ? 325  GLY A C   1 
ATOM 2556  O O   . GLY A 1 328  ? 17.820  12.360  83.839  1.00 51.17  ? 325  GLY A O   1 
ATOM 2557  N N   . SER A 1 329  ? 19.422  12.605  82.295  1.00 51.14  ? 326  SER A N   1 
ATOM 2558  C CA  . SER A 1 329  ? 19.945  13.818  82.907  1.00 51.12  ? 326  SER A CA  1 
ATOM 2559  C C   . SER A 1 329  ? 19.568  15.049  82.096  1.00 51.19  ? 326  SER A C   1 
ATOM 2560  O O   . SER A 1 329  ? 19.391  14.979  80.865  1.00 51.42  ? 326  SER A O   1 
ATOM 2561  C CB  . SER A 1 329  ? 21.464  13.732  83.057  1.00 51.20  ? 326  SER A CB  1 
ATOM 2562  O OG  . SER A 1 329  ? 21.982  14.931  83.599  1.00 50.86  ? 326  SER A OG  1 
ATOM 2563  N N   . ARG A 1 330  ? 19.457  16.175  82.798  1.00 50.72  ? 327  ARG A N   1 
ATOM 2564  C CA  . ARG A 1 330  ? 19.125  17.448  82.180  1.00 50.40  ? 327  ARG A CA  1 
ATOM 2565  C C   . ARG A 1 330  ? 20.303  18.400  82.311  1.00 49.38  ? 327  ARG A C   1 
ATOM 2566  O O   . ARG A 1 330  ? 20.559  19.210  81.425  1.00 49.32  ? 327  ARG A O   1 
ATOM 2567  C CB  . ARG A 1 330  ? 17.880  18.028  82.838  1.00 50.38  ? 327  ARG A CB  1 
ATOM 2568  C CG  . ARG A 1 330  ? 17.287  19.258  82.157  1.00 51.43  ? 327  ARG A CG  1 
ATOM 2569  C CD  . ARG A 1 330  ? 15.906  19.611  82.757  1.00 52.04  ? 327  ARG A CD  1 
ATOM 2570  N NE  . ARG A 1 330  ? 15.838  19.427  84.217  1.00 54.38  ? 327  ARG A NE  1 
ATOM 2571  C CZ  . ARG A 1 330  ? 16.232  20.324  85.122  1.00 55.18  ? 327  ARG A CZ  1 
ATOM 2572  N NH1 . ARG A 1 330  ? 16.742  21.497  84.748  1.00 55.94  ? 327  ARG A NH1 1 
ATOM 2573  N NH2 . ARG A 1 330  ? 16.122  20.047  86.411  1.00 55.74  ? 327  ARG A NH2 1 
ATOM 2574  N N   . LEU A 1 331  ? 21.029  18.279  83.414  1.00 48.56  ? 328  LEU A N   1 
ATOM 2575  C CA  . LEU A 1 331  ? 22.157  19.154  83.687  1.00 47.85  ? 328  LEU A CA  1 
ATOM 2576  C C   . LEU A 1 331  ? 23.478  18.504  83.298  1.00 47.73  ? 328  LEU A C   1 
ATOM 2577  O O   . LEU A 1 331  ? 24.523  19.129  83.401  1.00 47.62  ? 328  LEU A O   1 
ATOM 2578  C CB  . LEU A 1 331  ? 22.186  19.545  85.162  1.00 47.65  ? 328  LEU A CB  1 
ATOM 2579  C CG  . LEU A 1 331  ? 20.941  20.153  85.805  1.00 47.10  ? 328  LEU A CG  1 
ATOM 2580  C CD1 . LEU A 1 331  ? 19.943  19.080  86.256  1.00 46.14  ? 328  LEU A CD1 1 
ATOM 2581  C CD2 . LEU A 1 331  ? 21.373  21.003  86.978  1.00 46.99  ? 328  LEU A CD2 1 
ATOM 2582  N N   . GLY A 1 332  ? 23.421  17.252  82.851  1.00 47.68  ? 329  GLY A N   1 
ATOM 2583  C CA  . GLY A 1 332  ? 24.613  16.491  82.494  1.00 47.65  ? 329  GLY A CA  1 
ATOM 2584  C C   . GLY A 1 332  ? 24.305  15.425  81.463  1.00 47.84  ? 329  GLY A C   1 
ATOM 2585  O O   . GLY A 1 332  ? 23.177  15.345  80.967  1.00 47.66  ? 329  GLY A O   1 
ATOM 2586  N N   . ASP A 1 333  ? 25.312  14.607  81.141  1.00 48.09  ? 330  ASP A N   1 
ATOM 2587  C CA  . ASP A 1 333  ? 25.182  13.565  80.120  1.00 48.06  ? 330  ASP A CA  1 
ATOM 2588  C C   . ASP A 1 333  ? 24.305  12.474  80.671  1.00 47.88  ? 330  ASP A C   1 
ATOM 2589  O O   . ASP A 1 333  ? 24.598  11.926  81.729  1.00 47.79  ? 330  ASP A O   1 
ATOM 2590  C CB  . ASP A 1 333  ? 26.520  12.897  79.770  1.00 48.22  ? 330  ASP A CB  1 
ATOM 2591  C CG  . ASP A 1 333  ? 27.691  13.866  79.688  1.00 49.06  ? 330  ASP A CG  1 
ATOM 2592  O OD1 . ASP A 1 333  ? 28.091  14.224  78.549  1.00 49.01  ? 330  ASP A OD1 1 
ATOM 2593  O OD2 . ASP A 1 333  ? 28.233  14.230  80.763  1.00 50.14  ? 330  ASP A OD2 1 
ATOM 2594  N N   . SER A 1 334  ? 23.237  12.146  79.954  1.00 47.89  ? 331  SER A N   1 
ATOM 2595  C CA  . SER A 1 334  ? 22.501  10.922  80.254  1.00 47.79  ? 331  SER A CA  1 
ATOM 2596  C C   . SER A 1 334  ? 23.454  9.728   80.116  1.00 47.63  ? 331  SER A C   1 
ATOM 2597  O O   . SER A 1 334  ? 24.554  9.863   79.566  1.00 47.71  ? 331  SER A O   1 
ATOM 2598  C CB  . SER A 1 334  ? 21.264  10.779  79.368  1.00 47.74  ? 331  SER A CB  1 
ATOM 2599  O OG  . SER A 1 334  ? 20.232  11.629  79.840  1.00 47.57  ? 331  SER A OG  1 
ATOM 2600  N N   . GLN A 1 335  ? 23.051  8.579   80.647  1.00 47.27  ? 332  GLN A N   1 
ATOM 2601  C CA  . GLN A 1 335  ? 23.949  7.437   80.752  1.00 46.85  ? 332  GLN A CA  1 
ATOM 2602  C C   . GLN A 1 335  ? 23.212  6.132   81.005  1.00 46.80  ? 332  GLN A C   1 
ATOM 2603  O O   . GLN A 1 335  ? 22.044  6.117   81.422  1.00 46.48  ? 332  GLN A O   1 
ATOM 2604  C CB  . GLN A 1 335  ? 25.003  7.666   81.844  1.00 46.86  ? 332  GLN A CB  1 
ATOM 2605  C CG  . GLN A 1 335  ? 24.415  8.032   83.209  1.00 47.03  ? 332  GLN A CG  1 
ATOM 2606  C CD  . GLN A 1 335  ? 25.439  8.095   84.337  1.00 46.74  ? 332  GLN A CD  1 
ATOM 2607  O OE1 . GLN A 1 335  ? 26.643  7.855   84.147  1.00 46.58  ? 332  GLN A OE1 1 
ATOM 2608  N NE2 . GLN A 1 335  ? 24.956  8.423   85.527  1.00 45.81  ? 332  GLN A NE2 1 
ATOM 2609  N N   . LEU A 1 336  ? 23.920  5.041   80.729  1.00 46.85  ? 333  LEU A N   1 
ATOM 2610  C CA  . LEU A 1 336  ? 23.446  3.698   81.008  1.00 46.80  ? 333  LEU A CA  1 
ATOM 2611  C C   . LEU A 1 336  ? 24.282  3.203   82.149  1.00 46.77  ? 333  LEU A C   1 
ATOM 2612  O O   . LEU A 1 336  ? 25.500  3.343   82.124  1.00 46.72  ? 333  LEU A O   1 
ATOM 2613  C CB  . LEU A 1 336  ? 23.629  2.794   79.794  1.00 46.78  ? 333  LEU A CB  1 
ATOM 2614  C CG  . LEU A 1 336  ? 22.480  1.832   79.497  1.00 46.62  ? 333  LEU A CG  1 
ATOM 2615  C CD1 . LEU A 1 336  ? 21.158  2.575   79.461  1.00 46.60  ? 333  LEU A CD1 1 
ATOM 2616  C CD2 . LEU A 1 336  ? 22.719  1.150   78.175  1.00 46.84  ? 333  LEU A CD2 1 
ATOM 2617  N N   . VAL A 1 337  ? 23.624  2.645   83.158  1.00 46.95  ? 334  VAL A N   1 
ATOM 2618  C CA  . VAL A 1 337  ? 24.287  2.319   84.408  1.00 47.30  ? 334  VAL A CA  1 
ATOM 2619  C C   . VAL A 1 337  ? 23.894  0.944   84.940  1.00 47.98  ? 334  VAL A C   1 
ATOM 2620  O O   . VAL A 1 337  ? 22.722  0.584   84.938  1.00 48.13  ? 334  VAL A O   1 
ATOM 2621  C CB  . VAL A 1 337  ? 24.063  3.444   85.428  1.00 46.83  ? 334  VAL A CB  1 
ATOM 2622  C CG1 . VAL A 1 337  ? 23.917  2.907   86.834  1.00 47.04  ? 334  VAL A CG1 1 
ATOM 2623  C CG2 . VAL A 1 337  ? 25.202  4.418   85.343  1.00 46.51  ? 334  VAL A CG2 1 
ATOM 2624  N N   . LYS A 1 338  ? 24.893  0.176   85.370  1.00 48.72  ? 335  LYS A N   1 
ATOM 2625  C CA  . LYS A 1 338  ? 24.686  -1.178  85.862  1.00 49.67  ? 335  LYS A CA  1 
ATOM 2626  C C   . LYS A 1 338  ? 24.678  -1.234  87.393  1.00 50.33  ? 335  LYS A C   1 
ATOM 2627  O O   . LYS A 1 338  ? 25.557  -0.668  88.048  1.00 50.50  ? 335  LYS A O   1 
ATOM 2628  C CB  . LYS A 1 338  ? 25.769  -2.100  85.289  1.00 49.81  ? 335  LYS A CB  1 
ATOM 2629  C CG  . LYS A 1 338  ? 25.770  -3.538  85.814  1.00 50.19  ? 335  LYS A CG  1 
ATOM 2630  C CD  . LYS A 1 338  ? 24.524  -4.317  85.399  1.00 50.74  ? 335  LYS A CD  1 
ATOM 2631  C CE  . LYS A 1 338  ? 24.626  -5.796  85.778  1.00 50.72  ? 335  LYS A CE  1 
ATOM 2632  N NZ  . LYS A 1 338  ? 25.448  -6.582  84.806  1.00 50.93  ? 335  LYS A NZ  1 
ATOM 2633  N N   . LEU A 1 339  ? 23.678  -1.915  87.951  1.00 51.11  ? 336  LEU A N   1 
ATOM 2634  C CA  . LEU A 1 339  ? 23.604  -2.168  89.389  1.00 51.80  ? 336  LEU A CA  1 
ATOM 2635  C C   . LEU A 1 339  ? 24.159  -3.544  89.714  1.00 52.46  ? 336  LEU A C   1 
ATOM 2636  O O   . LEU A 1 339  ? 23.503  -4.557  89.459  1.00 52.75  ? 336  LEU A O   1 
ATOM 2637  C CB  . LEU A 1 339  ? 22.161  -2.093  89.886  1.00 51.65  ? 336  LEU A CB  1 
ATOM 2638  C CG  . LEU A 1 339  ? 21.496  -0.727  90.010  1.00 51.89  ? 336  LEU A CG  1 
ATOM 2639  C CD1 . LEU A 1 339  ? 20.165  -0.864  90.745  1.00 51.57  ? 336  LEU A CD1 1 
ATOM 2640  C CD2 . LEU A 1 339  ? 22.411  0.253   90.723  1.00 52.12  ? 336  LEU A CD2 1 
ATOM 2641  N N   . ASN A 1 340  ? 25.369  -3.580  90.268  1.00 53.07  ? 337  ASN A N   1 
ATOM 2642  C CA  . ASN A 1 340  ? 25.968  -4.829  90.727  1.00 53.57  ? 337  ASN A CA  1 
ATOM 2643  C C   . ASN A 1 340  ? 25.478  -5.199  92.122  1.00 54.11  ? 337  ASN A C   1 
ATOM 2644  O O   . ASN A 1 340  ? 24.775  -4.421  92.771  1.00 54.20  ? 337  ASN A O   1 
ATOM 2645  C CB  . ASN A 1 340  ? 27.491  -4.720  90.713  1.00 53.42  ? 337  ASN A CB  1 
ATOM 2646  C CG  . ASN A 1 340  ? 28.039  -4.432  89.333  1.00 53.37  ? 337  ASN A CG  1 
ATOM 2647  O OD1 . ASN A 1 340  ? 28.962  -3.640  89.174  1.00 53.35  ? 337  ASN A OD1 1 
ATOM 2648  N ND2 . ASN A 1 340  ? 27.471  -5.074  88.325  1.00 53.55  ? 337  ASN A ND2 1 
ATOM 2649  N N   . VAL A 1 341  ? 25.842  -6.389  92.582  1.00 54.84  ? 338  VAL A N   1 
ATOM 2650  C CA  . VAL A 1 341  ? 25.536  -6.779  93.954  1.00 55.60  ? 338  VAL A CA  1 
ATOM 2651  C C   . VAL A 1 341  ? 26.686  -6.360  94.878  1.00 56.24  ? 338  VAL A C   1 
ATOM 2652  O O   . VAL A 1 341  ? 26.483  -6.144  96.074  1.00 56.21  ? 338  VAL A O   1 
ATOM 2653  C CB  . VAL A 1 341  ? 25.258  -8.298  94.085  1.00 55.51  ? 338  VAL A CB  1 
ATOM 2654  C CG1 . VAL A 1 341  ? 24.405  -8.580  95.317  1.00 55.22  ? 338  VAL A CG1 1 
ATOM 2655  C CG2 . VAL A 1 341  ? 24.562  -8.829  92.841  1.00 55.50  ? 338  VAL A CG2 1 
ATOM 2656  N N   . ASP A 1 342  ? 27.881  -6.217  94.303  1.00 57.09  ? 339  ASP A N   1 
ATOM 2657  C CA  . ASP A 1 342  ? 29.100  -5.982  95.079  1.00 57.86  ? 339  ASP A CA  1 
ATOM 2658  C C   . ASP A 1 342  ? 29.732  -4.605  94.859  1.00 58.48  ? 339  ASP A C   1 
ATOM 2659  O O   . ASP A 1 342  ? 29.801  -4.100  93.734  1.00 58.53  ? 339  ASP A O   1 
ATOM 2660  C CB  . ASP A 1 342  ? 30.125  -7.087  94.792  1.00 57.81  ? 339  ASP A CB  1 
ATOM 2661  C CG  . ASP A 1 342  ? 29.580  -8.484  95.076  1.00 57.83  ? 339  ASP A CG  1 
ATOM 2662  O OD1 . ASP A 1 342  ? 29.176  -8.767  96.224  1.00 57.55  ? 339  ASP A OD1 1 
ATOM 2663  O OD2 . ASP A 1 342  ? 29.561  -9.308  94.144  1.00 58.14  ? 339  ASP A OD2 1 
ATOM 2664  N N   . SER A 1 343  ? 30.200  -4.011  95.953  1.00 59.24  ? 340  SER A N   1 
ATOM 2665  C CA  . SER A 1 343  ? 30.898  -2.729  95.918  1.00 60.05  ? 340  SER A CA  1 
ATOM 2666  C C   . SER A 1 343  ? 32.309  -2.885  95.371  1.00 60.57  ? 340  SER A C   1 
ATOM 2667  O O   . SER A 1 343  ? 32.860  -3.989  95.357  1.00 60.69  ? 340  SER A O   1 
ATOM 2668  C CB  . SER A 1 343  ? 30.980  -2.141  97.326  1.00 60.08  ? 340  SER A CB  1 
ATOM 2669  O OG  . SER A 1 343  ? 29.722  -2.178  97.976  1.00 60.46  ? 340  SER A OG  1 
ATOM 2670  N N   . ASN A 1 344  ? 32.892  -1.773  94.931  1.00 61.32  ? 341  ASN A N   1 
ATOM 2671  C CA  . ASN A 1 344  ? 34.297  -1.738  94.511  1.00 62.02  ? 341  ASN A CA  1 
ATOM 2672  C C   . ASN A 1 344  ? 35.108  -0.767  95.367  1.00 62.44  ? 341  ASN A C   1 
ATOM 2673  O O   . ASN A 1 344  ? 35.086  -0.847  96.601  1.00 62.62  ? 341  ASN A O   1 
ATOM 2674  C CB  . ASN A 1 344  ? 34.419  -1.380  93.022  1.00 61.92  ? 341  ASN A CB  1 
ATOM 2675  C CG  . ASN A 1 344  ? 33.668  -0.105  92.655  1.00 62.21  ? 341  ASN A CG  1 
ATOM 2676  O OD1 . ASN A 1 344  ? 33.580  0.841   93.447  1.00 61.53  ? 341  ASN A OD1 1 
ATOM 2677  N ND2 . ASN A 1 344  ? 33.123  -0.078  91.440  1.00 62.94  ? 341  ASN A ND2 1 
ATOM 2678  N N   . GLU A 1 345  ? 35.878  0.139   94.741  1.00 62.82  ? 342  GLU A N   1 
ATOM 2679  C CA  . GLU A 1 345  ? 36.557  1.252   95.403  1.00 63.06  ? 342  GLU A CA  1 
ATOM 2680  C C   . GLU A 1 345  ? 35.617  2.423   95.620  1.00 62.92  ? 342  GLU A C   1 
ATOM 2681  O O   . GLU A 1 345  ? 35.288  3.265   94.709  1.00 62.74  ? 342  GLU A O   1 
ATOM 2682  C CB  . GLU A 1 345  ? 37.729  1.757   94.549  1.00 63.21  ? 342  GLU A CB  1 
ATOM 2683  C CG  . GLU A 1 345  ? 38.653  0.653   94.018  1.00 63.70  ? 342  GLU A CG  1 
ATOM 2684  C CD  . GLU A 1 345  ? 39.246  -0.224  95.117  1.00 64.36  ? 342  GLU A CD  1 
ATOM 2685  O OE1 . GLU A 1 345  ? 38.830  -0.095  96.291  1.00 64.25  ? 342  GLU A OE1 1 
ATOM 2686  O OE2 . GLU A 1 345  ? 40.135  -1.046  94.802  1.00 64.95  ? 342  GLU A OE2 1 
ATOM 2687  N N   . GLN A 1 346  ? 35.337  2.666   97.071  1.00 62.63  ? 343  GLN A N   1 
ATOM 2688  C CA  . GLN A 1 346  ? 34.645  3.790   97.610  1.00 62.36  ? 343  GLN A CA  1 
ATOM 2689  C C   . GLN A 1 346  ? 33.159  3.405   97.916  1.00 61.70  ? 343  GLN A C   1 
ATOM 2690  O O   . GLN A 1 346  ? 32.300  4.220   98.239  1.00 61.72  ? 343  GLN A O   1 
ATOM 2691  C CB  . GLN A 1 346  ? 34.565  5.032   96.695  1.00 62.65  ? 343  GLN A CB  1 
ATOM 2692  C CG  . GLN A 1 346  ? 35.914  5.725   96.434  1.00 63.76  ? 343  GLN A CG  1 
ATOM 2693  C CD  . GLN A 1 346  ? 36.136  6.063   94.957  1.00 65.05  ? 343  GLN A CD  1 
ATOM 2694  O OE1 . GLN A 1 346  ? 35.509  6.980   94.413  1.00 66.22  ? 343  GLN A OE1 1 
ATOM 2695  N NE2 . GLN A 1 346  ? 37.037  5.323   94.308  1.00 64.26  ? 343  GLN A NE2 1 
ATOM 2696  N N   . GLY A 1 347  ? 32.988  2.039   97.656  1.00 60.92  ? 344  GLY A N   1 
ATOM 2697  C CA  . GLY A 1 347  ? 31.720  1.416   98.018  1.00 59.80  ? 344  GLY A CA  1 
ATOM 2698  C C   . GLY A 1 347  ? 30.598  1.670   97.035  1.00 59.03  ? 344  GLY A C   1 
ATOM 2699  O O   . GLY A 1 347  ? 29.470  1.932   97.447  1.00 58.83  ? 344  GLY A O   1 
ATOM 2700  N N   . SER A 1 348  ? 30.901  1.574   95.740  1.00 58.42  ? 345  SER A N   1 
ATOM 2701  C CA  . SER A 1 348  ? 29.908  1.856   94.697  1.00 57.92  ? 345  SER A CA  1 
ATOM 2702  C C   . SER A 1 348  ? 29.359  0.625   93.969  1.00 57.35  ? 345  SER A C   1 
ATOM 2703  O O   . SER A 1 348  ? 30.056  -0.016  93.177  1.00 57.21  ? 345  SER A O   1 
ATOM 2704  C CB  . SER A 1 348  ? 30.438  2.869   93.682  1.00 58.05  ? 345  SER A CB  1 
ATOM 2705  O OG  . SER A 1 348  ? 29.396  3.275   92.807  1.00 58.39  ? 345  SER A OG  1 
ATOM 2706  N N   . TYR A 1 349  ? 28.087  0.333   94.238  1.00 56.68  ? 346  TYR A N   1 
ATOM 2707  C CA  . TYR A 1 349  ? 27.363  -0.764  93.610  1.00 55.99  ? 346  TYR A CA  1 
ATOM 2708  C C   . TYR A 1 349  ? 26.964  -0.371  92.195  1.00 55.91  ? 346  TYR A C   1 
ATOM 2709  O O   . TYR A 1 349  ? 26.342  -1.157  91.472  1.00 55.94  ? 346  TYR A O   1 
ATOM 2710  C CB  . TYR A 1 349  ? 26.108  -1.102  94.415  1.00 55.66  ? 346  TYR A CB  1 
ATOM 2711  C CG  . TYR A 1 349  ? 26.352  -1.459  95.861  1.00 55.09  ? 346  TYR A CG  1 
ATOM 2712  C CD1 . TYR A 1 349  ? 26.413  -0.473  96.844  1.00 54.62  ? 346  TYR A CD1 1 
ATOM 2713  C CD2 . TYR A 1 349  ? 26.500  -2.782  96.250  1.00 54.89  ? 346  TYR A CD2 1 
ATOM 2714  C CE1 . TYR A 1 349  ? 26.626  -0.795  98.173  1.00 54.53  ? 346  TYR A CE1 1 
ATOM 2715  C CE2 . TYR A 1 349  ? 26.715  -3.116  97.577  1.00 55.10  ? 346  TYR A CE2 1 
ATOM 2716  C CZ  . TYR A 1 349  ? 26.773  -2.118  98.533  1.00 55.00  ? 346  TYR A CZ  1 
ATOM 2717  O OH  . TYR A 1 349  ? 26.990  -2.449  99.849  1.00 55.38  ? 346  TYR A OH  1 
ATOM 2718  N N   . VAL A 1 350  ? 27.329  0.853   91.816  1.00 55.72  ? 347  VAL A N   1 
ATOM 2719  C CA  . VAL A 1 350  ? 27.001  1.430   90.511  1.00 55.44  ? 347  VAL A CA  1 
ATOM 2720  C C   . VAL A 1 350  ? 28.225  1.420   89.596  1.00 55.37  ? 347  VAL A C   1 
ATOM 2721  O O   . VAL A 1 350  ? 29.302  1.864   89.991  1.00 55.57  ? 347  VAL A O   1 
ATOM 2722  C CB  . VAL A 1 350  ? 26.490  2.878   90.684  1.00 55.32  ? 347  VAL A CB  1 
ATOM 2723  C CG1 . VAL A 1 350  ? 26.430  3.613   89.353  1.00 55.01  ? 347  VAL A CG1 1 
ATOM 2724  C CG2 . VAL A 1 350  ? 25.141  2.874   91.365  1.00 55.01  ? 347  VAL A CG2 1 
ATOM 2725  N N   . VAL A 1 351  ? 28.065  0.894   88.387  1.00 55.21  ? 348  VAL A N   1 
ATOM 2726  C CA  . VAL A 1 351  ? 29.143  0.919   87.400  1.00 55.42  ? 348  VAL A CA  1 
ATOM 2727  C C   . VAL A 1 351  ? 28.646  1.496   86.070  1.00 55.66  ? 348  VAL A C   1 
ATOM 2728  O O   . VAL A 1 351  ? 27.701  0.971   85.466  1.00 55.86  ? 348  VAL A O   1 
ATOM 2729  C CB  . VAL A 1 351  ? 29.814  -0.481  87.216  1.00 55.40  ? 348  VAL A CB  1 
ATOM 2730  C CG1 . VAL A 1 351  ? 30.636  -0.542  85.930  1.00 55.24  ? 348  VAL A CG1 1 
ATOM 2731  C CG2 . VAL A 1 351  ? 30.700  -0.821  88.419  1.00 55.37  ? 348  VAL A CG2 1 
ATOM 2732  N N   . ALA A 1 352  ? 29.278  2.585   85.634  1.00 55.80  ? 349  ALA A N   1 
ATOM 2733  C CA  . ALA A 1 352  ? 28.930  3.242   84.379  1.00 55.88  ? 349  ALA A CA  1 
ATOM 2734  C C   . ALA A 1 352  ? 29.208  2.291   83.237  1.00 56.10  ? 349  ALA A C   1 
ATOM 2735  O O   . ALA A 1 352  ? 30.275  1.680   83.196  1.00 56.36  ? 349  ALA A O   1 
ATOM 2736  C CB  . ALA A 1 352  ? 29.741  4.515   84.203  1.00 55.81  ? 349  ALA A CB  1 
ATOM 2737  N N   . MET A 1 353  ? 28.239  2.143   82.335  1.00 56.32  ? 350  MET A N   1 
ATOM 2738  C CA  . MET A 1 353  ? 28.423  1.363   81.109  1.00 56.65  ? 350  MET A CA  1 
ATOM 2739  C C   . MET A 1 353  ? 28.662  2.295   79.932  1.00 56.27  ? 350  MET A C   1 
ATOM 2740  O O   . MET A 1 353  ? 29.683  2.187   79.258  1.00 56.49  ? 350  MET A O   1 
ATOM 2741  C CB  . MET A 1 353  ? 27.209  0.488   80.807  1.00 56.62  ? 350  MET A CB  1 
ATOM 2742  C CG  . MET A 1 353  ? 26.791  -0.483  81.901  1.00 57.32  ? 350  MET A CG  1 
ATOM 2743  S SD  . MET A 1 353  ? 25.115  -1.102  81.576  1.00 58.22  ? 350  MET A SD  1 
ATOM 2744  C CE  . MET A 1 353  ? 25.387  -2.252  80.210  1.00 58.29  ? 350  MET A CE  1 
ATOM 2745  N N   . GLU A 1 354  ? 27.715  3.203   79.691  1.00 56.00  ? 351  GLU A N   1 
ATOM 2746  C CA  . GLU A 1 354  ? 27.806  4.159   78.586  1.00 55.72  ? 351  GLU A CA  1 
ATOM 2747  C C   . GLU A 1 354  ? 27.371  5.570   78.984  1.00 55.35  ? 351  GLU A C   1 
ATOM 2748  O O   . GLU A 1 354  ? 26.467  5.735   79.806  1.00 55.28  ? 351  GLU A O   1 
ATOM 2749  C CB  . GLU A 1 354  ? 26.994  3.668   77.389  1.00 55.76  ? 351  GLU A CB  1 
ATOM 2750  C CG  . GLU A 1 354  ? 27.006  4.636   76.222  1.00 56.84  ? 351  GLU A CG  1 
ATOM 2751  C CD  . GLU A 1 354  ? 27.136  3.962   74.870  1.00 58.36  ? 351  GLU A CD  1 
ATOM 2752  O OE1 . GLU A 1 354  ? 26.854  2.745   74.753  1.00 59.04  ? 351  GLU A OE1 1 
ATOM 2753  O OE2 . GLU A 1 354  ? 27.520  4.666   73.911  1.00 58.79  ? 351  GLU A OE2 1 
ATOM 2754  N N   . THR A 1 355  ? 28.021  6.573   78.384  1.00 54.89  ? 352  THR A N   1 
ATOM 2755  C CA  . THR A 1 355  ? 27.768  7.995   78.663  1.00 54.33  ? 352  THR A CA  1 
ATOM 2756  C C   . THR A 1 355  ? 27.432  8.801   77.387  1.00 53.93  ? 352  THR A C   1 
ATOM 2757  O O   . THR A 1 355  ? 28.308  9.096   76.575  1.00 53.90  ? 352  THR A O   1 
ATOM 2758  C CB  . THR A 1 355  ? 28.953  8.620   79.460  1.00 54.28  ? 352  THR A CB  1 
ATOM 2759  O OG1 . THR A 1 355  ? 28.787  8.351   80.859  1.00 53.88  ? 352  THR A OG1 1 
ATOM 2760  C CG2 . THR A 1 355  ? 29.032  10.125  79.265  1.00 54.73  ? 352  THR A CG2 1 
ATOM 2761  N N   . PHE A 1 356  ? 26.155  9.158   77.241  1.00 53.46  ? 353  PHE A N   1 
ATOM 2762  C CA  . PHE A 1 356  ? 25.622  9.826   76.050  1.00 53.04  ? 353  PHE A CA  1 
ATOM 2763  C C   . PHE A 1 356  ? 25.740  11.345  76.119  1.00 52.81  ? 353  PHE A C   1 
ATOM 2764  O O   . PHE A 1 356  ? 25.273  11.956  77.080  1.00 52.95  ? 353  PHE A O   1 
ATOM 2765  C CB  . PHE A 1 356  ? 24.144  9.474   75.872  1.00 53.13  ? 353  PHE A CB  1 
ATOM 2766  C CG  . PHE A 1 356  ? 23.820  8.027   76.118  1.00 53.33  ? 353  PHE A CG  1 
ATOM 2767  C CD1 . PHE A 1 356  ? 23.241  7.627   77.315  1.00 53.19  ? 353  PHE A CD1 1 
ATOM 2768  C CD2 . PHE A 1 356  ? 24.071  7.067   75.146  1.00 54.08  ? 353  PHE A CD2 1 
ATOM 2769  C CE1 . PHE A 1 356  ? 22.929  6.291   77.548  1.00 52.94  ? 353  PHE A CE1 1 
ATOM 2770  C CE2 . PHE A 1 356  ? 23.763  5.726   75.373  1.00 53.95  ? 353  PHE A CE2 1 
ATOM 2771  C CZ  . PHE A 1 356  ? 23.193  5.341   76.579  1.00 53.24  ? 353  PHE A CZ  1 
ATOM 2772  N N   . THR A 1 357  ? 26.314  11.948  75.076  1.00 52.45  ? 354  THR A N   1 
ATOM 2773  C CA  . THR A 1 357  ? 26.617  13.392  75.054  1.00 52.17  ? 354  THR A CA  1 
ATOM 2774  C C   . THR A 1 357  ? 25.410  14.310  75.083  1.00 51.89  ? 354  THR A C   1 
ATOM 2775  O O   . THR A 1 357  ? 24.705  14.458  74.089  1.00 51.76  ? 354  THR A O   1 
ATOM 2776  C CB  . THR A 1 357  ? 27.465  13.801  73.836  1.00 52.19  ? 354  THR A CB  1 
ATOM 2777  O OG1 . THR A 1 357  ? 27.049  13.043  72.692  1.00 52.72  ? 354  THR A OG1 1 
ATOM 2778  C CG2 . THR A 1 357  ? 28.956  13.577  74.105  1.00 52.30  ? 354  THR A CG2 1 
ATOM 2779  N N   . ASN A 1 358  ? 25.195  14.930  76.240  1.00 51.80  ? 355  ASN A N   1 
ATOM 2780  C CA  . ASN A 1 358  ? 24.249  16.031  76.387  1.00 51.51  ? 355  ASN A CA  1 
ATOM 2781  C C   . ASN A 1 358  ? 24.999  17.374  76.484  1.00 51.03  ? 355  ASN A C   1 
ATOM 2782  O O   . ASN A 1 358  ? 25.799  17.586  77.407  1.00 50.97  ? 355  ASN A O   1 
ATOM 2783  C CB  . ASN A 1 358  ? 23.349  15.783  77.605  1.00 51.74  ? 355  ASN A CB  1 
ATOM 2784  C CG  . ASN A 1 358  ? 22.564  17.019  78.036  1.00 52.46  ? 355  ASN A CG  1 
ATOM 2785  O OD1 . ASN A 1 358  ? 21.866  17.655  77.233  1.00 52.47  ? 355  ASN A OD1 1 
ATOM 2786  N ND2 . ASN A 1 358  ? 22.673  17.359  79.321  1.00 52.89  ? 355  ASN A ND2 1 
ATOM 2787  N N   . LEU A 1 359  ? 24.753  18.258  75.513  1.00 50.25  ? 356  LEU A N   1 
ATOM 2788  C CA  . LEU A 1 359  ? 25.298  19.619  75.523  1.00 49.62  ? 356  LEU A CA  1 
ATOM 2789  C C   . LEU A 1 359  ? 24.555  20.503  76.528  1.00 49.29  ? 356  LEU A C   1 
ATOM 2790  O O   . LEU A 1 359  ? 24.809  21.717  76.595  1.00 49.11  ? 356  LEU A O   1 
ATOM 2791  C CB  . LEU A 1 359  ? 25.198  20.270  74.145  1.00 49.66  ? 356  LEU A CB  1 
ATOM 2792  C CG  . LEU A 1 359  ? 25.774  19.614  72.899  1.00 49.22  ? 356  LEU A CG  1 
ATOM 2793  C CD1 . LEU A 1 359  ? 25.065  20.209  71.717  1.00 48.56  ? 356  LEU A CD1 1 
ATOM 2794  C CD2 . LEU A 1 359  ? 27.270  19.836  72.792  1.00 49.32  ? 356  LEU A CD2 1 
ATOM 2795  N N   . GLY A 1 360  ? 23.601  19.887  77.242  1.00 48.71  ? 357  GLY A N   1 
ATOM 2796  C CA  . GLY A 1 360  ? 23.034  20.378  78.510  1.00 47.72  ? 357  GLY A CA  1 
ATOM 2797  C C   . GLY A 1 360  ? 22.681  21.842  78.554  1.00 47.09  ? 357  GLY A C   1 
ATOM 2798  O O   . GLY A 1 360  ? 22.651  22.503  77.505  1.00 47.25  ? 357  GLY A O   1 
ATOM 2799  N N   . PRO A 1 361  ? 22.417  22.370  79.765  1.00 46.31  ? 358  PRO A N   1 
ATOM 2800  C CA  . PRO A 1 361  ? 22.142  23.801  79.866  1.00 45.78  ? 358  PRO A CA  1 
ATOM 2801  C C   . PRO A 1 361  ? 23.279  24.591  79.226  1.00 45.40  ? 358  PRO A C   1 
ATOM 2802  O O   . PRO A 1 361  ? 24.361  24.709  79.799  1.00 44.99  ? 358  PRO A O   1 
ATOM 2803  C CB  . PRO A 1 361  ? 22.079  24.051  81.373  1.00 45.57  ? 358  PRO A CB  1 
ATOM 2804  C CG  . PRO A 1 361  ? 21.759  22.746  81.959  1.00 45.89  ? 358  PRO A CG  1 
ATOM 2805  C CD  . PRO A 1 361  ? 22.369  21.701  81.072  1.00 46.06  ? 358  PRO A CD  1 
ATOM 2806  N N   . ILE A 1 362  ? 23.044  25.059  78.006  1.00 45.27  ? 359  ILE A N   1 
ATOM 2807  C CA  . ILE A 1 362  ? 23.942  26.004  77.383  1.00 45.38  ? 359  ILE A CA  1 
ATOM 2808  C C   . ILE A 1 362  ? 23.630  27.359  78.004  1.00 45.91  ? 359  ILE A C   1 
ATOM 2809  O O   . ILE A 1 362  ? 22.593  27.965  77.734  1.00 45.80  ? 359  ILE A O   1 
ATOM 2810  C CB  . ILE A 1 362  ? 23.817  26.021  75.856  1.00 44.99  ? 359  ILE A CB  1 
ATOM 2811  C CG1 . ILE A 1 362  ? 24.141  24.638  75.297  1.00 44.88  ? 359  ILE A CG1 1 
ATOM 2812  C CG2 . ILE A 1 362  ? 24.762  27.049  75.267  1.00 44.87  ? 359  ILE A CG2 1 
ATOM 2813  C CD1 . ILE A 1 362  ? 24.237  24.584  73.785  1.00 45.53  ? 359  ILE A CD1 1 
ATOM 2814  N N   . VAL A 1 363  ? 24.523  27.794  78.883  1.00 46.51  ? 360  VAL A N   1 
ATOM 2815  C CA  . VAL A 1 363  ? 24.353  29.025  79.611  1.00 47.18  ? 360  VAL A CA  1 
ATOM 2816  C C   . VAL A 1 363  ? 24.891  30.138  78.736  1.00 47.81  ? 360  VAL A C   1 
ATOM 2817  O O   . VAL A 1 363  ? 24.306  31.228  78.655  1.00 47.82  ? 360  VAL A O   1 
ATOM 2818  C CB  . VAL A 1 363  ? 25.137  28.990  80.928  1.00 47.02  ? 360  VAL A CB  1 
ATOM 2819  C CG1 . VAL A 1 363  ? 24.724  30.135  81.821  1.00 47.86  ? 360  VAL A CG1 1 
ATOM 2820  C CG2 . VAL A 1 363  ? 24.887  27.699  81.647  1.00 47.45  ? 360  VAL A CG2 1 
ATOM 2821  N N   . ASP A 1 364  ? 26.004  29.840  78.067  1.00 48.57  ? 361  ASP A N   1 
ATOM 2822  C CA  . ASP A 1 364  ? 26.753  30.829  77.304  1.00 49.47  ? 361  ASP A CA  1 
ATOM 2823  C C   . ASP A 1 364  ? 27.723  30.129  76.363  1.00 49.78  ? 361  ASP A C   1 
ATOM 2824  O O   . ASP A 1 364  ? 28.175  29.022  76.653  1.00 50.14  ? 361  ASP A O   1 
ATOM 2825  C CB  . ASP A 1 364  ? 27.517  31.759  78.260  1.00 49.56  ? 361  ASP A CB  1 
ATOM 2826  C CG  . ASP A 1 364  ? 28.219  32.898  77.542  1.00 50.62  ? 361  ASP A CG  1 
ATOM 2827  O OD1 . ASP A 1 364  ? 29.250  33.367  78.064  1.00 51.70  ? 361  ASP A OD1 1 
ATOM 2828  O OD2 . ASP A 1 364  ? 27.759  33.328  76.456  1.00 51.75  ? 361  ASP A OD2 1 
ATOM 2829  N N   . MET A 1 365  ? 28.037  30.775  75.241  1.00 50.21  ? 362  MET A N   1 
ATOM 2830  C CA  . MET A 1 365  ? 28.981  30.234  74.267  1.00 50.73  ? 362  MET A CA  1 
ATOM 2831  C C   . MET A 1 365  ? 29.550  31.342  73.396  1.00 51.43  ? 362  MET A C   1 
ATOM 2832  O O   . MET A 1 365  ? 29.061  32.478  73.419  1.00 51.42  ? 362  MET A O   1 
ATOM 2833  C CB  . MET A 1 365  ? 28.287  29.209  73.380  1.00 50.50  ? 362  MET A CB  1 
ATOM 2834  C CG  . MET A 1 365  ? 27.512  29.828  72.247  1.00 50.35  ? 362  MET A CG  1 
ATOM 2835  S SD  . MET A 1 365  ? 25.996  28.951  71.887  1.00 50.74  ? 362  MET A SD  1 
ATOM 2836  C CE  . MET A 1 365  ? 25.621  29.686  70.296  1.00 50.46  ? 362  MET A CE  1 
ATOM 2837  N N   . CYS A 1 366  ? 30.580  30.999  72.624  1.00 52.34  ? 363  CYS A N   1 
ATOM 2838  C CA  . CYS A 1 366  ? 31.139  31.905  71.622  1.00 53.60  ? 363  CYS A CA  1 
ATOM 2839  C C   . CYS A 1 366  ? 31.788  31.136  70.461  1.00 54.41  ? 363  CYS A C   1 
ATOM 2840  O O   . CYS A 1 366  ? 32.155  29.959  70.614  1.00 54.60  ? 363  CYS A O   1 
ATOM 2841  C CB  . CYS A 1 366  ? 32.152  32.849  72.260  1.00 53.42  ? 363  CYS A CB  1 
ATOM 2842  S SG  . CYS A 1 366  ? 33.564  31.970  72.904  1.00 54.01  ? 363  CYS A SG  1 
ATOM 2843  N N   . VAL A 1 367  ? 31.928  31.814  69.316  1.00 55.27  ? 364  VAL A N   1 
ATOM 2844  C CA  . VAL A 1 367  ? 32.537  31.246  68.103  1.00 56.10  ? 364  VAL A CA  1 
ATOM 2845  C C   . VAL A 1 367  ? 34.038  31.562  68.002  1.00 56.71  ? 364  VAL A C   1 
ATOM 2846  O O   . VAL A 1 367  ? 34.447  32.725  67.955  1.00 56.72  ? 364  VAL A O   1 
ATOM 2847  C CB  . VAL A 1 367  ? 31.793  31.717  66.826  1.00 56.13  ? 364  VAL A CB  1 
ATOM 2848  C CG1 . VAL A 1 367  ? 32.561  31.338  65.555  1.00 56.20  ? 364  VAL A CG1 1 
ATOM 2849  C CG2 . VAL A 1 367  ? 30.393  31.135  66.790  1.00 56.13  ? 364  VAL A CG2 1 
ATOM 2850  N N   . VAL A 1 368  ? 34.849  30.510  67.965  1.00 57.53  ? 365  VAL A N   1 
ATOM 2851  C CA  . VAL A 1 368  ? 36.303  30.640  68.001  1.00 58.51  ? 365  VAL A CA  1 
ATOM 2852  C C   . VAL A 1 368  ? 36.934  29.648  67.029  1.00 59.09  ? 365  VAL A C   1 
ATOM 2853  O O   . VAL A 1 368  ? 36.634  28.456  67.078  1.00 59.13  ? 365  VAL A O   1 
ATOM 2854  C CB  . VAL A 1 368  ? 36.848  30.380  69.434  1.00 58.57  ? 365  VAL A CB  1 
ATOM 2855  C CG1 . VAL A 1 368  ? 38.370  30.491  69.484  1.00 58.56  ? 365  VAL A CG1 1 
ATOM 2856  C CG2 . VAL A 1 368  ? 36.215  31.338  70.434  1.00 58.94  ? 365  VAL A CG2 1 
ATOM 2857  N N   . ASP A 1 369  ? 37.813  30.142  66.159  1.00 59.88  ? 366  ASP A N   1 
ATOM 2858  C CA  . ASP A 1 369  ? 38.447  29.307  65.133  1.00 60.74  ? 366  ASP A CA  1 
ATOM 2859  C C   . ASP A 1 369  ? 39.310  28.165  65.674  1.00 61.33  ? 366  ASP A C   1 
ATOM 2860  O O   . ASP A 1 369  ? 39.054  27.001  65.359  1.00 61.44  ? 366  ASP A O   1 
ATOM 2861  C CB  . ASP A 1 369  ? 39.240  30.166  64.149  1.00 60.75  ? 366  ASP A CB  1 
ATOM 2862  C CG  . ASP A 1 369  ? 38.353  30.834  63.124  1.00 60.82  ? 366  ASP A CG  1 
ATOM 2863  O OD1 . ASP A 1 369  ? 37.120  30.867  63.333  1.00 60.58  ? 366  ASP A OD1 1 
ATOM 2864  O OD2 . ASP A 1 369  ? 38.887  31.322  62.104  1.00 61.09  ? 366  ASP A OD2 1 
ATOM 2865  N N   . LEU A 1 370  ? 40.331  28.496  66.467  1.00 62.01  ? 367  LEU A N   1 
ATOM 2866  C CA  . LEU A 1 370  ? 41.188  27.488  67.114  1.00 62.71  ? 367  LEU A CA  1 
ATOM 2867  C C   . LEU A 1 370  ? 41.954  26.593  66.117  1.00 63.08  ? 367  LEU A C   1 
ATOM 2868  O O   . LEU A 1 370  ? 42.746  25.724  66.518  1.00 63.11  ? 367  LEU A O   1 
ATOM 2869  C CB  . LEU A 1 370  ? 40.363  26.624  68.091  1.00 62.91  ? 367  LEU A CB  1 
ATOM 2870  C CG  . LEU A 1 370  ? 39.818  27.228  69.396  1.00 62.89  ? 367  LEU A CG  1 
ATOM 2871  C CD1 . LEU A 1 370  ? 38.441  26.663  69.726  1.00 63.03  ? 367  LEU A CD1 1 
ATOM 2872  C CD2 . LEU A 1 370  ? 40.773  27.032  70.569  1.00 62.42  ? 367  LEU A CD2 1 
ATOM 2873  N N   . GLU A 1 371  ? 41.708  26.814  64.824  1.00 63.43  ? 368  GLU A N   1 
ATOM 2874  C CA  . GLU A 1 371  ? 42.375  26.077  63.742  1.00 63.69  ? 368  GLU A CA  1 
ATOM 2875  C C   . GLU A 1 371  ? 42.980  27.025  62.703  1.00 63.52  ? 368  GLU A C   1 
ATOM 2876  O O   . GLU A 1 371  ? 43.527  26.571  61.700  1.00 63.56  ? 368  GLU A O   1 
ATOM 2877  C CB  . GLU A 1 371  ? 41.394  25.129  63.043  1.00 63.81  ? 368  GLU A CB  1 
ATOM 2878  C CG  . GLU A 1 371  ? 40.431  24.369  63.961  1.00 64.92  ? 368  GLU A CG  1 
ATOM 2879  C CD  . GLU A 1 371  ? 40.974  23.038  64.447  1.00 66.25  ? 368  GLU A CD  1 
ATOM 2880  O OE1 . GLU A 1 371  ? 42.166  22.743  64.198  1.00 66.97  ? 368  GLU A OE1 1 
ATOM 2881  O OE2 . GLU A 1 371  ? 40.200  22.278  65.076  1.00 66.53  ? 368  GLU A OE2 1 
ATOM 2882  N N   . ARG A 1 372  ? 42.873  28.332  62.956  1.00 63.39  ? 369  ARG A N   1 
ATOM 2883  C CA  . ARG A 1 372  ? 43.306  29.405  62.028  1.00 63.19  ? 369  ARG A CA  1 
ATOM 2884  C C   . ARG A 1 372  ? 42.981  29.165  60.543  1.00 62.76  ? 369  ARG A C   1 
ATOM 2885  O O   . ARG A 1 372  ? 43.768  29.513  59.650  1.00 62.67  ? 369  ARG A O   1 
ATOM 2886  C CB  . ARG A 1 372  ? 44.784  29.792  62.231  1.00 63.33  ? 369  ARG A CB  1 
ATOM 2887  C CG  . ARG A 1 372  ? 45.053  30.571  63.527  1.00 63.86  ? 369  ARG A CG  1 
ATOM 2888  C CD  . ARG A 1 372  ? 46.056  31.724  63.343  1.00 64.48  ? 369  ARG A CD  1 
ATOM 2889  N NE  . ARG A 1 372  ? 47.387  31.276  62.921  1.00 64.80  ? 369  ARG A NE  1 
ATOM 2890  C CZ  . ARG A 1 372  ? 48.533  31.866  63.262  1.00 64.79  ? 369  ARG A CZ  1 
ATOM 2891  N NH1 . ARG A 1 372  ? 48.535  32.933  64.055  1.00 64.69  ? 369  ARG A NH1 1 
ATOM 2892  N NH2 . ARG A 1 372  ? 49.685  31.373  62.818  1.00 64.73  ? 369  ARG A NH2 1 
ATOM 2893  N N   . GLN A 1 373  ? 41.813  28.567  60.306  1.00 62.16  ? 370  GLN A N   1 
ATOM 2894  C CA  . GLN A 1 373  ? 41.282  28.355  58.965  1.00 61.57  ? 370  GLN A CA  1 
ATOM 2895  C C   . GLN A 1 373  ? 40.247  29.446  58.664  1.00 60.79  ? 370  GLN A C   1 
ATOM 2896  O O   . GLN A 1 373  ? 40.551  30.635  58.742  1.00 60.63  ? 370  GLN A O   1 
ATOM 2897  C CB  . GLN A 1 373  ? 40.636  26.965  58.851  1.00 61.68  ? 370  GLN A CB  1 
ATOM 2898  C CG  . GLN A 1 373  ? 41.487  25.782  59.316  1.00 61.92  ? 370  GLN A CG  1 
ATOM 2899  C CD  . GLN A 1 373  ? 40.718  24.457  59.301  1.00 62.11  ? 370  GLN A CD  1 
ATOM 2900  O OE1 . GLN A 1 373  ? 40.216  24.016  58.256  1.00 62.44  ? 370  GLN A OE1 1 
ATOM 2901  N NE2 . GLN A 1 373  ? 40.630  23.814  60.463  1.00 62.45  ? 370  GLN A NE2 1 
ATOM 2902  N N   . GLY A 1 374  ? 39.030  29.031  58.325  1.00 60.01  ? 371  GLY A N   1 
ATOM 2903  C CA  . GLY A 1 374  ? 37.908  29.942  58.135  1.00 58.92  ? 371  GLY A CA  1 
ATOM 2904  C C   . GLY A 1 374  ? 36.734  29.464  58.959  1.00 58.17  ? 371  GLY A C   1 
ATOM 2905  O O   . GLY A 1 374  ? 35.900  30.260  59.388  1.00 58.14  ? 371  GLY A O   1 
ATOM 2906  N N   . GLN A 1 375  ? 36.685  28.153  59.184  1.00 57.47  ? 372  GLN A N   1 
ATOM 2907  C CA  . GLN A 1 375  ? 35.653  27.523  60.015  1.00 56.89  ? 372  GLN A CA  1 
ATOM 2908  C C   . GLN A 1 375  ? 35.727  27.941  61.482  1.00 55.90  ? 372  GLN A C   1 
ATOM 2909  O O   . GLN A 1 375  ? 36.785  28.314  61.990  1.00 55.78  ? 372  GLN A O   1 
ATOM 2910  C CB  . GLN A 1 375  ? 35.711  25.989  59.901  1.00 57.19  ? 372  GLN A CB  1 
ATOM 2911  C CG  . GLN A 1 375  ? 37.125  25.375  59.946  1.00 58.60  ? 372  GLN A CG  1 
ATOM 2912  C CD  . GLN A 1 375  ? 37.809  25.502  61.312  1.00 60.11  ? 372  GLN A CD  1 
ATOM 2913  O OE1 . GLN A 1 375  ? 37.549  24.718  62.235  1.00 60.52  ? 372  GLN A OE1 1 
ATOM 2914  N NE2 . GLN A 1 375  ? 38.696  26.492  61.438  1.00 60.00  ? 372  GLN A NE2 1 
ATOM 2915  N N   . GLY A 1 376  ? 34.591  27.872  62.158  1.00 54.82  ? 373  GLY A N   1 
ATOM 2916  C CA  . GLY A 1 376  ? 34.546  28.192  63.569  1.00 53.73  ? 373  GLY A CA  1 
ATOM 2917  C C   . GLY A 1 376  ? 34.207  26.978  64.407  1.00 52.94  ? 373  GLY A C   1 
ATOM 2918  O O   . GLY A 1 376  ? 33.324  26.192  64.049  1.00 53.33  ? 373  GLY A O   1 
ATOM 2919  N N   . GLN A 1 377  ? 34.933  26.803  65.507  1.00 51.58  ? 374  GLN A N   1 
ATOM 2920  C CA  . GLN A 1 377  ? 34.508  25.901  66.555  1.00 50.11  ? 374  GLN A CA  1 
ATOM 2921  C C   . GLN A 1 377  ? 33.579  26.729  67.403  1.00 48.97  ? 374  GLN A C   1 
ATOM 2922  O O   . GLN A 1 377  ? 33.671  27.956  67.424  1.00 48.82  ? 374  GLN A O   1 
ATOM 2923  C CB  . GLN A 1 377  ? 35.682  25.479  67.431  1.00 50.42  ? 374  GLN A CB  1 
ATOM 2924  C CG  . GLN A 1 377  ? 36.926  25.053  66.700  1.00 50.99  ? 374  GLN A CG  1 
ATOM 2925  C CD  . GLN A 1 377  ? 36.839  23.640  66.208  1.00 52.03  ? 374  GLN A CD  1 
ATOM 2926  O OE1 . GLN A 1 377  ? 36.814  23.400  65.005  1.00 52.94  ? 374  GLN A OE1 1 
ATOM 2927  N NE2 . GLN A 1 377  ? 36.785  22.688  67.132  1.00 52.09  ? 374  GLN A NE2 1 
ATOM 2928  N N   . LEU A 1 378  ? 32.694  26.053  68.115  1.00 47.61  ? 375  LEU A N   1 
ATOM 2929  C CA  . LEU A 1 378  ? 31.859  26.696  69.109  1.00 46.38  ? 375  LEU A CA  1 
ATOM 2930  C C   . LEU A 1 378  ? 32.285  26.145  70.457  1.00 46.09  ? 375  LEU A C   1 
ATOM 2931  O O   . LEU A 1 378  ? 32.548  24.945  70.575  1.00 46.19  ? 375  LEU A O   1 
ATOM 2932  C CB  . LEU A 1 378  ? 30.403  26.349  68.834  1.00 46.02  ? 375  LEU A CB  1 
ATOM 2933  C CG  . LEU A 1 378  ? 29.276  27.071  69.547  1.00 44.30  ? 375  LEU A CG  1 
ATOM 2934  C CD1 . LEU A 1 378  ? 29.173  28.472  69.041  1.00 43.42  ? 375  LEU A CD1 1 
ATOM 2935  C CD2 . LEU A 1 378  ? 28.010  26.321  69.262  1.00 43.13  ? 375  LEU A CD2 1 
ATOM 2936  N N   . VAL A 1 379  ? 32.372  27.005  71.469  1.00 45.48  ? 376  VAL A N   1 
ATOM 2937  C CA  . VAL A 1 379  ? 32.730  26.548  72.817  1.00 44.97  ? 376  VAL A CA  1 
ATOM 2938  C C   . VAL A 1 379  ? 31.635  26.911  73.823  1.00 44.78  ? 376  VAL A C   1 
ATOM 2939  O O   . VAL A 1 379  ? 31.579  28.048  74.306  1.00 45.16  ? 376  VAL A O   1 
ATOM 2940  C CB  . VAL A 1 379  ? 34.103  27.105  73.284  1.00 44.86  ? 376  VAL A CB  1 
ATOM 2941  C CG1 . VAL A 1 379  ? 34.454  26.565  74.649  1.00 44.57  ? 376  VAL A CG1 1 
ATOM 2942  C CG2 . VAL A 1 379  ? 35.203  26.747  72.297  1.00 44.81  ? 376  VAL A CG2 1 
ATOM 2943  N N   . THR A 1 380  ? 30.765  25.952  74.138  1.00 44.14  ? 377  THR A N   1 
ATOM 2944  C CA  . THR A 1 380  ? 29.631  26.223  75.032  1.00 43.42  ? 377  THR A CA  1 
ATOM 2945  C C   . THR A 1 380  ? 29.930  25.878  76.475  1.00 42.95  ? 377  THR A C   1 
ATOM 2946  O O   . THR A 1 380  ? 30.427  24.787  76.761  1.00 43.12  ? 377  THR A O   1 
ATOM 2947  C CB  . THR A 1 380  ? 28.370  25.427  74.646  1.00 43.44  ? 377  THR A CB  1 
ATOM 2948  O OG1 . THR A 1 380  ? 28.554  24.038  74.970  1.00 43.26  ? 377  THR A OG1 1 
ATOM 2949  C CG2 . THR A 1 380  ? 28.052  25.589  73.168  1.00 43.37  ? 377  THR A CG2 1 
ATOM 2950  N N   . CYS A 1 381  ? 29.619  26.806  77.377  1.00 42.13  ? 378  CYS A N   1 
ATOM 2951  C CA  . CYS A 1 381  ? 29.561  26.501  78.796  1.00 41.36  ? 378  CYS A CA  1 
ATOM 2952  C C   . CYS A 1 381  ? 28.312  25.675  78.990  1.00 41.02  ? 378  CYS A C   1 
ATOM 2953  O O   . CYS A 1 381  ? 27.204  26.178  78.810  1.00 40.88  ? 378  CYS A O   1 
ATOM 2954  C CB  . CYS A 1 381  ? 29.467  27.775  79.617  1.00 41.26  ? 378  CYS A CB  1 
ATOM 2955  S SG  . CYS A 1 381  ? 30.874  28.846  79.409  1.00 40.74  ? 378  CYS A SG  1 
ATOM 2956  N N   . SER A 1 382  ? 28.494  24.404  79.322  1.00 40.60  ? 379  SER A N   1 
ATOM 2957  C CA  . SER A 1 382  ? 27.374  23.494  79.476  1.00 40.55  ? 379  SER A CA  1 
ATOM 2958  C C   . SER A 1 382  ? 27.296  22.987  80.906  1.00 40.60  ? 379  SER A C   1 
ATOM 2959  O O   . SER A 1 382  ? 28.129  23.345  81.748  1.00 40.76  ? 379  SER A O   1 
ATOM 2960  C CB  . SER A 1 382  ? 27.515  22.316  78.513  1.00 40.60  ? 379  SER A CB  1 
ATOM 2961  O OG  . SER A 1 382  ? 27.478  22.738  77.155  1.00 40.95  ? 379  SER A OG  1 
ATOM 2962  N N   . GLY A 1 383  ? 26.295  22.155  81.178  1.00 40.43  ? 380  GLY A N   1 
ATOM 2963  C CA  . GLY A 1 383  ? 26.146  21.527  82.478  1.00 40.12  ? 380  GLY A CA  1 
ATOM 2964  C C   . GLY A 1 383  ? 25.933  22.519  83.592  1.00 40.26  ? 380  GLY A C   1 
ATOM 2965  O O   . GLY A 1 383  ? 25.754  23.716  83.349  1.00 40.25  ? 380  GLY A O   1 
ATOM 2966  N N   . ALA A 1 384  ? 25.963  22.004  84.818  1.00 40.64  ? 381  ALA A N   1 
ATOM 2967  C CA  . ALA A 1 384  ? 25.757  22.780  86.048  1.00 40.89  ? 381  ALA A CA  1 
ATOM 2968  C C   . ALA A 1 384  ? 26.144  21.925  87.225  1.00 40.98  ? 381  ALA A C   1 
ATOM 2969  O O   . ALA A 1 384  ? 25.925  20.716  87.214  1.00 41.19  ? 381  ALA A O   1 
ATOM 2970  C CB  . ALA A 1 384  ? 24.307  23.183  86.188  1.00 41.21  ? 381  ALA A CB  1 
ATOM 2971  N N   . PHE A 1 385  ? 26.692  22.550  88.258  1.00 41.22  ? 382  PHE A N   1 
ATOM 2972  C CA  . PHE A 1 385  ? 27.159  21.807  89.427  1.00 41.26  ? 382  PHE A CA  1 
ATOM 2973  C C   . PHE A 1 385  ? 28.169  20.761  88.931  1.00 41.36  ? 382  PHE A C   1 
ATOM 2974  O O   . PHE A 1 385  ? 28.883  21.024  87.966  1.00 41.39  ? 382  PHE A O   1 
ATOM 2975  C CB  . PHE A 1 385  ? 25.973  21.192  90.185  1.00 40.99  ? 382  PHE A CB  1 
ATOM 2976  C CG  . PHE A 1 385  ? 24.782  22.122  90.314  1.00 41.03  ? 382  PHE A CG  1 
ATOM 2977  C CD1 . PHE A 1 385  ? 23.502  21.688  89.965  1.00 41.24  ? 382  PHE A CD1 1 
ATOM 2978  C CD2 . PHE A 1 385  ? 24.941  23.437  90.772  1.00 40.69  ? 382  PHE A CD2 1 
ATOM 2979  C CE1 . PHE A 1 385  ? 22.390  22.545  90.084  1.00 41.32  ? 382  PHE A CE1 1 
ATOM 2980  C CE2 . PHE A 1 385  ? 23.842  24.302  90.883  1.00 40.67  ? 382  PHE A CE2 1 
ATOM 2981  C CZ  . PHE A 1 385  ? 22.565  23.855  90.541  1.00 40.78  ? 382  PHE A CZ  1 
ATOM 2982  N N   . LYS A 1 386  ? 28.226  19.583  89.542  1.00 41.42  ? 383  LYS A N   1 
ATOM 2983  C CA  . LYS A 1 386  ? 29.277  18.623  89.185  1.00 41.72  ? 383  LYS A CA  1 
ATOM 2984  C C   . LYS A 1 386  ? 29.358  18.288  87.684  1.00 41.97  ? 383  LYS A C   1 
ATOM 2985  O O   . LYS A 1 386  ? 30.386  17.781  87.209  1.00 42.52  ? 383  LYS A O   1 
ATOM 2986  C CB  . LYS A 1 386  ? 29.176  17.346  90.021  1.00 41.75  ? 383  LYS A CB  1 
ATOM 2987  C CG  . LYS A 1 386  ? 27.869  16.583  89.870  1.00 42.27  ? 383  LYS A CG  1 
ATOM 2988  C CD  . LYS A 1 386  ? 27.838  15.370  90.779  1.00 42.86  ? 383  LYS A CD  1 
ATOM 2989  C CE  . LYS A 1 386  ? 28.325  14.129  90.069  1.00 43.12  ? 383  LYS A CE  1 
ATOM 2990  N NZ  . LYS A 1 386  ? 27.204  13.505  89.325  1.00 44.10  ? 383  LYS A NZ  1 
ATOM 2991  N N   . GLU A 1 387  ? 28.300  18.583  86.934  1.00 41.53  ? 384  GLU A N   1 
ATOM 2992  C CA  . GLU A 1 387  ? 28.263  18.190  85.538  1.00 41.38  ? 384  GLU A CA  1 
ATOM 2993  C C   . GLU A 1 387  ? 28.833  19.246  84.617  1.00 41.08  ? 384  GLU A C   1 
ATOM 2994  O O   . GLU A 1 387  ? 28.947  19.029  83.413  1.00 41.39  ? 384  GLU A O   1 
ATOM 2995  C CB  . GLU A 1 387  ? 26.840  17.857  85.119  1.00 41.63  ? 384  GLU A CB  1 
ATOM 2996  C CG  . GLU A 1 387  ? 26.077  17.012  86.119  1.00 43.02  ? 384  GLU A CG  1 
ATOM 2997  C CD  . GLU A 1 387  ? 26.633  15.605  86.276  1.00 44.61  ? 384  GLU A CD  1 
ATOM 2998  O OE1 . GLU A 1 387  ? 27.213  15.063  85.299  1.00 45.13  ? 384  GLU A OE1 1 
ATOM 2999  O OE2 . GLU A 1 387  ? 26.469  15.045  87.384  1.00 44.60  ? 384  GLU A OE2 1 
ATOM 3000  N N   . GLY A 1 388  ? 29.185  20.392  85.181  1.00 40.79  ? 385  GLY A N   1 
ATOM 3001  C CA  . GLY A 1 388  ? 29.696  21.512  84.397  1.00 40.37  ? 385  GLY A CA  1 
ATOM 3002  C C   . GLY A 1 388  ? 30.835  21.144  83.481  1.00 40.00  ? 385  GLY A C   1 
ATOM 3003  O O   . GLY A 1 388  ? 31.625  20.256  83.777  1.00 39.81  ? 385  GLY A O   1 
ATOM 3004  N N   . SER A 1 389  ? 30.906  21.843  82.362  1.00 40.10  ? 386  SER A N   1 
ATOM 3005  C CA  . SER A 1 389  ? 31.837  21.518  81.304  1.00 40.36  ? 386  SER A CA  1 
ATOM 3006  C C   . SER A 1 389  ? 31.864  22.622  80.272  1.00 40.92  ? 386  SER A C   1 
ATOM 3007  O O   . SER A 1 389  ? 30.953  23.457  80.195  1.00 41.01  ? 386  SER A O   1 
ATOM 3008  C CB  . SER A 1 389  ? 31.415  20.223  80.608  1.00 40.20  ? 386  SER A CB  1 
ATOM 3009  O OG  . SER A 1 389  ? 30.057  20.280  80.200  1.00 39.39  ? 386  SER A OG  1 
ATOM 3010  N N   . LEU A 1 390  ? 32.931  22.621  79.486  1.00 41.44  ? 387  LEU A N   1 
ATOM 3011  C CA  . LEU A 1 390  ? 32.934  23.292  78.203  1.00 41.96  ? 387  LEU A CA  1 
ATOM 3012  C C   . LEU A 1 390  ? 32.768  22.206  77.145  1.00 42.69  ? 387  LEU A C   1 
ATOM 3013  O O   . LEU A 1 390  ? 33.223  21.082  77.338  1.00 42.68  ? 387  LEU A O   1 
ATOM 3014  C CB  . LEU A 1 390  ? 34.246  24.028  77.987  1.00 41.60  ? 387  LEU A CB  1 
ATOM 3015  C CG  . LEU A 1 390  ? 34.686  25.031  79.036  1.00 40.74  ? 387  LEU A CG  1 
ATOM 3016  C CD1 . LEU A 1 390  ? 36.142  25.331  78.808  1.00 40.25  ? 387  LEU A CD1 1 
ATOM 3017  C CD2 . LEU A 1 390  ? 33.852  26.286  78.941  1.00 40.29  ? 387  LEU A CD2 1 
ATOM 3018  N N   . ARG A 1 391  ? 32.096  22.537  76.047  1.00 43.63  ? 388  ARG A N   1 
ATOM 3019  C CA  . ARG A 1 391  ? 32.011  21.642  74.896  1.00 44.65  ? 388  ARG A CA  1 
ATOM 3020  C C   . ARG A 1 391  ? 32.605  22.348  73.682  1.00 45.76  ? 388  ARG A C   1 
ATOM 3021  O O   . ARG A 1 391  ? 32.167  23.460  73.338  1.00 45.90  ? 388  ARG A O   1 
ATOM 3022  C CB  . ARG A 1 391  ? 30.554  21.267  74.602  1.00 44.30  ? 388  ARG A CB  1 
ATOM 3023  C CG  . ARG A 1 391  ? 29.832  20.558  75.725  1.00 43.34  ? 388  ARG A CG  1 
ATOM 3024  C CD  . ARG A 1 391  ? 30.472  19.226  76.045  1.00 41.78  ? 388  ARG A CD  1 
ATOM 3025  N NE  . ARG A 1 391  ? 30.100  18.764  77.374  1.00 40.86  ? 388  ARG A NE  1 
ATOM 3026  C CZ  . ARG A 1 391  ? 29.516  17.602  77.649  1.00 40.54  ? 388  ARG A CZ  1 
ATOM 3027  N NH1 . ARG A 1 391  ? 29.243  16.726  76.694  1.00 39.59  ? 388  ARG A NH1 1 
ATOM 3028  N NH2 . ARG A 1 391  ? 29.222  17.309  78.908  1.00 41.65  ? 388  ARG A NH2 1 
ATOM 3029  N N   . ILE A 1 392  ? 33.594  21.726  73.037  1.00 46.75  ? 389  ILE A N   1 
ATOM 3030  C CA  . ILE A 1 392  ? 34.112  22.286  71.775  1.00 47.74  ? 389  ILE A CA  1 
ATOM 3031  C C   . ILE A 1 392  ? 33.540  21.579  70.534  1.00 48.79  ? 389  ILE A C   1 
ATOM 3032  O O   . ILE A 1 392  ? 33.944  20.456  70.181  1.00 48.80  ? 389  ILE A O   1 
ATOM 3033  C CB  . ILE A 1 392  ? 35.659  22.393  71.723  1.00 47.48  ? 389  ILE A CB  1 
ATOM 3034  C CG1 . ILE A 1 392  ? 36.191  23.202  72.902  1.00 46.70  ? 389  ILE A CG1 1 
ATOM 3035  C CG2 . ILE A 1 392  ? 36.102  23.051  70.427  1.00 47.21  ? 389  ILE A CG2 1 
ATOM 3036  C CD1 . ILE A 1 392  ? 36.636  22.364  74.056  1.00 45.94  ? 389  ILE A CD1 1 
ATOM 3037  N N   . ILE A 1 393  ? 32.599  22.262  69.886  1.00 50.00  ? 390  ILE A N   1 
ATOM 3038  C CA  . ILE A 1 393  ? 31.830  21.700  68.778  1.00 51.40  ? 390  ILE A CA  1 
ATOM 3039  C C   . ILE A 1 393  ? 32.450  22.046  67.414  1.00 52.70  ? 390  ILE A C   1 
ATOM 3040  O O   . ILE A 1 393  ? 32.514  23.219  67.027  1.00 53.14  ? 390  ILE A O   1 
ATOM 3041  C CB  . ILE A 1 393  ? 30.367  22.153  68.848  1.00 51.11  ? 390  ILE A CB  1 
ATOM 3042  C CG1 . ILE A 1 393  ? 29.780  21.817  70.221  1.00 51.09  ? 390  ILE A CG1 1 
ATOM 3043  C CG2 . ILE A 1 393  ? 29.566  21.483  67.766  1.00 51.16  ? 390  ILE A CG2 1 
ATOM 3044  C CD1 . ILE A 1 393  ? 28.671  22.739  70.657  1.00 50.42  ? 390  ILE A CD1 1 
ATOM 3045  N N   . ARG A 1 394  ? 32.902  21.012  66.702  1.00 54.03  ? 391  ARG A N   1 
ATOM 3046  C CA  . ARG A 1 394  ? 33.644  21.159  65.450  1.00 55.23  ? 391  ARG A CA  1 
ATOM 3047  C C   . ARG A 1 394  ? 32.895  20.461  64.334  1.00 55.97  ? 391  ARG A C   1 
ATOM 3048  O O   . ARG A 1 394  ? 32.661  19.253  64.390  1.00 56.01  ? 391  ARG A O   1 
ATOM 3049  C CB  . ARG A 1 394  ? 35.045  20.552  65.596  1.00 55.41  ? 391  ARG A CB  1 
ATOM 3050  C CG  . ARG A 1 394  ? 35.971  20.682  64.372  1.00 56.43  ? 391  ARG A CG  1 
ATOM 3051  C CD  . ARG A 1 394  ? 36.111  19.380  63.553  1.00 58.10  ? 391  ARG A CD  1 
ATOM 3052  N NE  . ARG A 1 394  ? 36.787  18.246  64.221  1.00 59.30  ? 391  ARG A NE  1 
ATOM 3053  C CZ  . ARG A 1 394  ? 37.799  18.310  65.096  1.00 59.36  ? 391  ARG A CZ  1 
ATOM 3054  N NH1 . ARG A 1 394  ? 38.338  19.469  65.472  1.00 59.50  ? 391  ARG A NH1 1 
ATOM 3055  N NH2 . ARG A 1 394  ? 38.285  17.182  65.600  1.00 58.79  ? 391  ARG A NH2 1 
ATOM 3056  N N   . ASN A 1 395  ? 32.537  21.231  63.316  1.00 57.07  ? 392  ASN A N   1 
ATOM 3057  C CA  . ASN A 1 395  ? 31.764  20.729  62.190  1.00 58.26  ? 392  ASN A CA  1 
ATOM 3058  C C   . ASN A 1 395  ? 32.648  20.015  61.173  1.00 58.80  ? 392  ASN A C   1 
ATOM 3059  O O   . ASN A 1 395  ? 33.705  20.521  60.796  1.00 58.80  ? 392  ASN A O   1 
ATOM 3060  C CB  . ASN A 1 395  ? 31.026  21.891  61.525  1.00 58.58  ? 392  ASN A CB  1 
ATOM 3061  C CG  . ASN A 1 395  ? 29.674  21.490  60.958  1.00 59.54  ? 392  ASN A CG  1 
ATOM 3062  O OD1 . ASN A 1 395  ? 28.633  21.832  61.523  1.00 60.57  ? 392  ASN A OD1 1 
ATOM 3063  N ND2 . ASN A 1 395  ? 29.681  20.772  59.833  1.00 60.43  ? 392  ASN A ND2 1 
ATOM 3064  N N   . GLY A 1 396  ? 32.207  18.839  60.738  1.00 59.60  ? 393  GLY A N   1 
ATOM 3065  C CA  . GLY A 1 396  ? 32.927  18.048  59.746  1.00 60.78  ? 393  GLY A CA  1 
ATOM 3066  C C   . GLY A 1 396  ? 33.960  17.086  60.309  1.00 61.78  ? 393  GLY A C   1 
ATOM 3067  O O   . GLY A 1 396  ? 34.463  17.260  61.423  1.00 61.66  ? 393  GLY A O   1 
ATOM 3068  N N   . ILE A 1 397  ? 34.268  16.064  59.518  1.00 62.94  ? 394  ILE A N   1 
ATOM 3069  C CA  . ILE A 1 397  ? 35.305  15.094  59.840  1.00 64.26  ? 394  ILE A CA  1 
ATOM 3070  C C   . ILE A 1 397  ? 36.628  15.641  59.320  1.00 65.62  ? 394  ILE A C   1 
ATOM 3071  O O   . ILE A 1 397  ? 36.682  16.172  58.221  1.00 65.65  ? 394  ILE A O   1 
ATOM 3072  C CB  . ILE A 1 397  ? 34.978  13.713  59.218  1.00 64.03  ? 394  ILE A CB  1 
ATOM 3073  C CG1 . ILE A 1 397  ? 33.621  13.215  59.743  1.00 63.54  ? 394  ILE A CG1 1 
ATOM 3074  C CG2 . ILE A 1 397  ? 36.097  12.703  59.495  1.00 63.60  ? 394  ILE A CG2 1 
ATOM 3075  C CD1 . ILE A 1 397  ? 33.001  12.101  58.944  1.00 62.68  ? 394  ILE A CD1 1 
ATOM 3076  N N   . GLY A 1 398  ? 37.686  15.532  60.115  1.00 67.43  ? 395  GLY A N   1 
ATOM 3077  C CA  . GLY A 1 398  ? 38.961  16.156  59.772  1.00 69.96  ? 395  GLY A CA  1 
ATOM 3078  C C   . GLY A 1 398  ? 40.098  15.173  59.628  1.00 71.88  ? 395  GLY A C   1 
ATOM 3079  O O   . GLY A 1 398  ? 39.991  14.032  60.065  1.00 71.94  ? 395  GLY A O   1 
ATOM 3080  N N   . ILE A 1 399  ? 41.195  15.629  59.025  1.00 74.05  ? 396  ILE A N   1 
ATOM 3081  C CA  . ILE A 1 399  ? 42.357  14.771  58.745  1.00 76.46  ? 396  ILE A CA  1 
ATOM 3082  C C   . ILE A 1 399  ? 43.600  15.084  59.572  1.00 78.03  ? 396  ILE A C   1 
ATOM 3083  O O   . ILE A 1 399  ? 43.947  16.251  59.786  1.00 78.14  ? 396  ILE A O   1 
ATOM 3084  C CB  . ILE A 1 399  ? 42.765  14.792  57.241  1.00 76.51  ? 396  ILE A CB  1 
ATOM 3085  C CG1 . ILE A 1 399  ? 42.899  16.232  56.705  1.00 77.25  ? 396  ILE A CG1 1 
ATOM 3086  C CG2 . ILE A 1 399  ? 41.789  13.970  56.404  1.00 76.33  ? 396  ILE A CG2 1 
ATOM 3087  C CD1 . ILE A 1 399  ? 44.269  16.905  56.936  1.00 77.37  ? 396  ILE A CD1 1 
ATOM 3088  N N   . HIS A 1 400  ? 44.268  14.023  60.016  1.00 80.18  ? 397  HIS A N   1 
ATOM 3089  C CA  . HIS A 1 400  ? 45.570  14.128  60.661  1.00 82.36  ? 397  HIS A CA  1 
ATOM 3090  C C   . HIS A 1 400  ? 46.656  13.894  59.621  1.00 83.70  ? 397  HIS A C   1 
ATOM 3091  O O   . HIS A 1 400  ? 46.817  12.774  59.145  1.00 83.89  ? 397  HIS A O   1 
ATOM 3092  C CB  . HIS A 1 400  ? 45.709  13.083  61.768  1.00 82.42  ? 397  HIS A CB  1 
ATOM 3093  C CG  . HIS A 1 400  ? 45.026  13.455  63.044  1.00 82.94  ? 397  HIS A CG  1 
ATOM 3094  N ND1 . HIS A 1 400  ? 45.406  14.542  63.800  1.00 83.20  ? 397  HIS A ND1 1 
ATOM 3095  C CD2 . HIS A 1 400  ? 44.003  12.870  63.710  1.00 83.37  ? 397  HIS A CD2 1 
ATOM 3096  C CE1 . HIS A 1 400  ? 44.637  14.618  64.871  1.00 83.73  ? 397  HIS A CE1 1 
ATOM 3097  N NE2 . HIS A 1 400  ? 43.778  13.615  64.841  1.00 83.65  ? 397  HIS A NE2 1 
ATOM 3098  N N   . GLU A 1 401  ? 47.405  14.936  59.273  1.00 85.43  ? 398  GLU A N   1 
ATOM 3099  C CA  . GLU A 1 401  ? 48.434  14.794  58.242  1.00 87.14  ? 398  GLU A CA  1 
ATOM 3100  C C   . GLU A 1 401  ? 49.836  14.507  58.815  1.00 88.43  ? 398  GLU A C   1 
ATOM 3101  O O   . GLU A 1 401  ? 50.193  15.008  59.886  1.00 88.55  ? 398  GLU A O   1 
ATOM 3102  C CB  . GLU A 1 401  ? 48.399  15.977  57.253  1.00 87.08  ? 398  GLU A CB  1 
ATOM 3103  C CG  . GLU A 1 401  ? 48.948  17.305  57.758  1.00 87.12  ? 398  GLU A CG  1 
ATOM 3104  C CD  . GLU A 1 401  ? 50.342  17.588  57.228  1.00 87.24  ? 398  GLU A CD  1 
ATOM 3105  O OE1 . GLU A 1 401  ? 51.221  17.973  58.035  1.00 87.12  ? 398  GLU A OE1 1 
ATOM 3106  O OE2 . GLU A 1 401  ? 50.557  17.418  56.005  1.00 86.83  ? 398  GLU A OE2 1 
ATOM 3107  N N   . HIS A 1 402  ? 50.606  13.683  58.100  1.00 90.13  ? 399  HIS A N   1 
ATOM 3108  C CA  . HIS A 1 402  ? 51.956  13.278  58.527  1.00 91.77  ? 399  HIS A CA  1 
ATOM 3109  C C   . HIS A 1 402  ? 53.067  13.767  57.581  1.00 92.77  ? 399  HIS A C   1 
ATOM 3110  O O   . HIS A 1 402  ? 53.991  14.460  58.020  1.00 92.88  ? 399  HIS A O   1 
ATOM 3111  C CB  . HIS A 1 402  ? 52.046  11.753  58.716  1.00 91.80  ? 399  HIS A CB  1 
ATOM 3112  C CG  . HIS A 1 402  ? 51.232  11.227  59.861  1.00 92.32  ? 399  HIS A CG  1 
ATOM 3113  N ND1 . HIS A 1 402  ? 50.113  10.441  59.681  1.00 92.41  ? 399  HIS A ND1 1 
ATOM 3114  C CD2 . HIS A 1 402  ? 51.379  11.369  61.201  1.00 92.58  ? 399  HIS A CD2 1 
ATOM 3115  C CE1 . HIS A 1 402  ? 49.603  10.125  60.859  1.00 92.46  ? 399  HIS A CE1 1 
ATOM 3116  N NE2 . HIS A 1 402  ? 50.353  10.676  61.797  1.00 92.68  ? 399  HIS A NE2 1 
ATOM 3117  N N   . ALA A 1 403  ? 52.978  13.396  56.301  1.00 94.04  ? 400  ALA A N   1 
ATOM 3118  C CA  . ALA A 1 403  ? 53.958  13.810  55.285  1.00 95.26  ? 400  ALA A CA  1 
ATOM 3119  C C   . ALA A 1 403  ? 53.266  14.447  54.082  1.00 96.18  ? 400  ALA A C   1 
ATOM 3120  O O   . ALA A 1 403  ? 52.131  14.096  53.759  1.00 96.33  ? 400  ALA A O   1 
ATOM 3121  C CB  . ALA A 1 403  ? 54.818  12.627  54.847  1.00 95.12  ? 400  ALA A CB  1 
ATOM 3122  N N   . SER A 1 404  ? 53.955  15.379  53.421  1.00 97.38  ? 401  SER A N   1 
ATOM 3123  C CA  . SER A 1 404  ? 53.364  16.152  52.324  1.00 98.57  ? 401  SER A CA  1 
ATOM 3124  C C   . SER A 1 404  ? 54.318  16.288  51.126  1.00 99.43  ? 401  SER A C   1 
ATOM 3125  O O   . SER A 1 404  ? 55.020  17.293  50.989  1.00 99.47  ? 401  SER A O   1 
ATOM 3126  C CB  . SER A 1 404  ? 52.922  17.531  52.835  1.00 98.57  ? 401  SER A CB  1 
ATOM 3127  O OG  . SER A 1 404  ? 51.758  17.993  52.168  1.00 98.77  ? 401  SER A OG  1 
ATOM 3128  N N   . ILE A 1 405  ? 54.328  15.270  50.262  1.00 100.59 ? 402  ILE A N   1 
ATOM 3129  C CA  . ILE A 1 405  ? 55.231  15.208  49.099  1.00 101.61 ? 402  ILE A CA  1 
ATOM 3130  C C   . ILE A 1 405  ? 54.554  15.805  47.875  1.00 102.46 ? 402  ILE A C   1 
ATOM 3131  O O   . ILE A 1 405  ? 53.413  15.458  47.568  1.00 102.59 ? 402  ILE A O   1 
ATOM 3132  C CB  . ILE A 1 405  ? 55.665  13.750  48.769  1.00 101.47 ? 402  ILE A CB  1 
ATOM 3133  C CG1 . ILE A 1 405  ? 56.118  13.003  50.028  1.00 101.49 ? 402  ILE A CG1 1 
ATOM 3134  C CG2 . ILE A 1 405  ? 56.770  13.735  47.719  1.00 101.33 ? 402  ILE A CG2 1 
ATOM 3135  C CD1 . ILE A 1 405  ? 55.003  12.247  50.747  1.00 101.43 ? 402  ILE A CD1 1 
ATOM 3136  N N   . ASP A 1 406  ? 55.269  16.683  47.171  1.00 103.55 ? 403  ASP A N   1 
ATOM 3137  C CA  . ASP A 1 406  ? 54.691  17.483  46.081  1.00 104.64 ? 403  ASP A CA  1 
ATOM 3138  C C   . ASP A 1 406  ? 54.687  16.800  44.695  1.00 105.32 ? 403  ASP A C   1 
ATOM 3139  O O   . ASP A 1 406  ? 55.571  17.047  43.866  1.00 105.43 ? 403  ASP A O   1 
ATOM 3140  C CB  . ASP A 1 406  ? 55.394  18.845  46.010  1.00 104.63 ? 403  ASP A CB  1 
ATOM 3141  C CG  . ASP A 1 406  ? 54.478  19.951  45.522  1.00 104.89 ? 403  ASP A CG  1 
ATOM 3142  O OD1 . ASP A 1 406  ? 53.995  19.876  44.368  1.00 104.85 ? 403  ASP A OD1 1 
ATOM 3143  O OD2 . ASP A 1 406  ? 54.247  20.903  46.300  1.00 105.04 ? 403  ASP A OD2 1 
ATOM 3144  N N   . LEU A 1 407  ? 53.674  15.968  44.446  1.00 106.18 ? 404  LEU A N   1 
ATOM 3145  C CA  . LEU A 1 407  ? 53.520  15.269  43.163  1.00 106.95 ? 404  LEU A CA  1 
ATOM 3146  C C   . LEU A 1 407  ? 52.244  15.704  42.420  1.00 107.72 ? 404  LEU A C   1 
ATOM 3147  O O   . LEU A 1 407  ? 51.139  15.279  42.783  1.00 107.75 ? 404  LEU A O   1 
ATOM 3148  C CB  . LEU A 1 407  ? 53.507  13.749  43.368  1.00 106.82 ? 404  LEU A CB  1 
ATOM 3149  C CG  . LEU A 1 407  ? 54.491  13.090  44.336  1.00 106.70 ? 404  LEU A CG  1 
ATOM 3150  C CD1 . LEU A 1 407  ? 54.065  11.657  44.613  1.00 106.48 ? 404  LEU A CD1 1 
ATOM 3151  C CD2 . LEU A 1 407  ? 55.914  13.139  43.799  1.00 106.89 ? 404  LEU A CD2 1 
ATOM 3152  N N   . PRO A 1 408  ? 52.388  16.565  41.385  1.00 108.45 ? 405  PRO A N   1 
ATOM 3153  C CA  . PRO A 1 408  ? 51.244  16.981  40.566  1.00 108.91 ? 405  PRO A CA  1 
ATOM 3154  C C   . PRO A 1 408  ? 50.851  15.961  39.489  1.00 109.36 ? 405  PRO A C   1 
ATOM 3155  O O   . PRO A 1 408  ? 51.688  15.553  38.674  1.00 109.34 ? 405  PRO A O   1 
ATOM 3156  C CB  . PRO A 1 408  ? 51.718  18.303  39.924  1.00 108.89 ? 405  PRO A CB  1 
ATOM 3157  C CG  . PRO A 1 408  ? 53.112  18.563  40.472  1.00 108.82 ? 405  PRO A CG  1 
ATOM 3158  C CD  . PRO A 1 408  ? 53.624  17.233  40.942  1.00 108.56 ? 405  PRO A CD  1 
ATOM 3159  N N   . GLY A 1 409  ? 49.580  15.562  39.504  1.00 109.79 ? 406  GLY A N   1 
ATOM 3160  C CA  . GLY A 1 409  ? 49.026  14.661  38.499  1.00 110.24 ? 406  GLY A CA  1 
ATOM 3161  C C   . GLY A 1 409  ? 49.024  13.197  38.897  1.00 110.57 ? 406  GLY A C   1 
ATOM 3162  O O   . GLY A 1 409  ? 49.408  12.333  38.107  1.00 110.64 ? 406  GLY A O   1 
ATOM 3163  N N   . ILE A 1 410  ? 48.595  12.912  40.121  1.00 110.87 ? 407  ILE A N   1 
ATOM 3164  C CA  . ILE A 1 410  ? 48.412  11.531  40.549  1.00 111.23 ? 407  ILE A CA  1 
ATOM 3165  C C   . ILE A 1 410  ? 47.023  11.072  40.099  1.00 111.53 ? 407  ILE A C   1 
ATOM 3166  O O   . ILE A 1 410  ? 46.077  11.860  40.125  1.00 111.60 ? 407  ILE A O   1 
ATOM 3167  C CB  . ILE A 1 410  ? 48.604  11.374  42.073  1.00 111.24 ? 407  ILE A CB  1 
ATOM 3168  C CG1 . ILE A 1 410  ? 49.914  12.043  42.512  1.00 111.20 ? 407  ILE A CG1 1 
ATOM 3169  C CG2 . ILE A 1 410  ? 48.593  9.892   42.465  1.00 111.30 ? 407  ILE A CG2 1 
ATOM 3170  C CD1 . ILE A 1 410  ? 50.049  12.264  44.011  1.00 111.18 ? 407  ILE A CD1 1 
ATOM 3171  N N   . LYS A 1 411  ? 46.914  9.811   39.672  1.00 111.92 ? 408  LYS A N   1 
ATOM 3172  C CA  . LYS A 1 411  ? 45.678  9.281   39.072  1.00 112.31 ? 408  LYS A CA  1 
ATOM 3173  C C   . LYS A 1 411  ? 45.041  8.094   39.819  1.00 112.70 ? 408  LYS A C   1 
ATOM 3174  O O   . LYS A 1 411  ? 43.932  7.672   39.487  1.00 112.71 ? 408  LYS A O   1 
ATOM 3175  C CB  . LYS A 1 411  ? 45.903  8.920   37.596  1.00 112.16 ? 408  LYS A CB  1 
ATOM 3176  C CG  . LYS A 1 411  ? 46.394  10.064  36.718  1.00 112.11 ? 408  LYS A CG  1 
ATOM 3177  C CD  . LYS A 1 411  ? 45.297  11.072  36.425  1.00 112.26 ? 408  LYS A CD  1 
ATOM 3178  C CE  . LYS A 1 411  ? 45.823  12.227  35.587  1.00 112.46 ? 408  LYS A CE  1 
ATOM 3179  N NZ  . LYS A 1 411  ? 44.757  13.212  35.244  1.00 112.41 ? 408  LYS A NZ  1 
ATOM 3180  N N   . GLY A 1 412  ? 45.733  7.563   40.824  1.00 113.15 ? 409  GLY A N   1 
ATOM 3181  C CA  . GLY A 1 412  ? 45.186  6.483   41.650  1.00 113.75 ? 409  GLY A CA  1 
ATOM 3182  C C   . GLY A 1 412  ? 46.197  5.975   42.656  1.00 114.20 ? 409  GLY A C   1 
ATOM 3183  O O   . GLY A 1 412  ? 47.364  6.355   42.597  1.00 114.18 ? 409  GLY A O   1 
ATOM 3184  N N   . LEU A 1 413  ? 45.744  5.138   43.593  1.00 114.69 ? 410  LEU A N   1 
ATOM 3185  C CA  . LEU A 1 413  ? 46.636  4.446   44.541  1.00 115.28 ? 410  LEU A CA  1 
ATOM 3186  C C   . LEU A 1 413  ? 45.965  3.283   45.269  1.00 115.70 ? 410  LEU A C   1 
ATOM 3187  O O   . LEU A 1 413  ? 44.788  3.357   45.623  1.00 115.61 ? 410  LEU A O   1 
ATOM 3188  C CB  . LEU A 1 413  ? 47.302  5.412   45.537  1.00 115.33 ? 410  LEU A CB  1 
ATOM 3189  C CG  . LEU A 1 413  ? 46.657  6.741   45.940  1.00 115.39 ? 410  LEU A CG  1 
ATOM 3190  C CD1 . LEU A 1 413  ? 45.698  6.567   47.106  1.00 115.54 ? 410  LEU A CD1 1 
ATOM 3191  C CD2 . LEU A 1 413  ? 47.747  7.749   46.282  1.00 115.29 ? 410  LEU A CD2 1 
ATOM 3192  N N   . TRP A 1 414  ? 46.737  2.216   45.481  1.00 116.38 ? 411  TRP A N   1 
ATOM 3193  C CA  . TRP A 1 414  ? 46.241  0.954   46.041  1.00 117.06 ? 411  TRP A CA  1 
ATOM 3194  C C   . TRP A 1 414  ? 47.222  0.371   47.075  1.00 117.72 ? 411  TRP A C   1 
ATOM 3195  O O   . TRP A 1 414  ? 48.440  0.520   46.918  1.00 117.68 ? 411  TRP A O   1 
ATOM 3196  C CB  . TRP A 1 414  ? 46.014  -0.069  44.919  1.00 116.86 ? 411  TRP A CB  1 
ATOM 3197  C CG  . TRP A 1 414  ? 45.077  0.380   43.820  1.00 116.72 ? 411  TRP A CG  1 
ATOM 3198  C CD1 . TRP A 1 414  ? 43.751  0.077   43.702  1.00 116.59 ? 411  TRP A CD1 1 
ATOM 3199  C CD2 . TRP A 1 414  ? 45.403  1.199   42.683  1.00 116.36 ? 411  TRP A CD2 1 
ATOM 3200  N NE1 . TRP A 1 414  ? 43.228  0.660   42.570  1.00 116.40 ? 411  TRP A NE1 1 
ATOM 3201  C CE2 . TRP A 1 414  ? 44.218  1.354   41.928  1.00 116.24 ? 411  TRP A CE2 1 
ATOM 3202  C CE3 . TRP A 1 414  ? 46.577  1.818   42.233  1.00 116.29 ? 411  TRP A CE3 1 
ATOM 3203  C CZ2 . TRP A 1 414  ? 44.173  2.106   40.751  1.00 116.33 ? 411  TRP A CZ2 1 
ATOM 3204  C CZ3 . TRP A 1 414  ? 46.530  2.567   41.060  1.00 116.44 ? 411  TRP A CZ3 1 
ATOM 3205  C CH2 . TRP A 1 414  ? 45.335  2.700   40.333  1.00 116.45 ? 411  TRP A CH2 1 
ATOM 3206  N N   . PRO A 1 415  ? 46.697  -0.310  48.123  1.00 118.44 ? 412  PRO A N   1 
ATOM 3207  C CA  . PRO A 1 415  ? 47.513  -0.894  49.214  1.00 119.03 ? 412  PRO A CA  1 
ATOM 3208  C C   . PRO A 1 415  ? 48.492  -1.992  48.750  1.00 119.62 ? 412  PRO A C   1 
ATOM 3209  O O   . PRO A 1 415  ? 48.097  -2.876  47.980  1.00 119.65 ? 412  PRO A O   1 
ATOM 3210  C CB  . PRO A 1 415  ? 46.461  -1.491  50.166  1.00 118.97 ? 412  PRO A CB  1 
ATOM 3211  C CG  . PRO A 1 415  ? 45.167  -0.843  49.793  1.00 118.68 ? 412  PRO A CG  1 
ATOM 3212  C CD  . PRO A 1 415  ? 45.257  -0.563  48.329  1.00 118.43 ? 412  PRO A CD  1 
ATOM 3213  N N   . LEU A 1 416  ? 49.742  -1.941  49.227  1.00 120.28 ? 413  LEU A N   1 
ATOM 3214  C CA  . LEU A 1 416  ? 50.799  -2.861  48.757  1.00 120.83 ? 413  LEU A CA  1 
ATOM 3215  C C   . LEU A 1 416  ? 51.859  -3.229  49.807  1.00 121.16 ? 413  LEU A C   1 
ATOM 3216  O O   . LEU A 1 416  ? 52.139  -2.455  50.718  1.00 121.11 ? 413  LEU A O   1 
ATOM 3217  C CB  . LEU A 1 416  ? 51.484  -2.285  47.506  1.00 120.88 ? 413  LEU A CB  1 
ATOM 3218  C CG  . LEU A 1 416  ? 52.149  -3.224  46.490  1.00 120.94 ? 413  LEU A CG  1 
ATOM 3219  C CD1 . LEU A 1 416  ? 51.112  -3.983  45.661  1.00 120.93 ? 413  LEU A CD1 1 
ATOM 3220  C CD2 . LEU A 1 416  ? 53.086  -2.446  45.576  1.00 120.82 ? 413  LEU A CD2 1 
ATOM 3221  N N   . ARG A 1 417  ? 52.445  -4.415  49.646  1.00 121.69 ? 414  ARG A N   1 
ATOM 3222  C CA  . ARG A 1 417  ? 53.492  -4.935  50.534  1.00 122.25 ? 414  ARG A CA  1 
ATOM 3223  C C   . ARG A 1 417  ? 54.597  -5.630  49.731  1.00 122.72 ? 414  ARG A C   1 
ATOM 3224  O O   . ARG A 1 417  ? 54.320  -6.280  48.721  1.00 122.75 ? 414  ARG A O   1 
ATOM 3225  C CB  . ARG A 1 417  ? 52.895  -5.918  51.548  1.00 122.20 ? 414  ARG A CB  1 
ATOM 3226  C CG  . ARG A 1 417  ? 52.115  -7.070  50.911  1.00 122.11 ? 414  ARG A CG  1 
ATOM 3227  C CD  . ARG A 1 417  ? 51.740  -8.159  51.905  1.00 122.15 ? 414  ARG A CD  1 
ATOM 3228  N NE  . ARG A 1 417  ? 50.833  -7.695  52.955  1.00 122.28 ? 414  ARG A NE  1 
ATOM 3229  C CZ  . ARG A 1 417  ? 49.539  -7.428  52.785  1.00 122.24 ? 414  ARG A CZ  1 
ATOM 3230  N NH1 . ARG A 1 417  ? 48.968  -7.557  51.595  1.00 122.15 ? 414  ARG A NH1 1 
ATOM 3231  N NH2 . ARG A 1 417  ? 48.811  -7.021  53.815  1.00 122.37 ? 414  ARG A NH2 1 
ATOM 3232  N N   . SER A 1 418  ? 55.844  -5.498  50.184  1.00 123.34 ? 415  SER A N   1 
ATOM 3233  C CA  . SER A 1 418  ? 56.980  -6.179  49.543  1.00 123.93 ? 415  SER A CA  1 
ATOM 3234  C C   . SER A 1 418  ? 57.518  -7.342  50.394  1.00 124.35 ? 415  SER A C   1 
ATOM 3235  O O   . SER A 1 418  ? 58.690  -7.723  50.288  1.00 124.32 ? 415  SER A O   1 
ATOM 3236  C CB  . SER A 1 418  ? 58.095  -5.184  49.195  1.00 123.90 ? 415  SER A CB  1 
ATOM 3237  O OG  . SER A 1 418  ? 59.096  -5.795  48.398  1.00 123.88 ? 415  SER A OG  1 
ATOM 3238  N N   . ASP A 1 419  ? 56.640  -7.892  51.231  1.00 124.91 ? 416  ASP A N   1 
ATOM 3239  C CA  . ASP A 1 419  ? 56.930  -9.063  52.057  1.00 125.46 ? 416  ASP A CA  1 
ATOM 3240  C C   . ASP A 1 419  ? 55.592  -9.693  52.471  1.00 125.93 ? 416  ASP A C   1 
ATOM 3241  O O   . ASP A 1 419  ? 54.764  -9.023  53.098  1.00 125.96 ? 416  ASP A O   1 
ATOM 3242  C CB  . ASP A 1 419  ? 57.761  -8.669  53.291  1.00 125.39 ? 416  ASP A CB  1 
ATOM 3243  C CG  . ASP A 1 419  ? 58.646  -9.803  53.799  1.00 125.28 ? 416  ASP A CG  1 
ATOM 3244  O OD1 . ASP A 1 419  ? 59.886  -9.645  53.785  1.00 125.05 ? 416  ASP A OD1 1 
ATOM 3245  O OD2 . ASP A 1 419  ? 58.109  -10.851 54.214  1.00 125.12 ? 416  ASP A OD2 1 
ATOM 3246  N N   . PRO A 1 420  ? 55.363  -10.973 52.098  1.00 126.40 ? 417  PRO A N   1 
ATOM 3247  C CA  . PRO A 1 420  ? 54.123  -11.689 52.444  1.00 126.79 ? 417  PRO A CA  1 
ATOM 3248  C C   . PRO A 1 420  ? 53.895  -11.872 53.952  1.00 127.26 ? 417  PRO A C   1 
ATOM 3249  O O   . PRO A 1 420  ? 52.774  -12.187 54.366  1.00 127.35 ? 417  PRO A O   1 
ATOM 3250  C CB  . PRO A 1 420  ? 54.303  -13.057 51.770  1.00 126.71 ? 417  PRO A CB  1 
ATOM 3251  C CG  . PRO A 1 420  ? 55.342  -12.846 50.730  1.00 126.52 ? 417  PRO A CG  1 
ATOM 3252  C CD  . PRO A 1 420  ? 56.266  -11.821 51.298  1.00 126.40 ? 417  PRO A CD  1 
ATOM 3253  N N   . ASN A 1 421  ? 54.946  -11.679 54.753  1.00 127.72 ? 418  ASN A N   1 
ATOM 3254  C CA  . ASN A 1 421  ? 54.863  -11.808 56.211  1.00 128.11 ? 418  ASN A CA  1 
ATOM 3255  C C   . ASN A 1 421  ? 54.125  -10.650 56.880  1.00 128.39 ? 418  ASN A C   1 
ATOM 3256  O O   . ASN A 1 421  ? 53.010  -10.828 57.376  1.00 128.43 ? 418  ASN A O   1 
ATOM 3257  C CB  . ASN A 1 421  ? 56.256  -11.983 56.831  1.00 128.10 ? 418  ASN A CB  1 
ATOM 3258  C CG  . ASN A 1 421  ? 56.899  -13.312 56.471  1.00 128.23 ? 418  ASN A CG  1 
ATOM 3259  O OD1 . ASN A 1 421  ? 56.217  -14.278 56.112  1.00 128.33 ? 418  ASN A OD1 1 
ATOM 3260  N ND2 . ASN A 1 421  ? 58.223  -13.367 56.572  1.00 128.45 ? 418  ASN A ND2 1 
ATOM 3261  N N   . ARG A 1 422  ? 54.747  -9.471  56.886  1.00 128.74 ? 419  ARG A N   1 
ATOM 3262  C CA  . ARG A 1 422  ? 54.175  -8.295  57.549  1.00 129.06 ? 419  ARG A CA  1 
ATOM 3263  C C   . ARG A 1 422  ? 52.959  -7.730  56.808  1.00 129.31 ? 419  ARG A C   1 
ATOM 3264  O O   . ARG A 1 422  ? 52.991  -7.535  55.587  1.00 129.28 ? 419  ARG A O   1 
ATOM 3265  C CB  . ARG A 1 422  ? 55.234  -7.203  57.799  1.00 129.02 ? 419  ARG A CB  1 
ATOM 3266  C CG  . ARG A 1 422  ? 56.109  -6.835  56.597  1.00 128.89 ? 419  ARG A CG  1 
ATOM 3267  C CD  . ARG A 1 422  ? 56.658  -5.410  56.702  1.00 128.62 ? 419  ARG A CD  1 
ATOM 3268  N NE  . ARG A 1 422  ? 57.619  -5.232  57.793  1.00 128.33 ? 419  ARG A NE  1 
ATOM 3269  C CZ  . ARG A 1 422  ? 58.233  -4.085  58.081  1.00 127.99 ? 419  ARG A CZ  1 
ATOM 3270  N NH1 . ARG A 1 422  ? 57.995  -2.994  57.363  1.00 127.87 ? 419  ARG A NH1 1 
ATOM 3271  N NH2 . ARG A 1 422  ? 59.089  -4.028  59.090  1.00 127.59 ? 419  ARG A NH2 1 
ATOM 3272  N N   . GLU A 1 423  ? 51.887  -7.495  57.566  1.00 129.64 ? 420  GLU A N   1 
ATOM 3273  C CA  . GLU A 1 423  ? 50.673  -6.857  57.053  1.00 129.92 ? 420  GLU A CA  1 
ATOM 3274  C C   . GLU A 1 423  ? 50.775  -5.334  57.155  1.00 130.12 ? 420  GLU A C   1 
ATOM 3275  O O   . GLU A 1 423  ? 49.851  -4.612  56.772  1.00 130.06 ? 420  GLU A O   1 
ATOM 3276  C CB  . GLU A 1 423  ? 49.432  -7.363  57.796  1.00 129.89 ? 420  GLU A CB  1 
ATOM 3277  C CG  . GLU A 1 423  ? 49.095  -8.823  57.535  1.00 129.74 ? 420  GLU A CG  1 
ATOM 3278  C CD  . GLU A 1 423  ? 47.755  -9.214  58.115  1.00 129.60 ? 420  GLU A CD  1 
ATOM 3279  O OE1 . GLU A 1 423  ? 46.720  -8.848  57.521  1.00 129.48 ? 420  GLU A OE1 1 
ATOM 3280  O OE2 . GLU A 1 423  ? 47.737  -9.891  59.165  1.00 129.59 ? 420  GLU A OE2 1 
ATOM 3281  N N   . THR A 1 424  ? 51.906  -4.862  57.680  1.00 130.44 ? 421  THR A N   1 
ATOM 3282  C CA  . THR A 1 424  ? 52.245  -3.442  57.671  1.00 130.73 ? 421  THR A CA  1 
ATOM 3283  C C   . THR A 1 424  ? 52.750  -3.045  56.279  1.00 130.97 ? 421  THR A C   1 
ATOM 3284  O O   . THR A 1 424  ? 53.959  -2.916  56.052  1.00 130.99 ? 421  THR A O   1 
ATOM 3285  C CB  . THR A 1 424  ? 53.285  -3.075  58.766  1.00 130.69 ? 421  THR A CB  1 
ATOM 3286  O OG1 . THR A 1 424  ? 54.468  -3.866  58.604  1.00 130.64 ? 421  THR A OG1 1 
ATOM 3287  C CG2 . THR A 1 424  ? 52.708  -3.289  60.165  1.00 130.67 ? 421  THR A CG2 1 
ATOM 3288  N N   . TYR A 1 425  ? 51.796  -2.867  55.364  1.00 131.26 ? 422  TYR A N   1 
ATOM 3289  C CA  . TYR A 1 425  ? 52.028  -2.546  53.947  1.00 131.57 ? 422  TYR A CA  1 
ATOM 3290  C C   . TYR A 1 425  ? 53.213  -1.595  53.715  1.00 131.73 ? 422  TYR A C   1 
ATOM 3291  O O   . TYR A 1 425  ? 53.086  -0.378  53.877  1.00 131.74 ? 422  TYR A O   1 
ATOM 3292  C CB  . TYR A 1 425  ? 50.751  -1.952  53.320  1.00 131.65 ? 422  TYR A CB  1 
ATOM 3293  C CG  . TYR A 1 425  ? 49.443  -2.577  53.780  1.00 131.77 ? 422  TYR A CG  1 
ATOM 3294  C CD1 . TYR A 1 425  ? 48.834  -2.171  54.969  1.00 131.81 ? 422  TYR A CD1 1 
ATOM 3295  C CD2 . TYR A 1 425  ? 48.803  -3.552  53.016  1.00 131.99 ? 422  TYR A CD2 1 
ATOM 3296  C CE1 . TYR A 1 425  ? 47.634  -2.732  55.399  1.00 131.79 ? 422  TYR A CE1 1 
ATOM 3297  C CE2 . TYR A 1 425  ? 47.594  -4.119  53.438  1.00 132.10 ? 422  TYR A CE2 1 
ATOM 3298  C CZ  . TYR A 1 425  ? 47.020  -3.702  54.633  1.00 131.89 ? 422  TYR A CZ  1 
ATOM 3299  O OH  . TYR A 1 425  ? 45.832  -4.249  55.065  1.00 131.79 ? 422  TYR A OH  1 
ATOM 3300  N N   . ASP A 1 426  ? 54.356  -2.156  53.325  1.00 131.94 ? 423  ASP A N   1 
ATOM 3301  C CA  . ASP A 1 426  ? 55.600  -1.382  53.194  1.00 132.11 ? 423  ASP A CA  1 
ATOM 3302  C C   . ASP A 1 426  ? 55.867  -0.829  51.784  1.00 132.22 ? 423  ASP A C   1 
ATOM 3303  O O   . ASP A 1 426  ? 56.996  -0.435  51.468  1.00 132.25 ? 423  ASP A O   1 
ATOM 3304  C CB  . ASP A 1 426  ? 56.807  -2.194  53.706  1.00 132.14 ? 423  ASP A CB  1 
ATOM 3305  C CG  . ASP A 1 426  ? 57.060  -3.468  52.899  1.00 132.01 ? 423  ASP A CG  1 
ATOM 3306  O OD1 . ASP A 1 426  ? 57.224  -3.383  51.663  1.00 131.79 ? 423  ASP A OD1 1 
ATOM 3307  O OD2 . ASP A 1 426  ? 57.117  -4.556  53.511  1.00 131.80 ? 423  ASP A OD2 1 
ATOM 3308  N N   . THR A 1 427  ? 54.831  -0.805  50.944  1.00 132.31 ? 424  THR A N   1 
ATOM 3309  C CA  . THR A 1 427  ? 54.943  -0.299  49.570  1.00 132.36 ? 424  THR A CA  1 
ATOM 3310  C C   . THR A 1 427  ? 53.616  0.303   49.087  1.00 132.38 ? 424  THR A C   1 
ATOM 3311  O O   . THR A 1 427  ? 52.549  -0.025  49.613  1.00 132.34 ? 424  THR A O   1 
ATOM 3312  C CB  . THR A 1 427  ? 55.411  -1.411  48.589  1.00 132.38 ? 424  THR A CB  1 
ATOM 3313  O OG1 . THR A 1 427  ? 56.425  -2.216  49.207  1.00 132.33 ? 424  THR A OG1 1 
ATOM 3314  C CG2 . THR A 1 427  ? 55.969  -0.806  47.302  1.00 132.41 ? 424  THR A CG2 1 
ATOM 3315  N N   . LEU A 1 428  ? 53.693  1.197   48.101  1.00 132.41 ? 425  LEU A N   1 
ATOM 3316  C CA  . LEU A 1 428  ? 52.504  1.776   47.470  1.00 132.47 ? 425  LEU A CA  1 
ATOM 3317  C C   . LEU A 1 428  ? 52.786  2.225   46.038  1.00 132.49 ? 425  LEU A C   1 
ATOM 3318  O O   . LEU A 1 428  ? 53.728  2.983   45.794  1.00 132.47 ? 425  LEU A O   1 
ATOM 3319  C CB  . LEU A 1 428  ? 51.980  2.964   48.279  1.00 132.48 ? 425  LEU A CB  1 
ATOM 3320  C CG  . LEU A 1 428  ? 50.593  3.476   47.884  1.00 132.55 ? 425  LEU A CG  1 
ATOM 3321  C CD1 . LEU A 1 428  ? 49.528  2.768   48.701  1.00 132.72 ? 425  LEU A CD1 1 
ATOM 3322  C CD2 . LEU A 1 428  ? 50.494  4.986   48.067  1.00 132.57 ? 425  LEU A CD2 1 
ATOM 3323  N N   . VAL A 1 429  ? 51.959  1.763   45.101  1.00 132.49 ? 426  VAL A N   1 
ATOM 3324  C CA  . VAL A 1 429  ? 52.086  2.146   43.690  1.00 132.42 ? 426  VAL A CA  1 
ATOM 3325  C C   . VAL A 1 429  ? 50.971  3.106   43.289  1.00 132.40 ? 426  VAL A C   1 
ATOM 3326  O O   . VAL A 1 429  ? 49.787  2.841   43.531  1.00 132.34 ? 426  VAL A O   1 
ATOM 3327  C CB  . VAL A 1 429  ? 52.115  0.912   42.744  1.00 132.40 ? 426  VAL A CB  1 
ATOM 3328  C CG1 . VAL A 1 429  ? 51.972  1.330   41.280  1.00 132.17 ? 426  VAL A CG1 1 
ATOM 3329  C CG2 . VAL A 1 429  ? 53.399  0.120   42.940  1.00 132.46 ? 426  VAL A CG2 1 
ATOM 3330  N N   . LEU A 1 430  ? 51.368  4.223   42.684  1.00 132.38 ? 427  LEU A N   1 
ATOM 3331  C CA  . LEU A 1 430  ? 50.422  5.223   42.201  1.00 132.36 ? 427  LEU A CA  1 
ATOM 3332  C C   . LEU A 1 430  ? 50.341  5.278   40.674  1.00 132.37 ? 427  LEU A C   1 
ATOM 3333  O O   . LEU A 1 430  ? 51.299  4.940   39.974  1.00 132.47 ? 427  LEU A O   1 
ATOM 3334  C CB  . LEU A 1 430  ? 50.737  6.615   42.781  1.00 132.33 ? 427  LEU A CB  1 
ATOM 3335  C CG  . LEU A 1 430  ? 52.075  7.342   42.584  1.00 132.16 ? 427  LEU A CG  1 
ATOM 3336  C CD1 . LEU A 1 430  ? 52.339  7.724   41.133  1.00 131.93 ? 427  LEU A CD1 1 
ATOM 3337  C CD2 . LEU A 1 430  ? 52.092  8.589   43.450  1.00 132.28 ? 427  LEU A CD2 1 
ATOM 3338  N N   . SER A 1 431  ? 49.184  5.699   40.172  1.00 132.29 ? 428  SER A N   1 
ATOM 3339  C CA  . SER A 1 431  ? 49.010  5.998   38.762  1.00 132.16 ? 428  SER A CA  1 
ATOM 3340  C C   . SER A 1 431  ? 49.413  7.451   38.528  1.00 132.08 ? 428  SER A C   1 
ATOM 3341  O O   . SER A 1 431  ? 48.962  8.347   39.237  1.00 132.18 ? 428  SER A O   1 
ATOM 3342  C CB  . SER A 1 431  ? 47.556  5.770   38.356  1.00 132.17 ? 428  SER A CB  1 
ATOM 3343  O OG  . SER A 1 431  ? 47.352  6.096   36.994  1.00 132.38 ? 428  SER A OG  1 
ATOM 3344  N N   . PHE A 1 432  ? 50.273  7.676   37.541  1.00 131.98 ? 429  PHE A N   1 
ATOM 3345  C CA  . PHE A 1 432  ? 50.792  9.011   37.235  1.00 131.94 ? 429  PHE A CA  1 
ATOM 3346  C C   . PHE A 1 432  ? 50.221  9.479   35.885  1.00 131.92 ? 429  PHE A C   1 
ATOM 3347  O O   . PHE A 1 432  ? 49.444  8.752   35.256  1.00 131.90 ? 429  PHE A O   1 
ATOM 3348  C CB  . PHE A 1 432  ? 52.325  8.953   37.205  1.00 132.01 ? 429  PHE A CB  1 
ATOM 3349  C CG  . PHE A 1 432  ? 53.014  10.194  37.721  1.00 131.89 ? 429  PHE A CG  1 
ATOM 3350  C CD1 . PHE A 1 432  ? 53.620  11.086  36.839  1.00 131.91 ? 429  PHE A CD1 1 
ATOM 3351  C CD2 . PHE A 1 432  ? 53.099  10.446  39.086  1.00 131.75 ? 429  PHE A CD2 1 
ATOM 3352  C CE1 . PHE A 1 432  ? 54.279  12.223  37.306  1.00 131.78 ? 429  PHE A CE1 1 
ATOM 3353  C CE2 . PHE A 1 432  ? 53.754  11.581  39.563  1.00 131.78 ? 429  PHE A CE2 1 
ATOM 3354  C CZ  . PHE A 1 432  ? 54.345  12.470  38.670  1.00 131.79 ? 429  PHE A CZ  1 
ATOM 3355  N N   . VAL A 1 433  ? 50.607  10.679  35.444  1.00 131.85 ? 430  VAL A N   1 
ATOM 3356  C CA  . VAL A 1 433  ? 50.105  11.271  34.187  1.00 131.75 ? 430  VAL A CA  1 
ATOM 3357  C C   . VAL A 1 433  ? 50.543  10.473  32.946  1.00 131.64 ? 430  VAL A C   1 
ATOM 3358  O O   . VAL A 1 433  ? 51.440  10.890  32.208  1.00 131.56 ? 430  VAL A O   1 
ATOM 3359  C CB  . VAL A 1 433  ? 50.542  12.763  34.014  1.00 131.78 ? 430  VAL A CB  1 
ATOM 3360  C CG1 . VAL A 1 433  ? 49.574  13.507  33.099  1.00 131.66 ? 430  VAL A CG1 1 
ATOM 3361  C CG2 . VAL A 1 433  ? 50.648  13.475  35.351  1.00 131.70 ? 430  VAL A CG2 1 
ATOM 3362  N N   . GLY A 1 434  ? 49.903  9.329   32.722  1.00 131.53 ? 431  GLY A N   1 
ATOM 3363  C CA  . GLY A 1 434  ? 50.278  8.437   31.624  1.00 131.59 ? 431  GLY A CA  1 
ATOM 3364  C C   . GLY A 1 434  ? 51.543  7.636   31.900  1.00 131.61 ? 431  GLY A C   1 
ATOM 3365  O O   . GLY A 1 434  ? 52.080  6.975   31.004  1.00 131.55 ? 431  GLY A O   1 
ATOM 3366  N N   . GLN A 1 435  ? 52.013  7.699   33.145  1.00 131.59 ? 432  GLN A N   1 
ATOM 3367  C CA  . GLN A 1 435  ? 53.225  7.008   33.583  1.00 131.53 ? 432  GLN A CA  1 
ATOM 3368  C C   . GLN A 1 435  ? 52.914  6.181   34.837  1.00 131.50 ? 432  GLN A C   1 
ATOM 3369  O O   . GLN A 1 435  ? 51.756  6.085   35.250  1.00 131.55 ? 432  GLN A O   1 
ATOM 3370  C CB  . GLN A 1 435  ? 54.337  8.029   33.861  1.00 131.53 ? 432  GLN A CB  1 
ATOM 3371  C CG  . GLN A 1 435  ? 55.751  7.532   33.565  1.00 131.50 ? 432  GLN A CG  1 
ATOM 3372  C CD  . GLN A 1 435  ? 56.838  8.542   33.914  1.00 131.46 ? 432  GLN A CD  1 
ATOM 3373  O OE1 . GLN A 1 435  ? 56.644  9.432   34.747  1.00 131.34 ? 432  GLN A OE1 1 
ATOM 3374  N NE2 . GLN A 1 435  ? 57.996  8.398   33.279  1.00 131.04 ? 432  GLN A NE2 1 
ATOM 3375  N N   . THR A 1 436  ? 53.941  5.564   35.419  1.00 131.47 ? 433  THR A N   1 
ATOM 3376  C CA  . THR A 1 436  ? 53.825  4.866   36.703  1.00 131.44 ? 433  THR A CA  1 
ATOM 3377  C C   . THR A 1 436  ? 55.161  4.955   37.452  1.00 131.59 ? 433  THR A C   1 
ATOM 3378  O O   . THR A 1 436  ? 56.202  4.550   36.924  1.00 131.68 ? 433  THR A O   1 
ATOM 3379  C CB  . THR A 1 436  ? 53.410  3.373   36.532  1.00 131.37 ? 433  THR A CB  1 
ATOM 3380  O OG1 . THR A 1 436  ? 52.266  3.273   35.675  1.00 131.07 ? 433  THR A OG1 1 
ATOM 3381  C CG2 . THR A 1 436  ? 53.078  2.740   37.879  1.00 131.18 ? 433  THR A CG2 1 
ATOM 3382  N N   . ARG A 1 437  ? 55.134  5.497   38.670  1.00 131.63 ? 434  ARG A N   1 
ATOM 3383  C CA  . ARG A 1 437  ? 56.325  5.519   39.526  1.00 131.62 ? 434  ARG A CA  1 
ATOM 3384  C C   . ARG A 1 437  ? 56.135  4.731   40.816  1.00 131.63 ? 434  ARG A C   1 
ATOM 3385  O O   . ARG A 1 437  ? 55.085  4.803   41.456  1.00 131.59 ? 434  ARG A O   1 
ATOM 3386  C CB  . ARG A 1 437  ? 56.783  6.952   39.825  1.00 131.58 ? 434  ARG A CB  1 
ATOM 3387  C CG  . ARG A 1 437  ? 57.875  7.468   38.887  1.00 131.60 ? 434  ARG A CG  1 
ATOM 3388  C CD  . ARG A 1 437  ? 59.198  6.704   39.082  1.00 131.58 ? 434  ARG A CD  1 
ATOM 3389  N NE  . ARG A 1 437  ? 60.263  7.046   38.127  1.00 131.39 ? 434  ARG A NE  1 
ATOM 3390  C CZ  . ARG A 1 437  ? 60.125  7.188   36.806  1.00 131.16 ? 434  ARG A CZ  1 
ATOM 3391  N NH1 . ARG A 1 437  ? 58.952  7.012   36.209  1.00 131.04 ? 434  ARG A NH1 1 
ATOM 3392  N NH2 . ARG A 1 437  ? 61.183  7.500   36.071  1.00 131.00 ? 434  ARG A NH2 1 
ATOM 3393  N N   . VAL A 1 438  ? 57.167  3.972   41.175  1.00 131.71 ? 435  VAL A N   1 
ATOM 3394  C CA  . VAL A 1 438  ? 57.151  3.125   42.364  1.00 131.85 ? 435  VAL A CA  1 
ATOM 3395  C C   . VAL A 1 438  ? 57.335  3.981   43.618  1.00 131.90 ? 435  VAL A C   1 
ATOM 3396  O O   . VAL A 1 438  ? 58.064  4.977   43.600  1.00 131.91 ? 435  VAL A O   1 
ATOM 3397  C CB  . VAL A 1 438  ? 58.262  2.036   42.302  1.00 131.89 ? 435  VAL A CB  1 
ATOM 3398  C CG1 . VAL A 1 438  ? 58.100  1.013   43.429  1.00 131.97 ? 435  VAL A CG1 1 
ATOM 3399  C CG2 . VAL A 1 438  ? 58.260  1.332   40.946  1.00 131.97 ? 435  VAL A CG2 1 
ATOM 3400  N N   . LEU A 1 439  ? 56.650  3.597   44.694  1.00 131.92 ? 436  LEU A N   1 
ATOM 3401  C CA  . LEU A 1 439  ? 56.872  4.194   46.004  1.00 131.92 ? 436  LEU A CA  1 
ATOM 3402  C C   . LEU A 1 439  ? 57.004  3.118   47.079  1.00 131.97 ? 436  LEU A C   1 
ATOM 3403  O O   . LEU A 1 439  ? 56.010  2.645   47.642  1.00 131.87 ? 436  LEU A O   1 
ATOM 3404  C CB  . LEU A 1 439  ? 55.777  5.211   46.352  1.00 131.87 ? 436  LEU A CB  1 
ATOM 3405  C CG  . LEU A 1 439  ? 55.726  6.528   45.567  1.00 131.83 ? 436  LEU A CG  1 
ATOM 3406  C CD1 . LEU A 1 439  ? 54.509  7.335   45.985  1.00 131.82 ? 436  LEU A CD1 1 
ATOM 3407  C CD2 . LEU A 1 439  ? 57.005  7.360   45.717  1.00 131.54 ? 436  LEU A CD2 1 
ATOM 3408  N N   . MET A 1 440  ? 58.251  2.722   47.327  1.00 132.05 ? 437  MET A N   1 
ATOM 3409  C CA  . MET A 1 440  ? 58.585  1.777   48.384  1.00 132.13 ? 437  MET A CA  1 
ATOM 3410  C C   . MET A 1 440  ? 59.086  2.566   49.583  1.00 132.05 ? 437  MET A C   1 
ATOM 3411  O O   . MET A 1 440  ? 59.712  3.614   49.422  1.00 132.03 ? 437  MET A O   1 
ATOM 3412  C CB  . MET A 1 440  ? 59.650  0.794   47.904  1.00 132.13 ? 437  MET A CB  1 
ATOM 3413  C CG  . MET A 1 440  ? 59.564  -0.577  48.559  1.00 132.27 ? 437  MET A CG  1 
ATOM 3414  S SD  . MET A 1 440  ? 60.305  -1.890  47.564  1.00 132.35 ? 437  MET A SD  1 
ATOM 3415  C CE  . MET A 1 440  ? 59.335  -1.791  46.058  1.00 132.00 ? 437  MET A CE  1 
ATOM 3416  N N   . LEU A 1 441  ? 58.804  2.068   50.782  1.00 132.02 ? 438  LEU A N   1 
ATOM 3417  C CA  . LEU A 1 441  ? 59.142  2.801   51.996  1.00 132.00 ? 438  LEU A CA  1 
ATOM 3418  C C   . LEU A 1 441  ? 60.243  2.137   52.815  1.00 132.09 ? 438  LEU A C   1 
ATOM 3419  O O   . LEU A 1 441  ? 60.122  0.979   53.226  1.00 132.11 ? 438  LEU A O   1 
ATOM 3420  C CB  . LEU A 1 441  ? 57.894  3.047   52.858  1.00 131.92 ? 438  LEU A CB  1 
ATOM 3421  C CG  . LEU A 1 441  ? 56.804  3.976   52.302  1.00 131.71 ? 438  LEU A CG  1 
ATOM 3422  C CD1 . LEU A 1 441  ? 55.510  3.816   53.083  1.00 131.53 ? 438  LEU A CD1 1 
ATOM 3423  C CD2 . LEU A 1 441  ? 57.236  5.439   52.282  1.00 131.30 ? 438  LEU A CD2 1 
ATOM 3424  N N   . ASN A 1 442  ? 61.324  2.887   53.028  1.00 132.14 ? 439  ASN A N   1 
ATOM 3425  C CA  . ASN A 1 442  ? 62.350  2.542   54.006  1.00 132.18 ? 439  ASN A CA  1 
ATOM 3426  C C   . ASN A 1 442  ? 61.781  2.742   55.414  1.00 132.23 ? 439  ASN A C   1 
ATOM 3427  O O   . ASN A 1 442  ? 62.447  2.475   56.417  1.00 132.22 ? 439  ASN A O   1 
ATOM 3428  C CB  . ASN A 1 442  ? 63.589  3.421   53.786  1.00 132.19 ? 439  ASN A CB  1 
ATOM 3429  C CG  . ASN A 1 442  ? 64.806  2.943   54.568  1.00 132.26 ? 439  ASN A CG  1 
ATOM 3430  O OD1 . ASN A 1 442  ? 65.194  1.775   54.496  1.00 132.30 ? 439  ASN A OD1 1 
ATOM 3431  N ND2 . ASN A 1 442  ? 65.426  3.857   55.307  1.00 132.24 ? 439  ASN A ND2 1 
ATOM 3432  N N   . GLY A 1 443  ? 60.532  3.205   55.463  1.00 132.32 ? 440  GLY A N   1 
ATOM 3433  C CA  . GLY A 1 443  ? 59.820  3.496   56.702  1.00 132.44 ? 440  GLY A CA  1 
ATOM 3434  C C   . GLY A 1 443  ? 58.985  4.749   56.530  1.00 132.50 ? 440  GLY A C   1 
ATOM 3435  O O   . GLY A 1 443  ? 57.838  4.685   56.085  1.00 132.41 ? 440  GLY A O   1 
ATOM 3436  N N   . GLU A 1 444  ? 59.576  5.888   56.888  1.00 132.63 ? 441  GLU A N   1 
ATOM 3437  C CA  . GLU A 1 444  ? 58.978  7.203   56.665  1.00 132.79 ? 441  GLU A CA  1 
ATOM 3438  C C   . GLU A 1 444  ? 59.711  7.947   55.546  1.00 132.86 ? 441  GLU A C   1 
ATOM 3439  O O   . GLU A 1 444  ? 59.486  9.142   55.334  1.00 132.86 ? 441  GLU A O   1 
ATOM 3440  C CB  . GLU A 1 444  ? 59.006  8.036   57.949  1.00 132.76 ? 441  GLU A CB  1 
ATOM 3441  C CG  . GLU A 1 444  ? 57.974  7.639   58.999  1.00 132.82 ? 441  GLU A CG  1 
ATOM 3442  C CD  . GLU A 1 444  ? 58.115  8.425   60.300  1.00 132.94 ? 441  GLU A CD  1 
ATOM 3443  O OE1 . GLU A 1 444  ? 57.087  8.656   60.974  1.00 132.99 ? 441  GLU A OE1 1 
ATOM 3444  O OE2 . GLU A 1 444  ? 59.251  8.814   60.654  1.00 133.34 ? 441  GLU A OE2 1 
ATOM 3445  N N   . GLU A 1 445  ? 60.589  7.233   54.841  1.00 133.00 ? 442  GLU A N   1 
ATOM 3446  C CA  . GLU A 1 445  ? 61.336  7.796   53.712  1.00 133.13 ? 442  GLU A CA  1 
ATOM 3447  C C   . GLU A 1 445  ? 60.655  7.502   52.373  1.00 133.25 ? 442  GLU A C   1 
ATOM 3448  O O   . GLU A 1 445  ? 60.396  6.341   52.036  1.00 133.26 ? 442  GLU A O   1 
ATOM 3449  C CB  . GLU A 1 445  ? 62.782  7.283   53.692  1.00 133.10 ? 442  GLU A CB  1 
ATOM 3450  C CG  . GLU A 1 445  ? 63.657  7.799   54.829  1.00 133.00 ? 442  GLU A CG  1 
ATOM 3451  C CD  . GLU A 1 445  ? 65.136  7.795   54.483  1.00 132.77 ? 442  GLU A CD  1 
ATOM 3452  O OE1 . GLU A 1 445  ? 65.532  8.517   53.542  1.00 132.63 ? 442  GLU A OE1 1 
ATOM 3453  O OE2 . GLU A 1 445  ? 65.904  7.080   55.160  1.00 132.63 ? 442  GLU A OE2 1 
ATOM 3454  N N   . VAL A 1 446  ? 60.375  8.565   51.618  1.00 133.38 ? 443  VAL A N   1 
ATOM 3455  C CA  . VAL A 1 446  ? 59.730  8.471   50.303  1.00 133.43 ? 443  VAL A CA  1 
ATOM 3456  C C   . VAL A 1 446  ? 60.755  8.149   49.210  1.00 133.46 ? 443  VAL A C   1 
ATOM 3457  O O   . VAL A 1 446  ? 61.650  8.951   48.919  1.00 133.49 ? 443  VAL A O   1 
ATOM 3458  C CB  . VAL A 1 446  ? 58.941  9.761   49.965  1.00 133.41 ? 443  VAL A CB  1 
ATOM 3459  C CG1 . VAL A 1 446  ? 58.410  9.727   48.532  1.00 133.45 ? 443  VAL A CG1 1 
ATOM 3460  C CG2 . VAL A 1 446  ? 57.803  9.948   50.956  1.00 133.41 ? 443  VAL A CG2 1 
ATOM 3461  N N   . GLU A 1 447  ? 60.601  6.973   48.608  1.00 133.43 ? 444  GLU A N   1 
ATOM 3462  C CA  . GLU A 1 447  ? 61.617  6.410   47.727  1.00 133.39 ? 444  GLU A CA  1 
ATOM 3463  C C   . GLU A 1 447  ? 61.022  6.012   46.382  1.00 133.26 ? 444  GLU A C   1 
ATOM 3464  O O   . GLU A 1 447  ? 60.155  5.138   46.313  1.00 133.26 ? 444  GLU A O   1 
ATOM 3465  C CB  . GLU A 1 447  ? 62.265  5.199   48.410  1.00 133.44 ? 444  GLU A CB  1 
ATOM 3466  C CG  . GLU A 1 447  ? 63.600  4.747   47.831  1.00 133.59 ? 444  GLU A CG  1 
ATOM 3467  C CD  . GLU A 1 447  ? 64.346  3.790   48.752  1.00 133.56 ? 444  GLU A CD  1 
ATOM 3468  O OE1 . GLU A 1 447  ? 64.901  2.791   48.245  1.00 133.81 ? 444  GLU A OE1 1 
ATOM 3469  O OE2 . GLU A 1 447  ? 64.380  4.036   49.981  1.00 133.73 ? 444  GLU A OE2 1 
ATOM 3470  N N   . GLU A 1 448  ? 61.492  6.665   45.320  1.00 133.11 ? 445  GLU A N   1 
ATOM 3471  C CA  . GLU A 1 448  ? 61.058  6.345   43.958  1.00 132.96 ? 445  GLU A CA  1 
ATOM 3472  C C   . GLU A 1 448  ? 62.151  5.644   43.129  1.00 132.84 ? 445  GLU A C   1 
ATOM 3473  O O   . GLU A 1 448  ? 63.110  6.273   42.671  1.00 132.83 ? 445  GLU A O   1 
ATOM 3474  C CB  . GLU A 1 448  ? 60.463  7.578   43.245  1.00 132.96 ? 445  GLU A CB  1 
ATOM 3475  C CG  . GLU A 1 448  ? 61.351  8.825   43.196  1.00 132.82 ? 445  GLU A CG  1 
ATOM 3476  C CD  . GLU A 1 448  ? 62.093  8.975   41.876  1.00 132.64 ? 445  GLU A CD  1 
ATOM 3477  O OE1 . GLU A 1 448  ? 61.438  8.939   40.811  1.00 132.36 ? 445  GLU A OE1 1 
ATOM 3478  O OE2 . GLU A 1 448  ? 63.331  9.140   41.906  1.00 132.64 ? 445  GLU A OE2 1 
ATOM 3479  N N   . THR A 1 449  ? 62.001  4.331   42.968  1.00 132.67 ? 446  THR A N   1 
ATOM 3480  C CA  . THR A 1 449  ? 62.926  3.526   42.167  1.00 132.46 ? 446  THR A CA  1 
ATOM 3481  C C   . THR A 1 449  ? 62.168  2.787   41.061  1.00 132.31 ? 446  THR A C   1 
ATOM 3482  O O   . THR A 1 449  ? 61.093  3.224   40.637  1.00 132.26 ? 446  THR A O   1 
ATOM 3483  C CB  . THR A 1 449  ? 63.739  2.518   43.041  1.00 132.48 ? 446  THR A CB  1 
ATOM 3484  O OG1 . THR A 1 449  ? 62.859  1.826   43.937  1.00 132.48 ? 446  THR A OG1 1 
ATOM 3485  C CG2 . THR A 1 449  ? 64.825  3.230   43.845  1.00 132.30 ? 446  THR A CG2 1 
ATOM 3486  N N   . GLU A 1 450  ? 62.744  1.683   40.589  1.00 132.14 ? 447  GLU A N   1 
ATOM 3487  C CA  . GLU A 1 450  ? 62.084  0.793   39.635  1.00 131.97 ? 447  GLU A CA  1 
ATOM 3488  C C   . GLU A 1 450  ? 61.737  -0.538  40.306  1.00 131.82 ? 447  GLU A C   1 
ATOM 3489  O O   . GLU A 1 450  ? 62.429  -0.970  41.235  1.00 131.83 ? 447  GLU A O   1 
ATOM 3490  C CB  . GLU A 1 450  ? 62.970  0.554   38.399  1.00 132.02 ? 447  GLU A CB  1 
ATOM 3491  C CG  . GLU A 1 450  ? 64.360  -0.039  38.695  1.00 131.91 ? 447  GLU A CG  1 
ATOM 3492  C CD  . GLU A 1 450  ? 65.001  -0.728  37.493  1.00 131.90 ? 447  GLU A CD  1 
ATOM 3493  O OE1 . GLU A 1 450  ? 64.283  -1.063  36.524  1.00 131.86 ? 447  GLU A OE1 1 
ATOM 3494  O OE2 . GLU A 1 450  ? 66.232  -0.943  37.526  1.00 131.69 ? 447  GLU A OE2 1 
ATOM 3495  N N   . LEU A 1 451  ? 60.663  -1.179  39.848  1.00 131.54 ? 448  LEU A N   1 
ATOM 3496  C CA  . LEU A 1 451  ? 60.356  -2.535  40.298  1.00 131.24 ? 448  LEU A CA  1 
ATOM 3497  C C   . LEU A 1 451  ? 60.174  -3.490  39.117  1.00 131.09 ? 448  LEU A C   1 
ATOM 3498  O O   . LEU A 1 451  ? 59.422  -3.203  38.179  1.00 131.04 ? 448  LEU A O   1 
ATOM 3499  C CB  . LEU A 1 451  ? 59.150  -2.564  41.248  1.00 131.19 ? 448  LEU A CB  1 
ATOM 3500  C CG  . LEU A 1 451  ? 59.066  -3.782  42.180  1.00 131.01 ? 448  LEU A CG  1 
ATOM 3501  C CD1 . LEU A 1 451  ? 60.278  -3.881  43.106  1.00 130.68 ? 448  LEU A CD1 1 
ATOM 3502  C CD2 . LEU A 1 451  ? 57.782  -3.764  42.987  1.00 131.10 ? 448  LEU A CD2 1 
ATOM 3503  N N   . MET A 1 452  ? 60.884  -4.618  39.185  1.00 130.85 ? 449  MET A N   1 
ATOM 3504  C CA  . MET A 1 452  ? 60.938  -5.615  38.110  1.00 130.60 ? 449  MET A CA  1 
ATOM 3505  C C   . MET A 1 452  ? 59.568  -6.241  37.842  1.00 130.33 ? 449  MET A C   1 
ATOM 3506  O O   . MET A 1 452  ? 58.874  -6.658  38.774  1.00 130.37 ? 449  MET A O   1 
ATOM 3507  C CB  . MET A 1 452  ? 61.964  -6.712  38.442  1.00 130.62 ? 449  MET A CB  1 
ATOM 3508  C CG  . MET A 1 452  ? 63.290  -6.213  39.033  1.00 130.66 ? 449  MET A CG  1 
ATOM 3509  S SD  . MET A 1 452  ? 64.628  -5.953  37.843  1.00 130.68 ? 449  MET A SD  1 
ATOM 3510  C CE  . MET A 1 452  ? 64.166  -4.397  37.084  1.00 130.63 ? 449  MET A CE  1 
ATOM 3511  N N   . GLY A 1 453  ? 59.187  -6.293  36.567  1.00 129.95 ? 450  GLY A N   1 
ATOM 3512  C CA  . GLY A 1 453  ? 57.890  -6.834  36.158  1.00 129.39 ? 450  GLY A CA  1 
ATOM 3513  C C   . GLY A 1 453  ? 56.755  -5.825  36.236  1.00 129.00 ? 450  GLY A C   1 
ATOM 3514  O O   . GLY A 1 453  ? 55.580  -6.186  36.119  1.00 129.05 ? 450  GLY A O   1 
ATOM 3515  N N   . PHE A 1 454  ? 57.113  -4.561  36.446  1.00 128.50 ? 451  PHE A N   1 
ATOM 3516  C CA  . PHE A 1 454  ? 56.164  -3.456  36.446  1.00 127.95 ? 451  PHE A CA  1 
ATOM 3517  C C   . PHE A 1 454  ? 56.609  -2.424  35.418  1.00 127.52 ? 451  PHE A C   1 
ATOM 3518  O O   . PHE A 1 454  ? 57.752  -1.966  35.454  1.00 127.47 ? 451  PHE A O   1 
ATOM 3519  C CB  . PHE A 1 454  ? 56.086  -2.820  37.837  1.00 128.06 ? 451  PHE A CB  1 
ATOM 3520  C CG  . PHE A 1 454  ? 54.980  -3.368  38.709  1.00 128.27 ? 451  PHE A CG  1 
ATOM 3521  C CD1 . PHE A 1 454  ? 54.759  -4.741  38.823  1.00 128.35 ? 451  PHE A CD1 1 
ATOM 3522  C CD2 . PHE A 1 454  ? 54.172  -2.501  39.443  1.00 128.33 ? 451  PHE A CD2 1 
ATOM 3523  C CE1 . PHE A 1 454  ? 53.739  -5.241  39.636  1.00 128.39 ? 451  PHE A CE1 1 
ATOM 3524  C CE2 . PHE A 1 454  ? 53.152  -2.991  40.261  1.00 128.25 ? 451  PHE A CE2 1 
ATOM 3525  C CZ  . PHE A 1 454  ? 52.935  -4.363  40.358  1.00 128.27 ? 451  PHE A CZ  1 
ATOM 3526  N N   . VAL A 1 455  ? 55.717  -2.077  34.493  1.00 126.99 ? 452  VAL A N   1 
ATOM 3527  C CA  . VAL A 1 455  ? 56.036  -1.091  33.452  1.00 126.45 ? 452  VAL A CA  1 
ATOM 3528  C C   . VAL A 1 455  ? 55.873  0.339   33.964  1.00 126.08 ? 452  VAL A C   1 
ATOM 3529  O O   . VAL A 1 455  ? 54.876  0.666   34.613  1.00 125.93 ? 452  VAL A O   1 
ATOM 3530  C CB  . VAL A 1 455  ? 55.235  -1.309  32.133  1.00 126.45 ? 452  VAL A CB  1 
ATOM 3531  C CG1 . VAL A 1 455  ? 55.936  -2.322  31.239  1.00 126.19 ? 452  VAL A CG1 1 
ATOM 3532  C CG2 . VAL A 1 455  ? 53.794  -1.723  32.412  1.00 126.45 ? 452  VAL A CG2 1 
ATOM 3533  N N   . ASP A 1 456  ? 56.866  1.178   33.663  1.00 125.68 ? 453  ASP A N   1 
ATOM 3534  C CA  . ASP A 1 456  ? 56.954  2.536   34.213  1.00 125.26 ? 453  ASP A CA  1 
ATOM 3535  C C   . ASP A 1 456  ? 56.835  3.661   33.172  1.00 124.74 ? 453  ASP A C   1 
ATOM 3536  O O   . ASP A 1 456  ? 57.113  4.823   33.478  1.00 124.57 ? 453  ASP A O   1 
ATOM 3537  C CB  . ASP A 1 456  ? 58.252  2.705   35.019  1.00 125.45 ? 453  ASP A CB  1 
ATOM 3538  C CG  . ASP A 1 456  ? 58.313  1.793   36.241  1.00 125.92 ? 453  ASP A CG  1 
ATOM 3539  O OD1 . ASP A 1 456  ? 58.712  0.617   36.088  1.00 126.66 ? 453  ASP A OD1 1 
ATOM 3540  O OD2 . ASP A 1 456  ? 57.984  2.258   37.355  1.00 125.98 ? 453  ASP A OD2 1 
ATOM 3541  N N   . ASP A 1 457  ? 56.428  3.312   31.951  1.00 124.16 ? 454  ASP A N   1 
ATOM 3542  C CA  . ASP A 1 457  ? 56.179  4.300   30.890  1.00 123.54 ? 454  ASP A CA  1 
ATOM 3543  C C   . ASP A 1 457  ? 54.782  4.164   30.278  1.00 123.09 ? 454  ASP A C   1 
ATOM 3544  O O   . ASP A 1 457  ? 54.423  4.893   29.352  1.00 123.07 ? 454  ASP A O   1 
ATOM 3545  C CB  . ASP A 1 457  ? 57.270  4.259   29.808  1.00 123.52 ? 454  ASP A CB  1 
ATOM 3546  C CG  . ASP A 1 457  ? 57.720  2.848   29.474  1.00 123.61 ? 454  ASP A CG  1 
ATOM 3547  O OD1 . ASP A 1 457  ? 58.949  2.626   29.399  1.00 123.71 ? 454  ASP A OD1 1 
ATOM 3548  O OD2 . ASP A 1 457  ? 56.854  1.964   29.292  1.00 123.62 ? 454  ASP A OD2 1 
ATOM 3549  N N   . GLN A 1 458  ? 54.009  3.216   30.805  1.00 122.53 ? 455  GLN A N   1 
ATOM 3550  C CA  . GLN A 1 458  ? 52.582  3.092   30.515  1.00 121.96 ? 455  GLN A CA  1 
ATOM 3551  C C   . GLN A 1 458  ? 51.793  3.661   31.701  1.00 121.46 ? 455  GLN A C   1 
ATOM 3552  O O   . GLN A 1 458  ? 52.383  4.049   32.709  1.00 121.43 ? 455  GLN A O   1 
ATOM 3553  C CB  . GLN A 1 458  ? 52.211  1.623   30.279  1.00 122.02 ? 455  GLN A CB  1 
ATOM 3554  C CG  . GLN A 1 458  ? 52.858  0.982   29.051  1.00 122.39 ? 455  GLN A CG  1 
ATOM 3555  C CD  . GLN A 1 458  ? 52.190  1.387   27.744  1.00 123.03 ? 455  GLN A CD  1 
ATOM 3556  O OE1 . GLN A 1 458  ? 52.836  1.937   26.851  1.00 123.12 ? 455  GLN A OE1 1 
ATOM 3557  N NE2 . GLN A 1 458  ? 50.892  1.117   27.627  1.00 123.26 ? 455  GLN A NE2 1 
ATOM 3558  N N   . GLN A 1 459  ? 50.468  3.711   31.585  1.00 120.81 ? 456  GLN A N   1 
ATOM 3559  C CA  . GLN A 1 459  ? 49.619  4.221   32.666  1.00 120.18 ? 456  GLN A CA  1 
ATOM 3560  C C   . GLN A 1 459  ? 48.847  3.103   33.373  1.00 119.64 ? 456  GLN A C   1 
ATOM 3561  O O   . GLN A 1 459  ? 48.015  2.435   32.756  1.00 119.72 ? 456  GLN A O   1 
ATOM 3562  C CB  . GLN A 1 459  ? 48.644  5.262   32.124  1.00 120.23 ? 456  GLN A CB  1 
ATOM 3563  C CG  . GLN A 1 459  ? 47.842  5.962   33.199  1.00 120.57 ? 456  GLN A CG  1 
ATOM 3564  C CD  . GLN A 1 459  ? 46.475  6.379   32.714  1.00 121.27 ? 456  GLN A CD  1 
ATOM 3565  O OE1 . GLN A 1 459  ? 45.462  5.845   33.163  1.00 121.54 ? 456  GLN A OE1 1 
ATOM 3566  N NE2 . GLN A 1 459  ? 46.434  7.328   31.782  1.00 121.61 ? 456  GLN A NE2 1 
ATOM 3567  N N   . THR A 1 460  ? 49.116  2.918   34.665  1.00 118.84 ? 457  THR A N   1 
ATOM 3568  C CA  . THR A 1 460  ? 48.504  1.843   35.456  1.00 118.04 ? 457  THR A CA  1 
ATOM 3569  C C   . THR A 1 460  ? 47.032  2.128   35.761  1.00 117.63 ? 457  THR A C   1 
ATOM 3570  O O   . THR A 1 460  ? 46.665  3.270   36.031  1.00 117.67 ? 457  THR A O   1 
ATOM 3571  C CB  . THR A 1 460  ? 49.279  1.619   36.770  1.00 118.02 ? 457  THR A CB  1 
ATOM 3572  O OG1 . THR A 1 460  ? 50.649  1.323   36.474  1.00 117.75 ? 457  THR A OG1 1 
ATOM 3573  C CG2 . THR A 1 460  ? 48.684  0.470   37.567  1.00 117.96 ? 457  THR A CG2 1 
ATOM 3574  N N   . PHE A 1 461  ? 46.198  1.090   35.708  1.00 117.05 ? 458  PHE A N   1 
ATOM 3575  C CA  . PHE A 1 461  ? 44.764  1.224   36.002  1.00 116.54 ? 458  PHE A CA  1 
ATOM 3576  C C   . PHE A 1 461  ? 44.376  0.633   37.356  1.00 116.26 ? 458  PHE A C   1 
ATOM 3577  O O   . PHE A 1 461  ? 43.509  1.175   38.040  1.00 116.15 ? 458  PHE A O   1 
ATOM 3578  C CB  . PHE A 1 461  ? 43.897  0.600   34.896  1.00 116.49 ? 458  PHE A CB  1 
ATOM 3579  C CG  . PHE A 1 461  ? 43.833  1.415   33.630  1.00 116.20 ? 458  PHE A CG  1 
ATOM 3580  C CD1 . PHE A 1 461  ? 43.367  2.727   33.649  1.00 115.94 ? 458  PHE A CD1 1 
ATOM 3581  C CD2 . PHE A 1 461  ? 44.222  0.865   32.416  1.00 116.09 ? 458  PHE A CD2 1 
ATOM 3582  C CE1 . PHE A 1 461  ? 43.305  3.480   32.482  1.00 115.73 ? 458  PHE A CE1 1 
ATOM 3583  C CE2 . PHE A 1 461  ? 44.160  1.611   31.243  1.00 116.05 ? 458  PHE A CE2 1 
ATOM 3584  C CZ  . PHE A 1 461  ? 43.701  2.921   31.278  1.00 116.02 ? 458  PHE A CZ  1 
ATOM 3585  N N   . PHE A 1 462  ? 45.006  -0.485  37.716  1.00 115.93 ? 459  PHE A N   1 
ATOM 3586  C CA  . PHE A 1 462  ? 44.790  -1.153  39.006  1.00 115.61 ? 459  PHE A CA  1 
ATOM 3587  C C   . PHE A 1 462  ? 46.099  -1.777  39.495  1.00 115.52 ? 459  PHE A C   1 
ATOM 3588  O O   . PHE A 1 462  ? 46.993  -2.055  38.695  1.00 115.44 ? 459  PHE A O   1 
ATOM 3589  C CB  . PHE A 1 462  ? 43.681  -2.214  38.902  1.00 115.44 ? 459  PHE A CB  1 
ATOM 3590  C CG  . PHE A 1 462  ? 43.333  -2.869  40.217  1.00 115.04 ? 459  PHE A CG  1 
ATOM 3591  C CD1 . PHE A 1 462  ? 42.399  -2.295  41.070  1.00 115.07 ? 459  PHE A CD1 1 
