data_3IAY
# 
_entry.id   3IAY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3IAY         
NDB   NA0085       
RCSB  RCSB054185   
WWPDB D_1000054185 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3IAY 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Swan, M.K.'     1 
'Aggarwal, A.K.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of high-fidelity DNA synthesis by yeast DNA polymerase delta' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            16 
_citation.page_first                979 
_citation.page_last                 986 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19718023 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1663 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Swan, M.K.'     1 
primary 'Johnson, R.E.'  2 
primary 'Prakash, L.'    3 
primary 'Prakash, S.'    4 
primary 'Aggarwal, A.K.' 5 
# 
_cell.entry_id           3IAY 
_cell.length_a           81.077 
_cell.length_b           85.948 
_cell.length_c           86.872 
_cell.angle_alpha        90.00 
_cell.angle_beta         111.10 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3IAY 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*TP*CP*CP*TP*CP*CP*CP*CP*TP*AP*(DOC))-3'"         3502.308   1   ?       ? ?                        ? 
2 polymer     syn "5'-D(*TP*AP*AP*GP*GP*TP*AP*GP*GP*GP*GP*AP*GP*GP*AP*T)-3'" 5067.301   1   ?       ? ?                        ? 
3 polymer     man 'DNA polymerase delta catalytic subunit'                   104476.148 1   2.7.7.7 ? 'UNP residues 67 to 985' ? 
4 non-polymer syn 'CALCIUM ION'                                              40.078     5   ?       ? ?                        ? 
5 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                         467.157    1   ?       ? ?                        ? 
6 non-polymer syn 'ACETATE ION'                                              59.044     2   ?       ? ?                        ? 
7 water       nat water                                                      18.015     558 ?       ? ?                        ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'DNA polymerase III' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DA)(DT)(DC)(DC)(DT)(DC)(DC)(DC)(DC)(DT)(DA)(DOC)' ATCCTCCCCTAC P ? 
2 polydeoxyribonucleotide no no  '(DT)(DA)(DA)(DG)(DG)(DT)(DA)(DG)(DG)(DG)(DG)(DA)(DG)(DG)(DA)(DT)' TAAGGTAGGGGAGGAT T ? 
3 'polypeptide(L)'        no no  
;MGTQLESTFEQDVSQMEHDMADQEEHDLSSFERKKLPTDFDPSLYDISFQQIDAEQSVLNGIKDENTSTVVRFFGVTSEG
HSVLCNVTGFKNYLYVPAPNSSDANDQEQINKFVHYLNETFDHAIDSIEVVSKQSIWGYSGDTKLPFWKIYVTYPHMVNK
LRTAFERGHLSFNSWFSNGTTTYDNIAYTLRLMVDCGIVGMSWITLPKGKYSMIEPNNRVSSCQLEVSINYRNLIAHPAE
GDWSHTAPLRIMSFDIECAGRIGVFPEPEYDPVIQIANVVSIAGAKKPFIRNVFTLNTCSPITGSMIFSHATEEEMLSNW
RNFIIKVDPDVIIGYNTTNFDIPYLLNRAKALKVNDFPYFGRLKTVKQEIKESVFSSKAYGTRETKNVNIDGRLQLDLLQ
FIQREYKLRSYTLNAVSAHFLGEQKEDVHYSIISDLQNGDSETRRRLAVYCLKDAYLPLRLMEKLMALVNYTEMARVTGV
PFSYLLARGQQIKVVSQLFRKCLEIDTVIPNMQSQASDDQYEGATVIEPIRGYYDVPIATLDFNSLYPSIMMAHNLCYTT
LCNKATVERLNLKIDEDYVITPNGDYFVTTKRRRGILPIILDELISARKRAKKDLRDEKDPFKRDVLNGRQLALKISANS
VYGFTGATVGKLPCLAISSSVTAYGRTMILKTKTAVQEKYCIKNGYKHDAVVVYGDTDSVMVKFGTTDLKEAMDLGTEAA
KYVSTLFKHPINLEFEKAYFPYLLINKKRYAGLFWTNPDKFDKLDQKGLASVRRDSCSLVSIVMNKVLKKILIERNVDGA
LAFVRETINDILHNRVDISKLIISKTLAPNYTNPQPHAVLAERMKRREGVGPNVGDRVDYVIIGGNDKLYNRAEDPLFVL
ENNIQVDSRYYLTNQLQNPIISIVAPIIGDKQANGMFVV
;
;MGTQLESTFEQDVSQMEHDMADQEEHDLSSFERKKLPTDFDPSLYDISFQQIDAEQSVLNGIKDENTSTVVRFFGVTSEG
HSVLCNVTGFKNYLYVPAPNSSDANDQEQINKFVHYLNETFDHAIDSIEVVSKQSIWGYSGDTKLPFWKIYVTYPHMVNK
LRTAFERGHLSFNSWFSNGTTTYDNIAYTLRLMVDCGIVGMSWITLPKGKYSMIEPNNRVSSCQLEVSINYRNLIAHPAE
GDWSHTAPLRIMSFDIECAGRIGVFPEPEYDPVIQIANVVSIAGAKKPFIRNVFTLNTCSPITGSMIFSHATEEEMLSNW
RNFIIKVDPDVIIGYNTTNFDIPYLLNRAKALKVNDFPYFGRLKTVKQEIKESVFSSKAYGTRETKNVNIDGRLQLDLLQ
FIQREYKLRSYTLNAVSAHFLGEQKEDVHYSIISDLQNGDSETRRRLAVYCLKDAYLPLRLMEKLMALVNYTEMARVTGV
PFSYLLARGQQIKVVSQLFRKCLEIDTVIPNMQSQASDDQYEGATVIEPIRGYYDVPIATLDFNSLYPSIMMAHNLCYTT
LCNKATVERLNLKIDEDYVITPNGDYFVTTKRRRGILPIILDELISARKRAKKDLRDEKDPFKRDVLNGRQLALKISANS
VYGFTGATVGKLPCLAISSSVTAYGRTMILKTKTAVQEKYCIKNGYKHDAVVVYGDTDSVMVKFGTTDLKEAMDLGTEAA
KYVSTLFKHPINLEFEKAYFPYLLINKKRYAGLFWTNPDKFDKLDQKGLASVRRDSCSLVSIVMNKVLKKILIERNVDGA
LAFVRETINDILHNRVDISKLIISKTLAPNYTNPQPHAVLAERMKRREGVGPNVGDRVDYVIIGGNDKLYNRAEDPLFVL
ENNIQVDSRYYLTNQLQNPIISIVAPIIGDKQANGMFVV
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DC  n 
1 5   DT  n 
1 6   DC  n 
1 7   DC  n 
1 8   DC  n 
1 9   DC  n 
1 10  DT  n 
1 11  DA  n 
1 12  DOC n 
2 1   DT  n 
2 2   DA  n 
2 3   DA  n 
2 4   DG  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DG  n 
2 11  DG  n 
2 12  DA  n 
2 13  DG  n 
2 14  DG  n 
2 15  DA  n 
2 16  DT  n 
3 1   MET n 
3 2   GLY n 
3 3   THR n 
3 4   GLN n 
3 5   LEU n 
3 6   GLU n 
3 7   SER n 
3 8   THR n 
3 9   PHE n 
3 10  GLU n 
3 11  GLN n 
3 12  ASP n 
3 13  VAL n 
3 14  SER n 
3 15  GLN n 
3 16  MET n 
3 17  GLU n 
3 18  HIS n 
3 19  ASP n 
3 20  MET n 
3 21  ALA n 
3 22  ASP n 
3 23  GLN n 
3 24  GLU n 
3 25  GLU n 
3 26  HIS n 
3 27  ASP n 
3 28  LEU n 
3 29  SER n 
3 30  SER n 
3 31  PHE n 
3 32  GLU n 
3 33  ARG n 
3 34  LYS n 
3 35  LYS n 
3 36  LEU n 
3 37  PRO n 
3 38  THR n 
3 39  ASP n 
3 40  PHE n 
3 41  ASP n 
3 42  PRO n 
3 43  SER n 
3 44  LEU n 
3 45  TYR n 
3 46  ASP n 
3 47  ILE n 
3 48  SER n 
3 49  PHE n 
3 50  GLN n 
3 51  GLN n 
3 52  ILE n 
3 53  ASP n 
3 54  ALA n 
3 55  GLU n 
3 56  GLN n 
3 57  SER n 
3 58  VAL n 
3 59  LEU n 
3 60  ASN n 
3 61  GLY n 
3 62  ILE n 
3 63  LYS n 
3 64  ASP n 
3 65  GLU n 
3 66  ASN n 
3 67  THR n 
3 68  SER n 
3 69  THR n 
3 70  VAL n 
3 71  VAL n 
3 72  ARG n 
3 73  PHE n 
3 74  PHE n 
3 75  GLY n 
3 76  VAL n 
3 77  THR n 
3 78  SER n 
3 79  GLU n 
3 80  GLY n 
3 81  HIS n 
3 82  SER n 
3 83  VAL n 
3 84  LEU n 
3 85  CYS n 
3 86  ASN n 
3 87  VAL n 
3 88  THR n 
3 89  GLY n 
3 90  PHE n 
3 91  LYS n 
3 92  ASN n 
3 93  TYR n 
3 94  LEU n 
3 95  TYR n 
3 96  VAL n 
3 97  PRO n 
3 98  ALA n 
3 99  PRO n 
3 100 ASN n 
3 101 SER n 
3 102 SER n 
3 103 ASP n 
3 104 ALA n 
3 105 ASN n 
3 106 ASP n 
3 107 GLN n 
3 108 GLU n 
3 109 GLN n 
3 110 ILE n 
3 111 ASN n 
3 112 LYS n 
3 113 PHE n 
3 114 VAL n 
3 115 HIS n 
3 116 TYR n 
3 117 LEU n 
3 118 ASN n 
3 119 GLU n 
3 120 THR n 
3 121 PHE n 
3 122 ASP n 
3 123 HIS n 
3 124 ALA n 
3 125 ILE n 
3 126 ASP n 
3 127 SER n 
3 128 ILE n 
3 129 GLU n 
3 130 VAL n 
3 131 VAL n 
3 132 SER n 
3 133 LYS n 
3 134 GLN n 
3 135 SER n 
3 136 ILE n 
3 137 TRP n 
3 138 GLY n 
3 139 TYR n 
3 140 SER n 
3 141 GLY n 
3 142 ASP n 
3 143 THR n 
3 144 LYS n 
3 145 LEU n 
3 146 PRO n 
3 147 PHE n 
3 148 TRP n 
3 149 LYS n 
3 150 ILE n 
3 151 TYR n 
3 152 VAL n 
3 153 THR n 
3 154 TYR n 
3 155 PRO n 
3 156 HIS n 
3 157 MET n 
3 158 VAL n 
3 159 ASN n 
3 160 LYS n 
3 161 LEU n 
3 162 ARG n 
3 163 THR n 
3 164 ALA n 
3 165 PHE n 
3 166 GLU n 
3 167 ARG n 
3 168 GLY n 
3 169 HIS n 
3 170 LEU n 
3 171 SER n 
3 172 PHE n 
3 173 ASN n 
3 174 SER n 
3 175 TRP n 
3 176 PHE n 
3 177 SER n 
3 178 ASN n 
3 179 GLY n 
3 180 THR n 
3 181 THR n 
3 182 THR n 
3 183 TYR n 
3 184 ASP n 
3 185 ASN n 
3 186 ILE n 
3 187 ALA n 
3 188 TYR n 
3 189 THR n 
3 190 LEU n 
3 191 ARG n 
3 192 LEU n 
3 193 MET n 
3 194 VAL n 
3 195 ASP n 
3 196 CYS n 
3 197 GLY n 
3 198 ILE n 
3 199 VAL n 
3 200 GLY n 
3 201 MET n 
3 202 SER n 
3 203 TRP n 
3 204 ILE n 
3 205 THR n 
3 206 LEU n 
3 207 PRO n 
3 208 LYS n 
3 209 GLY n 
3 210 LYS n 
3 211 TYR n 
3 212 SER n 
3 213 MET n 
3 214 ILE n 
3 215 GLU n 
3 216 PRO n 
3 217 ASN n 
3 218 ASN n 
3 219 ARG n 
3 220 VAL n 
3 221 SER n 
3 222 SER n 
3 223 CYS n 
3 224 GLN n 
3 225 LEU n 
3 226 GLU n 
3 227 VAL n 
3 228 SER n 
3 229 ILE n 
3 230 ASN n 
3 231 TYR n 
3 232 ARG n 
3 233 ASN n 
3 234 LEU n 
3 235 ILE n 
3 236 ALA n 
3 237 HIS n 
3 238 PRO n 
3 239 ALA n 
3 240 GLU n 
3 241 GLY n 
3 242 ASP n 
3 243 TRP n 
3 244 SER n 
3 245 HIS n 
3 246 THR n 
3 247 ALA n 
3 248 PRO n 
3 249 LEU n 
3 250 ARG n 
3 251 ILE n 
3 252 MET n 
3 253 SER n 
3 254 PHE n 
3 255 ASP n 
3 256 ILE n 
3 257 GLU n 
3 258 CYS n 
3 259 ALA n 
3 260 GLY n 
3 261 ARG n 
3 262 ILE n 
3 263 GLY n 
3 264 VAL n 
3 265 PHE n 
3 266 PRO n 
3 267 GLU n 
3 268 PRO n 
3 269 GLU n 
3 270 TYR n 
3 271 ASP n 
3 272 PRO n 
3 273 VAL n 
3 274 ILE n 
3 275 GLN n 
3 276 ILE n 
3 277 ALA n 
3 278 ASN n 
3 279 VAL n 
3 280 VAL n 
3 281 SER n 
3 282 ILE n 
3 283 ALA n 
3 284 GLY n 
3 285 ALA n 
3 286 LYS n 
3 287 LYS n 
3 288 PRO n 
3 289 PHE n 
3 290 ILE n 
3 291 ARG n 
3 292 ASN n 
3 293 VAL n 
3 294 PHE n 
3 295 THR n 
3 296 LEU n 
3 297 ASN n 
3 298 THR n 
3 299 CYS n 
3 300 SER n 
3 301 PRO n 
3 302 ILE n 
3 303 THR n 
3 304 GLY n 
3 305 SER n 
3 306 MET n 
3 307 ILE n 
3 308 PHE n 
3 309 SER n 
3 310 HIS n 
3 311 ALA n 
3 312 THR n 
3 313 GLU n 
3 314 GLU n 
3 315 GLU n 
3 316 MET n 
3 317 LEU n 
3 318 SER n 
3 319 ASN n 
3 320 TRP n 
3 321 ARG n 
3 322 ASN n 
3 323 PHE n 
3 324 ILE n 
3 325 ILE n 
3 326 LYS n 
3 327 VAL n 
3 328 ASP n 
3 329 PRO n 
3 330 ASP n 
3 331 VAL n 
3 332 ILE n 
3 333 ILE n 
3 334 GLY n 
3 335 TYR n 
3 336 ASN n 
3 337 THR n 
3 338 THR n 
3 339 ASN n 
3 340 PHE n 
3 341 ASP n 
3 342 ILE n 
3 343 PRO n 
3 344 TYR n 
3 345 LEU n 
3 346 LEU n 
3 347 ASN n 
3 348 ARG n 
3 349 ALA n 
3 350 LYS n 
3 351 ALA n 
3 352 LEU n 
3 353 LYS n 
3 354 VAL n 
3 355 ASN n 
3 356 ASP n 
3 357 PHE n 
3 358 PRO n 
3 359 TYR n 
3 360 PHE n 
3 361 GLY n 
3 362 ARG n 
3 363 LEU n 
3 364 LYS n 
3 365 THR n 
3 366 VAL n 
3 367 LYS n 
3 368 GLN n 
3 369 GLU n 
3 370 ILE n 
3 371 LYS n 
3 372 GLU n 
3 373 SER n 
3 374 VAL n 
3 375 PHE n 
3 376 SER n 
3 377 SER n 
3 378 LYS n 
3 379 ALA n 
3 380 TYR n 
3 381 GLY n 
3 382 THR n 
3 383 ARG n 
3 384 GLU n 
3 385 THR n 
3 386 LYS n 
3 387 ASN n 
3 388 VAL n 
3 389 ASN n 
3 390 ILE n 
3 391 ASP n 
3 392 GLY n 
3 393 ARG n 
3 394 LEU n 
3 395 GLN n 
3 396 LEU n 
3 397 ASP n 
3 398 LEU n 
3 399 LEU n 
3 400 GLN n 
3 401 PHE n 
3 402 ILE n 
3 403 GLN n 
3 404 ARG n 
3 405 GLU n 
3 406 TYR n 
3 407 LYS n 
3 408 LEU n 
3 409 ARG n 
3 410 SER n 
3 411 TYR n 
3 412 THR n 
3 413 LEU n 
3 414 ASN n 
3 415 ALA n 
3 416 VAL n 
3 417 SER n 
3 418 ALA n 
3 419 HIS n 
3 420 PHE n 
3 421 LEU n 
3 422 GLY n 
3 423 GLU n 
3 424 GLN n 
3 425 LYS n 
3 426 GLU n 
3 427 ASP n 
3 428 VAL n 
3 429 HIS n 
3 430 TYR n 
3 431 SER n 
3 432 ILE n 
3 433 ILE n 
3 434 SER n 
3 435 ASP n 
3 436 LEU n 
3 437 GLN n 
3 438 ASN n 
3 439 GLY n 
3 440 ASP n 
3 441 SER n 
3 442 GLU n 
3 443 THR n 
3 444 ARG n 
3 445 ARG n 
3 446 ARG n 
3 447 LEU n 
3 448 ALA n 
3 449 VAL n 
3 450 TYR n 
3 451 CYS n 
3 452 LEU n 
3 453 LYS n 
3 454 ASP n 
3 455 ALA n 
3 456 TYR n 
3 457 LEU n 
3 458 PRO n 
3 459 LEU n 
3 460 ARG n 
3 461 LEU n 
3 462 MET n 
3 463 GLU n 
3 464 LYS n 
3 465 LEU n 
3 466 MET n 
3 467 ALA n 
3 468 LEU n 
3 469 VAL n 
3 470 ASN n 
3 471 TYR n 
3 472 THR n 
3 473 GLU n 
3 474 MET n 
3 475 ALA n 
3 476 ARG n 
3 477 VAL n 
3 478 THR n 
3 479 GLY n 
3 480 VAL n 
3 481 PRO n 
3 482 PHE n 
3 483 SER n 
3 484 TYR n 
3 485 LEU n 
3 486 LEU n 
3 487 ALA n 
3 488 ARG n 
3 489 GLY n 
3 490 GLN n 
3 491 GLN n 
3 492 ILE n 
3 493 LYS n 
3 494 VAL n 
3 495 VAL n 
3 496 SER n 
3 497 GLN n 
3 498 LEU n 
3 499 PHE n 
3 500 ARG n 
3 501 LYS n 
3 502 CYS n 
3 503 LEU n 
3 504 GLU n 
3 505 ILE n 
3 506 ASP n 
3 507 THR n 
3 508 VAL n 
3 509 ILE n 
3 510 PRO n 
3 511 ASN n 
3 512 MET n 
3 513 GLN n 
3 514 SER n 
3 515 GLN n 
3 516 ALA n 
3 517 SER n 
3 518 ASP n 
3 519 ASP n 
3 520 GLN n 
3 521 TYR n 
3 522 GLU n 
3 523 GLY n 
3 524 ALA n 
3 525 THR n 
3 526 VAL n 
3 527 ILE n 
3 528 GLU n 
3 529 PRO n 
3 530 ILE n 
3 531 ARG n 
3 532 GLY n 
3 533 TYR n 
3 534 TYR n 
3 535 ASP n 
3 536 VAL n 
3 537 PRO n 
3 538 ILE n 
3 539 ALA n 
3 540 THR n 
3 541 LEU n 
3 542 ASP n 
3 543 PHE n 
3 544 ASN n 
3 545 SER n 
3 546 LEU n 
3 547 TYR n 
3 548 PRO n 
3 549 SER n 
3 550 ILE n 
3 551 MET n 
3 552 MET n 
3 553 ALA n 
3 554 HIS n 
3 555 ASN n 
3 556 LEU n 
3 557 CYS n 
3 558 TYR n 
3 559 THR n 
3 560 THR n 
3 561 LEU n 
3 562 CYS n 
3 563 ASN n 
3 564 LYS n 
3 565 ALA n 
3 566 THR n 
3 567 VAL n 
3 568 GLU n 
3 569 ARG n 
3 570 LEU n 
3 571 ASN n 
3 572 LEU n 
3 573 LYS n 
3 574 ILE n 
3 575 ASP n 
3 576 GLU n 
3 577 ASP n 
3 578 TYR n 
3 579 VAL n 
3 580 ILE n 
3 581 THR n 
3 582 PRO n 
3 583 ASN n 
3 584 GLY n 
3 585 ASP n 
3 586 TYR n 
3 587 PHE n 
3 588 VAL n 
3 589 THR n 
3 590 THR n 
3 591 LYS n 
3 592 ARG n 
3 593 ARG n 
3 594 ARG n 
3 595 GLY n 
3 596 ILE n 
3 597 LEU n 
3 598 PRO n 
3 599 ILE n 
3 600 ILE n 
3 601 LEU n 
3 602 ASP n 
3 603 GLU n 
3 604 LEU n 
3 605 ILE n 
3 606 SER n 
3 607 ALA n 
3 608 ARG n 
3 609 LYS n 
3 610 ARG n 
3 611 ALA n 
3 612 LYS n 
3 613 LYS n 
3 614 ASP n 
3 615 LEU n 
3 616 ARG n 
3 617 ASP n 
3 618 GLU n 
3 619 LYS n 
3 620 ASP n 
3 621 PRO n 
3 622 PHE n 
3 623 LYS n 
3 624 ARG n 
3 625 ASP n 
3 626 VAL n 
3 627 LEU n 
3 628 ASN n 
3 629 GLY n 
3 630 ARG n 
3 631 GLN n 
3 632 LEU n 
3 633 ALA n 
3 634 LEU n 
3 635 LYS n 
3 636 ILE n 
3 637 SER n 
3 638 ALA n 
3 639 ASN n 
3 640 SER n 
3 641 VAL n 
3 642 TYR n 
3 643 GLY n 
3 644 PHE n 
3 645 THR n 
3 646 GLY n 
3 647 ALA n 
3 648 THR n 
3 649 VAL n 
3 650 GLY n 
3 651 LYS n 
3 652 LEU n 
3 653 PRO n 
3 654 CYS n 
3 655 LEU n 
3 656 ALA n 
3 657 ILE n 
3 658 SER n 
3 659 SER n 
3 660 SER n 
3 661 VAL n 
3 662 THR n 
3 663 ALA n 
3 664 TYR n 
3 665 GLY n 
3 666 ARG n 
3 667 THR n 
3 668 MET n 
3 669 ILE n 
3 670 LEU n 
3 671 LYS n 
3 672 THR n 
3 673 LYS n 
3 674 THR n 
3 675 ALA n 
3 676 VAL n 
3 677 GLN n 
3 678 GLU n 
3 679 LYS n 
3 680 TYR n 
3 681 CYS n 
3 682 ILE n 
3 683 LYS n 
3 684 ASN n 
3 685 GLY n 
3 686 TYR n 
3 687 LYS n 
3 688 HIS n 
3 689 ASP n 
3 690 ALA n 
3 691 VAL n 
3 692 VAL n 
3 693 VAL n 
3 694 TYR n 
3 695 GLY n 
3 696 ASP n 
3 697 THR n 
3 698 ASP n 
3 699 SER n 
3 700 VAL n 
3 701 MET n 
3 702 VAL n 
3 703 LYS n 
3 704 PHE n 
3 705 GLY n 
3 706 THR n 
3 707 THR n 
3 708 ASP n 
3 709 LEU n 
3 710 LYS n 
3 711 GLU n 
3 712 ALA n 
3 713 MET n 
3 714 ASP n 
3 715 LEU n 
3 716 GLY n 
3 717 THR n 
3 718 GLU n 
3 719 ALA n 
3 720 ALA n 
3 721 LYS n 
3 722 TYR n 
3 723 VAL n 
3 724 SER n 
3 725 THR n 
3 726 LEU n 
3 727 PHE n 
3 728 LYS n 
3 729 HIS n 
3 730 PRO n 
3 731 ILE n 
3 732 ASN n 
3 733 LEU n 
3 734 GLU n 
3 735 PHE n 
3 736 GLU n 
3 737 LYS n 
3 738 ALA n 
3 739 TYR n 
3 740 PHE n 
3 741 PRO n 
3 742 TYR n 
3 743 LEU n 
3 744 LEU n 
3 745 ILE n 
3 746 ASN n 
3 747 LYS n 
3 748 LYS n 
3 749 ARG n 
3 750 TYR n 
3 751 ALA n 
3 752 GLY n 
3 753 LEU n 
3 754 PHE n 
3 755 TRP n 
3 756 THR n 
3 757 ASN n 
3 758 PRO n 
3 759 ASP n 
3 760 LYS n 
3 761 PHE n 
3 762 ASP n 
3 763 LYS n 
3 764 LEU n 
3 765 ASP n 
3 766 GLN n 
3 767 LYS n 
3 768 GLY n 
3 769 LEU n 
3 770 ALA n 
3 771 SER n 
3 772 VAL n 
3 773 ARG n 
3 774 ARG n 
3 775 ASP n 
3 776 SER n 
3 777 CYS n 
3 778 SER n 
3 779 LEU n 
3 780 VAL n 
3 781 SER n 
3 782 ILE n 
3 783 VAL n 
3 784 MET n 
3 785 ASN n 
3 786 LYS n 
3 787 VAL n 
3 788 LEU n 
3 789 LYS n 
3 790 LYS n 
3 791 ILE n 
3 792 LEU n 
3 793 ILE n 
3 794 GLU n 
3 795 ARG n 
3 796 ASN n 
3 797 VAL n 
3 798 ASP n 
3 799 GLY n 
3 800 ALA n 
3 801 LEU n 
3 802 ALA n 
3 803 PHE n 
3 804 VAL n 
3 805 ARG n 
3 806 GLU n 
3 807 THR n 
3 808 ILE n 
3 809 ASN n 
3 810 ASP n 
3 811 ILE n 
3 812 LEU n 
3 813 HIS n 
3 814 ASN n 
3 815 ARG n 
3 816 VAL n 
3 817 ASP n 
3 818 ILE n 
3 819 SER n 
3 820 LYS n 
3 821 LEU n 
3 822 ILE n 
3 823 ILE n 
3 824 SER n 
3 825 LYS n 
3 826 THR n 
3 827 LEU n 
3 828 ALA n 
3 829 PRO n 
3 830 ASN n 
3 831 TYR n 
3 832 THR n 
3 833 ASN n 
3 834 PRO n 
3 835 GLN n 
3 836 PRO n 
3 837 HIS n 
3 838 ALA n 
3 839 VAL n 
3 840 LEU n 
3 841 ALA n 
3 842 GLU n 
3 843 ARG n 
3 844 MET n 
3 845 LYS n 
3 846 ARG n 
3 847 ARG n 
3 848 GLU n 
3 849 GLY n 
3 850 VAL n 
3 851 GLY n 
3 852 PRO n 
3 853 ASN n 
3 854 VAL n 
3 855 GLY n 
3 856 ASP n 
3 857 ARG n 
3 858 VAL n 
3 859 ASP n 
3 860 TYR n 
3 861 VAL n 
3 862 ILE n 
3 863 ILE n 
3 864 GLY n 
3 865 GLY n 
3 866 ASN n 
3 867 ASP n 
3 868 LYS n 
3 869 LEU n 
3 870 TYR n 
3 871 ASN n 
3 872 ARG n 
3 873 ALA n 
3 874 GLU n 
3 875 ASP n 
3 876 PRO n 
3 877 LEU n 
3 878 PHE n 
3 879 VAL n 
3 880 LEU n 
3 881 GLU n 
3 882 ASN n 
3 883 ASN n 
3 884 ILE n 
3 885 GLN n 
3 886 VAL n 
3 887 ASP n 
3 888 SER n 
3 889 ARG n 
3 890 TYR n 
3 891 TYR n 
3 892 LEU n 
3 893 THR n 
3 894 ASN n 
3 895 GLN n 
3 896 LEU n 
3 897 GLN n 
3 898 ASN n 
3 899 PRO n 
3 900 ILE n 
3 901 ILE n 
3 902 SER n 
3 903 ILE n 
3 904 VAL n 
3 905 ALA n 
3 906 PRO n 
3 907 ILE n 
3 908 ILE n 
3 909 GLY n 
3 910 ASP n 
3 911 LYS n 
3 912 GLN n 
3 913 ALA n 
3 914 ASN n 
3 915 GLY n 
3 916 MET n 
3 917 PHE n 
3 918 VAL n 
3 919 VAL n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Pol3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4932 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'Oligonucleotide synthesis' 
2 1 sample ? ? ? ? ? 'Oligonucleotide synthesis' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOD_YEAST P15436 3 
;MGTQLESTFEQDVSQMEHDMADQEEHDLSSFERKKLPTDFDPSLYDISFQQIDAEQSVLNGIKDENTSTVVRFFGVTSEG
HSVLCNVTGFKNYLYVPAPNSSDANDQEQINKFVHYLNETFDHAIDSIEVVSKQSIWGYSGDTKLPFWKIYVTYPHMVNK
LRTAFERGHLSFNSWFSNGTTTYDNIAYTLRLMVDCGIVGMSWITLPKGKYSMIEPNNRVSSCQLEVSINYRNLIAHPAE
GDWSHTAPLRIMSFDIECAGRIGVFPEPEYDPVIQIANVVSIAGAKKPFIRNVFTLNTCSPITGSMIFSHATEEEMLSNW
RNFIIKVDPDVIIGYNTTNFDIPYLLNRAKALKVNDFPYFGRLKTVKQEIKESVFSSKAYGTRETKNVNIDGRLQLDLLQ
FIQREYKLRSYTLNAVSAHFLGEQKEDVHYSIISDLQNGDSETRRRLAVYCLKDAYLPLRLMEKLMALVNYTEMARVTGV
PFSYLLARGQQIKVVSQLFRKCLEIDTVIPNMQSQASDDQYEGATVIEPIRGYYDVPIATLDFNSLYPSIMMAHNLCYTT
LCNKATVERLNLKIDEDYVITPNGDYFVTTKRRRGILPIILDELISARKRAKKDLRDEKDPFKRDVLNGRQLALKISANS
VYGFTGATVGKLPCLAISSSVTAYGRTMILKTKTAVQEKYCIKNGYKHDAVVVYGDTDSVMVKFGTTDLKEAMDLGTEAA
KYVSTLFKHPINLEFEKAYFPYLLINKKRYAGLFWTNPDKFDKLDQKGLASVRRDSCSLVSIVMNKVLKKILIERNVDGA
LAFVRETINDILHNRVDISKLIISKTLAPNYTNPQPHAVLAERMKRREGVGPNVGDRVDYVIIGGNDKLYNRAEDPLFVL
ENNIQVDSRYYLTNQLQNPIISIVAPIIGDKQANGMFVV
;
67 ? 
2 PDB 3IAY       3IAY   1 ATCCTCCCCTAC 1  ? 
3 PDB 3IAY       3IAY   2 TAAGGTAGGGGAGGAT 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3IAY A 1 ? 919 ? P15436 67 ? 985 ? 67 985 
2 2 3IAY P 1 ? 12  ? 3IAY   1  ? 12  ? 1  12  
3 3 3IAY T 1 ? 16  ? 3IAY   1  ? 16  ? 1  16  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                            ? 'C2 H3 O2 -1'      59.044  
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                            ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"       ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'  347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'   291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                    ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3IAY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   4 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.50 
_exptl_crystal.density_percent_sol   50.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '12% PEG 4000, NaAc pH 5.5, 200mM CaAc., VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1       100 ? 1 
2       100 ? 1 
3       100 ? 1 
4       100 ? 1 
1,2,3,4 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 315' 2007-10-13 ? 
2 CCD 'ADSC QUANTUM 210' 2007-08-29 ? 
3 CCD 'ADSC QUANTUM 315' 2007-10-13 ? 
4 CCD 'ADSC QUANTUM 315' 2007-11-08 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? 'SINGLE WAVELENGTH' x-ray 
3 1 M ? MAD                 x-ray 
4 1 M ? 'SINGLE WAVELENGTH' x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'NSLS BEAMLINE X29A' NSLS X29A  ? ? 
2 SYNCHROTRON 'NSLS BEAMLINE X12B' NSLS X12B  ? ? 
3 SYNCHROTRON 'APS BEAMLINE 17-ID' APS  17-ID ? ? 
4 ?           ?                    ?    ?     ? ? 
# 
_reflns.entry_id                     3IAY 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             41.52 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   69856 
_reflns.number_all                   73557 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2,3,4 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   97.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2,3,4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3IAY 
_refine.ls_number_reflns_obs                     69856 
_refine.ls_number_reflns_all                     73557 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.52 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.25 
_refine.ls_R_factor_obs                          0.19497 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19281 
_refine.ls_R_factor_R_free                       0.23589 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3692 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.921 
_refine.B_iso_mean                               28.037 
_refine.aniso_B[1][1]                            -0.29 
_refine.aniso_B[2][2]                            0.56 
_refine.aniso_B[3][3]                            0.09 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.50 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.186 
_refine.pdbx_overall_ESU_R_Free                  0.166 
_refine.overall_SU_ML                            0.103 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.879 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6986 
_refine_hist.pdbx_number_atoms_nucleic_acid   569 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             558 
_refine_hist.number_atoms_total               8154 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        41.52 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 7852  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.227  2.059  ? 10786 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.646  5.000  ? 894   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.958 23.860 ? 329   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.138 15.000 ? 1228  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.191 15.000 ? 49    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.081  0.200  ? 1220  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 5746  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.554  1.500  ? 4438  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.033  2.000  ? 7197  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.708  3.000  ? 3414  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.663  4.500  ? 3583  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.003 
_refine_ls_shell.d_res_low                        2.055 
_refine_ls_shell.number_reflns_R_work             4983 
_refine_ls_shell.R_factor_R_work                  0.216 
_refine_ls_shell.percent_reflns_obs               96.47 
_refine_ls_shell.R_factor_R_free                  0.247 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             239 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3IAY 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3IAY 
_struct.title                     'Ternary complex of DNA polymerase delta' 
_struct.pdbx_descriptor           'DNA polymerase delta catalytic subunit(2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3IAY 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;DNA Polymerase, protein-DNA complex, DNA replication, DNA-binding, DNA-directed DNA polymerase, Exonuclease, Hydrolase, Metal-binding, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Transferase, Zinc-finger, TRANSFERASE-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 6 ? 
K N N 6 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER C 101 ? ASN C 105 ? SER A 167 ASN A 171 5 ? 5  
HELX_P HELX_P2  2  ASP C 106 ? GLU C 119 ? ASP A 172 GLU A 185 1 ? 14 
HELX_P HELX_P3  3  HIS C 156 ? GLY C 168 ? HIS A 222 GLY A 234 1 ? 13 
HELX_P HELX_P4  4  SER C 171 ? TRP C 175 ? SER A 237 TRP A 241 5 ? 5  
HELX_P HELX_P5  5  ALA C 187 ? GLY C 197 ? ALA A 253 GLY A 263 1 ? 11 
HELX_P HELX_P6  6  GLU C 215 ? ARG C 219 ? GLU A 281 ARG A 285 5 ? 5  
HELX_P HELX_P7  7  GLU C 240 ? SER C 244 ? GLU A 306 SER A 310 5 ? 5  
HELX_P HELX_P8  8  THR C 312 ? ASP C 328 ? THR A 378 ASP A 394 1 ? 17 
HELX_P HELX_P9  9  PHE C 340 ? LEU C 352 ? PHE A 406 LEU A 418 1 ? 13 
HELX_P HELX_P10 10 LEU C 398 ? TYR C 406 ? LEU A 464 TYR A 472 1 ? 9  
HELX_P HELX_P11 11 THR C 412 ? GLY C 422 ? THR A 478 GLY A 488 1 ? 11 
HELX_P HELX_P12 12 ILE C 432 ? ASN C 438 ? ILE A 498 ASN A 504 1 ? 7  
HELX_P HELX_P13 13 ASP C 440 ? LEU C 465 ? ASP A 506 LEU A 531 1 ? 26 
HELX_P HELX_P14 14 MET C 466 ? GLY C 479 ? MET A 532 GLY A 545 1 ? 14 
HELX_P HELX_P15 15 SER C 483 ? ARG C 488 ? SER A 549 ARG A 554 1 ? 6  
HELX_P HELX_P16 16 GLY C 489 ? ILE C 505 ? GLY A 555 ILE A 571 1 ? 17 
HELX_P HELX_P17 17 SER C 545 ? HIS C 554 ? SER A 611 HIS A 620 1 ? 10 
HELX_P HELX_P18 18 CYS C 557 ? THR C 559 ? CYS A 623 THR A 625 5 ? 3  
HELX_P HELX_P19 19 ASN C 563 ? LEU C 570 ? ASN A 629 LEU A 636 1 ? 8  
HELX_P HELX_P20 20 GLY C 595 ? ASP C 617 ? GLY A 661 ASP A 683 1 ? 23 
HELX_P HELX_P21 21 ASP C 620 ? GLY C 646 ? ASP A 686 GLY A 712 1 ? 27 
HELX_P HELX_P22 22 CYS C 654 ? TYR C 680 ? CYS A 720 TYR A 746 1 ? 27 
HELX_P HELX_P23 23 CYS C 681 ? GLY C 685 ? CYS A 747 GLY A 751 5 ? 5  
HELX_P HELX_P24 24 ASP C 708 ? THR C 725 ? ASP A 774 THR A 791 1 ? 18 
HELX_P HELX_P25 25 LEU C 769 ? ARG C 773 ? LEU A 835 ARG A 839 5 ? 5  
HELX_P HELX_P26 26 CYS C 777 ? ILE C 793 ? CYS A 843 ILE A 859 1 ? 17 
HELX_P HELX_P27 27 ASN C 796 ? HIS C 813 ? ASN A 862 HIS A 879 1 ? 18 
HELX_P HELX_P28 28 ASP C 817 ? ILE C 822 ? ASP A 883 ILE A 888 5 ? 6  
HELX_P HELX_P29 29 GLN C 835 ? GLY C 849 ? GLN A 901 GLY A 915 1 ? 15 
HELX_P HELX_P30 30 LYS C 868 ? ASN C 871 ? LYS A 934 ASN A 937 5 ? 4  
HELX_P HELX_P31 31 ASP C 875 ? ASN C 882 ? ASP A 941 ASN A 948 1 ? 8  
HELX_P HELX_P32 32 ASP C 887 ? GLN C 895 ? ASP A 953 GLN A 961 1 ? 9  
HELX_P HELX_P33 33 LEU C 896 ? GLY C 909 ? LEU A 962 GLY A 975 1 ? 14 
HELX_P HELX_P34 34 GLY C 909 ? PHE C 917 ? GLY A 975 PHE A 983 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A DA  11  "O3'" ? ? ? 1_555 A DOC 12 P  ? ? P DA  11  P DOC 12   1_555 ? ? ? ? ? ? ?            1.577 ? 
metalc1  metalc ? ? C ASP 255 OD1   ? ? ? 1_555 I CA  .  CA ? ? A ASP 321 A CA  4    1_555 ? ? ? ? ? ? ?            2.479 ? 
metalc2  metalc ? ? C ASP 542 OD1   ? ? ? 1_555 F CA  .  CA ? ? A ASP 608 A CA  1    1_555 ? ? ? ? ? ? ?            2.373 ? 
metalc3  metalc ? ? C ASP 542 OD1   ? ? ? 1_555 H CA  .  CA ? ? A ASP 608 A CA  3    1_555 ? ? ? ? ? ? ?            2.557 ? 
metalc4  metalc ? ? C ASP 542 OD2   ? ? ? 1_555 H CA  .  CA ? ? A ASP 608 A CA  3    1_555 ? ? ? ? ? ? ?            2.662 ? 
metalc5  metalc ? ? C PHE 543 O     ? ? ? 1_555 F CA  .  CA ? ? A PHE 609 A CA  1    1_555 ? ? ? ? ? ? ?            2.215 ? 
metalc6  metalc ? ? C ASP 698 OD1   ? ? ? 1_555 F CA  .  CA ? ? A ASP 764 A CA  1    1_555 ? ? ? ? ? ? ?            2.251 ? 
metalc7  metalc ? ? C ASP 698 OD2   ? ? ? 1_555 G CA  .  CA ? ? A ASP 764 A CA  2    1_555 ? ? ? ? ? ? ?            2.530 ? 
metalc8  metalc ? ? C GLU 736 OE2   ? ? ? 1_555 H CA  .  CA ? ? A GLU 802 A CA  3    1_555 ? ? ? ? ? ? ?            2.779 ? 
metalc9  metalc ? ? E DCP .   O1A   ? ? ? 1_555 F CA  .  CA ? ? A DCP 986 A CA  1    1_555 ? ? ? ? ? ? ?            2.354 ? 
metalc10 metalc ? ? E DCP .   O1A   ? ? ? 1_555 G CA  .  CA ? ? A DCP 986 A CA  2    1_555 ? ? ? ? ? ? ?            2.674 ? 
metalc11 metalc ? ? E DCP .   O2B   ? ? ? 1_555 F CA  .  CA ? ? A DCP 986 A CA  1    1_555 ? ? ? ? ? ? ?            2.286 ? 
metalc12 metalc ? ? E DCP .   O3G   ? ? ? 1_555 F CA  .  CA ? ? A DCP 986 A CA  1    1_555 ? ? ? ? ? ? ?            2.316 ? 
metalc13 metalc ? ? E DCP .   O3G   ? ? ? 1_555 H CA  .  CA ? ? A DCP 986 A CA  3    1_555 ? ? ? ? ? ? ?            2.728 ? 
metalc14 metalc ? ? D CA  .   CA    ? ? ? 1_555 M HOH .  O  ? ? T CA  17  T HOH 463  1_555 ? ? ? ? ? ? ?            2.527 ? 
metalc15 metalc ? ? D CA  .   CA    ? ? ? 1_555 M HOH .  O  ? ? T CA  17  T HOH 461  1_555 ? ? ? ? ? ? ?            2.532 ? 
metalc16 metalc ? ? D CA  .   CA    ? ? ? 1_555 M HOH .  O  ? ? T CA  17  T HOH 51   1_555 ? ? ? ? ? ? ?            2.898 ? 
metalc17 metalc ? ? D CA  .   CA    ? ? ? 1_555 M HOH .  O  ? ? T CA  17  T HOH 462  1_555 ? ? ? ? ? ? ?            2.801 ? 
metalc18 metalc ? ? G CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  2   A HOH 1071 1_555 ? ? ? ? ? ? ?            2.918 ? 
metalc19 metalc ? ? G CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  2   A HOH 1270 1_555 ? ? ? ? ? ? ?            2.250 ? 
metalc20 metalc ? ? H CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  3   A HOH 1272 1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc21 metalc ? ? H CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  3   A HOH 1378 1_555 ? ? ? ? ? ? ?            2.700 ? 
metalc22 metalc ? ? H CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  3   A HOH 1271 1_555 ? ? ? ? ? ? ?            2.359 ? 
metalc23 metalc ? ? I CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  4   A HOH 1289 1_555 ? ? ? ? ? ? ?            2.740 ? 
metalc24 metalc ? ? I CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  4   A HOH 1314 1_555 ? ? ? ? ? ? ?            2.441 ? 
metalc25 metalc ? ? I CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  4   A HOH 1291 1_555 ? ? ? ? ? ? ?            2.479 ? 
metalc26 metalc ? ? I CA  .   CA    ? ? ? 1_555 N HOH .  O  ? ? A CA  4   A HOH 1290 1_555 ? ? ? ? ? ? ?            2.338 ? 
hydrog1  hydrog ? ? A DA  1   N1    ? ? ? 1_555 B DT  16 N3 ? ? P DA  1   T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DA  1   N6    ? ? ? 1_555 B DT  16 O4 ? ? P DA  1   T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DT  2   N3    ? ? ? 1_555 B DA  15 N1 ? ? P DT  2   T DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DT  2   O4    ? ? ? 1_555 B DA  15 N6 ? ? P DT  2   T DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC  3   N3    ? ? ? 1_555 B DG  14 N1 ? ? P DC  3   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC  3   N4    ? ? ? 1_555 B DG  14 O6 ? ? P DC  3   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  3   O2    ? ? ? 1_555 B DG  14 N2 ? ? P DC  3   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  4   N3    ? ? ? 1_555 B DG  13 N1 ? ? P DC  4   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  4   N4    ? ? ? 1_555 B DG  13 O6 ? ? P DC  4   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC  4   O2    ? ? ? 1_555 B DG  13 N2 ? ? P DC  4   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT  5   N3    ? ? ? 1_555 B DA  12 N1 ? ? P DT  5   T DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT  5   O4    ? ? ? 1_555 B DA  12 N6 ? ? P DT  5   T DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC  6   N3    ? ? ? 1_555 B DG  11 N1 ? ? P DC  6   T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  6   N4    ? ? ? 1_555 B DG  11 O6 ? ? P DC  6   T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  6   O2    ? ? ? 1_555 B DG  11 N2 ? ? P DC  6   T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  7   N3    ? ? ? 1_555 B DG  10 N1 ? ? P DC  7   T DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  7   N4    ? ? ? 1_555 B DG  10 O6 ? ? P DC  7   T DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  7   O2    ? ? ? 1_555 B DG  10 N2 ? ? P DC  7   T DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  8   N3    ? ? ? 1_555 B DG  9  N1 ? ? P DC  8   T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  8   N4    ? ? ? 1_555 B DG  9  O6 ? ? P DC  8   T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  8   O2    ? ? ? 1_555 B DG  9  N2 ? ? P DC  8   T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DC  9   N3    ? ? ? 1_555 B DG  8  N1 ? ? P DC  9   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC  9   N4    ? ? ? 1_555 B DG  8  O6 ? ? P DC  9   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC  9   O2    ? ? ? 1_555 B DG  8  N2 ? ? P DC  9   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DT  10  N3    ? ? ? 1_555 B DA  7  N1 ? ? P DT  10  T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DT  10  O4    ? ? ? 1_555 B DA  7  N6 ? ? P DT  10  T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA  11  N1    ? ? ? 1_555 B DT  6  N3 ? ? P DA  11  T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA  11  N6    ? ? ? 1_555 B DT  6  O4 ? ? P DA  11  T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DOC 12  N3    ? ? ? 1_555 B DG  5  N1 ? ? P DOC 12  T DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DOC 12  N4    ? ? ? 1_555 B DG  5  O6 ? ? P DOC 12  T DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DOC 12  O2    ? ? ? 1_555 B DG  5  N2 ? ? P DOC 12  T DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 177 C . ? SER 243 A ASN 178 C ? ASN 244 A 1 6.13   
2 ASN 178 C . ? ASN 244 A GLY 179 C ? GLY 245 A 1 -3.92  
3 HIS 729 C . ? HIS 795 A PRO 730 C ? PRO 796 A 1 3.07   
4 HIS 729 C . ? HIS 795 A PRO 730 C ? PRO 796 A 1 4.85   
5 PHE 740 C . ? PHE 806 A PRO 741 C ? PRO 807 A 1 -1.27  
6 VAL 918 C . ? VAL 984 A VAL 919 C ? VAL 985 A 1 -24.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 4 ? 
C ? 6 ? 
D ? 2 ? 
E ? 5 ? 
F ? 4 ? 
G ? 3 ? 
H ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER C 212 ? MET C 213 ? SER A 278 MET A 279 
A 2 LEU C 225 ? ASN C 230 ? LEU A 291 ASN A 296 
A 3 SER C 82  ? THR C 88  ? SER A 148 THR A 154 
A 4 THR C 69  ? THR C 77  ? THR A 135 THR A 143 
A 5 ILE C 47  ? VAL C 58  ? ILE A 113 VAL A 124 
A 6 TRP C 203 ? LEU C 206 ? TRP A 269 LEU A 272 
A 7 ILE C 235 ? HIS C 237 ? ILE A 301 HIS A 303 
B 1 TYR C 93  ? PRO C 97  ? TYR A 159 PRO A 163 
B 2 LEU C 145 ? VAL C 152 ? LEU A 211 VAL A 218 
B 3 ILE C 125 ? SER C 135 ? ILE A 191 SER A 201 
B 4 THR C 507 ? VAL C 508 ? THR A 573 VAL A 574 
C 1 MET C 306 ? HIS C 310 ? MET A 372 HIS A 376 
C 2 ILE C 290 ? LEU C 296 ? ILE A 356 LEU A 362 
C 3 VAL C 273 ? ILE C 282 ? VAL A 339 ILE A 348 
C 4 ARG C 250 ? CYS C 258 ? ARG A 316 CYS A 324 
C 5 VAL C 331 ? GLY C 334 ? VAL A 397 GLY A 400 
C 6 LEU C 394 ? ASP C 397 ? LEU A 460 ASP A 463 
D 1 SER C 373 ? SER C 377 ? SER A 439 SER A 443 
D 2 GLY C 381 ? THR C 385 ? GLY A 447 THR A 451 
E 1 GLY C 532 ? TYR C 534 ? GLY A 598 TYR A 600 
E 2 LEU C 733 ? ASN C 746 ? LEU A 799 ASN A 812 
E 3 ILE C 538 ? PHE C 543 ? ILE A 604 PHE A 609 
E 4 SER C 699 ? LYS C 703 ? SER A 765 LYS A 769 
E 5 VAL C 691 ? TYR C 694 ? VAL A 757 TYR A 760 
F 1 GLY C 532 ? TYR C 534 ? GLY A 598 TYR A 600 
F 2 LEU C 733 ? ASN C 746 ? LEU A 799 ASN A 812 
F 3 ARG C 749 ? TRP C 755 ? ARG A 815 TRP A 821 
F 4 LYS C 763 ? LYS C 767 ? LYS A 829 LYS A 833 
G 1 LEU C 561 ? CYS C 562 ? LEU A 627 CYS A 628 
G 2 TYR C 586 ? VAL C 588 ? TYR A 652 VAL A 654 
G 3 TYR C 578 ? ILE C 580 ? TYR A 644 ILE A 646 
H 1 ILE C 823 ? THR C 826 ? ILE A 889 THR A 892 
H 2 ARG C 857 ? ILE C 862 ? ARG A 923 ILE A 928 
H 3 ALA C 873 ? GLU C 874 ? ALA A 939 GLU A 940 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER C 212 ? N SER A 278 O SER C 228 ? O SER A 294 
A 2 3 O LEU C 225 ? O LEU A 291 N LEU C 84  ? N LEU A 150 
A 3 4 O CYS C 85  ? O CYS A 151 N PHE C 73  ? N PHE A 139 
A 4 5 O VAL C 70  ? O VAL A 136 N SER C 57  ? N SER A 123 
A 5 6 N ILE C 47  ? N ILE A 113 O LEU C 206 ? O LEU A 272 
A 6 7 N THR C 205 ? N THR A 271 O ILE C 235 ? O ILE A 301 
B 1 2 N VAL C 96  ? N VAL A 162 O TRP C 148 ? O TRP A 214 
B 2 3 O PHE C 147 ? O PHE A 213 N VAL C 131 ? N VAL A 197 
B 3 4 N GLN C 134 ? N GLN A 200 O VAL C 508 ? O VAL A 574 
C 1 2 O PHE C 308 ? O PHE A 374 N VAL C 293 ? N VAL A 359 
C 2 3 O PHE C 294 ? O PHE A 360 N ILE C 276 ? N ILE A 342 
C 3 4 O SER C 281 ? O SER A 347 N ILE C 251 ? N ILE A 317 
C 4 5 N MET C 252 ? N MET A 318 O ILE C 333 ? O ILE A 399 
C 5 6 N ILE C 332 ? N ILE A 398 O LEU C 394 ? O LEU A 460 
D 1 2 N PHE C 375 ? N PHE A 441 O ARG C 383 ? O ARG A 449 
E 1 2 N TYR C 534 ? N TYR A 600 O TYR C 742 ? O TYR A 808 
E 2 3 O GLU C 736 ? O GLU A 802 N THR C 540 ? N THR A 606 
E 3 4 N ALA C 539 ? N ALA A 605 O VAL C 702 ? O VAL A 768 
E 4 5 O LYS C 703 ? O LYS A 769 N VAL C 691 ? N VAL A 757 
F 1 2 N TYR C 534 ? N TYR A 600 O TYR C 742 ? O TYR A 808 
F 2 3 N ALA C 738 ? N ALA A 804 O TRP C 755 ? O TRP A 821 
F 3 4 N TYR C 750 ? N TYR A 816 O LYS C 767 ? O LYS A 833 
G 1 2 N CYS C 562 ? N CYS A 628 O TYR C 586 ? O TYR A 652 
G 2 3 O PHE C 587 ? O PHE A 653 N VAL C 579 ? N VAL A 645 
H 1 2 N LYS C 825 ? N LYS A 891 O VAL C 858 ? O VAL A 924 
H 2 3 N VAL C 861 ? N VAL A 927 O GLU C 874 ? O GLU A 940 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA T 17'   
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE DCP A 986' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1'    
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 2'    
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 3'    
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 4'    
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT A 987' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT A 988' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HOH M .   ? HOH T 51   . ? 1_555 ? 
2  AC1 4  HOH M .   ? HOH T 461  . ? 1_555 ? 
3  AC1 4  HOH M .   ? HOH T 462  . ? 1_555 ? 
4  AC1 4  HOH M .   ? HOH T 463  . ? 1_555 ? 
5  AC2 20 CA  F .   ? CA  A 1    . ? 1_555 ? 
6  AC2 20 CA  G .   ? CA  A 2    . ? 1_555 ? 
7  AC2 20 CA  H .   ? CA  A 3    . ? 1_555 ? 
8  AC2 20 HOH N .   ? HOH A 11   . ? 1_555 ? 
9  AC2 20 ASP C 542 ? ASP A 608  . ? 1_555 ? 
10 AC2 20 PHE C 543 ? PHE A 609  . ? 1_555 ? 
11 AC2 20 ASN C 544 ? ASN A 610  . ? 1_555 ? 
12 AC2 20 SER C 545 ? SER A 611  . ? 1_555 ? 
13 AC2 20 LEU C 546 ? LEU A 612  . ? 1_555 ? 
14 AC2 20 TYR C 547 ? TYR A 613  . ? 1_555 ? 
15 AC2 20 ARG C 608 ? ARG A 674  . ? 1_555 ? 
16 AC2 20 LYS C 635 ? LYS A 701  . ? 1_555 ? 
17 AC2 20 ASN C 639 ? ASN A 705  . ? 1_555 ? 
18 AC2 20 ASP C 698 ? ASP A 764  . ? 1_555 ? 
19 AC2 20 HOH N .   ? HOH A 1133 . ? 1_555 ? 
20 AC2 20 HOH N .   ? HOH A 1269 . ? 1_555 ? 
21 AC2 20 HOH N .   ? HOH A 1357 . ? 1_555 ? 
22 AC2 20 DOC A 12  ? DOC P 12   . ? 1_555 ? 
23 AC2 20 DG  B 4   ? DG  T 4    . ? 1_555 ? 
24 AC2 20 DG  B 5   ? DG  T 5    . ? 1_555 ? 
25 AC3 5  CA  G .   ? CA  A 2    . ? 1_555 ? 
26 AC3 5  ASP C 542 ? ASP A 608  . ? 1_555 ? 
27 AC3 5  PHE C 543 ? PHE A 609  . ? 1_555 ? 
28 AC3 5  ASP C 698 ? ASP A 764  . ? 1_555 ? 
29 AC3 5  DCP E .   ? DCP A 986  . ? 1_555 ? 
30 AC4 7  CA  F .   ? CA  A 1    . ? 1_555 ? 
31 AC4 7  ASP C 542 ? ASP A 608  . ? 1_555 ? 
32 AC4 7  ASP C 698 ? ASP A 764  . ? 1_555 ? 
33 AC4 7  DCP E .   ? DCP A 986  . ? 1_555 ? 
34 AC4 7  HOH N .   ? HOH A 1071 . ? 1_555 ? 
35 AC4 7  HOH N .   ? HOH A 1270 . ? 1_555 ? 
36 AC4 7  DOC A 12  ? DOC P 12   . ? 1_555 ? 
37 AC5 6  ASP C 542 ? ASP A 608  . ? 1_555 ? 
38 AC5 6  GLU C 736 ? GLU A 802  . ? 1_555 ? 
39 AC5 6  DCP E .   ? DCP A 986  . ? 1_555 ? 
40 AC5 6  HOH N .   ? HOH A 1271 . ? 1_555 ? 
41 AC5 6  HOH N .   ? HOH A 1272 . ? 1_555 ? 
42 AC5 6  HOH N .   ? HOH A 1378 . ? 1_555 ? 
43 AC6 5  ASP C 255 ? ASP A 321  . ? 1_555 ? 
44 AC6 5  HOH N .   ? HOH A 1289 . ? 1_555 ? 
45 AC6 5  HOH N .   ? HOH A 1290 . ? 1_555 ? 
46 AC6 5  HOH N .   ? HOH A 1291 . ? 1_555 ? 
47 AC6 5  HOH N .   ? HOH A 1314 . ? 1_555 ? 
48 AC7 3  GLN C 520 ? GLN A 586  . ? 1_555 ? 
49 AC7 3  HOH N .   ? HOH A 1232 . ? 1_555 ? 
50 AC7 3  HOH N .   ? HOH A 1388 . ? 1_555 ? 
51 AC8 4  GLU C 119 ? GLU A 185  . ? 1_555 ? 
52 AC8 4  HIS C 123 ? HIS A 189  . ? 1_555 ? 
53 AC8 4  HOH N .   ? HOH A 1406 . ? 1_555 ? 
54 AC8 4  HOH N .   ? HOH A 1407 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3IAY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3IAY 
_atom_sites.fract_transf_matrix[1][1]   0.012334 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004760 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011635 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012339 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DA  A 1 1   ? -35.241 0.459   33.772  1.00 76.92 ?  1    DA  P "O5'" 1 
ATOM   2    C  "C5'" . DA  A 1 1   ? -35.634 -0.791  34.328  1.00 77.11 ?  1    DA  P "C5'" 1 
ATOM   3    C  "C4'" . DA  A 1 1   ? -34.397 -1.553  34.762  1.00 77.00 ?  1    DA  P "C4'" 1 
ATOM   4    O  "O4'" . DA  A 1 1   ? -34.020 -2.482  33.714  1.00 76.94 ?  1    DA  P "O4'" 1 
ATOM   5    C  "C3'" . DA  A 1 1   ? -33.177 -0.668  34.970  1.00 76.63 ?  1    DA  P "C3'" 1 
ATOM   6    O  "O3'" . DA  A 1 1   ? -32.251 -1.284  35.854  1.00 76.24 ?  1    DA  P "O3'" 1 
ATOM   7    C  "C2'" . DA  A 1 1   ? -32.605 -0.587  33.562  1.00 76.51 ?  1    DA  P "C2'" 1 
ATOM   8    C  "C1'" . DA  A 1 1   ? -32.866 -1.999  33.047  1.00 76.47 ?  1    DA  P "C1'" 1 
ATOM   9    N  N9    . DA  A 1 1   ? -33.109 -2.016  31.609  1.00 75.74 ?  1    DA  P N9    1 
ATOM   10   C  C8    . DA  A 1 1   ? -33.542 -0.968  30.843  1.00 75.44 ?  1    DA  P C8    1 
ATOM   11   N  N7    . DA  A 1 1   ? -33.672 -1.265  29.573  1.00 75.35 ?  1    DA  P N7    1 
ATOM   12   C  C5    . DA  A 1 1   ? -33.295 -2.596  29.502  1.00 74.93 ?  1    DA  P C5    1 
ATOM   13   C  C6    . DA  A 1 1   ? -33.215 -3.502  28.428  1.00 74.57 ?  1    DA  P C6    1 
ATOM   14   N  N6    . DA  A 1 1   ? -33.525 -3.164  27.173  1.00 74.52 ?  1    DA  P N6    1 
ATOM   15   N  N1    . DA  A 1 1   ? -32.801 -4.761  28.692  1.00 74.04 ?  1    DA  P N1    1 
ATOM   16   C  C2    . DA  A 1 1   ? -32.493 -5.085  29.953  1.00 74.30 ?  1    DA  P C2    1 
ATOM   17   N  N3    . DA  A 1 1   ? -32.531 -4.321  31.047  1.00 74.87 ?  1    DA  P N3    1 
ATOM   18   C  C4    . DA  A 1 1   ? -32.945 -3.077  30.749  1.00 75.33 ?  1    DA  P C4    1 
ATOM   19   P  P     . DT  A 1 2   ? -30.704 -0.872  35.768  1.00 75.68 ?  2    DT  P P     1 
ATOM   20   O  OP1   . DT  A 1 2   ? -30.252 -0.515  37.135  1.00 76.00 ?  2    DT  P OP1   1 
ATOM   21   O  OP2   . DT  A 1 2   ? -30.544 0.096   34.656  1.00 75.76 ?  2    DT  P OP2   1 
ATOM   22   O  "O5'" . DT  A 1 2   ? -29.995 -2.251  35.370  1.00 73.75 ?  2    DT  P "O5'" 1 
ATOM   23   C  "C5'" . DT  A 1 2   ? -30.507 -3.477  35.887  1.00 70.46 ?  2    DT  P "C5'" 1 
ATOM   24   C  "C4'" . DT  A 1 2   ? -29.755 -4.643  35.280  1.00 67.93 ?  2    DT  P "C4'" 1 
ATOM   25   O  "O4'" . DT  A 1 2   ? -30.172 -4.812  33.901  1.00 67.17 ?  2    DT  P "O4'" 1 
ATOM   26   C  "C3'" . DT  A 1 2   ? -28.242 -4.463  35.279  1.00 66.18 ?  2    DT  P "C3'" 1 
ATOM   27   O  "O3'" . DT  A 1 2   ? -27.621 -5.629  35.771  1.00 64.29 ?  2    DT  P "O3'" 1 
ATOM   28   C  "C2'" . DT  A 1 2   ? -27.881 -4.227  33.817  1.00 66.45 ?  2    DT  P "C2'" 1 
ATOM   29   C  "C1'" . DT  A 1 2   ? -29.050 -4.833  33.047  1.00 66.57 ?  2    DT  P "C1'" 1 
ATOM   30   N  N1    . DT  A 1 2   ? -29.367 -4.055  31.817  1.00 66.00 ?  2    DT  P N1    1 
ATOM   31   C  C2    . DT  A 1 2   ? -29.455 -4.705  30.605  1.00 65.93 ?  2    DT  P C2    1 
ATOM   32   O  O2    . DT  A 1 2   ? -29.294 -5.906  30.481  1.00 66.38 ?  2    DT  P O2    1 
ATOM   33   N  N3    . DT  A 1 2   ? -29.744 -3.892  29.537  1.00 65.19 ?  2    DT  P N3    1 
ATOM   34   C  C4    . DT  A 1 2   ? -29.943 -2.524  29.562  1.00 64.84 ?  2    DT  P C4    1 
ATOM   35   O  O4    . DT  A 1 2   ? -30.196 -1.884  28.547  1.00 64.55 ?  2    DT  P O4    1 
ATOM   36   C  C5    . DT  A 1 2   ? -29.832 -1.905  30.861  1.00 64.97 ?  2    DT  P C5    1 
ATOM   37   C  C7    . DT  A 1 2   ? -30.028 -0.427  31.018  1.00 64.75 ?  2    DT  P C7    1 
ATOM   38   C  C6    . DT  A 1 2   ? -29.552 -2.689  31.911  1.00 65.61 ?  2    DT  P C6    1 
ATOM   39   P  P     . DC  A 1 3   ? -26.098 -5.582  36.260  1.00 63.61 ?  3    DC  P P     1 
ATOM   40   O  OP1   . DC  A 1 3   ? -25.967 -6.574  37.351  1.00 63.64 ?  3    DC  P OP1   1 
ATOM   41   O  OP2   . DC  A 1 3   ? -25.706 -4.166  36.468  1.00 63.39 ?  3    DC  P OP2   1 
ATOM   42   O  "O5'" . DC  A 1 3   ? -25.301 -6.139  34.986  1.00 60.86 ?  3    DC  P "O5'" 1 
ATOM   43   C  "C5'" . DC  A 1 3   ? -25.739 -7.367  34.411  1.00 57.01 ?  3    DC  P "C5'" 1 
ATOM   44   C  "C4'" . DC  A 1 3   ? -25.197 -7.508  33.004  1.00 54.02 ?  3    DC  P "C4'" 1 
ATOM   45   O  "O4'" . DC  A 1 3   ? -25.932 -6.624  32.124  1.00 52.53 ?  3    DC  P "O4'" 1 
ATOM   46   C  "C3'" . DC  A 1 3   ? -23.719 -7.140  32.873  1.00 52.09 ?  3    DC  P "C3'" 1 
ATOM   47   O  "O3'" . DC  A 1 3   ? -22.973 -8.253  32.395  1.00 49.67 ?  3    DC  P "O3'" 1 
ATOM   48   C  "C2'" . DC  A 1 3   ? -23.700 -5.979  31.881  1.00 51.97 ?  3    DC  P "C2'" 1 
ATOM   49   C  "C1'" . DC  A 1 3   ? -25.024 -6.159  31.148  1.00 52.08 ?  3    DC  P "C1'" 1 
ATOM   50   N  N1    . DC  A 1 3   ? -25.534 -4.898  30.539  1.00 50.47 ?  3    DC  P N1    1 
ATOM   51   C  C2    . DC  A 1 3   ? -25.956 -4.909  29.207  1.00 49.94 ?  3    DC  P C2    1 
ATOM   52   O  O2    . DC  A 1 3   ? -25.904 -5.970  28.571  1.00 49.66 ?  3    DC  P O2    1 
ATOM   53   N  N3    . DC  A 1 3   ? -26.410 -3.758  28.654  1.00 49.46 ?  3    DC  P N3    1 
ATOM   54   C  C4    . DC  A 1 3   ? -26.450 -2.638  29.379  1.00 48.97 ?  3    DC  P C4    1 
ATOM   55   N  N4    . DC  A 1 3   ? -26.907 -1.527  28.789  1.00 48.24 ?  3    DC  P N4    1 
ATOM   56   C  C5    . DC  A 1 3   ? -26.021 -2.610  30.739  1.00 49.71 ?  3    DC  P C5    1 
ATOM   57   C  C6    . DC  A 1 3   ? -25.570 -3.750  31.276  1.00 50.02 ?  3    DC  P C6    1 
ATOM   58   P  P     . DC  A 1 4   ? -21.417 -8.074  32.080  1.00 49.26 ?  4    DC  P P     1 
ATOM   59   O  OP1   . DC  A 1 4   ? -20.700 -9.289  32.508  1.00 49.73 ?  4    DC  P OP1   1 
ATOM   60   O  OP2   . DC  A 1 4   ? -20.974 -6.746  32.575  1.00 49.24 ?  4    DC  P OP2   1 
ATOM   61   O  "O5'" . DC  A 1 4   ? -21.403 -8.044  30.477  1.00 46.66 ?  4    DC  P "O5'" 1 
ATOM   62   C  "C5'" . DC  A 1 4   ? -22.191 -8.985  29.751  1.00 42.43 ?  4    DC  P "C5'" 1 
ATOM   63   C  "C4'" . DC  A 1 4   ? -22.026 -8.759  28.261  1.00 39.71 ?  4    DC  P "C4'" 1 
ATOM   64   O  "O4'" . DC  A 1 4   ? -22.832 -7.630  27.839  1.00 37.94 ?  4    DC  P "O4'" 1 
ATOM   65   C  "C3'" . DC  A 1 4   ? -20.591 -8.480  27.826  1.00 39.21 ?  4    DC  P "C3'" 1 
ATOM   66   O  "O3'" . DC  A 1 4   ? -20.283 -9.411  26.823  1.00 40.05 ?  4    DC  P "O3'" 1 
ATOM   67   C  "C2'" . DC  A 1 4   ? -20.598 -7.072  27.247  1.00 37.58 ?  4    DC  P "C2'" 1 
ATOM   68   C  "C1'" . DC  A 1 4   ? -22.076 -6.750  27.040  1.00 36.15 ?  4    DC  P "C1'" 1 
ATOM   69   N  N1    . DC  A 1 4   ? -22.393 -5.372  27.485  1.00 34.15 ?  4    DC  P N1    1 
ATOM   70   C  C2    . DC  A 1 4   ? -22.687 -4.391  26.528  1.00 32.50 ?  4    DC  P C2    1 
ATOM   71   O  O2    . DC  A 1 4   ? -22.676 -4.690  25.326  1.00 29.70 ?  4    DC  P O2    1 
ATOM   72   N  N3    . DC  A 1 4   ? -22.969 -3.139  26.955  1.00 30.97 ?  4    DC  P N3    1 
ATOM   73   C  C4    . DC  A 1 4   ? -22.961 -2.840  28.253  1.00 32.14 ?  4    DC  P C4    1 
ATOM   74   N  N4    . DC  A 1 4   ? -23.254 -1.582  28.599  1.00 31.07 ?  4    DC  P N4    1 
ATOM   75   C  C5    . DC  A 1 4   ? -22.656 -3.823  29.245  1.00 32.66 ?  4    DC  P C5    1 
ATOM   76   C  C6    . DC  A 1 4   ? -22.379 -5.063  28.816  1.00 33.26 ?  4    DC  P C6    1 
ATOM   77   P  P     . DT  A 1 5   ? -18.828 -9.489  26.169  1.00 41.48 ?  5    DT  P P     1 
ATOM   78   O  OP1   . DT  A 1 5   ? -18.809 -10.809 25.483  1.00 40.59 ?  5    DT  P OP1   1 
ATOM   79   O  OP2   . DT  A 1 5   ? -17.792 -9.066  27.131  1.00 36.22 ?  5    DT  P OP2   1 
ATOM   80   O  "O5'" . DT  A 1 5   ? -18.844 -8.366  25.025  1.00 38.33 ?  5    DT  P "O5'" 1 
ATOM   81   C  "C5'" . DT  A 1 5   ? -19.506 -8.616  23.820  1.00 35.91 ?  5    DT  P "C5'" 1 
ATOM   82   C  "C4'" . DT  A 1 5   ? -19.135 -7.538  22.827  1.00 34.70 ?  5    DT  P "C4'" 1 
ATOM   83   O  "O4'" . DT  A 1 5   ? -19.669 -6.278  23.296  1.00 32.26 ?  5    DT  P "O4'" 1 
ATOM   84   C  "C3'" . DT  A 1 5   ? -17.640 -7.327  22.600  1.00 34.39 ?  5    DT  P "C3'" 1 
ATOM   85   O  "O3'" . DT  A 1 5   ? -17.448 -7.312  21.184  1.00 36.16 ?  5    DT  P "O3'" 1 
ATOM   86   C  "C2'" . DT  A 1 5   ? -17.367 -5.958  23.229  1.00 33.12 ?  5    DT  P "C2'" 1 
ATOM   87   C  "C1'" . DT  A 1 5   ? -18.719 -5.269  23.045  1.00 31.86 ?  5    DT  P "C1'" 1 
ATOM   88   N  N1    . DT  A 1 5   ? -19.060 -4.214  24.036  1.00 29.84 ?  5    DT  P N1    1 
ATOM   89   C  C2    . DT  A 1 5   ? -19.534 -2.981  23.618  1.00 27.44 ?  5    DT  P C2    1 
ATOM   90   O  O2    . DT  A 1 5   ? -19.679 -2.641  22.458  1.00 26.56 ?  5    DT  P O2    1 
ATOM   91   N  N3    . DT  A 1 5   ? -19.823 -2.120  24.640  1.00 25.32 ?  5    DT  P N3    1 
ATOM   92   C  C4    . DT  A 1 5   ? -19.682 -2.362  25.990  1.00 26.14 ?  5    DT  P C4    1 
ATOM   93   O  O4    . DT  A 1 5   ? -19.973 -1.507  26.820  1.00 28.29 ?  5    DT  P O4    1 
ATOM   94   C  C5    . DT  A 1 5   ? -19.188 -3.657  26.362  1.00 26.64 ?  5    DT  P C5    1 
ATOM   95   C  C7    . DT  A 1 5   ? -19.021 -4.012  27.822  1.00 26.03 ?  5    DT  P C7    1 
ATOM   96   C  C6    . DT  A 1 5   ? -18.905 -4.516  25.379  1.00 27.92 ?  5    DT  P C6    1 
ATOM   97   P  P     . DC  A 1 6   ? -16.003 -7.257  20.489  1.00 36.62 ?  6    DC  P P     1 
ATOM   98   O  OP1   . DC  A 1 6   ? -16.076 -8.184  19.339  1.00 37.03 ?  6    DC  P OP1   1 
ATOM   99   O  OP2   . DC  A 1 6   ? -14.930 -7.365  21.511  1.00 35.71 ?  6    DC  P OP2   1 
ATOM   100  O  "O5'" . DC  A 1 6   ? -15.954 -5.757  19.910  1.00 32.63 ?  6    DC  P "O5'" 1 
ATOM   101  C  "C5'" . DC  A 1 6   ? -16.917 -5.334  18.952  1.00 28.88 ?  6    DC  P "C5'" 1 
ATOM   102  C  "C4'" . DC  A 1 6   ? -16.764 -3.831  18.791  1.00 26.64 ?  6    DC  P "C4'" 1 
ATOM   103  O  "O4'" . DC  A 1 6   ? -17.104 -3.210  20.058  1.00 24.16 ?  6    DC  P "O4'" 1 
ATOM   104  C  "C3'" . DC  A 1 6   ? -15.333 -3.386  18.471  1.00 25.51 ?  6    DC  P "C3'" 1 
ATOM   105  O  "O3'" . DC  A 1 6   ? -15.384 -2.536  17.314  1.00 25.49 ?  6    DC  P "O3'" 1 
ATOM   106  C  "C2'" . DC  A 1 6   ? -14.868 -2.670  19.752  1.00 23.06 ?  6    DC  P "C2'" 1 
ATOM   107  C  "C1'" . DC  A 1 6   ? -16.193 -2.156  20.317  1.00 23.67 ?  6    DC  P "C1'" 1 
ATOM   108  N  N1    . DC  A 1 6   ? -16.294 -1.898  21.790  1.00 22.33 ?  6    DC  P N1    1 
ATOM   109  C  C2    . DC  A 1 6   ? -16.811 -0.661  22.217  1.00 22.06 ?  6    DC  P C2    1 
ATOM   110  O  O2    . DC  A 1 6   ? -17.135 0.215   21.384  1.00 21.95 ?  6    DC  P O2    1 
ATOM   111  N  N3    . DC  A 1 6   ? -16.913 -0.436  23.541  1.00 21.27 ?  6    DC  P N3    1 
ATOM   112  C  C4    . DC  A 1 6   ? -16.578 -1.377  24.431  1.00 22.27 ?  6    DC  P C4    1 
ATOM   113  N  N4    . DC  A 1 6   ? -16.724 -1.061  25.725  1.00 21.42 ?  6    DC  P N4    1 
ATOM   114  C  C5    . DC  A 1 6   ? -16.058 -2.653  24.027  1.00 20.63 ?  6    DC  P C5    1 
ATOM   115  C  C6    . DC  A 1 6   ? -15.945 -2.865  22.705  1.00 21.49 ?  6    DC  P C6    1 
ATOM   116  P  P     . DC  A 1 7   ? -14.053 -2.024  16.583  1.00 25.14 ?  7    DC  P P     1 
ATOM   117  O  OP1   . DC  A 1 7   ? -14.469 -1.693  15.204  1.00 24.22 ?  7    DC  P OP1   1 
ATOM   118  O  OP2   . DC  A 1 7   ? -12.975 -2.992  16.887  1.00 23.76 ?  7    DC  P OP2   1 
ATOM   119  O  "O5'" . DC  A 1 7   ? -13.600 -0.689  17.360  1.00 24.63 ?  7    DC  P "O5'" 1 
ATOM   120  C  "C5'" . DC  A 1 7   ? -14.390 0.485   17.320  1.00 21.40 ?  7    DC  P "C5'" 1 
ATOM   121  C  "C4'" . DC  A 1 7   ? -13.877 1.502   18.335  1.00 22.34 ?  7    DC  P "C4'" 1 
ATOM   122  O  "O4'" . DC  A 1 7   ? -14.200 1.107   19.684  1.00 23.02 ?  7    DC  P "O4'" 1 
ATOM   123  C  "C3'" . DC  A 1 7   ? -12.373 1.752   18.337  1.00 21.16 ?  7    DC  P "C3'" 1 
ATOM   124  O  "O3'" . DC  A 1 7   ? -12.179 2.914   17.502  1.00 20.20 ?  7    DC  P "O3'" 1 
ATOM   125  C  "C2'" . DC  A 1 7   ? -11.998 1.966   19.812  1.00 20.55 ?  7    DC  P "C2'" 1 
ATOM   126  C  "C1'" . DC  A 1 7   ? -13.358 1.882   20.530  1.00 22.43 ?  7    DC  P "C1'" 1 
ATOM   127  N  N1    . DC  A 1 7   ? -13.391 1.195   21.864  1.00 21.85 ?  7    DC  P N1    1 
ATOM   128  C  C2    . DC  A 1 7   ? -13.772 1.913   23.008  1.00 21.63 ?  7    DC  P C2    1 
ATOM   129  O  O2    . DC  A 1 7   ? -14.050 3.117   22.894  1.00 22.61 ?  7    DC  P O2    1 
ATOM   130  N  N3    . DC  A 1 7   ? -13.818 1.275   24.206  1.00 20.56 ?  7    DC  P N3    1 
ATOM   131  C  C4    . DC  A 1 7   ? -13.486 -0.017  24.284  1.00 19.91 ?  7    DC  P C4    1 
ATOM   132  N  N4    . DC  A 1 7   ? -13.542 -0.599  25.482  1.00 17.68 ?  7    DC  P N4    1 
ATOM   133  C  C5    . DC  A 1 7   ? -13.090 -0.777  23.132  1.00 18.68 ?  7    DC  P C5    1 
ATOM   134  C  C6    . DC  A 1 7   ? -13.052 -0.129  21.952  1.00 21.75 ?  7    DC  P C6    1 
ATOM   135  P  P     . DC  A 1 8   ? -10.719 3.450   17.171  1.00 22.59 ?  8    DC  P P     1 
ATOM   136  O  OP1   . DC  A 1 8   ? -10.853 4.423   16.072  1.00 21.17 ?  8    DC  P OP1   1 
ATOM   137  O  OP2   . DC  A 1 8   ? -9.785  2.305   17.064  1.00 21.64 ?  8    DC  P OP2   1 
ATOM   138  O  "O5'" . DC  A 1 8   ? -10.326 4.248   18.501  1.00 21.91 ?  8    DC  P "O5'" 1 
ATOM   139  C  "C5'" . DC  A 1 8   ? -10.904 5.527   18.757  1.00 20.17 ?  8    DC  P "C5'" 1 
ATOM   140  C  "C4'" . DC  A 1 8   ? -10.303 6.041   20.065  1.00 21.34 ?  8    DC  P "C4'" 1 
ATOM   141  O  "O4'" . DC  A 1 8   ? -10.743 5.157   21.122  1.00 20.83 ?  8    DC  P "O4'" 1 
ATOM   142  C  "C3'" . DC  A 1 8   ? -8.785  5.987   20.103  1.00 21.87 ?  8    DC  P "C3'" 1 
ATOM   143  O  "O3'" . DC  A 1 8   ? -8.307  7.302   20.030  1.00 18.95 ?  8    DC  P "O3'" 1 
ATOM   144  C  "C2'" . DC  A 1 8   ? -8.426  5.312   21.431  1.00 19.80 ?  8    DC  P "C2'" 1 
ATOM   145  C  "C1'" . DC  A 1 8   ? -9.785  5.228   22.134  1.00 21.13 ?  8    DC  P "C1'" 1 
ATOM   146  N  N1    . DC  A 1 8   ? -9.982  4.009   22.950  1.00 21.27 ?  8    DC  P N1    1 
ATOM   147  C  C2    . DC  A 1 8   ? -10.430 4.163   24.270  1.00 20.49 ?  8    DC  P C2    1 
ATOM   148  O  O2    . DC  A 1 8   ? -10.664 5.308   24.702  1.00 18.18 ?  8    DC  P O2    1 
ATOM   149  N  N3    . DC  A 1 8   ? -10.587 3.051   25.027  1.00 20.46 ?  8    DC  P N3    1 
ATOM   150  C  C4    . DC  A 1 8   ? -10.332 1.846   24.510  1.00 20.52 ?  8    DC  P C4    1 
ATOM   151  N  N4    . DC  A 1 8   ? -10.515 0.796   25.313  1.00 18.69 ?  8    DC  P N4    1 
ATOM   152  C  C5    . DC  A 1 8   ? -9.871  1.668   23.161  1.00 19.25 ?  8    DC  P C5    1 
ATOM   153  C  C6    . DC  A 1 8   ? -9.707  2.776   22.424  1.00 19.61 ?  8    DC  P C6    1 
ATOM   154  P  P     . DC  A 1 9   ? -6.764  7.666   20.066  1.00 21.06 ?  9    DC  P P     1 
ATOM   155  O  OP1   . DC  A 1 9   ? -6.669  8.978   19.401  1.00 20.69 ?  9    DC  P OP1   1 
ATOM   156  O  OP2   . DC  A 1 9   ? -5.941  6.518   19.597  1.00 22.18 ?  9    DC  P OP2   1 
ATOM   157  O  "O5'" . DC  A 1 9   ? -6.437  7.907   21.602  1.00 19.88 ?  9    DC  P "O5'" 1 
ATOM   158  C  "C5'" . DC  A 1 9   ? -7.289  8.692   22.446  1.00 17.71 ?  9    DC  P "C5'" 1 
ATOM   159  C  "C4'" . DC  A 1 9   ? -6.994  8.352   23.903  1.00 17.47 ?  9    DC  P "C4'" 1 
ATOM   160  O  "O4'" . DC  A 1 9   ? -7.475  7.002   24.144  1.00 19.48 ?  9    DC  P "O4'" 1 
ATOM   161  C  "C3'" . DC  A 1 9   ? -5.538  8.363   24.335  1.00 17.38 ?  9    DC  P "C3'" 1 
ATOM   162  O  "O3'" . DC  A 1 9   ? -5.291  9.614   25.047  1.00 16.74 ?  9    DC  P "O3'" 1 
ATOM   163  C  "C2'" . DC  A 1 9   ? -5.402  7.113   25.218  1.00 20.29 ?  9    DC  P "C2'" 1 
ATOM   164  C  "C1'" . DC  A 1 9   ? -6.815  6.522   25.292  1.00 19.52 ?  9    DC  P "C1'" 1 
ATOM   165  N  N1    . DC  A 1 9   ? -6.872  5.036   25.269  1.00 21.31 ?  9    DC  P N1    1 
ATOM   166  C  C2    . DC  A 1 9   ? -7.448  4.358   26.340  1.00 21.36 ?  9    DC  P C2    1 
ATOM   167  O  O2    . DC  A 1 9   ? -7.918  5.011   27.280  1.00 21.53 ?  9    DC  P O2    1 
ATOM   168  N  N3    . DC  A 1 9   ? -7.488  3.003   26.319  1.00 19.43 ?  9    DC  P N3    1 
ATOM   169  C  C4    . DC  A 1 9   ? -6.990  2.331   25.283  1.00 21.38 ?  9    DC  P C4    1 
ATOM   170  N  N4    . DC  A 1 9   ? -7.069  0.989   25.335  1.00 18.61 ?  9    DC  P N4    1 
ATOM   171  C  C5    . DC  A 1 9   ? -6.396  3.003   24.166  1.00 20.49 ?  9    DC  P C5    1 
ATOM   172  C  C6    . DC  A 1 9   ? -6.353  4.339   24.199  1.00 20.81 ?  9    DC  P C6    1 
ATOM   173  P  P     . DT  A 1 10  ? -3.880  9.958   25.697  1.00 19.38 ?  10   DT  P P     1 
ATOM   174  O  OP1   . DT  A 1 10  ? -3.837  11.429  25.767  1.00 16.70 ?  10   DT  P OP1   1 
ATOM   175  O  OP2   . DT  A 1 10  ? -2.792  9.248   24.990  1.00 19.90 ?  10   DT  P OP2   1 
ATOM   176  O  "O5'" . DT  A 1 10  ? -3.972  9.321   27.179  1.00 19.88 ?  10   DT  P "O5'" 1 
ATOM   177  C  "C5'" . DT  A 1 10  ? -5.086  9.709   27.995  1.00 18.77 ?  10   DT  P "C5'" 1 
ATOM   178  C  "C4'" . DT  A 1 10  ? -5.159  8.821   29.226  1.00 18.83 ?  10   DT  P "C4'" 1 
ATOM   179  O  "O4'" . DT  A 1 10  ? -5.448  7.464   28.834  1.00 17.81 ?  10   DT  P "O4'" 1 
ATOM   180  C  "C3'" . DT  A 1 10  ? -3.875  8.758   30.050  1.00 18.79 ?  10   DT  P "C3'" 1 
ATOM   181  O  "O3'" . DT  A 1 10  ? -4.226  8.920   31.410  1.00 17.09 ?  10   DT  P "O3'" 1 
ATOM   182  C  "C2'" . DT  A 1 10  ? -3.364  7.352   29.795  1.00 18.36 ?  10   DT  P "C2'" 1 
ATOM   183  C  "C1'" . DT  A 1 10  ? -4.688  6.602   29.645  1.00 19.39 ?  10   DT  P "C1'" 1 
ATOM   184  N  N1    . DT  A 1 10  ? -4.579  5.252   28.974  1.00 17.86 ?  10   DT  P N1    1 
ATOM   185  C  C2    . DT  A 1 10  ? -5.084  4.134   29.636  1.00 18.68 ?  10   DT  P C2    1 
ATOM   186  O  O2    . DT  A 1 10  ? -5.659  4.184   30.726  1.00 18.70 ?  10   DT  P O2    1 
ATOM   187  N  N3    . DT  A 1 10  ? -4.937  2.949   28.967  1.00 16.78 ?  10   DT  P N3    1 
ATOM   188  C  C4    . DT  A 1 10  ? -4.333  2.761   27.726  1.00 17.30 ?  10   DT  P C4    1 
ATOM   189  O  O4    . DT  A 1 10  ? -4.265  1.639   27.226  1.00 17.55 ?  10   DT  P O4    1 
ATOM   190  C  C5    . DT  A 1 10  ? -3.814  3.959   27.082  1.00 17.44 ?  10   DT  P C5    1 
ATOM   191  C  C7    . DT  A 1 10  ? -3.111  3.879   25.742  1.00 14.60 ?  10   DT  P C7    1 
ATOM   192  C  C6    . DT  A 1 10  ? -3.953  5.139   27.737  1.00 17.62 ?  10   DT  P C6    1 
ATOM   193  P  P     . DA  A 1 11  ? -3.137  9.061   32.563  1.00 17.03 ?  11   DA  P P     1 
ATOM   194  O  OP1   . DA  A 1 11  ? -3.585  10.204  33.385  1.00 16.52 ?  11   DA  P OP1   1 
ATOM   195  O  OP2   . DA  A 1 11  ? -1.740  8.998   32.112  1.00 18.34 ?  11   DA  P OP2   1 
ATOM   196  O  "O5'" . DA  A 1 11  ? -3.374  7.668   33.324  1.00 18.65 ?  11   DA  P "O5'" 1 
ATOM   197  C  "C5'" . DA  A 1 11  ? -4.625  7.449   33.979  1.00 17.41 ?  11   DA  P "C5'" 1 
ATOM   198  C  "C4'" . DA  A 1 11  ? -4.415  6.386   35.050  1.00 16.21 ?  11   DA  P "C4'" 1 
ATOM   199  O  "O4'" . DA  A 1 11  ? -4.521  5.103   34.402  1.00 17.66 ?  11   DA  P "O4'" 1 
ATOM   200  C  "C3'" . DA  A 1 11  ? -3.061  6.419   35.743  1.00 15.99 ?  11   DA  P "C3'" 1 
ATOM   201  O  "O3'" . DA  A 1 11  ? -3.323  6.135   37.102  1.00 15.83 ?  11   DA  P "O3'" 1 
ATOM   202  C  "C2'" . DA  A 1 11  ? -2.258  5.307   35.070  1.00 16.71 ?  11   DA  P "C2'" 1 
ATOM   203  C  "C1'" . DA  A 1 11  ? -3.346  4.340   34.567  1.00 17.04 ?  11   DA  P "C1'" 1 
ATOM   204  N  N9    . DA  A 1 11  ? -2.973  3.773   33.269  1.00 17.54 ?  11   DA  P N9    1 
ATOM   205  C  C8    . DA  A 1 11  ? -2.525  4.487   32.184  1.00 16.53 ?  11   DA  P C8    1 
ATOM   206  N  N7    . DA  A 1 11  ? -2.259  3.745   31.136  1.00 16.22 ?  11   DA  P N7    1 
ATOM   207  C  C5    . DA  A 1 11  ? -2.536  2.448   31.554  1.00 15.36 ?  11   DA  P C5    1 
ATOM   208  C  C6    . DA  A 1 11  ? -2.421  1.199   30.908  1.00 16.27 ?  11   DA  P C6    1 
ATOM   209  N  N6    . DA  A 1 11  ? -1.969  1.031   29.650  1.00 12.71 ?  11   DA  P N6    1 
ATOM   210  N  N1    . DA  A 1 11  ? -2.776  0.103   31.620  1.00 16.78 ?  11   DA  P N1    1 
ATOM   211  C  C2    . DA  A 1 11  ? -3.212  0.250   32.889  1.00 14.96 ?  11   DA  P C2    1 
ATOM   212  N  N3    . DA  A 1 11  ? -3.345  1.376   33.593  1.00 16.60 ?  11   DA  P N3    1 
ATOM   213  C  C4    . DA  A 1 11  ? -2.974  2.447   32.869  1.00 16.34 ?  11   DA  P C4    1 
HETATM 214  N  N1    . DOC A 1 12  ? -0.122  1.494   34.653  1.00 13.80 ?  12   DOC P N1    1 
HETATM 215  C  C2    . DOC A 1 12  ? -0.011  0.390   33.794  1.00 13.20 ?  12   DOC P C2    1 
HETATM 216  N  N3    . DOC A 1 12  ? 0.444   0.536   32.533  1.00 14.27 ?  12   DOC P N3    1 
HETATM 217  C  C4    . DOC A 1 12  ? 0.772   1.767   32.074  1.00 15.12 ?  12   DOC P C4    1 
HETATM 218  C  C5    . DOC A 1 12  ? 0.667   2.899   32.918  1.00 14.77 ?  12   DOC P C5    1 
HETATM 219  C  C6    . DOC A 1 12  ? 0.196   2.736   34.217  1.00 13.39 ?  12   DOC P C6    1 
HETATM 220  O  O2    . DOC A 1 12  ? -0.329  -0.739  34.212  1.00 14.74 ?  12   DOC P O2    1 
HETATM 221  N  N4    . DOC A 1 12  ? 1.200   1.870   30.786  1.00 12.88 ?  12   DOC P N4    1 
HETATM 222  C  "C1'" . DOC A 1 12  ? -0.661  1.249   36.006  1.00 15.01 ?  12   DOC P "C1'" 1 
HETATM 223  C  "C2'" . DOC A 1 12  ? 0.362   0.691   36.987  1.00 13.37 ?  12   DOC P "C2'" 1 
HETATM 224  C  "C3'" . DOC A 1 12  ? 0.528   1.780   38.059  1.00 14.24 ?  12   DOC P "C3'" 1 
HETATM 225  C  "C4'" . DOC A 1 12  ? -0.744  2.608   37.903  1.00 15.27 ?  12   DOC P "C4'" 1 
HETATM 226  O  "O4'" . DOC A 1 12  ? -1.183  2.467   36.547  1.00 14.61 ?  12   DOC P "O4'" 1 
HETATM 227  C  "C5'" . DOC A 1 12  ? -0.522  4.086   38.174  1.00 16.64 ?  12   DOC P "C5'" 1 
HETATM 228  O  "O5'" . DOC A 1 12  ? -1.844  4.560   38.291  1.00 17.00 ?  12   DOC P "O5'" 1 
HETATM 229  P  P     . DOC A 1 12  ? -2.256  6.099   38.262  1.00 17.37 ?  12   DOC P P     1 
HETATM 230  O  OP1   . DOC A 1 12  ? -3.016  6.321   39.557  1.00 15.97 ?  12   DOC P OP1   1 
HETATM 231  O  OP2   . DOC A 1 12  ? -1.068  6.929   37.887  1.00 16.26 ?  12   DOC P OP2   1 
ATOM   232  O  "O5'" . DT  B 2 1   ? 9.772   -8.271  17.459  1.00 34.29 ?  1    DT  T "O5'" 1 
ATOM   233  C  "C5'" . DT  B 2 1   ? 10.604  -9.235  18.120  1.00 33.65 ?  1    DT  T "C5'" 1 
ATOM   234  C  "C4'" . DT  B 2 1   ? 11.570  -9.819  17.113  1.00 34.52 ?  1    DT  T "C4'" 1 
ATOM   235  O  "O4'" . DT  B 2 1   ? 12.625  -10.509 17.815  1.00 33.93 ?  1    DT  T "O4'" 1 
ATOM   236  C  "C3'" . DT  B 2 1   ? 10.960  -10.816 16.117  1.00 34.28 ?  1    DT  T "C3'" 1 
ATOM   237  O  "O3'" . DT  B 2 1   ? 11.154  -10.385 14.800  1.00 34.94 ?  1    DT  T "O3'" 1 
ATOM   238  C  "C2'" . DT  B 2 1   ? 11.772  -12.081 16.318  1.00 33.18 ?  1    DT  T "C2'" 1 
ATOM   239  C  "C1'" . DT  B 2 1   ? 13.035  -11.566 16.988  1.00 31.21 ?  1    DT  T "C1'" 1 
ATOM   240  N  N1    . DT  B 2 1   ? 13.533  -12.687 17.770  1.00 29.94 ?  1    DT  T N1    1 
ATOM   241  C  C2    . DT  B 2 1   ? 14.699  -13.260 17.350  1.00 29.07 ?  1    DT  T C2    1 
ATOM   242  O  O2    . DT  B 2 1   ? 15.318  -12.817 16.393  1.00 29.09 ?  1    DT  T O2    1 
ATOM   243  N  N3    . DT  B 2 1   ? 15.093  -14.334 18.109  1.00 26.47 ?  1    DT  T N3    1 
ATOM   244  C  C4    . DT  B 2 1   ? 14.426  -14.874 19.192  1.00 25.89 ?  1    DT  T C4    1 
ATOM   245  O  O4    . DT  B 2 1   ? 14.861  -15.846 19.797  1.00 26.20 ?  1    DT  T O4    1 
ATOM   246  C  C5    . DT  B 2 1   ? 13.196  -14.224 19.562  1.00 25.60 ?  1    DT  T C5    1 
ATOM   247  C  C7    . DT  B 2 1   ? 12.381  -14.715 20.724  1.00 25.88 ?  1    DT  T C7    1 
ATOM   248  C  C6    . DT  B 2 1   ? 12.806  -13.175 18.836  1.00 27.58 ?  1    DT  T C6    1 
ATOM   249  P  P     . DA  B 2 2   ? 10.430  -11.142 13.577  1.00 37.82 ?  2    DA  T P     1 
ATOM   250  O  OP1   . DA  B 2 2   ? 9.368   -12.019 14.153  1.00 37.09 ?  2    DA  T OP1   1 
ATOM   251  O  OP2   . DA  B 2 2   ? 11.465  -11.689 12.679  1.00 34.41 ?  2    DA  T OP2   1 
ATOM   252  O  "O5'" . DA  B 2 2   ? 9.661   -9.923  12.856  1.00 35.38 ?  2    DA  T "O5'" 1 
ATOM   253  C  "C5'" . DA  B 2 2   ? 10.310  -8.978  12.006  1.00 32.46 ?  2    DA  T "C5'" 1 
ATOM   254  C  "C4'" . DA  B 2 2   ? 9.702   -7.616  12.300  1.00 31.25 ?  2    DA  T "C4'" 1 
ATOM   255  O  "O4'" . DA  B 2 2   ? 8.386   -7.556  11.689  1.00 31.06 ?  2    DA  T "O4'" 1 
ATOM   256  C  "C3'" . DA  B 2 2   ? 9.482   -7.363  13.798  1.00 28.96 ?  2    DA  T "C3'" 1 
ATOM   257  O  "O3'" . DA  B 2 2   ? 9.604   -5.984  14.082  1.00 24.77 ?  2    DA  T "O3'" 1 
ATOM   258  C  "C2'" . DA  B 2 2   ? 8.055   -7.851  14.010  1.00 30.66 ?  2    DA  T "C2'" 1 
ATOM   259  C  "C1'" . DA  B 2 2   ? 7.413   -7.402  12.706  1.00 32.58 ?  2    DA  T "C1'" 1 
ATOM   260  N  N9    . DA  B 2 2   ? 6.268   -8.213  12.331  1.00 36.36 ?  2    DA  T N9    1 
ATOM   261  C  C8    . DA  B 2 2   ? 6.244   -9.559  12.105  1.00 37.37 ?  2    DA  T C8    1 
ATOM   262  N  N7    . DA  B 2 2   ? 5.059   -10.015 11.765  1.00 38.57 ?  2    DA  T N7    1 
ATOM   263  C  C5    . DA  B 2 2   ? 4.259   -8.887  11.767  1.00 39.21 ?  2    DA  T C5    1 
ATOM   264  C  C6    . DA  B 2 2   ? 2.891   -8.693  11.502  1.00 40.08 ?  2    DA  T C6    1 
ATOM   265  N  N6    . DA  B 2 2   ? 2.071   -9.694  11.156  1.00 41.17 ?  2    DA  T N6    1 
ATOM   266  N  N1    . DA  B 2 2   ? 2.407   -7.427  11.597  1.00 40.34 ?  2    DA  T N1    1 
ATOM   267  C  C2    . DA  B 2 2   ? 3.238   -6.432  11.935  1.00 38.95 ?  2    DA  T C2    1 
ATOM   268  N  N3    . DA  B 2 2   ? 4.541   -6.503  12.214  1.00 38.32 ?  2    DA  T N3    1 
ATOM   269  C  C4    . DA  B 2 2   ? 4.988   -7.764  12.111  1.00 38.08 ?  2    DA  T C4    1 
ATOM   270  P  P     . DA  B 2 3   ? 10.061  -5.478  15.527  1.00 23.34 ?  3    DA  T P     1 
ATOM   271  O  OP1   . DA  B 2 3   ? 10.674  -4.142  15.387  1.00 20.67 ?  3    DA  T OP1   1 
ATOM   272  O  OP2   . DA  B 2 3   ? 10.860  -6.501  16.247  1.00 22.63 ?  3    DA  T OP2   1 
ATOM   273  O  "O5'" . DA  B 2 3   ? 8.660   -5.374  16.314  1.00 25.44 ?  3    DA  T "O5'" 1 
ATOM   274  C  "C5'" . DA  B 2 3   ? 7.754   -4.277  16.255  1.00 24.43 ?  3    DA  T "C5'" 1 
ATOM   275  C  "C4'" . DA  B 2 3   ? 6.379   -4.653  16.814  1.00 24.09 ?  3    DA  T "C4'" 1 
ATOM   276  O  "O4'" . DA  B 2 3   ? 5.755   -5.701  16.015  1.00 25.15 ?  3    DA  T "O4'" 1 
ATOM   277  C  "C3'" . DA  B 2 3   ? 6.357   -5.238  18.214  1.00 23.60 ?  3    DA  T "C3'" 1 
ATOM   278  O  "O3'" . DA  B 2 3   ? 6.486   -4.186  19.195  1.00 23.29 ?  3    DA  T "O3'" 1 
ATOM   279  C  "C2'" . DA  B 2 3   ? 4.985   -5.913  18.244  1.00 23.80 ?  3    DA  T "C2'" 1 
ATOM   280  C  "C1'" . DA  B 2 3   ? 4.790   -6.375  16.795  1.00 25.72 ?  3    DA  T "C1'" 1 
ATOM   281  N  N9    . DA  B 2 3   ? 5.056   -7.779  16.581  1.00 28.05 ?  3    DA  T N9    1 
ATOM   282  C  C8    . DA  B 2 3   ? 6.181   -8.457  16.967  1.00 28.51 ?  3    DA  T C8    1 
ATOM   283  N  N7    . DA  B 2 3   ? 6.158   -9.723  16.617  1.00 32.01 ?  3    DA  T N7    1 
ATOM   284  C  C5    . DA  B 2 3   ? 4.936   -9.883  15.973  1.00 31.34 ?  3    DA  T C5    1 
ATOM   285  C  C6    . DA  B 2 3   ? 4.310   -11.003 15.377  1.00 33.90 ?  3    DA  T C6    1 
ATOM   286  N  N6    . DA  B 2 3   ? 4.857   -12.222 15.334  1.00 33.29 ?  3    DA  T N6    1 
ATOM   287  N  N1    . DA  B 2 3   ? 3.094   -10.818 14.818  1.00 35.00 ?  3    DA  T N1    1 
ATOM   288  C  C2    . DA  B 2 3   ? 2.550   -9.586  14.869  1.00 34.98 ?  3    DA  T C2    1 
ATOM   289  N  N3    . DA  B 2 3   ? 3.039   -8.459  15.401  1.00 32.80 ?  3    DA  T N3    1 
ATOM   290  C  C4    . DA  B 2 3   ? 4.248   -8.687  15.941  1.00 30.61 ?  3    DA  T C4    1 
ATOM   291  P  P     . DG  B 2 4   ? 7.415   -4.415  20.462  1.00 20.90 ?  4    DG  T P     1 
ATOM   292  O  OP1   . DG  B 2 4   ? 7.453   -3.138  21.221  1.00 22.38 ?  4    DG  T OP1   1 
ATOM   293  O  OP2   . DG  B 2 4   ? 8.691   -5.021  20.029  1.00 22.08 ?  4    DG  T OP2   1 
ATOM   294  O  "O5'" . DG  B 2 4   ? 6.597   -5.541  21.269  1.00 20.53 ?  4    DG  T "O5'" 1 
ATOM   295  C  "C5'" . DG  B 2 4   ? 5.494   -5.178  22.152  1.00 19.67 ?  4    DG  T "C5'" 1 
ATOM   296  C  "C4'" . DG  B 2 4   ? 5.645   -5.947  23.473  1.00 18.82 ?  4    DG  T "C4'" 1 
ATOM   297  O  "O4'" . DG  B 2 4   ? 6.738   -5.416  24.266  1.00 19.19 ?  4    DG  T "O4'" 1 
ATOM   298  C  "C3'" . DG  B 2 4   ? 4.425   -5.943  24.382  1.00 19.17 ?  4    DG  T "C3'" 1 
ATOM   299  O  "O3'" . DG  B 2 4   ? 3.584   -7.031  23.973  1.00 20.24 ?  4    DG  T "O3'" 1 
ATOM   300  C  "C2'" . DG  B 2 4   ? 5.065   -6.198  25.749  1.00 18.68 ?  4    DG  T "C2'" 1 
ATOM   301  C  "C1'" . DG  B 2 4   ? 6.342   -5.350  25.612  1.00 18.67 ?  4    DG  T "C1'" 1 
ATOM   302  N  N9    . DG  B 2 4   ? 6.112   -3.953  25.980  1.00 18.78 ?  4    DG  T N9    1 
ATOM   303  C  C8    . DG  B 2 4   ? 6.229   -2.806  25.206  1.00 18.14 ?  4    DG  T C8    1 
ATOM   304  N  N7    . DG  B 2 4   ? 5.951   -1.721  25.875  1.00 20.04 ?  4    DG  T N7    1 
ATOM   305  C  C5    . DG  B 2 4   ? 5.631   -2.167  27.178  1.00 20.07 ?  4    DG  T C5    1 
ATOM   306  C  C6    . DG  B 2 4   ? 5.244   -1.456  28.349  1.00 20.71 ?  4    DG  T C6    1 
ATOM   307  O  O6    . DG  B 2 4   ? 5.097   -0.221  28.517  1.00 21.67 ?  4    DG  T O6    1 
ATOM   308  N  N1    . DG  B 2 4   ? 5.022   -2.314  29.433  1.00 18.24 ?  4    DG  T N1    1 
ATOM   309  C  C2    . DG  B 2 4   ? 5.134   -3.690  29.390  1.00 20.81 ?  4    DG  T C2    1 
ATOM   310  N  N2    . DG  B 2 4   ? 4.854   -4.328  30.540  1.00 18.09 ?  4    DG  T N2    1 
ATOM   311  N  N3    . DG  B 2 4   ? 5.507   -4.372  28.300  1.00 18.01 ?  4    DG  T N3    1 
ATOM   312  C  C4    . DG  B 2 4   ? 5.736   -3.543  27.246  1.00 18.48 ?  4    DG  T C4    1 
ATOM   313  P  P     . DG  B 2 5   ? 2.009   -6.955  24.135  1.00 22.19 ?  5    DG  T P     1 
ATOM   314  O  OP1   . DG  B 2 5   ? 1.521   -8.133  23.403  1.00 20.17 ?  5    DG  T OP1   1 
ATOM   315  O  OP2   . DG  B 2 5   ? 1.504   -5.619  23.867  1.00 22.59 ?  5    DG  T OP2   1 
ATOM   316  O  "O5'" . DG  B 2 5   ? 1.841   -7.198  25.717  1.00 20.96 ?  5    DG  T "O5'" 1 
ATOM   317  C  "C5'" . DG  B 2 5   ? 2.154   -8.447  26.299  1.00 19.40 ?  5    DG  T "C5'" 1 
ATOM   318  C  "C4'" . DG  B 2 5   ? 1.834   -8.339  27.782  1.00 19.56 ?  5    DG  T "C4'" 1 
ATOM   319  O  "O4'" . DG  B 2 5   ? 2.626   -7.270  28.358  1.00 19.90 ?  5    DG  T "O4'" 1 
ATOM   320  C  "C3'" . DG  B 2 5   ? 0.390   -7.955  28.075  1.00 18.72 ?  5    DG  T "C3'" 1 
ATOM   321  O  "O3'" . DG  B 2 5   ? -0.368  -9.149  28.161  1.00 18.01 ?  5    DG  T "O3'" 1 
ATOM   322  C  "C2'" . DG  B 2 5   ? 0.507   -7.320  29.472  1.00 18.69 ?  5    DG  T "C2'" 1 
ATOM   323  C  "C1'" . DG  B 2 5   ? 1.862   -6.607  29.353  1.00 18.87 ?  5    DG  T "C1'" 1 
ATOM   324  N  N9    . DG  B 2 5   ? 1.802   -5.182  29.026  1.00 17.60 ?  5    DG  T N9    1 
ATOM   325  C  C8    . DG  B 2 5   ? 2.131   -4.551  27.829  1.00 20.20 ?  5    DG  T C8    1 
ATOM   326  N  N7    . DG  B 2 5   ? 2.012   -3.234  27.878  1.00 19.62 ?  5    DG  T N7    1 
ATOM   327  C  C5    . DG  B 2 5   ? 1.604   -2.977  29.186  1.00 19.24 ?  5    DG  T C5    1 
ATOM   328  C  C6    . DG  B 2 5   ? 1.311   -1.736  29.809  1.00 19.06 ?  5    DG  T C6    1 
ATOM   329  O  O6    . DG  B 2 5   ? 1.359   -0.583  29.318  1.00 18.12 ?  5    DG  T O6    1 
ATOM   330  N  N1    . DG  B 2 5   ? 0.900   -1.911  31.118  1.00 15.93 ?  5    DG  T N1    1 
ATOM   331  C  C2    . DG  B 2 5   ? 0.819   -3.133  31.762  1.00 18.75 ?  5    DG  T C2    1 
ATOM   332  N  N2    . DG  B 2 5   ? 0.418   -3.087  33.051  1.00 17.69 ?  5    DG  T N2    1 
ATOM   333  N  N3    . DG  B 2 5   ? 1.089   -4.311  31.193  1.00 18.67 ?  5    DG  T N3    1 
ATOM   334  C  C4    . DG  B 2 5   ? 1.468   -4.162  29.899  1.00 19.31 ?  5    DG  T C4    1 
ATOM   335  P  P     . DT  B 2 6   ? -1.972  -9.159  28.085  1.00 19.18 ?  6    DT  T P     1 