ATOM 3592  C CD2 . PHE A 1 462  ? 43.936  -4.062  40.599  1.00 114.62 ? 459  PHE A CD2 1 
ATOM 3593  C CE1 . PHE A 1 462  ? 42.078  -2.898  42.288  1.00 115.09 ? 459  PHE A CE1 1 
ATOM 3594  C CE2 . PHE A 1 462  ? 43.622  -4.666  41.810  1.00 114.54 ? 459  PHE A CE2 1 
ATOM 3595  C CZ  . PHE A 1 462  ? 42.694  -4.085  42.655  1.00 114.82 ? 459  PHE A CZ  1 
ATOM 3596  N N   . CYS A 1 463  ? 46.200  -1.990  40.807  1.00 115.48 ? 460  CYS A N   1 
ATOM 3597  C CA  . CYS A 1 463  ? 47.408  -2.529  41.430  1.00 115.36 ? 460  CYS A CA  1 
ATOM 3598  C C   . CYS A 1 463  ? 47.148  -3.004  42.866  1.00 115.28 ? 460  CYS A C   1 
ATOM 3599  O O   . CYS A 1 463  ? 47.690  -2.446  43.822  1.00 115.28 ? 460  CYS A O   1 
ATOM 3600  C CB  . CYS A 1 463  ? 48.519  -1.474  41.406  1.00 115.36 ? 460  CYS A CB  1 
ATOM 3601  S SG  . CYS A 1 463  ? 50.151  -2.107  41.795  1.00 115.60 ? 460  CYS A SG  1 
ATOM 3602  N N   . GLY A 1 464  ? 46.329  -4.043  43.012  1.00 115.20 ? 461  GLY A N   1 
ATOM 3603  C CA  . GLY A 1 464  ? 45.921  -4.534  44.333  1.00 115.20 ? 461  GLY A CA  1 
ATOM 3604  C C   . GLY A 1 464  ? 46.676  -5.741  44.874  1.00 115.18 ? 461  GLY A C   1 
ATOM 3605  O O   . GLY A 1 464  ? 47.694  -6.161  44.312  1.00 115.14 ? 461  GLY A O   1 
ATOM 3606  N N   . ASN A 1 465  ? 46.166  -6.292  45.978  1.00 115.13 ? 462  ASN A N   1 
ATOM 3607  C CA  . ASN A 1 465  ? 46.771  -7.451  46.648  1.00 114.98 ? 462  ASN A CA  1 
ATOM 3608  C C   . ASN A 1 465  ? 46.164  -8.797  46.240  1.00 114.78 ? 462  ASN A C   1 
ATOM 3609  O O   . ASN A 1 465  ? 45.280  -9.329  46.921  1.00 114.82 ? 462  ASN A O   1 
ATOM 3610  C CB  . ASN A 1 465  ? 46.722  -7.290  48.176  1.00 114.98 ? 462  ASN A CB  1 
ATOM 3611  C CG  . ASN A 1 465  ? 47.858  -6.443  48.713  1.00 115.16 ? 462  ASN A CG  1 
ATOM 3612  O OD1 . ASN A 1 465  ? 47.670  -5.643  49.632  1.00 115.30 ? 462  ASN A OD1 1 
ATOM 3613  N ND2 . ASN A 1 465  ? 49.050  -6.617  48.146  1.00 115.38 ? 462  ASN A ND2 1 
ATOM 3614  N N   . VAL A 1 466  ? 46.643  -9.335  45.120  1.00 114.42 ? 463  VAL A N   1 
ATOM 3615  C CA  . VAL A 1 466  ? 46.278  -10.681 44.697  1.00 114.01 ? 463  VAL A CA  1 
ATOM 3616  C C   . VAL A 1 466  ? 47.103  -11.677 45.505  1.00 113.78 ? 463  VAL A C   1 
ATOM 3617  O O   . VAL A 1 466  ? 48.327  -11.740 45.370  1.00 113.65 ? 463  VAL A O   1 
ATOM 3618  C CB  . VAL A 1 466  ? 46.456  -10.900 43.160  1.00 114.05 ? 463  VAL A CB  1 
ATOM 3619  C CG1 . VAL A 1 466  ? 45.387  -10.144 42.375  1.00 114.02 ? 463  VAL A CG1 1 
ATOM 3620  C CG2 . VAL A 1 466  ? 47.850  -10.492 42.687  1.00 113.98 ? 463  VAL A CG2 1 
ATOM 3621  N N   . ALA A 1 467  ? 46.427  -12.431 46.370  1.00 113.56 ? 464  ALA A N   1 
ATOM 3622  C CA  . ALA A 1 467  ? 47.094  -13.399 47.242  1.00 113.36 ? 464  ALA A CA  1 
ATOM 3623  C C   . ALA A 1 467  ? 47.631  -14.600 46.450  1.00 113.22 ? 464  ALA A C   1 
ATOM 3624  O O   . ALA A 1 467  ? 47.405  -14.704 45.237  1.00 113.09 ? 464  ALA A O   1 
ATOM 3625  C CB  . ALA A 1 467  ? 46.156  -13.847 48.367  1.00 113.33 ? 464  ALA A CB  1 
ATOM 3626  N N   . HIS A 1 468  ? 48.335  -15.496 47.146  1.00 113.01 ? 465  HIS A N   1 
ATOM 3627  C CA  . HIS A 1 468  ? 49.049  -16.629 46.535  1.00 112.78 ? 465  HIS A CA  1 
ATOM 3628  C C   . HIS A 1 468  ? 50.379  -16.170 45.911  1.00 112.56 ? 465  HIS A C   1 
ATOM 3629  O O   . HIS A 1 468  ? 50.745  -16.585 44.804  1.00 112.52 ? 465  HIS A O   1 
ATOM 3630  C CB  . HIS A 1 468  ? 48.169  -17.378 45.515  1.00 112.85 ? 465  HIS A CB  1 
ATOM 3631  C CG  . HIS A 1 468  ? 46.928  -17.979 46.103  1.00 112.88 ? 465  HIS A CG  1 
ATOM 3632  N ND1 . HIS A 1 468  ? 45.902  -17.217 46.622  1.00 112.81 ? 465  HIS A ND1 1 
ATOM 3633  C CD2 . HIS A 1 468  ? 46.542  -19.270 46.239  1.00 112.88 ? 465  HIS A CD2 1 
ATOM 3634  C CE1 . HIS A 1 468  ? 44.944  -18.012 47.062  1.00 112.89 ? 465  HIS A CE1 1 
ATOM 3635  N NE2 . HIS A 1 468  ? 45.306  -19.263 46.840  1.00 113.02 ? 465  HIS A NE2 1 
ATOM 3636  N N   . GLN A 1 469  ? 51.085  -15.310 46.649  1.00 112.24 ? 466  GLN A N   1 
ATOM 3637  C CA  . GLN A 1 469  ? 52.389  -14.746 46.258  1.00 111.92 ? 466  GLN A CA  1 
ATOM 3638  C C   . GLN A 1 469  ? 52.456  -14.145 44.844  1.00 111.65 ? 466  GLN A C   1 
ATOM 3639  O O   . GLN A 1 469  ? 53.052  -14.738 43.938  1.00 111.54 ? 466  GLN A O   1 
ATOM 3640  C CB  . GLN A 1 469  ? 53.514  -15.764 46.474  1.00 111.90 ? 466  GLN A CB  1 
ATOM 3641  C CG  . GLN A 1 469  ? 53.884  -15.976 47.930  1.00 111.83 ? 466  GLN A CG  1 
ATOM 3642  C CD  . GLN A 1 469  ? 55.095  -16.872 48.096  1.00 112.02 ? 466  GLN A CD  1 
ATOM 3643  O OE1 . GLN A 1 469  ? 55.970  -16.600 48.920  1.00 112.29 ? 466  GLN A OE1 1 
ATOM 3644  N NE2 . GLN A 1 469  ? 55.156  -17.946 47.310  1.00 112.11 ? 466  GLN A NE2 1 
ATOM 3645  N N   . GLN A 1 470  ? 51.848  -12.965 44.683  1.00 111.37 ? 467  GLN A N   1 
ATOM 3646  C CA  . GLN A 1 470  ? 51.789  -12.241 43.398  1.00 111.02 ? 467  GLN A CA  1 
ATOM 3647  C C   . GLN A 1 470  ? 51.455  -10.740 43.538  1.00 110.84 ? 467  GLN A C   1 
ATOM 3648  O O   . GLN A 1 470  ? 50.769  -10.330 44.481  1.00 110.72 ? 467  GLN A O   1 
ATOM 3649  C CB  . GLN A 1 470  ? 50.794  -12.914 42.434  1.00 111.00 ? 467  GLN A CB  1 
ATOM 3650  C CG  . GLN A 1 470  ? 51.418  -13.923 41.466  1.00 110.37 ? 467  GLN A CG  1 
ATOM 3651  C CD  . GLN A 1 470  ? 50.501  -15.086 41.153  1.00 109.54 ? 467  GLN A CD  1 
ATOM 3652  O OE1 . GLN A 1 470  ? 49.775  -15.568 42.022  1.00 109.24 ? 467  GLN A OE1 1 
ATOM 3653  N NE2 . GLN A 1 470  ? 50.536  -15.550 39.912  1.00 109.15 ? 467  GLN A NE2 1 
ATOM 3654  N N   . LEU A 1 471  ? 51.952  -9.941  42.587  1.00 110.59 ? 468  LEU A N   1 
ATOM 3655  C CA  . LEU A 1 471  ? 51.659  -8.500  42.486  1.00 110.34 ? 468  LEU A CA  1 
ATOM 3656  C C   . LEU A 1 471  ? 51.155  -8.140  41.086  1.00 110.14 ? 468  LEU A C   1 
ATOM 3657  O O   . LEU A 1 471  ? 51.835  -8.399  40.088  1.00 110.23 ? 468  LEU A O   1 
ATOM 3658  C CB  . LEU A 1 471  ? 52.896  -7.660  42.813  1.00 110.33 ? 468  LEU A CB  1 
ATOM 3659  C CG  . LEU A 1 471  ? 53.585  -7.858  44.166  1.00 110.60 ? 468  LEU A CG  1 
ATOM 3660  C CD1 . LEU A 1 471  ? 54.951  -7.180  44.168  1.00 110.70 ? 468  LEU A CD1 1 
ATOM 3661  C CD2 . LEU A 1 471  ? 52.715  -7.363  45.325  1.00 110.66 ? 468  LEU A CD2 1 
ATOM 3662  N N   . ILE A 1 472  ? 49.974  -7.524  41.027  1.00 109.79 ? 469  ILE A N   1 
ATOM 3663  C CA  . ILE A 1 472  ? 49.248  -7.292  39.770  1.00 109.36 ? 469  ILE A CA  1 
ATOM 3664  C C   . ILE A 1 472  ? 49.384  -5.842  39.273  1.00 109.18 ? 469  ILE A C   1 
ATOM 3665  O O   . ILE A 1 472  ? 49.413  -4.913  40.078  1.00 109.21 ? 469  ILE A O   1 
ATOM 3666  C CB  . ILE A 1 472  ? 47.749  -7.745  39.912  1.00 109.25 ? 469  ILE A CB  1 
ATOM 3667  C CG1 . ILE A 1 472  ? 47.028  -7.765  38.562  1.00 109.20 ? 469  ILE A CG1 1 
ATOM 3668  C CG2 . ILE A 1 472  ? 46.998  -6.905  40.947  1.00 109.17 ? 469  ILE A CG2 1 
ATOM 3669  C CD1 . ILE A 1 472  ? 45.843  -8.714  38.521  1.00 109.09 ? 469  ILE A CD1 1 
ATOM 3670  N N   . GLN A 1 473  ? 49.503  -5.660  37.956  1.00 108.96 ? 470  GLN A N   1 
ATOM 3671  C CA  . GLN A 1 473  ? 49.549  -4.318  37.355  1.00 108.80 ? 470  GLN A CA  1 
ATOM 3672  C C   . GLN A 1 473  ? 48.811  -4.233  36.017  1.00 108.86 ? 470  GLN A C   1 
ATOM 3673  O O   . GLN A 1 473  ? 49.407  -4.416  34.953  1.00 108.79 ? 470  GLN A O   1 
ATOM 3674  C CB  . GLN A 1 473  ? 50.993  -3.810  37.196  1.00 108.83 ? 470  GLN A CB  1 
ATOM 3675  C CG  . GLN A 1 473  ? 51.085  -2.319  36.808  1.00 108.57 ? 470  GLN A CG  1 
ATOM 3676  C CD  . GLN A 1 473  ? 52.456  -1.886  36.296  1.00 108.51 ? 470  GLN A CD  1 
ATOM 3677  O OE1 . GLN A 1 473  ? 53.275  -2.705  35.883  1.00 107.98 ? 470  GLN A OE1 1 
ATOM 3678  N NE2 . GLN A 1 473  ? 52.699  -0.581  36.311  1.00 108.23 ? 470  GLN A NE2 1 
ATOM 3679  N N   . ILE A 1 474  ? 47.514  -3.945  36.079  1.00 108.98 ? 471  ILE A N   1 
ATOM 3680  C CA  . ILE A 1 474  ? 46.724  -3.723  34.873  1.00 109.13 ? 471  ILE A CA  1 
ATOM 3681  C C   . ILE A 1 474  ? 47.048  -2.341  34.323  1.00 109.42 ? 471  ILE A C   1 
ATOM 3682  O O   . ILE A 1 474  ? 47.072  -1.360  35.065  1.00 109.51 ? 471  ILE A O   1 
ATOM 3683  C CB  . ILE A 1 474  ? 45.203  -3.830  35.128  1.00 109.02 ? 471  ILE A CB  1 
ATOM 3684  C CG1 . ILE A 1 474  ? 44.893  -4.929  36.155  1.00 109.01 ? 471  ILE A CG1 1 
ATOM 3685  C CG2 . ILE A 1 474  ? 44.472  -4.067  33.808  1.00 109.05 ? 471  ILE A CG2 1 
ATOM 3686  C CD1 . ILE A 1 474  ? 43.416  -5.101  36.487  1.00 109.03 ? 471  ILE A CD1 1 
ATOM 3687  N N   . THR A 1 475  ? 47.308  -2.274  33.023  1.00 109.82 ? 472  THR A N   1 
ATOM 3688  C CA  . THR A 1 475  ? 47.653  -1.012  32.363  1.00 110.26 ? 472  THR A CA  1 
ATOM 3689  C C   . THR A 1 475  ? 47.107  -0.954  30.934  1.00 110.57 ? 472  THR A C   1 
ATOM 3690  O O   . THR A 1 475  ? 46.672  -1.975  30.393  1.00 110.60 ? 472  THR A O   1 
ATOM 3691  C CB  . THR A 1 475  ? 49.194  -0.722  32.410  1.00 110.23 ? 472  THR A CB  1 
ATOM 3692  O OG1 . THR A 1 475  ? 49.547  0.230   31.400  1.00 110.17 ? 472  THR A OG1 1 
ATOM 3693  C CG2 . THR A 1 475  ? 50.012  -1.987  32.200  1.00 110.41 ? 472  THR A CG2 1 
ATOM 3694  N N   . SER A 1 476  ? 47.121  0.244   30.345  1.00 110.99 ? 473  SER A N   1 
ATOM 3695  C CA  . SER A 1 476  ? 46.650  0.493   28.977  1.00 111.41 ? 473  SER A CA  1 
ATOM 3696  C C   . SER A 1 476  ? 46.601  -0.771  28.131  1.00 111.81 ? 473  SER A C   1 
ATOM 3697  O O   . SER A 1 476  ? 45.523  -1.243  27.768  1.00 111.83 ? 473  SER A O   1 
ATOM 3698  C CB  . SER A 1 476  ? 47.524  1.547   28.283  1.00 111.33 ? 473  SER A CB  1 
ATOM 3699  O OG  . SER A 1 476  ? 47.285  2.844   28.795  1.00 111.25 ? 473  SER A OG  1 
ATOM 3700  N N   . ALA A 1 477  ? 47.778  -1.320  27.841  1.00 112.35 ? 474  ALA A N   1 
ATOM 3701  C CA  . ALA A 1 477  ? 47.896  -2.519  27.020  1.00 112.93 ? 474  ALA A CA  1 
ATOM 3702  C C   . ALA A 1 477  ? 47.715  -3.798  27.845  1.00 113.29 ? 474  ALA A C   1 
ATOM 3703  O O   . ALA A 1 477  ? 46.584  -4.245  28.066  1.00 113.48 ? 474  ALA A O   1 
ATOM 3704  C CB  . ALA A 1 477  ? 49.233  -2.526  26.272  1.00 112.91 ? 474  ALA A CB  1 
ATOM 3705  N N   . SER A 1 478  ? 48.828  -4.372  28.302  1.00 113.59 ? 475  SER A N   1 
ATOM 3706  C CA  . SER A 1 478  ? 48.819  -5.658  28.997  1.00 113.74 ? 475  SER A CA  1 
ATOM 3707  C C   . SER A 1 478  ? 48.477  -5.526  30.474  1.00 113.79 ? 475  SER A C   1 
ATOM 3708  O O   . SER A 1 478  ? 48.555  -4.442  31.047  1.00 113.65 ? 475  SER A O   1 
ATOM 3709  C CB  . SER A 1 478  ? 50.170  -6.378  28.829  1.00 113.78 ? 475  SER A CB  1 
ATOM 3710  O OG  . SER A 1 478  ? 51.220  -5.708  29.511  1.00 113.62 ? 475  SER A OG  1 
ATOM 3711  N N   . VAL A 1 479  ? 48.067  -6.640  31.069  1.00 114.02 ? 476  VAL A N   1 
ATOM 3712  C CA  . VAL A 1 479  ? 48.038  -6.777  32.518  1.00 114.30 ? 476  VAL A CA  1 
ATOM 3713  C C   . VAL A 1 479  ? 49.192  -7.709  32.915  1.00 114.55 ? 476  VAL A C   1 
ATOM 3714  O O   . VAL A 1 479  ? 49.113  -8.934  32.751  1.00 114.54 ? 476  VAL A O   1 
ATOM 3715  C CB  . VAL A 1 479  ? 46.626  -7.210  33.063  1.00 114.25 ? 476  VAL A CB  1 
ATOM 3716  C CG1 . VAL A 1 479  ? 45.936  -8.200  32.135  1.00 114.17 ? 476  VAL A CG1 1 
ATOM 3717  C CG2 . VAL A 1 479  ? 46.710  -7.748  34.491  1.00 114.14 ? 476  VAL A CG2 1 
ATOM 3718  N N   . ARG A 1 480  ? 50.281  -7.101  33.393  1.00 114.84 ? 477  ARG A N   1 
ATOM 3719  C CA  . ARG A 1 480  ? 51.494  -7.826  33.790  1.00 115.19 ? 477  ARG A CA  1 
ATOM 3720  C C   . ARG A 1 480  ? 51.292  -8.571  35.109  1.00 115.36 ? 477  ARG A C   1 
ATOM 3721  O O   . ARG A 1 480  ? 50.228  -8.480  35.726  1.00 115.39 ? 477  ARG A O   1 
ATOM 3722  C CB  . ARG A 1 480  ? 52.699  -6.875  33.899  1.00 115.13 ? 477  ARG A CB  1 
ATOM 3723  C CG  . ARG A 1 480  ? 53.224  -6.342  32.568  1.00 115.27 ? 477  ARG A CG  1 
ATOM 3724  C CD  . ARG A 1 480  ? 54.641  -5.766  32.688  1.00 115.36 ? 477  ARG A CD  1 
ATOM 3725  N NE  . ARG A 1 480  ? 55.678  -6.806  32.681  1.00 115.98 ? 477  ARG A NE  1 
ATOM 3726  C CZ  . ARG A 1 480  ? 56.995  -6.580  32.696  1.00 116.00 ? 477  ARG A CZ  1 
ATOM 3727  N NH1 . ARG A 1 480  ? 57.478  -5.342  32.718  1.00 116.12 ? 477  ARG A NH1 1 
ATOM 3728  N NH2 . ARG A 1 480  ? 57.840  -7.603  32.690  1.00 115.73 ? 477  ARG A NH2 1 
ATOM 3729  N N   . LEU A 1 481  ? 52.313  -9.310  35.535  1.00 115.62 ? 478  LEU A N   1 
ATOM 3730  C CA  . LEU A 1 481  ? 52.248  -10.049 36.791  1.00 115.89 ? 478  LEU A CA  1 
ATOM 3731  C C   . LEU A 1 481  ? 53.647  -10.258 37.366  1.00 116.14 ? 478  LEU A C   1 
ATOM 3732  O O   . LEU A 1 481  ? 54.608  -10.469 36.619  1.00 116.22 ? 478  LEU A O   1 
ATOM 3733  C CB  . LEU A 1 481  ? 51.536  -11.397 36.585  1.00 115.93 ? 478  LEU A CB  1 
ATOM 3734  C CG  . LEU A 1 481  ? 50.694  -12.031 37.703  1.00 115.83 ? 478  LEU A CG  1 
ATOM 3735  C CD1 . LEU A 1 481  ? 49.433  -11.227 38.000  1.00 115.44 ? 478  LEU A CD1 1 
ATOM 3736  C CD2 . LEU A 1 481  ? 50.326  -13.462 37.335  1.00 115.76 ? 478  LEU A CD2 1 
ATOM 3737  N N   . VAL A 1 482  ? 53.745  -10.177 38.694  1.00 116.36 ? 479  VAL A N   1 
ATOM 3738  C CA  . VAL A 1 482  ? 54.982  -10.435 39.444  1.00 116.57 ? 479  VAL A CA  1 
ATOM 3739  C C   . VAL A 1 482  ? 54.649  -11.383 40.599  1.00 116.73 ? 479  VAL A C   1 
ATOM 3740  O O   . VAL A 1 482  ? 53.492  -11.476 40.997  1.00 116.74 ? 479  VAL A O   1 
ATOM 3741  C CB  . VAL A 1 482  ? 55.592  -9.120  40.003  1.00 116.57 ? 479  VAL A CB  1 
ATOM 3742  C CG1 . VAL A 1 482  ? 56.917  -9.378  40.713  1.00 116.50 ? 479  VAL A CG1 1 
ATOM 3743  C CG2 . VAL A 1 482  ? 55.792  -8.108  38.893  1.00 116.58 ? 479  VAL A CG2 1 
ATOM 3744  N N   . SER A 1 483  ? 55.648  -12.091 41.125  1.00 116.95 ? 480  SER A N   1 
ATOM 3745  C CA  . SER A 1 483  ? 55.449  -12.954 42.292  1.00 117.16 ? 480  SER A CA  1 
ATOM 3746  C C   . SER A 1 483  ? 56.283  -12.499 43.487  1.00 117.33 ? 480  SER A C   1 
ATOM 3747  O O   . SER A 1 483  ? 56.878  -11.418 43.468  1.00 117.34 ? 480  SER A O   1 
ATOM 3748  C CB  . SER A 1 483  ? 55.753  -14.419 41.958  1.00 117.10 ? 480  SER A CB  1 
ATOM 3749  O OG  . SER A 1 483  ? 54.658  -15.045 41.315  1.00 117.18 ? 480  SER A OG  1 
ATOM 3750  N N   . GLN A 1 484  ? 56.303  -13.332 44.525  1.00 117.60 ? 481  GLN A N   1 
ATOM 3751  C CA  . GLN A 1 484  ? 57.116  -13.093 45.719  1.00 117.78 ? 481  GLN A CA  1 
ATOM 3752  C C   . GLN A 1 484  ? 58.292  -14.078 45.794  1.00 117.97 ? 481  GLN A C   1 
ATOM 3753  O O   . GLN A 1 484  ? 59.072  -14.067 46.753  1.00 117.87 ? 481  GLN A O   1 
ATOM 3754  C CB  . GLN A 1 484  ? 56.253  -13.165 46.990  1.00 117.75 ? 481  GLN A CB  1 
ATOM 3755  C CG  . GLN A 1 484  ? 55.019  -12.248 47.001  1.00 117.30 ? 481  GLN A CG  1 
ATOM 3756  C CD  . GLN A 1 484  ? 55.364  -10.770 47.055  1.00 116.63 ? 481  GLN A CD  1 
ATOM 3757  O OE1 . GLN A 1 484  ? 55.754  -10.172 46.051  1.00 116.21 ? 481  GLN A OE1 1 
ATOM 3758  N NE2 . GLN A 1 484  ? 55.205  -10.171 48.227  1.00 116.44 ? 481  GLN A NE2 1 
ATOM 3759  N N   . GLU A 1 485  ? 58.409  -14.923 44.771  1.00 118.28 ? 482  GLU A N   1 
ATOM 3760  C CA  . GLU A 1 485  ? 59.522  -15.866 44.661  1.00 118.57 ? 482  GLU A CA  1 
ATOM 3761  C C   . GLU A 1 485  ? 60.613  -15.378 43.680  1.00 118.82 ? 482  GLU A C   1 
ATOM 3762  O O   . GLU A 1 485  ? 61.759  -15.194 44.099  1.00 118.87 ? 482  GLU A O   1 
ATOM 3763  C CB  . GLU A 1 485  ? 59.031  -17.291 44.330  1.00 118.51 ? 482  GLU A CB  1 
ATOM 3764  C CG  . GLU A 1 485  ? 57.979  -17.869 45.297  1.00 118.45 ? 482  GLU A CG  1 
ATOM 3765  C CD  . GLU A 1 485  ? 58.530  -18.225 46.681  1.00 118.54 ? 482  GLU A CD  1 
ATOM 3766  O OE1 . GLU A 1 485  ? 59.757  -18.132 46.903  1.00 118.62 ? 482  GLU A OE1 1 
ATOM 3767  O OE2 . GLU A 1 485  ? 57.724  -18.608 47.557  1.00 118.38 ? 482  GLU A OE2 1 
ATOM 3768  N N   . PRO A 1 486  ? 60.274  -15.168 42.381  1.00 119.05 ? 483  PRO A N   1 
ATOM 3769  C CA  . PRO A 1 486  ? 61.284  -14.631 41.457  1.00 119.13 ? 483  PRO A CA  1 
ATOM 3770  C C   . PRO A 1 486  ? 61.321  -13.092 41.312  1.00 119.16 ? 483  PRO A C   1 
ATOM 3771  O O   . PRO A 1 486  ? 62.410  -12.510 41.355  1.00 119.19 ? 483  PRO A O   1 
ATOM 3772  C CB  . PRO A 1 486  ? 60.922  -15.299 40.118  1.00 119.14 ? 483  PRO A CB  1 
ATOM 3773  C CG  . PRO A 1 486  ? 59.488  -15.806 40.282  1.00 119.15 ? 483  PRO A CG  1 
ATOM 3774  C CD  . PRO A 1 486  ? 59.015  -15.447 41.667  1.00 119.10 ? 483  PRO A CD  1 
ATOM 3775  N N   . LYS A 1 487  ? 60.158  -12.454 41.140  1.00 119.13 ? 484  LYS A N   1 
ATOM 3776  C CA  . LYS A 1 487  ? 60.053  -10.999 40.915  1.00 119.12 ? 484  LYS A CA  1 
ATOM 3777  C C   . LYS A 1 487  ? 60.540  -10.579 39.515  1.00 119.20 ? 484  LYS A C   1 
ATOM 3778  O O   . LYS A 1 487  ? 61.623  -10.006 39.365  1.00 119.22 ? 484  LYS A O   1 
ATOM 3779  C CB  . LYS A 1 487  ? 60.765  -10.200 42.026  1.00 119.07 ? 484  LYS A CB  1 
ATOM 3780  C CG  . LYS A 1 487  ? 60.742  -8.677  41.859  1.00 118.95 ? 484  LYS A CG  1 
ATOM 3781  C CD  . LYS A 1 487  ? 59.742  -7.996  42.780  1.00 118.90 ? 484  LYS A CD  1 
ATOM 3782  C CE  . LYS A 1 487  ? 60.390  -7.596  44.100  1.00 118.78 ? 484  LYS A CE  1 
ATOM 3783  N NZ  . LYS A 1 487  ? 59.503  -6.735  44.931  1.00 118.62 ? 484  LYS A NZ  1 
ATOM 3784  N N   . ALA A 1 488  ? 59.728  -10.882 38.501  1.00 119.32 ? 485  ALA A N   1 
ATOM 3785  C CA  . ALA A 1 488  ? 59.974  -10.479 37.106  1.00 119.45 ? 485  ALA A CA  1 
ATOM 3786  C C   . ALA A 1 488  ? 58.674  -10.608 36.298  1.00 119.57 ? 485  ALA A C   1 
ATOM 3787  O O   . ALA A 1 488  ? 57.628  -10.133 36.741  1.00 119.61 ? 485  ALA A O   1 
ATOM 3788  C CB  . ALA A 1 488  ? 61.094  -11.316 36.483  1.00 119.44 ? 485  ALA A CB  1 
ATOM 3789  N N   . LEU A 1 489  ? 58.738  -11.230 35.119  1.00 119.73 ? 486  LEU A N   1 
ATOM 3790  C CA  . LEU A 1 489  ? 57.524  -11.595 34.379  1.00 119.85 ? 486  LEU A CA  1 
ATOM 3791  C C   . LEU A 1 489  ? 57.144  -13.040 34.713  1.00 120.02 ? 486  LEU A C   1 
ATOM 3792  O O   . LEU A 1 489  ? 57.599  -13.987 34.062  1.00 119.99 ? 486  LEU A O   1 
ATOM 3793  C CB  . LEU A 1 489  ? 57.697  -11.402 32.861  1.00 119.92 ? 486  LEU A CB  1 
ATOM 3794  C CG  . LEU A 1 489  ? 56.480  -11.632 31.944  1.00 119.77 ? 486  LEU A CG  1 
ATOM 3795  C CD1 . LEU A 1 489  ? 55.552  -10.419 31.929  1.00 119.55 ? 486  LEU A CD1 1 
ATOM 3796  C CD2 . LEU A 1 489  ? 56.914  -12.001 30.523  1.00 119.66 ? 486  LEU A CD2 1 
ATOM 3797  N N   . VAL A 1 490  ? 56.318  -13.192 35.746  1.00 120.19 ? 487  VAL A N   1 
ATOM 3798  C CA  . VAL A 1 490  ? 55.871  -14.504 36.215  1.00 120.37 ? 487  VAL A CA  1 
ATOM 3799  C C   . VAL A 1 490  ? 54.819  -15.053 35.249  1.00 120.58 ? 487  VAL A C   1 
ATOM 3800  O O   . VAL A 1 490  ? 54.874  -16.219 34.844  1.00 120.54 ? 487  VAL A O   1 
ATOM 3801  C CB  . VAL A 1 490  ? 55.338  -14.431 37.670  1.00 120.29 ? 487  VAL A CB  1 
ATOM 3802  C CG1 . VAL A 1 490  ? 54.949  -15.799 38.173  1.00 120.20 ? 487  VAL A CG1 1 
ATOM 3803  C CG2 . VAL A 1 490  ? 56.402  -13.848 38.578  1.00 120.21 ? 487  VAL A CG2 1 
ATOM 3804  N N   . SER A 1 491  ? 53.873  -14.190 34.885  1.00 120.86 ? 488  SER A N   1 
ATOM 3805  C CA  . SER A 1 491  ? 52.919  -14.461 33.813  1.00 121.08 ? 488  SER A CA  1 
ATOM 3806  C C   . SER A 1 491  ? 52.449  -13.132 33.214  1.00 121.13 ? 488  SER A C   1 
ATOM 3807  O O   . SER A 1 491  ? 52.870  -12.056 33.662  1.00 121.10 ? 488  SER A O   1 
ATOM 3808  C CB  . SER A 1 491  ? 51.733  -15.284 34.327  1.00 121.14 ? 488  SER A CB  1 
ATOM 3809  O OG  . SER A 1 491  ? 51.122  -16.016 33.278  1.00 121.17 ? 488  SER A OG  1 
ATOM 3810  N N   . GLU A 1 492  ? 51.589  -13.210 32.199  1.00 121.17 ? 489  GLU A N   1 
ATOM 3811  C CA  . GLU A 1 492  ? 51.081  -12.020 31.520  1.00 121.22 ? 489  GLU A CA  1 
ATOM 3812  C C   . GLU A 1 492  ? 49.789  -12.306 30.753  1.00 121.18 ? 489  GLU A C   1 
ATOM 3813  O O   . GLU A 1 492  ? 49.570  -13.426 30.278  1.00 121.14 ? 489  GLU A O   1 
ATOM 3814  C CB  . GLU A 1 492  ? 52.145  -11.459 30.566  1.00 121.25 ? 489  GLU A CB  1 
ATOM 3815  C CG  . GLU A 1 492  ? 52.069  -9.948  30.353  1.00 121.28 ? 489  GLU A CG  1 
ATOM 3816  C CD  . GLU A 1 492  ? 53.103  -9.429  29.365  1.00 121.29 ? 489  GLU A CD  1 
ATOM 3817  O OE1 . GLU A 1 492  ? 53.932  -10.229 28.872  1.00 121.31 ? 489  GLU A OE1 1 
ATOM 3818  O OE2 . GLU A 1 492  ? 53.082  -8.212  29.080  1.00 121.21 ? 489  GLU A OE2 1 
ATOM 3819  N N   . TRP A 1 493  ? 48.938  -11.285 30.648  1.00 121.12 ? 490  TRP A N   1 
ATOM 3820  C CA  . TRP A 1 493  ? 47.743  -11.336 29.800  1.00 120.99 ? 490  TRP A CA  1 
ATOM 3821  C C   . TRP A 1 493  ? 47.763  -10.189 28.788  1.00 120.78 ? 490  TRP A C   1 
ATOM 3822  O O   . TRP A 1 493  ? 48.169  -9.069  29.111  1.00 120.81 ? 490  TRP A O   1 
ATOM 3823  C CB  . TRP A 1 493  ? 46.462  -11.286 30.643  1.00 121.05 ? 490  TRP A CB  1 
ATOM 3824  C CG  . TRP A 1 493  ? 45.204  -11.689 29.901  1.00 121.02 ? 490  TRP A CG  1 
ATOM 3825  C CD1 . TRP A 1 493  ? 44.692  -12.950 29.786  1.00 120.92 ? 490  TRP A CD1 1 
ATOM 3826  C CD2 . TRP A 1 493  ? 44.305  -10.826 29.186  1.00 121.06 ? 490  TRP A CD2 1 
ATOM 3827  N NE1 . TRP A 1 493  ? 43.536  -12.927 29.043  1.00 120.95 ? 490  TRP A NE1 1 
ATOM 3828  C CE2 . TRP A 1 493  ? 43.275  -11.637 28.662  1.00 121.00 ? 490  TRP A CE2 1 
ATOM 3829  C CE3 . TRP A 1 493  ? 44.271  -9.446  28.936  1.00 121.20 ? 490  TRP A CE3 1 
ATOM 3830  C CZ2 . TRP A 1 493  ? 42.220  -11.116 27.901  1.00 120.96 ? 490  TRP A CZ2 1 
ATOM 3831  C CZ3 . TRP A 1 493  ? 43.220  -8.928  28.178  1.00 121.02 ? 490  TRP A CZ3 1 
ATOM 3832  C CH2 . TRP A 1 493  ? 42.210  -9.764  27.671  1.00 120.93 ? 490  TRP A CH2 1 
ATOM 3833  N N   . LYS A 1 494  ? 47.328  -10.488 27.567  1.00 120.45 ? 491  LYS A N   1 
ATOM 3834  C CA  . LYS A 1 494  ? 47.269  -9.519  26.476  1.00 120.12 ? 491  LYS A CA  1 
ATOM 3835  C C   . LYS A 1 494  ? 45.938  -9.700  25.744  1.00 119.96 ? 491  LYS A C   1 
ATOM 3836  O O   . LYS A 1 494  ? 45.465  -10.830 25.586  1.00 120.03 ? 491  LYS A O   1 
ATOM 3837  C CB  . LYS A 1 494  ? 48.438  -9.752  25.512  1.00 120.07 ? 491  LYS A CB  1 
ATOM 3838  C CG  . LYS A 1 494  ? 48.845  -8.548  24.678  1.00 119.83 ? 491  LYS A CG  1 
ATOM 3839  C CD  . LYS A 1 494  ? 49.968  -7.770  25.338  1.00 119.36 ? 491  LYS A CD  1 
ATOM 3840  C CE  . LYS A 1 494  ? 50.375  -6.582  24.490  1.00 119.29 ? 491  LYS A CE  1 
ATOM 3841  N NZ  . LYS A 1 494  ? 51.430  -5.773  25.152  1.00 119.06 ? 491  LYS A NZ  1 
ATOM 3842  N N   . GLU A 1 495  ? 45.331  -8.596  25.309  1.00 119.63 ? 492  GLU A N   1 
ATOM 3843  C CA  . GLU A 1 495  ? 44.070  -8.659  24.562  1.00 119.27 ? 492  GLU A CA  1 
ATOM 3844  C C   . GLU A 1 495  ? 44.333  -9.175  23.142  1.00 118.87 ? 492  GLU A C   1 
ATOM 3845  O O   . GLU A 1 495  ? 45.106  -8.563  22.402  1.00 118.88 ? 492  GLU A O   1 
ATOM 3846  C CB  . GLU A 1 495  ? 43.378  -7.290  24.537  1.00 119.32 ? 492  GLU A CB  1 
ATOM 3847  C CG  . GLU A 1 495  ? 41.849  -7.347  24.396  1.00 119.46 ? 492  GLU A CG  1 
ATOM 3848  C CD  . GLU A 1 495  ? 41.370  -7.569  22.962  1.00 119.50 ? 492  GLU A CD  1 
ATOM 3849  O OE1 . GLU A 1 495  ? 41.985  -7.013  22.027  1.00 119.49 ? 492  GLU A OE1 1 
ATOM 3850  O OE2 . GLU A 1 495  ? 40.366  -8.289  22.772  1.00 119.32 ? 492  GLU A OE2 1 
ATOM 3851  N N   . PRO A 1 496  ? 43.692  -10.304 22.763  1.00 118.45 ? 493  PRO A N   1 
ATOM 3852  C CA  . PRO A 1 496  ? 43.973  -11.013 21.506  1.00 118.15 ? 493  PRO A CA  1 
ATOM 3853  C C   . PRO A 1 496  ? 43.619  -10.227 20.234  1.00 117.85 ? 493  PRO A C   1 
ATOM 3854  O O   . PRO A 1 496  ? 42.980  -10.771 19.332  1.00 117.82 ? 493  PRO A O   1 
ATOM 3855  C CB  . PRO A 1 496  ? 43.109  -12.281 21.617  1.00 118.16 ? 493  PRO A CB  1 
ATOM 3856  C CG  . PRO A 1 496  ? 42.732  -12.386 23.061  1.00 118.18 ? 493  PRO A CG  1 
ATOM 3857  C CD  . PRO A 1 496  ? 42.635  -10.982 23.536  1.00 118.38 ? 493  PRO A CD  1 
ATOM 3858  N N   . GLN A 1 497  ? 44.051  -8.967  20.172  1.00 117.50 ? 494  GLN A N   1 
ATOM 3859  C CA  . GLN A 1 497  ? 43.822  -8.074  19.030  1.00 117.18 ? 494  GLN A CA  1 
ATOM 3860  C C   . GLN A 1 497  ? 44.775  -6.874  19.059  1.00 116.95 ? 494  GLN A C   1 
ATOM 3861  O O   . GLN A 1 497  ? 44.979  -6.216  18.037  1.00 116.90 ? 494  GLN A O   1 
ATOM 3862  C CB  . GLN A 1 497  ? 42.374  -7.567  19.013  1.00 117.23 ? 494  GLN A CB  1 
ATOM 3863  C CG  . GLN A 1 497  ? 41.401  -8.389  18.172  1.00 117.12 ? 494  GLN A CG  1 
ATOM 3864  C CD  . GLN A 1 497  ? 41.172  -7.807  16.787  1.00 116.92 ? 494  GLN A CD  1 
ATOM 3865  O OE1 . GLN A 1 497  ? 42.115  -7.529  16.044  1.00 116.67 ? 494  GLN A OE1 1 
ATOM 3866  N NE2 . GLN A 1 497  ? 39.908  -7.627  16.433  1.00 116.90 ? 494  GLN A NE2 1 
ATOM 3867  N N   . ALA A 1 498  ? 45.351  -6.611  20.234  1.00 116.64 ? 495  ALA A N   1 
ATOM 3868  C CA  . ALA A 1 498  ? 46.189  -5.430  20.511  1.00 116.37 ? 495  ALA A CA  1 
ATOM 3869  C C   . ALA A 1 498  ? 45.365  -4.192  20.896  1.00 116.17 ? 495  ALA A C   1 
ATOM 3870  O O   . ALA A 1 498  ? 45.877  -3.069  20.897  1.00 116.18 ? 495  ALA A O   1 
ATOM 3871  C CB  . ALA A 1 498  ? 47.147  -5.121  19.346  1.00 116.34 ? 495  ALA A CB  1 
ATOM 3872  N N   . LYS A 1 499  ? 44.092  -4.409  21.229  1.00 115.86 ? 496  LYS A N   1 
ATOM 3873  C CA  . LYS A 1 499  ? 43.211  -3.343  21.707  1.00 115.49 ? 496  LYS A CA  1 
ATOM 3874  C C   . LYS A 1 499  ? 43.475  -2.992  23.174  1.00 115.38 ? 496  LYS A C   1 
ATOM 3875  O O   . LYS A 1 499  ? 43.811  -3.863  23.984  1.00 115.30 ? 496  LYS A O   1 
ATOM 3876  C CB  . LYS A 1 499  ? 41.739  -3.716  21.504  1.00 115.54 ? 496  LYS A CB  1 
ATOM 3877  C CG  . LYS A 1 499  ? 41.122  -3.164  20.226  1.00 115.36 ? 496  LYS A CG  1 
ATOM 3878  C CD  . LYS A 1 499  ? 39.674  -3.594  20.056  1.00 115.24 ? 496  LYS A CD  1 
ATOM 3879  C CE  . LYS A 1 499  ? 39.571  -4.972  19.428  1.00 114.76 ? 496  LYS A CE  1 
ATOM 3880  N NZ  . LYS A 1 499  ? 38.167  -5.304  19.074  1.00 114.79 ? 496  LYS A NZ  1 
ATOM 3881  N N   . ASN A 1 500  ? 43.311  -1.709  23.497  1.00 115.17 ? 497  ASN A N   1 
ATOM 3882  C CA  . ASN A 1 500  ? 43.591  -1.177  24.832  1.00 114.91 ? 497  ASN A CA  1 
ATOM 3883  C C   . ASN A 1 500  ? 42.463  -1.425  25.835  1.00 114.75 ? 497  ASN A C   1 
ATOM 3884  O O   . ASN A 1 500  ? 41.286  -1.259  25.507  1.00 114.66 ? 497  ASN A O   1 
ATOM 3885  C CB  . ASN A 1 500  ? 43.897  0.327   24.754  1.00 114.87 ? 497  ASN A CB  1 
ATOM 3886  C CG  . ASN A 1 500  ? 45.281  0.624   24.180  1.00 114.73 ? 497  ASN A CG  1 
ATOM 3887  O OD1 . ASN A 1 500  ? 46.281  0.023   24.580  1.00 114.36 ? 497  ASN A OD1 1 
ATOM 3888  N ND2 . ASN A 1 500  ? 45.341  1.573   23.249  1.00 114.42 ? 497  ASN A ND2 1 
ATOM 3889  N N   . ILE A 1 501  ? 42.840  -1.820  27.053  1.00 114.57 ? 498  ILE A N   1 
ATOM 3890  C CA  . ILE A 1 501  ? 41.892  -2.015  28.157  1.00 114.30 ? 498  ILE A CA  1 
ATOM 3891  C C   . ILE A 1 501  ? 41.425  -0.653  28.685  1.00 114.20 ? 498  ILE A C   1 
ATOM 3892  O O   . ILE A 1 501  ? 42.205  0.303   28.732  1.00 114.13 ? 498  ILE A O   1 
ATOM 3893  C CB  . ILE A 1 501  ? 42.504  -2.863  29.315  1.00 114.26 ? 498  ILE A CB  1 
ATOM 3894  C CG1 . ILE A 1 501  ? 43.245  -4.089  28.763  1.00 114.19 ? 498  ILE A CG1 1 
ATOM 3895  C CG2 . ILE A 1 501  ? 41.418  -3.292  30.313  1.00 114.10 ? 498  ILE A CG2 1 
ATOM 3896  C CD1 . ILE A 1 501  ? 43.943  -4.943  29.818  1.00 114.27 ? 498  ILE A CD1 1 
ATOM 3897  N N   . SER A 1 502  ? 40.150  -0.573  29.064  1.00 114.09 ? 499  SER A N   1 
ATOM 3898  C CA  . SER A 1 502  ? 39.567  0.660   29.589  1.00 113.97 ? 499  SER A CA  1 
ATOM 3899  C C   . SER A 1 502  ? 39.254  0.564   31.087  1.00 114.03 ? 499  SER A C   1 
ATOM 3900  O O   . SER A 1 502  ? 40.008  1.080   31.910  1.00 114.04 ? 499  SER A O   1 
ATOM 3901  C CB  . SER A 1 502  ? 38.334  1.072   28.775  1.00 113.93 ? 499  SER A CB  1 
ATOM 3902  O OG  . SER A 1 502  ? 37.459  -0.022  28.563  1.00 113.59 ? 499  SER A OG  1 
ATOM 3903  N N   . VAL A 1 503  ? 38.159  -0.106  31.441  1.00 114.13 ? 500  VAL A N   1 
ATOM 3904  C CA  . VAL A 1 503  ? 37.741  -0.202  32.841  1.00 114.26 ? 500  VAL A CA  1 
ATOM 3905  C C   . VAL A 1 503  ? 38.263  -1.487  33.469  1.00 114.40 ? 500  VAL A C   1 
ATOM 3906  O O   . VAL A 1 503  ? 38.329  -2.519  32.804  1.00 114.38 ? 500  VAL A O   1 
ATOM 3907  C CB  . VAL A 1 503  ? 36.201  -0.126  33.004  1.00 114.26 ? 500  VAL A CB  1 
ATOM 3908  C CG1 . VAL A 1 503  ? 35.834  0.177   34.448  1.00 114.44 ? 500  VAL A CG1 1 
ATOM 3909  C CG2 . VAL A 1 503  ? 35.606  0.940   32.095  1.00 114.36 ? 500  VAL A CG2 1 
ATOM 3910  N N   . ALA A 1 504  ? 38.629  -1.409  34.750  1.00 114.73 ? 501  ALA A N   1 
ATOM 3911  C CA  . ALA A 1 504  ? 39.197  -2.539  35.497  1.00 115.03 ? 501  ALA A CA  1 
ATOM 3912  C C   . ALA A 1 504  ? 38.645  -2.670  36.924  1.00 115.19 ? 501  ALA A C   1 
ATOM 3913  O O   . ALA A 1 504  ? 38.355  -1.670  37.582  1.00 115.17 ? 501  ALA A O   1 
ATOM 3914  C CB  . ALA A 1 504  ? 40.720  -2.432  35.530  1.00 115.03 ? 501  ALA A CB  1 
ATOM 3915  N N   . SER A 1 505  ? 38.510  -3.913  37.387  1.00 115.47 ? 502  SER A N   1 
ATOM 3916  C CA  . SER A 1 505  ? 38.087  -4.222  38.761  1.00 115.71 ? 502  SER A CA  1 
ATOM 3917  C C   . SER A 1 505  ? 38.772  -5.511  39.217  1.00 115.88 ? 502  SER A C   1 
ATOM 3918  O O   . SER A 1 505  ? 38.882  -6.455  38.432  1.00 115.99 ? 502  SER A O   1 
ATOM 3919  C CB  . SER A 1 505  ? 36.567  -4.385  38.835  1.00 115.62 ? 502  SER A CB  1 
ATOM 3920  O OG  . SER A 1 505  ? 35.905  -3.264  38.284  1.00 115.44 ? 502  SER A OG  1 
ATOM 3921  N N   . CYS A 1 506  ? 39.237  -5.554  40.468  1.00 116.02 ? 503  CYS A N   1 
ATOM 3922  C CA  . CYS A 1 506  ? 40.007  -6.710  40.956  1.00 116.05 ? 503  CYS A CA  1 
ATOM 3923  C C   . CYS A 1 506  ? 40.096  -6.858  42.477  1.00 116.08 ? 503  CYS A C   1 
ATOM 3924  O O   . CYS A 1 506  ? 40.202  -5.870  43.211  1.00 116.04 ? 503  CYS A O   1 
ATOM 3925  C CB  . CYS A 1 506  ? 41.417  -6.713  40.350  1.00 116.07 ? 503  CYS A CB  1 
ATOM 3926  S SG  . CYS A 1 506  ? 42.551  -7.948  41.042  1.00 116.21 ? 503  CYS A SG  1 
ATOM 3927  N N   . ASN A 1 507  ? 40.068  -8.114  42.923  1.00 116.08 ? 504  ASN A N   1 
ATOM 3928  C CA  . ASN A 1 507  ? 40.269  -8.475  44.331  1.00 116.07 ? 504  ASN A CA  1 
ATOM 3929  C C   . ASN A 1 507  ? 41.437  -9.468  44.516  1.00 115.93 ? 504  ASN A C   1 
ATOM 3930  O O   . ASN A 1 507  ? 42.520  -9.255  43.964  1.00 116.02 ? 504  ASN A O   1 
ATOM 3931  C CB  . ASN A 1 507  ? 38.959  -8.985  44.956  1.00 116.12 ? 504  ASN A CB  1 
ATOM 3932  C CG  . ASN A 1 507  ? 38.296  -10.079 44.133  1.00 116.04 ? 504  ASN A CG  1 
ATOM 3933  O OD1 . ASN A 1 507  ? 38.762  -11.218 44.105  1.00 116.13 ? 504  ASN A OD1 1 
ATOM 3934  N ND2 . ASN A 1 507  ? 37.188  -9.740  43.478  1.00 115.66 ? 504  ASN A ND2 1 
ATOM 3935  N N   . SER A 1 508  ? 41.225  -10.540 45.282  1.00 115.63 ? 505  SER A N   1 
ATOM 3936  C CA  . SER A 1 508  ? 42.283  -11.522 45.539  1.00 115.29 ? 505  SER A CA  1 
ATOM 3937  C C   . SER A 1 508  ? 42.523  -12.445 44.344  1.00 115.07 ? 505  SER A C   1 
ATOM 3938  O O   . SER A 1 508  ? 43.624  -12.486 43.795  1.00 115.02 ? 505  SER A O   1 
ATOM 3939  C CB  . SER A 1 508  ? 41.969  -12.346 46.793  1.00 115.30 ? 505  SER A CB  1 
ATOM 3940  O OG  . SER A 1 508  ? 42.960  -13.336 47.016  1.00 115.16 ? 505  SER A OG  1 
ATOM 3941  N N   . SER A 1 509  ? 41.485  -13.177 43.950  1.00 114.74 ? 506  SER A N   1 
ATOM 3942  C CA  . SER A 1 509  ? 41.603  -14.189 42.907  1.00 114.38 ? 506  SER A CA  1 
ATOM 3943  C C   . SER A 1 509  ? 40.477  -14.055 41.882  1.00 114.07 ? 506  SER A C   1 
ATOM 3944  O O   . SER A 1 509  ? 39.872  -15.050 41.472  1.00 114.15 ? 506  SER A O   1 
ATOM 3945  C CB  . SER A 1 509  ? 41.608  -15.592 43.532  1.00 114.45 ? 506  SER A CB  1 
ATOM 3946  O OG  . SER A 1 509  ? 42.559  -15.690 44.583  1.00 114.46 ? 506  SER A OG  1 
ATOM 3947  N N   . GLN A 1 510  ? 40.215  -12.817 41.465  1.00 113.62 ? 507  GLN A N   1 
ATOM 3948  C CA  . GLN A 1 510  ? 39.106  -12.501 40.558  1.00 113.18 ? 507  GLN A CA  1 
ATOM 3949  C C   . GLN A 1 510  ? 39.322  -11.145 39.872  1.00 112.92 ? 507  GLN A C   1 
ATOM 3950  O O   . GLN A 1 510  ? 39.633  -10.153 40.540  1.00 113.03 ? 507  GLN A O   1 
ATOM 3951  C CB  . GLN A 1 510  ? 37.783  -12.505 41.337  1.00 113.19 ? 507  GLN A CB  1 
ATOM 3952  C CG  . GLN A 1 510  ? 36.532  -12.298 40.506  1.00 112.90 ? 507  GLN A CG  1 
ATOM 3953  C CD  . GLN A 1 510  ? 35.274  -12.385 41.340  1.00 113.01 ? 507  GLN A CD  1 
ATOM 3954  O OE1 . GLN A 1 510  ? 35.069  -13.350 42.077  1.00 112.80 ? 507  GLN A OE1 1 
ATOM 3955  N NE2 . GLN A 1 510  ? 34.420  -11.375 41.227  1.00 112.80 ? 507  GLN A NE2 1 
ATOM 3956  N N   . VAL A 1 511  ? 39.163  -11.113 38.545  1.00 112.40 ? 508  VAL A N   1 
ATOM 3957  C CA  . VAL A 1 511  ? 39.344  -9.887  37.740  1.00 111.89 ? 508  VAL A CA  1 
ATOM 3958  C C   . VAL A 1 511  ? 38.289  -9.761  36.621  1.00 111.47 ? 508  VAL A C   1 
ATOM 3959  O O   . VAL A 1 511  ? 38.072  -10.703 35.860  1.00 111.49 ? 508  VAL A O   1 
ATOM 3960  C CB  . VAL A 1 511  ? 40.775  -9.800  37.102  1.00 111.95 ? 508  VAL A CB  1 
ATOM 3961  C CG1 . VAL A 1 511  ? 41.017  -8.428  36.460  1.00 112.00 ? 508  VAL A CG1 1 
ATOM 3962  C CG2 . VAL A 1 511  ? 41.872  -10.104 38.121  1.00 111.91 ? 508  VAL A CG2 1 
ATOM 3963  N N   . VAL A 1 512  ? 37.637  -8.598  36.537  1.00 110.89 ? 509  VAL A N   1 
ATOM 3964  C CA  . VAL A 1 512  ? 36.761  -8.247  35.408  1.00 110.25 ? 509  VAL A CA  1 
ATOM 3965  C C   . VAL A 1 512  ? 37.282  -6.965  34.751  1.00 110.07 ? 509  VAL A C   1 
ATOM 3966  O O   . VAL A 1 512  ? 37.485  -5.952  35.428  1.00 110.04 ? 509  VAL A O   1 
ATOM 3967  C CB  . VAL A 1 512  ? 35.272  -8.068  35.839  1.00 110.11 ? 509  VAL A CB  1 
ATOM 3968  C CG1 . VAL A 1 512  ? 34.443  -7.443  34.723  1.00 109.74 ? 509  VAL A CG1 1 
ATOM 3969  C CG2 . VAL A 1 512  ? 34.668  -9.391  36.244  1.00 109.87 ? 509  VAL A CG2 1 
ATOM 3970  N N   . VAL A 1 513  ? 37.510  -7.022  33.438  1.00 109.74 ? 510  VAL A N   1 
ATOM 3971  C CA  . VAL A 1 513  ? 37.974  -5.858  32.668  1.00 109.36 ? 510  VAL A CA  1 
ATOM 3972  C C   . VAL A 1 513  ? 36.980  -5.427  31.580  1.00 109.07 ? 510  VAL A C   1 
ATOM 3973  O O   . VAL A 1 513  ? 35.886  -5.990  31.463  1.00 108.98 ? 510  VAL A O   1 
ATOM 3974  C CB  . VAL A 1 513  ? 39.396  -6.065  32.049  1.00 109.37 ? 510  VAL A CB  1 
ATOM 3975  C CG1 . VAL A 1 513  ? 40.483  -5.894  33.107  1.00 109.30 ? 510  VAL A CG1 1 
ATOM 3976  C CG2 . VAL A 1 513  ? 39.506  -7.415  31.342  1.00 109.29 ? 510  VAL A CG2 1 
ATOM 3977  N N   . ALA A 1 514  ? 37.369  -4.417  30.803  1.00 108.71 ? 511  ALA A N   1 
ATOM 3978  C CA  . ALA A 1 514  ? 36.557  -3.914  29.705  1.00 108.39 ? 511  ALA A CA  1 
ATOM 3979  C C   . ALA A 1 514  ? 37.429  -3.268  28.640  1.00 108.22 ? 511  ALA A C   1 
ATOM 3980  O O   . ALA A 1 514  ? 38.317  -2.473  28.956  1.00 108.07 ? 511  ALA A O   1 
ATOM 3981  C CB  . ALA A 1 514  ? 35.529  -2.928  30.214  1.00 108.47 ? 511  ALA A CB  1 
ATOM 3982  N N   . VAL A 1 515  ? 37.161  -3.617  27.382  1.00 108.08 ? 512  VAL A N   1 
ATOM 3983  C CA  . VAL A 1 515  ? 37.905  -3.105  26.226  1.00 107.93 ? 512  VAL A CA  1 
ATOM 3984  C C   . VAL A 1 515  ? 37.017  -2.168  25.412  1.00 107.76 ? 512  VAL A C   1 
ATOM 3985  O O   . VAL A 1 515  ? 37.196  -2.010  24.204  1.00 107.66 ? 512  VAL A O   1 
ATOM 3986  C CB  . VAL A 1 515  ? 38.381  -4.260  25.308  1.00 107.97 ? 512  VAL A CB  1 
ATOM 3987  C CG1 . VAL A 1 515  ? 39.615  -3.846  24.520  1.00 108.09 ? 512  VAL A CG1 1 
ATOM 3988  C CG2 . VAL A 1 515  ? 38.674  -5.517  26.117  1.00 108.02 ? 512  VAL A CG2 1 
ATOM 3989  N N   . GLY A 1 516  ? 36.070  -1.530  26.093  1.00 107.77 ? 513  GLY A N   1 
ATOM 3990  C CA  . GLY A 1 516  ? 34.981  -0.826  25.433  1.00 107.65 ? 513  GLY A CA  1 
ATOM 3991  C C   . GLY A 1 516  ? 33.982  -1.879  25.009  1.00 107.61 ? 513  GLY A C   1 
ATOM 3992  O O   . GLY A 1 516  ? 34.268  -2.691  24.132  1.00 107.53 ? 513  GLY A O   1 
ATOM 3993  N N   . ARG A 1 517  ? 32.738  -1.903  25.424  1.00 107.67 ? 514  ARG A N   1 
ATOM 3994  C CA  . ARG A 1 517  ? 31.751  -2.866  25.437  1.00 107.75 ? 514  ARG A CA  1 
ATOM 3995  C C   . ARG A 1 517  ? 32.155  -4.308  25.753  1.00 107.85 ? 514  ARG A C   1 
ATOM 3996  O O   . ARG A 1 517  ? 31.330  -5.094  26.217  1.00 107.80 ? 514  ARG A O   1 
ATOM 3997  C CB  . ARG A 1 517  ? 31.179  -2.793  24.013  1.00 107.76 ? 514  ARG A CB  1 
ATOM 3998  C CG  . ARG A 1 517  ? 30.992  -1.390  23.444  1.00 107.57 ? 514  ARG A CG  1 
ATOM 3999  C CD  . ARG A 1 517  ? 29.883  -1.338  22.391  1.00 107.37 ? 514  ARG A CD  1 
ATOM 4000  N NE  . ARG A 1 517  ? 29.919  -2.460  21.449  1.00 106.82 ? 514  ARG A NE  1 
ATOM 4001  C CZ  . ARG A 1 517  ? 30.706  -2.532  20.379  1.00 106.30 ? 514  ARG A CZ  1 
ATOM 4002  N NH1 . ARG A 1 517  ? 31.552  -1.549  20.087  1.00 106.04 ? 514  ARG A NH1 1 
ATOM 4003  N NH2 . ARG A 1 517  ? 30.647  -3.599  19.599  1.00 106.21 ? 514  ARG A NH2 1 
ATOM 4004  N N   . ALA A 1 518  ? 33.416  -4.647  25.494  1.00 108.11 ? 515  ALA A N   1 
ATOM 4005  C CA  . ALA A 1 518  ? 33.907  -6.016  25.639  1.00 108.51 ? 515  ALA A CA  1 
ATOM 4006  C C   . ALA A 1 518  ? 34.213  -6.354  27.089  1.00 108.79 ? 515  ALA A C   1 
ATOM 4007  O O   . ALA A 1 518  ? 34.670  -5.500  27.847  1.00 108.78 ? 515  ALA A O   1 
ATOM 4008  C CB  . ALA A 1 518  ? 35.138  -6.232  24.772  1.00 108.47 ? 515  ALA A CB  1 
ATOM 4009  N N   . LEU A 1 519  ? 33.957  -7.603  27.468  1.00 109.19 ? 516  LEU A N   1 
ATOM 4010  C CA  . LEU A 1 519  ? 34.205  -8.056  28.835  1.00 109.62 ? 516  LEU A CA  1 
ATOM 4011  C C   . LEU A 1 519  ? 35.028  -9.340  28.893  1.00 109.93 ? 516  LEU A C   1 
ATOM 4012  O O   . LEU A 1 519  ? 34.946  -10.185 28.001  1.00 109.97 ? 516  LEU A O   1 
ATOM 4013  C CB  . LEU A 1 519  ? 32.888  -8.248  29.599  1.00 109.61 ? 516  LEU A CB  1 
ATOM 4014  C CG  . LEU A 1 519  ? 31.962  -7.059  29.881  1.00 109.55 ? 516  LEU A CG  1 
ATOM 4015  C CD1 . LEU A 1 519  ? 30.770  -7.532  30.701  1.00 109.48 ? 516  LEU A CD1 1 
ATOM 4016  C CD2 . LEU A 1 519  ? 32.686  -5.925  30.597  1.00 109.39 ? 516  LEU A CD2 1 
ATOM 4017  N N   . TYR A 1 520  ? 35.818  -9.469  29.957  1.00 110.30 ? 517  TYR A N   1 
ATOM 4018  C CA  . TYR A 1 520  ? 36.607  -10.670 30.227  1.00 110.65 ? 517  TYR A CA  1 
ATOM 4019  C C   . TYR A 1 520  ? 36.699  -10.932 31.731  1.00 110.89 ? 517  TYR A C   1 
ATOM 4020  O O   . TYR A 1 520  ? 36.751  -9.988  32.524  1.00 111.00 ? 517  TYR A O   1 
ATOM 4021  C CB  . TYR A 1 520  ? 38.016  -10.542 29.638  1.00 110.66 ? 517  TYR A CB  1 
ATOM 4022  C CG  . TYR A 1 520  ? 38.056  -10.437 28.132  1.00 110.60 ? 517  TYR A CG  1 
ATOM 4023  C CD1 . TYR A 1 520  ? 38.354  -9.229  27.510  1.00 110.59 ? 517  TYR A CD1 1 
ATOM 4024  C CD2 . TYR A 1 520  ? 37.789  -11.544 27.330  1.00 110.59 ? 517  TYR A CD2 1 
ATOM 4025  C CE1 . TYR A 1 520  ? 38.394  -9.127  26.126  1.00 110.76 ? 517  TYR A CE1 1 
ATOM 4026  C CE2 . TYR A 1 520  ? 37.825  -11.453 25.946  1.00 110.73 ? 517  TYR A CE2 1 
ATOM 4027  C CZ  . TYR A 1 520  ? 38.127  -10.241 25.350  1.00 110.77 ? 517  TYR A CZ  1 
ATOM 4028  O OH  . TYR A 1 520  ? 38.164  -10.144 23.977  1.00 110.74 ? 517  TYR A OH  1 
ATOM 4029  N N   . TYR A 1 521  ? 36.719  -12.211 32.108  1.00 111.08 ? 518  TYR A N   1 
ATOM 4030  C CA  . TYR A 1 521  ? 36.873  -12.630 33.505  1.00 111.22 ? 518  TYR A CA  1 
ATOM 4031  C C   . TYR A 1 521  ? 38.161  -13.440 33.668  1.00 111.43 ? 518  TYR A C   1 
ATOM 4032  O O   . TYR A 1 521  ? 38.365  -14.427 32.966  1.00 111.58 ? 518  TYR A O   1 
ATOM 4033  C CB  . TYR A 1 521  ? 35.630  -13.412 33.972  1.00 111.08 ? 518  TYR A CB  1 
ATOM 4034  C CG  . TYR A 1 521  ? 35.793  -14.207 35.254  1.00 110.93 ? 518  TYR A CG  1 
ATOM 4035  C CD1 . TYR A 1 521  ? 36.309  -13.623 36.408  1.00 110.84 ? 518  TYR A CD1 1 
ATOM 4036  C CD2 . TYR A 1 521  ? 35.403  -15.544 35.315  1.00 111.14 ? 518  TYR A CD2 1 
ATOM 4037  C CE1 . TYR A 1 521  ? 36.456  -14.356 37.584  1.00 111.05 ? 518  TYR A CE1 1 
ATOM 4038  C CE2 . TYR A 1 521  ? 35.540  -16.285 36.491  1.00 111.14 ? 518  TYR A CE2 1 
ATOM 4039  C CZ  . TYR A 1 521  ? 36.071  -15.685 37.620  1.00 111.01 ? 518  TYR A CZ  1 
ATOM 4040  O OH  . TYR A 1 521  ? 36.212  -16.405 38.784  1.00 110.83 ? 518  TYR A OH  1 
ATOM 4041  N N   . LEU A 1 522  ? 39.030  -13.005 34.582  1.00 111.71 ? 519  LEU A N   1 
ATOM 4042  C CA  . LEU A 1 522  ? 40.336  -13.645 34.796  1.00 112.02 ? 519  LEU A CA  1 
ATOM 4043  C C   . LEU A 1 522  ? 40.401  -14.440 36.103  1.00 112.22 ? 519  LEU A C   1 
ATOM 4044  O O   . LEU A 1 522  ? 39.470  -14.410 36.911  1.00 112.24 ? 519  LEU A O   1 
ATOM 4045  C CB  . LEU A 1 522  ? 41.474  -12.609 34.768  1.00 112.00 ? 519  LEU A CB  1 
ATOM 4046  C CG  . LEU A 1 522  ? 41.717  -11.684 33.566  1.00 112.16 ? 519  LEU A CG  1 
ATOM 4047  C CD1 . LEU A 1 522  ? 42.787  -10.646 33.911  1.00 112.10 ? 519  LEU A CD1 1 
ATOM 4048  C CD2 . LEU A 1 522  ? 42.094  -12.450 32.293  1.00 112.06 ? 519  LEU A CD2 1 
ATOM 4049  N N   . GLN A 1 523  ? 41.509  -15.155 36.290  1.00 112.47 ? 520  GLN A N   1 
ATOM 4050  C CA  . GLN A 1 523  ? 41.796  -15.870 37.532  1.00 112.70 ? 520  GLN A CA  1 
ATOM 4051  C C   . GLN A 1 523  ? 43.289  -15.836 37.827  1.00 112.74 ? 520  GLN A C   1 
ATOM 4052  O O   . GLN A 1 523  ? 44.109  -15.808 36.906  1.00 112.77 ? 520  GLN A O   1 
ATOM 4053  C CB  . GLN A 1 523  ? 41.311  -17.322 37.460  1.00 112.72 ? 520  GLN A CB  1 
ATOM 4054  C CG  . GLN A 1 523  ? 40.080  -17.624 38.312  1.00 112.87 ? 520  GLN A CG  1 
ATOM 4055  C CD  . GLN A 1 523  ? 39.737  -19.110 38.352  1.00 112.89 ? 520  GLN A CD  1 
ATOM 4056  O OE1 . GLN A 1 523  ? 39.787  -19.800 37.332  1.00 113.05 ? 520  GLN A OE1 1 
ATOM 4057  N NE2 . GLN A 1 523  ? 39.386  -19.607 39.536  1.00 113.16 ? 520  GLN A NE2 1 
ATOM 4058  N N   . ILE A 1 524  ? 43.629  -15.824 39.114  1.00 112.82 ? 521  ILE A N   1 
ATOM 4059  C CA  . ILE A 1 524  ? 45.022  -15.900 39.556  1.00 112.88 ? 521  ILE A CA  1 
ATOM 4060  C C   . ILE A 1 524  ? 45.212  -17.121 40.459  1.00 112.84 ? 521  ILE A C   1 
ATOM 4061  O O   . ILE A 1 524  ? 44.420  -17.360 41.375  1.00 112.88 ? 521  ILE A O   1 
ATOM 4062  C CB  . ILE A 1 524  ? 45.486  -14.613 40.306  1.00 112.91 ? 521  ILE A CB  1 
ATOM 4063  C CG1 . ILE A 1 524  ? 44.957  -13.332 39.636  1.00 113.07 ? 521  ILE A CG1 1 
ATOM 4064  C CG2 . ILE A 1 524  ? 47.012  -14.591 40.450  1.00 113.00 ? 521  ILE A CG2 1 
ATOM 4065  C CD1 . ILE A 1 524  ? 45.562  -13.010 38.269  1.00 113.45 ? 521  ILE A CD1 1 
ATOM 4066  N N   . HIS A 1 525  ? 46.259  -17.893 40.177  1.00 112.77 ? 522  HIS A N   1 
ATOM 4067  C CA  . HIS A 1 525  ? 46.604  -19.088 40.950  1.00 112.65 ? 522  HIS A CA  1 
ATOM 4068  C C   . HIS A 1 525  ? 48.117  -19.062 41.223  1.00 112.62 ? 522  HIS A C   1 
ATOM 4069  O O   . HIS A 1 525  ? 48.727  -17.994 41.120  1.00 112.70 ? 522  HIS A O   1 
ATOM 4070  C CB  . HIS A 1 525  ? 46.171  -20.343 40.184  1.00 112.56 ? 522  HIS A CB  1 
ATOM 4071  C CG  . HIS A 1 525  ? 44.753  -20.298 39.714  1.00 112.20 ? 522  HIS A CG  1 
ATOM 4072  N ND1 . HIS A 1 525  ? 43.690  -20.632 40.525  1.00 112.00 ? 522  HIS A ND1 1 
ATOM 4073  C CD2 . HIS A 1 525  ? 44.220  -19.935 38.524  1.00 111.80 ? 522  HIS A CD2 1 
ATOM 4074  C CE1 . HIS A 1 525  ? 42.563  -20.487 39.851  1.00 111.90 ? 522  HIS A CE1 1 
ATOM 4075  N NE2 . HIS A 1 525  ? 42.858  -20.066 38.634  1.00 111.81 ? 522  HIS A NE2 1 
ATOM 4076  N N   . PRO A 1 526  ? 48.730  -20.208 41.602  1.00 112.52 ? 523  PRO A N   1 
ATOM 4077  C CA  . PRO A 1 526  ? 50.196  -20.181 41.636  1.00 112.39 ? 523  PRO A CA  1 
ATOM 4078  C C   . PRO A 1 526  ? 50.842  -19.835 40.274  1.00 112.24 ? 523  PRO A C   1 
ATOM 4079  O O   . PRO A 1 526  ? 50.807  -20.641 39.338  1.00 112.26 ? 523  PRO A O   1 
ATOM 4080  C CB  . PRO A 1 526  ? 50.566  -21.605 42.084  1.00 112.40 ? 523  PRO A CB  1 
ATOM 4081  C CG  . PRO A 1 526  ? 49.359  -22.107 42.800  1.00 112.37 ? 523  PRO A CG  1 
ATOM 4082  C CD  . PRO A 1 526  ? 48.201  -21.510 42.058  1.00 112.50 ? 523  PRO A CD  1 
ATOM 4083  N N   . GLN A 1 527  ? 51.376  -18.614 40.184  1.00 111.97 ? 524  GLN A N   1 
ATOM 4084  C CA  . GLN A 1 527  ? 52.299  -18.167 39.115  1.00 111.66 ? 524  GLN A CA  1 
ATOM 4085  C C   . GLN A 1 527  ? 51.750  -17.824 37.714  1.00 111.39 ? 524  GLN A C   1 
ATOM 4086  O O   . GLN A 1 527  ? 52.445  -17.179 36.928  1.00 111.37 ? 524  GLN A O   1 
ATOM 4087  C CB  . GLN A 1 527  ? 53.532  -19.084 39.008  1.00 111.74 ? 524  GLN A CB  1 
ATOM 4088  C CG  . GLN A 1 527  ? 54.526  -18.926 40.160  1.00 111.75 ? 524  GLN A CG  1 
ATOM 4089  C CD  . GLN A 1 527  ? 55.933  -19.367 39.791  1.00 111.67 ? 524  GLN A CD  1 
ATOM 4090  O OE1 . GLN A 1 527  ? 56.528  -18.855 38.841  1.00 111.68 ? 524  GLN A OE1 1 
ATOM 4091  N NE2 . GLN A 1 527  ? 56.475  -20.313 40.550  1.00 111.45 ? 524  GLN A NE2 1 
ATOM 4092  N N   . GLU A 1 528  ? 50.532  -18.250 37.392  1.00 111.03 ? 525  GLU A N   1 
ATOM 4093  C CA  . GLU A 1 528  ? 50.014  -18.071 36.024  1.00 110.74 ? 525  GLU A CA  1 
ATOM 4094  C C   . GLU A 1 528  ? 48.725  -17.248 35.902  1.00 110.38 ? 525  GLU A C   1 
ATOM 4095  O O   . GLU A 1 528  ? 47.913  -17.210 36.828  1.00 110.35 ? 525  GLU A O   1 
ATOM 4096  C CB  . GLU A 1 528  ? 49.877  -19.416 35.285  1.00 110.87 ? 525  GLU A CB  1 
ATOM 4097  C CG  . GLU A 1 528  ? 49.618  -20.650 36.160  1.00 111.28 ? 525  GLU A CG  1 
ATOM 4098  C CD  . GLU A 1 528  ? 48.284  -20.620 36.897  1.00 111.90 ? 525  GLU A CD  1 
ATOM 4099  O OE1 . GLU A 1 528  ? 48.227  -21.168 38.019  1.00 111.88 ? 525  GLU A OE1 1 
ATOM 4100  O OE2 . GLU A 1 528  ? 47.298  -20.060 36.364  1.00 112.18 ? 525  GLU A OE2 1 
ATOM 4101  N N   . LEU A 1 529  ? 48.557  -16.606 34.742  1.00 109.93 ? 526  LEU A N   1 
ATOM 4102  C CA  . LEU A 1 529  ? 47.387  -15.776 34.435  1.00 109.52 ? 526  LEU A CA  1 
ATOM 4103  C C   . LEU A 1 529  ? 46.445  -16.528 33.494  1.00 109.26 ? 526  LEU A C   1 
ATOM 4104  O O   . LEU A 1 529  ? 46.761  -16.711 32.317  1.00 109.25 ? 526  LEU A O   1 
ATOM 4105  C CB  . LEU A 1 529  ? 47.831  -14.456 33.781  1.00 109.51 ? 526  LEU A CB  1 
ATOM 4106  C CG  . LEU A 1 529  ? 47.030  -13.137 33.853  1.00 109.39 ? 526  LEU A CG  1 
ATOM 4107  C CD1 . LEU A 1 529  ? 45.514  -13.319 33.756  1.00 109.35 ? 526  LEU A CD1 1 
ATOM 4108  C CD2 . LEU A 1 529  ? 47.379  -12.333 35.095  1.00 109.23 ? 526  LEU A CD2 1 
ATOM 4109  N N   . ARG A 1 530  ? 45.288  -16.945 34.011  1.00 108.95 ? 527  ARG A N   1 
ATOM 4110  C CA  . ARG A 1 530  ? 44.331  -17.750 33.237  1.00 108.59 ? 527  ARG A CA  1 
ATOM 4111  C C   . ARG A 1 530  ? 42.988  -17.049 32.988  1.00 108.42 ? 527  ARG A C   1 
ATOM 4112  O O   . ARG A 1 530  ? 42.285  -16.662 33.927  1.00 108.33 ? 527  ARG A O   1 
ATOM 4113  C CB  . ARG A 1 530  ? 44.116  -19.124 33.889  1.00 108.62 ? 527  ARG A CB  1 
ATOM 4114  C CG  . ARG A 1 530  ? 43.383  -20.126 33.002  1.00 108.44 ? 527  ARG A CG  1 
ATOM 4115  C CD  . ARG A 1 530  ? 43.408  -21.537 33.575  1.00 108.43 ? 527  ARG A CD  1 
ATOM 4116  N NE  . ARG A 1 530  ? 44.725  -22.164 33.462  1.00 108.19 ? 527  ARG A NE  1 
ATOM 4117  C CZ  . ARG A 1 530  ? 45.450  -22.599 34.490  1.00 108.12 ? 527  ARG A CZ  1 
ATOM 4118  N NH1 . ARG A 1 530  ? 44.994  -22.495 35.731  1.00 108.10 ? 527  ARG A NH1 1 
ATOM 4119  N NH2 . ARG A 1 530  ? 46.635  -23.154 34.276  1.00 108.07 ? 527  ARG A NH2 1 
ATOM 4120  N N   . GLN A 1 531  ? 42.651  -16.919 31.704  1.00 108.19 ? 528  GLN A N   1 
ATOM 4121  C CA  . GLN A 1 531  ? 41.438  -16.248 31.221  1.00 107.97 ? 528  GLN A CA  1 
ATOM 4122  C C   . GLN A 1 531  ? 40.225  -17.183 31.253  1.00 107.73 ? 528  GLN A C   1 
ATOM 4123  O O   . GLN A 1 531  ? 40.380  -18.403 31.164  1.00 107.82 ? 528  GLN A O   1 
ATOM 4124  C CB  . GLN A 1 531  ? 41.682  -15.752 29.787  1.00 107.96 ? 528  GLN A CB  1 
ATOM 4125  C CG  . GLN A 1 531  ? 40.602  -14.850 29.188  1.00 108.04 ? 528  GLN A CG  1 
ATOM 4126  C CD  . GLN A 1 531  ? 40.830  -14.553 27.708  1.00 108.11 ? 528  GLN A CD  1 
ATOM 4127  O OE1 . GLN A 1 531  ? 41.558  -15.267 27.015  1.00 108.39 ? 528  GLN A OE1 1 
ATOM 4128  N NE2 . GLN A 1 531  ? 40.198  -13.495 27.218  1.00 108.30 ? 528  GLN A NE2 1 
ATOM 4129  N N   . ILE A 1 532  ? 39.026  -16.609 31.382  1.00 107.39 ? 529  ILE A N   1 
ATOM 4130  C CA  . ILE A 1 532  ? 37.772  -17.380 31.368  1.00 107.06 ? 529  ILE A CA  1 
ATOM 4131  C C   . ILE A 1 532  ? 36.733  -16.733 30.425  1.00 106.98 ? 529  ILE A C   1 
ATOM 4132  O O   . ILE A 1 532  ? 37.068  -16.386 29.292  1.00 106.85 ? 529  ILE A O   1 
ATOM 4133  C CB  . ILE A 1 532  ? 37.232  -17.659 32.815  1.00 106.99 ? 529  ILE A CB  1 
ATOM 4134  C CG1 . ILE A 1 532  ? 38.320  -18.339 33.658  1.00 106.80 ? 529  ILE A CG1 1 
ATOM 4135  C CG2 . ILE A 1 532  ? 36.004  -18.580 32.787  1.00 106.82 ? 529  ILE A CG2 1 
ATOM 4136  C CD1 . ILE A 1 532  ? 38.182  -18.150 35.144  1.00 106.57 ? 529  ILE A CD1 1 
ATOM 4137  N N   . SER A 1 533  ? 35.498  -16.560 30.896  1.00 106.98 ? 530  SER A N   1 
ATOM 4138  C CA  . SER A 1 533  ? 34.354  -16.186 30.050  1.00 107.05 ? 530  SER A CA  1 
ATOM 4139  C C   . SER A 1 533  ? 34.475  -14.807 29.372  1.00 107.13 ? 530  SER A C   1 
ATOM 4140  O O   . SER A 1 533  ? 35.372  -14.024 29.697  1.00 107.19 ? 530  SER A O   1 
ATOM 4141  C CB  . SER A 1 533  ? 33.055  -16.269 30.862  1.00 107.03 ? 530  SER A CB  1 
ATOM 4142  O OG  . SER A 1 533  ? 33.017  -17.435 31.669  1.00 106.94 ? 530  SER A OG  1 
ATOM 4143  N N   . HIS A 1 534  ? 33.568  -14.530 28.430  1.00 107.17 ? 531  HIS A N   1 
ATOM 4144  C CA  . HIS A 1 534  ? 33.535  -13.262 27.673  1.00 107.06 ? 531  HIS A CA  1 
ATOM 4145  C C   . HIS A 1 534  ? 32.143  -12.957 27.093  1.00 106.94 ? 531  HIS A C   1 
ATOM 4146  O O   . HIS A 1 534  ? 31.507  -13.829 26.485  1.00 106.98 ? 531  HIS A O   1 
ATOM 4147  C CB  . HIS A 1 534  ? 34.601  -13.268 26.556  1.00 107.11 ? 531  HIS A CB  1 
ATOM 4148  C CG  . HIS A 1 534  ? 34.284  -12.372 25.394  1.00 107.14 ? 531  HIS A CG  1 
ATOM 4149  N ND1 . HIS A 1 534  ? 34.342  -10.996 25.473  1.00 107.24 ? 531  HIS A ND1 1 
ATOM 4150  C CD2 . HIS A 1 534  ? 33.916  -12.660 24.123  1.00 107.03 ? 531  HIS A CD2 1 
ATOM 4151  C CE1 . HIS A 1 534  ? 34.016  -10.476 24.303  1.00 107.08 ? 531  HIS A CE1 1 
ATOM 4152  N NE2 . HIS A 1 534  ? 33.753  -11.464 23.466  1.00 106.97 ? 531  HIS A NE2 1 
ATOM 4153  N N   . THR A 1 535  ? 31.678  -11.722 27.292  1.00 106.65 ? 532  THR A N   1 
ATOM 4154  C CA  . THR A 1 535  ? 30.442  -11.238 26.663  1.00 106.34 ? 532  THR A CA  1 
ATOM 4155  C C   . THR A 1 535  ? 30.532  -9.745  26.322  1.00 106.12 ? 532  THR A C   1 
ATOM 4156  O O   . THR A 1 535  ? 31.152  -8.963  27.041  1.00 105.96 ? 532  THR A O   1 
ATOM 4157  C CB  . THR A 1 535  ? 29.176  -11.541 27.521  1.00 106.35 ? 532  THR A CB  1 
ATOM 4158  O OG1 . THR A 1 535  ? 29.208  -12.902 27.968  1.00 106.33 ? 532  THR A OG1 1 
ATOM 4159  C CG2 . THR A 1 535  ? 27.898  -11.328 26.716  1.00 106.19 ? 532  THR A CG2 1 
ATOM 4160  N N   . GLU A 1 536  ? 29.924  -9.381  25.197  1.00 105.97 ? 533  GLU A N   1 
ATOM 4161  C CA  . GLU A 1 536  ? 29.839  -8.003  24.727  1.00 105.84 ? 533  GLU A CA  1 
ATOM 4162  C C   . GLU A 1 536  ? 28.617  -7.367  25.371  1.00 105.53 ? 533  GLU A C   1 
ATOM 4163  O O   . GLU A 1 536  ? 27.735  -8.074  25.866  1.00 105.35 ? 533  GLU A O   1 
ATOM 4164  C CB  . GLU A 1 536  ? 29.700  -7.995  23.198  1.00 105.98 ? 533  GLU A CB  1 
ATOM 4165  C CG  . GLU A 1 536  ? 30.293  -6.782  22.473  1.00 106.20 ? 533  GLU A CG  1 
ATOM 4166  C CD  . GLU A 1 536  ? 30.439  -7.004  20.966  1.00 106.20 ? 533  GLU A CD  1 
ATOM 4167  O OE1 . GLU A 1 536  ? 29.922  -6.171  20.187  1.00 106.61 ? 533  GLU A OE1 1 
ATOM 4168  O OE2 . GLU A 1 536  ? 31.065  -8.010  20.557  1.00 106.54 ? 533  GLU A OE2 1 
ATOM 4169  N N   . MET A 1 537  ? 28.564  -6.036  25.371  1.00 105.39 ? 534  MET A N   1 
ATOM 4170  C CA  . MET A 1 537  ? 27.469  -5.319  26.031  1.00 105.23 ? 534  MET A CA  1 
ATOM 4171  C C   . MET A 1 537  ? 26.886  -4.184  25.197  1.00 105.18 ? 534  MET A C   1 
ATOM 4172  O O   . MET A 1 537  ? 27.552  -3.640  24.318  1.00 105.02 ? 534  MET A O   1 
ATOM 4173  C CB  . MET A 1 537  ? 27.902  -4.805  27.410  1.00 105.27 ? 534  MET A CB  1 
ATOM 4174  C CG  . MET A 1 537  ? 28.418  -5.901  28.337  1.00 105.13 ? 534  MET A CG  1 
ATOM 4175  S SD  . MET A 1 537  ? 27.732  -5.862  29.997  1.00 104.99 ? 534  MET A SD  1 
ATOM 4176  C CE  . MET A 1 537  ? 25.979  -6.045  29.661  1.00 104.75 ? 534  MET A CE  1 
ATOM 4177  N N   . GLU A 1 538  ? 25.634  -3.844  25.503  1.00 105.28 ? 535  GLU A N   1 
ATOM 4178  C CA  . GLU A 1 538  ? 24.858  -2.818  24.798  1.00 105.52 ? 535  GLU A CA  1 
ATOM 4179  C C   . GLU A 1 538  ? 25.665  -1.617  24.301  1.00 105.83 ? 535  GLU A C   1 
ATOM 4180  O O   . GLU A 1 538  ? 25.700  -1.347  23.101  1.00 105.90 ? 535  GLU A O   1 
ATOM 4181  C CB  . GLU A 1 538  ? 23.704  -2.338  25.681  1.00 105.41 ? 535  GLU A CB  1 
ATOM 4182  C CG  . GLU A 1 538  ? 22.543  -3.309  25.785  1.00 105.09 ? 535  GLU A CG  1 
ATOM 4183  C CD  . GLU A 1 538  ? 21.473  -3.050  24.749  1.00 104.69 ? 535  GLU A CD  1 
ATOM 4184  O OE1 . GLU A 1 538  ? 21.745  -3.226  23.542  1.00 104.53 ? 535  GLU A OE1 1 
ATOM 4185  O OE2 . GLU A 1 538  ? 20.352  -2.674  25.147  1.00 104.53 ? 535  GLU A OE2 1 
ATOM 4186  N N   . HIS A 1 539  ? 26.305  -0.901  25.225  1.00 106.21 ? 536  HIS A N   1 
ATOM 4187  C CA  . HIS A 1 539  ? 27.099  0.287   24.895  1.00 106.53 ? 536  HIS A CA  1 
ATOM 4188  C C   . HIS A 1 539  ? 28.509  0.170   25.479  1.00 106.79 ? 536  HIS A C   1 
ATOM 4189  O O   . HIS A 1 539  ? 28.971  -0.939  25.765  1.00 106.85 ? 536  HIS A O   1 
ATOM 4190  C CB  . HIS A 1 539  ? 26.399  1.550   25.397  1.00 106.47 ? 536  HIS A CB  1 
ATOM 4191  C CG  . HIS A 1 539  ? 24.919  1.547   25.169  1.00 106.90 ? 536  HIS A CG  1 
ATOM 4192  N ND1 . HIS A 1 539  ? 24.351  1.893   23.963  1.00 107.26 ? 536  HIS A ND1 1 
ATOM 4193  C CD2 . HIS A 1 539  ? 23.892  1.225   25.990  1.00 107.27 ? 536  HIS A CD2 1 
ATOM 4194  C CE1 . HIS A 1 539  ? 23.036  1.791   24.052  1.00 107.26 ? 536  HIS A CE1 1 
ATOM 4195  N NE2 . HIS A 1 539  ? 22.732  1.387   25.272  1.00 107.42 ? 536  HIS A NE2 1 
ATOM 4196  N N   . GLU A 1 540  ? 29.193  1.302   25.650  1.00 107.05 ? 537  GLU A N   1 
ATOM 4197  C CA  . GLU A 1 540  ? 30.566  1.294   26.165  1.00 107.34 ? 537  GLU A CA  1 
ATOM 4198  C C   . GLU A 1 540  ? 30.625  1.313   27.682  1.00 107.31 ? 537  GLU A C   1 
ATOM 4199  O O   . GLU A 1 540  ? 29.940  2.100   28.327  1.00 107.33 ? 537  GLU A O   1 
ATOM 4200  C CB  . GLU A 1 540  ? 31.379  2.457   25.596  1.00 107.47 ? 537  GLU A CB  1 
ATOM 4201  C CG  . GLU A 1 540  ? 32.009  2.150   24.249  1.00 108.28 ? 537  GLU A CG  1 
ATOM 4202  C CD  . GLU A 1 540  ? 33.191  3.043   23.930  1.00 109.09 ? 537  GLU A CD  1 
ATOM 4203  O OE1 . GLU A 1 540  ? 33.170  4.234   24.335  1.00 109.09 ? 537  GLU A OE1 1 
ATOM 4204  O OE2 . GLU A 1 540  ? 34.133  2.545   23.265  1.00 109.07 ? 537  GLU A OE2 1 
ATOM 4205  N N   . VAL A 1 541  ? 31.462  0.447   28.243  1.00 107.35 ? 538  VAL A N   1 
ATOM 4206  C CA  . VAL A 1 541  ? 31.579  0.321   29.688  1.00 107.29 ? 538  VAL A CA  1 
ATOM 4207  C C   . VAL A 1 541  ? 32.198  1.584   30.279  1.00 107.44 ? 538  VAL A C   1 
ATOM 4208  O O   . VAL A 1 541  ? 33.309  1.975   29.913  1.00 107.37 ? 538  VAL A O   1 
ATOM 4209  C CB  . VAL A 1 541  ? 32.409  -0.914  30.091  1.00 107.16 ? 538  VAL A CB  1 
ATOM 4210  C CG1 . VAL A 1 541  ? 32.151  -1.263  31.536  1.00 107.25 ? 538  VAL A CG1 1 
ATOM 4211  C CG2 . VAL A 1 541  ? 32.067  -2.100  29.215  1.00 106.99 ? 538  VAL A CG2 1 
ATOM 4212  N N   . ALA A 1 542  ? 31.456  2.229   31.175  1.00 107.71 ? 539  ALA A N   1 
ATOM 4213  C CA  . ALA A 1 542  ? 31.952  3.403   31.892  1.00 107.99 ? 539  ALA A CA  1 
ATOM 4214  C C   . ALA A 1 542  ? 32.656  3.008   33.189  1.00 108.20 ? 539  ALA A C   1 
ATOM 4215  O O   . ALA A 1 542  ? 33.691  3.584   33.526  1.00 108.17 ? 539  ALA A O   1 
ATOM 4216  C CB  . ALA A 1 542  ? 30.826  4.389   32.167  1.00 107.87 ? 539  ALA A CB  1 
ATOM 4217  N N   . CYS A 1 543  ? 32.094  2.028   33.902  1.00 108.59 ? 540  CYS A N   1 
ATOM 4218  C CA  . CYS A 1 543  ? 32.685  1.511   35.145  1.00 108.95 ? 540  CYS A CA  1 
ATOM 4219  C C   . CYS A 1 543  ? 32.205  0.111   35.539  1.00 109.25 ? 540  CYS A C   1 
ATOM 4220  O O   . CYS A 1 543  ? 31.136  -0.332  35.119  1.00 109.13 ? 540  CYS A O   1 
ATOM 4221  C CB  . CYS A 1 543  ? 32.467  2.490   36.308  1.00 109.02 ? 540  CYS A CB  1 
ATOM 4222  S SG  . CYS A 1 543  ? 30.761  3.002   36.556  1.00 108.51 ? 540  CYS A SG  1 
ATOM 4223  N N   . LEU A 1 544  ? 33.017  -0.566  36.352  1.00 109.77 ? 541  LEU A N   1 
ATOM 4224  C CA  . LEU A 1 544  ? 32.719  -1.902  36.878  1.00 110.38 ? 541  LEU A CA  1 
ATOM 4225  C C   . LEU A 1 544  ? 33.062  -1.960  38.372  1.00 110.82 ? 541  LEU A C   1 
ATOM 4226  O O   . LEU A 1 544  ? 33.800  -1.106  38.864  1.00 110.84 ? 541  LEU A O   1 
ATOM 4227  C CB  . LEU A 1 544  ? 33.562  -2.961  36.154  1.00 110.30 ? 541  LEU A CB  1 
ATOM 4228  C CG  . LEU A 1 544  ? 33.780  -3.004  34.639  1.00 110.18 ? 541  LEU A CG  1 
ATOM 4229  C CD1 . LEU A 1 544  ? 35.223  -3.358  34.346  1.00 110.10 ? 541  LEU A CD1 1 
ATOM 4230  C CD2 . LEU A 1 544  ? 32.862  -4.006  33.975  1.00 110.14 ? 541  LEU A CD2 1 
ATOM 4231  N N   . ASP A 1 545  ? 32.532  -2.957  39.087  1.00 111.45 ? 542  ASP A N   1 
ATOM 4232  C CA  . ASP A 1 545  ? 33.062  -3.335  40.413  1.00 112.15 ? 542  ASP A CA  1 
ATOM 4233  C C   . ASP A 1 545  ? 32.832  -4.801  40.807  1.00 112.54 ? 542  ASP A C   1 
ATOM 4234  O O   . ASP A 1 545  ? 31.737  -5.347  40.625  1.00 112.48 ? 542  ASP A O   1 
ATOM 4235  C CB  . ASP A 1 545  ? 32.569  -2.405  41.534  1.00 112.21 ? 542  ASP A CB  1 
ATOM 4236  C CG  . ASP A 1 545  ? 33.369  -2.574  42.835  1.00 112.54 ? 542  ASP A CG  1 
ATOM 4237  O OD1 . ASP A 1 545  ? 34.614  -2.443  42.799  1.00 112.45 ? 542  ASP A OD1 1 
ATOM 4238  O OD2 . ASP A 1 545  ? 32.753  -2.842  43.892  1.00 112.98 ? 542  ASP A OD2 1 
ATOM 4239  N N   . ILE A 1 546  ? 33.887  -5.411  41.352  1.00 113.07 ? 543  ILE A N   1 
ATOM 4240  C CA  . ILE A 1 546  ? 33.865  -6.777  41.891  1.00 113.53 ? 543  ILE A CA  1 
ATOM 4241  C C   . ILE A 1 546  ? 34.602  -6.857  43.241  1.00 113.96 ? 543  ILE A C   1 
ATOM 4242  O O   . ILE A 1 546  ? 35.700  -6.307  43.385  1.00 114.11 ? 543  ILE A O   1 
ATOM 4243  C CB  . ILE A 1 546  ? 34.515  -7.790  40.919  1.00 113.46 ? 543  ILE A CB  1 
ATOM 4244  C CG1 . ILE A 1 546  ? 35.930  -7.347  40.537  1.00 113.32 ? 543  ILE A CG1 1 
ATOM 4245  C CG2 . ILE A 1 546  ? 33.659  -7.977  39.681  1.00 113.28 ? 543  ILE A CG2 1 
ATOM 4246  C CD1 . ILE A 1 546  ? 36.858  -8.486  40.268  1.00 113.51 ? 543  ILE A CD1 1 
ATOM 4247  N N   . THR A 1 547  ? 33.991  -7.532  44.221  1.00 114.37 ? 544  THR A N   1 
ATOM 4248  C CA  . THR A 1 547  ? 34.604  -7.771  45.545  1.00 114.62 ? 544  THR A CA  1 
ATOM 4249  C C   . THR A 1 547  ? 33.894  -8.920  46.289  1.00 114.86 ? 544  THR A C   1 
ATOM 4250  O O   . THR A 1 547  ? 32.663  -8.915  46.395  1.00 114.92 ? 544  THR A O   1 
ATOM 4251  C CB  . THR A 1 547  ? 34.591  -6.506  46.464  1.00 114.58 ? 544  THR A CB  1 
ATOM 4252  O OG1 . THR A 1 547  ? 34.437  -5.310  45.683  1.00 114.38 ? 544  THR A OG1 1 
ATOM 4253  C CG2 . THR A 1 547  ? 35.874  -6.422  47.285  1.00 114.50 ? 544  THR A CG2 1 
ATOM 4254  N N   . PRO A 1 548  ? 34.664  -9.907  46.800  1.00 115.02 ? 545  PRO A N   1 
ATOM 4255  C CA  . PRO A 1 548  ? 34.089  -10.987 47.617  1.00 115.11 ? 545  PRO A CA  1 
ATOM 4256  C C   . PRO A 1 548  ? 33.448  -10.467 48.913  1.00 115.19 ? 545  PRO A C   1 
ATOM 4257  O O   . PRO A 1 548  ? 34.152  -9.988  49.814  1.00 115.25 ? 545  PRO A O   1 
ATOM 4258  C CB  . PRO A 1 548  ? 35.295  -11.890 47.919  1.00 115.10 ? 545  PRO A CB  1 
ATOM 4259  C CG  . PRO A 1 548  ? 36.495  -11.039 47.684  1.00 115.05 ? 545  PRO A CG  1 
ATOM 4260  C CD  . PRO A 1 548  ? 36.118  -10.071 46.620  1.00 114.99 ? 545  PRO A CD  1 
ATOM 4261  N N   . LEU A 1 549  ? 32.121  -10.569 48.992  1.00 115.16 ? 546  LEU A N   1 
ATOM 4262  C CA  . LEU A 1 549  ? 31.344  -9.975  50.087  1.00 115.06 ? 546  LEU A CA  1 
ATOM 4263  C C   . LEU A 1 549  ? 31.404  -10.782 51.399  1.00 115.13 ? 546  LEU A C   1 
ATOM 4264  O O   . LEU A 1 549  ? 32.391  -11.476 51.662  1.00 115.08 ? 546  LEU A O   1 
ATOM 4265  C CB  . LEU A 1 549  ? 29.893  -9.698  49.643  1.00 114.94 ? 546  LEU A CB  1 
ATOM 4266  C CG  . LEU A 1 549  ? 29.669  -8.713  48.486  1.00 114.34 ? 546  LEU A CG  1 
ATOM 4267  C CD1 . LEU A 1 549  ? 29.465  -9.455  47.185  1.00 114.05 ? 546  LEU A CD1 1 
ATOM 4268  C CD2 . LEU A 1 549  ? 28.473  -7.824  48.753  1.00 113.86 ? 546  LEU A CD2 1 
ATOM 4269  N N   . GLY A 1 550  ? 30.356  -10.677 52.217  1.00 115.21 ? 547  GLY A N   1 
ATOM 4270  C CA  . GLY A 1 550  ? 30.301  -11.364 53.512  1.00 115.40 ? 547  GLY A CA  1 
ATOM 4271  C C   . GLY A 1 550  ? 29.761  -12.789 53.483  1.00 115.46 ? 547  GLY A C   1 
ATOM 4272  O O   . GLY A 1 550  ? 29.424  -13.352 54.531  1.00 115.51 ? 547  GLY A O   1 
ATOM 4273  N N   . ASP A 1 551  ? 29.684  -13.371 52.286  1.00 115.42 ? 548  ASP A N   1 
ATOM 4274  C CA  . ASP A 1 551  ? 29.179  -14.736 52.099  1.00 115.32 ? 548  ASP A CA  1 
ATOM 4275  C C   . ASP A 1 551  ? 30.220  -15.686 51.482  1.00 115.27 ? 548  ASP A C   1 
ATOM 4276  O O   . ASP A 1 551  ? 29.958  -16.884 51.317  1.00 115.26 ? 548  ASP A O   1 
ATOM 4277  C CB  . ASP A 1 551  ? 27.888  -14.724 51.260  1.00 115.31 ? 548  ASP A CB  1 
ATOM 4278  C CG  . ASP A 1 551  ? 28.020  -13.917 49.964  1.00 115.28 ? 548  ASP A CG  1 
ATOM 4279  O OD1 . ASP A 1 551  ? 27.010  -13.317 49.541  1.00 115.21 ? 548  ASP A OD1 1 
ATOM 4280  O OD2 . ASP A 1 551  ? 29.116  -13.880 49.364  1.00 115.17 ? 548  ASP A OD2 1 
ATOM 4281  N N   . SER A 1 552  ? 31.395  -15.142 51.153  1.00 115.14 ? 549  SER A N   1 
ATOM 4282  C CA  . SER A 1 552  ? 32.458  -15.897 50.478  1.00 114.94 ? 549  SER A CA  1 
ATOM 4283  C C   . SER A 1 552  ? 33.872  -15.419 50.839  1.00 114.84 ? 549  SER A C   1 
ATOM 4284  O O   . SER A 1 552  ? 34.067  -14.274 51.262  1.00 114.79 ? 549  SER A O   1 
ATOM 4285  C CB  . SER A 1 552  ? 32.246  -15.872 48.960  1.00 114.92 ? 549  SER A CB  1 
ATOM 4286  O OG  . SER A 1 552  ? 31.915  -14.570 48.506  1.00 114.65 ? 549  SER A OG  1 
ATOM 4287  N N   . ASN A 1 553  ? 34.850  -16.309 50.660  1.00 114.70 ? 550  ASN A N   1 
ATOM 4288  C CA  . ASN A 1 553  ? 36.234  -16.062 51.077  1.00 114.55 ? 550  ASN A CA  1 
ATOM 4289  C C   . ASN A 1 553  ? 37.186  -15.867 49.893  1.00 114.41 ? 550  ASN A C   1 
ATOM 4290  O O   . ASN A 1 553  ? 37.816  -16.822 49.428  1.00 114.44 ? 550  ASN A O   1 
ATOM 4291  C CB  . ASN A 1 553  ? 36.742  -17.213 51.963  1.00 114.56 ? 550  ASN A CB  1 
ATOM 4292  C CG  . ASN A 1 553  ? 35.662  -17.783 52.873  1.00 114.56 ? 550  ASN A CG  1 
ATOM 4293  O OD1 . ASN A 1 553  ? 35.071  -17.069 53.684  1.00 114.76 ? 550  ASN A OD1 1 
ATOM 4294  N ND2 . ASN A 1 553  ? 35.407  -19.081 52.744  1.00 114.24 ? 550  ASN A ND2 1 
ATOM 4295  N N   . GLY A 1 554  ? 37.286  -14.631 49.406  1.00 114.16 ? 551  GLY A N   1 
ATOM 4296  C CA  . GLY A 1 554  ? 38.192  -14.312 48.301  1.00 113.82 ? 551  GLY A CA  1 
ATOM 4297  C C   . GLY A 1 554  ? 37.599  -14.405 46.901  1.00 113.60 ? 551  GLY A C   1 
ATOM 4298  O O   . GLY A 1 554  ? 38.215  -13.947 45.937  1.00 113.63 ? 551  GLY A O   1 
ATOM 4299  N N   . LEU A 1 555  ? 36.411  -15.003 46.785  1.00 113.34 ? 552  LEU A N   1 
ATOM 4300  C CA  . LEU A 1 555  ? 35.701  -15.117 45.501  1.00 113.01 ? 552  LEU A CA  1 
ATOM 4301  C C   . LEU A 1 555  ? 34.321  -14.457 45.590  1.00 112.79 ? 552  LEU A C   1 
ATOM 4302  O O   . LEU A 1 555  ? 33.663  -14.536 46.630  1.00 112.82 ? 552  LEU A O   1 
ATOM 4303  C CB  . LEU A 1 555  ? 35.574  -16.588 45.081  1.00 113.04 ? 552  LEU A CB  1 
ATOM 4304  C CG  . LEU A 1 555  ? 35.281  -16.924 43.613  1.00 113.06 ? 552  LEU A CG  1 
ATOM 4305  C CD1 . LEU A 1 555  ? 36.402  -16.444 42.695  1.00 113.08 ? 552  LEU A CD1 1 
ATOM 4306  C CD2 . LEU A 1 555  ? 35.050  -18.423 43.429  1.00 112.95 ? 552  LEU A CD2 1 
ATOM 4307  N N   . SER A 1 556  ? 33.889  -13.819 44.498  1.00 112.38 ? 553  SER A N   1 
ATOM 4308  C CA  . SER A 1 556  ? 32.693  -12.949 44.502  1.00 111.86 ? 553  SER A CA  1 
ATOM 4309  C C   . SER A 1 556  ? 31.484  -13.524 43.725  1.00 111.40 ? 553  SER A C   1 
ATOM 4310  O O   . SER A 1 556  ? 31.595  -13.793 42.525  1.00 111.30 ? 553  SER A O   1 
ATOM 4311  C CB  . SER A 1 556  ? 33.070  -11.544 43.992  1.00 111.79 ? 553  SER A CB  1 
ATOM 4312  O OG  . SER A 1 556  ? 31.990  -10.632 44.069  1.00 111.58 ? 553  SER A OG  1 
ATOM 4313  N N   . PRO A 1 557  ? 30.332  -13.722 44.418  1.00 110.91 ? 554  PRO A N   1 
ATOM 4314  C CA  . PRO A 1 557  ? 29.093  -14.258 43.825  1.00 110.45 ? 554  PRO A CA  1 
ATOM 4315  C C   . PRO A 1 557  ? 28.520  -13.450 42.645  1.00 109.92 ? 554  PRO A C   1 
ATOM 4316  O O   . PRO A 1 557  ? 28.832  -13.765 41.495  1.00 109.91 ? 554  PRO A O   1 
ATOM 4317  C CB  . PRO A 1 557  ? 28.116  -14.284 45.014  1.00 110.50 ? 554  PRO A CB  1 
ATOM 4318  C CG  . PRO A 1 557  ? 28.988  -14.348 46.212  1.00 110.65 ? 554  PRO A CG  1 
ATOM 4319  C CD  . PRO A 1 557  ? 30.159  -13.475 45.862  1.00 110.90 ? 554  PRO A CD  1 
ATOM 4320  N N   . LEU A 1 558  ? 27.693  -12.438 42.921  1.00 109.27 ? 555  LEU A N   1 
ATOM 4321  C CA  . LEU A 1 558  ? 27.029  -11.664 41.855  1.00 108.62 ? 555  LEU A CA  1 
ATOM 4322  C C   . LEU A 1 558  ? 27.747  -10.354 41.494  1.00 108.14 ? 555  LEU A C   1 
ATOM 4323  O O   . LEU A 1 558  ? 28.769  -10.016 42.097  1.00 108.07 ? 555  LEU A O   1 
ATOM 4324  C CB  . LEU A 1 558  ? 25.544  -11.433 42.171  1.00 108.61 ? 555  LEU A CB  1 
ATOM 4325  C CG  . LEU A 1 558  ? 25.106  -10.360 43.167  1.00 108.55 ? 555  LEU A CG  1 
ATOM 4326  C CD1 . LEU A 1 558  ? 23.646  -10.022 42.933  1.00 108.48 ? 555  LEU A CD1 1 
ATOM 4327  C CD2 . LEU A 1 558  ? 25.343  -10.801 44.602  1.00 108.41 ? 555  LEU A CD2 1 
ATOM 4328  N N   . CYS A 1 559  ? 27.207  -9.625  40.513  1.00 107.57 ? 556  CYS A N   1 
ATOM 4329  C CA  . CYS A 1 559  ? 27.927  -8.501  39.899  1.00 106.97 ? 556  CYS A CA  1 
ATOM 4330  C C   . CYS A 1 559  ? 27.049  -7.429  39.218  1.00 106.33 ? 556  CYS A C   1 
ATOM 4331  O O   . CYS A 1 559  ? 25.843  -7.616  39.035  1.00 106.21 ? 556  CYS A O   1 
ATOM 4332  C CB  . CYS A 1 559  ? 28.962  -9.043  38.910  1.00 107.04 ? 556  CYS A CB  1 
ATOM 4333  S SG  . CYS A 1 559  ? 30.365  -7.947  38.665  1.00 107.74 ? 556  CYS A SG  1 
ATOM 4334  N N   . ALA A 1 560  ? 27.677  -6.313  38.840  1.00 105.59 ? 557  ALA A N   1 
ATOM 4335  C CA  . ALA A 1 560  ? 26.965  -5.144  38.311  1.00 104.83 ? 557  ALA A CA  1 
ATOM 4336  C C   . ALA A 1 560  ? 27.896  -4.042  37.778  1.00 104.22 ? 557  ALA A C   1 
ATOM 4337  O O   . ALA A 1 560  ? 28.998  -3.836  38.303  1.00 104.21 ? 557  ALA A O   1 
ATOM 4338  C CB  . ALA A 1 560  ? 26.029  -4.571  39.380  1.00 104.99 ? 557  ALA A CB  1 
ATOM 4339  N N   . ILE A 1 561  ? 27.430  -3.334  36.744  1.00 103.29 ? 558  ILE A N   1 
ATOM 4340  C CA  . ILE A 1 561  ? 28.186  -2.247  36.097  1.00 102.36 ? 558  ILE A CA  1 
ATOM 4341  C C   . ILE A 1 561  ? 27.284  -1.084  35.661  1.00 101.88 ? 558  ILE A C   1 
ATOM 4342  O O   . ILE A 1 561  ? 26.068  -1.124  35.853  1.00 101.76 ? 558  ILE A O   1 
ATOM 4343  C CB  . ILE A 1 561  ? 28.989  -2.748  34.857  1.00 102.30 ? 558  ILE A CB  1 
ATOM 4344  C CG1 . ILE A 1 561  ? 28.049  -3.169  33.716  1.00 102.01 ? 558  ILE A CG1 1 
ATOM 4345  C CG2 . ILE A 1 561  ? 29.930  -3.878  35.241  1.00 102.12 ? 558  ILE A CG2 1 
ATOM 4346  C CD1 . ILE A 1 561  ? 28.637  -3.006  32.328  1.00 101.18 ? 558  ILE A CD1 1 
ATOM 4347  N N   . GLY A 1 562  ? 27.892  -0.056  35.073  1.00 101.28 ? 559  GLY A N   1 
ATOM 4348  C CA  . GLY A 1 562  ? 27.163  1.060   34.473  1.00 100.63 ? 559  GLY A CA  1 
ATOM 4349  C C   . GLY A 1 562  ? 27.900  1.560   33.246  1.00 100.24 ? 559  GLY A C   1 
ATOM 4350  O O   . GLY A 1 562  ? 29.110  1.765   33.299  1.00 100.20 ? 559  GLY A O   1 
ATOM 4351  N N   . LEU A 1 563  ? 27.177  1.759   32.144  1.00 99.99  ? 560  LEU A N   1 
ATOM 4352  C CA  . LEU A 1 563  ? 27.799  2.095   30.844  1.00 99.63  ? 560  LEU A CA  1 
ATOM 4353  C C   . LEU A 1 563  ? 27.446  3.477   30.228  1.00 99.52  ? 560  LEU A C   1 
ATOM 4354  O O   . LEU A 1 563  ? 26.745  4.282   30.840  1.00 99.48  ? 560  LEU A O   1 
ATOM 4355  C CB  . LEU A 1 563  ? 27.645  0.942   29.826  1.00 99.60  ? 560  LEU A CB  1 
ATOM 4356  C CG  . LEU A 1 563  ? 26.436  0.001   29.782  1.00 99.27  ? 560  LEU A CG  1 
ATOM 4357  C CD1 . LEU A 1 563  ? 25.334  0.563   28.919  1.00 98.92  ? 560  LEU A CD1 1 
ATOM 4358  C CD2 . LEU A 1 563  ? 26.861  -1.351  29.252  1.00 99.36  ? 560  LEU A CD2 1 
ATOM 4359  N N   . TRP A 1 564  ? 27.930  3.710   29.006  1.00 99.40  ? 561  TRP A N   1 
ATOM 4360  C CA  . TRP A 1 564  ? 28.085  5.051   28.408  1.00 99.33  ? 561  TRP A CA  1 
ATOM 4361  C C   . TRP A 1 564  ? 26.862  5.763   27.816  1.00 99.51  ? 561  TRP A C   1 
ATOM 4362  O O   . TRP A 1 564  ? 26.573  6.894   28.196  1.00 99.78  ? 561  TRP A O   1 
ATOM 4363  C CB  . TRP A 1 564  ? 29.163  5.010   27.322  1.00 99.10  ? 561  TRP A CB  1 
ATOM 4364  C CG  . TRP A 1 564  ? 30.489  5.523   27.734  1.00 98.75  ? 561  TRP A CG  1 
ATOM 4365  C CD1 . TRP A 1 564  ? 31.489  4.826   28.344  1.00 98.68  ? 561  TRP A CD1 1 
ATOM 4366  C CD2 . TRP A 1 564  ? 30.982  6.848   27.540  1.00 98.54  ? 561  TRP A CD2 1 
ATOM 4367  N NE1 . TRP A 1 564  ? 32.574  5.640   28.554  1.00 98.64  ? 561  TRP A NE1 1 
ATOM 4368  C CE2 . TRP A 1 564  ? 32.288  6.889   28.070  1.00 98.54  ? 561  TRP A CE2 1 
ATOM 4369  C CE3 . TRP A 1 564  ? 30.444  8.010   26.975  1.00 98.60  ? 561  TRP A CE3 1 
ATOM 4370  C CZ2 . TRP A 1 564  ? 33.066  8.048   28.054  1.00 98.61  ? 561  TRP A CZ2 1 
ATOM 4371  C CZ3 . TRP A 1 564  ? 31.220  9.163   26.957  1.00 98.62  ? 561  TRP A CZ3 1 
ATOM 4372  C CH2 . TRP A 1 564  ? 32.516  9.172   27.494  1.00 98.61  ? 561  TRP A CH2 1 
ATOM 4373  N N   . THR A 1 565  ? 26.176  5.133   26.864  1.00 99.65  ? 562  THR A N   1 
ATOM 4374  C CA  . THR A 1 565  ? 25.226  5.864   26.016  1.00 99.85  ? 562  THR A CA  1 
ATOM 4375  C C   . THR A 1 565  ? 23.854  6.043   26.663  1.00 99.86  ? 562  THR A C   1 
ATOM 4376  O O   . THR A 1 565  ? 23.351  7.168   26.743  1.00 99.89  ? 562  THR A O   1 
ATOM 4377  C CB  . THR A 1 565  ? 25.094  5.251   24.585  1.00 99.96  ? 562  THR A CB  1 
ATOM 4378  O OG1 . THR A 1 565  ? 26.395  5.013   24.030  1.00 100.47 ? 562  THR A OG1 1 
ATOM 4379  C CG2 . THR A 1 565  ? 24.338  6.196   23.654  1.00 99.99  ? 562  THR A CG2 1 
ATOM 4380  N N   . ASP A 1 566  ? 23.260  4.942   27.122  1.00 99.95  ? 563  ASP A N   1 
ATOM 4381  C CA  . ASP A 1 566  ? 21.936  4.983   27.755  1.00 100.00 ? 563  ASP A CA  1 
ATOM 4382  C C   . ASP A 1 566  ? 21.966  5.682   29.112  1.00 100.14 ? 563  ASP A C   1 
ATOM 4383  O O   . ASP A 1 566  ? 20.946  6.206   29.562  1.00 100.24 ? 563  ASP A O   1 
ATOM 4384  C CB  . ASP A 1 566  ? 21.327  3.577   27.885  1.00 99.94  ? 563  ASP A CB  1 
ATOM 4385  C CG  . ASP A 1 566  ? 22.224  2.599   28.637  1.00 99.76  ? 563  ASP A CG  1 
ATOM 4386  O OD1 . ASP A 1 566  ? 23.198  3.031   29.285  1.00 99.99  ? 563  ASP A OD1 1 
ATOM 4387  O OD2 . ASP A 1 566  ? 21.948  1.381   28.583  1.00 99.33  ? 563  ASP A OD2 1 
ATOM 4388  N N   . ILE A 1 567  ? 23.147  5.693   29.735  1.00 100.27 ? 564  ILE A N   1 
ATOM 4389  C CA  . ILE A 1 567  ? 23.372  6.273   31.067  1.00 100.30 ? 564  ILE A CA  1 
ATOM 4390  C C   . ILE A 1 567  ? 22.586  5.457   32.098  1.00 100.29 ? 564  ILE A C   1 
ATOM 4391  O O   . ILE A 1 567  ? 21.498  5.846   32.528  1.00 100.24 ? 564  ILE A O   1 
ATOM 4392  C CB  . ILE A 1 567  ? 23.081  7.814   31.092  1.00 100.30 ? 564  ILE A CB  1 
ATOM 4393  C CG1 . ILE A 1 567  ? 24.013  8.524   30.107  1.00 100.25 ? 564  ILE A CG1 1 
ATOM 4394  C CG2 . ILE A 1 567  ? 23.255  8.407   32.495  1.00 100.25 ? 564  ILE A CG2 1 
ATOM 4395  C CD1 . ILE A 1 567  ? 23.360  9.638   29.332  1.00 100.89 ? 564  ILE A CD1 1 
ATOM 4396  N N   . SER A 1 568  ? 23.158  4.310   32.469  1.00 100.34 ? 565  SER A N   1 
ATOM 4397  C CA  . SER A 1 568  ? 22.442  3.285   33.224  1.00 100.58 ? 565  SER A CA  1 
ATOM 4398  C C   . SER A 1 568  ? 23.270  2.578   34.298  1.00 100.81 ? 565  SER A C   1 
ATOM 4399  O O   . SER A 1 568  ? 24.473  2.804   34.431  1.00 100.90 ? 565  SER A O   1 
ATOM 4400  C CB  . SER A 1 568  ? 21.884  2.241   32.256  1.00 100.57 ? 565  SER A CB  1 
ATOM 4401  O OG  . SER A 1 568  ? 22.930  1.603   31.545  1.00 100.38 ? 565  SER A OG  1 
ATOM 4402  N N   . ALA A 1 569  ? 22.600  1.719   35.061  1.00 101.10 ? 566  ALA A N   1 
ATOM 4403  C CA  . ALA A 1 569  ? 23.240  0.879   36.056  1.00 101.53 ? 566  ALA A CA  1 
ATOM 4404  C C   . ALA A 1 569  ? 22.697  -0.541  35.917  1.00 101.95 ? 566  ALA A C   1 
ATOM 4405  O O   . ALA A 1 569  ? 21.497  -0.779  36.077  1.00 101.91 ? 566  ALA A O   1 
ATOM 4406  C CB  . ALA A 1 569  ? 22.983  1.425   37.440  1.00 101.48 ? 566  ALA A CB  1 
ATOM 4407  N N   . ARG A 1 570  ? 23.586  -1.479  35.613  1.00 102.54 ? 567  ARG A N   1 
ATOM 4408  C CA  . ARG A 1 570  ? 23.184  -2.826  35.219  1.00 103.27 ? 567  ARG A CA  1 
ATOM 4409  C C   . ARG A 1 570  ? 23.448  -3.837  36.320  1.00 103.78 ? 567  ARG A C   1 
ATOM 4410  O O   . ARG A 1 570  ? 24.552  -3.889  36.857  1.00 103.79 ? 567  ARG A O   1 
ATOM 4411  C CB  . ARG A 1 570  ? 23.935  -3.257  33.953  1.00 103.26 ? 567  ARG A CB  1 
ATOM 4412  C CG  . ARG A 1 570  ? 24.131  -2.161  32.905  1.00 103.47 ? 567  ARG A CG  1 
ATOM 4413  C CD  . ARG A 1 570  ? 22.969  -2.068  31.924  1.00 103.49 ? 567  ARG A CD  1 
ATOM 4414  N NE  . ARG A 1 570  ? 22.894  -3.248  31.066  1.00 103.81 ? 567  ARG A NE  1 
ATOM 4415  C CZ  . ARG A 1 570  ? 22.443  -3.244  29.815  1.00 104.12 ? 567  ARG A CZ  1 
ATOM 4416  N NH1 . ARG A 1 570  ? 22.028  -2.114  29.250  1.00 104.34 ? 567  ARG A NH1 1 
ATOM 4417  N NH2 . ARG A 1 570  ? 22.415  -4.375  29.121  1.00 104.18 ? 567  ARG A NH2 1 
ATOM 4418  N N   . ILE A 1 571  ? 22.431  -4.634  36.645  1.00 104.47 ? 568  ILE A N   1 
ATOM 4419  C CA  . ILE A 1 571  ? 22.560  -5.738  37.599  1.00 105.11 ? 568  ILE A CA  1 
ATOM 4420  C C   . ILE A 1 571  ? 22.740  -7.026  36.802  1.00 105.60 ? 568  ILE A C   1 
ATOM 4421  O O   . ILE A 1 571  ? 21.986  -7.279  35.861  1.00 105.66 ? 568  ILE A O   1 
ATOM 4422  C CB  . ILE A 1 571  ? 21.307  -5.854  38.521  1.00 105.05 ? 568  ILE A CB  1 
ATOM 4423  C CG1 . ILE A 1 571  ? 21.032  -4.540  39.276  1.00 105.04 ? 568  ILE A CG1 1 
ATOM 4424  C CG2 . ILE A 1 571  ? 21.431  -7.039  39.487  1.00 105.29 ? 568  ILE A CG2 1 
ATOM 4425  C CD1 . ILE A 1 571  ? 22.050  -4.155  40.344  1.00 104.64 ? 568  ILE A CD1 1 
ATOM 4426  N N   . LEU A 1 572  ? 23.735  -7.832  37.173  1.00 106.26 ? 569  LEU A N   1 
ATOM 4427  C CA  . LEU A 1 572  ? 24.089  -9.033  36.397  1.00 106.94 ? 569  LEU A CA  1 
ATOM 4428  C C   . LEU A 1 572  ? 24.615  -10.206 37.240  1.00 107.34 ? 569  LEU A C   1 
ATOM 4429  O O   . LEU A 1 572  ? 24.713  -10.100 38.462  1.00 107.58 ? 569  LEU A O   1 
ATOM 4430  C CB  . LEU A 1 572  ? 25.082  -8.664  35.283  1.00 106.97 ? 569  LEU A CB  1 
ATOM 4431  C CG  . LEU A 1 572  ? 26.209  -7.664  35.566  1.00 107.12 ? 569  LEU A CG  1 
ATOM 4432  C CD1 . LEU A 1 572  ? 27.509  -8.373  35.897  1.00 107.08 ? 569  LEU A CD1 1 
ATOM 4433  C CD2 . LEU A 1 572  ? 26.400  -6.766  34.359  1.00 107.23 ? 569  LEU A CD2 1 
ATOM 4434  N N   . LYS A 1 573  ? 24.914  -11.329 36.585  1.00 107.77 ? 570  LYS A N   1 
ATOM 4435  C CA  . LYS A 1 573  ? 25.603  -12.460 37.222  1.00 108.21 ? 570  LYS A CA  1 
ATOM 4436  C C   . LYS A 1 573  ? 27.072  -12.428 36.785  1.00 108.62 ? 570  LYS A C   1 
ATOM 4437  O O   . LYS A 1 573  ? 27.413  -11.706 35.848  1.00 108.74 ? 570  LYS A O   1 
ATOM 4438  C CB  . LYS A 1 573  ? 24.941  -13.781 36.824  1.00 108.10 ? 570  LYS A CB  1 
ATOM 4439  C CG  . LYS A 1 573  ? 24.751  -14.769 37.967  1.00 108.01 ? 570  LYS A CG  1 
ATOM 4440  C CD  . LYS A 1 573  ? 26.010  -15.569 38.251  1.00 107.90 ? 570  LYS A CD  1 
ATOM 4441  C CE  . LYS A 1 573  ? 25.942  -16.242 39.610  1.00 107.89 ? 570  LYS A CE  1 
ATOM 4442  N NZ  . LYS A 1 573  ? 27.253  -16.824 40.013  1.00 107.79 ? 570  LYS A NZ  1 
ATOM 4443  N N   . LEU A 1 574  ? 27.943  -13.191 37.447  1.00 109.12 ? 571  LEU A N   1 
ATOM 4444  C CA  . LEU A 1 574  ? 29.381  -13.129 37.128  1.00 109.64 ? 571  LEU A CA  1 
ATOM 4445  C C   . LEU A 1 574  ? 29.912  -14.143 36.091  1.00 109.98 ? 571  LEU A C   1 
ATOM 4446  O O   . LEU A 1 574  ? 30.335  -13.725 35.011  1.00 110.09 ? 571  LEU A O   1 
ATOM 4447  C CB  . LEU A 1 574  ? 30.259  -13.105 38.389  1.00 109.66 ? 571  LEU A CB  1 
ATOM 4448  C CG  . LEU A 1 574  ? 31.772  -13.170 38.137  1.00 109.80 ? 571  LEU A CG  1 
ATOM 4449  C CD1 . LEU A 1 574  ? 32.301  -11.899 37.474  1.00 109.65 ? 571  LEU A CD1 1 
ATOM 4450  C CD2 . LEU A 1 574  ? 32.511  -13.456 39.427  1.00 110.17 ? 571  LEU A CD2 1 
ATOM 4451  N N   . PRO A 1 575  ? 29.933  -15.458 36.416  1.00 110.26 ? 572  PRO A N   1 
ATOM 4452  C CA  . PRO A 1 575  ? 30.459  -16.395 35.418  1.00 110.50 ? 572  PRO A CA  1 
ATOM 4453  C C   . PRO A 1 575  ? 29.585  -16.484 34.163  1.00 110.76 ? 572  PRO A C   1 
ATOM 4454  O O   . PRO A 1 575  ? 30.114  -16.540 33.048  1.00 110.78 ? 572  PRO A O   1 
ATOM 4455  C CB  . PRO A 1 575  ? 30.478  -17.736 36.165  1.00 110.50 ? 572  PRO A CB  1 
ATOM 4456  C CG  . PRO A 1 575  ? 30.395  -17.375 37.620  1.00 110.36 ? 572  PRO A CG  1 
ATOM 4457  C CD  . PRO A 1 575  ? 29.533  -16.163 37.647  1.00 110.25 ? 572  PRO A CD  1 
ATOM 4458  N N   . SER A 1 576  ? 28.265  -16.473 34.353  1.00 111.04 ? 573  SER A N   1 
ATOM 4459  C CA  . SER A 1 576  ? 27.304  -16.605 33.251  1.00 111.32 ? 573  SER A CA  1 
ATOM 4460  C C   . SER A 1 576  ? 27.084  -15.309 32.461  1.00 111.41 ? 573  SER A C   1 
ATOM 4461  O O   . SER A 1 576  ? 26.588  -15.345 31.331  1.00 111.45 ? 573  SER A O   1 
ATOM 4462  C CB  . SER A 1 576  ? 25.967  -17.153 33.763  1.00 111.33 ? 573  SER A CB  1 
ATOM 4463  O OG  . SER A 1 576  ? 25.456  -16.357 34.819  1.00 111.61 ? 573  SER A OG  1 
ATOM 4464  N N   . PHE A 1 577  ? 27.445  -14.176 33.068  1.00 111.51 ? 574  PHE A N   1 
ATOM 4465  C CA  . PHE A 1 577  ? 27.392  -12.852 32.426  1.00 111.66 ? 574  PHE A CA  1 
ATOM 4466  C C   . PHE A 1 577  ? 25.993  -12.366 32.006  1.00 111.83 ? 574  PHE A C   1 
ATOM 4467  O O   . PHE A 1 577  ? 25.868  -11.333 31.346  1.00 111.84 ? 574  PHE A O   1 
ATOM 4468  C CB  . PHE A 1 577  ? 28.369  -12.777 31.238  1.00 111.60 ? 574  PHE A CB  1 
ATOM 4469  C CG  . PHE A 1 577  ? 29.797  -12.500 31.634  1.00 111.64 ? 574  PHE A CG  1 
ATOM 4470  C CD1 . PHE A 1 577  ? 30.710  -13.542 31.774  1.00 111.52 ? 574  PHE A CD1 1 
ATOM 4471  C CD2 . PHE A 1 577  ? 30.233  -11.191 31.856  1.00 111.53 ? 574  PHE A CD2 1 
ATOM 4472  C CE1 . PHE A 1 577  ? 32.037  -13.283 32.141  1.00 111.56 ? 574  PHE A CE1 1 
ATOM 4473  C CE2 . PHE A 1 577  ? 31.557  -10.924 32.220  1.00 111.20 ? 574  PHE A CE2 1 
ATOM 4474  C CZ  . PHE A 1 577  ? 32.459  -11.971 32.362  1.00 111.31 ? 574  PHE A CZ  1 
ATOM 4475  N N   . GLU A 1 578  ? 24.954  -13.098 32.404  1.00 112.08 ? 575  GLU A N   1 
ATOM 4476  C CA  . GLU A 1 578  ? 23.564  -12.763 32.058  1.00 112.36 ? 575  GLU A CA  1 
ATOM 4477  C C   . GLU A 1 578  ? 23.108  -11.416 32.648  1.00 112.54 ? 575  GLU A C   1 
ATOM 4478  O O   . GLU A 1 578  ? 23.740  -10.885 33.560  1.00 112.55 ? 575  GLU A O   1 
ATOM 4479  C CB  . GLU A 1 578  ? 22.621  -13.902 32.476  1.00 112.33 ? 575  GLU A CB  1 
ATOM 4480  C CG  . GLU A 1 578  ? 22.688  -14.262 33.962  1.00 112.58 ? 575  GLU A CG  1 
ATOM 4481  C CD  . GLU A 1 578  ? 22.354  -15.718 34.255  1.00 112.87 ? 575  GLU A CD  1 
ATOM 4482  O OE1 . GLU A 1 578  ? 22.609  -16.586 33.392  1.00 113.14 ? 575  GLU A OE1 1 
ATOM 4483  O OE2 . GLU A 1 578  ? 21.851  -15.995 35.365  1.00 112.93 ? 575  GLU A OE2 1 
ATOM 4484  N N   . LEU A 1 579  ? 22.012  -10.875 32.120  1.00 112.76 ? 576  LEU A N   1 
ATOM 4485  C CA  . LEU A 1 579  ? 21.519  -9.556  32.513  1.00 113.00 ? 576  LEU A CA  1 
ATOM 4486  C C   . LEU A 1 579  ? 20.243  -9.649  33.357  1.00 113.29 ? 576  LEU A C   1 
ATOM 4487  O O   . LEU A 1 579  ? 19.226  -10.165 32.892  1.00 113.31 ? 576  LEU A O   1 
ATOM 4488  C CB  . LEU A 1 579  ? 21.271  -8.711  31.257  1.00 112.93 ? 576  LEU A CB  1 
ATOM 4489  C CG  . LEU A 1 579  ? 21.184  -7.178  31.295  1.00 113.07 ? 576  LEU A CG  1 
ATOM 4490  C CD1 . LEU A 1 579  ? 19.803  -6.674  31.728  1.00 112.94 ? 576  LEU A CD1 1 
ATOM 4491  C CD2 . LEU A 1 579  ? 22.297  -6.558  32.145  1.00 113.34 ? 576  LEU A CD2 1 
ATOM 4492  N N   . LEU A 1 580  ? 20.302  -9.140  34.591  1.00 113.72 ? 577  LEU A N   1 
ATOM 4493  C CA  . LEU A 1 580  ? 19.151  -9.158  35.516  1.00 114.12 ? 577  LEU A CA  1 
ATOM 4494  C C   . LEU A 1 580  ? 18.207  -7.952  35.357  1.00 114.42 ? 577  LEU A C   1 
ATOM 4495  O O   . LEU A 1 580  ? 17.730  -7.673  34.254  1.00 114.51 ? 577  LEU A O   1 
ATOM 4496  C CB  . LEU A 1 580  ? 19.615  -9.294  36.977  1.00 114.06 ? 577  LEU A CB  1 
ATOM 4497  C CG  . LEU A 1 580  ? 19.844  -10.700 37.543  1.00 114.00 ? 577  LEU A CG  1 
ATOM 4498  C CD1 . LEU A 1 580  ? 21.287  -11.144 37.356  1.00 113.72 ? 577  LEU A CD1 1 
ATOM 4499  C CD2 . LEU A 1 580  ? 19.463  -10.755 39.015  1.00 113.76 ? 577  LEU A CD2 1 
ATOM 4500  N N   . HIS A 1 581  ? 17.930  -7.260  36.463  1.00 114.76 ? 578  HIS A N   1 
ATOM 4501  C CA  . HIS A 1 581  ? 17.084  -6.063  36.455  1.00 115.08 ? 578  HIS A CA  1 
ATOM 4502  C C   . HIS A 1 581  ? 17.920  -4.792  36.635  1.00 115.16 ? 578  HIS A C   1 
ATOM 4503  O O   . HIS A 1 581  ? 18.258  -4.402  37.755  1.00 115.19 ? 578  HIS A O   1 
ATOM 4504  C CB  . HIS A 1 581  ? 15.980  -6.160  37.524  1.00 115.18 ? 578  HIS A CB  1 
ATOM 4505  C CG  . HIS A 1 581  ? 15.183  -4.900  37.698  1.00 115.47 ? 578  HIS A CG  1 
ATOM 4506  N ND1 . HIS A 1 581  ? 14.077  -4.605  36.930  1.00 115.68 ? 578  HIS A ND1 1 
ATOM 4507  C CD2 . HIS A 1 581  ? 15.331  -3.861  38.556  1.00 115.58 ? 578  HIS A CD2 1 
ATOM 4508  C CE1 . HIS A 1 581  ? 13.580  -3.439  37.304  1.00 115.79 ? 578  HIS A CE1 1 
ATOM 4509  N NE2 . HIS A 1 581  ? 14.323  -2.967  38.289  1.00 115.74 ? 578  HIS A NE2 1 
ATOM 4510  N N   . LYS A 1 582  ? 18.251  -4.162  35.512  1.00 115.30 ? 579  LYS A N   1 
ATOM 4511  C CA  . LYS A 1 582  ? 18.956  -2.883  35.494  1.00 115.44 ? 579  LYS A CA  1 
ATOM 4512  C C   . LYS A 1 582  ? 18.066  -1.766  36.029  1.00 115.55 ? 579  LYS A C   1 
ATOM 4513  O O   . LYS A 1 582  ? 16.838  -1.885  36.024  1.00 115.64 ? 579  LYS A O   1 
ATOM 4514  C CB  . LYS A 1 582  ? 19.398  -2.545  34.065  1.00 115.47 ? 579  LYS A CB  1 
ATOM 4515  C CG  . LYS A 1 582  ? 18.291  -2.715  33.011  1.00 115.56 ? 579  LYS A CG  1 
ATOM 4516  C CD  . LYS A 1 582  ? 18.796  -2.527  31.588  1.00 115.39 ? 579  LYS A CD  1 
ATOM 4517  C CE  . LYS A 1 582  ? 18.691  -1.076  31.147  1.00 115.30 ? 579  LYS A CE  1 
ATOM 4518  N NZ  . LYS A 1 582  ? 19.142  -0.890  29.743  1.00 115.16 ? 579  LYS A NZ  1 
ATOM 4519  N N   . GLU A 1 583  ? 18.689  -0.688  36.497  1.00 115.65 ? 580  GLU A N   1 
ATOM 4520  C CA  . GLU A 1 583  ? 17.955  0.514   36.895  1.00 115.67 ? 580  GLU A CA  1 
ATOM 4521  C C   . GLU A 1 583  ? 18.251  1.659   35.930  1.00 115.46 ? 580  GLU A C   1 
ATOM 4522  O O   . GLU A 1 583  ? 19.350  2.226   35.934  1.00 115.48 ? 580  GLU A O   1 
ATOM 4523  C CB  . GLU A 1 583  ? 18.272  0.911   38.347  1.00 115.75 ? 580  GLU A CB  1 
ATOM 4524  C CG  . GLU A 1 583  ? 17.779  2.313   38.765  1.00 116.25 ? 580  GLU A CG  1 
ATOM 4525  C CD  . GLU A 1 583  ? 16.267  2.412   38.993  1.00 117.02 ? 580  GLU A CD  1 
ATOM 4526  O OE1 . GLU A 1 583  ? 15.522  1.460   38.661  1.00 117.38 ? 580  GLU A OE1 1 
ATOM 4527  O OE2 . GLU A 1 583  ? 15.824  3.460   39.514  1.00 116.94 ? 580  GLU A OE2 1 
ATOM 4528  N N   . MET A 1 584  ? 17.266  1.986   35.099  1.00 115.16 ? 581  MET A N   1 
ATOM 4529  C CA  . MET A 1 584  ? 17.411  3.065   34.135  1.00 114.90 ? 581  MET A CA  1 
ATOM 4530  C C   . MET A 1 584  ? 17.594  4.394   34.873  1.00 114.70 ? 581  MET A C   1 
ATOM 4531  O O   . MET A 1 584  ? 16.864  4.695   35.821  1.00 114.62 ? 581  MET A O   1 
ATOM 4532  C CB  . MET A 1 584  ? 16.209  3.110   33.182  1.00 114.92 ? 581  MET A CB  1 
ATOM 4533  C CG  . MET A 1 584  ? 16.473  3.838   31.854  1.00 114.79 ? 581  MET A CG  1 
ATOM 4534  S SD  . MET A 1 584  ? 17.448  2.913   30.638  1.00 113.83 ? 581  MET A SD  1 
ATOM 4535  C CE  . MET A 1 584  ? 16.177  1.912   29.865  1.00 114.54 ? 581  MET A CE  1 
ATOM 4536  N N   . LEU A 1 585  ? 18.596  5.160   34.445  1.00 114.49 ? 582  LEU A N   1 
ATOM 4537  C CA  . LEU A 1 585  ? 18.903  6.466   35.025  1.00 114.33 ? 582  LEU A CA  1 
ATOM 4538  C C   . LEU A 1 585  ? 18.690  7.592   34.024  1.00 114.33 ? 582  LEU A C   1 
ATOM 4539  O O   . LEU A 1 585  ? 18.908  7.420   32.822  1.00 114.29 ? 582  LEU A O   1 
ATOM 4540  C CB  . LEU A 1 585  ? 20.356  6.522   35.507  1.00 114.24 ? 582  LEU A CB  1 
ATOM 4541  C CG  . LEU A 1 585  ? 20.819  5.743   36.735  1.00 113.98 ? 582  LEU A CG  1 
ATOM 4542  C CD1 . LEU A 1 585  ? 22.328  5.768   36.792  1.00 113.59 ? 582  LEU A CD1 1 
ATOM 4543  C CD2 . LEU A 1 585  ? 20.233  6.324   38.012  1.00 114.21 ? 582  LEU A CD2 1 
ATOM 4544  N N   . GLY A 1 586  ? 18.281  8.750   34.532  1.00 114.31 ? 583  GLY A N   1 
ATOM 4545  C CA  . GLY A 1 586  ? 18.215  9.959   33.724  1.00 114.38 ? 583  GLY A CA  1 
ATOM 4546  C C   . GLY A 1 586  ? 19.593  10.579  33.615  1.00 114.45 ? 583  GLY A C   1 
ATOM 4547  O O   . GLY A 1 586  ? 20.587  9.982   34.035  1.00 114.47 ? 583  GLY A O   1 
ATOM 4548  N N   . GLY A 1 587  ? 19.654  11.778  33.047  1.00 114.56 ? 584  GLY A N   1 
ATOM 4549  C CA  . GLY A 1 587  ? 20.903  12.529  32.968  1.00 114.70 ? 584  GLY A CA  1 
ATOM 4550  C C   . GLY A 1 587  ? 21.555  12.491  31.602  1.00 114.80 ? 584  GLY A C   1 
ATOM 4551  O O   . GLY A 1 587  ? 21.071  11.820  30.688  1.00 114.75 ? 584  GLY A O   1 
ATOM 4552  N N   . GLU A 1 588  ? 22.667  13.214  31.478  1.00 114.94 ? 585  GLU A N   1 
ATOM 4553  C CA  . GLU A 1 588  ? 23.372  13.373  30.205  1.00 115.06 ? 585  GLU A CA  1 
ATOM 4554  C C   . GLU A 1 588  ? 24.880  13.089  30.301  1.00 115.08 ? 585  GLU A C   1 
ATOM 4555  O O   . GLU A 1 588  ? 25.575  13.059  29.278  1.00 115.08 ? 585  GLU A O   1 
ATOM 4556  C CB  . GLU A 1 588  ? 23.130  14.779  29.628  1.00 115.10 ? 585  GLU A CB  1 
ATOM 4557  C CG  . GLU A 1 588  ? 21.756  14.986  28.981  1.00 115.24 ? 585  GLU A CG  1 
ATOM 4558  C CD  . GLU A 1 588  ? 21.642  14.349  27.602  1.00 115.47 ? 585  GLU A CD  1 
ATOM 4559  O OE1 . GLU A 1 588  ? 20.827  13.416  27.441  1.00 115.74 ? 585  GLU A OE1 1 
ATOM 4560  O OE2 . GLU A 1 588  ? 22.368  14.777  26.680  1.00 115.54 ? 585  GLU A OE2 1 
ATOM 4561  N N   . ILE A 1 589  ? 25.379  12.888  31.522  1.00 115.08 ? 586  ILE A N   1 
ATOM 4562  C CA  . ILE A 1 589  ? 26.805  12.600  31.738  1.00 114.99 ? 586  ILE A CA  1 
ATOM 4563  C C   . ILE A 1 589  ? 26.993  11.139  32.143  1.00 114.80 ? 586  ILE A C   1 
ATOM 4564  O O   . ILE A 1 589  ? 26.062  10.512  32.654  1.00 114.82 ? 586  ILE A O   1 
ATOM 4565  C CB  . ILE A 1 589  ? 27.456  13.528  32.819  1.00 115.09 ? 586  ILE A CB  1 
ATOM 4566  C CG1 . ILE A 1 589  ? 26.653  14.835  33.035  1.00 114.95 ? 586  ILE A CG1 1 
ATOM 4567  C CG2 . ILE A 1 589  ? 28.959  13.743  32.512  1.00 115.10 ? 586  ILE A CG2 1 
ATOM 4568  C CD1 . ILE A 1 589  ? 26.821  15.919  31.964  1.00 114.77 ? 586  ILE A CD1 1 
ATOM 4569  N N   . ILE A 1 590  ? 28.193  10.604  31.913  1.00 114.57 ? 587  ILE A N   1 
ATOM 4570  C CA  . ILE A 1 590  ? 28.506  9.216   32.265  1.00 114.53 ? 587  ILE A CA  1 
ATOM 4571  C C   . ILE A 1 590  ? 28.311  8.959   33.762  1.00 114.46 ? 587  ILE A C   1 
ATOM 4572  O O   . ILE A 1 590  ? 28.317  9.904   34.556  1.00 114.64 ? 587  ILE A O   1 
ATOM 4573  C CB  . ILE A 1 590  ? 29.970  8.785   31.839  1.00 114.54 ? 587  ILE A CB  1 
ATOM 4574  C CG1 . ILE A 1 590  ? 31.057  9.267   32.833  1.00 114.71 ? 587  ILE A CG1 1 
ATOM 4575  C CG2 . ILE A 1 590  ? 30.267  9.161   30.390  1.00 114.45 ? 587  ILE A CG2 1 
ATOM 4576  C CD1 . ILE A 1 590  ? 31.414  10.763  32.799  1.00 114.66 ? 587  ILE A CD1 1 
ATOM 4577  N N   . PRO A 1 591  ? 28.084  7.690   34.149  1.00 114.27 ? 588  PRO A N   1 
ATOM 4578  C CA  . PRO A 1 591  ? 28.351  7.306   35.530  1.00 114.23 ? 588  PRO A CA  1 
ATOM 4579  C C   . PRO A 1 591  ? 29.849  7.030   35.695  1.00 114.30 ? 588  PRO A C   1 
ATOM 4580  O O   . PRO A 1 591  ? 30.391  6.166   35.007  1.00 114.38 ? 588  PRO A O   1 
ATOM 4581  C CB  . PRO A 1 591  ? 27.530  6.021   35.706  1.00 114.20 ? 588  PRO A CB  1 
ATOM 4582  C CG  . PRO A 1 591  ? 26.776  5.817   34.408  1.00 114.10 ? 588  PRO A CG  1 
ATOM 4583  C CD  . PRO A 1 591  ? 27.517  6.577   33.374  1.00 114.21 ? 588  PRO A CD  1 
ATOM 4584  N N   . ARG A 1 592  ? 30.510  7.766   36.588  1.00 114.42 ? 589  ARG A N   1 
ATOM 4585  C CA  . ARG A 1 592  ? 31.970  7.704   36.734  1.00 114.57 ? 589  ARG A CA  1 
ATOM 4586  C C   . ARG A 1 592  ? 32.445  6.548   37.624  1.00 114.59 ? 589  ARG A C   1 
ATOM 4587  O O   . ARG A 1 592  ? 33.455  5.906   37.322  1.00 114.36 ? 589  ARG A O   1 
ATOM 4588  C CB  . ARG A 1 592  ? 32.505  9.041   37.262  1.00 114.67 ? 589  ARG A CB  1 
ATOM 4589  C CG  . ARG A 1 592  ? 33.870  9.454   36.709  1.00 115.39 ? 589  ARG A CG  1 
ATOM 4590  C CD  . ARG A 1 592  ? 35.043  8.987   37.585  1.00 115.92 ? 589  ARG A CD  1 
ATOM 4591  N NE  . ARG A 1 592  ? 36.341  9.368   37.015  1.00 115.73 ? 589  ARG A NE  1 
ATOM 4592  C CZ  . ARG A 1 592  ? 37.499  8.760   37.272  1.00 115.47 ? 589  ARG A CZ  1 
ATOM 4593  N NH1 . ARG A 1 592  ? 37.558  7.718   38.097  1.00 115.15 ? 589  ARG A NH1 1 
ATOM 4594  N NH2 . ARG A 1 592  ? 38.609  9.195   36.691  1.00 115.41 ? 589  ARG A NH2 1 
ATOM 4595  N N   . SER A 1 593  ? 31.720  6.292   38.715  1.00 114.81 ? 590  SER A N   1 
ATOM 4596  C CA  . SER A 1 593  ? 32.071  5.215   39.655  1.00 115.03 ? 590  SER A CA  1 
ATOM 4597  C C   . SER A 1 593  ? 30.888  4.402   40.195  1.00 114.97 ? 590  SER A C   1 
ATOM 4598  O O   . SER A 1 593  ? 29.780  4.917   40.355  1.00 114.89 ? 590  SER A O   1 
ATOM 4599  C CB  . SER A 1 593  ? 32.908  5.758   40.818  1.00 115.10 ? 590  SER A CB  1 
ATOM 4600  O OG  . SER A 1 593  ? 34.294  5.624   40.548  1.00 115.62 ? 590  SER A OG  1 
ATOM 4601  N N   . ILE A 1 594  ? 31.161  3.130   40.480  1.00 114.94 ? 591  ILE A N   1 
ATOM 4602  C CA  . ILE A 1 594  ? 30.172  2.179   40.979  1.00 115.00 ? 591  ILE A CA  1 
ATOM 4603  C C   . ILE A 1 594  ? 30.850  1.290   42.032  1.00 114.96 ? 591  ILE A C   1 
ATOM 4604  O O   . ILE A 1 594  ? 32.033  0.970   41.896  1.00 114.90 ? 591  ILE A O   1 
ATOM 4605  C CB  . ILE A 1 594  ? 29.568  1.338   39.803  1.00 115.09 ? 591  ILE A CB  1 
ATOM 4606  C CG1 . ILE A 1 594  ? 28.341  0.529   40.246  1.00 115.52 ? 591  ILE A CG1 1 
ATOM 4607  C CG2 . ILE A 1 594  ? 30.616  0.436   39.142  1.00 115.10 ? 591  ILE A CG2 1 
ATOM 4608  C CD1 . ILE A 1 594  ? 27.011  1.108   39.795  1.00 115.65 ? 591  ILE A CD1 1 
ATOM 4609  N N   . LEU A 1 595  ? 30.123  0.909   43.084  1.00 115.00 ? 592  LEU A N   1 
ATOM 4610  C CA  . LEU A 1 595  ? 30.723  0.109   44.162  1.00 115.14 ? 592  LEU A CA  1 
ATOM 4611  C C   . LEU A 1 595  ? 29.746  -0.844  44.864  1.00 115.40 ? 592  LEU A C   1 
ATOM 4612  O O   . LEU A 1 595  ? 28.532  -0.785  44.636  1.00 115.38 ? 592  LEU A O   1 
ATOM 4613  C CB  . LEU A 1 595  ? 31.412  1.030   45.190  1.00 115.07 ? 592  LEU A CB  1 
ATOM 4614  C CG  . LEU A 1 595  ? 32.504  0.484   46.127  1.00 114.83 ? 592  LEU A CG  1 
ATOM 4615  C CD1 . LEU A 1 595  ? 33.779  0.098   45.379  1.00 114.44 ? 592  LEU A CD1 1 
ATOM 4616  C CD2 . LEU A 1 595  ? 32.821  1.488   47.227  1.00 114.97 ? 592  LEU A CD2 1 
ATOM 4617  N N   . MET A 1 596  ? 30.306  -1.729  45.696  1.00 115.70 ? 593  MET A N   1 
ATOM 4618  C CA  . MET A 1 596  ? 29.552  -2.570  46.640  1.00 115.95 ? 593  MET A CA  1 
ATOM 4619  C C   . MET A 1 596  ? 30.208  -2.582  48.039  1.00 116.15 ? 593  MET A C   1 
ATOM 4620  O O   . MET A 1 596  ? 31.437  -2.536  48.151  1.00 116.11 ? 593  MET A O   1 
ATOM 4621  C CB  . MET A 1 596  ? 29.368  -3.998  46.095  1.00 115.97 ? 593  MET A CB  1 
ATOM 4622  C CG  . MET A 1 596  ? 30.659  -4.749  45.738  1.00 115.97 ? 593  MET A CG  1 
ATOM 4623  S SD  . MET A 1 596  ? 30.370  -6.437  45.150  1.00 115.81 ? 593  MET A SD  1 
ATOM 4624  C CE  . MET A 1 596  ? 29.548  -6.125  43.586  1.00 115.88 ? 593  MET A CE  1 
ATOM 4625  N N   . THR A 1 597  ? 29.380  -2.635  49.090  1.00 116.46 ? 594  THR A N   1 
ATOM 4626  C CA  . THR A 1 597  ? 29.843  -2.596  50.497  1.00 116.68 ? 594  THR A CA  1 
ATOM 4627  C C   . THR A 1 597  ? 29.107  -3.576  51.432  1.00 116.81 ? 594  THR A C   1 
ATOM 4628  O O   . THR A 1 597  ? 28.109  -4.182  51.044  1.00 116.94 ? 594  THR A O   1 
ATOM 4629  C CB  . THR A 1 597  ? 29.706  -1.180  51.101  1.00 116.68 ? 594  THR A CB  1 
ATOM 4630  O OG1 . THR A 1 597  ? 28.329  -0.779  51.080  1.00 116.72 ? 594  THR A OG1 1 
ATOM 4631  C CG2 . THR A 1 597  ? 30.551  -0.170  50.330  1.00 116.71 ? 594  THR A CG2 1 
ATOM 4632  N N   . THR A 1 598  ? 29.613  -3.722  52.659  1.00 116.96 ? 595  THR A N   1 
ATOM 4633  C CA  . THR A 1 598  ? 28.964  -4.518  53.717  1.00 117.19 ? 595  THR A CA  1 
ATOM 4634  C C   . THR A 1 598  ? 29.401  -3.973  55.088  1.00 117.32 ? 595  THR A C   1 
ATOM 4635  O O   . THR A 1 598  ? 30.581  -3.667  55.284  1.00 117.47 ? 595  THR A O   1 
ATOM 4636  C CB  . THR A 1 598  ? 29.293  -6.043  53.606  1.00 117.19 ? 595  THR A CB  1 
ATOM 4637  O OG1 . THR A 1 598  ? 28.965  -6.524  52.296  1.00 117.12 ? 595  THR A OG1 1 
ATOM 4638  C CG2 . THR A 1 598  ? 28.510  -6.860  54.637  1.00 117.25 ? 595  THR A CG2 1 
ATOM 4639  N N   . PHE A 1 599  ? 28.455  -3.854  56.025  1.00 117.37 ? 596  PHE A N   1 
ATOM 4640  C CA  . PHE A 1 599  ? 28.728  -3.268  57.351  1.00 117.32 ? 596  PHE A CA  1 
ATOM 4641  C C   . PHE A 1 599  ? 28.400  -4.221  58.511  1.00 117.22 ? 596  PHE A C   1 
ATOM 4642  O O   . PHE A 1 599  ? 29.273  -4.964  58.971  1.00 117.20 ? 596  PHE A O   1 
ATOM 4643  C CB  . PHE A 1 599  ? 27.999  -1.923  57.513  1.00 117.36 ? 596  PHE A CB  1 
ATOM 4644  C CG  . PHE A 1 599  ? 28.415  -0.878  56.509  1.00 117.48 ? 596  PHE A CG  1 
ATOM 4645  C CD1 . PHE A 1 599  ? 27.849  -0.849  55.236  1.00 117.41 ? 596  PHE A CD1 1 
ATOM 4646  C CD2 . PHE A 1 599  ? 29.371  0.078   56.835  1.00 117.62 ? 596  PHE A CD2 1 
ATOM 4647  C CE1 . PHE A 1 599  ? 28.231  0.111   54.302  1.00 117.57 ? 596  PHE A CE1 1 
ATOM 4648  C CE2 . PHE A 1 599  ? 29.757  1.047   55.905  1.00 117.60 ? 596  PHE A CE2 1 
ATOM 4649  C CZ  . PHE A 1 599  ? 29.187  1.063   54.639  1.00 117.57 ? 596  PHE A CZ  1 
ATOM 4650  N N   . GLU A 1 600  ? 27.154  -4.186  58.986  1.00 117.10 ? 597  GLU A N   1 
ATOM 4651  C CA  . GLU A 1 600  ? 26.670  -5.149  59.981  1.00 117.00 ? 597  GLU A CA  1 
ATOM 4652  C C   . GLU A 1 600  ? 25.535  -5.999  59.404  1.00 116.76 ? 597  GLU A C   1 
ATOM 4653  O O   . GLU A 1 600  ? 25.611  -7.234  59.399  1.00 116.77 ? 597  GLU A O   1 
ATOM 4654  C CB  . GLU A 1 600  ? 26.200  -4.456  61.270  1.00 117.07 ? 597  GLU A CB  1 
ATOM 4655  C CG  . GLU A 1 600  ? 27.299  -3.808  62.104  1.00 117.52 ? 597  GLU A CG  1 
ATOM 4656  C CD  . GLU A 1 600  ? 27.345  -2.293  61.957  1.00 118.34 ? 597  GLU A CD  1 
ATOM 4657  O OE1 . GLU A 1 600  ? 27.056  -1.777  60.850  1.00 118.64 ? 597  GLU A OE1 1 
ATOM 4658  O OE2 . GLU A 1 600  ? 27.674  -1.619  62.959  1.00 118.44 ? 597  GLU A OE2 1 
ATOM 4659  N N   . SER A 1 601  ? 24.489  -5.324  58.923  1.00 116.36 ? 598  SER A N   1 
ATOM 4660  C CA  . SER A 1 601  ? 23.320  -5.984  58.345  1.00 115.88 ? 598  SER A CA  1 
ATOM 4661  C C   . SER A 1 601  ? 22.765  -5.182  57.165  1.00 115.51 ? 598  SER A C   1 
ATOM 4662  O O   . SER A 1 601  ? 22.032  -4.204  57.352  1.00 115.40 ? 598  SER A O   1 
ATOM 4663  C CB  . SER A 1 601  ? 22.237  -6.221  59.411  1.00 115.92 ? 598  SER A CB  1 
ATOM 4664  O OG  . SER A 1 601  ? 22.658  -7.161  60.388  1.00 115.71 ? 598  SER A OG  1 
ATOM 4665  N N   . SER A 1 602  ? 23.152  -5.611  55.961  1.00 115.05 ? 599  SER A N   1 
ATOM 4666  C CA  . SER A 1 602  ? 22.684  -5.082  54.664  1.00 114.65 ? 599  SER A CA  1 
ATOM 4667  C C   . SER A 1 602  ? 23.824  -5.024  53.640  1.00 114.31 ? 599  SER A C   1 
ATOM 4668  O O   . SER A 1 602  ? 24.998  -4.928  54.010  1.00 114.25 ? 599  SER A O   1 
ATOM 4669  C CB  . SER A 1 602  ? 22.003  -3.709  54.784  1.00 114.66 ? 599  SER A CB  1 
ATOM 4670  O OG  . SER A 1 602  ? 20.668  -3.820  55.253  1.00 114.58 ? 599  SER A OG  1 
ATOM 4671  N N   . HIS A 1 603  ? 23.463  -5.096  52.357  1.00 113.86 ? 600  HIS A N   1 
ATOM 4672  C CA  . HIS A 1 603  ? 24.412  -4.935  51.249  1.00 113.40 ? 600  HIS A CA  1 
ATOM 4673  C C   . HIS A 1 603  ? 23.975  -3.775  50.340  1.00 113.15 ? 600  HIS A C   1 
ATOM 4674  O O   . HIS A 1 603  ? 22.786  -3.641  50.030  1.00 113.16 ? 600  HIS A O   1 
ATOM 4675  C CB  . HIS A 1 603  ? 24.557  -6.242  50.459  1.00 113.32 ? 600  HIS A CB  1 
ATOM 4676  C CG  . HIS A 1 603  ? 25.060  -7.392  51.278  1.00 113.03 ? 600  HIS A CG  1 
ATOM 4677  N ND1 . HIS A 1 603  ? 26.402  -7.658  51.444  1.00 112.78 ? 600  HIS A ND1 1 
ATOM 4678  C CD2 . HIS A 1 603  ? 24.400  -8.347  51.976  1.00 112.86 ? 600  HIS A CD2 1 
ATOM 4679  C CE1 . HIS A 1 603  ? 26.548  -8.726  52.208  1.00 112.64 ? 600  HIS A CE1 1 
ATOM 4680  N NE2 . HIS A 1 603  ? 25.348  -9.165  52.543  1.00 112.65 ? 600  HIS A NE2 1 
ATOM 4681  N N   . TYR A 1 604  ? 24.938  -2.951  49.915  1.00 112.73 ? 601  TYR A N   1 
ATOM 4682  C CA  . TYR A 1 604  ? 24.655  -1.653  49.278  1.00 112.26 ? 601  TYR A CA  1 
ATOM 4683  C C   . TYR A 1 604  ? 25.328  -1.460  47.908  1.00 111.92 ? 601  TYR A C   1 
ATOM 4684  O O   . TYR A 1 604  ? 26.529  -1.698  47.762  1.00 111.79 ? 601  TYR A O   1 
ATOM 4685  C CB  . TYR A 1 604  ? 25.074  -0.508  50.212  1.00 112.23 ? 601  TYR A CB  1 
ATOM 4686  C CG  . TYR A 1 604  ? 24.570  -0.619  51.642  1.00 112.31 ? 601  TYR A CG  1 
ATOM 4687  C CD1 . TYR A 1 604  ? 25.319  -1.278  52.620  1.00 112.46 ? 601  TYR A CD1 1 
ATOM 4688  C CD2 . TYR A 1 604  ? 23.351  -0.051  52.023  1.00 112.50 ? 601  TYR A CD2 1 
ATOM 4689  C CE1 . TYR A 1 604  ? 24.860  -1.379  53.939  1.00 112.52 ? 601  TYR A CE1 1 
ATOM 4690  C CE2 . TYR A 1 604  ? 22.884  -0.146  53.344  1.00 112.40 ? 601  TYR A CE2 1 
ATOM 4691  C CZ  . TYR A 1 604  ? 23.648  -0.807  54.293  1.00 112.37 ? 601  TYR A CZ  1 
ATOM 4692  O OH  . TYR A 1 604  ? 23.203  -0.906  55.594  1.00 112.31 ? 601  TYR A OH  1 
ATOM 4693  N N   . LEU A 1 605  ? 24.550  -1.014  46.918  1.00 111.54 ? 602  LEU A N   1 
ATOM 4694  C CA  . LEU A 1 605  ? 25.079  -0.690  45.583  1.00 111.15 ? 602  LEU A CA  1 
ATOM 4695  C C   . LEU A 1 605  ? 24.985  0.801   45.256  1.00 110.82 ? 602  LEU A C   1 
ATOM 4696  O O   . LEU A 1 605  ? 23.893  1.346   45.047  1.00 110.70 ? 602  LEU A O   1 
ATOM 4697  C CB  . LEU A 1 605  ? 24.378  -1.497  44.491  1.00 111.24 ? 602  LEU A CB  1 
ATOM 4698  C CG  . LEU A 1 605  ? 24.942  -1.290  43.080  1.00 111.51 ? 602  LEU A CG  1 
ATOM 4699  C CD1 . LEU A 1 605  ? 26.071  -2.275  42.781  1.00 111.81 ? 602  LEU A CD1 1 
ATOM 4700  C CD2 . LEU A 1 605  ? 23.847  -1.392  42.032  1.00 111.73 ? 602  LEU A CD2 1 
ATOM 4701  N N   . LEU A 1 606  ? 26.148  1.441   45.187  1.00 110.44 ? 603  LEU A N   1 
ATOM 4702  C CA  . LEU A 1 606  ? 26.240  2.888   45.016  1.00 110.00 ? 603  LEU A CA  1 
ATOM 4703  C C   . LEU A 1 606  ? 26.826  3.239   43.659  1.00 109.60 ? 603  LEU A C   1 
ATOM 4704  O O   . LEU A 1 606  ? 27.793  2.615   43.206  1.00 109.51 ? 603  LEU A O   1 
ATOM 4705  C CB  . LEU A 1 606  ? 27.109  3.515   46.118  1.00 110.10 ? 603  LEU A CB  1 
ATOM 4706  C CG  . LEU A 1 606  ? 26.685  3.488   47.594  1.00 110.02 ? 603  LEU A CG  1 
ATOM 4707  C CD1 . LEU A 1 606  ? 27.010  2.154   48.273  1.00 109.81 ? 603  LEU A CD1 1 
ATOM 4708  C CD2 . LEU A 1 606  ? 27.365  4.631   48.334  1.00 109.99 ? 603  LEU A CD2 1 
ATOM 4709  N N   . CYS A 1 607  ? 26.234  4.249   43.028  1.00 108.98 ? 604  CYS A N   1 
ATOM 4710  C CA  . CYS A 1 607  ? 26.703  4.751   41.748  1.00 108.50 ? 604  CYS A CA  1 
ATOM 4711  C C   . CYS A 1 607  ? 26.899  6.259   41.809  1.00 108.21 ? 604  CYS A C   1 
ATOM 4712  O O   . CYS A 1 607  ? 26.037  6.980   42.314  1.00 108.23 ? 604  CYS A O   1 
ATOM 4713  C CB  . CYS A 1 607  ? 25.703  4.409   40.650  1.00 108.45 ? 604  CYS A CB  1 
ATOM 4714  S SG  . CYS A 1 607  ? 26.247  4.888   39.002  1.00 108.73 ? 604  CYS A SG  1 
ATOM 4715  N N   . ALA A 1 608  ? 28.032  6.725   41.286  1.00 107.85 ? 605  ALA A N   1 
ATOM 4716  C CA  . ALA A 1 608  ? 28.353  8.154   41.245  1.00 107.46 ? 605  ALA A CA  1 
ATOM 4717  C C   . ALA A 1 608  ? 28.330  8.690   39.822  1.00 107.19 ? 605  ALA A C   1 
ATOM 4718  O O   . ALA A 1 608  ? 28.784  8.020   38.894  1.00 107.12 ? 605  ALA A O   1 
ATOM 4719  C CB  . ALA A 1 608  ? 29.708  8.407   41.874  1.00 107.59 ? 605  ALA A CB  1 
ATOM 4720  N N   . LEU A 1 609  ? 27.807  9.901   39.657  1.00 106.91 ? 606  LEU A N   1 
ATOM 4721  C CA  . LEU A 1 609  ? 27.718  10.525  38.338  1.00 106.75 ? 606  LEU A CA  1 
ATOM 4722  C C   . LEU A 1 609  ? 28.853  11.503  38.070  1.00 106.63 ? 606  LEU A C   1 
ATOM 4723  O O   . LEU A 1 609  ? 29.668  11.780  38.952  1.00 106.78 ? 606  LEU A O   1 
ATOM 4724  C CB  . LEU A 1 609  ? 26.378  11.238  38.162  1.00 106.78 ? 606  LEU A CB  1 
ATOM 4725  C CG  . LEU A 1 609  ? 25.105  10.423  37.939  1.00 106.80 ? 606  LEU A CG  1 
ATOM 4726  C CD1 . LEU A 1 609  ? 23.987  11.386  37.590  1.00 107.24 ? 606  LEU A CD1 1 
ATOM 4727  C CD2 . LEU A 1 609  ? 25.269  9.382   36.841  1.00 106.86 ? 606  LEU A CD2 1 
ATOM 4728  N N   . GLY A 1 610  ? 28.880  12.035  36.849  1.00 106.38 ? 607  GLY A N   1 
ATOM 4729  C CA  . GLY A 1 610  ? 29.928  12.949  36.405  1.00 106.21 ? 607  GLY A CA  1 
ATOM 4730  C C   . GLY A 1 610  ? 29.799  14.382  36.896  1.00 106.12 ? 607  GLY A C   1 
ATOM 4731  O O   . GLY A 1 610  ? 30.808  15.060  37.114  1.00 106.11 ? 607  GLY A O   1 
ATOM 4732  N N   . ASP A 1 611  ? 28.568  14.855  37.067  1.00 105.94 ? 608  ASP A N   1 
ATOM 4733  C CA  . ASP A 1 611  ? 28.343  16.221  37.543  1.00 105.93 ? 608  ASP A CA  1 
ATOM 4734  C C   . ASP A 1 611  ? 28.299  16.318  39.082  1.00 105.95 ? 608  ASP A C   1 
ATOM 4735  O O   . ASP A 1 611  ? 27.915  17.354  39.648  1.00 105.95 ? 608  ASP A O   1 
ATOM 4736  C CB  . ASP A 1 611  ? 27.086  16.814  36.907  1.00 105.87 ? 608  ASP A CB  1 
ATOM 4737  C CG  . ASP A 1 611  ? 25.831  16.068  37.295  1.00 106.09 ? 608  ASP A CG  1 
ATOM 4738  O OD1 . ASP A 1 611  ? 24.798  16.738  37.512  1.00 106.22 ? 608  ASP A OD1 1 
ATOM 4739  O OD2 . ASP A 1 611  ? 25.878  14.819  37.392  1.00 106.20 ? 608  ASP A OD2 1 
ATOM 4740  N N   . GLY A 1 612  ? 28.697  15.232  39.745  1.00 105.83 ? 609  GLY A N   1 
ATOM 4741  C CA  . GLY A 1 612  ? 28.863  15.224  41.194  1.00 105.70 ? 609  GLY A CA  1 
ATOM 4742  C C   . GLY A 1 612  ? 27.779  14.521  41.981  1.00 105.55 ? 609  GLY A C   1 
ATOM 4743  O O   . GLY A 1 612  ? 27.996  14.130  43.130  1.00 105.56 ? 609  GLY A O   1 
ATOM 4744  N N   . ALA A 1 613  ? 26.610  14.368  41.369  1.00 105.43 ? 610  ALA A N   1 
ATOM 4745  C CA  . ALA A 1 613  ? 25.473  13.732  42.023  1.00 105.36 ? 610  ALA A CA  1 
ATOM 4746  C C   . ALA A 1 613  ? 25.724  12.251  42.323  1.00 105.25 ? 610  ALA A C   1 
ATOM 4747  O O   . ALA A 1 613  ? 26.629  11.633  41.754  1.00 105.11 ? 610  ALA A O   1 
ATOM 4748  C CB  . ALA A 1 613  ? 24.212  13.913  41.183  1.00 105.46 ? 610  ALA A CB  1 
ATOM 4749  N N   . LEU A 1 614  ? 24.922  11.698  43.227  1.00 105.21 ? 611  LEU A N   1 
ATOM 4750  C CA  . LEU A 1 614  ? 25.065  10.309  43.642  1.00 105.38 ? 611  LEU A CA  1 
ATOM 4751  C C   . LEU A 1 614  ? 23.707  9.671   43.921  1.00 105.78 ? 611  LEU A C   1 
ATOM 4752  O O   . LEU A 1 614  ? 22.844  10.283  44.557  1.00 105.97 ? 611  LEU A O   1 
ATOM 4753  C CB  . LEU A 1 614  ? 25.964  10.220  44.879  1.00 105.14 ? 611  LEU A CB  1 
ATOM 4754  C CG  . LEU A 1 614  ? 26.437  8.843   45.343  1.00 104.53 ? 611  LEU A CG  1 
ATOM 4755  C CD1 . LEU A 1 614  ? 27.855  8.929   45.867  1.00 104.18 ? 611  LEU A CD1 1 
ATOM 4756  C CD2 . LEU A 1 614  ? 25.505  8.263   46.389  1.00 103.70 ? 611  LEU A CD2 1 
ATOM 4757  N N   . PHE A 1 615  ? 23.531  8.440   43.442  1.00 106.11 ? 612  PHE A N   1 
ATOM 4758  C CA  . PHE A 1 615  ? 22.295  7.687   43.645  1.00 106.38 ? 612  PHE A CA  1 
ATOM 4759  C C   . PHE A 1 615  ? 22.559  6.460   44.505  1.00 106.72 ? 612  PHE A C   1 
ATOM 4760  O O   . PHE A 1 615  ? 23.582  5.788   44.343  1.00 106.61 ? 612  PHE A O   1 
ATOM 4761  C CB  . PHE A 1 615  ? 21.691  7.255   42.302  1.00 106.27 ? 612  PHE A CB  1 
ATOM 4762  C CG  . PHE A 1 615  ? 21.259  8.401   41.418  1.00 106.03 ? 612  PHE A CG  1 
ATOM 4763  C CD1 . PHE A 1 615  ? 21.968  8.710   40.264  1.00 105.69 ? 612  PHE A CD1 1 
ATOM 4764  C CD2 . PHE A 1 615  ? 20.138  9.163   41.732  1.00 105.90 ? 612  PHE A CD2 1 
ATOM 4765  C CE1 . PHE A 1 615  ? 21.569  9.761   39.439  1.00 105.34 ? 612  PHE A CE1 1 
ATOM 4766  C CE2 . PHE A 1 615  ? 19.739  10.216  40.910  1.00 105.65 ? 612  PHE A CE2 1 
ATOM 4767  C CZ  . PHE A 1 615  ? 20.458  10.515  39.764  1.00 105.41 ? 612  PHE A CZ  1 
ATOM 4768  N N   . TYR A 1 616  ? 21.633  6.166   45.415  1.00 107.35 ? 613  TYR A N   1 
ATOM 4769  C CA  . TYR A 1 616  ? 21.780  5.006   46.302  1.00 108.08 ? 613  TYR A CA  1 
ATOM 4770  C C   . TYR A 1 616  ? 20.723  3.928   46.110  1.00 108.48 ? 613  TYR A C   1 
ATOM 4771  O O   . TYR A 1 616  ? 19.525  4.221   46.040  1.00 108.48 ? 613  TYR A O   1 
ATOM 4772  C CB  . TYR A 1 616  ? 21.889  5.402   47.787  1.00 108.16 ? 613  TYR A CB  1 
ATOM 4773  C CG  . TYR A 1 616  ? 21.108  6.629   48.239  1.00 108.40 ? 613  TYR A CG  1 
ATOM 4774  C CD1 . TYR A 1 616  ? 21.607  7.917   48.015  1.00 108.55 ? 613  TYR A CD1 1 
ATOM 4775  C CD2 . TYR A 1 616  ? 19.904  6.501   48.937  1.00 108.35 ? 613  TYR A CD2 1 
ATOM 4776  C CE1 . TYR A 1 616  ? 20.917  9.044   48.441  1.00 108.14 ? 613  TYR A CE1 1 
ATOM 4777  C CE2 . TYR A 1 616  ? 19.208  7.628   49.373  1.00 108.21 ? 613  TYR A CE2 1 
ATOM 4778  C CZ  . TYR A 1 616  ? 19.727  8.893   49.119  1.00 108.15 ? 613  TYR A CZ  1 
ATOM 4779  O OH  . TYR A 1 616  ? 19.064  10.021  49.533  1.00 108.33 ? 613  TYR A OH  1 
ATOM 4780  N N   . PHE A 1 617  ? 21.195  2.683   46.028  1.00 109.02 ? 614  PHE A N   1 
ATOM 4781  C CA  . PHE A 1 617  ? 20.346  1.509   45.813  1.00 109.52 ? 614  PHE A CA  1 
ATOM 4782  C C   . PHE A 1 617  ? 20.818  0.305   46.634  1.00 109.80 ? 614  PHE A C   1 
ATOM 4783  O O   . PHE A 1 617  ? 21.970  0.252   47.078  1.00 109.69 ? 614  PHE A O   1 
ATOM 4784  C CB  . PHE A 1 617  ? 20.292  1.138   44.320  1.00 109.59 ? 614  PHE A CB  1 
ATOM 4785  C CG  . PHE A 1 617  ? 19.644  2.188   43.449  1.00 109.72 ? 614  PHE A CG  1 
ATOM 4786  C CD1 . PHE A 1 617  ? 20.402  2.919   42.537  1.00 109.64 ? 614  PHE A CD1 1 
ATOM 4787  C CD2 . PHE A 1 617  ? 18.278  2.445   43.540  1.00 109.74 ? 614  PHE A CD2 1 
ATOM 4788  C CE1 . PHE A 1 617  ? 19.808  3.895   41.732  1.00 109.60 ? 614  PHE A CE1 1 
ATOM 4789  C CE2 . PHE A 1 617  ? 17.678  3.415   42.742  1.00 109.64 ? 614  PHE A CE2 1 
ATOM 4790  C CZ  . PHE A 1 617  ? 18.442  4.142   41.838  1.00 109.59 ? 614  PHE A CZ  1 
ATOM 4791  N N   . GLY A 1 618  ? 19.915  -0.657  46.823  1.00 110.21 ? 615  GLY A N   1 
ATOM 4792  C CA  . GLY A 1 618  ? 20.193  -1.871  47.594  1.00 110.66 ? 615  GLY A CA  1 
ATOM 4793  C C   . GLY A 1 618  ? 20.152  -3.142  46.761  1.00 110.96 ? 615  GLY A C   1 
ATOM 4794  O O   . GLY A 1 618  ? 19.078  -3.648  46.418  1.00 110.79 ? 615  GLY A O   1 
ATOM 4795  N N   . LEU A 1 619  ? 21.343  -3.643  46.443  1.00 111.38 ? 616  LEU A N   1 
ATOM 4796  C CA  . LEU A 1 619  ? 21.532  -4.897  45.722  1.00 111.80 ? 616  LEU A CA  1 
ATOM 4797  C C   . LEU A 1 619  ? 21.669  -6.049  46.716  1.00 112.14 ? 616  LEU A C   1 
ATOM 4798  O O   . LEU A 1 619  ? 22.614  -6.085  47.511  1.00 112.22 ? 616  LEU A O   1 
ATOM 4799  C CB  . LEU A 1 619  ? 22.785  -4.804  44.837  1.00 111.80 ? 616  LEU A CB  1 
ATOM 4800  C CG  . LEU A 1 619  ? 23.488  -6.063  44.309  1.00 111.88 ? 616  LEU A CG  1 
ATOM 4801  C CD1 . LEU A 1 619  ? 22.773  -6.623  43.085  1.00 112.18 ? 616  LEU A CD1 1 
ATOM 4802  C CD2 . LEU A 1 619  ? 24.950  -5.769  43.993  1.00 111.72 ? 616  LEU A CD2 1 
ATOM 4803  N N   . ASN A 1 620  ? 20.722  -6.983  46.671  1.00 112.50 ? 617  ASN A N   1 
ATOM 4804  C CA  . ASN A 1 620  ? 20.768  -8.158  47.535  1.00 112.86 ? 617  ASN A CA  1 
ATOM 4805  C C   . ASN A 1 620  ? 21.836  -9.134  47.063  1.00 113.18 ? 617  ASN A C   1 
ATOM 4806  O O   . ASN A 1 620  ? 22.028  -9.312  45.857  1.00 113.18 ? 617  ASN A O   1 
ATOM 4807  C CB  . ASN A 1 620  ? 19.411  -8.861  47.583  1.00 112.80 ? 617  ASN A CB  1 
ATOM 4808  C CG  . ASN A 1 620  ? 18.295  -7.951  48.052  1.00 112.72 ? 617  ASN A CG  1 
ATOM 4809  O OD1 . ASN A 1 620  ? 17.949  -7.933  49.234  1.00 112.50 ? 617  ASN A OD1 1 
ATOM 4810  N ND2 . ASN A 1 620  ? 17.723  -7.187  47.126  1.00 112.62 ? 617  ASN A ND2 1 
ATOM 4811  N N   . ILE A 1 621  ? 22.531  -9.754  48.017  1.00 113.63 ? 618  ILE A N   1 
ATOM 4812  C CA  . ILE A 1 621  ? 23.519  -10.802 47.715  1.00 114.03 ? 618  ILE A CA  1 
ATOM 4813  C C   . ILE A 1 621  ? 22.874  -12.037 47.076  1.00 114.21 ? 618  ILE A C   1 
ATOM 4814  O O   . ILE A 1 621  ? 23.552  -12.846 46.434  1.00 114.28 ? 618  ILE A O   1 
ATOM 4815  C CB  . ILE A 1 621  ? 24.362  -11.222 48.962  1.00 114.06 ? 618  ILE A CB  1 
ATOM 4816  C CG1 . ILE A 1 621  ? 23.481  -11.362 50.215  1.00 114.16 ? 618  ILE A CG1 1 
ATOM 4817  C CG2 . ILE A 1 621  ? 25.519  -10.246 49.176  1.00 114.10 ? 618  ILE A CG2 1 
ATOM 4818  C CD1 . ILE A 1 621  ? 24.095  -12.201 51.336  1.00 114.11 ? 618  ILE A CD1 1 
ATOM 4819  N N   . GLU A 1 622  ? 21.561  -12.163 47.252  1.00 114.40 ? 619  GLU A N   1 
ATOM 4820  C CA  . GLU A 1 622  ? 20.805  -13.276 46.700  1.00 114.52 ? 619  GLU A CA  1 
ATOM 4821  C C   . GLU A 1 622  ? 19.920  -12.814 45.537  1.00 114.58 ? 619  GLU A C   1 
ATOM 4822  O O   . GLU A 1 622  ? 20.230  -13.084 44.371  1.00 114.50 ? 619  GLU A O   1 
ATOM 4823  C CB  . GLU A 1 622  ? 19.963  -13.951 47.794  1.00 114.57 ? 619  GLU A CB  1 
ATOM 4824  C CG  . GLU A 1 622  ? 20.675  -14.158 49.138  1.00 114.70 ? 619  GLU A CG  1 
ATOM 4825  C CD  . GLU A 1 622  ? 21.789  -15.191 49.076  1.00 114.95 ? 619  GLU A CD  1 
ATOM 4826  O OE1 . GLU A 1 622  ? 22.903  -14.850 48.621  1.00 114.77 ? 619  GLU A OE1 1 
ATOM 4827  O OE2 . GLU A 1 622  ? 21.554  -16.344 49.501  1.00 115.18 ? 619  GLU A OE2 1 
ATOM 4828  N N   . THR A 1 623  ? 18.846  -12.093 45.865  1.00 114.68 ? 620  THR A N   1 
ATOM 4829  C CA  . THR A 1 623  ? 17.782  -11.767 44.907  1.00 114.83 ? 620  THR A CA  1 
ATOM 4830  C C   . THR A 1 623  ? 18.279  -11.025 43.666  1.00 114.98 ? 620  THR A C   1 
ATOM 4831  O O   . THR A 1 623  ? 17.959  -11.407 42.539  1.00 114.95 ? 620  THR A O   1 
ATOM 4832  C CB  . THR A 1 623  ? 16.613  -10.974 45.565  1.00 114.79 ? 620  THR A CB  1 
ATOM 4833  O OG1 . THR A 1 623  ? 16.992  -9.607  45.760  1.00 114.70 ? 620  THR A OG1 1 
ATOM 4834  C CG2 . THR A 1 623  ? 16.204  -11.591 46.899  1.00 114.75 ? 620  THR A CG2 1 
ATOM 4835  N N   . GLY A 1 624  ? 19.066  -9.974  43.884  1.00 115.22 ? 621  GLY A N   1 
ATOM 4836  C CA  . GLY A 1 624  ? 19.535  -9.115  42.796  1.00 115.46 ? 621  GLY A CA  1 
ATOM 4837  C C   . GLY A 1 624  ? 18.404  -8.259  42.259  1.00 115.59 ? 621  GLY A C   1 
ATOM 4838  O O   . GLY A 1 624  ? 18.118  -8.262  41.059  1.00 115.65 ? 621  GLY A O   1 
ATOM 4839  N N   . LEU A 1 625  ? 17.754  -7.532  43.163  1.00 115.66 ? 622  LEU A N   1 
ATOM 4840  C CA  . LEU A 1 625  ? 16.594  -6.714  42.833  1.00 115.68 ? 622  LEU A CA  1 
ATOM 4841  C C   . LEU A 1 625  ? 16.874  -5.238  43.117  1.00 115.69 ? 622  LEU A C   1 
ATOM 4842  O O   . LEU A 1 625  ? 17.923  -4.893  43.666  1.00 115.78 ? 622  LEU A O   1 
ATOM 4843  C CB  . LEU A 1 625  ? 15.375  -7.196  43.634  1.00 115.69 ? 622  LEU A CB  1 
ATOM 4844  C CG  . LEU A 1 625  ? 14.439  -8.299  43.106  1.00 115.68 ? 622  LEU A CG  1 
ATOM 4845  C CD1 . LEU A 1 625  ? 15.152  -9.512  42.504  1.00 115.37 ? 622  LEU A CD1 1 
ATOM 4846  C CD2 . LEU A 1 625  ? 13.487  -8.736  44.215  1.00 115.70 ? 622  LEU A CD2 1 
ATOM 4847  N N   . LEU A 1 626  ? 15.935  -4.375  42.737  1.00 115.68 ? 623  LEU A N   1 
ATOM 4848  C CA  . LEU A 1 626  ? 16.021  -2.939  43.017  1.00 115.67 ? 623  LEU A CA  1 
ATOM 4849  C C   . LEU A 1 626  ? 15.940  -2.597  44.511  1.00 115.70 ? 623  LEU A C   1 
ATOM 4850  O O   . LEU A 1 626  ? 15.906  -3.486  45.369  1.00 115.71 ? 623  LEU A O   1 
ATOM 4851  C CB  . LEU A 1 626  ? 14.910  -2.189  42.273  1.00 115.66 ? 623  LEU A CB  1 
ATOM 4852  C CG  . LEU A 1 626  ? 15.242  -1.231  41.130  1.00 115.57 ? 623  LEU A CG  1 
ATOM 4853  C CD1 . LEU A 1 626  ? 13.948  -0.637  40.611  1.00 115.68 ? 623  LEU A CD1 1 
ATOM 4854  C CD2 . LEU A 1 626  ? 16.181  -0.121  41.580  1.00 115.20 ? 623  LEU A CD2 1 
ATOM 4855  N N   . SER A 1 627  ? 15.933  -1.293  44.799  1.00 115.69 ? 624  SER A N   1 
ATOM 4856  C CA  . SER A 1 627  ? 15.644  -0.741  46.130  1.00 115.55 ? 624  SER A CA  1 
ATOM 4857  C C   . SER A 1 627  ? 15.186  0.719   46.016  1.00 115.42 ? 624  SER A C   1 
ATOM 4858  O O   . SER A 1 627  ? 14.630  1.129   44.987  1.00 115.41 ? 624  SER A O   1 
ATOM 4859  C CB  . SER A 1 627  ? 16.853  -0.855  47.067  1.00 115.53 ? 624  SER A CB  1 
ATOM 4860  O OG  . SER A 1 627  ? 17.077  -2.199  47.459  1.00 115.48 ? 624  SER A OG  1 
ATOM 4861  N N   . ASP A 1 628  ? 15.424  1.494   47.072  1.00 115.18 ? 625  ASP A N   1 
ATOM 4862  C CA  . ASP A 1 628  ? 14.983  2.885   47.134  1.00 114.92 ? 625  ASP A CA  1 
ATOM 4863  C C   . ASP A 1 628  ? 15.803  3.765   46.193  1.00 114.64 ? 625  ASP A C   1 
ATOM 4864  O O   . ASP A 1 628  ? 16.980  3.492   45.951  1.00 114.58 ? 625  ASP A O   1 
ATOM 4865  C CB  . ASP A 1 628  ? 15.080  3.424   48.571  1.00 115.01 ? 625  ASP A CB  1 
ATOM 4866  C CG  . ASP A 1 628  ? 14.442  2.498   49.603  1.00 115.04 ? 625  ASP A CG  1 
ATOM 4867  O OD1 . ASP A 1 628  ? 14.781  2.629   50.800  1.00 115.04 ? 625  ASP A OD1 1 
ATOM 4868  O OD2 . ASP A 1 628  ? 13.608  1.644   49.230  1.00 115.19 ? 625  ASP A OD2 1 
ATOM 4869  N N   . ARG A 1 629  ? 15.169  4.813   45.668  1.00 114.24 ? 626  ARG A N   1 
ATOM 4870  C CA  . ARG A 1 629  ? 15.848  5.799   44.826  1.00 113.82 ? 626  ARG A CA  1 
ATOM 4871  C C   . ARG A 1 629  ? 15.780  7.198   45.425  1.00 113.43 ? 626  ARG A C   1 
ATOM 4872  O O   . ARG A 1 629  ? 14.728  7.624   45.907  1.00 113.39 ? 626  ARG A O   1 
ATOM 4873  C CB  . ARG A 1 629  ? 15.246  5.830   43.420  1.00 113.89 ? 626  ARG A CB  1 
ATOM 4874  C CG  . ARG A 1 629  ? 15.954  6.794   42.474  1.00 113.82 ? 626  ARG A CG  1 
ATOM 4875  C CD  . ARG A 1 629  ? 15.093  7.137   41.279  1.00 114.13 ? 626  ARG A CD  1 
ATOM 4876  N NE  . ARG A 1 629  ? 15.835  7.899   40.277  1.00 114.19 ? 626  ARG A NE  1 
ATOM 4877  C CZ  . ARG A 1 629  ? 16.536  7.362   39.280  1.00 114.16 ? 626  ARG A CZ  1 
ATOM 4878  N NH1 . ARG A 1 629  ? 16.608  6.043   39.130  1.00 114.04 ? 626  ARG A NH1 1 
ATOM 4879  N NH2 . ARG A 1 629  ? 17.170  8.151   38.426  1.00 114.25 ? 626  ARG A NH2 1 
ATOM 4880  N N   . LYS A 1 630  ? 16.914  7.897   45.376  1.00 112.94 ? 627  LYS A N   1 
ATOM 4881  C CA  . LYS A 1 630  ? 17.023  9.306   45.767  1.00 112.44 ? 627  LYS A CA  1 
ATOM 4882  C C   . LYS A 1 630  ? 18.306  9.925   45.193  1.00 111.95 ? 627  LYS A C   1 
ATOM 4883  O O   . LYS A 1 630  ? 19.279  9.218   44.903  1.00 111.79 ? 627  LYS A O   1 
ATOM 4884  C CB  . LYS A 1 630  ? 16.969  9.466   47.297  1.00 112.55 ? 627  LYS A CB  1 
ATOM 4885  C CG  . LYS A 1 630  ? 15.581  9.791   47.881  1.00 112.70 ? 627  LYS A CG  1 
ATOM 4886  C CD  . LYS A 1 630  ? 15.297  9.050   49.203  1.00 112.89 ? 627  LYS A CD  1 
ATOM 4887  C CE  . LYS A 1 630  ? 15.955  9.706   50.424  1.00 112.90 ? 627  LYS A CE  1 
ATOM 4888  N NZ  . LYS A 1 630  ? 15.327  11.003  50.810  1.00 112.96 ? 627  LYS A NZ  1 
ATOM 4889  N N   . LYS A 1 631  ? 18.290  11.247  45.032  1.00 111.34 ? 628  LYS A N   1 
ATOM 4890  C CA  . LYS A 1 631  ? 19.410  11.993  44.461  1.00 110.70 ? 628  LYS A CA  1 
ATOM 4891  C C   . LYS A 1 631  ? 19.969  13.010  45.455  1.00 110.30 ? 628  LYS A C   1 
ATOM 4892  O O   . LYS A 1 631  ? 19.219  13.795  46.044  1.00 110.16 ? 628  LYS A O   1 
ATOM 4893  C CB  . LYS A 1 631  ? 18.972  12.705  43.173  1.00 110.71 ? 628  LYS A CB  1 
ATOM 4894  C CG  . LYS A 1 631  ? 20.059  13.541  42.494  1.00 110.65 ? 628  LYS A CG  1 
ATOM 4895  C CD  . LYS A 1 631  ? 19.544  14.229  41.230  1.00 110.65 ? 628  LYS A CD  1 
ATOM 4896  C CE  . LYS A 1 631  ? 20.633  15.075  40.577  1.00 110.49 ? 628  LYS A CE  1 
ATOM 4897  N NZ  . LYS A 1 631  ? 20.282  15.501  39.195  1.00 109.90 ? 628  LYS A NZ  1 
ATOM 4898  N N   . VAL A 1 632  ? 21.289  12.982  45.628  1.00 109.81 ? 629  VAL A N   1 
ATOM 4899  C CA  . VAL A 1 632  ? 22.010  13.970  46.438  1.00 109.30 ? 629  VAL A CA  1 
ATOM 4900  C C   . VAL A 1 632  ? 23.021  14.723  45.571  1.00 108.90 ? 629  VAL A C   1 
ATOM 4901  O O   . VAL A 1 632  ? 23.361  14.268  44.478  1.00 108.91 ? 629  VAL A O   1 
ATOM 4902  C CB  . VAL A 1 632  ? 22.761  13.310  47.629  1.00 109.30 ? 629  VAL A CB  1 
ATOM 4903  C CG1 . VAL A 1 632  ? 21.783  12.677  48.611  1.00 109.43 ? 629  VAL A CG1 1 
ATOM 4904  C CG2 . VAL A 1 632  ? 23.765  12.280  47.137  1.00 109.21 ? 629  VAL A CG2 1 
ATOM 4905  N N   . THR A 1 633  ? 23.490  15.873  46.048  1.00 108.35 ? 630  THR A N   1 
ATOM 4906  C CA  . THR A 1 633  ? 24.677  16.490  45.460  1.00 107.92 ? 630  THR A CA  1 
ATOM 4907  C C   . THR A 1 633  ? 25.885  16.318  46.379  1.00 107.72 ? 630  THR A C   1 
ATOM 4908  O O   . THR A 1 633  ? 25.758  16.321  47.608  1.00 107.84 ? 630  THR A O   1 
ATOM 4909  C CB  . THR A 1 633  ? 24.491  17.989  45.088  1.00 107.89 ? 630  THR A CB  1 
ATOM 4910  O OG1 . THR A 1 633  ? 25.682  18.471  44.452  1.00 107.50 ? 630  THR A OG1 1 
ATOM 4911  C CG2 . THR A 1 633  ? 24.222  18.846  46.317  1.00 108.01 ? 630  THR A CG2 1 
ATOM 4912  N N   . LEU A 1 634  ? 27.050  16.138  45.772  1.00 107.25 ? 631  LEU A N   1 
ATOM 4913  C CA  . LEU A 1 634  ? 28.299  16.213  46.495  1.00 106.79 ? 631  LEU A CA  1 
ATOM 4914  C C   . LEU A 1 634  ? 28.990  17.469  46.003  1.00 106.60 ? 631  LEU A C   1 
ATOM 4915  O O   . LEU A 1 634  ? 28.510  18.575  46.251  1.00 106.60 ? 631  LEU A O   1 
ATOM 4916  C CB  . LEU A 1 634  ? 29.153  14.971  46.249  1.00 106.77 ? 631  LEU A CB  1 
ATOM 4917  C CG  . LEU A 1 634  ? 28.793  13.661  46.955  1.00 106.58 ? 631  LEU A CG  1 
ATOM 4918  C CD1 . LEU A 1 634  ? 30.087  12.936  47.271  1.00 106.63 ? 631  LEU A CD1 1 
ATOM 4919  C CD2 . LEU A 1 634  ? 27.984  13.862  48.234  1.00 106.09 ? 631  LEU A CD2 1 
ATOM 4920  N N   . GLY A 1 635  ? 30.100  17.296  45.290  1.00 106.36 ? 632  GLY A N   1 
ATOM 4921  C CA  . GLY A 1 635  ? 30.748  18.403  44.603  1.00 105.92 ? 632  GLY A CA  1 
ATOM 4922  C C   . GLY A 1 635  ? 30.105  18.598  43.247  1.00 105.63 ? 632  GLY A C   1 
ATOM 4923  O O   . GLY A 1 635  ? 29.034  18.057  42.977  1.00 105.73 ? 632  GLY A O   1 
ATOM 4924  N N   . THR A 1 636  ? 30.748  19.379  42.390  1.00 105.34 ? 633  THR A N   1 
ATOM 4925  C CA  . THR A 1 636  ? 30.279  19.532  41.015  1.00 105.04 ? 633  THR A CA  1 
ATOM 4926  C C   . THR A 1 636  ? 31.235  18.828  40.060  1.00 104.61 ? 633  THR A C   1 
ATOM 4927  O O   . THR A 1 636  ? 31.099  18.939  38.845  1.00 104.51 ? 633  THR A O   1 
ATOM 4928  C CB  . THR A 1 636  ? 30.118  21.015  40.617  1.00 105.20 ? 633  THR A CB  1 
ATOM 4929  O OG1 . THR A 1 636  ? 31.363  21.702  40.805  1.00 105.61 ? 633  THR A OG1 1 
ATOM 4930  C CG2 . THR A 1 636  ? 29.029  21.691  41.457  1.00 105.16 ? 633  THR A CG2 1 
ATOM 4931  N N   . GLN A 1 637  ? 32.203  18.113  40.633  1.00 104.26 ? 634  GLN A N   1 
ATOM 4932  C CA  . GLN A 1 637  ? 33.177  17.316  39.882  1.00 103.82 ? 634  GLN A CA  1 
ATOM 4933  C C   . GLN A 1 637  ? 32.781  15.844  39.950  1.00 103.62 ? 634  GLN A C   1 
ATOM 4934  O O   . GLN A 1 637  ? 31.910  15.480  40.736  1.00 103.61 ? 634  GLN A O   1 
ATOM 4935  C CB  . GLN A 1 637  ? 34.593  17.489  40.460  1.00 103.73 ? 634  GLN A CB  1 
ATOM 4936  C CG  . GLN A 1 637  ? 35.022  18.924  40.741  1.00 103.30 ? 634  GLN A CG  1 
ATOM 4937  C CD  . GLN A 1 637  ? 34.672  19.886  39.623  1.00 102.72 ? 634  GLN A CD  1 
ATOM 4938  O OE1 . GLN A 1 637  ? 35.182  19.778  38.506  1.00 102.47 ? 634  GLN A OE1 1 
ATOM 4939  N NE2 . GLN A 1 637  ? 33.797  20.840  39.923  1.00 102.04 ? 634  GLN A NE2 1 
ATOM 4940  N N   . PRO A 1 638  ? 33.411  14.987  39.126  1.00 103.46 ? 635  PRO A N   1 
ATOM 4941  C CA  . PRO A 1 638  ? 33.175  13.546  39.279  1.00 103.33 ? 635  PRO A CA  1 
ATOM 4942  C C   . PRO A 1 638  ? 33.556  13.039  40.671  1.00 103.00 ? 635  PRO A C   1 
ATOM 4943  O O   . PRO A 1 638  ? 34.415  13.630  41.329  1.00 102.97 ? 635  PRO A O   1 
ATOM 4944  C CB  . PRO A 1 638  ? 34.081  12.916  38.206  1.00 103.38 ? 635  PRO A CB  1 
ATOM 4945  C CG  . PRO A 1 638  ? 35.053  13.988  37.820  1.00 103.53 ? 635  PRO A CG  1 
ATOM 4946  C CD  . PRO A 1 638  ? 34.327  15.281  38.010  1.00 103.54 ? 635  PRO A CD  1 
ATOM 4947  N N   . THR A 1 639  ? 32.917  11.957  41.107  1.00 102.67 ? 636  THR A N   1 
ATOM 4948  C CA  . THR A 1 639  ? 33.160  11.410  42.434  1.00 102.45 ? 636  THR A CA  1 
ATOM 4949  C C   . THR A 1 639  ? 33.723  9.990   42.389  1.00 102.37 ? 636  THR A C   1 
ATOM 4950  O O   . THR A 1 639  ? 33.104  9.087   41.819  1.00 102.47 ? 636  THR A O   1 
ATOM 4951  C CB  . THR A 1 639  ? 31.887  11.453  43.278  1.00 102.39 ? 636  THR A CB  1 
ATOM 4952  O OG1 . THR A 1 639  ? 31.417  12.802  43.340  1.00 102.74 ? 636  THR A OG1 1 
ATOM 4953  C CG2 . THR A 1 639  ? 32.153  10.963  44.685  1.00 102.45 ? 636  THR A CG2 1 
ATOM 4954  N N   . VAL A 1 640  ? 34.900  9.809   42.990  1.00 102.09 ? 637  VAL A N   1 
ATOM 4955  C CA  . VAL A 1 640  ? 35.552  8.500   43.076  1.00 101.77 ? 637  VAL A CA  1 
ATOM 4956  C C   . VAL A 1 640  ? 35.191  7.837   44.402  1.00 101.76 ? 637  VAL A C   1 
ATOM 4957  O O   . VAL A 1 640  ? 35.388  8.418   45.472  1.00 101.78 ? 637  VAL A O   1 
ATOM 4958  C CB  . VAL A 1 640  ? 37.087  8.613   42.937  1.00 101.67 ? 637  VAL A CB  1 
ATOM 4959  C CG1 . VAL A 1 640  ? 37.738  7.233   42.918  1.00 101.46 ? 637  VAL A CG1 1 
ATOM 4960  C CG2 . VAL A 1 640  ? 37.442  9.375   41.683  1.00 101.56 ? 637  VAL A CG2 1 
ATOM 4961  N N   . LEU A 1 641  ? 34.658  6.622   44.318  1.00 101.66 ? 638  LEU A N   1 
ATOM 4962  C CA  . LEU A 1 641  ? 34.191  5.888   45.489  1.00 101.58 ? 638  LEU A CA  1 
ATOM 4963  C C   . LEU A 1 641  ? 35.213  4.847   45.934  1.00 101.78 ? 638  LEU A C   1 
ATOM 4964  O O   . LEU A 1 641  ? 35.604  3.977   45.156  1.00 101.72 ? 638  LEU A O   1 
ATOM 4965  C CB  . LEU A 1 641  ? 32.846  5.219   45.195  1.00 101.36 ? 638  LEU A CB  1 
ATOM 4966  C CG  . LEU A 1 641  ? 31.734  6.080   44.585  1.00 101.06 ? 638  LEU A CG  1 
ATOM 4967  C CD1 . LEU A 1 641  ? 30.727  5.208   43.862  1.00 101.09 ? 638  LEU A CD1 1 
ATOM 4968  C CD2 . LEU A 1 641  ? 31.041  6.943   45.632  1.00 100.87 ? 638  LEU A CD2 1 
ATOM 4969  N N   . ARG A 1 642  ? 35.653  4.955   47.184  1.00 102.15 ? 639  ARG A N   1 
ATOM 4970  C CA  . ARG A 1 642  ? 36.568  3.981   47.778  1.00 102.42 ? 639  ARG A CA  1 
ATOM 4971  C C   . ARG A 1 642  ? 36.015  3.451   49.093  1.00 102.60 ? 639  ARG A C   1 
ATOM 4972  O O   . ARG A 1 642  ? 35.049  3.986   49.637  1.00 102.55 ? 639  ARG A O   1 
ATOM 4973  C CB  . ARG A 1 642  ? 37.964  4.584   47.990  1.00 102.41 ? 639  ARG A CB  1 
ATOM 4974  C CG  . ARG A 1 642  ? 39.025  3.595   48.507  1.00 102.67 ? 639  ARG A CG  1 
ATOM 4975  C CD  . ARG A 1 642  ? 39.395  2.548   47.464  1.00 103.65 ? 639  ARG A CD  1 
ATOM 4976  N NE  . ARG A 1 642  ? 40.096  3.143   46.326  1.00 104.56 ? 639  ARG A NE  1 
ATOM 4977  C CZ  . ARG A 1 642  ? 41.354  2.876   45.983  1.00 104.93 ? 639  ARG A CZ  1 
ATOM 4978  N NH1 . ARG A 1 642  ? 42.072  1.998   46.675  1.00 105.24 ? 639  ARG A NH1 1 
ATOM 4979  N NH2 . ARG A 1 642  ? 41.895  3.486   44.934  1.00 104.96 ? 639  ARG A NH2 1 
ATOM 4980  N N   . THR A 1 643  ? 36.638  2.389   49.587  1.00 102.96 ? 640  THR A N   1 
ATOM 4981  C CA  . THR A 1 643  ? 36.269  1.787   50.856  1.00 103.31 ? 640  THR A CA  1 
ATOM 4982  C C   . THR A 1 643  ? 37.417  1.943   51.865  1.00 103.53 ? 640  THR A C   1 
ATOM 4983  O O   . THR A 1 643  ? 38.594  1.916   51.486  1.00 103.51 ? 640  THR A O   1 
ATOM 4984  C CB  . THR A 1 643  ? 35.843  0.307   50.663  1.00 103.29 ? 640  THR A CB  1 
ATOM 4985  O OG1 . THR A 1 643  ? 35.311  -0.209  51.888  1.00 103.44 ? 640  THR A OG1 1 
ATOM 4986  C CG2 . THR A 1 643  ? 37.013  -0.567  50.174  1.00 103.00 ? 640  THR A CG2 1 
ATOM 4987  N N   . PHE A 1 644  ? 37.076  2.132   53.138  1.00 103.83 ? 641  PHE A N   1 
ATOM 4988  C CA  . PHE A 1 644  ? 38.098  2.390   54.154  1.00 104.18 ? 641  PHE A CA  1 
ATOM 4989  C C   . PHE A 1 644  ? 37.976  1.612   55.473  1.00 104.34 ? 641  PHE A C   1 
ATOM 4990  O O   . PHE A 1 644  ? 36.902  1.119   55.827  1.00 104.27 ? 641  PHE A O   1 
ATOM 4991  C CB  . PHE A 1 644  ? 38.272  3.910   54.407  1.00 104.22 ? 641  PHE A CB  1 
ATOM 4992  C CG  . PHE A 1 644  ? 37.102  4.588   55.109  1.00 104.24 ? 641  PHE A CG  1 
ATOM 4993  C CD1 . PHE A 1 644  ? 36.794  4.310   56.441  1.00 104.31 ? 641  PHE A CD1 1 
ATOM 4994  C CD2 . PHE A 1 644  ? 36.355  5.556   54.453  1.00 103.92 ? 641  PHE A CD2 1 
ATOM 4995  C CE1 . PHE A 1 644  ? 35.739  4.951   57.086  1.00 103.73 ? 641  PHE A CE1 1 
ATOM 4996  C CE2 . PHE A 1 644  ? 35.302  6.203   55.096  1.00 103.68 ? 641  PHE A CE2 1 
ATOM 4997  C CZ  . PHE A 1 644  ? 34.998  5.899   56.412  1.00 103.56 ? 641  PHE A CZ  1 
ATOM 4998  N N   . ARG A 1 645  ? 39.109  1.501   56.169  1.00 104.57 ? 642  ARG A N   1 
ATOM 4999  C CA  . ARG A 1 645  ? 39.179  0.963   57.523  1.00 104.82 ? 642  ARG A CA  1 
ATOM 5000  C C   . ARG A 1 645  ? 39.151  2.109   58.535  1.00 104.84 ? 642  ARG A C   1 
ATOM 5001  O O   . ARG A 1 645  ? 39.951  3.045   58.440  1.00 104.87 ? 642  ARG A O   1 
ATOM 5002  C CB  . ARG A 1 645  ? 40.455  0.115   57.707  1.00 104.88 ? 642  ARG A CB  1 
ATOM 5003  C CG  . ARG A 1 645  ? 40.919  -0.035  59.172  1.00 105.13 ? 642  ARG A CG  1 
ATOM 5004  C CD  . ARG A 1 645  ? 41.972  -1.122  59.394  1.00 104.93 ? 642  ARG A CD  1 
ATOM 5005  N NE  . ARG A 1 645  ? 43.189  -0.926  58.605  1.00 105.08 ? 642  ARG A NE  1 
ATOM 5006  C CZ  . ARG A 1 645  ? 44.384  -1.421  58.923  1.00 104.91 ? 642  ARG A CZ  1 
ATOM 5007  N NH1 . ARG A 1 645  ? 44.547  -2.134  60.033  1.00 105.04 ? 642  ARG A NH1 1 
ATOM 5008  N NH2 . ARG A 1 645  ? 45.423  -1.199  58.131  1.00 104.43 ? 642  ARG A NH2 1 
ATOM 5009  N N   . SER A 1 646  ? 38.227  2.030   59.492  1.00 104.93 ? 643  SER A N   1 
ATOM 5010  C CA  . SER A 1 646  ? 38.205  2.960   60.625  1.00 105.04 ? 643  SER A CA  1 
ATOM 5011  C C   . SER A 1 646  ? 38.179  2.197   61.959  1.00 105.15 ? 643  SER A C   1 
ATOM 5012  O O   . SER A 1 646  ? 39.234  1.849   62.500  1.00 105.14 ? 643  SER A O   1 
ATOM 5013  C CB  . SER A 1 646  ? 37.048  3.970   60.505  1.00 104.99 ? 643  SER A CB  1 
ATOM 5014  O OG  . SER A 1 646  ? 35.802  3.327   60.296  1.00 104.81 ? 643  SER A OG  1 
ATOM 5015  N N   . LEU A 1 647  ? 36.979  1.938   62.474  1.00 105.24 ? 644  LEU A N   1 
ATOM 5016  C CA  . LEU A 1 647  ? 36.795  1.090   63.648  1.00 105.21 ? 644  LEU A CA  1 
ATOM 5017  C C   . LEU A 1 647  ? 36.321  -0.294  63.191  1.00 105.22 ? 644  LEU A C   1 
ATOM 5018  O O   . LEU A 1 647  ? 36.772  -0.798  62.153  1.00 105.24 ? 644  LEU A O   1 
ATOM 5019  C CB  . LEU A 1 647  ? 35.817  1.737   64.652  1.00 105.26 ? 644  LEU A CB  1 
ATOM 5020  C CG  . LEU A 1 647  ? 34.362  2.108   64.301  1.00 105.26 ? 644  LEU A CG  1 
ATOM 5021  C CD1 . LEU A 1 647  ? 33.502  2.189   65.562  1.00 104.99 ? 644  LEU A CD1 1 
ATOM 5022  C CD2 . LEU A 1 647  ? 34.260  3.408   63.505  1.00 105.58 ? 644  LEU A CD2 1 
ATOM 5023  N N   . SER A 1 648  ? 35.428  -0.906  63.969  1.00 105.21 ? 645  SER A N   1 
ATOM 5024  C CA  . SER A 1 648  ? 34.747  -2.138  63.570  1.00 105.08 ? 645  SER A CA  1 
ATOM 5025  C C   . SER A 1 648  ? 33.922  -1.901  62.301  1.00 104.96 ? 645  SER A C   1 
ATOM 5026  O O   . SER A 1 648  ? 34.026  -2.663  61.335  1.00 104.91 ? 645  SER A O   1 
ATOM 5027  C CB  . SER A 1 648  ? 33.872  -2.677  64.712  1.00 105.07 ? 645  SER A CB  1 
ATOM 5028  O OG  . SER A 1 648  ? 33.004  -1.678  65.228  1.00 104.99 ? 645  SER A OG  1 
ATOM 5029  N N   . THR A 1 649  ? 33.118  -0.837  62.308  1.00 104.83 ? 646  THR A N   1 
ATOM 5030  C CA  . THR A 1 649  ? 32.417  -0.394  61.102  1.00 104.67 ? 646  THR A CA  1 
ATOM 5031  C C   . THR A 1 649  ? 33.442  0.221   60.148  1.00 104.60 ? 646  THR A C   1 
ATOM 5032  O O   . THR A 1 649  ? 33.977  1.306   60.405  1.00 104.61 ? 646  THR A O   1 
ATOM 5033  C CB  . THR A 1 649  ? 31.237  0.600   61.392  1.00 104.66 ? 646  THR A CB  1 
ATOM 5034  O OG1 . THR A 1 649  ? 31.732  1.933   61.586  1.00 104.36 ? 646  THR A OG1 1 
ATOM 5035  C CG2 . THR A 1 649  ? 30.433  0.165   62.617  1.00 104.61 ? 646  THR A CG2 1 
ATOM 5036  N N   . THR A 1 650  ? 33.738  -0.509  59.073  1.00 104.42 ? 647  THR A N   1 
ATOM 5037  C CA  . THR A 1 650  ? 34.672  -0.064  58.035  1.00 104.12 ? 647  THR A CA  1 
ATOM 5038  C C   . THR A 1 650  ? 33.862  0.438   56.839  1.00 103.88 ? 647  THR A C   1 
ATOM 5039  O O   . THR A 1 650  ? 33.007  -0.286  56.319  1.00 103.79 ? 647  THR A O   1 
ATOM 5040  C CB  . THR A 1 650  ? 35.646  -1.191  57.625  1.00 104.15 ? 647  THR A CB  1 
ATOM 5041  O OG1 . THR A 1 650  ? 34.905  -2.369  57.283  1.00 104.08 ? 647  THR A OG1 1 
ATOM 5042  C CG2 . THR A 1 650  ? 36.601  -1.516  58.774  1.00 104.09 ? 647  THR A CG2 1 
ATOM 5043  N N   . ASN A 1 651  ? 34.132  1.677   56.414  1.00 103.58 ? 648  ASN A N   1 
ATOM 5044  C CA  . ASN A 1 651  ? 33.163  2.457   55.621  1.00 103.26 ? 648  ASN A CA  1 
ATOM 5045  C C   . ASN A 1 651  ? 33.634  3.015   54.263  1.00 102.79 ? 648  ASN A C   1 
ATOM 5046  O O   . ASN A 1 651  ? 34.664  2.599   53.732  1.00 102.68 ? 648  ASN A O   1 
ATOM 5047  C CB  . ASN A 1 651  ? 32.566  3.577   56.486  1.00 103.41 ? 648  ASN A CB  1 
ATOM 5048  C CG  . ASN A 1 651  ? 32.090  3.083   57.842  1.00 103.90 ? 648  ASN A CG  1 
ATOM 5049  O OD1 . ASN A 1 651  ? 31.030  2.469   57.961  1.00 104.12 ? 648  ASN A OD1 1 
ATOM 5050  N ND2 . ASN A 1 651  ? 32.879  3.355   58.876  1.00 104.60 ? 648  ASN A ND2 1 
ATOM 5051  N N   . VAL A 1 652  ? 32.864  3.967   53.726  1.00 102.21 ? 649  VAL A N   1 
ATOM 5052  C CA  . VAL A 1 652  ? 33.008  4.437   52.339  1.00 101.63 ? 649  VAL A CA  1 
ATOM 5053  C C   . VAL A 1 652  ? 33.395  5.921   52.213  1.00 101.07 ? 649  VAL A C   1 
ATOM 5054  O O   . VAL A 1 652  ? 32.654  6.801   52.646  1.00 100.90 ? 649  VAL A O   1 
ATOM 5055  C CB  . VAL A 1 652  ? 31.699  4.208   51.542  1.00 101.76 ? 649  VAL A CB  1 
ATOM 5056  C CG1 . VAL A 1 652  ? 31.985  4.062   50.045  1.00 101.67 ? 649  VAL A CG1 1 
ATOM 5057  C CG2 . VAL A 1 652  ? 30.945  2.991   52.076  1.00 101.85 ? 649  VAL A CG2 1 
ATOM 5058  N N   . PHE A 1 653  ? 34.552  6.178   51.602  1.00 100.43 ? 650  PHE A N   1 
ATOM 5059  C CA  . PHE A 1 653  ? 35.058  7.536   51.378  1.00 99.82  ? 650  PHE A CA  1 
ATOM 5060  C C   . PHE A 1 653  ? 34.731  7.980   49.961  1.00 99.45  ? 650  PHE A C   1 
ATOM 5061  O O   . PHE A 1 653  ? 35.147  7.344   48.994  1.00 99.39  ? 650  PHE A O   1 
ATOM 5062  C CB  . PHE A 1 653  ? 36.580  7.575   51.588  1.00 99.74  ? 650  PHE A CB  1 
ATOM 5063  C CG  . PHE A 1 653  ? 37.195  8.965   51.519  1.00 99.74  ? 650  PHE A CG  1 
ATOM 5064  C CD1 . PHE A 1 653  ? 37.869  9.492   52.618  1.00 99.37  ? 650  PHE A CD1 1 
ATOM 5065  C CD2 . PHE A 1 653  ? 37.131  9.732   50.355  1.00 99.52  ? 650  PHE A CD2 1 
ATOM 5066  C CE1 . PHE A 1 653  ? 38.450  10.762  52.563  1.00 98.90  ? 650  PHE A CE1 1 
ATOM 5067  C CE2 . PHE A 1 653  ? 37.705  11.005  50.299  1.00 99.09  ? 650  PHE A CE2 1 
ATOM 5068  C CZ  . PHE A 1 653  ? 38.367  11.517  51.403  1.00 98.79  ? 650  PHE A CZ  1 
ATOM 5069  N N   . ALA A 1 654  ? 34.004  9.083   49.841  1.00 99.03  ? 651  ALA A N   1 
ATOM 5070  C CA  . ALA A 1 654  ? 33.689  9.641   48.532  1.00 98.67  ? 651  ALA A CA  1 
ATOM 5071  C C   . ALA A 1 654  ? 34.614  10.805  48.179  1.00 98.40  ? 651  ALA A C   1 
ATOM 5072  O O   . ALA A 1 654  ? 34.542  11.880  48.780  1.00 98.39  ? 651  ALA A O   1 
ATOM 5073  C CB  . ALA A 1 654  ? 32.235  10.068  48.477  1.00 98.77  ? 651  ALA A CB  1 
ATOM 5074  N N   . CYS A 1 655  ? 35.489  10.576  47.204  1.00 98.03  ? 652  CYS A N   1 
ATOM 5075  C CA  . CYS A 1 655  ? 36.421  11.597  46.737  1.00 97.63  ? 652  CYS A CA  1 
ATOM 5076  C C   . CYS A 1 655  ? 35.723  12.502  45.734  1.00 97.46  ? 652  CYS A C   1 
ATOM 5077  O O   . CYS A 1 655  ? 35.050  12.016  44.828  1.00 97.40  ? 652  CYS A O   1 
ATOM 5078  C CB  . CYS A 1 655  ? 37.647  10.948  46.090  1.00 97.65  ? 652  CYS A CB  1 
ATOM 5079  S SG  . CYS A 1 655  ? 38.457  9.670   47.082  1.00 97.14  ? 652  CYS A SG  1 
ATOM 5080  N N   . SER A 1 656  ? 35.891  13.811  45.904  1.00 97.27  ? 653  SER A N   1 
ATOM 5081  C CA  . SER A 1 656  ? 35.231  14.819  45.071  1.00 97.25  ? 653  SER A CA  1 
ATOM 5082  C C   . SER A 1 656  ? 35.956  16.145  45.266  1.00 97.37  ? 653  SER A C   1 
ATOM 5083  O O   . SER A 1 656  ? 37.021  16.175  45.882  1.00 97.56  ? 653  SER A O   1 
ATOM 5084  C CB  . SER A 1 656  ? 33.758  14.955  45.477  1.00 97.21  ? 653  SER A CB  1 
ATOM 5085  O OG  . SER A 1 656  ? 33.016  15.699  44.529  1.00 97.06  ? 653  SER A OG  1 
ATOM 5086  N N   . ASP A 1 657  ? 35.403  17.241  44.748  1.00 97.49  ? 654  ASP A N   1 
ATOM 5087  C CA  . ASP A 1 657  ? 35.913  18.563  45.117  1.00 97.59  ? 654  ASP A CA  1 
ATOM 5088  C C   . ASP A 1 657  ? 35.368  18.933  46.493  1.00 97.53  ? 654  ASP A C   1 
ATOM 5089  O O   . ASP A 1 657  ? 35.960  19.739  47.207  1.00 97.71  ? 654  ASP A O   1 
ATOM 5090  C CB  . ASP A 1 657  ? 35.588  19.640  44.072  1.00 97.70  ? 654  ASP A CB  1 
ATOM 5091  C CG  . ASP A 1 657  ? 34.180  20.211  44.218  1.00 98.57  ? 654  ASP A CG  1 
ATOM 5092  O OD1 . ASP A 1 657  ? 33.228  19.579  43.708  1.00 99.10  ? 654  ASP A OD1 1 
ATOM 5093  O OD2 . ASP A 1 657  ? 34.030  21.303  44.822  1.00 99.42  ? 654  ASP A OD2 1 
ATOM 5094  N N   . ARG A 1 658  ? 34.229  18.335  46.840  1.00 97.36  ? 655  ARG A N   1 
ATOM 5095  C CA  . ARG A 1 658  ? 33.670  18.397  48.183  1.00 97.13  ? 655  ARG A CA  1 
ATOM 5096  C C   . ARG A 1 658  ? 33.685  16.970  48.754  1.00 96.69  ? 655  ARG A C   1 
ATOM 5097  O O   . ARG A 1 658  ? 32.767  16.186  48.489  1.00 96.72  ? 655  ARG A O   1 
ATOM 5098  C CB  . ARG A 1 658  ? 32.252  18.962  48.139  1.00 97.20  ? 655  ARG A CB  1 
ATOM 5099  C CG  . ARG A 1 658  ? 31.585  19.080  49.499  1.00 98.19  ? 655  ARG A CG  1 
ATOM 5100  C CD  . ARG A 1 658  ? 30.079  19.206  49.357  1.00 99.78  ? 655  ARG A CD  1 
ATOM 5101  N NE  . ARG A 1 658  ? 29.704  20.487  48.763  1.00 101.03 ? 655  ARG A NE  1 
ATOM 5102  C CZ  . ARG A 1 658  ? 29.335  21.560  49.457  1.00 101.88 ? 655  ARG A CZ  1 
ATOM 5103  N NH1 . ARG A 1 658  ? 29.276  21.521  50.788  1.00 102.08 ? 655  ARG A NH1 1 
ATOM 5104  N NH2 . ARG A 1 658  ? 29.017  22.677  48.817  1.00 102.30 ? 655  ARG A NH2 1 
ATOM 5105  N N   . PRO A 1 659  ? 34.746  16.624  49.513  1.00 96.20  ? 656  PRO A N   1 
ATOM 5106  C CA  . PRO A 1 659  ? 34.976  15.271  50.020  1.00 95.87  ? 656  PRO A CA  1 
ATOM 5107  C C   . PRO A 1 659  ? 33.991  14.868  51.112  1.00 95.67  ? 656  PRO A C   1 
ATOM 5108  O O   . PRO A 1 659  ? 33.807  15.594  52.087  1.00 95.50  ? 656  PRO A O   1 
ATOM 5109  C CB  . PRO A 1 659  ? 36.403  15.340  50.574  1.00 95.84  ? 656  PRO A CB  1 
ATOM 5110  C CG  . PRO A 1 659  ? 36.980  16.604  50.016  1.00 95.95  ? 656  PRO A CG  1 
ATOM 5111  C CD  . PRO A 1 659  ? 35.830  17.529  49.918  1.00 96.11  ? 656  PRO A CD  1 
ATOM 5112  N N   . THR A 1 660  ? 33.370  13.706  50.928  1.00 95.60  ? 657  THR A N   1 
ATOM 5113  C CA  . THR A 1 660  ? 32.298  13.226  51.789  1.00 95.48  ? 657  THR A CA  1 
ATOM 5114  C C   . THR A 1 660  ? 32.602  11.808  52.267  1.00 95.59  ? 657  THR A C   1 
ATOM 5115  O O   . THR A 1 660  ? 33.166  11.001  51.528  1.00 95.32  ? 657  THR A O   1 
ATOM 5116  C CB  . THR A 1 660  ? 30.932  13.263  51.049  1.00 95.42  ? 657  THR A CB  1 
ATOM 5117  O OG1 . THR A 1 660  ? 30.661  14.596  50.600  1.00 95.04  ? 657  THR A OG1 1 
ATOM 5118  C CG2 . THR A 1 660  ? 29.795  12.823  51.957  1.00 95.61  ? 657  THR A CG2 1 
ATOM 5119  N N   . VAL A 1 661  ? 32.232  11.525  53.513  1.00 95.96  ? 658  VAL A N   1 
ATOM 5120  C CA  . VAL A 1 661  ? 32.426  10.207  54.109  1.00 96.26  ? 658  VAL A CA  1 
ATOM 5121  C C   . VAL A 1 661  ? 31.085  9.541   54.377  1.00 96.65  ? 658  VAL A C   1 
ATOM 5122  O O   . VAL A 1 661  ? 30.095  10.216  54.667  1.00 96.55  ? 658  VAL A O   1 
ATOM 5123  C CB  . VAL A 1 661  ? 33.269  10.279  55.401  1.00 96.10  ? 658  VAL A CB  1 
ATOM 5124  C CG1 . VAL A 1 661  ? 33.100  9.027   56.218  1.00 96.06  ? 658  VAL A CG1 1 
ATOM 5125  C CG2 . VAL A 1 661  ? 34.735  10.459  55.062  1.00 96.06  ? 658  VAL A CG2 1 
ATOM 5126  N N   . ILE A 1 662  ? 31.076  8.212   54.264  1.00 97.34  ? 659  ILE A N   1 
ATOM 5127  C CA  . ILE A 1 662  ? 29.875  7.392   54.419  1.00 98.10  ? 659  ILE A CA  1 
ATOM 5128  C C   . ILE A 1 662  ? 30.054  6.342   55.529  1.00 98.56  ? 659  ILE A C   1 
ATOM 5129  O O   . ILE A 1 662  ? 30.445  5.202   55.260  1.00 98.68  ? 659  ILE A O   1 
ATOM 5130  C CB  . ILE A 1 662  ? 29.492  6.700   53.077  1.00 98.07  ? 659  ILE A CB  1 
ATOM 5131  C CG1 . ILE A 1 662  ? 29.416  7.726   51.937  1.00 98.09  ? 659  ILE A CG1 1 
ATOM 5132  C CG2 . ILE A 1 662  ? 28.180  5.924   53.214  1.00 98.31  ? 659  ILE A CG2 1 
ATOM 5133  C CD1 . ILE A 1 662  ? 29.446  7.124   50.539  1.00 98.10  ? 659  ILE A CD1 1 
ATOM 5134  N N   . TYR A 1 663  ? 29.766  6.744   56.769  1.00 99.10  ? 660  TYR A N   1 
ATOM 5135  C CA  . TYR A 1 663  ? 29.828  5.862   57.941  1.00 99.57  ? 660  TYR A CA  1 
ATOM 5136  C C   . TYR A 1 663  ? 28.516  5.067   58.105  1.00 99.64  ? 660  TYR A C   1 
ATOM 5137  O O   . TYR A 1 663  ? 27.796  4.847   57.129  1.00 99.69  ? 660  TYR A O   1 
ATOM 5138  C CB  . TYR A 1 663  ? 30.096  6.688   59.208  1.00 99.93  ? 660  TYR A CB  1 
ATOM 5139  C CG  . TYR A 1 663  ? 31.554  6.974   59.550  1.00 100.57 ? 660  TYR A CG  1 
ATOM 5140  C CD1 . TYR A 1 663  ? 32.107  8.242   59.347  1.00 100.57 ? 660  TYR A CD1 1 
ATOM 5141  C CD2 . TYR A 1 663  ? 32.365  5.990   60.128  1.00 101.45 ? 660  TYR A CD2 1 
ATOM 5142  C CE1 . TYR A 1 663  ? 33.440  8.512   59.674  1.00 100.53 ? 660  TYR A CE1 1 
ATOM 5143  C CE2 . TYR A 1 663  ? 33.702  6.252   60.463  1.00 101.47 ? 660  TYR A CE2 1 
ATOM 5144  C CZ  . TYR A 1 663  ? 34.230  7.514   60.231  1.00 100.89 ? 660  TYR A CZ  1 
ATOM 5145  O OH  . TYR A 1 663  ? 35.544  7.774   60.559  1.00 100.75 ? 660  TYR A OH  1 
ATOM 5146  N N   . SER A 1 664  ? 28.220  4.633   59.335  1.00 99.74  ? 661  SER A N   1 
ATOM 5147  C CA  . SER A 1 664  ? 26.918  4.030   59.688  1.00 99.70  ? 661  SER A CA  1 
ATOM 5148  C C   . SER A 1 664  ? 26.341  4.589   60.999  1.00 99.73  ? 661  SER A C   1 
ATOM 5149  O O   . SER A 1 664  ? 27.054  4.708   62.008  1.00 99.69  ? 661  SER A O   1 
ATOM 5150  C CB  . SER A 1 664  ? 26.989  2.498   59.742  1.00 99.71  ? 661  SER A CB  1 
ATOM 5151  O OG  . SER A 1 664  ? 26.470  1.917   58.557  1.00 99.42  ? 661  SER A OG  1 
ATOM 5152  N N   . SER A 1 665  ? 25.046  4.918   60.961  1.00 99.61  ? 662  SER A N   1 
ATOM 5153  C CA  . SER A 1 665  ? 24.353  5.600   62.059  1.00 99.34  ? 662  SER A CA  1 
ATOM 5154  C C   . SER A 1 665  ? 23.640  4.608   62.987  1.00 99.14  ? 662  SER A C   1 
ATOM 5155  O O   . SER A 1 665  ? 24.128  4.320   64.085  1.00 99.09  ? 662  SER A O   1 
ATOM 5156  C CB  . SER A 1 665  ? 23.371  6.645   61.498  1.00 99.34  ? 662  SER A CB  1 
ATOM 5157  O OG  . SER A 1 665  ? 23.143  7.701   62.420  1.00 99.20  ? 662  SER A OG  1 
ATOM 5158  N N   . ASN A 1 666  ? 22.491  4.097   62.539  1.00 98.86  ? 663  ASN A N   1 
ATOM 5159  C CA  . ASN A 1 666  ? 21.713  3.093   63.280  1.00 98.51  ? 663  ASN A CA  1 
ATOM 5160  C C   . ASN A 1 666  ? 21.519  1.813   62.467  1.00 98.14  ? 663  ASN A C   1 
ATOM 5161  O O   . ASN A 1 666  ? 21.371  0.720   63.021  1.00 98.20  ? 663  ASN A O   1 
ATOM 5162  C CB  . ASN A 1 666  ? 20.357  3.662   63.739  1.00 98.58  ? 663  ASN A CB  1 
ATOM 5163  C CG  . ASN A 1 666  ? 19.503  4.211   62.587  1.00 98.79  ? 663  ASN A CG  1 
ATOM 5164  O OD1 . ASN A 1 666  ? 19.926  4.255   61.426  1.00 98.93  ? 663  ASN A OD1 1 
ATOM 5165  N ND2 . ASN A 1 666  ? 18.286  4.635   62.920  1.00 99.09  ? 663  ASN A ND2 1 
ATOM 5166  N N   . HIS A 1 667  ? 21.517  1.989   61.149  1.00 97.61  ? 664  HIS A N   1 
ATOM 5167  C CA  . HIS A 1 667  ? 21.428  0.926   60.155  1.00 97.07  ? 664  HIS A CA  1 
ATOM 5168  C C   . HIS A 1 667  ? 21.599  1.670   58.843  1.00 96.47  ? 664  HIS A C   1 
ATOM 5169  O O   . HIS A 1 667  ? 21.925  1.081   57.813  1.00 96.33  ? 664  HIS A O   1 
ATOM 5170  C CB  . HIS A 1 667  ? 20.060  0.243   60.199  1.00 97.29  ? 664  HIS A CB  1 
ATOM 5171  C CG  . HIS A 1 667  ? 20.127  -1.236  60.437  1.00 97.74  ? 664  HIS A CG  1 
ATOM 5172  N ND1 . HIS A 1 667  ? 20.243  -2.154  59.413  1.00 97.96  ? 664  HIS A ND1 1 
ATOM 5173  C CD2 . HIS A 1 667  ? 20.089  -1.955  61.586  1.00 97.78  ? 664  HIS A CD2 1 
ATOM 5174  C CE1 . HIS A 1 667  ? 20.274  -3.373  59.922  1.00 97.98  ? 664  HIS A CE1 1 
ATOM 5175  N NE2 . HIS A 1 667  ? 20.185  -3.281  61.237  1.00 97.90  ? 664  HIS A NE2 1 
ATOM 5176  N N   . LYS A 1 668  ? 21.366  2.983   58.926  1.00 95.87  ? 665  LYS A N   1 
ATOM 5177  C CA  . LYS A 1 668  ? 21.561  3.959   57.848  1.00 95.22  ? 665  LYS A CA  1 
ATOM 5178  C C   . LYS A 1 668  ? 23.029  4.289   57.596  1.00 94.74  ? 665  LYS A C   1 
ATOM 5179  O O   . LYS A 1 668  ? 23.882  4.078   58.461  1.00 94.74  ? 665  LYS A O   1 
ATOM 5180  C CB  . LYS A 1 668  ? 20.840  5.266   58.200  1.00 95.26  ? 665  LYS A CB  1 
ATOM 5181  C CG  . LYS A 1 668  ? 19.685  5.634   57.287  1.00 94.79  ? 665  LYS A CG  1 
ATOM 5182  C CD  . LYS A 1 668  ? 19.432  7.128   57.355  1.00 93.56  ? 665  LYS A CD  1 
ATOM 5183  C CE  . LYS A 1 668  ? 18.366  7.553   56.375  1.00 92.70  ? 665  LYS A CE  1 
ATOM 5184  N NZ  . LYS A 1 668  ? 18.133  9.013   56.465  1.00 91.94  ? 665  LYS A NZ  1 
ATOM 5185  N N   . LEU A 1 669  ? 23.306  4.838   56.414  1.00 93.99  ? 666  LEU A N   1 
ATOM 5186  C CA  . LEU A 1 669  ? 24.659  5.234   56.041  1.00 93.29  ? 666  LEU A CA  1 
ATOM 5187  C C   . LEU A 1 669  ? 24.836  6.742   56.150  1.00 92.82  ? 666  LEU A C   1 
ATOM 5188  O O   . LEU A 1 669  ? 24.131  7.495   55.479  1.00 92.72  ? 666  LEU A O   1 
ATOM 5189  C CB  . LEU A 1 669  ? 24.987  4.775   54.613  1.00 93.32  ? 666  LEU A CB  1 
ATOM 5190  C CG  . LEU A 1 669  ? 24.849  3.320   54.135  1.00 92.85  ? 666  LEU A CG  1 
ATOM 5191  C CD1 . LEU A 1 669  ? 25.582  3.160   52.806  1.00 91.76  ? 666  LEU A CD1 1 
ATOM 5192  C CD2 . LEU A 1 669  ? 25.358  2.297   55.155  1.00 92.60  ? 666  LEU A CD2 1 
ATOM 5193  N N   . VAL A 1 670  ? 25.779  7.174   56.989  1.00 92.30  ? 667  VAL A N   1 
ATOM 5194  C CA  . VAL A 1 670  ? 26.074  8.604   57.180  1.00 91.88  ? 667  VAL A CA  1 
ATOM 5195  C C   . VAL A 1 670  ? 26.500  9.228   55.840  1.00 91.64  ? 667  VAL A C   1 
ATOM 5196  O O   . VAL A 1 670  ? 26.831  8.506   54.892  1.00 91.47  ? 667  VAL A O   1 
ATOM 5197  C CB  . VAL A 1 670  ? 27.130  8.847   58.314  1.00 91.79  ? 667  VAL A CB  1 
ATOM 5198  C CG1 . VAL A 1 670  ? 27.376  10.333  58.549  1.00 91.41  ? 667  VAL A CG1 1 
ATOM 5199  C CG2 . VAL A 1 670  ? 26.664  8.218   59.610  1.00 91.86  ? 667  VAL A CG2 1 
ATOM 5200  N N   . PHE A 1 671  ? 26.462  10.562  55.765  1.00 91.22  ? 668  PHE A N   1 
ATOM 5201  C CA  . PHE A 1 671  ? 26.715  11.288  54.522  1.00 90.62  ? 668  PHE A CA  1 
ATOM 5202  C C   . PHE A 1 671  ? 27.150  12.736  54.789  1.00 90.15  ? 668  PHE A C   1 
ATOM 5203  O O   . PHE A 1 671  ? 26.384  13.679  54.546  1.00 90.14  ? 668  PHE A O   1 
ATOM 5204  C CB  . PHE A 1 671  ? 25.445  11.261  53.671  1.00 90.73  ? 668  PHE A CB  1 
ATOM 5205  C CG  . PHE A 1 671  ? 25.680  10.862  52.252  1.00 91.00  ? 668  PHE A CG  1 
ATOM 5206  C CD1 . PHE A 1 671  ? 26.388  9.696   51.951  1.00 90.97  ? 668  PHE A CD1 1 
ATOM 5207  C CD2 . PHE A 1 671  ? 25.178  11.635  51.212  1.00 91.09  ? 668  PHE A CD2 1 
ATOM 5208  C CE1 . PHE A 1 671  ? 26.608  9.318   50.637  1.00 90.85  ? 668  PHE A CE1 1 
ATOM 5209  C CE2 . PHE A 1 671  ? 25.390  11.265  49.893  1.00 91.25  ? 668  PHE A CE2 1 
ATOM 5210  C CZ  . PHE A 1 671  ? 26.110  10.103  49.603  1.00 91.22  ? 668  PHE A CZ  1 
ATOM 5211  N N   . SER A 1 672  ? 28.381  12.910  55.274  1.00 89.37  ? 669  SER A N   1 
ATOM 5212  C CA  . SER A 1 672  ? 28.814  14.210  55.802  1.00 88.74  ? 669  SER A CA  1 
ATOM 5213  C C   . SER A 1 672  ? 30.195  14.662  55.339  1.00 88.19  ? 669  SER A C   1 
ATOM 5214  O O   . SER A 1 672  ? 31.019  13.840  54.950  1.00 88.10  ? 669  SER A O   1 
ATOM 5215  C CB  . SER A 1 672  ? 28.736  14.213  57.336  1.00 88.91  ? 669  SER A CB  1 
ATOM 5216  O OG  . SER A 1 672  ? 29.328  13.050  57.891  1.00 88.95  ? 669  SER A OG  1 
ATOM 5217  N N   . ASN A 1 673  ? 30.429  15.973  55.416  1.00 87.62  ? 670  ASN A N   1 
ATOM 5218  C CA  . ASN A 1 673  ? 31.642  16.633  54.913  1.00 87.28  ? 670  ASN A CA  1 
ATOM 5219  C C   . ASN A 1 673  ? 32.966  16.191  55.520  1.00 87.09  ? 670  ASN A C   1 
ATOM 5220  O O   . ASN A 1 673  ? 33.007  15.653  56.622  1.00 87.05  ? 670  ASN A O   1 
ATOM 5221  C CB  . ASN A 1 673  ? 31.531  18.144  55.095  1.00 87.24  ? 670  ASN A CB  1 
ATOM 5222  C CG  . ASN A 1 673  ? 30.401  18.745  54.308  1.00 87.36  ? 670  ASN A CG  1 
ATOM 5223  O OD1 . ASN A 1 673  ? 30.124  18.336  53.183  1.00 87.92  ? 670  ASN A OD1 1 
ATOM 5224  N ND2 . ASN A 1 673  ? 29.743  19.738  54.890  1.00 87.81  ? 670  ASN A ND2 1 
ATOM 5225  N N   . VAL A 1 674  ? 34.046  16.450  54.784  1.00 86.95  ? 671  VAL A N   1 
ATOM 5226  C CA  . VAL A 1 674  ? 35.406  16.169  55.231  1.00 86.84  ? 671  VAL A CA  1 
ATOM 5227  C C   . VAL A 1 674  ? 36.262  17.410  55.027  1.00 87.09  ? 671  VAL A C   1 
ATOM 5228  O O   . VAL A 1 674  ? 36.398  17.894  53.906  1.00 87.02  ? 671  VAL A O   1 
ATOM 5229  C CB  . VAL A 1 674  ? 36.037  14.984  54.462  1.00 86.69  ? 671  VAL A CB  1 
ATOM 5230  C CG1 . VAL A 1 674  ? 37.441  14.709  54.953  1.00 86.21  ? 671  VAL A CG1 1 
ATOM 5231  C CG2 . VAL A 1 674  ? 35.194  13.746  54.615  1.00 86.58  ? 671  VAL A CG2 1 
ATOM 5232  N N   . ASN A 1 675  ? 36.834  17.914  56.119  1.00 87.59  ? 672  ASN A N   1 
ATOM 5233  C CA  . ASN A 1 675  ? 37.707  19.092  56.100  1.00 88.03  ? 672  ASN A CA  1 
ATOM 5234  C C   . ASN A 1 675  ? 38.989  18.875  55.302  1.00 88.59  ? 672  ASN A C   1 
ATOM 5235  O O   . ASN A 1 675  ? 40.041  18.531  55.854  1.00 88.50  ? 672  ASN A O   1 
ATOM 5236  C CB  . ASN A 1 675  ? 38.052  19.527  57.522  1.00 87.86  ? 672  ASN A CB  1 
ATOM 5237  C CG  . ASN A 1 675  ? 36.832  19.729  58.372  1.00 87.51  ? 672  ASN A CG  1 
ATOM 5238  O OD1 . ASN A 1 675  ? 35.991  20.580  58.081  1.00 87.28  ? 672  ASN A OD1 1 
ATOM 5239  N ND2 . ASN A 1 675  ? 36.724  18.947  59.435  1.00 87.42  ? 672  ASN A ND2 1 
ATOM 5240  N N   . LEU A 1 676  ? 38.876  19.071  53.993  1.00 89.35  ? 673  LEU A N   1 
ATOM 5241  C CA  . LEU A 1 676  ? 40.008  18.993  53.082  1.00 89.97  ? 673  LEU A CA  1 
ATOM 5242  C C   . LEU A 1 676  ? 39.838  19.938  51.903  1.00 90.33  ? 673  LEU A C   1 
ATOM 5243  O O   . LEU A 1 676  ? 38.716  20.210  51.456  1.00 90.13  ? 673  LEU A O   1 
ATOM 5244  C CB  . LEU A 1 676  ? 40.220  17.562  52.590  1.00 90.01  ? 673  LEU A CB  1 
ATOM 5245  C CG  . LEU A 1 676  ? 41.292  16.774  53.347  1.00 90.39  ? 673  LEU A CG  1 
ATOM 5246  C CD1 . LEU A 1 676  ? 40.831  15.360  53.605  1.00 90.97  ? 673  LEU A CD1 1 
ATOM 5247  C CD2 . LEU A 1 676  ? 42.617  16.787  52.596  1.00 90.90  ? 673  LEU A CD2 1 
ATOM 5248  N N   . LYS A 1 677  ? 40.976  20.438  51.429  1.00 90.97  ? 674  LYS A N   1 
ATOM 5249  C CA  . LYS A 1 677  ? 41.066  21.287  50.249  1.00 91.60  ? 674  LYS A CA  1 
ATOM 5250  C C   . LYS A 1 677  ? 40.191  20.722  49.118  1.00 91.97  ? 674  LYS A C   1 
ATOM 5251  O O   . LYS A 1 677  ? 39.142  21.289  48.795  1.00 92.02  ? 674  LYS A O   1 
ATOM 5252  C CB  . LYS A 1 677  ? 42.544  21.403  49.822  1.00 91.60  ? 674  LYS A CB  1 
ATOM 5253  C CG  . LYS A 1 677  ? 42.873  22.544  48.865  1.00 91.78  ? 674  LYS A CG  1 
ATOM 5254  C CD  . LYS A 1 677  ? 42.888  23.904  49.562  1.00 91.83  ? 674  LYS A CD  1 
ATOM 5255  C CE  . LYS A 1 677  ? 42.973  25.040  48.546  1.00 92.02  ? 674  LYS A CE  1 
ATOM 5256  N NZ  . LYS A 1 677  ? 44.207  24.968  47.703  1.00 91.65  ? 674  LYS A NZ  1 
ATOM 5257  N N   . GLU A 1 678  ? 40.625  19.594  48.554  1.00 92.35  ? 675  GLU A N   1 
ATOM 5258  C CA  . GLU A 1 678  ? 39.942  18.897  47.472  1.00 92.78  ? 675  GLU A CA  1 
ATOM 5259  C C   . GLU A 1 678  ? 40.600  17.530  47.412  1.00 92.94  ? 675  GLU A C   1 
ATOM 5260  O O   . GLU A 1 678  ? 41.820  17.439  47.511  1.00 93.08  ? 675  GLU A O   1 
ATOM 5261  C CB  . GLU A 1 678  ? 40.158  19.648  46.159  1.00 92.71  ? 675  GLU A CB  1 
ATOM 5262  C CG  . GLU A 1 678  ? 39.397  19.091  44.968  1.00 93.24  ? 675  GLU A CG  1 
ATOM 5263  C CD  . GLU A 1 678  ? 39.908  19.625  43.628  1.00 93.30  ? 675  GLU A CD  1 
ATOM 5264  O OE1 . GLU A 1 678  ? 40.471  20.745  43.595  1.00 93.43  ? 675  GLU A OE1 1 
ATOM 5265  O OE2 . GLU A 1 678  ? 39.743  18.918  42.604  1.00 93.92  ? 675  GLU A OE2 1 
ATOM 5266  N N   . VAL A 1 679  ? 39.814  16.466  47.273  1.00 93.25  ? 676  VAL A N   1 
ATOM 5267  C CA  . VAL A 1 679  ? 40.375  15.108  47.327  1.00 93.62  ? 676  VAL A CA  1 
ATOM 5268  C C   . VAL A 1 679  ? 40.034  14.283  46.090  1.00 94.09  ? 676  VAL A C   1 
ATOM 5269  O O   . VAL A 1 679  ? 38.859  14.032  45.811  1.00 94.15  ? 676  VAL A O   1 
ATOM 5270  C CB  . VAL A 1 679  ? 39.933  14.355  48.601  1.00 93.49  ? 676  VAL A CB  1 
ATOM 5271  C CG1 . VAL A 1 679  ? 40.494  12.950  48.612  1.00 93.54  ? 676  VAL A CG1 1 
ATOM 5272  C CG2 . VAL A 1 679  ? 40.385  15.097  49.838  1.00 93.47  ? 676  VAL A CG2 1 
ATOM 5273  N N   . ASN A 1 680  ? 41.073  13.850  45.372  1.00 94.69  ? 677  ASN A N   1 
ATOM 5274  C CA  . ASN A 1 680  ? 40.925  13.160  44.080  1.00 95.20  ? 677  ASN A CA  1 
ATOM 5275  C C   . ASN A 1 680  ? 40.830  11.637  44.146  1.00 95.58  ? 677  ASN A C   1 
ATOM 5276  O O   . ASN A 1 680  ? 39.897  11.059  43.585  1.00 95.63  ? 677  ASN A O   1 
ATOM 5277  C CB  . ASN A 1 680  ? 42.043  13.568  43.113  1.00 95.15  ? 677  ASN A CB  1 
ATOM 5278  C CG  . ASN A 1 680  ? 41.697  14.800  42.293  1.00 95.42  ? 677  ASN A CG  1 
ATOM 5279  O OD1 . ASN A 1 680  ? 42.022  14.870  41.108  1.00 95.77  ? 677  ASN A OD1 1 
ATOM 5280  N ND2 . ASN A 1 680  ? 41.034  15.774  42.914  1.00 95.48  ? 677  ASN A ND2 1 
ATOM 5281  N N   . TYR A 1 681  ? 41.805  10.997  44.798  1.00 96.07  ? 678  TYR A N   1 
ATOM 5282  C CA  . TYR A 1 681  ? 41.853  9.529   44.926  1.00 96.52  ? 678  TYR A CA  1 
ATOM 5283  C C   . TYR A 1 681  ? 42.438  9.148   46.271  1.00 96.83  ? 678  TYR A C   1 
ATOM 5284  O O   . TYR A 1 681  ? 43.345  9.818   46.760  1.00 96.96  ? 678  TYR A O   1 
ATOM 5285  C CB  . TYR A 1 681  ? 42.695  8.899   43.816  1.00 96.44  ? 678  TYR A CB  1 
ATOM 5286  C CG  . TYR A 1 681  ? 42.337  9.377   42.430  1.00 96.63  ? 678  TYR A CG  1 
ATOM 5287  C CD1 . TYR A 1 681  ? 43.023  10.437  41.840  1.00 96.75  ? 678  TYR A CD1 1 
ATOM 5288  C CD2 . TYR A 1 681  ? 41.305  8.779   41.711  1.00 96.96  ? 678  TYR A CD2 1 
ATOM 5289  C CE1 . TYR A 1 681  ? 42.690  10.887  40.565  1.00 96.65  ? 678  TYR A CE1 1 
ATOM 5290  C CE2 . TYR A 1 681  ? 40.968  9.222   40.433  1.00 96.75  ? 678  TYR A CE2 1 
ATOM 5291  C CZ  . TYR A 1 681  ? 41.666  10.273  39.872  1.00 96.38  ? 678  TYR A CZ  1 
ATOM 5292  O OH  . TYR A 1 681  ? 41.334  10.708  38.617  1.00 96.47  ? 678  TYR A OH  1 
ATOM 5293  N N   . MET A 1 682  ? 41.936  8.061   46.854  1.00 97.27  ? 679  MET A N   1 
ATOM 5294  C CA  . MET A 1 682  ? 42.241  7.729   48.248  1.00 97.76  ? 679  MET A CA  1 
ATOM 5295  C C   . MET A 1 682  ? 42.211  6.225   48.530  1.00 98.06  ? 679  MET A C   1 
ATOM 5296  O O   . MET A 1 682  ? 41.462  5.493   47.881  1.00 98.18  ? 679  MET A O   1 
ATOM 5297  C CB  . MET A 1 682  ? 41.276  8.494   49.168  1.00 97.77  ? 679  MET A CB  1 
ATOM 5298  C CG  . MET A 1 682  ? 41.062  7.905   50.545  1.00 98.17  ? 679  MET A CG  1 
ATOM 5299  S SD  . MET A 1 682  ? 39.826  6.594   50.517  1.00 99.09  ? 679  MET A SD  1 
ATOM 5300  C CE  . MET A 1 682  ? 40.223  5.706   52.026  1.00 98.27  ? 679  MET A CE  1 
ATOM 5301  N N   . CYS A 1 683  ? 43.020  5.778   49.498  1.00 98.42  ? 680  CYS A N   1 
ATOM 5302  C CA  . CYS A 1 683  ? 43.063  4.364   49.927  1.00 98.76  ? 680  CYS A CA  1 
ATOM 5303  C C   . CYS A 1 683  ? 43.484  4.182   51.399  1.00 98.82  ? 680  CYS A C   1 
ATOM 5304  O O   . CYS A 1 683  ? 44.148  5.053   51.961  1.00 98.81  ? 680  CYS A O   1 
ATOM 5305  C CB  . CYS A 1 683  ? 44.000  3.554   49.019  1.00 98.84  ? 680  CYS A CB  1 
ATOM 5306  S SG  . CYS A 1 683  ? 45.767  3.917   49.216  1.00 99.39  ? 680  CYS A SG  1 
ATOM 5307  N N   . PRO A 1 684  ? 43.086  3.052   52.029  1.00 98.95  ? 681  PRO A N   1 
ATOM 5308  C CA  . PRO A 1 684  ? 43.610  2.659   53.352  1.00 99.03  ? 681  PRO A CA  1 
ATOM 5309  C C   . PRO A 1 684  ? 45.089  2.246   53.321  1.00 99.09  ? 681  PRO A C   1 
ATOM 5310  O O   . PRO A 1 684  ? 45.653  2.040   52.238  1.00 99.09  ? 681  PRO A O   1 
ATOM 5311  C CB  . PRO A 1 684  ? 42.737  1.455   53.742  1.00 99.02  ? 681  PRO A CB  1 
ATOM 5312  C CG  . PRO A 1 684  ? 41.561  1.498   52.817  1.00 99.10  ? 681  PRO A CG  1 
ATOM 5313  C CD  . PRO A 1 684  ? 42.068  2.102   51.548  1.00 98.99  ? 681  PRO A CD  1 
ATOM 5314  N N   . LEU A 1 685  ? 45.696  2.118   54.505  1.00 99.06  ? 682  LEU A N   1 
ATOM 5315  C CA  . LEU A 1 685  ? 47.134  1.839   54.641  1.00 99.01  ? 682  LEU A CA  1 
ATOM 5316  C C   . LEU A 1 685  ? 47.438  1.124   55.971  1.00 99.12  ? 682  LEU A C   1 
ATOM 5317  O O   . LEU A 1 685  ? 46.509  0.705   56.668  1.00 99.15  ? 682  LEU A O   1 
ATOM 5318  C CB  . LEU A 1 685  ? 47.927  3.154   54.546  1.00 98.86  ? 682  LEU A CB  1 
ATOM 5319  C CG  . LEU A 1 685  ? 49.126  3.220   53.598  1.00 98.43  ? 682  LEU A CG  1 
ATOM 5320  C CD1 . LEU A 1 685  ? 48.680  3.703   52.233  1.00 97.88  ? 682  LEU A CD1 1 
ATOM 5321  C CD2 . LEU A 1 685  ? 50.182  4.147   54.151  1.00 98.23  ? 682  LEU A CD2 1 
ATOM 5322  N N   . ASN A 1 686  ? 48.731  0.965   56.292  1.00 99.21  ? 683  ASN A N   1 
ATOM 5323  C CA  . ASN A 1 686  ? 49.215  0.533   57.626  1.00 99.21  ? 683  ASN A CA  1 
ATOM 5324  C C   . ASN A 1 686  ? 50.736  0.324   57.705  1.00 99.23  ? 683  ASN A C   1 
ATOM 5325  O O   . ASN A 1 686  ? 51.199  -0.592  58.385  1.00 99.25  ? 683  ASN A O   1 
ATOM 5326  C CB  . ASN A 1 686  ? 48.487  -0.727  58.131  1.00 99.17  ? 683  ASN A CB  1 
ATOM 5327  C CG  . ASN A 1 686  ? 48.516  -0.862  59.653  1.00 99.36  ? 683  ASN A CG  1 
ATOM 5328  O OD1 . ASN A 1 686  ? 49.539  -1.213  60.246  1.00 99.49  ? 683  ASN A OD1 1 
ATOM 5329  N ND2 . ASN A 1 686  ? 47.381  -0.598  60.288  1.00 99.75  ? 683  ASN A ND2 1 
ATOM 5330  N N   . SER A 1 687  ? 51.513  1.178   57.038  1.00 99.27  ? 684  SER A N   1 
ATOM 5331  C CA  . SER A 1 687  ? 52.978  1.011   56.985  1.00 99.43  ? 684  SER A CA  1 
ATOM 5332  C C   . SER A 1 687  ? 53.666  1.122   58.365  1.00 99.43  ? 684  SER A C   1 
ATOM 5333  O O   . SER A 1 687  ? 53.060  1.607   59.325  1.00 99.57  ? 684  SER A O   1 
ATOM 5334  C CB  . SER A 1 687  ? 53.596  1.997   55.984  1.00 99.46  ? 684  SER A CB  1 
ATOM 5335  O OG  . SER A 1 687  ? 54.778  1.461   55.405  1.00 99.74  ? 684  SER A OG  1 
ATOM 5336  N N   . ASP A 1 688  ? 54.918  0.663   58.467  1.00 99.30  ? 685  ASP A N   1 
ATOM 5337  C CA  . ASP A 1 688  ? 55.683  0.780   59.724  1.00 99.01  ? 685  ASP A CA  1 
ATOM 5338  C C   . ASP A 1 688  ? 56.299  2.172   59.885  1.00 98.74  ? 685  ASP A C   1 
ATOM 5339  O O   . ASP A 1 688  ? 57.173  2.397   60.721  1.00 98.78  ? 685  ASP A O   1 
ATOM 5340  C CB  . ASP A 1 688  ? 56.726  -0.349  59.878  1.00 99.04  ? 685  ASP A CB  1 
ATOM 5341  C CG  . ASP A 1 688  ? 57.929  -0.193  58.955  1.00 99.04  ? 685  ASP A CG  1 
ATOM 5342  O OD1 . ASP A 1 688  ? 57.784  0.350   57.838  1.00 99.34  ? 685  ASP A OD1 1 
ATOM 5343  O OD2 . ASP A 1 688  ? 59.028  -0.639  59.351  1.00 98.85  ? 685  ASP A OD2 1 
ATOM 5344  N N   . GLY A 1 689  ? 55.822  3.096   59.059  1.00 98.50  ? 686  GLY A N   1 
ATOM 5345  C CA  . GLY A 1 689  ? 56.109  4.513   59.189  1.00 98.20  ? 686  GLY A CA  1 
ATOM 5346  C C   . GLY A 1 689  ? 54.825  5.321   59.316  1.00 98.01  ? 686  GLY A C   1 
ATOM 5347  O O   . GLY A 1 689  ? 54.844  6.424   59.858  1.00 98.13  ? 686  GLY A O   1 
ATOM 5348  N N   . TYR A 1 690  ? 53.712  4.775   58.811  1.00 97.68  ? 687  TYR A N   1 
ATOM 5349  C CA  . TYR A 1 690  ? 52.393  5.421   58.891  1.00 97.30  ? 687  TYR A CA  1 
ATOM 5350  C C   . TYR A 1 690  ? 51.238  4.406   59.020  1.00 97.14  ? 687  TYR A C   1 
ATOM 5351  O O   . TYR A 1 690  ? 50.500  4.190   58.057  1.00 97.06  ? 687  TYR A O   1 
ATOM 5352  C CB  . TYR A 1 690  ? 52.149  6.309   57.661  1.00 97.29  ? 687  TYR A CB  1 
ATOM 5353  C CG  . TYR A 1 690  ? 53.287  7.235   57.280  1.00 97.24  ? 687  TYR A CG  1 
ATOM 5354  C CD1 . TYR A 1 690  ? 53.484  8.449   57.945  1.00 97.25  ? 687  TYR A CD1 1 
ATOM 5355  C CD2 . TYR A 1 690  ? 54.154  6.908   56.238  1.00 97.15  ? 687  TYR A CD2 1 
ATOM 5356  C CE1 . TYR A 1 690  ? 54.529  9.307   57.590  1.00 97.23  ? 687  TYR A CE1 1 
ATOM 5357  C CE2 . TYR A 1 690  ? 55.200  7.760   55.873  1.00 97.25  ? 687  TYR A CE2 1 
ATOM 5358  C CZ  . TYR A 1 690  ? 55.381  8.955   56.552  1.00 97.28  ? 687  TYR A CZ  1 
ATOM 5359  O OH  . TYR A 1 690  ? 56.412  9.795   56.192  1.00 97.24  ? 687  TYR A OH  1 
ATOM 5360  N N   . PRO A 1 691  ? 51.072  3.780   60.208  1.00 97.02  ? 688  PRO A N   1 
ATOM 5361  C CA  . PRO A 1 691  ? 50.000  2.789   60.419  1.00 96.98  ? 688  PRO A CA  1 
ATOM 5362  C C   . PRO A 1 691  ? 48.584  3.374   60.493  1.00 96.91  ? 688  PRO A C   1 
ATOM 5363  O O   . PRO A 1 691  ? 48.423  4.558   60.786  1.00 97.06  ? 688  PRO A O   1 
ATOM 5364  C CB  . PRO A 1 691  ? 50.373  2.142   61.765  1.00 96.98  ? 688  PRO A CB  1 
ATOM 5365  C CG  . PRO A 1 691  ? 51.784  2.578   62.049  1.00 96.95  ? 688  PRO A CG  1 
ATOM 5366  C CD  . PRO A 1 691  ? 51.898  3.928   61.417  1.00 97.02  ? 688  PRO A CD  1 
ATOM 5367  N N   . ASP A 1 692  ? 47.580  2.534   60.224  1.00 96.79  ? 689  ASP A N   1 
ATOM 5368  C CA  . ASP A 1 692  ? 46.141  2.898   60.239  1.00 96.67  ? 689  ASP A CA  1 
ATOM 5369  C C   . ASP A 1 692  ? 45.786  4.146   59.400  1.00 96.50  ? 689  ASP A C   1 
ATOM 5370  O O   . ASP A 1 692  ? 44.679  4.692   59.496  1.00 96.47  ? 689  ASP A O   1 
ATOM 5371  C CB  . ASP A 1 692  ? 45.619  3.018   61.687  1.00 96.74  ? 689  ASP A CB  1 
ATOM 5372  C CG  . ASP A 1 692  ? 44.130  2.684   61.813  1.00 96.80  ? 689  ASP A CG  1 
ATOM 5373  O OD1 . ASP A 1 692  ? 43.806  1.540   62.198  1.00 96.75  ? 689  ASP A OD1 1 
ATOM 5374  O OD2 . ASP A 1 692  ? 43.284  3.559   61.526  1.00 96.84  ? 689  ASP A OD2 1 
ATOM 5375  N N   . SER A 1 693  ? 46.730  4.568   58.561  1.00 96.24  ? 690  SER A N   1 
ATOM 5376  C CA  . SER A 1 693  ? 46.608  5.798   57.779  1.00 95.98  ? 690  SER A CA  1 
ATOM 5377  C C   . SER A 1 693  ? 45.628  5.682   56.603  1.00 95.81  ? 690  SER A C   1 
ATOM 5378  O O   . SER A 1 693  ? 45.292  4.578   56.160  1.00 95.80  ? 690  SER A O   1 
ATOM 5379  C CB  . SER A 1 693  ? 47.989  6.235   57.266  1.00 96.02  ? 690  SER A CB  1 
ATOM 5380  O OG  . SER A 1 693  ? 48.918  6.384   58.326  1.00 95.63  ? 690  SER A OG  1 
ATOM 5381  N N   . LEU A 1 694  ? 45.162  6.836   56.124  1.00 95.47  ? 691  LEU A N   1 
ATOM 5382  C CA  . LEU A 1 694  ? 44.437  6.930   54.861  1.00 95.15  ? 691  LEU A CA  1 
ATOM 5383  C C   . LEU A 1 694  ? 45.251  7.799   53.907  1.00 95.05  ? 691  LEU A C   1 
ATOM 5384  O O   . LEU A 1 694  ? 45.717  8.876   54.280  1.00 94.93  ? 691  LEU A O   1 
ATOM 5385  C CB  . LEU A 1 694  ? 43.020  7.494   55.055  1.00 95.02  ? 691  LEU A CB  1 
ATOM 5386  C CG  . LEU A 1 694  ? 42.001  6.766   55.950  1.00 94.84  ? 691  LEU A CG  1 
ATOM 5387  C CD1 . LEU A 1 694  ? 40.589  7.229   55.628  1.00 94.55  ? 691  LEU A CD1 1 
ATOM 5388  C CD2 . LEU A 1 694  ? 42.074  5.245   55.837  1.00 94.86  ? 691  LEU A CD2 1 
ATOM 5389  N N   . ALA A 1 695  ? 45.439  7.307   52.686  1.00 95.02  ? 692  ALA A N   1 
ATOM 5390  C CA  . ALA A 1 695  ? 46.259  7.987   51.685  1.00 94.98  ? 692  ALA A CA  1 
ATOM 5391  C C   . ALA A 1 695  ? 45.403  8.860   50.783  1.00 94.95  ? 692  ALA A C   1 
ATOM 5392  O O   . ALA A 1 695  ? 44.313  8.463   50.373  1.00 94.85  ? 692  ALA A O   1 
ATOM 5393  C CB  . ALA A 1 695  ? 47.043  6.976   50.858  1.00 95.00  ? 692  ALA A CB  1 
ATOM 5394  N N   . LEU A 1 696  ? 45.908  10.051  50.479  1.00 94.94  ? 693  LEU A N   1 
ATOM 5395  C CA  . LEU A 1 696  ? 45.156  11.040  49.715  1.00 94.94  ? 693  LEU A CA  1 
ATOM 5396  C C   . LEU A 1 696  ? 46.010  11.737  48.676  1.00 95.05  ? 693  LEU A C   1 
ATOM 5397  O O   . LEU A 1 696  ? 47.220  11.886  48.841  1.00 94.99  ? 693  LEU A O   1 
ATOM 5398  C CB  . LEU A 1 696  ? 44.565  12.094  50.646  1.00 94.88  ? 693  LEU A CB  1 
ATOM 5399  C CG  . LEU A 1 696  ? 43.236  11.832  51.343  1.00 94.81  ? 693  LEU A CG  1 
ATOM 5400  C CD1 . LEU A 1 696  ? 43.398  10.986  52.597  1.00 95.08  ? 693  LEU A CD1 1 
ATOM 5401  C CD2 . LEU A 1 696  ? 42.666  13.165  51.705  1.00 94.86  ? 693  LEU A CD2 1 
ATOM 5402  N N   . ALA A 1 697  ? 45.352  12.183  47.613  1.00 95.32  ? 694  ALA A N   1 
ATOM 5403  C CA  . ALA A 1 697  ? 46.003  12.891  46.522  1.00 95.61  ? 694  ALA A CA  1 
ATOM 5404  C C   . ALA A 1 697  ? 45.014  13.817  45.837  1.00 95.74  ? 694  ALA A C   1 
ATOM 5405  O O   . ALA A 1 697  ? 43.809  13.555  45.830  1.00 95.81  ? 694  ALA A O   1 
ATOM 5406  C CB  . ALA A 1 697  ? 46.567  11.900  45.518  1.00 95.75  ? 694  ALA A CB  1 
ATOM 5407  N N   . ASN A 1 698  ? 45.531  14.898  45.261  1.00 95.83  ? 695  ASN A N   1 
ATOM 5408  C CA  . ASN A 1 698  ? 44.718  15.808  44.461  1.00 95.99  ? 695  ASN A CA  1 
ATOM 5409  C C   . ASN A 1 698  ? 45.467  16.316  43.228  1.00 95.93  ? 695  ASN A C   1 
ATOM 5410  O O   . ASN A 1 698  ? 46.111  15.535  42.514  1.00 96.02  ? 695  ASN A O   1 
ATOM 5411  C CB  . ASN A 1 698  ? 44.210  16.973  45.316  1.00 96.06  ? 695  ASN A CB  1 
ATOM 5412  C CG  . ASN A 1 698  ? 45.329  17.695  46.045  1.00 96.65  ? 695  ASN A CG  1 
ATOM 5413  O OD1 . ASN A 1 698  ? 45.996  17.119  46.907  1.00 97.36  ? 695  ASN A OD1 1 
ATOM 5414  N ND2 . ASN A 1 698  ? 45.534  18.968  45.705  1.00 97.02  ? 695  ASN A ND2 1 
ATOM 5415  N N   . ASN A 1 699  ? 45.352  17.621  42.981  1.00 95.73  ? 696  ASN A N   1 
ATOM 5416  C CA  . ASN A 1 699  ? 46.096  18.329  41.950  1.00 95.44  ? 696  ASN A CA  1 
ATOM 5417  C C   . ASN A 1 699  ? 47.585  18.016  42.064  1.00 95.04  ? 696  ASN A C   1 
ATOM 5418  O O   . ASN A 1 699  ? 48.176  17.419  41.165  1.00 94.92  ? 696  ASN A O   1 
ATOM 5419  C CB  . ASN A 1 699  ? 45.861  19.831  42.116  1.00 95.62  ? 696  ASN A CB  1 
ATOM 5420  C CG  . ASN A 1 699  ? 45.955  20.592  40.810  1.00 96.18  ? 696  ASN A CG  1 
ATOM 5421  O OD1 . ASN A 1 699  ? 46.927  20.467  40.063  1.00 96.41  ? 696  ASN A OD1 1 
ATOM 5422  N ND2 . ASN A 1 699  ? 44.942  21.409  40.536  1.00 97.39  ? 696  ASN A ND2 1 
ATOM 5423  N N   . SER A 1 700  ? 48.173  18.425  43.184  1.00 94.62  ? 697  SER A N   1 
ATOM 5424  C CA  . SER A 1 700  ? 49.522  18.033  43.573  1.00 94.17  ? 697  SER A CA  1 
ATOM 5425  C C   . SER A 1 700  ? 49.475  17.738  45.061  1.00 93.87  ? 697  SER A C   1 
ATOM 5426  O O   . SER A 1 700  ? 48.492  18.080  45.716  1.00 93.98  ? 697  SER A O   1 
ATOM 5427  C CB  . SER A 1 700  ? 50.526  19.154  43.289  1.00 94.16  ? 697  SER A CB  1 
ATOM 5428  O OG  . SER A 1 700  ? 50.369  20.229  44.196  1.00 93.93  ? 697  SER A OG  1 
ATOM 5429  N N   . THR A 1 701  ? 50.429  17.061  45.569  1.00 93.36  ? 698  THR A N   1 
ATOM 5430  C CA  . THR A 1 701  ? 50.614  16.846  47.029  1.00 92.96  ? 698  THR A CA  1 
ATOM 5431  C C   . THR A 1 701  ? 49.867  15.623  47.635  1.00 92.71  ? 698  THR A C   1 
ATOM 5432  O O   . THR A 1 701  ? 48.635  15.635  47.802  1.00 92.79  ? 698  THR A O   1 
ATOM 5433  C CB  . THR A 1 701  ? 50.058  18.039  47.864  1.00 92.93  ? 698  THR A CB  1 
ATOM 5434  O OG1 . THR A 1 701  ? 50.927  19.167  47.717  1.00 93.03  ? 698  THR A OG1 1 
ATOM 5435  C CG2 . THR A 1 701  ? 49.911  17.689  49.344  1.00 92.92  ? 698  THR A CG2 1 
ATOM 5436  N N   . LEU A 1 702  ? 50.643  14.728  48.192  1.00 92.32  ? 699  LEU A N   1 
ATOM 5437  C CA  . LEU A 1 702  ? 50.075  13.559  48.852  1.00 91.85  ? 699  LEU A CA  1 
ATOM 5438  C C   . LEU A 1 702  ? 49.818  13.901  50.328  1.00 91.69  ? 699  LEU A C   1 
ATOM 5439  O O   . LEU A 1 702  ? 50.431  14.831  50.870  1.00 91.66  ? 699  LEU A O   1 
ATOM 5440  C CB  . LEU A 1 702  ? 51.038  12.372  48.733  1.00 91.70  ? 699  LEU A CB  1 
ATOM 5441  C CG  . LEU A 1 702  ? 50.497  10.974  49.042  1.00 91.31  ? 699  LEU A CG  1 
ATOM 5442  C CD1 . LEU A 1 702  ? 50.059  10.278  47.771  1.00 91.05  ? 699  LEU A CD1 1 
ATOM 5443  C CD2 . LEU A 1 702  ? 51.544  10.152  49.763  1.00 91.03  ? 699  LEU A CD2 1 
ATOM 5444  N N   . THR A 1 703  ? 48.903  13.163  50.964  1.00 91.30  ? 700  THR A N   1 
ATOM 5445  C CA  . THR A 1 703  ? 48.692  13.232  52.422  1.00 90.94  ? 700  THR A CA  1 
ATOM 5446  C C   . THR A 1 703  ? 48.340  11.873  53.033  1.00 90.46  ? 700  THR A C   1 
ATOM 5447  O O   . THR A 1 703  ? 47.766  11.009  52.365  1.00 90.40  ? 700  THR A O   1 
ATOM 5448  C CB  . THR A 1 703  ? 47.630  14.300  52.842  1.00 91.09  ? 700  THR A CB  1 
ATOM 5449  O OG1 . THR A 1 703  ? 46.693  14.517  51.779  1.00 91.48  ? 700  THR A OG1 1 
ATOM 5450  C CG2 . THR A 1 703  ? 48.296  15.627  53.195  1.00 91.31  ? 700  THR A CG2 1 
ATOM 5451  N N   . ILE A 1 704  ? 48.702  11.696  54.304  1.00 89.94  ? 701  ILE A N   1 
ATOM 5452  C CA  . ILE A 1 704  ? 48.460  10.455  55.049  1.00 89.50  ? 701  ILE A CA  1 
ATOM 5453  C C   . ILE A 1 704  ? 48.148  10.756  56.507  1.00 89.14  ? 701  ILE A C   1 
ATOM 5454  O O   . ILE A 1 704  ? 48.674  11.719  57.060  1.00 89.29  ? 701  ILE A O   1 
ATOM 5455  C CB  . ILE A 1 704  ? 49.688  9.497   55.024  1.00 89.53  ? 701  ILE A CB  1 
ATOM 5456  C CG1 . ILE A 1 704  ? 51.021  10.269  55.173  1.00 89.52  ? 701  ILE A CG1 1 
ATOM 5457  C CG2 . ILE A 1 704  ? 49.643  8.586   53.803  1.00 89.64  ? 701  ILE A CG2 1 
ATOM 5458  C CD1 . ILE A 1 704  ? 51.633  10.843  53.885  1.00 89.31  ? 701  ILE A CD1 1 
ATOM 5459  N N   . GLY A 1 705  ? 47.306  9.935   57.134  1.00 88.65  ? 702  GLY A N   1 
ATOM 5460  C CA  . GLY A 1 705  ? 47.065  10.054  58.578  1.00 88.05  ? 702  GLY A CA  1 
ATOM 5461  C C   . GLY A 1 705  ? 45.648  9.811   59.057  1.00 87.57  ? 702  GLY A C   1 
ATOM 5462  O O   . GLY A 1 705  ? 44.691  10.011  58.310  1.00 87.53  ? 702  GLY A O   1 
ATOM 5463  N N   . THR A 1 706  ? 45.520  9.407   60.321  1.00 87.11  ? 703  THR A N   1 
ATOM 5464  C CA  . THR A 1 706  ? 44.247  8.915   60.864  1.00 86.66  ? 703  THR A CA  1 
ATOM 5465  C C   . THR A 1 706  ? 43.075  9.891   60.699  1.00 86.27  ? 703  THR A C   1 
ATOM 5466  O O   . THR A 1 706  ? 43.255  11.114  60.656  1.00 86.26  ? 703  THR A O   1 
ATOM 5467  C CB  . THR A 1 706  ? 44.360  8.452   62.354  1.00 86.72  ? 703  THR A CB  1 
ATOM 5468  O OG1 . THR A 1 706  ? 44.770  9.546   63.185  1.00 86.71  ? 703  THR A OG1 1 
ATOM 5469  C CG2 . THR A 1 706  ? 45.345  7.290   62.499  1.00 86.57  ? 703  THR A CG2 1 
ATOM 5470  N N   . ILE A 1 707  ? 41.879  9.317   60.596  1.00 85.63  ? 704  ILE A N   1 
ATOM 5471  C CA  . ILE A 1 707  ? 40.644  10.061  60.416  1.00 84.91  ? 704  ILE A CA  1 
ATOM 5472  C C   . ILE A 1 707  ? 39.915  10.241  61.745  1.00 84.65  ? 704  ILE A C   1 
ATOM 5473  O O   . ILE A 1 707  ? 40.060  9.423   62.652  1.00 84.72  ? 704  ILE A O   1 
ATOM 5474  C CB  . ILE A 1 707  ? 39.758  9.364   59.351  1.00 84.82  ? 704  ILE A CB  1 
ATOM 5475  C CG1 . ILE A 1 707  ? 40.027  9.967   57.969  1.00 84.49  ? 704  ILE A CG1 1 
ATOM 5476  C CG2 . ILE A 1 707  ? 38.272  9.408   59.698  1.00 84.88  ? 704  ILE A CG2 1 
ATOM 5477  C CD1 . ILE A 1 707  ? 39.974  11.476  57.909  1.00 83.66  ? 704  ILE A CD1 1 
ATOM 5478  N N   . ASP A 1 708  ? 39.146  11.326  61.847  1.00 84.20  ? 705  ASP A N   1 
ATOM 5479  C CA  . ASP A 1 708  ? 38.351  11.648  63.036  1.00 83.65  ? 705  ASP A CA  1 
ATOM 5480  C C   . ASP A 1 708  ? 37.174  10.695  63.274  1.00 83.07  ? 705  ASP A C   1 
ATOM 5481  O O   . ASP A 1 708  ? 37.249  9.493   62.998  1.00 82.78  ? 705  ASP A O   1 
ATOM 5482  C CB  . ASP A 1 708  ? 37.835  13.096  62.959  1.00 83.86  ? 705  ASP A CB  1 
ATOM 5483  C CG  . ASP A 1 708  ? 38.905  14.135  63.291  1.00 84.49  ? 705  ASP A CG  1 
ATOM 5484  O OD1 . ASP A 1 708  ? 39.979  13.763  63.820  1.00 85.19  ? 705  ASP A OD1 1 
ATOM 5485  O OD2 . ASP A 1 708  ? 38.661  15.337  63.028  1.00 84.82  ? 705  ASP A OD2 1 
ATOM 5486  N N   . GLU A 1 709  ? 36.080  11.256  63.780  1.00 82.54  ? 706  GLU A N   1 
ATOM 5487  C CA  . GLU A 1 709  ? 34.957  10.470  64.266  1.00 82.14  ? 706  GLU A CA  1 
ATOM 5488  C C   . GLU A 1 709  ? 33.976  10.157  63.147  1.00 81.39  ? 706  GLU A C   1 
ATOM 5489  O O   . GLU A 1 709  ? 34.382  9.756   62.068  1.00 81.44  ? 706  GLU A O   1 
ATOM 5490  C CB  . GLU A 1 709  ? 34.266  11.206  65.415  1.00 82.41  ? 706  GLU A CB  1 
ATOM 5491  C CG  . GLU A 1 709  ? 33.761  10.308  66.529  1.00 83.05  ? 706  GLU A CG  1 
ATOM 5492  C CD  . GLU A 1 709  ? 33.423  11.095  67.776  1.00 84.96  ? 706  GLU A CD  1 
ATOM 5493  O OE1 . GLU A 1 709  ? 34.172  12.043  68.102  1.00 85.40  ? 706  GLU A OE1 1 
ATOM 5494  O OE2 . GLU A 1 709  ? 32.413  10.769  68.437  1.00 86.26  ? 706  GLU A OE2 1 
ATOM 5495  N N   . ILE A 1 710  ? 32.689  10.318  63.428  1.00 80.53  ? 707  ILE A N   1 
ATOM 5496  C CA  . ILE A 1 710  ? 31.626  10.115  62.454  1.00 79.74  ? 707  ILE A CA  1 
ATOM 5497  C C   . ILE A 1 710  ? 30.855  11.437  62.453  1.00 79.03  ? 707  ILE A C   1 
ATOM 5498  O O   . ILE A 1 710  ? 31.448  12.482  62.722  1.00 79.04  ? 707  ILE A O   1 
ATOM 5499  C CB  . ILE A 1 710  ? 30.734  8.885   62.845  1.00 79.94  ? 707  ILE A CB  1 
ATOM 5500  C CG1 . ILE A 1 710  ? 31.591  7.616   63.018  1.00 79.79  ? 707  ILE A CG1 1 
ATOM 5501  C CG2 . ILE A 1 710  ? 29.591  8.663   61.840  1.00 79.80  ? 707  ILE A CG2 1 
ATOM 5502  C CD1 . ILE A 1 710  ? 30.903  6.461   63.758  1.00 79.74  ? 707  ILE A CD1 1 
ATOM 5503  N N   . GLN A 1 711  ? 29.561  11.393  62.133  1.00 78.08  ? 708  GLN A N   1 
ATOM 5504  C CA  . GLN A 1 711  ? 28.621  12.507  62.321  1.00 77.22  ? 708  GLN A CA  1 
ATOM 5505  C C   . GLN A 1 711  ? 29.038  13.861  61.731  1.00 76.36  ? 708  GLN A C   1 
ATOM 5506  O O   . GLN A 1 711  ? 30.145  14.019  61.212  1.00 76.20  ? 708  GLN A O   1 
ATOM 5507  C CB  . GLN A 1 711  ? 28.237  12.642  63.810  1.00 77.63  ? 708  GLN A CB  1 
ATOM 5508  C CG  . GLN A 1 711  ? 29.156  13.533  64.690  1.00 78.21  ? 708  GLN A CG  1 
ATOM 5509  C CD  . GLN A 1 711  ? 30.164  12.772  65.565  1.00 78.37  ? 708  GLN A CD  1 
ATOM 5510  O OE1 . GLN A 1 711  ? 30.116  11.544  65.686  1.00 78.47  ? 708  GLN A OE1 1 
ATOM 5511  N NE2 . GLN A 1 711  ? 31.079  13.516  66.184  1.00 77.82  ? 708  GLN A NE2 1 
ATOM 5512  N N   . LYS A 1 712  ? 28.131  14.830  61.800  1.00 75.37  ? 709  LYS A N   1 
ATOM 5513  C CA  . LYS A 1 712  ? 28.435  16.182  61.347  1.00 74.52  ? 709  LYS A CA  1 
ATOM 5514  C C   . LYS A 1 712  ? 29.123  16.959  62.457  1.00 73.58  ? 709  LYS A C   1 
ATOM 5515  O O   . LYS A 1 712  ? 30.134  17.623  62.219  1.00 73.67  ? 709  LYS A O   1 
ATOM 5516  C CB  . LYS A 1 712  ? 27.174  16.926  60.872  1.00 74.83  ? 709  LYS A CB  1 
ATOM 5517  C CG  . LYS A 1 712  ? 27.466  18.244  60.140  1.00 75.01  ? 709  LYS A CG  1 
ATOM 5518  C CD  . LYS A 1 712  ? 26.319  18.673  59.228  1.00 75.30  ? 709  LYS A CD  1 
ATOM 5519  C CE  . LYS A 1 712  ? 26.804  19.616  58.117  1.00 74.79  ? 709  LYS A CE  1 
ATOM 5520  N NZ  . LYS A 1 712  ? 27.519  18.925  57.008  1.00 73.51  ? 709  LYS A NZ  1 
ATOM 5521  N N   . LEU A 1 713  ? 28.574  16.869  63.667  1.00 72.25  ? 710  LEU A N   1 
ATOM 5522  C CA  . LEU A 1 713  ? 29.091  17.630  64.796  1.00 70.77  ? 710  LEU A CA  1 
ATOM 5523  C C   . LEU A 1 713  ? 30.039  16.821  65.668  1.00 70.04  ? 710  LEU A C   1 
ATOM 5524  O O   . LEU A 1 713  ? 29.629  15.868  66.331  1.00 69.96  ? 710  LEU A O   1 
ATOM 5525  C CB  . LEU A 1 713  ? 27.949  18.200  65.644  1.00 70.52  ? 710  LEU A CB  1 
ATOM 5526  C CG  . LEU A 1 713  ? 27.053  19.305  65.082  1.00 69.80  ? 710  LEU A CG  1 
ATOM 5527  C CD1 . LEU A 1 713  ? 26.181  19.805  66.195  1.00 69.67  ? 710  LEU A CD1 1 
ATOM 5528  C CD2 . LEU A 1 713  ? 27.829  20.464  64.484  1.00 68.97  ? 710  LEU A CD2 1 
ATOM 5529  N N   . HIS A 1 714  ? 31.310  17.204  65.655  1.00 69.02  ? 711  HIS A N   1 
ATOM 5530  C CA  . HIS A 1 714  ? 32.270  16.654  66.592  1.00 68.17  ? 711  HIS A CA  1 
ATOM 5531  C C   . HIS A 1 714  ? 32.179  17.378  67.942  1.00 67.57  ? 711  HIS A C   1 
ATOM 5532  O O   . HIS A 1 714  ? 32.043  18.602  67.993  1.00 67.68  ? 711  HIS A O   1 
ATOM 5533  C CB  . HIS A 1 714  ? 33.680  16.744  66.025  1.00 68.20  ? 711  HIS A CB  1 
ATOM 5534  C CG  . HIS A 1 714  ? 34.716  16.128  66.907  1.00 68.07  ? 711  HIS A CG  1 
ATOM 5535  N ND1 . HIS A 1 714  ? 34.748  14.778  67.186  1.00 67.87  ? 711  HIS A ND1 1 
ATOM 5536  C CD2 . HIS A 1 714  ? 35.750  16.679  67.583  1.00 67.55  ? 711  HIS A CD2 1 
ATOM 5537  C CE1 . HIS A 1 714  ? 35.761  14.524  67.992  1.00 67.82  ? 711  HIS A CE1 1 
ATOM 5538  N NE2 . HIS A 1 714  ? 36.385  15.659  68.248  1.00 67.86  ? 711  HIS A NE2 1 
ATOM 5539  N N   . ILE A 1 715  ? 32.256  16.612  69.029  1.00 66.54  ? 712  ILE A N   1 
ATOM 5540  C CA  . ILE A 1 715  ? 32.106  17.148  70.384  1.00 65.40  ? 712  ILE A CA  1 
ATOM 5541  C C   . ILE A 1 715  ? 33.315  16.800  71.254  1.00 64.93  ? 712  ILE A C   1 
ATOM 5542  O O   . ILE A 1 715  ? 33.643  15.620  71.416  1.00 65.00  ? 712  ILE A O   1 
ATOM 5543  C CB  . ILE A 1 715  ? 30.801  16.617  71.020  1.00 65.27  ? 712  ILE A CB  1 
ATOM 5544  C CG1 . ILE A 1 715  ? 29.613  17.399  70.457  1.00 64.85  ? 712  ILE A CG1 1 
ATOM 5545  C CG2 . ILE A 1 715  ? 30.852  16.680  72.553  1.00 64.56  ? 712  ILE A CG2 1 
ATOM 5546  C CD1 . ILE A 1 715  ? 28.389  16.568  70.203  1.00 64.49  ? 712  ILE A CD1 1 
ATOM 5547  N N   . ARG A 1 716  ? 33.985  17.815  71.808  1.00 64.05  ? 713  ARG A N   1 
ATOM 5548  C CA  . ARG A 1 716  ? 35.135  17.542  72.685  1.00 63.03  ? 713  ARG A CA  1 
ATOM 5549  C C   . ARG A 1 716  ? 34.698  17.194  74.120  1.00 62.50  ? 713  ARG A C   1 
ATOM 5550  O O   . ARG A 1 716  ? 34.607  16.007  74.455  1.00 62.76  ? 713  ARG A O   1 
ATOM 5551  C CB  . ARG A 1 716  ? 36.190  18.659  72.640  1.00 62.93  ? 713  ARG A CB  1 
ATOM 5552  C CG  . ARG A 1 716  ? 37.607  18.234  73.068  1.00 62.15  ? 713  ARG A CG  1 
ATOM 5553  C CD  . ARG A 1 716  ? 38.626  19.294  72.607  1.00 62.72  ? 713  ARG A CD  1 
ATOM 5554  N NE  . ARG A 1 716  ? 40.030  19.127  73.030  1.00 62.02  ? 713  ARG A NE  1 
ATOM 5555  C CZ  . ARG A 1 716  ? 40.460  18.768  74.242  1.00 61.97  ? 713  ARG A CZ  1 
ATOM 5556  N NH1 . ARG A 1 716  ? 39.615  18.513  75.234  1.00 62.32  ? 713  ARG A NH1 1 
ATOM 5557  N NH2 . ARG A 1 716  ? 41.761  18.672  74.471  1.00 61.29  ? 713  ARG A NH2 1 
ATOM 5558  N N   . THR A 1 717  ? 34.393  18.210  74.932  1.00 61.26  ? 714  THR A N   1 
ATOM 5559  C CA  . THR A 1 717  ? 34.122  18.063  76.380  1.00 60.12  ? 714  THR A CA  1 
ATOM 5560  C C   . THR A 1 717  ? 35.381  18.243  77.232  1.00 59.34  ? 714  THR A C   1 
ATOM 5561  O O   . THR A 1 717  ? 36.314  17.454  77.152  1.00 58.99  ? 714  THR A O   1 
ATOM 5562  C CB  . THR A 1 717  ? 33.414  16.728  76.776  1.00 59.98  ? 714  THR A CB  1 
ATOM 5563  O OG1 . THR A 1 717  ? 32.259  16.521  75.959  1.00 60.28  ? 714  THR A OG1 1 
ATOM 5564  C CG2 . THR A 1 717  ? 32.978  16.758  78.229  1.00 59.87  ? 714  THR A CG2 1 
ATOM 5565  N N   . VAL A 1 718  ? 35.384  19.304  78.036  1.00 58.65  ? 715  VAL A N   1 
ATOM 5566  C CA  . VAL A 1 718  ? 36.423  19.562  79.022  1.00 57.97  ? 715  VAL A CA  1 
ATOM 5567  C C   . VAL A 1 718  ? 35.754  19.571  80.391  1.00 57.66  ? 715  VAL A C   1 
ATOM 5568  O O   . VAL A 1 718  ? 35.285  20.617  80.832  1.00 57.83  ? 715  VAL A O   1 
ATOM 5569  C CB  . VAL A 1 718  ? 37.114  20.927  78.794  1.00 57.87  ? 715  VAL A CB  1 
ATOM 5570  C CG1 . VAL A 1 718  ? 38.291  21.102  79.757  1.00 57.79  ? 715  VAL A CG1 1 
ATOM 5571  C CG2 . VAL A 1 718  ? 37.578  21.068  77.359  1.00 57.60  ? 715  VAL A CG2 1 
ATOM 5572  N N   . PRO A 1 719  ? 35.694  18.407  81.065  1.00 57.28  ? 716  PRO A N   1 
ATOM 5573  C CA  . PRO A 1 719  ? 34.985  18.309  82.355  1.00 57.05  ? 716  PRO A CA  1 
ATOM 5574  C C   . PRO A 1 719  ? 35.502  19.268  83.456  1.00 56.76  ? 716  PRO A C   1 
ATOM 5575  O O   . PRO A 1 719  ? 36.602  19.074  83.972  1.00 57.06  ? 716  PRO A O   1 
ATOM 5576  C CB  . PRO A 1 719  ? 35.195  16.839  82.756  1.00 57.02  ? 716  PRO A CB  1 
ATOM 5577  C CG  . PRO A 1 719  ? 36.370  16.375  81.947  1.00 56.93  ? 716  PRO A CG  1 
ATOM 5578  C CD  . PRO A 1 719  ? 36.277  17.114  80.661  1.00 57.07  ? 716  PRO A CD  1 
ATOM 5579  N N   . LEU A 1 720  ? 34.708  20.284  83.805  1.00 56.18  ? 717  LEU A N   1 
ATOM 5580  C CA  . LEU A 1 720  ? 35.077  21.280  84.826  1.00 55.68  ? 717  LEU A CA  1 
ATOM 5581  C C   . LEU A 1 720  ? 34.690  20.879  86.255  1.00 55.65  ? 717  LEU A C   1 
ATOM 5582  O O   . LEU A 1 720  ? 35.296  21.339  87.228  1.00 55.67  ? 717  LEU A O   1 
ATOM 5583  C CB  . LEU A 1 720  ? 34.429  22.624  84.513  1.00 55.50  ? 717  LEU A CB  1 
ATOM 5584  C CG  . LEU A 1 720  ? 34.755  23.331  83.201  1.00 55.46  ? 717  LEU A CG  1 
ATOM 5585  C CD1 . LEU A 1 720  ? 33.693  24.373  82.920  1.00 55.18  ? 717  LEU A CD1 1 
ATOM 5586  C CD2 . LEU A 1 720  ? 36.146  23.963  83.226  1.00 55.05  ? 717  LEU A CD2 1 
ATOM 5587  N N   . TYR A 1 721  ? 33.657  20.047  86.372  1.00 55.49  ? 718  TYR A N   1 
ATOM 5588  C CA  . TYR A 1 721  ? 33.158  19.550  87.662  1.00 55.27  ? 718  TYR A CA  1 
ATOM 5589  C C   . TYR A 1 721  ? 32.451  20.589  88.527  1.00 55.29  ? 718  TYR A C   1 
ATOM 5590  O O   . TYR A 1 721  ? 31.859  20.254  89.553  1.00 55.24  ? 718  TYR A O   1 
ATOM 5591  C CB  . TYR A 1 721  ? 34.248  18.780  88.428  1.00 55.21  ? 718  TYR A CB  1 
ATOM 5592  C CG  . TYR A 1 721  ? 34.731  17.601  87.629  1.00 54.89  ? 718  TYR A CG  1 
ATOM 5593  C CD1 . TYR A 1 721  ? 35.895  17.686  86.868  1.00 54.49  ? 718  TYR A CD1 1 
ATOM 5594  C CD2 . TYR A 1 721  ? 33.991  16.417  87.584  1.00 54.83  ? 718  TYR A CD2 1 
ATOM 5595  C CE1 . TYR A 1 721  ? 36.327  16.617  86.102  1.00 54.74  ? 718  TYR A CE1 1 
ATOM 5596  C CE2 . TYR A 1 721  ? 34.411  15.340  86.820  1.00 54.94  ? 718  TYR A CE2 1 
ATOM 5597  C CZ  . TYR A 1 721  ? 35.582  15.447  86.081  1.00 55.08  ? 718  TYR A CZ  1 
ATOM 5598  O OH  . TYR A 1 721  ? 36.012  14.387  85.322  1.00 55.08  ? 718  TYR A OH  1 
ATOM 5599  N N   . GLU A 1 722  ? 32.509  21.848  88.101  1.00 55.33  ? 719  GLU A N   1 
ATOM 5600  C CA  . GLU A 1 722  ? 31.660  22.892  88.674  1.00 55.67  ? 719  GLU A CA  1 
ATOM 5601  C C   . GLU A 1 722  ? 30.672  23.444  87.638  1.00 55.02  ? 719  GLU A C   1 
ATOM 5602  O O   . GLU A 1 722  ? 30.093  22.677  86.891  1.00 54.92  ? 719  GLU A O   1 
ATOM 5603  C CB  . GLU A 1 722  ? 32.469  23.991  89.384  1.00 55.74  ? 719  GLU A CB  1 
ATOM 5604  C CG  . GLU A 1 722  ? 33.803  24.378  88.768  1.00 56.51  ? 719  GLU A CG  1 
ATOM 5605  C CD  . GLU A 1 722  ? 34.583  25.324  89.672  1.00 57.15  ? 719  GLU A CD  1 
ATOM 5606  O OE1 . GLU A 1 722  ? 34.021  26.373  90.063  1.00 59.62  ? 719  GLU A OE1 1 
ATOM 5607  O OE2 . GLU A 1 722  ? 35.755  25.023  90.001  1.00 59.52  ? 719  GLU A OE2 1 
ATOM 5608  N N   . SER A 1 723  ? 30.464  24.752  87.589  1.00 54.53  ? 720  SER A N   1 
ATOM 5609  C CA  . SER A 1 723  ? 29.420  25.282  86.731  1.00 54.22  ? 720  SER A CA  1 
ATOM 5610  C C   . SER A 1 723  ? 29.794  26.630  86.174  1.00 54.04  ? 720  SER A C   1 
ATOM 5611  O O   . SER A 1 723  ? 29.881  27.602  86.915  1.00 54.10  ? 720  SER A O   1 
ATOM 5612  C CB  . SER A 1 723  ? 28.105  25.369  87.494  1.00 54.26  ? 720  SER A CB  1 
ATOM 5613  O OG  . SER A 1 723  ? 28.353  25.706  88.844  1.00 54.67  ? 720  SER A OG  1 
ATOM 5614  N N   . PRO A 1 724  ? 29.990  26.699  84.855  1.00 53.93  ? 721  PRO A N   1 
ATOM 5615  C CA  . PRO A 1 724  ? 30.497  27.901  84.228  1.00 54.16  ? 721  PRO A CA  1 
ATOM 5616  C C   . PRO A 1 724  ? 29.356  28.834  83.873  1.00 54.72  ? 721  PRO A C   1 
ATOM 5617  O O   . PRO A 1 724  ? 28.332  28.374  83.354  1.00 55.15  ? 721  PRO A O   1 
ATOM 5618  C CB  . PRO A 1 724  ? 31.161  27.366  82.968  1.00 54.03  ? 721  PRO A CB  1 
ATOM 5619  C CG  . PRO A 1 724  ? 30.415  26.101  82.645  1.00 53.96  ? 721  PRO A CG  1 
ATOM 5620  C CD  . PRO A 1 724  ? 29.707  25.638  83.875  1.00 53.84  ? 721  PRO A CD  1 
ATOM 5621  N N   . ARG A 1 725  ? 29.512  30.129  84.148  1.00 55.17  ? 722  ARG A N   1 
ATOM 5622  C CA  . ARG A 1 725  ? 28.425  31.089  83.870  1.00 55.61  ? 722  ARG A CA  1 
ATOM 5623  C C   . ARG A 1 725  ? 28.580  31.821  82.526  1.00 55.78  ? 722  ARG A C   1 
ATOM 5624  O O   . ARG A 1 725  ? 27.635  31.860  81.740  1.00 55.78  ? 722  ARG A O   1 
ATOM 5625  C CB  . ARG A 1 725  ? 28.189  32.074  85.032  1.00 55.71  ? 722  ARG A CB  1 
ATOM 5626  C CG  . ARG A 1 725  ? 28.491  31.525  86.424  1.00 55.70  ? 722  ARG A CG  1 
ATOM 5627  C CD  . ARG A 1 725  ? 27.306  31.604  87.369  1.00 55.73  ? 722  ARG A CD  1 
ATOM 5628  N NE  . ARG A 1 725  ? 26.652  30.297  87.484  1.00 56.40  ? 722  ARG A NE  1 
ATOM 5629  C CZ  . ARG A 1 725  ? 26.024  29.844  88.573  1.00 56.36  ? 722  ARG A CZ  1 
ATOM 5630  N NH1 . ARG A 1 725  ? 25.956  30.582  89.678  1.00 55.83  ? 722  ARG A NH1 1 
ATOM 5631  N NH2 . ARG A 1 725  ? 25.465  28.637  88.557  1.00 56.07  ? 722  ARG A NH2 1 
ATOM 5632  N N   . LYS A 1 726  ? 29.755  32.391  82.257  1.00 56.03  ? 723  LYS A N   1 
ATOM 5633  C CA  . LYS A 1 726  ? 30.020  33.002  80.943  1.00 56.36  ? 723  LYS A CA  1 
ATOM 5634  C C   . LYS A 1 726  ? 31.445  32.747  80.391  1.00 56.21  ? 723  LYS A C   1 
ATOM 5635  O O   . LYS A 1 726  ? 32.358  32.401  81.150  1.00 56.20  ? 723  LYS A O   1 
ATOM 5636  C CB  . LYS A 1 726  ? 29.672  34.502  80.947  1.00 56.63  ? 723  LYS A CB  1 
ATOM 5637  C CG  . LYS A 1 726  ? 28.172  34.804  81.120  1.00 57.80  ? 723  LYS A CG  1 
ATOM 5638  C CD  . LYS A 1 726  ? 27.594  35.679  79.995  1.00 59.82  ? 723  LYS A CD  1 
ATOM 5639  C CE  . LYS A 1 726  ? 27.862  37.170  80.206  1.00 61.29  ? 723  LYS A CE  1 
ATOM 5640  N NZ  . LYS A 1 726  ? 27.115  37.731  81.383  1.00 62.39  ? 723  LYS A NZ  1 
ATOM 5641  N N   . ILE A 1 727  ? 31.621  32.928  79.077  1.00 56.01  ? 724  ILE A N   1 
ATOM 5642  C CA  . ILE A 1 727  ? 32.909  32.674  78.402  1.00 55.77  ? 724  ILE A CA  1 
ATOM 5643  C C   . ILE A 1 727  ? 33.366  33.780  77.431  1.00 55.98  ? 724  ILE A C   1 
ATOM 5644  O O   . ILE A 1 727  ? 32.571  34.311  76.668  1.00 55.78  ? 724  ILE A O   1 
ATOM 5645  C CB  . ILE A 1 727  ? 32.920  31.298  77.693  1.00 55.45  ? 724  ILE A CB  1 
ATOM 5646  C CG1 . ILE A 1 727  ? 34.318  30.961  77.186  1.00 55.42  ? 724  ILE A CG1 1 
ATOM 5647  C CG2 . ILE A 1 727  ? 31.937  31.259  76.554  1.00 55.08  ? 724  ILE A CG2 1 
ATOM 5648  C CD1 . ILE A 1 727  ? 34.515  29.503  76.865  1.00 56.00  ? 724  ILE A CD1 1 
ATOM 5649  N N   . CYS A 1 728  ? 34.661  34.101  77.478  1.00 56.49  ? 725  CYS A N   1 
ATOM 5650  C CA  . CYS A 1 728  ? 35.295  35.080  76.589  1.00 56.95  ? 725  CYS A CA  1 
ATOM 5651  C C   . CYS A 1 728  ? 36.566  34.556  75.939  1.00 57.14  ? 725  CYS A C   1 
ATOM 5652  O O   . CYS A 1 728  ? 37.297  33.773  76.548  1.00 57.05  ? 725  CYS A O   1 
ATOM 5653  C CB  . CYS A 1 728  ? 35.649  36.323  77.373  1.00 56.90  ? 725  CYS A CB  1 
ATOM 5654  S SG  . CYS A 1 728  ? 34.264  37.394  77.558  1.00 58.42  ? 725  CYS A SG  1 
ATOM 5655  N N   . TYR A 1 729  ? 36.842  35.015  74.717  1.00 57.49  ? 726  TYR A N   1 
ATOM 5656  C CA  . TYR A 1 729  ? 38.060  34.606  74.000  1.00 57.84  ? 726  TYR A CA  1 
ATOM 5657  C C   . TYR A 1 729  ? 39.084  35.727  73.691  1.00 58.29  ? 726  TYR A C   1 
ATOM 5658  O O   . TYR A 1 729  ? 38.924  36.497  72.738  1.00 58.42  ? 726  TYR A O   1 
ATOM 5659  C CB  . TYR A 1 729  ? 37.711  33.837  72.725  1.00 57.37  ? 726  TYR A CB  1 
ATOM 5660  C CG  . TYR A 1 729  ? 38.926  33.367  71.960  1.00 57.14  ? 726  TYR A CG  1 
ATOM 5661  C CD1 . TYR A 1 729  ? 39.794  32.416  72.501  1.00 57.14  ? 726  TYR A CD1 1 
ATOM 5662  C CD2 . TYR A 1 729  ? 39.210  33.871  70.696  1.00 56.93  ? 726  TYR A CD2 1 
ATOM 5663  C CE1 . TYR A 1 729  ? 40.910  31.977  71.796  1.00 57.29  ? 726  TYR A CE1 1 
ATOM 5664  C CE2 . TYR A 1 729  ? 40.321  33.434  69.982  1.00 57.03  ? 726  TYR A CE2 1 
ATOM 5665  C CZ  . TYR A 1 729  ? 41.170  32.492  70.537  1.00 57.05  ? 726  TYR A CZ  1 