ATOM   336  O  OP1   . DT  B 2 6   ? -2.348  -10.574 28.082  1.00 16.62 ?  6    DT  T OP1   1 
ATOM   337  O  OP2   . DT  B 2 6   ? -2.420  -8.255  27.021  1.00 16.47 ?  6    DT  T OP2   1 
ATOM   338  O  "O5'" . DT  B 2 6   ? -2.432  -8.445  29.444  1.00 17.15 ?  6    DT  T "O5'" 1 
ATOM   339  C  "C5'" . DT  B 2 6   ? -2.326  -9.096  30.717  1.00 16.32 ?  6    DT  T "C5'" 1 
ATOM   340  C  "C4'" . DT  B 2 6   ? -2.965  -8.242  31.812  1.00 16.41 ?  6    DT  T "C4'" 1 
ATOM   341  O  "O4'" . DT  B 2 6   ? -2.352  -6.926  31.863  1.00 16.76 ?  6    DT  T "O4'" 1 
ATOM   342  C  "C3'" . DT  B 2 6   ? -4.472  -8.049  31.680  1.00 17.74 ?  6    DT  T "C3'" 1 
ATOM   343  O  "O3'" . DT  B 2 6   ? -5.046  -7.997  32.996  1.00 18.80 ?  6    DT  T "O3'" 1 
ATOM   344  C  "C2'" . DT  B 2 6   ? -4.537  -6.691  30.992  1.00 16.82 ?  6    DT  T "C2'" 1 
ATOM   345  C  "C1'" . DT  B 2 6   ? -3.388  -5.976  31.697  1.00 17.06 ?  6    DT  T "C1'" 1 
ATOM   346  N  N1    . DT  B 2 6   ? -2.926  -4.823  30.898  1.00 17.11 ?  6    DT  T N1    1 
ATOM   347  C  C2    . DT  B 2 6   ? -2.978  -3.564  31.461  1.00 17.53 ?  6    DT  T C2    1 
ATOM   348  O  O2    . DT  B 2 6   ? -3.364  -3.337  32.606  1.00 18.16 ?  6    DT  T O2    1 
ATOM   349  N  N3    . DT  B 2 6   ? -2.545  -2.562  30.638  1.00 16.67 ?  6    DT  T N3    1 
ATOM   350  C  C4    . DT  B 2 6   ? -2.094  -2.688  29.328  1.00 17.07 ?  6    DT  T C4    1 
ATOM   351  O  O4    . DT  B 2 6   ? -1.741  -1.693  28.687  1.00 19.31 ?  6    DT  T O4    1 
ATOM   352  C  C5    . DT  B 2 6   ? -2.056  -4.032  28.795  1.00 15.44 ?  6    DT  T C5    1 
ATOM   353  C  C7    . DT  B 2 6   ? -1.585  -4.293  27.368  1.00 13.30 ?  6    DT  T C7    1 
ATOM   354  C  C6    . DT  B 2 6   ? -2.467  -5.025  29.602  1.00 16.36 ?  6    DT  T C6    1 
ATOM   355  P  P     . DA  B 2 7   ? -6.599  -7.816  33.298  1.00 19.22 ?  7    DA  T P     1 
ATOM   356  O  OP1   . DA  B 2 7   ? -6.830  -8.693  34.457  1.00 18.55 ?  7    DA  T OP1   1 
ATOM   357  O  OP2   . DA  B 2 7   ? -7.412  -7.922  32.068  1.00 16.88 ?  7    DA  T OP2   1 
ATOM   358  O  "O5'" . DA  B 2 7   ? -6.709  -6.292  33.772  1.00 19.13 ?  7    DA  T "O5'" 1 
ATOM   359  C  "C5'" . DA  B 2 7   ? -6.011  -5.790  34.903  1.00 19.83 ?  7    DA  T "C5'" 1 
ATOM   360  C  "C4'" . DA  B 2 7   ? -6.687  -4.529  35.413  1.00 19.24 ?  7    DA  T "C4'" 1 
ATOM   361  O  "O4'" . DA  B 2 7   ? -6.275  -3.386  34.621  1.00 20.04 ?  7    DA  T "O4'" 1 
ATOM   362  C  "C3'" . DA  B 2 7   ? -8.210  -4.492  35.381  1.00 21.44 ?  7    DA  T "C3'" 1 
ATOM   363  O  "O3'" . DA  B 2 7   ? -8.657  -3.696  36.519  1.00 20.49 ?  7    DA  T "O3'" 1 
ATOM   364  C  "C2'" . DA  B 2 7   ? -8.517  -3.792  34.048  1.00 19.80 ?  7    DA  T "C2'" 1 
ATOM   365  C  "C1'" . DA  B 2 7   ? -7.349  -2.818  33.903  1.00 20.04 ?  7    DA  T "C1'" 1 
ATOM   366  N  N9    . DA  B 2 7   ? -6.825  -2.618  32.543  1.00 20.41 ?  7    DA  T N9    1 
ATOM   367  C  C8    . DA  B 2 7   ? -6.536  -3.591  31.620  1.00 21.26 ?  7    DA  T C8    1 
ATOM   368  N  N7    . DA  B 2 7   ? -6.061  -3.115  30.488  1.00 19.91 ?  7    DA  T N7    1 
ATOM   369  C  C5    . DA  B 2 7   ? -6.018  -1.745  30.688  1.00 20.44 ?  7    DA  T C5    1 
ATOM   370  C  C6    . DA  B 2 7   ? -5.630  -0.670  29.857  1.00 21.50 ?  7    DA  T C6    1 
ATOM   371  N  N6    . DA  B 2 7   ? -5.149  -0.825  28.605  1.00 19.74 ?  7    DA  T N6    1 
ATOM   372  N  N1    . DA  B 2 7   ? -5.720  0.579   30.364  1.00 21.70 ?  7    DA  T N1    1 
ATOM   373  C  C2    . DA  B 2 7   ? -6.197  0.751   31.607  1.00 20.28 ?  7    DA  T C2    1 
ATOM   374  N  N3    . DA  B 2 7   ? -6.599  -0.182  32.465  1.00 20.33 ?  7    DA  T N3    1 
ATOM   375  C  C4    . DA  B 2 7   ? -6.487  -1.422  31.946  1.00 21.10 ?  7    DA  T C4    1 
ATOM   376  P  P     . DG  B 2 8   ? -10.212 -3.483  36.861  1.00 21.60 ?  8    DG  T P     1 
ATOM   377  O  OP1   . DG  B 2 8   ? -10.255 -3.070  38.282  1.00 19.84 ?  8    DG  T OP1   1 
ATOM   378  O  OP2   . DG  B 2 8   ? -10.968 -4.641  36.389  1.00 19.32 ?  8    DG  T OP2   1 
ATOM   379  O  "O5'" . DG  B 2 8   ? -10.666 -2.235  35.993  1.00 20.04 ?  8    DG  T "O5'" 1 
ATOM   380  C  "C5'" . DG  B 2 8   ? -10.045 -0.984  36.281  1.00 22.27 ?  8    DG  T "C5'" 1 
ATOM   381  C  "C4'" . DG  B 2 8   ? -10.594 0.027   35.284  1.00 22.84 ?  8    DG  T "C4'" 1 
ATOM   382  O  "O4'" . DG  B 2 8   ? -9.782  -0.061  34.090  1.00 22.63 ?  8    DG  T "O4'" 1 
ATOM   383  C  "C3'" . DG  B 2 8   ? -12.040 -0.224  34.835  1.00 25.43 ?  8    DG  T "C3'" 1 
ATOM   384  O  "O3'" . DG  B 2 8   ? -12.686 1.019   34.812  1.00 27.42 ?  8    DG  T "O3'" 1 
ATOM   385  C  "C2'" . DG  B 2 8   ? -11.922 -0.726  33.394  1.00 23.77 ?  8    DG  T "C2'" 1 
ATOM   386  C  "C1'" . DG  B 2 8   ? -10.675 0.064   33.001  1.00 23.78 ?  8    DG  T "C1'" 1 
ATOM   387  N  N9    . DG  B 2 8   ? -10.079 -0.349  31.736  1.00 22.25 ?  8    DG  T N9    1 
ATOM   388  C  C8    . DG  B 2 8   ? -9.926  -1.624  31.235  1.00 20.47 ?  8    DG  T C8    1 
ATOM   389  N  N7    . DG  B 2 8   ? -9.369  -1.630  30.054  1.00 21.93 ?  8    DG  T N7    1 
ATOM   390  C  C5    . DG  B 2 8   ? -9.158  -0.287  29.750  1.00 21.61 ?  8    DG  T C5    1 
ATOM   391  C  C6    . DG  B 2 8   ? -8.592  0.313   28.599  1.00 23.82 ?  8    DG  T C6    1 
ATOM   392  O  O6    . DG  B 2 8   ? -8.160  -0.259  27.594  1.00 23.98 ?  8    DG  T O6    1 
ATOM   393  N  N1    . DG  B 2 8   ? -8.578  1.705   28.680  1.00 20.95 ?  8    DG  T N1    1 
ATOM   394  C  C2    . DG  B 2 8   ? -9.039  2.426   29.752  1.00 23.47 ?  8    DG  T C2    1 
ATOM   395  N  N2    . DG  B 2 8   ? -8.928  3.763   29.652  1.00 22.65 ?  8    DG  T N2    1 
ATOM   396  N  N3    . DG  B 2 8   ? -9.561  1.884   30.851  1.00 22.18 ?  8    DG  T N3    1 
ATOM   397  C  C4    . DG  B 2 8   ? -9.598  0.522   30.767  1.00 22.35 ?  8    DG  T C4    1 
ATOM   398  P  P     . DG  B 2 9   ? -14.088 1.297   35.481  1.00 24.69 ?  9    DG  T P     1 
ATOM   399  O  OP1   . DG  B 2 9   ? -13.881 1.070   36.924  1.00 24.20 ?  9    DG  T OP1   1 
ATOM   400  O  OP2   . DG  B 2 9   ? -15.172 0.599   34.774  1.00 21.92 ?  9    DG  T OP2   1 
ATOM   401  O  "O5'" . DG  B 2 9   ? -14.269 2.848   35.154  1.00 24.46 ?  9    DG  T "O5'" 1 
ATOM   402  C  "C5'" . DG  B 2 9   ? -13.162 3.722   35.459  1.00 21.93 ?  9    DG  T "C5'" 1 
ATOM   403  C  "C4'" . DG  B 2 9   ? -13.254 4.948   34.572  1.00 22.44 ?  9    DG  T "C4'" 1 
ATOM   404  O  "O4'" . DG  B 2 9   ? -12.648 4.670   33.280  1.00 22.38 ?  9    DG  T "O4'" 1 
ATOM   405  C  "C3'" . DG  B 2 9   ? -14.693 5.356   34.270  1.00 23.21 ?  9    DG  T "C3'" 1 
ATOM   406  O  "O3'" . DG  B 2 9   ? -14.710 6.756   34.355  1.00 25.36 ?  9    DG  T "O3'" 1 
ATOM   407  C  "C2'" . DG  B 2 9   ? -14.973 4.859   32.834  1.00 19.43 ?  9    DG  T "C2'" 1 
ATOM   408  C  "C1'" . DG  B 2 9   ? -13.581 4.832   32.217  1.00 21.34 ?  9    DG  T "C1'" 1 
ATOM   409  N  N9    . DG  B 2 9   ? -13.247 3.707   31.340  1.00 20.81 ?  9    DG  T N9    1 
ATOM   410  C  C8    . DG  B 2 9   ? -13.363 2.366   31.640  1.00 19.13 ?  9    DG  T C8    1 
ATOM   411  N  N7    . DG  B 2 9   ? -12.945 1.596   30.667  1.00 21.45 ?  9    DG  T N7    1 
ATOM   412  C  C5    . DG  B 2 9   ? -12.560 2.490   29.657  1.00 21.00 ?  9    DG  T C5    1 
ATOM   413  C  C6    . DG  B 2 9   ? -12.028 2.239   28.377  1.00 21.94 ?  9    DG  T C6    1 
ATOM   414  O  O6    . DG  B 2 9   ? -11.787 1.131   27.876  1.00 20.99 ?  9    DG  T O6    1 
ATOM   415  N  N1    . DG  B 2 9   ? -11.754 3.421   27.675  1.00 21.26 ?  9    DG  T N1    1 
ATOM   416  C  C2    . DG  B 2 9   ? -11.970 4.692   28.167  1.00 23.02 ?  9    DG  T C2    1 
ATOM   417  N  N2    . DG  B 2 9   ? -11.661 5.728   27.356  1.00 21.94 ?  9    DG  T N2    1 
ATOM   418  N  N3    . DG  B 2 9   ? -12.466 4.936   29.378  1.00 21.56 ?  9    DG  T N3    1 
ATOM   419  C  C4    . DG  B 2 9   ? -12.735 3.793   30.061  1.00 20.68 ?  9    DG  T C4    1 
ATOM   420  P  P     . DG  B 2 10  ? -16.095 7.542   34.456  1.00 27.09 ?  10   DG  T P     1 
ATOM   421  O  OP1   . DG  B 2 10  ? -15.758 8.836   35.078  1.00 25.65 ?  10   DG  T OP1   1 
ATOM   422  O  OP2   . DG  B 2 10  ? -17.094 6.629   35.059  1.00 29.08 ?  10   DG  T OP2   1 
ATOM   423  O  "O5'" . DG  B 2 10  ? -16.597 7.690   32.945  1.00 26.48 ?  10   DG  T "O5'" 1 
ATOM   424  C  "C5'" . DG  B 2 10  ? -15.868 8.503   32.033  1.00 27.45 ?  10   DG  T "C5'" 1 
ATOM   425  C  "C4'" . DG  B 2 10  ? -16.330 8.228   30.621  1.00 28.02 ?  10   DG  T "C4'" 1 
ATOM   426  O  "O4'" . DG  B 2 10  ? -15.797 6.950   30.148  1.00 25.97 ?  10   DG  T "O4'" 1 
ATOM   427  C  "C3'" . DG  B 2 10  ? -17.845 8.156   30.440  1.00 28.16 ?  10   DG  T "C3'" 1 
ATOM   428  O  "O3'" . DG  B 2 10  ? -18.125 8.877   29.260  1.00 30.36 ?  10   DG  T "O3'" 1 
ATOM   429  C  "C2'" . DG  B 2 10  ? -18.098 6.653   30.266  1.00 26.01 ?  10   DG  T "C2'" 1 
ATOM   430  C  "C1'" . DG  B 2 10  ? -16.845 6.319   29.461  1.00 24.63 ?  10   DG  T "C1'" 1 
ATOM   431  N  N9    . DG  B 2 10  ? -16.523 4.906   29.305  1.00 24.86 ?  10   DG  T N9    1 
ATOM   432  C  C8    . DG  B 2 10  ? -16.742 3.863   30.178  1.00 23.41 ?  10   DG  T C8    1 
ATOM   433  N  N7    . DG  B 2 10  ? -16.321 2.724   29.715  1.00 22.79 ?  10   DG  T N7    1 
ATOM   434  C  C5    . DG  B 2 10  ? -15.785 3.029   28.469  1.00 23.64 ?  10   DG  T C5    1 
ATOM   435  C  C6    . DG  B 2 10  ? -15.179 2.191   27.505  1.00 22.29 ?  10   DG  T C6    1 
ATOM   436  O  O6    . DG  B 2 10  ? -14.994 0.972   27.565  1.00 22.59 ?  10   DG  T O6    1 
ATOM   437  N  N1    . DG  B 2 10  ? -14.766 2.896   26.378  1.00 22.42 ?  10   DG  T N1    1 
ATOM   438  C  C2    . DG  B 2 10  ? -14.932 4.249   26.207  1.00 24.50 ?  10   DG  T C2    1 
ATOM   439  N  N2    . DG  B 2 10  ? -14.470 4.738   25.055  1.00 21.88 ?  10   DG  T N2    1 
ATOM   440  N  N3    . DG  B 2 10  ? -15.495 5.064   27.116  1.00 24.18 ?  10   DG  T N3    1 
ATOM   441  C  C4    . DG  B 2 10  ? -15.901 4.372   28.205  1.00 23.72 ?  10   DG  T C4    1 
ATOM   442  P  P     . DG  B 2 11  ? -19.587 9.439   28.891  1.00 32.89 ?  11   DG  T P     1 
ATOM   443  O  OP1   . DG  B 2 11  ? -19.556 10.877  29.221  1.00 32.30 ?  11   DG  T OP1   1 
ATOM   444  O  OP2   . DG  B 2 11  ? -20.640 8.543   29.404  1.00 32.31 ?  11   DG  T OP2   1 
ATOM   445  O  "O5'" . DG  B 2 11  ? -19.567 9.305   27.310  1.00 31.55 ?  11   DG  T "O5'" 1 
ATOM   446  C  "C5'" . DG  B 2 11  ? -18.470 9.887   26.617  1.00 29.41 ?  11   DG  T "C5'" 1 
ATOM   447  C  "C4'" . DG  B 2 11  ? -18.518 9.464   25.161  1.00 30.06 ?  11   DG  T "C4'" 1 
ATOM   448  O  "O4'" . DG  B 2 11  ? -18.028 8.103   25.014  1.00 28.70 ?  11   DG  T "O4'" 1 
ATOM   449  C  "C3'" . DG  B 2 11  ? -19.922 9.463   24.569  1.00 30.04 ?  11   DG  T "C3'" 1 
ATOM   450  O  "O3'" . DG  B 2 11  ? -19.737 9.803   23.195  1.00 32.28 ?  11   DG  T "O3'" 1 
ATOM   451  C  "C2'" . DG  B 2 11  ? -20.371 8.016   24.801  1.00 28.87 ?  11   DG  T "C2'" 1 
ATOM   452  C  "C1'" . DG  B 2 11  ? -19.068 7.256   24.559  1.00 27.29 ?  11   DG  T "C1'" 1 
ATOM   453  N  N9    . DG  B 2 11  ? -18.905 5.984   25.272  1.00 25.66 ?  11   DG  T N9    1 
ATOM   454  C  C8    . DG  B 2 11  ? -19.137 5.721   26.601  1.00 24.61 ?  11   DG  T C8    1 
ATOM   455  N  N7    . DG  B 2 11  ? -18.896 4.479   26.932  1.00 24.81 ?  11   DG  T N7    1 
ATOM   456  C  C5    . DG  B 2 11  ? -18.471 3.883   25.745  1.00 22.92 ?  11   DG  T C5    1 
ATOM   457  C  C6    . DG  B 2 11  ? -18.063 2.557   25.464  1.00 21.85 ?  11   DG  T C6    1 
ATOM   458  O  O6    . DG  B 2 11  ? -17.982 1.579   26.222  1.00 21.79 ?  11   DG  T O6    1 
ATOM   459  N  N1    . DG  B 2 11  ? -17.727 2.384   24.123  1.00 20.18 ?  11   DG  T N1    1 
ATOM   460  C  C2    . DG  B 2 11  ? -17.774 3.355   23.152  1.00 22.68 ?  11   DG  T C2    1 
ATOM   461  N  N2    . DG  B 2 11  ? -17.411 2.976   21.892  1.00 21.45 ?  11   DG  T N2    1 
ATOM   462  N  N3    . DG  B 2 11  ? -18.137 4.604   23.410  1.00 22.73 ?  11   DG  T N3    1 
ATOM   463  C  C4    . DG  B 2 11  ? -18.486 4.793   24.715  1.00 23.85 ?  11   DG  T C4    1 
ATOM   464  P  P     . DA  B 2 12  ? -20.950 10.259  22.258  1.00 34.99 ?  12   DA  T P     1 
ATOM   465  O  OP1   . DA  B 2 12  ? -20.353 11.036  21.137  1.00 33.15 ?  12   DA  T OP1   1 
ATOM   466  O  OP2   . DA  B 2 12  ? -22.009 10.813  23.131  1.00 32.75 ?  12   DA  T OP2   1 
ATOM   467  O  "O5'" . DA  B 2 12  ? -21.557 8.885   21.682  1.00 33.32 ?  12   DA  T "O5'" 1 
ATOM   468  C  "C5'" . DA  B 2 12  ? -20.879 8.160   20.658  1.00 31.39 ?  12   DA  T "C5'" 1 
ATOM   469  C  "C4'" . DA  B 2 12  ? -21.458 6.757   20.536  1.00 29.68 ?  12   DA  T "C4'" 1 
ATOM   470  O  "O4'" . DA  B 2 12  ? -21.050 5.970   21.675  1.00 28.02 ?  12   DA  T "O4'" 1 
ATOM   471  C  "C3'" . DA  B 2 12  ? -22.980 6.651   20.522  1.00 29.39 ?  12   DA  T "C3'" 1 
ATOM   472  O  "O3'" . DA  B 2 12  ? -23.338 6.356   19.186  1.00 31.69 ?  12   DA  T "O3'" 1 
ATOM   473  C  "C2'" . DA  B 2 12  ? -23.298 5.486   21.474  1.00 28.26 ?  12   DA  T "C2'" 1 
ATOM   474  C  "C1'" . DA  B 2 12  ? -21.922 4.865   21.713  1.00 27.12 ?  12   DA  T "C1'" 1 
ATOM   475  N  N9    . DA  B 2 12  ? -21.805 4.149   22.991  1.00 26.29 ?  12   DA  T N9    1 
ATOM   476  C  C8    . DA  B 2 12  ? -22.138 4.619   24.239  1.00 25.08 ?  12   DA  T C8    1 
ATOM   477  N  N7    . DA  B 2 12  ? -21.945 3.743   25.198  1.00 24.55 ?  12   DA  T N7    1 
ATOM   478  C  C5    . DA  B 2 12  ? -21.451 2.620   24.542  1.00 25.53 ?  12   DA  T C5    1 
ATOM   479  C  C6    . DA  B 2 12  ? -21.056 1.338   24.989  1.00 24.92 ?  12   DA  T C6    1 
ATOM   480  N  N6    . DA  B 2 12  ? -21.073 0.948   26.275  1.00 26.32 ?  12   DA  T N6    1 
ATOM   481  N  N1    . DA  B 2 12  ? -20.619 0.457   24.068  1.00 24.16 ?  12   DA  T N1    1 
ATOM   482  C  C2    . DA  B 2 12  ? -20.583 0.825   22.780  1.00 25.50 ?  12   DA  T C2    1 
ATOM   483  N  N3    . DA  B 2 12  ? -20.934 2.001   22.246  1.00 25.73 ?  12   DA  T N3    1 
ATOM   484  C  C4    . DA  B 2 12  ? -21.364 2.860   23.182  1.00 25.11 ?  12   DA  T C4    1 
ATOM   485  P  P     . DG  B 2 13  ? -24.840 6.071   18.742  1.00 33.26 ?  13   DG  T P     1 
ATOM   486  O  OP1   . DG  B 2 13  ? -24.884 6.403   17.299  1.00 34.80 ?  13   DG  T OP1   1 
ATOM   487  O  OP2   . DG  B 2 13  ? -25.795 6.712   19.667  1.00 32.33 ?  13   DG  T OP2   1 
ATOM   488  O  "O5'" . DG  B 2 13  ? -24.976 4.480   18.875  1.00 30.81 ?  13   DG  T "O5'" 1 
ATOM   489  C  "C5'" . DG  B 2 13  ? -24.039 3.672   18.164  1.00 30.24 ?  13   DG  T "C5'" 1 
ATOM   490  C  "C4'" . DG  B 2 13  ? -24.105 2.225   18.599  1.00 29.46 ?  13   DG  T "C4'" 1 
ATOM   491  O  "O4'" . DG  B 2 13  ? -23.750 2.122   20.002  1.00 29.98 ?  13   DG  T "O4'" 1 
ATOM   492  C  "C3'" . DG  B 2 13  ? -25.482 1.568   18.480  1.00 31.65 ?  13   DG  T "C3'" 1 
ATOM   493  O  "O3'" . DG  B 2 13  ? -25.262 0.287   17.907  1.00 33.19 ?  13   DG  T "O3'" 1 
ATOM   494  C  "C2'" . DG  B 2 13  ? -25.959 1.464   19.925  1.00 29.13 ?  13   DG  T "C2'" 1 
ATOM   495  C  "C1'" . DG  B 2 13  ? -24.612 1.166   20.579  1.00 29.49 ?  13   DG  T "C1'" 1 
ATOM   496  N  N9    . DG  B 2 13  ? -24.599 1.245   22.044  1.00 28.48 ?  13   DG  T N9    1 
ATOM   497  C  C8    . DG  B 2 13  ? -24.991 2.298   22.848  1.00 27.36 ?  13   DG  T C8    1 
ATOM   498  N  N7    . DG  B 2 13  ? -24.873 2.038   24.129  1.00 28.34 ?  13   DG  T N7    1 
ATOM   499  C  C5    . DG  B 2 13  ? -24.371 0.732   24.158  1.00 28.39 ?  13   DG  T C5    1 
ATOM   500  C  C6    . DG  B 2 13  ? -24.040 -0.091  25.259  1.00 29.42 ?  13   DG  T C6    1 
ATOM   501  O  O6    . DG  B 2 13  ? -24.118 0.192   26.462  1.00 29.31 ?  13   DG  T O6    1 
ATOM   502  N  N1    . DG  B 2 13  ? -23.573 -1.346  24.864  1.00 28.37 ?  13   DG  T N1    1 
ATOM   503  C  C2    . DG  B 2 13  ? -23.430 -1.751  23.557  1.00 28.55 ?  13   DG  T C2    1 
ATOM   504  N  N2    . DG  B 2 13  ? -22.961 -3.002  23.375  1.00 26.53 ?  13   DG  T N2    1 
ATOM   505  N  N3    . DG  B 2 13  ? -23.736 -0.986  22.511  1.00 27.86 ?  13   DG  T N3    1 
ATOM   506  C  C4    . DG  B 2 13  ? -24.197 0.234   22.889  1.00 27.90 ?  13   DG  T C4    1 
ATOM   507  P  P     . DG  B 2 14  ? -26.461 -0.632  17.412  1.00 33.64 ?  14   DG  T P     1 
ATOM   508  O  OP1   . DG  B 2 14  ? -26.162 -0.945  15.995  1.00 36.78 ?  14   DG  T OP1   1 
ATOM   509  O  OP2   . DG  B 2 14  ? -27.758 -0.048  17.828  1.00 34.05 ?  14   DG  T OP2   1 
ATOM   510  O  "O5'" . DG  B 2 14  ? -26.223 -1.969  18.255  1.00 36.30 ?  14   DG  T "O5'" 1 
ATOM   511  C  "C5'" . DG  B 2 14  ? -24.953 -2.633  18.169  1.00 35.40 ?  14   DG  T "C5'" 1 
ATOM   512  C  "C4'" . DG  B 2 14  ? -25.023 -3.946  18.920  1.00 35.72 ?  14   DG  T "C4'" 1 
ATOM   513  O  "O4'" . DG  B 2 14  ? -24.937 -3.662  20.335  1.00 35.35 ?  14   DG  T "O4'" 1 
ATOM   514  C  "C3'" . DG  B 2 14  ? -26.325 -4.728  18.742  1.00 35.65 ?  14   DG  T "C3'" 1 
ATOM   515  O  "O3'" . DG  B 2 14  ? -26.031 -6.112  18.830  1.00 36.99 ?  14   DG  T "O3'" 1 
ATOM   516  C  "C2'" . DG  B 2 14  ? -27.156 -4.257  19.926  1.00 34.97 ?  14   DG  T "C2'" 1 
ATOM   517  C  "C1'" . DG  B 2 14  ? -26.075 -4.158  20.999  1.00 34.05 ?  14   DG  T "C1'" 1 
ATOM   518  N  N9    . DG  B 2 14  ? -26.402 -3.266  22.114  1.00 33.72 ?  14   DG  T N9    1 
ATOM   519  C  C8    . DG  B 2 14  ? -26.869 -1.970  22.063  1.00 33.70 ?  14   DG  T C8    1 
ATOM   520  N  N7    . DG  B 2 14  ? -27.076 -1.440  23.240  1.00 32.76 ?  14   DG  T N7    1 
ATOM   521  C  C5    . DG  B 2 14  ? -26.735 -2.451  24.129  1.00 33.14 ?  14   DG  T C5    1 
ATOM   522  C  C6    . DG  B 2 14  ? -26.743 -2.472  25.541  1.00 33.24 ?  14   DG  T C6    1 
ATOM   523  O  O6    . DG  B 2 14  ? -27.067 -1.579  26.325  1.00 33.43 ?  14   DG  T O6    1 
ATOM   524  N  N1    . DG  B 2 14  ? -26.316 -3.695  26.047  1.00 34.93 ?  14   DG  T N1    1 
ATOM   525  C  C2    . DG  B 2 14  ? -25.925 -4.768  25.283  1.00 35.60 ?  14   DG  T C2    1 
ATOM   526  N  N2    . DG  B 2 14  ? -25.543 -5.868  25.953  1.00 36.66 ?  14   DG  T N2    1 
ATOM   527  N  N3    . DG  B 2 14  ? -25.906 -4.763  23.956  1.00 34.37 ?  14   DG  T N3    1 
ATOM   528  C  C4    . DG  B 2 14  ? -26.319 -3.577  23.451  1.00 33.34 ?  14   DG  T C4    1 
ATOM   529  P  P     . DA  B 2 15  ? -27.090 -7.252  18.455  1.00 39.91 ?  15   DA  T P     1 
ATOM   530  O  OP1   . DA  B 2 15  ? -26.379 -8.214  17.579  1.00 40.43 ?  15   DA  T OP1   1 
ATOM   531  O  OP2   . DA  B 2 15  ? -28.373 -6.639  18.028  1.00 38.72 ?  15   DA  T OP2   1 
ATOM   532  O  "O5'" . DA  B 2 15  ? -27.360 -7.981  19.856  1.00 40.44 ?  15   DA  T "O5'" 1 
ATOM   533  C  "C5'" . DA  B 2 15  ? -26.264 -8.541  20.569  1.00 41.80 ?  15   DA  T "C5'" 1 
ATOM   534  C  "C4'" . DA  B 2 15  ? -26.769 -9.204  21.834  1.00 42.67 ?  15   DA  T "C4'" 1 
ATOM   535  O  "O4'" . DA  B 2 15  ? -27.028 -8.198  22.845  1.00 41.62 ?  15   DA  T "O4'" 1 
ATOM   536  C  "C3'" . DA  B 2 15  ? -28.080 -9.963  21.682  1.00 43.99 ?  15   DA  T "C3'" 1 
ATOM   537  O  "O3'" . DA  B 2 15  ? -28.040 -11.029 22.599  1.00 46.85 ?  15   DA  T "O3'" 1 
ATOM   538  C  "C2'" . DA  B 2 15  ? -29.123 -8.929  22.094  1.00 42.49 ?  15   DA  T "C2'" 1 
ATOM   539  C  "C1'" . DA  B 2 15  ? -28.377 -8.278  23.259  1.00 41.29 ?  15   DA  T "C1'" 1 
ATOM   540  N  N9    . DA  B 2 15  ? -28.816 -6.938  23.645  1.00 39.44 ?  15   DA  T N9    1 
ATOM   541  C  C8    . DA  B 2 15  ? -29.246 -5.923  22.834  1.00 39.15 ?  15   DA  T C8    1 
ATOM   542  N  N7    . DA  B 2 15  ? -29.573 -4.832  23.488  1.00 38.93 ?  15   DA  T N7    1 
ATOM   543  C  C5    . DA  B 2 15  ? -29.337 -5.152  24.816  1.00 38.75 ?  15   DA  T C5    1 
ATOM   544  C  C6    . DA  B 2 15  ? -29.480 -4.427  26.017  1.00 38.97 ?  15   DA  T C6    1 
ATOM   545  N  N6    . DA  B 2 15  ? -29.921 -3.166  26.079  1.00 39.91 ?  15   DA  T N6    1 
ATOM   546  N  N1    . DA  B 2 15  ? -29.157 -5.053  27.168  1.00 38.97 ?  15   DA  T N1    1 
ATOM   547  C  C2    . DA  B 2 15  ? -28.717 -6.314  27.123  1.00 38.06 ?  15   DA  T C2    1 
ATOM   548  N  N3    . DA  B 2 15  ? -28.542 -7.093  26.061  1.00 38.24 ?  15   DA  T N3    1 
ATOM   549  C  C4    . DA  B 2 15  ? -28.868 -6.445  24.928  1.00 38.81 ?  15   DA  T C4    1 
ATOM   550  P  P     . DT  B 2 16  ? -28.671 -12.453 22.237  1.00 49.99 ?  16   DT  T P     1 
ATOM   551  O  OP1   . DT  B 2 16  ? -27.545 -13.417 22.146  1.00 50.31 ?  16   DT  T OP1   1 
ATOM   552  O  OP2   . DT  B 2 16  ? -29.630 -12.293 21.115  1.00 48.67 ?  16   DT  T OP2   1 
ATOM   553  O  "O5'" . DT  B 2 16  ? -29.525 -12.747 23.554  1.00 50.61 ?  16   DT  T "O5'" 1 
ATOM   554  C  "C5'" . DT  B 2 16  ? -30.234 -11.659 24.132  1.00 51.48 ?  16   DT  T "C5'" 1 
ATOM   555  C  "C4'" . DT  B 2 16  ? -30.264 -11.770 25.642  1.00 51.66 ?  16   DT  T "C4'" 1 
ATOM   556  O  "O4'" . DT  B 2 16  ? -30.185 -10.441 26.219  1.00 51.46 ?  16   DT  T "O4'" 1 
ATOM   557  C  "C3'" . DT  B 2 16  ? -31.553 -12.373 26.173  1.00 51.51 ?  16   DT  T "C3'" 1 
ATOM   558  O  "O3'" . DT  B 2 16  ? -31.317 -13.012 27.422  1.00 52.02 ?  16   DT  T "O3'" 1 
ATOM   559  C  "C2'" . DT  B 2 16  ? -32.443 -11.141 26.308  1.00 51.08 ?  16   DT  T "C2'" 1 
ATOM   560  C  "C1'" . DT  B 2 16  ? -31.441 -10.080 26.759  1.00 50.69 ?  16   DT  T "C1'" 1 
ATOM   561  N  N1    . DT  B 2 16  ? -31.797 -8.702  26.305  1.00 49.85 ?  16   DT  T N1    1 
ATOM   562  C  C2    . DT  B 2 16  ? -31.848 -7.684  27.235  1.00 49.78 ?  16   DT  T C2    1 
ATOM   563  O  O2    . DT  B 2 16  ? -31.614 -7.839  28.422  1.00 49.54 ?  16   DT  T O2    1 
ATOM   564  N  N3    . DT  B 2 16  ? -32.183 -6.456  26.719  1.00 49.24 ?  16   DT  T N3    1 
ATOM   565  C  C4    . DT  B 2 16  ? -32.473 -6.153  25.403  1.00 48.76 ?  16   DT  T C4    1 
ATOM   566  O  O4    . DT  B 2 16  ? -32.771 -5.017  25.056  1.00 48.23 ?  16   DT  T O4    1 
ATOM   567  C  C5    . DT  B 2 16  ? -32.401 -7.257  24.478  1.00 48.99 ?  16   DT  T C5    1 
ATOM   568  C  C7    . DT  B 2 16  ? -32.694 -7.037  23.019  1.00 48.52 ?  16   DT  T C7    1 
ATOM   569  C  C6    . DT  B 2 16  ? -32.074 -8.463  24.969  1.00 49.55 ?  16   DT  T C6    1 
ATOM   570  N  N     . SER C 3 29  ? 28.475  25.274  2.546   1.00 44.47 ?  95   SER A N     1 
ATOM   571  C  CA    . SER C 3 29  ? 29.891  24.997  2.146   1.00 44.84 ?  95   SER A CA    1 
ATOM   572  C  C     . SER C 3 29  ? 30.083  23.577  1.618   1.00 44.68 ?  95   SER A C     1 
ATOM   573  O  O     . SER C 3 29  ? 29.600  23.234  0.533   1.00 45.25 ?  95   SER A O     1 
ATOM   574  C  CB    . SER C 3 29  ? 30.846  25.267  3.318   1.00 45.01 ?  95   SER A CB    1 
ATOM   575  N  N     . SER C 3 30  ? 30.806  22.760  2.378   1.00 43.90 ?  96   SER A N     1 
ATOM   576  C  CA    . SER C 3 30  ? 31.005  21.362  2.010   1.00 43.07 ?  96   SER A CA    1 
ATOM   577  C  C     . SER C 3 30  ? 32.354  20.817  2.471   1.00 42.49 ?  96   SER A C     1 
ATOM   578  O  O     . SER C 3 30  ? 32.795  19.772  1.995   1.00 43.12 ?  96   SER A O     1 
ATOM   579  C  CB    . SER C 3 30  ? 30.842  21.167  0.501   1.00 42.86 ?  96   SER A CB    1 
ATOM   580  N  N     . PHE C 3 31  ? 33.007  21.515  3.398   1.00 41.34 ?  97   PHE A N     1 
ATOM   581  C  CA    . PHE C 3 31  ? 34.274  21.032  3.951   1.00 39.71 ?  97   PHE A CA    1 
ATOM   582  C  C     . PHE C 3 31  ? 34.314  19.499  4.095   1.00 38.58 ?  97   PHE A C     1 
ATOM   583  O  O     . PHE C 3 31  ? 33.334  18.855  4.469   1.00 38.31 ?  97   PHE A O     1 
ATOM   584  C  CB    . PHE C 3 31  ? 34.572  21.697  5.295   1.00 39.58 ?  97   PHE A CB    1 
ATOM   585  N  N     . GLU C 3 32  ? 35.470  18.926  3.802   1.00 37.29 ?  98   GLU A N     1 
ATOM   586  C  CA    . GLU C 3 32  ? 35.636  17.488  3.813   1.00 36.30 ?  98   GLU A CA    1 
ATOM   587  C  C     . GLU C 3 32  ? 36.336  17.082  5.088   1.00 34.53 ?  98   GLU A C     1 
ATOM   588  O  O     . GLU C 3 32  ? 36.830  17.933  5.817   1.00 34.50 ?  98   GLU A O     1 
ATOM   589  C  CB    . GLU C 3 32  ? 36.465  17.052  2.608   1.00 36.93 ?  98   GLU A CB    1 
ATOM   590  C  CG    . GLU C 3 32  ? 35.979  17.642  1.294   1.00 39.53 ?  98   GLU A CG    1 
ATOM   591  C  CD    . GLU C 3 32  ? 36.508  16.893  0.085   1.00 42.52 ?  98   GLU A CD    1 
ATOM   592  O  OE1   . GLU C 3 32  ? 36.563  15.645  0.132   1.00 43.95 ?  98   GLU A OE1   1 
ATOM   593  O  OE2   . GLU C 3 32  ? 36.857  17.552  -0.914  1.00 45.16 ?  98   GLU A OE2   1 
ATOM   594  N  N     . ARG C 3 33  ? 36.401  15.782  5.341   1.00 32.62 ?  99   ARG A N     1 
ATOM   595  C  CA    . ARG C 3 33  ? 37.011  15.280  6.559   1.00 31.20 ?  99   ARG A CA    1 
ATOM   596  C  C     . ARG C 3 33  ? 38.508  15.548  6.594   1.00 31.40 ?  99   ARG A C     1 
ATOM   597  O  O     . ARG C 3 33  ? 39.141  15.733  5.551   1.00 30.83 ?  99   ARG A O     1 
ATOM   598  C  CB    . ARG C 3 33  ? 36.745  13.788  6.704   1.00 30.58 ?  99   ARG A CB    1 
ATOM   599  C  CG    . ARG C 3 33  ? 35.287  13.461  6.880   1.00 28.61 ?  99   ARG A CG    1 
ATOM   600  C  CD    . ARG C 3 33  ? 35.099  11.993  7.214   1.00 25.48 ?  99   ARG A CD    1 
ATOM   601  N  NE    . ARG C 3 33  ? 33.704  11.709  7.531   1.00 23.93 ?  99   ARG A NE    1 
ATOM   602  C  CZ    . ARG C 3 33  ? 33.203  11.777  8.758   1.00 23.53 ?  99   ARG A CZ    1 
ATOM   603  N  NH1   . ARG C 3 33  ? 31.925  11.505  8.967   1.00 23.04 ?  99   ARG A NH1   1 
ATOM   604  N  NH2   . ARG C 3 33  ? 33.991  12.098  9.778   1.00 21.29 ?  99   ARG A NH2   1 
ATOM   605  N  N     . LYS C 3 34  ? 39.059  15.584  7.803   1.00 31.41 ?  100  LYS A N     1 
ATOM   606  C  CA    . LYS C 3 34  ? 40.487  15.759  8.000   1.00 31.61 ?  100  LYS A CA    1 
ATOM   607  C  C     . LYS C 3 34  ? 41.235  14.712  7.183   1.00 30.92 ?  100  LYS A C     1 
ATOM   608  O  O     . LYS C 3 34  ? 40.859  13.541  7.180   1.00 30.31 ?  100  LYS A O     1 
ATOM   609  C  CB    . LYS C 3 34  ? 40.844  15.589  9.479   1.00 31.77 ?  100  LYS A CB    1 
ATOM   610  C  CG    . LYS C 3 34  ? 42.328  15.738  9.774   1.00 34.57 ?  100  LYS A CG    1 
ATOM   611  C  CD    . LYS C 3 34  ? 42.786  14.789  10.886  1.00 37.85 ?  100  LYS A CD    1 
ATOM   612  C  CE    . LYS C 3 34  ? 42.736  15.440  12.258  1.00 39.77 ?  100  LYS A CE    1 
ATOM   613  N  NZ    . LYS C 3 34  ? 41.375  15.938  12.598  1.00 41.84 ?  100  LYS A NZ    1 
ATOM   614  N  N     . LYS C 3 35  ? 42.293  15.137  6.499   1.00 29.96 ?  101  LYS A N     1 
ATOM   615  C  CA    . LYS C 3 35  ? 43.104  14.233  5.694   1.00 29.30 ?  101  LYS A CA    1 
ATOM   616  C  C     . LYS C 3 35  ? 43.776  13.188  6.572   1.00 28.67 ?  101  LYS A C     1 
ATOM   617  O  O     . LYS C 3 35  ? 44.153  13.470  7.707   1.00 28.33 ?  101  LYS A O     1 
ATOM   618  C  CB    . LYS C 3 35  ? 44.188  15.012  4.936   1.00 29.93 ?  101  LYS A CB    1 
ATOM   619  N  N     . LEU C 3 36  ? 43.919  11.979  6.038   1.00 27.78 ?  102  LEU A N     1 
ATOM   620  C  CA    . LEU C 3 36  ? 44.606  10.903  6.737   1.00 26.80 ?  102  LEU A CA    1 
ATOM   621  C  C     . LEU C 3 36  ? 46.073  11.255  6.870   1.00 26.53 ?  102  LEU A C     1 
ATOM   622  O  O     . LEU C 3 36  ? 46.594  12.046  6.081   1.00 25.72 ?  102  LEU A O     1 
ATOM   623  C  CB    . LEU C 3 36  ? 44.468  9.590   5.956   1.00 26.62 ?  102  LEU A CB    1 
ATOM   624  C  CG    . LEU C 3 36  ? 43.092  8.919   5.998   1.00 27.60 ?  102  LEU A CG    1 
ATOM   625  C  CD1   . LEU C 3 36  ? 42.974  7.796   4.951   1.00 27.32 ?  102  LEU A CD1   1 
ATOM   626  C  CD2   . LEU C 3 36  ? 42.770  8.395   7.412   1.00 29.14 ?  102  LEU A CD2   1 
ATOM   627  N  N     . PRO C 3 37  ? 46.759  10.651  7.849   1.00 26.11 ?  103  PRO A N     1 
ATOM   628  C  CA    . PRO C 3 37  ? 48.201  10.808  7.915   1.00 26.25 ?  103  PRO A CA    1 
ATOM   629  C  C     . PRO C 3 37  ? 48.838  10.392  6.587   1.00 26.18 ?  103  PRO A C     1 
ATOM   630  O  O     . PRO C 3 37  ? 48.400  9.439   5.951   1.00 25.69 ?  103  PRO A O     1 
ATOM   631  C  CB    . PRO C 3 37  ? 48.605  9.833   9.013   1.00 25.64 ?  103  PRO A CB    1 
ATOM   632  C  CG    . PRO C 3 37  ? 47.383  9.703   9.861   1.00 26.88 ?  103  PRO A CG    1 
ATOM   633  C  CD    . PRO C 3 37  ? 46.258  9.736   8.885   1.00 26.83 ?  103  PRO A CD    1 
ATOM   634  N  N     . THR C 3 38  ? 49.865  11.109  6.177   1.00 26.57 ?  104  THR A N     1 
ATOM   635  C  CA    . THR C 3 38  ? 50.512  10.867  4.894   1.00 27.50 ?  104  THR A CA    1 
ATOM   636  C  C     . THR C 3 38  ? 51.202  9.506   4.829   1.00 27.02 ?  104  THR A C     1 
ATOM   637  O  O     . THR C 3 38  ? 51.318  8.895   3.755   1.00 27.37 ?  104  THR A O     1 
ATOM   638  C  CB    . THR C 3 38  ? 51.566  11.932  4.643   1.00 27.56 ?  104  THR A CB    1 
ATOM   639  O  OG1   . THR C 3 38  ? 50.918  13.143  4.230   1.00 30.30 ?  104  THR A OG1   1 
ATOM   640  C  CG2   . THR C 3 38  ? 52.493  11.480  3.568   1.00 29.58 ?  104  THR A CG2   1 
ATOM   641  N  N     . ASP C 3 39  ? 51.655  9.024   5.978   1.00 25.83 ?  105  ASP A N     1 
ATOM   642  C  CA    . ASP C 3 39  ? 52.363  7.753   6.015   1.00 25.13 ?  105  ASP A CA    1 
ATOM   643  C  C     . ASP C 3 39  ? 51.451  6.606   6.399   1.00 25.29 ?  105  ASP A C     1 
ATOM   644  O  O     . ASP C 3 39  ? 51.921  5.545   6.814   1.00 24.79 ?  105  ASP A O     1 
ATOM   645  C  CB    . ASP C 3 39  ? 53.555  7.827   6.973   1.00 24.47 ?  105  ASP A CB    1 
ATOM   646  C  CG    . ASP C 3 39  ? 53.143  8.194   8.380   1.00 22.72 ?  105  ASP A CG    1 
ATOM   647  O  OD1   . ASP C 3 39  ? 51.928  8.342   8.618   1.00 19.17 ?  105  ASP A OD1   1 
ATOM   648  O  OD2   . ASP C 3 39  ? 54.034  8.307   9.242   1.00 21.04 ?  105  ASP A OD2   1 
ATOM   649  N  N     . PHE C 3 40  ? 50.144  6.793   6.241   1.00 25.40 ?  106  PHE A N     1 
ATOM   650  C  CA    . PHE C 3 40  ? 49.235  5.771   6.726   1.00 26.36 ?  106  PHE A CA    1 
ATOM   651  C  C     . PHE C 3 40  ? 49.508  4.411   6.079   1.00 26.57 ?  106  PHE A C     1 
ATOM   652  O  O     . PHE C 3 40  ? 49.762  4.316   4.879   1.00 26.01 ?  106  PHE A O     1 
ATOM   653  C  CB    . PHE C 3 40  ? 47.761  6.139   6.533   1.00 26.31 ?  106  PHE A CB    1 
ATOM   654  C  CG    . PHE C 3 40  ? 46.844  5.053   6.979   1.00 28.82 ?  106  PHE A CG    1 
ATOM   655  C  CD1   . PHE C 3 40  ? 46.362  5.027   8.272   1.00 30.33 ?  106  PHE A CD1   1 
ATOM   656  C  CD2   . PHE C 3 40  ? 46.530  4.000   6.126   1.00 31.16 ?  106  PHE A CD2   1 
ATOM   657  C  CE1   . PHE C 3 40  ? 45.542  3.992   8.701   1.00 32.87 ?  106  PHE A CE1   1 
ATOM   658  C  CE2   . PHE C 3 40  ? 45.723  2.965   6.554   1.00 31.59 ?  106  PHE A CE2   1 
ATOM   659  C  CZ    . PHE C 3 40  ? 45.224  2.965   7.834   1.00 32.51 ?  106  PHE A CZ    1 
ATOM   660  N  N     . ASP C 3 41  ? 49.438  3.364   6.889   1.00 26.63 ?  107  ASP A N     1 
ATOM   661  C  CA    . ASP C 3 41  ? 49.723  2.021   6.431   1.00 27.38 ?  107  ASP A CA    1 
ATOM   662  C  C     . ASP C 3 41  ? 49.238  1.068   7.509   1.00 27.02 ?  107  ASP A C     1 
ATOM   663  O  O     . ASP C 3 41  ? 49.435  1.317   8.695   1.00 26.41 ?  107  ASP A O     1 
ATOM   664  C  CB    . ASP C 3 41  ? 51.225  1.826   6.182   1.00 27.88 ?  107  ASP A CB    1 
ATOM   665  C  CG    . ASP C 3 41  ? 51.553  0.439   5.624   1.00 30.86 ?  107  ASP A CG    1 
ATOM   666  O  OD1   . ASP C 3 41  ? 51.670  0.312   4.389   1.00 35.19 ?  107  ASP A OD1   1 
ATOM   667  O  OD2   . ASP C 3 41  ? 51.676  -0.533  6.403   1.00 31.93 ?  107  ASP A OD2   1 
ATOM   668  N  N     . PRO C 3 42  ? 48.582  -0.018  7.098   1.00 27.06 ?  108  PRO A N     1 
ATOM   669  C  CA    . PRO C 3 42  ? 48.005  -0.958  8.043   1.00 27.37 ?  108  PRO A CA    1 
ATOM   670  C  C     . PRO C 3 42  ? 49.011  -1.554  9.035   1.00 27.20 ?  108  PRO A C     1 
ATOM   671  O  O     . PRO C 3 42  ? 48.610  -1.943  10.140  1.00 27.27 ?  108  PRO A O     1 
ATOM   672  C  CB    . PRO C 3 42  ? 47.378  -2.042  7.142   1.00 27.67 ?  108  PRO A CB    1 
ATOM   673  C  CG    . PRO C 3 42  ? 47.912  -1.782  5.765   1.00 27.69 ?  108  PRO A CG    1 
ATOM   674  C  CD    . PRO C 3 42  ? 48.255  -0.349  5.700   1.00 27.11 ?  108  PRO A CD    1 
ATOM   675  N  N     . SER C 3 43  ? 50.294  -1.606  8.675   1.00 26.52 ?  109  SER A N     1 
ATOM   676  C  CA    . SER C 3 43  ? 51.300  -2.158  9.585   1.00 27.00 ?  109  SER A CA    1 
ATOM   677  C  C     . SER C 3 43  ? 51.748  -1.153  10.655  1.00 26.53 ?  109  SER A C     1 
ATOM   678  O  O     . SER C 3 43  ? 52.406  -1.523  11.624  1.00 26.87 ?  109  SER A O     1 
ATOM   679  C  CB    . SER C 3 43  ? 52.517  -2.720  8.818   1.00 26.93 ?  109  SER A CB    1 
ATOM   680  O  OG    . SER C 3 43  ? 53.251  -1.691  8.160   1.00 28.64 ?  109  SER A OG    1 
ATOM   681  N  N     . LEU C 3 44  ? 51.345  0.102   10.503  1.00 26.09 ?  110  LEU A N     1 
ATOM   682  C  CA    . LEU C 3 44  ? 51.830  1.184   11.365  1.00 26.04 ?  110  LEU A CA    1 
ATOM   683  C  C     . LEU C 3 44  ? 50.781  1.705   12.356  1.00 25.55 ?  110  LEU A C     1 
ATOM   684  O  O     . LEU C 3 44  ? 51.119  2.144   13.466  1.00 24.95 ?  110  LEU A O     1 
ATOM   685  C  CB    . LEU C 3 44  ? 52.283  2.358   10.490  1.00 26.05 ?  110  LEU A CB    1 
ATOM   686  C  CG    . LEU C 3 44  ? 53.697  2.340   9.918   1.00 28.37 ?  110  LEU A CG    1 
ATOM   687  C  CD1   . LEU C 3 44  ? 54.141  0.928   9.575   1.00 30.57 ?  110  LEU A CD1   1 
ATOM   688  C  CD2   . LEU C 3 44  ? 53.831  3.287   8.713   1.00 28.00 ?  110  LEU A CD2   1 
ATOM   689  N  N     . TYR C 3 45  ? 49.520  1.663   11.934  1.00 24.87 ?  111  TYR A N     1 
ATOM   690  C  CA    . TYR C 3 45  ? 48.433  2.379   12.601  1.00 24.67 ?  111  TYR A CA    1 
ATOM   691  C  C     . TYR C 3 45  ? 47.355  1.408   13.092  1.00 24.90 ?  111  TYR A C     1 
ATOM   692  O  O     . TYR C 3 45  ? 46.855  0.585   12.323  1.00 24.56 ?  111  TYR A O     1 
ATOM   693  C  CB    . TYR C 3 45  ? 47.782  3.394   11.630  1.00 24.58 ?  111  TYR A CB    1 
ATOM   694  C  CG    . TYR C 3 45  ? 48.587  4.675   11.427  1.00 24.41 ?  111  TYR A CG    1 
ATOM   695  C  CD1   . TYR C 3 45  ? 48.405  5.777   12.269  1.00 23.85 ?  111  TYR A CD1   1 
ATOM   696  C  CD2   . TYR C 3 45  ? 49.533  4.777   10.415  1.00 23.75 ?  111  TYR A CD2   1 
ATOM   697  C  CE1   . TYR C 3 45  ? 49.152  6.952   12.103  1.00 24.37 ?  111  TYR A CE1   1 
ATOM   698  C  CE2   . TYR C 3 45  ? 50.288  5.961   10.235  1.00 24.09 ?  111  TYR A CE2   1 
ATOM   699  C  CZ    . TYR C 3 45  ? 50.085  7.040   11.081  1.00 24.35 ?  111  TYR A CZ    1 