ATOM 5666  O OH  . TYR A 1 729  ? 42.274  32.068  69.834  1.00 56.55  ? 726  TYR A OH  1 
ATOM 5667  N N   . GLN A 1 730  ? 40.138  35.796  74.501  1.00 58.69  ? 727  GLN A N   1 
ATOM 5668  C CA  . GLN A 1 730  ? 41.277  36.663  74.222  1.00 59.05  ? 727  GLN A CA  1 
ATOM 5669  C C   . GLN A 1 730  ? 42.294  35.900  73.363  1.00 59.10  ? 727  GLN A C   1 
ATOM 5670  O O   . GLN A 1 730  ? 42.993  34.996  73.839  1.00 59.03  ? 727  GLN A O   1 
ATOM 5671  C CB  . GLN A 1 730  ? 41.907  37.145  75.527  1.00 59.23  ? 727  GLN A CB  1 
ATOM 5672  C CG  . GLN A 1 730  ? 42.758  38.400  75.401  1.00 59.73  ? 727  GLN A CG  1 
ATOM 5673  C CD  . GLN A 1 730  ? 42.991  39.072  76.744  1.00 60.65  ? 727  GLN A CD  1 
ATOM 5674  O OE1 . GLN A 1 730  ? 42.055  39.554  77.382  1.00 61.03  ? 727  GLN A OE1 1 
ATOM 5675  N NE2 . GLN A 1 730  ? 44.245  39.115  77.175  1.00 61.48  ? 727  GLN A NE2 1 
ATOM 5676  N N   . GLU A 1 731  ? 42.363  36.274  72.090  1.00 59.18  ? 728  GLU A N   1 
ATOM 5677  C CA  . GLU A 1 731  ? 43.179  35.560  71.106  1.00 59.18  ? 728  GLU A CA  1 
ATOM 5678  C C   . GLU A 1 731  ? 44.641  36.025  71.090  1.00 58.92  ? 728  GLU A C   1 
ATOM 5679  O O   . GLU A 1 731  ? 45.561  35.222  70.911  1.00 58.76  ? 728  GLU A O   1 
ATOM 5680  C CB  . GLU A 1 731  ? 42.528  35.688  69.729  1.00 59.36  ? 728  GLU A CB  1 
ATOM 5681  C CG  . GLU A 1 731  ? 43.267  35.022  68.591  1.00 59.67  ? 728  GLU A CG  1 
ATOM 5682  C CD  . GLU A 1 731  ? 43.998  36.028  67.746  1.00 60.10  ? 728  GLU A CD  1 
ATOM 5683  O OE1 . GLU A 1 731  ? 44.304  35.700  66.579  1.00 60.53  ? 728  GLU A OE1 1 
ATOM 5684  O OE2 . GLU A 1 731  ? 44.251  37.150  68.246  1.00 59.98  ? 728  GLU A OE2 1 
ATOM 5685  N N   . VAL A 1 732  ? 44.840  37.326  71.277  1.00 58.71  ? 729  VAL A N   1 
ATOM 5686  C CA  . VAL A 1 732  ? 46.167  37.890  71.525  1.00 58.41  ? 729  VAL A CA  1 
ATOM 5687  C C   . VAL A 1 732  ? 46.850  37.160  72.703  1.00 58.48  ? 729  VAL A C   1 
ATOM 5688  O O   . VAL A 1 732  ? 48.083  37.072  72.769  1.00 58.58  ? 729  VAL A O   1 
ATOM 5689  C CB  . VAL A 1 732  ? 46.091  39.449  71.712  1.00 58.25  ? 729  VAL A CB  1 
ATOM 5690  C CG1 . VAL A 1 732  ? 44.802  39.868  72.429  1.00 57.74  ? 729  VAL A CG1 1 
ATOM 5691  C CG2 . VAL A 1 732  ? 47.340  40.018  72.396  1.00 57.84  ? 729  VAL A CG2 1 
ATOM 5692  N N   . SER A 1 733  ? 46.032  36.603  73.598  1.00 58.35  ? 730  SER A N   1 
ATOM 5693  C CA  . SER A 1 733  ? 46.518  35.845  74.751  1.00 58.29  ? 730  SER A CA  1 
ATOM 5694  C C   . SER A 1 733  ? 46.474  34.329  74.565  1.00 58.06  ? 730  SER A C   1 
ATOM 5695  O O   . SER A 1 733  ? 47.168  33.594  75.275  1.00 57.95  ? 730  SER A O   1 
ATOM 5696  C CB  . SER A 1 733  ? 45.738  36.233  76.005  1.00 58.31  ? 730  SER A CB  1 
ATOM 5697  O OG  . SER A 1 733  ? 46.323  37.359  76.631  1.00 59.02  ? 730  SER A OG  1 
ATOM 5698  N N   . GLN A 1 734  ? 45.656  33.873  73.617  1.00 57.86  ? 731  GLN A N   1 
ATOM 5699  C CA  . GLN A 1 734  ? 45.501  32.442  73.300  1.00 57.65  ? 731  GLN A CA  1 
ATOM 5700  C C   . GLN A 1 734  ? 44.911  31.648  74.476  1.00 57.54  ? 731  GLN A C   1 
ATOM 5701  O O   . GLN A 1 734  ? 45.480  30.646  74.920  1.00 57.76  ? 731  GLN A O   1 
ATOM 5702  C CB  . GLN A 1 734  ? 46.833  31.818  72.829  1.00 57.53  ? 731  GLN A CB  1 
ATOM 5703  C CG  . GLN A 1 734  ? 47.540  32.566  71.702  1.00 56.80  ? 731  GLN A CG  1 
ATOM 5704  C CD  . GLN A 1 734  ? 47.384  31.898  70.352  1.00 55.80  ? 731  GLN A CD  1 
ATOM 5705  O OE1 . GLN A 1 734  ? 48.364  31.445  69.757  1.00 55.37  ? 731  GLN A OE1 1 
ATOM 5706  N NE2 . GLN A 1 734  ? 46.154  31.837  69.857  1.00 55.36  ? 731  GLN A NE2 1 
ATOM 5707  N N   . CYS A 1 735  ? 43.763  32.094  74.972  1.00 57.21  ? 732  CYS A N   1 
ATOM 5708  C CA  . CYS A 1 735  ? 43.162  31.473  76.144  1.00 57.10  ? 732  CYS A CA  1 
ATOM 5709  C C   . CYS A 1 735  ? 41.734  31.931  76.382  1.00 56.73  ? 732  CYS A C   1 
ATOM 5710  O O   . CYS A 1 735  ? 41.351  33.037  76.012  1.00 56.88  ? 732  CYS A O   1 
ATOM 5711  C CB  . CYS A 1 735  ? 43.987  31.804  77.376  1.00 57.11  ? 732  CYS A CB  1 
ATOM 5712  S SG  . CYS A 1 735  ? 44.197  33.563  77.555  1.00 58.32  ? 732  CYS A SG  1 
ATOM 5713  N N   . PHE A 1 736  ? 40.951  31.080  77.023  1.00 56.23  ? 733  PHE A N   1 
ATOM 5714  C CA  . PHE A 1 736  ? 39.585  31.432  77.342  1.00 55.89  ? 733  PHE A CA  1 
ATOM 5715  C C   . PHE A 1 736  ? 39.498  31.926  78.777  1.00 55.35  ? 733  PHE A C   1 
ATOM 5716  O O   . PHE A 1 736  ? 40.190  31.413  79.655  1.00 55.41  ? 733  PHE A O   1 
ATOM 5717  C CB  . PHE A 1 736  ? 38.651  30.235  77.130  1.00 56.21  ? 733  PHE A CB  1 
ATOM 5718  C CG  . PHE A 1 736  ? 38.475  29.835  75.681  1.00 56.46  ? 733  PHE A CG  1 
ATOM 5719  C CD1 . PHE A 1 736  ? 39.104  28.707  75.177  1.00 56.64  ? 733  PHE A CD1 1 
ATOM 5720  C CD2 . PHE A 1 736  ? 37.670  30.580  74.831  1.00 57.09  ? 733  PHE A CD2 1 
ATOM 5721  C CE1 . PHE A 1 736  ? 38.941  28.332  73.853  1.00 56.81  ? 733  PHE A CE1 1 
ATOM 5722  C CE2 . PHE A 1 736  ? 37.498  30.206  73.506  1.00 57.19  ? 733  PHE A CE2 1 
ATOM 5723  C CZ  . PHE A 1 736  ? 38.136  29.087  73.015  1.00 56.80  ? 733  PHE A CZ  1 
ATOM 5724  N N   . GLY A 1 737  ? 38.666  32.943  78.996  1.00 54.65  ? 734  GLY A N   1 
ATOM 5725  C CA  . GLY A 1 737  ? 38.309  33.397  80.338  1.00 53.60  ? 734  GLY A CA  1 
ATOM 5726  C C   . GLY A 1 737  ? 36.910  32.884  80.584  1.00 52.99  ? 734  GLY A C   1 
ATOM 5727  O O   . GLY A 1 737  ? 36.040  33.054  79.734  1.00 53.01  ? 734  GLY A O   1 
ATOM 5728  N N   . VAL A 1 738  ? 36.693  32.228  81.720  1.00 52.34  ? 735  VAL A N   1 
ATOM 5729  C CA  . VAL A 1 738  ? 35.410  31.580  81.997  1.00 51.77  ? 735  VAL A CA  1 
ATOM 5730  C C   . VAL A 1 738  ? 35.060  31.797  83.440  1.00 51.29  ? 735  VAL A C   1 
ATOM 5731  O O   . VAL A 1 738  ? 35.850  31.478  84.322  1.00 51.32  ? 735  VAL A O   1 
ATOM 5732  C CB  . VAL A 1 738  ? 35.445  30.043  81.723  1.00 51.91  ? 735  VAL A CB  1 
ATOM 5733  C CG1 . VAL A 1 738  ? 34.291  29.326  82.404  1.00 51.86  ? 735  VAL A CG1 1 
ATOM 5734  C CG2 . VAL A 1 738  ? 35.400  29.749  80.242  1.00 52.28  ? 735  VAL A CG2 1 
ATOM 5735  N N   . LEU A 1 739  ? 33.873  32.340  83.679  1.00 50.79  ? 736  LEU A N   1 
ATOM 5736  C CA  . LEU A 1 739  ? 33.387  32.511  85.035  1.00 50.26  ? 736  LEU A CA  1 
ATOM 5737  C C   . LEU A 1 739  ? 32.784  31.201  85.494  1.00 50.28  ? 736  LEU A C   1 
ATOM 5738  O O   . LEU A 1 739  ? 31.946  30.631  84.791  1.00 50.32  ? 736  LEU A O   1 
ATOM 5739  C CB  . LEU A 1 739  ? 32.358  33.644  85.113  1.00 50.00  ? 736  LEU A CB  1 
ATOM 5740  C CG  . LEU A 1 739  ? 32.838  35.050  84.754  1.00 49.13  ? 736  LEU A CG  1 
ATOM 5741  C CD1 . LEU A 1 739  ? 31.748  36.051  84.998  1.00 48.81  ? 736  LEU A CD1 1 
ATOM 5742  C CD2 . LEU A 1 739  ? 34.059  35.425  85.552  1.00 48.82  ? 736  LEU A CD2 1 
ATOM 5743  N N   . SER A 1 740  ? 33.225  30.710  86.649  1.00 50.15  ? 737  SER A N   1 
ATOM 5744  C CA  . SER A 1 740  ? 32.642  29.501  87.219  1.00 50.58  ? 737  SER A CA  1 
ATOM 5745  C C   . SER A 1 740  ? 32.043  29.752  88.598  1.00 50.75  ? 737  SER A C   1 
ATOM 5746  O O   . SER A 1 740  ? 32.070  30.874  89.095  1.00 51.01  ? 737  SER A O   1 
ATOM 5747  C CB  . SER A 1 740  ? 33.658  28.360  87.255  1.00 50.51  ? 737  SER A CB  1 
ATOM 5748  O OG  . SER A 1 740  ? 34.738  28.683  88.104  1.00 51.79  ? 737  SER A OG  1 
ATOM 5749  N N   . SER A 1 741  ? 31.488  28.707  89.203  1.00 51.09  ? 738  SER A N   1 
ATOM 5750  C CA  . SER A 1 741  ? 30.780  28.821  90.471  1.00 51.38  ? 738  SER A CA  1 
ATOM 5751  C C   . SER A 1 741  ? 30.734  27.477  91.151  1.00 51.78  ? 738  SER A C   1 
ATOM 5752  O O   . SER A 1 741  ? 30.202  26.517  90.597  1.00 51.86  ? 738  SER A O   1 
ATOM 5753  C CB  . SER A 1 741  ? 29.349  29.318  90.244  1.00 51.44  ? 738  SER A CB  1 
ATOM 5754  O OG  . SER A 1 741  ? 28.434  28.763  91.177  1.00 51.09  ? 738  SER A OG  1 
ATOM 5755  N N   . ARG A 1 742  ? 31.287  27.409  92.353  1.00 52.36  ? 739  ARG A N   1 
ATOM 5756  C CA  . ARG A 1 742  ? 31.196  26.196  93.150  1.00 53.11  ? 739  ARG A CA  1 
ATOM 5757  C C   . ARG A 1 742  ? 30.415  26.415  94.428  1.00 53.49  ? 739  ARG A C   1 
ATOM 5758  O O   . ARG A 1 742  ? 30.460  27.490  95.011  1.00 53.29  ? 739  ARG A O   1 
ATOM 5759  C CB  . ARG A 1 742  ? 32.572  25.589  93.448  1.00 53.26  ? 739  ARG A CB  1 
ATOM 5760  C CG  . ARG A 1 742  ? 33.729  26.560  93.513  1.00 53.71  ? 739  ARG A CG  1 
ATOM 5761  C CD  . ARG A 1 742  ? 34.984  25.828  93.917  1.00 54.88  ? 739  ARG A CD  1 
ATOM 5762  N NE  . ARG A 1 742  ? 35.496  26.270  95.209  1.00 56.21  ? 739  ARG A NE  1 
ATOM 5763  C CZ  . ARG A 1 742  ? 36.357  27.275  95.360  1.00 57.52  ? 739  ARG A CZ  1 
ATOM 5764  N NH1 . ARG A 1 742  ? 36.794  27.948  94.299  1.00 57.97  ? 739  ARG A NH1 1 
ATOM 5765  N NH2 . ARG A 1 742  ? 36.784  27.616  96.572  1.00 58.08  ? 739  ARG A NH2 1 
ATOM 5766  N N   . ILE A 1 743  ? 29.683  25.385  94.829  1.00 54.33  ? 740  ILE A N   1 
ATOM 5767  C CA  . ILE A 1 743  ? 28.909  25.402  96.045  1.00 55.46  ? 740  ILE A CA  1 
ATOM 5768  C C   . ILE A 1 743  ? 29.784  24.807  97.122  1.00 56.52  ? 740  ILE A C   1 
ATOM 5769  O O   . ILE A 1 743  ? 30.454  23.808  96.892  1.00 56.74  ? 740  ILE A O   1 
ATOM 5770  C CB  . ILE A 1 743  ? 27.635  24.560  95.898  1.00 55.27  ? 740  ILE A CB  1 
ATOM 5771  C CG1 . ILE A 1 743  ? 26.624  25.265  94.983  1.00 55.66  ? 740  ILE A CG1 1 
ATOM 5772  C CG2 . ILE A 1 743  ? 27.015  24.281  97.255  1.00 55.48  ? 740  ILE A CG2 1 
ATOM 5773  C CD1 . ILE A 1 743  ? 25.441  24.387  94.530  1.00 55.62  ? 740  ILE A CD1 1 
ATOM 5774  N N   . GLU A 1 744  ? 29.797  25.437  98.289  1.00 58.01  ? 741  GLU A N   1 
ATOM 5775  C CA  . GLU A 1 744  ? 30.501  24.896  99.443  1.00 59.64  ? 741  GLU A CA  1 
ATOM 5776  C C   . GLU A 1 744  ? 29.558  24.823  100.639 1.00 60.40  ? 741  GLU A C   1 
ATOM 5777  O O   . GLU A 1 744  ? 28.476  25.409  100.626 1.00 60.50  ? 741  GLU A O   1 
ATOM 5778  C CB  . GLU A 1 744  ? 31.732  25.742  99.775  1.00 59.66  ? 741  GLU A CB  1 
ATOM 5779  C CG  . GLU A 1 744  ? 32.852  25.705  98.728  1.00 60.34  ? 741  GLU A CG  1 
ATOM 5780  C CD  . GLU A 1 744  ? 34.033  26.624  99.069  1.00 60.47  ? 741  GLU A CD  1 
ATOM 5781  O OE1 . GLU A 1 744  ? 33.924  27.441  100.014 1.00 61.22  ? 741  GLU A OE1 1 
ATOM 5782  O OE2 . GLU A 1 744  ? 35.079  26.523  98.394  1.00 61.59  ? 741  GLU A OE2 1 
ATOM 5783  N N   . VAL A 1 745  ? 29.971  24.100  101.672 1.00 61.66  ? 742  VAL A N   1 
ATOM 5784  C CA  . VAL A 1 745  ? 29.136  23.927  102.855 1.00 62.81  ? 742  VAL A CA  1 
ATOM 5785  C C   . VAL A 1 745  ? 29.737  24.590  104.086 1.00 63.64  ? 742  VAL A C   1 
ATOM 5786  O O   . VAL A 1 745  ? 30.956  24.551  104.285 1.00 63.52  ? 742  VAL A O   1 
ATOM 5787  C CB  . VAL A 1 745  ? 28.855  22.429  103.152 1.00 62.86  ? 742  VAL A CB  1 
ATOM 5788  C CG1 . VAL A 1 745  ? 27.876  21.854  102.130 1.00 62.74  ? 742  VAL A CG1 1 
ATOM 5789  C CG2 . VAL A 1 745  ? 30.156  21.614  103.200 1.00 62.87  ? 742  VAL A CG2 1 
ATOM 5790  N N   . GLN A 1 746  ? 28.871  25.208  104.891 1.00 64.85  ? 743  GLN A N   1 
ATOM 5791  C CA  . GLN A 1 746  ? 29.244  25.712  106.214 1.00 66.13  ? 743  GLN A CA  1 
ATOM 5792  C C   . GLN A 1 746  ? 29.940  24.603  107.007 1.00 67.15  ? 743  GLN A C   1 
ATOM 5793  O O   . GLN A 1 746  ? 29.494  23.447  106.999 1.00 67.31  ? 743  GLN A O   1 
ATOM 5794  C CB  . GLN A 1 746  ? 28.015  26.213  106.984 1.00 65.96  ? 743  GLN A CB  1 
ATOM 5795  C CG  . GLN A 1 746  ? 26.919  25.157  107.201 1.00 65.85  ? 743  GLN A CG  1 
ATOM 5796  C CD  . GLN A 1 746  ? 26.214  25.280  108.548 1.00 65.62  ? 743  GLN A CD  1 
ATOM 5797  O OE1 . GLN A 1 746  ? 24.987  25.321  108.609 1.00 65.18  ? 743  GLN A OE1 1 
ATOM 5798  N NE2 . GLN A 1 746  ? 26.990  25.323  109.634 1.00 65.10  ? 743  GLN A NE2 1 
ATOM 5799  N N   . ASP A 1 747  ? 31.044  24.950  107.663 1.00 68.34  ? 744  ASP A N   1 
ATOM 5800  C CA  . ASP A 1 747  ? 31.772  23.975  108.475 1.00 69.49  ? 744  ASP A CA  1 
ATOM 5801  C C   . ASP A 1 747  ? 31.812  24.367  109.950 1.00 70.08  ? 744  ASP A C   1 
ATOM 5802  O O   . ASP A 1 747  ? 31.435  25.488  110.311 1.00 70.24  ? 744  ASP A O   1 
ATOM 5803  C CB  . ASP A 1 747  ? 33.178  23.692  107.912 1.00 69.62  ? 744  ASP A CB  1 
ATOM 5804  C CG  . ASP A 1 747  ? 34.061  24.933  107.848 1.00 70.16  ? 744  ASP A CG  1 
ATOM 5805  O OD1 . ASP A 1 747  ? 34.730  25.112  106.808 1.00 70.56  ? 744  ASP A OD1 1 
ATOM 5806  O OD2 . ASP A 1 747  ? 34.099  25.724  108.819 1.00 70.71  ? 744  ASP A OD2 1 
ATOM 5807  N N   . THR A 1 748  ? 32.284  23.438  110.781 1.00 70.76  ? 745  THR A N   1 
ATOM 5808  C CA  . THR A 1 748  ? 32.189  23.547  112.240 1.00 71.47  ? 745  THR A CA  1 
ATOM 5809  C C   . THR A 1 748  ? 32.933  24.742  112.852 1.00 71.78  ? 745  THR A C   1 
ATOM 5810  O O   . THR A 1 748  ? 32.455  25.333  113.828 1.00 71.84  ? 745  THR A O   1 
ATOM 5811  C CB  . THR A 1 748  ? 32.636  22.235  112.933 1.00 71.55  ? 745  THR A CB  1 
ATOM 5812  O OG1 . THR A 1 748  ? 33.992  21.937  112.571 1.00 71.96  ? 745  THR A OG1 1 
ATOM 5813  C CG2 . THR A 1 748  ? 31.725  21.068  112.525 1.00 71.45  ? 745  THR A CG2 1 
ATOM 5814  N N   . SER A 1 749  ? 34.085  25.096  112.276 1.00 72.10  ? 746  SER A N   1 
ATOM 5815  C CA  . SER A 1 749  ? 34.876  26.243  112.743 1.00 72.34  ? 746  SER A CA  1 
ATOM 5816  C C   . SER A 1 749  ? 34.142  27.569  112.515 1.00 72.43  ? 746  SER A C   1 
ATOM 5817  O O   . SER A 1 749  ? 33.949  28.352  113.452 1.00 72.40  ? 746  SER A O   1 
ATOM 5818  C CB  . SER A 1 749  ? 36.249  26.271  112.058 1.00 72.37  ? 746  SER A CB  1 
ATOM 5819  O OG  . SER A 1 749  ? 36.135  26.636  110.688 1.00 72.54  ? 746  SER A OG  1 
ATOM 5820  N N   . GLY A 1 750  ? 33.735  27.806  111.270 1.00 72.46  ? 747  GLY A N   1 
ATOM 5821  C CA  . GLY A 1 750  ? 33.040  29.026  110.908 1.00 72.62  ? 747  GLY A CA  1 
ATOM 5822  C C   . GLY A 1 750  ? 33.185  29.379  109.444 1.00 72.82  ? 747  GLY A C   1 
ATOM 5823  O O   . GLY A 1 750  ? 32.626  30.382  108.998 1.00 73.03  ? 747  GLY A O   1 
ATOM 5824  N N   . GLY A 1 751  ? 33.924  28.560  108.694 1.00 72.92  ? 748  GLY A N   1 
ATOM 5825  C CA  . GLY A 1 751  ? 34.140  28.789  107.252 1.00 72.88  ? 748  GLY A CA  1 
ATOM 5826  C C   . GLY A 1 751  ? 33.430  27.818  106.317 1.00 72.73  ? 748  GLY A C   1 
ATOM 5827  O O   . GLY A 1 751  ? 32.445  27.177  106.699 1.00 72.62  ? 748  GLY A O   1 
ATOM 5828  N N   . THR A 1 752  ? 33.928  27.721  105.084 1.00 72.73  ? 749  THR A N   1 
ATOM 5829  C CA  . THR A 1 752  ? 33.442  26.731  104.097 1.00 72.71  ? 749  THR A CA  1 
ATOM 5830  C C   . THR A 1 752  ? 34.605  25.941  103.457 1.00 72.58  ? 749  THR A C   1 
ATOM 5831  O O   . THR A 1 752  ? 35.749  26.402  103.467 1.00 72.44  ? 749  THR A O   1 
ATOM 5832  C CB  . THR A 1 752  ? 32.499  27.356  103.013 1.00 72.68  ? 749  THR A CB  1 
ATOM 5833  O OG1 . THR A 1 752  ? 33.093  28.533  102.445 1.00 72.69  ? 749  THR A OG1 1 
ATOM 5834  C CG2 . THR A 1 752  ? 31.147  27.717  103.613 1.00 72.49  ? 749  THR A CG2 1 
ATOM 5835  N N   . THR A 1 753  ? 34.234  24.825  102.896 1.00 72.48  ? 750  THR A N   1 
ATOM 5836  C CA  . THR A 1 753  ? 35.153  23.895  102.397 1.00 72.50  ? 750  THR A CA  1 
ATOM 5837  C C   . THR A 1 753  ? 34.644  23.637  101.026 1.00 72.29  ? 750  THR A C   1 
ATOM 5838  O O   . THR A 1 753  ? 34.112  24.523  100.370 1.00 72.47  ? 750  THR A O   1 
ATOM 5839  C CB  . THR A 1 753  ? 34.938  22.666  103.135 1.00 72.52  ? 750  THR A CB  1 
ATOM 5840  O OG1 . THR A 1 753  ? 33.752  22.078  102.623 1.00 72.85  ? 750  THR A OG1 1 
ATOM 5841  C CG2 . THR A 1 753  ? 34.682  23.017  104.564 1.00 72.63  ? 750  THR A CG2 1 
ATOM 5842  N N   . ALA A 1 754  ? 34.791  22.400  100.600 1.00 71.80  ? 751  ALA A N   1 
ATOM 5843  C CA  . ALA A 1 754  ? 34.444  22.037  99.263  1.00 71.41  ? 751  ALA A CA  1 
ATOM 5844  C C   . ALA A 1 754  ? 33.927  20.629  99.310  1.00 71.06  ? 751  ALA A C   1 
ATOM 5845  O O   . ALA A 1 754  ? 34.240  19.903  100.218 1.00 70.97  ? 751  ALA A O   1 
ATOM 5846  C CB  . ALA A 1 754  ? 35.653  22.116  98.417  1.00 71.41  ? 751  ALA A CB  1 
ATOM 5847  N N   . LEU A 1 755  ? 33.140  20.230  98.326  1.00 70.59  ? 752  LEU A N   1 
ATOM 5848  C CA  . LEU A 1 755  ? 32.543  18.898  98.358  1.00 70.02  ? 752  LEU A CA  1 
ATOM 5849  C C   . LEU A 1 755  ? 33.305  17.902  97.486  1.00 69.58  ? 752  LEU A C   1 
ATOM 5850  O O   . LEU A 1 755  ? 33.210  16.683  97.690  1.00 69.46  ? 752  LEU A O   1 
ATOM 5851  C CB  . LEU A 1 755  ? 31.082  19.004  97.904  1.00 70.06  ? 752  LEU A CB  1 
ATOM 5852  C CG  . LEU A 1 755  ? 30.365  20.287  98.359  1.00 69.77  ? 752  LEU A CG  1 
ATOM 5853  C CD1 . LEU A 1 755  ? 29.127  20.574  97.538  1.00 69.37  ? 752  LEU A CD1 1 
ATOM 5854  C CD2 . LEU A 1 755  ? 30.023  20.231  99.844  1.00 70.22  ? 752  LEU A CD2 1 
ATOM 5855  N N   . ARG A 1 756  ? 34.051  18.442  96.519  1.00 68.86  ? 753  ARG A N   1 
ATOM 5856  C CA  . ARG A 1 756  ? 34.839  17.666  95.564  1.00 68.14  ? 753  ARG A CA  1 
ATOM 5857  C C   . ARG A 1 756  ? 35.895  18.541  94.894  1.00 67.75  ? 753  ARG A C   1 
ATOM 5858  O O   . ARG A 1 756  ? 35.784  19.767  94.915  1.00 67.65  ? 753  ARG A O   1 
ATOM 5859  C CB  . ARG A 1 756  ? 33.935  17.045  94.493  1.00 68.25  ? 753  ARG A CB  1 
ATOM 5860  C CG  . ARG A 1 756  ? 33.258  18.044  93.547  1.00 68.22  ? 753  ARG A CG  1 
ATOM 5861  C CD  . ARG A 1 756  ? 32.345  17.332  92.562  1.00 67.98  ? 753  ARG A CD  1 
ATOM 5862  N NE  . ARG A 1 756  ? 31.430  16.412  93.238  1.00 67.13  ? 753  ARG A NE  1 
ATOM 5863  C CZ  . ARG A 1 756  ? 30.240  16.753  93.729  1.00 66.60  ? 753  ARG A CZ  1 
ATOM 5864  N NH1 . ARG A 1 756  ? 29.794  18.003  93.622  1.00 65.51  ? 753  ARG A NH1 1 
ATOM 5865  N NH2 . ARG A 1 756  ? 29.491  15.835  94.326  1.00 66.46  ? 753  ARG A NH2 1 
ATOM 5866  N N   . PRO A 1 757  ? 36.931  17.916  94.306  1.00 67.45  ? 754  PRO A N   1 
ATOM 5867  C CA  . PRO A 1 757  ? 37.885  18.640  93.478  1.00 67.28  ? 754  PRO A CA  1 
ATOM 5868  C C   . PRO A 1 757  ? 37.201  19.213  92.246  1.00 67.11  ? 754  PRO A C   1 
ATOM 5869  O O   . PRO A 1 757  ? 36.698  18.459  91.420  1.00 67.33  ? 754  PRO A O   1 
ATOM 5870  C CB  . PRO A 1 757  ? 38.880  17.552  93.062  1.00 67.30  ? 754  PRO A CB  1 
ATOM 5871  C CG  . PRO A 1 757  ? 38.144  16.273  93.218  1.00 67.35  ? 754  PRO A CG  1 
ATOM 5872  C CD  . PRO A 1 757  ? 37.283  16.489  94.412  1.00 67.51  ? 754  PRO A CD  1 
ATOM 5873  N N   . SER A 1 758  ? 37.166  20.539  92.144  1.00 66.87  ? 755  SER A N   1 
ATOM 5874  C CA  . SER A 1 758  ? 36.522  21.228  91.027  1.00 66.35  ? 755  SER A CA  1 
ATOM 5875  C C   . SER A 1 758  ? 37.586  21.741  90.074  1.00 66.09  ? 755  SER A C   1 
ATOM 5876  O O   . SER A 1 758  ? 38.725  21.280  90.112  1.00 66.01  ? 755  SER A O   1 
ATOM 5877  C CB  . SER A 1 758  ? 35.681  22.396  91.540  1.00 66.32  ? 755  SER A CB  1 
ATOM 5878  O OG  . SER A 1 758  ? 34.960  22.047  92.706  1.00 66.40  ? 755  SER A OG  1 
ATOM 5879  N N   . ALA A 1 759  ? 37.214  22.690  89.223  1.00 65.91  ? 756  ALA A N   1 
ATOM 5880  C CA  . ALA A 1 759  ? 38.146  23.295  88.276  1.00 65.76  ? 756  ALA A CA  1 
ATOM 5881  C C   . ALA A 1 759  ? 39.000  24.374  88.922  1.00 65.76  ? 756  ALA A C   1 
ATOM 5882  O O   . ALA A 1 759  ? 40.168  24.524  88.575  1.00 65.82  ? 756  ALA A O   1 
ATOM 5883  C CB  . ALA A 1 759  ? 37.406  23.863  87.078  1.00 65.71  ? 756  ALA A CB  1 
ATOM 5884  N N   . SER A 1 760  ? 38.419  25.126  89.854  1.00 65.82  ? 757  SER A N   1 
ATOM 5885  C CA  . SER A 1 760  ? 39.124  26.236  90.510  1.00 65.95  ? 757  SER A CA  1 
ATOM 5886  C C   . SER A 1 760  ? 40.062  25.793  91.637  1.00 65.92  ? 757  SER A C   1 
ATOM 5887  O O   . SER A 1 760  ? 41.056  26.462  91.944  1.00 65.65  ? 757  SER A O   1 
ATOM 5888  C CB  . SER A 1 760  ? 38.127  27.276  91.029  1.00 66.02  ? 757  SER A CB  1 
ATOM 5889  O OG  . SER A 1 760  ? 36.976  26.665  91.585  1.00 65.92  ? 757  SER A OG  1 
ATOM 5890  N N   . THR A 1 761  ? 39.734  24.657  92.241  1.00 66.00  ? 758  THR A N   1 
ATOM 5891  C CA  . THR A 1 761  ? 40.520  24.112  93.334  1.00 66.10  ? 758  THR A CA  1 
ATOM 5892  C C   . THR A 1 761  ? 41.796  23.468  92.797  1.00 66.11  ? 758  THR A C   1 
ATOM 5893  O O   . THR A 1 761  ? 42.892  23.894  93.146  1.00 66.05  ? 758  THR A O   1 
ATOM 5894  C CB  . THR A 1 761  ? 39.697  23.115  94.194  1.00 66.17  ? 758  THR A CB  1 
ATOM 5895  O OG1 . THR A 1 761  ? 39.824  21.785  93.674  1.00 66.33  ? 758  THR A OG1 1 
ATOM 5896  C CG2 . THR A 1 761  ? 38.219  23.518  94.229  1.00 66.11  ? 758  THR A CG2 1 
ATOM 5897  N N   . GLN A 1 762  ? 41.647  22.465  91.929  1.00 66.27  ? 759  GLN A N   1 
ATOM 5898  C CA  . GLN A 1 762  ? 42.792  21.775  91.318  1.00 66.41  ? 759  GLN A CA  1 
ATOM 5899  C C   . GLN A 1 762  ? 43.336  22.537  90.105  1.00 66.41  ? 759  GLN A C   1 
ATOM 5900  O O   . GLN A 1 762  ? 43.852  21.934  89.164  1.00 66.34  ? 759  GLN A O   1 
ATOM 5901  C CB  . GLN A 1 762  ? 42.435  20.331  90.922  1.00 66.36  ? 759  GLN A CB  1 
ATOM 5902  C CG  . GLN A 1 762  ? 41.594  19.543  91.929  1.00 67.06  ? 759  GLN A CG  1 
ATOM 5903  C CD  . GLN A 1 762  ? 42.303  19.257  93.258  1.00 68.20  ? 759  GLN A CD  1 
ATOM 5904  O OE1 . GLN A 1 762  ? 42.418  20.134  94.119  1.00 68.67  ? 759  GLN A OE1 1 
ATOM 5905  N NE2 . GLN A 1 762  ? 42.745  18.012  93.440  1.00 68.32  ? 759  GLN A NE2 1 
ATOM 5906  N N   . ALA A 1 763  ? 43.213  23.864  90.143  1.00 66.55  ? 760  ALA A N   1 
ATOM 5907  C CA  . ALA A 1 763  ? 43.733  24.746  89.102  1.00 66.67  ? 760  ALA A CA  1 
ATOM 5908  C C   . ALA A 1 763  ? 45.245  24.858  89.216  1.00 66.85  ? 760  ALA A C   1 
ATOM 5909  O O   . ALA A 1 763  ? 45.785  24.842  90.325  1.00 66.92  ? 760  ALA A O   1 
ATOM 5910  C CB  . ALA A 1 763  ? 43.103  26.108  89.227  1.00 66.69  ? 760  ALA A CB  1 
ATOM 5911  N N   . LEU A 1 764  ? 45.924  24.988  88.077  1.00 67.07  ? 761  LEU A N   1 
ATOM 5912  C CA  . LEU A 1 764  ? 47.397  24.968  88.045  1.00 67.41  ? 761  LEU A CA  1 
ATOM 5913  C C   . LEU A 1 764  ? 48.057  26.117  88.819  1.00 67.60  ? 761  LEU A C   1 
ATOM 5914  O O   . LEU A 1 764  ? 49.180  25.979  89.306  1.00 67.75  ? 761  LEU A O   1 
ATOM 5915  C CB  . LEU A 1 764  ? 47.933  24.907  86.603  1.00 67.35  ? 761  LEU A CB  1 
ATOM 5916  C CG  . LEU A 1 764  ? 47.613  23.697  85.701  1.00 67.53  ? 761  LEU A CG  1 
ATOM 5917  C CD1 . LEU A 1 764  ? 48.099  23.958  84.282  1.00 67.55  ? 761  LEU A CD1 1 
ATOM 5918  C CD2 . LEU A 1 764  ? 48.180  22.371  86.216  1.00 67.25  ? 761  LEU A CD2 1 
ATOM 5919  N N   . SER A 1 765  ? 47.350  27.238  88.930  1.00 67.89  ? 762  SER A N   1 
ATOM 5920  C CA  . SER A 1 765  ? 47.813  28.404  89.681  1.00 68.19  ? 762  SER A CA  1 
ATOM 5921  C C   . SER A 1 765  ? 46.632  29.328  89.972  1.00 68.63  ? 762  SER A C   1 
ATOM 5922  O O   . SER A 1 765  ? 45.768  29.528  89.106  1.00 68.72  ? 762  SER A O   1 
ATOM 5923  C CB  . SER A 1 765  ? 48.909  29.148  88.915  1.00 68.19  ? 762  SER A CB  1 
ATOM 5924  O OG  . SER A 1 765  ? 48.713  29.063  87.514  1.00 67.82  ? 762  SER A OG  1 
ATOM 5925  N N   . SER A 1 766  ? 46.599  29.889  91.187  1.00 68.88  ? 763  SER A N   1 
ATOM 5926  C CA  . SER A 1 766  ? 45.418  30.619  91.681  1.00 68.90  ? 763  SER A CA  1 
ATOM 5927  C C   . SER A 1 766  ? 45.729  31.924  92.408  1.00 68.84  ? 763  SER A C   1 
ATOM 5928  O O   . SER A 1 766  ? 46.879  32.216  92.733  1.00 68.78  ? 763  SER A O   1 
ATOM 5929  C CB  . SER A 1 766  ? 44.593  29.728  92.611  1.00 68.83  ? 763  SER A CB  1 
ATOM 5930  O OG  . SER A 1 766  ? 45.002  29.912  93.957  1.00 68.97  ? 763  SER A OG  1 
ATOM 5931  N N   . SER A 1 767  ? 44.668  32.684  92.670  1.00 68.93  ? 764  SER A N   1 
ATOM 5932  C CA  . SER A 1 767  ? 44.731  33.939  93.409  1.00 69.03  ? 764  SER A CA  1 
ATOM 5933  C C   . SER A 1 767  ? 43.334  34.320  93.879  1.00 69.24  ? 764  SER A C   1 
ATOM 5934  O O   . SER A 1 767  ? 42.350  34.013  93.217  1.00 69.23  ? 764  SER A O   1 
ATOM 5935  C CB  . SER A 1 767  ? 45.324  35.057  92.543  1.00 68.97  ? 764  SER A CB  1 
ATOM 5936  O OG  . SER A 1 767  ? 44.644  35.181  91.307  1.00 68.62  ? 764  SER A OG  1 
ATOM 5937  N N   . VAL A 1 768  ? 43.252  34.977  95.030  1.00 69.61  ? 765  VAL A N   1 
ATOM 5938  C CA  . VAL A 1 768  ? 41.977  35.451  95.558  1.00 70.11  ? 765  VAL A CA  1 
ATOM 5939  C C   . VAL A 1 768  ? 41.914  36.983  95.512  1.00 70.41  ? 765  VAL A C   1 
ATOM 5940  O O   . VAL A 1 768  ? 42.855  37.637  95.058  1.00 70.28  ? 765  VAL A O   1 
ATOM 5941  C CB  . VAL A 1 768  ? 41.705  34.895  96.986  1.00 70.09  ? 765  VAL A CB  1 
ATOM 5942  C CG1 . VAL A 1 768  ? 42.526  35.638  98.038  1.00 70.47  ? 765  VAL A CG1 1 
ATOM 5943  C CG2 . VAL A 1 768  ? 40.214  34.949  97.323  1.00 70.45  ? 765  VAL A CG2 1 
ATOM 5944  N N   . SER A 1 769  ? 40.795  37.544  95.962  1.00 70.99  ? 766  SER A N   1 
ATOM 5945  C CA  . SER A 1 769  ? 40.617  38.981  95.980  1.00 71.70  ? 766  SER A CA  1 
ATOM 5946  C C   . SER A 1 769  ? 41.035  39.557  97.318  1.00 72.37  ? 766  SER A C   1 
ATOM 5947  O O   . SER A 1 769  ? 40.938  38.886  98.350  1.00 72.37  ? 766  SER A O   1 
ATOM 5948  C CB  . SER A 1 769  ? 39.173  39.346  95.662  1.00 71.56  ? 766  SER A CB  1 
ATOM 5949  O OG  . SER A 1 769  ? 38.916  39.174  94.280  1.00 71.61  ? 766  SER A OG  1 
ATOM 5950  N N   . SER A 1 770  ? 41.502  40.804  97.279  1.00 73.29  ? 767  SER A N   1 
ATOM 5951  C CA  . SER A 1 770  ? 42.014  41.499  98.458  1.00 74.07  ? 767  SER A CA  1 
ATOM 5952  C C   . SER A 1 770  ? 41.270  42.801  98.780  1.00 74.74  ? 767  SER A C   1 
ATOM 5953  O O   . SER A 1 770  ? 41.541  43.424  99.804  1.00 74.97  ? 767  SER A O   1 
ATOM 5954  C CB  . SER A 1 770  ? 43.518  41.765  98.307  1.00 73.90  ? 767  SER A CB  1 
ATOM 5955  O OG  . SER A 1 770  ? 43.765  42.866  97.453  1.00 73.87  ? 767  SER A OG  1 
ATOM 5956  N N   . SER A 1 771  ? 40.336  43.201  97.916  1.00 75.66  ? 768  SER A N   1 
ATOM 5957  C CA  . SER A 1 771  ? 39.567  44.445  98.093  1.00 76.79  ? 768  SER A CA  1 
ATOM 5958  C C   . SER A 1 771  ? 38.922  44.604  99.474  1.00 77.51  ? 768  SER A C   1 
ATOM 5959  O O   . SER A 1 771  ? 38.447  43.631  100.065 1.00 77.64  ? 768  SER A O   1 
ATOM 5960  C CB  . SER A 1 771  ? 38.486  44.569  97.017  1.00 76.85  ? 768  SER A CB  1 
ATOM 5961  O OG  . SER A 1 771  ? 37.596  45.637  97.314  1.00 77.06  ? 768  SER A OG  1 
ATOM 5962  N N   . LYS A 1 772  ? 38.890  45.842  99.961  1.00 78.40  ? 769  LYS A N   1 
ATOM 5963  C CA  . LYS A 1 772  ? 38.417  46.143  101.316 1.00 79.37  ? 769  LYS A CA  1 
ATOM 5964  C C   . LYS A 1 772  ? 37.248  47.140  101.311 1.00 79.97  ? 769  LYS A C   1 
ATOM 5965  O O   . LYS A 1 772  ? 37.001  47.839  102.308 1.00 79.93  ? 769  LYS A O   1 
ATOM 5966  C CB  . LYS A 1 772  ? 39.581  46.691  102.157 1.00 79.46  ? 769  LYS A CB  1 
ATOM 5967  C CG  . LYS A 1 772  ? 40.550  45.640  102.705 1.00 79.74  ? 769  LYS A CG  1 
ATOM 5968  C CD  . LYS A 1 772  ? 40.171  45.244  104.127 1.00 80.47  ? 769  LYS A CD  1 
ATOM 5969  C CE  . LYS A 1 772  ? 41.235  44.384  104.782 1.00 80.37  ? 769  LYS A CE  1 
ATOM 5970  N NZ  . LYS A 1 772  ? 40.889  44.129  106.203 1.00 80.16  ? 769  LYS A NZ  1 
ATOM 5971  N N   . LEU A 1 773  ? 36.520  47.173  100.192 1.00 80.70  ? 770  LEU A N   1 
ATOM 5972  C CA  . LEU A 1 773  ? 35.539  48.232  99.902  1.00 81.29  ? 770  LEU A CA  1 
ATOM 5973  C C   . LEU A 1 773  ? 34.179  48.129  100.615 1.00 81.81  ? 770  LEU A C   1 
ATOM 5974  O O   . LEU A 1 773  ? 33.366  49.055  100.529 1.00 81.99  ? 770  LEU A O   1 
ATOM 5975  C CB  . LEU A 1 773  ? 35.322  48.353  98.382  1.00 81.16  ? 770  LEU A CB  1 
ATOM 5976  C CG  . LEU A 1 773  ? 36.514  48.691  97.476  1.00 80.79  ? 770  LEU A CG  1 
ATOM 5977  C CD1 . LEU A 1 773  ? 36.090  48.645  96.018  1.00 79.89  ? 770  LEU A CD1 1 
ATOM 5978  C CD2 . LEU A 1 773  ? 37.131  50.048  97.825  1.00 80.68  ? 770  LEU A CD2 1 
ATOM 5979  N N   . PHE A 1 774  ? 33.940  47.028  101.327 1.00 82.38  ? 771  PHE A N   1 
ATOM 5980  C CA  . PHE A 1 774  ? 32.615  46.748  101.893 1.00 82.94  ? 771  PHE A CA  1 
ATOM 5981  C C   . PHE A 1 774  ? 32.624  46.544  103.419 1.00 83.43  ? 771  PHE A C   1 
ATOM 5982  O O   . PHE A 1 774  ? 33.604  46.034  103.971 1.00 83.54  ? 771  PHE A O   1 
ATOM 5983  C CB  . PHE A 1 774  ? 31.997  45.539  101.174 1.00 82.76  ? 771  PHE A CB  1 
ATOM 5984  C CG  . PHE A 1 774  ? 31.852  45.725  99.676  1.00 82.67  ? 771  PHE A CG  1 
ATOM 5985  C CD1 . PHE A 1 774  ? 32.899  45.413  98.812  1.00 82.60  ? 771  PHE A CD1 1 
ATOM 5986  C CD2 . PHE A 1 774  ? 30.667  46.212  99.131  1.00 82.52  ? 771  PHE A CD2 1 
ATOM 5987  C CE1 . PHE A 1 774  ? 32.768  45.584  97.426  1.00 82.32  ? 771  PHE A CE1 1 
ATOM 5988  C CE2 . PHE A 1 774  ? 30.530  46.386  97.748  1.00 82.34  ? 771  PHE A CE2 1 
ATOM 5989  C CZ  . PHE A 1 774  ? 31.584  46.069  96.897  1.00 82.15  ? 771  PHE A CZ  1 
ATOM 5990  N N   . SER A 1 775  ? 31.539  46.958  104.087 1.00 84.05  ? 772  SER A N   1 
ATOM 5991  C CA  . SER A 1 775  ? 31.378  46.811  105.560 1.00 84.56  ? 772  SER A CA  1 
ATOM 5992  C C   . SER A 1 775  ? 29.915  46.794  106.059 1.00 84.96  ? 772  SER A C   1 
ATOM 5993  O O   . SER A 1 775  ? 29.299  45.722  106.130 1.00 85.22  ? 772  SER A O   1 
ATOM 5994  C CB  . SER A 1 775  ? 32.190  47.866  106.333 1.00 84.42  ? 772  SER A CB  1 
ATOM 5995  O OG  . SER A 1 775  ? 33.544  47.472  106.472 1.00 84.17  ? 772  SER A OG  1 
ATOM 5996  N N   . SER A 1 776  ? 29.378  47.975  106.396 1.00 85.21  ? 773  SER A N   1 
ATOM 5997  C CA  . SER A 1 776  ? 28.031  48.145  106.997 1.00 85.33  ? 773  SER A CA  1 
ATOM 5998  C C   . SER A 1 776  ? 27.835  47.350  108.306 1.00 85.31  ? 773  SER A C   1 
ATOM 5999  O O   . SER A 1 776  ? 26.759  46.765  108.556 1.00 85.27  ? 773  SER A O   1 
ATOM 6000  C CB  . SER A 1 776  ? 26.877  47.930  105.977 1.00 85.39  ? 773  SER A CB  1 
ATOM 6001  O OG  . SER A 1 776  ? 26.917  46.664  105.330 1.00 85.23  ? 773  SER A OG  1 
ATOM 6002  N N   . GLY A 1 786  ? 23.269  23.385  107.924 1.00 62.29  ? 783  GLY A N   1 
ATOM 6003  C CA  . GLY A 1 786  ? 22.461  23.508  106.714 1.00 62.46  ? 783  GLY A CA  1 
ATOM 6004  C C   . GLY A 1 786  ? 22.575  24.865  106.032 1.00 62.51  ? 783  GLY A C   1 
ATOM 6005  O O   . GLY A 1 786  ? 21.573  25.582  105.893 1.00 62.54  ? 783  GLY A O   1 
ATOM 6006  N N   . GLU A 1 787  ? 23.796  25.212  105.607 1.00 62.35  ? 784  GLU A N   1 
ATOM 6007  C CA  . GLU A 1 787  ? 24.073  26.485  104.914 1.00 62.04  ? 784  GLU A CA  1 
ATOM 6008  C C   . GLU A 1 787  ? 25.000  26.296  103.693 1.00 61.43  ? 784  GLU A C   1 
ATOM 6009  O O   . GLU A 1 787  ? 26.173  25.930  103.841 1.00 61.44  ? 784  GLU A O   1 
ATOM 6010  C CB  . GLU A 1 787  ? 24.677  27.527  105.886 1.00 62.18  ? 784  GLU A CB  1 
ATOM 6011  C CG  . GLU A 1 787  ? 23.785  27.974  107.066 1.00 62.34  ? 784  GLU A CG  1 
ATOM 6012  C CD  . GLU A 1 787  ? 24.570  28.639  108.212 1.00 62.48  ? 784  GLU A CD  1 
ATOM 6013  O OE1 . GLU A 1 787  ? 24.278  28.328  109.390 1.00 63.49  ? 784  GLU A OE1 1 
ATOM 6014  O OE2 . GLU A 1 787  ? 25.474  29.469  107.949 1.00 62.37  ? 784  GLU A OE2 1 
ATOM 6015  N N   . GLU A 1 788  ? 24.467  26.547  102.497 1.00 60.68  ? 785  GLU A N   1 
ATOM 6016  C CA  . GLU A 1 788  ? 25.242  26.474  101.245 1.00 60.00  ? 785  GLU A CA  1 
ATOM 6017  C C   . GLU A 1 788  ? 25.600  27.862  100.729 1.00 59.12  ? 785  GLU A C   1 
ATOM 6018  O O   . GLU A 1 788  ? 24.754  28.753  100.718 1.00 59.11  ? 785  GLU A O   1 
ATOM 6019  C CB  . GLU A 1 788  ? 24.439  25.773  100.148 1.00 59.98  ? 785  GLU A CB  1 
ATOM 6020  C CG  . GLU A 1 788  ? 24.300  24.268  100.277 1.00 60.44  ? 785  GLU A CG  1 
ATOM 6021  C CD  . GLU A 1 788  ? 23.192  23.718  99.382  1.00 60.68  ? 785  GLU A CD  1 
ATOM 6022  O OE1 . GLU A 1 788  ? 22.365  22.917  99.882  1.00 62.22  ? 785  GLU A OE1 1 
ATOM 6023  O OE2 . GLU A 1 788  ? 23.135  24.098  98.188  1.00 60.74  ? 785  GLU A OE2 1 
ATOM 6024  N N   . VAL A 1 789  ? 26.837  28.042  100.276 1.00 58.16  ? 786  VAL A N   1 
ATOM 6025  C CA  . VAL A 1 789  ? 27.237  29.305  99.653  1.00 57.36  ? 786  VAL A CA  1 
ATOM 6026  C C   . VAL A 1 789  ? 28.059  29.084  98.385  1.00 56.76  ? 786  VAL A C   1 
ATOM 6027  O O   . VAL A 1 789  ? 29.052  28.360  98.419  1.00 56.86  ? 786  VAL A O   1 
ATOM 6028  C CB  . VAL A 1 789  ? 27.976  30.254  100.652 1.00 57.46  ? 786  VAL A CB  1 
ATOM 6029  C CG1 . VAL A 1 789  ? 28.958  29.482  101.524 1.00 57.55  ? 786  VAL A CG1 1 
ATOM 6030  C CG2 . VAL A 1 789  ? 28.663  31.430  99.921  1.00 57.38  ? 786  VAL A CG2 1 
ATOM 6031  N N   . GLU A 1 790  ? 27.621  29.706  97.282  1.00 55.85  ? 787  GLU A N   1 
ATOM 6032  C CA  . GLU A 1 790  ? 28.336  29.711  96.000  1.00 55.00  ? 787  GLU A CA  1 
ATOM 6033  C C   . GLU A 1 790  ? 29.645  30.499  96.071  1.00 54.53  ? 787  GLU A C   1 
ATOM 6034  O O   . GLU A 1 790  ? 29.688  31.608  96.609  1.00 54.60  ? 787  GLU A O   1 
ATOM 6035  C CB  . GLU A 1 790  ? 27.466  30.318  94.895  1.00 54.98  ? 787  GLU A CB  1 
ATOM 6036  C CG  . GLU A 1 790  ? 26.142  29.600  94.616  1.00 55.32  ? 787  GLU A CG  1 
ATOM 6037  C CD  . GLU A 1 790  ? 25.657  29.759  93.164  1.00 55.24  ? 787  GLU A CD  1 
ATOM 6038  O OE1 . GLU A 1 790  ? 25.335  28.718  92.539  1.00 55.04  ? 787  GLU A OE1 1 
ATOM 6039  O OE2 . GLU A 1 790  ? 25.604  30.908  92.652  1.00 54.90  ? 787  GLU A OE2 1 
ATOM 6040  N N   . VAL A 1 791  ? 30.712  29.920  95.529  1.00 53.89  ? 788  VAL A N   1 
ATOM 6041  C CA  . VAL A 1 791  ? 31.999  30.602  95.423  1.00 53.42  ? 788  VAL A CA  1 
ATOM 6042  C C   . VAL A 1 791  ? 32.281  30.806  93.944  1.00 53.38  ? 788  VAL A C   1 
ATOM 6043  O O   . VAL A 1 791  ? 32.120  29.879  93.147  1.00 53.67  ? 788  VAL A O   1 
ATOM 6044  C CB  . VAL A 1 791  ? 33.138  29.778  96.034  1.00 53.26  ? 788  VAL A CB  1 
ATOM 6045  C CG1 . VAL A 1 791  ? 34.394  30.617  96.148  1.00 53.10  ? 788  VAL A CG1 1 
ATOM 6046  C CG2 . VAL A 1 791  ? 32.742  29.250  97.395  1.00 53.42  ? 788  VAL A CG2 1 
ATOM 6047  N N   . HIS A 1 792  ? 32.692  32.012  93.566  1.00 53.00  ? 789  HIS A N   1 
ATOM 6048  C CA  . HIS A 1 792  ? 32.847  32.328  92.152  1.00 52.51  ? 789  HIS A CA  1 
ATOM 6049  C C   . HIS A 1 792  ? 34.280  32.487  91.718  1.00 52.45  ? 789  HIS A C   1 
ATOM 6050  O O   . HIS A 1 792  ? 35.163  32.709  92.541  1.00 52.49  ? 789  HIS A O   1 
ATOM 6051  C CB  . HIS A 1 792  ? 32.013  33.542  91.784  1.00 52.50  ? 789  HIS A CB  1 
ATOM 6052  C CG  . HIS A 1 792  ? 30.569  33.219  91.591  1.00 52.05  ? 789  HIS A CG  1 
ATOM 6053  N ND1 . HIS A 1 792  ? 29.935  33.349  90.377  1.00 51.42  ? 789  HIS A ND1 1 
ATOM 6054  C CD2 . HIS A 1 792  ? 29.646  32.728  92.451  1.00 51.63  ? 789  HIS A CD2 1 
ATOM 6055  C CE1 . HIS A 1 792  ? 28.676  32.973  90.503  1.00 51.85  ? 789  HIS A CE1 1 
ATOM 6056  N NE2 . HIS A 1 792  ? 28.474  32.592  91.751  1.00 51.58  ? 789  HIS A NE2 1 
ATOM 6057  N N   . ASN A 1 793  ? 34.502  32.365  90.414  1.00 52.42  ? 790  ASN A N   1 
ATOM 6058  C CA  . ASN A 1 793  ? 35.844  32.370  89.855  1.00 52.52  ? 790  ASN A CA  1 
ATOM 6059  C C   . ASN A 1 793  ? 35.908  32.826  88.420  1.00 52.32  ? 790  ASN A C   1 
ATOM 6060  O O   . ASN A 1 793  ? 35.033  32.496  87.624  1.00 52.37  ? 790  ASN A O   1 
ATOM 6061  C CB  . ASN A 1 793  ? 36.439  30.968  89.905  1.00 52.67  ? 790  ASN A CB  1 
ATOM 6062  C CG  . ASN A 1 793  ? 36.772  30.528  91.302  1.00 53.73  ? 790  ASN A CG  1 
ATOM 6063  O OD1 . ASN A 1 793  ? 37.790  30.937  91.876  1.00 53.88  ? 790  ASN A OD1 1 
ATOM 6064  N ND2 . ASN A 1 793  ? 35.918  29.669  91.864  1.00 54.58  ? 790  ASN A ND2 1 
ATOM 6065  N N   . LEU A 1 794  ? 36.953  33.586  88.103  1.00 52.17  ? 791  LEU A N   1 
ATOM 6066  C CA  . LEU A 1 794  ? 37.444  33.689  86.738  1.00 52.02  ? 791  LEU A CA  1 
ATOM 6067  C C   . LEU A 1 794  ? 38.446  32.553  86.537  1.00 52.04  ? 791  LEU A C   1 
ATOM 6068  O O   . LEU A 1 794  ? 39.206  32.224  87.442  1.00 52.04  ? 791  LEU A O   1 
ATOM 6069  C CB  . LEU A 1 794  ? 38.104  35.047  86.478  1.00 52.01  ? 791  LEU A CB  1 
ATOM 6070  C CG  . LEU A 1 794  ? 38.780  35.226  85.109  1.00 52.09  ? 791  LEU A CG  1 
ATOM 6071  C CD1 . LEU A 1 794  ? 37.788  34.955  83.962  1.00 52.10  ? 791  LEU A CD1 1 
ATOM 6072  C CD2 . LEU A 1 794  ? 39.459  36.597  84.962  1.00 51.67  ? 791  LEU A CD2 1 
ATOM 6073  N N   . LEU A 1 795  ? 38.419  31.934  85.366  1.00 52.15  ? 792  LEU A N   1 
ATOM 6074  C CA  . LEU A 1 795  ? 39.349  30.862  85.051  1.00 52.36  ? 792  LEU A CA  1 
ATOM 6075  C C   . LEU A 1 795  ? 40.077  31.231  83.778  1.00 52.94  ? 792  LEU A C   1 
ATOM 6076  O O   . LEU A 1 795  ? 39.447  31.670  82.815  1.00 53.33  ? 792  LEU A O   1 
ATOM 6077  C CB  . LEU A 1 795  ? 38.615  29.528  84.835  1.00 51.86  ? 792  LEU A CB  1 
ATOM 6078  C CG  . LEU A 1 795  ? 37.591  28.967  85.818  1.00 50.79  ? 792  LEU A CG  1 
ATOM 6079  C CD1 . LEU A 1 795  ? 37.402  27.513  85.522  1.00 50.32  ? 792  LEU A CD1 1 
ATOM 6080  C CD2 . LEU A 1 795  ? 38.005  29.116  87.255  1.00 50.55  ? 792  LEU A CD2 1 
ATOM 6081  N N   . ILE A 1 796  ? 41.393  31.054  83.756  1.00 53.31  ? 793  ILE A N   1 
ATOM 6082  C CA  . ILE A 1 796  ? 42.130  31.206  82.507  1.00 53.87  ? 793  ILE A CA  1 
ATOM 6083  C C   . ILE A 1 796  ? 42.428  29.832  81.905  1.00 54.08  ? 793  ILE A C   1 
ATOM 6084  O O   . ILE A 1 796  ? 43.002  28.973  82.565  1.00 53.98  ? 793  ILE A O   1 
ATOM 6085  C CB  . ILE A 1 796  ? 43.423  32.041  82.683  1.00 54.06  ? 793  ILE A CB  1 
ATOM 6086  C CG1 . ILE A 1 796  ? 43.204  33.210  83.657  1.00 53.80  ? 793  ILE A CG1 1 
ATOM 6087  C CG2 . ILE A 1 796  ? 43.948  32.523  81.314  1.00 54.35  ? 793  ILE A CG2 1 
ATOM 6088  C CD1 . ILE A 1 796  ? 42.345  34.343  83.116  1.00 53.87  ? 793  ILE A CD1 1 
ATOM 6089  N N   . ILE A 1 797  ? 42.023  29.635  80.654  1.00 54.73  ? 794  ILE A N   1 
ATOM 6090  C CA  . ILE A 1 797  ? 42.079  28.316  79.998  1.00 55.41  ? 794  ILE A CA  1 
ATOM 6091  C C   . ILE A 1 797  ? 42.856  28.341  78.682  1.00 55.83  ? 794  ILE A C   1 
ATOM 6092  O O   . ILE A 1 797  ? 42.463  29.011  77.728  1.00 55.64  ? 794  ILE A O   1 
ATOM 6093  C CB  . ILE A 1 797  ? 40.647  27.710  79.773  1.00 55.38  ? 794  ILE A CB  1 
ATOM 6094  C CG1 . ILE A 1 797  ? 40.035  27.286  81.105  1.00 55.33  ? 794  ILE A CG1 1 
ATOM 6095  C CG2 . ILE A 1 797  ? 40.674  26.515  78.819  1.00 54.72  ? 794  ILE A CG2 1 
ATOM 6096  C CD1 . ILE A 1 797  ? 38.541  27.138  81.051  1.00 55.93  ? 794  ILE A CD1 1 
ATOM 6097  N N   . ASP A 1 798  ? 43.957  27.597  78.652  1.00 56.49  ? 795  ASP A N   1 
ATOM 6098  C CA  . ASP A 1 798  ? 44.752  27.421  77.453  1.00 57.42  ? 795  ASP A CA  1 
ATOM 6099  C C   . ASP A 1 798  ? 43.834  26.930  76.339  1.00 57.94  ? 795  ASP A C   1 
ATOM 6100  O O   . ASP A 1 798  ? 42.997  26.053  76.556  1.00 58.21  ? 795  ASP A O   1 
ATOM 6101  C CB  . ASP A 1 798  ? 45.847  26.392  77.736  1.00 57.62  ? 795  ASP A CB  1 
ATOM 6102  C CG  . ASP A 1 798  ? 46.919  26.341  76.651  1.00 58.48  ? 795  ASP A CG  1 
ATOM 6103  O OD1 . ASP A 1 798  ? 46.656  25.791  75.560  1.00 58.81  ? 795  ASP A OD1 1 
ATOM 6104  O OD2 . ASP A 1 798  ? 48.046  26.821  76.906  1.00 59.51  ? 795  ASP A OD2 1 
ATOM 6105  N N   . GLN A 1 799  ? 43.966  27.511  75.152  1.00 58.46  ? 796  GLN A N   1 
ATOM 6106  C CA  . GLN A 1 799  ? 43.134  27.088  74.030  1.00 58.91  ? 796  GLN A CA  1 
ATOM 6107  C C   . GLN A 1 799  ? 43.627  25.785  73.371  1.00 59.38  ? 796  GLN A C   1 
ATOM 6108  O O   . GLN A 1 799  ? 42.841  25.043  72.792  1.00 59.54  ? 796  GLN A O   1 
ATOM 6109  C CB  . GLN A 1 799  ? 42.957  28.219  73.013  1.00 58.78  ? 796  GLN A CB  1 
ATOM 6110  C CG  . GLN A 1 799  ? 44.230  28.742  72.363  1.00 58.86  ? 796  GLN A CG  1 
ATOM 6111  C CD  . GLN A 1 799  ? 43.978  29.276  70.959  1.00 59.12  ? 796  GLN A CD  1 
ATOM 6112  O OE1 . GLN A 1 799  ? 43.842  28.508  70.000  1.00 59.15  ? 796  GLN A OE1 1 
ATOM 6113  N NE2 . GLN A 1 799  ? 43.912  30.596  70.833  1.00 58.62  ? 796  GLN A NE2 1 
ATOM 6114  N N   . HIS A 1 800  ? 44.924  25.507  73.481  1.00 59.94  ? 797  HIS A N   1 
ATOM 6115  C CA  . HIS A 1 800  ? 45.525  24.309  72.886  1.00 60.48  ? 797  HIS A CA  1 
ATOM 6116  C C   . HIS A 1 800  ? 45.397  23.067  73.766  1.00 60.61  ? 797  HIS A C   1 
ATOM 6117  O O   . HIS A 1 800  ? 45.215  21.957  73.261  1.00 60.54  ? 797  HIS A O   1 
ATOM 6118  C CB  . HIS A 1 800  ? 47.006  24.555  72.574  1.00 60.70  ? 797  HIS A CB  1 
ATOM 6119  C CG  . HIS A 1 800  ? 47.235  25.579  71.507  1.00 61.36  ? 797  HIS A CG  1 
ATOM 6120  N ND1 . HIS A 1 800  ? 47.256  25.263  70.165  1.00 61.61  ? 797  HIS A ND1 1 
ATOM 6121  C CD2 . HIS A 1 800  ? 47.447  26.914  71.583  1.00 62.03  ? 797  HIS A CD2 1 
ATOM 6122  C CE1 . HIS A 1 800  ? 47.473  26.359  69.462  1.00 61.93  ? 797  HIS A CE1 1 
ATOM 6123  N NE2 . HIS A 1 800  ? 47.592  27.375  70.297  1.00 62.19  ? 797  HIS A NE2 1 
ATOM 6124  N N   . THR A 1 801  ? 45.507  23.263  75.079  1.00 60.87  ? 798  THR A N   1 
ATOM 6125  C CA  . THR A 1 801  ? 45.509  22.160  76.046  1.00 60.90  ? 798  THR A CA  1 
ATOM 6126  C C   . THR A 1 801  ? 44.178  22.008  76.789  1.00 61.03  ? 798  THR A C   1 
ATOM 6127  O O   . THR A 1 801  ? 43.842  20.919  77.248  1.00 60.92  ? 798  THR A O   1 
ATOM 6128  C CB  . THR A 1 801  ? 46.664  22.308  77.082  1.00 60.85  ? 798  THR A CB  1 
ATOM 6129  O OG1 . THR A 1 801  ? 46.268  23.172  78.153  1.00 59.97  ? 798  THR A OG1 1 
ATOM 6130  C CG2 . THR A 1 801  ? 47.928  22.856  76.421  1.00 61.06  ? 798  THR A CG2 1 
ATOM 6131  N N   . PHE A 1 802  ? 43.435  23.111  76.883  1.00 61.28  ? 799  PHE A N   1 
ATOM 6132  C CA  . PHE A 1 802  ? 42.246  23.242  77.735  1.00 61.50  ? 799  PHE A CA  1 
ATOM 6133  C C   . PHE A 1 802  ? 42.460  22.848  79.197  1.00 61.50  ? 799  PHE A C   1 
ATOM 6134  O O   . PHE A 1 802  ? 41.526  22.407  79.877  1.00 61.44  ? 799  PHE A O   1 
ATOM 6135  C CB  . PHE A 1 802  ? 41.038  22.550  77.119  1.00 61.74  ? 799  PHE A CB  1 
ATOM 6136  C CG  . PHE A 1 802  ? 40.501  23.257  75.918  1.00 62.74  ? 799  PHE A CG  1 
ATOM 6137  C CD1 . PHE A 1 802  ? 40.891  22.871  74.633  1.00 63.74  ? 799  PHE A CD1 1 
ATOM 6138  C CD2 . PHE A 1 802  ? 39.609  24.322  76.064  1.00 63.61  ? 799  PHE A CD2 1 
ATOM 6139  C CE1 . PHE A 1 802  ? 40.386  23.527  73.501  1.00 64.25  ? 799  PHE A CE1 1 
ATOM 6140  C CE2 . PHE A 1 802  ? 39.103  24.994  74.946  1.00 64.04  ? 799  PHE A CE2 1 
ATOM 6141  C CZ  . PHE A 1 802  ? 39.496  24.601  73.658  1.00 63.90  ? 799  PHE A CZ  1 
ATOM 6142  N N   . GLU A 1 803  ? 43.704  23.009  79.655  1.00 61.46  ? 800  GLU A N   1 
ATOM 6143  C CA  . GLU A 1 803  ? 44.048  22.962  81.073  1.00 61.55  ? 800  GLU A CA  1 
ATOM 6144  C C   . GLU A 1 803  ? 43.704  24.299  81.696  1.00 60.97  ? 800  GLU A C   1 
ATOM 6145  O O   . GLU A 1 803  ? 43.606  25.308  80.991  1.00 60.95  ? 800  GLU A O   1 
ATOM 6146  C CB  . GLU A 1 803  ? 45.545  22.730  81.265  1.00 61.52  ? 800  GLU A CB  1 
ATOM 6147  C CG  . GLU A 1 803  ? 45.981  21.276  81.260  1.00 62.58  ? 800  GLU A CG  1 
ATOM 6148  C CD  . GLU A 1 803  ? 47.396  21.068  81.810  1.00 62.74  ? 800  GLU A CD  1 
ATOM 6149  O OE1 . GLU A 1 803  ? 47.642  19.981  82.391  1.00 63.78  ? 800  GLU A OE1 1 
ATOM 6150  O OE2 . GLU A 1 803  ? 48.255  21.978  81.662  1.00 64.38  ? 800  GLU A OE2 1 
ATOM 6151  N N   . VAL A 1 804  ? 43.540  24.304  83.017  1.00 60.47  ? 801  VAL A N   1 
ATOM 6152  C CA  . VAL A 1 804  ? 43.301  25.540  83.753  1.00 59.96  ? 801  VAL A CA  1 
ATOM 6153  C C   . VAL A 1 804  ? 44.635  26.241  84.060  1.00 59.76  ? 801  VAL A C   1 
ATOM 6154  O O   . VAL A 1 804  ? 45.294  25.940  85.054  1.00 59.72  ? 801  VAL A O   1 
ATOM 6155  C CB  . VAL A 1 804  ? 42.490  25.299  85.051  1.00 59.77  ? 801  VAL A CB  1 
ATOM 6156  C CG1 . VAL A 1 804  ? 41.888  26.598  85.547  1.00 59.54  ? 801  VAL A CG1 1 
ATOM 6157  C CG2 . VAL A 1 804  ? 41.390  24.294  84.807  1.00 59.70  ? 801  VAL A CG2 1 
ATOM 6158  N N   . LEU A 1 805  ? 45.025  27.166  83.185  1.00 59.39  ? 802  LEU A N   1 
ATOM 6159  C CA  . LEU A 1 805  ? 46.199  27.993  83.396  1.00 59.15  ? 802  LEU A CA  1 
ATOM 6160  C C   . LEU A 1 805  ? 46.127  28.739  84.730  1.00 59.30  ? 802  LEU A C   1 
ATOM 6161  O O   . LEU A 1 805  ? 47.110  28.782  85.468  1.00 59.62  ? 802  LEU A O   1 
ATOM 6162  C CB  . LEU A 1 805  ? 46.367  29.009  82.261  1.00 59.07  ? 802  LEU A CB  1 
ATOM 6163  C CG  . LEU A 1 805  ? 46.700  28.640  80.812  1.00 58.65  ? 802  LEU A CG  1 
ATOM 6164  C CD1 . LEU A 1 805  ? 47.146  29.900  80.085  1.00 58.03  ? 802  LEU A CD1 1 
ATOM 6165  C CD2 . LEU A 1 805  ? 47.772  27.574  80.698  1.00 58.43  ? 802  LEU A CD2 1 
ATOM 6166  N N   . HIS A 1 806  ? 44.975  29.331  85.038  1.00 59.26  ? 803  HIS A N   1 
ATOM 6167  C CA  . HIS A 1 806  ? 44.811  30.085  86.287  1.00 59.24  ? 803  HIS A CA  1 
ATOM 6168  C C   . HIS A 1 806  ? 43.350  30.115  86.763  1.00 59.02  ? 803  HIS A C   1 
ATOM 6169  O O   . HIS A 1 806  ? 42.422  30.008  85.950  1.00 58.78  ? 803  HIS A O   1 
ATOM 6170  C CB  . HIS A 1 806  ? 45.369  31.511  86.127  1.00 59.38  ? 803  HIS A CB  1 
ATOM 6171  C CG  . HIS A 1 806  ? 45.543  32.254  87.421  1.00 59.99  ? 803  HIS A CG  1 
ATOM 6172  N ND1 . HIS A 1 806  ? 46.736  32.280  88.112  1.00 60.25  ? 803  HIS A ND1 1 
ATOM 6173  C CD2 . HIS A 1 806  ? 44.677  33.011  88.140  1.00 60.04  ? 803  HIS A CD2 1 
ATOM 6174  C CE1 . HIS A 1 806  ? 46.596  33.013  89.202  1.00 60.11  ? 803  HIS A CE1 1 
ATOM 6175  N NE2 . HIS A 1 806  ? 45.357  33.469  89.243  1.00 59.96  ? 803  HIS A NE2 1 
ATOM 6176  N N   . ALA A 1 807  ? 43.160  30.246  88.080  1.00 58.76  ? 804  ALA A N   1 
ATOM 6177  C CA  . ALA A 1 807  ? 41.823  30.431  88.673  1.00 58.54  ? 804  ALA A CA  1 
ATOM 6178  C C   . ALA A 1 807  ? 41.774  31.495  89.785  1.00 58.25  ? 804  ALA A C   1 
ATOM 6179  O O   . ALA A 1 807  ? 42.245  31.267  90.906  1.00 58.36  ? 804  ALA A O   1 
ATOM 6180  C CB  . ALA A 1 807  ? 41.259  29.099  89.172  1.00 58.48  ? 804  ALA A CB  1 
ATOM 6181  N N   . HIS A 1 808  ? 41.194  32.650  89.462  1.00 57.72  ? 805  HIS A N   1 
ATOM 6182  C CA  . HIS A 1 808  ? 41.013  33.733  90.423  1.00 57.23  ? 805  HIS A CA  1 
ATOM 6183  C C   . HIS A 1 808  ? 39.683  33.621  91.167  1.00 56.64  ? 805  HIS A C   1 
ATOM 6184  O O   . HIS A 1 808  ? 38.624  33.573  90.553  1.00 56.54  ? 805  HIS A O   1 
ATOM 6185  C CB  . HIS A 1 808  ? 41.104  35.080  89.721  1.00 57.39  ? 805  HIS A CB  1 
ATOM 6186  C CG  . HIS A 1 808  ? 40.986  36.249  90.645  1.00 58.69  ? 805  HIS A CG  1 
ATOM 6187  N ND1 . HIS A 1 808  ? 42.070  36.794  91.299  1.00 60.16  ? 805  HIS A ND1 1 
ATOM 6188  C CD2 . HIS A 1 808  ? 39.911  36.981  91.024  1.00 59.99  ? 805  HIS A CD2 1 
ATOM 6189  C CE1 . HIS A 1 808  ? 41.669  37.813  92.039  1.00 60.81  ? 805  HIS A CE1 1 
ATOM 6190  N NE2 . HIS A 1 808  ? 40.362  37.948  91.890  1.00 60.40  ? 805  HIS A NE2 1 
ATOM 6191  N N   . GLN A 1 809  ? 39.752  33.577  92.494  1.00 56.12  ? 806  GLN A N   1 
ATOM 6192  C CA  . GLN A 1 809  ? 38.562  33.485  93.342  1.00 55.42  ? 806  GLN A CA  1 
ATOM 6193  C C   . GLN A 1 809  ? 38.112  34.868  93.787  1.00 55.08  ? 806  GLN A C   1 
ATOM 6194  O O   . GLN A 1 809  ? 38.913  35.667  94.274  1.00 55.23  ? 806  GLN A O   1 
ATOM 6195  C CB  . GLN A 1 809  ? 38.823  32.599  94.568  1.00 55.38  ? 806  GLN A CB  1 
ATOM 6196  C CG  . GLN A 1 809  ? 37.698  32.619  95.584  1.00 54.75  ? 806  GLN A CG  1 
ATOM 6197  C CD  . GLN A 1 809  ? 37.886  31.622  96.694  1.00 54.45  ? 806  GLN A CD  1 
ATOM 6198  O OE1 . GLN A 1 809  ? 37.584  30.439  96.541  1.00 53.93  ? 806  GLN A OE1 1 
ATOM 6199  N NE2 . GLN A 1 809  ? 38.369  32.097  97.836  1.00 54.78  ? 806  GLN A NE2 1 
ATOM 6200  N N   . PHE A 1 810  ? 36.823  35.141  93.626  1.00 54.39  ? 807  PHE A N   1 
ATOM 6201  C CA  . PHE A 1 810  ? 36.258  36.418  94.010  1.00 53.60  ? 807  PHE A CA  1 
ATOM 6202  C C   . PHE A 1 810  ? 35.969  36.456  95.505  1.00 53.76  ? 807  PHE A C   1 
ATOM 6203  O O   . PHE A 1 810  ? 36.358  35.542  96.235  1.00 53.94  ? 807  PHE A O   1 
ATOM 6204  C CB  . PHE A 1 810  ? 35.024  36.691  93.174  1.00 53.14  ? 807  PHE A CB  1 
ATOM 6205  C CG  . PHE A 1 810  ? 35.335  36.949  91.737  1.00 52.22  ? 807  PHE A CG  1 
ATOM 6206  C CD1 . PHE A 1 810  ? 35.336  35.917  90.821  1.00 51.72  ? 807  PHE A CD1 1 
ATOM 6207  C CD2 . PHE A 1 810  ? 35.644  38.225  91.302  1.00 51.80  ? 807  PHE A CD2 1 
ATOM 6208  C CE1 . PHE A 1 810  ? 35.635  36.154  89.499  1.00 51.62  ? 807  PHE A CE1 1 
ATOM 6209  C CE2 . PHE A 1 810  ? 35.940  38.470  89.981  1.00 51.30  ? 807  PHE A CE2 1 
ATOM 6210  C CZ  . PHE A 1 810  ? 35.938  37.434  89.079  1.00 51.78  ? 807  PHE A CZ  1 
ATOM 6211  N N   . LEU A 1 811  ? 35.310  37.514  95.968  1.00 53.78  ? 808  LEU A N   1 
ATOM 6212  C CA  . LEU A 1 811  ? 35.106  37.712  97.401  1.00 53.70  ? 808  LEU A CA  1 
ATOM 6213  C C   . LEU A 1 811  ? 34.058  36.760  97.970  1.00 53.79  ? 808  LEU A C   1 
ATOM 6214  O O   . LEU A 1 811  ? 33.441  35.981  97.242  1.00 53.81  ? 808  LEU A O   1 
ATOM 6215  C CB  . LEU A 1 811  ? 34.742  39.171  97.696  1.00 53.61  ? 808  LEU A CB  1 
ATOM 6216  C CG  . LEU A 1 811  ? 35.727  40.250  97.218  1.00 53.67  ? 808  LEU A CG  1 
ATOM 6217  C CD1 . LEU A 1 811  ? 35.056  41.624  97.129  1.00 53.75  ? 808  LEU A CD1 1 
ATOM 6218  C CD2 . LEU A 1 811  ? 36.968  40.311  98.094  1.00 53.56  ? 808  LEU A CD2 1 
ATOM 6219  N N   . GLN A 1 812  ? 33.887  36.810  99.284  1.00 53.95  ? 809  GLN A N   1 
ATOM 6220  C CA  . GLN A 1 812  ? 32.840  36.059  99.962  1.00 54.10  ? 809  GLN A CA  1 
ATOM 6221  C C   . GLN A 1 812  ? 31.477  36.672  99.623  1.00 54.07  ? 809  GLN A C   1 
ATOM 6222  O O   . GLN A 1 812  ? 31.326  37.898  99.592  1.00 54.17  ? 809  GLN A O   1 
ATOM 6223  C CB  . GLN A 1 812  ? 33.085  36.104  101.470 1.00 54.24  ? 809  GLN A CB  1 
ATOM 6224  C CG  . GLN A 1 812  ? 32.534  34.927  102.264 1.00 54.71  ? 809  GLN A CG  1 
ATOM 6225  C CD  . GLN A 1 812  ? 33.136  34.854  103.657 1.00 55.30  ? 809  GLN A CD  1 
ATOM 6226  O OE1 . GLN A 1 812  ? 32.435  35.011  104.654 1.00 55.78  ? 809  GLN A OE1 1 
ATOM 6227  N NE2 . GLN A 1 812  ? 34.449  34.638  103.730 1.00 55.38  ? 809  GLN A NE2 1 
ATOM 6228  N N   . ASN A 1 813  ? 30.495  35.815  99.354  1.00 53.97  ? 810  ASN A N   1 
ATOM 6229  C CA  . ASN A 1 813  ? 29.148  36.245  98.961  1.00 53.80  ? 810  ASN A CA  1 
ATOM 6230  C C   . ASN A 1 813  ? 29.129  37.182  97.754  1.00 53.65  ? 810  ASN A C   1 
ATOM 6231  O O   . ASN A 1 813  ? 28.132  37.858  97.518  1.00 53.69  ? 810  ASN A O   1 
ATOM 6232  C CB  . ASN A 1 813  ? 28.400  36.892  100.139 1.00 53.90  ? 810  ASN A CB  1 
ATOM 6233  C CG  . ASN A 1 813  ? 28.121  35.919  101.278 1.00 53.94  ? 810  ASN A CG  1 
ATOM 6234  O OD1 . ASN A 1 813  ? 27.302  35.003  101.156 1.00 53.99  ? 810  ASN A OD1 1 
ATOM 6235  N ND2 . ASN A 1 813  ? 28.789  36.134  102.404 1.00 53.94  ? 810  ASN A ND2 1 
ATOM 6236  N N   . GLU A 1 814  ? 30.235  37.227  97.008  1.00 53.67  ? 811  GLU A N   1 
ATOM 6237  C CA  . GLU A 1 814  ? 30.306  37.960  95.734  1.00 53.64  ? 811  GLU A CA  1 
ATOM 6238  C C   . GLU A 1 814  ? 30.180  37.011  94.543  1.00 53.92  ? 811  GLU A C   1 
ATOM 6239  O O   . GLU A 1 814  ? 30.986  36.083  94.403  1.00 53.89  ? 811  GLU A O   1 
ATOM 6240  C CB  . GLU A 1 814  ? 31.618  38.748  95.617  1.00 53.55  ? 811  GLU A CB  1 
ATOM 6241  C CG  . GLU A 1 814  ? 31.758  39.523  94.304  1.00 52.77  ? 811  GLU A CG  1 
ATOM 6242  C CD  . GLU A 1 814  ? 33.141  40.112  94.109  1.00 53.07  ? 811  GLU A CD  1 
ATOM 6243  O OE1 . GLU A 1 814  ? 34.139  39.451  94.444  1.00 52.44  ? 811  GLU A OE1 1 
ATOM 6244  O OE2 . GLU A 1 814  ? 33.241  41.244  93.609  1.00 53.01  ? 811  GLU A OE2 1 
ATOM 6245  N N   . TYR A 1 815  ? 29.175  37.241  93.694  1.00 54.13  ? 812  TYR A N   1 
ATOM 6246  C CA  . TYR A 1 815  ? 29.005  36.445  92.468  1.00 54.59  ? 812  TYR A CA  1 
ATOM 6247  C C   . TYR A 1 815  ? 29.505  37.227  91.254  1.00 54.92  ? 812  TYR A C   1 
ATOM 6248  O O   . TYR A 1 815  ? 29.250  38.429  91.151  1.00 55.50  ? 812  TYR A O   1 
ATOM 6249  C CB  . TYR A 1 815  ? 27.538  36.053  92.247  1.00 54.52  ? 812  TYR A CB  1 
ATOM 6250  C CG  . TYR A 1 815  ? 26.872  35.262  93.354  1.00 54.33  ? 812  TYR A CG  1 
ATOM 6251  C CD1 . TYR A 1 815  ? 25.501  35.074  93.355  1.00 53.88  ? 812  TYR A CD1 1 
ATOM 6252  C CD2 . TYR A 1 815  ? 27.606  34.711  94.400  1.00 54.84  ? 812  TYR A CD2 1 
ATOM 6253  C CE1 . TYR A 1 815  ? 24.875  34.351  94.356  1.00 54.72  ? 812  TYR A CE1 1 
ATOM 6254  C CE2 . TYR A 1 815  ? 26.991  33.995  95.419  1.00 55.14  ? 812  TYR A CE2 1 
ATOM 6255  C CZ  . TYR A 1 815  ? 25.622  33.816  95.393  1.00 55.07  ? 812  TYR A CZ  1 
ATOM 6256  O OH  . TYR A 1 815  ? 25.001  33.103  96.404  1.00 55.03  ? 812  TYR A OH  1 
ATOM 6257  N N   . ALA A 1 816  ? 30.200  36.557  90.336  1.00 54.87  ? 813  ALA A N   1 
ATOM 6258  C CA  . ALA A 1 816  ? 30.739  37.231  89.145  1.00 54.94  ? 813  ALA A CA  1 
ATOM 6259  C C   . ALA A 1 816  ? 29.810  37.095  87.941  1.00 55.02  ? 813  ALA A C   1 
ATOM 6260  O O   . ALA A 1 816  ? 29.745  36.036  87.318  1.00 55.46  ? 813  ALA A O   1 
ATOM 6261  C CB  . ALA A 1 816  ? 32.123  36.705  88.818  1.00 54.89  ? 813  ALA A CB  1 
ATOM 6262  N N   . LEU A 1 817  ? 29.099  38.166  87.606  1.00 54.94  ? 814  LEU A N   1 
ATOM 6263  C CA  . LEU A 1 817  ? 27.997  38.076  86.637  1.00 55.02  ? 814  LEU A CA  1 
ATOM 6264  C C   . LEU A 1 817  ? 28.369  38.151  85.143  1.00 54.96  ? 814  LEU A C   1 
ATOM 6265  O O   . LEU A 1 817  ? 27.728  37.493  84.316  1.00 55.23  ? 814  LEU A O   1 
ATOM 6266  C CB  . LEU A 1 817  ? 26.908  39.119  86.941  1.00 55.10  ? 814  LEU A CB  1 
ATOM 6267  C CG  . LEU A 1 817  ? 26.307  39.264  88.341  1.00 54.84  ? 814  LEU A CG  1 
ATOM 6268  C CD1 . LEU A 1 817  ? 25.680  40.635  88.458  1.00 54.16  ? 814  LEU A CD1 1 
ATOM 6269  C CD2 . LEU A 1 817  ? 25.281  38.190  88.616  1.00 54.67  ? 814  LEU A CD2 1 
ATOM 6270  N N   . SER A 1 818  ? 29.374  38.956  84.794  1.00 54.55  ? 815  SER A N   1 
ATOM 6271  C CA  . SER A 1 818  ? 29.631  39.270  83.381  1.00 54.23  ? 815  SER A CA  1 
ATOM 6272  C C   . SER A 1 818  ? 31.114  39.350  82.990  1.00 53.94  ? 815  SER A C   1 
ATOM 6273  O O   . SER A 1 818  ? 31.968  39.633  83.827  1.00 53.90  ? 815  SER A O   1 
ATOM 6274  C CB  . SER A 1 818  ? 28.908  40.564  83.008  1.00 54.30  ? 815  SER A CB  1 
ATOM 6275  O OG  . SER A 1 818  ? 29.062  41.535  84.029  1.00 54.31  ? 815  SER A OG  1 
ATOM 6276  N N   . LEU A 1 819  ? 31.403  39.130  81.708  1.00 53.52  ? 816  LEU A N   1 
ATOM 6277  C CA  . LEU A 1 819  ? 32.780  39.076  81.224  1.00 53.29  ? 816  LEU A CA  1 
ATOM 6278  C C   . LEU A 1 819  ? 32.967  39.725  79.844  1.00 53.70  ? 816  LEU A C   1 
ATOM 6279  O O   . LEU A 1 819  ? 32.154  39.517  78.946  1.00 53.71  ? 816  LEU A O   1 
ATOM 6280  C CB  . LEU A 1 819  ? 33.234  37.617  81.197  1.00 52.88  ? 816  LEU A CB  1 
ATOM 6281  C CG  . LEU A 1 819  ? 34.700  37.206  81.127  1.00 51.78  ? 816  LEU A CG  1 
ATOM 6282  C CD1 . LEU A 1 819  ? 35.588  37.973  82.087  1.00 50.83  ? 816  LEU A CD1 1 
ATOM 6283  C CD2 . LEU A 1 819  ? 34.746  35.745  81.435  1.00 51.48  ? 816  LEU A CD2 1 
ATOM 6284  N N   . VAL A 1 820  ? 34.027  40.525  79.689  1.00 54.19  ? 817  VAL A N   1 
ATOM 6285  C CA  . VAL A 1 820  ? 34.421  41.085  78.381  1.00 54.75  ? 817  VAL A CA  1 
ATOM 6286  C C   . VAL A 1 820  ? 35.932  40.988  78.204  1.00 55.13  ? 817  VAL A C   1 
ATOM 6287  O O   . VAL A 1 820  ? 36.668  41.070  79.187  1.00 55.33  ? 817  VAL A O   1 
ATOM 6288  C CB  . VAL A 1 820  ? 34.054  42.587  78.228  1.00 54.76  ? 817  VAL A CB  1 
ATOM 6289  C CG1 . VAL A 1 820  ? 33.705  42.918  76.767  1.00 54.82  ? 817  VAL A CG1 1 
ATOM 6290  C CG2 . VAL A 1 820  ? 32.917  42.980  79.147  1.00 54.88  ? 817  VAL A CG2 1 
ATOM 6291  N N   . SER A 1 821  ? 36.396  40.820  76.965  1.00 55.54  ? 818  SER A N   1 
ATOM 6292  C CA  . SER A 1 821  ? 37.836  40.846  76.680  1.00 56.01  ? 818  SER A CA  1 
ATOM 6293  C C   . SER A 1 821  ? 38.188  41.842  75.580  1.00 56.24  ? 818  SER A C   1 
ATOM 6294  O O   . SER A 1 821  ? 38.040  41.538  74.394  1.00 56.22  ? 818  SER A O   1 
ATOM 6295  C CB  . SER A 1 821  ? 38.359  39.452  76.327  1.00 56.06  ? 818  SER A CB  1 
ATOM 6296  O OG  . SER A 1 821  ? 39.552  39.538  75.556  1.00 56.29  ? 818  SER A OG  1 
ATOM 6297  N N   . CYS A 1 822  ? 38.682  43.014  75.979  1.00 56.70  ? 819  CYS A N   1 
ATOM 6298  C CA  . CYS A 1 822  ? 38.825  44.150  75.054  1.00 57.30  ? 819  CYS A CA  1 
ATOM 6299  C C   . CYS A 1 822  ? 40.008  45.069  75.326  1.00 57.62  ? 819  CYS A C   1 
ATOM 6300  O O   . CYS A 1 822  ? 40.668  44.961  76.358  1.00 57.76  ? 819  CYS A O   1 
ATOM 6301  C CB  . CYS A 1 822  ? 37.566  45.000  75.108  1.00 57.26  ? 819  CYS A CB  1 
ATOM 6302  S SG  . CYS A 1 822  ? 37.150  45.424  76.791  1.00 56.90  ? 819  CYS A SG  1 
ATOM 6303  N N   . LYS A 1 823  ? 40.264  45.966  74.377  1.00 58.05  ? 820  LYS A N   1 
ATOM 6304  C CA  . LYS A 1 823  ? 41.181  47.084  74.579  1.00 58.43  ? 820  LYS A CA  1 
ATOM 6305  C C   . LYS A 1 823  ? 40.334  48.336  74.765  1.00 58.95  ? 820  LYS A C   1 
ATOM 6306  O O   . LYS A 1 823  ? 39.432  48.613  73.962  1.00 59.06  ? 820  LYS A O   1 
ATOM 6307  C CB  . LYS A 1 823  ? 42.129  47.263  73.385  1.00 58.48  ? 820  LYS A CB  1 
ATOM 6308  C CG  . LYS A 1 823  ? 43.192  46.176  73.229  1.00 58.08  ? 820  LYS A CG  1 
ATOM 6309  C CD  . LYS A 1 823  ? 44.188  46.479  72.100  1.00 57.84  ? 820  LYS A CD  1 
ATOM 6310  C CE  . LYS A 1 823  ? 43.558  46.357  70.715  1.00 56.31  ? 820  LYS A CE  1 
ATOM 6311  N NZ  . LYS A 1 823  ? 44.581  46.147  69.662  1.00 55.55  ? 820  LYS A NZ  1 
ATOM 6312  N N   . LEU A 1 824  ? 40.625  49.094  75.817  1.00 59.31  ? 821  LEU A N   1 
ATOM 6313  C CA  . LEU A 1 824  ? 39.792  50.236  76.177  1.00 59.68  ? 821  LEU A CA  1 
ATOM 6314  C C   . LEU A 1 824  ? 40.497  51.581  76.013  1.00 59.96  ? 821  LEU A C   1 
ATOM 6315  O O   . LEU A 1 824  ? 41.467  51.870  76.708  1.00 60.16  ? 821  LEU A O   1 
ATOM 6316  C CB  . LEU A 1 824  ? 39.260  50.062  77.599  1.00 59.55  ? 821  LEU A CB  1 
ATOM 6317  C CG  . LEU A 1 824  ? 38.300  48.888  77.795  1.00 59.52  ? 821  LEU A CG  1 
ATOM 6318  C CD1 . LEU A 1 824  ? 37.938  48.773  79.263  1.00 59.60  ? 821  LEU A CD1 1 
ATOM 6319  C CD2 . LEU A 1 824  ? 37.041  49.033  76.937  1.00 59.31  ? 821  LEU A CD2 1 
ATOM 6320  N N   . GLY A 1 825  ? 39.996  52.403  75.097  1.00 60.17  ? 822  GLY A N   1 
ATOM 6321  C CA  . GLY A 1 825  ? 40.648  53.656  74.755  1.00 60.78  ? 822  GLY A CA  1 
ATOM 6322  C C   . GLY A 1 825  ? 42.036  53.412  74.187  1.00 61.33  ? 822  GLY A C   1 
ATOM 6323  O O   . GLY A 1 825  ? 42.260  52.431  73.465  1.00 61.39  ? 822  GLY A O   1 
ATOM 6324  N N   . LYS A 1 826  ? 42.974  54.291  74.544  1.00 61.79  ? 823  LYS A N   1 
ATOM 6325  C CA  . LYS A 1 826  ? 44.353  54.242  74.032  1.00 62.12  ? 823  LYS A CA  1 
ATOM 6326  C C   . LYS A 1 826  ? 45.287  53.302  74.818  1.00 62.11  ? 823  LYS A C   1 
ATOM 6327  O O   . LYS A 1 826  ? 46.508  53.343  74.650  1.00 62.03  ? 823  LYS A O   1 
ATOM 6328  C CB  . LYS A 1 826  ? 44.943  55.654  73.953  1.00 62.22  ? 823  LYS A CB  1 
ATOM 6329  C CG  . LYS A 1 826  ? 44.195  56.598  73.013  1.00 63.16  ? 823  LYS A CG  1 
ATOM 6330  C CD  . LYS A 1 826  ? 43.213  57.501  73.762  1.00 64.48  ? 823  LYS A CD  1 
ATOM 6331  C CE  . LYS A 1 826  ? 42.682  58.603  72.845  1.00 65.20  ? 823  LYS A CE  1 
ATOM 6332  N NZ  . LYS A 1 826  ? 42.343  59.854  73.590  1.00 65.44  ? 823  LYS A NZ  1 
ATOM 6333  N N   . ASP A 1 827  ? 44.698  52.459  75.664  1.00 62.20  ? 824  ASP A N   1 
ATOM 6334  C CA  . ASP A 1 827  ? 45.416  51.418  76.392  1.00 62.26  ? 824  ASP A CA  1 
ATOM 6335  C C   . ASP A 1 827  ? 45.754  50.283  75.420  1.00 62.30  ? 824  ASP A C   1 
ATOM 6336  O O   . ASP A 1 827  ? 44.845  49.686  74.833  1.00 62.31  ? 824  ASP A O   1 
ATOM 6337  C CB  . ASP A 1 827  ? 44.541  50.901  77.545  1.00 62.34  ? 824  ASP A CB  1 
ATOM 6338  C CG  . ASP A 1 827  ? 45.347  50.255  78.662  1.00 62.60  ? 824  ASP A CG  1 
ATOM 6339  O OD1 . ASP A 1 827  ? 46.026  49.233  78.411  1.00 63.24  ? 824  ASP A OD1 1 
ATOM 6340  O OD2 . ASP A 1 827  ? 45.282  50.765  79.803  1.00 62.40  ? 824  ASP A OD2 1 
ATOM 6341  N N   . PRO A 1 828  ? 47.060  49.983  75.242  1.00 62.38  ? 825  PRO A N   1 
ATOM 6342  C CA  . PRO A 1 828  ? 47.471  48.982  74.249  1.00 62.38  ? 825  PRO A CA  1 
ATOM 6343  C C   . PRO A 1 828  ? 47.227  47.556  74.725  1.00 62.34  ? 825  PRO A C   1 
ATOM 6344  O O   . PRO A 1 828  ? 47.137  46.646  73.905  1.00 62.23  ? 825  PRO A O   1 
ATOM 6345  C CB  . PRO A 1 828  ? 48.980  49.236  74.073  1.00 62.47  ? 825  PRO A CB  1 
ATOM 6346  C CG  . PRO A 1 828  ? 49.325  50.409  74.959  1.00 62.50  ? 825  PRO A CG  1 
ATOM 6347  C CD  . PRO A 1 828  ? 48.220  50.544  75.958  1.00 62.42  ? 825  PRO A CD  1 
ATOM 6348  N N   . ASN A 1 829  ? 47.123  47.379  76.041  1.00 62.43  ? 826  ASN A N   1 
ATOM 6349  C CA  . ASN A 1 829  ? 46.829  46.086  76.648  1.00 62.67  ? 826  ASN A CA  1 
ATOM 6350  C C   . ASN A 1 829  ? 45.382  45.648  76.465  1.00 62.85  ? 826  ASN A C   1 
ATOM 6351  O O   . ASN A 1 829  ? 44.461  46.477  76.521  1.00 63.05  ? 826  ASN A O   1 
ATOM 6352  C CB  . ASN A 1 829  ? 47.133  46.129  78.140  1.00 62.59  ? 826  ASN A CB  1 
ATOM 6353  C CG  . ASN A 1 829  ? 48.587  46.354  78.423  1.00 63.12  ? 826  ASN A CG  1 
ATOM 6354  O OD1 . ASN A 1 829  ? 49.399  46.433  77.503  1.00 64.06  ? 826  ASN A OD1 1 
ATOM 6355  N ND2 . ASN A 1 829  ? 48.935  46.459  79.702  1.00 63.73  ? 826  ASN A ND2 1 
ATOM 6356  N N   . THR A 1 830  ? 45.189  44.344  76.254  1.00 62.70  ? 827  THR A N   1 
ATOM 6357  C CA  . THR A 1 830  ? 43.855  43.751  76.251  1.00 62.37  ? 827  THR A CA  1 
ATOM 6358  C C   . THR A 1 830  ? 43.560  43.208  77.641  1.00 62.03  ? 827  THR A C   1 
ATOM 6359  O O   . THR A 1 830  ? 44.457  42.720  78.329  1.00 62.07  ? 827  THR A O   1 
ATOM 6360  C CB  . THR A 1 830  ? 43.737  42.633  75.218  1.00 62.49  ? 827  THR A CB  1 
ATOM 6361  O OG1 . THR A 1 830  ? 44.364  43.044  73.995  1.00 62.66  ? 827  THR A OG1 1 
ATOM 6362  C CG2 . THR A 1 830  ? 42.268  42.314  74.947  1.00 62.93  ? 827  THR A CG2 1 
ATOM 6363  N N   . TYR A 1 831  ? 42.302  43.292  78.052  1.00 61.65  ? 828  TYR A N   1 
ATOM 6364  C CA  . TYR A 1 831  ? 41.940  42.981  79.430  1.00 61.39  ? 828  TYR A CA  1 
ATOM 6365  C C   . TYR A 1 831  ? 40.848  41.917  79.560  1.00 61.19  ? 828  TYR A C   1 
ATOM 6366  O O   . TYR A 1 831  ? 40.216  41.540  78.572  1.00 61.21  ? 828  TYR A O   1 
ATOM 6367  C CB  . TYR A 1 831  ? 41.509  44.268  80.148  1.00 61.30  ? 828  TYR A CB  1 
ATOM 6368  C CG  . TYR A 1 831  ? 42.646  45.214  80.431  1.00 61.07  ? 828  TYR A CG  1 
ATOM 6369  C CD1 . TYR A 1 831  ? 42.959  46.243  79.549  1.00 60.76  ? 828  TYR A CD1 1 
ATOM 6370  C CD2 . TYR A 1 831  ? 43.416  45.076  81.586  1.00 61.43  ? 828  TYR A CD2 1 
ATOM 6371  C CE1 . TYR A 1 831  ? 44.011  47.118  79.810  1.00 60.98  ? 828  TYR A CE1 1 
ATOM 6372  C CE2 . TYR A 1 831  ? 44.468  45.944  81.857  1.00 61.35  ? 828  TYR A CE2 1 
ATOM 6373  C CZ  . TYR A 1 831  ? 44.760  46.959  80.968  1.00 61.34  ? 828  TYR A CZ  1 
ATOM 6374  O OH  . TYR A 1 831  ? 45.807  47.807  81.241  1.00 61.61  ? 828  TYR A OH  1 
ATOM 6375  N N   . PHE A 1 832  ? 40.669  41.418  80.782  1.00 60.83  ? 829  PHE A N   1 
ATOM 6376  C CA  . PHE A 1 832  ? 39.449  40.730  81.176  1.00 60.56  ? 829  PHE A CA  1 
ATOM 6377  C C   . PHE A 1 832  ? 38.727  41.612  82.181  1.00 60.35  ? 829  PHE A C   1 
ATOM 6378  O O   . PHE A 1 832  ? 39.304  42.000  83.194  1.00 60.53  ? 829  PHE A O   1 
ATOM 6379  C CB  . PHE A 1 832  ? 39.747  39.368  81.805  1.00 60.65  ? 829  PHE A CB  1 
ATOM 6380  C CG  . PHE A 1 832  ? 40.249  38.346  80.835  1.00 60.81  ? 829  PHE A CG  1 
ATOM 6381  C CD1 . PHE A 1 832  ? 39.842  38.366  79.502  1.00 61.09  ? 829  PHE A CD1 1 
ATOM 6382  C CD2 . PHE A 1 832  ? 41.110  37.342  81.257  1.00 60.84  ? 829  PHE A CD2 1 
ATOM 6383  C CE1 . PHE A 1 832  ? 40.306  37.413  78.601  1.00 61.52  ? 829  PHE A CE1 1 
ATOM 6384  C CE2 . PHE A 1 832  ? 41.578  36.384  80.362  1.00 61.18  ? 829  PHE A CE2 1 
ATOM 6385  C CZ  . PHE A 1 832  ? 41.179  36.421  79.030  1.00 61.17  ? 829  PHE A CZ  1 
ATOM 6386  N N   . ILE A 1 833  ? 37.474  41.945  81.897  1.00 59.96  ? 830  ILE A N   1 
ATOM 6387  C CA  . ILE A 1 833  ? 36.683  42.754  82.818  1.00 59.58  ? 830  ILE A CA  1 
ATOM 6388  C C   . ILE A 1 833  ? 35.502  41.950  83.337  1.00 59.49  ? 830  ILE A C   1 
ATOM 6389  O O   . ILE A 1 833  ? 34.728  41.385  82.560  1.00 59.65  ? 830  ILE A O   1 
ATOM 6390  C CB  . ILE A 1 833  ? 36.193  44.045  82.161  1.00 59.47  ? 830  ILE A CB  1 
ATOM 6391  C CG1 . ILE A 1 833  ? 37.380  44.808  81.588  1.00 59.47  ? 830  ILE A CG1 1 
ATOM 6392  C CG2 . ILE A 1 833  ? 35.449  44.909  83.167  1.00 59.21  ? 830  ILE A CG2 1 
ATOM 6393  C CD1 . ILE A 1 833  ? 37.051  45.583  80.359  1.00 59.91  ? 830  ILE A CD1 1 
ATOM 6394  N N   . VAL A 1 834  ? 35.369  41.901  84.657  1.00 59.09  ? 831  VAL A N   1 
ATOM 6395  C CA  . VAL A 1 834  ? 34.331  41.092  85.269  1.00 58.70  ? 831  VAL A CA  1 
ATOM 6396  C C   . VAL A 1 834  ? 33.348  41.941  86.068  1.00 58.68  ? 831  VAL A C   1 
ATOM 6397  O O   . VAL A 1 834  ? 33.743  42.696  86.956  1.00 58.63  ? 831  VAL A O   1 
ATOM 6398  C CB  . VAL A 1 834  ? 34.927  39.981  86.153  1.00 58.54  ? 831  VAL A CB  1 
ATOM 6399  C CG1 . VAL A 1 834  ? 33.848  39.005  86.563  1.00 58.25  ? 831  VAL A CG1 1 
ATOM 6400  C CG2 . VAL A 1 834  ? 36.034  39.253  85.415  1.00 58.34  ? 831  VAL A CG2 1 
ATOM 6401  N N   . GLY A 1 835  ? 32.068  41.820  85.724  1.00 58.59  ? 832  GLY A N   1 
ATOM 6402  C CA  . GLY A 1 835  ? 30.997  42.435  86.497  1.00 58.53  ? 832  GLY A CA  1 
ATOM 6403  C C   . GLY A 1 835  ? 30.565  41.492  87.598  1.00 58.50  ? 832  GLY A C   1 
ATOM 6404  O O   . GLY A 1 835  ? 30.535  40.278  87.400  1.00 58.56  ? 832  GLY A O   1 
ATOM 6405  N N   . THR A 1 836  ? 30.221  42.048  88.754  1.00 58.48  ? 833  THR A N   1 
ATOM 6406  C CA  . THR A 1 836  ? 29.964  41.254  89.955  1.00 58.65  ? 833  THR A CA  1 
ATOM 6407  C C   . THR A 1 836  ? 28.813  41.813  90.792  1.00 58.52  ? 833  THR A C   1 
ATOM 6408  O O   . THR A 1 836  ? 28.307  42.896  90.505  1.00 58.76  ? 833  THR A O   1 
ATOM 6409  C CB  . THR A 1 836  ? 31.219  41.205  90.837  1.00 58.88  ? 833  THR A CB  1 
ATOM 6410  O OG1 . THR A 1 836  ? 31.874  42.477  90.782  1.00 59.61  ? 833  THR A OG1 1 
ATOM 6411  C CG2 . THR A 1 836  ? 32.195  40.132  90.359  1.00 59.02  ? 833  THR A CG2 1 
ATOM 6412  N N   . ALA A 1 837  ? 28.402  41.073  91.821  1.00 58.36  ? 834  ALA A N   1 
ATOM 6413  C CA  . ALA A 1 837  ? 27.346  41.516  92.737  1.00 58.35  ? 834  ALA A CA  1 
ATOM 6414  C C   . ALA A 1 837  ? 27.430  40.798  94.078  1.00 58.48  ? 834  ALA A C   1 
ATOM 6415  O O   . ALA A 1 837  ? 27.858  39.638  94.140  1.00 58.48  ? 834  ALA A O   1 
ATOM 6416  C CB  . ALA A 1 837  ? 25.987  41.298  92.123  1.00 58.29  ? 834  ALA A CB  1 
ATOM 6417  N N   . MET A 1 838  ? 27.003  41.491  95.136  1.00 58.49  ? 835  MET A N   1 
ATOM 6418  C CA  . MET A 1 838  ? 27.048  40.979  96.503  1.00 58.56  ? 835  MET A CA  1 
ATOM 6419  C C   . MET A 1 838  ? 25.656  40.569  96.930  1.00 58.98  ? 835  MET A C   1 
ATOM 6420  O O   . MET A 1 838  ? 24.738  41.385  96.932  1.00 59.04  ? 835  MET A O   1 
ATOM 6421  C CB  . MET A 1 838  ? 27.569  42.050  97.449  1.00 58.42  ? 835  MET A CB  1 
ATOM 6422  C CG  . MET A 1 838  ? 28.810  42.760  96.963  1.00 58.31  ? 835  MET A CG  1 
ATOM 6423  S SD  . MET A 1 838  ? 30.255  41.699  97.022  1.00 58.92  ? 835  MET A SD  1 
ATOM 6424  C CE  . MET A 1 838  ? 30.760  41.855  98.736  1.00 60.23  ? 835  MET A CE  1 
ATOM 6425  N N   . VAL A 1 839  ? 25.512  39.308  97.315  1.00 59.65  ? 836  VAL A N   1 
ATOM 6426  C CA  . VAL A 1 839  ? 24.201  38.695  97.492  1.00 60.52  ? 836  VAL A CA  1 
ATOM 6427  C C   . VAL A 1 839  ? 23.980  38.198  98.910  1.00 61.38  ? 836  VAL A C   1 
ATOM 6428  O O   . VAL A 1 839  ? 24.785  37.421  99.416  1.00 61.77  ? 836  VAL A O   1 
ATOM 6429  C CB  . VAL A 1 839  ? 24.065  37.490  96.558  1.00 60.34  ? 836  VAL A CB  1 
ATOM 6430  C CG1 . VAL A 1 839  ? 22.822  36.670  96.906  1.00 60.78  ? 836  VAL A CG1 1 
ATOM 6431  C CG2 . VAL A 1 839  ? 24.054  37.938  95.101  1.00 59.98  ? 836  VAL A CG2 1 
ATOM 6432  N N   . TYR A 1 840  ? 22.892  38.632  99.545  1.00 62.32  ? 837  TYR A N   1 
ATOM 6433  C CA  . TYR A 1 840  ? 22.506  38.105  100.864 1.00 63.29  ? 837  TYR A CA  1 
ATOM 6434  C C   . TYR A 1 840  ? 20.971  38.058  100.988 1.00 64.27  ? 837  TYR A C   1 
ATOM 6435  O O   . TYR A 1 840  ? 20.301  39.037  100.631 1.00 64.44  ? 837  TYR A O   1 
ATOM 6436  C CB  . TYR A 1 840  ? 23.097  38.931  102.012 1.00 63.05  ? 837  TYR A CB  1 
ATOM 6437  C CG  . TYR A 1 840  ? 24.420  39.638  101.758 1.00 62.91  ? 837  TYR A CG  1 
ATOM 6438  C CD1 . TYR A 1 840  ? 24.450  40.911  101.186 1.00 63.09  ? 837  TYR A CD1 1 
ATOM 6439  C CD2 . TYR A 1 840  ? 25.635  39.063  102.142 1.00 62.70  ? 837  TYR A CD2 1 
ATOM 6440  C CE1 . TYR A 1 840  ? 25.656  41.585  100.971 1.00 62.99  ? 837  TYR A CE1 1 
ATOM 6441  C CE2 . TYR A 1 840  ? 26.851  39.733  101.933 1.00 62.63  ? 837  TYR A CE2 1 
ATOM 6442  C CZ  . TYR A 1 840  ? 26.851  40.994  101.345 1.00 62.66  ? 837  TYR A CZ  1 
ATOM 6443  O OH  . TYR A 1 840  ? 28.033  41.676  101.127 1.00 62.16  ? 837  TYR A OH  1 
ATOM 6444  N N   . PRO A 1 841  ? 20.413  36.944  101.532 1.00 65.13  ? 838  PRO A N   1 
ATOM 6445  C CA  . PRO A 1 841  ? 18.992  36.548  101.326 1.00 65.71  ? 838  PRO A CA  1 
ATOM 6446  C C   . PRO A 1 841  ? 17.876  37.422  101.940 1.00 66.38  ? 838  PRO A C   1 
ATOM 6447  O O   . PRO A 1 841  ? 16.705  37.023  101.916 1.00 66.34  ? 838  PRO A O   1 
ATOM 6448  C CB  . PRO A 1 841  ? 18.929  35.116  101.891 1.00 65.64  ? 838  PRO A CB  1 
ATOM 6449  C CG  . PRO A 1 841  ? 20.335  34.732  102.221 1.00 65.43  ? 838  PRO A CG  1 
ATOM 6450  C CD  . PRO A 1 841  ? 21.114  35.990  102.410 1.00 65.06  ? 838  PRO A CD  1 
ATOM 6451  N N   . GLU A 1 842  ? 18.222  38.594  102.466 1.00 67.22  ? 839  GLU A N   1 
ATOM 6452  C CA  . GLU A 1 842  ? 17.212  39.548  102.944 1.00 68.13  ? 839  GLU A CA  1 
ATOM 6453  C C   . GLU A 1 842  ? 16.705  40.445  101.813 1.00 68.72  ? 839  GLU A C   1 
ATOM 6454  O O   . GLU A 1 842  ? 15.493  40.518  101.564 1.00 68.70  ? 839  GLU A O   1 
ATOM 6455  C CB  . GLU A 1 842  ? 17.728  40.395  104.120 1.00 68.10  ? 839  GLU A CB  1 
ATOM 6456  C CG  . GLU A 1 842  ? 19.227  40.641  104.132 1.00 68.44  ? 839  GLU A CG  1 
ATOM 6457  C CD  . GLU A 1 842  ? 19.980  39.530  104.839 1.00 68.93  ? 839  GLU A CD  1 
ATOM 6458  O OE1 . GLU A 1 842  ? 20.109  39.597  106.078 1.00 69.59  ? 839  GLU A OE1 1 
ATOM 6459  O OE2 . GLU A 1 842  ? 20.439  38.590  104.158 1.00 68.89  ? 839  GLU A OE2 1 
ATOM 6460  N N   . GLU A 1 843  ? 17.638  41.112  101.132 1.00 69.39  ? 840  GLU A N   1 
ATOM 6461  C CA  . GLU A 1 843  ? 17.317  42.009  100.019 1.00 70.25  ? 840  GLU A CA  1 
ATOM 6462  C C   . GLU A 1 843  ? 16.845  41.252  98.767  1.00 70.29  ? 840  GLU A C   1 
ATOM 6463  O O   . GLU A 1 843  ? 17.452  40.253  98.360  1.00 70.25  ? 840  GLU A O   1 
ATOM 6464  C CB  . GLU A 1 843  ? 18.507  42.923  99.696  1.00 70.12  ? 840  GLU A CB  1 
ATOM 6465  C CG  . GLU A 1 843  ? 19.795  42.188  99.336  1.00 70.95  ? 840  GLU A CG  1 
ATOM 6466  C CD  . GLU A 1 843  ? 21.029  43.082  99.370  1.00 71.41  ? 840  GLU A CD  1 
ATOM 6467  O OE1 . GLU A 1 843  ? 21.174  43.884  100.329 1.00 72.34  ? 840  GLU A OE1 1 
ATOM 6468  O OE2 . GLU A 1 843  ? 21.868  42.964  98.442  1.00 73.30  ? 840  GLU A OE2 1 
ATOM 6469  N N   . ALA A 1 844  ? 15.751  41.734  98.176  1.00 70.50  ? 841  ALA A N   1 
ATOM 6470  C CA  . ALA A 1 844  ? 15.190  41.138  96.962  1.00 70.52  ? 841  ALA A CA  1 
ATOM 6471  C C   . ALA A 1 844  ? 16.160  41.282  95.798  1.00 70.45  ? 841  ALA A C   1 
ATOM 6472  O O   . ALA A 1 844  ? 16.215  40.424  94.922  1.00 70.61  ? 841  ALA A O   1 
ATOM 6473  C CB  . ALA A 1 844  ? 13.826  41.758  96.620  1.00 70.56  ? 841  ALA A CB  1 
ATOM 6474  N N   . GLU A 1 845  ? 16.930  42.363  95.791  1.00 70.22  ? 842  GLU A N   1 
ATOM 6475  C CA  . GLU A 1 845  ? 17.958  42.534  94.774  1.00 70.28  ? 842  GLU A CA  1 
ATOM 6476  C C   . GLU A 1 845  ? 19.207  43.185  95.358  1.00 69.98  ? 842  GLU A C   1 
ATOM 6477  O O   . GLU A 1 845  ? 19.123  43.837  96.407  1.00 69.91  ? 842  GLU A O   1 
ATOM 6478  C CB  . GLU A 1 845  ? 17.423  43.314  93.563  1.00 70.34  ? 842  GLU A CB  1 
ATOM 6479  C CG  . GLU A 1 845  ? 17.035  44.765  93.838  1.00 70.88  ? 842  GLU A CG  1 
ATOM 6480  C CD  . GLU A 1 845  ? 16.521  45.483  92.595  1.00 70.79  ? 842  GLU A CD  1 
ATOM 6481  O OE1 . GLU A 1 845  ? 15.631  46.350  92.740  1.00 71.06  ? 842  GLU A OE1 1 
ATOM 6482  O OE2 . GLU A 1 845  ? 17.004  45.182  91.477  1.00 71.37  ? 842  GLU A OE2 1 
ATOM 6483  N N   . PRO A 1 846  ? 20.373  42.983  94.696  1.00 69.68  ? 843  PRO A N   1 
ATOM 6484  C CA  . PRO A 1 846  ? 21.634  43.622  95.083  1.00 69.28  ? 843  PRO A CA  1 
ATOM 6485  C C   . PRO A 1 846  ? 21.544  45.142  95.126  1.00 68.91  ? 843  PRO A C   1 
ATOM 6486  O O   . PRO A 1 846  ? 20.826  45.756  94.328  1.00 69.05  ? 843  PRO A O   1 
ATOM 6487  C CB  . PRO A 1 846  ? 22.597  43.202  93.968  1.00 69.16  ? 843  PRO A CB  1 
ATOM 6488  C CG  . PRO A 1 846  ? 22.054  41.939  93.468  1.00 69.29  ? 843  PRO A CG  1 
ATOM 6489  C CD  . PRO A 1 846  ? 20.567  42.089  93.537  1.00 69.65  ? 843  PRO A CD  1 
ATOM 6490  N N   . LYS A 1 847  ? 22.265  45.730  96.073  1.00 68.26  ? 844  LYS A N   1 
ATOM 6491  C CA  . LYS A 1 847  ? 22.438  47.171  96.135  1.00 67.61  ? 844  LYS A CA  1 
ATOM 6492  C C   . LYS A 1 847  ? 23.934  47.483  96.261  1.00 66.89  ? 844  LYS A C   1 
ATOM 6493  O O   . LYS A 1 847  ? 24.325  48.571  96.693  1.00 66.81  ? 844  LYS A O   1 
ATOM 6494  C CB  . LYS A 1 847  ? 21.596  47.779  97.269  1.00 67.80  ? 844  LYS A CB  1 
ATOM 6495  C CG  . LYS A 1 847  ? 21.697  47.073  98.633  1.00 68.12  ? 844  LYS A CG  1 
ATOM 6496  C CD  . LYS A 1 847  ? 20.671  47.625  99.639  1.00 68.05  ? 844  LYS A CD  1 
ATOM 6497  C CE  . LYS A 1 847  ? 20.974  47.170  101.072 1.00 68.28  ? 844  LYS A CE  1 
ATOM 6498  N NZ  . LYS A 1 847  ? 19.998  47.713  102.065 1.00 68.12  ? 844  LYS A NZ  1 
ATOM 6499  N N   . GLN A 1 848  ? 24.752  46.508  95.855  1.00 65.98  ? 845  GLN A N   1 
ATOM 6500  C CA  . GLN A 1 848  ? 26.214  46.598  95.859  1.00 65.13  ? 845  GLN A CA  1 
ATOM 6501  C C   . GLN A 1 848  ? 26.815  45.977  94.581  1.00 64.48  ? 845  GLN A C   1 
ATOM 6502  O O   . GLN A 1 848  ? 26.074  45.591  93.682  1.00 64.51  ? 845  GLN A O   1 
ATOM 6503  C CB  . GLN A 1 848  ? 26.754  45.908  97.105  1.00 65.14  ? 845  GLN A CB  1 
ATOM 6504  C CG  . GLN A 1 848  ? 26.619  46.738  98.375  1.00 65.68  ? 845  GLN A CG  1 
ATOM 6505  C CD  . GLN A 1 848  ? 26.559  45.895  99.643  1.00 66.50  ? 845  GLN A CD  1 
ATOM 6506  O OE1 . GLN A 1 848  ? 26.095  44.751  99.630  1.00 67.18  ? 845  GLN A OE1 1 
ATOM 6507  N NE2 . GLN A 1 848  ? 27.012  46.468  100.752 1.00 66.28  ? 845  GLN A NE2 1 
ATOM 6508  N N   . GLY A 1 849  ? 28.146  45.891  94.495  1.00 63.67  ? 846  GLY A N   1 
ATOM 6509  C CA  . GLY A 1 849  ? 28.826  45.272  93.339  1.00 62.57  ? 846  GLY A CA  1 
ATOM 6510  C C   . GLY A 1 849  ? 30.173  45.882  92.973  1.00 61.83  ? 846  GLY A C   1 
ATOM 6511  O O   . GLY A 1 849  ? 30.558  46.912  93.523  1.00 61.91  ? 846  GLY A O   1 
ATOM 6512  N N   . ARG A 1 850  ? 30.888  45.247  92.043  1.00 61.03  ? 847  ARG A N   1 
ATOM 6513  C CA  . ARG A 1 850  ? 32.205  45.727  91.589  1.00 60.30  ? 847  ARG A CA  1 
ATOM 6514  C C   . ARG A 1 850  ? 32.341  45.730  90.060  1.00 59.99  ? 847  ARG A C   1 
ATOM 6515  O O   . ARG A 1 850  ? 31.465  45.266  89.346  1.00 60.00  ? 847  ARG A O   1 
ATOM 6516  C CB  . ARG A 1 850  ? 33.349  44.878  92.178  1.00 60.24  ? 847  ARG A CB  1 
ATOM 6517  C CG  . ARG A 1 850  ? 33.390  44.725  93.701  1.00 60.05  ? 847  ARG A CG  1 
ATOM 6518  C CD  . ARG A 1 850  ? 34.800  44.334  94.207  1.00 59.98  ? 847  ARG A CD  1 
ATOM 6519  N NE  . ARG A 1 850  ? 35.222  42.985  93.811  1.00 58.40  ? 847  ARG A NE  1 
ATOM 6520  C CZ  . ARG A 1 850  ? 36.488  42.573  93.717  1.00 57.10  ? 847  ARG A CZ  1 
ATOM 6521  N NH1 . ARG A 1 850  ? 37.499  43.395  93.980  1.00 56.10  ? 847  ARG A NH1 1 
ATOM 6522  N NH2 . ARG A 1 850  ? 36.742  41.330  93.342  1.00 56.03  ? 847  ARG A NH2 1 
ATOM 6523  N N   . ILE A 1 851  ? 33.450  46.271  89.572  1.00 59.68  ? 848  ILE A N   1 
ATOM 6524  C CA  . ILE A 1 851  ? 33.875  46.103  88.188  1.00 59.58  ? 848  ILE A CA  1 
ATOM 6525  C C   . ILE A 1 851  ? 35.402  45.973  88.222  1.00 59.77  ? 848  ILE A C   1 
ATOM 6526  O O   . ILE A 1 851  ? 36.110  46.953  88.450  1.00 59.83  ? 848  ILE A O   1 
ATOM 6527  C CB  . ILE A 1 851  ? 33.437  47.290  87.276  1.00 59.53  ? 848  ILE A CB  1 
ATOM 6528  C CG1 . ILE A 1 851  ? 31.950  47.212  86.943  1.00 59.37  ? 848  ILE A CG1 1 
ATOM 6529  C CG2 . ILE A 1 851  ? 34.224  47.306  85.959  1.00 59.59  ? 848  ILE A CG2 1 
ATOM 6530  C CD1 . ILE A 1 851  ? 31.440  48.410  86.166  1.00 59.33  ? 848  ILE A CD1 1 
ATOM 6531  N N   . VAL A 1 852  ? 35.905  44.757  88.021  1.00 59.94  ? 849  VAL A N   1 
ATOM 6532  C CA  . VAL A 1 852  ? 37.346  44.496  88.086  1.00 60.03  ? 849  VAL A CA  1 
ATOM 6533  C C   . VAL A 1 852  ? 37.945  44.355  86.694  1.00 60.32  ? 849  VAL A C   1 
ATOM 6534  O O   . VAL A 1 852  ? 37.391  43.660  85.841  1.00 60.47  ? 849  VAL A O   1 
ATOM 6535  C CB  . VAL A 1 852  ? 37.685  43.216  88.887  1.00 59.84  ? 849  VAL A CB  1 
ATOM 6536  C CG1 . VAL A 1 852  ? 39.165  43.174  89.175  1.00 60.03  ? 849  VAL A CG1 1 
ATOM 6537  C CG2 . VAL A 1 852  ? 36.909  43.154  90.188  1.00 59.69  ? 849  VAL A CG2 1 
ATOM 6538  N N   . VAL A 1 853  ? 39.081  45.009  86.474  1.00 60.62  ? 850  VAL A N   1 
ATOM 6539  C CA  . VAL A 1 853  ? 39.787  44.907  85.204  1.00 60.96  ? 850  VAL A CA  1 
ATOM 6540  C C   . VAL A 1 853  ? 41.031  44.062  85.404  1.00 61.40  ? 850  VAL A C   1 
ATOM 6541  O O   . VAL A 1 853  ? 42.014  44.524  85.978  1.00 61.63  ? 850  VAL A O   1 
ATOM 6542  C CB  . VAL A 1 853  ? 40.194  46.285  84.649  1.00 60.88  ? 850  VAL A CB  1 
ATOM 6543  C CG1 . VAL A 1 853  ? 40.690  46.143  83.239  1.00 60.58  ? 850  VAL A CG1 1 
ATOM 6544  C CG2 . VAL A 1 853  ? 39.025  47.266  84.702  1.00 60.99  ? 850  VAL A CG2 1 
ATOM 6545  N N   . PHE A 1 854  ? 40.972  42.816  84.943  1.00 61.84  ? 851  PHE A N   1 
ATOM 6546  C CA  . PHE A 1 854  ? 42.084  41.874  85.065  1.00 62.10  ? 851  PHE A CA  1 
ATOM 6547  C C   . PHE A 1 854  ? 43.005  41.918  83.838  1.00 62.61  ? 851  PHE A C   1 
ATOM 6548  O O   . PHE A 1 854  ? 42.534  42.121  82.715  1.00 62.53  ? 851  PHE A O   1 
ATOM 6549  C CB  . PHE A 1 854  ? 41.546  40.453  85.221  1.00 61.70  ? 851  PHE A CB  1 
ATOM 6550  C CG  . PHE A 1 854  ? 40.835  40.191  86.523  1.00 60.96  ? 851  PHE A CG  1 
ATOM 6551  C CD1 . PHE A 1 854  ? 39.457  40.051  86.556  1.00 60.35  ? 851  PHE A CD1 1 
ATOM 6552  C CD2 . PHE A 1 854  ? 41.545  40.031  87.704  1.00 60.45  ? 851  PHE A CD2 1 
ATOM 6553  C CE1 . PHE A 1 854  ? 38.797  39.778  87.747  1.00 59.93  ? 851  PHE A CE1 1 
ATOM 6554  C CE2 . PHE A 1 854  ? 40.891  39.755  88.898  1.00 59.86  ? 851  PHE A CE2 1 
ATOM 6555  C CZ  . PHE A 1 854  ? 39.516  39.630  88.916  1.00 60.14  ? 851  PHE A CZ  1 
ATOM 6556  N N   . GLN A 1 855  ? 44.308  41.717  84.056  1.00 63.23  ? 852  GLN A N   1 
ATOM 6557  C CA  . GLN A 1 855  ? 45.265  41.586  82.952  1.00 63.87  ? 852  GLN A CA  1 
ATOM 6558  C C   . GLN A 1 855  ? 46.120  40.336  83.060  1.00 64.34  ? 852  GLN A C   1 
ATOM 6559  O O   . GLN A 1 855  ? 46.750  40.099  84.090  1.00 64.13  ? 852  GLN A O   1 
ATOM 6560  C CB  . GLN A 1 855  ? 46.188  42.799  82.852  1.00 63.90  ? 852  GLN A CB  1 
ATOM 6561  C CG  . GLN A 1 855  ? 46.771  42.989  81.451  1.00 64.14  ? 852  GLN A CG  1 
ATOM 6562  C CD  . GLN A 1 855  ? 48.248  43.344  81.444  1.00 64.02  ? 852  GLN A CD  1 
ATOM 6563  O OE1 . GLN A 1 855  ? 48.818  43.738  82.464  1.00 63.99  ? 852  GLN A OE1 1 
ATOM 6564  N NE2 . GLN A 1 855  ? 48.878  43.201  80.281  1.00 63.64  ? 852  GLN A NE2 1 
ATOM 6565  N N   . TYR A 1 856  ? 46.156  39.566  81.970  1.00 65.27  ? 853  TYR A N   1 
ATOM 6566  C CA  . TYR A 1 856  ? 46.939  38.330  81.894  1.00 66.06  ? 853  TYR A CA  1 
ATOM 6567  C C   . TYR A 1 856  ? 48.226  38.512  81.081  1.00 66.56  ? 853  TYR A C   1 
ATOM 6568  O O   . TYR A 1 856  ? 48.192  38.959  79.929  1.00 66.41  ? 853  TYR A O   1 
ATOM 6569  C CB  . TYR A 1 856  ? 46.088  37.180  81.347  1.00 66.03  ? 853  TYR A CB  1 
ATOM 6570  C CG  . TYR A 1 856  ? 46.606  35.797  81.701  1.00 66.27  ? 853  TYR A CG  1 
ATOM 6571  C CD1 . TYR A 1 856  ? 46.665  35.372  83.028  1.00 66.33  ? 853  TYR A CD1 1 
ATOM 6572  C CD2 . TYR A 1 856  ? 47.025  34.906  80.706  1.00 66.59  ? 853  TYR A CD2 1 
ATOM 6573  C CE1 . TYR A 1 856  ? 47.140  34.101  83.356  1.00 66.39  ? 853  TYR A CE1 1 
ATOM 6574  C CE2 . TYR A 1 856  ? 47.498  33.633  81.026  1.00 66.10  ? 853  TYR A CE2 1 
ATOM 6575  C CZ  . TYR A 1 856  ? 47.551  33.242  82.351  1.00 65.94  ? 853  TYR A CZ  1 
ATOM 6576  O OH  . TYR A 1 856  ? 48.011  31.997  82.678  1.00 65.80  ? 853  TYR A OH  1 
ATOM 6577  N N   . SER A 1 857  ? 49.348  38.140  81.699  1.00 67.47  ? 854  SER A N   1 
ATOM 6578  C CA  . SER A 1 857  ? 50.696  38.502  81.231  1.00 68.49  ? 854  SER A CA  1 
ATOM 6579  C C   . SER A 1 857  ? 51.406  37.393  80.431  1.00 69.02  ? 854  SER A C   1 
ATOM 6580  O O   . SER A 1 857  ? 50.853  36.864  79.450  1.00 69.22  ? 854  SER A O   1 
ATOM 6581  C CB  . SER A 1 857  ? 51.564  38.919  82.432  1.00 68.45  ? 854  SER A CB  1 
ATOM 6582  O OG  . SER A 1 857  ? 50.893  39.848  83.269  1.00 68.71  ? 854  SER A OG  1 
ATOM 6583  N N   . ASP A 1 858  ? 52.646  37.088  80.838  1.00 69.46  ? 855  ASP A N   1 
ATOM 6584  C CA  . ASP A 1 858  ? 53.365  35.884  80.403  1.00 69.82  ? 855  ASP A CA  1 
ATOM 6585  C C   . ASP A 1 858  ? 52.534  34.661  80.805  1.00 69.96  ? 855  ASP A C   1 
ATOM 6586  O O   . ASP A 1 858  ? 52.169  33.827  79.963  1.00 70.00  ? 855  ASP A O   1 
ATOM 6587  C CB  . ASP A 1 858  ? 54.754  35.805  81.067  1.00 69.87  ? 855  ASP A CB  1 
ATOM 6588  C CG  . ASP A 1 858  ? 55.850  36.513  80.263  1.00 70.17  ? 855  ASP A CG  1 
ATOM 6589  O OD1 . ASP A 1 858  ? 55.909  36.337  79.022  1.00 70.31  ? 855  ASP A OD1 1 
ATOM 6590  O OD2 . ASP A 1 858  ? 56.676  37.224  80.886  1.00 69.98  ? 855  ASP A OD2 1 
ATOM 6591  N N   . GLY A 1 859  ? 52.237  34.589  82.105  1.00 70.00  ? 856  GLY A N   1 
ATOM 6592  C CA  . GLY A 1 859  ? 51.360  33.579  82.695  1.00 69.85  ? 856  GLY A CA  1 
ATOM 6593  C C   . GLY A 1 859  ? 50.972  34.029  84.088  1.00 69.71  ? 856  GLY A C   1 
ATOM 6594  O O   . GLY A 1 859  ? 51.175  33.313  85.068  1.00 69.65  ? 856  GLY A O   1 
ATOM 6595  N N   . LYS A 1 860  ? 50.413  35.234  84.164  1.00 69.65  ? 857  LYS A N   1 
ATOM 6596  C CA  . LYS A 1 860  ? 50.207  35.928  85.430  1.00 69.60  ? 857  LYS A CA  1 
ATOM 6597  C C   . LYS A 1 860  ? 48.883  36.688  85.378  1.00 69.32  ? 857  LYS A C   1 
ATOM 6598  O O   . LYS A 1 860  ? 48.610  37.368  84.390  1.00 69.45  ? 857  LYS A O   1 
ATOM 6599  C CB  . LYS A 1 860  ? 51.375  36.898  85.669  1.00 69.68  ? 857  LYS A CB  1 
ATOM 6600  C CG  . LYS A 1 860  ? 52.704  36.454  85.011  1.00 70.00  ? 857  LYS A CG  1 
ATOM 6601  C CD  . LYS A 1 860  ? 53.907  37.288  85.437  1.00 69.84  ? 857  LYS A CD  1 
ATOM 6602  C CE  . LYS A 1 860  ? 55.176  36.776  84.772  1.00 69.44  ? 857  LYS A CE  1 
ATOM 6603  N NZ  . LYS A 1 860  ? 56.397  37.323  85.423  1.00 69.17  ? 857  LYS A NZ  1 
ATOM 6604  N N   . LEU A 1 861  ? 48.061  36.573  86.422  1.00 68.88  ? 858  LEU A N   1 
ATOM 6605  C CA  . LEU A 1 861  ? 46.741  37.226  86.429  1.00 68.52  ? 858  LEU A CA  1 
ATOM 6606  C C   . LEU A 1 861  ? 46.650  38.484  87.331  1.00 68.26  ? 858  LEU A C   1 
ATOM 6607  O O   . LEU A 1 861  ? 46.334  38.406  88.523  1.00 68.32  ? 858  LEU A O   1 
ATOM 6608  C CB  . LEU A 1 861  ? 45.632  36.204  86.733  1.00 68.45  ? 858  LEU A CB  1 
ATOM 6609  C CG  . LEU A 1 861  ? 44.216  36.403  86.150  1.00 68.40  ? 858  LEU A CG  1 
ATOM 6610  C CD1 . LEU A 1 861  ? 43.266  37.022  87.159  1.00 68.41  ? 858  LEU A CD1 1 
ATOM 6611  C CD2 . LEU A 1 861  ? 44.195  37.190  84.832  1.00 68.15  ? 858  LEU A CD2 1 
ATOM 6612  N N   . GLN A 1 862  ? 46.896  39.642  86.724  1.00 67.76  ? 859  GLN A N   1 
ATOM 6613  C CA  . GLN A 1 862  ? 47.054  40.910  87.433  1.00 67.45  ? 859  GLN A CA  1 
ATOM 6614  C C   . GLN A 1 862  ? 45.748  41.722  87.604  1.00 66.97  ? 859  GLN A C   1 
ATOM 6615  O O   . GLN A 1 862  ? 45.056  42.035  86.628  1.00 66.74  ? 859  GLN A O   1 
ATOM 6616  C CB  . GLN A 1 862  ? 48.116  41.731  86.690  1.00 67.61  ? 859  GLN A CB  1 
ATOM 6617  C CG  . GLN A 1 862  ? 48.575  43.035  87.344  1.00 67.87  ? 859  GLN A CG  1 
ATOM 6618  C CD  . GLN A 1 862  ? 49.636  43.751  86.505  1.00 67.89  ? 859  GLN A CD  1 
ATOM 6619  O OE1 . GLN A 1 862  ? 49.784  43.488  85.306  1.00 67.58  ? 859  GLN A OE1 1 
ATOM 6620  N NE2 . GLN A 1 862  ? 50.383  44.654  87.138  1.00 68.85  ? 859  GLN A NE2 1 
ATOM 6621  N N   . THR A 1 863  ? 45.428  42.063  88.854  1.00 66.49  ? 860  THR A N   1 
ATOM 6622  C CA  . THR A 1 863  ? 44.293  42.944  89.164  1.00 65.87  ? 860  THR A CA  1 
ATOM 6623  C C   . THR A 1 863  ? 44.688  44.393  88.861  1.00 65.59  ? 860  THR A C   1 
ATOM 6624  O O   . THR A 1 863  ? 45.416  45.018  89.639  1.00 65.52  ? 860  THR A O   1 
ATOM 6625  C CB  . THR A 1 863  ? 43.839  42.825  90.651  1.00 65.77  ? 860  THR A CB  1 
ATOM 6626  O OG1 . THR A 1 863  ? 43.800  41.450  91.053  1.00 65.54  ? 860  THR A OG1 1 
ATOM 6627  C CG2 . THR A 1 863  ? 42.464  43.442  90.846  1.00 65.37  ? 860  THR A CG2 1 
ATOM 6628  N N   . VAL A 1 864  ? 44.203  44.917  87.734  1.00 65.09  ? 861  VAL A N   1 
ATOM 6629  C CA  . VAL A 1 864  ? 44.634  46.228  87.229  1.00 64.48  ? 861  VAL A CA  1 
ATOM 6630  C C   . VAL A 1 864  ? 43.873  47.399  87.834  1.00 64.12  ? 861  VAL A C   1 
ATOM 6631  O O   . VAL A 1 864  ? 44.484  48.340  88.334  1.00 64.22  ? 861  VAL A O   1 
ATOM 6632  C CB  . VAL A 1 864  ? 44.549  46.313  85.692  1.00 64.47  ? 861  VAL A CB  1 
ATOM 6633  C CG1 . VAL A 1 864  ? 45.270  47.563  85.182  1.00 64.28  ? 861  VAL A CG1 1 
ATOM 6634  C CG2 . VAL A 1 864  ? 45.131  45.064  85.069  1.00 64.38  ? 861  VAL A CG2 1 
ATOM 6635  N N   . ALA A 1 865  ? 42.549  47.356  87.773  1.00 63.73  ? 862  ALA A N   1 
ATOM 6636  C CA  . ALA A 1 865  ? 41.740  48.452  88.289  1.00 63.62  ? 862  ALA A CA  1 
ATOM 6637  C C   . ALA A 1 865  ? 40.376  47.972  88.735  1.00 63.55  ? 862  ALA A C   1 
ATOM 6638  O O   . ALA A 1 865  ? 39.739  47.174  88.047  1.00 63.64  ? 862  ALA A O   1 
ATOM 6639  C CB  . ALA A 1 865  ? 41.595  49.547  87.246  1.00 63.65  ? 862  ALA A CB  1 
ATOM 6640  N N   . GLU A 1 866  ? 39.934  48.462  89.888  1.00 63.41  ? 863  GLU A N   1 
ATOM 6641  C CA  . GLU A 1 866  ? 38.601  48.148  90.385  1.00 63.58  ? 863  GLU A CA  1 
ATOM 6642  C C   . GLU A 1 866  ? 37.709  49.392  90.455  1.00 63.45  ? 863  GLU A C   1 
ATOM 6643  O O   . GLU A 1 866  ? 38.200  50.522  90.356  1.00 63.70  ? 863  GLU A O   1 
ATOM 6644  C CB  . GLU A 1 866  ? 38.669  47.413  91.729  1.00 63.46  ? 863  GLU A CB  1 
ATOM 6645  C CG  . GLU A 1 866  ? 39.210  48.225  92.902  1.00 64.00  ? 863  GLU A CG  1 
ATOM 6646  C CD  . GLU A 1 866  ? 39.269  47.424  94.202  1.00 64.12  ? 863  GLU A CD  1 
ATOM 6647  O OE1 . GLU A 1 866  ? 38.395  46.549  94.415  1.00 64.74  ? 863  GLU A OE1 1 
ATOM 6648  O OE2 . GLU A 1 866  ? 40.192  47.673  95.013  1.00 64.94  ? 863  GLU A OE2 1 
ATOM 6649  N N   . LYS A 1 867  ? 36.403  49.170  90.601  1.00 63.12  ? 864  LYS A N   1 
ATOM 6650  C CA  . LYS A 1 867  ? 35.425  50.246  90.681  1.00 62.96  ? 864  LYS A CA  1 
ATOM 6651  C C   . LYS A 1 867  ? 34.173  49.762  91.406  1.00 62.90  ? 864  LYS A C   1 
ATOM 6652  O O   . LYS A 1 867  ? 33.697  48.661  91.141  1.00 63.13  ? 864  LYS A O   1 
ATOM 6653  C CB  . LYS A 1 867  ? 35.060  50.731  89.275  1.00 62.88  ? 864  LYS A CB  1 
ATOM 6654  C CG  . LYS A 1 867  ? 34.426  52.124  89.220  1.00 63.15  ? 864  LYS A CG  1 
ATOM 6655  C CD  . LYS A 1 867  ? 35.455  53.231  89.433  1.00 62.53  ? 864  LYS A CD  1 
ATOM 6656  C CE  . LYS A 1 867  ? 34.813  54.592  89.357  1.00 61.80  ? 864  LYS A CE  1 
ATOM 6657  N NZ  . LYS A 1 867  ? 35.840  55.621  89.086  1.00 61.57  ? 864  LYS A NZ  1 
ATOM 6658  N N   . GLU A 1 868  ? 33.642  50.576  92.316  1.00 62.73  ? 865  GLU A N   1 
ATOM 6659  C CA  . GLU A 1 868  ? 32.418  50.219  93.037  1.00 62.61  ? 865  GLU A CA  1 
ATOM 6660  C C   . GLU A 1 868  ? 31.158  50.649  92.281  1.00 62.33  ? 865  GLU A C   1 
ATOM 6661  O O   . GLU A 1 868  ? 31.194  51.588  91.487  1.00 62.28  ? 865  GLU A O   1 
ATOM 6662  C CB  . GLU A 1 868  ? 32.425  50.791  94.462  1.00 62.74  ? 865  GLU A CB  1 
ATOM 6663  C CG  . GLU A 1 868  ? 31.099  50.602  95.221  1.00 63.55  ? 865  GLU A CG  1 
ATOM 6664  C CD  . GLU A 1 868  ? 31.250  50.540  96.738  1.00 64.62  ? 865  GLU A CD  1 
ATOM 6665  O OE1 . GLU A 1 868  ? 30.677  49.604  97.342  1.00 65.06  ? 865  GLU A OE1 1 
ATOM 6666  O OE2 . GLU A 1 868  ? 31.925  51.416  97.329  1.00 64.80  ? 865  GLU A OE2 1 
ATOM 6667  N N   . VAL A 1 869  ? 30.060  49.937  92.534  1.00 62.08  ? 866  VAL A N   1 
ATOM 6668  C CA  . VAL A 1 869  ? 28.751  50.224  91.948  1.00 61.89  ? 866  VAL A CA  1 
ATOM 6669  C C   . VAL A 1 869  ? 27.649  49.858  92.932  1.00 61.95  ? 866  VAL A C   1 
ATOM 6670  O O   . VAL A 1 869  ? 27.762  48.868  93.655  1.00 61.81  ? 866  VAL A O   1 
ATOM 6671  C CB  . VAL A 1 869  ? 28.505  49.454  90.621  1.00 61.80  ? 866  VAL A CB  1 
ATOM 6672  C CG1 . VAL A 1 869  ? 29.044  50.224  89.429  1.00 61.34  ? 866  VAL A CG1 1 
ATOM 6673  C CG2 . VAL A 1 869  ? 29.094  48.050  90.678  1.00 61.74  ? 866  VAL A CG2 1 
ATOM 6674  N N   . LYS A 1 870  ? 26.584  50.657  92.946  1.00 62.22  ? 867  LYS A N   1 
ATOM 6675  C CA  . LYS A 1 870  ? 25.461  50.449  93.870  1.00 62.45  ? 867  LYS A CA  1 
ATOM 6676  C C   . LYS A 1 870  ? 24.354  49.610  93.239  1.00 62.60  ? 867  LYS A C   1 
ATOM 6677  O O   . LYS A 1 870  ? 23.185  50.022  93.178  1.00 62.59  ? 867  LYS A O   1 
ATOM 6678  C CB  . LYS A 1 870  ? 24.920  51.784  94.394  1.00 62.33  ? 867  LYS A CB  1 
ATOM 6679  C CG  . LYS A 1 870  ? 25.759  52.385  95.512  1.00 61.98  ? 867  LYS A CG  1 
ATOM 6680  C CD  . LYS A 1 870  ? 25.817  53.898  95.379  1.00 62.20  ? 867  LYS A CD  1 
ATOM 6681  C CE  . LYS A 1 870  ? 26.685  54.333  94.190  1.00 61.86  ? 867  LYS A CE  1 
ATOM 6682  N NZ  . LYS A 1 870  ? 26.376  55.713  93.708  1.00 61.15  ? 867  LYS A NZ  1 
ATOM 6683  N N   . GLY A 1 871  ? 24.744  48.421  92.787  1.00 62.63  ? 868  GLY A N   1 
ATOM 6684  C CA  . GLY A 1 871  ? 23.831  47.491  92.144  1.00 62.87  ? 868  GLY A CA  1 
ATOM 6685  C C   . GLY A 1 871  ? 24.591  46.494  91.295  1.00 63.00  ? 868  GLY A C   1 
ATOM 6686  O O   . GLY A 1 871  ? 25.755  46.720  90.959  1.00 63.17  ? 868  GLY A O   1 
ATOM 6687  N N   . ALA A 1 872  ? 23.924  45.392  90.954  1.00 62.98  ? 869  ALA A N   1 
ATOM 6688  C CA  . ALA A 1 872  ? 24.521  44.286  90.201  1.00 62.72  ? 869  ALA A CA  1 
ATOM 6689  C C   . ALA A 1 872  ? 24.934  44.676  88.787  1.00 62.59  ? 869  ALA A C   1 
ATOM 6690  O O   . ALA A 1 872  ? 24.228  45.423  88.111  1.00 62.41  ? 869  ALA A O   1 
ATOM 6691  C CB  . ALA A 1 872  ? 23.554  43.119  90.156  1.00 62.74  ? 869  ALA A CB  1 
ATOM 6692  N N   . VAL A 1 873  ? 26.078  44.162  88.345  1.00 62.55  ? 870  VAL A N   1 
ATOM 6693  C CA  . VAL A 1 873  ? 26.540  44.395  86.978  1.00 62.63  ? 870  VAL A CA  1 
ATOM 6694  C C   . VAL A 1 873  ? 26.104  43.226  86.083  1.00 62.65  ? 870  VAL A C   1 
ATOM 6695  O O   . VAL A 1 873  ? 26.808  42.222  85.965  1.00 62.52  ? 870  VAL A O   1 
ATOM 6696  C CB  . VAL A 1 873  ? 28.070  44.627  86.903  1.00 62.54  ? 870  VAL A CB  1 
ATOM 6697  C CG1 . VAL A 1 873  ? 28.425  45.294  85.603  1.00 63.00  ? 870  VAL A CG1 1 
ATOM 6698  C CG2 . VAL A 1 873  ? 28.542  45.496  88.037  1.00 62.30  ? 870  VAL A CG2 1 
ATOM 6699  N N   . TYR A 1 874  ? 24.935  43.372  85.461  1.00 62.73  ? 871  TYR A N   1 
ATOM 6700  C CA  . TYR A 1 874  ? 24.284  42.272  84.745  1.00 62.66  ? 871  TYR A CA  1 
ATOM 6701  C C   . TYR A 1 874  ? 24.991  41.890  83.459  1.00 62.77  ? 871  TYR A C   1 
ATOM 6702  O O   . TYR A 1 874  ? 25.352  40.729  83.266  1.00 62.97  ? 871  TYR A O   1 
ATOM 6703  C CB  . TYR A 1 874  ? 22.801  42.567  84.512  1.00 62.54  ? 871  TYR A CB  1 
ATOM 6704  C CG  . TYR A 1 874  ? 22.021  42.510  85.791  1.00 62.09  ? 871  TYR A CG  1 
ATOM 6705  C CD1 . TYR A 1 874  ? 21.763  43.665  86.517  1.00 62.55  ? 871  TYR A CD1 1 
ATOM 6706  C CD2 . TYR A 1 874  ? 21.578  41.296  86.301  1.00 61.53  ? 871  TYR A CD2 1 
ATOM 6707  C CE1 . TYR A 1 874  ? 21.056  43.620  87.714  1.00 63.08  ? 871  TYR A CE1 1 
ATOM 6708  C CE2 . TYR A 1 874  ? 20.875  41.235  87.491  1.00 62.28  ? 871  TYR A CE2 1 
ATOM 6709  C CZ  . TYR A 1 874  ? 20.616  42.402  88.203  1.00 62.93  ? 871  TYR A CZ  1 
ATOM 6710  O OH  . TYR A 1 874  ? 19.916  42.362  89.398  1.00 62.59  ? 871  TYR A OH  1 
ATOM 6711  N N   . SER A 1 875  ? 25.194  42.858  82.580  1.00 62.78  ? 872  SER A N   1 
ATOM 6712  C CA  . SER A 1 875  ? 26.090  42.637  81.458  1.00 63.05  ? 872  SER A CA  1 
ATOM 6713  C C   . SER A 1 875  ? 26.966  43.866  81.211  1.00 63.24  ? 872  SER A C   1 
ATOM 6714  O O   . SER A 1 875  ? 26.901  44.849  81.970  1.00 63.30  ? 872  SER A O   1 
ATOM 6715  C CB  . SER A 1 875  ? 25.331  42.183  80.204  1.00 62.78  ? 872  SER A CB  1 
ATOM 6716  O OG  . SER A 1 875  ? 24.341  43.117  79.847  1.00 62.78  ? 872  SER A OG  1 
ATOM 6717  N N   . MET A 1 876  ? 27.812  43.773  80.182  1.00 63.23  ? 873  MET A N   1 
ATOM 6718  C CA  . MET A 1 876  ? 28.713  44.849  79.769  1.00 63.22  ? 873  MET A CA  1 
ATOM 6719  C C   . MET A 1 876  ? 29.384  44.492  78.458  1.00 63.27  ? 873  MET A C   1 
ATOM 6720  O O   . MET A 1 876  ? 29.753  43.342  78.240  1.00 63.49  ? 873  MET A O   1 
ATOM 6721  C CB  . MET A 1 876  ? 29.770  45.147  80.832  1.00 63.08  ? 873  MET A CB  1 
ATOM 6722  C CG  . MET A 1 876  ? 30.208  43.948  81.642  1.00 63.02  ? 873  MET A CG  1 
ATOM 6723  S SD  . MET A 1 876  ? 31.732  44.252  82.545  1.00 63.46  ? 873  MET A SD  1 
ATOM 6724  C CE  . MET A 1 876  ? 31.306  45.742  83.445  1.00 63.18  ? 873  MET A CE  1 
ATOM 6725  N N   . VAL A 1 877  ? 29.534  45.485  77.587  1.00 63.34  ? 874  VAL A N   1 
ATOM 6726  C CA  . VAL A 1 877  ? 30.135  45.284  76.270  1.00 63.35  ? 874  VAL A CA  1 
ATOM 6727  C C   . VAL A 1 877  ? 31.150  46.385  75.978  1.00 63.51  ? 874  VAL A C   1 
ATOM 6728  O O   . VAL A 1 877  ? 31.042  47.486  76.524  1.00 63.65  ? 874  VAL A O   1 
ATOM 6729  C CB  . VAL A 1 877  ? 29.058  45.250  75.159  1.00 63.22  ? 874  VAL A CB  1 
ATOM 6730  C CG1 . VAL A 1 877  ? 28.186  46.493  75.209  1.00 62.92  ? 874  VAL A CG1 1 
ATOM 6731  C CG2 . VAL A 1 877  ? 29.701  45.094  73.779  1.00 63.48  ? 874  VAL A CG2 1 
ATOM 6732  N N   . GLU A 1 878  ? 32.140  46.080  75.137  1.00 63.64  ? 875  GLU A N   1 
ATOM 6733  C CA  . GLU A 1 878  ? 33.061  47.096  74.621  1.00 63.68  ? 875  GLU A CA  1 
ATOM 6734  C C   . GLU A 1 878  ? 32.311  47.930  73.605  1.00 63.42  ? 875  GLU A C   1 
ATOM 6735  O O   . GLU A 1 878  ? 31.918  47.422  72.549  1.00 63.58  ? 875  GLU A O   1 
ATOM 6736  C CB  . GLU A 1 878  ? 34.288  46.453  73.964  1.00 63.84  ? 875  GLU A CB  1 
ATOM 6737  C CG  . GLU A 1 878  ? 35.285  47.441  73.341  1.00 65.00  ? 875  GLU A CG  1 
ATOM 6738  C CD  . GLU A 1 878  ? 34.967  47.824  71.887  1.00 67.14  ? 875  GLU A CD  1 
ATOM 6739  O OE1 . GLU A 1 878  ? 34.336  47.018  71.158  1.00 67.98  ? 875  GLU A OE1 1 
ATOM 6740  O OE2 . GLU A 1 878  ? 35.366  48.939  71.464  1.00 67.83  ? 875  GLU A OE2 1 
ATOM 6741  N N   . PHE A 1 879  ? 32.101  49.204  73.928  1.00 63.09  ? 876  PHE A N   1 
ATOM 6742  C CA  . PHE A 1 879  ? 31.390  50.099  73.025  1.00 62.71  ? 876  PHE A CA  1 
ATOM 6743  C C   . PHE A 1 879  ? 32.335  50.664  71.961  1.00 62.50  ? 876  PHE A C   1 
ATOM 6744  O O   . PHE A 1 879  ? 32.393  50.131  70.842  1.00 62.73  ? 876  PHE A O   1 
ATOM 6745  C CB  . PHE A 1 879  ? 30.659  51.201  73.794  1.00 62.63  ? 876  PHE A CB  1 
ATOM 6746  C CG  . PHE A 1 879  ? 29.612  51.911  72.982  1.00 62.51  ? 876  PHE A CG  1 
ATOM 6747  C CD1 . PHE A 1 879  ? 28.469  51.244  72.560  1.00 61.91  ? 876  PHE A CD1 1 
ATOM 6748  C CD2 . PHE A 1 879  ? 29.765  53.252  72.646  1.00 62.47  ? 876  PHE A CD2 1 
ATOM 6749  C CE1 . PHE A 1 879  ? 27.507  51.894  71.815  1.00 61.66  ? 876  PHE A CE1 1 
ATOM 6750  C CE2 . PHE A 1 879  ? 28.801  53.909  71.901  1.00 62.07  ? 876  PHE A CE2 1 
ATOM 6751  C CZ  . PHE A 1 879  ? 27.669  53.225  71.488  1.00 62.12  ? 876  PHE A CZ  1 
ATOM 6752  N N   . ASN A 1 880  ? 33.075  51.718  72.308  1.00 61.81  ? 877  ASN A N   1 
ATOM 6753  C CA  . ASN A 1 880  ? 34.042  52.313  71.395  1.00 61.36  ? 877  ASN A CA  1 
ATOM 6754  C C   . ASN A 1 880  ? 35.304  52.743  72.134  1.00 61.30  ? 877  ASN A C   1 
ATOM 6755  O O   . ASN A 1 880  ? 35.597  53.940  72.262  1.00 61.41  ? 877  ASN A O   1 
ATOM 6756  C CB  . ASN A 1 880  ? 33.420  53.492  70.640  1.00 61.32  ? 877  ASN A CB  1 
ATOM 6757  C CG  . ASN A 1 880  ? 32.534  53.053  69.486  1.00 60.73  ? 877  ASN A CG  1 
ATOM 6758  O OD1 . ASN A 1 880  ? 32.916  52.211  68.671  1.00 60.17  ? 877  ASN A OD1 1 
ATOM 6759  N ND2 . ASN A 1 880  ? 31.347  53.639  69.401  1.00 60.12  ? 877  ASN A ND2 1 
ATOM 6760  N N   . GLY A 1 881  ? 36.053  51.756  72.619  1.00 61.04  ? 878  GLY A N   1 
ATOM 6761  C CA  . GLY A 1 881  ? 37.176  52.011  73.524  1.00 60.67  ? 878  GLY A CA  1 
ATOM 6762  C C   . GLY A 1 881  ? 36.676  52.394  74.909  1.00 60.35  ? 878  GLY A C   1 
ATOM 6763  O O   . GLY A 1 881  ? 37.462  52.769  75.791  1.00 60.28  ? 878  GLY A O   1 
ATOM 6764  N N   . LYS A 1 882  ? 35.356  52.293  75.079  1.00 59.97  ? 879  LYS A N   1 
ATOM 6765  C CA  . LYS A 1 882  ? 34.648  52.651  76.303  1.00 59.49  ? 879  LYS A CA  1 
ATOM 6766  C C   . LYS A 1 882  ? 33.868  51.419  76.759  1.00 59.39  ? 879  LYS A C   1 
ATOM 6767  O O   . LYS A 1 882  ? 33.428  50.629  75.922  1.00 59.43  ? 879  LYS A O   1 
ATOM 6768  C CB  . LYS A 1 882  ? 33.692  53.825  76.048  1.00 59.41  ? 879  LYS A CB  1 
ATOM 6769  C CG  . LYS A 1 882  ? 34.329  55.016  75.326  1.00 59.14  ? 879  LYS A CG  1 
ATOM 6770  C CD  . LYS A 1 882  ? 33.388  56.206  75.231  1.00 59.10  ? 879  LYS A CD  1 
ATOM 6771  C CE  . LYS A 1 882  ? 33.790  57.164  74.109  1.00 57.88  ? 879  LYS A CE  1 
ATOM 6772  N NZ  . LYS A 1 882  ? 33.309  56.721  72.766  1.00 56.84  ? 879  LYS A NZ  1 
ATOM 6773  N N   . LEU A 1 883  ? 33.702  51.260  78.074  1.00 59.18  ? 880  LEU A N   1 
ATOM 6774  C CA  . LEU A 1 883  ? 33.020  50.092  78.648  1.00 58.86  ? 880  LEU A CA  1 
ATOM 6775  C C   . LEU A 1 883  ? 31.594  50.404  79.040  1.00 58.71  ? 880  LEU A C   1 
ATOM 6776  O O   . LEU A 1 883  ? 31.348  51.333  79.803  1.00 58.65  ? 880  LEU A O   1 
ATOM 6777  C CB  . LEU A 1 883  ? 33.753  49.573  79.880  1.00 58.86  ? 880  LEU A CB  1 
ATOM 6778  C CG  . LEU A 1 883  ? 33.131  48.310  80.474  1.00 58.45  ? 880  LEU A CG  1 
ATOM 6779  C CD1 . LEU A 1 883  ? 33.773  47.104  79.833  1.00 58.63  ? 880  LEU A CD1 1 
ATOM 6780  C CD2 . LEU A 1 883  ? 33.289  48.272  81.980  1.00 57.90  ? 880  LEU A CD2 1 
ATOM 6781  N N   . LEU A 1 884  ? 30.669  49.585  78.552  1.00 58.61  ? 881  LEU A N   1 
ATOM 6782  C CA  . LEU A 1 884  ? 29.240  49.849  78.689  1.00 58.64  ? 881  LEU A CA  1 
ATOM 6783  C C   . LEU A 1 884  ? 28.515  48.829  79.558  1.00 58.52  ? 881  LEU A C   1 
ATOM 6784  O O   . LEU A 1 884  ? 28.111  47.767  79.086  1.00 58.25  ? 881  LEU A O   1 
ATOM 6785  C CB  . LEU A 1 884  ? 28.597  49.933  77.303  1.00 58.75  ? 881  LEU A CB  1 
ATOM 6786  C CG  . LEU A 1 884  ? 27.086  49.818  77.099  1.00 58.61  ? 881  LEU A CG  1 
ATOM 6787  C CD1 . LEU A 1 884  ? 26.288  50.788  77.966  1.00 58.50  ? 881  LEU A CD1 1 
ATOM 6788  C CD2 . LEU A 1 884  ? 26.837  50.063  75.638  1.00 58.70  ? 881  LEU A CD2 1 
ATOM 6789  N N   . ALA A 1 885  ? 28.322  49.187  80.821  1.00 58.62  ? 882  ALA A N   1 
ATOM 6790  C CA  . ALA A 1 885  ? 27.757  48.271  81.792  1.00 58.88  ? 882  ALA A CA  1 
ATOM 6791  C C   . ALA A 1 885  ? 26.321  48.601  82.157  1.00 59.22  ? 882  ALA A C   1 
ATOM 6792  O O   . ALA A 1 885  ? 25.887  49.757  82.080  1.00 59.22  ? 882  ALA A O   1 
ATOM 6793  C CB  . ALA A 1 885  ? 28.607  48.241  83.026  1.00 58.88  ? 882  ALA A CB  1 
ATOM 6794  N N   . SER A 1 886  ? 25.594  47.561  82.550  1.00 59.52  ? 883  SER A N   1 
ATOM 6795  C CA  . SER A 1 886  ? 24.246  47.695  83.076  1.00 59.92  ? 883  SER A CA  1 
ATOM 6796  C C   . SER A 1 886  ? 24.284  47.396  84.570  1.00 60.07  ? 883  SER A C   1 
ATOM 6797  O O   . SER A 1 886  ? 24.558  46.266  84.987  1.00 60.01  ? 883  SER A O   1 
ATOM 6798  C CB  . SER A 1 886  ? 23.312  46.736  82.354  1.00 59.95  ? 883  SER A CB  1 
ATOM 6799  O OG  . SER A 1 886  ? 23.973  45.503  82.131  1.00 60.64  ? 883  SER A OG  1 
ATOM 6800  N N   . ILE A 1 887  ? 23.947  48.399  85.378  1.00 44.56  ? 884  ILE A N   1 
ATOM 6801  C CA  . ILE A 1 887  ? 24.036  48.272  86.833  1.00 44.56  ? 884  ILE A CA  1 
ATOM 6802  C C   . ILE A 1 887  ? 22.712  48.276  87.613  1.00 44.56  ? 884  ILE A C   1 
ATOM 6803  O O   . ILE A 1 887  ? 22.483  49.152  88.446  1.00 44.56  ? 884  ILE A O   1 
ATOM 6804  C CB  . ILE A 1 887  ? 24.954  49.361  87.429  1.00 37.65  ? 884  ILE A CB  1 
ATOM 6805  C CG1 . ILE A 1 887  ? 26.343  49.297  86.790  1.00 37.65  ? 884  ILE A CG1 1 
ATOM 6806  C CG2 . ILE A 1 887  ? 25.048  49.211  88.939  1.00 37.65  ? 884  ILE A CG2 1 
ATOM 6807  C CD1 . ILE A 1 887  ? 26.336  49.508  85.292  1.00 37.65  ? 884  ILE A CD1 1 
ATOM 6808  N N   . ASN A 1 888  ? 21.857  47.288  87.358  1.00 51.78  ? 885  ASN A N   1 
ATOM 6809  C CA  . ASN A 1 888  ? 20.725  46.994  88.237  1.00 51.78  ? 885  ASN A CA  1 
ATOM 6810  C C   . ASN A 1 888  ? 19.661  47.678  87.606  1.00 51.78  ? 885  ASN A C   1 
ATOM 6811  O O   . ASN A 1 888  ? 18.492  47.362  87.711  1.00 51.78  ? 885  ASN A O   1 
ATOM 6812  C CB  . ASN A 1 888  ? 20.968  47.710  89.547  1.00 50.72  ? 885  ASN A CB  1 
ATOM 6813  C CG  . ASN A 1 888  ? 20.319  47.031  90.721  1.00 50.72  ? 885  ASN A CG  1 
ATOM 6814  O OD1 . ASN A 1 888  ? 20.602  47.342  91.863  1.00 50.72  ? 885  ASN A OD1 1 
ATOM 6815  N ND2 . ASN A 1 888  ? 19.426  46.123  90.447  1.00 50.72  ? 885  ASN A ND2 1 
ATOM 6816  N N   . SER A 1 889  ? 19.933  48.734  86.908  1.00 38.53  ? 886  SER A N   1 
ATOM 6817  C CA  . SER A 1 889  ? 18.764  49.373  86.363  1.00 38.53  ? 886  SER A CA  1 
ATOM 6818  C C   . SER A 1 889  ? 19.128  50.678  85.800  1.00 38.53  ? 886  SER A C   1 
ATOM 6819  O O   . SER A 1 889  ? 18.287  51.420  85.376  1.00 38.53  ? 886  SER A O   1 
ATOM 6820  C CB  . SER A 1 889  ? 17.756  49.590  87.457  1.00 38.65  ? 886  SER A CB  1 
ATOM 6821  O OG  . SER A 1 889  ? 17.329  50.921  87.406  1.00 38.65  ? 886  SER A OG  1 
ATOM 6822  N N   . THR A 1 890  ? 20.367  51.148  86.238  1.00 61.64  ? 887  THR A N   1 
ATOM 6823  C CA  . THR A 1 890  ? 21.044  52.206  85.490  1.00 61.65  ? 887  THR A CA  1 
ATOM 6824  C C   . THR A 1 890  ? 21.994  51.589  84.462  1.00 61.51  ? 887  THR A C   1 
ATOM 6825  O O   . THR A 1 890  ? 22.758  50.680  84.795  1.00 61.55  ? 887  THR A O   1 
ATOM 6826  C CB  . THR A 1 890  ? 21.861  53.110  86.449  1.00 61.76  ? 887  THR A CB  1 
ATOM 6827  O OG1 . THR A 1 890  ? 20.978  53.772  87.366  1.00 62.40  ? 887  THR A OG1 1 
ATOM 6828  C CG2 . THR A 1 890  ? 22.662  54.158  85.681  1.00 61.91  ? 887  THR A CG2 1 
ATOM 6829  N N   . VAL A 1 891  ? 21.946  52.082  83.221  1.00 61.31  ? 888  VAL A N   1 
ATOM 6830  C CA  . VAL A 1 891  ? 22.846  51.620  82.148  1.00 60.92  ? 888  VAL A CA  1 
ATOM 6831  C C   . VAL A 1 891  ? 23.872  52.709  81.816  1.00 60.72  ? 888  VAL A C   1 
ATOM 6832  O O   . VAL A 1 891  ? 23.529  53.724  81.229  1.00 60.68  ? 888  VAL A O   1 
ATOM 6833  C CB  . VAL A 1 891  ? 22.053  51.179  80.886  1.00 60.90  ? 888  VAL A CB  1 
ATOM 6834  C CG1 . VAL A 1 891  ? 22.948  51.124  79.656  1.00 60.80  ? 888  VAL A CG1 1 
ATOM 6835  C CG2 . VAL A 1 891  ? 21.402  49.830  81.118  1.00 60.41  ? 888  VAL A CG2 1 
ATOM 6836  N N   . ARG A 1 892  ? 25.132  52.465  82.163  1.00 60.51  ? 889  ARG A N   1 
ATOM 6837  C CA  . ARG A 1 892  ? 26.143  53.525  82.276  1.00 60.26  ? 889  ARG A CA  1 
ATOM 6838  C C   . ARG A 1 892  ? 27.376  53.317  81.398  1.00 60.46  ? 889  ARG A C   1 
ATOM 6839  O O   . ARG A 1 892  ? 27.951  52.229  81.365  1.00 60.43  ? 889  ARG A O   1 
ATOM 6840  C CB  . ARG A 1 892  ? 26.573  53.616  83.737  1.00 60.16  ? 889  ARG A CB  1 
ATOM 6841  C CG  . ARG A 1 892  ? 27.526  54.728  84.074  1.00 58.90  ? 889  ARG A CG  1 
ATOM 6842  C CD  . ARG A 1 892  ? 28.259  54.440  85.376  1.00 56.59  ? 889  ARG A CD  1 
ATOM 6843  N NE  . ARG A 1 892  ? 27.463  53.727  86.375  1.00 54.11  ? 889  ARG A NE  1 
ATOM 6844  C CZ  . ARG A 1 892  ? 26.604  54.300  87.210  1.00 53.28  ? 889  ARG A CZ  1 
ATOM 6845  N NH1 . ARG A 1 892  ? 26.396  55.607  87.168  1.00 53.16  ? 889  ARG A NH1 1 
ATOM 6846  N NH2 . ARG A 1 892  ? 25.943  53.558  88.084  1.00 53.23  ? 889  ARG A NH2 1 
ATOM 6847  N N   . LEU A 1 893  ? 27.799  54.374  80.714  1.00 60.76  ? 890  LEU A N   1 
ATOM 6848  C CA  . LEU A 1 893  ? 28.901  54.259  79.770  1.00 61.19  ? 890  LEU A CA  1 
ATOM 6849  C C   . LEU A 1 893  ? 30.216  54.794  80.317  1.00 61.68  ? 890  LEU A C   1 
ATOM 6850  O O   . LEU A 1 893  ? 30.461  55.999  80.304  1.00 61.75  ? 890  LEU A O   1 
ATOM 6851  C CB  . LEU A 1 893  ? 28.561  54.931  78.440  1.00 61.02  ? 890  LEU A CB  1 
ATOM 6852  C CG  . LEU A 1 893  ? 29.621  54.763  77.351  1.00 60.93  ? 890  LEU A CG  1 
ATOM 6853  C CD1 . LEU A 1 893  ? 29.750  53.303  76.934  1.00 60.60  ? 890  LEU A CD1 1 
ATOM 6854  C CD2 . LEU A 1 893  ? 29.299  55.637  76.160  1.00 61.04  ? 890  LEU A CD2 1 
ATOM 6855  N N   . TYR A 1 894  ? 31.063  53.874  80.775  1.00 62.30  ? 891  TYR A N   1 
ATOM 6856  C CA  . TYR A 1 894  ? 32.385  54.194  81.311  1.00 62.63  ? 891  TYR A CA  1 
ATOM 6857  C C   . TYR A 1 894  ? 33.397  54.497  80.214  1.00 63.24  ? 891  TYR A C   1 
ATOM 6858  O O   . TYR A 1 894  ? 33.247  54.041  79.082  1.00 63.24  ? 891  TYR A O   1 
ATOM 6859  C CB  . TYR A 1 894  ? 32.894  53.024  82.144  1.00 62.26  ? 891  TYR A CB  1 
ATOM 6860  C CG  . TYR A 1 894  ? 32.176  52.839  83.454  1.00 61.71  ? 891  TYR A CG  1 
ATOM 6861  C CD1 . TYR A 1 894  ? 31.150  51.907  83.586  1.00 61.32  ? 891  TYR A CD1 1 
ATOM 6862  C CD2 . TYR A 1 894  ? 32.532  53.589  84.568  1.00 61.39  ? 891  TYR A CD2 1 
ATOM 6863  C CE1 . TYR A 1 894  ? 30.497  51.730  84.800  1.00 61.25  ? 891  TYR A CE1 1 
ATOM 6864  C CE2 . TYR A 1 894  ? 31.890  53.422  85.782  1.00 61.42  ? 891  TYR A CE2 1 
ATOM 6865  C CZ  . TYR A 1 894  ? 30.878  52.493  85.895  1.00 61.53  ? 891  TYR A CZ  1 
ATOM 6866  O OH  . TYR A 1 894  ? 30.251  52.343  87.107  1.00 61.58  ? 891  TYR A OH  1 
ATOM 6867  N N   . GLU A 1 895  ? 34.424  55.269  80.561  1.00 64.10  ? 892  GLU A N   1 
ATOM 6868  C CA  . GLU A 1 895  ? 35.561  55.497  79.674  1.00 65.13  ? 892  GLU A CA  1 
ATOM 6869  C C   . GLU A 1 895  ? 36.870  55.219  80.407  1.00 65.68  ? 892  GLU A C   1 
ATOM 6870  O O   . GLU A 1 895  ? 36.891  55.076  81.631  1.00 65.55  ? 892  GLU A O   1 
ATOM 6871  C CB  . GLU A 1 895  ? 35.543  56.915  79.097  1.00 65.04  ? 892  GLU A CB  1 
ATOM 6872  C CG  . GLU A 1 895  ? 36.527  57.134  77.946  1.00 65.27  ? 892  GLU A CG  1 
ATOM 6873  C CD  . GLU A 1 895  ? 36.208  58.364  77.103  1.00 65.68  ? 892  GLU A CD  1 
ATOM 6874  O OE1 . GLU A 1 895  ? 35.310  59.155  77.481  1.00 66.28  ? 892  GLU A OE1 1 
ATOM 6875  O OE2 . GLU A 1 895  ? 36.864  58.534  76.049  1.00 66.45  ? 892  GLU A OE2 1 
ATOM 6876  N N   . TRP A 1 896  ? 37.956  55.148  79.644  1.00 66.64  ? 893  TRP A N   1 
ATOM 6877  C CA  . TRP A 1 896  ? 39.245  54.733  80.172  1.00 67.51  ? 893  TRP A CA  1 
ATOM 6878  C C   . TRP A 1 896  ? 40.292  55.824  80.051  1.00 67.90  ? 893  TRP A C   1 
ATOM 6879  O O   . TRP A 1 896  ? 40.760  56.144  78.957  1.00 67.82  ? 893  TRP A O   1 
ATOM 6880  C CB  . TRP A 1 896  ? 39.713  53.483  79.439  1.00 67.78  ? 893  TRP A CB  1 
ATOM 6881  C CG  . TRP A 1 896  ? 40.831  52.756  80.103  1.00 67.96  ? 893  TRP A CG  1 
ATOM 6882  C CD1 . TRP A 1 896  ? 42.130  52.709  79.694  1.00 68.27  ? 893  TRP A CD1 1 
ATOM 6883  C CD2 . TRP A 1 896  ? 40.749  51.947  81.279  1.00 68.08  ? 893  TRP A CD2 1 
ATOM 6884  N NE1 . TRP A 1 896  ? 42.866  51.921  80.544  1.00 68.55  ? 893  TRP A NE1 1 
ATOM 6885  C CE2 . TRP A 1 896  ? 42.042  51.441  81.528  1.00 68.46  ? 893  TRP A CE2 1 
ATOM 6886  C CE3 . TRP A 1 896  ? 39.708  51.601  82.150  1.00 68.27  ? 893  TRP A CE3 1 
ATOM 6887  C CZ2 . TRP A 1 896  ? 42.326  50.602  82.615  1.00 68.41  ? 893  TRP A CZ2 1 
ATOM 6888  C CZ3 . TRP A 1 896  ? 39.990  50.770  83.234  1.00 68.35  ? 893  TRP A CZ3 1 
ATOM 6889  C CH2 . TRP A 1 896  ? 41.289  50.280  83.454  1.00 68.23  ? 893  TRP A CH2 1 
ATOM 6890  N N   . THR A 1 897  ? 40.660  56.381  81.196  1.00 68.63  ? 894  THR A N   1 
ATOM 6891  C CA  . THR A 1 897  ? 41.705  57.396  81.265  1.00 69.36  ? 894  THR A CA  1 
ATOM 6892  C C   . THR A 1 897  ? 43.065  56.825  80.852  1.00 69.82  ? 894  THR A C   1 
ATOM 6893  O O   . THR A 1 897  ? 43.217  55.619  80.640  1.00 69.95  ? 894  THR A O   1 
ATOM 6894  C CB  . THR A 1 897  ? 41.795  58.048  82.687  1.00 69.32  ? 894  THR A CB  1 
ATOM 6895  O OG1 . THR A 1 897  ? 41.957  57.039  83.696  1.00 68.83  ? 894  THR A OG1 1 
ATOM 6896  C CG2 . THR A 1 897  ? 40.544  58.865  82.986  1.00 69.49  ? 894  THR A CG2 1 
ATOM 6897  N N   . THR A 1 898  ? 44.047  57.704  80.709  1.00 70.37  ? 895  THR A N   1 
ATOM 6898  C CA  . THR A 1 898  ? 45.422  57.265  80.593  1.00 70.96  ? 895  THR A CA  1 
ATOM 6899  C C   . THR A 1 898  ? 45.886  56.822  81.981  1.00 71.27  ? 895  THR A C   1 
ATOM 6900  O O   . THR A 1 898  ? 46.856  56.072  82.103  1.00 71.50  ? 895  THR A O   1 
ATOM 6901  C CB  . THR A 1 898  ? 46.347  58.374  80.026  1.00 71.06  ? 895  THR A CB  1 
ATOM 6902  O OG1 . THR A 1 898  ? 46.142  59.596  80.748  1.00 71.32  ? 895  THR A OG1 1 
ATOM 6903  C CG2 . THR A 1 898  ? 46.075  58.609  78.535  1.00 70.95  ? 895  THR A CG2 1 
ATOM 6904  N N   . GLU A 1 899  ? 45.165  57.276  83.012  1.00 71.57  ? 896  GLU A N   1 
ATOM 6905  C CA  . GLU A 1 899  ? 45.432  56.927  84.419  1.00 71.96  ? 896  GLU A CA  1 
ATOM 6906  C C   . GLU A 1 899  ? 45.441  55.412  84.681  1.00 71.87  ? 896  GLU A C   1 
ATOM 6907  O O   . GLU A 1 899  ? 46.022  54.959  85.676  1.00 71.90  ? 896  GLU A O   1 
ATOM 6908  C CB  . GLU A 1 899  ? 44.391  57.573  85.357  1.00 71.99  ? 896  GLU A CB  1 
ATOM 6909  C CG  . GLU A 1 899  ? 44.227  59.097  85.256  1.00 72.61  ? 896  GLU A CG  1 
ATOM 6910  C CD  . GLU A 1 899  ? 43.017  59.628  86.043  1.00 72.42  ? 896  GLU A CD  1 
ATOM 6911  O OE1 . GLU A 1 899  ? 43.032  59.576  87.294  1.00 72.80  ? 896  GLU A OE1 1 
ATOM 6912  O OE2 . GLU A 1 899  ? 42.055  60.116  85.409  1.00 72.68  ? 896  GLU A OE2 1 
ATOM 6913  N N   . LYS A 1 900  ? 44.810  54.650  83.778  1.00 71.73  ? 897  LYS A N   1 
ATOM 6914  C CA  . LYS A 1 900  ? 44.468  53.226  83.975  1.00 71.51  ? 897  LYS A CA  1 
ATOM 6915  C C   . LYS A 1 900  ? 43.401  53.085  85.071  1.00 71.45  ? 897  LYS A C   1 
ATOM 6916  O O   . LYS A 1 900  ? 43.631  52.492  86.137  1.00 71.21  ? 897  LYS A O   1 
ATOM 6917  C CB  . LYS A 1 900  ? 45.705  52.348  84.240  1.00 71.56  ? 897  LYS A CB  1 
ATOM 6918  C CG  . LYS A 1 900  ? 46.633  52.181  83.039  1.00 71.60  ? 897  LYS A CG  1 
ATOM 6919  C CD  . LYS A 1 900  ? 47.959  51.525  83.430  1.00 71.43  ? 897  LYS A CD  1 
ATOM 6920  C CE  . LYS A 1 900  ? 48.909  51.421  82.241  1.00 70.87  ? 897  LYS A CE  1 
ATOM 6921  N NZ  . LYS A 1 900  ? 48.372  50.543  81.159  1.00 70.28  ? 897  LYS A NZ  1 
ATOM 6922  N N   . ASP A 1 901  ? 42.229  53.653  84.778  1.00 71.42  ? 898  ASP A N   1 
ATOM 6923  C CA  . ASP A 1 901  ? 41.121  53.744  85.724  1.00 71.35  ? 898  ASP A CA  1 
ATOM 6924  C C   . ASP A 1 901  ? 39.806  54.025  84.996  1.00 71.15  ? 898  ASP A C   1 
ATOM 6925  O O   . ASP A 1 901  ? 39.783  54.807  84.044  1.00 71.20  ? 898  ASP A O   1 
ATOM 6926  C CB  . ASP A 1 901  ? 41.400  54.856  86.736  1.00 71.35  ? 898  ASP A CB  1 
ATOM 6927  C CG  . ASP A 1 901  ? 40.702  54.630  88.056  1.00 71.68  ? 898  ASP A CG  1 
ATOM 6928  O OD1 . ASP A 1 901  ? 40.525  53.453  88.456  1.00 71.98  ? 898  ASP A OD1 1 
ATOM 6929  O OD2 . ASP A 1 901  ? 40.336  55.637  88.698  1.00 72.00  ? 898  ASP A OD2 1 
ATOM 6930  N N   . VAL A 1 902  ? 38.720  53.392  85.444  1.00 70.92  ? 899  VAL A N   1 
ATOM 6931  C CA  . VAL A 1 902  ? 37.383  53.606  84.855  1.00 70.72  ? 899  VAL A CA  1 
ATOM 6932  C C   . VAL A 1 902  ? 36.681  54.879  85.365  1.00 70.62  ? 899  VAL A C   1 
ATOM 6933  O O   . VAL A 1 902  ? 36.274  54.960  86.523  1.00 70.27  ? 899  VAL A O   1 
ATOM 6934  C CB  . VAL A 1 902  ? 36.433  52.358  85.010  1.00 70.68  ? 899  VAL A CB  1 
ATOM 6935  C CG1 . VAL A 1 902  ? 36.450  51.482  83.764  1.00 69.88  ? 899  VAL A CG1 1 
ATOM 6936  C CG2 . VAL A 1 902  ? 36.780  51.551  86.241  1.00 70.75  ? 899  VAL A CG2 1 
ATOM 6937  N N   . ARG A 1 903  ? 36.552  55.865  84.481  1.00 70.85  ? 900  ARG A N   1 
ATOM 6938  C CA  . ARG A 1 903  ? 35.830  57.104  84.780  1.00 71.33  ? 900  ARG A CA  1 
ATOM 6939  C C   . ARG A 1 903  ? 34.506  57.167  84.022  1.00 71.67  ? 900  ARG A C   1 
ATOM 6940  O O   . ARG A 1 903  ? 34.400  56.669  82.898  1.00 71.89  ? 900  ARG A O   1 
ATOM 6941  C CB  . ARG A 1 903  ? 36.678  58.335  84.444  1.00 71.32  ? 900  ARG A CB  1 
ATOM 6942  C CG  . ARG A 1 903  ? 35.986  59.660  84.760  1.00 71.20  ? 900  ARG A CG  1 
ATOM 6943  C CD  . ARG A 1 903  ? 36.877  60.847  84.496  1.00 70.80  ? 900  ARG A CD  1 
ATOM 6944  N NE  . ARG A 1 903  ? 37.008  61.127  83.072  1.00 70.18  ? 900  ARG A NE  1 
ATOM 6945  C CZ  . ARG A 1 903  ? 37.937  61.920  82.554  1.00 70.03  ? 900  ARG A CZ  1 
ATOM 6946  N NH1 . ARG A 1 903  ? 38.827  62.514  83.345  1.00 70.00  ? 900  ARG A NH1 1 
ATOM 6947  N NH2 . ARG A 1 903  ? 37.983  62.114  81.244  1.00 69.65  ? 900  ARG A NH2 1 
ATOM 6948  N N   . THR A 1 904  ? 33.510  57.805  84.635  1.00 71.94  ? 901  THR A N   1 
ATOM 6949  C CA  . THR A 1 904  ? 32.145  57.790  84.124  1.00 72.25  ? 901  THR A CA  1 
ATOM 6950  C C   . THR A 1 904  ? 31.919  58.804  83.000  1.00 72.57  ? 901  THR A C   1 
ATOM 6951  O O   . THR A 1 904  ? 32.728  59.704  82.783  1.00 72.55  ? 901  THR A O   1 
ATOM 6952  C CB  . THR A 1 904  ? 31.114  58.000  85.270  1.00 72.24  ? 901  THR A CB  1 
ATOM 6953  O OG1 . THR A 1 904  ? 31.450  57.169  86.388  1.00 71.97  ? 901  THR A OG1 1 
ATOM 6954  C CG2 . THR A 1 904  ? 29.706  57.656  84.815  1.00 72.21  ? 901  THR A CG2 1 
ATOM 6955  N N   . GLU A 1 905  ? 30.814  58.604  82.283  1.00 73.10  ? 902  GLU A N   1 
ATOM 6956  C CA  . GLU A 1 905  ? 30.294  59.489  81.246  1.00 73.66  ? 902  GLU A CA  1 
ATOM 6957  C C   . GLU A 1 905  ? 28.880  58.972  80.938  1.00 74.22  ? 902  GLU A C   1 
ATOM 6958  O O   . GLU A 1 905  ? 28.692  57.768  80.724  1.00 74.34  ? 902  GLU A O   1 
ATOM 6959  C CB  . GLU A 1 905  ? 31.177  59.435  79.995  1.00 73.57  ? 902  GLU A CB  1 
ATOM 6960  C CG  . GLU A 1 905  ? 30.717  60.321  78.836  1.00 73.55  ? 902  GLU A CG  1 
ATOM 6961  C CD  . GLU A 1 905  ? 31.417  59.996  77.516  1.00 73.59  ? 902  GLU A CD  1 
ATOM 6962  O OE1 . GLU A 1 905  ? 32.045  58.918  77.402  1.00 73.17  ? 902  GLU A OE1 1 
ATOM 6963  O OE2 . GLU A 1 905  ? 31.334  60.823  76.583  1.00 73.46  ? 902  GLU A OE2 1 
ATOM 6964  N N   . CYS A 1 906  ? 27.894  59.877  80.936  1.00 74.78  ? 903  CYS A N   1 
ATOM 6965  C CA  . CYS A 1 906  ? 26.450  59.550  80.749  1.00 75.14  ? 903  CYS A CA  1 
ATOM 6966  C C   . CYS A 1 906  ? 25.929  58.348  81.570  1.00 75.33  ? 903  CYS A C   1 
ATOM 6967  O O   . CYS A 1 906  ? 26.656  57.819  82.422  1.00 75.21  ? 903  CYS A O   1 
ATOM 6968  C CB  . CYS A 1 906  ? 26.091  59.412  79.257  1.00 75.09  ? 903  CYS A CB  1 
ATOM 6969  S SG  . CYS A 1 906  ? 26.953  58.105  78.348  1.00 75.06  ? 903  CYS A SG  1 
ATOM 6970  N N   . ASN A 1 907  ? 24.668  57.949  81.345  1.00 75.60  ? 904  ASN A N   1 
ATOM 6971  C CA  . ASN A 1 907  ? 24.146  56.695  81.924  1.00 75.88  ? 904  ASN A CA  1 
ATOM 6972  C C   . ASN A 1 907  ? 22.663  56.284  81.769  1.00 75.96  ? 904  ASN A C   1 
ATOM 6973  O O   . ASN A 1 907  ? 22.197  55.428  82.535  1.00 76.14  ? 904  ASN A O   1 
ATOM 6974  C CB  . ASN A 1 907  ? 24.568  56.538  83.402  1.00 75.91  ? 904  ASN A CB  1 
ATOM 6975  C CG  . ASN A 1 907  ? 23.883  57.521  84.330  1.00 75.97  ? 904  ASN A CG  1 
ATOM 6976  O OD1 . ASN A 1 907  ? 22.960  58.242  83.942  1.00 76.15  ? 904  ASN A OD1 1 
ATOM 6977  N ND2 . ASN A 1 907  ? 24.329  57.541  85.582  1.00 76.06  ? 904  ASN A ND2 1 
ATOM 6978  N N   . HIS A 1 908  ? 21.931  56.839  80.799  1.00 75.87  ? 905  HIS A N   1 
ATOM 6979  C CA  . HIS A 1 908  ? 20.521  56.438  80.593  1.00 75.85  ? 905  HIS A CA  1 
ATOM 6980  C C   . HIS A 1 908  ? 19.803  56.339  81.960  1.00 75.70  ? 905  HIS A C   1 
ATOM 6981  O O   . HIS A 1 908  ? 20.207  57.036  82.893  1.00 75.87  ? 905  HIS A O   1 
ATOM 6982  C CB  . HIS A 1 908  ? 20.458  55.130  79.790  1.00 75.97  ? 905  HIS A CB  1 
ATOM 6983  C CG  . HIS A 1 908  ? 19.074  54.713  79.396  1.00 76.48  ? 905  HIS A CG  1 
ATOM 6984  N ND1 . HIS A 1 908  ? 18.183  55.566  78.778  1.00 76.85  ? 905  HIS A ND1 1 
ATOM 6985  C CD2 . HIS A 1 908  ? 18.437  53.523  79.511  1.00 76.59  ? 905  HIS A CD2 1 
ATOM 6986  C CE1 . HIS A 1 908  ? 17.050  54.924  78.549  1.00 76.82  ? 905  HIS A CE1 1 
ATOM 6987  N NE2 . HIS A 1 908  ? 17.179  53.683  78.984  1.00 76.59  ? 905  HIS A NE2 1 
ATOM 6988  N N   . TYR A 1 909  ? 18.767  55.506  82.102  1.00 75.42  ? 906  TYR A N   1 
ATOM 6989  C CA  . TYR A 1 909  ? 18.056  55.387  83.388  1.00 75.25  ? 906  TYR A CA  1 
ATOM 6990  C C   . TYR A 1 909  ? 16.657  54.799  83.286  1.00 74.96  ? 906  TYR A C   1 
ATOM 6991  O O   . TYR A 1 909  ? 16.102  54.335  84.281  1.00 74.79  ? 906  TYR A O   1 
ATOM 6992  C CB  . TYR A 1 909  ? 17.924  56.760  84.045  1.00 75.59  ? 906  TYR A CB  1 
ATOM 6993  C CG  . TYR A 1 909  ? 18.149  56.774  85.536  1.00 76.02  ? 906  TYR A CG  1 
ATOM 6994  C CD1 . TYR A 1 909  ? 17.111  56.474  86.419  1.00 76.51  ? 906  TYR A CD1 1 
ATOM 6995  C CD2 . TYR A 1 909  ? 19.400  57.111  86.069  1.00 76.20  ? 906  TYR A CD2 1 
ATOM 6996  C CE1 . TYR A 1 909  ? 17.310  56.499  87.794  1.00 76.75  ? 906  TYR A CE1 1 
ATOM 6997  C CE2 . TYR A 1 909  ? 19.613  57.134  87.443  1.00 76.33  ? 906  TYR A CE2 1 
ATOM 6998  C CZ  . TYR A 1 909  ? 18.561  56.830  88.300  1.00 76.47  ? 906  TYR A CZ  1 
ATOM 6999  O OH  . TYR A 1 909  ? 18.747  56.853  89.662  1.00 76.26  ? 906  TYR A OH  1 
ATOM 7000  N N   . ASN A 1 910  ? 16.078  54.859  82.092  1.00 74.78  ? 907  ASN A N   1 
ATOM 7001  C CA  . ASN A 1 910  ? 14.715  54.381  81.858  1.00 74.59  ? 907  ASN A CA  1 
ATOM 7002  C C   . ASN A 1 910  ? 14.660  52.858  81.666  1.00 74.27  ? 907  ASN A C   1 
ATOM 7003  O O   . ASN A 1 910  ? 14.425  52.364  80.555  1.00 74.31  ? 907  ASN A O   1 
ATOM 7004  C CB  . ASN A 1 910  ? 14.092  55.114  80.659  1.00 74.68  ? 907  ASN A CB  1 
ATOM 7005  C CG  . ASN A 1 910  ? 12.568  55.031  80.641  1.00 75.06  ? 907  ASN A CG  1 
ATOM 7006  O OD1 . ASN A 1 910  ? 11.989  53.961  80.438  1.00 75.29  ? 907  ASN A OD1 1 
ATOM 7007  N ND2 . ASN A 1 910  ? 11.914  56.172  80.835  1.00 75.48  ? 907  ASN A ND2 1 
ATOM 7008  N N   . ASN A 1 911  ? 14.888  52.124  82.756  1.00 73.65  ? 908  ASN A N   1 
ATOM 7009  C CA  . ASN A 1 911  ? 14.843  50.661  82.753  1.00 73.05  ? 908  ASN A CA  1 
ATOM 7010  C C   . ASN A 1 911  ? 14.055  50.153  83.952  1.00 72.62  ? 908  ASN A C   1 
ATOM 7011  O O   . ASN A 1 911  ? 13.819  50.904  84.903  1.00 72.79  ? 908  ASN A O   1 
ATOM 7012  C CB  . ASN A 1 911  ? 16.258  50.070  82.803  1.00 73.09  ? 908  ASN A CB  1 
ATOM 7013  C CG  . ASN A 1 911  ? 17.179  50.621  81.717  1.00 73.33  ? 908  ASN A CG  1 
ATOM 7014  O OD1 . ASN A 1 911  ? 16.848  50.610  80.527  1.00 73.32  ? 908  ASN A OD1 1 
ATOM 7015  N ND2 . ASN A 1 911  ? 18.356  51.091  82.128  1.00 73.42  ? 908  ASN A ND2 1 
ATOM 7016  N N   . ILE A 1 912  ? 13.639  48.888  83.909  1.00 71.88  ? 909  ILE A N   1 
ATOM 7017  C CA  . ILE A 1 912  ? 13.107  48.221  85.102  1.00 71.02  ? 909  ILE A CA  1 
ATOM 7018  C C   . ILE A 1 912  ? 14.205  47.381  85.769  1.00 70.45  ? 909  ILE A C   1 
ATOM 7019  O O   . ILE A 1 912  ? 14.372  47.428  86.987  1.00 70.40  ? 909  ILE A O   1 
ATOM 7020  C CB  . ILE A 1 912  ? 11.813  47.412  84.799  1.00 71.08  ? 909  ILE A CB  1 
ATOM 7021  C CG1 . ILE A 1 912  ? 10.590  48.178  85.327  1.00 71.01  ? 909  ILE A CG1 1 
ATOM 7022  C CG2 . ILE A 1 912  ? 11.877  46.006  85.398  1.00 71.12  ? 909  ILE A CG2 1 
ATOM 7023  C CD1 . ILE A 1 912  ? 9.250   47.425  85.247  1.00 70.91  ? 909  ILE A CD1 1 
ATOM 7024  N N   . MET A 1 913  ? 14.945  46.635  84.946  1.00 69.72  ? 910  MET A N   1 
ATOM 7025  C CA  . MET A 1 913  ? 16.125  45.851  85.344  1.00 68.89  ? 910  MET A CA  1 
ATOM 7026  C C   . MET A 1 913  ? 16.880  45.456  84.062  1.00 67.96  ? 910  MET A C   1 
ATOM 7027  O O   . MET A 1 913  ? 16.520  44.481  83.393  1.00 67.81  ? 910  MET A O   1 
ATOM 7028  C CB  . MET A 1 913  ? 15.716  44.609  86.157  1.00 69.02  ? 910  MET A CB  1 
ATOM 7029  C CG  . MET A 1 913  ? 16.853  43.914  86.922  1.00 69.17  ? 910  MET A CG  1 
ATOM 7030  S SD  . MET A 1 913  ? 16.290  42.688  88.146  1.00 69.34  ? 910  MET A SD  1 
ATOM 7031  C CE  . MET A 1 913  ? 16.085  41.189  87.190  1.00 68.23  ? 910  MET A CE  1 
ATOM 7032  N N   . ALA A 1 914  ? 17.909  46.232  83.720  1.00 66.79  ? 911  ALA A N   1 
ATOM 7033  C CA  . ALA A 1 914  ? 18.634  46.075  82.460  1.00 65.81  ? 911  ALA A CA  1 
ATOM 7034  C C   . ALA A 1 914  ? 19.495  44.816  82.451  1.00 65.25  ? 911  ALA A C   1 
ATOM 7035  O O   . ALA A 1 914  ? 20.622  44.820  82.945  1.00 65.26  ? 911  ALA A O   1 
ATOM 7036  C CB  . ALA A 1 914  ? 19.481  47.299  82.191  1.00 65.75  ? 911  ALA A CB  1 
ATOM 7037  N N   . LEU A 1 915  ? 18.962  43.740  81.880  1.00 64.40  ? 912  LEU A N   1 
ATOM 7038  C CA  . LEU A 1 915  ? 19.608  42.438  81.980  1.00 63.58  ? 912  LEU A CA  1 
ATOM 7039  C C   . LEU A 1 915  ? 20.603  42.168  80.878  1.00 63.12  ? 912  LEU A C   1 
ATOM 7040  O O   . LEU A 1 915  ? 21.615  41.510  81.115  1.00 63.51  ? 912  LEU A O   1 
ATOM 7041  C CB  . LEU A 1 915  ? 18.583  41.309  81.997  1.00 63.60  ? 912  LEU A CB  1 
ATOM 7042  C CG  . LEU A 1 915  ? 17.613  41.171  83.168  1.00 64.02  ? 912  LEU A CG  1 
ATOM 7043  C CD1 . LEU A 1 915  ? 17.134  39.728  83.267  1.00 64.24  ? 912  LEU A CD1 1 
ATOM 7044  C CD2 . LEU A 1 915  ? 18.262  41.608  84.472  1.00 64.94  ? 912  LEU A CD2 1 
ATOM 7045  N N   . TYR A 1 916  ? 20.313  42.654  79.674  1.00 62.29  ? 913  TYR A N   1 
ATOM 7046  C CA  . TYR A 1 916  ? 21.131  42.333  78.503  1.00 61.23  ? 913  TYR A CA  1 
ATOM 7047  C C   . TYR A 1 916  ? 21.451  43.556  77.649  1.00 60.90  ? 913  TYR A C   1 
ATOM 7048  O O   . TYR A 1 916  ? 20.678  44.511  77.600  1.00 60.99  ? 913  TYR A O   1 
ATOM 7049  C CB  . TYR A 1 916  ? 20.432  41.280  77.648  1.00 60.85  ? 913  TYR A CB  1 
ATOM 7050  C CG  . TYR A 1 916  ? 19.759  40.185  78.435  1.00 60.25  ? 913  TYR A CG  1 
ATOM 7051  C CD1 . TYR A 1 916  ? 18.383  40.205  78.669  1.00 59.73  ? 913  TYR A CD1 1 
ATOM 7052  C CD2 . TYR A 1 916  ? 20.495  39.129  78.945  1.00 60.45  ? 913  TYR A CD2 1 
ATOM 7053  C CE1 . TYR A 1 916  ? 17.762  39.191  79.391  1.00 59.35  ? 913  TYR A CE1 1 
ATOM 7054  C CE2 . TYR A 1 916  ? 19.886  38.112  79.670  1.00 60.21  ? 913  TYR A CE2 1 
ATOM 7055  C CZ  . TYR A 1 916  ? 18.528  38.149  79.890  1.00 59.76  ? 913  TYR A CZ  1 
ATOM 7056  O OH  . TYR A 1 916  ? 17.961  37.129  80.611  1.00 59.95  ? 913  TYR A OH  1 
ATOM 7057  N N   . LEU A 1 917  ? 22.593  43.506  76.975  1.00 60.43  ? 914  LEU A N   1 
ATOM 7058  C CA  . LEU A 1 917  ? 23.044  44.570  76.099  1.00 60.26  ? 914  LEU A CA  1 
ATOM 7059  C C   . LEU A 1 917  ? 23.677  43.967  74.860  1.00 60.78  ? 914  LEU A C   1 
ATOM 7060  O O   . LEU A 1 917  ? 24.306  42.912  74.946  1.00 61.03  ? 914  LEU A O   1 
ATOM 7061  C CB  . LEU A 1 917  ? 24.103  45.408  76.801  1.00 59.83  ? 914  LEU A CB  1 
ATOM 7062  C CG  . LEU A 1 917  ? 23.738  46.226  78.028  1.00 58.93  ? 914  LEU A CG  1 
ATOM 7063  C CD1 . LEU A 1 917  ? 24.976  46.458  78.859  1.00 58.28  ? 914  LEU A CD1 1 
ATOM 7064  C CD2 . LEU A 1 917  ? 23.122  47.536  77.603  1.00 58.59  ? 914  LEU A CD2 1 
ATOM 7065  N N   . LYS A 1 918  ? 23.511  44.635  73.717  1.00 61.28  ? 915  LYS A N   1 
ATOM 7066  C CA  . LYS A 1 918  ? 24.268  44.337  72.490  1.00 61.76  ? 915  LYS A CA  1 
ATOM 7067  C C   . LYS A 1 918  ? 24.573  45.644  71.768  1.00 62.63  ? 915  LYS A C   1 
ATOM 7068  O O   . LYS A 1 918  ? 23.792  46.596  71.855  1.00 62.89  ? 915  LYS A O   1 
ATOM 7069  C CB  . LYS A 1 918  ? 23.492  43.402  71.556  1.00 61.49  ? 915  LYS A CB  1 
ATOM 7070  C CG  . LYS A 1 918  ? 23.429  41.935  71.979  1.00 60.46  ? 915  LYS A CG  1 
ATOM 7071  C CD  . LYS A 1 918  ? 24.671  41.156  71.576  1.00 58.77  ? 915  LYS A CD  1 
ATOM 7072  C CE  . LYS A 1 918  ? 24.776  39.843  72.333  1.00 57.66  ? 915  LYS A CE  1 
ATOM 7073  N NZ  . LYS A 1 918  ? 23.753  38.853  71.919  1.00 56.88  ? 915  LYS A NZ  1 
ATOM 7074  N N   . THR A 1 919  ? 25.698  45.693  71.058  1.00 63.66  ? 916  THR A N   1 
ATOM 7075  C CA  . THR A 1 919  ? 26.132  46.918  70.374  1.00 64.60  ? 916  THR A CA  1 
ATOM 7076  C C   . THR A 1 919  ? 26.145  46.775  68.857  1.00 65.73  ? 916  THR A C   1 
ATOM 7077  O O   . THR A 1 919  ? 26.880  45.952  68.302  1.00 65.71  ? 916  THR A O   1 
ATOM 7078  C CB  . THR A 1 919  ? 27.531  47.373  70.860  1.00 64.33  ? 916  THR A CB  1 
ATOM 7079  O OG1 . THR A 1 919  ? 27.434  47.837  72.206  1.00 63.74  ? 916  THR A OG1 1 
ATOM 7080  C CG2 . THR A 1 919  ? 28.097  48.496  69.990  1.00 64.15  ? 916  THR A CG2 1 
ATOM 7081  N N   . LYS A 1 920  ? 25.333  47.582  68.183  1.00 67.21  ? 917  LYS A N   1 
ATOM 7082  C CA  . LYS A 1 920  ? 25.460  47.688  66.733  1.00 68.67  ? 917  LYS A CA  1 
ATOM 7083  C C   . LYS A 1 920  ? 26.583  48.664  66.409  1.00 69.24  ? 917  LYS A C   1 
ATOM 7084  O O   . LYS A 1 920  ? 26.432  49.894  66.532  1.00 68.95  ? 917  LYS A O   1 
ATOM 7085  C CB  . LYS A 1 920  ? 24.148  48.084  66.048  1.00 68.94  ? 917  LYS A CB  1 
ATOM 7086  C CG  . LYS A 1 920  ? 24.082  47.741  64.543  1.00 69.95  ? 917  LYS A CG  1 
ATOM 7087  C CD  . LYS A 1 920  ? 24.779  48.771  63.641  1.00 72.11  ? 917  LYS A CD  1 
ATOM 7088  C CE  . LYS A 1 920  ? 24.083  50.145  63.655  1.00 73.52  ? 917  LYS A CE  1 
ATOM 7089  N NZ  . LYS A 1 920  ? 24.605  51.065  64.721  1.00 74.72  ? 917  LYS A NZ  1 
ATOM 7090  N N   . GLY A 1 921  ? 27.712  48.063  66.029  1.00 70.16  ? 918  GLY A N   1 
ATOM 7091  C CA  . GLY A 1 921  ? 28.939  48.735  65.589  1.00 70.97  ? 918  GLY A CA  1 
ATOM 7092  C C   . GLY A 1 921  ? 29.196  50.134  66.100  1.00 71.36  ? 918  GLY A C   1 
ATOM 7093  O O   . GLY A 1 921  ? 30.039  50.343  66.983  1.00 71.54  ? 918  GLY A O   1 
ATOM 7094  N N   . ASP A 1 922  ? 28.450  51.082  65.538  1.00 71.62  ? 919  ASP A N   1 
ATOM 7095  C CA  . ASP A 1 922  ? 28.696  52.504  65.735  1.00 71.76  ? 919  ASP A CA  1 
ATOM 7096  C C   . ASP A 1 922  ? 28.238  53.022  67.098  1.00 71.54  ? 919  ASP A C   1 
ATOM 7097  O O   . ASP A 1 922  ? 28.988  52.958  68.071  1.00 71.57  ? 919  ASP A O   1 
ATOM 7098  C CB  . ASP A 1 922  ? 28.059  53.310  64.599  1.00 71.95  ? 919  ASP A CB  1 
ATOM 7099  C CG  . ASP A 1 922  ? 28.749  54.635  64.376  1.00 72.47  ? 919  ASP A CG  1 
ATOM 7100  O OD1 . ASP A 1 922  ? 29.861  54.824  64.928  1.00 72.39  ? 919  ASP A OD1 1 
ATOM 7101  O OD2 . ASP A 1 922  ? 28.180  55.481  63.647  1.00 73.16  ? 919  ASP A OD2 1 
ATOM 7102  N N   . PHE A 1 923  ? 27.017  53.545  67.164  1.00 71.27  ? 920  PHE A N   1 
ATOM 7103  C CA  . PHE A 1 923  ? 26.506  54.110  68.402  1.00 71.04  ? 920  PHE A CA  1 
ATOM 7104  C C   . PHE A 1 923  ? 25.058  53.689  68.641  1.00 70.64  ? 920  PHE A C   1 
ATOM 7105  O O   . PHE A 1 923  ? 24.151  54.517  68.511  1.00 70.60  ? 920  PHE A O   1 
ATOM 7106  C CB  . PHE A 1 923  ? 26.593  55.649  68.389  1.00 71.41  ? 920  PHE A CB  1 
ATOM 7107  C CG  . PHE A 1 923  ? 27.926  56.215  67.923  1.00 71.98  ? 920  PHE A CG  1 
ATOM 7108  C CD1 . PHE A 1 923  ? 29.103  55.977  68.636  1.00 72.42  ? 920  PHE A CD1 1 
ATOM 7109  C CD2 . PHE A 1 923  ? 27.984  57.042  66.794  1.00 72.41  ? 920  PHE A CD2 1 
ATOM 7110  C CE1 . PHE A 1 923  ? 30.324  56.517  68.207  1.00 72.74  ? 920  PHE A CE1 1 
ATOM 7111  C CE2 . PHE A 1 923  ? 29.196  57.594  66.359  1.00 72.46  ? 920  PHE A CE2 1 
ATOM 7112  C CZ  . PHE A 1 923  ? 30.369  57.328  67.066  1.00 72.58  ? 920  PHE A CZ  1 
ATOM 7113  N N   . ILE A 1 924  ? 24.841  52.417  68.996  1.00 70.11  ? 921  ILE A N   1 
ATOM 7114  C CA  . ILE A 1 924  ? 23.477  51.871  69.176  1.00 69.61  ? 921  ILE A CA  1 
ATOM 7115  C C   . ILE A 1 924  ? 23.389  50.733  70.231  1.00 69.39  ? 921  ILE A C   1 
ATOM 7116  O O   . ILE A 1 924  ? 24.299  49.909  70.335  1.00 69.38  ? 921  ILE A O   1 
ATOM 7117  C CB  . ILE A 1 924  ? 22.814  51.527  67.778  1.00 69.49  ? 921  ILE A CB  1 
ATOM 7118  C CG1 . ILE A 1 924  ? 21.977  52.714  67.276  1.00 69.26  ? 921  ILE A CG1 1 
ATOM 7119  C CG2 . ILE A 1 924  ? 21.936  50.292  67.847  1.00 69.38  ? 921  ILE A CG2 1 
ATOM 7120  C CD1 . ILE A 1 924  ? 21.987  52.929  65.769  1.00 68.92  ? 921  ILE A CD1 1 
ATOM 7121  N N   . LEU A 1 925  ? 22.298  50.716  71.009  1.00 69.05  ? 922  LEU A N   1 
ATOM 7122  C CA  . LEU A 1 925  ? 22.112  49.794  72.144  1.00 68.80  ? 922  LEU A CA  1 
ATOM 7123  C C   . LEU A 1 925  ? 20.687  49.240  72.260  1.00 68.94  ? 922  LEU A C   1 
ATOM 7124  O O   . LEU A 1 925  ? 19.800  49.682  71.535  1.00 68.78  ? 922  LEU A O   1 
ATOM 7125  C CB  . LEU A 1 925  ? 22.441  50.510  73.442  1.00 68.76  ? 922  LEU A CB  1 
ATOM 7126  C CG  . LEU A 1 925  ? 23.868  50.674  73.942  1.00 68.66  ? 922  LEU A CG  1 
ATOM 7127  C CD1 . LEU A 1 925  ? 24.661  51.680  73.135  1.00 68.75  ? 922  LEU A CD1 1 
ATOM 7128  C CD2 . LEU A 1 925  ? 23.761  51.147  75.369  1.00 68.79  ? 922  LEU A CD2 1 
ATOM 7129  N N   . VAL A 1 926  ? 20.465  48.322  73.217  1.00 69.28  ? 923  VAL A N   1 
ATOM 7130  C CA  . VAL A 1 926  ? 19.245  47.470  73.278  1.00 69.50  ? 923  VAL A CA  1 
ATOM 7131  C C   . VAL A 1 926  ? 18.938  46.809  74.677  1.00 69.67  ? 923  VAL A C   1 
ATOM 7132  O O   . VAL A 1 926  ? 19.826  46.727  75.522  1.00 69.75  ? 923  VAL A O   1 
ATOM 7133  C CB  . VAL A 1 926  ? 19.355  46.393  72.143  1.00 69.15  ? 923  VAL A CB  1 
ATOM 7134  C CG1 . VAL A 1 926  ? 20.335  45.311  72.529  1.00 68.94  ? 923  VAL A CG1 1 
ATOM 7135  C CG2 . VAL A 1 926  ? 18.002  45.837  71.731  1.00 68.86  ? 923  VAL A CG2 1 
ATOM 7136  N N   . GLY A 1 927  ? 17.684  46.396  74.932  1.00 69.99  ? 924  GLY A N   1 
ATOM 7137  C CA  . GLY A 1 927  ? 17.357  45.339  75.950  1.00 70.34  ? 924  GLY A CA  1 
ATOM 7138  C C   . GLY A 1 927  ? 16.995  45.623  77.416  1.00 70.70  ? 924  GLY A C   1 
ATOM 7139  O O   . GLY A 1 927  ? 17.621  46.479  78.046  1.00 70.86  ? 924  GLY A O   1 
ATOM 7140  N N   . ASP A 1 928  ? 16.011  44.869  77.956  1.00 70.85  ? 925  ASP A N   1 
ATOM 7141  C CA  . ASP A 1 928  ? 15.461  45.010  79.353  1.00 70.80  ? 925  ASP A CA  1 
ATOM 7142  C C   . ASP A 1 928  ? 15.084  43.642  79.999  1.00 70.81  ? 925  ASP A C   1 
ATOM 7143  O O   . ASP A 1 928  ? 15.584  42.613  79.553  1.00 70.94  ? 925  ASP A O   1 
ATOM 7144  C CB  . ASP A 1 928  ? 14.270  46.004  79.387  1.00 70.89  ? 925  ASP A CB  1 
ATOM 7145  C CG  . ASP A 1 928  ? 13.905  46.480  80.819  1.00 70.95  ? 925  ASP A CG  1 
ATOM 7146  O OD1 . ASP A 1 928  ? 14.415  47.538  81.259  1.00 70.64  ? 925  ASP A OD1 1 
ATOM 7147  O OD2 . ASP A 1 928  ? 13.094  45.808  81.501  1.00 70.69  ? 925  ASP A OD2 1 
ATOM 7148  N N   . LEU A 1 929  ? 14.233  43.633  81.039  1.00 70.74  ? 926  LEU A N   1 
ATOM 7149  C CA  . LEU A 1 929  ? 13.815  42.395  81.749  1.00 70.81  ? 926  LEU A CA  1 
ATOM 7150  C C   . LEU A 1 929  ? 12.360  41.957  81.531  1.00 70.96  ? 926  LEU A C   1 
ATOM 7151  O O   . LEU A 1 929  ? 12.108  40.877  81.003  1.00 70.91  ? 926  LEU A O   1 
ATOM 7152  C CB  . LEU A 1 929  ? 14.084  42.475  83.269  1.00 70.74  ? 926  LEU A CB  1 
ATOM 7153  C CG  . LEU A 1 929  ? 13.135  41.667  84.199  1.00 70.94  ? 926  LEU A CG  1 
ATOM 7154  C CD1 . LEU A 1 929  ? 13.351  40.149  84.164  1.00 70.95  ? 926  LEU A CD1 1 
ATOM 7155  C CD2 . LEU A 1 929  ? 13.169  42.137  85.636  1.00 70.82  ? 926  LEU A CD2 1 
ATOM 7156  N N   . MET A 1 930  ? 11.416  42.772  81.996  1.00 71.29  ? 927  MET A N   1 
ATOM 7157  C CA  . MET A 1 930  ? 9.996   42.427  81.951  1.00 71.81  ? 927  MET A CA  1 
ATOM 7158  C C   . MET A 1 930  ? 9.199   43.388  81.061  1.00 71.95  ? 927  MET A C   1 
ATOM 7159  O O   . MET A 1 930  ? 7.966   43.293  80.972  1.00 71.97  ? 927  MET A O   1 
ATOM 7160  C CB  . MET A 1 930  ? 9.404   42.387  83.361  1.00 71.71  ? 927  MET A CB  1 
ATOM 7161  C CG  . MET A 1 930  ? 9.224   43.759  84.014  1.00 72.28  ? 927  MET A CG  1 
ATOM 7162  S SD  . MET A 1 930  ? 8.021   43.789  85.368  1.00 72.58  ? 927  MET A SD  1 
ATOM 7163  C CE  . MET A 1 930  ? 8.854   42.778  86.603  1.00 73.58  ? 927  MET A CE  1 
ATOM 7164  N N   . ARG A 1 931  ? 9.917   44.312  80.416  1.00 72.19  ? 928  ARG A N   1 
ATOM 7165  C CA  . ARG A 1 931  ? 9.341   45.236  79.437  1.00 72.28  ? 928  ARG A CA  1 
ATOM 7166  C C   . ARG A 1 931  ? 10.126  45.195  78.131  1.00 72.14  ? 928  ARG A C   1 
ATOM 7167  O O   . ARG A 1 931  ? 10.823  46.157  77.791  1.00 72.19  ? 928  ARG A O   1 
ATOM 7168  C CB  . ARG A 1 931  ? 9.336   46.678  79.950  1.00 72.37  ? 928  ARG A CB  1 
ATOM 7169  C CG  . ARG A 1 931  ? 9.492   46.863  81.442  1.00 73.16  ? 928  ARG A CG  1 
ATOM 7170  C CD  . ARG A 1 931  ? 9.211   48.306  81.801  1.00 74.92  ? 928  ARG A CD  1 
ATOM 7171  N NE  . ARG A 1 931  ? 10.153  49.230  81.171  1.00 75.79  ? 928  ARG A NE  1 
ATOM 7172  C CZ  . ARG A 1 931  ? 9.895   50.512  80.913  1.00 76.60  ? 928  ARG A CZ  1 
ATOM 7173  N NH1 . ARG A 1 931  ? 8.710   51.043  81.212  1.00 76.43  ? 928  ARG A NH1 1 
ATOM 7174  N NH2 . ARG A 1 931  ? 10.827  51.264  80.338  1.00 77.11  ? 928  ARG A NH2 1 
ATOM 7175  N N   . SER A 1 932  ? 10.013  44.083  77.410  1.00 72.03  ? 929  SER A N   1 
ATOM 7176  C CA  . SER A 1 932  ? 10.634  43.914  76.085  1.00 72.10  ? 929  SER A CA  1 
ATOM 7177  C C   . SER A 1 932  ? 12.002  44.593  75.915  1.00 71.97  ? 929  SER A C   1 
ATOM 7178  O O   . SER A 1 932  ? 12.885  44.433  76.767  1.00 72.15  ? 929  SER A O   1 
ATOM 7179  C CB  . SER A 1 932  ? 9.672   44.358  74.987  1.00 72.04  ? 929  SER A CB  1 
ATOM 7180  O OG  . SER A 1 932  ? 9.380   45.734  75.128  1.00 72.68  ? 929  SER A OG  1 
ATOM 7181  N N   . VAL A 1 933  ? 12.167  45.346  74.824  1.00 71.66  ? 930  VAL A N   1 
ATOM 7182  C CA  . VAL A 1 933  ? 13.462  45.953  74.478  1.00 71.58  ? 930  VAL A CA  1 
ATOM 7183  C C   . VAL A 1 933  ? 13.422  47.475  74.265  1.00 71.50  ? 930  VAL A C   1 
ATOM 7184  O O   . VAL A 1 933  ? 12.352  48.067  74.079  1.00 71.41  ? 930  VAL A O   1 
ATOM 7185  C CB  . VAL A 1 933  ? 14.110  45.281  73.231  1.00 71.56  ? 930  VAL A CB  1 
ATOM 7186  C CG1 . VAL A 1 933  ? 14.663  43.906  73.571  1.00 71.44  ? 930  VAL A CG1 1 
ATOM 7187  C CG2 . VAL A 1 933  ? 13.118  45.203  72.075  1.00 71.77  ? 930  VAL A CG2 1 
ATOM 7188  N N   . LEU A 1 934  ? 14.605  48.092  74.311  1.00 71.40  ? 931  LEU A N   1 
ATOM 7189  C CA  . LEU A 1 934  ? 14.776  49.525  74.057  1.00 71.25  ? 931  LEU A CA  1 
ATOM 7190  C C   . LEU A 1 934  ? 15.797  49.701  72.944  1.00 71.21  ? 931  LEU A C   1 
ATOM 7191  O O   . LEU A 1 934  ? 16.409  48.736  72.504  1.00 71.21  ? 931  LEU A O   1 
ATOM 7192  C CB  . LEU A 1 934  ? 15.257  50.251  75.319  1.00 71.09  ? 931  LEU A CB  1 
ATOM 7193  C CG  . LEU A 1 934  ? 14.296  50.627  76.452  1.00 70.84  ? 931  LEU A CG  1 
ATOM 7194  C CD1 . LEU A 1 934  ? 13.760  49.434  77.250  1.00 70.73  ? 931  LEU A CD1 1 
ATOM 7195  C CD2 . LEU A 1 934  ? 15.034  51.546  77.377  1.00 71.13  ? 931  LEU A CD2 1 
ATOM 7196  N N   . LEU A 1 935  ? 15.978  50.930  72.482  1.00 71.16  ? 932  LEU A N   1 
ATOM 7197  C CA  . LEU A 1 935  ? 17.005  51.219  71.497  1.00 71.19  ? 932  LEU A CA  1 
ATOM 7198  C C   . LEU A 1 935  ? 17.559  52.600  71.767  1.00 71.30  ? 932  LEU A C   1 
ATOM 7199  O O   . LEU A 1 935  ? 16.808  53.566  71.870  1.00 71.54  ? 932  LEU A O   1 
ATOM 7200  C CB  . LEU A 1 935  ? 16.442  51.128  70.078  1.00 71.21  ? 932  LEU A CB  1 
ATOM 7201  C CG  . LEU A 1 935  ? 17.357  51.543  68.922  1.00 71.32  ? 932  LEU A CG  1 
ATOM 7202  C CD1 . LEU A 1 935  ? 18.424  50.500  68.692  1.00 71.80  ? 932  LEU A CD1 1 
ATOM 7203  C CD2 . LEU A 1 935  ? 16.572  51.783  67.646  1.00 71.21  ? 932  LEU A CD2 1 
ATOM 7204  N N   . LEU A 1 936  ? 18.876  52.692  71.891  1.00 71.40  ? 933  LEU A N   1 
ATOM 7205  C CA  . LEU A 1 936  ? 19.510  53.935  72.304  1.00 71.51  ? 933  LEU A CA  1 
ATOM 7206  C C   . LEU A 1 936  ? 20.574  54.384  71.317  1.00 71.78  ? 933  LEU A C   1 
ATOM 7207  O O   . LEU A 1 936  ? 21.078  53.583  70.537  1.00 71.67  ? 933  LEU A O   1 
ATOM 7208  C CB  . LEU A 1 936  ? 20.126  53.770  73.696  1.00 71.44  ? 933  LEU A CB  1 
ATOM 7209  C CG  . LEU A 1 936  ? 19.285  53.981  74.959  1.00 71.23  ? 933  LEU A CG  1 
ATOM 7210  C CD1 . LEU A 1 936  ? 17.973  53.198  74.979  1.00 71.27  ? 933  LEU A CD1 1 
ATOM 7211  C CD2 . LEU A 1 936  ? 20.123  53.617  76.163  1.00 71.33  ? 933  LEU A CD2 1 
ATOM 7212  N N   . ALA A 1 937  ? 20.897  55.673  71.357  1.00 72.36  ? 934  ALA A N   1 
ATOM 7213  C CA  . ALA A 1 937  ? 22.003  56.231  70.582  1.00 72.85  ? 934  ALA A CA  1 
ATOM 7214  C C   . ALA A 1 937  ? 22.968  56.973  71.492  1.00 73.23  ? 934  ALA A C   1 
ATOM 7215  O O   . ALA A 1 937  ? 22.555  57.767  72.343  1.00 73.34  ? 934  ALA A O   1 
ATOM 7216  C CB  . ALA A 1 937  ? 21.489  57.161  69.502  1.00 72.75  ? 934  ALA A CB  1 
ATOM 7217  N N   . TYR A 1 938  ? 24.255  56.695  71.323  1.00 73.71  ? 935  TYR A N   1 
ATOM 7218  C CA  . TYR A 1 938  ? 25.288  57.492  71.956  1.00 74.29  ? 935  TYR A CA  1 
ATOM 7219  C C   . TYR A 1 938  ? 25.561  58.672  71.047  1.00 74.79  ? 935  TYR A C   1 
ATOM 7220  O O   . TYR A 1 938  ? 25.718  58.510  69.835  1.00 74.94  ? 935  TYR A O   1 
ATOM 7221  C CB  . TYR A 1 938  ? 26.562  56.675  72.167  1.00 74.20  ? 935  TYR A CB  1 
ATOM 7222  C CG  . TYR A 1 938  ? 27.769  57.484  72.600  1.00 74.20  ? 935  TYR A CG  1 
ATOM 7223  C CD1 . TYR A 1 938  ? 27.862  58.003  73.893  1.00 73.91  ? 935  TYR A CD1 1 
ATOM 7224  C CD2 . TYR A 1 938  ? 28.826  57.721  71.716  1.00 74.26  ? 935  TYR A CD2 1 
ATOM 7225  C CE1 . TYR A 1 938  ? 28.973  58.735  74.292  1.00 73.89  ? 935  TYR A CE1 1 
ATOM 7226  C CE2 . TYR A 1 938  ? 29.943  58.455  72.107  1.00 74.02  ? 935  TYR A CE2 1 
ATOM 7227  C CZ  . TYR A 1 938  ? 30.009  58.959  73.395  1.00 74.01  ? 935  TYR A CZ  1 
ATOM 7228  O OH  . TYR A 1 938  ? 31.110  59.685  73.785  1.00 73.97  ? 935  TYR A OH  1 
ATOM 7229  N N   . LYS A 1 939  ? 25.602  59.863  71.626  1.00 75.37  ? 936  LYS A N   1 
ATOM 7230  C CA  . LYS A 1 939  ? 25.872  61.052  70.839  1.00 75.87  ? 936  LYS A CA  1 
ATOM 7231  C C   . LYS A 1 939  ? 27.271  61.576  71.160  1.00 76.34  ? 936  LYS A C   1 
ATOM 7232  O O   . LYS A 1 939  ? 27.548  61.940  72.308  1.00 76.41  ? 936  LYS A O   1 
ATOM 7233  C CB  . LYS A 1 939  ? 24.804  62.132  71.078  1.00 75.76  ? 936  LYS A CB  1 
ATOM 7234  C CG  . LYS A 1 939  ? 23.353  61.629  71.137  1.00 75.51  ? 936  LYS A CG  1 
ATOM 7235  C CD  . LYS A 1 939  ? 22.864  61.032  69.814  1.00 75.56  ? 936  LYS A CD  1 
ATOM 7236  C CE  . LYS A 1 939  ? 22.462  62.106  68.801  1.00 75.83  ? 936  LYS A CE  1 
ATOM 7237  N NZ  . LYS A 1 939  ? 21.853  61.533  67.559  1.00 75.34  ? 936  LYS A NZ  1 
ATOM 7238  N N   . PRO A 1 940  ? 28.174  61.574  70.157  1.00 76.74  ? 937  PRO A N   1 
ATOM 7239  C CA  . PRO A 1 940  ? 29.404  62.364  70.243  1.00 77.06  ? 937  PRO A CA  1 
ATOM 7240  C C   . PRO A 1 940  ? 29.085  63.866  70.318  1.00 77.40  ? 937  PRO A C   1 
ATOM 7241  O O   . PRO A 1 940  ? 29.952  64.708  70.071  1.00 77.41  ? 937  PRO A O   1 
ATOM 7242  C CB  . PRO A 1 940  ? 30.141  62.014  68.942  1.00 77.04  ? 937  PRO A CB  1 
ATOM 7243  C CG  . PRO A 1 940  ? 29.561  60.715  68.509  1.00 76.96  ? 937  PRO A CG  1 
ATOM 7244  C CD  . PRO A 1 940  ? 28.120  60.793  68.909  1.00 76.80  ? 937  PRO A CD  1 
ATOM 7245  N N   . MET A 1 941  ? 27.831  64.176  70.643  1.00 77.81  ? 938  MET A N   1 
ATOM 7246  C CA  . MET A 1 941  ? 27.406  65.510  71.039  1.00 78.31  ? 938  MET A CA  1 
ATOM 7247  C C   . MET A 1 941  ? 28.156  65.879  72.318  1.00 78.25  ? 938  MET A C   1 
ATOM 7248  O O   . MET A 1 941  ? 29.209  66.518  72.262  1.00 78.34  ? 938  MET A O   1 
ATOM 7249  C CB  . MET A 1 941  ? 25.881  65.529  71.248  1.00 78.33  ? 938  MET A CB  1 
ATOM 7250  C CG  . MET A 1 941  ? 25.324  66.687  72.095  1.00 78.80  ? 938  MET A CG  1 
ATOM 7251  S SD  . MET A 1 941  ? 23.551  66.577  72.474  1.00 79.06  ? 938  MET A SD  1 
ATOM 7252  C CE  . MET A 1 941  ? 23.391  64.929  73.161  1.00 79.24  ? 938  MET A CE  1 
ATOM 7253  N N   . GLU A 1 942  ? 27.620  65.452  73.460  1.00 78.29  ? 939  GLU A N   1 
ATOM 7254  C CA  . GLU A 1 942  ? 28.252  65.685  74.759  1.00 78.36  ? 939  GLU A CA  1 
ATOM 7255  C C   . GLU A 1 942  ? 28.417  64.371  75.529  1.00 77.95  ? 939  GLU A C   1 
ATOM 7256  O O   . GLU A 1 942  ? 28.500  64.356  76.765  1.00 78.00  ? 939  GLU A O   1 
ATOM 7257  C CB  . GLU A 1 942  ? 27.480  66.744  75.577  1.00 78.45  ? 939  GLU A CB  1 
ATOM 7258  C CG  . GLU A 1 942  ? 25.982  66.463  75.801  1.00 78.91  ? 939  GLU A CG  1 
ATOM 7259  C CD  . GLU A 1 942  ? 25.297  67.518  76.673  1.00 78.87  ? 939  GLU A CD  1 
ATOM 7260  O OE1 . GLU A 1 942  ? 24.517  67.133  77.574  1.00 79.61  ? 939  GLU A OE1 1 
ATOM 7261  O OE2 . GLU A 1 942  ? 25.540  68.730  76.460  1.00 79.02  ? 939  GLU A OE2 1 
ATOM 7262  N N   . GLY A 1 943  ? 28.492  63.272  74.779  1.00 77.42  ? 940  GLY A N   1 
ATOM 7263  C CA  . GLY A 1 943  ? 28.525  61.949  75.370  1.00 76.81  ? 940  GLY A CA  1 
ATOM 7264  C C   . GLY A 1 943  ? 27.296  61.800  76.238  1.00 76.37  ? 940  GLY A C   1 
ATOM 7265  O O   . GLY A 1 943  ? 27.397  61.676  77.460  1.00 76.51  ? 940  GLY A O   1 
ATOM 7266  N N   . ASN A 1 944  ? 26.135  61.846  75.592  1.00 75.76  ? 941  ASN A N   1 
ATOM 7267  C CA  . ASN A 1 944  ? 24.846  61.837  76.275  1.00 75.04  ? 941  ASN A CA  1 
ATOM 7268  C C   . ASN A 1 944  ? 23.912  60.809  75.619  1.00 74.36  ? 941  ASN A C   1 
ATOM 7269  O O   . ASN A 1 944  ? 23.935  60.643  74.396  1.00 74.40  ? 941  ASN A O   1 
ATOM 7270  C CB  . ASN A 1 944  ? 24.247  63.250  76.221  1.00 75.09  ? 941  ASN A CB  1 
ATOM 7271  C CG  . ASN A 1 944  ? 23.311  63.546  77.377  1.00 75.22  ? 941  ASN A CG  1 
ATOM 7272  O OD1 . ASN A 1 944  ? 22.329  62.834  77.600  1.00 76.30  ? 941  ASN A OD1 1 
ATOM 7273  N ND2 . ASN A 1 944  ? 23.599  64.618  78.106  1.00 74.40  ? 941  ASN A ND2 1 
ATOM 7274  N N   . PHE A 1 945  ? 23.107  60.112  76.418  1.00 73.37  ? 942  PHE A N   1 
ATOM 7275  C CA  . PHE A 1 945  ? 22.184  59.123  75.856  1.00 72.53  ? 942  PHE A CA  1 
ATOM 7276  C C   . PHE A 1 945  ? 20.848  59.726  75.435  1.00 72.22  ? 942  PHE A C   1 
ATOM 7277  O O   . PHE A 1 945  ? 20.344  60.660  76.068  1.00 72.19  ? 942  PHE A O   1 
ATOM 7278  C CB  . PHE A 1 945  ? 21.957  57.946  76.808  1.00 72.29  ? 942  PHE A CB  1 
ATOM 7279  C CG  . PHE A 1 945  ? 23.021  56.888  76.733  1.00 71.67  ? 942  PHE A CG  1 
ATOM 7280  C CD1 . PHE A 1 945  ? 23.608  56.392  77.894  1.00 70.98  ? 942  PHE A CD1 1 
ATOM 7281  C CD2 . PHE A 1 945  ? 23.441  56.386  75.505  1.00 71.14  ? 942  PHE A CD2 1 
ATOM 7282  C CE1 . PHE A 1 945  ? 24.592  55.414  77.835  1.00 70.32  ? 942  PHE A CE1 1 
ATOM 7283  C CE2 . PHE A 1 945  ? 24.426  55.406  75.439  1.00 70.83  ? 942  PHE A CE2 1 
ATOM 7284  C CZ  . PHE A 1 945  ? 25.001  54.922  76.608  1.00 70.75  ? 942  PHE A CZ  1 
ATOM 7285  N N   . GLU A 1 946  ? 20.295  59.172  74.356  1.00 71.69  ? 943  GLU A N   1 
ATOM 7286  C CA  . GLU A 1 946  ? 19.002  59.572  73.816  1.00 71.13  ? 943  GLU A CA  1 
ATOM 7287  C C   . GLU A 1 946  ? 18.225  58.325  73.413  1.00 70.85  ? 943  GLU A C   1 
ATOM 7288  O O   . GLU A 1 946  ? 18.632  57.592  72.507  1.00 70.83  ? 943  GLU A O   1 
ATOM 7289  C CB  . GLU A 1 946  ? 19.193  60.483  72.606  1.00 71.14  ? 943  GLU A CB  1 
ATOM 7290  C CG  . GLU A 1 946  ? 17.899  60.870  71.897  1.00 71.01  ? 943  GLU A CG  1 
ATOM 7291  C CD  . GLU A 1 946  ? 18.118  61.339  70.463  1.00 70.88  ? 943  GLU A CD  1 
ATOM 7292  O OE1 . GLU A 1 946  ? 17.111  61.539  69.755  1.00 70.77  ? 943  GLU A OE1 1 
ATOM 7293  O OE2 . GLU A 1 946  ? 19.284  61.504  70.036  1.00 70.83  ? 943  GLU A OE2 1 
ATOM 7294  N N   . GLU A 1 947  ? 17.104  58.095  74.088  1.00 70.40  ? 944  GLU A N   1 
ATOM 7295  C CA  . GLU A 1 947  ? 16.302  56.899  73.878  1.00 69.98  ? 944  GLU A CA  1 
ATOM 7296  C C   . GLU A 1 947  ? 15.568  56.965  72.543  1.00 69.71  ? 944  GLU A C   1 
ATOM 7297  O O   . GLU A 1 947  ? 14.526  57.615  72.445  1.00 69.81  ? 944  GLU A O   1 
ATOM 7298  C CB  . GLU A 1 947  ? 15.310  56.751  75.028  1.00 70.01  ? 944  GLU A CB  1 
ATOM 7299  C CG  . GLU A 1 947  ? 14.452  55.505  74.964  1.00 70.15  ? 944  GLU A CG  1 
ATOM 7300  C CD  . GLU A 1 947  ? 13.600  55.320  76.203  1.00 70.31  ? 944  GLU A CD  1 
ATOM 7301  O OE1 . GLU A 1 947  ? 12.398  54.999  76.044  1.00 69.90  ? 944  GLU A OE1 1 
ATOM 7302  O OE2 . GLU A 1 947  ? 14.130  55.494  77.329  1.00 70.07  ? 944  GLU A OE2 1 
ATOM 7303  N N   . ILE A 1 948  ? 16.113  56.296  71.524  1.00 69.27  ? 945  ILE A N   1 
ATOM 7304  C CA  . ILE A 1 948  ? 15.565  56.358  70.161  1.00 69.05  ? 945  ILE A CA  1 
ATOM 7305  C C   . ILE A 1 948  ? 14.149  55.799  70.057  1.00 68.95  ? 945  ILE A C   1 
ATOM 7306  O O   . ILE A 1 948  ? 13.221  56.506  69.662  1.00 69.09  ? 945  ILE A O   1 
ATOM 7307  C CB  . ILE A 1 948  ? 16.448  55.624  69.122  1.00 69.00  ? 945  ILE A CB  1 
ATOM 7308  C CG1 . ILE A 1 948  ? 17.833  56.263  69.020  1.00 69.11  ? 945  ILE A CG1 1 
ATOM 7309  C CG2 . ILE A 1 948  ? 15.775  55.624  67.745  1.00 68.84  ? 945  ILE A CG2 1 
ATOM 7310  C CD1 . ILE A 1 948  ? 18.778  55.519  68.070  1.00 69.18  ? 945  ILE A CD1 1 
ATOM 7311  N N   . ALA A 1 949  ? 13.999  54.525  70.395  1.00 68.81  ? 946  ALA A N   1 
ATOM 7312  C CA  . ALA A 1 949  ? 12.730  53.823  70.252  1.00 68.83  ? 946  ALA A CA  1 
ATOM 7313  C C   . ALA A 1 949  ? 12.672  52.632  71.201  1.00 68.91  ? 946  ALA A C   1 
ATOM 7314  O O   . ALA A 1 949  ? 13.707  52.091  71.596  1.00 68.92  ? 946  ALA A O   1 
ATOM 7315  C CB  . ALA A 1 949  ? 12.535  53.364  68.808  1.00 68.70  ? 946  ALA A CB  1 
ATOM 7316  N N   . ARG A 1 950  ? 11.462  52.225  71.569  1.00 68.98  ? 947  ARG A N   1 
ATOM 7317  C CA  . ARG A 1 950  ? 11.292  51.062  72.438  1.00 69.11  ? 947  ARG A CA  1 
ATOM 7318  C C   . ARG A 1 950  ? 10.044  50.252  72.112  1.00 68.76  ? 947  ARG A C   1 
ATOM 7319  O O   . ARG A 1 950  ? 9.041   50.792  71.648  1.00 68.75  ? 947  ARG A O   1 
ATOM 7320  C CB  . ARG A 1 950  ? 11.310  51.461  73.919  1.00 69.34  ? 947  ARG A CB  1 
ATOM 7321  C CG  . ARG A 1 950  ? 10.377  52.613  74.288  1.00 70.71  ? 947  ARG A CG  1 
ATOM 7322  C CD  . ARG A 1 950  ? 10.069  52.632  75.781  1.00 72.58  ? 947  ARG A CD  1 
ATOM 7323  N NE  . ARG A 1 950  ? 9.933   51.274  76.302  1.00 74.26  ? 947  ARG A NE  1 
ATOM 7324  C CZ  . ARG A 1 950  ? 9.278   50.947  77.410  1.00 75.11  ? 947  ARG A CZ  1 
ATOM 7325  N NH1 . ARG A 1 950  ? 8.669   51.883  78.134  1.00 75.14  ? 947  ARG A NH1 1 
ATOM 7326  N NH2 . ARG A 1 950  ? 9.227   49.672  77.786  1.00 75.32  ? 947  ARG A NH2 1 
ATOM 7327  N N   . ASP A 1 951  ? 10.140  48.947  72.353  1.00 68.39  ? 948  ASP A N   1 
ATOM 7328  C CA  . ASP A 1 951  ? 9.048   48.008  72.146  1.00 67.93  ? 948  ASP A CA  1 
ATOM 7329  C C   . ASP A 1 951  ? 8.104   48.135  73.323  1.00 67.61  ? 948  ASP A C   1 
ATOM 7330  O O   . ASP A 1 951  ? 8.537   48.234  74.474  1.00 67.54  ? 948  ASP A O   1 
ATOM 7331  C CB  . ASP A 1 951  ? 9.602   46.585  72.046  1.00 68.06  ? 948  ASP A CB  1 
ATOM 7332  C CG  . ASP A 1 951  ? 8.635   45.614  71.402  1.00 68.30  ? 948  ASP A CG  1 
ATOM 7333  O OD1 . ASP A 1 951  ? 7.831   46.043  70.557  1.00 69.86  ? 948  ASP A OD1 1 
ATOM 7334  O OD2 . ASP A 1 951  ? 8.699   44.407  71.718  1.00 68.10  ? 948  ASP A OD2 1 
ATOM 7335  N N   . PHE A 1 952  ? 6.811   48.150  73.036  1.00 67.36  ? 949  PHE A N   1 
ATOM 7336  C CA  . PHE A 1 952  ? 5.825   48.477  74.061  1.00 67.17  ? 949  PHE A CA  1 
ATOM 7337  C C   . PHE A 1 952  ? 5.059   47.263  74.576  1.00 66.69  ? 949  PHE A C   1 
ATOM 7338  O O   . PHE A 1 952  ? 4.229   47.372  75.476  1.00 66.65  ? 949  PHE A O   1 
ATOM 7339  C CB  . PHE A 1 952  ? 4.895   49.607  73.574  1.00 67.42  ? 949  PHE A CB  1 
ATOM 7340  C CG  . PHE A 1 952  ? 5.417   50.998  73.877  1.00 67.89  ? 949  PHE A CG  1 
ATOM 7341  C CD1 . PHE A 1 952  ? 6.580   51.474  73.276  1.00 68.22  ? 949  PHE A CD1 1 
ATOM 7342  C CD2 . PHE A 1 952  ? 4.749   51.827  74.776  1.00 68.64  ? 949  PHE A CD2 1 
ATOM 7343  C CE1 . PHE A 1 952  ? 7.070   52.755  73.561  1.00 68.41  ? 949  PHE A CE1 1 
ATOM 7344  C CE2 . PHE A 1 952  ? 5.232   53.112  75.069  1.00 68.65  ? 949  PHE A CE2 1 
ATOM 7345  C CZ  . PHE A 1 952  ? 6.397   53.573  74.460  1.00 68.26  ? 949  PHE A CZ  1 
ATOM 7346  N N   . ASN A 1 953  ? 5.371   46.100  74.015  1.00 66.15  ? 950  ASN A N   1 
ATOM 7347  C CA  . ASN A 1 953  ? 4.795   44.844  74.468  1.00 65.78  ? 950  ASN A CA  1 
ATOM 7348  C C   . ASN A 1 953  ? 5.419   44.441  75.805  1.00 65.60  ? 950  ASN A C   1 
ATOM 7349  O O   . ASN A 1 953  ? 6.486   44.944  76.156  1.00 65.74  ? 950  ASN A O   1 
ATOM 7350  C CB  . ASN A 1 953  ? 5.023   43.755  73.421  1.00 65.84  ? 950  ASN A CB  1 
ATOM 7351  C CG  . ASN A 1 953  ? 4.712   44.223  72.014  1.00 65.66  ? 950  ASN A CG  1 
ATOM 7352  O OD1 . ASN A 1 953  ? 5.360   45.128  71.493  1.00 65.45  ? 950  ASN A OD1 1 
ATOM 7353  N ND2 . ASN A 1 953  ? 3.725   43.596  71.385  1.00 65.96  ? 950  ASN A ND2 1 
ATOM 7354  N N   . PRO A 1 954  ? 4.752   43.553  76.568  1.00 65.29  ? 951  PRO A N   1 
ATOM 7355  C CA  . PRO A 1 954  ? 5.299   43.137  77.850  1.00 64.88  ? 951  PRO A CA  1 
ATOM 7356  C C   . PRO A 1 954  ? 5.962   41.769  77.765  1.00 64.46  ? 951  PRO A C   1 
ATOM 7357  O O   . PRO A 1 954  ? 5.390   40.774  78.217  1.00 64.61  ? 951  PRO A O   1 
ATOM 7358  C CB  . PRO A 1 954  ? 4.052   43.048  78.723  1.00 64.85  ? 951  PRO A CB  1 
ATOM 7359  C CG  . PRO A 1 954  ? 2.936   42.646  77.737  1.00 65.31  ? 951  PRO A CG  1 
ATOM 7360  C CD  . PRO A 1 954  ? 3.446   42.914  76.326  1.00 65.36  ? 951  PRO A CD  1 
ATOM 7361  N N   . ASN A 1 955  ? 7.153   41.715  77.188  1.00 63.86  ? 952  ASN A N   1 
ATOM 7362  C CA  . ASN A 1 955  ? 7.873   40.451  77.115  1.00 63.38  ? 952  ASN A CA  1 
ATOM 7363  C C   . ASN A 1 955  ? 8.811   40.262  78.303  1.00 62.79  ? 952  ASN A C   1 
ATOM 7364  O O   . ASN A 1 955  ? 9.414   41.228  78.778  1.00 62.79  ? 952  ASN A O   1 
ATOM 7365  C CB  . ASN A 1 955  ? 8.648   40.343  75.799  1.00 63.51  ? 952  ASN A CB  1 
ATOM 7366  C CG  . ASN A 1 955  ? 7.760   40.497  74.583  1.00 63.71  ? 952  ASN A CG  1 
ATOM 7367  O OD1 . ASN A 1 955  ? 6.547   40.249  74.634  1.00 63.69  ? 952  ASN A OD1 1 
ATOM 7368  N ND2 . ASN A 1 955  ? 8.362   40.910  73.474  1.00 64.15  ? 952  ASN A ND2 1 
ATOM 7369  N N   . TRP A 1 956  ? 8.920   39.019  78.776  1.00 61.91  ? 953  TRP A N   1 
ATOM 7370  C CA  . TRP A 1 956  ? 9.905   38.652  79.797  1.00 60.94  ? 953  TRP A CA  1 
ATOM 7371  C C   . TRP A 1 956  ? 11.166  38.101  79.141  1.00 60.15  ? 953  TRP A C   1 
ATOM 7372  O O   . TRP A 1 956  ? 11.312  36.899  78.947  1.00 60.02  ? 953  TRP A O   1 
ATOM 7373  C CB  . TRP A 1 956  ? 9.307   37.667  80.802  1.00 61.04  ? 953  TRP A CB  1 
ATOM 7374  C CG  . TRP A 1 956  ? 8.373   38.338  81.744  1.00 61.11  ? 953  TRP A CG  1 
ATOM 7375  C CD1 . TRP A 1 956  ? 7.213   38.982  81.424  1.00 61.34  ? 953  TRP A CD1 1 
ATOM 7376  C CD2 . TRP A 1 956  ? 8.519   38.455  83.164  1.00 61.50  ? 953  TRP A CD2 1 
ATOM 7377  N NE1 . TRP A 1 956  ? 6.623   39.490  82.553  1.00 61.59  ? 953  TRP A NE1 1 
ATOM 7378  C CE2 . TRP A 1 956  ? 7.400   39.182  83.639  1.00 61.66  ? 953  TRP A CE2 1 
ATOM 7379  C CE3 . TRP A 1 956  ? 9.484   38.018  84.085  1.00 61.53  ? 953  TRP A CE3 1 
ATOM 7380  C CZ2 . TRP A 1 956  ? 7.217   39.484  85.001  1.00 61.28  ? 953  TRP A CZ2 1 
ATOM 7381  C CZ3 . TRP A 1 956  ? 9.298   38.313  85.441  1.00 61.52  ? 953  TRP A CZ3 1 
ATOM 7382  C CH2 . TRP A 1 956  ? 8.172   39.041  85.882  1.00 61.35  ? 953  TRP A CH2 1 
ATOM 7383  N N   . MET A 1 957  ? 12.067  39.015  78.809  1.00 59.33  ? 954  MET A N   1 
ATOM 7384  C CA  . MET A 1 957  ? 13.259  38.740  78.012  1.00 58.70  ? 954  MET A CA  1 
ATOM 7385  C C   . MET A 1 957  ? 14.199  37.675  78.569  1.00 58.40  ? 954  MET A C   1 
ATOM 7386  O O   . MET A 1 957  ? 14.293  37.488  79.787  1.00 58.27  ? 954  MET A O   1 
ATOM 7387  C CB  . MET A 1 957  ? 14.048  40.040  77.842  1.00 58.82  ? 954  MET A CB  1 
ATOM 7388  C CG  . MET A 1 957  ? 13.250  41.166  77.233  1.00 57.69  ? 954  MET A CG  1 
ATOM 7389  S SD  . MET A 1 957  ? 12.604  40.589  75.676  1.00 56.52  ? 954  MET A SD  1 
ATOM 7390  C CE  . MET A 1 957  ? 14.082  40.650  74.667  1.00 56.02  ? 954  MET A CE  1 
ATOM 7391  N N   . SER A 1 958  ? 14.910  37.006  77.663  1.00 57.91  ? 955  SER A N   1 
ATOM 7392  C CA  . SER A 1 958  ? 15.942  36.050  78.045  1.00 57.77  ? 955  SER A CA  1 
ATOM 7393  C C   . SER A 1 958  ? 17.213  36.129  77.195  1.00 57.76  ? 955  SER A C   1 
ATOM 7394  O O   . SER A 1 958  ? 18.266  35.623  77.596  1.00 57.89  ? 955  SER A O   1 
ATOM 7395  C CB  . SER A 1 958  ? 15.391  34.638  77.992  1.00 57.65  ? 955  SER A CB  1 
ATOM 7396  O OG  . SER A 1 958  ? 15.382  34.172  76.661  1.00 58.19  ? 955  SER A OG  1 
ATOM 7397  N N   . ALA A 1 959  ? 17.114  36.750  76.022  1.00 57.71  ? 956  ALA A N   1 
ATOM 7398  C CA  . ALA A 1 959  ? 18.241  36.853  75.103  1.00 57.74  ? 956  ALA A CA  1 
ATOM 7399  C C   . ALA A 1 959  ? 17.994  37.942  74.073  1.00 57.86  ? 956  ALA A C   1 
ATOM 7400  O O   . ALA A 1 959  ? 16.889  38.060  73.553  1.00 57.90  ? 956  ALA A O   1 
ATOM 7401  C CB  . ALA A 1 959  ? 18.474  35.518  74.410  1.00 57.76  ? 956  ALA A CB  1 
ATOM 7402  N N   . VAL A 1 960  ? 19.024  38.734  73.778  1.00 58.13  ? 957  VAL A N   1 
ATOM 7403  C CA  . VAL A 1 960  ? 18.919  39.823  72.800  1.00 58.42  ? 957  VAL A CA  1 
ATOM 7404  C C   . VAL A 1 960  ? 20.121  39.858  71.862  1.00 58.83  ? 957  VAL A C   1 
ATOM 7405  O O   . VAL A 1 960  ? 21.259  39.752  72.310  1.00 59.02  ? 957  VAL A O   1 
ATOM 7406  C CB  . VAL A 1 960  ? 18.824  41.205  73.480  1.00 58.21  ? 957  VAL A CB  1 
ATOM 7407  C CG1 . VAL A 1 960  ? 18.664  42.275  72.449  1.00 58.20  ? 957  VAL A CG1 1 
ATOM 7408  C CG2 . VAL A 1 960  ? 17.655  41.268  74.440  1.00 58.61  ? 957  VAL A CG2 1 
ATOM 7409  N N   . GLU A 1 961  ? 19.860  40.011  70.563  1.00 59.32  ? 958  GLU A N   1 
ATOM 7410  C CA  . GLU A 1 961  ? 20.911  40.231  69.564  1.00 59.60  ? 958  GLU A CA  1 
ATOM 7411  C C   . GLU A 1 961  ? 20.432  41.196  68.493  1.00 59.71  ? 958  GLU A C   1 
ATOM 7412  O O   . GLU A 1 961  ? 19.292  41.118  68.062  1.00 59.69  ? 958  GLU A O   1 
ATOM 7413  C CB  . GLU A 1 961  ? 21.343  38.913  68.922  1.00 59.49  ? 958  GLU A CB  1 
ATOM 7414  C CG  . GLU A 1 961  ? 22.456  39.052  67.879  1.00 60.22  ? 958  GLU A CG  1 
ATOM 7415  C CD  . GLU A 1 961  ? 23.847  39.294  68.472  1.00 61.22  ? 958  GLU A CD  1 
ATOM 7416  O OE1 . GLU A 1 961  ? 24.433  40.366  68.204  1.00 61.03  ? 958  GLU A OE1 1 
ATOM 7417  O OE2 . GLU A 1 961  ? 24.364  38.409  69.188  1.00 62.36  ? 958  GLU A OE2 1 
ATOM 7418  N N   . ILE A 1 962  ? 21.307  42.112  68.083  1.00 60.20  ? 959  ILE A N   1 
ATOM 7419  C CA  . ILE A 1 962  ? 21.045  43.014  66.966  1.00 60.76  ? 959  ILE A CA  1 
ATOM 7420  C C   . ILE A 1 962  ? 21.473  42.319  65.684  1.00 61.50  ? 959  ILE A C   1 
ATOM 7421  O O   . ILE A 1 962  ? 22.639  41.960  65.549  1.00 61.94  ? 959  ILE A O   1 
ATOM 7422  C CB  . ILE A 1 962  ? 21.851  44.320  67.100  1.00 60.58  ? 959  ILE A CB  1 
ATOM 7423  C CG1 . ILE A 1 962  ? 21.397  45.116  68.332  1.00 60.20  ? 959  ILE A CG1 1 
ATOM 7424  C CG2 . ILE A 1 962  ? 21.724  45.153  65.825  1.00 60.63  ? 959  ILE A CG2 1 
ATOM 7425  C CD1 . ILE A 1 962  ? 22.352  46.222  68.757  1.00 58.93  ? 959  ILE A CD1 1 
ATOM 7426  N N   . LEU A 1 963  ? 20.545  42.119  64.749  1.00 62.30  ? 960  LEU A N   1 
ATOM 7427  C CA  . LEU A 1 963  ? 20.862  41.427  63.489  1.00 63.11  ? 960  LEU A CA  1 
ATOM 7428  C C   . LEU A 1 963  ? 21.482  42.367  62.445  1.00 64.03  ? 960  LEU A C   1 
ATOM 7429  O O   . LEU A 1 963  ? 22.462  42.017  61.776  1.00 64.13  ? 960  LEU A O   1 
ATOM 7430  C CB  . LEU A 1 963  ? 19.618  40.758  62.899  1.00 62.92  ? 960  LEU A CB  1 
ATOM 7431  C CG  . LEU A 1 963  ? 18.794  39.765  63.711  1.00 62.37  ? 960  LEU A CG  1 
ATOM 7432  C CD1 . LEU A 1 963  ? 17.772  39.118  62.809  1.00 62.47  ? 960  LEU A CD1 1 
ATOM 7433  C CD2 . LEU A 1 963  ? 19.680  38.717  64.305  1.00 62.49  ? 960  LEU A CD2 1 
ATOM 7434  N N   . ASP A 1 964  ? 20.876  43.545  62.298  1.00 64.94  ? 961  ASP A N   1 
ATOM 7435  C CA  . ASP A 1 964  ? 21.382  44.616  61.442  1.00 65.79  ? 961  ASP A CA  1 
ATOM 7436  C C   . ASP A 1 964  ? 20.817  45.943  61.943  1.00 66.01  ? 961  ASP A C   1 
ATOM 7437  O O   . ASP A 1 964  ? 20.017  45.958  62.887  1.00 66.08  ? 961  ASP A O   1 
ATOM 7438  C CB  . ASP A 1 964  ? 21.012  44.375  59.971  1.00 66.13  ? 961  ASP A CB  1 
ATOM 7439  C CG  . ASP A 1 964  ? 19.502  44.379  59.725  1.00 67.27  ? 961  ASP A CG  1 
ATOM 7440  O OD1 . ASP A 1 964  ? 19.086  43.988  58.607  1.00 68.96  ? 961  ASP A OD1 1 
ATOM 7441  O OD2 . ASP A 1 964  ? 18.734  44.775  60.633  1.00 67.16  ? 961  ASP A OD2 1 
ATOM 7442  N N   . ASP A 1 965  ? 21.204  47.043  61.296  1.00 66.27  ? 962  ASP A N   1 
ATOM 7443  C CA  . ASP A 1 965  ? 20.911  48.396  61.787  1.00 66.47  ? 962  ASP A CA  1 
ATOM 7444  C C   . ASP A 1 965  ? 19.456  48.644  62.190  1.00 66.59  ? 962  ASP A C   1 
ATOM 7445  O O   . ASP A 1 965  ? 19.153  49.653  62.822  1.00 66.34  ? 962  ASP A O   1 
ATOM 7446  C CB  . ASP A 1 965  ? 21.388  49.442  60.775  1.00 66.49  ? 962  ASP A CB  1 
ATOM 7447  C CG  . ASP A 1 965  ? 22.905  49.458  60.628  1.00 66.85  ? 962  ASP A CG  1 
ATOM 7448  O OD1 . ASP A 1 965  ? 23.530  48.390  60.808  1.00 67.11  ? 962  ASP A OD1 1 
ATOM 7449  O OD2 . ASP A 1 965  ? 23.479  50.533  60.342  1.00 67.00  ? 962  ASP A OD2 1 
ATOM 7450  N N   . ASP A 1 966  ? 18.578  47.701  61.845  1.00 67.10  ? 963  ASP A N   1 
ATOM 7451  C CA  . ASP A 1 966  ? 17.140  47.812  62.101  1.00 67.68  ? 963  ASP A CA  1 
ATOM 7452  C C   . ASP A 1 966  ? 16.515  46.567  62.750  1.00 67.50  ? 963  ASP A C   1 
ATOM 7453  O O   . ASP A 1 966  ? 15.618  46.698  63.581  1.00 67.55  ? 963  ASP A O   1 
ATOM 7454  C CB  . ASP A 1 966  ? 16.384  48.135  60.802  1.00 68.11  ? 963  ASP A CB  1 
ATOM 7455  C CG  . ASP A 1 966  ? 16.823  49.458  60.166  1.00 69.63  ? 963  ASP A CG  1 
ATOM 7456  O OD1 . ASP A 1 966  ? 17.051  50.447  60.904  1.00 70.70  ? 963  ASP A OD1 1 
ATOM 7457  O OD2 . ASP A 1 966  ? 16.930  49.510  58.915  1.00 71.49  ? 963  ASP A OD2 1 
ATOM 7458  N N   . ASN A 1 967  ? 16.971  45.372  62.364  1.00 67.19  ? 964  ASN A N   1 
ATOM 7459  C CA  . ASN A 1 967  ? 16.392  44.114  62.873  1.00 66.76  ? 964  ASN A CA  1 
ATOM 7460  C C   . ASN A 1 967  ? 16.949  43.654  64.224  1.00 66.05  ? 964  ASN A C   1 
ATOM 7461  O O   . ASN A 1 967  ? 18.118  43.286  64.350  1.00 65.94  ? 964  ASN A O   1 
ATOM 7462  C CB  . ASN A 1 967  ? 16.495  42.988  61.831  1.00 67.02  ? 964  ASN A CB  1 
ATOM 7463  C CG  . ASN A 1 967  ? 15.568  43.203  60.630  1.00 68.09  ? 964  ASN A CG  1 
ATOM 7464  O OD1 . ASN A 1 967  ? 14.625  44.002  60.682  1.00 68.78  ? 964  ASN A OD1 1 
ATOM 7465  N ND2 . ASN A 1 967  ? 15.836  42.480  59.542  1.00 69.24  ? 964  ASN A ND2 1 
ATOM 7466  N N   . PHE A 1 968  ? 16.093  43.683  65.235  1.00 65.21  ? 965  PHE A N   1 
ATOM 7467  C CA  . PHE A 1 968  ? 16.492  43.314  66.575  1.00 64.49  ? 965  PHE A CA  1 
ATOM 7468  C C   . PHE A 1 968  ? 15.754  42.064  67.019  1.00 64.22  ? 965  PHE A C   1 
ATOM 7469  O O   . PHE A 1 968  ? 14.528  42.058  67.125  1.00 64.35  ? 965  PHE A O   1 
ATOM 7470  C CB  . PHE A 1 968  ? 16.218  44.461  67.541  1.00 64.41  ? 965  PHE A CB  1 
ATOM 7471  C CG  . PHE A 1 968  ? 16.795  45.782  67.104  1.00 64.27  ? 965  PHE A CG  1 
ATOM 7472  C CD1 . PHE A 1 968  ? 16.058  46.952  67.253  1.00 64.00  ? 965  PHE A CD1 1 
ATOM 7473  C CD2 . PHE A 1 968  ? 18.073  45.861  66.553  1.00 64.10  ? 965  PHE A CD2 1 
ATOM 7474  C CE1 . PHE A 1 968  ? 16.580  48.172  66.862  1.00 63.50  ? 965  PHE A CE1 1 
ATOM 7475  C CE2 . PHE A 1 968  ? 18.602  47.076  66.156  1.00 63.57  ? 965  PHE A CE2 1 
ATOM 7476  C CZ  . PHE A 1 968  ? 17.855  48.232  66.311  1.00 63.89  ? 965  PHE A CZ  1 
ATOM 7477  N N   . LEU A 1 969  ? 16.518  41.010  67.275  1.00 63.78  ? 966  LEU A N   1 
ATOM 7478  C CA  . LEU A 1 969  ? 15.980  39.705  67.642  1.00 63.29  ? 966  LEU A CA  1 
ATOM 7479  C C   . LEU A 1 969  ? 15.949  39.546  69.162  1.00 62.73  ? 966  LEU A C   1 
ATOM 7480  O O   . LEU A 1 969  ? 16.956  39.724  69.841  1.00 62.63  ? 966  LEU A O   1 
ATOM 7481  C CB  . LEU A 1 969  ? 16.844  38.606  67.014  1.00 63.47  ? 966  LEU A CB  1 
ATOM 7482  C CG  . LEU A 1 969  ? 16.358  37.179  66.738  1.00 63.87  ? 966  LEU A CG  1 
ATOM 7483  C CD1 . LEU A 1 969  ? 17.591  36.303  66.605  1.00 64.42  ? 966  LEU A CD1 1 
ATOM 7484  C CD2 . LEU A 1 969  ? 15.416  36.603  67.804  1.00 63.84  ? 966  LEU A CD2 1 
ATOM 7485  N N   . GLY A 1 970  ? 14.784  39.205  69.689  1.00 62.23  ? 967  GLY A N   1 
ATOM 7486  C CA  . GLY A 1 970  ? 14.624  39.010  71.119  1.00 61.83  ? 967  GLY A CA  1 
ATOM 7487  C C   . GLY A 1 970  ? 14.026  37.652  71.396  1.00 61.52  ? 967  GLY A C   1 
ATOM 7488  O O   . GLY A 1 970  ? 13.254  37.137  70.585  1.00 61.59  ? 967  GLY A O   1 
ATOM 7489  N N   . ALA A 1 971  ? 14.393  37.078  72.539  1.00 61.14  ? 968  ALA A N   1 
ATOM 7490  C CA  . ALA A 1 971  ? 13.916  35.769  72.961  1.00 61.01  ? 968  ALA A CA  1 
ATOM 7491  C C   . ALA A 1 971  ? 13.287  35.899  74.333  1.00 60.99  ? 968  ALA A C   1 
ATOM 7492  O O   . ALA A 1 971  ? 13.627  36.814  75.083  1.00 60.90  ? 968  ALA A O   1 
ATOM 7493  C CB  . ALA A 1 971  ? 15.054  34.797  73.000  1.00 61.05  ? 968  ALA A CB  1 
ATOM 7494  N N   . GLU A 1 972  ? 12.381  34.991  74.681  1.00 61.08  ? 969  GLU A N   1 
ATOM 7495  C CA  . GLU A 1 972  ? 11.608  35.214  75.891  1.00 61.41  ? 969  GLU A CA  1 
ATOM 7496  C C   . GLU A 1 972  ? 11.005  34.028  76.611  1.00 61.16  ? 969  GLU A C   1 
ATOM 7497  O O   . GLU A 1 972  ? 10.495  33.097  76.002  1.00 61.00  ? 969  GLU A O   1 
ATOM 7498  C CB  . GLU A 1 972  ? 10.568  36.312  75.634  1.00 61.83  ? 969  GLU A CB  1 
ATOM 7499  C CG  . GLU A 1 972  ? 9.260   36.219  76.395  1.00 63.56  ? 969  GLU A CG  1 
ATOM 7500  C CD  . GLU A 1 972  ? 8.098   36.009  75.462  1.00 65.96  ? 969  GLU A CD  1 
ATOM 7501  O OE1 . GLU A 1 972  ? 7.234   36.916  75.369  1.00 66.67  ? 969  GLU A OE1 1 
ATOM 7502  O OE2 . GLU A 1 972  ? 8.070   34.948  74.801  1.00 67.43  ? 969  GLU A OE2 1 
ATOM 7503  N N   . ASN A 1 973  ? 11.083  34.112  77.937  1.00 61.24  ? 970  ASN A N   1 
ATOM 7504  C CA  . ASN A 1 973  ? 10.579  33.135  78.900  1.00 61.33  ? 970  ASN A CA  1 
ATOM 7505  C C   . ASN A 1 973  ? 9.537   32.136  78.423  1.00 61.04  ? 970  ASN A C   1 
ATOM 7506  O O   . ASN A 1 973  ? 9.545   31.002  78.876  1.00 61.41  ? 970  ASN A O   1 
ATOM 7507  C CB  . ASN A 1 973  ? 10.053  33.857  80.152  1.00 61.65  ? 970  ASN A CB  1 
ATOM 7508  C CG  . ASN A 1 973  ? 11.177  34.367  81.071  1.00 62.75  ? 970  ASN A CG  1 
ATOM 7509  O OD1 . ASN A 1 973  ? 12.372  34.224  80.771  1.00 63.89  ? 970  ASN A OD1 1 
ATOM 7510  N ND2 . ASN A 1 973  ? 10.790  34.956  82.203  1.00 63.30  ? 970  ASN A ND2 1 
ATOM 7511  N N   . ALA A 1 974  ? 8.640   32.542  77.529  1.00 60.52  ? 971  ALA A N   1 
ATOM 7512  C CA  . ALA A 1 974  ? 7.594   31.636  77.044  1.00 59.86  ? 971  ALA A CA  1 
ATOM 7513  C C   . ALA A 1 974  ? 8.015   30.853  75.799  1.00 59.37  ? 971  ALA A C   1 
ATOM 7514  O O   . ALA A 1 974  ? 7.165   30.423  75.013  1.00 59.45  ? 971  ALA A O   1 
ATOM 7515  C CB  . ALA A 1 974  ? 6.300   32.399  76.792  1.00 60.01  ? 971  ALA A CB  1 
ATOM 7516  N N   . PHE A 1 975  ? 9.326   30.665  75.641  1.00 58.61  ? 972  PHE A N   1 
ATOM 7517  C CA  . PHE A 1 975  ? 9.930   29.928  74.512  1.00 57.98  ? 972  PHE A CA  1 
ATOM 7518  C C   . PHE A 1 975  ? 9.687   30.561  73.148  1.00 57.60  ? 972  PHE A C   1 
ATOM 7519  O O   . PHE A 1 975  ? 9.905   29.926  72.120  1.00 57.62  ? 972  PHE A O   1 
ATOM 7520  C CB  . PHE A 1 975  ? 9.501   28.452  74.485  1.00 57.73  ? 972  PHE A CB  1 
ATOM 7521  C CG  . PHE A 1 975  ? 9.417   27.826  75.835  1.00 57.28  ? 972  PHE A CG  1 
ATOM 7522  C CD1 . PHE A 1 975  ? 8.182   27.620  76.437  1.00 56.34  ? 972  PHE A CD1 1 
ATOM 7523  C CD2 . PHE A 1 975  ? 10.566  27.453  76.510  1.00 57.00  ? 972  PHE A CD2 1 
ATOM 7524  C CE1 . PHE A 1 975  ? 8.089   27.053  77.680  1.00 56.12  ? 972  PHE A CE1 1 
ATOM 7525  C CE2 . PHE A 1 975  ? 10.482  26.885  77.763  1.00 57.29  ? 972  PHE A CE2 1 
ATOM 7526  C CZ  . PHE A 1 975  ? 9.235   26.686  78.351  1.00 57.13  ? 972  PHE A CZ  1 
ATOM 7527  N N   . ASN A 1 976  ? 9.253   31.809  73.135  1.00 57.24  ? 973  ASN A N   1 
ATOM 7528  C CA  . ASN A 1 976  ? 8.965   32.467  71.882  1.00 57.29  ? 973  ASN A CA  1 
ATOM 7529  C C   . ASN A 1 976  ? 10.060  33.428  71.426  1.00 57.42  ? 973  ASN A C   1 
ATOM 7530  O O   . ASN A 1 976  ? 10.638  34.167  72.229  1.00 57.29  ? 973  ASN A O   1 
ATOM 7531  C CB  . ASN A 1 976  ? 7.605   33.163  71.942  1.00 57.30  ? 973  ASN A CB  1 
ATOM 7532  C CG  . ASN A 1 976  ? 6.450   32.186  72.097  1.00 57.01  ? 973  ASN A CG  1 
ATOM 7533  O OD1 . ASN A 1 976  ? 6.244   31.313  71.263  1.00 56.69  ? 973  ASN A OD1 1 
ATOM 7534  N ND2 . ASN A 1 976  ? 5.679   32.349  73.160  1.00 57.22  ? 973  ASN A ND2 1 
ATOM 7535  N N   . LEU A 1 977  ? 10.341  33.383  70.125  1.00 57.62  ? 974  LEU A N   1 
ATOM 7536  C CA  . LEU A 1 977  ? 11.199  34.346  69.447  1.00 57.69  ? 974  LEU A CA  1 
ATOM 7537  C C   . LEU A 1 977  ? 10.368  35.486  68.912  1.00 58.26  ? 974  LEU A C   1 
ATOM 7538  O O   . LEU A 1 977  ? 9.211   35.292  68.517  1.00 58.52  ? 974  LEU A O   1 
ATOM 7539  C CB  . LEU A 1 977  ? 11.895  33.699  68.264  1.00 57.15  ? 974  LEU A CB  1 
ATOM 7540  C CG  . LEU A 1 977  ? 12.981  32.707  68.603  1.00 56.91  ? 974  LEU A CG  1 
ATOM 7541  C CD1 . LEU A 1 977  ? 13.853  32.507  67.381  1.00 57.10  ? 974  LEU A CD1 1 
ATOM 7542  C CD2 . LEU A 1 977  ? 13.797  33.192  69.793  1.00 56.43  ? 974  LEU A CD2 1 
ATOM 7543  N N   . PHE A 1 978  ? 10.957  36.678  68.892  1.00 58.68  ? 975  PHE A N   1 
ATOM 7544  C CA  . PHE A 1 978  ? 10.336  37.808  68.220  1.00 59.05  ? 975  PHE A CA  1 
ATOM 7545  C C   . PHE A 1 978  ? 11.389  38.709  67.620  1.00 59.53  ? 975  PHE A C   1 
ATOM 7546  O O   . PHE A 1 978  ? 12.569  38.586  67.944  1.00 59.76  ? 975  PHE A O   1 
ATOM 7547  C CB  . PHE A 1 978  ? 9.374   38.566  69.145  1.00 58.97  ? 975  PHE A CB  1 
ATOM 7548  C CG  . PHE A 1 978  ? 10.042  39.360  70.214  1.00 58.29  ? 975  PHE A CG  1 
ATOM 7549  C CD1 . PHE A 1 978  ? 10.146  40.734  70.098  1.00 57.89  ? 975  PHE A CD1 1 
ATOM 7550  C CD2 . PHE A 1 978  ? 10.540  38.741  71.347  1.00 58.21  ? 975  PHE A CD2 1 
ATOM 7551  C CE1 . PHE A 1 978  ? 10.748  41.480  71.083  1.00 58.21  ? 975  PHE A CE1 1 
ATOM 7552  C CE2 . PHE A 1 978  ? 11.149  39.479  72.343  1.00 58.60  ? 975  PHE A CE2 1 
ATOM 7553  C CZ  . PHE A 1 978  ? 11.255  40.852  72.211  1.00 58.71  ? 975  PHE A CZ  1 
ATOM 7554  N N   . VAL A 1 979  ? 10.955  39.587  66.723  1.00 60.09  ? 976  VAL A N   1 
ATOM 7555  C CA  . VAL A 1 979  ? 11.851  40.479  66.013  1.00 60.75  ? 976  VAL A CA  1 
ATOM 7556  C C   . VAL A 1 979  ? 11.232  41.850  65.987  1.00 61.46  ? 976  VAL A C   1 
ATOM 7557  O O   . VAL A 1 979  ? 10.058  42.000  65.665  1.00 61.46  ? 976  VAL A O   1 
ATOM 7558  C CB  . VAL A 1 979  ? 12.097  40.009  64.569  1.00 60.65  ? 976  VAL A CB  1 
ATOM 7559  C CG1 . VAL A 1 979  ? 12.800  41.088  63.767  1.00 60.78  ? 976  VAL A CG1 1 
ATOM 7560  C CG2 . VAL A 1 979  ? 12.916  38.736  64.559  1.00 60.44  ? 976  VAL A CG2 1 
ATOM 7561  N N   . CYS A 1 980  ? 12.032  42.846  66.334  1.00 62.61  ? 977  CYS A N   1 
ATOM 7562  C CA  . CYS A 1 980  ? 11.592  44.229  66.320  1.00 63.94  ? 977  CYS A CA  1 
ATOM 7563  C C   . CYS A 1 980  ? 12.382  45.014  65.281  1.00 64.72  ? 977  CYS A C   1 
ATOM 7564  O O   . CYS A 1 980  ? 13.533  44.678  64.988  1.00 64.82  ? 977  CYS A O   1 
ATOM 7565  C CB  . CYS A 1 980  ? 11.780  44.861  67.706  1.00 64.11  ? 977  CYS A CB  1 
ATOM 7566  S SG  . CYS A 1 980  ? 10.431  44.610  68.937  1.00 64.60  ? 977  CYS A SG  1 
ATOM 7567  N N   . GLN A 1 981  ? 11.745  46.039  64.713  1.00 65.83  ? 978  GLN A N   1 
ATOM 7568  C CA  . GLN A 1 981  ? 12.416  47.042  63.873  1.00 66.99  ? 978  GLN A CA  1 
ATOM 7569  C C   . GLN A 1 981  ? 11.695  48.384  63.991  1.00 68.05  ? 978  GLN A C   1 
ATOM 7570  O O   . GLN A 1 981  ? 10.503  48.422  64.301  1.00 68.29  ? 978  GLN A O   1 
ATOM 7571  C CB  . GLN A 1 981  ? 12.516  46.595  62.408  1.00 66.86  ? 978  GLN A CB  1 
ATOM 7572  C CG  . GLN A 1 981  ? 11.211  46.625  61.624  1.00 66.63  ? 978  GLN A CG  1 
ATOM 7573  C CD  . GLN A 1 981  ? 11.396  46.324  60.148  1.00 66.74  ? 978  GLN A CD  1 
ATOM 7574  O OE1 . GLN A 1 981  ? 10.647  46.820  59.311  1.00 66.46  ? 978  GLN A OE1 1 
ATOM 7575  N NE2 . GLN A 1 981  ? 12.394  45.508  59.822  1.00 66.68  ? 978  GLN A NE2 1 
ATOM 7576  N N   . LYS A 1 982  ? 12.412  49.480  63.753  1.00 69.32  ? 979  LYS A N   1 
ATOM 7577  C CA  . LYS A 1 982  ? 11.821  50.809  63.914  1.00 70.57  ? 979  LYS A CA  1 
ATOM 7578  C C   . LYS A 1 982  ? 10.870  51.170  62.769  1.00 71.39  ? 979  LYS A C   1 
ATOM 7579  O O   . LYS A 1 982  ? 11.189  50.969  61.589  1.00 71.47  ? 979  LYS A O   1 
ATOM 7580  C CB  . LYS A 1 982  ? 12.893  51.896  64.109  1.00 70.63  ? 979  LYS A CB  1 
ATOM 7581  C CG  . LYS A 1 982  ? 13.812  52.128  62.915  1.00 71.08  ? 979  LYS A CG  1 
ATOM 7582  C CD  . LYS A 1 982  ? 15.190  51.544  63.155  1.00 71.83  ? 979  LYS A CD  1 
ATOM 7583  C CE  . LYS A 1 982  ? 16.228  52.636  63.405  1.00 72.26  ? 979  LYS A CE  1 
ATOM 7584  N NZ  . LYS A 1 982  ? 15.966  53.408  64.647  1.00 72.62  ? 979  LYS A NZ  1 
ATOM 7585  N N   . ASP A 1 983  ? 9.699   51.689  63.140  1.00 72.44  ? 980  ASP A N   1 
ATOM 7586  C CA  . ASP A 1 983  ? 8.726   52.226  62.190  1.00 73.45  ? 980  ASP A CA  1 
ATOM 7587  C C   . ASP A 1 983  ? 9.359   53.359  61.380  1.00 74.21  ? 980  ASP A C   1 
ATOM 7588  O O   . ASP A 1 983  ? 10.013  54.251  61.936  1.00 74.25  ? 980  ASP A O   1 
ATOM 7589  C CB  . ASP A 1 983  ? 7.468   52.720  62.932  1.00 73.35  ? 980  ASP A CB  1 
ATOM 7590  C CG  . ASP A 1 983  ? 6.426   53.367  62.005  1.00 73.54  ? 980  ASP A CG  1 
ATOM 7591  O OD1 . ASP A 1 983  ? 6.457   53.148  60.773  1.00 73.62  ? 980  ASP A OD1 1 
ATOM 7592  O OD2 . ASP A 1 983  ? 5.555   54.100  62.526  1.00 73.56  ? 980  ASP A OD2 1 
ATOM 7593  N N   . SER A 1 984  ? 9.178   53.295  60.063  1.00 75.15  ? 981  SER A N   1 
ATOM 7594  C CA  . SER A 1 984  ? 9.620   54.362  59.172  1.00 76.01  ? 981  SER A CA  1 
ATOM 7595  C C   . SER A 1 984  ? 8.417   55.059  58.528  1.00 76.49  ? 981  SER A C   1 
ATOM 7596  O O   . SER A 1 984  ? 8.192   54.971  57.316  1.00 76.62  ? 981  SER A O   1 
ATOM 7597  C CB  . SER A 1 984  ? 10.611  53.832  58.131  1.00 76.03  ? 981  SER A CB  1 
ATOM 7598  O OG  . SER A 1 984  ? 11.876  53.593  58.726  1.00 76.26  ? 981  SER A OG  1 
ATOM 7599  N N   . ALA A 1 985  ? 7.644   55.738  59.372  1.00 77.02  ? 982  ALA A N   1 
ATOM 7600  C CA  . ALA A 1 985  ? 6.501   56.527  58.938  1.00 77.50  ? 982  ALA A CA  1 
ATOM 7601  C C   . ALA A 1 985  ? 6.679   57.973  59.390  1.00 77.86  ? 982  ALA A C   1 
ATOM 7602  O O   . ALA A 1 985  ? 7.595   58.280  60.161  1.00 77.87  ? 982  ALA A O   1 
ATOM 7603  C CB  . ALA A 1 985  ? 5.210   55.939  59.497  1.00 77.47  ? 982  ALA A CB  1 
ATOM 7604  N N   . ALA A 1 986  ? 5.802   58.852  58.904  1.00 78.34  ? 983  ALA A N   1 
ATOM 7605  C CA  . ALA A 1 986  ? 5.818   60.279  59.248  1.00 78.78  ? 983  ALA A CA  1 
ATOM 7606  C C   . ALA A 1 986  ? 5.451   60.520  60.717  1.00 79.10  ? 983  ALA A C   1 
ATOM 7607  O O   . ALA A 1 986  ? 5.170   59.570  61.456  1.00 79.12  ? 983  ALA A O   1 
ATOM 7608  C CB  . ALA A 1 986  ? 4.872   61.049  58.327  1.00 78.66  ? 983  ALA A CB  1 
ATOM 7609  N N   . THR A 1 987  ? 5.454   61.793  61.125  1.00 79.52  ? 984  THR A N   1 
ATOM 7610  C CA  . THR A 1 987  ? 5.060   62.226  62.482  1.00 79.84  ? 984  THR A CA  1 
ATOM 7611  C C   . THR A 1 987  ? 5.915   61.550  63.561  1.00 79.92  ? 984  THR A C   1 
ATOM 7612  O O   . THR A 1 987  ? 5.402   60.879  64.465  1.00 79.84  ? 984  THR A O   1 
ATOM 7613  C CB  . THR A 1 987  ? 3.527   62.035  62.754  1.00 79.96  ? 984  THR A CB  1 
ATOM 7614  O OG1 . THR A 1 987  ? 3.170   60.649  62.633  1.00 80.05  ? 984  THR A OG1 1 
ATOM 7615  C CG2 . THR A 1 987  ? 2.684   62.873  61.781  1.00 79.85  ? 984  THR A CG2 1 
ATOM 7616  N N   . THR A 1 988  ? 7.226   61.770  63.459  1.00 80.11  ? 985  THR A N   1 
ATOM 7617  C CA  . THR A 1 988  ? 8.234   60.930  64.128  1.00 80.30  ? 985  THR A CA  1 
ATOM 7618  C C   . THR A 1 988  ? 8.580   61.322  65.575  1.00 80.24  ? 985  THR A C   1 
ATOM 7619  O O   . THR A 1 988  ? 9.647   60.971  66.091  1.00 80.21  ? 985  THR A O   1 
ATOM 7620  C CB  . THR A 1 988  ? 9.533   60.796  63.267  1.00 80.34  ? 985  THR A CB  1 
ATOM 7621  O OG1 . THR A 1 988  ? 10.549  61.693  63.743  1.00 80.39  ? 985  THR A OG1 1 
ATOM 7622  C CG2 . THR A 1 988  ? 9.239   61.057  61.779  1.00 80.37  ? 985  THR A CG2 1 
ATOM 7623  N N   . ASP A 1 989  ? 7.676   62.049  66.221  1.00 80.17  ? 986  ASP A N   1 
ATOM 7624  C CA  . ASP A 1 989  ? 7.808   62.322  67.644  1.00 80.13  ? 986  ASP A CA  1 
ATOM 7625  C C   . ASP A 1 989  ? 6.985   61.329  68.460  1.00 80.03  ? 986  ASP A C   1 
ATOM 7626  O O   . ASP A 1 989  ? 6.877   61.445  69.685  1.00 80.09  ? 986  ASP A O   1 
ATOM 7627  C CB  . ASP A 1 989  ? 7.423   63.771  67.959  1.00 80.14  ? 986  ASP A CB  1 
ATOM 7628  C CG  . ASP A 1 989  ? 8.633   64.661  68.183  1.00 80.20  ? 986  ASP A CG  1 
ATOM 7629  O OD1 . ASP A 1 989  ? 9.714   64.375  67.622  1.00 80.27  ? 986  ASP A OD1 1 
ATOM 7630  O OD2 . ASP A 1 989  ? 8.505   65.647  68.934  1.00 80.49  ? 986  ASP A OD2 1 
ATOM 7631  N N   . GLU A 1 990  ? 6.426   60.339  67.767  1.00 79.84  ? 987  GLU A N   1 
ATOM 7632  C CA  . GLU A 1 990  ? 5.573   59.338  68.392  1.00 79.60  ? 987  GLU A CA  1 
ATOM 7633  C C   . GLU A 1 990  ? 5.728   57.973  67.728  1.00 79.09  ? 987  GLU A C   1 
ATOM 7634  O O   . GLU A 1 990  ? 6.030   56.986  68.394  1.00 78.91  ? 987  GLU A O   1 
ATOM 7635  C CB  . GLU A 1 990  ? 4.103   59.794  68.366  1.00 79.82  ? 987  GLU A CB  1 
ATOM 7636  C CG  . GLU A 1 990  ? 3.163   58.943  69.220  1.00 80.54  ? 987  GLU A CG  1 
ATOM 7637  C CD  . GLU A 1 990  ? 3.575   58.896  70.687  1.00 81.30  ? 987  GLU A CD  1 
ATOM 7638  O OE1 . GLU A 1 990  ? 3.267   59.861  71.426  1.00 81.43  ? 987  GLU A OE1 1 
ATOM 7639  O OE2 . GLU A 1 990  ? 4.198   57.889  71.095  1.00 81.49  ? 987  GLU A OE2 1 
ATOM 7640  N N   . GLU A 1 991  ? 5.517   57.925  66.415  1.00 78.61  ? 988  GLU A N   1 
ATOM 7641  C CA  . GLU A 1 991  ? 5.604   56.673  65.673  1.00 78.13  ? 988  GLU A CA  1 
ATOM 7642  C C   . GLU A 1 991  ? 7.045   56.195  65.564  1.00 77.72  ? 988  GLU A C   1 
ATOM 7643  O O   . GLU A 1 991  ? 7.290   54.998  65.416  1.00 77.86  ? 988  GLU A O   1 
ATOM 7644  C CB  . GLU A 1 991  ? 4.941   56.788  64.295  1.00 78.25  ? 988  GLU A CB  1 
ATOM 7645  C CG  . GLU A 1 991  ? 3.407   56.674  64.337  1.00 78.27  ? 988  GLU A CG  1 
ATOM 7646  C CD  . GLU A 1 991  ? 2.749   56.715  62.962  1.00 78.11  ? 988  GLU A CD  1 
ATOM 7647  O OE1 . GLU A 1 991  ? 3.224   56.024  62.034  1.00 77.93  ? 988  GLU A OE1 1 
ATOM 7648  O OE2 . GLU A 1 991  ? 1.737   57.432  62.818  1.00 77.87  ? 988  GLU A OE2 1 
ATOM 7649  N N   . ARG A 1 992  ? 7.988   57.131  65.654  1.00 77.06  ? 989  ARG A N   1 
ATOM 7650  C CA  . ARG A 1 992  ? 9.406   56.790  65.746  1.00 76.48  ? 989  ARG A CA  1 
ATOM 7651  C C   . ARG A 1 992  ? 9.711   56.193  67.115  1.00 75.81  ? 989  ARG A C   1 
ATOM 7652  O O   . ARG A 1 992  ? 10.509  55.264  67.229  1.00 75.78  ? 989  ARG A O   1 
ATOM 7653  C CB  . ARG A 1 992  ? 10.277  58.026  65.506  1.00 76.67  ? 989  ARG A CB  1 
ATOM 7654  C CG  . ARG A 1 992  ? 11.786  57.773  65.513  1.00 77.27  ? 989  ARG A CG  1 
ATOM 7655  C CD  . ARG A 1 992  ? 12.260  57.119  64.220  1.00 78.51  ? 989  ARG A CD  1 
ATOM 7656  N NE  . ARG A 1 992  ? 12.349  58.068  63.104  1.00 79.24  ? 989  ARG A NE  1 
ATOM 7657  C CZ  . ARG A 1 992  ? 11.465  58.176  62.111  1.00 79.43  ? 989  ARG A CZ  1 
ATOM 7658  N NH1 . ARG A 1 992  ? 10.385  57.401  62.067  1.00 79.93  ? 989  ARG A NH1 1 
ATOM 7659  N NH2 . ARG A 1 992  ? 11.660  59.068  61.149  1.00 79.27  ? 989  ARG A NH2 1 
ATOM 7660  N N   . GLN A 1 993  ? 9.053   56.733  68.141  1.00 74.95  ? 990  GLN A N   1 
ATOM 7661  C CA  . GLN A 1 993  ? 9.238   56.319  69.534  1.00 74.16  ? 990  GLN A CA  1 
ATOM 7662  C C   . GLN A 1 993  ? 8.930   54.835  69.788  1.00 73.45  ? 990  GLN A C   1 
ATOM 7663  O O   . GLN A 1 993  ? 9.492   54.223  70.699  1.00 73.31  ? 990  GLN A O   1 
ATOM 7664  C CB  . GLN A 1 993  ? 8.380   57.208  70.446  1.00 74.35  ? 990  GLN A CB  1 
ATOM 7665  C CG  . GLN A 1 993  ? 8.520   56.951  71.948  1.00 74.38  ? 990  GLN A CG  1 
ATOM 7666  C CD  . GLN A 1 993  ? 9.830   57.459  72.512  1.00 74.33  ? 990  GLN A CD  1 
ATOM 7667  O OE1 . GLN A 1 993  ? 10.405  58.432  72.011  1.00 73.77  ? 990  GLN A OE1 1 
ATOM 7668  N NE2 . GLN A 1 993  ? 10.312  56.803  73.565  1.00 74.53  ? 990  GLN A NE2 1 
ATOM 7669  N N   . HIS A 1 994  ? 8.032   54.269  68.985  1.00 72.58  ? 991  HIS A N   1 
ATOM 7670  C CA  . HIS A 1 994  ? 7.658   52.859  69.093  1.00 71.69  ? 991  HIS A CA  1 
ATOM 7671  C C   . HIS A 1 994  ? 8.320   52.064  67.973  1.00 70.85  ? 991  HIS A C   1 
ATOM 7672  O O   . HIS A 1 994  ? 8.382   52.539  66.838  1.00 70.88  ? 991  HIS A O   1 
ATOM 7673  C CB  . HIS A 1 994  ? 6.131   52.699  69.010  1.00 71.85  ? 991  HIS A CB  1 
ATOM 7674  C CG  . HIS A 1 994  ? 5.378   53.381  70.118  1.00 72.17  ? 991  HIS A CG  1 
ATOM 7675  N ND1 . HIS A 1 994  ? 4.607   52.691  71.030  1.00 72.35  ? 991  HIS A ND1 1 
ATOM 7676  C CD2 . HIS A 1 994  ? 5.270   54.691  70.451  1.00 72.08  ? 991  HIS A CD2 1 
ATOM 7677  C CE1 . HIS A 1 994  ? 4.062   53.544  71.879  1.00 72.21  ? 991  HIS A CE1 1 
ATOM 7678  N NE2 . HIS A 1 994  ? 4.450   54.764  71.552  1.00 72.13  ? 991  HIS A NE2 1 
ATOM 7679  N N   . LEU A 1 995  ? 8.833   50.875  68.293  1.00 69.70  ? 992  LEU A N   1 
ATOM 7680  C CA  . LEU A 1 995  ? 9.299   49.937  67.262  1.00 68.58  ? 992  LEU A CA  1 
ATOM 7681  C C   . LEU A 1 995  ? 8.428   48.685  67.236  1.00 67.90  ? 992  LEU A C   1 
ATOM 7682  O O   . LEU A 1 995  ? 8.285   47.998  68.240  1.00 67.75  ? 992  LEU A O   1 
ATOM 7683  C CB  . LEU A 1 995  ? 10.803  49.610  67.379  1.00 68.62  ? 992  LEU A CB  1 
ATOM 7684  C CG  . LEU A 1 995  ? 11.608  49.407  68.672  1.00 68.35  ? 992  LEU A CG  1 
ATOM 7685  C CD1 . LEU A 1 995  ? 11.351  48.074  69.317  1.00 67.86  ? 992  LEU A CD1 1 
ATOM 7686  C CD2 . LEU A 1 995  ? 13.086  49.513  68.360  1.00 68.43  ? 992  LEU A CD2 1 
ATOM 7687  N N   . GLN A 1 996  ? 7.840   48.403  66.079  1.00 67.09  ? 993  GLN A N   1 
ATOM 7688  C CA  . GLN A 1 996  ? 6.801   47.381  65.978  1.00 66.48  ? 993  GLN A CA  1 
ATOM 7689  C C   . GLN A 1 996  ? 7.319   45.942  65.933  1.00 65.90  ? 993  GLN A C   1 
ATOM 7690  O O   . GLN A 1 996  ? 8.400   45.681  65.404  1.00 65.82  ? 993  GLN A O   1 
ATOM 7691  C CB  . GLN A 1 996  ? 5.878   47.673  64.786  1.00 66.60  ? 993  GLN A CB  1 
ATOM 7692  C CG  . GLN A 1 996  ? 4.653   48.529  65.141  1.00 66.80  ? 993  GLN A CG  1 
ATOM 7693  C CD  . GLN A 1 996  ? 5.020   49.927  65.616  1.00 67.16  ? 993  GLN A CD  1 
ATOM 7694  O OE1 . GLN A 1 996  ? 5.731   50.653  64.926  1.00 67.91  ? 993  GLN A OE1 1 
ATOM 7695  N NE2 . GLN A 1 996  ? 4.534   50.310  66.798  1.00 66.80  ? 993  GLN A NE2 1 
ATOM 7696  N N   . GLU A 1 997  ? 6.539   45.020  66.502  1.00 65.18  ? 994  GLU A N   1 
ATOM 7697  C CA  . GLU A 1 997  ? 6.861   43.587  66.459  1.00 64.41  ? 994  GLU A CA  1 
ATOM 7698  C C   . GLU A 1 997  ? 6.516   43.012  65.084  1.00 63.82  ? 994  GLU A C   1 
ATOM 7699  O O   . GLU A 1 997  ? 5.367   42.666  64.803  1.00 63.84  ? 994  GLU A O   1 
ATOM 7700  C CB  . GLU A 1 997  ? 6.172   42.812  67.598  1.00 64.35  ? 994  GLU A CB  1 
ATOM 7701  C CG  . GLU A 1 997  ? 6.550   43.319  69.000  1.00 64.47  ? 994  GLU A CG  1 
ATOM 7702  C CD  . GLU A 1 997  ? 6.351   42.298  70.122  1.00 64.35  ? 994  GLU A CD  1 
ATOM 7703  O OE1 . GLU A 1 997  ? 5.301   41.620  70.167  1.00 64.61  ? 994  GLU A OE1 1 
ATOM 7704  O OE2 . GLU A 1 997  ? 7.247   42.197  70.986  1.00 63.78  ? 994  GLU A OE2 1 
ATOM 7705  N N   . VAL A 1 998  ? 7.531   42.927  64.232  1.00 62.96  ? 995  VAL A N   1 
ATOM 7706  C CA  . VAL A 1 998  ? 7.349   42.564  62.830  1.00 62.19  ? 995  VAL A CA  1 
ATOM 7707  C C   . VAL A 1 998  ? 7.551   41.080  62.547  1.00 61.56  ? 995  VAL A C   1 
ATOM 7708  O O   . VAL A 1 998  ? 7.654   40.689  61.383  1.00 61.77  ? 995  VAL A O   1 
ATOM 7709  C CB  . VAL A 1 998  ? 8.297   43.382  61.904  1.00 62.31  ? 995  VAL A CB  1 
ATOM 7710  C CG1 . VAL A 1 998  ? 7.997   44.869  62.006  1.00 62.53  ? 995  VAL A CG1 1 
ATOM 7711  C CG2 . VAL A 1 998  ? 9.761   43.110  62.232  1.00 62.26  ? 995  VAL A CG2 1 
ATOM 7712  N N   . GLY A 1 999  ? 7.620   40.260  63.597  1.00 60.70  ? 996  GLY A N   1 
ATOM 7713  C CA  . GLY A 1 999  ? 7.814   38.819  63.428  1.00 59.48  ? 996  GLY A CA  1 
ATOM 7714  C C   . GLY A 1 999  ? 7.813   38.003  64.701  1.00 58.65  ? 996  GLY A C   1 
ATOM 7715  O O   . GLY A 1 999  ? 8.764   38.048  65.467  1.00 58.62  ? 996  GLY A O   1 
ATOM 7716  N N   . LEU A 1 1000 ? 6.745   37.244  64.913  1.00 58.02  ? 997  LEU A N   1 
ATOM 7717  C CA  . LEU A 1 1000 ? 6.615   36.380  66.088  1.00 57.53  ? 997  LEU A CA  1 
ATOM 7718  C C   . LEU A 1 1000 ? 6.884   34.917  65.711  1.00 57.35  ? 997  LEU A C   1 
ATOM 7719  O O   . LEU A 1 1000 ? 6.947   34.595  64.529  1.00 57.48  ? 997  LEU A O   1 
ATOM 7720  C CB  . LEU A 1 1000 ? 5.223   36.541  66.700  1.00 57.33  ? 997  LEU A CB  1 
ATOM 7721  C CG  . LEU A 1 1000 ? 4.733   37.967  66.964  1.00 56.69  ? 997  LEU A CG  1 
ATOM 7722  C CD1 . LEU A 1 1000 ? 3.249   37.978  67.272  1.00 56.44  ? 997  LEU A CD1 1 
ATOM 7723  C CD2 . LEU A 1 1000 ? 5.510   38.605  68.096  1.00 56.57  ? 997  LEU A CD2 1 
ATOM 7724  N N   . PHE A 1 1001 ? 7.045   34.035  66.700  1.00 57.11  ? 998  PHE A N   1 
ATOM 7725  C CA  . PHE A 1 1001 ? 7.427   32.633  66.431  1.00 56.80  ? 998  PHE A CA  1 
ATOM 7726  C C   . PHE A 1 1001 ? 7.586   31.783  67.696  1.00 56.51  ? 998  PHE A C   1 
ATOM 7727  O O   . PHE A 1 1001 ? 8.130   32.240  68.699  1.00 56.51  ? 998  PHE A O   1 
ATOM 7728  C CB  . PHE A 1 1001 ? 8.733   32.600  65.640  1.00 56.83  ? 998  PHE A CB  1 
ATOM 7729  C CG  . PHE A 1 1001 ? 9.044   31.278  65.035  1.00 57.07  ? 998  PHE A CG  1 
ATOM 7730  C CD1 . PHE A 1 1001 ? 8.307   30.796  63.969  1.00 57.61  ? 998  PHE A CD1 1 
ATOM 7731  C CD2 . PHE A 1 1001 ? 10.097  30.518  65.516  1.00 58.04  ? 998  PHE A CD2 1 
ATOM 7732  C CE1 . PHE A 1 1001 ? 8.612   29.564  63.393  1.00 58.05  ? 998  PHE A CE1 1 
ATOM 7733  C CE2 . PHE A 1 1001 ? 10.409  29.282  64.949  1.00 58.05  ? 998  PHE A CE2 1 
ATOM 7734  C CZ  . PHE A 1 1001 ? 9.665   28.806  63.886  1.00 57.72  ? 998  PHE A CZ  1 
ATOM 7735  N N   . HIS A 1 1002 ? 7.122   30.541  67.647  1.00 56.12  ? 999  HIS A N   1 
ATOM 7736  C CA  . HIS A 1 1002 ? 7.261   29.658  68.799  1.00 55.82  ? 999  HIS A CA  1 
ATOM 7737  C C   . HIS A 1 1002 ? 8.327   28.576  68.608  1.00 55.66  ? 999  HIS A C   1 
ATOM 7738  O O   . HIS A 1 1002 ? 8.029   27.458  68.163  1.00 55.72  ? 999  HIS A O   1 