ATOM   700  O  OH    . TYR C 3 45  ? 50.837  8.204   10.939  1.00 23.19 ?  111  TYR A OH    1 
ATOM   701  N  N     . ASP C 3 46  ? 47.004  1.506   14.368  1.00 24.65 ?  112  ASP A N     1 
ATOM   702  C  CA    . ASP C 3 46  ? 45.779  0.905   14.830  1.00 24.71 ?  112  ASP A CA    1 
ATOM   703  C  C     . ASP C 3 46  ? 44.677  1.773   14.235  1.00 24.69 ?  112  ASP A C     1 
ATOM   704  O  O     . ASP C 3 46  ? 44.900  2.947   13.936  1.00 24.66 ?  112  ASP A O     1 
ATOM   705  C  CB    . ASP C 3 46  ? 45.668  0.957   16.356  1.00 24.85 ?  112  ASP A CB    1 
ATOM   706  C  CG    . ASP C 3 46  ? 46.710  0.112   17.064  1.00 25.41 ?  112  ASP A CG    1 
ATOM   707  O  OD1   . ASP C 3 46  ? 47.198  -0.888  16.496  1.00 26.10 ?  112  ASP A OD1   1 
ATOM   708  O  OD2   . ASP C 3 46  ? 47.048  0.462   18.211  1.00 27.84 ?  112  ASP A OD2   1 
ATOM   709  N  N     . ILE C 3 47  ? 43.496  1.197   14.038  1.00 24.54 ?  113  ILE A N     1 
ATOM   710  C  CA    . ILE C 3 47  ? 42.302  2.003   13.781  1.00 24.21 ?  113  ILE A CA    1 
ATOM   711  C  C     . ILE C 3 47  ? 41.277  1.734   14.884  1.00 24.16 ?  113  ILE A C     1 
ATOM   712  O  O     . ILE C 3 47  ? 40.786  0.622   15.020  1.00 23.97 ?  113  ILE A O     1 
ATOM   713  C  CB    . ILE C 3 47  ? 41.660  1.674   12.425  1.00 24.82 ?  113  ILE A CB    1 
ATOM   714  C  CG1   . ILE C 3 47  ? 42.640  1.947   11.278  1.00 23.40 ?  113  ILE A CG1   1 
ATOM   715  C  CG2   . ILE C 3 47  ? 40.334  2.460   12.258  1.00 23.95 ?  113  ILE A CG2   1 
ATOM   716  C  CD1   . ILE C 3 47  ? 42.160  1.399   9.939   1.00 25.14 ?  113  ILE A CD1   1 
ATOM   717  N  N     . SER C 3 48  ? 40.991  2.750   15.692  1.00 24.09 ?  114  SER A N     1 
ATOM   718  C  CA    . SER C 3 48  ? 39.946  2.654   16.708  1.00 24.04 ?  114  SER A CA    1 
ATOM   719  C  C     . SER C 3 48  ? 38.841  3.599   16.284  1.00 23.91 ?  114  SER A C     1 
ATOM   720  O  O     . SER C 3 48  ? 39.096  4.781   16.017  1.00 23.41 ?  114  SER A O     1 
ATOM   721  C  CB    . SER C 3 48  ? 40.484  3.041   18.089  1.00 23.96 ?  114  SER A CB    1 
ATOM   722  O  OG    . SER C 3 48  ? 41.388  2.065   18.582  1.00 23.56 ?  114  SER A OG    1 
ATOM   723  N  N     . PHE C 3 49  ? 37.627  3.071   16.173  1.00 23.66 ?  115  PHE A N     1 
ATOM   724  C  CA    . PHE C 3 49  ? 36.504  3.868   15.673  1.00 24.20 ?  115  PHE A CA    1 
ATOM   725  C  C     . PHE C 3 49  ? 35.226  3.501   16.420  1.00 24.20 ?  115  PHE A C     1 
ATOM   726  O  O     . PHE C 3 49  ? 35.073  2.368   16.893  1.00 24.77 ?  115  PHE A O     1 
ATOM   727  C  CB    . PHE C 3 49  ? 36.326  3.723   14.139  1.00 23.62 ?  115  PHE A CB    1 
ATOM   728  C  CG    . PHE C 3 49  ? 35.864  2.348   13.691  1.00 24.65 ?  115  PHE A CG    1 
ATOM   729  C  CD1   . PHE C 3 49  ? 36.692  1.235   13.818  1.00 25.69 ?  115  PHE A CD1   1 
ATOM   730  C  CD2   . PHE C 3 49  ? 34.610  2.170   13.130  1.00 25.86 ?  115  PHE A CD2   1 
ATOM   731  C  CE1   . PHE C 3 49  ? 36.268  -0.035  13.398  1.00 25.67 ?  115  PHE A CE1   1 
ATOM   732  C  CE2   . PHE C 3 49  ? 34.181  0.891   12.702  1.00 26.95 ?  115  PHE A CE2   1 
ATOM   733  C  CZ    . PHE C 3 49  ? 35.022  -0.200  12.842  1.00 24.45 ?  115  PHE A CZ    1 
ATOM   734  N  N     . GLN C 3 50  ? 34.331  4.471   16.575  1.00 23.98 ?  116  GLN A N     1 
ATOM   735  C  CA    . GLN C 3 50  ? 33.017  4.170   17.131  1.00 23.99 ?  116  GLN A CA    1 
ATOM   736  C  C     . GLN C 3 50  ? 32.159  3.701   15.978  1.00 24.01 ?  116  GLN A C     1 
ATOM   737  O  O     . GLN C 3 50  ? 31.935  4.451   15.018  1.00 23.38 ?  116  GLN A O     1 
ATOM   738  C  CB    . GLN C 3 50  ? 32.389  5.401   17.769  1.00 23.72 ?  116  GLN A CB    1 
ATOM   739  C  CG    . GLN C 3 50  ? 30.970  5.163   18.280  1.00 25.27 ?  116  GLN A CG    1 
ATOM   740  C  CD    . GLN C 3 50  ? 30.405  6.383   18.973  1.00 27.18 ?  116  GLN A CD    1 
ATOM   741  O  OE1   . GLN C 3 50  ? 30.936  7.483   18.840  1.00 29.65 ?  116  GLN A OE1   1 
ATOM   742  N  NE2   . GLN C 3 50  ? 29.338  6.197   19.728  1.00 27.88 ?  116  GLN A NE2   1 
ATOM   743  N  N     . GLN C 3 51  ? 31.685  2.463   16.054  1.00 24.13 ?  117  GLN A N     1 
ATOM   744  C  CA    . GLN C 3 51  ? 30.850  1.941   14.991  1.00 23.85 ?  117  GLN A CA    1 
ATOM   745  C  C     . GLN C 3 51  ? 29.407  2.368   15.250  1.00 23.98 ?  117  GLN A C     1 
ATOM   746  O  O     . GLN C 3 51  ? 28.902  2.216   16.375  1.00 24.08 ?  117  GLN A O     1 
ATOM   747  C  CB    . GLN C 3 51  ? 30.981  0.421   14.883  1.00 24.18 ?  117  GLN A CB    1 
ATOM   748  C  CG    . GLN C 3 51  ? 30.591  -0.382  16.142  1.00 24.23 ?  117  GLN A CG    1 
ATOM   749  C  CD    . GLN C 3 51  ? 29.110  -0.719  16.231  1.00 26.43 ?  117  GLN A CD    1 
ATOM   750  O  OE1   . GLN C 3 51  ? 28.631  -1.171  17.288  1.00 30.23 ?  117  GLN A OE1   1 
ATOM   751  N  NE2   . GLN C 3 51  ? 28.375  -0.516  15.140  1.00 22.60 ?  117  GLN A NE2   1 
ATOM   752  N  N     . ILE C 3 52  ? 28.752  2.914   14.227  1.00 23.11 ?  118  ILE A N     1 
ATOM   753  C  CA    . ILE C 3 52  ? 27.382  3.434   14.392  1.00 23.59 ?  118  ILE A CA    1 
ATOM   754  C  C     . ILE C 3 52  ? 26.341  2.597   13.671  1.00 23.99 ?  118  ILE A C     1 
ATOM   755  O  O     . ILE C 3 52  ? 25.146  2.681   13.958  1.00 23.03 ?  118  ILE A O     1 
ATOM   756  C  CB    . ILE C 3 52  ? 27.261  4.879   13.877  1.00 23.22 ?  118  ILE A CB    1 
ATOM   757  C  CG1   . ILE C 3 52  ? 27.546  4.930   12.379  1.00 23.57 ?  118  ILE A CG1   1 
ATOM   758  C  CG2   . ILE C 3 52  ? 28.221  5.820   14.643  1.00 24.54 ?  118  ILE A CG2   1 
ATOM   759  C  CD1   . ILE C 3 52  ? 27.408  6.323   11.794  1.00 24.38 ?  118  ILE A CD1   1 
ATOM   760  N  N     . ASP C 3 53  ? 26.775  1.815   12.692  1.00 24.61 ?  119  ASP A N     1 
ATOM   761  C  CA    . ASP C 3 53  ? 25.838  0.924   12.045  1.00 26.18 ?  119  ASP A CA    1 
ATOM   762  C  C     . ASP C 3 53  ? 26.578  -0.201  11.351  1.00 26.11 ?  119  ASP A C     1 
ATOM   763  O  O     . ASP C 3 53  ? 27.784  -0.113  11.114  1.00 26.25 ?  119  ASP A O     1 
ATOM   764  C  CB    . ASP C 3 53  ? 24.961  1.679   11.063  1.00 26.93 ?  119  ASP A CB    1 
ATOM   765  C  CG    . ASP C 3 53  ? 23.631  0.965   10.784  1.00 30.29 ?  119  ASP A CG    1 
ATOM   766  O  OD1   . ASP C 3 53  ? 23.257  -0.014  11.495  1.00 32.00 ?  119  ASP A OD1   1 
ATOM   767  O  OD2   . ASP C 3 53  ? 22.940  1.414   9.856   1.00 33.70 ?  119  ASP A OD2   1 
ATOM   768  N  N     . ALA C 3 54  ? 25.858  -1.268  11.051  1.00 25.69 ?  120  ALA A N     1 
ATOM   769  C  CA    . ALA C 3 54  ? 26.477  -2.437  10.457  1.00 25.75 ?  120  ALA A CA    1 
ATOM   770  C  C     . ALA C 3 54  ? 25.445  -3.119  9.607   1.00 26.42 ?  120  ALA A C     1 
ATOM   771  O  O     . ALA C 3 54  ? 24.248  -3.037  9.894   1.00 26.14 ?  120  ALA A O     1 
ATOM   772  C  CB    . ALA C 3 54  ? 26.972  -3.372  11.527  1.00 26.04 ?  120  ALA A CB    1 
ATOM   773  N  N     . GLU C 3 55  ? 25.893  -3.778  8.544   1.00 26.12 ?  121  GLU A N     1 
ATOM   774  C  CA    . GLU C 3 55  ? 24.971  -4.507  7.699   1.00 27.07 ?  121  GLU A CA    1 
ATOM   775  C  C     . GLU C 3 55  ? 25.679  -5.671  7.046   1.00 26.91 ?  121  GLU A C     1 
ATOM   776  O  O     . GLU C 3 55  ? 26.872  -5.627  6.787   1.00 25.67 ?  121  GLU A O     1 
ATOM   777  C  CB    . GLU C 3 55  ? 24.348  -3.608  6.624   1.00 27.11 ?  121  GLU A CB    1 
ATOM   778  C  CG    . GLU C 3 55  ? 25.340  -3.096  5.594   1.00 30.67 ?  121  GLU A CG    1 
ATOM   779  C  CD    . GLU C 3 55  ? 24.690  -2.178  4.563   1.00 35.27 ?  121  GLU A CD    1 
ATOM   780  O  OE1   . GLU C 3 55  ? 25.312  -1.947  3.518   1.00 39.52 ?  121  GLU A OE1   1 
ATOM   781  O  OE2   . GLU C 3 55  ? 23.559  -1.693  4.784   1.00 37.48 ?  121  GLU A OE2   1 
ATOM   782  N  N     . GLN C 3 56  ? 24.912  -6.715  6.784   1.00 27.90 ?  122  GLN A N     1 
ATOM   783  C  CA    . GLN C 3 56  ? 25.403  -7.869  6.060   1.00 28.68 ?  122  GLN A CA    1 
ATOM   784  C  C     . GLN C 3 56  ? 25.701  -7.537  4.595   1.00 29.25 ?  122  GLN A C     1 
ATOM   785  O  O     . GLN C 3 56  ? 24.926  -6.843  3.926   1.00 29.00 ?  122  GLN A O     1 
ATOM   786  C  CB    . GLN C 3 56  ? 24.373  -8.976  6.153   1.00 28.22 ?  122  GLN A CB    1 
ATOM   787  C  CG    . GLN C 3 56  ? 24.673  -10.177 5.292   1.00 30.65 ?  122  GLN A CG    1 
ATOM   788  C  CD    . GLN C 3 56  ? 23.559  -11.201 5.352   1.00 31.19 ?  122  GLN A CD    1 
ATOM   789  O  OE1   . GLN C 3 56  ? 22.729  -11.187 6.272   1.00 31.93 ?  122  GLN A OE1   1 
ATOM   790  N  NE2   . GLN C 3 56  ? 23.528  -12.090 4.374   1.00 31.10 ?  122  GLN A NE2   1 
ATOM   791  N  N     . SER C 3 57  ? 26.814  -8.048  4.081   1.00 29.72 ?  123  SER A N     1 
ATOM   792  C  CA    . SER C 3 57  ? 27.116  -7.845  2.667   1.00 31.21 ?  123  SER A CA    1 
ATOM   793  C  C     . SER C 3 57  ? 28.058  -8.925  2.159   1.00 31.69 ?  123  SER A C     1 
ATOM   794  O  O     . SER C 3 57  ? 28.625  -9.684  2.941   1.00 32.08 ?  123  SER A O     1 
ATOM   795  C  CB    . SER C 3 57  ? 27.748  -6.461  2.461   1.00 30.94 ?  123  SER A CB    1 
ATOM   796  O  OG    . SER C 3 57  ? 27.700  -6.119  1.102   1.00 32.89 ?  123  SER A OG    1 
ATOM   797  N  N     . VAL C 3 58  ? 28.231  -8.996  0.851   1.00 32.91 ?  124  VAL A N     1 
ATOM   798  C  CA    . VAL C 3 58  ? 29.131  -9.977  0.271   1.00 33.86 ?  124  VAL A CA    1 
ATOM   799  C  C     . VAL C 3 58  ? 30.371  -9.248  -0.207  1.00 34.55 ?  124  VAL A C     1 
ATOM   800  O  O     . VAL C 3 58  ? 30.279  -8.228  -0.894  1.00 34.72 ?  124  VAL A O     1 
ATOM   801  C  CB    . VAL C 3 58  ? 28.498  -10.728 -0.906  1.00 34.13 ?  124  VAL A CB    1 
ATOM   802  C  CG1   . VAL C 3 58  ? 29.575  -11.470 -1.693  1.00 34.58 ?  124  VAL A CG1   1 
ATOM   803  C  CG2   . VAL C 3 58  ? 27.436  -11.713 -0.417  1.00 34.36 ?  124  VAL A CG2   1 
ATOM   804  N  N     . LEU C 3 59  ? 31.532  -9.760  0.166   1.00 35.18 ?  125  LEU A N     1 
ATOM   805  C  CA    . LEU C 3 59  ? 32.788  -9.099  -0.178  1.00 36.18 ?  125  LEU A CA    1 
ATOM   806  C  C     . LEU C 3 59  ? 33.385  -9.717  -1.437  1.00 37.15 ?  125  LEU A C     1 
ATOM   807  O  O     . LEU C 3 59  ? 33.550  -10.932 -1.542  1.00 36.93 ?  125  LEU A O     1 
ATOM   808  C  CB    . LEU C 3 59  ? 33.777  -9.182  0.992   1.00 35.69 ?  125  LEU A CB    1 
ATOM   809  C  CG    . LEU C 3 59  ? 35.088  -8.402  0.871   1.00 36.17 ?  125  LEU A CG    1 
ATOM   810  C  CD1   . LEU C 3 59  ? 34.812  -6.896  0.755   1.00 35.85 ?  125  LEU A CD1   1 
ATOM   811  C  CD2   . LEU C 3 59  ? 36.009  -8.698  2.052   1.00 34.38 ?  125  LEU A CD2   1 
ATOM   812  N  N     . ASN C 3 60  ? 33.685  -8.872  -2.408  1.00 38.63 ?  126  ASN A N     1 
ATOM   813  C  CA    . ASN C 3 60  ? 34.356  -9.326  -3.610  1.00 39.83 ?  126  ASN A CA    1 
ATOM   814  C  C     . ASN C 3 60  ? 35.774  -9.782  -3.284  1.00 39.94 ?  126  ASN A C     1 
ATOM   815  O  O     . ASN C 3 60  ? 36.464  -9.145  -2.500  1.00 40.24 ?  126  ASN A O     1 
ATOM   816  C  CB    . ASN C 3 60  ? 34.406  -8.189  -4.628  1.00 40.28 ?  126  ASN A CB    1 
ATOM   817  C  CG    . ASN C 3 60  ? 34.063  -8.653  -6.018  1.00 42.21 ?  126  ASN A CG    1 
ATOM   818  O  OD1   . ASN C 3 60  ? 34.914  -8.667  -6.909  1.00 45.17 ?  126  ASN A OD1   1 
ATOM   819  N  ND2   . ASN C 3 60  ? 32.809  -9.054  -6.213  1.00 44.16 ?  126  ASN A ND2   1 
ATOM   820  N  N     . GLY C 3 61  ? 36.216  -10.882 -3.880  1.00 40.36 ?  127  GLY A N     1 
ATOM   821  C  CA    . GLY C 3 61  ? 37.586  -11.342 -3.654  1.00 40.59 ?  127  GLY A CA    1 
ATOM   822  C  C     . GLY C 3 61  ? 37.682  -12.523 -2.707  1.00 40.59 ?  127  GLY A C     1 
ATOM   823  O  O     . GLY C 3 61  ? 36.666  -13.062 -2.265  1.00 41.46 ?  127  GLY A O     1 
ATOM   824  N  N     . ILE C 3 62  ? 38.909  -12.931 -2.399  1.00 40.18 ?  128  ILE A N     1 
ATOM   825  C  CA    . ILE C 3 62  ? 39.157  -14.091 -1.526  1.00 39.30 ?  128  ILE A CA    1 
ATOM   826  C  C     . ILE C 3 62  ? 38.114  -14.300 -0.404  1.00 38.39 ?  128  ILE A C     1 
ATOM   827  O  O     . ILE C 3 62  ? 37.619  -13.348 0.173   1.00 38.62 ?  128  ILE A O     1 
ATOM   828  C  CB    . ILE C 3 62  ? 40.565  -14.013 -0.886  1.00 39.25 ?  128  ILE A CB    1 
ATOM   829  N  N     . LYS C 3 63  ? 37.805  -15.562 -0.114  1.00 36.76 ?  129  LYS A N     1 
ATOM   830  C  CA    . LYS C 3 63  ? 36.993  -15.949 1.028   1.00 35.13 ?  129  LYS A CA    1 
ATOM   831  C  C     . LYS C 3 63  ? 37.815  -15.994 2.321   1.00 33.48 ?  129  LYS A C     1 
ATOM   832  O  O     . LYS C 3 63  ? 39.042  -16.107 2.288   1.00 32.60 ?  129  LYS A O     1 
ATOM   833  C  CB    . LYS C 3 63  ? 36.406  -17.342 0.790   1.00 35.43 ?  129  LYS A CB    1 
ATOM   834  C  CG    . LYS C 3 63  ? 35.427  -17.434 -0.368  1.00 37.27 ?  129  LYS A CG    1 
ATOM   835  C  CD    . LYS C 3 63  ? 34.794  -18.819 -0.439  1.00 39.12 ?  129  LYS A CD    1 
ATOM   836  C  CE    . LYS C 3 63  ? 33.301  -18.726 -0.758  1.00 40.89 ?  129  LYS A CE    1 
ATOM   837  N  NZ    . LYS C 3 63  ? 33.035  -18.073 -2.075  1.00 41.40 ?  129  LYS A NZ    1 
ATOM   838  N  N     . ASP C 3 64  ? 37.130  -15.945 3.461   1.00 31.35 ?  130  ASP A N     1 
ATOM   839  C  CA    . ASP C 3 64  ? 37.795  -16.104 4.753   1.00 29.42 ?  130  ASP A CA    1 
ATOM   840  C  C     . ASP C 3 64  ? 37.033  -17.162 5.572   1.00 29.07 ?  130  ASP A C     1 
ATOM   841  O  O     . ASP C 3 64  ? 35.816  -17.060 5.745   1.00 28.30 ?  130  ASP A O     1 
ATOM   842  C  CB    . ASP C 3 64  ? 37.840  -14.754 5.481   1.00 29.59 ?  130  ASP A CB    1 
ATOM   843  C  CG    . ASP C 3 64  ? 38.765  -14.761 6.689   1.00 27.58 ?  130  ASP A CG    1 
ATOM   844  O  OD1   . ASP C 3 64  ? 39.573  -15.693 6.815   1.00 25.49 ?  130  ASP A OD1   1 
ATOM   845  O  OD2   . ASP C 3 64  ? 38.690  -13.827 7.515   1.00 25.72 ?  130  ASP A OD2   1 
ATOM   846  N  N     . GLU C 3 65  ? 37.745  -18.176 6.061   1.00 27.99 ?  131  GLU A N     1 
ATOM   847  C  CA    . GLU C 3 65  ? 37.103  -19.281 6.770   1.00 27.42 ?  131  GLU A CA    1 
ATOM   848  C  C     . GLU C 3 65  ? 35.925  -19.818 5.947   1.00 27.15 ?  131  GLU A C     1 
ATOM   849  O  O     . GLU C 3 65  ? 34.856  -20.102 6.481   1.00 26.52 ?  131  GLU A O     1 
ATOM   850  C  CB    . GLU C 3 65  ? 36.659  -18.833 8.181   1.00 27.12 ?  131  GLU A CB    1 
ATOM   851  C  CG    . GLU C 3 65  ? 37.857  -18.377 9.038   1.00 26.93 ?  131  GLU A CG    1 
ATOM   852  C  CD    . GLU C 3 65  ? 37.555  -18.280 10.529  1.00 27.31 ?  131  GLU A CD    1 
ATOM   853  O  OE1   . GLU C 3 65  ? 36.701  -19.042 11.035  1.00 28.40 ?  131  GLU A OE1   1 
ATOM   854  O  OE2   . GLU C 3 65  ? 38.175  -17.432 11.198  1.00 26.10 ?  131  GLU A OE2   1 
ATOM   855  N  N     . ASN C 3 66  ? 36.132  -19.914 4.635   1.00 26.76 ?  132  ASN A N     1 
ATOM   856  C  CA    . ASN C 3 66  ? 35.157  -20.508 3.723   1.00 26.75 ?  132  ASN A CA    1 
ATOM   857  C  C     . ASN C 3 66  ? 33.857  -19.712 3.571   1.00 26.46 ?  132  ASN A C     1 
ATOM   858  O  O     . ASN C 3 66  ? 32.826  -20.280 3.260   1.00 26.38 ?  132  ASN A O     1 
ATOM   859  C  CB    . ASN C 3 66  ? 34.812  -21.947 4.138   1.00 26.72 ?  132  ASN A CB    1 
ATOM   860  C  CG    . ASN C 3 66  ? 34.159  -22.741 3.005   1.00 26.98 ?  132  ASN A CG    1 
ATOM   861  O  OD1   . ASN C 3 66  ? 34.287  -22.381 1.843   1.00 28.41 ?  132  ASN A OD1   1 
ATOM   862  N  ND2   . ASN C 3 66  ? 33.477  -23.825 3.343   1.00 26.43 ?  132  ASN A ND2   1 
ATOM   863  N  N     . THR C 3 67  ? 33.898  -18.408 3.793   1.00 25.99 ?  133  THR A N     1 
ATOM   864  C  CA    . THR C 3 67  ? 32.721  -17.591 3.514   1.00 25.65 ?  133  THR A CA    1 
ATOM   865  C  C     . THR C 3 67  ? 33.146  -16.256 2.914   1.00 25.89 ?  133  THR A C     1 
ATOM   866  O  O     . THR C 3 67  ? 34.186  -15.706 3.304   1.00 25.87 ?  133  THR A O     1 
ATOM   867  C  CB    . THR C 3 67  ? 31.840  -17.350 4.779   1.00 25.31 ?  133  THR A CB    1 
ATOM   868  O  OG1   . THR C 3 67  ? 30.697  -16.569 4.411   1.00 24.44 ?  133  THR A OG1   1 
ATOM   869  C  CG2   . THR C 3 67  ? 32.617  -16.607 5.869   1.00 24.62 ?  133  THR A CG2   1 
ATOM   870  N  N     . SER C 3 68  ? 32.351  -15.747 1.972   1.00 25.54 ?  134  SER A N     1 
ATOM   871  C  CA    . SER C 3 68  ? 32.612  -14.447 1.351   1.00 26.44 ?  134  SER A CA    1 
ATOM   872  C  C     . SER C 3 68  ? 31.662  -13.380 1.897   1.00 26.78 ?  134  SER A C     1 
ATOM   873  O  O     . SER C 3 68  ? 31.684  -12.220 1.451   1.00 26.87 ?  134  SER A O     1 
ATOM   874  C  CB    . SER C 3 68  ? 32.503  -14.524 -0.184  1.00 26.61 ?  134  SER A CB    1 
ATOM   875  O  OG    . SER C 3 68  ? 31.173  -14.843 -0.587  1.00 28.89 ?  134  SER A OG    1 
ATOM   876  N  N     . THR C 3 69  ? 30.830  -13.768 2.865   1.00 26.11 ?  135  THR A N     1 
ATOM   877  C  CA    . THR C 3 69  ? 29.895  -12.823 3.451   1.00 25.88 ?  135  THR A CA    1 
ATOM   878  C  C     . THR C 3 69  ? 30.504  -12.144 4.679   1.00 25.47 ?  135  THR A C     1 
ATOM   879  O  O     . THR C 3 69  ? 31.226  -12.769 5.449   1.00 24.69 ?  135  THR A O     1 
ATOM   880  C  CB    . THR C 3 69  ? 28.555  -13.488 3.774   1.00 26.20 ?  135  THR A CB    1 
ATOM   881  O  OG1   . THR C 3 69  ? 27.878  -13.757 2.534   1.00 26.49 ?  135  THR A OG1   1 
ATOM   882  C  CG2   . THR C 3 69  ? 27.687  -12.569 4.635   1.00 25.94 ?  135  THR A CG2   1 
ATOM   883  N  N     . VAL C 3 70  ? 30.219  -10.860 4.838   1.00 25.10 ?  136  VAL A N     1 
ATOM   884  C  CA    . VAL C 3 70  ? 30.811  -10.085 5.920   1.00 24.71 ?  136  VAL A CA    1 
ATOM   885  C  C     . VAL C 3 70  ? 29.750  -9.284  6.633   1.00 24.92 ?  136  VAL A C     1 
ATOM   886  O  O     . VAL C 3 70  ? 28.622  -9.178  6.156   1.00 25.32 ?  136  VAL A O     1 
ATOM   887  C  CB    . VAL C 3 70  ? 31.889  -9.104  5.364   1.00 24.86 ?  136  VAL A CB    1 
ATOM   888  C  CG1   . VAL C 3 70  ? 32.936  -9.877  4.537   1.00 23.36 ?  136  VAL A CG1   1 
ATOM   889  C  CG2   . VAL C 3 70  ? 31.241  -8.003  4.521   1.00 21.58 ?  136  VAL A CG2   1 
ATOM   890  N  N     . VAL C 3 71  ? 30.102  -8.740  7.794   1.00 24.77 ?  137  VAL A N     1 
ATOM   891  C  CA    . VAL C 3 71  ? 29.338  -7.646  8.353   1.00 25.16 ?  137  VAL A CA    1 
ATOM   892  C  C     . VAL C 3 71  ? 30.166  -6.384  8.131   1.00 24.92 ?  137  VAL A C     1 
ATOM   893  O  O     . VAL C 3 71  ? 31.328  -6.313  8.548   1.00 24.18 ?  137  VAL A O     1 
ATOM   894  C  CB    . VAL C 3 71  ? 29.035  -7.846  9.861   1.00 25.66 ?  137  VAL A CB    1 
ATOM   895  C  CG1   . VAL C 3 71  ? 28.334  -6.611  10.435  1.00 27.41 ?  137  VAL A CG1   1 
ATOM   896  C  CG2   . VAL C 3 71  ? 28.161  -9.083  10.059  1.00 26.96 ?  137  VAL A CG2   1 
ATOM   897  N  N     . ARG C 3 72  ? 29.582  -5.415  7.438   1.00 24.39 ?  138  ARG A N     1 
ATOM   898  C  CA    . ARG C 3 72  ? 30.259  -4.174  7.180   1.00 24.97 ?  138  ARG A CA    1 
ATOM   899  C  C     . ARG C 3 72  ? 29.869  -3.220  8.295   1.00 25.04 ?  138  ARG A C     1 
ATOM   900  O  O     . ARG C 3 72  ? 28.692  -2.874  8.401   1.00 24.49 ?  138  ARG A O     1 
ATOM   901  C  CB    . ARG C 3 72  ? 29.792  -3.572  5.857   1.00 25.23 ?  138  ARG A CB    1 
ATOM   902  C  CG    . ARG C 3 72  ? 30.143  -4.365  4.588   1.00 27.47 ?  138  ARG A CG    1 
ATOM   903  C  CD    . ARG C 3 72  ? 29.928  -3.474  3.368   1.00 28.75 ?  138  ARG A CD    1 
ATOM   904  N  NE    . ARG C 3 72  ? 30.004  -4.158  2.069   1.00 29.54 ?  138  ARG A NE    1 
ATOM   905  C  CZ    . ARG C 3 72  ? 31.124  -4.323  1.366   1.00 31.40 ?  138  ARG A CZ    1 
ATOM   906  N  NH1   . ARG C 3 72  ? 32.268  -3.895  1.854   1.00 30.20 ?  138  ARG A NH1   1 
ATOM   907  N  NH2   . ARG C 3 72  ? 31.102  -4.932  0.172   1.00 34.09 ?  138  ARG A NH2   1 
ATOM   908  N  N     . PHE C 3 73  ? 30.848  -2.799  9.104   1.00 24.18 ?  139  PHE A N     1 
ATOM   909  C  CA    . PHE C 3 73  ? 30.625  -1.780  10.128  1.00 23.68 ?  139  PHE A CA    1 
ATOM   910  C  C     . PHE C 3 73  ? 31.096  -0.423  9.637   1.00 23.43 ?  139  PHE A C     1 
ATOM   911  O  O     . PHE C 3 73  ? 32.162  -0.304  9.050   1.00 23.82 ?  139  PHE A O     1 
ATOM   912  C  CB    . PHE C 3 73  ? 31.397  -2.108  11.409  1.00 23.02 ?  139  PHE A CB    1 
ATOM   913  C  CG    . PHE C 3 73  ? 30.824  -3.263  12.190  1.00 23.64 ?  139  PHE A CG    1 
ATOM   914  C  CD1   . PHE C 3 73  ? 29.962  -3.035  13.259  1.00 23.80 ?  139  PHE A CD1   1 
ATOM   915  C  CD2   . PHE C 3 73  ? 31.151  -4.574  11.864  1.00 23.40 ?  139  PHE A CD2   1 
ATOM   916  C  CE1   . PHE C 3 73  ? 29.461  -4.090  14.012  1.00 23.46 ?  139  PHE A CE1   1 
ATOM   917  C  CE2   . PHE C 3 73  ? 30.630  -5.650  12.613  1.00 24.23 ?  139  PHE A CE2   1 
ATOM   918  C  CZ    . PHE C 3 73  ? 29.778  -5.390  13.686  1.00 23.40 ?  139  PHE A CZ    1 
ATOM   919  N  N     . PHE C 3 74  ? 30.311  0.609   9.890   1.00 23.24 ?  140  PHE A N     1 
ATOM   920  C  CA    . PHE C 3 74  ? 30.710  1.954   9.510   1.00 22.97 ?  140  PHE A CA    1 
ATOM   921  C  C     . PHE C 3 74  ? 30.862  2.785   10.774  1.00 23.31 ?  140  PHE A C     1 
ATOM   922  O  O     . PHE C 3 74  ? 30.108  2.582   11.743  1.00 23.59 ?  140  PHE A O     1 
ATOM   923  C  CB    . PHE C 3 74  ? 29.608  2.588   8.676   1.00 22.23 ?  140  PHE A CB    1 
ATOM   924  C  CG    . PHE C 3 74  ? 29.315  1.871   7.386   1.00 23.41 ?  140  PHE A CG    1 
ATOM   925  C  CD1   . PHE C 3 74  ? 29.878  2.313   6.194   1.00 22.26 ?  140  PHE A CD1   1 
ATOM   926  C  CD2   . PHE C 3 74  ? 28.447  0.799   7.354   1.00 23.24 ?  140  PHE A CD2   1 
ATOM   927  C  CE1   . PHE C 3 74  ? 29.597  1.670   4.991   1.00 23.90 ?  140  PHE A CE1   1 
ATOM   928  C  CE2   . PHE C 3 74  ? 28.152  0.159   6.150   1.00 25.13 ?  140  PHE A CE2   1 
ATOM   929  C  CZ    . PHE C 3 74  ? 28.742  0.605   4.968   1.00 23.32 ?  140  PHE A CZ    1 
ATOM   930  N  N     . GLY C 3 75  ? 31.784  3.741   10.766  1.00 23.77 ?  141  GLY A N     1 
ATOM   931  C  CA    . GLY C 3 75  ? 31.931  4.631   11.905  1.00 23.41 ?  141  GLY A CA    1 
ATOM   932  C  C     . GLY C 3 75  ? 33.024  5.668   11.773  1.00 24.22 ?  141  GLY A C     1 
ATOM   933  O  O     . GLY C 3 75  ? 33.481  5.989   10.665  1.00 23.89 ?  141  GLY A O     1 
ATOM   934  N  N     . VAL C 3 76  ? 33.474  6.171   12.918  1.00 23.64 ?  142  VAL A N     1 
ATOM   935  C  CA    . VAL C 3 76  ? 34.329  7.347   12.953  1.00 24.00 ?  142  VAL A CA    1 
ATOM   936  C  C     . VAL C 3 76  ? 35.391  7.229   14.035  1.00 24.14 ?  142  VAL A C     1 
ATOM   937  O  O     . VAL C 3 76  ? 35.095  6.788   15.159  1.00 24.13 ?  142  VAL A O     1 
ATOM   938  C  CB    . VAL C 3 76  ? 33.485  8.621   13.230  1.00 24.67 ?  142  VAL A CB    1 
ATOM   939  C  CG1   . VAL C 3 76  ? 34.355  9.879   13.145  1.00 23.89 ?  142  VAL A CG1   1 
ATOM   940  C  CG2   . VAL C 3 76  ? 32.279  8.701   12.273  1.00 24.29 ?  142  VAL A CG2   1 
ATOM   941  N  N     . THR C 3 77  ? 36.616  7.628   13.708  1.00 23.71 ?  143  THR A N     1 
ATOM   942  C  CA    . THR C 3 77  ? 37.718  7.593   14.659  1.00 24.71 ?  143  THR A CA    1 
ATOM   943  C  C     . THR C 3 77  ? 37.672  8.838   15.561  1.00 24.82 ?  143  THR A C     1 
ATOM   944  O  O     . THR C 3 77  ? 36.907  9.772   15.311  1.00 23.98 ?  143  THR A O     1 
ATOM   945  C  CB    . THR C 3 77  ? 39.094  7.510   13.949  1.00 24.47 ?  143  THR A CB    1 
ATOM   946  O  OG1   . THR C 3 77  ? 39.359  8.742   13.261  1.00 25.84 ?  143  THR A OG1   1 
ATOM   947  C  CG2   . THR C 3 77  ? 39.120  6.333   12.930  1.00 25.05 ?  143  THR A CG2   1 
ATOM   948  N  N     . SER C 3 78  ? 38.483  8.856   16.613  1.00 25.45 ?  144  SER A N     1 
ATOM   949  C  CA    . SER C 3 78  ? 38.476  10.022  17.497  1.00 26.51 ?  144  SER A CA    1 
ATOM   950  C  C     . SER C 3 78  ? 38.935  11.287  16.767  1.00 26.66 ?  144  SER A C     1 
ATOM   951  O  O     . SER C 3 78  ? 38.552  12.386  17.156  1.00 26.24 ?  144  SER A O     1 
ATOM   952  C  CB    . SER C 3 78  ? 39.300  9.787   18.766  1.00 26.52 ?  144  SER A CB    1 
ATOM   953  O  OG    . SER C 3 78  ? 40.682  9.823   18.455  1.00 29.16 ?  144  SER A OG    1 
ATOM   954  N  N     . GLU C 3 79  ? 39.734  11.138  15.706  1.00 27.50 ?  145  GLU A N     1 
ATOM   955  C  CA    . GLU C 3 79  ? 40.177  12.301  14.919  1.00 28.39 ?  145  GLU A CA    1 
ATOM   956  C  C     . GLU C 3 79  ? 39.206  12.706  13.811  1.00 27.76 ?  145  GLU A C     1 
ATOM   957  O  O     . GLU C 3 79  ? 39.498  13.627  13.049  1.00 28.00 ?  145  GLU A O     1 
ATOM   958  C  CB    . GLU C 3 79  ? 41.560  12.079  14.269  1.00 28.91 ?  145  GLU A CB    1 
ATOM   959  C  CG    . GLU C 3 79  ? 42.605  11.404  15.140  1.00 33.12 ?  145  GLU A CG    1 
ATOM   960  C  CD    . GLU C 3 79  ? 42.452  9.885   15.173  1.00 38.49 ?  145  GLU A CD    1 
ATOM   961  O  OE1   . GLU C 3 79  ? 41.683  9.320   14.356  1.00 40.03 ?  145  GLU A OE1   1 
ATOM   962  O  OE2   . GLU C 3 79  ? 43.107  9.249   16.023  1.00 41.88 ?  145  GLU A OE2   1 
ATOM   963  N  N     . GLY C 3 80  ? 38.087  12.001  13.676  1.00 27.08 ?  146  GLY A N     1 
ATOM   964  C  CA    . GLY C 3 80  ? 37.104  12.351  12.653  1.00 25.84 ?  146  GLY A CA    1 
ATOM   965  C  C     . GLY C 3 80  ? 37.301  11.729  11.274  1.00 25.51 ?  146  GLY A C     1 
ATOM   966  O  O     . GLY C 3 80  ? 36.852  12.289  10.266  1.00 25.53 ?  146  GLY A O     1 
ATOM   967  N  N     . HIS C 3 81  ? 37.952  10.572  11.219  1.00 24.89 ?  147  HIS A N     1 
ATOM   968  C  CA    . HIS C 3 81  ? 38.060  9.815   9.966   1.00 24.53 ?  147  HIS A CA    1 
ATOM   969  C  C     . HIS C 3 81  ? 36.965  8.773   9.851   1.00 24.41 ?  147  HIS A C     1 
ATOM   970  O  O     . HIS C 3 81  ? 36.682  8.057   10.813  1.00 24.28 ?  147  HIS A O     1 
ATOM   971  C  CB    . HIS C 3 81  ? 39.430  9.132   9.853   1.00 23.93 ?  147  HIS A CB    1 
ATOM   972  C  CG    . HIS C 3 81  ? 40.583  10.084  9.944   1.00 24.40 ?  147  HIS A CG    1 
ATOM   973  N  ND1   . HIS C 3 81  ? 40.705  11.178  9.116   1.00 24.31 ?  147  HIS A ND1   1 
ATOM   974  C  CD2   . HIS C 3 81  ? 41.683  10.084  10.736  1.00 22.39 ?  147  HIS A CD2   1 
ATOM   975  C  CE1   . HIS C 3 81  ? 41.815  11.830  9.415   1.00 25.47 ?  147  HIS A CE1   1 
ATOM   976  N  NE2   . HIS C 3 81  ? 42.430  11.182  10.387  1.00 24.16 ?  147  HIS A NE2   1 
ATOM   977  N  N     . SER C 3 82  ? 36.366  8.662   8.666   1.00 23.76 ?  148  SER A N     1 
ATOM   978  C  CA    . SER C 3 82  ? 35.298  7.690   8.439   1.00 23.46 ?  148  SER A CA    1 
ATOM   979  C  C     . SER C 3 82  ? 35.876  6.342   8.051   1.00 23.82 ?  148  SER A C     1 
ATOM   980  O  O     . SER C 3 82  ? 36.899  6.260   7.355   1.00 23.91 ?  148  SER A O     1 
ATOM   981  C  CB    . SER C 3 82  ? 34.342  8.180   7.348   1.00 22.97 ?  148  SER A CB    1 
ATOM   982  O  OG    . SER C 3 82  ? 35.069  8.505   6.180   1.00 22.97 ?  148  SER A OG    1 
ATOM   983  N  N     . VAL C 3 83  ? 35.207  5.286   8.495   1.00 23.70 ?  149  VAL A N     1 
ATOM   984  C  CA    . VAL C 3 83  ? 35.724  3.936   8.361   1.00 24.30 ?  149  VAL A CA    1 
ATOM   985  C  C     . VAL C 3 83  ? 34.633  3.005   7.858   1.00 24.31 ?  149  VAL A C     1 
ATOM   986  O  O     . VAL C 3 83  ? 33.477  3.070   8.330   1.00 23.61 ?  149  VAL A O     1 
ATOM   987  C  CB    . VAL C 3 83  ? 36.261  3.381   9.726   1.00 24.62 ?  149  VAL A CB    1 
ATOM   988  C  CG1   . VAL C 3 83  ? 36.898  2.008   9.529   1.00 24.42 ?  149  VAL A CG1   1 
ATOM   989  C  CG2   . VAL C 3 83  ? 37.267  4.364   10.363  1.00 23.45 ?  149  VAL A CG2   1 
ATOM   990  N  N     . LEU C 3 84  ? 34.976  2.202   6.847   1.00 24.03 ?  150  LEU A N     1 
ATOM   991  C  CA    . LEU C 3 84  ? 34.206  1.000   6.527   1.00 23.76 ?  150  LEU A CA    1 
ATOM   992  C  C     . LEU C 3 84  ? 35.114  -0.163  6.903   1.00 24.07 ?  150  LEU A C     1 
ATOM   993  O  O     . LEU C 3 84  ? 36.219  -0.293  6.371   1.00 23.76 ?  150  LEU A O     1 
ATOM   994  C  CB    . LEU C 3 84  ? 33.847  0.923   5.033   1.00 24.18 ?  150  LEU A CB    1 
ATOM   995  C  CG    . LEU C 3 84  ? 33.340  -0.441  4.530   1.00 24.17 ?  150  LEU A CG    1 
ATOM   996  C  CD1   . LEU C 3 84  ? 32.234  -1.017  5.442   1.00 25.20 ?  150  LEU A CD1   1 
ATOM   997  C  CD2   . LEU C 3 84  ? 32.864  -0.397  3.043   1.00 25.84 ?  150  LEU A CD2   1 
ATOM   998  N  N     . CYS C 3 85  ? 34.675  -0.980  7.848   1.00 23.97 ?  151  CYS A N     1 
ATOM   999  C  CA    . CYS C 3 85  ? 35.454  -2.146  8.260   1.00 24.15 ?  151  CYS A CA    1 
ATOM   1000 C  C     . CYS C 3 85  ? 34.657  -3.409  7.949   1.00 24.08 ?  151  CYS A C     1 
ATOM   1001 O  O     . CYS C 3 85  ? 33.599  -3.653  8.561   1.00 24.32 ?  151  CYS A O     1 
ATOM   1002 C  CB    . CYS C 3 85  ? 35.764  -2.080  9.756   1.00 24.16 ?  151  CYS A CB    1 
ATOM   1003 S  SG    . CYS C 3 85  ? 36.623  -3.546  10.389  1.00 27.64 ?  151  CYS A SG    1 
ATOM   1004 N  N     . ASN C 3 86  ? 35.152  -4.200  6.999   1.00 23.88 ?  152  ASN A N     1 
ATOM   1005 C  CA    . ASN C 3 86  ? 34.553  -5.480  6.683   1.00 23.74 ?  152  ASN A CA    1 
ATOM   1006 C  C     . ASN C 3 86  ? 35.002  -6.516  7.694   1.00 23.38 ?  152  ASN A C     1 
ATOM   1007 O  O     . ASN C 3 86  ? 36.184  -6.800  7.790   1.00 23.23 ?  152  ASN A O     1 
ATOM   1008 C  CB    . ASN C 3 86  ? 34.996  -5.974  5.306   1.00 24.21 ?  152  ASN A CB    1 
ATOM   1009 C  CG    . ASN C 3 86  ? 34.642  -5.000  4.190   1.00 24.65 ?  152  ASN A CG    1 
ATOM   1010 O  OD1   . ASN C 3 86  ? 33.480  -4.629  4.025   1.00 25.72 ?  152  ASN A OD1   1 
ATOM   1011 N  ND2   . ASN C 3 86  ? 35.647  -4.590  3.417   1.00 23.42 ?  152  ASN A ND2   1 
ATOM   1012 N  N     . VAL C 3 87  ? 34.063  -7.102  8.426   1.00 22.85 ?  153  VAL A N     1 
ATOM   1013 C  CA    . VAL C 3 87  ? 34.436  -8.154  9.354   1.00 22.74 ?  153  VAL A CA    1 
ATOM   1014 C  C     . VAL C 3 87  ? 34.211  -9.492  8.678   1.00 22.86 ?  153  VAL A C     1 
ATOM   1015 O  O     . VAL C 3 87  ? 33.071  -9.881  8.413   1.00 22.62 ?  153  VAL A O     1 
ATOM   1016 C  CB    . VAL C 3 87  ? 33.681  -8.036  10.689  1.00 23.02 ?  153  VAL A CB    1 
ATOM   1017 C  CG1   . VAL C 3 87  ? 34.092  -9.167  11.624  1.00 22.24 ?  153  VAL A CG1   1 
ATOM   1018 C  CG2   . VAL C 3 87  ? 33.994  -6.677  11.323  1.00 23.36 ?  153  VAL A CG2   1 
ATOM   1019 N  N     . THR C 3 88  ? 35.310  -10.188 8.405   1.00 22.68 ?  154  THR A N     1 
ATOM   1020 C  CA    . THR C 3 88  ? 35.290  -11.378 7.574   1.00 22.80 ?  154  THR A CA    1 
ATOM   1021 C  C     . THR C 3 88  ? 35.417  -12.643 8.405   1.00 22.89 ?  154  THR A C     1 
ATOM   1022 O  O     . THR C 3 88  ? 35.784  -12.601 9.589   1.00 21.96 ?  154  THR A O     1 
ATOM   1023 C  CB    . THR C 3 88  ? 36.466  -11.385 6.537   1.00 23.08 ?  154  THR A CB    1 
ATOM   1024 O  OG1   . THR C 3 88  ? 37.718  -11.557 7.216   1.00 23.60 ?  154  THR A OG1   1 
ATOM   1025 C  CG2   . THR C 3 88  ? 36.518  -10.076 5.737   1.00 23.59 ?  154  THR A CG2   1 
ATOM   1026 N  N     . GLY C 3 89  ? 35.129  -13.763 7.753   1.00 22.63 ?  155  GLY A N     1 
ATOM   1027 C  CA    . GLY C 3 89  ? 35.388  -15.085 8.308   1.00 23.21 ?  155  GLY A CA    1 
ATOM   1028 C  C     . GLY C 3 89  ? 34.372  -15.564 9.323   1.00 23.45 ?  155  GLY A C     1 
ATOM   1029 O  O     . GLY C 3 89  ? 34.590  -16.590 9.954   1.00 23.45 ?  155  GLY A O     1 
ATOM   1030 N  N     . PHE C 3 90  ? 33.273  -14.823 9.487   1.00 23.33 ?  156  PHE A N     1 
ATOM   1031 C  CA    . PHE C 3 90  ? 32.245  -15.186 10.476  1.00 24.05 ?  156  PHE A CA    1 
ATOM   1032 C  C     . PHE C 3 90  ? 31.044  -15.849 9.792   1.00 24.02 ?  156  PHE A C     1 
ATOM   1033 O  O     . PHE C 3 90  ? 30.206  -15.181 9.163   1.00 23.60 ?  156  PHE A O     1 
ATOM   1034 C  CB    . PHE C 3 90  ? 31.794  -13.977 11.314  1.00 23.93 ?  156  PHE A CB    1 
ATOM   1035 C  CG    . PHE C 3 90  ? 30.900  -14.348 12.491  1.00 25.10 ?  156  PHE A CG    1 
ATOM   1036 C  CD1   . PHE C 3 90  ? 31.452  -14.665 13.730  1.00 23.75 ?  156  PHE A CD1   1 
ATOM   1037 C  CD2   . PHE C 3 90  ? 29.516  -14.386 12.346  1.00 23.79 ?  156  PHE A CD2   1 
ATOM   1038 C  CE1   . PHE C 3 90  ? 30.639  -15.013 14.811  1.00 27.41 ?  156  PHE A CE1   1 
ATOM   1039 C  CE2   . PHE C 3 90  ? 28.684  -14.729 13.431  1.00 25.34 ?  156  PHE A CE2   1 
ATOM   1040 C  CZ    . PHE C 3 90  ? 29.241  -15.046 14.658  1.00 24.98 ?  156  PHE A CZ    1 
ATOM   1041 N  N     . LYS C 3 91  ? 30.994  -17.172 9.903   1.00 24.35 ?  157  LYS A N     1 
ATOM   1042 C  CA    . LYS C 3 91  ? 29.894  -17.972 9.356   1.00 24.87 ?  157  LYS A CA    1 
ATOM   1043 C  C     . LYS C 3 91  ? 28.684  -17.990 10.289  1.00 25.01 ?  157  LYS A C     1 
ATOM   1044 O  O     . LYS C 3 91  ? 28.821  -18.222 11.479  1.00 24.82 ?  157  LYS A O     1 
ATOM   1045 C  CB    . LYS C 3 91  ? 30.352  -19.411 9.094   1.00 24.38 ?  157  LYS A CB    1 
ATOM   1046 C  CG    . LYS C 3 91  ? 31.457  -19.521 8.030   1.00 24.57 ?  157  LYS A CG    1 
ATOM   1047 C  CD    . LYS C 3 91  ? 31.892  -20.973 7.813   1.00 24.29 ?  157  LYS A CD    1 
ATOM   1048 C  CE    . LYS C 3 91  ? 32.644  -21.565 8.994   1.00 24.16 ?  157  LYS A CE    1 
ATOM   1049 N  NZ    . LYS C 3 91  ? 34.031  -21.018 9.190   1.00 24.00 ?  157  LYS A NZ    1 
ATOM   1050 N  N     . ASN C 3 92  ? 27.503  -17.749 9.724   1.00 25.91 ?  158  ASN A N     1 
ATOM   1051 C  CA    . ASN C 3 92  ? 26.253  -17.902 10.448  1.00 26.36 ?  158  ASN A CA    1 
ATOM   1052 C  C     . ASN C 3 92  ? 26.104  -19.384 10.841  1.00 26.88 ?  158  ASN A C     1 
ATOM   1053 O  O     . ASN C 3 92  ? 26.783  -20.246 10.280  1.00 26.74 ?  158  ASN A O     1 
ATOM   1054 C  CB    . ASN C 3 92  ? 25.079  -17.442 9.575   1.00 25.81 ?  158  ASN A CB    1 
ATOM   1055 C  CG    . ASN C 3 92  ? 23.876  -17.019 10.391  1.00 26.74 ?  158  ASN A CG    1 
ATOM   1056 O  OD1   . ASN C 3 92  ? 23.990  -16.797 11.599  1.00 25.38 ?  158  ASN A OD1   1 
ATOM   1057 N  ND2   . ASN C 3 92  ? 22.703  -16.906 9.734   1.00 25.98 ?  158  ASN A ND2   1 
ATOM   1058 N  N     . TYR C 3 93  ? 25.261  -19.673 11.825  1.00 26.73 ?  159  TYR A N     1 
ATOM   1059 C  CA    . TYR C 3 93  ? 25.019  -21.062 12.241  1.00 27.57 ?  159  TYR A CA    1 
ATOM   1060 C  C     . TYR C 3 93  ? 23.659  -21.207 12.916  1.00 27.72 ?  159  TYR A C     1 
ATOM   1061 O  O     . TYR C 3 93  ? 23.043  -20.219 13.306  1.00 27.69 ?  159  TYR A O     1 
ATOM   1062 C  CB    . TYR C 3 93  ? 26.105  -21.538 13.217  1.00 27.37 ?  159  TYR A CB    1 
ATOM   1063 C  CG    . TYR C 3 93  ? 26.252  -20.639 14.435  1.00 27.18 ?  159  TYR A CG    1 