ATOM 7739  C CB  . HIS A 1 1002 ? 5.924   29.032  69.185  1.00 55.70  ? 999  HIS A CB  1 
ATOM 7740  C CG  . HIS A 1 1002 ? 5.987   28.248  70.455  1.00 55.97  ? 999  HIS A CG  1 
ATOM 7741  N ND1 . HIS A 1 1002 ? 6.005   28.845  71.697  1.00 56.70  ? 999  HIS A ND1 1 
ATOM 7742  C CD2 . HIS A 1 1002 ? 6.063   26.915  70.678  1.00 56.46  ? 999  HIS A CD2 1 
ATOM 7743  C CE1 . HIS A 1 1002 ? 6.076   27.913  72.631  1.00 56.97  ? 999  HIS A CE1 1 
ATOM 7744  N NE2 . HIS A 1 1002 ? 6.108   26.732  72.039  1.00 56.63  ? 999  HIS A NE2 1 
ATOM 7745  N N   . LEU A 1 1003 ? 9.567   28.917  68.956  1.00 55.17  ? 1000 LEU A N   1 
ATOM 7746  C CA  . LEU A 1 1003 ? 10.679  27.969  68.915  1.00 54.76  ? 1000 LEU A CA  1 
ATOM 7747  C C   . LEU A 1 1003 ? 10.354  26.714  69.735  1.00 54.63  ? 1000 LEU A C   1 
ATOM 7748  O O   . LEU A 1 1003 ? 10.586  25.590  69.293  1.00 54.23  ? 1000 LEU A O   1 
ATOM 7749  C CB  . LEU A 1 1003 ? 11.945  28.633  69.462  1.00 54.62  ? 1000 LEU A CB  1 
ATOM 7750  C CG  . LEU A 1 1003 ? 13.284  28.531  68.724  1.00 54.25  ? 1000 LEU A CG  1 
ATOM 7751  C CD1 . LEU A 1 1003 ? 14.264  29.404  69.451  1.00 54.28  ? 1000 LEU A CD1 1 
ATOM 7752  C CD2 . LEU A 1 1003 ? 13.835  27.114  68.622  1.00 53.74  ? 1000 LEU A CD2 1 
ATOM 7753  N N   . GLY A 1 1004 ? 9.792   26.925  70.923  1.00 54.71  ? 1001 GLY A N   1 
ATOM 7754  C CA  . GLY A 1 1004 ? 9.551   25.845  71.866  1.00 54.88  ? 1001 GLY A CA  1 
ATOM 7755  C C   . GLY A 1 1004 ? 10.831  25.521  72.608  1.00 55.02  ? 1001 GLY A C   1 
ATOM 7756  O O   . GLY A 1 1004 ? 11.096  24.359  72.929  1.00 55.00  ? 1001 GLY A O   1 
ATOM 7757  N N   . GLU A 1 1005 ? 11.620  26.562  72.878  1.00 55.07  ? 1002 GLU A N   1 
ATOM 7758  C CA  . GLU A 1 1005 ? 12.956  26.428  73.461  1.00 55.08  ? 1002 GLU A CA  1 
ATOM 7759  C C   . GLU A 1 1005 ? 13.390  27.704  74.189  1.00 55.07  ? 1002 GLU A C   1 
ATOM 7760  O O   . GLU A 1 1005 ? 13.404  28.786  73.591  1.00 55.16  ? 1002 GLU A O   1 
ATOM 7761  C CB  . GLU A 1 1005 ? 13.976  26.123  72.358  1.00 55.07  ? 1002 GLU A CB  1 
ATOM 7762  C CG  . GLU A 1 1005 ? 13.840  24.758  71.708  1.00 54.69  ? 1002 GLU A CG  1 
ATOM 7763  C CD  . GLU A 1 1005 ? 14.539  23.660  72.479  1.00 54.48  ? 1002 GLU A CD  1 
ATOM 7764  O OE1 . GLU A 1 1005 ? 15.100  22.762  71.820  1.00 54.28  ? 1002 GLU A OE1 1 
ATOM 7765  O OE2 . GLU A 1 1005 ? 14.542  23.694  73.730  1.00 54.53  ? 1002 GLU A OE2 1 
ATOM 7766  N N   . PHE A 1 1006 ? 13.755  27.569  75.466  1.00 54.83  ? 1003 PHE A N   1 
ATOM 7767  C CA  . PHE A 1 1006 ? 14.295  28.680  76.267  1.00 54.51  ? 1003 PHE A CA  1 
ATOM 7768  C C   . PHE A 1 1006 ? 15.665  29.106  75.755  1.00 54.38  ? 1003 PHE A C   1 
ATOM 7769  O O   . PHE A 1 1006 ? 16.618  28.330  75.820  1.00 54.52  ? 1003 PHE A O   1 
ATOM 7770  C CB  . PHE A 1 1006 ? 14.446  28.260  77.728  1.00 54.50  ? 1003 PHE A CB  1 
ATOM 7771  C CG  . PHE A 1 1006 ? 14.545  29.406  78.668  1.00 54.30  ? 1003 PHE A CG  1 
ATOM 7772  C CD1 . PHE A 1 1006 ? 13.611  29.551  79.696  1.00 54.85  ? 1003 PHE A CD1 1 
ATOM 7773  C CD2 . PHE A 1 1006 ? 15.547  30.359  78.520  1.00 53.52  ? 1003 PHE A CD2 1 
ATOM 7774  C CE1 . PHE A 1 1006 ? 13.679  30.635  80.569  1.00 55.33  ? 1003 PHE A CE1 1 
ATOM 7775  C CE2 . PHE A 1 1006 ? 15.626  31.444  79.383  1.00 54.32  ? 1003 PHE A CE2 1 
ATOM 7776  C CZ  . PHE A 1 1006 ? 14.693  31.588  80.413  1.00 54.55  ? 1003 PHE A CZ  1 
ATOM 7777  N N   . VAL A 1 1007 ? 15.777  30.336  75.267  1.00 54.00  ? 1004 VAL A N   1 
ATOM 7778  C CA  . VAL A 1 1007 ? 17.009  30.747  74.604  1.00 53.61  ? 1004 VAL A CA  1 
ATOM 7779  C C   . VAL A 1 1007 ? 17.912  31.507  75.552  1.00 53.47  ? 1004 VAL A C   1 
ATOM 7780  O O   . VAL A 1 1007 ? 17.581  32.617  75.963  1.00 53.71  ? 1004 VAL A O   1 
ATOM 7781  C CB  . VAL A 1 1007 ? 16.741  31.594  73.356  1.00 53.52  ? 1004 VAL A CB  1 
ATOM 7782  C CG1 . VAL A 1 1007 ? 17.989  31.684  72.507  1.00 53.37  ? 1004 VAL A CG1 1 
ATOM 7783  C CG2 . VAL A 1 1007 ? 15.613  30.994  72.542  1.00 53.82  ? 1004 VAL A CG2 1 
ATOM 7784  N N   . ASN A 1 1008 ? 19.053  30.906  75.886  1.00 53.14  ? 1005 ASN A N   1 
ATOM 7785  C CA  . ASN A 1 1008 ? 20.032  31.532  76.765  1.00 52.76  ? 1005 ASN A CA  1 
ATOM 7786  C C   . ASN A 1 1008 ? 20.914  32.542  76.064  1.00 52.78  ? 1005 ASN A C   1 
ATOM 7787  O O   . ASN A 1 1008 ? 21.088  33.647  76.566  1.00 52.57  ? 1005 ASN A O   1 
ATOM 7788  C CB  . ASN A 1 1008 ? 20.888  30.485  77.472  1.00 52.56  ? 1005 ASN A CB  1 
ATOM 7789  C CG  . ASN A 1 1008 ? 20.362  30.133  78.862  1.00 52.94  ? 1005 ASN A CG  1 
ATOM 7790  O OD1 . ASN A 1 1008 ? 19.888  31.002  79.606  1.00 52.94  ? 1005 ASN A OD1 1 
ATOM 7791  N ND2 . ASN A 1 1008 ? 20.464  28.855  79.227  1.00 52.50  ? 1005 ASN A ND2 1 
ATOM 7792  N N   . VAL A 1 1009 ? 21.448  32.181  74.898  1.00 53.15  ? 1006 VAL A N   1 
ATOM 7793  C CA  . VAL A 1 1009 ? 22.447  33.020  74.228  1.00 53.72  ? 1006 VAL A CA  1 
ATOM 7794  C C   . VAL A 1 1009 ? 22.366  33.070  72.705  1.00 54.10  ? 1006 VAL A C   1 
ATOM 7795  O O   . VAL A 1 1009 ? 22.135  32.061  72.058  1.00 54.26  ? 1006 VAL A O   1 
ATOM 7796  C CB  . VAL A 1 1009 ? 23.892  32.624  74.648  1.00 53.82  ? 1006 VAL A CB  1 
ATOM 7797  C CG1 . VAL A 1 1009 ? 24.261  31.216  74.161  1.00 53.50  ? 1006 VAL A CG1 1 
ATOM 7798  C CG2 . VAL A 1 1009 ? 24.903  33.651  74.154  1.00 54.23  ? 1006 VAL A CG2 1 
ATOM 7799  N N   . PHE A 1 1010 ? 22.566  34.263  72.154  1.00 54.77  ? 1007 PHE A N   1 
ATOM 7800  C CA  . PHE A 1 1010 ? 22.729  34.473  70.719  1.00 55.34  ? 1007 PHE A CA  1 
ATOM 7801  C C   . PHE A 1 1010 ? 24.150  34.941  70.469  1.00 56.11  ? 1007 PHE A C   1 
ATOM 7802  O O   . PHE A 1 1010 ? 24.811  35.434  71.377  1.00 56.37  ? 1007 PHE A O   1 
ATOM 7803  C CB  . PHE A 1 1010 ? 21.837  35.614  70.232  1.00 54.97  ? 1007 PHE A CB  1 
ATOM 7804  C CG  . PHE A 1 1010 ? 20.378  35.296  70.184  1.00 54.52  ? 1007 PHE A CG  1 
ATOM 7805  C CD1 . PHE A 1 1010 ? 19.479  36.042  70.922  1.00 53.98  ? 1007 PHE A CD1 1 
ATOM 7806  C CD2 . PHE A 1 1010 ? 19.892  34.289  69.364  1.00 54.06  ? 1007 PHE A CD2 1 
ATOM 7807  C CE1 . PHE A 1 1010 ? 18.118  35.767  70.863  1.00 54.18  ? 1007 PHE A CE1 1 
ATOM 7808  C CE2 . PHE A 1 1010 ? 18.529  34.015  69.303  1.00 53.63  ? 1007 PHE A CE2 1 
ATOM 7809  C CZ  . PHE A 1 1010 ? 17.645  34.753  70.051  1.00 53.54  ? 1007 PHE A CZ  1 
ATOM 7810  N N   . CYS A 1 1011 ? 24.605  34.811  69.229  1.00 57.18  ? 1008 CYS A N   1 
ATOM 7811  C CA  . CYS A 1 1011 ? 25.866  35.406  68.784  1.00 58.33  ? 1008 CYS A CA  1 
ATOM 7812  C C   . CYS A 1 1011 ? 26.108  35.138  67.302  1.00 58.92  ? 1008 CYS A C   1 
ATOM 7813  O O   . CYS A 1 1011 ? 25.432  34.305  66.685  1.00 58.83  ? 1008 CYS A O   1 
ATOM 7814  C CB  . CYS A 1 1011 ? 27.065  34.925  69.619  1.00 58.48  ? 1008 CYS A CB  1 
ATOM 7815  S SG  . CYS A 1 1011 ? 27.773  33.340  69.109  1.00 59.30  ? 1008 CYS A SG  1 
ATOM 7816  N N   . HIS A 1 1012 ? 27.086  35.856  66.750  1.00 59.80  ? 1009 HIS A N   1 
ATOM 7817  C CA  . HIS A 1 1012 ? 27.423  35.796  65.331  1.00 60.48  ? 1009 HIS A CA  1 
ATOM 7818  C C   . HIS A 1 1012 ? 28.530  34.784  65.110  1.00 61.05  ? 1009 HIS A C   1 
ATOM 7819  O O   . HIS A 1 1012 ? 29.379  34.582  65.982  1.00 61.13  ? 1009 HIS A O   1 
ATOM 7820  C CB  . HIS A 1 1012 ? 27.842  37.182  64.824  1.00 60.39  ? 1009 HIS A CB  1 
ATOM 7821  C CG  . HIS A 1 1012 ? 26.746  38.201  64.890  1.00 60.13  ? 1009 HIS A CG  1 
ATOM 7822  N ND1 . HIS A 1 1012 ? 26.206  38.785  63.766  1.00 59.97  ? 1009 HIS A ND1 1 
ATOM 7823  C CD2 . HIS A 1 1012 ? 26.072  38.719  65.944  1.00 59.90  ? 1009 HIS A CD2 1 
ATOM 7824  C CE1 . HIS A 1 1012 ? 25.254  39.628  64.124  1.00 59.70  ? 1009 HIS A CE1 1 
ATOM 7825  N NE2 . HIS A 1 1012 ? 25.150  39.603  65.440  1.00 59.83  ? 1009 HIS A NE2 1 
ATOM 7826  N N   . GLY A 1 1013 ? 28.509  34.153  63.941  1.00 61.73  ? 1010 GLY A N   1 
ATOM 7827  C CA  . GLY A 1 1013 ? 29.453  33.093  63.608  1.00 62.59  ? 1010 GLY A CA  1 
ATOM 7828  C C   . GLY A 1 1013 ? 28.741  31.956  62.904  1.00 63.29  ? 1010 GLY A C   1 
ATOM 7829  O O   . GLY A 1 1013 ? 27.513  31.852  62.944  1.00 63.47  ? 1010 GLY A O   1 
ATOM 7830  N N   . SER A 1 1014 ? 29.520  31.104  62.253  1.00 63.82  ? 1011 SER A N   1 
ATOM 7831  C CA  . SER A 1 1014 ? 28.998  29.967  61.513  1.00 64.33  ? 1011 SER A CA  1 
ATOM 7832  C C   . SER A 1 1014 ? 29.933  28.796  61.793  1.00 64.65  ? 1011 SER A C   1 
ATOM 7833  O O   . SER A 1 1014 ? 31.107  29.002  62.096  1.00 64.68  ? 1011 SER A O   1 
ATOM 7834  C CB  . SER A 1 1014 ? 28.933  30.323  60.018  1.00 64.35  ? 1011 SER A CB  1 
ATOM 7835  O OG  . SER A 1 1014 ? 29.161  29.212  59.165  1.00 64.99  ? 1011 SER A OG  1 
ATOM 7836  N N   . LEU A 1 1015 ? 29.423  27.573  61.721  1.00 65.27  ? 1012 LEU A N   1 
ATOM 7837  C CA  . LEU A 1 1015 ? 30.267  26.401  61.978  1.00 66.00  ? 1012 LEU A CA  1 
ATOM 7838  C C   . LEU A 1 1015 ? 30.968  25.869  60.727  1.00 66.54  ? 1012 LEU A C   1 
ATOM 7839  O O   . LEU A 1 1015 ? 31.806  24.960  60.824  1.00 66.66  ? 1012 LEU A O   1 
ATOM 7840  C CB  . LEU A 1 1015 ? 29.479  25.294  62.686  1.00 66.03  ? 1012 LEU A CB  1 
ATOM 7841  C CG  . LEU A 1 1015 ? 29.144  25.596  64.154  1.00 66.07  ? 1012 LEU A CG  1 
ATOM 7842  C CD1 . LEU A 1 1015 ? 27.952  24.787  64.631  1.00 66.42  ? 1012 LEU A CD1 1 
ATOM 7843  C CD2 . LEU A 1 1015 ? 30.339  25.376  65.068  1.00 65.92  ? 1012 LEU A CD2 1 
ATOM 7844  N N   . VAL A 1 1016 ? 30.646  26.468  59.574  1.00 67.06  ? 1013 VAL A N   1 
ATOM 7845  C CA  . VAL A 1 1016 ? 31.181  26.062  58.266  1.00 67.43  ? 1013 VAL A CA  1 
ATOM 7846  C C   . VAL A 1 1016 ? 31.851  27.201  57.487  1.00 67.82  ? 1013 VAL A C   1 
ATOM 7847  O O   . VAL A 1 1016 ? 32.291  28.185  58.078  1.00 67.67  ? 1013 VAL A O   1 
ATOM 7848  C CB  . VAL A 1 1016 ? 30.083  25.431  57.378  1.00 67.49  ? 1013 VAL A CB  1 
ATOM 7849  C CG1 . VAL A 1 1016 ? 29.823  23.974  57.786  1.00 67.76  ? 1013 VAL A CG1 1 
ATOM 7850  C CG2 . VAL A 1 1016 ? 28.797  26.289  57.389  1.00 66.92  ? 1013 VAL A CG2 1 
ATOM 7851  N N   . MET A 1 1017 ? 31.883  27.040  56.158  1.00 68.48  ? 1014 MET A N   1 
ATOM 7852  C CA  . MET A 1 1017 ? 32.551  27.910  55.153  1.00 68.99  ? 1014 MET A CA  1 
ATOM 7853  C C   . MET A 1 1017 ? 34.060  27.671  55.069  1.00 69.39  ? 1014 MET A C   1 
ATOM 7854  O O   . MET A 1 1017 ? 34.596  26.788  55.747  1.00 69.38  ? 1014 MET A O   1 
ATOM 7855  C CB  . MET A 1 1017 ? 32.149  29.409  55.218  1.00 68.92  ? 1014 MET A CB  1 
ATOM 7856  C CG  . MET A 1 1017 ? 32.838  30.297  56.272  1.00 69.36  ? 1014 MET A CG  1 
ATOM 7857  S SD  . MET A 1 1017 ? 34.404  31.066  55.773  1.00 70.57  ? 1014 MET A SD  1 
ATOM 7858  C CE  . MET A 1 1017 ? 34.508  32.425  56.945  1.00 69.35  ? 1014 MET A CE  1 
ATOM 7859  N N   . GLN A 1 1018 ? 34.715  28.454  54.212  1.00 69.97  ? 1015 GLN A N   1 
ATOM 7860  C CA  . GLN A 1 1018 ? 36.157  28.352  53.935  1.00 70.52  ? 1015 GLN A CA  1 
ATOM 7861  C C   . GLN A 1 1018 ? 37.009  28.251  55.206  1.00 70.54  ? 1015 GLN A C   1 
ATOM 7862  O O   . GLN A 1 1018 ? 37.848  27.355  55.341  1.00 70.61  ? 1015 GLN A O   1 
ATOM 7863  C CB  . GLN A 1 1018 ? 36.622  29.552  53.086  1.00 70.67  ? 1015 GLN A CB  1 
ATOM 7864  C CG  . GLN A 1 1018 ? 35.811  29.802  51.796  1.00 71.25  ? 1015 GLN A CG  1 
ATOM 7865  C CD  . GLN A 1 1018 ? 36.298  28.976  50.599  1.00 71.67  ? 1015 GLN A CD  1 
ATOM 7866  O OE1 . GLN A 1 1018 ? 37.351  29.259  50.018  1.00 71.28  ? 1015 GLN A OE1 1 
ATOM 7867  N NE2 . GLN A 1 1018 ? 35.515  27.966  50.219  1.00 72.14  ? 1015 GLN A NE2 1 
ATOM 7868  N N   . PRO A 1 1026 ? 22.715  32.380  48.808  1.00 72.45  ? 1023 PRO A N   1 
ATOM 7869  C CA  . PRO A 1 1026 ? 21.353  31.888  49.075  1.00 72.43  ? 1023 PRO A CA  1 
ATOM 7870  C C   . PRO A 1 1026 ? 20.649  32.633  50.218  1.00 72.29  ? 1023 PRO A C   1 
ATOM 7871  O O   . PRO A 1 1026 ? 19.424  32.815  50.170  1.00 72.29  ? 1023 PRO A O   1 
ATOM 7872  C CB  . PRO A 1 1026 ? 21.562  30.405  49.444  1.00 72.46  ? 1023 PRO A CB  1 
ATOM 7873  C CG  . PRO A 1 1026 ? 23.021  30.098  49.152  1.00 72.53  ? 1023 PRO A CG  1 
ATOM 7874  C CD  . PRO A 1 1026 ? 23.752  31.406  49.193  1.00 72.43  ? 1023 PRO A CD  1 
ATOM 7875  N N   . THR A 1 1027 ? 21.422  33.038  51.232  1.00 71.92  ? 1024 THR A N   1 
ATOM 7876  C CA  . THR A 1 1027 ? 20.925  33.814  52.378  1.00 71.49  ? 1024 THR A CA  1 
ATOM 7877  C C   . THR A 1 1027 ? 21.872  34.966  52.732  1.00 71.24  ? 1024 THR A C   1 
ATOM 7878  O O   . THR A 1 1027 ? 22.729  35.339  51.924  1.00 71.32  ? 1024 THR A O   1 
ATOM 7879  C CB  . THR A 1 1027 ? 20.700  32.938  53.631  1.00 71.44  ? 1024 THR A CB  1 
ATOM 7880  O OG1 . THR A 1 1027 ? 21.827  32.077  53.827  1.00 71.37  ? 1024 THR A OG1 1 
ATOM 7881  C CG2 . THR A 1 1027 ? 19.434  32.105  53.493  1.00 71.73  ? 1024 THR A CG2 1 
ATOM 7882  N N   . GLN A 1 1028 ? 21.708  35.524  53.934  1.00 70.79  ? 1025 GLN A N   1 
ATOM 7883  C CA  . GLN A 1 1028 ? 22.488  36.683  54.386  1.00 70.37  ? 1025 GLN A CA  1 
ATOM 7884  C C   . GLN A 1 1028 ? 22.471  36.824  55.923  1.00 69.56  ? 1025 GLN A C   1 
ATOM 7885  O O   . GLN A 1 1028 ? 21.406  36.825  56.550  1.00 69.51  ? 1025 GLN A O   1 
ATOM 7886  C CB  . GLN A 1 1028 ? 21.974  37.966  53.712  1.00 70.40  ? 1025 GLN A CB  1 
ATOM 7887  C CG  . GLN A 1 1028 ? 23.022  39.069  53.554  1.00 71.02  ? 1025 GLN A CG  1 
ATOM 7888  C CD  . GLN A 1 1028 ? 22.418  40.452  53.288  1.00 71.21  ? 1025 GLN A CD  1 
ATOM 7889  O OE1 . GLN A 1 1028 ? 21.268  40.738  53.656  1.00 72.07  ? 1025 GLN A OE1 1 
ATOM 7890  N NE2 . GLN A 1 1028 ? 23.205  41.322  52.651  1.00 72.17  ? 1025 GLN A NE2 1 
ATOM 7891  N N   . GLY A 1 1029 ? 23.659  36.952  56.515  1.00 68.68  ? 1026 GLY A N   1 
ATOM 7892  C CA  . GLY A 1 1029 ? 23.808  36.986  57.973  1.00 67.68  ? 1026 GLY A CA  1 
ATOM 7893  C C   . GLY A 1 1029 ? 23.893  35.578  58.540  1.00 66.93  ? 1026 GLY A C   1 
ATOM 7894  O O   . GLY A 1 1029 ? 23.800  34.606  57.786  1.00 67.13  ? 1026 GLY A O   1 
ATOM 7895  N N   . SER A 1 1030 ? 24.081  35.464  59.861  1.00 65.88  ? 1027 SER A N   1 
ATOM 7896  C CA  . SER A 1 1030 ? 24.143  34.161  60.559  1.00 64.53  ? 1027 SER A CA  1 
ATOM 7897  C C   . SER A 1 1030 ? 24.284  34.348  62.069  1.00 63.61  ? 1027 SER A C   1 
ATOM 7898  O O   . SER A 1 1030 ? 25.290  34.892  62.547  1.00 63.60  ? 1027 SER A O   1 
ATOM 7899  C CB  . SER A 1 1030 ? 25.300  33.307  60.028  1.00 64.54  ? 1027 SER A CB  1 
ATOM 7900  O OG  . SER A 1 1030 ? 25.291  32.014  60.600  1.00 64.71  ? 1027 SER A OG  1 
ATOM 7901  N N   . VAL A 1 1031 ? 23.279  33.901  62.818  1.00 62.22  ? 1028 VAL A N   1 
ATOM 7902  C CA  . VAL A 1 1031 ? 23.272  34.112  64.266  1.00 61.05  ? 1028 VAL A CA  1 
ATOM 7903  C C   . VAL A 1 1031 ? 22.914  32.838  65.027  1.00 60.34  ? 1028 VAL A C   1 
ATOM 7904  O O   . VAL A 1 1031 ? 21.766  32.383  65.028  1.00 60.49  ? 1028 VAL A O   1 
ATOM 7905  C CB  . VAL A 1 1031 ? 22.354  35.297  64.677  1.00 60.97  ? 1028 VAL A CB  1 
ATOM 7906  C CG1 . VAL A 1 1031 ? 22.190  35.360  66.179  1.00 60.55  ? 1028 VAL A CG1 1 
ATOM 7907  C CG2 . VAL A 1 1031 ? 22.918  36.612  64.162  1.00 60.92  ? 1028 VAL A CG2 1 
ATOM 7908  N N   . LEU A 1 1032 ? 23.920  32.263  65.672  1.00 59.26  ? 1029 LEU A N   1 
ATOM 7909  C CA  . LEU A 1 1032 ? 23.763  31.008  66.397  1.00 58.16  ? 1029 LEU A CA  1 
ATOM 7910  C C   . LEU A 1 1032 ? 23.146  31.240  67.774  1.00 57.22  ? 1029 LEU A C   1 
ATOM 7911  O O   . LEU A 1 1032 ? 23.368  32.270  68.400  1.00 57.26  ? 1029 LEU A O   1 
ATOM 7912  C CB  . LEU A 1 1032 ? 25.124  30.314  66.545  1.00 58.32  ? 1029 LEU A CB  1 
ATOM 7913  C CG  . LEU A 1 1032 ? 25.777  29.628  65.339  1.00 57.99  ? 1029 LEU A CG  1 
ATOM 7914  C CD1 . LEU A 1 1032 ? 27.294  29.606  65.488  1.00 57.41  ? 1029 LEU A CD1 1 
ATOM 7915  C CD2 . LEU A 1 1032 ? 25.234  28.220  65.158  1.00 57.92  ? 1029 LEU A CD2 1 
ATOM 7916  N N   . PHE A 1 1033 ? 22.372  30.277  68.250  1.00 55.93  ? 1030 PHE A N   1 
ATOM 7917  C CA  . PHE A 1 1033 ? 21.858  30.373  69.599  1.00 54.79  ? 1030 PHE A CA  1 
ATOM 7918  C C   . PHE A 1 1033 ? 21.944  29.052  70.343  1.00 54.48  ? 1030 PHE A C   1 
ATOM 7919  O O   . PHE A 1 1033 ? 21.750  27.982  69.745  1.00 54.35  ? 1030 PHE A O   1 
ATOM 7920  C CB  . PHE A 1 1033 ? 20.434  30.956  69.619  1.00 54.46  ? 1030 PHE A CB  1 
ATOM 7921  C CG  . PHE A 1 1033 ? 19.380  30.064  69.000  1.00 53.77  ? 1030 PHE A CG  1 
ATOM 7922  C CD1 . PHE A 1 1033 ? 18.626  29.211  69.787  1.00 52.82  ? 1030 PHE A CD1 1 
ATOM 7923  C CD2 . PHE A 1 1033 ? 19.117  30.111  67.634  1.00 52.81  ? 1030 PHE A CD2 1 
ATOM 7924  C CE1 . PHE A 1 1033 ? 17.664  28.404  69.220  1.00 52.53  ? 1030 PHE A CE1 1 
ATOM 7925  C CE2 . PHE A 1 1033 ? 18.147  29.309  67.066  1.00 51.31  ? 1030 PHE A CE2 1 
ATOM 7926  C CZ  . PHE A 1 1033 ? 17.425  28.456  67.857  1.00 52.32  ? 1030 PHE A CZ  1 
ATOM 7927  N N   . GLY A 1 1034 ? 22.257  29.147  71.639  1.00 53.96  ? 1031 GLY A N   1 
ATOM 7928  C CA  . GLY A 1 1034 ? 22.268  28.010  72.556  1.00 53.39  ? 1031 GLY A CA  1 
ATOM 7929  C C   . GLY A 1 1034 ? 21.100  28.073  73.521  1.00 53.03  ? 1031 GLY A C   1 
ATOM 7930  O O   . GLY A 1 1034 ? 20.742  29.147  74.000  1.00 52.75  ? 1031 GLY A O   1 
ATOM 7931  N N   . THR A 1 1035 ? 20.515  26.913  73.807  1.00 53.01  ? 1032 THR A N   1 
ATOM 7932  C CA  . THR A 1 1035 ? 19.307  26.809  74.631  1.00 53.22  ? 1032 THR A CA  1 
ATOM 7933  C C   . THR A 1 1035 ? 19.507  25.937  75.863  1.00 53.13  ? 1032 THR A C   1 
ATOM 7934  O O   . THR A 1 1035 ? 20.526  25.289  76.019  1.00 53.31  ? 1032 THR A O   1 
ATOM 7935  C CB  . THR A 1 1035 ? 18.148  26.190  73.835  1.00 53.38  ? 1032 THR A CB  1 
ATOM 7936  O OG1 . THR A 1 1035 ? 18.557  24.915  73.322  1.00 54.01  ? 1032 THR A OG1 1 
ATOM 7937  C CG2 . THR A 1 1035 ? 17.729  27.093  72.681  1.00 53.41  ? 1032 THR A CG2 1 
ATOM 7938  N N   . VAL A 1 1036 ? 18.503  25.903  76.722  1.00 53.32  ? 1033 VAL A N   1 
ATOM 7939  C CA  . VAL A 1 1036 ? 18.552  25.143  77.970  1.00 53.73  ? 1033 VAL A CA  1 
ATOM 7940  C C   . VAL A 1 1036 ? 18.539  23.622  77.757  1.00 54.19  ? 1033 VAL A C   1 
ATOM 7941  O O   . VAL A 1 1036 ? 19.112  22.862  78.541  1.00 53.98  ? 1033 VAL A O   1 
ATOM 7942  C CB  . VAL A 1 1036 ? 17.395  25.606  78.896  1.00 53.53  ? 1033 VAL A CB  1 
ATOM 7943  C CG1 . VAL A 1 1036 ? 16.776  24.468  79.681  1.00 53.41  ? 1033 VAL A CG1 1 
ATOM 7944  C CG2 . VAL A 1 1036 ? 17.885  26.699  79.812  1.00 53.83  ? 1033 VAL A CG2 1 
ATOM 7945  N N   . ASN A 1 1037 ? 17.878  23.193  76.690  1.00 54.94  ? 1034 ASN A N   1 
ATOM 7946  C CA  . ASN A 1 1037 ? 17.721  21.781  76.397  1.00 55.48  ? 1034 ASN A CA  1 
ATOM 7947  C C   . ASN A 1 1037 ? 18.905  21.251  75.620  1.00 55.88  ? 1034 ASN A C   1 
ATOM 7948  O O   . ASN A 1 1037 ? 18.971  20.056  75.309  1.00 55.86  ? 1034 ASN A O   1 
ATOM 7949  C CB  . ASN A 1 1037 ? 16.420  21.536  75.631  1.00 55.59  ? 1034 ASN A CB  1 
ATOM 7950  C CG  . ASN A 1 1037 ? 15.225  21.365  76.548  1.00 56.06  ? 1034 ASN A CG  1 
ATOM 7951  O OD1 . ASN A 1 1037 ? 15.359  20.957  77.700  1.00 56.91  ? 1034 ASN A OD1 1 
ATOM 7952  N ND2 . ASN A 1 1037 ? 14.045  21.660  76.033  1.00 56.97  ? 1034 ASN A ND2 1 
ATOM 7953  N N   . GLY A 1 1038 ? 19.835  22.150  75.304  1.00 56.40  ? 1035 GLY A N   1 
ATOM 7954  C CA  . GLY A 1 1038 ? 21.086  21.779  74.642  1.00 57.34  ? 1035 GLY A CA  1 
ATOM 7955  C C   . GLY A 1 1038 ? 21.027  21.882  73.132  1.00 57.86  ? 1035 GLY A C   1 
ATOM 7956  O O   . GLY A 1 1038 ? 22.002  21.577  72.438  1.00 57.76  ? 1035 GLY A O   1 
ATOM 7957  N N   . MET A 1 1039 ? 19.870  22.304  72.635  1.00 58.54  ? 1036 MET A N   1 
ATOM 7958  C CA  . MET A 1 1039 ? 19.635  22.484  71.217  1.00 59.29  ? 1036 MET A CA  1 
ATOM 7959  C C   . MET A 1 1039 ? 20.457  23.681  70.769  1.00 59.67  ? 1036 MET A C   1 
ATOM 7960  O O   . MET A 1 1039 ? 20.494  24.707  71.463  1.00 59.73  ? 1036 MET A O   1 
ATOM 7961  C CB  . MET A 1 1039 ? 18.140  22.726  70.988  1.00 59.48  ? 1036 MET A CB  1 
ATOM 7962  C CG  . MET A 1 1039 ? 17.691  22.921  69.547  1.00 60.14  ? 1036 MET A CG  1 
ATOM 7963  S SD  . MET A 1 1039 ? 17.701  24.643  69.025  1.00 60.97  ? 1036 MET A SD  1 
ATOM 7964  C CE  . MET A 1 1039 ? 16.586  24.588  67.624  1.00 60.65  ? 1036 MET A CE  1 
ATOM 7965  N N   . ILE A 1 1040 ? 21.143  23.533  69.636  1.00 60.07  ? 1037 ILE A N   1 
ATOM 7966  C CA  . ILE A 1 1040 ? 21.853  24.657  69.023  1.00 60.46  ? 1037 ILE A CA  1 
ATOM 7967  C C   . ILE A 1 1040 ? 21.137  25.055  67.752  1.00 60.68  ? 1037 ILE A C   1 
ATOM 7968  O O   . ILE A 1 1040 ? 21.013  24.261  66.820  1.00 60.57  ? 1037 ILE A O   1 
ATOM 7969  C CB  . ILE A 1 1040 ? 23.338  24.353  68.701  1.00 60.44  ? 1037 ILE A CB  1 
ATOM 7970  C CG1 . ILE A 1 1040 ? 24.131  24.081  69.976  1.00 60.13  ? 1037 ILE A CG1 1 
ATOM 7971  C CG2 . ILE A 1 1040 ? 23.978  25.527  67.933  1.00 60.55  ? 1037 ILE A CG2 1 
ATOM 7972  C CD1 . ILE A 1 1040 ? 25.490  23.485  69.702  1.00 60.56  ? 1037 ILE A CD1 1 
ATOM 7973  N N   . GLY A 1 1041 ? 20.670  26.291  67.715  1.00 61.06  ? 1038 GLY A N   1 
ATOM 7974  C CA  . GLY A 1 1041 ? 19.949  26.760  66.550  1.00 61.82  ? 1038 GLY A CA  1 
ATOM 7975  C C   . GLY A 1 1041 ? 20.758  27.693  65.672  1.00 62.23  ? 1038 GLY A C   1 
ATOM 7976  O O   . GLY A 1 1041 ? 21.928  28.006  65.975  1.00 62.41  ? 1038 GLY A O   1 
ATOM 7977  N N   . LEU A 1 1042 ? 20.121  28.139  64.587  1.00 62.16  ? 1039 LEU A N   1 
ATOM 7978  C CA  . LEU A 1 1042 ? 20.714  29.089  63.661  1.00 62.16  ? 1039 LEU A CA  1 
ATOM 7979  C C   . LEU A 1 1042 ? 19.631  29.996  63.090  1.00 62.30  ? 1039 LEU A C   1 
ATOM 7980  O O   . LEU A 1 1042 ? 18.714  29.521  62.432  1.00 62.45  ? 1039 LEU A O   1 
ATOM 7981  C CB  . LEU A 1 1042 ? 21.451  28.344  62.537  1.00 62.11  ? 1039 LEU A CB  1 
ATOM 7982  C CG  . LEU A 1 1042 ? 22.150  29.146  61.434  1.00 62.10  ? 1039 LEU A CG  1 
ATOM 7983  C CD1 . LEU A 1 1042 ? 23.145  30.120  62.035  1.00 62.87  ? 1039 LEU A CD1 1 
ATOM 7984  C CD2 . LEU A 1 1042 ? 22.842  28.226  60.451  1.00 61.94  ? 1039 LEU A CD2 1 
ATOM 7985  N N   . VAL A 1 1043 ? 19.726  31.293  63.365  1.00 62.48  ? 1040 VAL A N   1 
ATOM 7986  C CA  . VAL A 1 1043 ? 18.864  32.274  62.714  1.00 62.85  ? 1040 VAL A CA  1 
ATOM 7987  C C   . VAL A 1 1043 ? 19.651  32.896  61.565  1.00 63.55  ? 1040 VAL A C   1 
ATOM 7988  O O   . VAL A 1 1043 ? 20.864  33.122  61.689  1.00 63.60  ? 1040 VAL A O   1 
ATOM 7989  C CB  . VAL A 1 1043 ? 18.380  33.382  63.688  1.00 62.63  ? 1040 VAL A CB  1 
ATOM 7990  C CG1 . VAL A 1 1043 ? 17.406  34.336  63.012  1.00 61.85  ? 1040 VAL A CG1 1 
ATOM 7991  C CG2 . VAL A 1 1043 ? 17.722  32.773  64.900  1.00 62.82  ? 1040 VAL A CG2 1 
ATOM 7992  N N   . THR A 1 1044 ? 18.953  33.135  60.448  1.00 64.33  ? 1041 THR A N   1 
ATOM 7993  C CA  . THR A 1 1044 ? 19.469  33.873  59.280  1.00 64.83  ? 1041 THR A CA  1 
ATOM 7994  C C   . THR A 1 1044 ? 18.366  34.787  58.718  1.00 65.47  ? 1041 THR A C   1 
ATOM 7995  O O   . THR A 1 1044 ? 17.174  34.479  58.839  1.00 65.45  ? 1041 THR A O   1 
ATOM 7996  C CB  . THR A 1 1044 ? 19.959  32.911  58.166  1.00 64.69  ? 1041 THR A CB  1 
ATOM 7997  O OG1 . THR A 1 1044 ? 20.627  31.787  58.751  1.00 64.52  ? 1041 THR A OG1 1 
ATOM 7998  C CG2 . THR A 1 1044 ? 20.904  33.612  57.208  1.00 64.06  ? 1041 THR A CG2 1 
ATOM 7999  N N   . SER A 1 1045 ? 18.766  35.908  58.117  1.00 66.32  ? 1042 SER A N   1 
ATOM 8000  C CA  . SER A 1 1045 ? 17.821  36.829  57.467  1.00 67.17  ? 1042 SER A CA  1 
ATOM 8001  C C   . SER A 1 1045 ? 17.683  36.540  55.958  1.00 67.69  ? 1042 SER A C   1 
ATOM 8002  O O   . SER A 1 1045 ? 18.628  36.056  55.325  1.00 67.69  ? 1042 SER A O   1 
ATOM 8003  C CB  . SER A 1 1045 ? 18.223  38.291  57.718  1.00 67.24  ? 1042 SER A CB  1 
ATOM 8004  O OG  . SER A 1 1045 ? 18.180  38.619  59.101  1.00 67.19  ? 1042 SER A OG  1 
ATOM 8005  N N   . LEU A 1 1046 ? 16.507  36.846  55.398  1.00 68.38  ? 1043 LEU A N   1 
ATOM 8006  C CA  . LEU A 1 1046 ? 16.130  36.438  54.031  1.00 68.90  ? 1043 LEU A CA  1 
ATOM 8007  C C   . LEU A 1 1046 ? 15.850  37.577  53.062  1.00 69.29  ? 1043 LEU A C   1 
ATOM 8008  O O   . LEU A 1 1046 ? 15.516  38.686  53.479  1.00 69.40  ? 1043 LEU A O   1 
ATOM 8009  C CB  . LEU A 1 1046 ? 14.886  35.553  54.072  1.00 68.78  ? 1043 LEU A CB  1 
ATOM 8010  C CG  . LEU A 1 1046 ? 15.071  34.065  54.336  1.00 68.97  ? 1043 LEU A CG  1 
ATOM 8011  C CD1 . LEU A 1 1046 ? 13.728  33.468  54.708  1.00 68.95  ? 1043 LEU A CD1 1 
ATOM 8012  C CD2 . LEU A 1 1046 ? 15.691  33.351  53.127  1.00 68.49  ? 1043 LEU A CD2 1 
ATOM 8013  N N   . SER A 1 1047 ? 15.967  37.272  51.767  1.00 69.78  ? 1044 SER A N   1 
ATOM 8014  C CA  . SER A 1 1047 ? 15.606  38.194  50.682  1.00 70.30  ? 1044 SER A CA  1 
ATOM 8015  C C   . SER A 1 1047 ? 14.119  38.082  50.337  1.00 70.58  ? 1044 SER A C   1 
ATOM 8016  O O   . SER A 1 1047 ? 13.557  36.982  50.354  1.00 70.69  ? 1044 SER A O   1 
ATOM 8017  C CB  . SER A 1 1047 ? 16.436  37.894  49.438  1.00 70.36  ? 1044 SER A CB  1 
ATOM 8018  O OG  . SER A 1 1047 ? 16.003  36.691  48.822  1.00 70.85  ? 1044 SER A OG  1 
ATOM 8019  N N   . GLU A 1 1048 ? 13.503  39.215  49.988  1.00 70.90  ? 1045 GLU A N   1 
ATOM 8020  C CA  . GLU A 1 1048 ? 12.039  39.321  49.840  1.00 71.24  ? 1045 GLU A CA  1 
ATOM 8021  C C   . GLU A 1 1048 ? 11.377  38.128  49.142  1.00 71.16  ? 1045 GLU A C   1 
ATOM 8022  O O   . GLU A 1 1048 ? 10.417  37.554  49.662  1.00 70.89  ? 1045 GLU A O   1 
ATOM 8023  C CB  . GLU A 1 1048 ? 11.635  40.652  49.176  1.00 71.43  ? 1045 GLU A CB  1 
ATOM 8024  C CG  . GLU A 1 1048 ? 11.737  40.702  47.637  1.00 72.55  ? 1045 GLU A CG  1 
ATOM 8025  C CD  . GLU A 1 1048 ? 13.156  40.940  47.129  1.00 74.03  ? 1045 GLU A CD  1 
ATOM 8026  O OE1 . GLU A 1 1048 ? 13.599  42.114  47.129  1.00 74.56  ? 1045 GLU A OE1 1 
ATOM 8027  O OE2 . GLU A 1 1048 ? 13.821  39.961  46.714  1.00 74.34  ? 1045 GLU A OE2 1 
ATOM 8028  N N   . SER A 1 1049 ? 11.922  37.759  47.981  1.00 71.35  ? 1046 SER A N   1 
ATOM 8029  C CA  . SER A 1 1049 ? 11.376  36.699  47.134  1.00 71.54  ? 1046 SER A CA  1 
ATOM 8030  C C   . SER A 1 1049 ? 11.515  35.337  47.787  1.00 71.62  ? 1046 SER A C   1 
ATOM 8031  O O   . SER A 1 1049 ? 10.598  34.511  47.716  1.00 71.88  ? 1046 SER A O   1 
ATOM 8032  C CB  . SER A 1 1049 ? 12.089  36.668  45.780  1.00 71.57  ? 1046 SER A CB  1 
ATOM 8033  O OG  . SER A 1 1049 ? 13.373  36.067  45.886  1.00 71.62  ? 1046 SER A OG  1 
ATOM 8034  N N   . TRP A 1 1050 ? 12.671  35.109  48.409  1.00 71.43  ? 1047 TRP A N   1 
ATOM 8035  C CA  . TRP A 1 1050 ? 12.973  33.820  49.000  1.00 71.14  ? 1047 TRP A CA  1 
ATOM 8036  C C   . TRP A 1 1050 ? 12.017  33.489  50.121  1.00 70.84  ? 1047 TRP A C   1 
ATOM 8037  O O   . TRP A 1 1050 ? 11.694  32.327  50.322  1.00 71.02  ? 1047 TRP A O   1 
ATOM 8038  C CB  . TRP A 1 1050 ? 14.428  33.744  49.445  1.00 71.52  ? 1047 TRP A CB  1 
ATOM 8039  C CG  . TRP A 1 1050 ? 15.293  33.204  48.369  1.00 71.86  ? 1047 TRP A CG  1 
ATOM 8040  C CD1 . TRP A 1 1050 ? 15.352  33.640  47.079  1.00 72.68  ? 1047 TRP A CD1 1 
ATOM 8041  C CD2 . TRP A 1 1050 ? 16.215  32.117  48.467  1.00 72.31  ? 1047 TRP A CD2 1 
ATOM 8042  N NE1 . TRP A 1 1050 ? 16.253  32.893  46.365  1.00 72.77  ? 1047 TRP A NE1 1 
ATOM 8043  C CE2 . TRP A 1 1050 ? 16.801  31.951  47.194  1.00 72.60  ? 1047 TRP A CE2 1 
ATOM 8044  C CE3 . TRP A 1 1050 ? 16.613  31.270  49.507  1.00 72.96  ? 1047 TRP A CE3 1 
ATOM 8045  C CZ2 . TRP A 1 1050 ? 17.763  30.969  46.930  1.00 72.68  ? 1047 TRP A CZ2 1 
ATOM 8046  C CZ3 . TRP A 1 1050 ? 17.573  30.289  49.245  1.00 72.76  ? 1047 TRP A CZ3 1 
ATOM 8047  C CH2 . TRP A 1 1050 ? 18.135  30.150  47.966  1.00 72.57  ? 1047 TRP A CH2 1 
ATOM 8048  N N   . TYR A 1 1051 ? 11.537  34.511  50.824  1.00 70.36  ? 1048 TYR A N   1 
ATOM 8049  C CA  . TYR A 1 1051 ? 10.509  34.309  51.838  1.00 69.93  ? 1048 TYR A CA  1 
ATOM 8050  C C   . TYR A 1 1051 ? 9.221   33.833  51.175  1.00 69.48  ? 1048 TYR A C   1 
ATOM 8051  O O   . TYR A 1 1051 ? 8.749   32.728  51.451  1.00 69.61  ? 1048 TYR A O   1 
ATOM 8052  C CB  . TYR A 1 1051 ? 10.256  35.595  52.633  1.00 70.09  ? 1048 TYR A CB  1 
ATOM 8053  C CG  . TYR A 1 1051 ? 9.137   35.516  53.660  1.00 70.04  ? 1048 TYR A CG  1 
ATOM 8054  C CD1 . TYR A 1 1051 ? 9.422   35.400  55.017  1.00 70.59  ? 1048 TYR A CD1 1 
ATOM 8055  C CD2 . TYR A 1 1051 ? 7.798   35.580  53.275  1.00 69.93  ? 1048 TYR A CD2 1 
ATOM 8056  C CE1 . TYR A 1 1051 ? 8.403   35.337  55.970  1.00 70.74  ? 1048 TYR A CE1 1 
ATOM 8057  C CE2 . TYR A 1 1051 ? 6.773   35.514  54.211  1.00 70.52  ? 1048 TYR A CE2 1 
ATOM 8058  C CZ  . TYR A 1 1051 ? 7.079   35.398  55.561  1.00 70.67  ? 1048 TYR A CZ  1 
ATOM 8059  O OH  . TYR A 1 1051 ? 6.065   35.345  56.498  1.00 70.36  ? 1048 TYR A OH  1 
ATOM 8060  N N   . ASN A 1 1052 ? 8.672   34.665  50.289  1.00 68.62  ? 1049 ASN A N   1 
ATOM 8061  C CA  . ASN A 1 1052 ? 7.341   34.440  49.728  1.00 67.76  ? 1049 ASN A CA  1 
ATOM 8062  C C   . ASN A 1 1052 ? 7.195   33.062  49.116  1.00 67.10  ? 1049 ASN A C   1 
ATOM 8063  O O   . ASN A 1 1052 ? 6.111   32.471  49.145  1.00 66.97  ? 1049 ASN A O   1 
ATOM 8064  C CB  . ASN A 1 1052 ? 6.990   35.537  48.724  1.00 67.84  ? 1049 ASN A CB  1 
ATOM 8065  C CG  . ASN A 1 1052 ? 6.589   36.835  49.406  1.00 68.12  ? 1049 ASN A CG  1 
ATOM 8066  O OD1 . ASN A 1 1052 ? 5.594   36.880  50.133  1.00 68.73  ? 1049 ASN A OD1 1 
ATOM 8067  N ND2 . ASN A 1 1052 ? 7.364   37.896  49.183  1.00 67.92  ? 1049 ASN A ND2 1 
ATOM 8068  N N   . LEU A 1 1053 ? 8.308   32.560  48.587  1.00 66.30  ? 1050 LEU A N   1 
ATOM 8069  C CA  . LEU A 1 1053 ? 8.399   31.212  48.055  1.00 65.56  ? 1050 LEU A CA  1 
ATOM 8070  C C   . LEU A 1 1053 ? 8.344   30.219  49.206  1.00 65.16  ? 1050 LEU A C   1 
ATOM 8071  O O   . LEU A 1 1053 ? 7.507   29.311  49.223  1.00 65.14  ? 1050 LEU A O   1 
ATOM 8072  C CB  . LEU A 1 1053 ? 9.709   31.041  47.274  1.00 65.39  ? 1050 LEU A CB  1 
ATOM 8073  C CG  . LEU A 1 1053 ? 9.963   29.760  46.469  1.00 65.01  ? 1050 LEU A CG  1 
ATOM 8074  C CD1 . LEU A 1 1053 ? 11.154  29.947  45.554  1.00 64.71  ? 1050 LEU A CD1 1 
ATOM 8075  C CD2 . LEU A 1 1053 ? 10.178  28.543  47.354  1.00 64.68  ? 1050 LEU A CD2 1 
ATOM 8076  N N   . LEU A 1 1054 ? 9.243   30.409  50.167  1.00 64.59  ? 1051 LEU A N   1 
ATOM 8077  C CA  . LEU A 1 1054 ? 9.413   29.469  51.264  1.00 64.05  ? 1051 LEU A CA  1 
ATOM 8078  C C   . LEU A 1 1054 ? 8.174   29.367  52.169  1.00 64.21  ? 1051 LEU A C   1 
ATOM 8079  O O   . LEU A 1 1054 ? 7.752   28.257  52.500  1.00 64.22  ? 1051 LEU A O   1 
ATOM 8080  C CB  . LEU A 1 1054 ? 10.688  29.781  52.057  1.00 63.61  ? 1051 LEU A CB  1 
ATOM 8081  C CG  . LEU A 1 1054 ? 12.034  29.463  51.396  1.00 62.17  ? 1051 LEU A CG  1 
ATOM 8082  C CD1 . LEU A 1 1054 ? 13.169  30.141  52.132  1.00 61.38  ? 1051 LEU A CD1 1 
ATOM 8083  C CD2 . LEU A 1 1054 ? 12.277  27.984  51.342  1.00 61.07  ? 1051 LEU A CD2 1 
ATOM 8084  N N   . LEU A 1 1055 ? 7.588   30.509  52.544  1.00 64.19  ? 1052 LEU A N   1 
ATOM 8085  C CA  . LEU A 1 1055 ? 6.343   30.533  53.330  1.00 64.34  ? 1052 LEU A CA  1 
ATOM 8086  C C   . LEU A 1 1055 ? 5.263   29.724  52.625  1.00 64.62  ? 1052 LEU A C   1 
ATOM 8087  O O   . LEU A 1 1055 ? 4.495   28.992  53.257  1.00 64.34  ? 1052 LEU A O   1 
ATOM 8088  C CB  . LEU A 1 1055 ? 5.858   31.976  53.586  1.00 64.16  ? 1052 LEU A CB  1 
ATOM 8089  C CG  . LEU A 1 1055 ? 4.387   32.200  53.997  1.00 63.83  ? 1052 LEU A CG  1 
ATOM 8090  C CD1 . LEU A 1 1055 ? 4.248   33.044  55.250  1.00 62.82  ? 1052 LEU A CD1 1 
ATOM 8091  C CD2 . LEU A 1 1055 ? 3.553   32.786  52.857  1.00 63.55  ? 1052 LEU A CD2 1 
ATOM 8092  N N   . ASP A 1 1056 ? 5.214   29.864  51.305  1.00 65.22  ? 1053 ASP A N   1 
ATOM 8093  C CA  . ASP A 1 1056 ? 4.232   29.140  50.531  1.00 65.76  ? 1053 ASP A CA  1 
ATOM 8094  C C   . ASP A 1 1056 ? 4.563   27.662  50.496  1.00 65.88  ? 1053 ASP A C   1 
ATOM 8095  O O   . ASP A 1 1056 ? 3.763   26.842  50.938  1.00 66.14  ? 1053 ASP A O   1 
ATOM 8096  C CB  . ASP A 1 1056 ? 4.113   29.666  49.113  1.00 65.84  ? 1053 ASP A CB  1 
ATOM 8097  C CG  . ASP A 1 1056 ? 3.098   28.887  48.319  1.00 66.69  ? 1053 ASP A CG  1 
ATOM 8098  O OD1 . ASP A 1 1056 ? 1.886   29.069  48.585  1.00 67.47  ? 1053 ASP A OD1 1 
ATOM 8099  O OD2 . ASP A 1 1056 ? 3.509   28.069  47.463  1.00 67.64  ? 1053 ASP A OD2 1 
ATOM 8100  N N   . MET A 1 1057 ? 5.740   27.320  49.977  1.00 65.90  ? 1054 MET A N   1 
ATOM 8101  C CA  . MET A 1 1057 ? 6.139   25.916  49.918  1.00 65.87  ? 1054 MET A CA  1 
ATOM 8102  C C   . MET A 1 1057 ? 6.162   25.275  51.320  1.00 65.52  ? 1054 MET A C   1 
ATOM 8103  O O   . MET A 1 1057 ? 6.170   24.054  51.455  1.00 65.40  ? 1054 MET A O   1 
ATOM 8104  C CB  . MET A 1 1057 ? 7.450   25.727  49.134  1.00 65.85  ? 1054 MET A CB  1 
ATOM 8105  C CG  . MET A 1 1057 ? 8.744   25.875  49.917  1.00 66.05  ? 1054 MET A CG  1 
ATOM 8106  S SD  . MET A 1 1057 ? 9.748   24.388  49.667  1.00 66.25  ? 1054 MET A SD  1 
ATOM 8107  C CE  . MET A 1 1057 ? 11.424  25.016  49.756  1.00 65.82  ? 1054 MET A CE  1 
ATOM 8108  N N   . GLN A 1 1058 ? 6.140   26.127  52.344  1.00 65.29  ? 1055 GLN A N   1 
ATOM 8109  C CA  . GLN A 1 1058 ? 5.957   25.722  53.734  1.00 65.16  ? 1055 GLN A CA  1 
ATOM 8110  C C   . GLN A 1 1058 ? 4.487   25.355  53.977  1.00 65.17  ? 1055 GLN A C   1 
ATOM 8111  O O   . GLN A 1 1058 ? 4.189   24.374  54.660  1.00 64.94  ? 1055 GLN A O   1 
ATOM 8112  C CB  . GLN A 1 1058 ? 6.392   26.867  54.653  1.00 65.11  ? 1055 GLN A CB  1 
ATOM 8113  C CG  . GLN A 1 1058 ? 6.663   26.525  56.099  1.00 64.37  ? 1055 GLN A CG  1 
ATOM 8114  C CD  . GLN A 1 1058 ? 6.621   27.760  56.977  1.00 64.33  ? 1055 GLN A CD  1 
ATOM 8115  O OE1 . GLN A 1 1058 ? 7.621   28.150  57.584  1.00 64.56  ? 1055 GLN A OE1 1 
ATOM 8116  N NE2 . GLN A 1 1058 ? 5.457   28.393  57.039  1.00 64.48  ? 1055 GLN A NE2 1 
ATOM 8117  N N   . ASN A 1 1059 ? 3.578   26.148  53.408  1.00 65.29  ? 1056 ASN A N   1 
ATOM 8118  C CA  . ASN A 1 1059 ? 2.134   25.885  53.483  1.00 65.58  ? 1056 ASN A CA  1 
ATOM 8119  C C   . ASN A 1 1059 ? 1.695   24.611  52.758  1.00 65.73  ? 1056 ASN A C   1 
ATOM 8120  O O   . ASN A 1 1059 ? 0.792   23.906  53.218  1.00 65.92  ? 1056 ASN A O   1 
ATOM 8121  C CB  . ASN A 1 1059 ? 1.339   27.075  52.941  1.00 65.63  ? 1056 ASN A CB  1 
ATOM 8122  C CG  . ASN A 1 1059 ? 1.067   28.127  53.994  1.00 65.67  ? 1056 ASN A CG  1 
ATOM 8123  O OD1 . ASN A 1 1059 ? 1.442   29.288  53.833  1.00 65.66  ? 1056 ASN A OD1 1 
ATOM 8124  N ND2 . ASN A 1 1059 ? 0.404   27.728  55.077  1.00 65.43  ? 1056 ASN A ND2 1 
ATOM 8125  N N   . ARG A 1 1060 ? 2.329   24.335  51.620  1.00 65.71  ? 1057 ARG A N   1 
ATOM 8126  C CA  . ARG A 1 1060 ? 2.096   23.114  50.854  1.00 65.70  ? 1057 ARG A CA  1 
ATOM 8127  C C   . ARG A 1 1060 ? 2.507   21.873  51.647  1.00 65.68  ? 1057 ARG A C   1 
ATOM 8128  O O   . ARG A 1 1060 ? 1.760   20.892  51.707  1.00 65.64  ? 1057 ARG A O   1 
ATOM 8129  C CB  . ARG A 1 1060 ? 2.897   23.157  49.560  1.00 65.74  ? 1057 ARG A CB  1 
ATOM 8130  C CG  . ARG A 1 1060 ? 2.752   24.433  48.759  1.00 66.03  ? 1057 ARG A CG  1 
ATOM 8131  C CD  . ARG A 1 1060 ? 1.920   24.205  47.516  1.00 66.80  ? 1057 ARG A CD  1 
ATOM 8132  N NE  . ARG A 1 1060 ? 2.384   25.048  46.419  1.00 67.16  ? 1057 ARG A NE  1 
ATOM 8133  C CZ  . ARG A 1 1060 ? 2.056   24.876  45.143  1.00 67.46  ? 1057 ARG A CZ  1 
ATOM 8134  N NH1 . ARG A 1 1060 ? 1.259   23.875  44.780  1.00 67.34  ? 1057 ARG A NH1 1 
ATOM 8135  N NH2 . ARG A 1 1060 ? 2.539   25.705  44.228  1.00 67.58  ? 1057 ARG A NH2 1 
ATOM 8136  N N   . LEU A 1 1061 ? 3.699   21.938  52.250  1.00 65.63  ? 1058 LEU A N   1 
ATOM 8137  C CA  . LEU A 1 1061 ? 4.281   20.847  53.041  1.00 65.58  ? 1058 LEU A CA  1 
ATOM 8138  C C   . LEU A 1 1061 ? 3.404   20.372  54.203  1.00 65.98  ? 1058 LEU A C   1 
ATOM 8139  O O   . LEU A 1 1061 ? 3.434   19.192  54.564  1.00 66.12  ? 1058 LEU A O   1 
ATOM 8140  C CB  . LEU A 1 1061 ? 5.671   21.236  53.562  1.00 65.20  ? 1058 LEU A CB  1 
ATOM 8141  C CG  . LEU A 1 1061 ? 6.855   21.052  52.612  1.00 64.41  ? 1058 LEU A CG  1 
ATOM 8142  C CD1 . LEU A 1 1061 ? 7.995   21.974  52.977  1.00 63.74  ? 1058 LEU A CD1 1 
ATOM 8143  C CD2 . LEU A 1 1061 ? 7.332   19.619  52.597  1.00 63.56  ? 1058 LEU A CD2 1 
ATOM 8144  N N   . ASN A 1 1062 ? 2.631   21.286  54.786  1.00 66.28  ? 1059 ASN A N   1 
ATOM 8145  C CA  . ASN A 1 1062 ? 1.714   20.939  55.872  1.00 66.56  ? 1059 ASN A CA  1 
ATOM 8146  C C   . ASN A 1 1062 ? 0.649   19.955  55.415  1.00 66.61  ? 1059 ASN A C   1 
ATOM 8147  O O   . ASN A 1 1062 ? 0.307   19.015  56.141  1.00 66.73  ? 1059 ASN A O   1 
ATOM 8148  C CB  . ASN A 1 1062 ? 1.049   22.192  56.437  1.00 66.66  ? 1059 ASN A CB  1 
ATOM 8149  C CG  . ASN A 1 1062 ? 2.050   23.184  56.976  1.00 67.06  ? 1059 ASN A CG  1 
ATOM 8150  O OD1 . ASN A 1 1062 ? 2.901   22.848  57.806  1.00 67.17  ? 1059 ASN A OD1 1 
ATOM 8151  N ND2 . ASN A 1 1062 ? 1.959   24.420  56.503  1.00 67.65  ? 1059 ASN A ND2 1 
ATOM 8152  N N   . LYS A 1 1063 ? 0.145   20.187  54.202  1.00 66.60  ? 1060 LYS A N   1 
ATOM 8153  C CA  . LYS A 1 1063 ? -0.873  19.350  53.566  1.00 66.42  ? 1060 LYS A CA  1 
ATOM 8154  C C   . LYS A 1 1063 ? -0.367  17.941  53.230  1.00 66.02  ? 1060 LYS A C   1 
ATOM 8155  O O   . LYS A 1 1063 ? -1.138  16.984  53.253  1.00 65.96  ? 1060 LYS A O   1 
ATOM 8156  C CB  . LYS A 1 1063 ? -1.378  20.034  52.290  1.00 66.45  ? 1060 LYS A CB  1 
ATOM 8157  C CG  . LYS A 1 1063 ? -2.360  21.178  52.514  1.00 66.68  ? 1060 LYS A CG  1 
ATOM 8158  C CD  . LYS A 1 1063 ? -2.641  21.920  51.209  1.00 66.79  ? 1060 LYS A CD  1 
ATOM 8159  C CE  . LYS A 1 1063 ? -4.144  22.078  50.950  1.00 67.65  ? 1060 LYS A CE  1 
ATOM 8160  N NZ  . LYS A 1 1063 ? -4.821  23.029  51.884  1.00 68.35  ? 1060 LYS A NZ  1 
ATOM 8161  N N   . VAL A 1 1064 ? 0.929   17.829  52.937  1.00 65.52  ? 1061 VAL A N   1 
ATOM 8162  C CA  . VAL A 1 1064 ? 1.533   16.583  52.455  1.00 65.16  ? 1061 VAL A CA  1 
ATOM 8163  C C   . VAL A 1 1064 ? 2.139   15.730  53.572  1.00 64.85  ? 1061 VAL A C   1 
ATOM 8164  O O   . VAL A 1 1064 ? 2.041   14.493  53.550  1.00 64.66  ? 1061 VAL A O   1 
ATOM 8165  C CB  . VAL A 1 1064 ? 2.600   16.882  51.375  1.00 65.20  ? 1061 VAL A CB  1 
ATOM 8166  C CG1 . VAL A 1 1064 ? 3.324   15.613  50.939  1.00 65.15  ? 1061 VAL A CG1 1 
ATOM 8167  C CG2 . VAL A 1 1064 ? 1.947   17.555  50.173  1.00 65.51  ? 1061 VAL A CG2 1 
ATOM 8168  N N   . ILE A 1 1065 ? 2.774   16.397  54.536  1.00 64.59  ? 1062 ILE A N   1 
ATOM 8169  C CA  . ILE A 1 1065 ? 3.369   15.720  55.695  1.00 64.14  ? 1062 ILE A CA  1 
ATOM 8170  C C   . ILE A 1 1065 ? 2.335   15.485  56.796  1.00 63.90  ? 1062 ILE A C   1 
ATOM 8171  O O   . ILE A 1 1065 ? 1.679   16.415  57.288  1.00 63.77  ? 1062 ILE A O   1 
ATOM 8172  C CB  . ILE A 1 1065 ? 4.596   16.470  56.268  1.00 63.93  ? 1062 ILE A CB  1 
ATOM 8173  C CG1 . ILE A 1 1065 ? 5.717   16.542  55.240  1.00 63.61  ? 1062 ILE A CG1 1 
ATOM 8174  C CG2 . ILE A 1 1065 ? 5.122   15.761  57.491  1.00 64.04  ? 1062 ILE A CG2 1 
ATOM 8175  C CD1 . ILE A 1 1065 ? 6.543   17.785  55.372  1.00 63.55  ? 1062 ILE A CD1 1 
ATOM 8176  N N   . LYS A 1 1066 ? 2.208   14.218  57.162  1.00 63.62  ? 1063 LYS A N   1 
ATOM 8177  C CA  . LYS A 1 1066 ? 1.296   13.770  58.195  1.00 63.46  ? 1063 LYS A CA  1 
ATOM 8178  C C   . LYS A 1 1066 ? 1.932   13.948  59.585  1.00 63.24  ? 1063 LYS A C   1 
ATOM 8179  O O   . LYS A 1 1066 ? 2.871   13.230  59.953  1.00 63.26  ? 1063 LYS A O   1 
ATOM 8180  C CB  . LYS A 1 1066 ? 0.877   12.314  57.915  1.00 63.53  ? 1063 LYS A CB  1 
ATOM 8181  C CG  . LYS A 1 1066 ? 2.033   11.288  57.711  1.00 63.79  ? 1063 LYS A CG  1 
ATOM 8182  C CD  . LYS A 1 1066 ? 2.990   11.608  56.540  1.00 63.77  ? 1063 LYS A CD  1 
ATOM 8183  C CE  . LYS A 1 1066 ? 4.297   10.816  56.672  1.00 63.83  ? 1063 LYS A CE  1 
ATOM 8184  N NZ  . LYS A 1 1066 ? 5.469   11.434  55.986  1.00 63.11  ? 1063 LYS A NZ  1 
ATOM 8185  N N   . SER A 1 1067 ? 1.425   14.931  60.332  1.00 62.85  ? 1064 SER A N   1 
ATOM 8186  C CA  . SER A 1 1067 ? 1.911   15.269  61.676  1.00 62.32  ? 1064 SER A CA  1 
ATOM 8187  C C   . SER A 1 1067 ? 1.724   14.109  62.642  1.00 61.88  ? 1064 SER A C   1 
ATOM 8188  O O   . SER A 1 1067 ? 0.771   13.341  62.516  1.00 61.86  ? 1064 SER A O   1 
ATOM 8189  C CB  . SER A 1 1067 ? 1.178   16.500  62.204  1.00 62.41  ? 1064 SER A CB  1 
ATOM 8190  O OG  . SER A 1 1067 ? 1.607   16.834  63.513  1.00 62.77  ? 1064 SER A OG  1 
ATOM 8191  N N   . VAL A 1 1068 ? 2.627   13.996  63.611  1.00 61.38  ? 1065 VAL A N   1 
ATOM 8192  C CA  . VAL A 1 1068 ? 2.713   12.787  64.424  1.00 60.90  ? 1065 VAL A CA  1 
ATOM 8193  C C   . VAL A 1 1068 ? 1.513   12.625  65.342  1.00 60.69  ? 1065 VAL A C   1 
ATOM 8194  O O   . VAL A 1 1068 ? 0.734   11.683  65.192  1.00 60.86  ? 1065 VAL A O   1 
ATOM 8195  C CB  . VAL A 1 1068 ? 4.038   12.688  65.207  1.00 60.84  ? 1065 VAL A CB  1 
ATOM 8196  C CG1 . VAL A 1 1068 ? 4.052   11.430  66.073  1.00 60.55  ? 1065 VAL A CG1 1 
ATOM 8197  C CG2 . VAL A 1 1068 ? 5.222   12.687  64.239  1.00 60.71  ? 1065 VAL A CG2 1 
ATOM 8198  N N   . GLY A 1 1069 ? 1.349   13.544  66.282  1.00 60.33  ? 1066 GLY A N   1 
ATOM 8199  C CA  . GLY A 1 1069 ? 0.201   13.479  67.179  1.00 59.90  ? 1066 GLY A CA  1 
ATOM 8200  C C   . GLY A 1 1069 ? -1.035  14.023  66.495  1.00 59.49  ? 1066 GLY A C   1 
ATOM 8201  O O   . GLY A 1 1069 ? -2.041  14.310  67.153  1.00 59.41  ? 1066 GLY A O   1 
ATOM 8202  N N   . LYS A 1 1070 ? -0.946  14.149  65.170  1.00 59.04  ? 1067 LYS A N   1 
ATOM 8203  C CA  . LYS A 1 1070 ? -1.933  14.851  64.365  1.00 58.76  ? 1067 LYS A CA  1 
ATOM 8204  C C   . LYS A 1 1070 ? -2.046  16.287  64.856  1.00 58.57  ? 1067 LYS A C   1 
ATOM 8205  O O   . LYS A 1 1070 ? -3.133  16.749  65.182  1.00 58.60  ? 1067 LYS A O   1 
ATOM 8206  C CB  . LYS A 1 1070 ? -3.293  14.141  64.413  1.00 58.80  ? 1067 LYS A CB  1 
ATOM 8207  C CG  . LYS A 1 1070 ? -3.430  12.911  63.504  1.00 58.95  ? 1067 LYS A CG  1 
ATOM 8208  C CD  . LYS A 1 1070 ? -4.009  13.282  62.132  1.00 59.07  ? 1067 LYS A CD  1 
ATOM 8209  C CE  . LYS A 1 1070 ? -4.598  12.072  61.415  1.00 58.89  ? 1067 LYS A CE  1 
ATOM 8210  N NZ  . LYS A 1 1070 ? -5.954  11.703  61.918  1.00 58.25  ? 1067 LYS A NZ  1 
ATOM 8211  N N   . ILE A 1 1071 ? -0.910  16.978  64.928  1.00 58.48  ? 1068 ILE A N   1 
ATOM 8212  C CA  . ILE A 1 1071 ? -0.874  18.368  65.376  1.00 58.39  ? 1068 ILE A CA  1 
ATOM 8213  C C   . ILE A 1 1071 ? -0.556  19.310  64.222  1.00 58.69  ? 1068 ILE A C   1 
ATOM 8214  O O   . ILE A 1 1071 ? 0.470   19.173  63.553  1.00 58.35  ? 1068 ILE A O   1 
ATOM 8215  C CB  . ILE A 1 1071 ? 0.171   18.620  66.491  1.00 58.19  ? 1068 ILE A CB  1 
ATOM 8216  C CG1 . ILE A 1 1071 ? -0.036  17.695  67.676  1.00 57.57  ? 1068 ILE A CG1 1 
ATOM 8217  C CG2 . ILE A 1 1071 ? 0.099   20.061  66.979  1.00 58.37  ? 1068 ILE A CG2 1 
ATOM 8218  C CD1 . ILE A 1 1071 ? 1.100   17.752  68.658  1.00 57.03  ? 1068 ILE A CD1 1 
ATOM 8219  N N   . GLU A 1 1072 ? -1.457  20.266  64.019  1.00 59.22  ? 1069 GLU A N   1 
ATOM 8220  C CA  . GLU A 1 1072 ? -1.262  21.415  63.135  1.00 59.69  ? 1069 GLU A CA  1 
ATOM 8221  C C   . GLU A 1 1072 ? 0.102   22.093  63.391  1.00 59.26  ? 1069 GLU A C   1 
ATOM 8222  O O   . GLU A 1 1072 ? 0.417   22.479  64.528  1.00 58.88  ? 1069 GLU A O   1 
ATOM 8223  C CB  . GLU A 1 1072 ? -2.413  22.410  63.369  1.00 60.12  ? 1069 GLU A CB  1 
ATOM 8224  C CG  . GLU A 1 1072 ? -2.555  23.535  62.347  1.00 62.35  ? 1069 GLU A CG  1 
ATOM 8225  C CD  . GLU A 1 1072 ? -3.764  23.367  61.430  1.00 65.81  ? 1069 GLU A CD  1 
ATOM 8226  O OE1 . GLU A 1 1072 ? -4.116  24.351  60.729  1.00 67.14  ? 1069 GLU A OE1 1 
ATOM 8227  O OE2 . GLU A 1 1072 ? -4.365  22.260  61.410  1.00 66.92  ? 1069 GLU A OE2 1 
ATOM 8228  N N   . HIS A 1 1073 ? 0.899   22.213  62.328  1.00 58.97  ? 1070 HIS A N   1 
ATOM 8229  C CA  . HIS A 1 1073 ? 2.220   22.829  62.397  1.00 58.78  ? 1070 HIS A CA  1 
ATOM 8230  C C   . HIS A 1 1073 ? 2.136   24.330  62.605  1.00 58.68  ? 1070 HIS A C   1 
ATOM 8231  O O   . HIS A 1 1073 ? 2.980   24.918  63.294  1.00 58.68  ? 1070 HIS A O   1 
ATOM 8232  C CB  . HIS A 1 1073 ? 3.022   22.548  61.132  1.00 58.85  ? 1070 HIS A CB  1 
ATOM 8233  C CG  . HIS A 1 1073 ? 4.180   23.481  60.940  1.00 59.48  ? 1070 HIS A CG  1 
ATOM 8234  N ND1 . HIS A 1 1073 ? 5.473   23.144  61.278  1.00 59.77  ? 1070 HIS A ND1 1 
ATOM 8235  C CD2 . HIS A 1 1073 ? 4.234   24.749  60.464  1.00 59.70  ? 1070 HIS A CD2 1 
ATOM 8236  C CE1 . HIS A 1 1073 ? 6.275   24.159  61.009  1.00 59.56  ? 1070 HIS A CE1 1 
ATOM 8237  N NE2 . HIS A 1 1073 ? 5.548   25.146  60.518  1.00 59.64  ? 1070 HIS A NE2 1 
ATOM 8238  N N   . SER A 1 1074 ? 1.137   24.946  61.979  1.00 58.61  ? 1071 SER A N   1 
ATOM 8239  C CA  . SER A 1 1074 ? 0.904   26.380  62.102  1.00 58.56  ? 1071 SER A CA  1 
ATOM 8240  C C   . SER A 1 1074 ? 0.460   26.767  63.521  1.00 58.44  ? 1071 SER A C   1 
ATOM 8241  O O   . SER A 1 1074 ? 0.765   27.866  63.987  1.00 58.40  ? 1071 SER A O   1 
ATOM 8242  C CB  . SER A 1 1074 ? -0.098  26.864  61.043  1.00 58.72  ? 1071 SER A CB  1 
ATOM 8243  O OG  . SER A 1 1074 ? -1.353  26.199  61.145  1.00 58.97  ? 1071 SER A OG  1 
ATOM 8244  N N   . PHE A 1 1075 ? -0.242  25.855  64.198  1.00 58.34  ? 1072 PHE A N   1 
ATOM 8245  C CA  . PHE A 1 1075 ? -0.626  26.021  65.605  1.00 58.34  ? 1072 PHE A CA  1 
ATOM 8246  C C   . PHE A 1 1075 ? 0.589   25.946  66.520  1.00 58.35  ? 1072 PHE A C   1 
ATOM 8247  O O   . PHE A 1 1075 ? 0.766   26.788  67.404  1.00 58.22  ? 1072 PHE A O   1 
ATOM 8248  C CB  . PHE A 1 1075 ? -1.633  24.944  66.010  1.00 58.45  ? 1072 PHE A CB  1 
ATOM 8249  C CG  . PHE A 1 1075 ? -1.955  24.925  67.479  1.00 58.60  ? 1072 PHE A CG  1 
ATOM 8250  C CD1 . PHE A 1 1075 ? -3.026  25.656  67.977  1.00 59.47  ? 1072 PHE A CD1 1 
ATOM 8251  C CD2 . PHE A 1 1075 ? -1.203  24.157  68.361  1.00 58.99  ? 1072 PHE A CD2 1 
ATOM 8252  C CE1 . PHE A 1 1075 ? -3.337  25.632  69.340  1.00 59.74  ? 1072 PHE A CE1 1 
ATOM 8253  C CE2 . PHE A 1 1075 ? -1.501  24.129  69.728  1.00 59.39  ? 1072 PHE A CE2 1 
ATOM 8254  C CZ  . PHE A 1 1075 ? -2.569  24.864  70.217  1.00 59.38  ? 1072 PHE A CZ  1 
ATOM 8255  N N   . TRP A 1 1076 ? 1.406   24.913  66.307  1.00 58.44  ? 1073 TRP A N   1 
ATOM 8256  C CA  . TRP A 1 1076 ? 2.660   24.716  67.036  1.00 58.42  ? 1073 TRP A CA  1 
ATOM 8257  C C   . TRP A 1 1076 ? 3.562   25.939  66.929  1.00 58.91  ? 1073 TRP A C   1 
ATOM 8258  O O   . TRP A 1 1076 ? 4.174   26.343  67.919  1.00 59.19  ? 1073 TRP A O   1 
ATOM 8259  C CB  . TRP A 1 1076 ? 3.364   23.443  66.543  1.00 57.77  ? 1073 TRP A CB  1 
ATOM 8260  C CG  . TRP A 1 1076 ? 4.850   23.330  66.807  1.00 57.39  ? 1073 TRP A CG  1 
ATOM 8261  C CD1 . TRP A 1 1076 ? 5.836   23.169  65.867  1.00 57.21  ? 1073 TRP A CD1 1 
ATOM 8262  C CD2 . TRP A 1 1076 ? 5.517   23.346  68.081  1.00 57.04  ? 1073 TRP A CD2 1 
ATOM 8263  N NE1 . TRP A 1 1076 ? 7.072   23.090  66.473  1.00 57.08  ? 1073 TRP A NE1 1 
ATOM 8264  C CE2 . TRP A 1 1076 ? 6.904   23.196  67.831  1.00 57.24  ? 1073 TRP A CE2 1 
ATOM 8265  C CE3 . TRP A 1 1076 ? 5.083   23.482  69.402  1.00 56.45  ? 1073 TRP A CE3 1 
ATOM 8266  C CZ2 . TRP A 1 1076 ? 7.851   23.172  68.857  1.00 56.88  ? 1073 TRP A CZ2 1 
ATOM 8267  C CZ3 . TRP A 1 1076 ? 6.028   23.462  70.417  1.00 56.82  ? 1073 TRP A CZ3 1 
ATOM 8268  C CH2 . TRP A 1 1076 ? 7.394   23.308  70.137  1.00 56.86  ? 1073 TRP A CH2 1 
ATOM 8269  N N   . ARG A 1 1077 ? 3.617   26.544  65.742  1.00 59.32  ? 1074 ARG A N   1 
ATOM 8270  C CA  . ARG A 1 1077 ? 4.499   27.685  65.511  1.00 59.76  ? 1074 ARG A CA  1 
ATOM 8271  C C   . ARG A 1 1077 ? 3.946   29.029  65.955  1.00 60.27  ? 1074 ARG A C   1 
ATOM 8272  O O   . ARG A 1 1077 ? 4.632   30.038  65.828  1.00 60.39  ? 1074 ARG A O   1 
ATOM 8273  C CB  . ARG A 1 1077 ? 4.923   27.757  64.048  1.00 59.63  ? 1074 ARG A CB  1 
ATOM 8274  C CG  . ARG A 1 1077 ? 6.024   26.790  63.693  1.00 59.75  ? 1074 ARG A CG  1 
ATOM 8275  C CD  . ARG A 1 1077 ? 7.172   26.845  64.700  1.00 59.43  ? 1074 ARG A CD  1 
ATOM 8276  N NE  . ARG A 1 1077 ? 8.005   25.648  64.619  1.00 59.16  ? 1074 ARG A NE  1 
ATOM 8277  C CZ  . ARG A 1 1077 ? 9.106   25.440  65.327  1.00 58.30  ? 1074 ARG A CZ  1 
ATOM 8278  N NH1 . ARG A 1 1077 ? 9.538   26.350  66.188  1.00 57.68  ? 1074 ARG A NH1 1 
ATOM 8279  N NH2 . ARG A 1 1077 ? 9.774   24.310  65.167  1.00 58.35  ? 1074 ARG A NH2 1 
ATOM 8280  N N   . SER A 1 1078 ? 2.724   29.039  66.484  1.00 60.95  ? 1075 SER A N   1 
ATOM 8281  C CA  . SER A 1 1078 ? 2.056   30.278  66.892  1.00 61.53  ? 1075 SER A CA  1 
ATOM 8282  C C   . SER A 1 1078 ? 2.605   30.864  68.186  1.00 62.02  ? 1075 SER A C   1 
ATOM 8283  O O   . SER A 1 1078 ? 2.957   30.135  69.112  1.00 62.11  ? 1075 SER A O   1 
ATOM 8284  C CB  . SER A 1 1078 ? 0.555   30.054  67.027  1.00 61.41  ? 1075 SER A CB  1 
ATOM 8285  O OG  . SER A 1 1078 ? -0.021  29.817  65.757  1.00 61.76  ? 1075 SER A OG  1 
ATOM 8286  N N   . PHE A 1 1079 ? 2.664   32.191  68.230  1.00 62.68  ? 1076 PHE A N   1 
ATOM 8287  C CA  . PHE A 1 1079 ? 3.149   32.937  69.387  1.00 63.52  ? 1076 PHE A CA  1 
ATOM 8288  C C   . PHE A 1 1079 ? 2.236   32.734  70.587  1.00 64.04  ? 1076 PHE A C   1 
ATOM 8289  O O   . PHE A 1 1079 ? 1.022   32.843  70.463  1.00 64.15  ? 1076 PHE A O   1 
ATOM 8290  C CB  . PHE A 1 1079 ? 3.214   34.421  69.033  1.00 63.71  ? 1076 PHE A CB  1 
ATOM 8291  C CG  . PHE A 1 1079 ? 3.944   35.256  70.040  1.00 63.80  ? 1076 PHE A CG  1 
ATOM 8292  C CD1 . PHE A 1 1079 ? 5.338   35.331  70.022  1.00 64.17  ? 1076 PHE A CD1 1 
ATOM 8293  C CD2 . PHE A 1 1079 ? 3.242   35.976  70.996  1.00 63.30  ? 1076 PHE A CD2 1 
ATOM 8294  C CE1 . PHE A 1 1079 ? 6.020   36.104  70.945  1.00 64.29  ? 1076 PHE A CE1 1 
ATOM 8295  C CE2 . PHE A 1 1079 ? 3.912   36.748  71.924  1.00 64.13  ? 1076 PHE A CE2 1 
ATOM 8296  C CZ  . PHE A 1 1079 ? 5.306   36.813  71.903  1.00 64.40  ? 1076 PHE A CZ  1 
ATOM 8297  N N   . HIS A 1 1080 ? 2.813   32.459  71.751  1.00 64.85  ? 1077 HIS A N   1 
ATOM 8298  C CA  . HIS A 1 1080 ? 2.006   32.026  72.887  1.00 65.77  ? 1077 HIS A CA  1 
ATOM 8299  C C   . HIS A 1 1080 ? 2.520   32.454  74.263  1.00 66.33  ? 1077 HIS A C   1 
ATOM 8300  O O   . HIS A 1 1080 ? 3.466   31.880  74.800  1.00 66.57  ? 1077 HIS A O   1 
ATOM 8301  C CB  . HIS A 1 1080 ? 1.843   30.507  72.833  1.00 65.80  ? 1077 HIS A CB  1 
ATOM 8302  C CG  . HIS A 1 1080 ? 0.930   29.952  73.878  1.00 66.39  ? 1077 HIS A CG  1 
ATOM 8303  N ND1 . HIS A 1 1080 ? -0.280  29.370  73.569  1.00 67.25  ? 1077 HIS A ND1 1 
ATOM 8304  C CD2 . HIS A 1 1080 ? 1.056   29.871  75.224  1.00 67.07  ? 1077 HIS A CD2 1 
ATOM 8305  C CE1 . HIS A 1 1080 ? -0.863  28.958  74.682  1.00 68.01  ? 1077 HIS A CE1 1 
ATOM 8306  N NE2 . HIS A 1 1080 ? -0.073  29.251  75.701  1.00 67.72  ? 1077 HIS A NE2 1 
ATOM 8307  N N   . THR A 1 1081 ? 1.878   33.470  74.826  1.00 67.11  ? 1078 THR A N   1 
ATOM 8308  C CA  . THR A 1 1081 ? 2.034   33.800  76.239  1.00 67.83  ? 1078 THR A CA  1 
ATOM 8309  C C   . THR A 1 1081 ? 0.729   33.398  76.917  1.00 68.37  ? 1078 THR A C   1 
ATOM 8310  O O   . THR A 1 1081 ? -0.203  32.951  76.245  1.00 68.48  ? 1078 THR A O   1 
ATOM 8311  C CB  . THR A 1 1081 ? 2.334   35.309  76.472  1.00 67.82  ? 1078 THR A CB  1 
ATOM 8312  O OG1 . THR A 1 1081 ? 1.117   36.067  76.462  1.00 67.76  ? 1078 THR A OG1 1 
ATOM 8313  C CG2 . THR A 1 1081 ? 3.304   35.855  75.410  1.00 67.71  ? 1078 THR A CG2 1 
ATOM 8314  N N   . GLU A 1 1082 ? 0.653   33.548  78.234  1.00 69.04  ? 1079 GLU A N   1 
ATOM 8315  C CA  . GLU A 1 1082 ? -0.587  33.262  78.952  1.00 69.90  ? 1079 GLU A CA  1 
ATOM 8316  C C   . GLU A 1 1082 ? -1.719  34.179  78.452  1.00 70.03  ? 1079 GLU A C   1 
ATOM 8317  O O   . GLU A 1 1082 ? -2.858  33.737  78.255  1.00 70.20  ? 1079 GLU A O   1 
ATOM 8318  C CB  . GLU A 1 1082 ? -0.372  33.415  80.467  1.00 70.14  ? 1079 GLU A CB  1 
ATOM 8319  C CG  . GLU A 1 1082 ? -1.634  33.254  81.341  1.00 71.76  ? 1079 GLU A CG  1 
ATOM 8320  C CD  . GLU A 1 1082 ? -1.756  31.885  82.012  1.00 73.49  ? 1079 GLU A CD  1 
ATOM 8321  O OE1 . GLU A 1 1082 ? -0.710  31.236  82.260  1.00 74.36  ? 1079 GLU A OE1 1 
ATOM 8322  O OE2 . GLU A 1 1082 ? -2.905  31.475  82.310  1.00 73.53  ? 1079 GLU A OE2 1 
ATOM 8323  N N   . ARG A 1 1083 ? -1.383  35.450  78.229  1.00 70.14  ? 1080 ARG A N   1 
ATOM 8324  C CA  . ARG A 1 1083 ? -2.364  36.471  77.859  1.00 70.10  ? 1080 ARG A CA  1 
ATOM 8325  C C   . ARG A 1 1083 ? -2.289  36.854  76.377  1.00 69.62  ? 1080 ARG A C   1 
ATOM 8326  O O   . ARG A 1 1083 ? -2.197  38.038  76.041  1.00 69.58  ? 1080 ARG A O   1 
ATOM 8327  C CB  . ARG A 1 1083 ? -2.217  37.715  78.753  1.00 70.06  ? 1080 ARG A CB  1 
ATOM 8328  C CG  . ARG A 1 1083 ? -0.850  38.416  78.665  1.00 70.50  ? 1080 ARG A CG  1 
ATOM 8329  C CD  . ARG A 1 1083 ? -0.914  39.878  79.122  1.00 71.05  ? 1080 ARG A CD  1 
ATOM 8330  N NE  . ARG A 1 1083 ? -2.058  40.622  78.567  1.00 73.24  ? 1080 ARG A NE  1 
ATOM 8331  C CZ  . ARG A 1 1083 ? -2.098  41.202  77.364  1.00 73.47  ? 1080 ARG A CZ  1 
ATOM 8332  N NH1 . ARG A 1 1083 ? -1.055  41.138  76.535  1.00 73.43  ? 1080 ARG A NH1 1 
ATOM 8333  N NH2 . ARG A 1 1083 ? -3.198  41.849  76.986  1.00 72.93  ? 1080 ARG A NH2 1 
ATOM 8334  N N   . LYS A 1 1084 ? -2.303  35.842  75.507  1.00 69.08  ? 1081 LYS A N   1 
ATOM 8335  C CA  . LYS A 1 1084 ? -2.533  36.019  74.063  1.00 68.70  ? 1081 LYS A CA  1 
ATOM 8336  C C   . LYS A 1 1084 ? -1.917  34.918  73.208  1.00 68.33  ? 1081 LYS A C   1 
ATOM 8337  O O   . LYS A 1 1084 ? -1.069  34.151  73.668  1.00 68.30  ? 1081 LYS A O   1 
ATOM 8338  C CB  . LYS A 1 1084 ? -2.098  37.403  73.543  1.00 68.78  ? 1081 LYS A CB  1 
ATOM 8339  C CG  . LYS A 1 1084 ? -0.628  37.541  73.148  1.00 68.77  ? 1081 LYS A CG  1 
ATOM 8340  C CD  . LYS A 1 1084 ? -0.398  38.871  72.433  1.00 68.70  ? 1081 LYS A CD  1 
ATOM 8341  C CE  . LYS A 1 1084 ? 1.081   39.162  72.239  1.00 68.66  ? 1081 LYS A CE  1 
ATOM 8342  N NZ  . LYS A 1 1084 ? 1.312   40.487  71.600  1.00 68.52  ? 1081 LYS A NZ  1 
ATOM 8343  N N   . THR A 1 1085 ? -2.369  34.864  71.958  1.00 67.75  ? 1082 THR A N   1 
ATOM 8344  C CA  . THR A 1 1085 ? -1.849  33.946  70.965  1.00 67.13  ? 1082 THR A CA  1 
ATOM 8345  C C   . THR A 1 1085 ? -2.054  34.554  69.584  1.00 66.88  ? 1082 THR A C   1 
ATOM 8346  O O   . THR A 1 1085 ? -3.155  34.988  69.246  1.00 67.09  ? 1082 THR A O   1 
ATOM 8347  C CB  . THR A 1 1085 ? -2.526  32.567  71.071  1.00 67.03  ? 1082 THR A CB  1 
ATOM 8348  O OG1 . THR A 1 1085 ? -2.090  31.923  72.272  1.00 66.77  ? 1082 THR A OG1 1 
ATOM 8349  C CG2 . THR A 1 1085 ? -2.169  31.686  69.887  1.00 67.17  ? 1082 THR A CG2 1 
ATOM 8350  N N   . GLU A 1 1086 ? -0.976  34.608  68.807  1.00 66.36  ? 1083 GLU A N   1 
ATOM 8351  C CA  . GLU A 1 1086 ? -1.013  35.100  67.437  1.00 65.99  ? 1083 GLU A CA  1 
ATOM 8352  C C   . GLU A 1 1086 ? -0.350  34.072  66.534  1.00 65.59  ? 1083 GLU A C   1 
ATOM 8353  O O   . GLU A 1 1086 ? 0.558   33.368  66.982  1.00 65.84  ? 1083 GLU A O   1 
ATOM 8354  C CB  . GLU A 1 1086 ? -0.248  36.426  67.306  1.00 66.08  ? 1083 GLU A CB  1 
ATOM 8355  C CG  . GLU A 1 1086 ? -0.656  37.547  68.264  1.00 66.65  ? 1083 GLU A CG  1 
ATOM 8356  C CD  . GLU A 1 1086 ? -2.097  38.005  68.097  1.00 67.40  ? 1083 GLU A CD  1 
ATOM 8357  O OE1 . GLU A 1 1086 ? -2.730  38.320  69.127  1.00 67.97  ? 1083 GLU A OE1 1 
ATOM 8358  O OE2 . GLU A 1 1086 ? -2.601  38.051  66.952  1.00 67.67  ? 1083 GLU A OE2 1 
ATOM 8359  N N   . PRO A 1 1087 ? -0.790  33.972  65.262  1.00 65.02  ? 1084 PRO A N   1 
ATOM 8360  C CA  . PRO A 1 1087 ? -0.049  33.174  64.284  1.00 64.59  ? 1084 PRO A CA  1 
ATOM 8361  C C   . PRO A 1 1087 ? 1.244   33.869  63.852  1.00 64.24  ? 1084 PRO A C   1 
ATOM 8362  O O   . PRO A 1 1087 ? 1.298   35.100  63.789  1.00 64.09  ? 1084 PRO A O   1 
ATOM 8363  C CB  . PRO A 1 1087 ? -1.024  33.061  63.119  1.00 64.51  ? 1084 PRO A CB  1 
ATOM 8364  C CG  . PRO A 1 1087 ? -1.841  34.277  63.212  1.00 64.80  ? 1084 PRO A CG  1 
ATOM 8365  C CD  . PRO A 1 1087 ? -2.001  34.563  64.671  1.00 64.92  ? 1084 PRO A CD  1 
ATOM 8366  N N   . ALA A 1 1088 ? 2.264   33.072  63.549  1.00 63.93  ? 1085 ALA A N   1 
ATOM 8367  C CA  . ALA A 1 1088 ? 3.626   33.567  63.375  1.00 63.78  ? 1085 ALA A CA  1 
ATOM 8368  C C   . ALA A 1 1088 ? 3.882   34.251  62.039  1.00 63.68  ? 1085 ALA A C   1 
ATOM 8369  O O   . ALA A 1 1088 ? 3.525   33.722  60.993  1.00 63.75  ? 1085 ALA A O   1 
ATOM 8370  C CB  . ALA A 1 1088 ? 4.608   32.424  63.566  1.00 63.86  ? 1085 ALA A CB  1 
ATOM 8371  N N   . THR A 1 1089 ? 4.523   35.413  62.075  1.00 63.61  ? 1086 THR A N   1 
ATOM 8372  C CA  . THR A 1 1089 ? 4.966   36.061  60.844  1.00 63.94  ? 1086 THR A CA  1 
ATOM 8373  C C   . THR A 1 1089 ? 6.481   36.139  60.759  1.00 64.02  ? 1086 THR A C   1 
ATOM 8374  O O   . THR A 1 1089 ? 7.177   36.013  61.761  1.00 63.97  ? 1086 THR A O   1 
ATOM 8375  C CB  . THR A 1 1089 ? 4.406   37.489  60.687  1.00 63.98  ? 1086 THR A CB  1 
ATOM 8376  O OG1 . THR A 1 1089 ? 4.742   38.262  61.840  1.00 64.43  ? 1086 THR A OG1 1 
ATOM 8377  C CG2 . THR A 1 1089 ? 2.890   37.474  60.507  1.00 64.37  ? 1086 THR A CG2 1 
ATOM 8378  N N   . GLY A 1 1090 ? 6.976   36.349  59.544  1.00 64.37  ? 1087 GLY A N   1 
ATOM 8379  C CA  . GLY A 1 1090 ? 8.396   36.598  59.291  1.00 64.78  ? 1087 GLY A CA  1 
ATOM 8380  C C   . GLY A 1 1090 ? 9.378   35.546  59.772  1.00 64.89  ? 1087 GLY A C   1 
ATOM 8381  O O   . GLY A 1 1090 ? 10.528  35.866  60.089  1.00 64.90  ? 1087 GLY A O   1 
ATOM 8382  N N   . PHE A 1 1091 ? 8.933   34.293  59.809  1.00 65.01  ? 1088 PHE A N   1 
ATOM 8383  C CA  . PHE A 1 1091 ? 9.743   33.220  60.371  1.00 65.20  ? 1088 PHE A CA  1 
ATOM 8384  C C   . PHE A 1 1091 ? 9.554   31.861  59.707  1.00 65.32  ? 1088 PHE A C   1 
ATOM 8385  O O   . PHE A 1 1091 ? 8.473   31.262  59.752  1.00 65.59  ? 1088 PHE A O   1 
ATOM 8386  C CB  . PHE A 1 1091 ? 9.512   33.108  61.877  1.00 65.16  ? 1088 PHE A CB  1 
ATOM 8387  C CG  . PHE A 1 1091 ? 10.514  33.858  62.699  1.00 64.93  ? 1088 PHE A CG  1 
ATOM 8388  C CD1 . PHE A 1 1091 ? 10.148  35.013  63.374  1.00 64.76  ? 1088 PHE A CD1 1 
ATOM 8389  C CD2 . PHE A 1 1091 ? 11.826  33.405  62.799  1.00 64.34  ? 1088 PHE A CD2 1 
ATOM 8390  C CE1 . PHE A 1 1091 ? 11.072  35.703  64.140  1.00 64.77  ? 1088 PHE A CE1 1 
ATOM 8391  C CE2 . PHE A 1 1091 ? 12.754  34.086  63.556  1.00 64.21  ? 1088 PHE A CE2 1 
ATOM 8392  C CZ  . PHE A 1 1091 ? 12.379  35.240  64.229  1.00 64.76  ? 1088 PHE A CZ  1 
ATOM 8393  N N   . ILE A 1 1092 ? 10.636  31.368  59.123  1.00 65.21  ? 1089 ILE A N   1 
ATOM 8394  C CA  . ILE A 1 1092 ? 10.596  30.152  58.336  1.00 65.30  ? 1089 ILE A CA  1 
ATOM 8395  C C   . ILE A 1 1092 ? 11.466  29.080  58.989  1.00 65.17  ? 1089 ILE A C   1 
ATOM 8396  O O   . ILE A 1 1092 ? 12.693  29.206  59.001  1.00 65.27  ? 1089 ILE A O   1 
ATOM 8397  C CB  . ILE A 1 1092 ? 11.043  30.469  56.873  1.00 65.26  ? 1089 ILE A CB  1 
ATOM 8398  C CG1 . ILE A 1 1092 ? 10.019  31.414  56.228  1.00 65.37  ? 1089 ILE A CG1 1 
ATOM 8399  C CG2 . ILE A 1 1092 ? 11.225  29.193  56.047  1.00 64.94  ? 1089 ILE A CG2 1 
ATOM 8400  C CD1 . ILE A 1 1092 ? 10.430  32.012  54.905  1.00 65.59  ? 1089 ILE A CD1 1 
ATOM 8401  N N   . ASP A 1 1093 ? 10.865  28.040  59.564  1.00 64.99  ? 1090 ASP A N   1 
ATOM 8402  C CA  . ASP A 1 1093 ? 11.744  26.980  60.060  1.00 64.93  ? 1090 ASP A CA  1 
ATOM 8403  C C   . ASP A 1 1093 ? 12.094  26.036  58.945  1.00 64.97  ? 1090 ASP A C   1 
ATOM 8404  O O   . ASP A 1 1093 ? 11.243  25.343  58.383  1.00 64.79  ? 1090 ASP A O   1 
ATOM 8405  C CB  . ASP A 1 1093 ? 11.361  26.301  61.411  1.00 64.85  ? 1090 ASP A CB  1 
ATOM 8406  C CG  . ASP A 1 1093 ? 10.046  25.552  61.377  1.00 64.07  ? 1090 ASP A CG  1 
ATOM 8407  O OD1 . ASP A 1 1093 ? 9.969   24.493  62.030  1.00 62.32  ? 1090 ASP A OD1 1 
ATOM 8408  O OD2 . ASP A 1 1093 ? 9.087   26.026  60.739  1.00 64.26  ? 1090 ASP A OD2 1 
ATOM 8409  N N   . GLY A 1 1094 ? 13.374  26.104  58.597  1.00 65.21  ? 1091 GLY A N   1 
ATOM 8410  C CA  . GLY A 1 1094 ? 13.978  25.251  57.595  1.00 65.47  ? 1091 GLY A CA  1 
ATOM 8411  C C   . GLY A 1 1094 ? 13.928  23.810  58.022  1.00 65.67  ? 1091 GLY A C   1 
ATOM 8412  O O   . GLY A 1 1094 ? 14.087  22.925  57.198  1.00 65.84  ? 1091 GLY A O   1 
ATOM 8413  N N   . ASP A 1 1095 ? 13.718  23.586  59.320  1.00 65.66  ? 1092 ASP A N   1 
ATOM 8414  C CA  . ASP A 1 1095 ? 13.420  22.267  59.843  1.00 65.55  ? 1092 ASP A CA  1 
ATOM 8415  C C   . ASP A 1 1095 ? 12.284  21.636  59.039  1.00 65.54  ? 1092 ASP A C   1 
ATOM 8416  O O   . ASP A 1 1095 ? 12.394  20.494  58.577  1.00 65.60  ? 1092 ASP A O   1 
ATOM 8417  C CB  . ASP A 1 1095 ? 13.051  22.367  61.322  1.00 65.60  ? 1092 ASP A CB  1 
ATOM 8418  C CG  . ASP A 1 1095 ? 14.233  22.101  62.240  1.00 65.74  ? 1092 ASP A CG  1 
ATOM 8419  O OD1 . ASP A 1 1095 ? 15.390  22.192  61.764  1.00 66.06  ? 1092 ASP A OD1 1 
ATOM 8420  O OD2 . ASP A 1 1095 ? 14.000  21.791  63.435  1.00 65.00  ? 1092 ASP A OD2 1 
ATOM 8421  N N   . LEU A 1 1096 ? 11.211  22.402  58.855  1.00 65.32  ? 1093 LEU A N   1 
ATOM 8422  C CA  . LEU A 1 1096 ? 10.091  21.979  58.041  1.00 65.17  ? 1093 LEU A CA  1 
ATOM 8423  C C   . LEU A 1 1096 ? 10.437  22.062  56.562  1.00 65.11  ? 1093 LEU A C   1 
ATOM 8424  O O   . LEU A 1 1096 ? 9.956   21.263  55.774  1.00 65.19  ? 1093 LEU A O   1 
ATOM 8425  C CB  . LEU A 1 1096 ? 8.863   22.831  58.359  1.00 65.26  ? 1093 LEU A CB  1 
ATOM 8426  C CG  . LEU A 1 1096 ? 7.465   22.421  57.878  1.00 65.39  ? 1093 LEU A CG  1 
ATOM 8427  C CD1 . LEU A 1 1096 ? 7.110   23.157  56.603  1.00 65.80  ? 1093 LEU A CD1 1 
ATOM 8428  C CD2 . LEU A 1 1096 ? 7.289   20.895  57.721  1.00 65.61  ? 1093 LEU A CD2 1 
ATOM 8429  N N   . ILE A 1 1097 ? 11.265  23.028  56.182  1.00 65.11  ? 1094 ILE A N   1 
ATOM 8430  C CA  . ILE A 1 1097 ? 11.717  23.132  54.795  1.00 65.19  ? 1094 ILE A CA  1 
ATOM 8431  C C   . ILE A 1 1097 ? 12.621  21.942  54.447  1.00 65.58  ? 1094 ILE A C   1 
ATOM 8432  O O   . ILE A 1 1097 ? 12.458  21.335  53.394  1.00 65.42  ? 1094 ILE A O   1 
ATOM 8433  C CB  . ILE A 1 1097 ? 12.430  24.483  54.514  1.00 65.05  ? 1094 ILE A CB  1 
ATOM 8434  C CG1 . ILE A 1 1097 ? 11.541  25.680  54.901  1.00 64.74  ? 1094 ILE A CG1 1 
ATOM 8435  C CG2 . ILE A 1 1097 ? 12.893  24.573  53.065  1.00 64.96  ? 1094 ILE A CG2 1 
ATOM 8436  C CD1 . ILE A 1 1097 ? 10.348  25.961  53.982  1.00 64.17  ? 1094 ILE A CD1 1 
ATOM 8437  N N   . GLU A 1 1098 ? 13.554  21.612  55.348  1.00 66.20  ? 1095 GLU A N   1 
ATOM 8438  C CA  . GLU A 1 1098 ? 14.410  20.417  55.247  1.00 66.74  ? 1095 GLU A CA  1 
ATOM 8439  C C   . GLU A 1 1098 ? 13.572  19.138  55.253  1.00 66.97  ? 1095 GLU A C   1 
ATOM 8440  O O   . GLU A 1 1098 ? 14.077  18.055  54.943  1.00 67.07  ? 1095 GLU A O   1 
ATOM 8441  C CB  . GLU A 1 1098 ? 15.428  20.353  56.405  1.00 66.66  ? 1095 GLU A CB  1 
ATOM 8442  C CG  . GLU A 1 1098 ? 16.660  21.279  56.291  1.00 67.17  ? 1095 GLU A CG  1 
ATOM 8443  C CD  . GLU A 1 1098 ? 17.634  21.197  57.503  1.00 67.24  ? 1095 GLU A CD  1 
ATOM 8444  O OE1 . GLU A 1 1098 ? 17.663  20.158  58.209  1.00 67.47  ? 1095 GLU A OE1 1 
ATOM 8445  O OE2 . GLU A 1 1098 ? 18.382  22.179  57.741  1.00 66.89  ? 1095 GLU A OE2 1 
ATOM 8446  N N   . SER A 1 1099 ? 12.297  19.266  55.615  1.00 67.27  ? 1096 SER A N   1 
ATOM 8447  C CA  . SER A 1 1099 ? 11.379  18.132  55.628  1.00 67.63  ? 1096 SER A CA  1 
ATOM 8448  C C   . SER A 1 1099 ? 11.039  17.667  54.216  1.00 67.81  ? 1096 SER A C   1 
ATOM 8449  O O   . SER A 1 1099 ? 10.640  16.520  54.019  1.00 67.84  ? 1096 SER A O   1 
ATOM 8450  C CB  . SER A 1 1099 ? 10.104  18.479  56.395  1.00 67.70  ? 1096 SER A CB  1 
ATOM 8451  O OG  . SER A 1 1099 ? 9.291   17.335  56.562  1.00 68.08  ? 1096 SER A OG  1 
ATOM 8452  N N   . PHE A 1 1100 ? 11.213  18.565  53.247  1.00 68.14  ? 1097 PHE A N   1 
ATOM 8453  C CA  . PHE A 1 1100 ? 11.004  18.286  51.825  1.00 68.49  ? 1097 PHE A CA  1 
ATOM 8454  C C   . PHE A 1 1100 ? 11.889  17.148  51.305  1.00 68.87  ? 1097 PHE A C   1 
ATOM 8455  O O   . PHE A 1 1100 ? 11.381  16.188  50.733  1.00 69.04  ? 1097 PHE A O   1 
ATOM 8456  C CB  . PHE A 1 1100 ? 11.250  19.564  51.015  1.00 68.41  ? 1097 PHE A CB  1 
ATOM 8457  C CG  . PHE A 1 1100 ? 10.907  19.456  49.547  1.00 68.47  ? 1097 PHE A CG  1 
ATOM 8458  C CD1 . PHE A 1 1100 ? 9.604   19.665  49.103  1.00 68.52  ? 1097 PHE A CD1 1 
ATOM 8459  C CD2 . PHE A 1 1100 ? 11.898  19.194  48.602  1.00 68.46  ? 1097 PHE A CD2 1 
ATOM 8460  C CE1 . PHE A 1 1100 ? 9.289   19.586  47.749  1.00 68.11  ? 1097 PHE A CE1 1 
ATOM 8461  C CE2 . PHE A 1 1100 ? 11.590  19.114  47.243  1.00 68.14  ? 1097 PHE A CE2 1 
ATOM 8462  C CZ  . PHE A 1 1100 ? 10.287  19.313  46.820  1.00 68.20  ? 1097 PHE A CZ  1 
ATOM 8463  N N   . LEU A 1 1101 ? 13.201  17.247  51.520  1.00 69.26  ? 1098 LEU A N   1 
ATOM 8464  C CA  . LEU A 1 1101 ? 14.164  16.285  50.965  1.00 69.73  ? 1098 LEU A CA  1 
ATOM 8465  C C   . LEU A 1 1101 ? 13.996  14.839  51.448  1.00 70.28  ? 1098 LEU A C   1 
ATOM 8466  O O   . LEU A 1 1101 ? 14.653  13.928  50.941  1.00 70.30  ? 1098 LEU A O   1 
ATOM 8467  C CB  . LEU A 1 1101 ? 15.597  16.758  51.213  1.00 69.59  ? 1098 LEU A CB  1 
ATOM 8468  C CG  . LEU A 1 1101 ? 15.975  18.113  50.618  1.00 69.54  ? 1098 LEU A CG  1 
ATOM 8469  C CD1 . LEU A 1 1101 ? 17.468  18.363  50.755  1.00 69.38  ? 1098 LEU A CD1 1 
ATOM 8470  C CD2 . LEU A 1 1101 ? 15.549  18.209  49.160  1.00 69.47  ? 1098 LEU A CD2 1 
ATOM 8471  N N   . ASP A 1 1102 ? 13.125  14.635  52.428  1.00 70.98  ? 1099 ASP A N   1 
ATOM 8472  C CA  . ASP A 1 1102 ? 12.826  13.300  52.920  1.00 71.77  ? 1099 ASP A CA  1 
ATOM 8473  C C   . ASP A 1 1102 ? 11.363  12.969  52.634  1.00 72.26  ? 1099 ASP A C   1 
ATOM 8474  O O   . ASP A 1 1102 ? 10.644  12.439  53.485  1.00 72.52  ? 1099 ASP A O   1 
ATOM 8475  C CB  . ASP A 1 1102 ? 13.157  13.184  54.418  1.00 71.90  ? 1099 ASP A CB  1 
ATOM 8476  C CG  . ASP A 1 1102 ? 14.661  13.036  54.688  1.00 72.12  ? 1099 ASP A CG  1 
ATOM 8477  O OD1 . ASP A 1 1102 ? 15.463  13.096  53.726  1.00 72.34  ? 1099 ASP A OD1 1 
ATOM 8478  O OD2 . ASP A 1 1102 ? 15.041  12.856  55.870  1.00 71.97  ? 1099 ASP A OD2 1 
ATOM 8479  N N   . ILE A 1 1103 ? 10.933  13.299  51.422  1.00 72.80  ? 1100 ILE A N   1 
ATOM 8480  C CA  . ILE A 1 1103 ? 9.583   12.994  50.961  1.00 73.31  ? 1100 ILE A CA  1 
ATOM 8481  C C   . ILE A 1 1103 ? 9.648   12.040  49.765  1.00 73.85  ? 1100 ILE A C   1 
ATOM 8482  O O   . ILE A 1 1103 ? 10.617  12.052  48.996  1.00 73.82  ? 1100 ILE A O   1 
ATOM 8483  C CB  . ILE A 1 1103 ? 8.796   14.291  50.608  1.00 73.24  ? 1100 ILE A CB  1 
ATOM 8484  C CG1 . ILE A 1 1103 ? 8.343   15.005  51.884  1.00 73.07  ? 1100 ILE A CG1 1 
ATOM 8485  C CG2 . ILE A 1 1103 ? 7.589   13.997  49.726  1.00 73.41  ? 1100 ILE A CG2 1 
ATOM 8486  C CD1 . ILE A 1 1103 ? 7.588   16.306  51.640  1.00 73.01  ? 1100 ILE A CD1 1 
ATOM 8487  N N   . SER A 1 1104 ? 8.623   11.198  49.637  1.00 74.50  ? 1101 SER A N   1 
ATOM 8488  C CA  . SER A 1 1104 ? 8.464   10.340  48.468  1.00 75.11  ? 1101 SER A CA  1 
ATOM 8489  C C   . SER A 1 1104 ? 8.204   11.189  47.223  1.00 75.53  ? 1101 SER A C   1 
ATOM 8490  O O   . SER A 1 1104 ? 7.511   12.208  47.285  1.00 75.54  ? 1101 SER A O   1 
ATOM 8491  C CB  . SER A 1 1104 ? 7.339   9.319   48.682  1.00 75.06  ? 1101 SER A CB  1 
ATOM 8492  O OG  . SER A 1 1104 ? 6.107   9.951   48.988  1.00 75.05  ? 1101 SER A OG  1 
ATOM 8493  N N   . ARG A 1 1105 ? 8.771   10.765  46.096  1.00 76.08  ? 1102 ARG A N   1 
ATOM 8494  C CA  . ARG A 1 1105 ? 8.650   11.509  44.841  1.00 76.61  ? 1102 ARG A CA  1 
ATOM 8495  C C   . ARG A 1 1105 ? 7.191   11.798  44.416  1.00 76.82  ? 1102 ARG A C   1 
ATOM 8496  O O   . ARG A 1 1105 ? 6.916   12.884  43.903  1.00 76.89  ? 1102 ARG A O   1 
ATOM 8497  C CB  . ARG A 1 1105 ? 9.476   10.852  43.718  1.00 76.70  ? 1102 ARG A CB  1 
ATOM 8498  C CG  . ARG A 1 1105 ? 9.607   11.700  42.460  1.00 77.04  ? 1102 ARG A CG  1 
ATOM 8499  C CD  . ARG A 1 1105 ? 11.059  11.893  42.037  1.00 77.62  ? 1102 ARG A CD  1 
ATOM 8500  N NE  . ARG A 1 1105 ? 11.146  12.747  40.849  1.00 78.45  ? 1102 ARG A NE  1 
ATOM 8501  C CZ  . ARG A 1 1105 ? 12.184  13.519  40.531  1.00 78.45  ? 1102 ARG A CZ  1 
ATOM 8502  N NH1 . ARG A 1 1105 ? 13.254  13.572  41.315  1.00 78.60  ? 1102 ARG A NH1 1 
ATOM 8503  N NH2 . ARG A 1 1105 ? 12.146  14.251  39.424  1.00 78.42  ? 1102 ARG A NH2 1 
ATOM 8504  N N   . PRO A 1 1106 ? 6.261   10.832  44.623  1.00 77.05  ? 1103 PRO A N   1 
ATOM 8505  C CA  . PRO A 1 1106 ? 4.822   11.086  44.403  1.00 77.15  ? 1103 PRO A CA  1 
ATOM 8506  C C   . PRO A 1 1106 ? 4.231   12.240  45.218  1.00 77.13  ? 1103 PRO A C   1 
ATOM 8507  O O   . PRO A 1 1106 ? 3.472   13.043  44.680  1.00 77.11  ? 1103 PRO A O   1 
ATOM 8508  C CB  . PRO A 1 1106 ? 4.160   9.762   44.816  1.00 77.23  ? 1103 PRO A CB  1 
ATOM 8509  C CG  . PRO A 1 1106 ? 5.196   9.032   45.619  1.00 77.29  ? 1103 PRO A CG  1 
ATOM 8510  C CD  . PRO A 1 1106 ? 6.496   9.428   45.011  1.00 77.04  ? 1103 PRO A CD  1 
ATOM 8511  N N   . LYS A 1 1107 ? 4.569   12.311  46.501  1.00 77.23  ? 1104 LYS A N   1 
ATOM 8512  C CA  . LYS A 1 1107 ? 4.095   13.392  47.366  1.00 77.49  ? 1104 LYS A CA  1 
ATOM 8513  C C   . LYS A 1 1107 ? 4.973   14.643  47.253  1.00 77.23  ? 1104 LYS A C   1 
ATOM 8514  O O   . LYS A 1 1107 ? 4.687   15.677  47.860  1.00 77.02  ? 1104 LYS A O   1 
ATOM 8515  C CB  . LYS A 1 1107 ? 4.004   12.916  48.821  1.00 77.63  ? 1104 LYS A CB  1 
ATOM 8516  C CG  . LYS A 1 1107 ? 2.750   12.101  49.150  1.00 78.01  ? 1104 LYS A CG  1 
ATOM 8517  C CD  . LYS A 1 1107 ? 2.633   11.835  50.658  1.00 78.04  ? 1104 LYS A CD  1 
ATOM 8518  C CE  . LYS A 1 1107 ? 1.282   11.202  51.035  1.00 78.47  ? 1104 LYS A CE  1 
ATOM 8519  N NZ  . LYS A 1 1107 ? 0.150   12.184  51.075  1.00 78.40  ? 1104 LYS A NZ  1 
ATOM 8520  N N   . MET A 1 1108 ? 6.041   14.531  46.469  1.00 77.17  ? 1105 MET A N   1 
ATOM 8521  C CA  . MET A 1 1108 ? 6.946   15.642  46.196  1.00 77.24  ? 1105 MET A CA  1 
ATOM 8522  C C   . MET A 1 1108 ? 6.437   16.478  45.012  1.00 77.19  ? 1105 MET A C   1 
ATOM 8523  O O   . MET A 1 1108 ? 6.462   17.713  45.051  1.00 77.07  ? 1105 MET A O   1 
ATOM 8524  C CB  . MET A 1 1108 ? 8.348   15.104  45.905  1.00 77.19  ? 1105 MET A CB  1 
ATOM 8525  C CG  . MET A 1 1108 ? 9.469   16.098  46.128  1.00 77.22  ? 1105 MET A CG  1 
ATOM 8526  S SD  . MET A 1 1108 ? 11.084  15.504  45.580  1.00 77.49  ? 1105 MET A SD  1 
ATOM 8527  C CE  . MET A 1 1108 ? 11.282  14.002  46.544  1.00 77.06  ? 1105 MET A CE  1 
ATOM 8528  N N   . GLN A 1 1109 ? 5.977   15.786  43.967  1.00 77.16  ? 1106 GLN A N   1 
ATOM 8529  C CA  . GLN A 1 1109 ? 5.405   16.411  42.774  1.00 76.96  ? 1106 GLN A CA  1 
ATOM 8530  C C   . GLN A 1 1109 ? 4.204   17.268  43.147  1.00 77.01  ? 1106 GLN A C   1 
ATOM 8531  O O   . GLN A 1 1109 ? 3.946   18.294  42.511  1.00 77.05  ? 1106 GLN A O   1 
ATOM 8532  C CB  . GLN A 1 1109 ? 4.975   15.338  41.772  1.00 76.87  ? 1106 GLN A CB  1 
ATOM 8533  C CG  . GLN A 1 1109 ? 6.117   14.513  41.188  1.00 76.75  ? 1106 GLN A CG  1 
ATOM 8534  C CD  . GLN A 1 1109 ? 6.640   15.062  39.875  1.00 76.71  ? 1106 GLN A CD  1 
ATOM 8535  O OE1 . GLN A 1 1109 ? 6.797   16.273  39.710  1.00 76.94  ? 1106 GLN A OE1 1 
ATOM 8536  N NE2 . GLN A 1 1109 ? 6.915   14.168  38.930  1.00 76.16  ? 1106 GLN A NE2 1 
ATOM 8537  N N   . GLU A 1 1110 ? 3.489   16.835  44.189  1.00 76.97  ? 1107 GLU A N   1 
ATOM 8538  C CA  . GLU A 1 1110 ? 2.276   17.495  44.685  1.00 76.90  ? 1107 GLU A CA  1 
ATOM 8539  C C   . GLU A 1 1110 ? 2.542   18.933  45.084  1.00 76.64  ? 1107 GLU A C   1 
ATOM 8540  O O   . GLU A 1 1110 ? 1.783   19.842  44.730  1.00 76.45  ? 1107 GLU A O   1 
ATOM 8541  C CB  . GLU A 1 1110 ? 1.712   16.744  45.893  1.00 76.82  ? 1107 GLU A CB  1 
ATOM 8542  C CG  . GLU A 1 1110 ? 1.258   15.321  45.604  1.00 77.09  ? 1107 GLU A CG  1 
ATOM 8543  C CD  . GLU A 1 1110 ? 0.432   14.728  46.733  1.00 77.22  ? 1107 GLU A CD  1 
ATOM 8544  O OE1 . GLU A 1 1110 ? -0.338  15.483  47.372  1.00 77.95  ? 1107 GLU A OE1 1 
ATOM 8545  O OE2 . GLU A 1 1110 ? 0.549   13.505  46.975  1.00 77.39  ? 1107 GLU A OE2 1 
ATOM 8546  N N   . VAL A 1 1111 ? 3.634   19.110  45.824  1.00 76.55  ? 1108 VAL A N   1 
ATOM 8547  C CA  . VAL A 1 1111 ? 4.071   20.403  46.331  1.00 76.48  ? 1108 VAL A CA  1 
ATOM 8548  C C   . VAL A 1 1111 ? 4.136   21.423  45.199  1.00 76.45  ? 1108 VAL A C   1 
ATOM 8549  O O   . VAL A 1 1111 ? 3.826   22.595  45.397  1.00 76.31  ? 1108 VAL A O   1 
ATOM 8550  C CB  . VAL A 1 1111 ? 5.449   20.278  47.052  1.00 76.57  ? 1108 VAL A CB  1 
ATOM 8551  C CG1 . VAL A 1 1111 ? 6.010   21.647  47.452  1.00 76.54  ? 1108 VAL A CG1 1 
ATOM 8552  C CG2 . VAL A 1 1111 ? 5.341   19.359  48.268  1.00 76.14  ? 1108 VAL A CG2 1 
ATOM 8553  N N   . VAL A 1 1112 ? 4.515   20.963  44.008  1.00 76.52  ? 1109 VAL A N   1 
ATOM 8554  C CA  . VAL A 1 1112 ? 4.616   21.851  42.853  1.00 76.57  ? 1109 VAL A CA  1 
ATOM 8555  C C   . VAL A 1 1112 ? 3.474   21.681  41.832  1.00 76.63  ? 1109 VAL A C   1 
ATOM 8556  O O   . VAL A 1 1112 ? 3.478   20.751  41.017  1.00 76.52  ? 1109 VAL A O   1 
ATOM 8557  C CB  . VAL A 1 1112 ? 5.995   21.756  42.165  1.00 76.52  ? 1109 VAL A CB  1 
ATOM 8558  C CG1 . VAL A 1 1112 ? 6.155   22.897  41.179  1.00 76.79  ? 1109 VAL A CG1 1 
ATOM 8559  C CG2 . VAL A 1 1112 ? 7.116   21.795  43.198  1.00 76.13  ? 1109 VAL A CG2 1 
ATOM 8560  N N   . ALA A 1 1113 ? 2.499   22.587  41.916  1.00 76.69  ? 1110 ALA A N   1 
ATOM 8561  C CA  . ALA A 1 1113 ? 1.429   22.732  40.928  1.00 76.64  ? 1110 ALA A CA  1 
ATOM 8562  C C   . ALA A 1 1113 ? 1.510   24.136  40.339  1.00 76.65  ? 1110 ALA A C   1 
ATOM 8563  O O   . ALA A 1 1113 ? 1.031   24.386  39.229  1.00 76.64  ? 1110 ALA A O   1 
ATOM 8564  C CB  . ALA A 1 1113 ? 0.071   22.500  41.566  1.00 76.59  ? 1110 ALA A CB  1 
ATOM 8565  N N   . ASN A 1 1114 ? 2.116   25.040  41.114  1.00 76.68  ? 1111 ASN A N   1 
ATOM 8566  C CA  . ASN A 1 1114 ? 2.436   26.413  40.704  1.00 76.77  ? 1111 ASN A CA  1 
ATOM 8567  C C   . ASN A 1 1114 ? 3.212   27.158  41.789  1.00 76.62  ? 1111 ASN A C   1 
ATOM 8568  O O   . ASN A 1 1114 ? 4.030   28.031  41.503  1.00 76.45  ? 1111 ASN A O   1 
ATOM 8569  C CB  . ASN A 1 1114 ? 1.179   27.206  40.301  1.00 76.93  ? 1111 ASN A CB  1 
ATOM 8570  C CG  . ASN A 1 1114 ? 0.073   27.150  41.349  1.00 77.23  ? 1111 ASN A CG  1 
ATOM 8571  O OD1 . ASN A 1 1114 ? -0.005  26.214  42.149  1.00 77.77  ? 1111 ASN A OD1 1 
ATOM 8572  N ND2 . ASN A 1 1114 ? -0.803  28.154  41.333  1.00 77.29  ? 1111 ASN A ND2 1 
ATOM 8573  N N   . ARG A 1 1125 ? 9.019   34.392  35.859  1.00 87.93  ? 1122 ARG A N   1 
ATOM 8574  C CA  . ARG A 1 1125 ? 8.473   33.636  36.986  1.00 87.92  ? 1122 ARG A CA  1 
ATOM 8575  C C   . ARG A 1 1125 ? 8.090   32.212  36.578  1.00 87.86  ? 1122 ARG A C   1 
ATOM 8576  O O   . ARG A 1 1125 ? 7.593   31.983  35.467  1.00 87.70  ? 1122 ARG A O   1 
ATOM 8577  C CB  . ARG A 1 1125 ? 7.290   34.375  37.629  1.00 87.87  ? 1122 ARG A CB  1 
ATOM 8578  C CG  . ARG A 1 1125 ? 6.288   34.966  36.639  1.00 88.03  ? 1122 ARG A CG  1 
ATOM 8579  C CD  . ARG A 1 1125 ? 5.112   35.634  37.345  1.00 88.03  ? 1122 ARG A CD  1 
ATOM 8580  N NE  . ARG A 1 1125 ? 4.156   34.660  37.877  1.00 88.02  ? 1122 ARG A NE  1 
ATOM 8581  C CZ  . ARG A 1 1125 ? 4.057   34.314  39.160  1.00 87.85  ? 1122 ARG A CZ  1 
ATOM 8582  N NH1 . ARG A 1 1125 ? 4.851   34.864  40.073  1.00 87.68  ? 1122 ARG A NH1 1 
ATOM 8583  N NH2 . ARG A 1 1125 ? 3.153   33.415  39.533  1.00 87.61  ? 1122 ARG A NH2 1 
ATOM 8584  N N   . GLU A 1 1126 ? 8.330   31.264  37.488  1.00 87.84  ? 1123 GLU A N   1 
ATOM 8585  C CA  . GLU A 1 1126 ? 8.192   29.834  37.192  1.00 87.83  ? 1123 GLU A CA  1 
ATOM 8586  C C   . GLU A 1 1126 ? 8.002   28.951  38.438  1.00 87.62  ? 1123 GLU A C   1 
ATOM 8587  O O   . GLU A 1 1126 ? 8.122   29.413  39.577  1.00 87.53  ? 1123 GLU A O   1 
ATOM 8588  C CB  . GLU A 1 1126 ? 9.423   29.358  36.410  1.00 87.87  ? 1123 GLU A CB  1 
ATOM 8589  C CG  . GLU A 1 1126 ? 9.218   28.108  35.564  1.00 87.94  ? 1123 GLU A CG  1 
ATOM 8590  C CD  . GLU A 1 1126 ? 10.501  27.655  34.894  1.00 88.06  ? 1123 GLU A CD  1 
ATOM 8591  O OE1 . GLU A 1 1126 ? 11.535  27.542  35.590  1.00 88.26  ? 1123 GLU A OE1 1 
ATOM 8592  O OE2 . GLU A 1 1126 ? 10.475  27.414  33.668  1.00 88.49  ? 1123 GLU A OE2 1 
ATOM 8593  N N   . ALA A 1 1127 ? 7.683   27.681  38.189  1.00 87.41  ? 1124 ALA A N   1 
ATOM 8594  C CA  . ALA A 1 1127 ? 7.688   26.623  39.199  1.00 87.13  ? 1124 ALA A CA  1 
ATOM 8595  C C   . ALA A 1 1127 ? 8.040   25.304  38.504  1.00 86.88  ? 1124 ALA A C   1 
ATOM 8596  O O   . ALA A 1 1127 ? 7.499   25.001  37.432  1.00 86.88  ? 1124 ALA A O   1 
ATOM 8597  C CB  . ALA A 1 1127 ? 6.337   26.527  39.885  1.00 87.21  ? 1124 ALA A CB  1 
ATOM 8598  N N   . THR A 1 1128 ? 8.943   24.529  39.107  1.00 86.39  ? 1125 THR A N   1 
ATOM 8599  C CA  . THR A 1 1128 ? 9.486   23.331  38.455  1.00 85.91  ? 1125 THR A CA  1 
ATOM 8600  C C   . THR A 1 1128 ? 8.945   22.023  39.042  1.00 85.57  ? 1125 THR A C   1 
ATOM 8601  O O   . THR A 1 1128 ? 7.812   21.626  38.743  1.00 85.46  ? 1125 THR A O   1 
ATOM 8602  C CB  . THR A 1 1128 ? 11.041  23.333  38.451  1.00 85.90  ? 1125 THR A CB  1 
ATOM 8603  O OG1 . THR A 1 1128 ? 11.524  24.627  38.068  1.00 85.94  ? 1125 THR A OG1 1 
ATOM 8604  C CG2 . THR A 1 1128 ? 11.595  22.291  37.478  1.00 85.97  ? 1125 THR A CG2 1 
ATOM 8605  N N   . ALA A 1 1129 ? 9.774   21.366  39.858  1.00 85.16  ? 1126 ALA A N   1 
ATOM 8606  C CA  . ALA A 1 1129 ? 9.485   20.075  40.495  1.00 84.72  ? 1126 ALA A CA  1 
ATOM 8607  C C   . ALA A 1 1129 ? 10.768  19.538  41.131  1.00 84.30  ? 1126 ALA A C   1 
ATOM 8608  O O   . ALA A 1 1129 ? 10.875  19.412  42.352  1.00 84.07  ? 1126 ALA A O   1 
ATOM 8609  C CB  . ALA A 1 1129 ? 8.923   19.063  39.479  1.00 84.75  ? 1126 ALA A CB  1 
ATOM 8610  N N   . ASP A 1 1130 ? 11.739  19.236  40.277  1.00 83.92  ? 1127 ASP A N   1 
ATOM 8611  C CA  . ASP A 1 1130 ? 13.042  18.732  40.693  1.00 83.55  ? 1127 ASP A CA  1 
ATOM 8612  C C   . ASP A 1 1130 ? 14.103  19.838  40.708  1.00 83.14  ? 1127 ASP A C   1 
ATOM 8613  O O   . ASP A 1 1130 ? 15.297  19.570  40.561  1.00 83.10  ? 1127 ASP A O   1 
ATOM 8614  C CB  . ASP A 1 1130 ? 13.474  17.548  39.805  1.00 83.65  ? 1127 ASP A CB  1 
ATOM 8615  C CG  . ASP A 1 1130 ? 12.858  17.590  38.396  1.00 84.02  ? 1127 ASP A CG  1 
ATOM 8616  O OD1 . ASP A 1 1130 ? 12.478  18.680  37.905  1.00 84.06  ? 1127 ASP A OD1 1 
ATOM 8617  O OD2 . ASP A 1 1130 ? 12.757  16.512  37.772  1.00 84.54  ? 1127 ASP A OD2 1 
ATOM 8618  N N   . ASP A 1 1131 ? 13.658  21.078  40.885  1.00 82.67  ? 1128 ASP A N   1 
ATOM 8619  C CA  . ASP A 1 1131 ? 14.564  22.215  41.022  1.00 82.34  ? 1128 ASP A CA  1 
ATOM 8620  C C   . ASP A 1 1131 ? 14.561  22.720  42.461  1.00 82.04  ? 1128 ASP A C   1 
ATOM 8621  O O   . ASP A 1 1131 ? 15.562  23.253  42.936  1.00 82.12  ? 1128 ASP A O   1 
ATOM 8622  C CB  . ASP A 1 1131 ? 14.188  23.342  40.053  1.00 82.44  ? 1128 ASP A CB  1 
ATOM 8623  C CG  . ASP A 1 1131 ? 15.259  24.427  39.956  1.00 82.65  ? 1128 ASP A CG  1 
ATOM 8624  O OD1 . ASP A 1 1131 ? 14.916  25.619  40.116  1.00 82.75  ? 1128 ASP A OD1 1 
ATOM 8625  O OD2 . ASP A 1 1131 ? 16.442  24.093  39.718  1.00 82.99  ? 1128 ASP A OD2 1 
ATOM 8626  N N   . LEU A 1 1132 ? 13.430  22.552  43.145  1.00 81.64  ? 1129 LEU A N   1 
ATOM 8627  C CA  . LEU A 1 1132 ? 13.318  22.862  44.574  1.00 81.14  ? 1129 LEU A CA  1 
ATOM 8628  C C   . LEU A 1 1132 ? 14.133  21.864  45.388  1.00 80.92  ? 1129 LEU A C   1 
ATOM 8629  O O   . LEU A 1 1132 ? 14.783  22.236  46.361  1.00 80.88  ? 1129 LEU A O   1 
ATOM 8630  C CB  . LEU A 1 1132 ? 11.850  22.851  45.031  1.00 81.08  ? 1129 LEU A CB  1 
ATOM 8631  C CG  . LEU A 1 1132 ? 10.911  24.044  44.774  1.00 80.70  ? 1129 LEU A CG  1 
ATOM 8632  C CD1 . LEU A 1 1132 ? 11.162  25.170  45.759  1.00 80.29  ? 1129 LEU A CD1 1 
ATOM 8633  C CD2 . LEU A 1 1132 ? 10.952  24.566  43.328  1.00 80.67  ? 1129 LEU A CD2 1 
ATOM 8634  N N   . ILE A 1 1133 ? 14.106  20.602  44.967  1.00 80.73  ? 1130 ILE A N   1 
ATOM 8635  C CA  . ILE A 1 1133 ? 14.956  19.559  45.538  1.00 80.65  ? 1130 ILE A CA  1 
ATOM 8636  C C   . ILE A 1 1133 ? 16.421  20.020  45.636  1.00 80.50  ? 1130 ILE A C   1 
ATOM 8637  O O   . ILE A 1 1133 ? 17.190  19.505  46.446  1.00 80.54  ? 1130 ILE A O   1 
ATOM 8638  C CB  . ILE A 1 1133 ? 14.844  18.229  44.724  1.00 80.70  ? 1130 ILE A CB  1 
ATOM 8639  C CG1 . ILE A 1 1133 ? 15.166  17.013  45.607  1.00 80.87  ? 1130 ILE A CG1 1 
ATOM 8640  C CG2 . ILE A 1 1133 ? 15.723  18.267  43.464  1.00 80.68  ? 1130 ILE A CG2 1 
ATOM 8641  C CD1 . ILE A 1 1133 ? 14.797  15.656  44.998  1.00 80.70  ? 1130 ILE A CD1 1 
ATOM 8642  N N   . LYS A 1 1134 ? 16.785  21.004  44.815  1.00 80.36  ? 1131 LYS A N   1 
ATOM 8643  C CA  . LYS A 1 1134 ? 18.141  21.551  44.779  1.00 80.15  ? 1131 LYS A CA  1 
ATOM 8644  C C   . LYS A 1 1134 ? 18.260  22.816  45.626  1.00 79.89  ? 1131 LYS A C   1 
ATOM 8645  O O   . LYS A 1 1134 ? 19.323  23.088  46.177  1.00 80.02  ? 1131 LYS A O   1 
ATOM 8646  C CB  . LYS A 1 1134 ? 18.567  21.830  43.329  1.00 80.24  ? 1131 LYS A CB  1 
ATOM 8647  C CG  . LYS A 1 1134 ? 20.059  22.121  43.131  1.00 80.35  ? 1131 LYS A CG  1 
ATOM 8648  C CD  . LYS A 1 1134 ? 20.480  22.069  41.651  1.00 80.12  ? 1131 LYS A CD  1 
ATOM 8649  C CE  . LYS A 1 1134 ? 20.816  20.652  41.196  1.00 79.55  ? 1131 LYS A CE  1 
ATOM 8650  N NZ  . LYS A 1 1134 ? 21.594  20.663  39.934  1.00 78.83  ? 1131 LYS A NZ  1 
ATOM 8651  N N   . VAL A 1 1135 ? 17.175  23.586  45.716  1.00 79.53  ? 1132 VAL A N   1 
ATOM 8652  C CA  . VAL A 1 1135 ? 17.140  24.802  46.538  1.00 79.11  ? 1132 VAL A CA  1 
ATOM 8653  C C   . VAL A 1 1135 ? 17.233  24.426  48.014  1.00 78.86  ? 1132 VAL A C   1 
ATOM 8654  O O   . VAL A 1 1135 ? 17.941  25.072  48.784  1.00 78.71  ? 1132 VAL A O   1 
ATOM 8655  C CB  . VAL A 1 1135 ? 15.860  25.648  46.283  1.00 79.15  ? 1132 VAL A CB  1 
ATOM 8656  C CG1 . VAL A 1 1135 ? 15.856  26.923  47.142  1.00 78.99  ? 1132 VAL A CG1 1 
ATOM 8657  C CG2 . VAL A 1 1135 ? 15.730  26.001  44.808  1.00 78.85  ? 1132 VAL A CG2 1 
ATOM 8658  N N   . VAL A 1 1136 ? 16.523  23.365  48.389  1.00 78.67  ? 1133 VAL A N   1 
ATOM 8659  C CA  . VAL A 1 1136 ? 16.573  22.833  49.748  1.00 78.59  ? 1133 VAL A CA  1 
ATOM 8660  C C   . VAL A 1 1136 ? 17.932  22.165  50.025  1.00 78.65  ? 1133 VAL A C   1 
ATOM 8661  O O   . VAL A 1 1136 ? 18.281  21.913  51.181  1.00 78.68  ? 1133 VAL A O   1 
ATOM 8662  C CB  . VAL A 1 1136 ? 15.396  21.866  50.031  1.00 78.49  ? 1133 VAL A CB  1 
ATOM 8663  C CG1 . VAL A 1 1136 ? 15.260  21.606  51.521  1.00 78.51  ? 1133 VAL A CG1 1 
ATOM 8664  C CG2 . VAL A 1 1136 ? 14.102  22.448  49.510  1.00 78.29  ? 1133 VAL A CG2 1 
ATOM 8665  N N   . GLU A 1 1137 ? 18.697  21.890  48.966  1.00 78.64  ? 1134 GLU A N   1 
ATOM 8666  C CA  . GLU A 1 1137 ? 20.104  21.503  49.114  1.00 78.62  ? 1134 GLU A CA  1 
ATOM 8667  C C   . GLU A 1 1137 ? 20.950  22.703  49.568  1.00 78.39  ? 1134 GLU A C   1 
ATOM 8668  O O   . GLU A 1 1137 ? 21.600  22.644  50.618  1.00 78.35  ? 1134 GLU A O   1 
ATOM 8669  C CB  . GLU A 1 1137 ? 20.670  20.902  47.819  1.00 78.64  ? 1134 GLU A CB  1 
ATOM 8670  C CG  . GLU A 1 1137 ? 20.364  19.421  47.595  1.00 78.81  ? 1134 GLU A CG  1 
ATOM 8671  C CD  . GLU A 1 1137 ? 20.926  18.887  46.271  1.00 78.92  ? 1134 GLU A CD  1 
ATOM 8672  O OE1 . GLU A 1 1137 ? 21.060  19.669  45.301  1.00 79.11  ? 1134 GLU A OE1 1 
ATOM 8673  O OE2 . GLU A 1 1137 ? 21.236  17.676  46.198  1.00 79.08  ? 1134 GLU A OE2 1 
ATOM 8674  N N   . GLU A 1 1138 ? 20.919  23.791  48.794  1.00 78.11  ? 1135 GLU A N   1 
ATOM 8675  C CA  . GLU A 1 1138 ? 21.681  25.003  49.120  1.00 78.03  ? 1135 GLU A CA  1 
ATOM 8676  C C   . GLU A 1 1138 ? 21.327  25.621  50.481  1.00 77.82  ? 1135 GLU A C   1 
ATOM 8677  O O   . GLU A 1 1138 ? 21.977  26.571  50.928  1.00 78.01  ? 1135 GLU A O   1 
ATOM 8678  C CB  . GLU A 1 1138 ? 21.578  26.053  48.005  1.00 78.07  ? 1135 GLU A CB  1 
ATOM 8679  C CG  . GLU A 1 1138 ? 22.802  26.096  47.085  1.00 78.98  ? 1135 GLU A CG  1 
ATOM 8680  C CD  . GLU A 1 1138 ? 22.978  27.430  46.355  1.00 79.77  ? 1135 GLU A CD  1 
ATOM 8681  O OE1 . GLU A 1 1138 ? 24.041  28.068  46.530  1.00 79.80  ? 1135 GLU A OE1 1 
ATOM 8682  O OE2 . GLU A 1 1138 ? 22.063  27.836  45.601  1.00 80.12  ? 1135 GLU A OE2 1 
ATOM 8683  N N   . LEU A 1 1139 ? 20.308  25.077  51.141  1.00 77.35  ? 1136 LEU A N   1 
ATOM 8684  C CA  . LEU A 1 1139 ? 19.946  25.526  52.475  1.00 76.86  ? 1136 LEU A CA  1 
ATOM 8685  C C   . LEU A 1 1139 ? 20.605  24.668  53.548  1.00 76.85  ? 1136 LEU A C   1 
ATOM 8686  O O   . LEU A 1 1139 ? 21.139  25.195  54.523  1.00 76.85  ? 1136 LEU A O   1 
ATOM 8687  C CB  . LEU A 1 1139 ? 18.427  25.555  52.654  1.00 76.73  ? 1136 LEU A CB  1 
ATOM 8688  C CG  . LEU A 1 1139 ? 17.630  26.670  51.971  1.00 76.03  ? 1136 LEU A CG  1 
ATOM 8689  C CD1 . LEU A 1 1139 ? 16.168  26.551  52.350  1.00 75.51  ? 1136 LEU A CD1 1 
ATOM 8690  C CD2 . LEU A 1 1139 ? 18.153  28.058  52.323  1.00 75.35  ? 1136 LEU A CD2 1 
ATOM 8691  N N   . THR A 1 1140 ? 20.582  23.349  53.360  1.00 76.75  ? 1137 THR A N   1 
ATOM 8692  C CA  . THR A 1 1140 ? 21.222  22.429  54.303  1.00 76.72  ? 1137 THR A CA  1 
ATOM 8693  C C   . THR A 1 1140 ? 22.736  22.584  54.280  1.00 76.80  ? 1137 THR A C   1 
ATOM 8694  O O   . THR A 1 1140 ? 23.467  21.695  54.716  1.00 76.82  ? 1137 THR A O   1 
ATOM 8695  C CB  . THR A 1 1140 ? 20.884  20.956  54.010  1.00 76.65  ? 1137 THR A CB  1 
ATOM 8696  O OG1 . THR A 1 1140 ? 21.065  20.698  52.616  1.00 76.80  ? 1137 THR A OG1 1 
ATOM 8697  C CG2 . THR A 1 1140 ? 19.462  20.633  54.400  1.00 76.25  ? 1137 THR A CG2 1 
ATOM 8698  N N   . ARG A 1 1141 ? 23.201  23.715  53.765  1.00 76.97  ? 1138 ARG A N   1 
ATOM 8699  C CA  . ARG A 1 1141 ? 24.617  24.029  53.780  1.00 77.29  ? 1138 ARG A CA  1 
ATOM 8700  C C   . ARG A 1 1141 ? 24.916  25.395  54.406  1.00 77.34  ? 1138 ARG A C   1 
ATOM 8701  O O   . ARG A 1 1141 ? 25.920  26.023  54.067  1.00 77.40  ? 1138 ARG A O   1 
ATOM 8702  C CB  . ARG A 1 1141 ? 25.216  23.902  52.375  1.00 77.32  ? 1138 ARG A CB  1 
ATOM 8703  C CG  . ARG A 1 1141 ? 25.500  22.459  51.957  1.00 77.64  ? 1138 ARG A CG  1 
ATOM 8704  C CD  . ARG A 1 1141 ? 25.971  22.352  50.508  1.00 77.68  ? 1138 ARG A CD  1 
ATOM 8705  N NE  . ARG A 1 1141 ? 24.894  22.581  49.543  1.00 78.74  ? 1138 ARG A NE  1 
ATOM 8706  C CZ  . ARG A 1 1141 ? 24.954  22.279  48.246  1.00 79.30  ? 1138 ARG A CZ  1 
ATOM 8707  N NH1 . ARG A 1 1141 ? 26.045  21.722  47.728  1.00 79.55  ? 1138 ARG A NH1 1 
ATOM 8708  N NH2 . ARG A 1 1141 ? 23.915  22.531  47.457  1.00 79.41  ? 1138 ARG A NH2 1 
ATOM 8709  N N   . ILE A 1 1142 ? 24.052  25.845  55.321  1.00 77.47  ? 1139 ILE A N   1 
ATOM 8710  C CA  . ILE A 1 1142 ? 24.379  26.993  56.185  1.00 77.70  ? 1139 ILE A CA  1 
ATOM 8711  C C   . ILE A 1 1142 ? 24.999  26.552  57.532  1.00 77.91  ? 1139 ILE A C   1 
ATOM 8712  O O   . ILE A 1 1142 ? 25.457  27.388  58.326  1.00 77.88  ? 1139 ILE A O   1 
ATOM 8713  C CB  . ILE A 1 1142 ? 23.175  27.940  56.448  1.00 77.62  ? 1139 ILE A CB  1 
ATOM 8714  C CG1 . ILE A 1 1142 ? 22.307  28.112  55.211  1.00 77.41  ? 1139 ILE A CG1 1 
ATOM 8715  C CG2 . ILE A 1 1142 ? 23.665  29.326  56.896  1.00 77.88  ? 1139 ILE A CG2 1 
ATOM 8716  C CD1 . ILE A 1 1142 ? 21.168  29.094  55.434  1.00 77.70  ? 1139 ILE A CD1 1 
ATOM 8717  N N   . HIS A 1 1143 ? 25.017  25.240  57.773  1.00 78.15  ? 1140 HIS A N   1 
ATOM 8718  C CA  . HIS A 1 1143 ? 25.591  24.662  58.995  1.00 78.37  ? 1140 HIS A CA  1 
ATOM 8719  C C   . HIS A 1 1143 ? 26.051  23.214  58.781  1.00 78.23  ? 1140 HIS A C   1 
ATOM 8720  O O   . HIS A 1 1143 ? 25.240  22.301  58.599  1.00 78.04  ? 1140 HIS A O   1 
ATOM 8721  C CB  . HIS A 1 1143 ? 24.589  24.742  60.151  1.00 78.60  ? 1140 HIS A CB  1 
ATOM 8722  C CG  . HIS A 1 1143 ? 23.270  24.106  59.842  1.00 79.16  ? 1140 HIS A CG  1 
ATOM 8723  N ND1 . HIS A 1 1143 ? 22.337  24.695  59.016  1.00 79.20  ? 1140 HIS A ND1 1 
ATOM 8724  C CD2 . HIS A 1 1143 ? 22.738  22.922  60.229  1.00 79.69  ? 1140 HIS A CD2 1 
ATOM 8725  C CE1 . HIS A 1 1143 ? 21.283  23.905  58.915  1.00 79.81  ? 1140 HIS A CE1 1 
ATOM 8726  N NE2 . HIS A 1 1143 ? 21.500  22.824  59.642  1.00 80.00  ? 1140 HIS A NE2 1 
ATOM 8727  N N   . MET B 1 4    ? -23.462 28.857  35.262  1.00 62.46  ? 1    MET B N   1 
ATOM 8728  C CA  . MET B 1 4    ? -22.342 29.289  36.159  1.00 62.44  ? 1    MET B CA  1 
ATOM 8729  C C   . MET B 1 4    ? -21.167 29.937  35.396  1.00 61.97  ? 1    MET B C   1 
ATOM 8730  O O   . MET B 1 4    ? -19.998 29.574  35.584  1.00 61.98  ? 1    MET B O   1 
ATOM 8731  C CB  . MET B 1 4    ? -21.890 28.139  37.088  1.00 62.42  ? 1    MET B CB  1 
ATOM 8732  C CG  . MET B 1 4    ? -21.768 26.761  36.431  1.00 62.71  ? 1    MET B CG  1 
ATOM 8733  S SD  . MET B 1 4    ? -21.925 25.406  37.628  1.00 63.28  ? 1    MET B SD  1 
ATOM 8734  C CE  . MET B 1 4    ? -21.589 23.956  36.615  1.00 62.73  ? 1    MET B CE  1 
ATOM 8735  N N   . SER B 1 5    ? -21.512 30.892  34.529  1.00 61.46  ? 2    SER B N   1 
ATOM 8736  C CA  . SER B 1 5    ? -20.558 31.803  33.886  1.00 60.80  ? 2    SER B CA  1 
ATOM 8737  C C   . SER B 1 5    ? -20.625 33.140  34.609  1.00 60.45  ? 2    SER B C   1 
ATOM 8738  O O   . SER B 1 5    ? -21.686 33.769  34.672  1.00 60.63  ? 2    SER B O   1 
ATOM 8739  C CB  . SER B 1 5    ? -20.902 31.999  32.400  1.00 60.84  ? 2    SER B CB  1 
ATOM 8740  O OG  . SER B 1 5    ? -20.512 33.283  31.917  1.00 59.98  ? 2    SER B OG  1 
ATOM 8741  N N   . TYR B 1 6    ? -19.503 33.578  35.162  1.00 59.70  ? 3    TYR B N   1 
ATOM 8742  C CA  . TYR B 1 6    ? -19.494 34.851  35.866  1.00 59.00  ? 3    TYR B CA  1 
ATOM 8743  C C   . TYR B 1 6    ? -18.482 35.795  35.213  1.00 58.13  ? 3    TYR B C   1 
ATOM 8744  O O   . TYR B 1 6    ? -17.280 35.675  35.437  1.00 58.01  ? 3    TYR B O   1 
ATOM 8745  C CB  . TYR B 1 6    ? -19.234 34.637  37.369  1.00 59.36  ? 3    TYR B CB  1 
ATOM 8746  C CG  . TYR B 1 6    ? -20.164 33.633  38.058  1.00 59.65  ? 3    TYR B CG  1 
ATOM 8747  C CD1 . TYR B 1 6    ? -21.561 33.797  38.050  1.00 60.01  ? 3    TYR B CD1 1 
ATOM 8748  C CD2 . TYR B 1 6    ? -19.642 32.531  38.737  1.00 60.20  ? 3    TYR B CD2 1 
ATOM 8749  C CE1 . TYR B 1 6    ? -22.413 32.871  38.696  1.00 60.12  ? 3    TYR B CE1 1 
ATOM 8750  C CE2 . TYR B 1 6    ? -20.482 31.601  39.382  1.00 60.52  ? 3    TYR B CE2 1 
ATOM 8751  C CZ  . TYR B 1 6    ? -21.861 31.776  39.363  1.00 60.14  ? 3    TYR B CZ  1 
ATOM 8752  O OH  . TYR B 1 6    ? -22.665 30.853  40.009  1.00 59.52  ? 3    TYR B OH  1 
ATOM 8753  N N   . ASN B 1 7    ? -18.982 36.719  34.392  1.00 57.06  ? 4    ASN B N   1 
ATOM 8754  C CA  . ASN B 1 7    ? -18.125 37.493  33.482  1.00 56.07  ? 4    ASN B CA  1 
ATOM 8755  C C   . ASN B 1 7    ? -18.259 39.001  33.511  1.00 55.44  ? 4    ASN B C   1 
ATOM 8756  O O   . ASN B 1 7    ? -19.328 39.556  33.769  1.00 55.47  ? 4    ASN B O   1 
ATOM 8757  C CB  . ASN B 1 7    ? -18.281 37.014  32.043  1.00 55.95  ? 4    ASN B CB  1 
ATOM 8758  C CG  . ASN B 1 7    ? -17.613 35.699  31.810  1.00 55.69  ? 4    ASN B CG  1 
ATOM 8759  O OD1 . ASN B 1 7    ? -16.395 35.579  31.940  1.00 55.12  ? 4    ASN B OD1 1 
ATOM 8760  N ND2 . ASN B 1 7    ? -18.404 34.689  31.472  1.00 55.90  ? 4    ASN B ND2 1 
ATOM 8761  N N   . TYR B 1 8    ? -17.147 39.649  33.195  1.00 54.49  ? 5    TYR B N   1 
ATOM 8762  C CA  . TYR B 1 8    ? -17.006 41.070  33.368  1.00 53.70  ? 5    TYR B CA  1 
ATOM 8763  C C   . TYR B 1 8    ? -16.380 41.661  32.120  1.00 53.28  ? 5    TYR B C   1 
ATOM 8764  O O   . TYR B 1 8    ? -15.432 41.100  31.585  1.00 53.48  ? 5    TYR B O   1 
ATOM 8765  C CB  . TYR B 1 8    ? -16.123 41.335  34.583  1.00 53.30  ? 5    TYR B CB  1 
ATOM 8766  C CG  . TYR B 1 8    ? -16.063 42.781  34.998  1.00 53.24  ? 5    TYR B CG  1 
ATOM 8767  C CD1 . TYR B 1 8    ? -17.137 43.385  35.641  1.00 53.29  ? 5    TYR B CD1 1 
ATOM 8768  C CD2 . TYR B 1 8    ? -14.927 43.548  34.758  1.00 52.98  ? 5    TYR B CD2 1 
ATOM 8769  C CE1 . TYR B 1 8    ? -17.081 44.719  36.026  1.00 53.12  ? 5    TYR B CE1 1 
ATOM 8770  C CE2 . TYR B 1 8    ? -14.866 44.875  35.147  1.00 52.59  ? 5    TYR B CE2 1 
ATOM 8771  C CZ  . TYR B 1 8    ? -15.944 45.454  35.776  1.00 52.51  ? 5    TYR B CZ  1 
ATOM 8772  O OH  . TYR B 1 8    ? -15.892 46.768  36.164  1.00 52.38  ? 5    TYR B OH  1 
ATOM 8773  N N   . VAL B 1 9    ? -16.917 42.783  31.654  1.00 52.64  ? 6    VAL B N   1 
ATOM 8774  C CA  . VAL B 1 9    ? -16.346 43.478  30.506  1.00 52.24  ? 6    VAL B CA  1 
ATOM 8775  C C   . VAL B 1 9    ? -16.102 44.950  30.800  1.00 52.01  ? 6    VAL B C   1 
ATOM 8776  O O   . VAL B 1 9    ? -16.865 45.567  31.540  1.00 52.21  ? 6    VAL B O   1 
ATOM 8777  C CB  . VAL B 1 9    ? -17.214 43.337  29.252  1.00 52.24  ? 6    VAL B CB  1 
ATOM 8778  C CG1 . VAL B 1 9    ? -16.933 42.015  28.568  1.00 52.53  ? 6    VAL B CG1 1 
ATOM 8779  C CG2 . VAL B 1 9    ? -18.684 43.467  29.601  1.00 52.17  ? 6    VAL B CG2 1 
ATOM 8780  N N   . VAL B 1 10   ? -15.024 45.491  30.228  1.00 51.48  ? 7    VAL B N   1 
ATOM 8781  C CA  . VAL B 1 10   ? -14.643 46.886  30.390  1.00 50.98  ? 7    VAL B CA  1 
ATOM 8782  C C   . VAL B 1 10   ? -14.012 47.439  29.128  1.00 51.12  ? 7    VAL B C   1 
ATOM 8783  O O   . VAL B 1 10   ? -13.098 46.844  28.564  1.00 51.33  ? 7    VAL B O   1 
ATOM 8784  C CB  . VAL B 1 10   ? -13.612 47.069  31.492  1.00 50.71  ? 7    VAL B CB  1 
ATOM 8785  C CG1 . VAL B 1 10   ? -13.130 48.507  31.521  1.00 50.89  ? 7    VAL B CG1 1 
ATOM 8786  C CG2 . VAL B 1 10   ? -14.195 46.712  32.818  1.00 51.11  ? 7    VAL B CG2 1 
ATOM 8787  N N   . THR B 1 11   ? -14.501 48.598  28.704  1.00 51.28  ? 8    THR B N   1 
ATOM 8788  C CA  . THR B 1 11   ? -13.872 49.401  27.660  1.00 51.17  ? 8    THR B CA  1 
ATOM 8789  C C   . THR B 1 11   ? -12.568 50.028  28.177  1.00 51.18  ? 8    THR B C   1 
ATOM 8790  O O   . THR B 1 11   ? -12.593 51.027  28.897  1.00 51.05  ? 8    THR B O   1 
ATOM 8791  C CB  . THR B 1 11   ? -14.854 50.502  27.188  1.00 51.14  ? 8    THR B CB  1 
ATOM 8792  O OG1 . THR B 1 11   ? -16.062 49.883  26.723  1.00 51.12  ? 8    THR B OG1 1 
ATOM 8793  C CG2 . THR B 1 11   ? -14.257 51.375  26.085  1.00 50.91  ? 8    THR B CG2 1 
ATOM 8794  N N   . ALA B 1 12   ? -11.440 49.421  27.806  1.00 51.34  ? 9    ALA B N   1 
ATOM 8795  C CA  . ALA B 1 12   ? -10.099 49.907  28.162  1.00 51.67  ? 9    ALA B CA  1 
ATOM 8796  C C   . ALA B 1 12   ? -9.628  51.127  27.327  1.00 52.09  ? 9    ALA B C   1 
ATOM 8797  O O   . ALA B 1 12   ? -8.575  51.716  27.598  1.00 52.00  ? 9    ALA B O   1 
ATOM 8798  C CB  . ALA B 1 12   ? -9.087  48.760  28.073  1.00 51.33  ? 9    ALA B CB  1 
ATOM 8799  N N   . GLN B 1 13   ? -10.422 51.494  26.322  1.00 52.67  ? 10   GLN B N   1 
ATOM 8800  C CA  . GLN B 1 13   ? -10.166 52.635  25.434  1.00 53.04  ? 10   GLN B CA  1 
ATOM 8801  C C   . GLN B 1 13   ? -11.349 52.707  24.482  1.00 53.45  ? 10   GLN B C   1 
ATOM 8802  O O   . GLN B 1 13   ? -11.640 51.722  23.798  1.00 53.57  ? 10   GLN B O   1 
ATOM 8803  C CB  . GLN B 1 13   ? -8.865  52.431  24.649  1.00 53.02  ? 10   GLN B CB  1 
ATOM 8804  C CG  . GLN B 1 13   ? -8.769  53.174  23.320  1.00 52.44  ? 10   GLN B CG  1 
ATOM 8805  C CD  . GLN B 1 13   ? -8.400  54.631  23.474  1.00 51.44  ? 10   GLN B CD  1 
ATOM 8806  O OE1 . GLN B 1 13   ? -7.238  54.971  23.711  1.00 51.03  ? 10   GLN B OE1 1 
ATOM 8807  N NE2 . GLN B 1 13   ? -9.386  55.506  23.312  1.00 50.87  ? 10   GLN B NE2 1 
ATOM 8808  N N   . LYS B 1 14   ? -12.017 53.862  24.444  1.00 53.79  ? 11   LYS B N   1 
ATOM 8809  C CA  . LYS B 1 14   ? -13.229 54.067  23.633  1.00 54.34  ? 11   LYS B CA  1 
ATOM 8810  C C   . LYS B 1 14   ? -12.964 53.968  22.120  1.00 54.45  ? 11   LYS B C   1 
ATOM 8811  O O   . LYS B 1 14   ? -11.814 54.013  21.695  1.00 54.60  ? 11   LYS B O   1 
ATOM 8812  C CB  . LYS B 1 14   ? -13.851 55.426  23.956  1.00 54.55  ? 11   LYS B CB  1 
ATOM 8813  C CG  . LYS B 1 14   ? -14.121 55.669  25.430  1.00 55.68  ? 11   LYS B CG  1 
ATOM 8814  C CD  . LYS B 1 14   ? -14.488 57.124  25.676  1.00 57.74  ? 11   LYS B CD  1 
ATOM 8815  C CE  . LYS B 1 14   ? -14.365 57.492  27.153  1.00 59.56  ? 11   LYS B CE  1 
ATOM 8816  N NZ  . LYS B 1 14   ? -14.758 58.918  27.431  1.00 60.31  ? 11   LYS B NZ  1 
ATOM 8817  N N   . PRO B 1 15   ? -14.022 53.824  21.298  1.00 54.61  ? 12   PRO B N   1 
ATOM 8818  C CA  . PRO B 1 15   ? -13.805 53.814  19.848  1.00 54.90  ? 12   PRO B CA  1 
ATOM 8819  C C   . PRO B 1 15   ? -13.216 55.140  19.331  1.00 55.39  ? 12   PRO B C   1 
ATOM 8820  O O   . PRO B 1 15   ? -13.764 56.219  19.610  1.00 55.77  ? 12   PRO B O   1 
ATOM 8821  C CB  . PRO B 1 15   ? -15.217 53.604  19.283  1.00 54.84  ? 12   PRO B CB  1 
ATOM 8822  C CG  . PRO B 1 15   ? -16.142 54.029  20.379  1.00 54.75  ? 12   PRO B CG  1 
ATOM 8823  C CD  . PRO B 1 15   ? -15.447 53.655  21.641  1.00 54.63  ? 12   PRO B CD  1 
ATOM 8824  N N   . THR B 1 16   ? -12.101 55.064  18.605  1.00 55.46  ? 13   THR B N   1 
ATOM 8825  C CA  . THR B 1 16   ? -11.486 56.265  18.031  1.00 55.50  ? 13   THR B CA  1 
ATOM 8826  C C   . THR B 1 16   ? -11.860 56.470  16.561  1.00 55.72  ? 13   THR B C   1 
ATOM 8827  O O   . THR B 1 16   ? -11.380 57.401  15.911  1.00 55.98  ? 13   THR B O   1 
ATOM 8828  C CB  . THR B 1 16   ? -9.944  56.306  18.224  1.00 55.42  ? 13   THR B CB  1 
ATOM 8829  O OG1 . THR B 1 16   ? -9.452  55.009  18.578  1.00 55.53  ? 13   THR B OG1 1 
ATOM 8830  C CG2 . THR B 1 16   ? -9.574  57.272  19.323  1.00 55.43  ? 13   THR B CG2 1 
ATOM 8831  N N   . ALA B 1 17   ? -12.717 55.598  16.039  1.00 55.82  ? 14   ALA B N   1 
ATOM 8832  C CA  . ALA B 1 17   ? -13.220 55.753  14.681  1.00 55.88  ? 14   ALA B CA  1 
ATOM 8833  C C   . ALA B 1 17   ? -14.312 56.801  14.668  1.00 55.90  ? 14   ALA B C   1 
ATOM 8834  O O   . ALA B 1 17   ? -15.202 56.785  15.509  1.00 56.02  ? 14   ALA B O   1 
ATOM 8835  C CB  . ALA B 1 17   ? -13.765 54.445  14.172  1.00 56.17  ? 14   ALA B CB  1 
ATOM 8836  N N   . VAL B 1 18   ? -14.237 57.719  13.719  1.00 55.96  ? 15   VAL B N   1 
ATOM 8837  C CA  . VAL B 1 18   ? -15.289 58.701  13.543  1.00 56.08  ? 15   VAL B CA  1 
ATOM 8838  C C   . VAL B 1 18   ? -16.251 58.099  12.549  1.00 56.08  ? 15   VAL B C   1 
ATOM 8839  O O   . VAL B 1 18   ? -15.866 57.744  11.436  1.00 55.73  ? 15   VAL B O   1 
ATOM 8840  C CB  . VAL B 1 18   ? -14.735 60.072  13.060  1.00 56.33  ? 15   VAL B CB  1 
ATOM 8841  C CG1 . VAL B 1 18   ? -15.864 61.032  12.634  1.00 56.48  ? 15   VAL B CG1 1 
ATOM 8842  C CG2 . VAL B 1 18   ? -13.881 60.709  14.149  1.00 56.20  ? 15   VAL B CG2 1 
ATOM 8843  N N   . ASN B 1 19   ? -17.496 57.956  12.984  1.00 56.57  ? 16   ASN B N   1 
ATOM 8844  C CA  . ASN B 1 19   ? -18.541 57.322  12.192  1.00 57.33  ? 16   ASN B CA  1 
ATOM 8845  C C   . ASN B 1 19   ? -19.526 58.357  11.661  1.00 57.52  ? 16   ASN B C   1 
ATOM 8846  O O   . ASN B 1 19   ? -20.330 58.058  10.777  1.00 57.75  ? 16   ASN B O   1 
ATOM 8847  C CB  . ASN B 1 19   ? -19.281 56.245  13.013  1.00 57.56  ? 16   ASN B CB  1 
ATOM 8848  C CG  . ASN B 1 19   ? -18.382 55.035  13.404  1.00 58.59  ? 16   ASN B CG  1 
ATOM 8849  O OD1 . ASN B 1 19   ? -17.489 54.612  12.650  1.00 59.35  ? 16   ASN B OD1 1 
ATOM 8850  N ND2 . ASN B 1 19   ? -18.652 54.460  14.583  1.00 58.88  ? 16   ASN B ND2 1 
ATOM 8851  N N   . GLY B 1 20   ? -19.454 59.568  12.211  1.00 57.78  ? 17   GLY B N   1 
ATOM 8852  C CA  . GLY B 1 20   ? -20.248 60.709  11.755  1.00 58.13  ? 17   GLY B CA  1 
ATOM 8853  C C   . GLY B 1 20   ? -19.766 62.024  12.352  1.00 58.51  ? 17   GLY B C   1 
ATOM 8854  O O   . GLY B 1 20   ? -19.059 62.049  13.360  1.00 58.74  ? 17   GLY B O   1 
ATOM 8855  N N   . CYS B 1 21   ? -20.135 63.130  11.720  1.00 58.66  ? 18   CYS B N   1 
ATOM 8856  C CA  . CYS B 1 21   ? -19.914 64.459  12.299  1.00 59.02  ? 18   CYS B CA  1 
ATOM 8857  C C   . CYS B 1 21   ? -20.845 65.459  11.641  1.00 58.61  ? 18   CYS B C   1 
ATOM 8858  O O   . CYS B 1 21   ? -21.421 65.170  10.596  1.00 58.69  ? 18   CYS B O   1 
ATOM 8859  C CB  . CYS B 1 21   ? -18.434 64.903  12.272  1.00 59.41  ? 18   CYS B CB  1 
ATOM 8860  S SG  . CYS B 1 21   ? -17.554 65.055  10.666  1.00 61.92  ? 18   CYS B SG  1 
ATOM 8861  N N   . VAL B 1 22   ? -21.023 66.611  12.280  1.00 58.35  ? 19   VAL B N   1 
ATOM 8862  C CA  . VAL B 1 22   ? -22.021 67.588  11.861  1.00 58.11  ? 19   VAL B CA  1 
ATOM 8863  C C   . VAL B 1 22   ? -21.771 68.928  12.546  1.00 58.22  ? 19   VAL B C   1 
ATOM 8864  O O   . VAL B 1 22   ? -21.271 68.980  13.675  1.00 58.21  ? 19   VAL B O   1 
ATOM 8865  C CB  . VAL B 1 22   ? -23.461 67.077  12.140  1.00 57.93  ? 19   VAL B CB  1 
ATOM 8866  C CG1 . VAL B 1 22   ? -23.815 67.192  13.613  1.00 57.87  ? 19   VAL B CG1 1 
ATOM 8867  C CG2 . VAL B 1 22   ? -24.467 67.808  11.283  1.00 58.06  ? 19   VAL B CG2 1 
ATOM 8868  N N   . THR B 1 23   ? -22.113 70.004  11.842  1.00 58.39  ? 20   THR B N   1 
ATOM 8869  C CA  . THR B 1 23   ? -21.903 71.374  12.315  1.00 58.54  ? 20   THR B CA  1 
ATOM 8870  C C   . THR B 1 23   ? -23.234 72.141  12.499  1.00 58.62  ? 20   THR B C   1 
ATOM 8871  O O   . THR B 1 23   ? -24.281 71.737  11.972  1.00 58.49  ? 20   THR B O   1 
ATOM 8872  C CB  . THR B 1 23   ? -20.884 72.158  11.407  1.00 58.51  ? 20   THR B CB  1 
ATOM 8873  O OG1 . THR B 1 23   ? -20.926 73.556  11.715  1.00 58.74  ? 20   THR B OG1 1 
ATOM 8874  C CG2 . THR B 1 23   ? -21.182 71.967  9.914   1.00 58.65  ? 20   THR B CG2 1 
ATOM 8875  N N   . GLY B 1 24   ? -23.180 73.235  13.259  1.00 58.76  ? 21   GLY B N   1 
ATOM 8876  C CA  . GLY B 1 24   ? -24.364 74.031  13.603  1.00 58.80  ? 21   GLY B CA  1 
ATOM 8877  C C   . GLY B 1 24   ? -24.246 74.692  14.971  1.00 58.83  ? 21   GLY B C   1 
ATOM 8878  O O   . GLY B 1 24   ? -23.163 74.715  15.567  1.00 58.89  ? 21   GLY B O   1 
ATOM 8879  N N   . HIS B 1 25   ? -25.362 75.221  15.475  1.00 58.71  ? 22   HIS B N   1 
ATOM 8880  C CA  . HIS B 1 25   ? -25.360 75.993  16.722  1.00 58.55  ? 22   HIS B CA  1 
ATOM 8881  C C   . HIS B 1 25   ? -26.133 75.244  17.810  1.00 58.38  ? 22   HIS B C   1 
ATOM 8882  O O   . HIS B 1 25   ? -27.359 75.320  17.897  1.00 58.41  ? 22   HIS B O   1 
ATOM 8883  C CB  . HIS B 1 25   ? -25.912 77.408  16.484  1.00 58.55  ? 22   HIS B CB  1 
ATOM 8884  C CG  . HIS B 1 25   ? -25.449 78.028  15.200  1.00 58.64  ? 22   HIS B CG  1 
ATOM 8885  N ND1 . HIS B 1 25   ? -26.010 77.720  13.979  1.00 59.18  ? 22   HIS B ND1 1 
ATOM 8886  C CD2 . HIS B 1 25   ? -24.475 78.933  14.944  1.00 58.82  ? 22   HIS B CD2 1 
ATOM 8887  C CE1 . HIS B 1 25   ? -25.400 78.404  13.027  1.00 59.12  ? 22   HIS B CE1 1 
ATOM 8888  N NE2 . HIS B 1 25   ? -24.462 79.146  13.586  1.00 59.03  ? 22   HIS B NE2 1 
ATOM 8889  N N   . PHE B 1 26   ? -25.393 74.508  18.630  1.00 58.13  ? 23   PHE B N   1 
ATOM 8890  C CA  . PHE B 1 26   ? -25.973 73.555  19.564  1.00 58.04  ? 23   PHE B CA  1 
ATOM 8891  C C   . PHE B 1 26   ? -25.761 74.027  20.993  1.00 58.18  ? 23   PHE B C   1 
ATOM 8892  O O   . PHE B 1 26   ? -26.676 73.965  21.819  1.00 58.23  ? 23   PHE B O   1 
ATOM 8893  C CB  . PHE B 1 26   ? -25.341 72.171  19.348  1.00 57.91  ? 23   PHE B CB  1 
ATOM 8894  C CG  . PHE B 1 26   ? -25.950 71.076  20.183  1.00 57.54  ? 23   PHE B CG  1 
ATOM 8895  C CD1 . PHE B 1 26   ? -27.081 70.408  19.755  1.00 57.18  ? 23   PHE B CD1 1 
ATOM 8896  C CD2 . PHE B 1 26   ? -25.378 70.702  21.392  1.00 57.35  ? 23   PHE B CD2 1 
ATOM 8897  C CE1 . PHE B 1 26   ? -27.639 69.405  20.523  1.00 57.06  ? 23   PHE B CE1 1 
ATOM 8898  C CE2 . PHE B 1 26   ? -25.937 69.695  22.166  1.00 56.46  ? 23   PHE B CE2 1 
ATOM 8899  C CZ  . PHE B 1 26   ? -27.066 69.050  21.730  1.00 56.87  ? 23   PHE B CZ  1 
ATOM 8900  N N   . THR B 1 27   ? -24.541 74.486  21.267  1.00 58.32  ? 24   THR B N   1 
ATOM 8901  C CA  . THR B 1 27   ? -24.162 75.045  22.561  1.00 58.47  ? 24   THR B CA  1 
ATOM 8902  C C   . THR B 1 27   ? -24.921 76.359  22.800  1.00 58.63  ? 24   THR B C   1 
ATOM 8903  O O   . THR B 1 27   ? -25.840 76.419  23.618  1.00 58.60  ? 24   THR B O   1 
ATOM 8904  C CB  . THR B 1 27   ? -22.629 75.293  22.617  1.00 58.39  ? 24   THR B CB  1 
ATOM 8905  O OG1 . THR B 1 27   ? -21.935 74.131  22.155  1.00 58.12  ? 24   THR B OG1 1 
ATOM 8906  C CG2 . THR B 1 27   ? -22.164 75.622  24.031  1.00 58.81  ? 24   THR B CG2 1 
ATOM 8907  N N   . SER B 1 28   ? -24.534 77.398  22.065  1.00 58.88  ? 25   SER B N   1 
ATOM 8908  C CA  . SER B 1 28   ? -25.158 78.713  22.161  1.00 59.05  ? 25   SER B CA  1 
ATOM 8909  C C   . SER B 1 28   ? -25.894 79.051  20.863  1.00 59.03  ? 25   SER B C   1 
ATOM 8910  O O   . SER B 1 28   ? -25.521 78.563  19.784  1.00 59.08  ? 25   SER B O   1 
ATOM 8911  C CB  . SER B 1 28   ? -24.100 79.784  22.454  1.00 59.12  ? 25   SER B CB  1 
ATOM 8912  O OG  . SER B 1 28   ? -23.185 79.351  23.453  1.00 59.54  ? 25   SER B OG  1 
ATOM 8913  N N   . ALA B 1 29   ? -26.933 79.885  20.980  1.00 58.87  ? 26   ALA B N   1 
ATOM 8914  C CA  . ALA B 1 29   ? -27.710 80.368  19.831  1.00 58.66  ? 26   ALA B CA  1 
ATOM 8915  C C   . ALA B 1 29   ? -26.785 80.880  18.721  1.00 58.52  ? 26   ALA B C   1 
ATOM 8916  O O   . ALA B 1 29   ? -27.021 80.648  17.529  1.00 58.51  ? 26   ALA B O   1 
ATOM 8917  C CB  . ALA B 1 29   ? -28.681 81.456  20.274  1.00 58.67  ? 26   ALA B CB  1 
ATOM 8918  N N   . GLU B 1 30   ? -25.733 81.577  19.140  1.00 58.20  ? 27   GLU B N   1 
ATOM 8919  C CA  . GLU B 1 30   ? -24.621 81.929  18.277  1.00 57.93  ? 27   GLU B CA  1 
ATOM 8920  C C   . GLU B 1 30   ? -23.382 81.202  18.771  1.00 57.45  ? 27   GLU B C   1 
ATOM 8921  O O   . GLU B 1 30   ? -22.886 81.465  19.863  1.00 57.30  ? 27   GLU B O   1 
ATOM 8922  C CB  . GLU B 1 30   ? -24.389 83.449  18.230  1.00 58.18  ? 27   GLU B CB  1 
ATOM 8923  C CG  . GLU B 1 30   ? -25.094 84.279  19.318  1.00 59.09  ? 27   GLU B CG  1 
ATOM 8924  C CD  . GLU B 1 30   ? -24.633 83.965  20.741  1.00 60.23  ? 27   GLU B CD  1 
ATOM 8925  O OE1 . GLU B 1 30   ? -25.512 83.839  21.628  1.00 60.49  ? 27   GLU B OE1 1 
ATOM 8926  O OE2 . GLU B 1 30   ? -23.404 83.848  20.973  1.00 60.36  ? 27   GLU B OE2 1 
ATOM 8927  N N   . ASP B 1 31   ? -22.922 80.260  17.953  1.00 57.01  ? 28   ASP B N   1 
ATOM 8928  C CA  . ASP B 1 31   ? -21.727 79.446  18.201  1.00 56.43  ? 28   ASP B CA  1 
ATOM 8929  C C   . ASP B 1 31   ? -21.436 78.598  16.957  1.00 56.00  ? 28   ASP B C   1 
ATOM 8930  O O   . ASP B 1 31   ? -22.309 78.413  16.108  1.00 56.03  ? 28   ASP B O   1 
ATOM 8931  C CB  . ASP B 1 31   ? -21.932 78.524  19.414  1.00 56.42  ? 28   ASP B CB  1 
ATOM 8932  C CG  . ASP B 1 31   ? -21.162 78.980  20.644  1.00 56.48  ? 28   ASP B CG  1 
ATOM 8933  O OD1 . ASP B 1 31   ? -20.479 80.024  20.571  1.00 57.17  ? 28   ASP B OD1 1 
ATOM 8934  O OD2 . ASP B 1 31   ? -21.229 78.286  21.686  1.00 56.20  ? 28   ASP B OD2 1 
ATOM 8935  N N   . LEU B 1 32   ? -20.216 78.089  16.834  1.00 55.29  ? 29   LEU B N   1 
ATOM 8936  C CA  . LEU B 1 32   ? -19.965 77.049  15.843  1.00 54.66  ? 29   LEU B CA  1 
ATOM 8937  C C   . LEU B 1 32   ? -19.555 75.776  16.566  1.00 54.40  ? 29   LEU B C   1 
ATOM 8938  O O   . LEU B 1 32   ? -18.661 75.788  17.421  1.00 54.48  ? 29   LEU B O   1 
ATOM 8939  C CB  . LEU B 1 32   ? -18.923 77.472  14.805  1.00 54.56  ? 29   LEU B CB  1 
ATOM 8940  C CG  . LEU B 1 32   ? -19.040 76.798  13.433  1.00 54.00  ? 29   LEU B CG  1 
ATOM 8941  C CD1 . LEU B 1 32   ? -20.233 77.321  12.662  1.00 53.71  ? 29   LEU B CD1 1 
ATOM 8942  C CD2 . LEU B 1 32   ? -17.785 77.007  12.620  1.00 54.13  ? 29   LEU B CD2 1 
ATOM 8943  N N   . ASN B 1 33   ? -20.239 74.686  16.240  1.00 53.77  ? 30   ASN B N   1 
ATOM 8944  C CA  . ASN B 1 33   ? -20.047 73.429  16.939  1.00 53.10  ? 30   ASN B CA  1 
ATOM 8945  C C   . ASN B 1 33   ? -19.659 72.333  15.985  1.00 52.60  ? 30   ASN B C   1 
ATOM 8946  O O   . ASN B 1 33   ? -20.123 72.298  14.843  1.00 52.71  ? 30   ASN B O   1 
ATOM 8947  C CB  . ASN B 1 33   ? -21.317 73.025  17.695  1.00 53.11  ? 30   ASN B CB  1 
ATOM 8948  C CG  . ASN B 1 33   ? -21.668 73.997  18.806  1.00 53.12  ? 30   ASN B CG  1 
ATOM 8949  O OD1 . ASN B 1 33   ? -20.926 74.141  19.778  1.00 53.41  ? 30   ASN B OD1 1 
ATOM 8950  N ND2 . ASN B 1 33   ? -22.804 74.671  18.667  1.00 52.28  ? 30   ASN B ND2 1 
ATOM 8951  N N   . LEU B 1 34   ? -18.781 71.456  16.454  1.00 51.78  ? 31   LEU B N   1 
ATOM 8952  C CA  . LEU B 1 34   ? -18.513 70.213  15.770  1.00 50.85  ? 31   LEU B CA  1 
ATOM 8953  C C   . LEU B 1 34   ? -19.066 69.117  16.646  1.00 50.51  ? 31   LEU B C   1 
ATOM 8954  O O   . LEU B 1 34   ? -18.725 69.025  17.831  1.00 50.67  ? 31   LEU B O   1 
ATOM 8955  C CB  . LEU B 1 34   ? -17.020 70.012  15.535  1.00 50.56  ? 31   LEU B CB  1 
ATOM 8956  C CG  . LEU B 1 34   ? -16.704 68.847  14.595  1.00 50.40  ? 31   LEU B CG  1 
ATOM 8957  C CD1 . LEU B 1 34   ? -17.352 69.014  13.217  1.00 49.92  ? 31   LEU B CD1 1 
ATOM 8958  C CD2 . LEU B 1 34   ? -15.213 68.669  14.462  1.00 50.67  ? 31   LEU B CD2 1 
ATOM 8959  N N   . LEU B 1 35   ? -19.949 68.309  16.074  1.00 49.86  ? 32   LEU B N   1 
ATOM 8960  C CA  . LEU B 1 35   ? -20.502 67.184  16.797  1.00 49.33  ? 32   LEU B CA  1 
ATOM 8961  C C   . LEU B 1 35   ? -19.993 65.889  16.204  1.00 49.19  ? 32   LEU B C   1 
ATOM 8962  O O   . LEU B 1 35   ? -20.570 65.363  15.259  1.00 49.44  ? 32   LEU B O   1 
ATOM 8963  C CB  . LEU B 1 35   ? -22.025 67.234  16.786  1.00 49.11  ? 32   LEU B CB  1 
ATOM 8964  C CG  . LEU B 1 35   ? -22.675 67.801  18.048  1.00 48.96  ? 32   LEU B CG  1 
ATOM 8965  C CD1 . LEU B 1 35   ? -22.179 69.205  18.403  1.00 49.00  ? 32   LEU B CD1 1 
ATOM 8966  C CD2 . LEU B 1 35   ? -24.176 67.806  17.874  1.00 49.16  ? 32   LEU B CD2 1 
ATOM 8967  N N   . ILE B 1 36   ? -18.894 65.385  16.751  1.00 48.79  ? 33   ILE B N   1 
ATOM 8968  C CA  . ILE B 1 36   ? -18.352 64.112  16.307  1.00 48.42  ? 33   ILE B CA  1 
ATOM 8969  C C   . ILE B 1 36   ? -19.093 62.974  17.013  1.00 48.55  ? 33   ILE B C   1 
ATOM 8970  O O   . ILE B 1 36   ? -19.169 62.935  18.251  1.00 48.56  ? 33   ILE B O   1 
ATOM 8971  C CB  . ILE B 1 36   ? -16.829 64.013  16.582  1.00 48.44  ? 33   ILE B CB  1 
ATOM 8972  C CG1 . ILE B 1 36   ? -16.089 65.187  15.928  1.00 48.14  ? 33   ILE B CG1 1 
ATOM 8973  C CG2 . ILE B 1 36   ? -16.278 62.665  16.104  1.00 48.00  ? 33   ILE B CG2 1 
ATOM 8974  C CD1 . ILE B 1 36   ? -14.608 65.257  16.239  1.00 48.06  ? 33   ILE B CD1 1 
ATOM 8975  N N   . ALA B 1 37   ? -19.666 62.071  16.222  1.00 48.39  ? 34   ALA B N   1 
ATOM 8976  C CA  . ALA B 1 37   ? -20.183 60.815  16.754  1.00 48.37  ? 34   ALA B CA  1 
ATOM 8977  C C   . ALA B 1 37   ? -19.153 59.730  16.494  1.00 48.44  ? 34   ALA B C   1 
ATOM 8978  O O   . ALA B 1 37   ? -18.824 59.452  15.341  1.00 48.64  ? 34   ALA B O   1 
ATOM 8979  C CB  . ALA B 1 37   ? -21.507 60.445  16.094  1.00 48.15  ? 34   ALA B CB  1 
ATOM 8980  N N   . LYS B 1 38   ? -18.627 59.117  17.547  1.00 48.43  ? 35   LYS B N   1 
ATOM 8981  C CA  . LYS B 1 38   ? -17.851 57.897  17.347  1.00 48.53  ? 35   LYS B CA  1 
ATOM 8982  C C   . LYS B 1 38   ? -18.819 56.706  17.164  1.00 48.70  ? 35   LYS B C   1 
ATOM 8983  O O   . LYS B 1 38   ? -19.503 56.608  16.137  1.00 48.92  ? 35   LYS B O   1 
ATOM 8984  C CB  . LYS B 1 38   ? -16.832 57.683  18.466  1.00 48.44  ? 35   LYS B CB  1 
ATOM 8985  C CG  . LYS B 1 38   ? -15.982 58.917  18.757  1.00 48.58  ? 35   LYS B CG  1 
ATOM 8986  C CD  . LYS B 1 38   ? -14.682 58.929  17.984  1.00 49.16  ? 35   LYS B CD  1 
ATOM 8987  C CE  . LYS B 1 38   ? -14.098 60.343  17.899  1.00 49.90  ? 35   LYS B CE  1 
ATOM 8988  N NZ  . LYS B 1 38   ? -13.510 60.864  19.166  1.00 49.08  ? 35   LYS B NZ  1 
ATOM 8989  N N   . ASN B 1 39   ? -18.908 55.806  18.131  1.00 48.58  ? 36   ASN B N   1 
ATOM 8990  C CA  . ASN B 1 39   ? -19.819 54.687  17.967  1.00 48.56  ? 36   ASN B CA  1 
ATOM 8991  C C   . ASN B 1 39   ? -20.976 54.847  18.926  1.00 48.68  ? 36   ASN B C   1 
ATOM 8992  O O   . ASN B 1 39   ? -22.127 54.990  18.515  1.00 48.52  ? 36   ASN B O   1 
ATOM 8993  C CB  . ASN B 1 39   ? -19.075 53.369  18.189  1.00 48.61  ? 36   ASN B CB  1 
ATOM 8994  C CG  . ASN B 1 39   ? -19.970 52.153  18.058  1.00 48.70  ? 36   ASN B CG  1 
ATOM 8995  O OD1 . ASN B 1 39   ? -21.126 52.246  17.650  1.00 48.49  ? 36   ASN B OD1 1 
ATOM 8996  N ND2 . ASN B 1 39   ? -19.429 50.997  18.407  1.00 48.95  ? 36   ASN B ND2 1 
ATOM 8997  N N   . THR B 1 40   ? -20.633 54.833  20.210  1.00 49.15  ? 37   THR B N   1 
ATOM 8998  C CA  . THR B 1 40   ? -21.559 55.029  21.318  1.00 49.26  ? 37   THR B CA  1 
ATOM 8999  C C   . THR B 1 40   ? -21.196 56.317  22.048  1.00 49.67  ? 37   THR B C   1 
ATOM 9000  O O   . THR B 1 40   ? -21.783 56.628  23.086  1.00 49.87  ? 37   THR B O   1 
ATOM 9001  C CB  . THR B 1 40   ? -21.461 53.877  22.309  1.00 49.04  ? 37   THR B CB  1 
ATOM 9002  O OG1 . THR B 1 40   ? -20.086 53.499  22.449  1.00 48.89  ? 37   THR B OG1 1 
ATOM 9003  C CG2 . THR B 1 40   ? -22.241 52.690  21.809  1.00 48.69  ? 37   THR B CG2 1 
ATOM 9004  N N   . ARG B 1 41   ? -20.223 57.051  21.501  1.00 49.92  ? 38   ARG B N   1 
ATOM 9005  C CA  . ARG B 1 41   ? -19.779 58.323  22.068  1.00 50.29  ? 38   ARG B CA  1 
ATOM 9006  C C   . ARG B 1 41   ? -20.264 59.544  21.303  1.00 50.57  ? 38   ARG B C   1 
ATOM 9007  O O   . ARG B 1 41   ? -20.312 59.539  20.074  1.00 50.56  ? 38   ARG B O   1 
ATOM 9008  C CB  . ARG B 1 41   ? -18.253 58.367  22.137  1.00 50.34  ? 38   ARG B CB  1 
ATOM 9009  C CG  . ARG B 1 41   ? -17.632 57.646  23.322  1.00 50.57  ? 38   ARG B CG  1 
ATOM 9010  C CD  . ARG B 1 41   ? -18.524 57.739  24.540  1.00 50.04  ? 38   ARG B CD  1 
ATOM 9011  N NE  . ARG B 1 41   ? -17.799 58.078  25.748  1.00 48.93  ? 38   ARG B NE  1 
ATOM 9012  C CZ  . ARG B 1 41   ? -18.235 57.780  26.960  1.00 50.18  ? 38   ARG B CZ  1 
ATOM 9013  N NH1 . ARG B 1 41   ? -19.373 57.122  27.107  1.00 50.74  ? 38   ARG B NH1 1 
ATOM 9014  N NH2 . ARG B 1 41   ? -17.528 58.119  28.027  1.00 51.44  ? 38   ARG B NH2 1 
ATOM 9015  N N   . LEU B 1 42   ? -20.598 60.602  22.030  1.00 51.13  ? 39   LEU B N   1 
ATOM 9016  C CA  . LEU B 1 42   ? -20.932 61.867  21.385  1.00 52.08  ? 39   LEU B CA  1 
ATOM 9017  C C   . LEU B 1 42   ? -20.055 63.041  21.845  1.00 52.56  ? 39   LEU B C   1 
ATOM 9018  O O   . LEU B 1 42   ? -20.302 63.626  22.902  1.00 52.64  ? 39   LEU B O   1 
ATOM 9019  C CB  . LEU B 1 42   ? -22.411 62.204  21.578  1.00 51.95  ? 39   LEU B CB  1 
ATOM 9020  C CG  . LEU B 1 42   ? -22.809 63.432  20.756  1.00 52.58  ? 39   LEU B CG  1 
ATOM 9021  C CD1 . LEU B 1 42   ? -23.568 63.051  19.481  1.00 52.15  ? 39   LEU B CD1 1 
ATOM 9022  C CD2 . LEU B 1 42   ? -23.608 64.394  21.619  1.00 53.42  ? 39   LEU B CD2 1 
ATOM 9023  N N   . GLU B 1 43   ? -19.042 63.388  21.048  1.00 53.10  ? 40   GLU B N   1 
ATOM 9024  C CA  . GLU B 1 43   ? -18.190 64.537  21.358  1.00 53.76  ? 40   GLU B CA  1 
ATOM 9025  C C   . GLU B 1 43   ? -18.819 65.852  20.920  1.00 54.13  ? 40   GLU B C   1 
ATOM 9026  O O   . GLU B 1 43   ? -19.334 65.973  19.801  1.00 54.24  ? 40   GLU B O   1 
ATOM 9027  C CB  . GLU B 1 43   ? -16.805 64.407  20.725  1.00 53.83  ? 40   GLU B CB  1 
ATOM 9028  C CG  . GLU B 1 43   ? -15.688 64.104  21.706  1.00 54.86  ? 40   GLU B CG  1 
ATOM 9029  C CD  . GLU B 1 43   ? -14.982 62.787  21.408  1.00 56.77  ? 40   GLU B CD  1 
ATOM 9030  O OE1 . GLU B 1 43   ? -14.320 62.696  20.348  1.00 56.39  ? 40   GLU B OE1 1 
ATOM 9031  O OE2 . GLU B 1 43   ? -15.074 61.849  22.238  1.00 57.94  ? 40   GLU B OE2 1 
ATOM 9032  N N   . ILE B 1 44   ? -18.761 66.839  21.807  1.00 54.49  ? 41   ILE B N   1 
ATOM 9033  C CA  . ILE B 1 44   ? -19.245 68.170  21.488  1.00 55.02  ? 41   ILE B CA  1 
ATOM 9034  C C   . ILE B 1 44   ? -18.095 69.168  21.544  1.00 55.60  ? 41   ILE B C   1 
ATOM 9035  O O   . ILE B 1 44   ? -17.432 69.315  22.571  1.00 55.60  ? 41   ILE B O   1 
ATOM 9036  C CB  . ILE B 1 44   ? -20.438 68.586  22.397  1.00 54.88  ? 41   ILE B CB  1 
ATOM 9037  C CG1 . ILE B 1 44   ? -21.649 67.702  22.096  1.00 54.30  ? 41   ILE B CG1 1 
ATOM 9038  C CG2 . ILE B 1 44   ? -20.800 70.060  22.203  1.00 54.96  ? 41   ILE B CG2 1 
ATOM 9039  C CD1 . ILE B 1 44   ? -22.930 68.209  22.660  1.00 53.46  ? 41   ILE B CD1 1 
ATOM 9040  N N   . TYR B 1 45   ? -17.862 69.836  20.421  1.00 56.43  ? 42   TYR B N   1 
ATOM 9041  C CA  . TYR B 1 45   ? -16.799 70.825  20.314  1.00 57.50  ? 42   TYR B CA  1 
ATOM 9042  C C   . TYR B 1 45   ? -17.356 72.217  20.017  1.00 58.14  ? 42   TYR B C   1 
ATOM 9043  O O   . TYR B 1 45   ? -18.514 72.361  19.607  1.00 58.12  ? 42   TYR B O   1 
ATOM 9044  C CB  . TYR B 1 45   ? -15.804 70.421  19.219  1.00 57.70  ? 42   TYR B CB  1 
ATOM 9045  C CG  . TYR B 1 45   ? -14.993 69.186  19.536  1.00 58.09  ? 42   TYR B CG  1 
ATOM 9046  C CD1 . TYR B 1 45   ? -15.458 67.913  19.194  1.00 58.31  ? 42   TYR B CD1 1 
ATOM 9047  C CD2 . TYR B 1 45   ? -13.760 69.285  20.175  1.00 58.57  ? 42   TYR B CD2 1 
ATOM 9048  C CE1 . TYR B 1 45   ? -14.720 66.769  19.488  1.00 57.90  ? 42   TYR B CE1 1 
ATOM 9049  C CE2 . TYR B 1 45   ? -13.010 68.144  20.469  1.00 59.00  ? 42   TYR B CE2 1 
ATOM 9050  C CZ  . TYR B 1 45   ? -13.500 66.890  20.126  1.00 58.33  ? 42   TYR B CZ  1 
ATOM 9051  O OH  . TYR B 1 45   ? -12.763 65.765  20.420  1.00 58.32  ? 42   TYR B OH  1 
ATOM 9052  N N   . VAL B 1 46   ? -16.525 73.233  20.254  1.00 58.86  ? 43   VAL B N   1 
ATOM 9053  C CA  . VAL B 1 46   ? -16.787 74.598  19.813  1.00 59.61  ? 43   VAL B CA  1 
ATOM 9054  C C   . VAL B 1 46   ? -15.543 75.079  19.085  1.00 60.19  ? 43   VAL B C   1 
ATOM 9055  O O   . VAL B 1 46   ? -14.425 74.870  19.558  1.00 60.30  ? 43   VAL B O   1 
ATOM 9056  C CB  . VAL B 1 46   ? -17.102 75.557  20.983  1.00 59.59  ? 43   VAL B CB  1 
ATOM 9057  C CG1 . VAL B 1 46   ? -17.379 76.968  20.464  1.00 59.82  ? 43   VAL B CG1 1 
ATOM 9058  C CG2 . VAL B 1 46   ? -18.293 75.066  21.779  1.00 59.91  ? 43   VAL B CG2 1 
ATOM 9059  N N   . VAL B 1 47   ? -15.747 75.729  17.940  1.00 60.98  ? 44   VAL B N   1 
ATOM 9060  C CA  . VAL B 1 47   ? -14.653 76.158  17.063  1.00 61.69  ? 44   VAL B CA  1 
ATOM 9061  C C   . VAL B 1 47   ? -14.055 77.493  17.500  1.00 62.24  ? 44   VAL B C   1 
ATOM 9062  O O   . VAL B 1 47   ? -14.757 78.352  18.046  1.00 62.41  ? 44   VAL B O   1 
ATOM 9063  C CB  . VAL B 1 47   ? -15.118 76.266  15.591  1.00 61.55  ? 44   VAL B CB  1 
ATOM 9064  C CG1 . VAL B 1 47   ? -13.928 76.302  14.650  1.00 61.63  ? 44   VAL B CG1 1 
ATOM 9065  C CG2 . VAL B 1 47   ? -16.009 75.094  15.230  1.00 62.12  ? 44   VAL B CG2 1 
ATOM 9066  N N   . THR B 1 48   ? -12.755 77.647  17.252  1.00 62.91  ? 45   THR B N   1 
ATOM 9067  C CA  . THR B 1 48   ? -12.016 78.880  17.523  1.00 63.65  ? 45   THR B CA  1 
ATOM 9068  C C   . THR B 1 48   ? -11.022 79.160  16.400  1.00 63.87  ? 45   THR B C   1 
ATOM 9069  O O   . THR B 1 48   ? -10.961 78.415  15.419  1.00 63.95  ? 45   THR B O   1 
ATOM 9070  C CB  . THR B 1 48   ? -11.222 78.777  18.839  1.00 63.80  ? 45   THR B CB  1 
ATOM 9071  O OG1 . THR B 1 48   ? -10.590 77.490  18.915  1.00 64.09  ? 45   THR B OG1 1 
ATOM 9072  C CG2 . THR B 1 48   ? -12.130 78.982  20.050  1.00 64.25  ? 45   THR B CG2 1 
ATOM 9073  N N   . ALA B 1 49   ? -10.241 80.229  16.553  1.00 64.24  ? 46   ALA B N   1 
ATOM 9074  C CA  . ALA B 1 49   ? -9.148  80.536  15.629  1.00 64.61  ? 46   ALA B CA  1 
ATOM 9075  C C   . ALA B 1 49   ? -7.991  79.524  15.737  1.00 64.90  ? 46   ALA B C   1 
ATOM 9076  O O   . ALA B 1 49   ? -7.327  79.220  14.742  1.00 64.79  ? 46   ALA B O   1 
ATOM 9077  C CB  . ALA B 1 49   ? -8.651  81.955  15.851  1.00 64.52  ? 46   ALA B CB  1 
ATOM 9078  N N   . GLU B 1 50   ? -7.768  79.005  16.944  1.00 65.35  ? 47   GLU B N   1 
ATOM 9079  C CA  . GLU B 1 50   ? -6.723  78.007  17.206  1.00 65.94  ? 47   GLU B CA  1 
ATOM 9080  C C   . GLU B 1 50   ? -7.106  76.592  16.715  1.00 65.90  ? 47   GLU B C   1 
ATOM 9081  O O   . GLU B 1 50   ? -6.276  75.866  16.138  1.00 65.87  ? 47   GLU B O   1 
ATOM 9082  C CB  . GLU B 1 50   ? -6.373  78.005  18.708  1.00 66.19  ? 47   GLU B CB  1 
ATOM 9083  C CG  . GLU B 1 50   ? -5.537  76.805  19.209  1.00 67.62  ? 47   GLU B CG  1 
ATOM 9084  C CD  . GLU B 1 50   ? -6.391  75.612  19.671  1.00 68.99  ? 47   GLU B CD  1 
ATOM 9085  O OE1 . GLU B 1 50   ? -7.174  75.767  20.641  1.00 69.87  ? 47   GLU B OE1 1 
ATOM 9086  O OE2 . GLU B 1 50   ? -6.262  74.518  19.072  1.00 68.87  ? 47   GLU B OE2 1 
ATOM 9087  N N   . GLY B 1 51   ? -8.359  76.210  16.957  1.00 65.74  ? 48   GLY B N   1 
ATOM 9088  C CA  . GLY B 1 51   ? -8.853  74.890  16.592  1.00 65.52  ? 48   GLY B CA  1 
ATOM 9089  C C   . GLY B 1 51   ? -10.199 74.613  17.226  1.00 65.40  ? 48   GLY B C   1 
ATOM 9090  O O   . GLY B 1 51   ? -11.136 75.401  17.071  1.00 65.49  ? 48   GLY B O   1 
ATOM 9091  N N   . LEU B 1 52   ? -10.289 73.495  17.942  1.00 65.13  ? 49   LEU B N   1 
ATOM 9092  C CA  . LEU B 1 52   ? -11.517 73.112  18.632  1.00 64.90  ? 49   LEU B CA  1 
ATOM 9093  C C   . LEU B 1 52   ? -11.400 73.174  20.155  1.00 64.78  ? 49   LEU B C   1 
ATOM 9094  O O   . LEU B 1 52   ? -10.436 72.669  20.739  1.00 64.74  ? 49   LEU B O   1 
ATOM 9095  C CB  . LEU B 1 52   ? -11.936 71.710  18.204  1.00 64.86  ? 49   LEU B CB  1 
ATOM 9096  C CG  . LEU B 1 52   ? -12.845 71.515  16.985  1.00 65.18  ? 49   LEU B CG  1 
ATOM 9097  C CD1 . LEU B 1 52   ? -12.390 72.277  15.743  1.00 64.78  ? 49   LEU B CD1 1 
ATOM 9098  C CD2 . LEU B 1 52   ? -12.967 70.028  16.682  1.00 64.99  ? 49   LEU B CD2 1 
ATOM 9099  N N   . ARG B 1 53   ? -12.383 73.813  20.786  1.00 64.73  ? 50   ARG B N   1 
ATOM 9100  C CA  . ARG B 1 53   ? -12.552 73.766  22.242  1.00 64.64  ? 50   ARG B CA  1 
ATOM 9101  C C   . ARG B 1 53   ? -13.572 72.674  22.627  1.00 64.17  ? 50   ARG B C   1 
ATOM 9102  O O   . ARG B 1 53   ? -14.766 72.820  22.338  1.00 64.16  ? 50   ARG B O   1 
ATOM 9103  C CB  . ARG B 1 53   ? -12.988 75.133  22.791  1.00 64.54  ? 50   ARG B CB  1 
ATOM 9104  C CG  . ARG B 1 53   ? -13.554 75.066  24.207  1.00 65.08  ? 50   ARG B CG  1 
ATOM 9105  C CD  . ARG B 1 53   ? -14.097 76.396  24.703  1.00 65.29  ? 50   ARG B CD  1 
ATOM 9106  N NE  . ARG B 1 53   ? -13.032 77.284  25.170  1.00 67.50  ? 50   ARG B NE  1 
ATOM 9107  C CZ  . ARG B 1 53   ? -12.333 77.117  26.296  1.00 68.43  ? 50   ARG B CZ  1 
ATOM 9108  N NH1 . ARG B 1 53   ? -12.567 76.075  27.087  1.00 69.07  ? 50   ARG B NH1 1 
ATOM 9109  N NH2 . ARG B 1 53   ? -11.388 77.994  26.632  1.00 68.47  ? 50   ARG B NH2 1 
ATOM 9110  N N   . PRO B 1 54   ? -13.099 71.572  23.258  1.00 63.68  ? 51   PRO B N   1 
ATOM 9111  C CA  . PRO B 1 54   ? -13.971 70.504  23.750  1.00 63.39  ? 51   PRO B CA  1 
ATOM 9112  C C   . PRO B 1 54   ? -14.841 70.990  24.912  1.00 63.16  ? 51   PRO B C   1 
ATOM 9113  O O   . PRO B 1 54   ? -14.361 71.710  25.796  1.00 63.08  ? 51   PRO B O   1 
ATOM 9114  C CB  . PRO B 1 54   ? -12.983 69.432  24.226  1.00 63.34  ? 51   PRO B CB  1 
ATOM 9115  C CG  . PRO B 1 54   ? -11.700 69.770  23.568  1.00 63.48  ? 51   PRO B CG  1 
ATOM 9116  C CD  . PRO B 1 54   ? -11.688 71.258  23.521  1.00 63.65  ? 51   PRO B CD  1 
ATOM 9117  N N   . VAL B 1 55   ? -16.109 70.583  24.904  1.00 62.71  ? 52   VAL B N   1 
ATOM 9118  C CA  . VAL B 1 55   ? -17.128 71.225  25.722  1.00 62.21  ? 52   VAL B CA  1 
ATOM 9119  C C   . VAL B 1 55   ? -18.021 70.247  26.479  1.00 62.13  ? 52   VAL B C   1 
ATOM 9120  O O   . VAL B 1 55   ? -18.458 70.544  27.599  1.00 62.23  ? 52   VAL B O   1 
ATOM 9121  C CB  . VAL B 1 55   ? -17.937 72.249  24.868  1.00 62.15  ? 52   VAL B CB  1 
ATOM 9122  C CG1 . VAL B 1 55   ? -19.446 72.090  25.020  1.00 61.74  ? 52   VAL B CG1 1 
ATOM 9123  C CG2 . VAL B 1 55   ? -17.481 73.671  25.187  1.00 62.31  ? 52   VAL B CG2 1 
ATOM 9124  N N   . LYS B 1 56   ? -18.280 69.088  25.872  1.00 61.87  ? 53   LYS B N   1 
ATOM 9125  C CA  . LYS B 1 56   ? -19.067 68.024  26.503  1.00 61.57  ? 53   LYS B CA  1 
ATOM 9126  C C   . LYS B 1 56   ? -18.928 66.713  25.764  1.00 61.14  ? 53   LYS B C   1 
ATOM 9127  O O   . LYS B 1 56   ? -19.333 66.600  24.608  1.00 61.06  ? 53   LYS B O   1 
ATOM 9128  C CB  . LYS B 1 56   ? -20.555 68.391  26.583  1.00 61.75  ? 53   LYS B CB  1 
ATOM 9129  C CG  . LYS B 1 56   ? -21.439 67.333  27.258  1.00 62.54  ? 53   LYS B CG  1 
ATOM 9130  C CD  . LYS B 1 56   ? -21.038 67.084  28.724  1.00 63.90  ? 53   LYS B CD  1 
ATOM 9131  C CE  . LYS B 1 56   ? -22.182 66.453  29.517  1.00 64.07  ? 53   LYS B CE  1 
ATOM 9132  N NZ  . LYS B 1 56   ? -21.908 66.424  30.977  1.00 64.60  ? 53   LYS B NZ  1 
ATOM 9133  N N   . GLU B 1 57   ? -18.348 65.731  26.445  1.00 60.69  ? 54   GLU B N   1 
ATOM 9134  C CA  . GLU B 1 57   ? -18.308 64.360  25.966  1.00 60.25  ? 54   GLU B CA  1 
ATOM 9135  C C   . GLU B 1 57   ? -19.471 63.658  26.635  1.00 59.69  ? 54   GLU B C   1 
ATOM 9136  O O   . GLU B 1 57   ? -19.747 63.914  27.807  1.00 59.97  ? 54   GLU B O   1 
ATOM 9137  C CB  . GLU B 1 57   ? -16.992 63.703  26.384  1.00 60.31  ? 54   GLU B CB  1 
ATOM 9138  C CG  . GLU B 1 57   ? -16.432 62.668  25.398  1.00 61.73  ? 54   GLU B CG  1 
ATOM 9139  C CD  . GLU B 1 57   ? -16.869 61.215  25.673  1.00 63.55  ? 54   GLU B CD  1 
ATOM 9140  O OE1 . GLU B 1 57   ? -16.171 60.284  25.191  1.00 63.58  ? 54   GLU B OE1 1 
ATOM 9141  O OE2 . GLU B 1 57   ? -17.899 60.997  26.359  1.00 63.87  ? 54   GLU B OE2 1 
ATOM 9142  N N   . VAL B 1 58   ? -20.179 62.807  25.901  1.00 58.94  ? 55   VAL B N   1 
ATOM 9143  C CA  . VAL B 1 58   ? -21.171 61.915  26.521  1.00 58.40  ? 55   VAL B CA  1 
ATOM 9144  C C   . VAL B 1 58   ? -21.083 60.501  25.958  1.00 58.18  ? 55   VAL B C   1 
ATOM 9145  O O   . VAL B 1 58   ? -20.410 60.258  24.956  1.00 58.26  ? 55   VAL B O   1 
ATOM 9146  C CB  . VAL B 1 58   ? -22.649 62.426  26.418  1.00 58.16  ? 55   VAL B CB  1 
ATOM 9147  C CG1 . VAL B 1 58   ? -22.889 63.581  27.351  1.00 57.91  ? 55   VAL B CG1 1 
ATOM 9148  C CG2 . VAL B 1 58   ? -23.028 62.780  24.994  1.00 57.92  ? 55   VAL B CG2 1 
ATOM 9149  N N   . GLY B 1 59   ? -21.760 59.572  26.622  1.00 57.78  ? 56   GLY B N   1 
ATOM 9150  C CA  . GLY B 1 59   ? -21.950 58.233  26.088  1.00 57.14  ? 56   GLY B CA  1 
ATOM 9151  C C   . GLY B 1 59   ? -23.396 58.047  25.687  1.00 56.66  ? 56   GLY B C   1 
ATOM 9152  O O   . GLY B 1 59   ? -24.237 58.903  25.959  1.00 56.38  ? 56   GLY B O   1 
ATOM 9153  N N   . MET B 1 60   ? -23.678 56.924  25.034  1.00 56.39  ? 57   MET B N   1 
ATOM 9154  C CA  . MET B 1 60   ? -25.028 56.586  24.588  1.00 56.06  ? 57   MET B CA  1 
ATOM 9155  C C   . MET B 1 60   ? -25.281 55.087  24.665  1.00 55.59  ? 57   MET B C   1 
ATOM 9156  O O   . MET B 1 60   ? -24.384 54.283  24.395  1.00 55.67  ? 57   MET B O   1 
ATOM 9157  C CB  . MET B 1 60   ? -25.257 57.075  23.162  1.00 55.91  ? 57   MET B CB  1 
ATOM 9158  C CG  . MET B 1 60   ? -25.564 58.543  23.097  1.00 56.03  ? 57   MET B CG  1 
ATOM 9159  S SD  . MET B 1 60   ? -26.901 58.936  21.972  1.00 56.61  ? 57   MET B SD  1 
ATOM 9160  C CE  . MET B 1 60   ? -28.038 57.587  22.298  1.00 55.91  ? 57   MET B CE  1 
ATOM 9161  N N   . TYR B 1 61   ? -26.500 54.707  25.032  1.00 55.02  ? 58   TYR B N   1 
ATOM 9162  C CA  . TYR B 1 61   ? -26.848 53.294  25.061  1.00 54.53  ? 58   TYR B CA  1 
ATOM 9163  C C   . TYR B 1 61   ? -27.273 52.798  23.680  1.00 54.43  ? 58   TYR B C   1 
ATOM 9164  O O   . TYR B 1 61   ? -28.297 52.134  23.524  1.00 54.26  ? 58   TYR B O   1 
ATOM 9165  C CB  . TYR B 1 61   ? -27.887 53.002  26.142  1.00 54.29  ? 58   TYR B CB  1 
ATOM 9166  C CG  . TYR B 1 61   ? -27.334 53.146  27.536  1.00 53.77  ? 58   TYR B CG  1 
ATOM 9167  C CD1 . TYR B 1 61   ? -26.007 52.821  27.814  1.00 53.80  ? 58   TYR B CD1 1 
ATOM 9168  C CD2 . TYR B 1 61   ? -28.131 53.590  28.578  1.00 53.54  ? 58   TYR B CD2 1 
ATOM 9169  C CE1 . TYR B 1 61   ? -25.481 52.951  29.094  1.00 53.92  ? 58   TYR B CE1 1 
ATOM 9170  C CE2 . TYR B 1 61   ? -27.620 53.718  29.865  1.00 54.07  ? 58   TYR B CE2 1 
ATOM 9171  C CZ  . TYR B 1 61   ? -26.293 53.399  30.116  1.00 54.16  ? 58   TYR B CZ  1 
ATOM 9172  O OH  . TYR B 1 61   ? -25.781 53.523  31.387  1.00 54.34  ? 58   TYR B OH  1 
ATOM 9173  N N   . GLY B 1 62   ? -26.457 53.130  22.683  1.00 54.36  ? 59   GLY B N   1 
ATOM 9174  C CA  . GLY B 1 62   ? -26.676 52.683  21.317  1.00 54.30  ? 59   GLY B CA  1 
ATOM 9175  C C   . GLY B 1 62   ? -25.576 53.049  20.339  1.00 54.17  ? 59   GLY B C   1 
ATOM 9176  O O   . GLY B 1 62   ? -24.830 54.002  20.549  1.00 54.28  ? 59   GLY B O   1 
ATOM 9177  N N   . LYS B 1 63   ? -25.478 52.280  19.262  1.00 54.06  ? 60   LYS B N   1 
ATOM 9178  C CA  . LYS B 1 63   ? -24.643 52.656  18.135  1.00 54.11  ? 60   LYS B CA  1 
ATOM 9179  C C   . LYS B 1 63   ? -25.323 53.780  17.374  1.00 54.37  ? 60   LYS B C   1 
ATOM 9180  O O   . LYS B 1 63   ? -26.381 53.579  16.782  1.00 54.63  ? 60   LYS B O   1 
ATOM 9181  C CB  . LYS B 1 63   ? -24.448 51.466  17.200  1.00 54.00  ? 60   LYS B CB  1 
ATOM 9182  C CG  . LYS B 1 63   ? -23.349 50.516  17.605  1.00 53.69  ? 60   LYS B CG  1 
ATOM 9183  C CD  . LYS B 1 63   ? -23.474 49.196  16.869  1.00 53.90  ? 60   LYS B CD  1 
ATOM 9184  C CE  . LYS B 1 63   ? -22.196 48.855  16.118  1.00 54.35  ? 60   LYS B CE  1 
ATOM 9185  N NZ  . LYS B 1 63   ? -20.957 49.182  16.864  1.00 54.08  ? 60   LYS B NZ  1 
ATOM 9186  N N   . ILE B 1 64   ? -24.724 54.964  17.392  1.00 54.62  ? 61   ILE B N   1 
ATOM 9187  C CA  . ILE B 1 64   ? -25.223 56.091  16.595  1.00 54.90  ? 61   ILE B CA  1 
ATOM 9188  C C   . ILE B 1 64   ? -25.183 55.801  15.079  1.00 55.02  ? 61   ILE B C   1 
ATOM 9189  O O   . ILE B 1 64   ? -24.122 55.524  14.515  1.00 54.86  ? 61   ILE B O   1 
ATOM 9190  C CB  . ILE B 1 64   ? -24.452 57.380  16.932  1.00 54.91  ? 61   ILE B CB  1 
ATOM 9191  C CG1 . ILE B 1 64   ? -24.622 57.694  18.418  1.00 54.91  ? 61   ILE B CG1 1 
ATOM 9192  C CG2 . ILE B 1 64   ? -24.921 58.548  16.056  1.00 54.90  ? 61   ILE B CG2 1 
ATOM 9193  C CD1 . ILE B 1 64   ? -23.465 58.429  19.028  1.00 55.59  ? 61   ILE B CD1 1 
ATOM 9194  N N   . ALA B 1 65   ? -26.353 55.857  14.443  1.00 55.29  ? 62   ALA B N   1 
ATOM 9195  C CA  . ALA B 1 65   ? -26.501 55.557  13.016  1.00 55.75  ? 62   ALA B CA  1 
ATOM 9196  C C   . ALA B 1 65   ? -26.985 56.764  12.203  1.00 56.09  ? 62   ALA B C   1 
ATOM 9197  O O   . ALA B 1 65   ? -26.721 56.869  11.002  1.00 56.11  ? 62   ALA B O   1 
ATOM 9198  C CB  . ALA B 1 65   ? -27.435 54.386  12.823  1.00 55.66  ? 62   ALA B CB  1 
ATOM 9199  N N   . VAL B 1 66   ? -27.720 57.653  12.864  1.00 56.48  ? 63   VAL B N   1 
ATOM 9200  C CA  . VAL B 1 66   ? -28.132 58.924  12.283  1.00 56.67  ? 63   VAL B CA  1 
ATOM 9201  C C   . VAL B 1 66   ? -27.861 60.021  13.296  1.00 56.91  ? 63   VAL B C   1 
ATOM 9202  O O   . VAL B 1 66   ? -28.222 59.887  14.471  1.00 56.99  ? 63   VAL B O   1 
ATOM 9203  C CB  . VAL B 1 66   ? -29.635 58.967  11.983  1.00 56.60  ? 63   VAL B CB  1 
ATOM 9204  C CG1 . VAL B 1 66   ? -29.921 60.071  10.985  1.00 56.90  ? 63   VAL B CG1 1 
ATOM 9205  C CG2 . VAL B 1 66   ? -30.131 57.641  11.462  1.00 56.52  ? 63   VAL B CG2 1 
ATOM 9206  N N   . MET B 1 67   ? -27.235 61.104  12.849  1.00 57.17  ? 64   MET B N   1 
ATOM 9207  C CA  . MET B 1 67   ? -27.019 62.263  13.717  1.00 57.27  ? 64   MET B CA  1 
ATOM 9208  C C   . MET B 1 67   ? -27.219 63.562  12.951  1.00 58.04  ? 64   MET B C   1 
ATOM 9209  O O   . MET B 1 67   ? -26.412 63.909  12.083  1.00 58.14  ? 64   MET B O   1 
ATOM 9210  C CB  . MET B 1 67   ? -25.636 62.219  14.371  1.00 57.14  ? 64   MET B CB  1 
ATOM 9211  C CG  . MET B 1 67   ? -25.270 63.478  15.128  1.00 56.35  ? 64   MET B CG  1 
ATOM 9212  S SD  . MET B 1 67   ? -23.638 63.399  15.860  1.00 55.97  ? 64   MET B SD  1 
ATOM 9213  C CE  . MET B 1 67   ? -22.648 63.019  14.428  1.00 56.13  ? 64   MET B CE  1 
ATOM 9214  N N   . GLU B 1 68   ? -28.297 64.273  13.279  1.00 58.67  ? 65   GLU B N   1 
ATOM 9215  C CA  . GLU B 1 68   ? -28.639 65.504  12.576  1.00 59.47  ? 65   GLU B CA  1 
ATOM 9216  C C   . GLU B 1 68   ? -28.904 66.667  13.515  1.00 59.82  ? 65   GLU B C   1 
ATOM 9217  O O   . GLU B 1 68   ? -29.430 66.484  14.617  1.00 59.78  ? 65   GLU B O   1 
ATOM 9218  C CB  . GLU B 1 68   ? -29.859 65.291  11.676  1.00 59.58  ? 65   GLU B CB  1 
ATOM 9219  C CG  . GLU B 1 68   ? -29.724 64.166  10.643  1.00 60.65  ? 65   GLU B CG  1 
ATOM 9220  C CD  . GLU B 1 68   ? -28.630 64.409  9.604   1.00 61.86  ? 65   GLU B CD  1 
ATOM 9221  O OE1 . GLU B 1 68   ? -28.405 63.508  8.764   1.00 62.12  ? 65   GLU B OE1 1 
ATOM 9222  O OE2 . GLU B 1 68   ? -27.994 65.490  9.622   1.00 62.78  ? 65   GLU B OE2 1 
ATOM 9223  N N   . LEU B 1 69   ? -28.525 67.865  13.073  1.00 60.30  ? 66   LEU B N   1 
ATOM 9224  C CA  . LEU B 1 69   ? -28.931 69.090  13.748  1.00 60.69  ? 66   LEU B CA  1 
ATOM 9225  C C   . LEU B 1 69   ? -30.053 69.716  12.940  1.00 61.34  ? 66   LEU B C   1 
ATOM 9226  O O   . LEU B 1 69   ? -29.970 69.807  11.709  1.00 61.50  ? 66   LEU B O   1 
ATOM 9227  C CB  . LEU B 1 69   ? -27.761 70.066  13.909  1.00 60.46  ? 66   LEU B CB  1 
ATOM 9228  C CG  . LEU B 1 69   ? -26.779 69.849  15.070  1.00 59.98  ? 66   LEU B CG  1 
ATOM 9229  C CD1 . LEU B 1 69   ? -25.576 70.750  14.938  1.00 59.49  ? 66   LEU B CD1 1 
ATOM 9230  C CD2 . LEU B 1 69   ? -27.432 70.067  16.419  1.00 59.70  ? 66   LEU B CD2 1 
ATOM 9231  N N   . PHE B 1 70   ? -31.116 70.109  13.634  1.00 62.01  ? 67   PHE B N   1 
ATOM 9232  C CA  . PHE B 1 70   ? -32.276 70.729  13.002  1.00 62.69  ? 67   PHE B CA  1 
ATOM 9233  C C   . PHE B 1 70   ? -32.846 71.797  13.929  1.00 63.18  ? 67   PHE B C   1 
ATOM 9234  O O   . PHE B 1 70   ? -32.678 71.721  15.153  1.00 63.07  ? 67   PHE B O   1 
ATOM 9235  C CB  . PHE B 1 70   ? -33.338 69.675  12.647  1.00 62.66  ? 67   PHE B CB  1 
ATOM 9236  C CG  . PHE B 1 70   ? -34.057 69.101  13.841  1.00 62.73  ? 67   PHE B CG  1 
ATOM 9237  C CD1 . PHE B 1 70   ? -35.275 69.636  14.262  1.00 63.25  ? 67   PHE B CD1 1 
ATOM 9238  C CD2 . PHE B 1 70   ? -33.521 68.031  14.547  1.00 62.39  ? 67   PHE B CD2 1 
ATOM 9239  C CE1 . PHE B 1 70   ? -35.945 69.118  15.374  1.00 63.06  ? 67   PHE B CE1 1 
ATOM 9240  C CE2 . PHE B 1 70   ? -34.186 67.501  15.658  1.00 62.68  ? 67   PHE B CE2 1 
ATOM 9241  C CZ  . PHE B 1 70   ? -35.399 68.045  16.072  1.00 62.64  ? 67   PHE B CZ  1 
ATOM 9242  N N   . ARG B 1 71   ? -33.511 72.790  13.339  1.00 63.85  ? 68   ARG B N   1 
ATOM 9243  C CA  . ARG B 1 71   ? -34.083 73.896  14.103  1.00 64.51  ? 68   ARG B CA  1 
ATOM 9244  C C   . ARG B 1 71   ? -35.391 74.370  13.479  1.00 64.72  ? 68   ARG B C   1 
ATOM 9245  O O   . ARG B 1 71   ? -35.393 74.899  12.368  1.00 64.72  ? 68   ARG B O   1 
ATOM 9246  C CB  . ARG B 1 71   ? -33.068 75.044  14.244  1.00 64.56  ? 68   ARG B CB  1 
ATOM 9247  C CG  . ARG B 1 71   ? -33.635 76.326  14.837  1.00 65.75  ? 68   ARG B CG  1 
ATOM 9248  C CD  . ARG B 1 71   ? -32.734 76.929  15.914  1.00 67.81  ? 68   ARG B CD  1 
ATOM 9249  N NE  . ARG B 1 71   ? -31.428 77.383  15.424  1.00 69.63  ? 68   ARG B NE  1 
ATOM 9250  C CZ  . ARG B 1 71   ? -30.995 78.647  15.459  1.00 70.52  ? 68   ARG B CZ  1 
ATOM 9251  N NH1 . ARG B 1 71   ? -31.759 79.620  15.954  1.00 70.35  ? 68   ARG B NH1 1 
ATOM 9252  N NH2 . ARG B 1 71   ? -29.787 78.944  14.994  1.00 71.17  ? 68   ARG B NH2 1 
ATOM 9253  N N   . PRO B 1 72   ? -36.514 74.159  14.187  1.00 65.16  ? 69   PRO B N   1 
ATOM 9254  C CA  . PRO B 1 72   ? -37.809 74.648  13.717  1.00 65.59  ? 69   PRO B CA  1 
ATOM 9255  C C   . PRO B 1 72   ? -38.091 76.096  14.140  1.00 65.97  ? 69   PRO B C   1 
ATOM 9256  O O   . PRO B 1 72   ? -37.286 76.712  14.852  1.00 66.15  ? 69   PRO B O   1 
ATOM 9257  C CB  . PRO B 1 72   ? -38.797 73.700  14.405  1.00 65.55  ? 69   PRO B CB  1 
ATOM 9258  C CG  . PRO B 1 72   ? -38.128 73.347  15.691  1.00 65.25  ? 69   PRO B CG  1 
ATOM 9259  C CD  . PRO B 1 72   ? -36.636 73.422  15.460  1.00 65.09  ? 69   PRO B CD  1 
ATOM 9260  N N   . LYS B 1 73   ? -39.230 76.627  13.698  1.00 66.22  ? 70   LYS B N   1 
ATOM 9261  C CA  . LYS B 1 73   ? -39.785 77.856  14.265  1.00 66.42  ? 70   LYS B CA  1 
ATOM 9262  C C   . LYS B 1 73   ? -39.945 77.659  15.782  1.00 66.29  ? 70   LYS B C   1 
ATOM 9263  O O   . LYS B 1 73   ? -39.848 76.531  16.274  1.00 66.31  ? 70   LYS B O   1 
ATOM 9264  C CB  . LYS B 1 73   ? -41.141 78.180  13.614  1.00 66.61  ? 70   LYS B CB  1 
ATOM 9265  C CG  . LYS B 1 73   ? -41.099 78.502  12.102  1.00 66.91  ? 70   LYS B CG  1 
ATOM 9266  C CD  . LYS B 1 73   ? -40.933 80.004  11.831  1.00 67.37  ? 70   LYS B CD  1 
ATOM 9267  C CE  . LYS B 1 73   ? -41.551 80.428  10.489  1.00 67.39  ? 70   LYS B CE  1 
ATOM 9268  N NZ  . LYS B 1 73   ? -40.802 79.956  9.283   1.00 66.99  ? 70   LYS B NZ  1 
ATOM 9269  N N   . GLY B 1 74   ? -40.173 78.748  16.518  1.00 66.16  ? 71   GLY B N   1 
ATOM 9270  C CA  . GLY B 1 74   ? -40.345 78.684  17.978  1.00 65.90  ? 71   GLY B CA  1 
ATOM 9271  C C   . GLY B 1 74   ? -39.199 78.000  18.714  1.00 65.66  ? 71   GLY B C   1 
ATOM 9272  O O   . GLY B 1 74   ? -39.416 77.309  19.717  1.00 65.48  ? 71   GLY B O   1 
ATOM 9273  N N   . GLU B 1 75   ? -37.982 78.195  18.202  1.00 65.41  ? 72   GLU B N   1 
ATOM 9274  C CA  . GLU B 1 75   ? -36.759 77.639  18.780  1.00 65.12  ? 72   GLU B CA  1 
ATOM 9275  C C   . GLU B 1 75   ? -35.601 78.632  18.677  1.00 64.56  ? 72   GLU B C   1 
ATOM 9276  O O   . GLU B 1 75   ? -35.543 79.422  17.727  1.00 64.56  ? 72   GLU B O   1 
ATOM 9277  C CB  . GLU B 1 75   ? -36.392 76.335  18.072  1.00 65.44  ? 72   GLU B CB  1 
ATOM 9278  C CG  . GLU B 1 75   ? -37.013 75.100  18.691  1.00 66.64  ? 72   GLU B CG  1 
ATOM 9279  C CD  . GLU B 1 75   ? -36.373 74.734  20.019  1.00 68.33  ? 72   GLU B CD  1 
ATOM 9280  O OE1 . GLU B 1 75   ? -37.080 74.778  21.052  1.00 68.95  ? 72   GLU B OE1 1 
ATOM 9281  O OE2 . GLU B 1 75   ? -35.161 74.416  20.028  1.00 68.90  ? 72   GLU B OE2 1 
ATOM 9282  N N   . SER B 1 76   ? -34.681 78.578  19.643  1.00 63.83  ? 73   SER B N   1 
ATOM 9283  C CA  . SER B 1 76   ? -33.561 79.536  19.721  1.00 63.16  ? 73   SER B CA  1 
ATOM 9284  C C   . SER B 1 76   ? -32.220 78.994  19.200  1.00 62.62  ? 73   SER B C   1 
ATOM 9285  O O   . SER B 1 76   ? -31.406 79.748  18.658  1.00 62.78  ? 73   SER B O   1 
ATOM 9286  C CB  . SER B 1 76   ? -33.394 80.075  21.151  1.00 63.19  ? 73   SER B CB  1 
ATOM 9287  O OG  . SER B 1 76   ? -32.963 79.066  22.056  1.00 63.03  ? 73   SER B OG  1 
ATOM 9288  N N   . LYS B 1 77   ? -31.996 77.695  19.376  1.00 61.71  ? 74   LYS B N   1 
ATOM 9289  C CA  . LYS B 1 77   ? -30.754 77.046  18.954  1.00 60.73  ? 74   LYS B CA  1 
ATOM 9290  C C   . LYS B 1 77   ? -31.059 75.630  18.482  1.00 60.16  ? 74   LYS B C   1 
ATOM 9291  O O   . LYS B 1 77   ? -32.081 75.050  18.865  1.00 60.24  ? 74   LYS B O   1 
ATOM 9292  C CB  . LYS B 1 77   ? -29.719 77.037  20.091  1.00 60.80  ? 74   LYS B CB  1 
ATOM 9293  C CG  . LYS B 1 77   ? -30.162 76.322  21.371  1.00 60.58  ? 74   LYS B CG  1 
ATOM 9294  C CD  . LYS B 1 77   ? -29.233 76.638  22.533  1.00 60.55  ? 74   LYS B CD  1 
ATOM 9295  C CE  . LYS B 1 77   ? -29.498 75.731  23.738  1.00 60.71  ? 74   LYS B CE  1 
ATOM 9296  N NZ  . LYS B 1 77   ? -30.723 76.071  24.525  1.00 60.25  ? 74   LYS B NZ  1 
ATOM 9297  N N   . ASP B 1 78   ? -30.176 75.080  17.651  1.00 59.20  ? 75   ASP B N   1 
ATOM 9298  C CA  . ASP B 1 78   ? -30.390 73.764  17.044  1.00 58.15  ? 75   ASP B CA  1 
ATOM 9299  C C   . ASP B 1 78   ? -30.524 72.662  18.086  1.00 57.27  ? 75   ASP B C   1 
ATOM 9300  O O   . ASP B 1 78   ? -29.852 72.680  19.116  1.00 57.16  ? 75   ASP B O   1 
ATOM 9301  C CB  . ASP B 1 78   ? -29.265 73.437  16.059  1.00 58.28  ? 75   ASP B CB  1 
ATOM 9302  C CG  . ASP B 1 78   ? -29.226 74.391  14.874  1.00 58.62  ? 75   ASP B CG  1 
ATOM 9303  O OD1 . ASP B 1 78   ? -29.134 73.906  13.724  1.00 59.52  ? 75   ASP B OD1 1 
ATOM 9304  O OD2 . ASP B 1 78   ? -29.293 75.623  15.087  1.00 58.56  ? 75   ASP B OD2 1 
ATOM 9305  N N   . LEU B 1 79   ? -31.422 71.721  17.819  1.00 56.28  ? 76   LEU B N   1 
ATOM 9306  C CA  . LEU B 1 79   ? -31.596 70.550  18.671  1.00 55.43  ? 76   LEU B CA  1 
ATOM 9307  C C   . LEU B 1 79   ? -30.958 69.351  17.990  1.00 54.85  ? 76   LEU B C   1 
ATOM 9308  O O   . LEU B 1 79   ? -30.752 69.358  16.780  1.00 55.05  ? 76   LEU B O   1 
ATOM 9309  C CB  . LEU B 1 79   ? -33.082 70.276  18.924  1.00 55.46  ? 76   LEU B CB  1 
ATOM 9310  C CG  . LEU B 1 79   ? -33.949 71.380  19.539  1.00 55.12  ? 76   LEU B CG  1 
ATOM 9311  C CD1 . LEU B 1 79   ? -35.428 71.094  19.311  1.00 54.56  ? 76   LEU B CD1 1 
ATOM 9312  C CD2 . LEU B 1 79   ? -33.651 71.548  21.019  1.00 54.77  ? 76   LEU B CD2 1 
ATOM 9313  N N   . LEU B 1 80   ? -30.642 68.317  18.750  1.00 54.06  ? 77   LEU B N   1 
ATOM 9314  C CA  . LEU B 1 80   ? -30.019 67.156  18.147  1.00 53.50  ? 77   LEU B CA  1 
ATOM 9315  C C   . LEU B 1 80   ? -31.011 66.027  17.974  1.00 53.28  ? 77   LEU B C   1 
ATOM 9316  O O   . LEU B 1 80   ? -31.846 65.780  18.835  1.00 53.11  ? 77   LEU B O   1 
ATOM 9317  C CB  . LEU B 1 80   ? -28.814 66.690  18.963  1.00 53.69  ? 77   LEU B CB  1 
ATOM 9318  C CG  . LEU B 1 80   ? -27.910 65.579  18.415  1.00 53.34  ? 77   LEU B CG  1 
ATOM 9319  C CD1 . LEU B 1 80   ? -27.371 65.941  17.036  1.00 52.94  ? 77   LEU B CD1 1 
ATOM 9320  C CD2 . LEU B 1 80   ? -26.776 65.303  19.392  1.00 53.07  ? 77   LEU B CD2 1 
ATOM 9321  N N   . PHE B 1 81   ? -30.913 65.363  16.830  1.00 53.12  ? 78   PHE B N   1 
ATOM 9322  C CA  . PHE B 1 81   ? -31.659 64.152  16.561  1.00 52.85  ? 78   PHE B CA  1 
ATOM 9323  C C   . PHE B 1 81   ? -30.681 63.004  16.470  1.00 52.42  ? 78   PHE B C   1 
ATOM 9324  O O   . PHE B 1 81   ? -29.724 63.043  15.708  1.00 52.56  ? 78   PHE B O   1 
ATOM 9325  C CB  . PHE B 1 81   ? -32.446 64.252  15.252  1.00 53.15  ? 78   PHE B CB  1 
ATOM 9326  C CG  . PHE B 1 81   ? -33.121 62.969  14.863  1.00 53.86  ? 78   PHE B CG  1 
ATOM 9327  C CD1 . PHE B 1 81   ? -34.447 62.737  15.208  1.00 54.08  ? 78   PHE B CD1 1 
ATOM 9328  C CD2 . PHE B 1 81   ? -32.420 61.977  14.176  1.00 54.49  ? 78   PHE B CD2 1 
ATOM 9329  C CE1 . PHE B 1 81   ? -35.071 61.542  14.864  1.00 54.51  ? 78   PHE B CE1 1 
ATOM 9330  C CE2 . PHE B 1 81   ? -33.035 60.776  13.830  1.00 54.48  ? 78   PHE B CE2 1 
ATOM 9331  C CZ  . PHE B 1 81   ? -34.364 60.559  14.172  1.00 54.22  ? 78   PHE B CZ  1 
ATOM 9332  N N   . ILE B 1 82   ? -30.953 61.969  17.238  1.00 51.95  ? 79   ILE B N   1 
ATOM 9333  C CA  . ILE B 1 82   ? -30.109 60.807  17.286  1.00 51.67  ? 79   ILE B CA  1 
ATOM 9334  C C   . ILE B 1 82   ? -31.002 59.607  17.005  1.00 51.64  ? 79   ILE B C   1 
ATOM 9335  O O   . ILE B 1 82   ? -32.145 59.578  17.466  1.00 51.86  ? 79   ILE B O   1 
ATOM 9336  C CB  . ILE B 1 82   ? -29.432 60.718  18.681  1.00 51.62  ? 79   ILE B CB  1 
ATOM 9337  C CG1 . ILE B 1 82   ? -28.218 61.664  18.755  1.00 51.46  ? 79   ILE B CG1 1 
ATOM 9338  C CG2 . ILE B 1 82   ? -29.100 59.271  19.074  1.00 51.42  ? 79   ILE B CG2 1 
ATOM 9339  C CD1 . ILE B 1 82   ? -26.912 61.123  18.169  1.00 51.21  ? 79   ILE B CD1 1 
ATOM 9340  N N   . LEU B 1 83   ? -30.499 58.651  16.217  1.00 51.27  ? 80   LEU B N   1 
ATOM 9341  C CA  . LEU B 1 83   ? -31.138 57.344  16.065  1.00 50.82  ? 80   LEU B CA  1 
ATOM 9342  C C   . LEU B 1 83   ? -30.115 56.226  16.216  1.00 51.06  ? 80   LEU B C   1 
ATOM 9343  O O   . LEU B 1 83   ? -29.079 56.236  15.548  1.00 51.31  ? 80   LEU B O   1 
ATOM 9344  C CB  . LEU B 1 83   ? -31.835 57.220  14.712  1.00 50.53  ? 80   LEU B CB  1 
ATOM 9345  C CG  . LEU B 1 83   ? -32.399 55.826  14.418  1.00 49.64  ? 80   LEU B CG  1 
ATOM 9346  C CD1 . LEU B 1 83   ? -33.561 55.500  15.350  1.00 48.27  ? 80   LEU B CD1 1 
ATOM 9347  C CD2 . LEU B 1 83   ? -32.793 55.668  12.955  1.00 48.38  ? 80   LEU B CD2 1 
ATOM 9348  N N   . THR B 1 84   ? -30.412 55.253  17.076  1.00 51.09  ? 81   THR B N   1 
ATOM 9349  C CA  . THR B 1 84   ? -29.503 54.128  17.298  1.00 51.08  ? 81   THR B CA  1 
ATOM 9350  C C   . THR B 1 84   ? -29.795 52.914  16.421  1.00 50.80  ? 81   THR B C   1 
ATOM 9351  O O   . THR B 1 84   ? -30.931 52.685  16.035  1.00 50.78  ? 81   THR B O   1 
ATOM 9352  C CB  . THR B 1 84   ? -29.492 53.689  18.768  1.00 51.21  ? 81   THR B CB  1 
ATOM 9353  O OG1 . THR B 1 84   ? -28.358 52.853  18.995  1.00 52.75  ? 81   THR B OG1 1 
ATOM 9354  C CG2 . THR B 1 84   ? -30.694 52.885  19.096  1.00 51.29  ? 81   THR B CG2 1 
ATOM 9355  N N   . ALA B 1 85   ? -28.761 52.126  16.138  1.00 50.82  ? 82   ALA B N   1 
ATOM 9356  C CA  . ALA B 1 85   ? -28.889 50.887  15.355  1.00 51.07  ? 82   ALA B CA  1 
ATOM 9357  C C   . ALA B 1 85   ? -29.959 49.911  15.880  1.00 51.28  ? 82   ALA B C   1 
ATOM 9358  O O   . ALA B 1 85   ? -30.420 49.032  15.142  1.00 51.25  ? 82   ALA B O   1 
ATOM 9359  C CB  . ALA B 1 85   ? -27.532 50.186  15.246  1.00 50.95  ? 82   ALA B CB  1 
ATOM 9360  N N   . LYS B 1 86   ? -30.329 50.060  17.153  1.00 51.42  ? 83   LYS B N   1 
ATOM 9361  C CA  . LYS B 1 86   ? -31.420 49.292  17.751  1.00 51.48  ? 83   LYS B CA  1 
ATOM 9362  C C   . LYS B 1 86   ? -32.731 50.034  17.577  1.00 51.64  ? 83   LYS B C   1 
ATOM 9363  O O   . LYS B 1 86   ? -33.755 49.642  18.142  1.00 51.57  ? 83   LYS B O   1 
ATOM 9364  C CB  . LYS B 1 86   ? -31.167 49.043  19.237  1.00 51.48  ? 83   LYS B CB  1 
ATOM 9365  C CG  . LYS B 1 86   ? -30.071 48.050  19.513  1.00 51.52  ? 83   LYS B CG  1 
ATOM 9366  C CD  . LYS B 1 86   ? -30.317 47.308  20.806  1.00 51.27  ? 83   LYS B CD  1 
ATOM 9367  C CE  . LYS B 1 86   ? -29.425 46.092  20.874  1.00 51.87  ? 83   LYS B CE  1 
ATOM 9368  N NZ  . LYS B 1 86   ? -29.996 45.027  21.734  1.00 53.29  ? 83   LYS B NZ  1 
ATOM 9369  N N   . TYR B 1 87   ? -32.671 51.117  16.805  1.00 51.95  ? 84   TYR B N   1 
ATOM 9370  C CA  . TYR B 1 87   ? -33.829 51.926  16.430  1.00 52.58  ? 84   TYR B CA  1 
ATOM 9371  C C   . TYR B 1 87   ? -34.393 52.830  17.546  1.00 53.16  ? 84   TYR B C   1 
ATOM 9372  O O   . TYR B 1 87   ? -35.559 53.226  17.492  1.00 53.42  ? 84   TYR B O   1 
ATOM 9373  C CB  . TYR B 1 87   ? -34.922 51.053  15.790  1.00 52.55  ? 84   TYR B CB  1 
ATOM 9374  C CG  . TYR B 1 87   ? -34.453 50.271  14.581  1.00 52.36  ? 84   TYR B CG  1 
ATOM 9375  C CD1 . TYR B 1 87   ? -34.258 48.890  14.644  1.00 52.28  ? 84   TYR B CD1 1 
ATOM 9376  C CD2 . TYR B 1 87   ? -34.197 50.917  13.371  1.00 52.51  ? 84   TYR B CD2 1 
ATOM 9377  C CE1 . TYR B 1 87   ? -33.820 48.173  13.524  1.00 52.28  ? 84   TYR B CE1 1 
ATOM 9378  C CE2 . TYR B 1 87   ? -33.754 50.215  12.254  1.00 52.33  ? 84   TYR B CE2 1 
ATOM 9379  C CZ  . TYR B 1 87   ? -33.570 48.851  12.337  1.00 52.25  ? 84   TYR B CZ  1 
ATOM 9380  O OH  . TYR B 1 87   ? -33.139 48.185  11.222  1.00 52.44  ? 84   TYR B OH  1 
ATOM 9381  N N   . ASN B 1 88   ? -33.566 53.157  18.542  1.00 53.84  ? 85   ASN B N   1 
ATOM 9382  C CA  . ASN B 1 88   ? -33.901 54.175  19.561  1.00 54.26  ? 85   ASN B CA  1 
ATOM 9383  C C   . ASN B 1 88   ? -33.684 55.589  19.001  1.00 54.41  ? 85   ASN B C   1 
ATOM 9384  O O   . ASN B 1 88   ? -32.550 55.991  18.713  1.00 54.38  ? 85   ASN B O   1 
ATOM 9385  C CB  . ASN B 1 88   ? -33.065 54.002  20.854  1.00 54.34  ? 85   ASN B CB  1 
ATOM 9386  C CG  . ASN B 1 88   ? -33.207 52.611  21.494  1.00 54.73  ? 85   ASN B CG  1 
ATOM 9387  O OD1 . ASN B 1 88   ? -32.274 51.800  21.468  1.00 53.94  ? 85   ASN B OD1 1 
ATOM 9388  N ND2 . ASN B 1 88   ? -34.367 52.346  22.088  1.00 55.89  ? 85   ASN B ND2 1 
ATOM 9389  N N   . ALA B 1 89   ? -34.773 56.330  18.840  1.00 54.63  ? 86   ALA B N   1 
ATOM 9390  C CA  . ALA B 1 89   ? -34.704 57.716  18.399  1.00 55.12  ? 86   ALA B CA  1 
ATOM 9391  C C   . ALA B 1 89   ? -34.966 58.662  19.560  1.00 55.58  ? 86   ALA B C   1 
ATOM 9392  O O   . ALA B 1 89   ? -35.761 58.351  20.447  1.00 55.80  ? 86   ALA B O   1 
ATOM 9393  C CB  . ALA B 1 89   ? -35.702 57.963  17.298  1.00 55.09  ? 86   ALA B CB  1 
ATOM 9394  N N   . CYS B 1 90   ? -34.298 59.814  19.553  1.00 56.13  ? 87   CYS B N   1 
ATOM 9395  C CA  . CYS B 1 90   ? -34.510 60.840  20.578  1.00 56.92  ? 87   CYS B CA  1 
ATOM 9396  C C   . CYS B 1 90   ? -34.326 62.245  20.014  1.00 56.98  ? 87   CYS B C   1 
ATOM 9397  O O   . CYS B 1 90   ? -34.046 62.398  18.835  1.00 57.16  ? 87   CYS B O   1 
ATOM 9398  C CB  . CYS B 1 90   ? -33.592 60.607  21.780  1.00 56.99  ? 87   CYS B CB  1 
ATOM 9399  S SG  . CYS B 1 90   ? -31.845 60.547  21.362  1.00 58.90  ? 87   CYS B SG  1 
ATOM 9400  N N   . ILE B 1 91   ? -34.519 63.264  20.845  1.00 57.41  ? 88   ILE B N   1 
ATOM 9401  C CA  . ILE B 1 91   ? -34.297 64.659  20.449  1.00 58.08  ? 88   ILE B CA  1 
ATOM 9402  C C   . ILE B 1 91   ? -33.628 65.413  21.600  1.00 58.84  ? 88   ILE B C   1 
ATOM 9403  O O   . ILE B 1 91   ? -34.183 65.537  22.697  1.00 58.90  ? 88   ILE B O   1 
ATOM 9404  C CB  . ILE B 1 91   ? -35.598 65.383  19.973  1.00 58.01  ? 88   ILE B CB  1 
ATOM 9405  C CG1 . ILE B 1 91   ? -35.920 65.025  18.521  1.00 57.62  ? 88   ILE B CG1 1 
ATOM 9406  C CG2 . ILE B 1 91   ? -35.455 66.903  20.080  1.00 58.10  ? 88   ILE B CG2 1 
ATOM 9407  C CD1 . ILE B 1 91   ? -37.294 65.472  18.056  1.00 57.63  ? 88   ILE B CD1 1 
ATOM 9408  N N   . LEU B 1 92   ? -32.435 65.924  21.331  1.00 59.67  ? 89   LEU B N   1 
ATOM 9409  C CA  . LEU B 1 92   ? -31.566 66.405  22.387  1.00 60.54  ? 89   LEU B CA  1 
ATOM 9410  C C   . LEU B 1 92   ? -31.339 67.911  22.339  1.00 61.42  ? 89   LEU B C   1 
ATOM 9411  O O   . LEU B 1 92   ? -31.161 68.487  21.264  1.00 61.47  ? 89   LEU B O   1 
ATOM 9412  C CB  . LEU B 1 92   ? -30.240 65.634  22.357  1.00 60.36  ? 89   LEU B CB  1 
ATOM 9413  C CG  . LEU B 1 92   ? -30.379 64.103  22.384  1.00 59.88  ? 89   LEU B CG  1 
ATOM 9414  C CD1 . LEU B 1 92   ? -29.113 63.438  21.935  1.00 59.61  ? 89   LEU B CD1 1 
ATOM 9415  C CD2 . LEU B 1 92   ? -30.771 63.596  23.760  1.00 60.03  ? 89   LEU B CD2 1 
ATOM 9416  N N   . GLU B 1 93   ? -31.382 68.531  23.523  1.00 62.55  ? 90   GLU B N   1 
ATOM 9417  C CA  . GLU B 1 93   ? -31.083 69.951  23.723  1.00 63.49  ? 90   GLU B CA  1 
ATOM 9418  C C   . GLU B 1 93   ? -29.969 70.074  24.746  1.00 64.08  ? 90   GLU B C   1 
ATOM 9419  O O   . GLU B 1 93   ? -29.907 69.290  25.698  1.00 64.04  ? 90   GLU B O   1 
ATOM 9420  C CB  . GLU B 1 93   ? -32.308 70.710  24.224  1.00 63.37  ? 90   GLU B CB  1 
ATOM 9421  C CG  . GLU B 1 93   ? -32.113 72.217  24.233  1.00 64.47  ? 90   GLU B CG  1 
ATOM 9422  C CD  . GLU B 1 93   ? -33.166 72.971  25.033  1.00 66.05  ? 90   GLU B CD  1 
ATOM 9423  O OE1 . GLU B 1 93   ? -34.199 72.368  25.406  1.00 66.78  ? 90   GLU B OE1 1 
ATOM 9424  O OE2 . GLU B 1 93   ? -32.954 74.181  25.288  1.00 66.51  ? 90   GLU B OE2 1 
ATOM 9425  N N   . TYR B 1 94   ? -29.097 71.059  24.541  1.00 65.02  ? 91   TYR B N   1 
ATOM 9426  C CA  . TYR B 1 94   ? -27.958 71.298  25.425  1.00 65.89  ? 91   TYR B CA  1 
ATOM 9427  C C   . TYR B 1 94   ? -28.301 72.386  26.420  1.00 66.45  ? 91   TYR B C   1 
ATOM 9428  O O   . TYR B 1 94   ? -28.356 73.563  26.063  1.00 66.53  ? 91   TYR B O   1 
ATOM 9429  C CB  . TYR B 1 94   ? -26.721 71.697  24.611  1.00 65.98  ? 91   TYR B CB  1 
ATOM 9430  C CG  . TYR B 1 94   ? -25.490 71.983  25.439  1.00 65.76  ? 91   TYR B CG  1 
ATOM 9431  C CD1 . TYR B 1 94   ? -24.718 70.944  25.965  1.00 65.67  ? 91   TYR B CD1 1 
ATOM 9432  C CD2 . TYR B 1 94   ? -25.094 73.289  25.689  1.00 65.34  ? 91   TYR B CD2 1 
ATOM 9433  C CE1 . TYR B 1 94   ? -23.588 71.206  26.731  1.00 65.54  ? 91   TYR B CE1 1 
ATOM 9434  C CE2 . TYR B 1 94   ? -23.970 73.561  26.451  1.00 65.85  ? 91   TYR B CE2 1 
ATOM 9435  C CZ  . TYR B 1 94   ? -23.221 72.520  26.970  1.00 65.73  ? 91   TYR B CZ  1 
ATOM 9436  O OH  . TYR B 1 94   ? -22.109 72.810  27.726  1.00 65.77  ? 91   TYR B OH  1 
ATOM 9437  N N   . LYS B 1 95   ? -28.528 71.988  27.668  1.00 67.23  ? 92   LYS B N   1 
ATOM 9438  C CA  . LYS B 1 95   ? -28.990 72.922  28.684  1.00 68.21  ? 92   LYS B CA  1 
ATOM 9439  C C   . LYS B 1 95   ? -27.917 73.198  29.732  1.00 68.68  ? 92   LYS B C   1 
ATOM 9440  O O   . LYS B 1 95   ? -27.576 72.330  30.535  1.00 68.80  ? 92   LYS B O   1 
ATOM 9441  C CB  . LYS B 1 95   ? -30.288 72.426  29.332  1.00 68.10  ? 92   LYS B CB  1 
ATOM 9442  C CG  . LYS B 1 95   ? -31.121 73.535  29.973  1.00 68.40  ? 92   LYS B CG  1 
ATOM 9443  C CD  . LYS B 1 95   ? -32.399 72.980  30.597  1.00 68.66  ? 92   LYS B CD  1 
ATOM 9444  C CE  . LYS B 1 95   ? -33.267 74.082  31.202  1.00 68.94  ? 92   LYS B CE  1 
ATOM 9445  N NZ  . LYS B 1 95   ? -34.639 73.599  31.560  1.00 68.83  ? 92   LYS B NZ  1 
ATOM 9446  N N   . GLN B 1 96   ? -27.381 74.414  29.704  1.00 69.37  ? 93   GLN B N   1 
ATOM 9447  C CA  . GLN B 1 96   ? -26.394 74.829  30.683  1.00 70.10  ? 93   GLN B CA  1 
ATOM 9448  C C   . GLN B 1 96   ? -27.096 75.482  31.862  1.00 70.65  ? 93   GLN B C   1 
ATOM 9449  O O   . GLN B 1 96   ? -28.020 76.284  31.684  1.00 70.80  ? 93   GLN B O   1 
ATOM 9450  C CB  . GLN B 1 96   ? -25.386 75.790  30.059  1.00 70.01  ? 93   GLN B CB  1 
ATOM 9451  C CG  . GLN B 1 96   ? -24.083 75.897  30.837  1.00 70.79  ? 93   GLN B CG  1 
ATOM 9452  C CD  . GLN B 1 96   ? -22.909 76.373  29.986  1.00 71.91  ? 93   GLN B CD  1 
ATOM 9453  O OE1 . GLN B 1 96   ? -23.086 77.082  28.994  1.00 72.51  ? 93   GLN B OE1 1 
ATOM 9454  N NE2 . GLN B 1 96   ? -21.699 75.987  30.382  1.00 72.11  ? 93   GLN B NE2 1 
ATOM 9455  N N   . SER B 1 97   ? -26.669 75.111  33.067  1.00 71.27  ? 94   SER B N   1 
ATOM 9456  C CA  . SER B 1 97   ? -27.142 75.752  34.291  1.00 71.82  ? 94   SER B CA  1 
ATOM 9457  C C   . SER B 1 97   ? -25.966 76.493  34.907  1.00 72.01  ? 94   SER B C   1 
ATOM 9458  O O   . SER B 1 97   ? -25.401 76.060  35.918  1.00 72.12  ? 94   SER B O   1 
ATOM 9459  C CB  . SER B 1 97   ? -27.712 74.724  35.270  1.00 71.91  ? 94   SER B CB  1 
ATOM 9460  O OG  . SER B 1 97   ? -28.624 73.849  34.623  1.00 72.82  ? 94   SER B OG  1 
ATOM 9461  N N   . GLY B 1 98   ? -25.589 77.598  34.262  1.00 72.21  ? 95   GLY B N   1 
ATOM 9462  C CA  . GLY B 1 98   ? -24.447 78.416  34.672  1.00 72.24  ? 95   GLY B CA  1 
ATOM 9463  C C   . GLY B 1 98   ? -23.105 77.745  34.431  1.00 72.25  ? 95   GLY B C   1 
ATOM 9464  O O   . GLY B 1 98   ? -22.380 78.100  33.501  1.00 72.28  ? 95   GLY B O   1 
ATOM 9465  N N   . GLU B 1 99   ? -22.781 76.770  35.279  1.00 72.22  ? 96   GLU B N   1 
ATOM 9466  C CA  . GLU B 1 99   ? -21.492 76.083  35.244  1.00 72.19  ? 96   GLU B CA  1 
ATOM 9467  C C   . GLU B 1 99   ? -21.665 74.586  35.050  1.00 71.90  ? 96   GLU B C   1 
ATOM 9468  O O   . GLU B 1 99   ? -20.724 73.901  34.652  1.00 72.03  ? 96   GLU B O   1 
ATOM 9469  C CB  . GLU B 1 99   ? -20.707 76.340  36.537  1.00 72.46  ? 96   GLU B CB  1 
ATOM 9470  C CG  . GLU B 1 99   ? -21.093 75.450  37.743  1.00 73.42  ? 96   GLU B CG  1 
ATOM 9471  C CD  . GLU B 1 99   ? -22.520 75.680  38.252  1.00 74.47  ? 96   GLU B CD  1 
ATOM 9472  O OE1 . GLU B 1 99   ? -22.807 76.786  38.777  1.00 74.52  ? 96   GLU B OE1 1 
ATOM 9473  O OE2 . GLU B 1 99   ? -23.343 74.739  38.138  1.00 74.40  ? 96   GLU B OE2 1 
ATOM 9474  N N   . SER B 1 100  ? -22.861 74.084  35.353  1.00 71.49  ? 97   SER B N   1 
ATOM 9475  C CA  . SER B 1 100  ? -23.165 72.660  35.220  1.00 71.03  ? 97   SER B CA  1 
ATOM 9476  C C   . SER B 1 100  ? -23.940 72.411  33.928  1.00 70.60  ? 97   SER B C   1 
ATOM 9477  O O   . SER B 1 100  ? -24.925 73.103  33.648  1.00 70.71  ? 97   SER B O   1 
ATOM 9478  C CB  . SER B 1 100  ? -23.960 72.171  36.433  1.00 71.09  ? 97   SER B CB  1 
ATOM 9479  O OG  . SER B 1 100  ? -23.976 70.758  36.493  1.00 71.09  ? 97   SER B OG  1 
ATOM 9480  N N   . ILE B 1 101  ? -23.496 71.431  33.144  1.00 69.84  ? 98   ILE B N   1 
ATOM 9481  C CA  . ILE B 1 101  ? -24.052 71.212  31.805  1.00 69.17  ? 98   ILE B CA  1 
ATOM 9482  C C   . ILE B 1 101  ? -24.871 69.921  31.682  1.00 68.95  ? 98   ILE B C   1 
ATOM 9483  O O   . ILE B 1 101  ? -24.604 68.944  32.384  1.00 68.91  ? 98   ILE B O   1 
ATOM 9484  C CB  . ILE B 1 101  ? -22.954 71.296  30.709  1.00 69.06  ? 98   ILE B CB  1 
ATOM 9485  C CG1 . ILE B 1 101  ? -22.121 69.996  30.619  1.00 68.93  ? 98   ILE B CG1 1 
ATOM 9486  C CG2 . ILE B 1 101  ? -22.103 72.551  30.893  1.00 68.72  ? 98   ILE B CG2 1 
ATOM 9487  C CD1 . ILE B 1 101  ? -21.121 69.727  31.741  1.00 68.23  ? 98   ILE B CD1 1 
ATOM 9488  N N   . ASP B 1 102  ? -25.869 69.934  30.792  1.00 68.64  ? 99   ASP B N   1 
ATOM 9489  C CA  . ASP B 1 102  ? -26.825 68.819  30.636  1.00 68.37  ? 99   ASP B CA  1 
ATOM 9490  C C   . ASP B 1 102  ? -27.286 68.626  29.183  1.00 67.97  ? 99   ASP B C   1 
ATOM 9491  O O   . ASP B 1 102  ? -27.761 69.577  28.550  1.00 68.05  ? 99   ASP B O   1 
ATOM 9492  C CB  . ASP B 1 102  ? -28.072 69.041  31.513  1.00 68.50  ? 99   ASP B CB  1 
ATOM 9493  C CG  . ASP B 1 102  ? -27.735 69.293  32.977  1.00 69.06  ? 99   ASP B CG  1 
ATOM 9494  O OD1 . ASP B 1 102  ? -27.070 68.425  33.580  1.00 70.40  ? 99   ASP B OD1 1 
ATOM 9495  O OD2 . ASP B 1 102  ? -28.139 70.349  33.525  1.00 68.67  ? 99   ASP B OD2 1 
ATOM 9496  N N   . ILE B 1 103  ? -27.145 67.398  28.669  1.00 67.28  ? 100  ILE B N   1 
ATOM 9497  C CA  . ILE B 1 103  ? -27.720 67.001  27.374  1.00 66.43  ? 100  ILE B CA  1 
ATOM 9498  C C   . ILE B 1 103  ? -29.064 66.324  27.636  1.00 66.04  ? 100  ILE B C   1 
ATOM 9499  O O   . ILE B 1 103  ? -29.124 65.142  27.995  1.00 65.91  ? 100  ILE B O   1 
ATOM 9500  C CB  . ILE B 1 103  ? -26.786 66.054  26.569  1.00 66.41  ? 100  ILE B CB  1 
ATOM 9501  C CG1 . ILE B 1 103  ? -25.472 66.754  26.222  1.00 66.49  ? 100  ILE B CG1 1 
ATOM 9502  C CG2 . ILE B 1 103  ? -27.452 65.587  25.276  1.00 66.30  ? 100  ILE B CG2 1 
ATOM 9503  C CD1 . ILE B 1 103  ? -24.613 65.990  25.235  1.00 66.29  ? 100  ILE B CD1 1 
ATOM 9504  N N   . ILE B 1 104  ? -30.139 67.085  27.456  1.00 65.54  ? 101  ILE B N   1 
ATOM 9505  C CA  . ILE B 1 104  ? -31.471 66.662  27.886  1.00 65.10  ? 101  ILE B CA  1 
ATOM 9506  C C   . ILE B 1 104  ? -32.285 66.041  26.748  1.00 64.71  ? 101  ILE B C   1 
ATOM 9507  O O   . ILE B 1 104  ? -31.948 66.214  25.579  1.00 64.63  ? 101  ILE B O   1 
ATOM 9508  C CB  . ILE B 1 104  ? -32.223 67.834  28.560  1.00 65.14  ? 101  ILE B CB  1 
ATOM 9509  C CG1 . ILE B 1 104  ? -33.109 67.312  29.688  1.00 65.25  ? 101  ILE B CG1 1 
ATOM 9510  C CG2 . ILE B 1 104  ? -32.988 68.678  27.528  1.00 65.14  ? 101  ILE B CG2 1 
ATOM 9511  C CD1 . ILE B 1 104  ? -33.351 68.329  30.784  1.00 66.32  ? 101  ILE B CD1 1 
ATOM 9512  N N   . THR B 1 105  ? -33.348 65.316  27.095  1.00 64.23  ? 102  THR B N   1 
ATOM 9513  C CA  . THR B 1 105  ? -34.136 64.579  26.103  1.00 63.70  ? 102  THR B CA  1 
ATOM 9514  C C   . THR B 1 105  ? -35.512 65.204  25.895  1.00 63.15  ? 102  THR B C   1 
ATOM 9515  O O   . THR B 1 105  ? -36.437 64.948  26.665  1.00 63.11  ? 102  THR B O   1 
ATOM 9516  C CB  . THR B 1 105  ? -34.320 63.093  26.497  1.00 63.79  ? 102  THR B CB  1 
ATOM 9517  O OG1 . THR B 1 105  ? -33.238 62.662  27.335  1.00 64.04  ? 102  THR B OG1 1 
ATOM 9518  C CG2 . THR B 1 105  ? -34.388 62.214  25.252  1.00 63.75  ? 102  THR B CG2 1 
ATOM 9519  N N   . ARG B 1 106  ? -35.641 66.008  24.844  1.00 62.47  ? 103  ARG B N   1 
ATOM 9520  C CA  . ARG B 1 106  ? -36.886 66.722  24.560  1.00 61.99  ? 103  ARG B CA  1 
ATOM 9521  C C   . ARG B 1 106  ? -38.020 65.811  24.061  1.00 61.77  ? 103  ARG B C   1 
ATOM 9522  O O   . ARG B 1 106  ? -39.206 66.152  24.180  1.00 61.82  ? 103  ARG B O   1 
ATOM 9523  C CB  . ARG B 1 106  ? -36.630 67.879  23.590  1.00 61.92  ? 103  ARG B CB  1 
ATOM 9524  C CG  . ARG B 1 106  ? -35.949 69.078  24.241  1.00 61.65  ? 103  ARG B CG  1 
ATOM 9525  C CD  . ARG B 1 106  ? -36.946 69.982  24.954  1.00 61.24  ? 103  ARG B CD  1 
ATOM 9526  N NE  . ARG B 1 106  ? -37.191 71.247  24.257  1.00 61.45  ? 103  ARG B NE  1 
ATOM 9527  C CZ  . ARG B 1 106  ? -37.849 71.382  23.104  1.00 61.90  ? 103  ARG B CZ  1 
ATOM 9528  N NH1 . ARG B 1 106  ? -38.331 70.321  22.464  1.00 62.36  ? 103  ARG B NH1 1 
ATOM 9529  N NH2 . ARG B 1 106  ? -38.014 72.590  22.577  1.00 61.62  ? 103  ARG B NH2 1 
ATOM 9530  N N   . ALA B 1 107  ? -37.642 64.660  23.509  1.00 61.23  ? 104  ALA B N   1 
ATOM 9531  C CA  . ALA B 1 107  ? -38.580 63.615  23.114  1.00 60.82  ? 104  ALA B CA  1 
ATOM 9532  C C   . ALA B 1 107  ? -37.768 62.397  22.746  1.00 60.64  ? 104  ALA B C   1 
ATOM 9533  O O   . ALA B 1 107  ? -36.647 62.530  22.273  1.00 60.71  ? 104  ALA B O   1 
ATOM 9534  C CB  . ALA B 1 107  ? -39.404 64.054  21.935  1.00 60.88  ? 104  ALA B CB  1 
ATOM 9535  N N   . HIS B 1 108  ? -38.325 61.214  22.971  1.00 60.44  ? 105  HIS B N   1 
ATOM 9536  C CA  . HIS B 1 108  ? -37.656 59.970  22.611  1.00 60.32  ? 105  HIS B CA  1 
ATOM 9537  C C   . HIS B 1 108  ? -38.691 58.940  22.199  1.00 60.44  ? 105  HIS B C   1 
ATOM 9538  O O   . HIS B 1 108  ? -39.874 59.246  22.154  1.00 60.75  ? 105  HIS B O   1 
ATOM 9539  C CB  . HIS B 1 108  ? -36.826 59.456  23.786  1.00 60.27  ? 105  HIS B CB  1 
ATOM 9540  C CG  . HIS B 1 108  ? -37.626 58.755  24.837  1.00 60.19  ? 105  HIS B CG  1 
ATOM 9541  N ND1 . HIS B 1 108  ? -38.628 59.377  25.550  1.00 60.30  ? 105  HIS B ND1 1 
ATOM 9542  C CD2 . HIS B 1 108  ? -37.568 57.484  25.300  1.00 60.13  ? 105  HIS B CD2 1 
ATOM 9543  C CE1 . HIS B 1 108  ? -39.155 58.518  26.405  1.00 60.53  ? 105  HIS B CE1 1 
ATOM 9544  N NE2 . HIS B 1 108  ? -38.529 57.362  26.274  1.00 60.39  ? 105  HIS B NE2 1 
ATOM 9545  N N   . GLY B 1 109  ? -38.254 57.723  21.902  1.00 60.41  ? 106  GLY B N   1 
ATOM 9546  C CA  . GLY B 1 109  ? -39.183 56.638  21.602  1.00 60.48  ? 106  GLY B CA  1 
ATOM 9547  C C   . GLY B 1 109  ? -38.623 55.764  20.511  1.00 60.56  ? 106  GLY B C   1 
ATOM 9548  O O   . GLY B 1 109  ? -38.070 56.274  19.540  1.00 60.61  ? 106  GLY B O   1 
ATOM 9549  N N   . ASN B 1 110  ? -38.763 54.449  20.670  1.00 60.62  ? 107  ASN B N   1 
ATOM 9550  C CA  . ASN B 1 110  ? -38.181 53.494  19.729  1.00 60.61  ? 107  ASN B CA  1 
ATOM 9551  C C   . ASN B 1 110  ? -38.990 53.358  18.456  1.00 60.61  ? 107  ASN B C   1 
ATOM 9552  O O   . ASN B 1 110  ? -40.201 53.165  18.518  1.00 60.56  ? 107  ASN B O   1 
ATOM 9553  C CB  . ASN B 1 110  ? -38.013 52.129  20.381  1.00 60.68  ? 107  ASN B CB  1 
ATOM 9554  C CG  . ASN B 1 110  ? -37.780 51.037  19.369  1.00 60.68  ? 107  ASN B CG  1 
ATOM 9555  O OD1 . ASN B 1 110  ? -38.718 50.561  18.729  1.00 60.67  ? 107  ASN B OD1 1 
ATOM 9556  N ND2 . ASN B 1 110  ? -36.526 50.638  19.209  1.00 61.02  ? 107  ASN B ND2 1 
ATOM 9557  N N   . VAL B 1 111  ? -38.308 53.416  17.313  1.00 60.83  ? 108  VAL B N   1 
ATOM 9558  C CA  . VAL B 1 111  ? -38.975 53.492  16.008  1.00 61.28  ? 108  VAL B CA  1 
ATOM 9559  C C   . VAL B 1 111  ? -38.687 52.347  15.033  1.00 61.92  ? 108  VAL B C   1 
ATOM 9560  O O   . VAL B 1 111  ? -38.575 52.576  13.827  1.00 62.19  ? 108  VAL B O   1 
ATOM 9561  C CB  . VAL B 1 111  ? -38.689 54.826  15.287  1.00 60.96  ? 108  VAL B CB  1 
ATOM 9562  C CG1 . VAL B 1 111  ? -39.477 55.949  15.914  1.00 61.16  ? 108  VAL B CG1 1 
ATOM 9563  C CG2 . VAL B 1 111  ? -37.213 55.131  15.290  1.00 60.62  ? 108  VAL B CG2 1 
ATOM 9564  N N   . GLN B 1 112  ? -38.592 51.121  15.538  1.00 62.56  ? 109  GLN B N   1 
ATOM 9565  C CA  . GLN B 1 112  ? -38.444 49.956  14.667  1.00 63.22  ? 109  GLN B CA  1 
ATOM 9566  C C   . GLN B 1 112  ? -39.809 49.523  14.136  1.00 63.95  ? 109  GLN B C   1 
ATOM 9567  O O   . GLN B 1 112  ? -40.779 50.266  14.255  1.00 64.13  ? 109  GLN B O   1 
ATOM 9568  C CB  . GLN B 1 112  ? -37.778 48.812  15.423  1.00 63.10  ? 109  GLN B CB  1 
ATOM 9569  C CG  . GLN B 1 112  ? -38.558 48.341  16.631  1.00 62.74  ? 109  GLN B CG  1 
ATOM 9570  C CD  . GLN B 1 112  ? -37.951 47.129  17.271  1.00 62.00  ? 109  GLN B CD  1 
ATOM 9571  O OE1 . GLN B 1 112  ? -36.755 47.099  17.569  1.00 61.98  ? 109  GLN B OE1 1 
ATOM 9572  N NE2 . GLN B 1 112  ? -38.773 46.113  17.493  1.00 61.72  ? 109  GLN B NE2 1 
ATOM 9573  N N   . ASP B 1 113  ? -39.872 48.332  13.539  1.00 64.93  ? 110  ASP B N   1 
ATOM 9574  C CA  . ASP B 1 113  ? -41.135 47.673  13.164  1.00 65.77  ? 110  ASP B CA  1 
ATOM 9575  C C   . ASP B 1 113  ? -40.956 46.162  13.183  1.00 66.39  ? 110  ASP B C   1 
ATOM 9576  O O   . ASP B 1 113  ? -39.845 45.660  12.990  1.00 66.57  ? 110  ASP B O   1 
ATOM 9577  C CB  . ASP B 1 113  ? -41.610 48.111  11.774  1.00 65.77  ? 110  ASP B CB  1 
ATOM 9578  C CG  . ASP B 1 113  ? -42.579 49.283  11.820  1.00 66.00  ? 110  ASP B CG  1 
ATOM 9579  O OD1 . ASP B 1 113  ? -42.208 50.363  11.307  1.00 65.82  ? 110  ASP B OD1 1 
ATOM 9580  O OD2 . ASP B 1 113  ? -43.705 49.126  12.356  1.00 66.13  ? 110  ASP B OD2 1 
ATOM 9581  N N   . ARG B 1 114  ? -42.050 45.442  13.413  1.00 67.20  ? 111  ARG B N   1 
ATOM 9582  C CA  . ARG B 1 114  ? -42.035 43.982  13.412  1.00 68.16  ? 111  ARG B CA  1 
ATOM 9583  C C   . ARG B 1 114  ? -41.578 43.443  12.043  1.00 68.58  ? 111  ARG B C   1 
ATOM 9584  O O   . ARG B 1 114  ? -40.812 42.475  11.961  1.00 68.60  ? 111  ARG B O   1 
ATOM 9585  C CB  . ARG B 1 114  ? -43.429 43.452  13.772  1.00 68.29  ? 111  ARG B CB  1 
ATOM 9586  C CG  . ARG B 1 114  ? -43.439 42.099  14.476  1.00 69.43  ? 111  ARG B CG  1 
ATOM 9587  C CD  . ARG B 1 114  ? -43.207 42.234  15.983  1.00 71.14  ? 111  ARG B CD  1 
ATOM 9588  N NE  . ARG B 1 114  ? -44.451 42.222  16.762  1.00 71.96  ? 111  ARG B NE  1 
ATOM 9589  C CZ  . ARG B 1 114  ? -44.518 42.378  18.086  1.00 72.37  ? 111  ARG B CZ  1 
ATOM 9590  N NH1 . ARG B 1 114  ? -43.413 42.572  18.804  1.00 72.32  ? 111  ARG B NH1 1 
ATOM 9591  N NH2 . ARG B 1 114  ? -45.698 42.344  18.699  1.00 72.24  ? 111  ARG B NH2 1 
ATOM 9592  N N   . ILE B 1 115  ? -42.033 44.114  10.982  1.00 69.16  ? 112  ILE B N   1 
ATOM 9593  C CA  . ILE B 1 115  ? -41.804 43.713  9.587   1.00 69.50  ? 112  ILE B CA  1 
ATOM 9594  C C   . ILE B 1 115  ? -40.759 44.587  8.892   1.00 69.78  ? 112  ILE B C   1 
ATOM 9595  O O   . ILE B 1 115  ? -40.655 45.793  9.155   1.00 69.81  ? 112  ILE B O   1 
ATOM 9596  C CB  . ILE B 1 115  ? -43.115 43.795  8.749   1.00 69.42  ? 112  ILE B CB  1 
ATOM 9597  C CG1 . ILE B 1 115  ? -44.292 43.162  9.498   1.00 69.56  ? 112  ILE B CG1 1 
ATOM 9598  C CG2 . ILE B 1 115  ? -42.935 43.160  7.366   1.00 69.39  ? 112  ILE B CG2 1 
ATOM 9599  C CD1 . ILE B 1 115  ? -45.020 44.132  10.416  1.00 69.93  ? 112  ILE B CD1 1 
ATOM 9600  N N   . GLY B 1 116  ? -39.999 43.965  7.992   1.00 70.06  ? 113  GLY B N   1 
ATOM 9601  C CA  . GLY B 1 116  ? -39.092 44.687  7.109   1.00 70.22  ? 113  GLY B CA  1 
ATOM 9602  C C   . GLY B 1 116  ? -37.660 44.218  7.202   1.00 70.26  ? 113  GLY B C   1 
ATOM 9603  O O   . GLY B 1 116  ? -37.082 44.167  8.286   1.00 70.24  ? 113  GLY B O   1 
ATOM 9604  N N   . ARG B 1 117  ? -37.094 43.871  6.054   1.00 70.40  ? 114  ARG B N   1 
ATOM 9605  C CA  . ARG B 1 117  ? -35.684 43.538  5.961   1.00 70.78  ? 114  ARG B CA  1 
ATOM 9606  C C   . ARG B 1 117  ? -34.851 44.831  5.991   1.00 70.51  ? 114  ARG B C   1 
ATOM 9607  O O   . ARG B 1 117  ? -35.149 45.775  5.249   1.00 70.45  ? 114  ARG B O   1 
ATOM 9608  C CB  . ARG B 1 117  ? -35.439 42.720  4.686   1.00 70.82  ? 114  ARG B CB  1 
ATOM 9609  C CG  . ARG B 1 117  ? -33.994 42.697  4.162   1.00 71.72  ? 114  ARG B CG  1 
ATOM 9610  C CD  . ARG B 1 117  ? -33.885 41.986  2.796   1.00 71.67  ? 114  ARG B CD  1 
ATOM 9611  N NE  . ARG B 1 117  ? -35.061 42.216  1.948   1.00 73.14  ? 114  ARG B NE  1 
ATOM 9612  C CZ  . ARG B 1 117  ? -35.095 42.058  0.626   1.00 73.19  ? 114  ARG B CZ  1 
ATOM 9613  N NH1 . ARG B 1 117  ? -34.012 41.675  -0.041  1.00 73.54  ? 114  ARG B NH1 1 
ATOM 9614  N NH2 . ARG B 1 117  ? -36.221 42.296  -0.031  1.00 73.23  ? 114  ARG B NH2 1 
ATOM 9615  N N   . PRO B 1 118  ? -33.812 44.885  6.858   1.00 70.38  ? 115  PRO B N   1 
ATOM 9616  C CA  . PRO B 1 118  ? -32.958 46.077  6.910   1.00 70.16  ? 115  PRO B CA  1 
ATOM 9617  C C   . PRO B 1 118  ? -32.164 46.180  5.611   1.00 69.98  ? 115  PRO B C   1 
ATOM 9618  O O   . PRO B 1 118  ? -31.215 45.428  5.403   1.00 70.14  ? 115  PRO B O   1 
ATOM 9619  C CB  . PRO B 1 118  ? -32.024 45.807  8.101   1.00 70.09  ? 115  PRO B CB  1 
ATOM 9620  C CG  . PRO B 1 118  ? -32.604 44.637  8.821   1.00 70.09  ? 115  PRO B CG  1 
ATOM 9621  C CD  . PRO B 1 118  ? -33.358 43.849  7.805   1.00 70.31  ? 115  PRO B CD  1 
ATOM 9622  N N   . SER B 1 119  ? -32.569 47.098  4.743   1.00 69.67  ? 116  SER B N   1 
ATOM 9623  C CA  . SER B 1 119  ? -32.081 47.135  3.371   1.00 69.38  ? 116  SER B CA  1 
ATOM 9624  C C   . SER B 1 119  ? -30.586 47.404  3.217   1.00 69.31  ? 116  SER B C   1 
ATOM 9625  O O   . SER B 1 119  ? -29.898 47.788  4.172   1.00 69.13  ? 116  SER B O   1 
ATOM 9626  C CB  . SER B 1 119  ? -32.883 48.150  2.548   1.00 69.46  ? 116  SER B CB  1 
ATOM 9627  O OG  . SER B 1 119  ? -32.902 49.415  3.179   1.00 69.04  ? 116  SER B OG  1 
ATOM 9628  N N   . GLU B 1 120  ? -30.114 47.162  1.991   1.00 69.22  ? 117  GLU B N   1 
ATOM 9629  C CA  . GLU B 1 120  ? -28.814 47.597  1.469   1.00 68.93  ? 117  GLU B CA  1 
ATOM 9630  C C   . GLU B 1 120  ? -28.589 49.086  1.749   1.00 68.46  ? 117  GLU B C   1 
ATOM 9631  O O   . GLU B 1 120  ? -29.529 49.882  1.682   1.00 68.63  ? 117  GLU B O   1 
ATOM 9632  C CB  . GLU B 1 120  ? -28.816 47.351  -0.048  1.00 69.16  ? 117  GLU B CB  1 
ATOM 9633  C CG  . GLU B 1 120  ? -27.590 47.827  -0.835  1.00 69.95  ? 117  GLU B CG  1 
ATOM 9634  C CD  . GLU B 1 120  ? -26.681 46.689  -1.292  1.00 70.35  ? 117  GLU B CD  1 
ATOM 9635  O OE1 . GLU B 1 120  ? -25.923 46.151  -0.455  1.00 70.65  ? 117  GLU B OE1 1 
ATOM 9636  O OE2 . GLU B 1 120  ? -26.715 46.348  -2.496  1.00 70.12  ? 117  GLU B OE2 1 
ATOM 9637  N N   . THR B 1 121  ? -27.348 49.460  2.049   1.00 67.74  ? 118  THR B N   1 
ATOM 9638  C CA  . THR B 1 121  ? -26.979 50.861  2.348   1.00 67.07  ? 118  THR B CA  1 
ATOM 9639  C C   . THR B 1 121  ? -27.356 51.280  3.779   1.00 66.50  ? 118  THR B C   1 
ATOM 9640  O O   . THR B 1 121  ? -27.036 52.393  4.211   1.00 66.52  ? 118  THR B O   1 
ATOM 9641  C CB  . THR B 1 121  ? -27.551 51.895  1.305   1.00 67.12  ? 118  THR B CB  1 
ATOM 9642  O OG1 . THR B 1 121  ? -27.587 51.316  -0.006  1.00 66.59  ? 118  THR B OG1 1 
ATOM 9643  C CG2 . THR B 1 121  ? -26.706 53.176  1.268   1.00 67.24  ? 118  THR B CG2 1 
ATOM 9644  N N   . GLY B 1 122  ? -28.025 50.384  4.503   1.00 65.81  ? 119  GLY B N   1 
ATOM 9645  C CA  . GLY B 1 122  ? -28.409 50.617  5.901   1.00 64.99  ? 119  GLY B CA  1 
ATOM 9646  C C   . GLY B 1 122  ? -29.386 51.767  6.100   1.00 64.34  ? 119  GLY B C   1 
ATOM 9647  O O   . GLY B 1 122  ? -30.103 52.153  5.173   1.00 64.41  ? 119  GLY B O   1 
ATOM 9648  N N   . ILE B 1 123  ? -29.398 52.319  7.311   1.00 63.45  ? 120  ILE B N   1 
ATOM 9649  C CA  . ILE B 1 123  ? -30.302 53.407  7.678   1.00 62.56  ? 120  ILE B CA  1 
ATOM 9650  C C   . ILE B 1 123  ? -30.033 54.702  6.902   1.00 62.39  ? 120  ILE B C   1 
ATOM 9651  O O   . ILE B 1 123  ? -28.908 54.959  6.470   1.00 62.33  ? 120  ILE B O   1 
ATOM 9652  C CB  . ILE B 1 123  ? -30.227 53.693  9.191   1.00 62.41  ? 120  ILE B CB  1 
ATOM 9653  C CG1 . ILE B 1 123  ? -30.341 52.391  9.990   1.00 62.45  ? 120  ILE B CG1 1 
ATOM 9654  C CG2 . ILE B 1 123  ? -31.315 54.658  9.604   1.00 62.20  ? 120  ILE B CG2 1 
ATOM 9655  C CD1 . ILE B 1 123  ? -30.170 52.533  11.503  1.00 62.35  ? 120  ILE B CD1 1 
ATOM 9656  N N   . ILE B 1 124  ? -31.096 55.481  6.703   1.00 62.20  ? 121  ILE B N   1 
ATOM 9657  C CA  . ILE B 1 124  ? -31.037 56.867  6.231   1.00 62.14  ? 121  ILE B CA  1 
ATOM 9658  C C   . ILE B 1 124  ? -32.041 57.706  7.033   1.00 62.25  ? 121  ILE B C   1 
ATOM 9659  O O   . ILE B 1 124  ? -33.255 57.481  6.951   1.00 62.44  ? 121  ILE B O   1 
ATOM 9660  C CB  . ILE B 1 124  ? -31.401 57.009  4.727   1.00 61.91  ? 121  ILE B CB  1 
ATOM 9661  C CG1 . ILE B 1 124  ? -30.353 56.367  3.834   1.00 62.33  ? 121  ILE B CG1 1 
ATOM 9662  C CG2 . ILE B 1 124  ? -31.521 58.467  4.328   1.00 61.77  ? 121  ILE B CG2 1 
ATOM 9663  C CD1 . ILE B 1 124  ? -30.756 55.027  3.308   1.00 63.42  ? 121  ILE B CD1 1 
ATOM 9664  N N   . GLY B 1 125  ? -31.545 58.661  7.811   1.00 62.18  ? 122  GLY B N   1 
ATOM 9665  C CA  . GLY B 1 125  ? -32.420 59.640  8.447   1.00 62.30  ? 122  GLY B CA  1 
ATOM 9666  C C   . GLY B 1 125  ? -32.310 60.963  7.716   1.00 62.49  ? 122  GLY B C   1 
ATOM 9667  O O   . GLY B 1 125  ? -31.226 61.331  7.271   1.00 62.64  ? 122  GLY B O   1 
ATOM 9668  N N   . ILE B 1 126  ? -33.426 61.672  7.569   1.00 62.59  ? 123  ILE B N   1 
ATOM 9669  C CA  . ILE B 1 126  ? -33.420 62.988  6.927   1.00 62.88  ? 123  ILE B CA  1 
ATOM 9670  C C   . ILE B 1 126  ? -34.500 63.913  7.487   1.00 63.26  ? 123  ILE B C   1 
ATOM 9671  O O   . ILE B 1 126  ? -35.564 63.452  7.900   1.00 63.07  ? 123  ILE B O   1 
ATOM 9672  C CB  . ILE B 1 126  ? -33.539 62.907  5.376   1.00 62.80  ? 123  ILE B CB  1 
ATOM 9673  C CG1 . ILE B 1 126  ? -34.372 61.699  4.950   1.00 62.79  ? 123  ILE B CG1 1 
ATOM 9674  C CG2 . ILE B 1 126  ? -32.162 62.860  4.722   1.00 62.77  ? 123  ILE B CG2 1 
ATOM 9675  C CD1 . ILE B 1 126  ? -34.837 61.754  3.510   1.00 62.77  ? 123  ILE B CD1 1 
ATOM 9676  N N   . ILE B 1 127  ? -34.209 65.217  7.502   1.00 63.89  ? 124  ILE B N   1 
ATOM 9677  C CA  . ILE B 1 127  ? -35.141 66.225  8.020   1.00 64.56  ? 124  ILE B CA  1 
ATOM 9678  C C   . ILE B 1 127  ? -35.449 67.322  6.993   1.00 65.23  ? 124  ILE B C   1 
ATOM 9679  O O   . ILE B 1 127  ? -34.542 67.990  6.499   1.00 65.43  ? 124  ILE B O   1 
ATOM 9680  C CB  . ILE B 1 127  ? -34.616 66.864  9.320   1.00 64.40  ? 124  ILE B CB  1 
ATOM 9681  C CG1 . ILE B 1 127  ? -34.388 65.789  10.377  1.00 64.65  ? 124  ILE B CG1 1 
ATOM 9682  C CG2 . ILE B 1 127  ? -35.615 67.868  9.871   1.00 64.45  ? 124  ILE B CG2 1 
ATOM 9683  C CD1 . ILE B 1 127  ? -33.412 66.190  11.455  1.00 65.03  ? 124  ILE B CD1 1 
ATOM 9684  N N   . ASP B 1 128  ? -36.737 67.493  6.691   1.00 65.94  ? 125  ASP B N   1 
ATOM 9685  C CA  . ASP B 1 128  ? -37.241 68.524  5.779   1.00 66.64  ? 125  ASP B CA  1 
ATOM 9686  C C   . ASP B 1 128  ? -36.903 69.939  6.277   1.00 66.87  ? 125  ASP B C   1 
ATOM 9687  O O   . ASP B 1 128  ? -37.132 70.238  7.447   1.00 67.10  ? 125  ASP B O   1 
ATOM 9688  C CB  . ASP B 1 128  ? -38.759 68.344  5.638   1.00 66.88  ? 125  ASP B CB  1 
ATOM 9689  C CG  . ASP B 1 128  ? -39.447 69.509  4.916   1.00 68.29  ? 125  ASP B CG  1 
ATOM 9690  O OD1 . ASP B 1 128  ? -38.965 69.945  3.841   1.00 69.51  ? 125  ASP B OD1 1 
ATOM 9691  O OD2 . ASP B 1 128  ? -40.502 69.971  5.418   1.00 69.36  ? 125  ASP B OD2 1 
ATOM 9692  N N   . PRO B 1 129  ? -36.350 70.807  5.395   1.00 67.06  ? 126  PRO B N   1 
ATOM 9693  C CA  . PRO B 1 129  ? -35.995 72.214  5.695   1.00 67.21  ? 126  PRO B CA  1 
ATOM 9694  C C   . PRO B 1 129  ? -37.046 73.032  6.462   1.00 67.39  ? 126  PRO B C   1 
ATOM 9695  O O   . PRO B 1 129  ? -36.689 73.980  7.169   1.00 67.18  ? 126  PRO B O   1 
ATOM 9696  C CB  . PRO B 1 129  ? -35.757 72.835  4.306   1.00 67.14  ? 126  PRO B CB  1 
ATOM 9697  C CG  . PRO B 1 129  ? -36.063 71.760  3.302   1.00 67.14  ? 126  PRO B CG  1 
ATOM 9698  C CD  . PRO B 1 129  ? -35.981 70.450  4.015   1.00 67.05  ? 126  PRO B CD  1 
ATOM 9699  N N   . GLU B 1 130  ? -38.317 72.671  6.313   1.00 67.79  ? 127  GLU B N   1 
ATOM 9700  C CA  . GLU B 1 130  ? -39.400 73.277  7.092   1.00 68.46  ? 127  GLU B CA  1 
ATOM 9701  C C   . GLU B 1 130  ? -39.449 72.758  8.540   1.00 68.56  ? 127  GLU B C   1 
ATOM 9702  O O   . GLU B 1 130  ? -40.002 73.430  9.424   1.00 68.69  ? 127  GLU B O   1 
ATOM 9703  C CB  . GLU B 1 130  ? -40.759 73.010  6.433   1.00 68.54  ? 127  GLU B CB  1 
ATOM 9704  C CG  . GLU B 1 130  ? -41.078 73.812  5.177   1.00 68.88  ? 127  GLU B CG  1 
ATOM 9705  C CD  . GLU B 1 130  ? -42.403 73.383  4.549   1.00 68.95  ? 127  GLU B CD  1 
ATOM 9706  O OE1 . GLU B 1 130  ? -42.361 72.700  3.498   1.00 69.96  ? 127  GLU B OE1 1 
ATOM 9707  O OE2 . GLU B 1 130  ? -43.479 73.706  5.111   1.00 68.60  ? 127  GLU B OE2 1 
ATOM 9708  N N   . CYS B 1 131  ? -38.890 71.564  8.765   1.00 68.49  ? 128  CYS B N   1 
ATOM 9709  C CA  . CYS B 1 131  ? -38.947 70.870  10.056  1.00 68.53  ? 128  CYS B CA  1 
ATOM 9710  C C   . CYS B 1 131  ? -40.371 70.459  10.406  1.00 68.57  ? 128  CYS B C   1 
ATOM 9711  O O   . CYS B 1 131  ? -40.732 70.348  11.584  1.00 68.62  ? 128  CYS B O   1 
ATOM 9712  C CB  . CYS B 1 131  ? -38.360 71.729  11.177  1.00 68.56  ? 128  CYS B CB  1 
ATOM 9713  S SG  . CYS B 1 131  ? -36.576 71.875  11.154  1.00 69.35  ? 128  CYS B SG  1 
ATOM 9714  N N   . ARG B 1 132  ? -41.180 70.237  9.375   1.00 68.60  ? 129  ARG B N   1 
ATOM 9715  C CA  . ARG B 1 132  ? -42.574 69.834  9.561   1.00 68.60  ? 129  ARG B CA  1 
ATOM 9716  C C   . ARG B 1 132  ? -42.666 68.343  9.880   1.00 68.22  ? 129  ARG B C   1 
ATOM 9717  O O   . ARG B 1 132  ? -43.714 67.856  10.321  1.00 68.31  ? 129  ARG B O   1 
ATOM 9718  C CB  . ARG B 1 132  ? -43.394 70.166  8.309   1.00 68.79  ? 129  ARG B CB  1 
ATOM 9719  C CG  . ARG B 1 132  ? -43.715 71.651  8.132   1.00 69.49  ? 129  ARG B CG  1 
ATOM 9720  C CD  . ARG B 1 132  ? -45.101 72.018  8.678   1.00 70.74  ? 129  ARG B CD  1 
ATOM 9721  N NE  . ARG B 1 132  ? -46.165 71.170  8.132   1.00 71.60  ? 129  ARG B NE  1 
ATOM 9722  C CZ  . ARG B 1 132  ? -46.586 71.189  6.867   1.00 72.12  ? 129  ARG B CZ  1 
ATOM 9723  N NH1 . ARG B 1 132  ? -46.033 72.013  5.980   1.00 72.54  ? 129  ARG B NH1 1 
ATOM 9724  N NH2 . ARG B 1 132  ? -47.560 70.374  6.484   1.00 72.11  ? 129  ARG B NH2 1 
ATOM 9725  N N   . MET B 1 133  ? -41.549 67.643  9.660   1.00 67.56  ? 130  MET B N   1 
ATOM 9726  C CA  . MET B 1 133  ? -41.457 66.191  9.780   1.00 66.92  ? 130  MET B CA  1 
ATOM 9727  C C   . MET B 1 133  ? -40.004 65.727  9.731   1.00 66.20  ? 130  MET B C   1 
ATOM 9728  O O   . MET B 1 133  ? -39.144 66.405  9.163   1.00 66.17  ? 130  MET B O   1 
ATOM 9729  C CB  . MET B 1 133  ? -42.222 65.517  8.642   1.00 66.78  ? 130  MET B CB  1 
ATOM 9730  C CG  . MET B 1 133  ? -41.848 66.045  7.257   1.00 67.27  ? 130  MET B CG  1 
ATOM 9731  S SD  . MET B 1 133  ? -42.057 64.848  5.921   1.00 67.78  ? 130  MET B SD  1 
ATOM 9732  C CE  . MET B 1 133  ? -43.833 64.635  5.952   1.00 68.93  ? 130  MET B CE  1 
ATOM 9733  N N   . ILE B 1 134  ? -39.743 64.573  10.339  1.00 65.47  ? 131  ILE B N   1 
ATOM 9734  C CA  . ILE B 1 134  ? -38.506 63.828  10.118  1.00 64.69  ? 131  ILE B CA  1 
ATOM 9735  C C   . ILE B 1 134  ? -38.844 62.608  9.264   1.00 64.27  ? 131  ILE B C   1 
ATOM 9736  O O   . ILE B 1 134  ? -39.882 61.961  9.461   1.00 64.25  ? 131  ILE B O   1 
ATOM 9737  C CB  . ILE B 1 134  ? -37.850 63.366  11.435  1.00 64.63  ? 131  ILE B CB  1 
ATOM 9738  C CG1 . ILE B 1 134  ? -37.419 64.567  12.268  1.00 64.62  ? 131  ILE B CG1 1 
ATOM 9739  C CG2 . ILE B 1 134  ? -36.634 62.489  11.162  1.00 64.54  ? 131  ILE B CG2 1 
ATOM 9740  C CD1 . ILE B 1 134  ? -36.999 64.214  13.682  1.00 64.39  ? 131  ILE B CD1 1 
ATOM 9741  N N   . GLY B 1 135  ? -37.973 62.317  8.304   1.00 63.64  ? 132  GLY B N   1 
ATOM 9742  C CA  . GLY B 1 135  ? -38.111 61.139  7.461   1.00 62.79  ? 132  GLY B CA  1 
ATOM 9743  C C   . GLY B 1 135  ? -37.048 60.106  7.773   1.00 62.15  ? 132  GLY B C   1 
ATOM 9744  O O   . GLY B 1 135  ? -35.967 60.437  8.266   1.00 62.08  ? 132  GLY B O   1 
ATOM 9745  N N   . LEU B 1 136  ? -37.367 58.851  7.480   1.00 61.57  ? 133  LEU B N   1 
ATOM 9746  C CA  . LEU B 1 136  ? -36.484 57.722  7.748   1.00 61.04  ? 133  LEU B CA  1 
ATOM 9747  C C   . LEU B 1 136  ? -36.663 56.639  6.690   1.00 60.77  ? 133  LEU B C   1 
ATOM 9748  O O   . LEU B 1 136  ? -37.796 56.339  6.279   1.00 60.90  ? 133  LEU B O   1 
ATOM 9749  C CB  . LEU B 1 136  ? -36.799 57.108  9.118   1.00 60.84  ? 133  LEU B CB  1 
ATOM 9750  C CG  . LEU B 1 136  ? -36.055 57.519  10.384  1.00 60.46  ? 133  LEU B CG  1 
ATOM 9751  C CD1 . LEU B 1 136  ? -36.451 58.881  10.899  1.00 60.55  ? 133  LEU B CD1 1 
ATOM 9752  C CD2 . LEU B 1 136  ? -36.355 56.517  11.437  1.00 60.37  ? 133  LEU B CD2 1 
ATOM 9753  N N   . ARG B 1 137  ? -35.555 56.049  6.253   1.00 59.96  ? 134  ARG B N   1 
ATOM 9754  C CA  . ARG B 1 137  ? -35.632 54.794  5.536   1.00 59.34  ? 134  ARG B CA  1 
ATOM 9755  C C   . ARG B 1 137  ? -35.031 53.746  6.445   1.00 59.20  ? 134  ARG B C   1 
ATOM 9756  O O   . ARG B 1 137  ? -33.819 53.655  6.560   1.00 59.39  ? 134  ARG B O   1 
ATOM 9757  C CB  . ARG B 1 137  ? -34.889 54.854  4.203   1.00 59.13  ? 134  ARG B CB  1 
ATOM 9758  C CG  . ARG B 1 137  ? -35.241 53.716  3.234   1.00 58.54  ? 134  ARG B CG  1 
ATOM 9759  C CD  . ARG B 1 137  ? -34.466 52.419  3.507   1.00 57.70  ? 134  ARG B CD  1 
ATOM 9760  N NE  . ARG B 1 137  ? -33.051 52.506  3.136   1.00 56.73  ? 134  ARG B NE  1 
ATOM 9761  C CZ  . ARG B 1 137  ? -32.500 51.917  2.076   1.00 56.40  ? 134  ARG B CZ  1 
ATOM 9762  N NH1 . ARG B 1 137  ? -33.228 51.169  1.258   1.00 57.02  ? 134  ARG B NH1 1 
ATOM 9763  N NH2 . ARG B 1 137  ? -31.208 52.064  1.836   1.00 56.35  ? 134  ARG B NH2 1 
ATOM 9764  N N   . LEU B 1 138  ? -35.879 52.974  7.113   1.00 59.01  ? 135  LEU B N   1 
ATOM 9765  C CA  . LEU B 1 138  ? -35.397 51.881  7.939   1.00 58.80  ? 135  LEU B CA  1 
ATOM 9766  C C   . LEU B 1 138  ? -35.418 50.573  7.173   1.00 58.86  ? 135  LEU B C   1 
ATOM 9767  O O   . LEU B 1 138  ? -34.417 49.858  7.138   1.00 58.94  ? 135  LEU B O   1 
ATOM 9768  C CB  . LEU B 1 138  ? -36.216 51.733  9.224   1.00 58.80  ? 135  LEU B CB  1 
ATOM 9769  C CG  . LEU B 1 138  ? -36.002 52.620  10.459  1.00 58.44  ? 135  LEU B CG  1 
ATOM 9770  C CD1 . LEU B 1 138  ? -34.671 53.357  10.433  1.00 57.92  ? 135  LEU B CD1 1 
ATOM 9771  C CD2 . LEU B 1 138  ? -37.149 53.595  10.596  1.00 58.12  ? 135  LEU B CD2 1 
ATOM 9772  N N   . TYR B 1 139  ? -36.556 50.268  6.554   1.00 58.87  ? 136  TYR B N   1 
ATOM 9773  C CA  . TYR B 1 139  ? -36.776 48.947  5.962   1.00 58.75  ? 136  TYR B CA  1 
ATOM 9774  C C   . TYR B 1 139  ? -37.099 48.942  4.468   1.00 58.72  ? 136  TYR B C   1 
ATOM 9775  O O   . TYR B 1 139  ? -37.939 49.716  4.001   1.00 58.82  ? 136  TYR B O   1 
ATOM 9776  C CB  . TYR B 1 139  ? -37.898 48.228  6.709   1.00 58.62  ? 136  TYR B CB  1 
ATOM 9777  C CG  . TYR B 1 139  ? -37.672 48.097  8.192   1.00 58.30  ? 136  TYR B CG  1 
ATOM 9778  C CD1 . TYR B 1 139  ? -38.342 48.917  9.088   1.00 58.19  ? 136  TYR B CD1 1 
ATOM 9779  C CD2 . TYR B 1 139  ? -36.791 47.153  8.698   1.00 58.13  ? 136  TYR B CD2 1 
ATOM 9780  C CE1 . TYR B 1 139  ? -38.141 48.801  10.453  1.00 58.04  ? 136  TYR B CE1 1 
ATOM 9781  C CE2 . TYR B 1 139  ? -36.585 47.025  10.061  1.00 58.32  ? 136  TYR B CE2 1 
ATOM 9782  C CZ  . TYR B 1 139  ? -37.264 47.854  10.932  1.00 58.08  ? 136  TYR B CZ  1 
ATOM 9783  O OH  . TYR B 1 139  ? -37.066 47.731  12.285  1.00 58.19  ? 136  TYR B OH  1 
ATOM 9784  N N   . ASP B 1 140  ? -36.428 48.054  3.736   1.00 58.55  ? 137  ASP B N   1 
ATOM 9785  C CA  . ASP B 1 140  ? -36.794 47.712  2.364   1.00 58.49  ? 137  ASP B CA  1 
ATOM 9786  C C   . ASP B 1 140  ? -38.280 47.936  2.092   1.00 58.16  ? 137  ASP B C   1 
ATOM 9787  O O   . ASP B 1 140  ? -39.125 47.245  2.650   1.00 58.26  ? 137  ASP B O   1 
ATOM 9788  C CB  . ASP B 1 140  ? -36.473 46.233  2.102   1.00 58.73  ? 137  ASP B CB  1 
ATOM 9789  C CG  . ASP B 1 140  ? -35.282 46.037  1.186   1.00 59.55  ? 137  ASP B CG  1 
ATOM 9790  O OD1 . ASP B 1 140  ? -35.263 46.642  0.090   1.00 60.27  ? 137  ASP B OD1 1 
ATOM 9791  O OD2 . ASP B 1 140  ? -34.370 45.261  1.557   1.00 60.65  ? 137  ASP B OD2 1 
ATOM 9792  N N   . GLY B 1 141  ? -38.594 48.915  1.252   1.00 57.88  ? 138  GLY B N   1 
ATOM 9793  C CA  . GLY B 1 141  ? -39.957 49.105  0.770   1.00 57.53  ? 138  GLY B CA  1 
ATOM 9794  C C   . GLY B 1 141  ? -40.921 49.851  1.673   1.00 57.39  ? 138  GLY B C   1 
ATOM 9795  O O   . GLY B 1 141  ? -42.098 49.971  1.353   1.00 57.57  ? 138  GLY B O   1 
ATOM 9796  N N   . LEU B 1 142  ? -40.448 50.343  2.808   1.00 57.24  ? 139  LEU B N   1 
ATOM 9797  C CA  . LEU B 1 142  ? -41.277 51.207  3.638   1.00 57.23  ? 139  LEU B CA  1 
ATOM 9798  C C   . LEU B 1 142  ? -40.560 52.520  3.789   1.00 57.36  ? 139  LEU B C   1 
ATOM 9799  O O   . LEU B 1 142  ? -39.338 52.580  3.651   1.00 57.51  ? 139  LEU B O   1 
ATOM 9800  C CB  . LEU B 1 142  ? -41.518 50.611  5.030   1.00 57.19  ? 139  LEU B CB  1 
ATOM 9801  C CG  . LEU B 1 142  ? -42.050 49.191  5.251   1.00 56.98  ? 139  LEU B CG  1 
ATOM 9802  C CD1 . LEU B 1 142  ? -42.371 49.005  6.726   1.00 56.17  ? 139  LEU B CD1 1 
ATOM 9803  C CD2 . LEU B 1 142  ? -43.265 48.863  4.379   1.00 56.68  ? 139  LEU B CD2 1 
ATOM 9804  N N   . PHE B 1 143  ? -41.313 53.576  4.065   1.00 57.44  ? 140  PHE B N   1 
ATOM 9805  C CA  . PHE B 1 143  ? -40.698 54.845  4.410   1.00 57.74  ? 140  PHE B CA  1 
ATOM 9806  C C   . PHE B 1 143  ? -41.357 55.371  5.671   1.00 58.16  ? 140  PHE B C   1 
ATOM 9807  O O   . PHE B 1 143  ? -42.549 55.680  5.661   1.00 58.40  ? 140  PHE B O   1 
ATOM 9808  C CB  . PHE B 1 143  ? -40.802 55.848  3.258   1.00 57.49  ? 140  PHE B CB  1 
ATOM 9809  C CG  . PHE B 1 143  ? -40.001 57.099  3.474   1.00 57.14  ? 140  PHE B CG  1 
ATOM 9810  C CD1 . PHE B 1 143  ? -38.615 57.078  3.375   1.00 56.92  ? 140  PHE B CD1 1 
ATOM 9811  C CD2 . PHE B 1 143  ? -40.633 58.302  3.781   1.00 56.98  ? 140  PHE B CD2 1 