ATOM   1064 C  CD1   . TYR C 3 93  ? 27.182  -19.598 14.439  1.00 25.93 ?  159  TYR A CD1   1 
ATOM   1065 C  CD2   . TYR C 3 93  ? 25.457  -20.818 15.568  1.00 25.36 ?  159  TYR A CD2   1 
ATOM   1066 C  CE1   . TYR C 3 93  ? 27.333  -18.760 15.550  1.00 26.12 ?  159  TYR A CE1   1 
ATOM   1067 C  CE2   . TYR C 3 93  ? 25.601  -19.983 16.682  1.00 25.26 ?  159  TYR A CE2   1 
ATOM   1068 C  CZ    . TYR C 3 93  ? 26.535  -18.954 16.669  1.00 25.97 ?  159  TYR A CZ    1 
ATOM   1069 O  OH    . TYR C 3 93  ? 26.683  -18.109 17.773  1.00 25.53 ?  159  TYR A OH    1 
ATOM   1070 N  N     . LEU C 3 94  ? 23.213  -22.445 13.065  1.00 28.04 ?  160  LEU A N     1 
ATOM   1071 C  CA    . LEU C 3 94  ? 22.097  -22.754 13.944  1.00 29.18 ?  160  LEU A CA    1 
ATOM   1072 C  C     . LEU C 3 94  ? 22.468  -23.938 14.838  1.00 28.99 ?  160  LEU A C     1 
ATOM   1073 O  O     . LEU C 3 94  ? 23.371  -24.718 14.521  1.00 30.23 ?  160  LEU A O     1 
ATOM   1074 C  CB    . LEU C 3 94  ? 20.818  -23.075 13.152  1.00 29.14 ?  160  LEU A CB    1 
ATOM   1075 C  CG    . LEU C 3 94  ? 20.741  -24.424 12.424  1.00 30.63 ?  160  LEU A CG    1 
ATOM   1076 C  CD1   . LEU C 3 94  ? 20.886  -25.579 13.394  1.00 34.98 ?  160  LEU A CD1   1 
ATOM   1077 C  CD2   . LEU C 3 94  ? 19.428  -24.574 11.690  1.00 33.53 ?  160  LEU A CD2   1 
ATOM   1078 N  N     . TYR C 3 95  ? 21.766  -24.082 15.944  1.00 28.38 ?  161  TYR A N     1 
ATOM   1079 C  CA    . TYR C 3 95  ? 21.957  -25.243 16.800  1.00 27.72 ?  161  TYR A CA    1 
ATOM   1080 C  C     . TYR C 3 95  ? 20.752  -26.147 16.719  1.00 27.32 ?  161  TYR A C     1 
ATOM   1081 O  O     . TYR C 3 95  ? 19.620  -25.671 16.766  1.00 27.66 ?  161  TYR A O     1 
ATOM   1082 C  CB    . TYR C 3 95  ? 22.081  -24.821 18.262  1.00 27.05 ?  161  TYR A CB    1 
ATOM   1083 C  CG    . TYR C 3 95  ? 23.304  -24.018 18.633  1.00 26.13 ?  161  TYR A CG    1 
ATOM   1084 C  CD1   . TYR C 3 95  ? 24.546  -24.624 18.752  1.00 23.80 ?  161  TYR A CD1   1 
ATOM   1085 C  CD2   . TYR C 3 95  ? 23.205  -22.661 18.926  1.00 25.82 ?  161  TYR A CD2   1 
ATOM   1086 C  CE1   . TYR C 3 95  ? 25.663  -23.901 19.141  1.00 25.10 ?  161  TYR A CE1   1 
ATOM   1087 C  CE2   . TYR C 3 95  ? 24.328  -21.923 19.308  1.00 25.34 ?  161  TYR A CE2   1 
ATOM   1088 C  CZ    . TYR C 3 95  ? 25.554  -22.556 19.413  1.00 23.90 ?  161  TYR A CZ    1 
ATOM   1089 O  OH    . TYR C 3 95  ? 26.677  -21.844 19.799  1.00 25.30 ?  161  TYR A OH    1 
ATOM   1090 N  N     . VAL C 3 96  ? 20.984  -27.451 16.616  1.00 27.20 ?  162  VAL A N     1 
ATOM   1091 C  CA    . VAL C 3 96  ? 19.933  -28.428 16.873  1.00 27.32 ?  162  VAL A CA    1 
ATOM   1092 C  C     . VAL C 3 96  ? 20.489  -29.421 17.891  1.00 27.47 ?  162  VAL A C     1 
ATOM   1093 O  O     . VAL C 3 96  ? 21.692  -29.583 17.983  1.00 27.61 ?  162  VAL A O     1 
ATOM   1094 C  CB    . VAL C 3 96  ? 19.523  -29.178 15.601  1.00 27.55 ?  162  VAL A CB    1 
ATOM   1095 C  CG1   . VAL C 3 96  ? 18.964  -28.201 14.550  1.00 28.66 ?  162  VAL A CG1   1 
ATOM   1096 C  CG2   . VAL C 3 96  ? 20.696  -29.960 15.041  1.00 26.75 ?  162  VAL A CG2   1 
ATOM   1097 N  N     . PRO C 3 97  ? 19.623  -30.062 18.685  1.00 27.96 ?  163  PRO A N     1 
ATOM   1098 C  CA    . PRO C 3 97  ? 20.135  -31.092 19.603  1.00 28.36 ?  163  PRO A CA    1 
ATOM   1099 C  C     . PRO C 3 97  ? 20.705  -32.269 18.821  1.00 28.67 ?  163  PRO A C     1 
ATOM   1100 O  O     . PRO C 3 97  ? 20.129  -32.645 17.798  1.00 28.17 ?  163  PRO A O     1 
ATOM   1101 C  CB    . PRO C 3 97  ? 18.889  -31.560 20.373  1.00 28.19 ?  163  PRO A CB    1 
ATOM   1102 C  CG    . PRO C 3 97  ? 17.802  -30.596 20.044  1.00 28.82 ?  163  PRO A CG    1 
ATOM   1103 C  CD    . PRO C 3 97  ? 18.171  -29.855 18.796  1.00 28.04 ?  163  PRO A CD    1 
ATOM   1104 N  N     . ALA C 3 98  ? 21.823  -32.833 19.279  1.00 29.16 ?  164  ALA A N     1 
ATOM   1105 C  CA    . ALA C 3 98  ? 22.374  -34.028 18.650  1.00 30.38 ?  164  ALA A CA    1 
ATOM   1106 C  C     . ALA C 3 98  ? 21.369  -35.166 18.723  1.00 31.46 ?  164  ALA A C     1 
ATOM   1107 O  O     . ALA C 3 98  ? 20.677  -35.316 19.718  1.00 31.49 ?  164  ALA A O     1 
ATOM   1108 C  CB    . ALA C 3 98  ? 23.688  -34.442 19.321  1.00 30.10 ?  164  ALA A CB    1 
ATOM   1109 N  N     . PRO C 3 99  ? 21.297  -35.992 17.666  1.00 32.51 ?  165  PRO A N     1 
ATOM   1110 C  CA    . PRO C 3 99  ? 20.289  -37.058 17.638  1.00 33.43 ?  165  PRO A CA    1 
ATOM   1111 C  C     . PRO C 3 99  ? 20.481  -38.083 18.758  1.00 34.38 ?  165  PRO A C     1 
ATOM   1112 O  O     . PRO C 3 99  ? 21.611  -38.347 19.162  1.00 34.79 ?  165  PRO A O     1 
ATOM   1113 C  CB    . PRO C 3 99  ? 20.508  -37.731 16.274  1.00 33.22 ?  165  PRO A CB    1 
ATOM   1114 C  CG    . PRO C 3 99  ? 21.340  -36.789 15.481  1.00 33.22 ?  165  PRO A CG    1 
ATOM   1115 C  CD    . PRO C 3 99  ? 22.113  -35.943 16.443  1.00 32.05 ?  165  PRO A CD    1 
ATOM   1116 N  N     . ASN C 3 100 ? 19.380  -38.646 19.247  1.00 35.48 ?  166  ASN A N     1 
ATOM   1117 C  CA    . ASN C 3 100 ? 19.424  -39.714 20.244  1.00 36.30 ?  166  ASN A CA    1 
ATOM   1118 C  C     . ASN C 3 100 ? 19.574  -41.063 19.558  1.00 36.91 ?  166  ASN A C     1 
ATOM   1119 O  O     . ASN C 3 100 ? 18.645  -41.873 19.541  1.00 37.39 ?  166  ASN A O     1 
ATOM   1120 C  CB    . ASN C 3 100 ? 18.150  -39.703 21.089  1.00 36.64 ?  166  ASN A CB    1 
ATOM   1121 N  N     . SER C 3 101 ? 20.759  -41.296 19.004  1.00 37.54 ?  167  SER A N     1 
ATOM   1122 C  CA    . SER C 3 101 ? 21.008  -42.424 18.121  1.00 37.73 ?  167  SER A CA    1 
ATOM   1123 C  C     . SER C 3 101 ? 22.455  -42.869 18.289  1.00 37.84 ?  167  SER A C     1 
ATOM   1124 O  O     . SER C 3 101 ? 23.347  -42.039 18.467  1.00 37.74 ?  167  SER A O     1 
ATOM   1125 C  CB    . SER C 3 101 ? 20.748  -41.996 16.673  1.00 37.73 ?  167  SER A CB    1 
ATOM   1126 O  OG    . SER C 3 101 ? 20.922  -43.069 15.765  1.00 38.74 ?  167  SER A OG    1 
ATOM   1127 N  N     . SER C 3 102 ? 22.689  -44.177 18.215  1.00 38.06 ?  168  SER A N     1 
ATOM   1128 C  CA    . SER C 3 102 ? 24.001  -44.740 18.529  1.00 38.25 ?  168  SER A CA    1 
ATOM   1129 C  C     . SER C 3 102 ? 25.101  -44.240 17.591  1.00 38.36 ?  168  SER A C     1 
ATOM   1130 O  O     . SER C 3 102 ? 26.263  -44.134 17.984  1.00 38.52 ?  168  SER A O     1 
ATOM   1131 C  CB    . SER C 3 102 ? 23.952  -46.275 18.519  1.00 38.20 ?  168  SER A CB    1 
ATOM   1132 N  N     . ASP C 3 103 ? 24.729  -43.934 16.354  1.00 38.26 ?  169  ASP A N     1 
ATOM   1133 C  CA    . ASP C 3 103 ? 25.699  -43.518 15.344  1.00 38.04 ?  169  ASP A CA    1 
ATOM   1134 C  C     . ASP C 3 103 ? 25.944  -42.009 15.386  1.00 37.83 ?  169  ASP A C     1 
ATOM   1135 O  O     . ASP C 3 103 ? 26.688  -41.465 14.569  1.00 37.54 ?  169  ASP A O     1 
ATOM   1136 C  CB    . ASP C 3 103 ? 25.205  -43.937 13.959  1.00 38.00 ?  169  ASP A CB    1 
ATOM   1137 C  CG    . ASP C 3 103 ? 23.743  -43.596 13.745  1.00 38.16 ?  169  ASP A CG    1 
ATOM   1138 O  OD1   . ASP C 3 103 ? 23.134  -43.028 14.679  1.00 37.35 ?  169  ASP A OD1   1 
ATOM   1139 O  OD2   . ASP C 3 103 ? 23.205  -43.889 12.658  1.00 38.09 ?  169  ASP A OD2   1 
ATOM   1140 N  N     . ALA C 3 104 ? 25.335  -41.339 16.357  1.00 37.88 ?  170  ALA A N     1 
ATOM   1141 C  CA    . ALA C 3 104 ? 25.443  -39.878 16.468  1.00 37.64 ?  170  ALA A CA    1 
ATOM   1142 C  C     . ALA C 3 104 ? 26.869  -39.374 16.724  1.00 37.71 ?  170  ALA A C     1 
ATOM   1143 O  O     . ALA C 3 104 ? 27.199  -38.219 16.424  1.00 37.04 ?  170  ALA A O     1 
ATOM   1144 C  CB    . ALA C 3 104 ? 24.493  -39.355 17.538  1.00 37.59 ?  170  ALA A CB    1 
ATOM   1145 N  N     . ASN C 3 105 ? 27.720  -40.225 17.283  1.00 37.55 ?  171  ASN A N     1 
ATOM   1146 C  CA    . ASN C 3 105 ? 29.078  -39.784 17.563  1.00 38.03 ?  171  ASN A CA    1 
ATOM   1147 C  C     . ASN C 3 105 ? 30.101  -40.263 16.536  1.00 37.68 ?  171  ASN A C     1 
ATOM   1148 O  O     . ASN C 3 105 ? 31.278  -39.884 16.591  1.00 37.71 ?  171  ASN A O     1 
ATOM   1149 C  CB    . ASN C 3 105 ? 29.494  -40.158 18.987  1.00 38.53 ?  171  ASN A CB    1 
ATOM   1150 C  CG    . ASN C 3 105 ? 29.141  -41.584 19.341  1.00 39.68 ?  171  ASN A CG    1 
ATOM   1151 O  OD1   . ASN C 3 105 ? 29.523  -42.077 20.403  1.00 41.62 ?  171  ASN A OD1   1 
ATOM   1152 N  ND2   . ASN C 3 105 ? 28.407  -42.260 18.454  1.00 40.93 ?  171  ASN A ND2   1 
ATOM   1153 N  N     . ASP C 3 106 ? 29.643  -41.083 15.595  1.00 37.33 ?  172  ASP A N     1 
ATOM   1154 C  CA    . ASP C 3 106 ? 30.476  -41.526 14.481  1.00 36.97 ?  172  ASP A CA    1 
ATOM   1155 C  C     . ASP C 3 106 ? 30.767  -40.355 13.532  1.00 36.90 ?  172  ASP A C     1 
ATOM   1156 O  O     . ASP C 3 106 ? 29.869  -39.863 12.841  1.00 36.22 ?  172  ASP A O     1 
ATOM   1157 C  CB    . ASP C 3 106 ? 29.772  -42.649 13.727  1.00 37.03 ?  172  ASP A CB    1 
ATOM   1158 C  CG    . ASP C 3 106 ? 30.643  -43.267 12.661  1.00 37.48 ?  172  ASP A CG    1 
ATOM   1159 O  OD1   . ASP C 3 106 ? 30.376  -44.424 12.278  1.00 38.62 ?  172  ASP A OD1   1 
ATOM   1160 O  OD2   . ASP C 3 106 ? 31.597  -42.602 12.209  1.00 38.38 ?  172  ASP A OD2   1 
ATOM   1161 N  N     . GLN C 3 107 ? 32.022  -39.914 13.499  1.00 36.65 ?  173  GLN A N     1 
ATOM   1162 C  CA    . GLN C 3 107 ? 32.404  -38.764 12.682  1.00 36.69 ?  173  GLN A CA    1 
ATOM   1163 C  C     . GLN C 3 107 ? 32.119  -38.984 11.195  1.00 36.32 ?  173  GLN A C     1 
ATOM   1164 O  O     . GLN C 3 107 ? 31.695  -38.069 10.486  1.00 36.28 ?  173  GLN A O     1 
ATOM   1165 C  CB    . GLN C 3 107 ? 33.886  -38.444 12.867  1.00 36.77 ?  173  GLN A CB    1 
ATOM   1166 C  CG    . GLN C 3 107 ? 34.313  -37.160 12.184  1.00 37.59 ?  173  GLN A CG    1 
ATOM   1167 C  CD    . GLN C 3 107 ? 33.672  -35.940 12.814  1.00 39.13 ?  173  GLN A CD    1 
ATOM   1168 O  OE1   . GLN C 3 107 ? 33.844  -35.679 14.006  1.00 39.62 ?  173  GLN A OE1   1 
ATOM   1169 N  NE2   . GLN C 3 107 ? 32.927  -35.185 12.015  1.00 39.31 ?  173  GLN A NE2   1 
ATOM   1170 N  N     . GLU C 3 108 ? 32.370  -40.200 10.725  1.00 35.61 ?  174  GLU A N     1 
ATOM   1171 C  CA    . GLU C 3 108 ? 32.132  -40.536 9.327   1.00 35.21 ?  174  GLU A CA    1 
ATOM   1172 C  C     . GLU C 3 108 ? 30.679  -40.235 8.966   1.00 34.44 ?  174  GLU A C     1 
ATOM   1173 O  O     . GLU C 3 108 ? 30.388  -39.720 7.882   1.00 34.25 ?  174  GLU A O     1 
ATOM   1174 C  CB    . GLU C 3 108 ? 32.449  -42.018 9.070   1.00 35.31 ?  174  GLU A CB    1 
ATOM   1175 C  CG    . GLU C 3 108 ? 32.216  -42.472 7.637   1.00 37.11 ?  174  GLU A CG    1 
ATOM   1176 C  CD    . GLU C 3 108 ? 33.490  -42.935 6.935   1.00 39.84 ?  174  GLU A CD    1 
ATOM   1177 O  OE1   . GLU C 3 108 ? 33.848  -42.333 5.893   1.00 41.66 ?  174  GLU A OE1   1 
ATOM   1178 O  OE2   . GLU C 3 108 ? 34.129  -43.906 7.414   1.00 39.26 ?  174  GLU A OE2   1 
ATOM   1179 N  N     . GLN C 3 109 ? 29.771  -40.560 9.881   1.00 33.34 ?  175  GLN A N     1 
ATOM   1180 C  CA    . GLN C 3 109 ? 28.350  -40.380 9.644   1.00 32.59 ?  175  GLN A CA    1 
ATOM   1181 C  C     . GLN C 3 109 ? 27.949  -38.909 9.664   1.00 32.41 ?  175  GLN A C     1 
ATOM   1182 O  O     . GLN C 3 109 ? 27.092  -38.485 8.886   1.00 32.12 ?  175  GLN A O     1 
ATOM   1183 C  CB    . GLN C 3 109 ? 27.527  -41.185 10.652  1.00 32.54 ?  175  GLN A CB    1 
ATOM   1184 C  CG    . GLN C 3 109 ? 27.659  -42.697 10.475  1.00 32.33 ?  175  GLN A CG    1 
ATOM   1185 C  CD    . GLN C 3 109 ? 27.164  -43.154 9.115   1.00 32.28 ?  175  GLN A CD    1 
ATOM   1186 O  OE1   . GLN C 3 109 ? 26.119  -42.704 8.640   1.00 32.35 ?  175  GLN A OE1   1 
ATOM   1187 N  NE2   . GLN C 3 109 ? 27.915  -44.046 8.476   1.00 32.82 ?  175  GLN A NE2   1 
ATOM   1188 N  N     . ILE C 3 110 ? 28.561  -38.141 10.566  1.00 31.76 ?  176  ILE A N     1 
ATOM   1189 C  CA    . ILE C 3 110 ? 28.338  -36.702 10.624  1.00 31.38 ?  176  ILE A CA    1 
ATOM   1190 C  C     . ILE C 3 110 ? 28.804  -36.052 9.324   1.00 30.72 ?  176  ILE A C     1 
ATOM   1191 O  O     . ILE C 3 110 ? 28.130  -35.169 8.774   1.00 30.30 ?  176  ILE A O     1 
ATOM   1192 C  CB    . ILE C 3 110 ? 29.054  -36.063 11.851  1.00 31.93 ?  176  ILE A CB    1 
ATOM   1193 C  CG1   . ILE C 3 110 ? 28.442  -36.584 13.156  1.00 31.95 ?  176  ILE A CG1   1 
ATOM   1194 C  CG2   . ILE C 3 110 ? 28.967  -34.541 11.798  1.00 30.69 ?  176  ILE A CG2   1 
ATOM   1195 C  CD1   . ILE C 3 110 ? 29.100  -36.038 14.422  1.00 33.53 ?  176  ILE A CD1   1 
ATOM   1196 N  N     . ASN C 3 111 ? 29.948  -36.515 8.824   1.00 30.11 ?  177  ASN A N     1 
ATOM   1197 C  CA    . ASN C 3 111 ? 30.486  -36.052 7.549   1.00 29.62 ?  177  ASN A CA    1 
ATOM   1198 C  C     . ASN C 3 111 ? 29.526  -36.358 6.405   1.00 29.33 ?  177  ASN A C     1 
ATOM   1199 O  O     . ASN C 3 111 ? 29.328  -35.540 5.504   1.00 28.80 ?  177  ASN A O     1 
ATOM   1200 C  CB    . ASN C 3 111 ? 31.831  -36.719 7.257   1.00 29.59 ?  177  ASN A CB    1 
ATOM   1201 C  CG    . ASN C 3 111 ? 32.952  -36.204 8.149   1.00 30.99 ?  177  ASN A CG    1 
ATOM   1202 O  OD1   . ASN C 3 111 ? 32.744  -35.324 8.988   1.00 33.15 ?  177  ASN A OD1   1 
ATOM   1203 N  ND2   . ASN C 3 111 ? 34.153  -36.765 7.976   1.00 31.70 ?  177  ASN A ND2   1 
ATOM   1204 N  N     . LYS C 3 112 ? 28.946  -37.555 6.433   1.00 28.83 ?  178  LYS A N     1 
ATOM   1205 C  CA    . LYS C 3 112 ? 27.989  -37.937 5.406   1.00 28.30 ?  178  LYS A CA    1 
ATOM   1206 C  C     . LYS C 3 112 ? 26.704  -37.108 5.513   1.00 27.62 ?  178  LYS A C     1 
ATOM   1207 O  O     . LYS C 3 112 ? 26.099  -36.757 4.500   1.00 26.94 ?  178  LYS A O     1 
ATOM   1208 C  CB    . LYS C 3 112 ? 27.699  -39.436 5.461   1.00 27.93 ?  178  LYS A CB    1 
ATOM   1209 C  CG    . LYS C 3 112 ? 28.823  -40.282 4.868   1.00 28.13 ?  178  LYS A CG    1 
ATOM   1210 C  CD    . LYS C 3 112 ? 28.613  -41.759 5.169   1.00 28.88 ?  178  LYS A CD    1 
ATOM   1211 C  CE    . LYS C 3 112 ? 29.841  -42.556 4.809   1.00 30.94 ?  178  LYS A CE    1 
ATOM   1212 N  NZ    . LYS C 3 112 ? 29.478  -43.794 4.064   1.00 32.82 ?  178  LYS A NZ    1 
ATOM   1213 N  N     . PHE C 3 113 ? 26.301  -36.771 6.738   1.00 27.02 ?  179  PHE A N     1 
ATOM   1214 C  CA    . PHE C 3 113 ? 25.099  -35.966 6.924   1.00 26.16 ?  179  PHE A CA    1 
ATOM   1215 C  C     . PHE C 3 113 ? 25.342  -34.587 6.342   1.00 27.14 ?  179  PHE A C     1 
ATOM   1216 O  O     . PHE C 3 113 ? 24.459  -34.012 5.677   1.00 27.30 ?  179  PHE A O     1 
ATOM   1217 C  CB    . PHE C 3 113 ? 24.722  -35.883 8.411   1.00 26.77 ?  179  PHE A CB    1 
ATOM   1218 C  CG    . PHE C 3 113 ? 23.494  -35.044 8.701   1.00 25.95 ?  179  PHE A CG    1 
ATOM   1219 C  CD1   . PHE C 3 113 ? 22.292  -35.271 8.031   1.00 25.65 ?  179  PHE A CD1   1 
ATOM   1220 C  CD2   . PHE C 3 113 ? 23.524  -34.082 9.696   1.00 24.90 ?  179  PHE A CD2   1 
ATOM   1221 C  CE1   . PHE C 3 113 ? 21.158  -34.506 8.324   1.00 24.42 ?  179  PHE A CE1   1 
ATOM   1222 C  CE2   . PHE C 3 113 ? 22.393  -33.318 10.000  1.00 24.79 ?  179  PHE A CE2   1 
ATOM   1223 C  CZ    . PHE C 3 113 ? 21.210  -33.534 9.311   1.00 25.25 ?  179  PHE A CZ    1 
ATOM   1224 N  N     . VAL C 3 114 ? 26.534  -34.050 6.580   1.00 27.20 ?  180  VAL A N     1 
ATOM   1225 C  CA    . VAL C 3 114 ? 26.927  -32.767 5.987   1.00 27.85 ?  180  VAL A CA    1 
ATOM   1226 C  C     . VAL C 3 114 ? 26.864  -32.781 4.443   1.00 27.83 ?  180  VAL A C     1 
ATOM   1227 O  O     . VAL C 3 114 ? 26.401  -31.822 3.818   1.00 27.20 ?  180  VAL A O     1 
ATOM   1228 C  CB    . VAL C 3 114 ? 28.318  -32.331 6.475   1.00 28.07 ?  180  VAL A CB    1 
ATOM   1229 C  CG1   . VAL C 3 114 ? 28.809  -31.113 5.694   1.00 28.95 ?  180  VAL A CG1   1 
ATOM   1230 C  CG2   . VAL C 3 114 ? 28.268  -32.020 7.974   1.00 28.51 ?  180  VAL A CG2   1 
ATOM   1231 N  N     . HIS C 3 115 ? 27.313  -33.878 3.839   1.00 27.93 ?  181  HIS A N     1 
ATOM   1232 C  CA    . HIS C 3 115 ? 27.210  -34.058 2.392   1.00 28.31 ?  181  HIS A CA    1 
ATOM   1233 C  C     . HIS C 3 115 ? 25.747  -34.067 1.943   1.00 28.16 ?  181  HIS A C     1 
ATOM   1234 O  O     . HIS C 3 115 ? 25.367  -33.408 0.974   1.00 27.54 ?  181  HIS A O     1 
ATOM   1235 C  CB    . HIS C 3 115 ? 27.880  -35.367 1.965   1.00 28.63 ?  181  HIS A CB    1 
ATOM   1236 C  CG    . HIS C 3 115 ? 27.760  -35.648 0.501   1.00 30.44 ?  181  HIS A CG    1 
ATOM   1237 N  ND1   . HIS C 3 115 ? 28.584  -35.065 -0.438  1.00 33.16 ?  181  HIS A ND1   1 
ATOM   1238 C  CD2   . HIS C 3 115 ? 26.903  -36.437 -0.191  1.00 31.69 ?  181  HIS A CD2   1 
ATOM   1239 C  CE1   . HIS C 3 115 ? 28.243  -35.483 -1.644  1.00 32.59 ?  181  HIS A CE1   1 
ATOM   1240 N  NE2   . HIS C 3 115 ? 27.225  -36.316 -1.523  1.00 32.25 ?  181  HIS A NE2   1 
ATOM   1241 N  N     . TYR C 3 116 ? 24.932  -34.830 2.664   1.00 28.39 ?  182  TYR A N     1 
ATOM   1242 C  CA    . TYR C 3 116 ? 23.488  -34.854 2.462   1.00 28.17 ?  182  TYR A CA    1 
ATOM   1243 C  C     . TYR C 3 116 ? 22.853  -33.450 2.541   1.00 28.10 ?  182  TYR A C     1 
ATOM   1244 O  O     . TYR C 3 116 ? 22.024  -33.096 1.704   1.00 28.05 ?  182  TYR A O     1 
ATOM   1245 C  CB    . TYR C 3 116 ? 22.868  -35.822 3.480   1.00 28.62 ?  182  TYR A CB    1 
ATOM   1246 C  CG    . TYR C 3 116 ? 21.358  -35.852 3.529   1.00 28.60 ?  182  TYR A CG    1 
ATOM   1247 C  CD1   . TYR C 3 116 ? 20.637  -36.783 2.792   1.00 30.40 ?  182  TYR A CD1   1 
ATOM   1248 C  CD2   . TYR C 3 116 ? 20.661  -34.962 4.339   1.00 29.37 ?  182  TYR A CD2   1 
ATOM   1249 C  CE1   . TYR C 3 116 ? 19.254  -36.820 2.856   1.00 31.03 ?  182  TYR A CE1   1 
ATOM   1250 C  CE2   . TYR C 3 116 ? 19.297  -34.990 4.413   1.00 29.81 ?  182  TYR A CE2   1 
ATOM   1251 C  CZ    . TYR C 3 116 ? 18.598  -35.920 3.673   1.00 31.00 ?  182  TYR A CZ    1 
ATOM   1252 O  OH    . TYR C 3 116 ? 17.230  -35.931 3.751   1.00 33.79 ?  182  TYR A OH    1 
ATOM   1253 N  N     . LEU C 3 117 ? 23.247  -32.639 3.525   1.00 27.79 ?  183  LEU A N     1 
ATOM   1254 C  CA    . LEU C 3 117 ? 22.721  -31.272 3.623   1.00 27.68 ?  183  LEU A CA    1 
ATOM   1255 C  C     . LEU C 3 117 ? 23.234  -30.388 2.475   1.00 27.51 ?  183  LEU A C     1 
ATOM   1256 O  O     . LEU C 3 117 ? 22.511  -29.546 1.946   1.00 26.87 ?  183  LEU A O     1 
ATOM   1257 C  CB    . LEU C 3 117 ? 23.084  -30.638 4.975   1.00 27.88 ?  183  LEU A CB    1 
ATOM   1258 C  CG    . LEU C 3 117 ? 22.499  -31.281 6.241   1.00 27.94 ?  183  LEU A CG    1 
ATOM   1259 C  CD1   . LEU C 3 117 ? 23.090  -30.620 7.503   1.00 28.54 ?  183  LEU A CD1   1 
ATOM   1260 C  CD2   . LEU C 3 117 ? 20.964  -31.182 6.239   1.00 26.54 ?  183  LEU A CD2   1 
ATOM   1261 N  N     . ASN C 3 118 ? 24.487  -30.567 2.093   1.00 27.25 ?  184  ASN A N     1 
ATOM   1262 C  CA    . ASN C 3 118 ? 25.011  -29.798 0.965   1.00 27.75 ?  184  ASN A CA    1 
ATOM   1263 C  C     . ASN C 3 118 ? 24.318  -30.095 -0.358  1.00 27.01 ?  184  ASN A C     1 
ATOM   1264 O  O     . ASN C 3 118 ? 24.172  -29.212 -1.202  1.00 26.22 ?  184  ASN A O     1 
ATOM   1265 C  CB    . ASN C 3 118 ? 26.527  -29.944 0.842   1.00 27.68 ?  184  ASN A CB    1 
ATOM   1266 C  CG    . ASN C 3 118 ? 27.257  -28.912 1.658   1.00 28.97 ?  184  ASN A CG    1 
ATOM   1267 O  OD1   . ASN C 3 118 ? 26.911  -27.728 1.616   1.00 28.81 ?  184  ASN A OD1   1 
ATOM   1268 N  ND2   . ASN C 3 118 ? 28.261  -29.348 2.422   1.00 27.60 ?  184  ASN A ND2   1 
ATOM   1269 N  N     . GLU C 3 119 ? 23.865  -31.331 -0.514  1.00 27.03 ?  185  GLU A N     1 
ATOM   1270 C  CA    . GLU C 3 119 ? 23.076  -31.717 -1.673  1.00 27.78 ?  185  GLU A CA    1 
ATOM   1271 C  C     . GLU C 3 119 ? 21.732  -31.020 -1.687  1.00 27.27 ?  185  GLU A C     1 
ATOM   1272 O  O     . GLU C 3 119 ? 21.065  -30.984 -2.716  1.00 27.74 ?  185  GLU A O     1 
ATOM   1273 C  CB    . GLU C 3 119 ? 22.754  -33.204 -1.628  1.00 28.47 ?  185  GLU A CB    1 
ATOM   1274 C  CG    . GLU C 3 119 ? 23.792  -34.158 -2.143  1.00 31.57 ?  185  GLU A CG    1 
ATOM   1275 C  CD    . GLU C 3 119 ? 23.279  -35.583 -2.054  1.00 37.26 ?  185  GLU A CD    1 
ATOM   1276 O  OE1   . GLU C 3 119 ? 23.631  -36.400 -2.934  1.00 40.51 ?  185  GLU A OE1   1 
ATOM   1277 O  OE2   . GLU C 3 119 ? 22.483  -35.878 -1.121  1.00 37.76 ?  185  GLU A OE2   1 
ATOM   1278 N  N     . THR C 3 120 ? 21.304  -30.514 -0.536  1.00 26.21 ?  186  THR A N     1 
ATOM   1279 C  CA    . THR C 3 120 ? 19.917  -30.106 -0.368  1.00 24.86 ?  186  THR A CA    1 
ATOM   1280 C  C     . THR C 3 120 ? 19.853  -28.601 -0.302  1.00 25.26 ?  186  THR A C     1 
ATOM   1281 O  O     . THR C 3 120 ? 18.854  -27.982 -0.685  1.00 24.56 ?  186  THR A O     1 
ATOM   1282 C  CB    . THR C 3 120 ? 19.358  -30.722 0.938   1.00 25.03 ?  186  THR A CB    1 
ATOM   1283 O  OG1   . THR C 3 120 ? 19.522  -32.139 0.877   1.00 23.34 ?  186  THR A OG1   1 
ATOM   1284 C  CG2   . THR C 3 120 ? 17.875  -30.398 1.152   1.00 24.25 ?  186  THR A CG2   1 
ATOM   1285 N  N     . PHE C 3 121 ? 20.934  -27.999 0.172   1.00 25.23 ?  187  PHE A N     1 
ATOM   1286 C  CA    . PHE C 3 121 ? 20.922  -26.573 0.419   1.00 26.74 ?  187  PHE A CA    1 
ATOM   1287 C  C     . PHE C 3 121 ? 22.024  -25.835 -0.356  1.00 27.81 ?  187  PHE A C     1 
ATOM   1288 O  O     . PHE C 3 121 ? 22.825  -25.107 0.236   1.00 28.85 ?  187  PHE A O     1 
ATOM   1289 C  CB    . PHE C 3 121 ? 21.009  -26.307 1.937   1.00 27.18 ?  187  PHE A CB    1 
ATOM   1290 C  CG    . PHE C 3 121 ? 19.830  -26.843 2.713   1.00 25.17 ?  187  PHE A CG    1 
ATOM   1291 C  CD1   . PHE C 3 121 ? 18.627  -26.164 2.724   1.00 24.66 ?  187  PHE A CD1   1 
ATOM   1292 C  CD2   . PHE C 3 121 ? 19.932  -28.033 3.415   1.00 25.72 ?  187  PHE A CD2   1 
ATOM   1293 C  CE1   . PHE C 3 121 ? 17.548  -26.652 3.425   1.00 24.94 ?  187  PHE A CE1   1 
ATOM   1294 C  CE2   . PHE C 3 121 ? 18.857  -28.544 4.122   1.00 25.64 ?  187  PHE A CE2   1 
ATOM   1295 C  CZ    . PHE C 3 121 ? 17.663  -27.854 4.136   1.00 25.33 ?  187  PHE A CZ    1 
ATOM   1296 N  N     . ASP C 3 122 ? 22.067  -26.037 -1.675  1.00 28.27 ?  188  ASP A N     1 
ATOM   1297 C  CA    . ASP C 3 122 ? 22.953  -25.251 -2.554  1.00 28.81 ?  188  ASP A CA    1 
ATOM   1298 C  C     . ASP C 3 122 ? 24.421  -25.257 -2.090  1.00 29.00 ?  188  ASP A C     1 
ATOM   1299 O  O     . ASP C 3 122 ? 25.110  -24.245 -2.197  1.00 28.52 ?  188  ASP A O     1 
ATOM   1300 C  CB    . ASP C 3 122 ? 22.436  -23.802 -2.644  1.00 29.05 ?  188  ASP A CB    1 
ATOM   1301 C  CG    . ASP C 3 122 ? 23.208  -22.947 -3.643  1.00 29.86 ?  188  ASP A CG    1 
ATOM   1302 O  OD1   . ASP C 3 122 ? 23.524  -23.444 -4.740  1.00 31.30 ?  188  ASP A OD1   1 
ATOM   1303 O  OD2   . ASP C 3 122 ? 23.474  -21.761 -3.335  1.00 31.70 ?  188  ASP A OD2   1 
ATOM   1304 N  N     . HIS C 3 123 ? 24.883  -26.395 -1.568  1.00 29.54 ?  189  HIS A N     1 
ATOM   1305 C  CA    . HIS C 3 123 ? 26.286  -26.586 -1.190  1.00 30.16 ?  189  HIS A CA    1 
ATOM   1306 C  C     . HIS C 3 123 ? 26.769  -25.516 -0.233  1.00 30.64 ?  189  HIS A C     1 
ATOM   1307 O  O     . HIS C 3 123 ? 27.913  -25.088 -0.298  1.00 30.82 ?  189  HIS A O     1 
ATOM   1308 C  CB    . HIS C 3 123 ? 27.175  -26.646 -2.443  1.00 30.61 ?  189  HIS A CB    1 
ATOM   1309 C  CG    . HIS C 3 123 ? 26.754  -27.712 -3.405  1.00 31.37 ?  189  HIS A CG    1 
ATOM   1310 N  ND1   . HIS C 3 123 ? 26.028  -27.440 -4.545  1.00 33.57 ?  189  HIS A ND1   1 
ATOM   1311 C  CD2   . HIS C 3 123 ? 26.895  -29.056 -3.360  1.00 30.20 ?  189  HIS A CD2   1 
ATOM   1312 C  CE1   . HIS C 3 123 ? 25.774  -28.570 -5.180  1.00 32.81 ?  189  HIS A CE1   1 
ATOM   1313 N  NE2   . HIS C 3 123 ? 26.276  -29.566 -4.476  1.00 32.58 ?  189  HIS A NE2   1 
ATOM   1314 N  N     . ALA C 3 124 ? 25.896  -25.100 0.671   1.00 30.94 ?  190  ALA A N     1 
ATOM   1315 C  CA    . ALA C 3 124 ? 26.213  -23.996 1.558   1.00 31.27 ?  190  ALA A CA    1 
ATOM   1316 C  C     . ALA C 3 124 ? 26.394  -24.402 3.026   1.00 31.42 ?  190  ALA A C     1 
ATOM   1317 O  O     . ALA C 3 124 ? 26.391  -23.546 3.907   1.00 32.41 ?  190  ALA A O     1 
ATOM   1318 C  CB    . ALA C 3 124 ? 25.147  -22.907 1.432   1.00 31.53 ?  190  ALA A CB    1 
ATOM   1319 N  N     . ILE C 3 125 ? 26.555  -25.691 3.304   1.00 31.18 ?  191  ILE A N     1 
ATOM   1320 C  CA    . ILE C 3 125 ? 26.791  -26.107 4.685   1.00 31.38 ?  191  ILE A CA    1 
ATOM   1321 C  C     . ILE C 3 125 ? 28.279  -26.369 4.890   1.00 30.39 ?  191  ILE A C     1 
ATOM   1322 O  O     . ILE C 3 125 ? 28.853  -27.227 4.230   1.00 30.36 ?  191  ILE A O     1 
ATOM   1323 C  CB    . ILE C 3 125 ? 25.971  -27.357 5.085   1.00 31.80 ?  191  ILE A CB    1 
ATOM   1324 C  CG1   . ILE C 3 125 ? 24.495  -26.992 5.286   1.00 34.64 ?  191  ILE A CG1   1 
ATOM   1325 C  CG2   . ILE C 3 125 ? 26.497  -27.928 6.389   1.00 32.10 ?  191  ILE A CG2   1 
ATOM   1326 C  CD1   . ILE C 3 125 ? 23.734  -26.896 4.002   1.00 34.67 ?  191  ILE A CD1   1 
ATOM   1327 N  N     . ASP C 3 126 ? 28.903  -25.604 5.780   1.00 29.28 ?  192  ASP A N     1 
ATOM   1328 C  CA    . ASP C 3 126 ? 30.337  -25.715 6.000   1.00 28.47 ?  192  ASP A CA    1 
ATOM   1329 C  C     . ASP C 3 126 ? 30.748  -26.949 6.792   1.00 28.23 ?  192  ASP A C     1 
ATOM   1330 O  O     . ASP C 3 126 ? 31.608  -27.713 6.361   1.00 28.03 ?  192  ASP A O     1 
ATOM   1331 C  CB    . ASP C 3 126 ? 30.900  -24.483 6.710   1.00 27.61 ?  192  ASP A CB    1 
ATOM   1332 C  CG    . ASP C 3 126 ? 32.402  -24.599 6.950   1.00 28.52 ?  192  ASP A CG    1 
ATOM   1333 O  OD1   . ASP C 3 126 ? 33.185  -24.387 6.003   1.00 28.39 ?  192  ASP A OD1   1 
ATOM   1334 O  OD2   . ASP C 3 126 ? 32.803  -24.928 8.084   1.00 29.69 ?  192  ASP A OD2   1 
ATOM   1335 N  N     . SER C 3 127 ? 30.150  -27.123 7.960   1.00 27.82 ?  193  SER A N     1 
ATOM   1336 C  CA    . SER C 3 127 ? 30.591  -28.149 8.887   1.00 28.00 ?  193  SER A CA    1 
ATOM   1337 C  C     . SER C 3 127 ? 29.631  -28.232 10.067  1.00 27.88 ?  193  SER A C     1 
ATOM   1338 O  O     . SER C 3 127 ? 28.776  -27.364 10.259  1.00 28.05 ?  193  SER A O     1 
ATOM   1339 C  CB    . SER C 3 127 ? 31.977  -27.799 9.413   1.00 27.88 ?  193  SER A CB    1 
ATOM   1340 O  OG    . SER C 3 127 ? 31.964  -26.471 9.936   1.00 28.66 ?  193  SER A OG    1 
ATOM   1341 N  N     . ILE C 3 128 ? 29.784  -29.274 10.869  1.00 27.75 ?  194  ILE A N     1 
ATOM   1342 C  CA    . ILE C 3 128 ? 29.021  -29.386 12.104  1.00 27.93 ?  194  ILE A CA    1 
ATOM   1343 C  C     . ILE C 3 128 ? 29.986  -29.531 13.261  1.00 27.96 ?  194  ILE A C     1 
ATOM   1344 O  O     . ILE C 3 128 ? 30.860  -30.380 13.229  1.00 28.08 ?  194  ILE A O     1 
ATOM   1345 C  CB    . ILE C 3 128 ? 28.104  -30.613 12.088  1.00 28.16 ?  194  ILE A CB    1 
ATOM   1346 C  CG1   . ILE C 3 128 ? 26.968  -30.422 11.085  1.00 27.47 ?  194  ILE A CG1   1 
ATOM   1347 C  CG2   . ILE C 3 128 ? 27.547  -30.884 13.481  1.00 27.81 ?  194  ILE A CG2   1 
ATOM   1348 C  CD1   . ILE C 3 128 ? 26.073  -31.646 10.945  1.00 25.87 ?  194  ILE A CD1   1 
ATOM   1349 N  N     . GLU C 3 129 ? 29.834  -28.702 14.284  1.00 28.44 ?  195  GLU A N     1 
ATOM   1350 C  CA    . GLU C 3 129 ? 30.697  -28.781 15.467  1.00 28.58 ?  195  GLU A CA    1 
ATOM   1351 C  C     . GLU C 3 129 ? 29.849  -29.303 16.627  1.00 28.58 ?  195  GLU A C     1 
ATOM   1352 O  O     . GLU C 3 129 ? 28.730  -28.838 16.827  1.00 27.60 ?  195  GLU A O     1 
ATOM   1353 C  CB    . GLU C 3 129 ? 31.244  -27.393 15.803  1.00 28.64 ?  195  GLU A CB    1 
ATOM   1354 C  CG    . GLU C 3 129 ? 32.136  -27.320 17.042  1.00 29.90 ?  195  GLU A CG    1 
ATOM   1355 C  CD    . GLU C 3 129 ? 32.511  -25.877 17.408  1.00 33.35 ?  195  GLU A CD    1 
ATOM   1356 O  OE1   . GLU C 3 129 ? 32.130  -24.947 16.656  1.00 33.70 ?  195  GLU A OE1   1 
ATOM   1357 O  OE2   . GLU C 3 129 ? 33.192  -25.673 18.446  1.00 33.46 ?  195  GLU A OE2   1 
ATOM   1358 N  N     . VAL C 3 130 ? 30.364  -30.269 17.382  1.00 27.99 ?  196  VAL A N     1 
ATOM   1359 C  CA    . VAL C 3 130 ? 29.623  -30.768 18.539  1.00 28.34 ?  196  VAL A CA    1 
ATOM   1360 C  C     . VAL C 3 130 ? 29.895  -29.890 19.772  1.00 28.59 ?  196  VAL A C     1 
ATOM   1361 O  O     . VAL C 3 130 ? 31.043  -29.689 20.156  1.00 28.63 ?  196  VAL A O     1 
ATOM   1362 C  CB    . VAL C 3 130 ? 29.953  -32.254 18.836  1.00 28.27 ?  196  VAL A CB    1 
ATOM   1363 C  CG1   . VAL C 3 130 ? 29.079  -32.779 19.972  1.00 28.62 ?  196  VAL A CG1   1 
ATOM   1364 C  CG2   . VAL C 3 130 ? 29.750  -33.102 17.578  1.00 28.15 ?  196  VAL A CG2   1 
ATOM   1365 N  N     . VAL C 3 131 ? 28.841  -29.343 20.371  1.00 28.76 ?  197  VAL A N     1 
ATOM   1366 C  CA    . VAL C 3 131 ? 29.006  -28.492 21.552  1.00 28.96 ?  197  VAL A CA    1 
ATOM   1367 C  C     . VAL C 3 131 ? 28.093  -28.928 22.707  1.00 29.02 ?  197  VAL A C     1 
ATOM   1368 O  O     . VAL C 3 131 ? 27.098  -29.612 22.491  1.00 29.84 ?  197  VAL A O     1 
ATOM   1369 C  CB    . VAL C 3 131 ? 28.727  -27.011 21.204  1.00 29.00 ?  197  VAL A CB    1 
ATOM   1370 C  CG1   . VAL C 3 131 ? 29.694  -26.530 20.146  1.00 30.03 ?  197  VAL A CG1   1 
ATOM   1371 C  CG2   . VAL C 3 131 ? 27.288  -26.822 20.739  1.00 27.08 ?  197  VAL A CG2   1 
ATOM   1372 N  N     . SER C 3 132 ? 28.439  -28.535 23.929  1.00 28.78 ?  198  SER A N     1 
ATOM   1373 C  CA    . SER C 3 132 ? 27.590  -28.783 25.086  1.00 28.41 ?  198  SER A CA    1 
ATOM   1374 C  C     . SER C 3 132 ? 26.808  -27.530 25.424  1.00 27.89 ?  198  SER A C     1 
ATOM   1375 O  O     . SER C 3 132 ? 27.399  -26.496 25.715  1.00 27.49 ?  198  SER A O     1 
ATOM   1376 C  CB    . SER C 3 132 ? 28.424  -29.192 26.302  1.00 28.19 ?  198  SER A CB    1 
ATOM   1377 O  OG    . SER C 3 132 ? 28.679  -30.577 26.264  1.00 30.22 ?  198  SER A OG    1 
ATOM   1378 N  N     . LYS C 3 133 ? 25.482  -27.622 25.380  1.00 27.78 ?  199  LYS A N     1 
ATOM   1379 C  CA    . LYS C 3 133 ? 24.628  -26.483 25.734  1.00 27.81 ?  199  LYS A CA    1 
ATOM   1380 C  C     . LYS C 3 133 ? 23.458  -26.961 26.583  1.00 28.14 ?  199  LYS A C     1 
ATOM   1381 O  O     . LYS C 3 133 ? 23.253  -28.171 26.737  1.00 27.53 ?  199  LYS A O     1 
ATOM   1382 C  CB    . LYS C 3 133 ? 24.085  -25.795 24.477  1.00 27.91 ?  199  LYS A CB    1 
ATOM   1383 C  CG    . LYS C 3 133 ? 25.139  -25.268 23.499  1.00 26.46 ?  199  LYS A CG    1 
ATOM   1384 C  CD    . LYS C 3 133 ? 25.821  -24.008 24.038  1.00 27.72 ?  199  LYS A CD    1 
ATOM   1385 C  CE    . LYS C 3 133 ? 26.719  -23.419 22.985  1.00 27.28 ?  199  LYS A CE    1 
ATOM   1386 N  NZ    . LYS C 3 133 ? 27.250  -22.092 23.368  1.00 29.08 ?  199  LYS A NZ    1 
ATOM   1387 N  N     . GLN C 3 134 ? 22.704  -26.002 27.132  1.00 28.03 ?  200  GLN A N     1 
ATOM   1388 C  CA    . GLN C 3 134 ? 21.401  -26.277 27.721  1.00 27.83 ?  200  GLN A CA    1 
ATOM   1389 C  C     . GLN C 3 134 ? 20.366  -25.307 27.151  1.00 27.43 ?  200  GLN A C     1 
ATOM   1390 O  O     . GLN C 3 134 ? 20.696  -24.181 26.775  1.00 26.95 ?  200  GLN A O     1 
ATOM   1391 C  CB    . GLN C 3 134 ? 21.452  -26.222 29.258  1.00 28.49 ?  200  GLN A CB    1 
ATOM   1392 C  CG    . GLN C 3 134 ? 21.885  -24.881 29.844  1.00 31.41 ?  200  GLN A CG    1 
ATOM   1393 C  CD    . GLN C 3 134 ? 22.408  -25.002 31.265  1.00 36.20 ?  200  GLN A CD    1 
ATOM   1394 O  OE1   . GLN C 3 134 ? 23.097  -24.111 31.763  1.00 39.35 ?  200  GLN A OE1   1 
ATOM   1395 N  NE2   . GLN C 3 134 ? 22.091  -26.114 31.925  1.00 38.19 ?  200  GLN A NE2   1 
ATOM   1396 N  N     . SER C 3 135 ? 19.124  -25.764 27.043  1.00 26.54 ?  201  SER A N     1 
ATOM   1397 C  CA    . SER C 3 135 ? 18.049  -24.902 26.614  1.00 26.38 ?  201  SER A CA    1 
ATOM   1398 C  C     . SER C 3 135 ? 17.762  -23.899 27.713  1.00 26.02 ?  201  SER A C     1 
ATOM   1399 O  O     . SER C 3 135 ? 17.929  -24.193 28.912  1.00 25.28 ?  201  SER A O     1 
ATOM   1400 C  CB    . SER C 3 135 ? 16.778  -25.691 26.287  1.00 26.53 ?  201  SER A CB    1 
ATOM   1401 O  OG    . SER C 3 135 ? 15.696  -24.803 25.994  1.00 26.81 ?  201  SER A OG    1 
ATOM   1402 N  N     . ILE C 3 136 ? 17.342  -22.710 27.303  1.00 25.07 ?  202  ILE A N     1 
ATOM   1403 C  CA    . ILE C 3 136 ? 16.997  -21.679 28.255  1.00 24.38 ?  202  ILE A CA    1 
ATOM   1404 C  C     . ILE C 3 136 ? 15.689  -22.062 28.964  1.00 24.54 ?  202  ILE A C     1 
ATOM   1405 O  O     . ILE C 3 136 ? 15.332  -21.477 29.993  1.00 24.54 ?  202  ILE A O     1 
ATOM   1406 C  CB    . ILE C 3 136 ? 16.834  -20.304 27.557  1.00 24.42 ?  202  ILE A CB    1 
ATOM   1407 C  CG1   . ILE C 3 136 ? 16.902  -19.168 28.586  1.00 22.56 ?  202  ILE A CG1   1 
ATOM   1408 C  CG2   . ILE C 3 136 ? 15.538  -20.271 26.759  1.00 24.46 ?  202  ILE A CG2   1 
ATOM   1409 C  CD1   . ILE C 3 136 ? 16.473  -17.793 28.064  1.00 20.56 ?  202  ILE A CD1   1 
ATOM   1410 N  N     . TRP C 3 137 ? 14.981  -23.053 28.425  1.00 24.68 ?  203  TRP A N     1 
ATOM   1411 C  CA    . TRP C 3 137 ? 13.656  -23.341 28.926  1.00 25.02 ?  203  TRP A CA    1 
ATOM   1412 C  C     . TRP C 3 137 ? 13.644  -24.250 30.149  1.00 24.84 ?  203  TRP A C     1 
ATOM   1413 O  O     . TRP C 3 137 ? 13.587  -25.461 30.016  1.00 24.91 ?  203  TRP A O     1 
ATOM   1414 C  CB    . TRP C 3 137 ? 12.758  -23.942 27.846  1.00 25.52 ?  203  TRP A CB    1 
ATOM   1415 C  CG    . TRP C 3 137 ? 11.329  -23.829 28.231  1.00 26.20 ?  203  TRP A CG    1 
ATOM   1416 C  CD1   . TRP C 3 137 ? 10.585  -24.749 28.912  1.00 27.93 ?  203  TRP A CD1   1 
ATOM   1417 C  CD2   . TRP C 3 137 ? 10.466  -22.711 27.985  1.00 27.60 ?  203  TRP A CD2   1 
ATOM   1418 N  NE1   . TRP C 3 137 ? 9.304   -24.275 29.102  1.00 29.92 ?  203  TRP A NE1   1 
ATOM   1419 C  CE2   . TRP C 3 137 ? 9.203   -23.028 28.536  1.00 29.33 ?  203  TRP A CE2   1 
ATOM   1420 C  CE3   . TRP C 3 137 ? 10.632  -21.481 27.331  1.00 28.27 ?  203  TRP A CE3   1 
ATOM   1421 C  CZ2   . TRP C 3 137 ? 8.110   -22.155 28.465  1.00 29.05 ?  203  TRP A CZ2   1 
ATOM   1422 C  CZ3   . TRP C 3 137 ? 9.546   -20.609 27.265  1.00 29.71 ?  203  TRP A CZ3   1 
ATOM   1423 C  CH2   . TRP C 3 137 ? 8.300   -20.953 27.830  1.00 29.32 ?  203  TRP A CH2   1 
ATOM   1424 N  N     . GLY C 3 138 ? 13.701  -23.660 31.333  1.00 24.65 ?  204  GLY A N     1 
ATOM   1425 C  CA    . GLY C 3 138 ? 13.481  -24.415 32.559  1.00 25.00 ?  204  GLY A CA    1 
ATOM   1426 C  C     . GLY C 3 138 ? 14.718  -24.919 33.277  1.00 25.70 ?  204  GLY A C     1 
ATOM   1427 O  O     . GLY C 3 138 ? 15.823  -24.930 32.728  1.00 24.90 ?  204  GLY A O     1 
ATOM   1428 N  N     . TYR C 3 139 ? 14.516  -25.329 34.524  1.00 25.94 ?  205  TYR A N     1 
ATOM   1429 C  CA    . TYR C 3 139 ? 15.557  -25.931 35.319  1.00 27.15 ?  205  TYR A CA    1 
ATOM   1430 C  C     . TYR C 3 139 ? 15.302  -27.435 35.365  1.00 28.66 ?  205  TYR A C     1 
ATOM   1431 O  O     . TYR C 3 139 ? 14.269  -27.880 35.865  1.00 28.05 ?  205  TYR A O     1 
ATOM   1432 C  CB    . TYR C 3 139 ? 15.522  -25.366 36.745  1.00 26.61 ?  205  TYR A CB    1 
ATOM   1433 C  CG    . TYR C 3 139 ? 16.529  -26.012 37.672  1.00 25.30 ?  205  TYR A CG    1 
ATOM   1434 C  CD1   . TYR C 3 139 ? 17.736  -25.387 37.963  1.00 23.85 ?  205  TYR A CD1   1 
ATOM   1435 C  CD2   . TYR C 3 139 ? 16.279  -27.253 38.241  1.00 25.08 ?  205  TYR A CD2   1 
ATOM   1436 C  CE1   . TYR C 3 139 ? 18.670  -25.975 38.807  1.00 24.63 ?  205  TYR A CE1   1 
ATOM   1437 C  CE2   . TYR C 3 139 ? 17.204  -27.857 39.097  1.00 25.15 ?  205  TYR A CE2   1 
ATOM   1438 C  CZ    . TYR C 3 139 ? 18.396  -27.212 39.372  1.00 24.66 ?  205  TYR A CZ    1 
ATOM   1439 O  OH    . TYR C 3 139 ? 19.311  -27.805 40.202  1.00 25.03 ?  205  TYR A OH    1 
ATOM   1440 N  N     . SER C 3 140 ? 16.238  -28.212 34.836  1.00 30.79 ?  206  SER A N     1 
ATOM   1441 C  CA    . SER C 3 140 ? 16.153  -29.668 34.906  1.00 33.06 ?  206  SER A CA    1 
ATOM   1442 C  C     . SER C 3 140 ? 17.341  -30.183 35.700  1.00 34.61 ?  206  SER A C     1 
ATOM   1443 O  O     . SER C 3 140 ? 17.451  -31.377 35.998  1.00 35.34 ?  206  SER A O     1 
ATOM   1444 C  CB    . SER C 3 140 ? 16.139  -30.278 33.499  1.00 32.54 ?  206  SER A CB    1 
ATOM   1445 N  N     . GLY C 3 141 ? 18.212  -29.250 36.072  1.00 36.41 ?  207  GLY A N     1 
ATOM   1446 C  CA    . GLY C 3 141 ? 19.484  -29.565 36.713  1.00 37.88 ?  207  GLY A CA    1 
ATOM   1447 C  C     . GLY C 3 141 ? 20.564  -28.832 35.935  1.00 38.91 ?  207  GLY A C     1 
ATOM   1448 O  O     . GLY C 3 141 ? 20.265  -28.162 34.950  1.00 38.93 ?  207  GLY A O     1 
ATOM   1449 N  N     . ASP C 3 142 ? 21.818  -28.969 36.356  1.00 39.84 ?  208  ASP A N     1 
ATOM   1450 C  CA    . ASP C 3 142 ? 22.905  -28.230 35.713  1.00 40.66 ?  208  ASP A CA    1 
ATOM   1451 C  C     . ASP C 3 142 ? 23.615  -29.016 34.606  1.00 40.67 ?  208  ASP A C     1 
ATOM   1452 O  O     . ASP C 3 142 ? 24.664  -28.603 34.105  1.00 40.81 ?  208  ASP A O     1 
ATOM   1453 C  CB    . ASP C 3 142 ? 23.902  -27.749 36.763  1.00 40.80 ?  208  ASP A CB    1 
ATOM   1454 C  CG    . ASP C 3 142 ? 23.297  -26.720 37.694  1.00 42.19 ?  208  ASP A CG    1 
ATOM   1455 O  OD1   . ASP C 3 142 ? 22.682  -25.757 37.187  1.00 44.67 ?  208  ASP A OD1   1 
ATOM   1456 O  OD2   . ASP C 3 142 ? 23.425  -26.873 38.928  1.00 42.53 ?  208  ASP A OD2   1 
ATOM   1457 N  N     . THR C 3 143 ? 23.019  -30.133 34.210  1.00 40.52 ?  209  THR A N     1 
ATOM   1458 C  CA    . THR C 3 143 ? 23.647  -31.040 33.260  1.00 40.47 ?  209  THR A CA    1 
ATOM   1459 C  C     . THR C 3 143 ? 23.386  -30.628 31.801  1.00 39.84 ?  209  THR A C     1 
ATOM   1460 O  O     . THR C 3 143 ? 22.244  -30.586 31.347  1.00 40.08 ?  209  THR A O     1 
ATOM   1461 C  CB    . THR C 3 143 ? 23.170  -32.475 33.526  1.00 40.67 ?  209  THR A CB    1 
ATOM   1462 O  OG1   . THR C 3 143 ? 23.538  -33.326 32.432  1.00 41.78 ?  209  THR A OG1   1 
ATOM   1463 C  CG2   . THR C 3 143 ? 21.649  -32.485 33.720  1.00 41.55 ?  209  THR A CG2   1 
ATOM   1464 N  N     . LYS C 3 144 ? 24.451  -30.305 31.076  1.00 38.85 ?  210  LYS A N     1 
ATOM   1465 C  CA    . LYS C 3 144 ? 24.316  -29.842 29.700  1.00 38.06 ?  210  LYS A CA    1 
ATOM   1466 C  C     . LYS C 3 144 ? 24.313  -31.006 28.716  1.00 37.27 ?  210  LYS A C     1 
ATOM   1467 O  O     . LYS C 3 144 ? 24.722  -32.112 29.058  1.00 36.91 ?  210  LYS A O     1 
ATOM   1468 C  CB    . LYS C 3 144 ? 25.409  -28.825 29.365  1.00 38.15 ?  210  LYS A CB    1 
ATOM   1469 C  CG    . LYS C 3 144 ? 25.357  -27.625 30.284  1.00 38.98 ?  210  LYS A CG    1 
ATOM   1470 C  CD    . LYS C 3 144 ? 25.966  -26.373 29.683  1.00 40.98 ?  210  LYS A CD    1 
ATOM   1471 C  CE    . LYS C 3 144 ? 27.415  -26.190 30.117  1.00 41.62 ?  210  LYS A CE    1 
ATOM   1472 N  NZ    . LYS C 3 144 ? 28.358  -26.757 29.107  1.00 42.91 ?  210  LYS A NZ    1 
ATOM   1473 N  N     . LEU C 3 145 ? 23.845  -30.747 27.498  1.00 36.08 ?  211  LEU A N     1 
ATOM   1474 C  CA    . LEU C 3 145 ? 23.626  -31.803 26.517  1.00 35.38 ?  211  LEU A CA    1 
ATOM   1475 C  C     . LEU C 3 145 ? 24.359  -31.520 25.215  1.00 34.32 ?  211  LEU A C     1 
ATOM   1476 O  O     . LEU C 3 145 ? 24.764  -30.390 24.955  1.00 34.08 ?  211  LEU A O     1 
ATOM   1477 C  CB    . LEU C 3 145 ? 22.128  -31.951 26.228  1.00 35.85 ?  211  LEU A CB    1 
ATOM   1478 C  CG    . LEU C 3 145 ? 21.245  -32.467 27.370  1.00 37.13 ?  211  LEU A CG    1 
ATOM   1479 C  CD1   . LEU C 3 145 ? 19.786  -32.184 27.070  1.00 37.59 ?  211  LEU A CD1   1 
ATOM   1480 C  CD2   . LEU C 3 145 ? 21.476  -33.958 27.608  1.00 37.41 ?  211  LEU A CD2   1 
ATOM   1481 N  N     . PRO C 3 146 ? 24.537  -32.559 24.390  1.00 33.33 ?  212  PRO A N     1 
ATOM   1482 C  CA    . PRO C 3 146 ? 25.204  -32.381 23.109  1.00 32.25 ?  212  PRO A CA    1 
ATOM   1483 C  C     . PRO C 3 146 ? 24.303  -31.682 22.106  1.00 31.06 ?  212  PRO A C     1 
ATOM   1484 O  O     . PRO C 3 146 ? 23.188  -32.133 21.843  1.00 31.02 ?  212  PRO A O     1 
ATOM   1485 C  CB    . PRO C 3 146 ? 25.482  -33.821 22.647  1.00 32.28 ?  212  PRO A CB    1 
ATOM   1486 C  CG    . PRO C 3 146 ? 25.354  -34.660 23.863  1.00 33.33 ?  212  PRO A CG    1 
ATOM   1487 C  CD    . PRO C 3 146 ? 24.343  -33.979 24.727  1.00 33.44 ?  212  PRO A CD    1 
ATOM   1488 N  N     . PHE C 3 147 ? 24.787  -30.579 21.558  1.00 29.75 ?  213  PHE A N     1 
ATOM   1489 C  CA    . PHE C 3 147 ? 24.122  -29.935 20.446  1.00 29.09 ?  213  PHE A CA    1 
ATOM   1490 C  C     . PHE C 3 147 ? 25.045  -29.892 19.239  1.00 28.95 ?  213  PHE A C     1 
ATOM   1491 O  O     . PHE C 3 147 ? 26.269  -29.905 19.369  1.00 29.19 ?  213  PHE A O     1 
ATOM   1492 C  CB    . PHE C 3 147 ? 23.721  -28.508 20.807  1.00 28.56 ?  213  PHE A CB    1 
ATOM   1493 C  CG    . PHE C 3 147 ? 22.476  -28.417 21.632  1.00 27.31 ?  213  PHE A CG    1 
ATOM   1494 C  CD1   . PHE C 3 147 ? 21.310  -27.907 21.090  1.00 26.64 ?  213  PHE A CD1   1 
ATOM   1495 C  CD2   . PHE C 3 147 ? 22.474  -28.817 22.960  1.00 26.11 ?  213  PHE A CD2   1 
ATOM   1496 C  CE1   . PHE C 3 147 ? 20.166  -27.805 21.847  1.00 26.48 ?  213  PHE A CE1   1 
ATOM   1497 C  CE2   . PHE C 3 147 ? 21.324  -28.712 23.728  1.00 26.59 ?  213  PHE A CE2   1 
ATOM   1498 C  CZ    . PHE C 3 147 ? 20.169  -28.199 23.164  1.00 25.47 ?  213  PHE A CZ    1 
ATOM   1499 N  N     . TRP C 3 148 ? 24.431  -29.832 18.069  1.00 28.29 ?  214  TRP A N     1 
ATOM   1500 C  CA    . TRP C 3 148 ? 25.137  -29.706 16.809  1.00 28.43 ?  214  TRP A CA    1 
ATOM   1501 C  C     . TRP C 3 148 ? 25.054  -28.273 16.311  1.00 28.34 ?  214  TRP A C     1 
ATOM   1502 O  O     . TRP C 3 148 ? 23.957  -27.758 16.028  1.00 28.63 ?  214  TRP A O     1 
ATOM   1503 C  CB    . TRP C 3 148 ? 24.522  -30.661 15.788  1.00 27.82 ?  214  TRP A CB    1 
ATOM   1504 C  CG    . TRP C 3 148 ? 24.986  -32.068 15.985  1.00 28.41 ?  214  TRP A CG    1 
ATOM   1505 C  CD1   . TRP C 3 148 ? 25.773  -32.538 17.001  1.00 27.75 ?  214  TRP A CD1   1 
ATOM   1506 C  CD2   . TRP C 3 148 ? 24.687  -33.194 15.155  1.00 27.89 ?  214  TRP A CD2   1 
ATOM   1507 N  NE1   . TRP C 3 148 ? 25.990  -33.890 16.848  1.00 27.70 ?  214  TRP A NE1   1 
ATOM   1508 C  CE2   . TRP C 3 148 ? 25.328  -34.317 15.726  1.00 27.96 ?  214  TRP A CE2   1 
ATOM   1509 C  CE3   . TRP C 3 148 ? 23.938  -33.366 13.986  1.00 26.89 ?  214  TRP A CE3   1 
ATOM   1510 C  CZ2   . TRP C 3 148 ? 25.249  -35.592 15.158  1.00 28.59 ?  214  TRP A CZ2   1 
ATOM   1511 C  CZ3   . TRP C 3 148 ? 23.864  -34.625 13.427  1.00 27.09 ?  214  TRP A CZ3   1 
ATOM   1512 C  CH2   . TRP C 3 148 ? 24.512  -35.723 14.014  1.00 26.67 ?  214  TRP A CH2   1 
ATOM   1513 N  N     . LYS C 3 149 ? 26.214  -27.626 16.253  1.00 27.65 ?  215  LYS A N     1 
ATOM   1514 C  CA    . LYS C 3 149 ? 26.340  -26.294 15.704  1.00 26.89 ?  215  LYS A CA    1 
ATOM   1515 C  C     . LYS C 3 149 ? 26.664  -26.427 14.228  1.00 27.14 ?  215  LYS A C     1 
ATOM   1516 O  O     . LYS C 3 149 ? 27.732  -26.933 13.845  1.00 27.05 ?  215  LYS A O     1 
ATOM   1517 C  CB    . LYS C 3 149 ? 27.439  -25.526 16.438  1.00 27.28 ?  215  LYS A CB    1 
ATOM   1518 C  CG    . LYS C 3 149 ? 27.568  -24.063 16.030  1.00 26.41 ?  215  LYS A CG    1 
ATOM   1519 C  CD    . LYS C 3 149 ? 28.579  -23.350 16.930  1.00 25.95 ?  215  LYS A CD    1 
ATOM   1520 C  CE    . LYS C 3 149 ? 28.690  -21.859 16.609  1.00 25.98 ?  215  LYS A CE    1 
ATOM   1521 N  NZ    . LYS C 3 149 ? 29.824  -21.275 17.396  1.00 26.09 ?  215  LYS A NZ    1 
ATOM   1522 N  N     . ILE C 3 150 ? 25.720  -26.006 13.394  1.00 26.91 ?  216  ILE A N     1 
ATOM   1523 C  CA    . ILE C 3 150 ? 25.819  -26.217 11.959  1.00 27.50 ?  216  ILE A CA    1 
ATOM   1524 C  C     . ILE C 3 150 ? 26.095  -24.882 11.269  1.00 27.62 ?  216  ILE A C     1 
ATOM   1525 O  O     . ILE C 3 150 ? 25.254  -23.983 11.268  1.00 26.95 ?  216  ILE A O     1 
ATOM   1526 C  CB    . ILE C 3 150 ? 24.532  -26.865 11.399  1.00 27.43 ?  216  ILE A CB    1 
ATOM   1527 C  CG1   . ILE C 3 150 ? 24.164  -28.108 12.224  1.00 27.27 ?  216  ILE A CG1   1 
ATOM   1528 C  CG2   . ILE C 3 150 ? 24.694  -27.194 9.919   1.00 27.60 ?  216  ILE A CG2   1 
ATOM   1529 C  CD1   . ILE C 3 150 ? 22.942  -28.895 11.664  1.00 26.39 ?  216  ILE A CD1   1 
ATOM   1530 N  N     . TYR C 3 151 ? 27.299  -24.766 10.703  1.00 27.87 ?  217  TYR A N     1 
ATOM   1531 C  CA    . TYR C 3 151 ? 27.755  -23.537 10.066  1.00 27.83 ?  217  TYR A CA    1 
ATOM   1532 C  C     . TYR C 3 151 ? 27.405  -23.490 8.590   1.00 27.98 ?  217  TYR A C     1 
ATOM   1533 O  O     . TYR C 3 151 ? 27.504  -24.508 7.888   1.00 27.33 ?  217  TYR A O     1 
ATOM   1534 C  CB    . TYR C 3 151 ? 29.268  -23.438 10.181  1.00 27.86 ?  217  TYR A CB    1 
ATOM   1535 C  CG    . TYR C 3 151 ? 29.830  -23.280 11.581  1.00 28.35 ?  217  TYR A CG    1 
ATOM   1536 C  CD1   . TYR C 3 151 ? 29.934  -22.032 12.169  1.00 29.08 ?  217  TYR A CD1   1 
ATOM   1537 C  CD2   . TYR C 3 151 ? 30.320  -24.378 12.282  1.00 29.47 ?  217  TYR A CD2   1 
ATOM   1538 C  CE1   . TYR C 3 151 ? 30.488  -21.878 13.430  1.00 29.32 ?  217  TYR A CE1   1 
ATOM   1539 C  CE2   . TYR C 3 151 ? 30.872  -24.242 13.544  1.00 29.55 ?  217  TYR A CE2   1 
ATOM   1540 C  CZ    . TYR C 3 151 ? 30.948  -22.988 14.117  1.00 30.78 ?  217  TYR A CZ    1 
ATOM   1541 O  OH    . TYR C 3 151 ? 31.494  -22.838 15.379  1.00 29.66 ?  217  TYR A OH    1 
ATOM   1542 N  N     . VAL C 3 152 ? 27.034  -22.306 8.105   1.00 27.78 ?  218  VAL A N     1 
ATOM   1543 C  CA    . VAL C 3 152 ? 26.745  -22.128 6.673   1.00 28.09 ?  218  VAL A CA    1 
ATOM   1544 C  C     . VAL C 3 152 ? 27.691  -21.113 6.038   1.00 27.34 ?  218  VAL A C     1 
ATOM   1545 O  O     . VAL C 3 152 ? 28.223  -20.234 6.729   1.00 26.96 ?  218  VAL A O     1 
ATOM   1546 C  CB    . VAL C 3 152 ? 25.288  -21.667 6.447   1.00 28.25 ?  218  VAL A CB    1 
ATOM   1547 C  CG1   . VAL C 3 152 ? 24.318  -22.704 7.007   1.00 30.11 ?  218  VAL A CG1   1 
ATOM   1548 C  CG2   . VAL C 3 152 ? 25.057  -20.303 7.090   1.00 28.11 ?  218  VAL A CG2   1 
ATOM   1549 N  N     . THR C 3 153 ? 27.895  -21.235 4.727   1.00 27.13 ?  219  THR A N     1 
ATOM   1550 C  CA    . THR C 3 153 ? 28.815  -20.363 3.982   1.00 26.77 ?  219  THR A CA    1 
ATOM   1551 C  C     . THR C 3 153 ? 28.167  -19.047 3.579   1.00 26.51 ?  219  THR A C     1 
ATOM   1552 O  O     . THR C 3 153 ? 28.863  -18.069 3.278   1.00 25.95 ?  219  THR A O     1 
ATOM   1553 C  CB    . THR C 3 153 ? 29.307  -21.032 2.693   1.00 26.87 ?  219  THR A CB    1 
ATOM   1554 O  OG1   . THR C 3 153 ? 28.172  -21.397 1.900   1.00 27.16 ?  219  THR A OG1   1 
ATOM   1555 C  CG2   . THR C 3 153 ? 30.106  -22.279 3.027   1.00 27.44 ?  219  THR A CG2   1 
ATOM   1556 N  N     . TYR C 3 154 ? 26.840  -19.035 3.508   1.00 26.45 ?  220  TYR A N     1 
ATOM   1557 C  CA    . TYR C 3 154 ? 26.132  -17.752 3.458   1.00 27.14 ?  220  TYR A CA    1 
ATOM   1558 C  C     . TYR C 3 154 ? 24.906  -17.724 4.378   1.00 26.64 ?  220  TYR A C     1 
ATOM   1559 O  O     . TYR C 3 154 ? 24.136  -18.682 4.438   1.00 25.83 ?  220  TYR A O     1 
ATOM   1560 C  CB    . TYR C 3 154 ? 25.867  -17.247 2.026   1.00 27.60 ?  220  TYR A CB    1 
ATOM   1561 C  CG    . TYR C 3 154 ? 24.969  -18.090 1.151   1.00 29.08 ?  220  TYR A CG    1 
ATOM   1562 C  CD1   . TYR C 3 154 ? 23.589  -17.913 1.165   1.00 31.56 ?  220  TYR A CD1   1 
ATOM   1563 C  CD2   . TYR C 3 154 ? 25.501  -19.026 0.266   1.00 32.07 ?  220  TYR A CD2   1 
ATOM   1564 C  CE1   . TYR C 3 154 ? 22.746  -18.665 0.346   1.00 31.41 ?  220  TYR A CE1   1 
ATOM   1565 C  CE2   . TYR C 3 154 ? 24.666  -19.796 -0.562  1.00 32.35 ?  220  TYR A CE2   1 
ATOM   1566 C  CZ    . TYR C 3 154 ? 23.290  -19.605 -0.519  1.00 32.86 ?  220  TYR A CZ    1 
ATOM   1567 O  OH    . TYR C 3 154 ? 22.456  -20.353 -1.337  1.00 32.59 ?  220  TYR A OH    1 
ATOM   1568 N  N     . PRO C 3 155 ? 24.753  -16.618 5.121   1.00 26.75 ?  221  PRO A N     1 
ATOM   1569 C  CA    . PRO C 3 155 ? 23.869  -16.560 6.281   1.00 27.23 ?  221  PRO A CA    1 
ATOM   1570 C  C     . PRO C 3 155 ? 22.413  -16.940 6.028   1.00 27.39 ?  221  PRO A C     1 
ATOM   1571 O  O     . PRO C 3 155 ? 21.820  -17.616 6.855   1.00 27.97 ?  221  PRO A O     1 
ATOM   1572 C  CB    . PRO C 3 155 ? 23.970  -15.090 6.727   1.00 26.51 ?  221  PRO A CB    1 
ATOM   1573 C  CG    . PRO C 3 155 ? 25.297  -14.655 6.244   1.00 28.03 ?  221  PRO A CG    1 
ATOM   1574 C  CD    . PRO C 3 155 ? 25.499  -15.361 4.934   1.00 26.11 ?  221  PRO A CD    1 
ATOM   1575 N  N     . HIS C 3 156 ? 21.841  -16.497 4.915   1.00 28.03 ?  222  HIS A N     1 
ATOM   1576 C  CA    . HIS C 3 156 ? 20.427  -16.718 4.643   1.00 29.11 ?  222  HIS A CA    1 
ATOM   1577 C  C     . HIS C 3 156 ? 20.035  -18.192 4.587   1.00 29.18 ?  222  HIS A C     1 
ATOM   1578 O  O     . HIS C 3 156 ? 18.880  -18.534 4.818   1.00 30.00 ?  222  HIS A O     1 
ATOM   1579 C  CB    . HIS C 3 156 ? 20.008  -16.019 3.346   1.00 29.52 ?  222  HIS A CB    1 
ATOM   1580 C  CG    . HIS C 3 156 ? 18.580  -16.259 2.972   1.00 33.10 ?  222  HIS A CG    1 
ATOM   1581 N  ND1   . HIS C 3 156 ? 17.533  -15.556 3.536   1.00 35.05 ?  222  HIS A ND1   1 
ATOM   1582 C  CD2   . HIS C 3 156 ? 18.019  -17.137 2.103   1.00 35.08 ?  222  HIS A CD2   1 
ATOM   1583 C  CE1   . HIS C 3 156 ? 16.391  -15.983 3.026   1.00 35.81 ?  222  HIS A CE1   1 
ATOM   1584 N  NE2   . HIS C 3 156 ? 16.657  -16.940 2.152   1.00 37.15 ?  222  HIS A NE2   1 
ATOM   1585 N  N     . MET C 3 157 ? 20.984  -19.070 4.284   1.00 29.30 ?  223  MET A N     1 
ATOM   1586 C  CA    . MET C 3 157 ? 20.670  -20.490 4.204   1.00 29.27 ?  223  MET A CA    1 
ATOM   1587 C  C     . MET C 3 157 ? 20.310  -21.085 5.572   1.00 29.25 ?  223  MET A C     1 
ATOM   1588 O  O     . MET C 3 157 ? 19.777  -22.186 5.656   1.00 29.30 ?  223  MET A O     1 
ATOM   1589 C  CB    . MET C 3 157 ? 21.824  -21.277 3.579   1.00 28.84 ?  223  MET A CB    1 
ATOM   1590 C  CG    . MET C 3 157 ? 21.386  -22.654 3.054   1.00 30.15 ?  223  MET A CG    1 
ATOM   1591 S  SD    . MET C 3 157 ? 20.007  -22.546 1.891   1.00 32.08 ?  223  MET A SD    1 
ATOM   1592 C  CE    . MET C 3 157 ? 20.781  -21.833 0.444   1.00 33.42 ?  223  MET A CE    1 
ATOM   1593 N  N     . VAL C 3 158 ? 20.642  -20.377 6.648   1.00 28.77 ?  224  VAL A N     1 
ATOM   1594 C  CA    . VAL C 3 158 ? 20.240  -20.823 7.983   1.00 28.56 ?  224  VAL A CA    1 
ATOM   1595 C  C     . VAL C 3 158 ? 18.718  -20.899 8.096   1.00 28.03 ?  224  VAL A C     1 
ATOM   1596 O  O     . VAL C 3 158 ? 18.178  -21.858 8.645   1.00 27.67 ?  224  VAL A O     1 
ATOM   1597 C  CB    . VAL C 3 158 ? 20.822  -19.917 9.086   1.00 28.84 ?  224  VAL A CB    1 
ATOM   1598 C  CG1   . VAL C 3 158 ? 20.131  -20.161 10.427  1.00 29.30 ?  224  VAL A CG1   1 
ATOM   1599 C  CG2   . VAL C 3 158 ? 22.335  -20.152 9.219   1.00 29.50 ?  224  VAL A CG2   1 
ATOM   1600 N  N     . ASN C 3 159 ? 18.033  -19.908 7.540   1.00 27.41 ?  225  ASN A N     1 
ATOM   1601 C  CA    . ASN C 3 159 ? 16.575  -19.878 7.554   1.00 28.40 ?  225  ASN A CA    1 
ATOM   1602 C  C     . ASN C 3 159 ? 15.973  -21.120 6.895   1.00 28.31 ?  225  ASN A C     1 
ATOM   1603 O  O     . ASN C 3 159 ? 15.039  -21.731 7.421   1.00 27.96 ?  225  ASN A O     1 
ATOM   1604 C  CB    . ASN C 3 159 ? 16.061  -18.652 6.797   1.00 28.38 ?  225  ASN A CB    1 
ATOM   1605 C  CG    . ASN C 3 159 ? 16.367  -17.345 7.498   1.00 31.05 ?  225  ASN A CG    1 
ATOM   1606 O  OD1   . ASN C 3 159 ? 16.619  -17.305 8.701   1.00 32.18 ?  225  ASN A OD1   1 
ATOM   1607 N  ND2   . ASN C 3 159 ? 16.317  -16.253 6.739   1.00 32.30 ?  225  ASN A ND2   1 
ATOM   1608 N  N     . LYS C 3 160 ? 16.502  -21.480 5.727   1.00 28.57 ?  226  LYS A N     1 
ATOM   1609 C  CA    . LYS C 3 160 ? 15.982  -22.632 4.993   1.00 28.91 ?  226  LYS A CA    1 
ATOM   1610 C  C     . LYS C 3 160 ? 16.288  -23.930 5.741   1.00 28.00 ?  226  LYS A C     1 
ATOM   1611 O  O     . LYS C 3 160 ? 15.453  -24.827 5.830   1.00 27.19 ?  226  LYS A O     1 
ATOM   1612 C  CB    . LYS C 3 160 ? 16.559  -22.655 3.578   1.00 29.94 ?  226  LYS A CB    1 
ATOM   1613 C  CG    . LYS C 3 160 ? 15.761  -21.808 2.573   1.00 33.30 ?  226  LYS A CG    1 
ATOM   1614 C  CD    . LYS C 3 160 ? 14.950  -22.728 1.652   1.00 37.77 ?  226  LYS A CD    1 
ATOM   1615 C  CE    . LYS C 3 160 ? 13.810  -22.017 0.958   1.00 39.82 ?  226  LYS A CE    1 
ATOM   1616 N  NZ    . LYS C 3 160 ? 12.626  -21.896 1.858   1.00 43.07 ?  226  LYS A NZ    1 
ATOM   1617 N  N     . LEU C 3 161 ? 17.485  -24.006 6.306   1.00 27.63 ?  227  LEU A N     1 
ATOM   1618 C  CA    . LEU C 3 161 ? 17.876  -25.136 7.139   1.00 28.40 ?  227  LEU A CA    1 
ATOM   1619 C  C     . LEU C 3 161 ? 16.941  -25.265 8.348   1.00 28.35 ?  227  LEU A C     1 
ATOM   1620 O  O     . LEU C 3 161 ? 16.423  -26.346 8.658   1.00 28.69 ?  227  LEU A O     1 
ATOM   1621 C  CB    . LEU C 3 161 ? 19.296  -24.897 7.624   1.00 28.39 ?  227  LEU A CB    1 
ATOM   1622 C  CG    . LEU C 3 161 ? 20.260  -26.029 7.920   1.00 30.40 ?  227  LEU A CG    1 
ATOM   1623 C  CD1   . LEU C 3 161 ? 20.157  -27.138 6.892   1.00 29.95 ?  227  LEU A CD1   1 
ATOM   1624 C  CD2   . LEU C 3 161 ? 21.694  -25.422 7.971   1.00 32.30 ?  227  LEU A CD2   1 
ATOM   1625 N  N     . ARG C 3 162 ? 16.716  -24.150 9.028   1.00 27.86 ?  228  ARG A N     1 
ATOM   1626 C  CA    . ARG C 3 162 ? 15.812  -24.134 10.166  1.00 28.07 ?  228  ARG A CA    1 
ATOM   1627 C  C     . ARG C 3 162 ? 14.445  -24.689 9.773   1.00 27.65 ?  228  ARG A C     1 
ATOM   1628 O  O     . ARG C 3 162 ? 13.859  -25.506 10.484  1.00 27.11 ?  228  ARG A O     1 
ATOM   1629 C  CB    . ARG C 3 162 ? 15.649  -22.699 10.658  1.00 28.41 ?  228  ARG A CB    1 
ATOM   1630 C  CG    . ARG C 3 162 ? 15.281  -22.571 12.117  1.00 30.39 ?  228  ARG A CG    1 
ATOM   1631 C  CD    . ARG C 3 162 ? 15.309  -21.100 12.565  1.00 28.49 ?  228  ARG A CD    1 
ATOM   1632 N  NE    . ARG C 3 162 ? 16.675  -20.602 12.800  1.00 28.31 ?  228  ARG A NE    1 
ATOM   1633 C  CZ    . ARG C 3 162 ? 17.437  -20.977 13.820  1.00 28.22 ?  228  ARG A CZ    1 
ATOM   1634 N  NH1   . ARG C 3 162 ? 16.985  -21.870 14.700  1.00 30.45 ?  228  ARG A NH1   1 
ATOM   1635 N  NH2   . ARG C 3 162 ? 18.649  -20.479 13.964  1.00 28.55 ?  228  ARG A NH2   1 
ATOM   1636 N  N     . THR C 3 163 ? 13.922  -24.214 8.647   1.00 27.50 ?  229  THR A N     1 
ATOM   1637 C  CA    . THR C 3 163 ? 12.625  -24.668 8.170   1.00 28.33 ?  229  THR A CA    1 
ATOM   1638 C  C     . THR C 3 163 ? 12.628  -26.185 7.878   1.00 27.81 ?  229  THR A C     1 
ATOM   1639 O  O     . THR C 3 163 ? 11.672  -26.901 8.207   1.00 28.20 ?  229  THR A O     1 
ATOM   1640 C  CB    . THR C 3 163 ? 12.209  -23.870 6.921   1.00 28.22 ?  229  THR A CB    1 
ATOM   1641 O  OG1   . THR C 3 163 ? 11.992  -22.506 7.303   1.00 31.72 ?  229  THR A OG1   1 
ATOM   1642 C  CG2   . THR C 3 163 ? 10.951  -24.415 6.327   1.00 29.23 ?  229  THR A CG2   1 
ATOM   1643 N  N     . ALA C 3 164 ? 13.702  -26.678 7.279   1.00 27.27 ?  230  ALA A N     1 
ATOM   1644 C  CA    . ALA C 3 164 ? 13.780  -28.099 6.945   1.00 26.89 ?  230  ALA A CA    1 
ATOM   1645 C  C     . ALA C 3 164 ? 13.784  -28.967 8.212   1.00 26.83 ?  230  ALA A C     1 
ATOM   1646 O  O     . ALA C 3 164 ? 13.067  -29.968 8.296   1.00 26.35 ?  230  ALA A O     1 
ATOM   1647 C  CB    . ALA C 3 164 ? 15.008  -28.374 6.098   1.00 26.90 ?  230  ALA A CB    1 
ATOM   1648 N  N     . PHE C 3 165 ? 14.580  -28.572 9.200   1.00 27.07 ?  231  PHE A N     1 
ATOM   1649 C  CA    . PHE C 3 165 ? 14.603  -29.281 10.485  1.00 27.91 ?  231  PHE A CA    1 
ATOM   1650 C  C     . PHE C 3 165 ? 13.242  -29.274 11.148  1.00 28.79 ?  231  PHE A C     1 
ATOM   1651 O  O     . PHE C 3 165 ? 12.827  -30.270 11.759  1.00 28.75 ?  231  PHE A O     1 
ATOM   1652 C  CB    . PHE C 3 165 ? 15.649  -28.682 11.431  1.00 27.95 ?  231  PHE A CB    1 
ATOM   1653 C  CG    . PHE C 3 165 ? 17.022  -29.263 11.245  1.00 28.89 ?  231  PHE A CG    1 
ATOM   1654 C  CD1   . PHE C 3 165 ? 17.285  -30.567 11.626  1.00 28.79 ?  231  PHE A CD1   1 
ATOM   1655 C  CD2   . PHE C 3 165 ? 18.040  -28.515 10.684  1.00 29.32 ?  231  PHE A CD2   1 
ATOM   1656 C  CE1   . PHE C 3 165 ? 18.540  -31.125 11.450  1.00 27.86 ?  231  PHE A CE1   1 
ATOM   1657 C  CE2   . PHE C 3 165 ? 19.290  -29.058 10.509  1.00 28.09 ?  231  PHE A CE2   1 
ATOM   1658 C  CZ    . PHE C 3 165 ? 19.540  -30.378 10.892  1.00 28.86 ?  231  PHE A CZ    1 
ATOM   1659 N  N     . GLU C 3 166 ? 12.529  -28.157 11.005  1.00 29.13 ?  232  GLU A N     1 
ATOM   1660 C  CA    . GLU C 3 166 ? 11.254  -27.995 11.699  1.00 29.86 ?  232  GLU A CA    1 
ATOM   1661 C  C     . GLU C 3 166 ? 10.082  -28.658 10.981  1.00 30.21 ?  232  GLU A C     1 
ATOM   1662 O  O     . GLU C 3 166 ? 9.277   -29.329 11.613  1.00 29.85 ?  232  GLU A O     1 
ATOM   1663 C  CB    . GLU C 3 166 ? 11.003  -26.514 12.034  1.00 29.42 ?  232  GLU A CB    1 
ATOM   1664 C  CG    . GLU C 3 166 ? 12.078  -25.963 12.998  1.00 30.46 ?  232  GLU A CG    1 
ATOM   1665 C  CD    . GLU C 3 166 ? 11.985  -24.461 13.228  1.00 32.41 ?  232  GLU A CD    1 
ATOM   1666 O  OE1   . GLU C 3 166 ? 11.243  -23.803 12.484  1.00 32.05 ?  232  GLU A OE1   1 
ATOM   1667 O  OE2   . GLU C 3 166 ? 12.670  -23.939 14.144  1.00 30.80 ?  232  GLU A OE2   1 
ATOM   1668 N  N     . ARG C 3 167 ? 9.994   -28.499 9.662   1.00 30.64 ?  233  ARG A N     1 
ATOM   1669 C  CA    . ARG C 3 167 ? 8.880   -29.078 8.922   1.00 31.36 ?  233  ARG A CA    1 
ATOM   1670 C  C     . ARG C 3 167 ? 9.276   -29.721 7.575   1.00 31.37 ?  233  ARG A C     1 
ATOM   1671 O  O     . ARG C 3 167 ? 8.410   -30.054 6.761   1.00 31.19 ?  233  ARG A O     1 
ATOM   1672 C  CB    . ARG C 3 167 ? 7.751   -28.052 8.737   1.00 31.90 ?  233  ARG A CB    1 
ATOM   1673 C  CG    . ARG C 3 167 ? 8.144   -26.789 7.976   1.00 34.90 ?  233  ARG A CG    1 
ATOM   1674 C  CD    . ARG C 3 167 ? 6.907   -25.977 7.587   1.00 39.04 ?  233  ARG A CD    1 
ATOM   1675 N  NE    . ARG C 3 167 ? 7.247   -24.637 7.126   1.00 43.25 ?  233  ARG A NE    1 
ATOM   1676 C  CZ    . ARG C 3 167 ? 7.544   -24.323 5.867   1.00 46.81 ?  233  ARG A CZ    1 
ATOM   1677 N  NH1   . ARG C 3 167 ? 7.545   -25.260 4.916   1.00 47.90 ?  233  ARG A NH1   1 
ATOM   1678 N  NH2   . ARG C 3 167 ? 7.841   -23.060 5.553   1.00 47.87 ?  233  ARG A NH2   1 
ATOM   1679 N  N     . GLY C 3 168 ? 10.577  -29.896 7.349   1.00 31.03 ?  234  GLY A N     1 
ATOM   1680 C  CA    . GLY C 3 168 ? 11.054  -30.563 6.148   1.00 31.48 ?  234  GLY A CA    1 
ATOM   1681 C  C     . GLY C 3 168 ? 11.153  -32.055 6.385   1.00 31.98 ?  234  GLY A C     1 
ATOM   1682 O  O     . GLY C 3 168 ? 10.567  -32.583 7.322   1.00 31.98 ?  234  GLY A O     1 
ATOM   1683 N  N     . HIS C 3 169 ? 11.908  -32.749 5.550   1.00 31.98 ?  235  HIS A N     1 
ATOM   1684 C  CA    . HIS C 3 169 ? 12.071  -34.177 5.737   1.00 32.74 ?  235  HIS A CA    1 
ATOM   1685 C  C     . HIS C 3 169 ? 13.519  -34.527 5.560   1.00 32.65 ?  235  HIS A C     1 
ATOM   1686 O  O     . HIS C 3 169 ? 13.896  -35.117 4.543   1.00 32.61 ?  235  HIS A O     1 
ATOM   1687 C  CB    . HIS C 3 169 ? 11.226  -34.982 4.736   1.00 32.80 ?  235  HIS A CB    1 
ATOM   1688 C  CG    . HIS C 3 169 ? 9.774   -35.050 5.088   1.00 35.08 ?  235  HIS A CG    1 
ATOM   1689 N  ND1   . HIS C 3 169 ? 9.328   -35.290 6.372   1.00 37.02 ?  235  HIS A ND1   1 
ATOM   1690 C  CD2   . HIS C 3 169 ? 8.663   -34.933 4.322   1.00 36.93 ?  235  HIS A CD2   1 
ATOM   1691 C  CE1   . HIS C 3 169 ? 8.007   -35.302 6.384   1.00 36.60 ?  235  HIS A CE1   1 
ATOM   1692 N  NE2   . HIS C 3 169 ? 7.578   -35.089 5.152   1.00 36.28 ?  235  HIS A NE2   1 
ATOM   1693 N  N     . LEU C 3 170 ? 14.326  -34.145 6.542   1.00 32.68 ?  236  LEU A N     1 
ATOM   1694 C  CA    . LEU C 3 170 ? 15.735  -34.492 6.562   1.00 33.36 ?  236  LEU A CA    1 
ATOM   1695 C  C     . LEU C 3 170 ? 15.881  -35.882 7.182   1.00 34.16 ?  236  LEU A C     1 
ATOM   1696 O  O     . LEU C 3 170 ? 16.097  -36.010 8.379   1.00 35.18 ?  236  LEU A O     1 
ATOM   1697 C  CB    . LEU C 3 170 ? 16.512  -33.454 7.369   1.00 32.49 ?  236  LEU A CB    1 
ATOM   1698 C  CG    . LEU C 3 170 ? 16.375  -32.011 6.860   1.00 32.51 ?  236  LEU A CG    1 
ATOM   1699 C  CD1   . LEU C 3 170 ? 17.266  -31.075 7.643   1.00 31.50 ?  236  LEU A CD1   1 
ATOM   1700 C  CD2   . LEU C 3 170 ? 16.690  -31.914 5.350   1.00 29.21 ?  236  LEU A CD2   1 
ATOM   1701 N  N     . SER C 3 171 ? 15.779  -36.919 6.360   1.00 34.57 ?  237  SER A N     1 
ATOM   1702 C  CA    . SER C 3 171 ? 15.587  -38.272 6.870   1.00 34.79 ?  237  SER A CA    1 
ATOM   1703 C  C     . SER C 3 171 ? 16.866  -39.091 6.950   1.00 34.66 ?  237  SER A C     1 
ATOM   1704 O  O     . SER C 3 171 ? 16.822  -40.304 7.163   1.00 34.85 ?  237  SER A O     1 
ATOM   1705 C  CB    . SER C 3 171 ? 14.579  -39.002 5.998   1.00 34.80 ?  237  SER A CB    1 
ATOM   1706 O  OG    . SER C 3 171 ? 15.040  -39.012 4.663   1.00 35.95 ?  237  SER A OG    1 
ATOM   1707 N  N     . PHE C 3 172 ? 18.000  -38.434 6.778   1.00 34.40 ?  238  PHE A N     1 
ATOM   1708 C  CA    . PHE C 3 172 ? 19.288  -39.112 6.857   1.00 34.46 ?  238  PHE A CA    1 
ATOM   1709 C  C     . PHE C 3 172 ? 19.435  -39.844 8.190   1.00 34.41 ?  238  PHE A C     1 
ATOM   1710 O  O     . PHE C 3 172 ? 19.361  -39.235 9.251   1.00 34.42 ?  238  PHE A O     1 
ATOM   1711 C  CB    . PHE C 3 172 ? 20.427  -38.104 6.670   1.00 34.42 ?  238  PHE A CB    1 
ATOM   1712 C  CG    . PHE C 3 172 ? 21.793  -38.723 6.688   1.00 33.90 ?  238  PHE A CG    1 
ATOM   1713 C  CD1   . PHE C 3 172 ? 22.355  -39.232 5.525   1.00 33.43 ?  238  PHE A CD1   1 
ATOM   1714 C  CD2   . PHE C 3 172 ? 22.520  -38.791 7.863   1.00 33.60 ?  238  PHE A CD2   1 
ATOM   1715 C  CE1   . PHE C 3 172 ? 23.615  -39.803 5.543   1.00 33.48 ?  238  PHE A CE1   1 
ATOM   1716 C  CE2   . PHE C 3 172 ? 23.788  -39.363 7.890   1.00 32.97 ?  238  PHE A CE2   1 
ATOM   1717 C  CZ    . PHE C 3 172 ? 24.334  -39.869 6.731   1.00 32.71 ?  238  PHE A CZ    1 
ATOM   1718 N  N     . ASN C 3 173 ? 19.635  -41.155 8.118   1.00 34.52 ?  239  ASN A N     1 
ATOM   1719 C  CA    . ASN C 3 173 ? 19.834  -41.996 9.302   1.00 34.56 ?  239  ASN A CA    1 
ATOM   1720 C  C     . ASN C 3 173 ? 18.669  -42.013 10.295  1.00 34.68 ?  239  ASN A C     1 
ATOM   1721 O  O     . ASN C 3 173 ? 18.840  -42.435 11.432  1.00 34.97 ?  239  ASN A O     1 
ATOM   1722 C  CB    . ASN C 3 173 ? 21.135  -41.617 10.025  1.00 34.50 ?  239  ASN A CB    1 
ATOM   1723 C  CG    . ASN C 3 173 ? 22.378  -42.149 9.315   1.00 33.82 ?  239  ASN A CG    1 
ATOM   1724 O  OD1   . ASN C 3 173 ? 22.284  -42.748 8.250   1.00 33.49 ?  239  ASN A OD1   1 
ATOM   1725 N  ND2   . ASN C 3 173 ? 23.545  -41.917 9.901   1.00 33.56 ?  239  ASN A ND2   1 
ATOM   1726 N  N     . SER C 3 174 ? 17.486  -41.579 9.866   1.00 34.93 ?  240  SER A N     1 
ATOM   1727 C  CA    . SER C 3 174 ? 16.360  -41.428 10.790  1.00 35.09 ?  240  SER A CA    1 
ATOM   1728 C  C     . SER C 3 174 ? 16.787  -40.576 11.979  1.00 35.39 ?  240  SER A C     1 
ATOM   1729 O  O     . SER C 3 174 ? 16.465  -40.891 13.119  1.00 35.77 ?  240  SER A O     1 
ATOM   1730 C  CB    . SER C 3 174 ? 15.866  -42.784 11.305  1.00 35.16 ?  240  SER A CB    1 
ATOM   1731 O  OG    . SER C 3 174 ? 15.118  -43.489 10.326  1.00 34.98 ?  240  SER A OG    1 
ATOM   1732 N  N     . TRP C 3 175 ? 17.527  -39.507 11.716  1.00 35.41 ?  241  TRP A N     1 
ATOM   1733 C  CA    . TRP C 3 175 ? 18.038  -38.672 12.794  1.00 35.36 ?  241  TRP A CA    1 
ATOM   1734 C  C     . TRP C 3 175 ? 17.067  -37.548 13.128  1.00 35.98 ?  241  TRP A C     1 
ATOM   1735 O  O     . TRP C 3 175 ? 16.861  -37.223 14.291  1.00 36.71 ?  241  TRP A O     1 
ATOM   1736 C  CB    . TRP C 3 175 ? 19.407  -38.085 12.437  1.00 34.60 ?  241  TRP A CB    1 
ATOM   1737 C  CG    . TRP C 3 175 ? 20.583  -38.988 12.726  1.00 32.08 ?  241  TRP A CG    1 
ATOM   1738 C  CD1   . TRP C 3 175 ? 20.579  -40.162 13.425  1.00 32.39 ?  241  TRP A CD1   1 
ATOM   1739 C  CD2   . TRP C 3 175 ? 21.944  -38.747 12.364  1.00 28.94 ?  241  TRP A CD2   1 
ATOM   1740 N  NE1   . TRP C 3 175 ? 21.852  -40.683 13.490  1.00 29.09 ?  241  TRP A NE1   1 
ATOM   1741 C  CE2   . TRP C 3 175 ? 22.708  -39.823 12.856  1.00 28.83 ?  241  TRP A CE2   1 
ATOM   1742 C  CE3   . TRP C 3 175 ? 22.589  -37.727 11.663  1.00 27.41 ?  241  TRP A CE3   1 
ATOM   1743 C  CZ2   . TRP C 3 175 ? 24.082  -39.907 12.659  1.00 29.14 ?  241  TRP A CZ2   1 
ATOM   1744 C  CZ3   . TRP C 3 175 ? 23.950  -37.811 11.471  1.00 27.65 ?  241  TRP A CZ3   1 
ATOM   1745 C  CH2   . TRP C 3 175 ? 24.681  -38.889 11.959  1.00 28.24 ?  241  TRP A CH2   1 
ATOM   1746 N  N     . PHE C 3 176 ? 16.464  -36.959 12.106  1.00 36.65 ?  242  PHE A N     1 
ATOM   1747 C  CA    . PHE C 3 176 ? 15.623  -35.794 12.313  1.00 36.83 ?  242  PHE A CA    1 
ATOM   1748 C  C     . PHE C 3 176 ? 14.312  -35.917 11.572  1.00 38.18 ?  242  PHE A C     1 
ATOM   1749 O  O     . PHE C 3 176 ? 13.467  -35.020 11.617  1.00 38.99 ?  242  PHE A O     1 
ATOM   1750 C  CB    . PHE C 3 176 ? 16.357  -34.539 11.868  1.00 36.27 ?  242  PHE A CB    1 
ATOM   1751 C  CG    . PHE C 3 176 ? 17.615  -34.287 12.626  1.00 33.16 ?  242  PHE A CG    1 
ATOM   1752 C  CD1   . PHE C 3 176 ? 17.575  -33.686 13.874  1.00 30.36 ?  242  PHE A CD1   1 
ATOM   1753 C  CD2   . PHE C 3 176 ? 18.834  -34.652 12.101  1.00 28.44 ?  242  PHE A CD2   1 
ATOM   1754 C  CE1   . PHE C 3 176 ? 18.738  -33.447 14.578  1.00 28.35 ?  242  PHE A CE1   1 
ATOM   1755 C  CE2   . PHE C 3 176 ? 19.994  -34.413 12.804  1.00 28.04 ?  242  PHE A CE2   1 
ATOM   1756 C  CZ    . PHE C 3 176 ? 19.945  -33.810 14.042  1.00 27.34 ?  242  PHE A CZ    1 
ATOM   1757 N  N     . SER C 3 177 ? 14.158  -37.024 10.864  1.00 39.26 ?  243  SER A N     1 
ATOM   1758 C  CA    . SER C 3 177 ? 12.858  -37.426 10.393  1.00 40.13 ?  243  SER A CA    1 
ATOM   1759 C  C     . SER C 3 177 ? 12.215  -38.110 11.588  1.00 40.70 ?  243  SER A C     1 
ATOM   1760 O  O     . SER C 3 177 ? 12.464  -39.303 11.843  1.00 41.23 ?  243  SER A O     1 
ATOM   1761 C  CB    . SER C 3 177 ? 12.990  -38.419 9.240   1.00 40.18 ?  243  SER A CB    1 
ATOM   1762 O  OG    . SER C 3 177 ? 13.752  -39.547 9.640   1.00 40.34 ?  243  SER A OG    1 
ATOM   1763 N  N     . ASN C 3 178 ? 11.386  -37.361 12.313  1.00 40.49 ?  244  ASN A N     1 
ATOM   1764 C  CA    . ASN C 3 178 ? 11.019  -36.016 11.897  1.00 40.48 ?  244  ASN A CA    1 
ATOM   1765 C  C     . ASN C 3 178 ? 9.973   -35.448 12.852  1.00 40.06 ?  244  ASN A C     1 
ATOM   1766 O  O     . ASN C 3 178 ? 9.020   -36.158 13.187  1.00 40.79 ?  244  ASN A O     1 
ATOM   1767 C  CB    . ASN C 3 178 ? 10.453  -36.071 10.471  1.00 40.73 ?  244  ASN A CB    1 
ATOM   1768 N  N     . GLY C 3 179 ? 10.133  -34.207 13.319  1.00 38.83 ?  245  GLY A N     1 
ATOM   1769 C  CA    . GLY C 3 179 ? 11.295  -33.352 13.050  1.00 37.28 ?  245  GLY A CA    1 
ATOM   1770 C  C     . GLY C 3 179 ? 11.878  -32.834 14.365  1.00 35.99 ?  245  GLY A C     1 
ATOM   1771 O  O     . GLY C 3 179 ? 11.901  -33.566 15.356  1.00 36.12 ?  245  GLY A O     1 
ATOM   1772 N  N     . THR C 3 180 ? 12.334  -31.581 14.413  1.00 34.01 ?  246  THR A N     1 
ATOM   1773 C  CA    . THR C 3 180 ? 12.991  -31.120 15.634  1.00 31.89 ?  246  THR A CA    1 
ATOM   1774 C  C     . THR C 3 180 ? 12.919  -29.630 15.938  1.00 30.54 ?  246  THR A C     1 
ATOM   1775 O  O     . THR C 3 180 ? 12.795  -28.784 15.040  1.00 29.78 ?  246  THR A O     1 
ATOM   1776 C  CB    . THR C 3 180 ? 14.485  -31.527 15.650  1.00 32.48 ?  246  THR A CB    1 
ATOM   1777 O  OG1   . THR C 3 180 ? 15.036  -31.288 16.950  1.00 34.00 ?  246  THR A OG1   1 
ATOM   1778 C  CG2   . THR C 3 180 ? 15.267  -30.692 14.664  1.00 32.56 ?  246  THR A CG2   1 
ATOM   1779 N  N     . THR C 3 181 ? 13.031  -29.318 17.225  1.00 28.37 ?  247  THR A N     1 
ATOM   1780 C  CA    . THR C 3 181 ? 13.193  -27.943 17.684  1.00 26.94 ?  247  THR A CA    1 
ATOM   1781 C  C     . THR C 3 181 ? 14.581  -27.422 17.300  1.00 25.76 ?  247  THR A C     1 
ATOM   1782 O  O     . THR C 3 181 ? 15.590  -28.111 17.484  1.00 25.88 ?  247  THR A O     1 
ATOM   1783 C  CB    . THR C 3 181 ? 13.008  -27.854 19.232  1.00 26.93 ?  247  THR A CB    1 
ATOM   1784 O  OG1   . THR C 3 181 ? 11.696  -28.308 19.573  1.00 27.80 ?  247  THR A OG1   1 
ATOM   1785 C  CG2   . THR C 3 181 ? 13.200  -26.416 19.751  1.00 25.26 ?  247  THR A CG2   1 
ATOM   1786 N  N     . THR C 3 182 ? 14.639  -26.205 16.765  1.00 24.73 ?  248  THR A N     1 
ATOM   1787 C  CA    . THR C 3 182 ? 15.921  -25.545 16.499  1.00 22.92 ?  248  THR A CA    1 
ATOM   1788 C  C     . THR C 3 182 ? 16.140  -24.384 17.479  1.00 23.24 ?  248  THR A C     1 
ATOM   1789 O  O     . THR C 3 182 ? 15.202  -23.931 18.146  1.00 22.46 ?  248  THR A O     1 
ATOM   1790 C  CB    . THR C 3 182 ? 15.992  -25.050 15.031  1.00 23.33 ?  248  THR A CB    1 
ATOM   1791 O  OG1   . THR C 3 182 ? 15.124  -23.913 14.847  1.00 22.40 ?  248  THR A OG1   1 
ATOM   1792 C  CG2   . THR C 3 182 ? 15.553  -26.189 14.108  1.00 21.62 ?  248  THR A CG2   1 