ATOM 9812  C CE1 . PHE B 1 143  ? -37.868 58.234  3.587   1.00 57.24  ? 140  PHE B CE1 1 
ATOM 9813  C CE2 . PHE B 1 143  ? -39.900 59.469  3.988   1.00 56.68  ? 140  PHE B CE2 1 
ATOM 9814  C CZ  . PHE B 1 143  ? -38.515 59.436  3.894   1.00 57.25  ? 140  PHE B CZ  1 
ATOM 9815  N N   . LYS B 1 144  ? -40.585 55.451  6.756   1.00 58.39  ? 141  LYS B N   1 
ATOM 9816  C CA  . LYS B 1 144  ? -41.121 55.847  8.057   1.00 58.61  ? 141  LYS B CA  1 
ATOM 9817  C C   . LYS B 1 144  ? -41.080 57.359  8.238   1.00 58.97  ? 141  LYS B C   1 
ATOM 9818  O O   . LYS B 1 144  ? -40.013 57.971  8.189   1.00 58.96  ? 141  LYS B O   1 
ATOM 9819  C CB  . LYS B 1 144  ? -40.361 55.140  9.190   1.00 58.62  ? 141  LYS B CB  1 
ATOM 9820  C CG  . LYS B 1 144  ? -41.016 55.236  10.573  1.00 58.09  ? 141  LYS B CG  1 
ATOM 9821  C CD  . LYS B 1 144  ? -41.954 54.071  10.853  1.00 56.79  ? 141  LYS B CD  1 
ATOM 9822  C CE  . LYS B 1 144  ? -41.342 53.078  11.819  1.00 56.13  ? 141  LYS B CE  1 
ATOM 9823  N NZ  . LYS B 1 144  ? -41.654 53.419  13.235  1.00 55.47  ? 141  LYS B NZ  1 
ATOM 9824  N N   . VAL B 1 145  ? -42.250 57.952  8.443   1.00 59.44  ? 142  VAL B N   1 
ATOM 9825  C CA  . VAL B 1 145  ? -42.362 59.387  8.662   1.00 60.19  ? 142  VAL B CA  1 
ATOM 9826  C C   . VAL B 1 145  ? -42.657 59.664  10.120  1.00 60.83  ? 142  VAL B C   1 
ATOM 9827  O O   . VAL B 1 145  ? -43.621 59.130  10.672  1.00 61.04  ? 142  VAL B O   1 
ATOM 9828  C CB  . VAL B 1 145  ? -43.509 59.989  7.845   1.00 60.13  ? 142  VAL B CB  1 
ATOM 9829  C CG1 . VAL B 1 145  ? -43.604 61.491  8.083   1.00 60.09  ? 142  VAL B CG1 1 
ATOM 9830  C CG2 . VAL B 1 145  ? -43.336 59.679  6.371   1.00 60.37  ? 142  VAL B CG2 1 
ATOM 9831  N N   . ILE B 1 146  ? -41.834 60.501  10.742  1.00 61.58  ? 143  ILE B N   1 
ATOM 9832  C CA  . ILE B 1 146  ? -42.108 60.959  12.098  1.00 62.40  ? 143  ILE B CA  1 
ATOM 9833  C C   . ILE B 1 146  ? -42.592 62.405  12.023  1.00 63.20  ? 143  ILE B C   1 
ATOM 9834  O O   . ILE B 1 146  ? -41.781 63.322  11.890  1.00 63.27  ? 143  ILE B O   1 
ATOM 9835  C CB  . ILE B 1 146  ? -40.879 60.816  13.022  1.00 62.29  ? 143  ILE B CB  1 
ATOM 9836  C CG1 . ILE B 1 146  ? -40.503 59.340  13.169  1.00 62.02  ? 143  ILE B CG1 1 
ATOM 9837  C CG2 . ILE B 1 146  ? -41.157 61.429  14.395  1.00 62.44  ? 143  ILE B CG2 1 
ATOM 9838  C CD1 . ILE B 1 146  ? -39.087 59.101  13.650  1.00 61.81  ? 143  ILE B CD1 1 
ATOM 9839  N N   . PRO B 1 147  ? -43.924 62.608  12.095  1.00 64.03  ? 144  PRO B N   1 
ATOM 9840  C CA  . PRO B 1 147  ? -44.549 63.917  11.911  1.00 64.63  ? 144  PRO B CA  1 
ATOM 9841  C C   . PRO B 1 147  ? -44.167 64.840  13.040  1.00 65.28  ? 144  PRO B C   1 
ATOM 9842  O O   . PRO B 1 147  ? -44.757 64.768  14.114  1.00 65.39  ? 144  PRO B O   1 
ATOM 9843  C CB  . PRO B 1 147  ? -46.049 63.607  11.979  1.00 64.62  ? 144  PRO B CB  1 
ATOM 9844  C CG  . PRO B 1 147  ? -46.160 62.143  11.778  1.00 64.37  ? 144  PRO B CG  1 
ATOM 9845  C CD  . PRO B 1 147  ? -44.929 61.570  12.377  1.00 64.12  ? 144  PRO B CD  1 
ATOM 9846  N N   . LEU B 1 148  ? -43.181 65.695  12.791  1.00 66.24  ? 145  LEU B N   1 
ATOM 9847  C CA  . LEU B 1 148  ? -42.594 66.524  13.835  1.00 67.25  ? 145  LEU B CA  1 
ATOM 9848  C C   . LEU B 1 148  ? -43.464 67.726  14.168  1.00 68.05  ? 145  LEU B C   1 
ATOM 9849  O O   . LEU B 1 148  ? -43.675 68.605  13.329  1.00 68.13  ? 145  LEU B O   1 
ATOM 9850  C CB  . LEU B 1 148  ? -41.187 66.982  13.443  1.00 67.09  ? 145  LEU B CB  1 
ATOM 9851  C CG  . LEU B 1 148  ? -40.163 67.090  14.576  1.00 66.95  ? 145  LEU B CG  1 
ATOM 9852  C CD1 . LEU B 1 148  ? -38.814 67.388  13.983  1.00 66.60  ? 145  LEU B CD1 1 
ATOM 9853  C CD2 . LEU B 1 148  ? -40.531 68.147  15.637  1.00 66.92  ? 145  LEU B CD2 1 
ATOM 9854  N N   . ASP B 1 149  ? -43.954 67.747  15.406  1.00 69.13  ? 146  ASP B N   1 
ATOM 9855  C CA  . ASP B 1 149  ? -44.768 68.844  15.922  1.00 70.29  ? 146  ASP B CA  1 
ATOM 9856  C C   . ASP B 1 149  ? -44.516 69.085  17.416  1.00 70.86  ? 146  ASP B C   1 
ATOM 9857  O O   . ASP B 1 149  ? -43.547 68.573  17.990  1.00 71.07  ? 146  ASP B O   1 
ATOM 9858  C CB  . ASP B 1 149  ? -46.264 68.595  15.658  1.00 70.41  ? 146  ASP B CB  1 
ATOM 9859  C CG  . ASP B 1 149  ? -46.719 69.106  14.290  1.00 71.14  ? 146  ASP B CG  1 
ATOM 9860  O OD1 . ASP B 1 149  ? -46.642 68.330  13.309  1.00 71.92  ? 146  ASP B OD1 1 
ATOM 9861  O OD2 . ASP B 1 149  ? -47.176 70.274  14.200  1.00 71.25  ? 146  ASP B OD2 1 
ATOM 9862  N N   . ARG B 1 150  ? -45.402 69.871  18.024  1.00 71.52  ? 147  ARG B N   1 
ATOM 9863  C CA  . ARG B 1 150  ? -45.330 70.245  19.431  1.00 72.17  ? 147  ARG B CA  1 
ATOM 9864  C C   . ARG B 1 150  ? -45.490 69.030  20.345  1.00 72.28  ? 147  ARG B C   1 
ATOM 9865  O O   . ARG B 1 150  ? -44.690 68.834  21.261  1.00 72.11  ? 147  ARG B O   1 
ATOM 9866  C CB  . ARG B 1 150  ? -46.435 71.270  19.745  1.00 72.49  ? 147  ARG B CB  1 
ATOM 9867  C CG  . ARG B 1 150  ? -46.001 72.464  20.604  1.00 73.33  ? 147  ARG B CG  1 
ATOM 9868  C CD  . ARG B 1 150  ? -45.762 72.092  22.065  1.00 74.49  ? 147  ARG B CD  1 
ATOM 9869  N NE  . ARG B 1 150  ? -44.768 72.977  22.671  1.00 75.10  ? 147  ARG B NE  1 
ATOM 9870  C CZ  . ARG B 1 150  ? -45.037 73.932  23.558  1.00 75.25  ? 147  ARG B CZ  1 
ATOM 9871  N NH1 . ARG B 1 150  ? -46.283 74.139  23.977  1.00 75.18  ? 147  ARG B NH1 1 
ATOM 9872  N NH2 . ARG B 1 150  ? -44.046 74.677  24.035  1.00 74.92  ? 147  ARG B NH2 1 
ATOM 9873  N N   . ASP B 1 151  ? -46.529 68.235  20.075  1.00 72.62  ? 148  ASP B N   1 
ATOM 9874  C CA  . ASP B 1 151  ? -46.940 67.090  20.903  1.00 72.98  ? 148  ASP B CA  1 
ATOM 9875  C C   . ASP B 1 151  ? -45.916 65.962  20.785  1.00 72.89  ? 148  ASP B C   1 
ATOM 9876  O O   . ASP B 1 151  ? -44.759 66.135  21.178  1.00 73.14  ? 148  ASP B O   1 
ATOM 9877  C CB  . ASP B 1 151  ? -48.337 66.593  20.483  1.00 73.17  ? 148  ASP B CB  1 
ATOM 9878  C CG  . ASP B 1 151  ? -49.316 67.736  20.163  1.00 74.19  ? 148  ASP B CG  1 
ATOM 9879  O OD1 . ASP B 1 151  ? -48.901 68.759  19.561  1.00 74.78  ? 148  ASP B OD1 1 
ATOM 9880  O OD2 . ASP B 1 151  ? -50.516 67.601  20.503  1.00 75.14  ? 148  ASP B OD2 1 
ATOM 9881  N N   . ASN B 1 152  ? -46.348 64.810  20.266  1.00 72.57  ? 149  ASN B N   1 
ATOM 9882  C CA  . ASN B 1 152  ? -45.441 63.779  19.750  1.00 72.16  ? 149  ASN B CA  1 
ATOM 9883  C C   . ASN B 1 152  ? -44.101 63.660  20.494  1.00 71.83  ? 149  ASN B C   1 
ATOM 9884  O O   . ASN B 1 152  ? -43.032 63.712  19.878  1.00 71.68  ? 149  ASN B O   1 
ATOM 9885  C CB  . ASN B 1 152  ? -45.187 64.049  18.260  1.00 72.23  ? 149  ASN B CB  1 
ATOM 9886  C CG  . ASN B 1 152  ? -44.842 62.796  17.486  1.00 72.56  ? 149  ASN B CG  1 
ATOM 9887  O OD1 . ASN B 1 152  ? -44.669 61.726  18.063  1.00 73.15  ? 149  ASN B OD1 1 
ATOM 9888  N ND2 . ASN B 1 152  ? -44.749 62.921  16.167  1.00 72.62  ? 149  ASN B ND2 1 
ATOM 9889  N N   . LYS B 1 153  ? -44.164 63.523  21.817  1.00 71.46  ? 150  LYS B N   1 
ATOM 9890  C CA  . LYS B 1 153  ? -42.956 63.408  22.635  1.00 71.11  ? 150  LYS B CA  1 
ATOM 9891  C C   . LYS B 1 153  ? -42.513 61.966  22.740  1.00 70.77  ? 150  LYS B C   1 
ATOM 9892  O O   . LYS B 1 153  ? -41.430 61.672  23.243  1.00 70.69  ? 150  LYS B O   1 
ATOM 9893  C CB  . LYS B 1 153  ? -43.159 63.999  24.029  1.00 71.17  ? 150  LYS B CB  1 
ATOM 9894  C CG  . LYS B 1 153  ? -42.874 65.488  24.115  1.00 71.47  ? 150  LYS B CG  1 
ATOM 9895  C CD  . LYS B 1 153  ? -42.362 65.872  25.497  1.00 71.95  ? 150  LYS B CD  1 
ATOM 9896  C CE  . LYS B 1 153  ? -42.487 67.372  25.751  1.00 71.93  ? 150  LYS B CE  1 
ATOM 9897  N NZ  . LYS B 1 153  ? -43.895 67.793  26.040  1.00 71.76  ? 150  LYS B NZ  1 
ATOM 9898  N N   . GLU B 1 154  ? -43.368 61.072  22.263  1.00 70.49  ? 151  GLU B N   1 
ATOM 9899  C CA  . GLU B 1 154  ? -43.055 59.656  22.204  1.00 70.39  ? 151  GLU B CA  1 
ATOM 9900  C C   . GLU B 1 154  ? -42.526 59.343  20.800  1.00 70.21  ? 151  GLU B C   1 
ATOM 9901  O O   . GLU B 1 154  ? -42.320 58.177  20.438  1.00 70.41  ? 151  GLU B O   1 
ATOM 9902  C CB  . GLU B 1 154  ? -44.295 58.825  22.545  1.00 70.45  ? 151  GLU B CB  1 
ATOM 9903  C CG  . GLU B 1 154  ? -45.296 59.565  23.438  1.00 70.88  ? 151  GLU B CG  1 
ATOM 9904  C CD  . GLU B 1 154  ? -45.992 58.662  24.436  1.00 71.62  ? 151  GLU B CD  1 
ATOM 9905  O OE1 . GLU B 1 154  ? -45.311 58.137  25.346  1.00 71.51  ? 151  GLU B OE1 1 
ATOM 9906  O OE2 . GLU B 1 154  ? -47.227 58.493  24.321  1.00 72.21  ? 151  GLU B OE2 1 
ATOM 9907  N N   . LEU B 1 155  ? -42.284 60.414  20.035  1.00 69.72  ? 152  LEU B N   1 
ATOM 9908  C CA  . LEU B 1 155  ? -41.826 60.363  18.643  1.00 69.02  ? 152  LEU B CA  1 
ATOM 9909  C C   . LEU B 1 155  ? -42.593 59.346  17.824  1.00 68.79  ? 152  LEU B C   1 
ATOM 9910  O O   . LEU B 1 155  ? -42.005 58.513  17.141  1.00 68.79  ? 152  LEU B O   1 
ATOM 9911  C CB  . LEU B 1 155  ? -40.314 60.141  18.559  1.00 68.92  ? 152  LEU B CB  1 
ATOM 9912  C CG  . LEU B 1 155  ? -39.465 61.387  18.828  1.00 68.69  ? 152  LEU B CG  1 
ATOM 9913  C CD1 . LEU B 1 155  ? -37.991 61.037  18.900  1.00 68.48  ? 152  LEU B CD1 1 
ATOM 9914  C CD2 . LEU B 1 155  ? -39.709 62.458  17.771  1.00 68.49  ? 152  LEU B CD2 1 
ATOM 9915  N N   . LYS B 1 156  ? -43.917 59.424  17.918  1.00 68.60  ? 153  LYS B N   1 
ATOM 9916  C CA  . LYS B 1 156  ? -44.816 58.512  17.220  1.00 68.47  ? 153  LYS B CA  1 
ATOM 9917  C C   . LYS B 1 156  ? -44.620 58.627  15.710  1.00 68.39  ? 153  LYS B C   1 
ATOM 9918  O O   . LYS B 1 156  ? -44.521 59.729  15.160  1.00 68.32  ? 153  LYS B O   1 
ATOM 9919  C CB  . LYS B 1 156  ? -46.278 58.784  17.599  1.00 68.43  ? 153  LYS B CB  1 
ATOM 9920  C CG  . LYS B 1 156  ? -46.577 58.767  19.099  1.00 68.23  ? 153  LYS B CG  1 
ATOM 9921  C CD  . LYS B 1 156  ? -46.735 57.357  19.650  1.00 68.46  ? 153  LYS B CD  1 
ATOM 9922  C CE  . LYS B 1 156  ? -47.310 57.383  21.064  1.00 68.59  ? 153  LYS B CE  1 
ATOM 9923  N NZ  . LYS B 1 156  ? -47.252 56.056  21.746  1.00 68.37  ? 153  LYS B NZ  1 
ATOM 9924  N N   . ALA B 1 157  ? -44.553 57.474  15.054  1.00 68.22  ? 154  ALA B N   1 
ATOM 9925  C CA  . ALA B 1 157  ? -44.270 57.411  13.631  1.00 68.06  ? 154  ALA B CA  1 
ATOM 9926  C C   . ALA B 1 157  ? -45.411 56.750  12.866  1.00 67.95  ? 154  ALA B C   1 
ATOM 9927  O O   . ALA B 1 157  ? -46.278 56.102  13.462  1.00 68.12  ? 154  ALA B O   1 
ATOM 9928  C CB  . ALA B 1 157  ? -42.986 56.651  13.408  1.00 68.16  ? 154  ALA B CB  1 
ATOM 9929  N N   . PHE B 1 158  ? -45.416 56.942  11.550  1.00 67.55  ? 155  PHE B N   1 
ATOM 9930  C CA  . PHE B 1 158  ? -46.273 56.173  10.661  1.00 67.34  ? 155  PHE B CA  1 
ATOM 9931  C C   . PHE B 1 158  ? -45.486 55.798  9.410   1.00 67.34  ? 155  PHE B C   1 
ATOM 9932  O O   . PHE B 1 158  ? -44.553 56.507  9.025   1.00 67.42  ? 155  PHE B O   1 
ATOM 9933  C CB  . PHE B 1 158  ? -47.564 56.931  10.321  1.00 67.19  ? 155  PHE B CB  1 
ATOM 9934  C CG  . PHE B 1 158  ? -47.388 58.053  9.322   1.00 67.22  ? 155  PHE B CG  1 
ATOM 9935  C CD1 . PHE B 1 158  ? -47.398 57.800  7.949   1.00 66.83  ? 155  PHE B CD1 1 
ATOM 9936  C CD2 . PHE B 1 158  ? -47.251 59.369  9.752   1.00 67.15  ? 155  PHE B CD2 1 
ATOM 9937  C CE1 . PHE B 1 158  ? -47.252 58.837  7.030   1.00 66.42  ? 155  PHE B CE1 1 
ATOM 9938  C CE2 . PHE B 1 158  ? -47.106 60.411  8.833   1.00 66.50  ? 155  PHE B CE2 1 
ATOM 9939  C CZ  . PHE B 1 158  ? -47.108 60.141  7.473   1.00 66.51  ? 155  PHE B CZ  1 
ATOM 9940  N N   . ASN B 1 159  ? -45.849 54.678  8.794   1.00 67.24  ? 156  ASN B N   1 
ATOM 9941  C CA  . ASN B 1 159  ? -45.193 54.221  7.579   1.00 67.18  ? 156  ASN B CA  1 
ATOM 9942  C C   . ASN B 1 159  ? -46.048 54.492  6.354   1.00 67.09  ? 156  ASN B C   1 
ATOM 9943  O O   . ASN B 1 159  ? -47.225 54.826  6.483   1.00 67.12  ? 156  ASN B O   1 
ATOM 9944  C CB  . ASN B 1 159  ? -44.843 52.735  7.674   1.00 67.36  ? 156  ASN B CB  1 
ATOM 9945  C CG  . ASN B 1 159  ? -43.425 52.494  8.179   1.00 68.02  ? 156  ASN B CG  1 
ATOM 9946  O OD1 . ASN B 1 159  ? -42.458 53.011  7.621   1.00 68.91  ? 156  ASN B OD1 1 
ATOM 9947  N ND2 . ASN B 1 159  ? -43.297 51.692  9.229   1.00 68.45  ? 156  ASN B ND2 1 
ATOM 9948  N N   . ILE B 1 160  ? -45.431 54.380  5.177   1.00 67.02  ? 157  ILE B N   1 
ATOM 9949  C CA  . ILE B 1 160  ? -46.099 54.487  3.877   1.00 66.81  ? 157  ILE B CA  1 
ATOM 9950  C C   . ILE B 1 160  ? -45.422 53.470  2.979   1.00 67.08  ? 157  ILE B C   1 
ATOM 9951  O O   . ILE B 1 160  ? -44.188 53.373  2.985   1.00 67.21  ? 157  ILE B O   1 
ATOM 9952  C CB  . ILE B 1 160  ? -45.900 55.873  3.226   1.00 66.53  ? 157  ILE B CB  1 
ATOM 9953  C CG1 . ILE B 1 160  ? -46.274 57.003  4.184   1.00 66.01  ? 157  ILE B CG1 1 
ATOM 9954  C CG2 . ILE B 1 160  ? -46.708 55.980  1.940   1.00 66.68  ? 157  ILE B CG2 1 
ATOM 9955  C CD1 . ILE B 1 160  ? -45.592 58.310  3.877   1.00 65.18  ? 157  ILE B CD1 1 
ATOM 9956  N N   . ARG B 1 161  ? -46.209 52.708  2.217   1.00 67.28  ? 158  ARG B N   1 
ATOM 9957  C CA  . ARG B 1 161  ? -45.639 51.705  1.306   1.00 67.40  ? 158  ARG B CA  1 
ATOM 9958  C C   . ARG B 1 161  ? -44.875 52.351  0.145   1.00 67.31  ? 158  ARG B C   1 
ATOM 9959  O O   . ARG B 1 161  ? -45.373 53.278  -0.503  1.00 67.35  ? 158  ARG B O   1 
ATOM 9960  C CB  . ARG B 1 161  ? -46.708 50.750  0.762   1.00 67.51  ? 158  ARG B CB  1 
ATOM 9961  C CG  . ARG B 1 161  ? -46.123 49.492  0.103   1.00 67.89  ? 158  ARG B CG  1 
ATOM 9962  C CD  . ARG B 1 161  ? -46.870 49.110  -1.176  1.00 68.85  ? 158  ARG B CD  1 
ATOM 9963  N NE  . ARG B 1 161  ? -48.096 48.356  -0.913  1.00 69.47  ? 158  ARG B NE  1 
ATOM 9964  C CZ  . ARG B 1 161  ? -48.991 48.020  -1.839  1.00 70.02  ? 158  ARG B CZ  1 
ATOM 9965  N NH1 . ARG B 1 161  ? -48.813 48.372  -3.106  1.00 70.45  ? 158  ARG B NH1 1 
ATOM 9966  N NH2 . ARG B 1 161  ? -50.073 47.333  -1.497  1.00 70.49  ? 158  ARG B NH2 1 
ATOM 9967  N N   . LEU B 1 162  ? -43.663 51.845  -0.093  1.00 67.14  ? 159  LEU B N   1 
ATOM 9968  C CA  . LEU B 1 162  ? -42.799 52.271  -1.196  1.00 66.80  ? 159  LEU B CA  1 
ATOM 9969  C C   . LEU B 1 162  ? -42.882 51.274  -2.359  1.00 66.54  ? 159  LEU B C   1 
ATOM 9970  O O   . LEU B 1 162  ? -42.702 50.062  -2.173  1.00 66.43  ? 159  LEU B O   1 
ATOM 9971  C CB  . LEU B 1 162  ? -41.349 52.363  -0.711  1.00 66.79  ? 159  LEU B CB  1 
ATOM 9972  C CG  . LEU B 1 162  ? -40.422 53.491  -1.164  1.00 66.90  ? 159  LEU B CG  1 
ATOM 9973  C CD1 . LEU B 1 162  ? -39.093 53.372  -0.423  1.00 66.96  ? 159  LEU B CD1 1 
ATOM 9974  C CD2 . LEU B 1 162  ? -40.197 53.509  -2.670  1.00 67.20  ? 159  LEU B CD2 1 
ATOM 9975  N N   . GLU B 1 163  ? -43.145 51.795  -3.555  1.00 66.10  ? 160  GLU B N   1 
ATOM 9976  C CA  . GLU B 1 163  ? -43.227 50.976  -4.761  1.00 65.71  ? 160  GLU B CA  1 
ATOM 9977  C C   . GLU B 1 163  ? -41.866 50.393  -5.179  1.00 65.26  ? 160  GLU B C   1 
ATOM 9978  O O   . GLU B 1 163  ? -41.817 49.390  -5.892  1.00 65.26  ? 160  GLU B O   1 
ATOM 9979  C CB  . GLU B 1 163  ? -43.867 51.787  -5.896  1.00 65.87  ? 160  GLU B CB  1 
ATOM 9980  C CG  . GLU B 1 163  ? -43.845 51.139  -7.292  1.00 66.72  ? 160  GLU B CG  1 
ATOM 9981  C CD  . GLU B 1 163  ? -44.861 50.015  -7.477  1.00 67.67  ? 160  GLU B CD  1 
ATOM 9982  O OE1 . GLU B 1 163  ? -44.846 49.392  -8.563  1.00 67.90  ? 160  GLU B OE1 1 
ATOM 9983  O OE2 . GLU B 1 163  ? -45.674 49.756  -6.558  1.00 68.03  ? 160  GLU B OE2 1 
ATOM 9984  N N   . GLU B 1 164  ? -40.777 51.009  -4.716  1.00 64.75  ? 161  GLU B N   1 
ATOM 9985  C CA  . GLU B 1 164  ? -39.415 50.608  -5.097  1.00 64.32  ? 161  GLU B CA  1 
ATOM 9986  C C   . GLU B 1 164  ? -38.616 49.943  -3.963  1.00 64.05  ? 161  GLU B C   1 
ATOM 9987  O O   . GLU B 1 164  ? -38.198 50.612  -3.013  1.00 63.90  ? 161  GLU B O   1 
ATOM 9988  C CB  . GLU B 1 164  ? -38.645 51.815  -5.647  1.00 64.33  ? 161  GLU B CB  1 
ATOM 9989  C CG  . GLU B 1 164  ? -39.092 52.285  -7.038  1.00 64.16  ? 161  GLU B CG  1 
ATOM 9990  C CD  . GLU B 1 164  ? -40.321 53.186  -7.013  1.00 63.48  ? 161  GLU B CD  1 
ATOM 9991  O OE1 . GLU B 1 164  ? -40.647 53.726  -5.931  1.00 62.62  ? 161  GLU B OE1 1 
ATOM 9992  O OE2 . GLU B 1 164  ? -40.952 53.354  -8.084  1.00 62.93  ? 161  GLU B OE2 1 
ATOM 9993  N N   . LEU B 1 165  ? -38.391 48.632  -4.078  1.00 63.75  ? 162  LEU B N   1 
ATOM 9994  C CA  . LEU B 1 165  ? -37.697 47.870  -3.025  1.00 63.40  ? 162  LEU B CA  1 
ATOM 9995  C C   . LEU B 1 165  ? -36.169 47.773  -3.237  1.00 63.34  ? 162  LEU B C   1 
ATOM 9996  O O   . LEU B 1 165  ? -35.587 46.682  -3.159  1.00 63.49  ? 162  LEU B O   1 
ATOM 9997  C CB  . LEU B 1 165  ? -38.295 46.459  -2.837  1.00 63.16  ? 162  LEU B CB  1 
ATOM 9998  C CG  . LEU B 1 165  ? -39.679 45.976  -3.292  1.00 62.97  ? 162  LEU B CG  1 
ATOM 9999  C CD1 . LEU B 1 165  ? -39.897 44.554  -2.776  1.00 62.78  ? 162  LEU B CD1 1 
ATOM 10000 C CD2 . LEU B 1 165  ? -40.834 46.875  -2.858  1.00 62.80  ? 162  LEU B CD2 1 
ATOM 10001 N N   . HIS B 1 166  ? -35.537 48.911  -3.527  1.00 62.93  ? 163  HIS B N   1 
ATOM 10002 C CA  . HIS B 1 166  ? -34.074 49.048  -3.487  1.00 62.62  ? 163  HIS B CA  1 
ATOM 10003 C C   . HIS B 1 166  ? -33.682 50.503  -3.722  1.00 62.20  ? 163  HIS B C   1 
ATOM 10004 O O   . HIS B 1 166  ? -33.450 50.926  -4.858  1.00 62.21  ? 163  HIS B O   1 
ATOM 10005 C CB  . HIS B 1 166  ? -33.350 48.115  -4.479  1.00 62.77  ? 163  HIS B CB  1 
ATOM 10006 C CG  . HIS B 1 166  ? -31.897 47.889  -4.153  1.00 63.54  ? 163  HIS B CG  1 
ATOM 10007 N ND1 . HIS B 1 166  ? -31.002 48.922  -3.951  1.00 63.68  ? 163  HIS B ND1 1 
ATOM 10008 C CD2 . HIS B 1 166  ? -31.184 46.745  -4.002  1.00 63.79  ? 163  HIS B CD2 1 
ATOM 10009 C CE1 . HIS B 1 166  ? -29.807 48.425  -3.683  1.00 63.33  ? 163  HIS B CE1 1 
ATOM 10010 N NE2 . HIS B 1 166  ? -29.890 47.107  -3.708  1.00 63.45  ? 163  HIS B NE2 1 
ATOM 10011 N N   . VAL B 1 167  ? -33.615 51.264  -2.636  1.00 61.60  ? 164  VAL B N   1 
ATOM 10012 C CA  . VAL B 1 167  ? -33.275 52.675  -2.710  1.00 61.05  ? 164  VAL B CA  1 
ATOM 10013 C C   . VAL B 1 167  ? -31.800 52.842  -2.367  1.00 60.71  ? 164  VAL B C   1 
ATOM 10014 O O   . VAL B 1 167  ? -31.255 52.074  -1.567  1.00 60.50  ? 164  VAL B O   1 
ATOM 10015 C CB  . VAL B 1 167  ? -34.184 53.526  -1.784  1.00 61.07  ? 164  VAL B CB  1 
ATOM 10016 C CG1 . VAL B 1 167  ? -33.731 54.983  -1.738  1.00 61.20  ? 164  VAL B CG1 1 
ATOM 10017 C CG2 . VAL B 1 167  ? -35.623 53.454  -2.254  1.00 60.97  ? 164  VAL B CG2 1 
ATOM 10018 N N   . ILE B 1 168  ? -31.168 53.842  -2.984  1.00 60.31  ? 165  ILE B N   1 
ATOM 10019 C CA  . ILE B 1 168  ? -29.733 54.082  -2.835  1.00 59.95  ? 165  ILE B CA  1 
ATOM 10020 C C   . ILE B 1 168  ? -29.399 55.341  -2.020  1.00 59.87  ? 165  ILE B C   1 
ATOM 10021 O O   . ILE B 1 168  ? -28.530 55.279  -1.147  1.00 59.95  ? 165  ILE B O   1 
ATOM 10022 C CB  . ILE B 1 168  ? -28.992 54.044  -4.206  1.00 59.85  ? 165  ILE B CB  1 
ATOM 10023 C CG1 . ILE B 1 168  ? -28.763 52.603  -4.660  1.00 59.43  ? 165  ILE B CG1 1 
ATOM 10024 C CG2 . ILE B 1 168  ? -27.644 54.706  -4.119  1.00 60.03  ? 165  ILE B CG2 1 
ATOM 10025 C CD1 . ILE B 1 168  ? -29.936 51.979  -5.351  1.00 59.69  ? 165  ILE B CD1 1 
ATOM 10026 N N   . ASP B 1 169  ? -30.067 56.466  -2.293  1.00 59.79  ? 166  ASP B N   1 
ATOM 10027 C CA  . ASP B 1 169  ? -29.925 57.668  -1.435  1.00 59.95  ? 166  ASP B CA  1 
ATOM 10028 C C   . ASP B 1 169  ? -31.089 58.660  -1.472  1.00 59.90  ? 166  ASP B C   1 
ATOM 10029 O O   . ASP B 1 169  ? -31.583 59.026  -2.529  1.00 59.84  ? 166  ASP B O   1 
ATOM 10030 C CB  . ASP B 1 169  ? -28.604 58.410  -1.683  1.00 60.00  ? 166  ASP B CB  1 
ATOM 10031 C CG  . ASP B 1 169  ? -28.117 59.188  -0.450  1.00 60.19  ? 166  ASP B CG  1 
ATOM 10032 O OD1 . ASP B 1 169  ? -28.889 59.349  0.532   1.00 59.20  ? 166  ASP B OD1 1 
ATOM 10033 O OD2 . ASP B 1 169  ? -26.944 59.637  -0.471  1.00 60.46  ? 166  ASP B OD2 1 
ATOM 10034 N N   . VAL B 1 170  ? -31.498 59.103  -0.290  1.00 59.94  ? 167  VAL B N   1 
ATOM 10035 C CA  . VAL B 1 170  ? -32.662 59.962  -0.139  1.00 60.01  ? 167  VAL B CA  1 
ATOM 10036 C C   . VAL B 1 170  ? -32.230 61.282  0.472   1.00 60.11  ? 167  VAL B C   1 
ATOM 10037 O O   . VAL B 1 170  ? -31.343 61.312  1.327   1.00 60.38  ? 167  VAL B O   1 
ATOM 10038 C CB  . VAL B 1 170  ? -33.739 59.339  0.799   1.00 59.96  ? 167  VAL B CB  1 
ATOM 10039 C CG1 . VAL B 1 170  ? -35.107 59.941  0.512   1.00 60.08  ? 167  VAL B CG1 1 
ATOM 10040 C CG2 . VAL B 1 170  ? -33.798 57.821  0.668   1.00 59.80  ? 167  VAL B CG2 1 
ATOM 10041 N N   . LYS B 1 171  ? -32.851 62.365  0.015   1.00 60.04  ? 168  LYS B N   1 
ATOM 10042 C CA  . LYS B 1 171  ? -32.730 63.679  0.631   1.00 59.89  ? 168  LYS B CA  1 
ATOM 10043 C C   . LYS B 1 171  ? -34.090 64.326  0.564   1.00 60.23  ? 168  LYS B C   1 
ATOM 10044 O O   . LYS B 1 171  ? -35.008 63.786  -0.047  1.00 60.22  ? 168  LYS B O   1 
ATOM 10045 C CB  . LYS B 1 171  ? -31.730 64.558  -0.120  1.00 59.64  ? 168  LYS B CB  1 
ATOM 10046 C CG  . LYS B 1 171  ? -30.290 64.111  -0.022  1.00 59.07  ? 168  LYS B CG  1 
ATOM 10047 C CD  . LYS B 1 171  ? -29.636 64.530  1.279   1.00 58.08  ? 168  LYS B CD  1 
ATOM 10048 C CE  . LYS B 1 171  ? -28.774 63.403  1.842   1.00 57.65  ? 168  LYS B CE  1 
ATOM 10049 N NZ  . LYS B 1 171  ? -28.000 62.651  0.813   1.00 56.40  ? 168  LYS B NZ  1 
ATOM 10050 N N   . PHE B 1 172  ? -34.224 65.477  1.212   1.00 60.77  ? 169  PHE B N   1 
ATOM 10051 C CA  . PHE B 1 172  ? -35.369 66.347  0.996   1.00 61.07  ? 169  PHE B CA  1 
ATOM 10052 C C   . PHE B 1 172  ? -34.934 67.445  0.051   1.00 61.31  ? 169  PHE B C   1 
ATOM 10053 O O   . PHE B 1 172  ? -33.761 67.829  0.037   1.00 61.14  ? 169  PHE B O   1 
ATOM 10054 C CB  . PHE B 1 172  ? -35.873 66.951  2.307   1.00 61.04  ? 169  PHE B CB  1 
ATOM 10055 C CG  . PHE B 1 172  ? -36.836 66.075  3.047   1.00 60.89  ? 169  PHE B CG  1 
ATOM 10056 C CD1 . PHE B 1 172  ? -36.432 65.382  4.179   1.00 60.84  ? 169  PHE B CD1 1 
ATOM 10057 C CD2 . PHE B 1 172  ? -38.149 65.942  2.613   1.00 60.95  ? 169  PHE B CD2 1 
ATOM 10058 C CE1 . PHE B 1 172  ? -37.324 64.571  4.877   1.00 60.76  ? 169  PHE B CE1 1 
ATOM 10059 C CE2 . PHE B 1 172  ? -39.046 65.136  3.298   1.00 60.97  ? 169  PHE B CE2 1 
ATOM 10060 C CZ  . PHE B 1 172  ? -38.629 64.445  4.434   1.00 61.04  ? 169  PHE B CZ  1 
ATOM 10061 N N   . LEU B 1 173  ? -35.874 67.935  -0.747  1.00 61.73  ? 170  LEU B N   1 
ATOM 10062 C CA  . LEU B 1 173  ? -35.576 69.007  -1.678  1.00 62.28  ? 170  LEU B CA  1 
ATOM 10063 C C   . LEU B 1 173  ? -35.868 70.340  -1.021  1.00 62.95  ? 170  LEU B C   1 
ATOM 10064 O O   . LEU B 1 173  ? -36.865 70.485  -0.310  1.00 63.20  ? 170  LEU B O   1 
ATOM 10065 C CB  . LEU B 1 173  ? -36.383 68.856  -2.964  1.00 62.00  ? 170  LEU B CB  1 
ATOM 10066 C CG  . LEU B 1 173  ? -36.159 67.570  -3.753  1.00 61.50  ? 170  LEU B CG  1 
ATOM 10067 C CD1 . LEU B 1 173  ? -37.341 67.313  -4.657  1.00 61.26  ? 170  LEU B CD1 1 
ATOM 10068 C CD2 . LEU B 1 173  ? -34.862 67.633  -4.540  1.00 61.20  ? 170  LEU B CD2 1 
ATOM 10069 N N   . TYR B 1 174  ? -34.979 71.299  -1.247  1.00 63.64  ? 171  TYR B N   1 
ATOM 10070 C CA  . TYR B 1 174  ? -35.155 72.650  -0.755  1.00 64.46  ? 171  TYR B CA  1 
ATOM 10071 C C   . TYR B 1 174  ? -36.234 73.387  -1.551  1.00 65.10  ? 171  TYR B C   1 
ATOM 10072 O O   . TYR B 1 174  ? -36.445 73.100  -2.734  1.00 65.10  ? 171  TYR B O   1 
ATOM 10073 C CB  . TYR B 1 174  ? -33.846 73.405  -0.906  1.00 64.50  ? 171  TYR B CB  1 
ATOM 10074 C CG  . TYR B 1 174  ? -32.879 73.291  0.244   1.00 64.67  ? 171  TYR B CG  1 
ATOM 10075 C CD1 . TYR B 1 174  ? -32.065 72.169  0.398   1.00 64.90  ? 171  TYR B CD1 1 
ATOM 10076 C CD2 . TYR B 1 174  ? -32.740 74.337  1.157   1.00 65.18  ? 171  TYR B CD2 1 
ATOM 10077 C CE1 . TYR B 1 174  ? -31.147 72.084  1.457   1.00 64.97  ? 171  TYR B CE1 1 
ATOM 10078 C CE2 . TYR B 1 174  ? -31.832 74.264  2.213   1.00 65.16  ? 171  TYR B CE2 1 
ATOM 10079 C CZ  . TYR B 1 174  ? -31.041 73.139  2.359   1.00 64.74  ? 171  TYR B CZ  1 
ATOM 10080 O OH  . TYR B 1 174  ? -30.148 73.088  3.403   1.00 64.34  ? 171  TYR B OH  1 
ATOM 10081 N N   . GLY B 1 175  ? -36.909 74.334  -0.895  1.00 65.84  ? 172  GLY B N   1 
ATOM 10082 C CA  . GLY B 1 175  ? -37.824 75.274  -1.563  1.00 66.83  ? 172  GLY B CA  1 
ATOM 10083 C C   . GLY B 1 175  ? -39.111 74.687  -2.117  1.00 67.55  ? 172  GLY B C   1 
ATOM 10084 O O   . GLY B 1 175  ? -39.843 75.353  -2.854  1.00 67.42  ? 172  GLY B O   1 
ATOM 10085 N N   . CYS B 1 176  ? -39.380 73.436  -1.753  1.00 68.36  ? 173  CYS B N   1 
ATOM 10086 C CA  . CYS B 1 176  ? -40.568 72.714  -2.201  1.00 69.09  ? 173  CYS B CA  1 
ATOM 10087 C C   . CYS B 1 176  ? -41.793 73.059  -1.346  1.00 69.26  ? 173  CYS B C   1 
ATOM 10088 O O   . CYS B 1 176  ? -41.688 73.176  -0.120  1.00 69.39  ? 173  CYS B O   1 
ATOM 10089 C CB  . CYS B 1 176  ? -40.302 71.202  -2.176  1.00 69.20  ? 173  CYS B CB  1 
ATOM 10090 S SG  . CYS B 1 176  ? -39.489 70.542  -3.668  1.00 69.72  ? 173  CYS B SG  1 
ATOM 10091 N N   . GLN B 1 177  ? -42.945 73.212  -2.002  1.00 69.38  ? 174  GLN B N   1 
ATOM 10092 C CA  . GLN B 1 177  ? -44.195 73.588  -1.332  1.00 69.54  ? 174  GLN B CA  1 
ATOM 10093 C C   . GLN B 1 177  ? -44.506 72.583  -0.222  1.00 69.37  ? 174  GLN B C   1 
ATOM 10094 O O   . GLN B 1 177  ? -44.506 72.930  0.963   1.00 69.45  ? 174  GLN B O   1 
ATOM 10095 C CB  . GLN B 1 177  ? -45.375 73.674  -2.321  1.00 69.69  ? 174  GLN B CB  1 
ATOM 10096 C CG  . GLN B 1 177  ? -45.030 73.502  -3.813  1.00 70.73  ? 174  GLN B CG  1 
ATOM 10097 C CD  . GLN B 1 177  ? -44.203 74.648  -4.394  1.00 72.00  ? 174  GLN B CD  1 
ATOM 10098 O OE1 . GLN B 1 177  ? -44.603 75.818  -4.339  1.00 72.33  ? 174  GLN B OE1 1 
ATOM 10099 N NE2 . GLN B 1 177  ? -43.045 74.309  -4.970  1.00 71.99  ? 174  GLN B NE2 1 
ATOM 10100 N N   . ALA B 1 178  ? -44.753 71.336  -0.611  1.00 69.08  ? 175  ALA B N   1 
ATOM 10101 C CA  . ALA B 1 178  ? -44.935 70.263  0.354   1.00 68.80  ? 175  ALA B CA  1 
ATOM 10102 C C   . ALA B 1 178  ? -43.559 69.758  0.820   1.00 68.46  ? 175  ALA B C   1 
ATOM 10103 O O   . ALA B 1 178  ? -42.526 70.174  0.277   1.00 68.61  ? 175  ALA B O   1 
ATOM 10104 C CB  . ALA B 1 178  ? -45.759 69.135  -0.269  1.00 68.82  ? 175  ALA B CB  1 
ATOM 10105 N N   . PRO B 1 179  ? -43.527 68.897  1.855   1.00 67.93  ? 176  PRO B N   1 
ATOM 10106 C CA  . PRO B 1 179  ? -42.287 68.165  2.090   1.00 67.39  ? 176  PRO B CA  1 
ATOM 10107 C C   . PRO B 1 179  ? -42.042 67.210  0.927   1.00 66.82  ? 176  PRO B C   1 
ATOM 10108 O O   . PRO B 1 179  ? -42.917 66.409  0.592   1.00 66.68  ? 176  PRO B O   1 
ATOM 10109 C CB  . PRO B 1 179  ? -42.576 67.386  3.375   1.00 67.53  ? 176  PRO B CB  1 
ATOM 10110 C CG  . PRO B 1 179  ? -43.752 68.079  4.004   1.00 67.83  ? 176  PRO B CG  1 
ATOM 10111 C CD  . PRO B 1 179  ? -44.558 68.576  2.859   1.00 67.95  ? 176  PRO B CD  1 
ATOM 10112 N N   . THR B 1 180  ? -40.869 67.312  0.308   1.00 66.27  ? 177  THR B N   1 
ATOM 10113 C CA  . THR B 1 180  ? -40.571 66.565  -0.915  1.00 65.70  ? 177  THR B CA  1 
ATOM 10114 C C   . THR B 1 180  ? -39.212 65.860  -0.869  1.00 65.36  ? 177  THR B C   1 
ATOM 10115 O O   . THR B 1 180  ? -38.217 66.432  -0.412  1.00 65.36  ? 177  THR B O   1 
ATOM 10116 C CB  . THR B 1 180  ? -40.604 67.492  -2.136  1.00 65.62  ? 177  THR B CB  1 
ATOM 10117 O OG1 . THR B 1 180  ? -41.714 68.388  -2.025  1.00 65.39  ? 177  THR B OG1 1 
ATOM 10118 C CG2 . THR B 1 180  ? -40.730 66.694  -3.415  1.00 65.67  ? 177  THR B CG2 1 
ATOM 10119 N N   . ILE B 1 181  ? -39.176 64.623  -1.361  1.00 64.76  ? 178  ILE B N   1 
ATOM 10120 C CA  . ILE B 1 181  ? -37.943 63.841  -1.367  1.00 64.14  ? 178  ILE B CA  1 
ATOM 10121 C C   . ILE B 1 181  ? -37.404 63.545  -2.770  1.00 63.91  ? 178  ILE B C   1 
ATOM 10122 O O   . ILE B 1 181  ? -38.106 63.706  -3.773  1.00 63.98  ? 178  ILE B O   1 
ATOM 10123 C CB  . ILE B 1 181  ? -38.083 62.526  -0.568  1.00 64.05  ? 178  ILE B CB  1 
ATOM 10124 C CG1 . ILE B 1 181  ? -38.939 61.509  -1.328  1.00 63.66  ? 178  ILE B CG1 1 
ATOM 10125 C CG2 . ILE B 1 181  ? -38.636 62.808  0.825   1.00 64.00  ? 178  ILE B CG2 1 
ATOM 10126 C CD1 . ILE B 1 181  ? -38.636 60.067  -0.963  1.00 63.19  ? 178  ILE B CD1 1 
ATOM 10127 N N   . CYS B 1 182  ? -36.148 63.107  -2.812  1.00 63.47  ? 179  CYS B N   1 
ATOM 10128 C CA  . CYS B 1 182  ? -35.442 62.800  -4.043  1.00 62.92  ? 179  CYS B CA  1 
ATOM 10129 C C   . CYS B 1 182  ? -34.571 61.582  -3.799  1.00 62.55  ? 179  CYS B C   1 
ATOM 10130 O O   . CYS B 1 182  ? -33.773 61.566  -2.861  1.00 62.49  ? 179  CYS B O   1 
ATOM 10131 C CB  . CYS B 1 182  ? -34.567 63.985  -4.442  1.00 62.89  ? 179  CYS B CB  1 
ATOM 10132 S SG  . CYS B 1 182  ? -33.587 63.735  -5.936  1.00 63.80  ? 179  CYS B SG  1 
ATOM 10133 N N   . PHE B 1 183  ? -34.718 60.557  -4.633  1.00 62.18  ? 180  PHE B N   1 
ATOM 10134 C CA  . PHE B 1 183  ? -33.926 59.342  -4.447  1.00 61.77  ? 180  PHE B CA  1 
ATOM 10135 C C   . PHE B 1 183  ? -33.461 58.651  -5.722  1.00 61.53  ? 180  PHE B C   1 
ATOM 10136 O O   . PHE B 1 183  ? -34.174 58.604  -6.712  1.00 61.53  ? 180  PHE B O   1 
ATOM 10137 C CB  . PHE B 1 183  ? -34.625 58.349  -3.492  1.00 61.58  ? 180  PHE B CB  1 
ATOM 10138 C CG  . PHE B 1 183  ? -35.918 57.762  -4.025  1.00 61.50  ? 180  PHE B CG  1 
ATOM 10139 C CD1 . PHE B 1 183  ? -35.941 56.492  -4.594  1.00 61.30  ? 180  PHE B CD1 1 
ATOM 10140 C CD2 . PHE B 1 183  ? -37.118 58.463  -3.923  1.00 61.33  ? 180  PHE B CD2 1 
ATOM 10141 C CE1 . PHE B 1 183  ? -37.134 55.945  -5.067  1.00 61.03  ? 180  PHE B CE1 1 
ATOM 10142 C CE2 . PHE B 1 183  ? -38.314 57.921  -4.399  1.00 60.47  ? 180  PHE B CE2 1 
ATOM 10143 C CZ  . PHE B 1 183  ? -38.321 56.663  -4.968  1.00 60.79  ? 180  PHE B CZ  1 
ATOM 10144 N N   . VAL B 1 184  ? -32.236 58.146  -5.672  1.00 61.50  ? 181  VAL B N   1 
ATOM 10145 C CA  . VAL B 1 184  ? -31.740 57.157  -6.613  1.00 61.71  ? 181  VAL B CA  1 
ATOM 10146 C C   . VAL B 1 184  ? -32.323 55.803  -6.184  1.00 62.19  ? 181  VAL B C   1 
ATOM 10147 O O   . VAL B 1 184  ? -32.310 55.474  -4.993  1.00 62.49  ? 181  VAL B O   1 
ATOM 10148 C CB  . VAL B 1 184  ? -30.189 57.080  -6.557  1.00 61.48  ? 181  VAL B CB  1 
ATOM 10149 C CG1 . VAL B 1 184  ? -29.646 56.044  -7.526  1.00 61.16  ? 181  VAL B CG1 1 
ATOM 10150 C CG2 . VAL B 1 184  ? -29.570 58.439  -6.825  1.00 61.23  ? 181  VAL B CG2 1 
ATOM 10151 N N   . TYR B 1 185  ? -32.853 55.028  -7.126  1.00 62.52  ? 182  TYR B N   1 
ATOM 10152 C CA  . TYR B 1 185  ? -33.294 53.663  -6.808  1.00 62.99  ? 182  TYR B CA  1 
ATOM 10153 C C   . TYR B 1 185  ? -32.874 52.682  -7.901  1.00 63.45  ? 182  TYR B C   1 
ATOM 10154 O O   . TYR B 1 185  ? -32.491 53.105  -8.995  1.00 63.51  ? 182  TYR B O   1 
ATOM 10155 C CB  . TYR B 1 185  ? -34.809 53.601  -6.557  1.00 62.89  ? 182  TYR B CB  1 
ATOM 10156 C CG  . TYR B 1 185  ? -35.643 53.780  -7.800  1.00 62.60  ? 182  TYR B CG  1 
ATOM 10157 C CD1 . TYR B 1 185  ? -35.888 52.708  -8.661  1.00 62.04  ? 182  TYR B CD1 1 
ATOM 10158 C CD2 . TYR B 1 185  ? -36.180 55.021  -8.121  1.00 62.34  ? 182  TYR B CD2 1 
ATOM 10159 C CE1 . TYR B 1 185  ? -36.641 52.869  -9.807  1.00 62.28  ? 182  TYR B CE1 1 
ATOM 10160 C CE2 . TYR B 1 185  ? -36.942 55.194  -9.263  1.00 62.63  ? 182  TYR B CE2 1 
ATOM 10161 C CZ  . TYR B 1 185  ? -37.168 54.115  -10.104 1.00 62.69  ? 182  TYR B CZ  1 
ATOM 10162 O OH  . TYR B 1 185  ? -37.917 54.289  -11.245 1.00 62.93  ? 182  TYR B OH  1 
ATOM 10163 N N   . GLN B 1 186  ? -32.952 51.382  -7.604  1.00 63.96  ? 183  GLN B N   1 
ATOM 10164 C CA  . GLN B 1 186  ? -32.525 50.342  -8.548  1.00 64.57  ? 183  GLN B CA  1 
ATOM 10165 C C   . GLN B 1 186  ? -33.615 49.321  -8.900  1.00 64.87  ? 183  GLN B C   1 
ATOM 10166 O O   . GLN B 1 186  ? -34.416 48.923  -8.054  1.00 65.10  ? 183  GLN B O   1 
ATOM 10167 C CB  . GLN B 1 186  ? -31.274 49.622  -8.035  1.00 64.43  ? 183  GLN B CB  1 
ATOM 10168 C CG  . GLN B 1 186  ? -30.457 48.932  -9.128  1.00 64.74  ? 183  GLN B CG  1 
ATOM 10169 C CD  . GLN B 1 186  ? -29.096 48.439  -8.648  1.00 64.88  ? 183  GLN B CD  1 
ATOM 10170 O OE1 . GLN B 1 186  ? -28.103 48.527  -9.375  1.00 65.32  ? 183  GLN B OE1 1 
ATOM 10171 N NE2 . GLN B 1 186  ? -29.045 47.918  -7.419  1.00 64.68  ? 183  GLN B NE2 1 
ATOM 10172 N N   . ASP B 1 187  ? -33.625 48.916  -10.168 1.00 65.21  ? 184  ASP B N   1 
ATOM 10173 C CA  . ASP B 1 187  ? -34.473 47.839  -10.670 1.00 65.42  ? 184  ASP B CA  1 
ATOM 10174 C C   . ASP B 1 187  ? -33.827 47.262  -11.948 1.00 65.59  ? 184  ASP B C   1 
ATOM 10175 O O   . ASP B 1 187  ? -32.808 47.790  -12.408 1.00 65.51  ? 184  ASP B O   1 
ATOM 10176 C CB  . ASP B 1 187  ? -35.905 48.343  -10.905 1.00 65.46  ? 184  ASP B CB  1 
ATOM 10177 C CG  . ASP B 1 187  ? -35.963 49.572  -11.794 1.00 65.79  ? 184  ASP B CG  1 
ATOM 10178 O OD1 . ASP B 1 187  ? -34.958 49.880  -12.472 1.00 66.58  ? 184  ASP B OD1 1 
ATOM 10179 O OD2 . ASP B 1 187  ? -37.027 50.229  -11.820 1.00 65.93  ? 184  ASP B OD2 1 
ATOM 10180 N N   . PRO B 1 188  ? -34.409 46.187  -12.525 1.00 65.82  ? 185  PRO B N   1 
ATOM 10181 C CA  . PRO B 1 188  ? -33.783 45.457  -13.643 1.00 65.94  ? 185  PRO B CA  1 
ATOM 10182 C C   . PRO B 1 188  ? -33.345 46.287  -14.870 1.00 65.96  ? 185  PRO B C   1 
ATOM 10183 O O   . PRO B 1 188  ? -32.683 45.744  -15.765 1.00 66.01  ? 185  PRO B O   1 
ATOM 10184 C CB  . PRO B 1 188  ? -34.868 44.448  -14.059 1.00 66.01  ? 185  PRO B CB  1 
ATOM 10185 C CG  . PRO B 1 188  ? -35.708 44.266  -12.863 1.00 66.05  ? 185  PRO B CG  1 
ATOM 10186 C CD  . PRO B 1 188  ? -35.707 45.588  -12.151 1.00 66.00  ? 185  PRO B CD  1 
ATOM 10187 N N   . GLN B 1 189  ? -33.702 47.570  -14.921 1.00 65.84  ? 186  GLN B N   1 
ATOM 10188 C CA  . GLN B 1 189  ? -33.309 48.428  -16.048 1.00 65.70  ? 186  GLN B CA  1 
ATOM 10189 C C   . GLN B 1 189  ? -32.019 49.176  -15.765 1.00 65.50  ? 186  GLN B C   1 
ATOM 10190 O O   . GLN B 1 189  ? -31.234 49.444  -16.678 1.00 65.38  ? 186  GLN B O   1 
ATOM 10191 C CB  . GLN B 1 189  ? -34.413 49.430  -16.391 1.00 65.73  ? 186  GLN B CB  1 
ATOM 10192 C CG  . GLN B 1 189  ? -35.651 48.804  -17.013 1.00 66.13  ? 186  GLN B CG  1 
ATOM 10193 C CD  . GLN B 1 189  ? -36.476 48.004  -16.016 1.00 66.66  ? 186  GLN B CD  1 
ATOM 10194 O OE1 . GLN B 1 189  ? -36.802 48.485  -14.929 1.00 67.20  ? 186  GLN B OE1 1 
ATOM 10195 N NE2 . GLN B 1 189  ? -36.819 46.778  -16.385 1.00 66.85  ? 186  GLN B NE2 1 
ATOM 10196 N N   . GLY B 1 190  ? -31.810 49.496  -14.490 1.00 65.31  ? 187  GLY B N   1 
ATOM 10197 C CA  . GLY B 1 190  ? -30.720 50.363  -14.059 1.00 64.94  ? 187  GLY B CA  1 
ATOM 10198 C C   . GLY B 1 190  ? -31.282 51.476  -13.199 1.00 64.60  ? 187  GLY B C   1 
ATOM 10199 O O   . GLY B 1 190  ? -32.497 51.552  -12.991 1.00 64.45  ? 187  GLY B O   1 
ATOM 10200 N N   . ARG B 1 191  ? -30.401 52.349  -12.715 1.00 64.25  ? 188  ARG B N   1 
ATOM 10201 C CA  . ARG B 1 191  ? -30.785 53.360  -11.731 1.00 63.80  ? 188  ARG B CA  1 
ATOM 10202 C C   . ARG B 1 191  ? -31.640 54.489  -12.268 1.00 63.55  ? 188  ARG B C   1 
ATOM 10203 O O   . ARG B 1 191  ? -31.411 54.998  -13.366 1.00 63.53  ? 188  ARG B O   1 
ATOM 10204 C CB  . ARG B 1 191  ? -29.558 53.913  -11.021 1.00 63.77  ? 188  ARG B CB  1 
ATOM 10205 C CG  . ARG B 1 191  ? -29.180 53.081  -9.830  1.00 63.62  ? 188  ARG B CG  1 
ATOM 10206 C CD  . ARG B 1 191  ? -27.697 52.939  -9.715  1.00 63.19  ? 188  ARG B CD  1 
ATOM 10207 N NE  . ARG B 1 191  ? -27.379 51.649  -9.125  1.00 62.76  ? 188  ARG B NE  1 
ATOM 10208 C CZ  . ARG B 1 191  ? -26.832 51.484  -7.929  1.00 62.80  ? 188  ARG B CZ  1 
ATOM 10209 N NH1 . ARG B 1 191  ? -26.521 52.537  -7.185  1.00 63.03  ? 188  ARG B NH1 1 
ATOM 10210 N NH2 . ARG B 1 191  ? -26.582 50.260  -7.485  1.00 62.94  ? 188  ARG B NH2 1 
ATOM 10211 N N   . HIS B 1 192  ? -32.637 54.863  -11.473 1.00 63.28  ? 189  HIS B N   1 
ATOM 10212 C CA  . HIS B 1 192  ? -33.506 55.991  -11.778 1.00 63.12  ? 189  HIS B CA  1 
ATOM 10213 C C   . HIS B 1 192  ? -33.549 56.961  -10.602 1.00 62.91  ? 189  HIS B C   1 
ATOM 10214 O O   . HIS B 1 192  ? -33.242 56.595  -9.465  1.00 62.89  ? 189  HIS B O   1 
ATOM 10215 C CB  . HIS B 1 192  ? -34.932 55.528  -12.105 1.00 63.07  ? 189  HIS B CB  1 
ATOM 10216 C CG  . HIS B 1 192  ? -35.009 54.492  -13.180 1.00 63.32  ? 189  HIS B CG  1 
ATOM 10217 N ND1 . HIS B 1 192  ? -35.253 53.163  -12.915 1.00 63.51  ? 189  HIS B ND1 1 
ATOM 10218 C CD2 . HIS B 1 192  ? -34.881 54.590  -14.523 1.00 64.05  ? 189  HIS B CD2 1 
ATOM 10219 C CE1 . HIS B 1 192  ? -35.267 52.485  -14.049 1.00 63.74  ? 189  HIS B CE1 1 
ATOM 10220 N NE2 . HIS B 1 192  ? -35.042 53.327  -15.040 1.00 64.27  ? 189  HIS B NE2 1 
ATOM 10221 N N   . VAL B 1 193  ? -33.918 58.201  -10.900 1.00 62.68  ? 190  VAL B N   1 
ATOM 10222 C CA  . VAL B 1 193  ? -34.215 59.204  -9.890  1.00 62.54  ? 190  VAL B CA  1 
ATOM 10223 C C   . VAL B 1 193  ? -35.714 59.488  -9.942  1.00 62.48  ? 190  VAL B C   1 
ATOM 10224 O O   . VAL B 1 193  ? -36.298 59.562  -11.021 1.00 62.43  ? 190  VAL B O   1 
ATOM 10225 C CB  . VAL B 1 193  ? -33.341 60.493  -10.059 1.00 62.47  ? 190  VAL B CB  1 
ATOM 10226 C CG1 . VAL B 1 193  ? -32.904 60.679  -11.496 1.00 62.62  ? 190  VAL B CG1 1 
ATOM 10227 C CG2 . VAL B 1 193  ? -34.056 61.744  -9.542  1.00 62.42  ? 190  VAL B CG2 1 
ATOM 10228 N N   . LYS B 1 194  ? -36.334 59.615  -8.774  1.00 62.49  ? 191  LYS B N   1 
ATOM 10229 C CA  . LYS B 1 194  ? -37.773 59.801  -8.687  1.00 62.71  ? 191  LYS B CA  1 
ATOM 10230 C C   . LYS B 1 194  ? -38.112 60.765  -7.552  1.00 63.00  ? 191  LYS B C   1 
ATOM 10231 O O   . LYS B 1 194  ? -37.294 60.973  -6.650  1.00 62.93  ? 191  LYS B O   1 
ATOM 10232 C CB  . LYS B 1 194  ? -38.446 58.446  -8.472  1.00 62.65  ? 191  LYS B CB  1 
ATOM 10233 C CG  . LYS B 1 194  ? -39.900 58.376  -8.898  1.00 62.65  ? 191  LYS B CG  1 
ATOM 10234 C CD  . LYS B 1 194  ? -40.426 56.958  -8.782  1.00 62.20  ? 191  LYS B CD  1 
ATOM 10235 C CE  . LYS B 1 194  ? -41.939 56.937  -8.727  1.00 62.11  ? 191  LYS B CE  1 
ATOM 10236 N NZ  . LYS B 1 194  ? -42.434 55.586  -8.344  1.00 62.25  ? 191  LYS B NZ  1 
ATOM 10237 N N   . THR B 1 195  ? -39.304 61.365  -7.609  1.00 63.39  ? 192  THR B N   1 
ATOM 10238 C CA  . THR B 1 195  ? -39.768 62.270  -6.553  1.00 63.77  ? 192  THR B CA  1 
ATOM 10239 C C   . THR B 1 195  ? -41.196 61.994  -6.071  1.00 64.43  ? 192  THR B C   1 
ATOM 10240 O O   . THR B 1 195  ? -42.072 61.605  -6.849  1.00 64.28  ? 192  THR B O   1 
ATOM 10241 C CB  . THR B 1 195  ? -39.676 63.750  -6.965  1.00 63.53  ? 192  THR B CB  1 
ATOM 10242 O OG1 . THR B 1 195  ? -40.361 63.941  -8.204  1.00 63.23  ? 192  THR B OG1 1 
ATOM 10243 C CG2 . THR B 1 195  ? -38.229 64.184  -7.110  1.00 63.11  ? 192  THR B CG2 1 
ATOM 10244 N N   . TYR B 1 196  ? -41.392 62.194  -4.767  1.00 65.30  ? 193  TYR B N   1 
ATOM 10245 C CA  . TYR B 1 196  ? -42.697 62.161  -4.114  1.00 66.07  ? 193  TYR B CA  1 
ATOM 10246 C C   . TYR B 1 196  ? -42.838 63.380  -3.199  1.00 66.86  ? 193  TYR B C   1 
ATOM 10247 O O   . TYR B 1 196  ? -41.882 63.769  -2.517  1.00 66.66  ? 193  TYR B O   1 
ATOM 10248 C CB  . TYR B 1 196  ? -42.842 60.926  -3.222  1.00 65.82  ? 193  TYR B CB  1 
ATOM 10249 C CG  . TYR B 1 196  ? -42.845 59.572  -3.893  1.00 65.70  ? 193  TYR B CG  1 
ATOM 10250 C CD1 . TYR B 1 196  ? -41.654 58.903  -4.174  1.00 65.95  ? 193  TYR B CD1 1 
ATOM 10251 C CD2 . TYR B 1 196  ? -44.039 58.928  -4.191  1.00 65.58  ? 193  TYR B CD2 1 
ATOM 10252 C CE1 . TYR B 1 196  ? -41.658 57.637  -4.767  1.00 65.80  ? 193  TYR B CE1 1 
ATOM 10253 C CE2 . TYR B 1 196  ? -44.054 57.664  -4.781  1.00 65.57  ? 193  TYR B CE2 1 
ATOM 10254 C CZ  . TYR B 1 196  ? -42.863 57.027  -5.065  1.00 65.58  ? 193  TYR B CZ  1 
ATOM 10255 O OH  . TYR B 1 196  ? -42.882 55.785  -5.648  1.00 65.53  ? 193  TYR B OH  1 
ATOM 10256 N N   . GLU B 1 197  ? -44.037 63.965  -3.180  1.00 68.04  ? 194  GLU B N   1 
ATOM 10257 C CA  . GLU B 1 197  ? -44.468 64.831  -2.076  1.00 69.16  ? 194  GLU B CA  1 
ATOM 10258 C C   . GLU B 1 197  ? -44.773 63.925  -0.883  1.00 69.63  ? 194  GLU B C   1 
ATOM 10259 O O   . GLU B 1 197  ? -44.819 62.703  -1.023  1.00 69.69  ? 194  GLU B O   1 
ATOM 10260 C CB  . GLU B 1 197  ? -45.714 65.646  -2.454  1.00 69.07  ? 194  GLU B CB  1 
ATOM 10261 C CG  . GLU B 1 197  ? -45.423 66.922  -3.263  1.00 69.68  ? 194  GLU B CG  1 
ATOM 10262 C CD  . GLU B 1 197  ? -46.675 67.749  -3.595  1.00 69.73  ? 194  GLU B CD  1 
ATOM 10263 O OE1 . GLU B 1 197  ? -47.559 67.913  -2.717  1.00 70.04  ? 194  GLU B OE1 1 
ATOM 10264 O OE2 . GLU B 1 197  ? -46.761 68.249  -4.743  1.00 70.05  ? 194  GLU B OE2 1 
ATOM 10265 N N   . VAL B 1 198  ? -44.959 64.515  0.293   1.00 70.38  ? 195  VAL B N   1 
ATOM 10266 C CA  . VAL B 1 198  ? -45.383 63.743  1.459   1.00 71.12  ? 195  VAL B CA  1 
ATOM 10267 C C   . VAL B 1 198  ? -46.567 64.443  2.136   1.00 71.73  ? 195  VAL B C   1 
ATOM 10268 O O   . VAL B 1 198  ? -46.402 65.451  2.830   1.00 71.74  ? 195  VAL B O   1 
ATOM 10269 C CB  . VAL B 1 198  ? -44.216 63.456  2.448   1.00 71.01  ? 195  VAL B CB  1 
ATOM 10270 C CG1 . VAL B 1 198  ? -44.595 62.350  3.417   1.00 71.03  ? 195  VAL B CG1 1 
ATOM 10271 C CG2 . VAL B 1 198  ? -42.962 63.045  1.702   1.00 71.11  ? 195  VAL B CG2 1 
ATOM 10272 N N   . SER B 1 199  ? -47.761 63.905  1.899   1.00 72.56  ? 196  SER B N   1 
ATOM 10273 C CA  . SER B 1 199  ? -49.005 64.506  2.371   1.00 73.45  ? 196  SER B CA  1 
ATOM 10274 C C   . SER B 1 199  ? -49.354 63.958  3.746   1.00 73.96  ? 196  SER B C   1 
ATOM 10275 O O   . SER B 1 199  ? -50.136 63.016  3.865   1.00 74.12  ? 196  SER B O   1 
ATOM 10276 C CB  . SER B 1 199  ? -50.144 64.242  1.366   1.00 73.51  ? 196  SER B CB  1 
ATOM 10277 O OG  . SER B 1 199  ? -51.399 64.734  1.826   1.00 73.64  ? 196  SER B OG  1 
ATOM 10278 N N   . LEU B 1 200  ? -48.775 64.554  4.784   1.00 74.59  ? 197  LEU B N   1 
ATOM 10279 C CA  . LEU B 1 200  ? -49.026 64.112  6.157   1.00 75.36  ? 197  LEU B CA  1 
ATOM 10280 C C   . LEU B 1 200  ? -50.495 64.281  6.559   1.00 75.87  ? 197  LEU B C   1 
ATOM 10281 O O   . LEU B 1 200  ? -50.904 63.895  7.660   1.00 75.89  ? 197  LEU B O   1 
ATOM 10282 C CB  . LEU B 1 200  ? -48.082 64.809  7.146   1.00 75.36  ? 197  LEU B CB  1 
ATOM 10283 C CG  . LEU B 1 200  ? -48.092 66.328  7.323   1.00 75.62  ? 197  LEU B CG  1 
ATOM 10284 C CD1 . LEU B 1 200  ? -47.481 66.686  8.678   1.00 75.67  ? 197  LEU B CD1 1 
ATOM 10285 C CD2 . LEU B 1 200  ? -47.363 67.038  6.178   1.00 75.61  ? 197  LEU B CD2 1 
ATOM 10286 N N   . ARG B 1 201  ? -51.270 64.854  5.641   1.00 76.53  ? 198  ARG B N   1 
ATOM 10287 C CA  . ARG B 1 201  ? -52.715 64.963  5.763   1.00 77.24  ? 198  ARG B CA  1 
ATOM 10288 C C   . ARG B 1 201  ? -53.356 63.596  5.489   1.00 77.53  ? 198  ARG B C   1 
ATOM 10289 O O   . ARG B 1 201  ? -54.029 63.033  6.356   1.00 77.64  ? 198  ARG B O   1 
ATOM 10290 C CB  . ARG B 1 201  ? -53.245 66.012  4.771   1.00 77.40  ? 198  ARG B CB  1 
ATOM 10291 C CG  . ARG B 1 201  ? -54.520 66.750  5.200   1.00 77.90  ? 198  ARG B CG  1 
ATOM 10292 C CD  . ARG B 1 201  ? -54.213 68.090  5.872   1.00 78.63  ? 198  ARG B CD  1 
ATOM 10293 N NE  . ARG B 1 201  ? -53.559 67.923  7.171   1.00 79.17  ? 198  ARG B NE  1 
ATOM 10294 C CZ  . ARG B 1 201  ? -54.194 67.884  8.342   1.00 79.65  ? 198  ARG B CZ  1 
ATOM 10295 N NH1 . ARG B 1 201  ? -55.517 68.004  8.404   1.00 79.79  ? 198  ARG B NH1 1 
ATOM 10296 N NH2 . ARG B 1 201  ? -53.498 67.728  9.462   1.00 79.72  ? 198  ARG B NH2 1 
ATOM 10297 N N   . GLU B 1 202  ? -53.122 63.064  4.290   1.00 77.84  ? 199  GLU B N   1 
ATOM 10298 C CA  . GLU B 1 202  ? -53.749 61.818  3.839   1.00 78.15  ? 199  GLU B CA  1 
ATOM 10299 C C   . GLU B 1 202  ? -52.852 60.602  4.091   1.00 78.27  ? 199  GLU B C   1 
ATOM 10300 O O   . GLU B 1 202  ? -53.247 59.464  3.813   1.00 78.44  ? 199  GLU B O   1 
ATOM 10301 C CB  . GLU B 1 202  ? -54.102 61.908  2.347   1.00 78.19  ? 199  GLU B CB  1 
ATOM 10302 C CG  . GLU B 1 202  ? -54.538 63.300  1.860   1.00 78.80  ? 199  GLU B CG  1 
ATOM 10303 C CD  . GLU B 1 202  ? -55.891 63.740  2.412   1.00 79.52  ? 199  GLU B CD  1 
ATOM 10304 O OE1 . GLU B 1 202  ? -55.951 64.789  3.093   1.00 79.53  ? 199  GLU B OE1 1 
ATOM 10305 O OE2 . GLU B 1 202  ? -56.897 63.038  2.164   1.00 80.02  ? 199  GLU B OE2 1 
ATOM 10306 N N   . LYS B 1 203  ? -51.654 60.865  4.624   1.00 78.31  ? 200  LYS B N   1 
ATOM 10307 C CA  . LYS B 1 203  ? -50.591 59.865  4.857   1.00 78.22  ? 200  LYS B CA  1 
ATOM 10308 C C   . LYS B 1 203  ? -50.204 59.040  3.618   1.00 78.33  ? 200  LYS B C   1 
ATOM 10309 O O   . LYS B 1 203  ? -49.824 57.872  3.719   1.00 78.29  ? 200  LYS B O   1 
ATOM 10310 C CB  . LYS B 1 203  ? -50.911 58.977  6.065   1.00 78.12  ? 200  LYS B CB  1 
ATOM 10311 C CG  . LYS B 1 203  ? -50.795 59.702  7.397   1.00 77.91  ? 200  LYS B CG  1 
ATOM 10312 C CD  . LYS B 1 203  ? -50.639 58.726  8.551   1.00 77.77  ? 200  LYS B CD  1 
ATOM 10313 C CE  . LYS B 1 203  ? -51.967 58.204  9.068   1.00 78.06  ? 200  LYS B CE  1 
ATOM 10314 N NZ  . LYS B 1 203  ? -52.677 59.211  9.908   1.00 78.48  ? 200  LYS B NZ  1 
ATOM 10315 N N   . GLU B 1 204  ? -50.300 59.677  2.454   1.00 78.53  ? 201  GLU B N   1 
ATOM 10316 C CA  . GLU B 1 204  ? -49.914 59.082  1.178   1.00 78.69  ? 201  GLU B CA  1 
ATOM 10317 C C   . GLU B 1 204  ? -48.637 59.751  0.695   1.00 78.52  ? 201  GLU B C   1 
ATOM 10318 O O   . GLU B 1 204  ? -47.954 60.422  1.471   1.00 78.35  ? 201  GLU B O   1 
ATOM 10319 C CB  . GLU B 1 204  ? -51.039 59.262  0.150   1.00 78.83  ? 201  GLU B CB  1 
ATOM 10320 C CG  . GLU B 1 204  ? -52.214 58.310  0.361   1.00 79.71  ? 201  GLU B CG  1 
ATOM 10321 C CD  . GLU B 1 204  ? -53.509 58.779  -0.284  1.00 80.50  ? 201  GLU B CD  1 
ATOM 10322 O OE1 . GLU B 1 204  ? -53.516 59.080  -1.502  1.00 80.67  ? 201  GLU B OE1 1 
ATOM 10323 O OE2 . GLU B 1 204  ? -54.528 58.823  0.441   1.00 80.72  ? 201  GLU B OE2 1 
ATOM 10324 N N   . PHE B 1 205  ? -48.317 59.568  -0.581  1.00 78.51  ? 202  PHE B N   1 
ATOM 10325 C CA  . PHE B 1 205  ? -47.167 60.240  -1.178  1.00 78.48  ? 202  PHE B CA  1 
ATOM 10326 C C   . PHE B 1 205  ? -47.553 61.292  -2.225  1.00 78.35  ? 202  PHE B C   1 
ATOM 10327 O O   . PHE B 1 205  ? -47.116 62.445  -2.147  1.00 78.22  ? 202  PHE B O   1 
ATOM 10328 C CB  . PHE B 1 205  ? -46.182 59.225  -1.767  1.00 78.58  ? 202  PHE B CB  1 
ATOM 10329 C CG  . PHE B 1 205  ? -45.049 58.846  -0.836  1.00 78.58  ? 202  PHE B CG  1 
ATOM 10330 C CD1 . PHE B 1 205  ? -44.540 59.759  0.086   1.00 78.65  ? 202  PHE B CD1 1 
ATOM 10331 C CD2 . PHE B 1 205  ? -44.466 57.585  -0.916  1.00 78.49  ? 202  PHE B CD2 1 
ATOM 10332 C CE1 . PHE B 1 205  ? -43.490 59.413  0.928   1.00 78.50  ? 202  PHE B CE1 1 
ATOM 10333 C CE2 . PHE B 1 205  ? -43.413 57.230  -0.084  1.00 78.38  ? 202  PHE B CE2 1 
ATOM 10334 C CZ  . PHE B 1 205  ? -42.924 58.146  0.841   1.00 78.61  ? 202  PHE B CZ  1 
ATOM 10335 N N   . ASN B 1 206  ? -48.392 60.927  -3.161  1.00 78.24  ? 203  ASN B N   1 
ATOM 10336 C CA  . ASN B 1 206  ? -48.782 61.763  -4.308  1.00 78.15  ? 203  ASN B CA  1 
ATOM 10337 C C   . ASN B 1 206  ? -47.611 61.940  -5.293  1.00 78.01  ? 203  ASN B C   1 
ATOM 10338 O O   . ASN B 1 206  ? -46.602 61.337  -5.177  1.00 78.06  ? 203  ASN B O   1 
ATOM 10339 C CB  . ASN B 1 206  ? -49.468 63.077  -3.864  1.00 78.19  ? 203  ASN B CB  1 
ATOM 10340 C CG  . ASN B 1 206  ? -50.433 62.893  -2.681  1.00 78.26  ? 203  ASN B CG  1 
ATOM 10341 O OD1 . ASN B 1 206  ? -50.778 61.771  -2.296  1.00 78.28  ? 203  ASN B OD1 1 
ATOM 10342 N ND2 . ASN B 1 206  ? -50.863 64.008  -2.097  1.00 78.06  ? 203  ASN B ND2 1 
ATOM 10343 N N   . LYS B 1 207  ? -47.785 62.665  -6.306  1.00 77.76  ? 204  LYS B N   1 
ATOM 10344 C CA  . LYS B 1 207  ? -46.850 62.803  -7.468  1.00 77.46  ? 204  LYS B CA  1 
ATOM 10345 C C   . LYS B 1 207  ? -45.815 63.832  -6.985  1.00 77.23  ? 204  LYS B C   1 
ATOM 10346 O O   . LYS B 1 207  ? -46.122 64.681  -6.143  1.00 77.11  ? 204  LYS B O   1 
ATOM 10347 C CB  . LYS B 1 207  ? -47.525 63.271  -8.769  1.00 77.48  ? 204  LYS B CB  1 
ATOM 10348 C CG  . LYS B 1 207  ? -46.708 63.050  -10.046 1.00 77.74  ? 204  LYS B CG  1 
ATOM 10349 C CD  . LYS B 1 207  ? -47.514 63.347  -11.322 1.00 77.49  ? 204  LYS B CD  1 
ATOM 10350 C CE  . LYS B 1 207  ? -46.611 63.337  -12.565 1.00 77.25  ? 204  LYS B CE  1 
ATOM 10351 N NZ  . LYS B 1 207  ? -47.366 63.331  -13.853 1.00 76.44  ? 204  LYS B NZ  1 
ATOM 10352 N N   . GLY B 1 208  ? -44.593 63.736  -7.512  1.00 77.06  ? 205  GLY B N   1 
ATOM 10353 C CA  . GLY B 1 208  ? -43.513 64.688  -7.209  1.00 76.79  ? 205  GLY B CA  1 
ATOM 10354 C C   . GLY B 1 208  ? -43.335 65.794  -8.251  1.00 76.55  ? 205  GLY B C   1 
ATOM 10355 O O   . GLY B 1 208  ? -43.735 65.626  -9.409  1.00 76.60  ? 205  GLY B O   1 
ATOM 10356 N N   . PRO B 1 209  ? -42.748 66.941  -7.838  1.00 76.24  ? 206  PRO B N   1 
ATOM 10357 C CA  . PRO B 1 209  ? -42.449 68.125  -8.660  1.00 75.94  ? 206  PRO B CA  1 
ATOM 10358 C C   . PRO B 1 209  ? -41.852 67.887  -10.056 1.00 75.67  ? 206  PRO B C   1 
ATOM 10359 O O   . PRO B 1 209  ? -42.188 68.623  -10.984 1.00 75.74  ? 206  PRO B O   1 
ATOM 10360 C CB  . PRO B 1 209  ? -41.467 68.905  -7.787  1.00 75.88  ? 206  PRO B CB  1 
ATOM 10361 C CG  . PRO B 1 209  ? -41.938 68.621  -6.417  1.00 76.05  ? 206  PRO B CG  1 
ATOM 10362 C CD  . PRO B 1 209  ? -42.365 67.170  -6.433  1.00 76.21  ? 206  PRO B CD  1 
ATOM 10363 N N   . TRP B 1 210  ? -40.977 66.900  -10.221 1.00 75.25  ? 207  TRP B N   1 
ATOM 10364 C CA  . TRP B 1 210  ? -40.480 66.611  -11.566 1.00 74.90  ? 207  TRP B CA  1 
ATOM 10365 C C   . TRP B 1 210  ? -40.358 65.141  -11.915 1.00 74.71  ? 207  TRP B C   1 
ATOM 10366 O O   . TRP B 1 210  ? -40.041 64.311  -11.063 1.00 74.73  ? 207  TRP B O   1 
ATOM 10367 C CB  . TRP B 1 210  ? -39.179 67.359  -11.867 1.00 74.97  ? 207  TRP B CB  1 
ATOM 10368 C CG  . TRP B 1 210  ? -37.999 66.998  -11.019 1.00 74.82  ? 207  TRP B CG  1 
ATOM 10369 C CD1 . TRP B 1 210  ? -37.110 65.978  -11.232 1.00 74.85  ? 207  TRP B CD1 1 
ATOM 10370 C CD2 . TRP B 1 210  ? -37.544 67.689  -9.853  1.00 74.70  ? 207  TRP B CD2 1 
ATOM 10371 N NE1 . TRP B 1 210  ? -36.139 65.985  -10.261 1.00 74.76  ? 207  TRP B NE1 1 
ATOM 10372 C CE2 . TRP B 1 210  ? -36.381 67.022  -9.399  1.00 74.73  ? 207  TRP B CE2 1 
ATOM 10373 C CE3 . TRP B 1 210  ? -38.012 68.803  -9.140  1.00 74.63  ? 207  TRP B CE3 1 
ATOM 10374 C CZ2 . TRP B 1 210  ? -35.678 67.429  -8.260  1.00 74.63  ? 207  TRP B CZ2 1 
ATOM 10375 C CZ3 . TRP B 1 210  ? -37.314 69.209  -8.010  1.00 74.91  ? 207  TRP B CZ3 1 
ATOM 10376 C CH2 . TRP B 1 210  ? -36.155 68.523  -7.584  1.00 74.86  ? 207  TRP B CH2 1 
ATOM 10377 N N   . LYS B 1 211  ? -40.597 64.850  -13.192 1.00 74.44  ? 208  LYS B N   1 
ATOM 10378 C CA  . LYS B 1 211  ? -40.687 63.489  -13.714 1.00 74.21  ? 208  LYS B CA  1 
ATOM 10379 C C   . LYS B 1 211  ? -39.472 62.617  -13.429 1.00 74.15  ? 208  LYS B C   1 
ATOM 10380 O O   . LYS B 1 211  ? -38.354 63.111  -13.275 1.00 74.01  ? 208  LYS B O   1 
ATOM 10381 C CB  . LYS B 1 211  ? -40.976 63.515  -15.217 1.00 74.18  ? 208  LYS B CB  1 
ATOM 10382 C CG  . LYS B 1 211  ? -42.451 63.636  -15.546 1.00 74.06  ? 208  LYS B CG  1 
ATOM 10383 C CD  . LYS B 1 211  ? -42.679 64.100  -16.973 1.00 73.74  ? 208  LYS B CD  1 
ATOM 10384 C CE  . LYS B 1 211  ? -44.079 63.743  -17.461 1.00 73.74  ? 208  LYS B CE  1 
ATOM 10385 N NZ  . LYS B 1 211  ? -45.171 64.292  -16.605 1.00 73.67  ? 208  LYS B NZ  1 
ATOM 10386 N N   . GLN B 1 212  ? -39.727 61.313  -13.349 1.00 74.17  ? 209  GLN B N   1 
ATOM 10387 C CA  . GLN B 1 212  ? -38.698 60.307  -13.135 1.00 74.15  ? 209  GLN B CA  1 
ATOM 10388 C C   . GLN B 1 212  ? -37.644 60.419  -14.228 1.00 73.93  ? 209  GLN B C   1 
ATOM 10389 O O   . GLN B 1 212  ? -37.956 60.419  -15.418 1.00 73.75  ? 209  GLN B O   1 
ATOM 10390 C CB  . GLN B 1 212  ? -39.324 58.906  -13.107 1.00 74.15  ? 209  GLN B CB  1 
ATOM 10391 C CG  . GLN B 1 212  ? -38.339 57.745  -12.974 1.00 74.39  ? 209  GLN B CG  1 
ATOM 10392 C CD  . GLN B 1 212  ? -38.907 56.421  -13.484 1.00 74.47  ? 209  GLN B CD  1 
ATOM 10393 O OE1 . GLN B 1 212  ? -39.959 55.958  -13.026 1.00 74.69  ? 209  GLN B OE1 1 
ATOM 10394 N NE2 . GLN B 1 212  ? -38.203 55.803  -14.432 1.00 74.68  ? 209  GLN B NE2 1 
ATOM 10395 N N   . GLU B 1 213  ? -36.396 60.547  -13.806 1.00 73.91  ? 210  GLU B N   1 
ATOM 10396 C CA  . GLU B 1 213  ? -35.288 60.646  -14.737 1.00 74.02  ? 210  GLU B CA  1 
ATOM 10397 C C   . GLU B 1 213  ? -34.386 59.425  -14.606 1.00 73.79  ? 210  GLU B C   1 
ATOM 10398 O O   . GLU B 1 213  ? -34.588 58.581  -13.731 1.00 73.84  ? 210  GLU B O   1 
ATOM 10399 C CB  . GLU B 1 213  ? -34.492 61.937  -14.498 1.00 74.12  ? 210  GLU B CB  1 
ATOM 10400 C CG  . GLU B 1 213  ? -35.343 63.208  -14.334 1.00 75.11  ? 210  GLU B CG  1 
ATOM 10401 C CD  . GLU B 1 213  ? -35.858 63.808  -15.653 1.00 76.01  ? 210  GLU B CD  1 
ATOM 10402 O OE1 . GLU B 1 213  ? -36.322 63.062  -16.552 1.00 75.98  ? 210  GLU B OE1 1 
ATOM 10403 O OE2 . GLU B 1 213  ? -35.815 65.052  -15.778 1.00 76.15  ? 210  GLU B OE2 1 
ATOM 10404 N N   . ASN B 1 214  ? -33.411 59.327  -15.503 1.00 73.56  ? 211  ASN B N   1 
ATOM 10405 C CA  . ASN B 1 214  ? -32.360 58.326  -15.399 1.00 73.21  ? 211  ASN B CA  1 
ATOM 10406 C C   . ASN B 1 214  ? -31.189 58.879  -14.601 1.00 72.81  ? 211  ASN B C   1 
ATOM 10407 O O   . ASN B 1 214  ? -31.013 60.092  -14.493 1.00 72.88  ? 211  ASN B O   1 
ATOM 10408 C CB  . ASN B 1 214  ? -31.874 57.903  -16.794 1.00 73.26  ? 211  ASN B CB  1 
ATOM 10409 C CG  . ASN B 1 214  ? -32.798 56.901  -17.463 1.00 73.27  ? 211  ASN B CG  1 
ATOM 10410 O OD1 . ASN B 1 214  ? -33.166 55.880  -16.878 1.00 72.80  ? 211  ASN B OD1 1 
ATOM 10411 N ND2 . ASN B 1 214  ? -33.164 57.183  -18.708 1.00 73.66  ? 211  ASN B ND2 1 
ATOM 10412 N N   . VAL B 1 215  ? -30.412 57.981  -14.017 1.00 72.27  ? 212  VAL B N   1 
ATOM 10413 C CA  . VAL B 1 215  ? -29.069 58.309  -13.573 1.00 71.94  ? 212  VAL B CA  1 
ATOM 10414 C C   . VAL B 1 215  ? -28.221 57.076  -13.800 1.00 71.71  ? 212  VAL B C   1 
ATOM 10415 O O   . VAL B 1 215  ? -28.751 55.994  -14.056 1.00 71.70  ? 212  VAL B O   1 
ATOM 10416 C CB  . VAL B 1 215  ? -28.989 58.818  -12.109 1.00 72.07  ? 212  VAL B CB  1 
ATOM 10417 C CG1 . VAL B 1 215  ? -29.049 60.346  -12.073 1.00 71.92  ? 212  VAL B CG1 1 
ATOM 10418 C CG2 . VAL B 1 215  ? -30.069 58.181  -11.221 1.00 72.12  ? 212  VAL B CG2 1 
ATOM 10419 N N   . GLU B 1 216  ? -26.909 57.240  -13.716 1.00 71.42  ? 213  GLU B N   1 
ATOM 10420 C CA  . GLU B 1 216  ? -25.983 56.225  -14.193 1.00 71.26  ? 213  GLU B CA  1 
ATOM 10421 C C   . GLU B 1 216  ? -26.024 54.888  -13.446 1.00 71.00  ? 213  GLU B C   1 
ATOM 10422 O O   . GLU B 1 216  ? -26.576 54.779  -12.351 1.00 70.92  ? 213  GLU B O   1 
ATOM 10423 C CB  . GLU B 1 216  ? -24.568 56.785  -14.201 1.00 71.40  ? 213  GLU B CB  1 
ATOM 10424 C CG  . GLU B 1 216  ? -23.966 56.926  -12.832 1.00 71.63  ? 213  GLU B CG  1 
ATOM 10425 C CD  . GLU B 1 216  ? -22.493 57.186  -12.900 1.00 72.08  ? 213  GLU B CD  1 
ATOM 10426 O OE1 . GLU B 1 216  ? -22.119 58.367  -13.067 1.00 72.02  ? 213  GLU B OE1 1 
ATOM 10427 O OE2 . GLU B 1 216  ? -21.717 56.210  -12.789 1.00 72.33  ? 213  GLU B OE2 1 
ATOM 10428 N N   . ALA B 1 217  ? -25.408 53.883  -14.063 1.00 70.81  ? 214  ALA B N   1 
ATOM 10429 C CA  . ALA B 1 217  ? -25.382 52.513  -13.556 1.00 70.54  ? 214  ALA B CA  1 
ATOM 10430 C C   . ALA B 1 217  ? -24.539 52.352  -12.291 1.00 70.25  ? 214  ALA B C   1 
ATOM 10431 O O   . ALA B 1 217  ? -24.286 51.231  -11.851 1.00 70.15  ? 214  ALA B O   1 
ATOM 10432 C CB  . ALA B 1 217  ? -24.883 51.559  -14.660 1.00 70.62  ? 214  ALA B CB  1 
ATOM 10433 N N   . GLU B 1 218  ? -24.112 53.474  -11.712 1.00 69.99  ? 215  GLU B N   1 
ATOM 10434 C CA  . GLU B 1 218  ? -23.218 53.467  -10.550 1.00 69.74  ? 215  GLU B CA  1 
ATOM 10435 C C   . GLU B 1 218  ? -23.431 54.638  -9.581  1.00 69.35  ? 215  GLU B C   1 
ATOM 10436 O O   . GLU B 1 218  ? -22.576 54.912  -8.730  1.00 69.19  ? 215  GLU B O   1 
ATOM 10437 C CB  . GLU B 1 218  ? -21.750 53.408  -11.006 1.00 69.87  ? 215  GLU B CB  1 
ATOM 10438 C CG  . GLU B 1 218  ? -21.173 51.999  -11.118 1.00 70.39  ? 215  GLU B CG  1 
ATOM 10439 C CD  . GLU B 1 218  ? -21.170 51.254  -9.783  1.00 71.07  ? 215  GLU B CD  1 
ATOM 10440 O OE1 . GLU B 1 218  ? -20.077 51.081  -9.197  1.00 71.76  ? 215  GLU B OE1 1 
ATOM 10441 O OE2 . GLU B 1 218  ? -22.260 50.852  -9.316  1.00 70.41  ? 215  GLU B OE2 1 
ATOM 10442 N N   . ALA B 1 219  ? -24.573 55.316  -9.712  1.00 68.91  ? 216  ALA B N   1 
ATOM 10443 C CA  . ALA B 1 219  ? -24.905 56.470  -8.877  1.00 68.42  ? 216  ALA B CA  1 
ATOM 10444 C C   . ALA B 1 219  ? -25.052 56.030  -7.427  1.00 68.17  ? 216  ALA B C   1 
ATOM 10445 O O   . ALA B 1 219  ? -25.606 54.961  -7.156  1.00 68.27  ? 216  ALA B O   1 
ATOM 10446 C CB  . ALA B 1 219  ? -26.180 57.127  -9.371  1.00 68.35  ? 216  ALA B CB  1 
ATOM 10447 N N   . SER B 1 220  ? -24.548 56.837  -6.497  1.00 67.63  ? 217  SER B N   1 
ATOM 10448 C CA  . SER B 1 220  ? -24.536 56.427  -5.100  1.00 67.27  ? 217  SER B CA  1 
ATOM 10449 C C   . SER B 1 220  ? -24.713 57.540  -4.075  1.00 67.14  ? 217  SER B C   1 
ATOM 10450 O O   . SER B 1 220  ? -24.589 57.303  -2.874  1.00 67.34  ? 217  SER B O   1 
ATOM 10451 C CB  . SER B 1 220  ? -23.278 55.599  -4.789  1.00 67.36  ? 217  SER B CB  1 
ATOM 10452 O OG  . SER B 1 220  ? -22.117 56.407  -4.681  1.00 67.26  ? 217  SER B OG  1 
ATOM 10453 N N   . MET B 1 221  ? -25.009 58.750  -4.531  1.00 66.88  ? 218  MET B N   1 
ATOM 10454 C CA  . MET B 1 221  ? -25.215 59.863  -3.608  1.00 67.03  ? 218  MET B CA  1 
ATOM 10455 C C   . MET B 1 221  ? -26.231 60.859  -4.128  1.00 66.77  ? 218  MET B C   1 
ATOM 10456 O O   . MET B 1 221  ? -26.316 61.097  -5.333  1.00 67.00  ? 218  MET B O   1 
ATOM 10457 C CB  . MET B 1 221  ? -23.909 60.607  -3.349  1.00 66.90  ? 218  MET B CB  1 
ATOM 10458 C CG  . MET B 1 221  ? -22.795 59.763  -2.791  1.00 67.25  ? 218  MET B CG  1 
ATOM 10459 S SD  . MET B 1 221  ? -21.937 60.619  -1.472  1.00 68.33  ? 218  MET B SD  1 
ATOM 10460 C CE  . MET B 1 221  ? -23.069 60.393  -0.072  1.00 67.91  ? 218  MET B CE  1 
ATOM 10461 N N   . VAL B 1 222  ? -26.993 61.449  -3.215  1.00 66.51  ? 219  VAL B N   1 
ATOM 10462 C CA  . VAL B 1 222  ? -27.851 62.577  -3.553  1.00 66.32  ? 219  VAL B CA  1 
ATOM 10463 C C   . VAL B 1 222  ? -27.423 63.778  -2.736  1.00 66.37  ? 219  VAL B C   1 
ATOM 10464 O O   . VAL B 1 222  ? -27.394 63.722  -1.509  1.00 66.43  ? 219  VAL B O   1 
ATOM 10465 C CB  . VAL B 1 222  ? -29.350 62.288  -3.296  1.00 66.19  ? 219  VAL B CB  1 
ATOM 10466 C CG1 . VAL B 1 222  ? -30.197 63.515  -3.599  1.00 65.95  ? 219  VAL B CG1 1 
ATOM 10467 C CG2 . VAL B 1 222  ? -29.816 61.143  -4.148  1.00 66.47  ? 219  VAL B CG2 1 
ATOM 10468 N N   . ILE B 1 223  ? -27.068 64.857  -3.420  1.00 66.46  ? 220  ILE B N   1 
ATOM 10469 C CA  . ILE B 1 223  ? -26.863 66.134  -2.753  1.00 66.55  ? 220  ILE B CA  1 
ATOM 10470 C C   . ILE B 1 223  ? -28.081 67.007  -3.009  1.00 66.75  ? 220  ILE B C   1 
ATOM 10471 O O   . ILE B 1 223  ? -28.355 67.380  -4.151  1.00 66.88  ? 220  ILE B O   1 
ATOM 10472 C CB  . ILE B 1 223  ? -25.579 66.861  -3.238  1.00 66.55  ? 220  ILE B CB  1 
ATOM 10473 C CG1 . ILE B 1 223  ? -24.331 66.001  -2.983  1.00 66.43  ? 220  ILE B CG1 1 
ATOM 10474 C CG2 . ILE B 1 223  ? -25.462 68.235  -2.573  1.00 66.33  ? 220  ILE B CG2 1 
ATOM 10475 C CD1 . ILE B 1 223  ? -23.018 66.638  -3.420  1.00 66.17  ? 220  ILE B CD1 1 
ATOM 10476 N N   . ALA B 1 224  ? -28.825 67.308  -1.953  1.00 66.94  ? 221  ALA B N   1 
ATOM 10477 C CA  . ALA B 1 224  ? -29.882 68.304  -2.040  1.00 67.34  ? 221  ALA B CA  1 
ATOM 10478 C C   . ALA B 1 224  ? -29.206 69.666  -2.068  1.00 67.62  ? 221  ALA B C   1 
ATOM 10479 O O   . ALA B 1 224  ? -28.151 69.845  -1.451  1.00 67.71  ? 221  ALA B O   1 
ATOM 10480 C CB  . ALA B 1 224  ? -30.813 68.195  -0.856  1.00 67.41  ? 221  ALA B CB  1 
ATOM 10481 N N   . VAL B 1 225  ? -29.796 70.620  -2.788  1.00 67.94  ? 222  VAL B N   1 
ATOM 10482 C CA  . VAL B 1 225  ? -29.166 71.934  -2.976  1.00 68.20  ? 222  VAL B CA  1 
ATOM 10483 C C   . VAL B 1 225  ? -30.016 73.098  -2.446  1.00 68.49  ? 222  VAL B C   1 
ATOM 10484 O O   . VAL B 1 225  ? -31.200 73.198  -2.766  1.00 68.60  ? 222  VAL B O   1 
ATOM 10485 C CB  . VAL B 1 225  ? -28.781 72.180  -4.453  1.00 68.09  ? 222  VAL B CB  1 
ATOM 10486 C CG1 . VAL B 1 225  ? -28.031 73.495  -4.603  1.00 68.23  ? 222  VAL B CG1 1 
ATOM 10487 C CG2 . VAL B 1 225  ? -27.930 71.040  -4.975  1.00 67.99  ? 222  VAL B CG2 1 
ATOM 10488 N N   . PRO B 1 226  ? -29.403 73.970  -1.622  1.00 68.73  ? 223  PRO B N   1 
ATOM 10489 C CA  . PRO B 1 226  ? -29.940 75.173  -1.006  1.00 69.07  ? 223  PRO B CA  1 
ATOM 10490 C C   . PRO B 1 226  ? -30.929 76.006  -1.811  1.00 69.53  ? 223  PRO B C   1 
ATOM 10491 O O   . PRO B 1 226  ? -31.149 75.771  -2.999  1.00 69.62  ? 223  PRO B O   1 
ATOM 10492 C CB  . PRO B 1 226  ? -28.681 75.992  -0.744  1.00 69.11  ? 223  PRO B CB  1 
ATOM 10493 C CG  . PRO B 1 226  ? -27.706 74.973  -0.344  1.00 68.94  ? 223  PRO B CG  1 
ATOM 10494 C CD  . PRO B 1 226  ? -28.010 73.754  -1.184  1.00 68.79  ? 223  PRO B CD  1 
ATOM 10495 N N   . GLU B 1 227  ? -31.478 77.004  -1.124  1.00 70.07  ? 224  GLU B N   1 
ATOM 10496 C CA  . GLU B 1 227  ? -32.572 77.853  -1.593  1.00 70.49  ? 224  GLU B CA  1 
ATOM 10497 C C   . GLU B 1 227  ? -32.455 78.502  -2.983  1.00 70.52  ? 224  GLU B C   1 
ATOM 10498 O O   . GLU B 1 227  ? -33.391 78.389  -3.777  1.00 70.60  ? 224  GLU B O   1 
ATOM 10499 C CB  . GLU B 1 227  ? -32.885 78.916  -0.531  1.00 70.61  ? 224  GLU B CB  1 
ATOM 10500 C CG  . GLU B 1 227  ? -34.041 78.544  0.382   1.00 71.43  ? 224  GLU B CG  1 
ATOM 10501 C CD  . GLU B 1 227  ? -35.388 78.916  -0.219  1.00 72.25  ? 224  GLU B CD  1 
ATOM 10502 O OE1 . GLU B 1 227  ? -36.196 77.996  -0.481  1.00 72.42  ? 224  GLU B OE1 1 
ATOM 10503 O OE2 . GLU B 1 227  ? -35.626 80.126  -0.441  1.00 72.14  ? 224  GLU B OE2 1 
ATOM 10504 N N   . PRO B 1 228  ? -31.327 79.186  -3.286  1.00 70.57  ? 225  PRO B N   1 
ATOM 10505 C CA  . PRO B 1 228  ? -31.328 79.983  -4.529  1.00 70.52  ? 225  PRO B CA  1 
ATOM 10506 C C   . PRO B 1 228  ? -31.245 79.132  -5.799  1.00 70.43  ? 225  PRO B C   1 
ATOM 10507 O O   . PRO B 1 228  ? -31.750 79.534  -6.851  1.00 70.45  ? 225  PRO B O   1 
ATOM 10508 C CB  . PRO B 1 228  ? -30.079 80.872  -4.395  1.00 70.45  ? 225  PRO B CB  1 
ATOM 10509 C CG  . PRO B 1 228  ? -29.542 80.628  -3.001  1.00 70.70  ? 225  PRO B CG  1 
ATOM 10510 C CD  . PRO B 1 228  ? -30.035 79.282  -2.582  1.00 70.51  ? 225  PRO B CD  1 
ATOM 10511 N N   . PHE B 1 229  ? -30.628 77.960  -5.679  1.00 70.27  ? 226  PHE B N   1 
ATOM 10512 C CA  . PHE B 1 229  ? -30.411 77.059  -6.805  1.00 70.04  ? 226  PHE B CA  1 
ATOM 10513 C C   . PHE B 1 229  ? -31.480 75.972  -6.860  1.00 69.36  ? 226  PHE B C   1 
ATOM 10514 O O   . PHE B 1 229  ? -32.094 75.750  -7.906  1.00 69.38  ? 226  PHE B O   1 
ATOM 10515 C CB  . PHE B 1 229  ? -29.016 76.426  -6.709  1.00 70.48  ? 226  PHE B CB  1 
ATOM 10516 C CG  . PHE B 1 229  ? -27.884 77.410  -6.881  1.00 71.54  ? 226  PHE B CG  1 
ATOM 10517 C CD1 . PHE B 1 229  ? -27.556 78.313  -5.866  1.00 72.50  ? 226  PHE B CD1 1 
ATOM 10518 C CD2 . PHE B 1 229  ? -27.137 77.428  -8.056  1.00 72.36  ? 226  PHE B CD2 1 
ATOM 10519 C CE1 . PHE B 1 229  ? -26.508 79.224  -6.025  1.00 72.45  ? 226  PHE B CE1 1 
ATOM 10520 C CE2 . PHE B 1 229  ? -26.089 78.330  -8.224  1.00 72.50  ? 226  PHE B CE2 1 
ATOM 10521 C CZ  . PHE B 1 229  ? -25.774 79.228  -7.203  1.00 72.17  ? 226  PHE B CZ  1 
ATOM 10522 N N   . GLY B 1 230  ? -31.694 75.302  -5.729  1.00 68.49  ? 227  GLY B N   1 
ATOM 10523 C CA  . GLY B 1 230  ? -32.606 74.171  -5.656  1.00 67.41  ? 227  GLY B CA  1 
ATOM 10524 C C   . GLY B 1 230  ? -32.091 73.000  -6.465  1.00 66.68  ? 227  GLY B C   1 
ATOM 10525 O O   . GLY B 1 230  ? -31.006 73.061  -7.041  1.00 66.46  ? 227  GLY B O   1 
ATOM 10526 N N   . GLY B 1 231  ? -32.876 71.931  -6.509  1.00 66.14  ? 228  GLY B N   1 
ATOM 10527 C CA  . GLY B 1 231  ? -32.530 70.763  -7.308  1.00 65.40  ? 228  GLY B CA  1 
ATOM 10528 C C   . GLY B 1 231  ? -31.569 69.803  -6.632  1.00 64.84  ? 228  GLY B C   1 
ATOM 10529 O O   . GLY B 1 231  ? -31.202 69.988  -5.467  1.00 64.87  ? 228  GLY B O   1 
ATOM 10530 N N   . ALA B 1 232  ? -31.153 68.785  -7.382  1.00 64.19  ? 229  ALA B N   1 
ATOM 10531 C CA  . ALA B 1 232  ? -30.384 67.674  -6.840  1.00 63.58  ? 229  ALA B CA  1 
ATOM 10532 C C   . ALA B 1 232  ? -29.093 67.432  -7.596  1.00 63.22  ? 229  ALA B C   1 
ATOM 10533 O O   . ALA B 1 232  ? -29.066 67.469  -8.822  1.00 63.34  ? 229  ALA B O   1 
ATOM 10534 C CB  . ALA B 1 232  ? -31.227 66.417  -6.852  1.00 63.62  ? 229  ALA B CB  1 
ATOM 10535 N N   . ILE B 1 233  ? -28.025 67.170  -6.857  1.00 62.74  ? 230  ILE B N   1 
ATOM 10536 C CA  . ILE B 1 233  ? -26.767 66.761  -7.464  1.00 62.43  ? 230  ILE B CA  1 
ATOM 10537 C C   . ILE B 1 233  ? -26.549 65.270  -7.218  1.00 62.36  ? 230  ILE B C   1 
ATOM 10538 O O   . ILE B 1 233  ? -26.471 64.823  -6.071  1.00 62.43  ? 230  ILE B O   1 
ATOM 10539 C CB  . ILE B 1 233  ? -25.585 67.590  -6.929  1.00 62.30  ? 230  ILE B CB  1 
ATOM 10540 C CG1 . ILE B 1 233  ? -25.676 69.021  -7.454  1.00 62.38  ? 230  ILE B CG1 1 
ATOM 10541 C CG2 . ILE B 1 233  ? -24.245 66.955  -7.306  1.00 61.82  ? 230  ILE B CG2 1 
ATOM 10542 C CD1 . ILE B 1 233  ? -24.780 70.009  -6.712  1.00 63.30  ? 230  ILE B CD1 1 
ATOM 10543 N N   . ILE B 1 234  ? -26.460 64.506  -8.301  1.00 62.09  ? 231  ILE B N   1 
ATOM 10544 C CA  . ILE B 1 234  ? -26.249 63.070  -8.200  1.00 62.00  ? 231  ILE B CA  1 
ATOM 10545 C C   . ILE B 1 234  ? -24.816 62.694  -8.567  1.00 62.00  ? 231  ILE B C   1 
ATOM 10546 O O   . ILE B 1 234  ? -24.381 62.885  -9.710  1.00 61.97  ? 231  ILE B O   1 
ATOM 10547 C CB  . ILE B 1 234  ? -27.281 62.289  -9.051  1.00 62.01  ? 231  ILE B CB  1 
ATOM 10548 C CG1 . ILE B 1 234  ? -28.599 62.151  -8.287  1.00 61.92  ? 231  ILE B CG1 1 
ATOM 10549 C CG2 . ILE B 1 234  ? -26.766 60.899  -9.414  1.00 62.16  ? 231  ILE B CG2 1 
ATOM 10550 C CD1 . ILE B 1 234  ? -29.450 63.404  -8.275  1.00 62.28  ? 231  ILE B CD1 1 
ATOM 10551 N N   . ILE B 1 235  ? -24.081 62.170  -7.590  1.00 61.98  ? 232  ILE B N   1 
ATOM 10552 C CA  . ILE B 1 235  ? -22.721 61.705  -7.842  1.00 62.22  ? 232  ILE B CA  1 
ATOM 10553 C C   . ILE B 1 235  ? -22.727 60.210  -8.084  1.00 62.40  ? 232  ILE B C   1 
ATOM 10554 O O   . ILE B 1 235  ? -23.474 59.473  -7.448  1.00 62.51  ? 232  ILE B O   1 
ATOM 10555 C CB  . ILE B 1 235  ? -21.746 62.008  -6.683  1.00 62.19  ? 232  ILE B CB  1 
ATOM 10556 C CG1 . ILE B 1 235  ? -22.076 63.341  -6.012  1.00 62.47  ? 232  ILE B CG1 1 
ATOM 10557 C CG2 . ILE B 1 235  ? -20.303 62.019  -7.189  1.00 61.95  ? 232  ILE B CG2 1 
ATOM 10558 C CD1 . ILE B 1 235  ? -21.576 63.425  -4.580  1.00 63.15  ? 232  ILE B CD1 1 
ATOM 10559 N N   . GLY B 1 236  ? -21.895 59.770  -9.016  1.00 62.67  ? 233  GLY B N   1 
ATOM 10560 C CA  . GLY B 1 236  ? -21.714 58.354  -9.260  1.00 63.15  ? 233  GLY B CA  1 
ATOM 10561 C C   . GLY B 1 236  ? -20.254 58.069  -9.507  1.00 63.52  ? 233  GLY B C   1 
ATOM 10562 O O   . GLY B 1 236  ? -19.382 58.565  -8.795  1.00 63.61  ? 233  GLY B O   1 
ATOM 10563 N N   . GLN B 1 237  ? -19.994 57.254  -10.516 1.00 63.94  ? 234  GLN B N   1 
ATOM 10564 C CA  . GLN B 1 237  ? -18.646 57.027  -10.976 1.00 64.52  ? 234  GLN B CA  1 
ATOM 10565 C C   . GLN B 1 237  ? -18.466 57.764  -12.294 1.00 64.87  ? 234  GLN B C   1 
ATOM 10566 O O   . GLN B 1 237  ? -19.442 58.004  -13.000 1.00 64.96  ? 234  GLN B O   1 
ATOM 10567 C CB  . GLN B 1 237  ? -18.392 55.534  -11.156 1.00 64.55  ? 234  GLN B CB  1 
ATOM 10568 C CG  . GLN B 1 237  ? -16.927 55.179  -11.089 1.00 65.45  ? 234  GLN B CG  1 
ATOM 10569 C CD  . GLN B 1 237  ? -16.263 55.743  -9.845  1.00 66.33  ? 234  GLN B CD  1 
ATOM 10570 O OE1 . GLN B 1 237  ? -16.495 55.253  -8.741  1.00 67.30  ? 234  GLN B OE1 1 
ATOM 10571 N NE2 . GLN B 1 237  ? -15.442 56.782  -10.016 1.00 66.09  ? 234  GLN B NE2 1 
ATOM 10572 N N   . GLU B 1 238  ? -17.225 58.138  -12.611 1.00 65.33  ? 235  GLU B N   1 
ATOM 10573 C CA  . GLU B 1 238  ? -16.871 58.820  -13.874 1.00 65.64  ? 235  GLU B CA  1 
ATOM 10574 C C   . GLU B 1 238  ? -17.597 60.157  -14.099 1.00 65.62  ? 235  GLU B C   1 
ATOM 10575 O O   . GLU B 1 238  ? -17.075 61.051  -14.769 1.00 65.52  ? 235  GLU B O   1 
ATOM 10576 C CB  . GLU B 1 238  ? -17.060 57.879  -15.090 1.00 65.73  ? 235  GLU B CB  1 
ATOM 10577 C CG  . GLU B 1 238  ? -18.470 57.883  -15.719 1.00 65.90  ? 235  GLU B CG  1 
ATOM 10578 C CD  . GLU B 1 238  ? -18.849 56.564  -16.368 1.00 65.90  ? 235  GLU B CD  1 
ATOM 10579 O OE1 . GLU B 1 238  ? -19.789 55.905  -15.863 1.00 65.62  ? 235  GLU B OE1 1 
ATOM 10580 O OE2 . GLU B 1 238  ? -18.213 56.192  -17.382 1.00 66.50  ? 235  GLU B OE2 1 
ATOM 10581 N N   . SER B 1 239  ? -18.783 60.282  -13.507 1.00 65.65  ? 236  SER B N   1 
ATOM 10582 C CA  . SER B 1 239  ? -19.755 61.294  -13.883 1.00 65.83  ? 236  SER B CA  1 
ATOM 10583 C C   . SER B 1 239  ? -20.448 61.929  -12.681 1.00 65.88  ? 236  SER B C   1 
ATOM 10584 O O   . SER B 1 239  ? -20.809 61.244  -11.719 1.00 65.95  ? 236  SER B O   1 
ATOM 10585 C CB  . SER B 1 239  ? -20.787 60.673  -14.839 1.00 65.87  ? 236  SER B CB  1 
ATOM 10586 O OG  . SER B 1 239  ? -22.126 60.920  -14.432 1.00 66.16  ? 236  SER B OG  1 
ATOM 10587 N N   . ILE B 1 240  ? -20.625 63.247  -12.757 1.00 65.91  ? 237  ILE B N   1 
ATOM 10588 C CA  . ILE B 1 240  ? -21.390 64.011  -11.774 1.00 65.99  ? 237  ILE B CA  1 
ATOM 10589 C C   . ILE B 1 240  ? -22.498 64.724  -12.526 1.00 66.14  ? 237  ILE B C   1 
ATOM 10590 O O   . ILE B 1 240  ? -22.231 65.434  -13.495 1.00 66.26  ? 237  ILE B O   1 
ATOM 10591 C CB  . ILE B 1 240  ? -20.505 65.047  -11.054 1.00 65.94  ? 237  ILE B CB  1 
ATOM 10592 C CG1 . ILE B 1 240  ? -19.434 64.340  -10.222 1.00 66.13  ? 237  ILE B CG1 1 
ATOM 10593 C CG2 . ILE B 1 240  ? -21.347 65.954  -10.167 1.00 65.70  ? 237  ILE B CG2 1 
ATOM 10594 C CD1 . ILE B 1 240  ? -18.070 64.989  -10.289 1.00 66.16  ? 237  ILE B CD1 1 
ATOM 10595 N N   . THR B 1 241  ? -23.739 64.526  -12.095 1.00 66.29  ? 238  THR B N   1 
ATOM 10596 C CA  . THR B 1 241  ? -24.884 65.102  -12.806 1.00 66.42  ? 238  THR B CA  1 
ATOM 10597 C C   . THR B 1 241  ? -25.546 66.205  -11.978 1.00 66.49  ? 238  THR B C   1 
ATOM 10598 O O   . THR B 1 241  ? -25.154 66.455  -10.840 1.00 66.48  ? 238  THR B O   1 
ATOM 10599 C CB  . THR B 1 241  ? -25.929 64.010  -13.252 1.00 66.41  ? 238  THR B CB  1 
ATOM 10600 O OG1 . THR B 1 241  ? -26.827 63.697  -12.179 1.00 66.70  ? 238  THR B OG1 1 
ATOM 10601 C CG2 . THR B 1 241  ? -25.237 62.724  -13.735 1.00 66.30  ? 238  THR B CG2 1 
ATOM 10602 N N   . TYR B 1 242  ? -26.527 66.878  -12.570 1.00 66.68  ? 239  TYR B N   1 
ATOM 10603 C CA  . TYR B 1 242  ? -27.362 67.841  -11.856 1.00 67.01  ? 239  TYR B CA  1 
ATOM 10604 C C   . TYR B 1 242  ? -28.812 67.691  -12.297 1.00 67.42  ? 239  TYR B C   1 
ATOM 10605 O O   . TYR B 1 242  ? -29.103 67.605  -13.496 1.00 67.63  ? 239  TYR B O   1 
ATOM 10606 C CB  . TYR B 1 242  ? -26.896 69.282  -12.098 1.00 66.83  ? 239  TYR B CB  1 
ATOM 10607 C CG  . TYR B 1 242  ? -27.775 70.322  -11.429 1.00 66.55  ? 239  TYR B CG  1 
ATOM 10608 C CD1 . TYR B 1 242  ? -27.573 70.680  -10.097 1.00 66.62  ? 239  TYR B CD1 1 
ATOM 10609 C CD2 . TYR B 1 242  ? -28.816 70.938  -12.123 1.00 66.23  ? 239  TYR B CD2 1 
ATOM 10610 C CE1 . TYR B 1 242  ? -28.384 71.631  -9.474  1.00 66.69  ? 239  TYR B CE1 1 
ATOM 10611 C CE2 . TYR B 1 242  ? -29.636 71.886  -11.510 1.00 66.28  ? 239  TYR B CE2 1 
ATOM 10612 C CZ  . TYR B 1 242  ? -29.414 72.229  -10.187 1.00 66.54  ? 239  TYR B CZ  1 
ATOM 10613 O OH  . TYR B 1 242  ? -30.216 73.167  -9.575  1.00 66.43  ? 239  TYR B OH  1 
ATOM 10614 N N   . HIS B 1 243  ? -29.722 67.676  -11.328 1.00 67.67  ? 240  HIS B N   1 
ATOM 10615 C CA  . HIS B 1 243  ? -31.138 67.571  -11.636 1.00 67.89  ? 240  HIS B CA  1 
ATOM 10616 C C   . HIS B 1 243  ? -31.968 68.699  -11.052 1.00 67.98  ? 240  HIS B C   1 
ATOM 10617 O O   . HIS B 1 243  ? -31.838 69.048  -9.884  1.00 67.96  ? 240  HIS B O   1 
ATOM 10618 C CB  . HIS B 1 243  ? -31.688 66.214  -11.200 1.00 67.92  ? 240  HIS B CB  1 
ATOM 10619 C CG  . HIS B 1 243  ? -31.297 65.097  -12.111 1.00 68.31  ? 240  HIS B CG  1 
ATOM 10620 N ND1 . HIS B 1 243  ? -32.018 64.776  -13.242 1.00 68.86  ? 240  HIS B ND1 1 
ATOM 10621 C CD2 . HIS B 1 243  ? -30.249 64.241  -12.074 1.00 68.69  ? 240  HIS B CD2 1 
ATOM 10622 C CE1 . HIS B 1 243  ? -31.435 63.761  -13.856 1.00 69.24  ? 240  HIS B CE1 1 
ATOM 10623 N NE2 . HIS B 1 243  ? -30.359 63.419  -13.169 1.00 69.29  ? 240  HIS B NE2 1 
ATOM 10624 N N   . ASN B 1 244  ? -32.794 69.285  -11.907 1.00 68.25  ? 241  ASN B N   1 
ATOM 10625 C CA  . ASN B 1 244  ? -33.918 70.097  -11.480 1.00 68.49  ? 241  ASN B CA  1 
ATOM 10626 C C   . ASN B 1 244  ? -35.137 69.643  -12.281 1.00 68.82  ? 241  ASN B C   1 
ATOM 10627 O O   . ASN B 1 244  ? -36.176 70.314  -12.309 1.00 68.89  ? 241  ASN B O   1 
ATOM 10628 C CB  . ASN B 1 244  ? -33.631 71.585  -11.675 1.00 68.41  ? 241  ASN B CB  1 
ATOM 10629 C CG  . ASN B 1 244  ? -34.153 72.438  -10.528 1.00 68.32  ? 241  ASN B CG  1 
ATOM 10630 O OD1 . ASN B 1 244  ? -35.131 72.090  -9.863  1.00 67.91  ? 241  ASN B OD1 1 
ATOM 10631 N ND2 . ASN B 1 244  ? -33.495 73.567  -10.293 1.00 68.60  ? 241  ASN B ND2 1 
ATOM 10632 N N   . GLY B 1 245  ? -34.980 68.489  -12.937 1.00 69.14  ? 242  GLY B N   1 
ATOM 10633 C CA  . GLY B 1 245  ? -36.055 67.816  -13.661 1.00 69.35  ? 242  GLY B CA  1 
ATOM 10634 C C   . GLY B 1 245  ? -36.363 68.429  -15.004 1.00 69.52  ? 242  GLY B C   1 
ATOM 10635 O O   . GLY B 1 245  ? -36.693 67.722  -15.958 1.00 69.72  ? 242  GLY B O   1 
ATOM 10636 N N   . ASP B 1 246  ? -36.282 69.754  -15.063 1.00 69.52  ? 243  ASP B N   1 
ATOM 10637 C CA  . ASP B 1 246  ? -36.397 70.485  -16.312 1.00 69.48  ? 243  ASP B CA  1 
ATOM 10638 C C   . ASP B 1 246  ? -35.000 70.902  -16.748 1.00 69.29  ? 243  ASP B C   1 
ATOM 10639 O O   . ASP B 1 246  ? -34.782 71.294  -17.899 1.00 69.33  ? 243  ASP B O   1 
ATOM 10640 C CB  . ASP B 1 246  ? -37.320 71.697  -16.144 1.00 69.63  ? 243  ASP B CB  1 
ATOM 10641 C CG  . ASP B 1 246  ? -38.797 71.311  -16.112 1.00 69.85  ? 243  ASP B CG  1 
ATOM 10642 O OD1 . ASP B 1 246  ? -39.239 70.664  -15.131 1.00 69.78  ? 243  ASP B OD1 1 
ATOM 10643 O OD2 . ASP B 1 246  ? -39.514 71.665  -17.073 1.00 69.97  ? 243  ASP B OD2 1 
ATOM 10644 N N   . LYS B 1 247  ? -34.057 70.794  -15.816 1.00 69.00  ? 244  LYS B N   1 
ATOM 10645 C CA  . LYS B 1 247  ? -32.654 71.055  -16.095 1.00 68.79  ? 244  LYS B CA  1 
ATOM 10646 C C   . LYS B 1 247  ? -31.832 69.786  -15.909 1.00 68.58  ? 244  LYS B C   1 
ATOM 10647 O O   . LYS B 1 247  ? -32.173 68.923  -15.095 1.00 68.52  ? 244  LYS B O   1 
ATOM 10648 C CB  . LYS B 1 247  ? -32.124 72.173  -15.194 1.00 68.81  ? 244  LYS B CB  1 
ATOM 10649 C CG  . LYS B 1 247  ? -30.861 72.848  -15.707 1.00 69.08  ? 244  LYS B CG  1 
ATOM 10650 C CD  . LYS B 1 247  ? -31.175 73.899  -16.765 1.00 70.11  ? 244  LYS B CD  1 
ATOM 10651 C CE  . LYS B 1 247  ? -29.939 74.255  -17.587 1.00 70.68  ? 244  LYS B CE  1 
ATOM 10652 N NZ  . LYS B 1 247  ? -29.594 73.206  -18.600 1.00 70.89  ? 244  LYS B NZ  1 
ATOM 10653 N N   . TYR B 1 248  ? -30.753 69.688  -16.682 1.00 68.41  ? 245  TYR B N   1 
ATOM 10654 C CA  . TYR B 1 248  ? -29.821 68.564  -16.627 1.00 68.18  ? 245  TYR B CA  1 
ATOM 10655 C C   . TYR B 1 248  ? -28.424 69.033  -17.035 1.00 67.94  ? 245  TYR B C   1 
ATOM 10656 O O   . TYR B 1 248  ? -28.153 69.239  -18.221 1.00 68.01  ? 245  TYR B O   1 
ATOM 10657 C CB  . TYR B 1 248  ? -30.292 67.426  -17.547 1.00 68.24  ? 245  TYR B CB  1 
ATOM 10658 C CG  . TYR B 1 248  ? -29.471 66.158  -17.444 1.00 68.22  ? 245  TYR B CG  1 
ATOM 10659 C CD1 . TYR B 1 248  ? -29.889 65.100  -16.636 1.00 68.52  ? 245  TYR B CD1 1 
ATOM 10660 C CD2 . TYR B 1 248  ? -28.278 66.011  -18.156 1.00 67.95  ? 245  TYR B CD2 1 
ATOM 10661 C CE1 . TYR B 1 248  ? -29.137 63.927  -16.535 1.00 68.62  ? 245  TYR B CE1 1 
ATOM 10662 C CE2 . TYR B 1 248  ? -27.517 64.848  -18.063 1.00 68.08  ? 245  TYR B CE2 1 
ATOM 10663 C CZ  . TYR B 1 248  ? -27.951 63.810  -17.253 1.00 68.50  ? 245  TYR B CZ  1 
ATOM 10664 O OH  . TYR B 1 248  ? -27.201 62.658  -17.160 1.00 68.57  ? 245  TYR B OH  1 
ATOM 10665 N N   . LEU B 1 249  ? -27.549 69.220  -16.052 1.00 67.54  ? 246  LEU B N   1 
ATOM 10666 C CA  . LEU B 1 249  ? -26.153 69.545  -16.325 1.00 67.28  ? 246  LEU B CA  1 
ATOM 10667 C C   . LEU B 1 249  ? -25.284 68.382  -15.886 1.00 67.29  ? 246  LEU B C   1 
ATOM 10668 O O   . LEU B 1 249  ? -25.500 67.820  -14.812 1.00 67.44  ? 246  LEU B O   1 
ATOM 10669 C CB  . LEU B 1 249  ? -25.730 70.821  -15.596 1.00 67.21  ? 246  LEU B CB  1 
ATOM 10670 C CG  . LEU B 1 249  ? -26.293 72.175  -16.038 1.00 67.14  ? 246  LEU B CG  1 
ATOM 10671 C CD1 . LEU B 1 249  ? -25.719 73.305  -15.193 1.00 66.81  ? 246  LEU B CD1 1 
ATOM 10672 C CD2 . LEU B 1 249  ? -26.013 72.430  -17.505 1.00 67.81  ? 246  LEU B CD2 1 
ATOM 10673 N N   . ALA B 1 250  ? -24.306 68.020  -16.714 1.00 67.16  ? 247  ALA B N   1 
ATOM 10674 C CA  . ALA B 1 250  ? -23.462 66.850  -16.446 1.00 66.98  ? 247  ALA B CA  1 
ATOM 10675 C C   . ALA B 1 250  ? -21.987 67.094  -16.740 1.00 66.84  ? 247  ALA B C   1 
ATOM 10676 O O   . ALA B 1 250  ? -21.645 67.865  -17.634 1.00 66.90  ? 247  ALA B O   1 
ATOM 10677 C CB  . ALA B 1 250  ? -23.964 65.641  -17.237 1.00 66.98  ? 247  ALA B CB  1 
ATOM 10678 N N   . ILE B 1 251  ? -21.123 66.428  -15.977 1.00 66.70  ? 248  ILE B N   1 
ATOM 10679 C CA  . ILE B 1 251  ? -19.676 66.438  -16.219 1.00 66.55  ? 248  ILE B CA  1 
ATOM 10680 C C   . ILE B 1 251  ? -19.031 65.087  -15.930 1.00 66.41  ? 248  ILE B C   1 
ATOM 10681 O O   . ILE B 1 251  ? -19.253 64.496  -14.868 1.00 66.31  ? 248  ILE B O   1 
ATOM 10682 C CB  . ILE B 1 251  ? -18.936 67.522  -15.400 1.00 66.60  ? 248  ILE B CB  1 
ATOM 10683 C CG1 . ILE B 1 251  ? -19.699 67.844  -14.103 1.00 66.31  ? 248  ILE B CG1 1 
ATOM 10684 C CG2 . ILE B 1 251  ? -18.683 68.765  -16.271 1.00 66.78  ? 248  ILE B CG2 1 
ATOM 10685 C CD1 . ILE B 1 251  ? -18.825 68.362  -12.968 1.00 66.03  ? 248  ILE B CD1 1 
ATOM 10686 N N   . ALA B 1 252  ? -18.222 64.618  -16.879 1.00 66.26  ? 249  ALA B N   1 
ATOM 10687 C CA  . ALA B 1 252  ? -17.514 63.344  -16.749 1.00 66.20  ? 249  ALA B CA  1 
ATOM 10688 C C   . ALA B 1 252  ? -15.977 63.493  -16.749 1.00 66.18  ? 249  ALA B C   1 
ATOM 10689 O O   . ALA B 1 252  ? -15.305 62.995  -17.665 1.00 66.06  ? 249  ALA B O   1 
ATOM 10690 C CB  . ALA B 1 252  ? -17.965 62.381  -17.849 1.00 66.17  ? 249  ALA B CB  1 
ATOM 10691 N N   . PRO B 1 253  ? -15.407 64.153  -15.710 1.00 66.11  ? 250  PRO B N   1 
ATOM 10692 C CA  . PRO B 1 253  ? -13.968 64.411  -15.783 1.00 66.01  ? 250  PRO B CA  1 
ATOM 10693 C C   . PRO B 1 253  ? -13.171 63.191  -15.327 1.00 66.04  ? 250  PRO B C   1 
ATOM 10694 O O   . PRO B 1 253  ? -13.473 62.631  -14.262 1.00 66.11  ? 250  PRO B O   1 
ATOM 10695 C CB  . PRO B 1 253  ? -13.764 65.593  -14.828 1.00 65.91  ? 250  PRO B CB  1 
ATOM 10696 C CG  . PRO B 1 253  ? -14.967 65.618  -13.935 1.00 65.83  ? 250  PRO B CG  1 
ATOM 10697 C CD  . PRO B 1 253  ? -15.988 64.642  -14.444 1.00 66.01  ? 250  PRO B CD  1 
ATOM 10698 N N   . PRO B 1 254  ? -12.172 62.764  -16.135 1.00 65.85  ? 251  PRO B N   1 
ATOM 10699 C CA  . PRO B 1 254  ? -11.348 61.590  -15.831 1.00 65.67  ? 251  PRO B CA  1 
ATOM 10700 C C   . PRO B 1 254  ? -10.789 61.568  -14.401 1.00 65.43  ? 251  PRO B C   1 
ATOM 10701 O O   . PRO B 1 254  ? -10.647 60.490  -13.817 1.00 65.34  ? 251  PRO B O   1 
ATOM 10702 C CB  . PRO B 1 254  ? -10.210 61.692  -16.856 1.00 65.54  ? 251  PRO B CB  1 
ATOM 10703 C CG  . PRO B 1 254  ? -10.825 62.360  -18.000 1.00 65.51  ? 251  PRO B CG  1 
ATOM 10704 C CD  . PRO B 1 254  ? -11.767 63.378  -17.412 1.00 65.76  ? 251  PRO B CD  1 
ATOM 10705 N N   . ILE B 1 255  ? -10.494 62.742  -13.843 1.00 65.20  ? 252  ILE B N   1 
ATOM 10706 C CA  . ILE B 1 255  ? -9.891  62.823  -12.513 1.00 64.89  ? 252  ILE B CA  1 
ATOM 10707 C C   . ILE B 1 255  ? -10.705 62.091  -11.433 1.00 65.01  ? 252  ILE B C   1 
ATOM 10708 O O   . ILE B 1 255  ? -10.143 61.273  -10.704 1.00 65.27  ? 252  ILE B O   1 
ATOM 10709 C CB  . ILE B 1 255  ? -9.499  64.285  -12.111 1.00 64.75  ? 252  ILE B CB  1 
ATOM 10710 C CG1 . ILE B 1 255  ? -8.599  64.276  -10.872 1.00 64.20  ? 252  ILE B CG1 1 
ATOM 10711 C CG2 . ILE B 1 255  ? -10.728 65.185  -11.937 1.00 64.27  ? 252  ILE B CG2 1 
ATOM 10712 C CD1 . ILE B 1 255  ? -7.478  65.274  -10.927 1.00 64.04  ? 252  ILE B CD1 1 
ATOM 10713 N N   . ILE B 1 256  ? -12.016 62.334  -11.360 1.00 64.89  ? 253  ILE B N   1 
ATOM 10714 C CA  . ILE B 1 256  ? -12.855 61.655  -10.357 1.00 64.65  ? 253  ILE B CA  1 
ATOM 10715 C C   . ILE B 1 256  ? -12.986 60.157  -10.625 1.00 64.62  ? 253  ILE B C   1 
ATOM 10716 O O   . ILE B 1 256  ? -13.205 59.385  -9.704  1.00 64.62  ? 253  ILE B O   1 
ATOM 10717 C CB  . ILE B 1 256  ? -14.281 62.291  -10.183 1.00 64.59  ? 253  ILE B CB  1 
ATOM 10718 C CG1 . ILE B 1 256  ? -15.207 61.951  -11.357 1.00 64.54  ? 253  ILE B CG1 1 
ATOM 10719 C CG2 . ILE B 1 256  ? -14.198 63.796  -9.938  1.00 64.41  ? 253  ILE B CG2 1 
ATOM 10720 C CD1 . ILE B 1 256  ? -16.638 61.668  -10.939 1.00 64.10  ? 253  ILE B CD1 1 
ATOM 10721 N N   . LYS B 1 257  ? -12.841 59.761  -11.887 1.00 64.75  ? 254  LYS B N   1 
ATOM 10722 C CA  . LYS B 1 257  ? -13.005 58.369  -12.309 1.00 64.87  ? 254  LYS B CA  1 
ATOM 10723 C C   . LYS B 1 257  ? -12.200 57.397  -11.447 1.00 64.81  ? 254  LYS B C   1 
ATOM 10724 O O   . LYS B 1 257  ? -12.766 56.475  -10.855 1.00 64.94  ? 254  LYS B O   1 
ATOM 10725 C CB  . LYS B 1 257  ? -12.635 58.207  -13.795 1.00 65.04  ? 254  LYS B CB  1 
ATOM 10726 C CG  . LYS B 1 257  ? -12.769 56.789  -14.358 1.00 65.02  ? 254  LYS B CG  1 
ATOM 10727 C CD  . LYS B 1 257  ? -12.286 56.716  -15.804 1.00 64.85  ? 254  LYS B CD  1 
ATOM 10728 C CE  . LYS B 1 257  ? -12.428 55.310  -16.362 1.00 64.61  ? 254  LYS B CE  1 
ATOM 10729 N NZ  . LYS B 1 257  ? -13.855 54.869  -16.415 1.00 64.44  ? 254  LYS B NZ  1 
ATOM 10730 N N   . GLN B 1 258  ? -10.893 57.630  -11.363 1.00 64.56  ? 255  GLN B N   1 
ATOM 10731 C CA  . GLN B 1 258  ? -9.953  56.716  -10.708 1.00 64.52  ? 255  GLN B CA  1 
ATOM 10732 C C   . GLN B 1 258  ? -10.430 56.060  -9.399  1.00 64.34  ? 255  GLN B C   1 
ATOM 10733 O O   . GLN B 1 258  ? -9.945  54.988  -9.035  1.00 64.27  ? 255  GLN B O   1 
ATOM 10734 C CB  . GLN B 1 258  ? -8.619  57.423  -10.484 1.00 64.65  ? 255  GLN B CB  1 
ATOM 10735 C CG  . GLN B 1 258  ? -8.022  58.024  -11.742 1.00 65.26  ? 255  GLN B CG  1 
ATOM 10736 C CD  . GLN B 1 258  ? -6.775  58.830  -11.459 1.00 66.51  ? 255  GLN B CD  1 
ATOM 10737 O OE1 . GLN B 1 258  ? -6.665  59.476  -10.415 1.00 66.95  ? 255  GLN B OE1 1 
ATOM 10738 N NE2 . GLN B 1 258  ? -5.823  58.801  -12.391 1.00 67.11  ? 255  GLN B NE2 1 
ATOM 10739 N N   . SER B 1 259  ? -11.360 56.707  -8.696  1.00 64.19  ? 256  SER B N   1 
ATOM 10740 C CA  . SER B 1 259  ? -11.993 56.126  -7.502  1.00 64.10  ? 256  SER B CA  1 
ATOM 10741 C C   . SER B 1 259  ? -13.403 56.676  -7.211  1.00 63.79  ? 256  SER B C   1 
ATOM 10742 O O   . SER B 1 259  ? -13.901 57.546  -7.925  1.00 63.91  ? 256  SER B O   1 
ATOM 10743 C CB  . SER B 1 259  ? -11.088 56.275  -6.277  1.00 64.19  ? 256  SER B CB  1 
ATOM 10744 O OG  . SER B 1 259  ? -11.710 55.749  -5.115  1.00 64.45  ? 256  SER B OG  1 
ATOM 10745 N N   . THR B 1 260  ? -14.038 56.165  -6.161  1.00 63.22  ? 257  THR B N   1 
ATOM 10746 C CA  . THR B 1 260  ? -15.425 56.495  -5.886  1.00 62.95  ? 257  THR B CA  1 
ATOM 10747 C C   . THR B 1 260  ? -15.522 57.621  -4.879  1.00 62.86  ? 257  THR B C   1 
ATOM 10748 O O   . THR B 1 260  ? -14.908 57.554  -3.812  1.00 62.95  ? 257  THR B O   1 
ATOM 10749 C CB  . THR B 1 260  ? -16.193 55.269  -5.355  1.00 62.96  ? 257  THR B CB  1 
ATOM 10750 O OG1 . THR B 1 260  ? -15.987 54.155  -6.233  1.00 63.11  ? 257  THR B OG1 1 
ATOM 10751 C CG2 . THR B 1 260  ? -17.689 55.557  -5.252  1.00 63.07  ? 257  THR B CG2 1 
ATOM 10752 N N   . ILE B 1 261  ? -16.293 58.655  -5.217  1.00 62.67  ? 258  ILE B N   1 
ATOM 10753 C CA  . ILE B 1 261  ? -16.610 59.703  -4.249  1.00 62.34  ? 258  ILE B CA  1 
ATOM 10754 C C   . ILE B 1 261  ? -17.499 59.102  -3.155  1.00 62.33  ? 258  ILE B C   1 
ATOM 10755 O O   . ILE B 1 261  ? -18.644 58.714  -3.415  1.00 62.38  ? 258  ILE B O   1 
ATOM 10756 C CB  . ILE B 1 261  ? -17.240 60.962  -4.913  1.00 62.24  ? 258  ILE B CB  1 
ATOM 10757 C CG1 . ILE B 1 261  ? -16.152 61.926  -5.394  1.00 61.95  ? 258  ILE B CG1 1 
ATOM 10758 C CG2 . ILE B 1 261  ? -18.108 61.729  -3.932  1.00 62.03  ? 258  ILE B CG2 1 
ATOM 10759 C CD1 . ILE B 1 261  ? -15.367 61.456  -6.581  1.00 61.79  ? 258  ILE B CD1 1 
ATOM 10760 N N   . VAL B 1 262  ? -16.943 59.003  -1.945  1.00 62.26  ? 259  VAL B N   1 
ATOM 10761 C CA  . VAL B 1 262  ? -17.608 58.348  -0.800  1.00 62.02  ? 259  VAL B CA  1 
ATOM 10762 C C   . VAL B 1 262  ? -18.382 59.294  0.142   1.00 61.87  ? 259  VAL B C   1 
ATOM 10763 O O   . VAL B 1 262  ? -19.410 58.906  0.697   1.00 61.78  ? 259  VAL B O   1 
ATOM 10764 C CB  . VAL B 1 262  ? -16.612 57.458  0.009   1.00 61.97  ? 259  VAL B CB  1 
ATOM 10765 C CG1 . VAL B 1 262  ? -15.626 58.301  0.817   1.00 61.68  ? 259  VAL B CG1 1 
ATOM 10766 C CG2 . VAL B 1 262  ? -17.363 56.482  0.912   1.00 62.32  ? 259  VAL B CG2 1 
ATOM 10767 N N   . CYS B 1 263  ? -17.890 60.524  0.309   1.00 61.73  ? 260  CYS B N   1 
ATOM 10768 C CA  . CYS B 1 263  ? -18.530 61.512  1.184   1.00 61.61  ? 260  CYS B CA  1 
ATOM 10769 C C   . CYS B 1 263  ? -18.472 62.941  0.631   1.00 61.31  ? 260  CYS B C   1 
ATOM 10770 O O   . CYS B 1 263  ? -17.441 63.378  0.115   1.00 61.60  ? 260  CYS B O   1 
ATOM 10771 C CB  . CYS B 1 263  ? -17.915 61.471  2.588   1.00 61.77  ? 260  CYS B CB  1 
ATOM 10772 S SG  . CYS B 1 263  ? -16.263 62.225  2.742   1.00 62.29  ? 260  CYS B SG  1 
ATOM 10773 N N   . HIS B 1 264  ? -19.584 63.662  0.761   1.00 60.73  ? 261  HIS B N   1 
ATOM 10774 C CA  . HIS B 1 264  ? -19.687 65.048  0.317   1.00 60.02  ? 261  HIS B CA  1 
ATOM 10775 C C   . HIS B 1 264  ? -19.913 65.989  1.502   1.00 60.06  ? 261  HIS B C   1 
ATOM 10776 O O   . HIS B 1 264  ? -19.972 65.537  2.649   1.00 60.16  ? 261  HIS B O   1 
ATOM 10777 C CB  . HIS B 1 264  ? -20.826 65.188  -0.690  1.00 59.70  ? 261  HIS B CB  1 
ATOM 10778 C CG  . HIS B 1 264  ? -22.180 64.947  -0.106  1.00 58.62  ? 261  HIS B CG  1 
ATOM 10779 N ND1 . HIS B 1 264  ? -22.879 65.918  0.578   1.00 57.46  ? 261  HIS B ND1 1 
ATOM 10780 C CD2 . HIS B 1 264  ? -22.965 63.844  -0.103  1.00 57.58  ? 261  HIS B CD2 1 
ATOM 10781 C CE1 . HIS B 1 264  ? -24.036 65.422  0.976   1.00 57.32  ? 261  HIS B CE1 1 
ATOM 10782 N NE2 . HIS B 1 264  ? -24.111 64.165  0.578   1.00 57.15  ? 261  HIS B NE2 1 
ATOM 10783 N N   . ASN B 1 265  ? -20.036 67.288  1.208   1.00 59.95  ? 262  ASN B N   1 
ATOM 10784 C CA  . ASN B 1 265  ? -20.336 68.337  2.196   1.00 59.87  ? 262  ASN B CA  1 
ATOM 10785 C C   . ASN B 1 265  ? -20.201 69.765  1.657   1.00 59.91  ? 262  ASN B C   1 
ATOM 10786 O O   . ASN B 1 265  ? -19.200 70.106  1.009   1.00 59.67  ? 262  ASN B O   1 
ATOM 10787 C CB  . ASN B 1 265  ? -19.464 68.209  3.445   1.00 59.92  ? 262  ASN B CB  1 
ATOM 10788 C CG  . ASN B 1 265  ? -20.049 68.939  4.631   1.00 59.84  ? 262  ASN B CG  1 
ATOM 10789 O OD1 . ASN B 1 265  ? -21.087 68.538  5.161   1.00 60.12  ? 262  ASN B OD1 1 
ATOM 10790 N ND2 . ASN B 1 265  ? -19.391 70.020  5.055   1.00 59.36  ? 262  ASN B ND2 1 
ATOM 10791 N N   . ARG B 1 266  ? -21.206 70.590  1.975   1.00 59.93  ? 263  ARG B N   1 
ATOM 10792 C CA  . ARG B 1 266  ? -21.305 71.989  1.542   1.00 59.68  ? 263  ARG B CA  1 
ATOM 10793 C C   . ARG B 1 266  ? -20.393 72.916  2.339   1.00 59.84  ? 263  ARG B C   1 
ATOM 10794 O O   . ARG B 1 266  ? -20.210 72.742  3.551   1.00 59.76  ? 263  ARG B O   1 
ATOM 10795 C CB  . ARG B 1 266  ? -22.767 72.458  1.612   1.00 59.55  ? 263  ARG B CB  1 
ATOM 10796 C CG  . ARG B 1 266  ? -22.973 73.965  1.717   1.00 59.41  ? 263  ARG B CG  1 
ATOM 10797 C CD  . ARG B 1 266  ? -24.368 74.421  1.280   1.00 59.46  ? 263  ARG B CD  1 
ATOM 10798 N NE  . ARG B 1 266  ? -25.463 73.647  1.864   1.00 60.03  ? 263  ARG B NE  1 
ATOM 10799 C CZ  . ARG B 1 266  ? -25.820 73.672  3.148   1.00 60.16  ? 263  ARG B CZ  1 
ATOM 10800 N NH1 . ARG B 1 266  ? -25.154 74.429  4.016   1.00 60.53  ? 263  ARG B NH1 1 
ATOM 10801 N NH2 . ARG B 1 266  ? -26.839 72.926  3.568   1.00 59.43  ? 263  ARG B NH2 1 
ATOM 10802 N N   . VAL B 1 267  ? -19.840 73.901  1.632   1.00 60.03  ? 264  VAL B N   1 
ATOM 10803 C CA  . VAL B 1 267  ? -18.925 74.896  2.186   1.00 60.30  ? 264  VAL B CA  1 
ATOM 10804 C C   . VAL B 1 267  ? -19.631 76.244  2.391   1.00 60.56  ? 264  VAL B C   1 
ATOM 10805 O O   . VAL B 1 267  ? -19.611 76.795  3.488   1.00 60.51  ? 264  VAL B O   1 
ATOM 10806 C CB  . VAL B 1 267  ? -17.683 75.071  1.269   1.00 60.34  ? 264  VAL B CB  1 
ATOM 10807 C CG1 . VAL B 1 267  ? -16.754 76.164  1.784   1.00 60.49  ? 264  VAL B CG1 1 
ATOM 10808 C CG2 . VAL B 1 267  ? -16.929 73.760  1.128   1.00 60.21  ? 264  VAL B CG2 1 
ATOM 10809 N N   . ASP B 1 268  ? -20.242 76.774  1.335   1.00 61.00  ? 265  ASP B N   1 
ATOM 10810 C CA  . ASP B 1 268  ? -20.972 78.035  1.424   1.00 61.61  ? 265  ASP B CA  1 
ATOM 10811 C C   . ASP B 1 268  ? -22.475 77.757  1.456   1.00 61.88  ? 265  ASP B C   1 
ATOM 10812 O O   . ASP B 1 268  ? -22.967 76.991  0.634   1.00 61.88  ? 265  ASP B O   1 
ATOM 10813 C CB  . ASP B 1 268  ? -20.642 78.950  0.238   1.00 61.84  ? 265  ASP B CB  1 
ATOM 10814 C CG  . ASP B 1 268  ? -19.157 79.298  0.140   1.00 62.62  ? 265  ASP B CG  1 
ATOM 10815 O OD1 . ASP B 1 268  ? -18.787 80.466  0.428   1.00 62.59  ? 265  ASP B OD1 1 
ATOM 10816 O OD2 . ASP B 1 268  ? -18.364 78.406  -0.245  1.00 63.73  ? 265  ASP B OD2 1 
ATOM 10817 N N   . PRO B 1 269  ? -23.214 78.403  2.383   1.00 62.22  ? 266  PRO B N   1 
ATOM 10818 C CA  . PRO B 1 269  ? -24.647 78.130  2.623   1.00 62.39  ? 266  PRO B CA  1 
ATOM 10819 C C   . PRO B 1 269  ? -25.557 78.294  1.399   1.00 62.60  ? 266  PRO B C   1 
ATOM 10820 O O   . PRO B 1 269  ? -26.632 77.700  1.350   1.00 62.44  ? 266  PRO B O   1 
ATOM 10821 C CB  . PRO B 1 269  ? -25.027 79.158  3.694   1.00 62.32  ? 266  PRO B CB  1 
ATOM 10822 C CG  . PRO B 1 269  ? -23.968 80.213  3.612   1.00 62.23  ? 266  PRO B CG  1 
ATOM 10823 C CD  . PRO B 1 269  ? -22.719 79.475  3.266   1.00 62.19  ? 266  PRO B CD  1 
ATOM 10824 N N   . ASN B 1 270  ? -25.126 79.093  0.428   1.00 62.95  ? 267  ASN B N   1 
ATOM 10825 C CA  . ASN B 1 270  ? -25.871 79.262  -0.815  1.00 63.36  ? 267  ASN B CA  1 
ATOM 10826 C C   . ASN B 1 270  ? -25.610 78.102  -1.771  1.00 63.35  ? 267  ASN B C   1 
ATOM 10827 O O   . ASN B 1 270  ? -25.933 78.172  -2.957  1.00 63.26  ? 267  ASN B O   1 
ATOM 10828 C CB  . ASN B 1 270  ? -25.509 80.596  -1.476  1.00 63.56  ? 267  ASN B CB  1 
ATOM 10829 C CG  . ASN B 1 270  ? -24.057 80.651  -1.921  1.00 64.38  ? 267  ASN B CG  1 
ATOM 10830 O OD1 . ASN B 1 270  ? -23.199 79.958  -1.365  1.00 64.87  ? 267  ASN B OD1 1 
ATOM 10831 N ND2 . ASN B 1 270  ? -23.772 81.478  -2.930  1.00 64.85  ? 267  ASN B ND2 1 
ATOM 10832 N N   . GLY B 1 271  ? -24.999 77.046  -1.241  1.00 63.59  ? 268  GLY B N   1 
ATOM 10833 C CA  . GLY B 1 271  ? -24.730 75.822  -1.993  1.00 63.89  ? 268  GLY B CA  1 
ATOM 10834 C C   . GLY B 1 271  ? -23.792 75.974  -3.172  1.00 64.03  ? 268  GLY B C   1 
ATOM 10835 O O   . GLY B 1 271  ? -23.793 75.135  -4.068  1.00 64.05  ? 268  GLY B O   1 
ATOM 10836 N N   . SER B 1 272  ? -22.988 77.035  -3.163  1.00 64.27  ? 269  SER B N   1 
ATOM 10837 C CA  . SER B 1 272  ? -22.079 77.339  -4.271  1.00 64.45  ? 269  SER B CA  1 
ATOM 10838 C C   . SER B 1 272  ? -20.887 76.376  -4.379  1.00 64.49  ? 269  SER B C   1 
ATOM 10839 O O   . SER B 1 272  ? -20.444 76.066  -5.492  1.00 64.51  ? 269  SER B O   1 
ATOM 10840 C CB  . SER B 1 272  ? -21.573 78.777  -4.163  1.00 64.44  ? 269  SER B CB  1 
ATOM 10841 O OG  . SER B 1 272  ? -20.696 78.912  -3.060  1.00 64.62  ? 269  SER B OG  1 
ATOM 10842 N N   . ARG B 1 273  ? -20.374 75.919  -3.232  1.00 64.40  ? 270  ARG B N   1 
ATOM 10843 C CA  . ARG B 1 273  ? -19.173 75.076  -3.195  1.00 64.39  ? 270  ARG B CA  1 
ATOM 10844 C C   . ARG B 1 273  ? -19.302 73.884  -2.263  1.00 64.29  ? 270  ARG B C   1 
ATOM 10845 O O   . ARG B 1 273  ? -19.746 74.030  -1.128  1.00 64.29  ? 270  ARG B O   1 
ATOM 10846 C CB  . ARG B 1 273  ? -17.960 75.894  -2.761  1.00 64.52  ? 270  ARG B CB  1 
ATOM 10847 C CG  . ARG B 1 273  ? -17.447 76.878  -3.789  1.00 64.66  ? 270  ARG B CG  1 
ATOM 10848 C CD  . ARG B 1 273  ? -16.119 77.