ATOM   1793 N  N     . TYR C 3 183 ? 17.374  -23.904 17.570  1.00 22.57 ?  249  TYR A N     1 
ATOM   1794 C  CA    . TYR C 3 183 ? 17.723  -22.940 18.614  1.00 23.28 ?  249  TYR A CA    1 
ATOM   1795 C  C     . TYR C 3 183 ? 18.489  -21.745 18.072  1.00 23.25 ?  249  TYR A C     1 
ATOM   1796 O  O     . TYR C 3 183 ? 19.176  -21.857 17.057  1.00 24.02 ?  249  TYR A O     1 
ATOM   1797 C  CB    . TYR C 3 183 ? 18.548  -23.619 19.701  1.00 22.25 ?  249  TYR A CB    1 
ATOM   1798 C  CG    . TYR C 3 183 ? 17.751  -24.630 20.496  1.00 23.15 ?  249  TYR A CG    1 
ATOM   1799 C  CD1   . TYR C 3 183 ? 17.298  -24.331 21.783  1.00 21.77 ?  249  TYR A CD1   1 
ATOM   1800 C  CD2   . TYR C 3 183 ? 17.438  -25.867 19.958  1.00 21.20 ?  249  TYR A CD2   1 
ATOM   1801 C  CE1   . TYR C 3 183 ? 16.554  -25.230 22.498  1.00 25.20 ?  249  TYR A CE1   1 
ATOM   1802 C  CE2   . TYR C 3 183 ? 16.694  -26.790 20.680  1.00 23.70 ?  249  TYR A CE2   1 
ATOM   1803 C  CZ    . TYR C 3 183 ? 16.262  -26.465 21.943  1.00 23.70 ?  249  TYR A CZ    1 
ATOM   1804 O  OH    . TYR C 3 183 ? 15.526  -27.366 22.658  1.00 26.98 ?  249  TYR A OH    1 
ATOM   1805 N  N     . ASP C 3 184 ? 18.372  -20.623 18.776  1.00 23.75 ?  250  ASP A N     1 
ATOM   1806 C  CA    . ASP C 3 184 ? 19.130  -19.393 18.523  1.00 23.91 ?  250  ASP A CA    1 
ATOM   1807 C  C     . ASP C 3 184 ? 18.831  -18.754 17.179  1.00 24.42 ?  250  ASP A C     1 
ATOM   1808 O  O     . ASP C 3 184 ? 19.756  -18.455 16.413  1.00 24.05 ?  250  ASP A O     1 
ATOM   1809 C  CB    . ASP C 3 184 ? 20.643  -19.618 18.682  1.00 23.99 ?  250  ASP A CB    1 
ATOM   1810 C  CG    . ASP C 3 184 ? 21.119  -19.458 20.131  1.00 25.42 ?  250  ASP A CG    1 
ATOM   1811 O  OD1   . ASP C 3 184 ? 20.297  -19.605 21.090  1.00 26.24 ?  250  ASP A OD1   1 
ATOM   1812 O  OD2   . ASP C 3 184 ? 22.322  -19.191 20.322  1.00 22.91 ?  250  ASP A OD2   1 
ATOM   1813 N  N     . ASN C 3 185 ? 17.542  -18.545 16.905  1.00 24.44 ?  251  ASN A N     1 
ATOM   1814 C  CA    . ASN C 3 185 ? 17.096  -17.821 15.723  1.00 24.90 ?  251  ASN A CA    1 
ATOM   1815 C  C     . ASN C 3 185 ? 17.302  -16.317 15.920  1.00 25.07 ?  251  ASN A C     1 
ATOM   1816 O  O     . ASN C 3 185 ? 16.676  -15.709 16.796  1.00 25.30 ?  251  ASN A O     1 
ATOM   1817 C  CB    . ASN C 3 185 ? 15.614  -18.130 15.426  1.00 24.75 ?  251  ASN A CB    1 
ATOM   1818 C  CG    . ASN C 3 185 ? 15.148  -17.577 14.073  1.00 27.56 ?  251  ASN A CG    1 
ATOM   1819 O  OD1   . ASN C 3 185 ? 15.905  -16.921 13.369  1.00 27.23 ?  251  ASN A OD1   1 
ATOM   1820 N  ND2   . ASN C 3 185 ? 13.898  -17.858 13.707  1.00 29.12 ?  251  ASN A ND2   1 
ATOM   1821 N  N     . ILE C 3 186 ? 18.186  -15.727 15.116  1.00 24.47 ?  252  ILE A N     1 
ATOM   1822 C  CA    . ILE C 3 186 ? 18.521  -14.304 15.227  1.00 24.46 ?  252  ILE A CA    1 
ATOM   1823 C  C     . ILE C 3 186 ? 19.198  -13.886 13.924  1.00 24.03 ?  252  ILE A C     1 
ATOM   1824 O  O     . ILE C 3 186 ? 19.910  -14.687 13.314  1.00 24.33 ?  252  ILE A O     1 
ATOM   1825 C  CB    . ILE C 3 186 ? 19.478  -14.041 16.446  1.00 24.53 ?  252  ILE A CB    1 
ATOM   1826 C  CG1   . ILE C 3 186 ? 19.643  -12.551 16.750  1.00 25.60 ?  252  ILE A CG1   1 
ATOM   1827 C  CG2   . ILE C 3 186 ? 20.839  -14.702 16.251  1.00 25.70 ?  252  ILE A CG2   1 
ATOM   1828 C  CD1   . ILE C 3 186 ? 20.432  -12.298 18.065  1.00 25.32 ?  252  ILE A CD1   1 
ATOM   1829 N  N     . ALA C 3 187 ? 18.962  -12.658 13.484  1.00 23.45 ?  253  ALA A N     1 
ATOM   1830 C  CA    . ALA C 3 187 ? 19.565  -12.161 12.230  1.00 24.53 ?  253  ALA A CA    1 
ATOM   1831 C  C     . ALA C 3 187 ? 21.092  -12.192 12.319  1.00 24.48 ?  253  ALA A C     1 
ATOM   1832 O  O     . ALA C 3 187 ? 21.670  -11.973 13.383  1.00 24.21 ?  253  ALA A O     1 
ATOM   1833 C  CB    . ALA C 3 187 ? 19.067  -10.734 11.908  1.00 24.28 ?  253  ALA A CB    1 
ATOM   1834 N  N     . TYR C 3 188 ? 21.726  -12.501 11.190  1.00 24.53 ?  254  TYR A N     1 
ATOM   1835 C  CA    . TYR C 3 188 ? 23.169  -12.643 11.076  1.00 24.48 ?  254  TYR A CA    1 
ATOM   1836 C  C     . TYR C 3 188 ? 23.974  -11.494 11.680  1.00 25.02 ?  254  TYR A C     1 
ATOM   1837 O  O     . TYR C 3 188 ? 24.887  -11.711 12.472  1.00 25.35 ?  254  TYR A O     1 
ATOM   1838 C  CB    . TYR C 3 188 ? 23.532  -12.834 9.594   1.00 24.38 ?  254  TYR A CB    1 
ATOM   1839 C  CG    . TYR C 3 188 ? 25.007  -12.846 9.301   1.00 24.78 ?  254  TYR A CG    1 
ATOM   1840 C  CD1   . TYR C 3 188 ? 25.810  -13.896 9.757   1.00 26.15 ?  254  TYR A CD1   1 
ATOM   1841 C  CD2   . TYR C 3 188 ? 25.604  -11.837 8.534   1.00 22.23 ?  254  TYR A CD2   1 
ATOM   1842 C  CE1   . TYR C 3 188 ? 27.163  -13.937 9.485   1.00 26.21 ?  254  TYR A CE1   1 
ATOM   1843 C  CE2   . TYR C 3 188 ? 26.972  -11.874 8.254   1.00 23.95 ?  254  TYR A CE2   1 
ATOM   1844 C  CZ    . TYR C 3 188 ? 27.752  -12.920 8.745   1.00 26.83 ?  254  TYR A CZ    1 
ATOM   1845 O  OH    . TYR C 3 188 ? 29.123  -12.990 8.476   1.00 24.63 ?  254  TYR A OH    1 
ATOM   1846 N  N     . THR C 3 189 ? 23.661  -10.262 11.314  1.00 25.39 ?  255  THR A N     1 
ATOM   1847 C  CA    . THR C 3 189 ? 24.415  -9.147  11.877  1.00 26.05 ?  255  THR A CA    1 
ATOM   1848 C  C     . THR C 3 189 ? 24.407  -9.122  13.413  1.00 25.86 ?  255  THR A C     1 
ATOM   1849 O  O     . THR C 3 189 ? 25.453  -8.932  14.043  1.00 25.35 ?  255  THR A O     1 
ATOM   1850 C  CB    . THR C 3 189 ? 23.897  -7.805  11.321  1.00 26.98 ?  255  THR A CB    1 
ATOM   1851 O  OG1   . THR C 3 189 ? 24.158  -7.755  9.905   1.00 27.68 ?  255  THR A OG1   1 
ATOM   1852 C  CG2   . THR C 3 189 ? 24.607  -6.656  11.992  1.00 27.26 ?  255  THR A CG2   1 
ATOM   1853 N  N     . LEU C 3 190 ? 23.230  -9.317  14.010  1.00 25.50 ?  256  LEU A N     1 
ATOM   1854 C  CA    . LEU C 3 190 ? 23.105  -9.325  15.459  1.00 26.37 ?  256  LEU A CA    1 
ATOM   1855 C  C     . LEU C 3 190 ? 23.804  -10.546 16.062  1.00 25.73 ?  256  LEU A C     1 
ATOM   1856 O  O     . LEU C 3 190 ? 24.343  -10.473 17.167  1.00 25.00 ?  256  LEU A O     1 
ATOM   1857 C  CB    . LEU C 3 190 ? 21.621  -9.317  15.861  1.00 27.61 ?  256  LEU A CB    1 
ATOM   1858 C  CG    . LEU C 3 190 ? 21.102  -8.297  16.882  1.00 29.83 ?  256  LEU A CG    1 
ATOM   1859 C  CD1   . LEU C 3 190 ? 19.742  -8.757  17.491  1.00 30.04 ?  256  LEU A CD1   1 
ATOM   1860 C  CD2   . LEU C 3 190 ? 22.122  -7.967  17.961  1.00 31.95 ?  256  LEU A CD2   1 
ATOM   1861 N  N     . ARG C 3 191 ? 23.792  -11.667 15.331  1.00 25.02 ?  257  ARG A N     1 
ATOM   1862 C  CA    . ARG C 3 191 ? 24.495  -12.880 15.768  1.00 24.87 ?  257  ARG A CA    1 
ATOM   1863 C  C     . ARG C 3 191 ? 25.980  -12.556 15.968  1.00 24.60 ?  257  ARG A C     1 
ATOM   1864 O  O     . ARG C 3 191 ? 26.588  -12.929 16.983  1.00 24.34 ?  257  ARG A O     1 
ATOM   1865 C  CB    . ARG C 3 191 ? 24.311  -14.017 14.736  1.00 24.28 ?  257  ARG A CB    1 
ATOM   1866 C  CG    . ARG C 3 191 ? 25.109  -15.277 15.020  1.00 24.35 ?  257  ARG A CG    1 
ATOM   1867 C  CD    . ARG C 3 191 ? 24.392  -16.198 15.997  1.00 24.59 ?  257  ARG A CD    1 
ATOM   1868 N  NE    . ARG C 3 191 ? 24.690  -15.830 17.374  1.00 23.74 ?  257  ARG A NE    1 
ATOM   1869 C  CZ    . ARG C 3 191 ? 24.184  -16.441 18.438  1.00 25.88 ?  257  ARG A CZ    1 
ATOM   1870 N  NH1   . ARG C 3 191 ? 23.314  -17.445 18.286  1.00 22.78 ?  257  ARG A NH1   1 
ATOM   1871 N  NH2   . ARG C 3 191 ? 24.546  -16.038 19.657  1.00 23.60 ?  257  ARG A NH2   1 
ATOM   1872 N  N     . LEU C 3 192 ? 26.553  -11.832 15.013  1.00 24.62 ?  258  LEU A N     1 
ATOM   1873 C  CA    . LEU C 3 192 ? 27.981  -11.489 15.078  1.00 25.29 ?  258  LEU A CA    1 
ATOM   1874 C  C     . LEU C 3 192 ? 28.263  -10.531 16.231  1.00 24.95 ?  258  LEU A C     1 
ATOM   1875 O  O     . LEU C 3 192 ? 29.229  -10.719 16.970  1.00 24.99 ?  258  LEU A O     1 
ATOM   1876 C  CB    . LEU C 3 192 ? 28.486  -10.880 13.752  1.00 24.69 ?  258  LEU A CB    1 
ATOM   1877 C  CG    . LEU C 3 192 ? 29.987  -10.583 13.610  1.00 25.96 ?  258  LEU A CG    1 
ATOM   1878 C  CD1   . LEU C 3 192 ? 30.469  -10.745 12.125  1.00 26.50 ?  258  LEU A CD1   1 
ATOM   1879 C  CD2   . LEU C 3 192 ? 30.350  -9.202  14.120  1.00 27.20 ?  258  LEU A CD2   1 
ATOM   1880 N  N     . MET C 3 193 ? 27.428  -9.501  16.353  1.00 25.00 ?  259  MET A N     1 
ATOM   1881 C  CA    . MET C 3 193 ? 27.553  -8.505  17.436  1.00 25.52 ?  259  MET A CA    1 
ATOM   1882 C  C     . MET C 3 193 ? 27.487  -9.179  18.801  1.00 24.76 ?  259  MET A C     1 
ATOM   1883 O  O     . MET C 3 193 ? 28.289  -8.891  19.690  1.00 23.98 ?  259  MET A O     1 
ATOM   1884 C  CB    . MET C 3 193 ? 26.456  -7.436  17.320  1.00 25.22 ?  259  MET A CB    1 
ATOM   1885 C  CG    . MET C 3 193 ? 26.660  -6.464  16.136  1.00 26.95 ?  259  MET A CG    1 
ATOM   1886 S  SD    . MET C 3 193 ? 25.276  -5.308  15.958  1.00 29.24 ?  259  MET A SD    1 
ATOM   1887 C  CE    . MET C 3 193 ? 25.596  -4.231  17.382  1.00 29.21 ?  259  MET A CE    1 
ATOM   1888 N  N     . VAL C 3 194 ? 26.525  -10.081 18.967  1.00 24.90 ?  260  VAL A N     1 
ATOM   1889 C  CA    . VAL C 3 194 ? 26.412  -10.819 20.219  1.00 24.84 ?  260  VAL A CA    1 
ATOM   1890 C  C     . VAL C 3 194 ? 27.684  -11.651 20.479  1.00 25.39 ?  260  VAL A C     1 
ATOM   1891 O  O     . VAL C 3 194 ? 28.278  -11.588 21.549  1.00 24.64 ?  260  VAL A O     1 
ATOM   1892 C  CB    . VAL C 3 194 ? 25.160  -11.742 20.221  1.00 25.54 ?  260  VAL A CB    1 
ATOM   1893 C  CG1   . VAL C 3 194 ? 25.243  -12.775 21.357  1.00 24.87 ?  260  VAL A CG1   1 
ATOM   1894 C  CG2   . VAL C 3 194 ? 23.869  -10.921 20.325  1.00 25.07 ?  260  VAL A CG2   1 
ATOM   1895 N  N     . ASP C 3 195 ? 28.110  -12.432 19.490  1.00 25.60 ?  261  ASP A N     1 
ATOM   1896 C  CA    . ASP C 3 195 ? 29.230  -13.345 19.715  1.00 25.75 ?  261  ASP A CA    1 
ATOM   1897 C  C     . ASP C 3 195 ? 30.549  -12.609 19.897  1.00 26.00 ?  261  ASP A C     1 
ATOM   1898 O  O     . ASP C 3 195 ? 31.464  -13.145 20.520  1.00 26.37 ?  261  ASP A O     1 
ATOM   1899 C  CB    . ASP C 3 195 ? 29.376  -14.363 18.575  1.00 26.03 ?  261  ASP A CB    1 
ATOM   1900 C  CG    . ASP C 3 195 ? 28.198  -15.307 18.482  1.00 25.54 ?  261  ASP A CG    1 
ATOM   1901 O  OD1   . ASP C 3 195 ? 28.193  -16.211 17.606  1.00 24.99 ?  261  ASP A OD1   1 
ATOM   1902 O  OD2   . ASP C 3 195 ? 27.262  -15.129 19.269  1.00 25.22 ?  261  ASP A OD2   1 
ATOM   1903 N  N     . CYS C 3 196 ? 30.661  -11.406 19.337  1.00 25.35 ?  262  CYS A N     1 
ATOM   1904 C  CA    . CYS C 3 196 ? 31.893  -10.630 19.464  1.00 25.71 ?  262  CYS A CA    1 
ATOM   1905 C  C     . CYS C 3 196 ? 31.883  -9.631  20.628  1.00 25.71 ?  262  CYS A C     1 
ATOM   1906 O  O     . CYS C 3 196 ? 32.903  -8.974  20.890  1.00 26.36 ?  262  CYS A O     1 
ATOM   1907 C  CB    . CYS C 3 196 ? 32.222  -9.899  18.155  1.00 25.50 ?  262  CYS A CB    1 
ATOM   1908 S  SG    . CYS C 3 196 ? 32.636  -11.026 16.774  1.00 27.80 ?  262  CYS A SG    1 
ATOM   1909 N  N     . GLY C 3 197 ? 30.751  -9.513  21.321  1.00 25.29 ?  263  GLY A N     1 
ATOM   1910 C  CA    . GLY C 3 197 ? 30.633  -8.558  22.434  1.00 24.68 ?  263  GLY A CA    1 
ATOM   1911 C  C     . GLY C 3 197 ? 30.499  -7.104  21.969  1.00 24.90 ?  263  GLY A C     1 
ATOM   1912 O  O     . GLY C 3 197 ? 30.941  -6.178  22.654  1.00 24.79 ?  263  GLY A O     1 
ATOM   1913 N  N     . ILE C 3 198 ? 29.901  -6.895  20.799  1.00 24.37 ?  264  ILE A N     1 
ATOM   1914 C  CA    . ILE C 3 198 ? 29.734  -5.553  20.248  1.00 23.98 ?  264  ILE A CA    1 
ATOM   1915 C  C     . ILE C 3 198 ? 28.322  -5.047  20.528  1.00 24.13 ?  264  ILE A C     1 
ATOM   1916 O  O     . ILE C 3 198 ? 27.348  -5.683  20.136  1.00 24.45 ?  264  ILE A O     1 
ATOM   1917 C  CB    . ILE C 3 198 ? 29.970  -5.562  18.713  1.00 24.01 ?  264  ILE A CB    1 
ATOM   1918 C  CG1   . ILE C 3 198 ? 31.401  -6.002  18.382  1.00 24.06 ?  264  ILE A CG1   1 
ATOM   1919 C  CG2   . ILE C 3 198 ? 29.664  -4.179  18.068  1.00 23.16 ?  264  ILE A CG2   1 
ATOM   1920 C  CD1   . ILE C 3 198 ? 31.590  -6.322  16.900  1.00 24.80 ?  264  ILE A CD1   1 
ATOM   1921 N  N     . VAL C 3 199 ? 28.200  -3.914  21.213  1.00 23.90 ?  265  VAL A N     1 
ATOM   1922 C  CA    . VAL C 3 199 ? 26.885  -3.332  21.462  1.00 23.76 ?  265  VAL A CA    1 
ATOM   1923 C  C     . VAL C 3 199 ? 26.692  -2.177  20.482  1.00 23.98 ?  265  VAL A C     1 
ATOM   1924 O  O     . VAL C 3 199 ? 27.581  -1.903  19.672  1.00 24.63 ?  265  VAL A O     1 
ATOM   1925 C  CB    . VAL C 3 199 ? 26.694  -2.881  22.951  1.00 23.49 ?  265  VAL A CB    1 
ATOM   1926 C  CG1   . VAL C 3 199 ? 26.780  -4.093  23.919  1.00 21.94 ?  265  VAL A CG1   1 
ATOM   1927 C  CG2   . VAL C 3 199 ? 27.695  -1.771  23.343  1.00 21.99 ?  265  VAL A CG2   1 
ATOM   1928 N  N     . GLY C 3 200 ? 25.546  -1.514  20.527  1.00 23.81 ?  266  GLY A N     1 
ATOM   1929 C  CA    . GLY C 3 200 ? 25.321  -0.393  19.606  1.00 24.01 ?  266  GLY A CA    1 
ATOM   1930 C  C     . GLY C 3 200 ? 26.230  0.771   19.988  1.00 23.72 ?  266  GLY A C     1 
ATOM   1931 O  O     . GLY C 3 200 ? 26.513  0.972   21.182  1.00 22.39 ?  266  GLY A O     1 
ATOM   1932 N  N     . MET C 3 201 ? 26.703  1.522   18.980  1.00 23.94 ?  267  MET A N     1 
ATOM   1933 C  CA    . MET C 3 201 ? 27.446  2.756   19.220  1.00 23.91 ?  267  MET A CA    1 
ATOM   1934 C  C     . MET C 3 201 ? 28.700  2.519   20.053  1.00 24.03 ?  267  MET A C     1 
ATOM   1935 O  O     . MET C 3 201 ? 29.094  3.348   20.888  1.00 23.39 ?  267  MET A O     1 
ATOM   1936 C  CB    . MET C 3 201 ? 26.530  3.799   19.892  1.00 24.76 ?  267  MET A CB    1 
ATOM   1937 C  CG    . MET C 3 201 ? 25.269  4.137   19.040  1.00 23.19 ?  267  MET A CG    1 
ATOM   1938 S  SD    . MET C 3 201 ? 25.681  4.786   17.394  1.00 25.98 ?  267  MET A SD    1 
ATOM   1939 C  CE    . MET C 3 201 ? 25.730  6.561   17.666  1.00 24.45 ?  267  MET A CE    1 
ATOM   1940 N  N     . SER C 3 202 ? 29.340  1.387   19.809  1.00 24.38 ?  268  SER A N     1 
ATOM   1941 C  CA    . SER C 3 202 ? 30.484  0.984   20.602  1.00 24.84 ?  268  SER A CA    1 
ATOM   1942 C  C     . SER C 3 202 ? 31.793  1.174   19.840  1.00 25.19 ?  268  SER A C     1 
ATOM   1943 O  O     . SER C 3 202 ? 31.808  1.375   18.609  1.00 25.66 ?  268  SER A O     1 
ATOM   1944 C  CB    . SER C 3 202 ? 30.347  -0.484  20.984  1.00 24.17 ?  268  SER A CB    1 
ATOM   1945 O  OG    . SER C 3 202 ? 30.563  -1.301  19.843  1.00 27.09 ?  268  SER A OG    1 
ATOM   1946 N  N     . TRP C 3 203 ? 32.901  1.055   20.568  1.00 24.72 ?  269  TRP A N     1 
ATOM   1947 C  CA    . TRP C 3 203 ? 34.202  1.239   19.952  1.00 24.45 ?  269  TRP A CA    1 
ATOM   1948 C  C     . TRP C 3 203 ? 34.819  -0.096  19.613  1.00 24.43 ?  269  TRP A C     1 
ATOM   1949 O  O     . TRP C 3 203 ? 34.736  -1.049  20.392  1.00 24.58 ?  269  TRP A O     1 
ATOM   1950 C  CB    . TRP C 3 203 ? 35.146  1.994   20.898  1.00 24.01 ?  269  TRP A CB    1 
ATOM   1951 C  CG    . TRP C 3 203 ? 34.860  3.453   21.010  1.00 24.56 ?  269  TRP A CG    1 
ATOM   1952 C  CD1   . TRP C 3 203 ? 33.957  4.064   21.852  1.00 24.38 ?  269  TRP A CD1   1 
ATOM   1953 C  CD2   . TRP C 3 203 ? 35.496  4.500   20.274  1.00 24.75 ?  269  TRP A CD2   1 
ATOM   1954 N  NE1   . TRP C 3 203 ? 34.001  5.433   21.674  1.00 23.32 ?  269  TRP A NE1   1 
ATOM   1955 C  CE2   . TRP C 3 203 ? 34.940  5.723   20.715  1.00 25.36 ?  269  TRP A CE2   1 
ATOM   1956 C  CE3   . TRP C 3 203 ? 36.487  4.525   19.283  1.00 24.69 ?  269  TRP A CE3   1 
ATOM   1957 C  CZ2   . TRP C 3 203 ? 35.337  6.957   20.189  1.00 26.14 ?  269  TRP A CZ2   1 
ATOM   1958 C  CZ3   . TRP C 3 203 ? 36.883  5.750   18.772  1.00 26.44 ?  269  TRP A CZ3   1 
ATOM   1959 C  CH2   . TRP C 3 203 ? 36.310  6.950   19.226  1.00 26.96 ?  269  TRP A CH2   1 
ATOM   1960 N  N     . ILE C 3 204 ? 35.471  -0.145  18.460  1.00 24.45 ?  270  ILE A N     1 
ATOM   1961 C  CA    . ILE C 3 204 ? 36.193  -1.320  18.030  1.00 24.45 ?  270  ILE A CA    1 
ATOM   1962 C  C     . ILE C 3 204 ? 37.593  -0.842  17.666  1.00 24.76 ?  270  ILE A C     1 
ATOM   1963 O  O     . ILE C 3 204 ? 37.767  0.241   17.074  1.00 24.04 ?  270  ILE A O     1 
ATOM   1964 C  CB    . ILE C 3 204 ? 35.538  -1.955  16.806  1.00 24.95 ?  270  ILE A CB    1 
ATOM   1965 C  CG1   . ILE C 3 204 ? 34.157  -2.575  17.155  1.00 25.74 ?  270  ILE A CG1   1 
ATOM   1966 C  CG2   . ILE C 3 204 ? 36.469  -2.974  16.167  1.00 25.62 ?  270  ILE A CG2   1 
ATOM   1967 C  CD1   . ILE C 3 204 ? 33.293  -2.862  15.886  1.00 25.45 ?  270  ILE A CD1   1 
ATOM   1968 N  N     . THR C 3 205 ? 38.588  -1.626  18.056  1.00 24.38 ?  271  THR A N     1 
ATOM   1969 C  CA    . THR C 3 205 ? 39.945  -1.387  17.618  1.00 24.80 ?  271  THR A CA    1 
ATOM   1970 C  C     . THR C 3 205 ? 40.408  -2.460  16.637  1.00 24.44 ?  271  THR A C     1 
ATOM   1971 O  O     . THR C 3 205 ? 40.232  -3.660  16.879  1.00 24.22 ?  271  THR A O     1 
ATOM   1972 C  CB    . THR C 3 205 ? 40.906  -1.284  18.799  1.00 25.03 ?  271  THR A CB    1 
ATOM   1973 O  OG1   . THR C 3 205 ? 40.583  -0.102  19.548  1.00 26.36 ?  271  THR A OG1   1 
ATOM   1974 C  CG2   . THR C 3 205 ? 42.364  -1.181  18.302  1.00 25.65 ?  271  THR A CG2   1 
ATOM   1975 N  N     . LEU C 3 206 ? 40.983  -2.008  15.525  1.00 23.89 ?  272  LEU A N     1 
ATOM   1976 C  CA    . LEU C 3 206 ? 41.637  -2.890  14.575  1.00 23.77 ?  272  LEU A CA    1 
ATOM   1977 C  C     . LEU C 3 206 ? 43.130  -2.722  14.792  1.00 23.64 ?  272  LEU A C     1 
ATOM   1978 O  O     . LEU C 3 206 ? 43.697  -1.679  14.454  1.00 23.82 ?  272  LEU A O     1 
ATOM   1979 C  CB    . LEU C 3 206 ? 41.251  -2.520  13.142  1.00 23.61 ?  272  LEU A CB    1 
ATOM   1980 C  CG    . LEU C 3 206 ? 39.784  -2.073  12.946  1.00 24.65 ?  272  LEU A CG    1 
ATOM   1981 C  CD1   . LEU C 3 206 ? 39.558  -1.585  11.489  1.00 25.37 ?  272  LEU A CD1   1 
ATOM   1982 C  CD2   . LEU C 3 206 ? 38.828  -3.221  13.275  1.00 23.51 ?  272  LEU A CD2   1 
ATOM   1983 N  N     . PRO C 3 207 ? 43.772  -3.738  15.393  1.00 23.28 ?  273  PRO A N     1 
ATOM   1984 C  CA    . PRO C 3 207 ? 45.200  -3.655  15.702  1.00 23.00 ?  273  PRO A CA    1 
ATOM   1985 C  C     . PRO C 3 207 ? 46.032  -3.573  14.431  1.00 23.00 ?  273  PRO A C     1 
ATOM   1986 O  O     . PRO C 3 207 ? 45.717  -4.224  13.434  1.00 22.17 ?  273  PRO A O     1 
ATOM   1987 C  CB    . PRO C 3 207 ? 45.483  -4.984  16.421  1.00 22.99 ?  273  PRO A CB    1 
ATOM   1988 C  CG    . PRO C 3 207 ? 44.155  -5.436  16.931  1.00 22.29 ?  273  PRO A CG    1 
ATOM   1989 C  CD    . PRO C 3 207 ? 43.197  -5.021  15.838  1.00 22.98 ?  273  PRO A CD    1 
ATOM   1990 N  N     . LYS C 3 208 ? 47.079  -2.751  14.463  1.00 23.17 ?  274  LYS A N     1 
ATOM   1991 C  CA    . LYS C 3 208 ? 47.989  -2.638  13.333  1.00 23.15 ?  274  LYS A CA    1 
ATOM   1992 C  C     . LYS C 3 208 ? 48.538  -4.022  13.001  1.00 23.57 ?  274  LYS A C     1 
ATOM   1993 O  O     . LYS C 3 208 ? 48.814  -4.826  13.903  1.00 23.41 ?  274  LYS A O     1 
ATOM   1994 C  CB    . LYS C 3 208 ? 49.139  -1.676  13.655  1.00 22.98 ?  274  LYS A CB    1 
ATOM   1995 C  CG    . LYS C 3 208 ? 50.060  -2.144  14.781  1.00 22.47 ?  274  LYS A CG    1 
ATOM   1996 C  CD    . LYS C 3 208 ? 51.158  -1.113  15.102  1.00 23.25 ?  274  LYS A CD    1 
ATOM   1997 C  CE    . LYS C 3 208 ? 50.567  0.158   15.710  1.00 21.76 ?  274  LYS A CE    1 
ATOM   1998 N  NZ    . LYS C 3 208 ? 51.606  1.090   16.177  1.00 22.38 ?  274  LYS A NZ    1 
ATOM   1999 N  N     . GLY C 3 209 ? 48.673  -4.303  11.710  1.00 23.73 ?  275  GLY A N     1 
ATOM   2000 C  CA    . GLY C 3 209 ? 49.152  -5.602  11.260  1.00 24.71 ?  275  GLY A CA    1 
ATOM   2001 C  C     . GLY C 3 209 ? 48.055  -6.655  11.159  1.00 25.56 ?  275  GLY A C     1 
ATOM   2002 O  O     . GLY C 3 209 ? 48.260  -7.716  10.559  1.00 25.83 ?  275  GLY A O     1 
ATOM   2003 N  N     . LYS C 3 210 ? 46.882  -6.368  11.719  1.00 25.59 ?  276  LYS A N     1 
ATOM   2004 C  CA    . LYS C 3 210 ? 45.829  -7.382  11.805  1.00 26.48 ?  276  LYS A CA    1 
ATOM   2005 C  C     . LYS C 3 210 ? 44.701  -7.185  10.801  1.00 26.27 ?  276  LYS A C     1 
ATOM   2006 O  O     . LYS C 3 210 ? 43.848  -8.047  10.655  1.00 27.02 ?  276  LYS A O     1 
ATOM   2007 C  CB    . LYS C 3 210 ? 45.242  -7.434  13.212  1.00 26.31 ?  276  LYS A CB    1 
ATOM   2008 C  CG    . LYS C 3 210 ? 46.233  -7.854  14.275  1.00 27.94 ?  276  LYS A CG    1 
ATOM   2009 C  CD    . LYS C 3 210 ? 46.780  -9.236  13.980  1.00 31.48 ?  276  LYS A CD    1 
ATOM   2010 C  CE    . LYS C 3 210 ? 47.249  -9.934  15.246  1.00 32.78 ?  276  LYS A CE    1 
ATOM   2011 N  NZ    . LYS C 3 210 ? 48.130  -9.071  16.089  1.00 36.12 ?  276  LYS A NZ    1 
ATOM   2012 N  N     . TYR C 3 211 ? 44.688  -6.047  10.125  1.00 25.94 ?  277  TYR A N     1 
ATOM   2013 C  CA    . TYR C 3 211 ? 43.692  -5.789  9.100   1.00 25.96 ?  277  TYR A CA    1 
ATOM   2014 C  C     . TYR C 3 211 ? 44.401  -5.451  7.793   1.00 25.93 ?  277  TYR A C     1 
ATOM   2015 O  O     . TYR C 3 211 ? 45.614  -5.246  7.759   1.00 25.15 ?  277  TYR A O     1 
ATOM   2016 C  CB    . TYR C 3 211 ? 42.776  -4.627  9.516   1.00 25.86 ?  277  TYR A CB    1 
ATOM   2017 C  CG    . TYR C 3 211 ? 43.505  -3.303  9.688   1.00 26.45 ?  277  TYR A CG    1 
ATOM   2018 C  CD1   . TYR C 3 211 ? 44.088  -2.946  10.909  1.00 25.61 ?  277  TYR A CD1   1 
ATOM   2019 C  CD2   . TYR C 3 211 ? 43.610  -2.412  8.627   1.00 27.02 ?  277  TYR A CD2   1 
ATOM   2020 C  CE1   . TYR C 3 211 ? 44.767  -1.723  11.060  1.00 25.68 ?  277  TYR A CE1   1 
ATOM   2021 C  CE2   . TYR C 3 211 ? 44.274  -1.195  8.762   1.00 26.62 ?  277  TYR A CE2   1 
ATOM   2022 C  CZ    . TYR C 3 211 ? 44.854  -0.858  9.979   1.00 26.38 ?  277  TYR A CZ    1 
ATOM   2023 O  OH    . TYR C 3 211 ? 45.506  0.349   10.087  1.00 25.55 ?  277  TYR A OH    1 
ATOM   2024 N  N     . SER C 3 212 ? 43.643  -5.372  6.712   1.00 26.43 ?  278  SER A N     1 
ATOM   2025 C  CA    . SER C 3 212 ? 44.243  -5.003  5.446   1.00 26.82 ?  278  SER A CA    1 
ATOM   2026 C  C     . SER C 3 212 ? 43.354  -3.985  4.751   1.00 27.22 ?  278  SER A C     1 
ATOM   2027 O  O     . SER C 3 212 ? 42.160  -3.871  5.064   1.00 26.96 ?  278  SER A O     1 
ATOM   2028 C  CB    . SER C 3 212 ? 44.437  -6.246  4.589   1.00 26.68 ?  278  SER A CB    1 
ATOM   2029 O  OG    . SER C 3 212 ? 43.186  -6.855  4.383   1.00 27.04 ?  278  SER A OG    1 
ATOM   2030 N  N     . MET C 3 213 ? 43.954  -3.220  3.844   1.00 27.57 ?  279  MET A N     1 
ATOM   2031 C  CA    . MET C 3 213 ? 43.244  -2.211  3.075   1.00 28.38 ?  279  MET A CA    1 
ATOM   2032 C  C     . MET C 3 213 ? 42.540  -2.880  1.913   1.00 28.75 ?  279  MET A C     1 
ATOM   2033 O  O     . MET C 3 213 ? 43.098  -3.785  1.294   1.00 29.09 ?  279  MET A O     1 
ATOM   2034 C  CB    . MET C 3 213 ? 44.233  -1.209  2.464   1.00 28.50 ?  279  MET A CB    1 
ATOM   2035 C  CG    . MET C 3 213 ? 45.185  -0.545  3.440   1.00 29.28 ?  279  MET A CG    1 
ATOM   2036 S  SD    . MET C 3 213 ? 44.330  0.140   4.881   1.00 30.97 ?  279  MET A SD    1 
ATOM   2037 C  CE    . MET C 3 213 ? 43.266  1.383   4.156   1.00 28.59 ?  279  MET A CE    1 
ATOM   2038 N  N     . ILE C 3 214 ? 41.346  -2.408  1.580   1.00 29.27 ?  280  ILE A N     1 
ATOM   2039 C  CA    . ILE C 3 214 ? 40.734  -2.748  0.309   1.00 30.16 ?  280  ILE A CA    1 
ATOM   2040 C  C     . ILE C 3 214 ? 41.500  -2.011  -0.784  1.00 31.39 ?  280  ILE A C     1 
ATOM   2041 O  O     . ILE C 3 214 ? 41.743  -0.809  -0.669  1.00 31.35 ?  280  ILE A O     1 
ATOM   2042 C  CB    . ILE C 3 214 ? 39.262  -2.304  0.251   1.00 30.05 ?  280  ILE A CB    1 
ATOM   2043 C  CG1   . ILE C 3 214 ? 38.427  -3.082  1.276   1.00 30.08 ?  280  ILE A CG1   1 
ATOM   2044 C  CG2   . ILE C 3 214 ? 38.718  -2.481  -1.156  1.00 29.06 ?  280  ILE A CG2   1 
ATOM   2045 C  CD1   . ILE C 3 214 ? 38.451  -4.594  1.034   1.00 30.69 ?  280  ILE A CD1   1 
ATOM   2046 N  N     . GLU C 3 215 ? 41.891  -2.735  -1.832  1.00 32.78 ?  281  GLU A N     1 
ATOM   2047 C  CA    . GLU C 3 215 ? 42.615  -2.149  -2.946  1.00 34.90 ?  281  GLU A CA    1 
ATOM   2048 C  C     . GLU C 3 215 ? 41.769  -1.105  -3.670  1.00 35.30 ?  281  GLU A C     1 
ATOM   2049 O  O     . GLU C 3 215 ? 40.543  -1.219  -3.733  1.00 35.01 ?  281  GLU A O     1 
ATOM   2050 C  CB    . GLU C 3 215 ? 43.060  -3.239  -3.919  1.00 35.50 ?  281  GLU A CB    1 
ATOM   2051 C  CG    . GLU C 3 215 ? 43.580  -4.497  -3.229  1.00 39.13 ?  281  GLU A CG    1 
ATOM   2052 C  CD    . GLU C 3 215 ? 42.505  -5.257  -2.439  1.00 43.86 ?  281  GLU A CD    1 
ATOM   2053 O  OE1   . GLU C 3 215 ? 42.821  -6.372  -1.956  1.00 47.28 ?  281  GLU A OE1   1 
ATOM   2054 O  OE2   . GLU C 3 215 ? 41.356  -4.762  -2.295  1.00 44.07 ?  281  GLU A OE2   1 
ATOM   2055 N  N     . PRO C 3 216 ? 42.428  -0.078  -4.216  1.00 35.88 ?  282  PRO A N     1 
ATOM   2056 C  CA    . PRO C 3 216 ? 41.744  1.064   -4.811  1.00 36.32 ?  282  PRO A CA    1 
ATOM   2057 C  C     . PRO C 3 216 ? 40.629  0.663   -5.774  1.00 36.49 ?  282  PRO A C     1 
ATOM   2058 O  O     . PRO C 3 216 ? 39.550  1.252   -5.751  1.00 36.80 ?  282  PRO A O     1 
ATOM   2059 C  CB    . PRO C 3 216 ? 42.876  1.791   -5.549  1.00 36.59 ?  282  PRO A CB    1 
ATOM   2060 C  CG    . PRO C 3 216 ? 44.077  1.513   -4.694  1.00 36.05 ?  282  PRO A CG    1 
ATOM   2061 C  CD    . PRO C 3 216 ? 43.895  0.083   -4.236  1.00 36.02 ?  282  PRO A CD    1 
ATOM   2062 N  N     . ASN C 3 217 ? 40.876  -0.348  -6.591  1.00 36.80 ?  283  ASN A N     1 
ATOM   2063 C  CA    . ASN C 3 217 ? 39.916  -0.740  -7.617  1.00 37.39 ?  283  ASN A CA    1 
ATOM   2064 C  C     . ASN C 3 217 ? 38.844  -1.684  -7.110  1.00 36.86 ?  283  ASN A C     1 
ATOM   2065 O  O     . ASN C 3 217 ? 37.963  -2.102  -7.864  1.00 36.94 ?  283  ASN A O     1 
ATOM   2066 C  CB    . ASN C 3 217 ? 40.646  -1.354  -8.811  1.00 38.24 ?  283  ASN A CB    1 
ATOM   2067 C  CG    . ASN C 3 217 ? 41.526  -0.346  -9.524  1.00 40.11 ?  283  ASN A CG    1 
ATOM   2068 O  OD1   . ASN C 3 217 ? 41.192  0.845   -9.594  1.00 42.90 ?  283  ASN A OD1   1 
ATOM   2069 N  ND2   . ASN C 3 217 ? 42.663  -0.806  -10.043 1.00 41.96 ?  283  ASN A ND2   1 
ATOM   2070 N  N     . ASN C 3 218 ? 38.915  -2.014  -5.825  1.00 35.67 ?  284  ASN A N     1 
ATOM   2071 C  CA    . ASN C 3 218 ? 37.924  -2.877  -5.216  1.00 34.38 ?  284  ASN A CA    1 
ATOM   2072 C  C     . ASN C 3 218 ? 37.077  -2.135  -4.186  1.00 33.34 ?  284  ASN A C     1 
ATOM   2073 O  O     . ASN C 3 218 ? 36.138  -2.690  -3.636  1.00 32.41 ?  284  ASN A O     1 
ATOM   2074 C  CB    . ASN C 3 218 ? 38.615  -4.076  -4.580  1.00 34.98 ?  284  ASN A CB    1 
ATOM   2075 C  CG    . ASN C 3 218 ? 39.379  -4.903  -5.591  1.00 36.86 ?  284  ASN A CG    1 
ATOM   2076 O  OD1   . ASN C 3 218 ? 40.372  -5.554  -5.255  1.00 40.28 ?  284  ASN A OD1   1 
ATOM   2077 N  ND2   . ASN C 3 218 ? 38.930  -4.873  -6.839  1.00 37.29 ?  284  ASN A ND2   1 
ATOM   2078 N  N     . ARG C 3 219 ? 37.425  -0.877  -3.935  1.00 32.34 ?  285  ARG A N     1 
ATOM   2079 C  CA    . ARG C 3 219 ? 36.661  -0.010  -3.042  1.00 32.33 ?  285  ARG A CA    1 
ATOM   2080 C  C     . ARG C 3 219 ? 35.189  0.095   -3.409  1.00 31.26 ?  285  ARG A C     1 
ATOM   2081 O  O     . ARG C 3 219 ? 34.846  0.272   -4.576  1.00 30.96 ?  285  ARG A O     1 
ATOM   2082 C  CB    . ARG C 3 219 ? 37.247  1.395   -3.069  1.00 32.62 ?  285  ARG A CB    1 
ATOM   2083 C  CG    . ARG C 3 219 ? 38.357  1.620   -2.088  1.00 34.57 ?  285  ARG A CG    1 
ATOM   2084 C  CD    . ARG C 3 219 ? 38.649  3.103   -2.058  1.00 37.93 ?  285  ARG A CD    1 
ATOM   2085 N  NE    . ARG C 3 219 ? 39.221  3.531   -0.793  1.00 39.75 ?  285  ARG A NE    1 
ATOM   2086 C  CZ    . ARG C 3 219 ? 38.551  4.167   0.159   1.00 38.41 ?  285  ARG A CZ    1 
ATOM   2087 N  NH1   . ARG C 3 219 ? 37.265  4.452   0.010   1.00 37.76 ?  285  ARG A NH1   1 
ATOM   2088 N  NH2   . ARG C 3 219 ? 39.181  4.511   1.269   1.00 38.40 ?  285  ARG A NH2   1 
ATOM   2089 N  N     . VAL C 3 220 ? 34.315  0.020   -2.410  1.00 30.10 ?  286  VAL A N     1 
ATOM   2090 C  CA    . VAL C 3 220 ? 32.889  0.159   -2.665  1.00 29.05 ?  286  VAL A CA    1 
ATOM   2091 C  C     . VAL C 3 220 ? 32.271  1.321   -1.900  1.00 28.70 ?  286  VAL A C     1 
ATOM   2092 O  O     . VAL C 3 220 ? 31.087  1.612   -2.068  1.00 27.95 ?  286  VAL A O     1 
ATOM   2093 C  CB    . VAL C 3 220 ? 32.122  -1.121  -2.314  1.00 29.69 ?  286  VAL A CB    1 
ATOM   2094 C  CG1   . VAL C 3 220 ? 32.660  -2.315  -3.143  1.00 30.47 ?  286  VAL A CG1   1 
ATOM   2095 C  CG2   . VAL C 3 220 ? 32.182  -1.377  -0.788  1.00 28.00 ?  286  VAL A CG2   1 
ATOM   2096 N  N     . SER C 3 221 ? 33.060  1.976   -1.048  1.00 28.30 ?  287  SER A N     1 
ATOM   2097 C  CA    . SER C 3 221 ? 32.511  3.032   -0.201  1.00 28.07 ?  287  SER A CA    1 
ATOM   2098 C  C     . SER C 3 221 ? 33.218  4.360   -0.432  1.00 27.91 ?  287  SER A C     1 
ATOM   2099 O  O     . SER C 3 221 ? 34.218  4.443   -1.135  1.00 27.71 ?  287  SER A O     1 
ATOM   2100 C  CB    . SER C 3 221 ? 32.646  2.666   1.283   1.00 28.21 ?  287  SER A CB    1 
ATOM   2101 O  OG    . SER C 3 221 ? 33.928  3.052   1.781   1.00 29.57 ?  287  SER A OG    1 
ATOM   2102 N  N     . SER C 3 222 ? 32.700  5.403   0.194   1.00 28.19 ?  288  SER A N     1 
ATOM   2103 C  CA    . SER C 3 222 ? 33.360  6.699   0.168   1.00 28.34 ?  288  SER A CA    1 
ATOM   2104 C  C     . SER C 3 222 ? 33.959  7.020   1.541   1.00 27.77 ?  288  SER A C     1 
ATOM   2105 O  O     . SER C 3 222 ? 34.190  8.183   1.880   1.00 27.42 ?  288  SER A O     1 
ATOM   2106 C  CB    . SER C 3 222 ? 32.369  7.791   -0.266  1.00 28.49 ?  288  SER A CB    1 
ATOM   2107 O  OG    . SER C 3 222 ? 31.117  7.622   0.380   1.00 29.15 ?  288  SER A OG    1 
ATOM   2108 N  N     . CYS C 3 223 ? 34.213  5.993   2.340   1.00 27.46 ?  289  CYS A N     1 
ATOM   2109 C  CA    . CYS C 3 223 ? 34.830  6.253   3.646   1.00 27.13 ?  289  CYS A CA    1 
ATOM   2110 C  C     . CYS C 3 223 ? 36.320  6.433   3.431   1.00 26.95 ?  289  CYS A C     1 
ATOM   2111 O  O     . CYS C 3 223 ? 36.903  5.819   2.542   1.00 26.19 ?  289  CYS A O     1 
ATOM   2112 C  CB    . CYS C 3 223 ? 34.553  5.108   4.618   1.00 26.99 ?  289  CYS A CB    1 
ATOM   2113 S  SG    . CYS C 3 223 ? 32.795  4.887   4.943   1.00 27.85 ?  289  CYS A SG    1 
ATOM   2114 N  N     . GLN C 3 224 ? 36.944  7.271   4.249   1.00 26.73 ?  290  GLN A N     1 
ATOM   2115 C  CA    . GLN C 3 224 ? 38.364  7.493   4.126   1.00 26.11 ?  290  GLN A CA    1 
ATOM   2116 C  C     . GLN C 3 224 ? 39.147  6.186   4.253   1.00 25.98 ?  290  GLN A C     1 
ATOM   2117 O  O     . GLN C 3 224 ? 40.089  5.942   3.500   1.00 26.05 ?  290  GLN A O     1 
ATOM   2118 C  CB    . GLN C 3 224 ? 38.818  8.508   5.167   1.00 26.20 ?  290  GLN A CB    1 
ATOM   2119 C  CG    . GLN C 3 224 ? 38.261  9.910   4.901   1.00 25.30 ?  290  GLN A CG    1 
ATOM   2120 C  CD    . GLN C 3 224 ? 38.797  10.913  5.888   1.00 25.19 ?  290  GLN A CD    1 
ATOM   2121 O  OE1   . GLN C 3 224 ? 38.608  10.764  7.094   1.00 26.71 ?  290  GLN A OE1   1 
ATOM   2122 N  NE2   . GLN C 3 224 ? 39.499  11.931  5.390   1.00 21.30 ?  290  GLN A NE2   1 
ATOM   2123 N  N     . LEU C 3 225 ? 38.754  5.348   5.204   1.00 25.02 ?  291  LEU A N     1 
ATOM   2124 C  CA    . LEU C 3 225 ? 39.459  4.103   5.455   1.00 24.77 ?  291  LEU A CA    1 
ATOM   2125 C  C     . LEU C 3 225 ? 38.516  2.941   5.152   1.00 24.88 ?  291  LEU A C     1 
ATOM   2126 O  O     . LEU C 3 225 ? 37.471  2.798   5.793   1.00 24.10 ?  291  LEU A O     1 
ATOM   2127 C  CB    . LEU C 3 225 ? 39.925  4.040   6.919   1.00 24.61 ?  291  LEU A CB    1 
ATOM   2128 C  CG    . LEU C 3 225 ? 41.005  5.043   7.343   1.00 24.26 ?  291  LEU A CG    1 
ATOM   2129 C  CD1   . LEU C 3 225 ? 41.115  5.176   8.871   1.00 23.44 ?  291  LEU A CD1   1 
ATOM   2130 C  CD2   . LEU C 3 225 ? 42.364  4.661   6.729   1.00 23.61 ?  291  LEU A CD2   1 
ATOM   2131 N  N     . GLU C 3 226 ? 38.883  2.131   4.165   1.00 23.94 ?  292  GLU A N     1 
ATOM   2132 C  CA    . GLU C 3 226 ? 38.097  0.952   3.804   1.00 24.33 ?  292  GLU A CA    1 
ATOM   2133 C  C     . GLU C 3 226 ? 39.004  -0.262  3.985   1.00 24.36 ?  292  GLU A C     1 
ATOM   2134 O  O     . GLU C 3 226 ? 40.021  -0.420  3.264   1.00 23.53 ?  292  GLU A O     1 
ATOM   2135 C  CB    . GLU C 3 226 ? 37.566  1.044   2.360   1.00 23.68 ?  292  GLU A CB    1 
ATOM   2136 C  CG    . GLU C 3 226 ? 36.535  -0.037  2.004   1.00 24.76 ?  292  GLU A CG    1 
ATOM   2137 C  CD    . GLU C 3 226 ? 35.846  0.200   0.649   1.00 24.25 ?  292  GLU A CD    1 
ATOM   2138 O  OE1   . GLU C 3 226 ? 35.625  1.370   0.286   1.00 23.55 ?  292  GLU A OE1   1 
ATOM   2139 O  OE2   . GLU C 3 226 ? 35.470  -0.784  -0.027  1.00 24.47 ?  292  GLU A OE2   1 
ATOM   2140 N  N     . VAL C 3 227 ? 38.653  -1.095  4.972   1.00 23.92 ?  293  VAL A N     1 
ATOM   2141 C  CA    . VAL C 3 227 ? 39.542  -2.145  5.461   1.00 24.19 ?  293  VAL A CA    1 
ATOM   2142 C  C     . VAL C 3 227 ? 38.808  -3.453  5.699   1.00 24.56 ?  293  VAL A C     1 
ATOM   2143 O  O     . VAL C 3 227 ? 37.592  -3.485  5.689   1.00 24.99 ?  293  VAL A O     1 
ATOM   2144 C  CB    . VAL C 3 227 ? 40.214  -1.752  6.800   1.00 23.89 ?  293  VAL A CB    1 
ATOM   2145 C  CG1   . VAL C 3 227 ? 41.065  -0.485  6.630   1.00 23.56 ?  293  VAL A CG1   1 
ATOM   2146 C  CG2   . VAL C 3 227 ? 39.159  -1.571  7.919   1.00 23.71 ?  293  VAL A CG2   1 
ATOM   2147 N  N     . SER C 3 228 ? 39.567  -4.515  5.953   1.00 24.91 ?  294  SER A N     1 
ATOM   2148 C  CA    . SER C 3 228 ? 39.004  -5.832  6.242   1.00 25.24 ?  294  SER A CA    1 
ATOM   2149 C  C     . SER C 3 228 ? 39.733  -6.470  7.410   1.00 25.11 ?  294  SER A C     1 
ATOM   2150 O  O     . SER C 3 228 ? 40.964  -6.412  7.479   1.00 24.46 ?  294  SER A O     1 
ATOM   2151 C  CB    . SER C 3 228 ? 39.136  -6.751  5.022   1.00 25.02 ?  294  SER A CB    1 
ATOM   2152 O  OG    . SER C 3 228 ? 38.152  -6.422  4.064   1.00 27.19 ?  294  SER A OG    1 
ATOM   2153 N  N     . ILE C 3 229 ? 38.983  -7.085  8.326   1.00 24.82 ?  295  ILE A N     1 
ATOM   2154 C  CA    . ILE C 3 229 ? 39.622  -7.804  9.426   1.00 24.19 ?  295  ILE A CA    1 
ATOM   2155 C  C     . ILE C 3 229 ? 38.874  -9.121  9.656   1.00 24.70 ?  295  ILE A C     1 
ATOM   2156 O  O     . ILE C 3 229 ? 37.654  -9.174  9.497   1.00 24.78 ?  295  ILE A O     1 
ATOM   2157 C  CB    . ILE C 3 229 ? 39.639  -6.934  10.721  1.00 23.75 ?  295  ILE A CB    1 
ATOM   2158 C  CG1   . ILE C 3 229 ? 40.543  -7.542  11.801  1.00 23.34 ?  295  ILE A CG1   1 
ATOM   2159 C  CG2   . ILE C 3 229 ? 38.213  -6.718  11.231  1.00 23.06 ?  295  ILE A CG2   1 
ATOM   2160 C  CD1   . ILE C 3 229 ? 40.875  -6.577  12.964  1.00 22.84 ?  295  ILE A CD1   1 
ATOM   2161 N  N     . ASN C 3 230 ? 39.594  -10.186 10.008  1.00 24.44 ?  296  ASN A N     1 
ATOM   2162 C  CA    . ASN C 3 230 ? 38.940  -11.406 10.484  1.00 25.00 ?  296  ASN A CA    1 
ATOM   2163 C  C     . ASN C 3 230 ? 38.310  -11.172 11.868  1.00 25.10 ?  296  ASN A C     1 
ATOM   2164 O  O     . ASN C 3 230 ? 38.926  -10.542 12.736  1.00 24.86 ?  296  ASN A O     1 
ATOM   2165 C  CB    . ASN C 3 230 ? 39.943  -12.552 10.536  1.00 25.06 ?  296  ASN A CB    1 
ATOM   2166 C  CG    . ASN C 3 230 ? 39.354  -13.812 11.134  1.00 26.67 ?  296  ASN A CG    1 
ATOM   2167 O  OD1   . ASN C 3 230 ? 39.377  -14.007 12.359  1.00 26.25 ?  296  ASN A OD1   1 
ATOM   2168 N  ND2   . ASN C 3 230 ? 38.825  -14.687 10.269  1.00 25.30 ?  296  ASN A ND2   1 
ATOM   2169 N  N     . TYR C 3 231 ? 37.096  -11.670 12.083  1.00 24.54 ?  297  TYR A N     1 
ATOM   2170 C  CA    . TYR C 3 231 ? 36.375  -11.349 13.320  1.00 25.04 ?  297  TYR A CA    1 
ATOM   2171 C  C     . TYR C 3 231 ? 37.152  -11.657 14.602  1.00 25.35 ?  297  TYR A C     1 
ATOM   2172 O  O     . TYR C 3 231 ? 36.918  -11.036 15.637  1.00 25.31 ?  297  TYR A O     1 
ATOM   2173 C  CB    . TYR C 3 231 ? 34.987  -12.005 13.368  1.00 24.46 ?  297  TYR A CB    1 
ATOM   2174 C  CG    . TYR C 3 231 ? 35.005  -13.464 13.745  1.00 25.59 ?  297  TYR A CG    1 
ATOM   2175 C  CD1   . TYR C 3 231 ? 35.262  -14.439 12.787  1.00 22.68 ?  297  TYR A CD1   1 
ATOM   2176 C  CD2   . TYR C 3 231 ? 34.744  -13.872 15.064  1.00 25.76 ?  297  TYR A CD2   1 
ATOM   2177 C  CE1   . TYR C 3 231 ? 35.272  -15.771 13.122  1.00 25.39 ?  297  TYR A CE1   1 
ATOM   2178 C  CE2   . TYR C 3 231 ? 34.747  -15.210 15.404  1.00 26.33 ?  297  TYR A CE2   1 
ATOM   2179 C  CZ    . TYR C 3 231 ? 35.015  -16.148 14.422  1.00 26.64 ?  297  TYR A CZ    1 
ATOM   2180 O  OH    . TYR C 3 231 ? 35.043  -17.474 14.733  1.00 29.44 ?  297  TYR A OH    1 
ATOM   2181 N  N     . ARG C 3 232 ? 38.064  -12.617 14.542  1.00 25.47 ?  298  ARG A N     1 
ATOM   2182 C  CA    . ARG C 3 232 ? 38.799  -13.018 15.731  1.00 25.63 ?  298  ARG A CA    1 
ATOM   2183 C  C     . ARG C 3 232 ? 39.865  -11.997 16.134  1.00 25.96 ?  298  ARG A C     1 
ATOM   2184 O  O     . ARG C 3 232 ? 40.390  -12.072 17.241  1.00 25.00 ?  298  ARG A O     1 
ATOM   2185 C  CB    . ARG C 3 232 ? 39.476  -14.372 15.504  1.00 26.23 ?  298  ARG A CB    1 
ATOM   2186 C  CG    . ARG C 3 232 ? 38.522  -15.451 14.972  1.00 26.33 ?  298  ARG A CG    1 
ATOM   2187 C  CD    . ARG C 3 232 ? 39.308  -16.674 14.494  1.00 28.71 ?  298  ARG A CD    1 
ATOM   2188 N  NE    . ARG C 3 232 ? 38.441  -17.673 13.878  1.00 29.51 ?  298  ARG A NE    1 
ATOM   2189 C  CZ    . ARG C 3 232 ? 37.982  -18.760 14.496  1.00 33.80 ?  298  ARG A CZ    1 
ATOM   2190 N  NH1   . ARG C 3 232 ? 37.192  -19.607 13.840  1.00 34.00 ?  298  ARG A NH1   1 
ATOM   2191 N  NH2   . ARG C 3 232 ? 38.316  -19.014 15.762  1.00 33.59 ?  298  ARG A NH2   1 
ATOM   2192 N  N     . ASN C 3 233 ? 40.180  -11.058 15.237  1.00 25.43 ?  299  ASN A N     1 
ATOM   2193 C  CA    . ASN C 3 233 ? 41.311  -10.141 15.433  1.00 26.03 ?  299  ASN A CA    1 
ATOM   2194 C  C     . ASN C 3 233 ? 40.911  -8.725  15.840  1.00 25.78 ?  299  ASN A C     1 
ATOM   2195 O  O     . ASN C 3 233 ? 41.763  -7.942  16.271  1.00 25.60 ?  299  ASN A O     1 
ATOM   2196 C  CB    . ASN C 3 233 ? 42.166  -10.071 14.159  1.00 26.00 ?  299  ASN A CB    1 
ATOM   2197 C  CG    . ASN C 3 233 ? 42.962  -11.337 13.921  1.00 28.32 ?  299  ASN A CG    1 
ATOM   2198 O  OD1   . ASN C 3 233 ? 43.285  -12.066 14.862  1.00 31.35 ?  299  ASN A OD1   1 
ATOM   2199 N  ND2   . ASN C 3 233 ? 43.288  -11.605 12.666  1.00 28.85 ?  299  ASN A ND2   1 
ATOM   2200 N  N     . LEU C 3 234 ? 39.637  -8.382  15.656  1.00 25.23 ?  300  LEU A N     1 
ATOM   2201 C  CA    . LEU C 3 234 ? 39.113  -7.098  16.148  1.00 25.15 ?  300  LEU A CA    1 
ATOM   2202 C  C     . LEU C 3 234 ? 38.979  -7.105  17.679  1.00 25.38 ?  300  LEU A C     1 
ATOM   2203 O  O     . LEU C 3 234 ? 38.802  -8.163  18.296  1.00 24.98 ?  300  LEU A O     1 
ATOM   2204 C  CB    . LEU C 3 234 ? 37.768  -6.757  15.479  1.00 25.15 ?  300  LEU A CB    1 
ATOM   2205 C  CG    . LEU C 3 234 ? 36.496  -7.561  15.798  1.00 26.52 ?  300  LEU A CG    1 
ATOM   2206 C  CD1   . LEU C 3 234 ? 35.875  -7.105  17.130  1.00 26.99 ?  300  LEU A CD1   1 
ATOM   2207 C  CD2   . LEU C 3 234 ? 35.448  -7.440  14.655  1.00 25.26 ?  300  LEU A CD2   1 
ATOM   2208 N  N     . ILE C 3 235 ? 39.105  -5.926  18.289  1.00 24.89 ?  301  ILE A N     1 
ATOM   2209 C  CA    . ILE C 3 235 ? 38.918  -5.772  19.725  1.00 25.03 ?  301  ILE A CA    1 
ATOM   2210 C  C     . ILE C 3 235 ? 37.635  -4.982  19.944  1.00 25.15 ?  301  ILE A C     1 
ATOM   2211 O  O     . ILE C 3 235 ? 37.530  -3.832  19.536  1.00 25.41 ?  301  ILE A O     1 
ATOM   2212 C  CB    . ILE C 3 235 ? 40.114  -5.028  20.396  1.00 25.01 ?  301  ILE A CB    1 
ATOM   2213 C  CG1   . ILE C 3 235 ? 41.422  -5.798  20.194  1.00 23.35 ?  301  ILE A CG1   1 
ATOM   2214 C  CG2   . ILE C 3 235 ? 39.851  -4.806  21.913  1.00 25.63 ?  301  ILE A CG2   1 
ATOM   2215 C  CD1   . ILE C 3 235 ? 42.691  -5.038  20.725  1.00 27.01 ?  301  ILE A CD1   1 
ATOM   2216 N  N     . ALA C 3 236 ? 36.647  -5.611  20.559  1.00 25.31 ?  302  ALA A N     1 
ATOM   2217 C  CA    . ALA C 3 236 ? 35.371  -4.951  20.825  1.00 25.53 ?  302  ALA A CA    1 
ATOM   2218 C  C     . ALA C 3 236 ? 35.389  -4.426  22.253  1.00 26.52 ?  302  ALA A C     1 
ATOM   2219 O  O     . ALA C 3 236 ? 35.374  -5.202  23.199  1.00 26.19 ?  302  ALA A O     1 
ATOM   2220 C  CB    . ALA C 3 236 ? 34.216  -5.926  20.629  1.00 24.64 ?  302  ALA A CB    1 
ATOM   2221 N  N     . HIS C 3 237 ? 35.461  -3.107  22.412  1.00 27.05 ?  303  HIS A N     1 
ATOM   2222 C  CA    . HIS C 3 237 ? 35.547  -2.514  23.746  1.00 27.10 ?  303  HIS A CA    1 
ATOM   2223 C  C     . HIS C 3 237 ? 34.175  -2.392  24.441  1.00 27.47 ?  303  HIS A C     1 
ATOM   2224 O  O     . HIS C 3 237 ? 33.245  -1.830  23.879  1.00 27.05 ?  303  HIS A O     1 
ATOM   2225 C  CB    . HIS C 3 237 ? 36.174  -1.115  23.657  1.00 26.61 ?  303  HIS A CB    1 
ATOM   2226 C  CG    . HIS C 3 237 ? 37.508  -1.085  22.984  1.00 26.50 ?  303  HIS A CG    1 
ATOM   2227 N  ND1   . HIS C 3 237 ? 38.666  -1.483  23.614  1.00 25.27 ?  303  HIS A ND1   1 
ATOM   2228 C  CD2   . HIS C 3 237 ? 37.874  -0.684  21.740  1.00 26.81 ?  303  HIS A CD2   1 
ATOM   2229 C  CE1   . HIS C 3 237 ? 39.690  -1.322  22.792  1.00 27.49 ?  303  HIS A CE1   1 
ATOM   2230 N  NE2   . HIS C 3 237 ? 39.234  -0.848  21.646  1.00 28.16 ?  303  HIS A NE2   1 
ATOM   2231 N  N     . PRO C 3 238 ? 34.054  -2.899  25.680  1.00 28.22 ?  304  PRO A N     1 
ATOM   2232 C  CA    . PRO C 3 238 ? 32.812  -2.579  26.390  1.00 28.78 ?  304  PRO A CA    1 
ATOM   2233 C  C     . PRO C 3 238 ? 32.662  -1.058  26.506  1.00 29.37 ?  304  PRO A C     1 
ATOM   2234 O  O     . PRO C 3 238 ? 33.654  -0.332  26.659  1.00 28.62 ?  304  PRO A O     1 
ATOM   2235 C  CB    . PRO C 3 238 ? 33.019  -3.187  27.793  1.00 28.93 ?  304  PRO A CB    1 
ATOM   2236 C  CG    . PRO C 3 238 ? 34.061  -4.266  27.606  1.00 29.10 ?  304  PRO A CG    1 
ATOM   2237 C  CD    . PRO C 3 238 ? 34.922  -3.839  26.420  1.00 27.86 ?  304  PRO A CD    1 
ATOM   2238 N  N     . ALA C 3 239 ? 31.432  -0.575  26.447  1.00 29.82 ?  305  ALA A N     1 
ATOM   2239 C  CA    . ALA C 3 239 ? 31.218  0.858   26.509  1.00 31.28 ?  305  ALA A CA    1 
ATOM   2240 C  C     . ALA C 3 239 ? 31.343  1.343   27.964  1.00 32.38 ?  305  ALA A C     1 
ATOM   2241 O  O     . ALA C 3 239 ? 30.352  1.627   28.639  1.00 32.49 ?  305  ALA A O     1 
ATOM   2242 C  CB    . ALA C 3 239 ? 29.865  1.205   25.909  1.00 30.97 ?  305  ALA A CB    1 
ATOM   2243 N  N     . GLU C 3 240 ? 32.582  1.419   28.439  1.00 33.87 ?  306  GLU A N     1 
ATOM   2244 C  CA    . GLU C 3 240 ? 32.872  1.704   29.832  1.00 34.83 ?  306  GLU A CA    1 
ATOM   2245 C  C     . GLU C 3 240 ? 34.176  2.462   29.896  1.00 35.05 ?  306  GLU A C     1 
ATOM   2246 O  O     . GLU C 3 240 ? 35.031  2.298   29.027  1.00 35.24 ?  306  GLU A O     1 
ATOM   2247 C  CB    . GLU C 3 240 ? 33.055  0.407   30.618  1.00 35.03 ?  306  GLU A CB    1 
ATOM   2248 C  CG    . GLU C 3 240 ? 31.792  -0.339  30.932  1.00 39.07 ?  306  GLU A CG    1 
ATOM   2249 C  CD    . GLU C 3 240 ? 32.068  -1.783  31.309  1.00 44.02 ?  306  GLU A CD    1 
ATOM   2250 O  OE1   . GLU C 3 240 ? 33.233  -2.092  31.651  1.00 45.71 ?  306  GLU A OE1   1 
ATOM   2251 O  OE2   . GLU C 3 240 ? 31.129  -2.614  31.247  1.00 46.99 ?  306  GLU A OE2   1 
ATOM   2252 N  N     . GLY C 3 241 ? 34.336  3.273   30.936  1.00 35.00 ?  307  GLY A N     1 
ATOM   2253 C  CA    . GLY C 3 241 ? 35.597  3.952   31.184  1.00 35.44 ?  307  GLY A CA    1 
ATOM   2254 C  C     . GLY C 3 241 ? 36.133  4.694   29.984  1.00 35.74 ?  307  GLY A C     1 
ATOM   2255 O  O     . GLY C 3 241 ? 35.438  5.516   29.379  1.00 35.61 ?  307  GLY A O     1 
ATOM   2256 N  N     . ASP C 3 242 ? 37.381  4.402   29.637  1.00 36.13 ?  308  ASP A N     1 
ATOM   2257 C  CA    . ASP C 3 242 ? 38.034  5.065   28.514  1.00 36.11 ?  308  ASP A CA    1 
ATOM   2258 C  C     . ASP C 3 242 ? 37.376  4.756   27.162  1.00 35.63 ?  308  ASP A C     1 
ATOM   2259 O  O     . ASP C 3 242 ? 37.624  5.456   26.172  1.00 36.28 ?  308  ASP A O     1 
ATOM   2260 C  CB    . ASP C 3 242 ? 39.519  4.685   28.483  1.00 37.23 ?  308  ASP A CB    1 
ATOM   2261 C  CG    . ASP C 3 242 ? 40.126  4.551   29.875  1.00 39.28 ?  308  ASP A CG    1 
ATOM   2262 O  OD1   . ASP C 3 242 ? 39.927  5.450   30.723  1.00 42.27 ?  308  ASP A OD1   1 
ATOM   2263 O  OD2   . ASP C 3 242 ? 40.817  3.541   30.128  1.00 42.30 ?  308  ASP A OD2   1 
ATOM   2264 N  N     . TRP C 3 243 ? 36.530  3.723   27.103  1.00 33.99 ?  309  TRP A N     1 
ATOM   2265 C  CA    . TRP C 3 243 ? 35.826  3.413   25.854  1.00 32.42 ?  309  TRP A CA    1 
ATOM   2266 C  C     . TRP C 3 243 ? 34.326  3.741   25.890  1.00 32.01 ?  309  TRP A C     1 
ATOM   2267 O  O     . TRP C 3 243 ? 33.532  3.189   25.124  1.00 31.75 ?  309  TRP A O     1 
ATOM   2268 C  CB    . TRP C 3 243 ? 36.098  1.970   25.404  1.00 32.13 ?  309  TRP A CB    1 
ATOM   2269 C  CG    . TRP C 3 243 ? 37.563  1.746   25.149  1.00 30.92 ?  309  TRP A CG    1 
ATOM   2270 C  CD1   . TRP C 3 243 ? 38.460  1.139   25.983  1.00 29.22 ?  309  TRP A CD1   1 
ATOM   2271 C  CD2   . TRP C 3 243 ? 38.307  2.170   23.993  1.00 31.00 ?  309  TRP A CD2   1 
ATOM   2272 N  NE1   . TRP C 3 243 ? 39.715  1.151   25.414  1.00 29.93 ?  309  TRP A NE1   1 
ATOM   2273 C  CE2   . TRP C 3 243 ? 39.650  1.779   24.195  1.00 30.54 ?  309  TRP A CE2   1 
ATOM   2274 C  CE3   . TRP C 3 243 ? 37.966  2.842   22.811  1.00 29.93 ?  309  TRP A CE3   1 
ATOM   2275 C  CZ2   . TRP C 3 243 ? 40.655  2.026   23.253  1.00 30.40 ?  309  TRP A CZ2   1 
ATOM   2276 C  CZ3   . TRP C 3 243 ? 38.972  3.093   21.869  1.00 31.24 ?  309  TRP A CZ3   1 
ATOM   2277 C  CH2   . TRP C 3 243 ? 40.302  2.685   22.102  1.00 29.82 ?  309  TRP A CH2   1 
ATOM   2278 N  N     . SER C 3 244 ? 33.941  4.648   26.780  1.00 31.46 ?  310  SER A N     1 
ATOM   2279 C  CA    . SER C 3 244 ? 32.558  5.104   26.816  1.00 30.98 ?  310  SER A CA    1 
ATOM   2280 C  C     . SER C 3 244 ? 32.399  6.484   26.188  1.00 30.14 ?  310  SER A C     1 
ATOM   2281 O  O     . SER C 3 244 ? 31.291  7.001   26.125  1.00 29.61 ?  310  SER A O     1 
ATOM   2282 C  CB    . SER C 3 244 ? 32.008  5.099   28.243  1.00 30.81 ?  310  SER A CB    1 
ATOM   2283 O  OG    . SER C 3 244 ? 32.759  5.958   29.073  1.00 32.69 ?  310  SER A OG    1 
ATOM   2284 N  N     . HIS C 3 245 ? 33.499  7.080   25.725  1.00 29.61 ?  311  HIS A N     1 
ATOM   2285 C  CA    A HIS C 3 245 ? 33.421  8.348   25.022  0.50 29.53 ?  311  HIS A CA    1 
ATOM   2286 C  CA    B HIS C 3 245 ? 33.416  8.355   25.015  0.50 29.56 ?  311  HIS A CA    1 
ATOM   2287 C  C     . HIS C 3 245 ? 32.737  8.125   23.674  1.00 29.27 ?  311  HIS A C     1 
ATOM   2288 O  O     . HIS C 3 245 ? 32.451  6.990   23.303  1.00 29.26 ?  311  HIS A O     1 
ATOM   2289 C  CB    A HIS C 3 245 ? 34.819  8.964   24.853  0.50 29.75 ?  311  HIS A CB    1 
ATOM   2290 C  CB    B HIS C 3 245 ? 34.798  8.978   24.770  0.50 29.85 ?  311  HIS A CB    1 
ATOM   2291 C  CG    A HIS C 3 245 ? 35.835  8.028   24.268  0.50 29.82 ?  311  HIS A CG    1 
ATOM   2292 C  CG    B HIS C 3 245 ? 35.684  9.006   25.974  0.50 29.97 ?  311  HIS A CG    1 
ATOM   2293 N  ND1   A HIS C 3 245 ? 36.367  6.967   24.973  0.50 29.92 ?  311  HIS A ND1   1 
ATOM   2294 N  ND1   B HIS C 3 245 ? 35.200  9.159   27.256  0.50 30.95 ?  311  HIS A ND1   1 
ATOM   2295 C  CD2   A HIS C 3 245 ? 36.424  8.002   23.049  0.50 30.02 ?  311  HIS A CD2   1 
ATOM   2296 C  CD2   B HIS C 3 245 ? 37.031  8.922   26.088  0.50 30.36 ?  311  HIS A CD2   1 
ATOM   2297 C  CE1   A HIS C 3 245 ? 37.233  6.324   24.209  0.50 30.34 ?  311  HIS A CE1   1 
ATOM   2298 C  CE1   B HIS C 3 245 ? 36.210  9.154   28.108  0.50 30.12 ?  311  HIS A CE1   1 
ATOM   2299 N  NE2   A HIS C 3 245 ? 37.291  6.935   23.037  0.50 29.25 ?  311  HIS A NE2   1 
ATOM   2300 N  NE2   B HIS C 3 245 ? 37.331  9.007   27.426  0.50 29.85 ?  311  HIS A NE2   1 
ATOM   2301 N  N     . THR C 3 246 ? 32.480  9.202   22.943  1.00 28.71 ?  312  THR A N     1 
ATOM   2302 C  CA    . THR C 3 246 ? 31.843  9.090   21.645  1.00 28.24 ?  312  THR A CA    1 
ATOM   2303 C  C     . THR C 3 246 ? 32.665  9.841   20.607  1.00 27.71 ?  312  THR A C     1 
ATOM   2304 O  O     . THR C 3 246 ? 33.384  10.791  20.942  1.00 26.66 ?  312  THR A O     1 
ATOM   2305 C  CB    . THR C 3 246 ? 30.436  9.677   21.678  1.00 28.69 ?  312  THR A CB    1 
ATOM   2306 O  OG1   . THR C 3 246 ? 30.504  10.967  22.278  1.00 30.43 ?  312  THR A OG1   1 
ATOM   2307 C  CG2   . THR C 3 246 ? 29.498  8.794   22.515  1.00 29.00 ?  312  THR A CG2   1 
ATOM   2308 N  N     . ALA C 3 247 ? 32.567  9.412   19.351  1.00 26.52 ?  313  ALA A N     1 
ATOM   2309 C  CA    . ALA C 3 247 ? 33.366  10.007  18.297  1.00 26.50 ?  313  ALA A CA    1 
ATOM   2310 C  C     . ALA C 3 247 ? 32.714  11.297  17.841  1.00 26.46 ?  313  ALA A C     1 
ATOM   2311 O  O     . ALA C 3 247 ? 31.514  11.485  18.042  1.00 26.03 ?  313  ALA A O     1 
ATOM   2312 C  CB    . ALA C 3 247 ? 33.530  9.043   17.110  1.00 25.38 ?  313  ALA A CB    1 
ATOM   2313 N  N     . PRO C 3 248 ? 33.500  12.179  17.203  1.00 27.08 ?  314  PRO A N     1 
ATOM   2314 C  CA    . PRO C 3 248 ? 33.000  13.476  16.754  1.00 27.03 ?  314  PRO A CA    1 
ATOM   2315 C  C     . PRO C 3 248 ? 32.114  13.333  15.512  1.00 27.18 ?  314  PRO A C     1 
ATOM   2316 O  O     . PRO C 3 248 ? 32.469  13.796  14.418  1.00 26.28 ?  314  PRO A O     1 
ATOM   2317 C  CB    . PRO C 3 248 ? 34.284  14.241  16.440  1.00 27.65 ?  314  PRO A CB    1 
ATOM   2318 C  CG    . PRO C 3 248 ? 35.228  13.184  15.995  1.00 27.68 ?  314  PRO A CG    1 
ATOM   2319 C  CD    . PRO C 3 248 ? 34.911  11.976  16.839  1.00 26.89 ?  314  PRO A CD    1 
ATOM   2320 N  N     . LEU C 3 249 ? 30.945  12.722  15.687  1.00 26.86 ?  315  LEU A N     1 
ATOM   2321 C  CA    . LEU C 3 249 ? 30.067  12.452  14.538  1.00 27.36 ?  315  LEU A CA    1 
ATOM   2322 C  C     . LEU C 3 249 ? 29.658  13.733  13.807  1.00 26.46 ?  315  LEU A C     1 
ATOM   2323 O  O     . LEU C 3 249 ? 29.374  14.750  14.432  1.00 25.68 ?  315  LEU A O     1 
ATOM   2324 C  CB    . LEU C 3 249 ? 28.807  11.730  14.998  1.00 27.37 ?  315  LEU A CB    1 
ATOM   2325 C  CG    . LEU C 3 249 ? 28.813  10.199  15.078  1.00 30.94 ?  315  LEU A CG    1 
ATOM   2326 C  CD1   . LEU C 3 249 ? 30.210  9.557   15.161  1.00 32.05 ?  315  LEU A CD1   1 
ATOM   2327 C  CD2   . LEU C 3 249 ? 27.903  9.705   16.171  1.00 29.89 ?  315  LEU A CD2   1 
ATOM   2328 N  N     . ARG C 3 250 ? 29.585  13.650  12.488  1.00 25.72 ?  316  ARG A N     1 
ATOM   2329 C  CA    . ARG C 3 250 ? 29.109  14.754  11.666  1.00 25.23 ?  316  ARG A CA    1 
ATOM   2330 C  C     . ARG C 3 250 ? 27.605  14.619  11.526  1.00 25.31 ?  316  ARG A C     1 
ATOM   2331 O  O     . ARG C 3 250 ? 27.103  13.607  11.034  1.00 24.53 ?  316  ARG A O     1 
ATOM   2332 C  CB    . ARG C 3 250 ? 29.761  14.720  10.286  1.00 25.04 ?  316  ARG A CB    1 
ATOM   2333 C  CG    . ARG C 3 250 ? 31.198  15.212  10.268  1.00 24.88 ?  316  ARG A CG    1 
ATOM   2334 C  CD    . ARG C 3 250 ? 31.745  15.401  8.857   1.00 25.09 ?  316  ARG A CD    1 
ATOM   2335 N  NE    . ARG C 3 250 ? 32.929  16.245  8.925   1.00 25.70 ?  316  ARG A NE    1 
ATOM   2336 C  CZ    . ARG C 3 250 ? 33.465  16.908  7.906   1.00 24.46 ?  316  ARG A CZ    1 
ATOM   2337 N  NH1   . ARG C 3 250 ? 34.544  17.650  8.121   1.00 23.32 ?  316  ARG A NH1   1 
ATOM   2338 N  NH2   . ARG C 3 250 ? 32.953  16.817  6.686   1.00 23.46 ?  316  ARG A NH2   1 
ATOM   2339 N  N     . ILE C 3 251 ? 26.892  15.639  11.978  1.00 25.47 ?  317  ILE A N     1 
ATOM   2340 C  CA    . ILE C 3 251 ? 25.448  15.605  11.998  1.00 25.53 ?  317  ILE A CA    1 
ATOM   2341 C  C     . ILE C 3 251 ? 24.915  16.550  10.942  1.00 25.58 ?  317  ILE A C     1 
ATOM   2342 O  O     . ILE C 3 251 ? 25.202  17.747  10.976  1.00 25.89 ?  317  ILE A O     1 
ATOM   2343 C  CB    . ILE C 3 251 ? 24.898  16.098  13.370  1.00 25.69 ?  317  ILE A CB    1 
ATOM   2344 C  CG1   . ILE C 3 251 ? 25.605  15.385  14.531  1.00 24.61 ?  317  ILE A CG1   1 
ATOM   2345 C  CG2   . ILE C 3 251 ? 23.385  15.910  13.415  1.00 25.56 ?  317  ILE A CG2   1 
ATOM   2346 C  CD1   . ILE C 3 251 ? 25.512  13.887  14.453  1.00 24.55 ?  317  ILE A CD1   1 
ATOM   2347 N  N     . MET C 3 252 ? 24.137  16.024  10.008  1.00 25.76 ?  318  MET A N     1 
ATOM   2348 C  CA    . MET C 3 252 ? 23.564  16.856  8.965   1.00 25.71 ?  318  MET A CA    1 
ATOM   2349 C  C     . MET C 3 252 ? 22.054  16.936  9.133   1.00 25.26 ?  318  MET A C     1 
ATOM   2350 O  O     . MET C 3 252 ? 21.360  15.914  9.168   1.00 25.16 ?  318  MET A O     1 
ATOM   2351 C  CB    . MET C 3 252 ? 23.899  16.316  7.571   1.00 26.20 ?  318  MET A CB    1 
ATOM   2352 C  CG    . MET C 3 252 ? 23.015  16.910  6.471   1.00 27.13 ?  318  MET A CG    1 
ATOM   2353 S  SD    . MET C 3 252 ? 23.499  16.406  4.797   1.00 31.05 ?  318  MET A SD    1 
ATOM   2354 C  CE    . MET C 3 252 ? 22.115  16.989  3.818   1.00 30.29 ?  318  MET A CE    1 
ATOM   2355 N  N     . SER C 3 253 ? 21.554  18.157  9.245   1.00 24.58 ?  319  SER A N     1 
ATOM   2356 C  CA    . SER C 3 253 ? 20.128  18.372  9.342   1.00 24.60 ?  319  SER A CA    1 
ATOM   2357 C  C     . SER C 3 253 ? 19.709  19.098  8.082   1.00 24.99 ?  319  SER A C     1 
ATOM   2358 O  O     . SER C 3 253 ? 20.410  20.015  7.636   1.00 24.58 ?  319  SER A O     1 
ATOM   2359 C  CB    . SER C 3 253 ? 19.809  19.231  10.570  1.00 24.64 ?  319  SER A CB    1 
ATOM   2360 O  OG    . SER C 3 253 ? 18.417  19.447  10.676  1.00 23.43 ?  319  SER A OG    1 
ATOM   2361 N  N     . PHE C 3 254 ? 18.590  18.692  7.492   1.00 24.80 ?  320  PHE A N     1 
ATOM   2362 C  CA    . PHE C 3 254 ? 18.128  19.370  6.280   1.00 25.42 ?  320  PHE A CA    1 
ATOM   2363 C  C     . PHE C 3 254 ? 16.608  19.457  6.223   1.00 26.28 ?  320  PHE A C     1 
ATOM   2364 O  O     . PHE C 3 254 ? 15.898  18.768  6.961   1.00 26.32 ?  320  PHE A O     1 
ATOM   2365 C  CB    . PHE C 3 254 ? 18.663  18.680  5.017   1.00 24.87 ?  320  PHE A CB    1 
ATOM   2366 C  CG    . PHE C 3 254 ? 17.906  17.431  4.644   1.00 24.02 ?  320  PHE A CG    1 
ATOM   2367 C  CD1   . PHE C 3 254 ? 17.022  17.441  3.585   1.00 25.01 ?  320  PHE A CD1   1 
ATOM   2368 C  CD2   . PHE C 3 254 ? 18.060  16.263  5.368   1.00 25.66 ?  320  PHE A CD2   1 
ATOM   2369 C  CE1   . PHE C 3 254 ? 16.317  16.311  3.228   1.00 25.14 ?  320  PHE A CE1   1 
ATOM   2370 C  CE2   . PHE C 3 254 ? 17.347  15.117  5.024   1.00 26.00 ?  320  PHE A CE2   1 
ATOM   2371 C  CZ    . PHE C 3 254 ? 16.483  15.142  3.948   1.00 25.48 ?  320  PHE A CZ    1 
ATOM   2372 N  N     . ASP C 3 255 ? 16.123  20.309  5.333   1.00 27.10 ?  321  ASP A N     1 
ATOM   2373 C  CA    . ASP C 3 255 ? 14.701  20.506  5.128   1.00 28.50 ?  321  ASP A CA    1 
ATOM   2374 C  C     . ASP C 3 255 ? 14.528  20.955  3.679   1.00 28.81 ?  321  ASP A C     1 
ATOM   2375 O  O     . ASP C 3 255 ? 15.337  21.746  3.159   1.00 28.54 ?  321  ASP A O     1 
ATOM   2376 C  CB    . ASP C 3 255 ? 14.196  21.597  6.076   1.00 29.44 ?  321  ASP A CB    1 
ATOM   2377 C  CG    . ASP C 3 255 ? 12.707  21.849  5.946   1.00 31.75 ?  321  ASP A CG    1 
ATOM   2378 O  OD1   . ASP C 3 255 ? 11.921  20.920  6.189   1.00 34.29 ?  321  ASP A OD1   1 
ATOM   2379 O  OD2   . ASP C 3 255 ? 12.324  22.988  5.620   1.00 36.29 ?  321  ASP A OD2   1 
ATOM   2380 N  N     . ILE C 3 256 ? 13.499  20.446  3.014   1.00 28.93 ?  322  ILE A N     1 
ATOM   2381 C  CA    . ILE C 3 256 ? 13.235  20.876  1.650   1.00 29.49 ?  322  ILE A CA    1 
ATOM   2382 C  C     . ILE C 3 256 ? 11.974  21.721  1.588   1.00 29.77 ?  322  ILE A C     1 
ATOM   2383 O  O     . ILE C 3 256 ? 11.087  21.609  2.437   1.00 29.74 ?  322  ILE A O     1 
ATOM   2384 C  CB    . ILE C 3 256 ? 13.074  19.688  0.678   1.00 29.27 ?  322  ILE A CB    1 
ATOM   2385 C  CG1   . ILE C 3 256 ? 11.699  19.049  0.851   1.00 28.67 ?  322  ILE A CG1   1 
ATOM   2386 C  CG2   . ILE C 3 256 ? 14.190  18.655  0.886   1.00 29.96 ?  322  ILE A CG2   1 
ATOM   2387 C  CD1   . ILE C 3 256 ? 11.375  17.998  -0.178  1.00 28.03 ?  322  ILE A CD1   1 
ATOM   2388 N  N     . GLU C 3 257 ? 11.910  22.566  0.566   1.00 30.06 ?  323  GLU A N     1 
ATOM   2389 C  CA    . GLU C 3 257 ? 10.715  23.314  0.248   1.00 30.55 ?  323  GLU A CA    1 
ATOM   2390 C  C     . GLU C 3 257 ? 10.249  22.897  -1.143  1.00 30.34 ?  323  GLU A C     1 
ATOM   2391 O  O     . GLU C 3 257 ? 11.074  22.668  -2.031  1.00 29.69 ?  323  GLU A O     1 
ATOM   2392 C  CB    . GLU C 3 257 ? 11.021  24.817  0.263   1.00 31.33 ?  323  GLU A CB    1 
ATOM   2393 C  CG    . GLU C 3 257 ? 11.417  25.359  1.636   1.00 33.49 ?  323  GLU A CG    1 
ATOM   2394 C  CD    . GLU C 3 257 ? 10.275  25.297  2.623   1.00 36.82 ?  323  GLU A CD    1 
ATOM   2395 O  OE1   . GLU C 3 257 ? 9.112   25.404  2.185   1.00 39.15 ?  323  GLU A OE1   1 
ATOM   2396 O  OE2   . GLU C 3 257 ? 10.530  25.131  3.836   1.00 39.92 ?  323  GLU A OE2   1 
ATOM   2397 N  N     . CYS C 3 258 ? 8.934   22.796  -1.327  1.00 30.21 ?  324  CYS A N     1 
ATOM   2398 C  CA    . CYS C 3 258 ? 8.365   22.491  -2.639  1.00 30.83 ?  324  CYS A CA    1 
ATOM   2399 C  C     . CYS C 3 258 ? 7.373   23.578  -3.087  1.00 31.08 ?  324  CYS A C     1 
ATOM   2400 O  O     . CYS C 3 258 ? 6.651   24.142  -2.273  1.00 30.49 ?  324  CYS A O     1 
ATOM   2401 C  CB    . CYS C 3 258 ? 7.661   21.137  -2.622  1.00 30.32 ?  324  CYS A CB    1 
ATOM   2402 S  SG    . CYS C 3 258 ? 8.618   19.788  -1.919  1.00 32.01 ?  324  CYS A SG    1 
ATOM   2403 N  N     . ALA C 3 259 ? 7.347   23.874  -4.381  1.00 31.87 ?  325  ALA A N     1 
ATOM   2404 C  CA    . ALA C 3 259 ? 6.355   24.796  -4.908  1.00 32.96 ?  325  ALA A CA    1 
ATOM   2405 C  C     . ALA C 3 259 ? 5.225   23.966  -5.495  1.00 33.77 ?  325  ALA A C     1 
ATOM   2406 O  O     . ALA C 3 259 ? 5.353   23.438  -6.603  1.00 34.23 ?  325  ALA A O     1 
ATOM   2407 C  CB    . ALA C 3 259 ? 6.964   25.708  -5.964  1.00 33.03 ?  325  ALA A CB    1 
ATOM   2408 N  N     . GLY C 3 260 ? 4.129   23.845  -4.745  1.00 34.05 ?  326  GLY A N     1 
ATOM   2409 C  CA    . GLY C 3 260 ? 3.007   22.991  -5.135  1.00 34.67 ?  326  GLY A CA    1 
ATOM   2410 C  C     . GLY C 3 260 ? 1.753   23.750  -5.523  1.00 35.08 ?  326  GLY A C     1 
ATOM   2411 O  O     . GLY C 3 260 ? 1.732   24.982  -5.517  1.00 35.32 ?  326  GLY A O     1 
ATOM   2412 N  N     . ARG C 3 261 ? 0.699   23.015  -5.859  1.00 35.32 ?  327  ARG A N     1 
ATOM   2413 C  CA    . ARG C 3 261 ? -0.528  23.636  -6.363  1.00 35.53 ?  327  ARG A CA    1 
ATOM   2414 C  C     . ARG C 3 261 ? -1.488  24.018  -5.243  1.00 35.39 ?  327  ARG A C     1 
ATOM   2415 O  O     . ARG C 3 261 ? -1.543  23.361  -4.205  1.00 35.36 ?  327  ARG A O     1 
ATOM   2416 C  CB    . ARG C 3 261 ? -1.219  22.703  -7.364  1.00 35.59 ?  327  ARG A CB    1 
ATOM   2417 C  CG    . ARG C 3 261 ? -0.475  22.557  -8.691  1.00 36.43 ?  327  ARG A CG    1 
ATOM   2418 C  CD    . ARG C 3 261 ? -0.797  21.230  -9.351  1.00 37.36 ?  327  ARG A CD    1 
ATOM   2419 N  NE    . ARG C 3 261 ? -0.131  20.116  -8.677  1.00 38.08 ?  327  ARG A NE    1 
ATOM   2420 C  CZ    . ARG C 3 261 ? -0.718  18.955  -8.408  1.00 37.87 ?  327  ARG A CZ    1 
ATOM   2421 N  NH1   . ARG C 3 261 ? -1.986  18.763  -8.742  1.00 37.46 ?  327  ARG A NH1   1 
ATOM   2422 N  NH2   . ARG C 3 261 ? -0.047  17.992  -7.789  1.00 37.61 ?  327  ARG A NH2   1 
ATOM   2423 N  N     . ILE C 3 262 ? -2.248  25.087  -5.462  1.00 35.45 ?  328  ILE A N     1 
ATOM   2424 C  CA    . ILE C 3 262 ? -3.246  25.512  -4.497  1.00 35.29 ?  328  ILE A CA    1 
ATOM   2425 C  C     . ILE C 3 262 ? -4.211  24.366  -4.226  1.00 35.30 ?  328  ILE A C     1 
ATOM   2426 O  O     . ILE C 3 262 ? -4.853  23.861  -5.146  1.00 35.18 ?  328  ILE A O     1 
ATOM   2427 C  CB    . ILE C 3 262 ? -4.041  26.732  -5.003  1.00 35.42 ?  328  ILE A CB    1 
ATOM   2428 N  N     . GLY C 3 263 ? -4.298  23.949  -2.966  1.00 35.28 ?  329  GLY A N     1 
ATOM   2429 C  CA    . GLY C 3 263 ? -5.245  22.914  -2.570  1.00 35.68 ?  329  GLY A CA    1 
ATOM   2430 C  C     . GLY C 3 263 ? -4.705  21.496  -2.571  1.00 35.99 ?  329  GLY A C     1 
ATOM   2431 O  O     . GLY C 3 263 ? -5.378  20.569  -2.124  1.00 36.26 ?  329  GLY A O     1 
ATOM   2432 N  N     . VAL C 3 264 ? -3.483  21.315  -3.056  1.00 36.32 ?  330  VAL A N     1 
ATOM   2433 C  CA    . VAL C 3 264 ? -2.926  19.973  -3.172  1.00 36.24 ?  330  VAL A CA    1 
ATOM   2434 C  C     . VAL C 3 264 ? -1.595  19.853  -2.448  1.00 36.45 ?  330  VAL A C     1 
ATOM   2435 O  O     . VAL C 3 264 ? -0.649  20.567  -2.768  1.00 36.53 ?  330  VAL A O     1 
ATOM   2436 C  CB    . VAL C 3 264 ? -2.707  19.594  -4.650  1.00 36.39 ?  330  VAL A CB    1 
ATOM   2437 C  CG1   . VAL C 3 264 ? -2.335  18.121  -4.770  1.00 36.40 ?  330  VAL A CG1   1 
ATOM   2438 C  CG2   . VAL C 3 264 ? -3.952  19.932  -5.484  1.00 35.80 ?  330  VAL A CG2   1 
ATOM   2439 N  N     . PHE C 3 265 ? -1.513  18.958  -1.468  1.00 36.65 ?  331  PHE A N     1 
ATOM   2440 C  CA    . PHE C 3 265 ? -0.223  18.675  -0.866  1.00 36.91 ?  331  PHE A CA    1 
ATOM   2441 C  C     . PHE C 3 265 ? 0.719   18.221  -1.974  1.00 36.84 ?  331  PHE A C     1 
ATOM   2442 O  O     . PHE C 3 265 ? 0.345   17.397  -2.812  1.00 36.63 ?  331  PHE A O     1 
ATOM   2443 C  CB    . PHE C 3 265 ? -0.315  17.615  0.227   1.00 37.00 ?  331  PHE A CB    1 
ATOM   2444 C  CG    . PHE C 3 265 ? 0.954   17.465  1.019   1.00 38.75 ?  331  PHE A CG    1 
ATOM   2445 C  CD1   . PHE C 3 265 ? 1.337   18.445  1.929   1.00 39.82 ?  331  PHE A CD1   1 
ATOM   2446 C  CD2   . PHE C 3 265 ? 1.780   16.363  0.834   1.00 39.55 ?  331  PHE A CD2   1 
ATOM   2447 C  CE1   . PHE C 3 265 ? 2.516   18.322  2.651   1.00 41.23 ?  331  PHE A CE1   1 
ATOM   2448 C  CE2   . PHE C 3 265 ? 2.952   16.225  1.559   1.00 41.09 ?  331  PHE A CE2   1 
ATOM   2449 C  CZ    . PHE C 3 265 ? 3.322   17.209  2.469   1.00 41.81 ?  331  PHE A CZ    1 
ATOM   2450 N  N     . PRO C 3 266 ? 1.948   18.763  -1.982  1.00 36.73 ?  332  PRO A N     1 
ATOM   2451 C  CA    . PRO C 3 266 ? 2.850   18.569  -3.104  1.00 36.38 ?  332  PRO A CA    1 
ATOM   2452 C  C     . PRO C 3 266 ? 2.990   17.098  -3.453  1.00 35.97 ?  332  PRO A C     1 
ATOM   2453 O  O     . PRO C 3 266 ? 3.081   16.259  -2.571  1.00 35.82 ?  332  PRO A O     1 
ATOM   2454 C  CB    . PRO C 3 266 ? 4.181   19.136  -2.596  1.00 36.37 ?  332  PRO A CB    1 
ATOM   2455 C  CG    . PRO C 3 266 ? 3.793   20.097  -1.512  1.00 37.08 ?  332  PRO A CG    1 
ATOM   2456 C  CD    . PRO C 3 266 ? 2.589   19.482  -0.867  1.00 36.93 ?  332  PRO A CD    1 
ATOM   2457 N  N     . GLU C 3 267 ? 3.005   16.804  -4.745  1.00 35.85 ?  333  GLU A N     1 
ATOM   2458 C  CA    . GLU C 3 267 ? 3.185   15.443  -5.229  1.00 35.44 ?  333  GLU A CA    1 
ATOM   2459 C  C     . GLU C 3 267 ? 4.425   15.417  -6.118  1.00 34.99 ?  333  GLU A C     1 
ATOM   2460 O  O     . GLU C 3 267 ? 4.570   16.262  -6.999  1.00 34.82 ?  333  GLU A O     1 
ATOM   2461 C  CB    . GLU C 3 267 ? 1.937   15.006  -5.997  1.00 35.57 ?  333  GLU A CB    1 
ATOM   2462 C  CG    . GLU C 3 267 ? 0.724   14.828  -5.092  1.00 35.86 ?  333  GLU A CG    1 
ATOM   2463 C  CD    . GLU C 3 267 ? -0.588  14.897  -5.842  1.00 36.52 ?  333  GLU A CD    1 
ATOM   2464 O  OE1   . GLU C 3 267 ? -0.620  15.487  -6.943  1.00 36.87 ?  333  GLU A OE1   1 
ATOM   2465 O  OE2   . GLU C 3 267 ? -1.591  14.364  -5.323  1.00 37.53 ?  333  GLU A OE2   1 
ATOM   2466 N  N     . PRO C 3 268 ? 5.332   14.455  -5.873  1.00 34.68 ?  334  PRO A N     1 
ATOM   2467 C  CA    . PRO C 3 268 ? 6.638   14.359  -6.541  1.00 34.62 ?  334  PRO A CA    1 
ATOM   2468 C  C     . PRO C 3 268 ? 6.529   14.269  -8.065  1.00 35.01 ?  334  PRO A C     1 
ATOM   2469 O  O     . PRO C 3 268 ? 7.441   14.699  -8.786  1.00 34.29 ?  334  PRO A O     1 
ATOM   2470 C  CB    . PRO C 3 268 ? 7.235   13.062  -5.973  1.00 34.66 ?  334  PRO A CB    1 
ATOM   2471 C  CG    . PRO C 3 268 ? 6.465   12.787  -4.711  1.00 34.34 ?  334  PRO A CG    1 
ATOM   2472 C  CD    . PRO C 3 268 ? 5.100   13.342  -4.935  1.00 34.61 ?  334  PRO A CD    1 
ATOM   2473 N  N     . GLU C 3 269 ? 5.426   13.700  -8.547  1.00 35.36 ?  335  GLU A N     1 
ATOM   2474 C  CA    . GLU C 3 269 ? 5.183   13.602  -9.988  1.00 36.04 ?  335  GLU A CA    1 
ATOM   2475 C  C     . GLU C 3 269 ? 4.985   14.965  -10.650 1.00 35.46 ?  335  GLU A C     1 
ATOM   2476 O  O     . GLU C 3 269 ? 5.153   15.097  -11.865 1.00 35.63 ?  335  GLU A O     1 
ATOM   2477 C  CB    . GLU C 3 269 ? 3.952   12.734  -10.282 1.00 36.51 ?  335  GLU A CB    1 
ATOM   2478 C  CG    . GLU C 3 269 ? 4.041   11.316  -9.753  1.00 39.94 ?  335  GLU A CG    1 
ATOM   2479 C  CD    . GLU C 3 269 ? 3.645   11.204  -8.290  1.00 43.24 ?  335  GLU A CD    1 
ATOM   2480 O  OE1   . GLU C 3 269 ? 3.457   12.252  -7.631  1.00 45.35 ?  335  GLU A OE1   1 
ATOM   2481 O  OE2   . GLU C 3 269 ? 3.517   10.063  -7.798  1.00 44.78 ?  335  GLU A OE2   1 
ATOM   2482 N  N     . TYR C 3 270 ? 4.614   15.978  -9.878  1.00 34.61 ?  336  TYR A N     1 
ATOM   2483 C  CA    . TYR C 3 270 ? 4.242   17.244  -10.513 1.00 34.39 ?  336  TYR A CA    1 
ATOM   2484 C  C     . TYR C 3 270 ? 4.873   18.493  -9.926  1.00 33.44 ?  336  TYR A C     1 
ATOM   2485 O  O     . TYR C 3 270 ? 5.094   19.473  -10.637 1.00 33.23 ?  336  TYR A O     1 
ATOM   2486 C  CB    . TYR C 3 270 ? 2.724   17.407  -10.493 1.00 34.89 ?  336  TYR A CB    1 
ATOM   2487 C  CG    . TYR C 3 270 ? 1.999   16.258  -11.134 1.00 36.79 ?  336  TYR A CG    1 
ATOM   2488 C  CD1   . TYR C 3 270 ? 2.024   16.084  -12.510 1.00 38.25 ?  336  TYR A CD1   1 
ATOM   2489 C  CD2   . TYR C 3 270 ? 1.298   15.342  -10.365 1.00 39.31 ?  336  TYR A CD2   1 
ATOM   2490 C  CE1   . TYR C 3 270 ? 1.366   15.031  -13.104 1.00 39.90 ?  336  TYR A CE1   1 
ATOM   2491 C  CE2   . TYR C 3 270 ? 0.633   14.283  -10.953 1.00 40.73 ?  336  TYR A CE2   1 
ATOM   2492 C  CZ    . TYR C 3 270 ? 0.672   14.136  -12.322 1.00 40.53 ?  336  TYR A CZ    1 
ATOM   2493 O  OH    . TYR C 3 270 ? 0.014   13.084  -12.912 1.00 42.77 ?  336  TYR A OH    1 
ATOM   2494 N  N     . ASP C 3 271 ? 5.126   18.469  -8.626  1.00 32.26 ?  337  ASP A N     1 
ATOM   2495 C  CA    . ASP C 3 271 ? 5.525   19.668  -7.911  1.00 31.49 ?  337  ASP A CA    1 
ATOM   2496 C  C     . ASP C 3 271 ? 7.022   19.679  -7.611  1.00 30.77 ?  337  ASP A C     1 
ATOM   2497 O  O     . ASP C 3 271 ? 7.558   18.745  -7.006  1.00 30.12 ?  337  ASP A O     1 
ATOM   2498 C  CB    . ASP C 3 271 ? 4.701   19.786  -6.634  1.00 31.33 ?  337  ASP A CB    1 
ATOM   2499 C  CG    . ASP C 3 271 ? 3.215   19.655  -6.906  1.00 32.08 ?  337  ASP A CG    1 
ATOM   2500 O  OD1   . ASP C 3 271 ? 2.767   20.275  -7.890  1.00 31.33 ?  337  ASP A OD1   1 
ATOM   2501 O  OD2   . ASP C 3 271 ? 2.507   18.931  -6.165  1.00 31.10 ?  337  ASP A OD2   1 
ATOM   2502 N  N     . PRO C 3 272 ? 7.702   20.743  -8.040  1.00 30.18 ?  338  PRO A N     1 
ATOM   2503 C  CA    . PRO C 3 272 ? 9.152   20.807  -7.889  1.00 29.97 ?  338  PRO A CA    1 
ATOM   2504 C  C     . PRO C 3 272 ? 9.597   21.001  -6.441  1.00 29.96 ?  338  PRO A C     1 
ATOM   2505 O  O     . PRO C 3 272 ? 8.880   21.624  -5.642  1.00 29.46 ?  338  PRO A O     1 
ATOM   2506 C  CB    . PRO C 3 272 ? 9.547   22.030  -8.725  1.00 29.97 ?  338  PRO A CB    1 
ATOM   2507 C  CG    . PRO C 3 272 ? 8.282   22.819  -8.913  1.00 30.32 ?  338  PRO A CG    1 
ATOM   2508 C  CD    . PRO C 3 272 ? 7.168   21.822  -8.890  1.00 30.53 ?  338  PRO A CD    1 
ATOM   2509 N  N     . VAL C 3 273 ? 10.762  20.436  -6.118  1.00 29.55 ?  339  VAL A N     1 
ATOM   2510 C  CA    . VAL C 3 273 ? 11.533  20.828  -4.950  1.00 29.11 ?  339  VAL A CA    1 
ATOM   2511 C  C     . VAL C 3 273 ? 12.241  22.120  -5.364  1.00 29.20 ?  339  VAL A C     1 
ATOM   2512 O  O     . VAL C 3 273 ? 12.881  22.158  -6.420  1.00 29.46 ?  339  VAL A O     1 
ATOM   2513 C  CB    . VAL C 3 273 ? 12.586  19.760  -4.610  1.00 29.18 ?  339  VAL A CB    1 
ATOM   2514 C  CG1   . VAL C 3 273 ? 13.492  20.231  -3.477  1.00 28.83 ?  339  VAL A CG1   1 
ATOM   2515 C  CG2   . VAL C 3 273 ? 11.909  18.438  -4.254  1.00 28.44 ?  339  VAL A CG2   1 
ATOM   2516 N  N     . ILE C 3 274 ? 12.112  23.189  -4.586  1.00 29.12 ?  340  ILE A N     1 
ATOM   2517 C  CA    . ILE C 3 274 ? 12.745  24.448  -5.002  1.00 29.14 ?  340  ILE A CA    1 
ATOM   2518 C  C     . ILE C 3 274 ? 13.806  24.964  -4.027  1.00 28.76 ?  340  ILE A C     1 
ATOM   2519 O  O     . ILE C 3 274 ? 14.552  25.887  -4.355  1.00 28.60 ?  340  ILE A O     1 
ATOM   2520 C  CB    . ILE C 3 274 ? 11.724  25.557  -5.377  1.00 29.35 ?  340  ILE A CB    1 
ATOM   2521 C  CG1   . ILE C 3 274 ? 11.141  26.241  -4.133  1.00 30.90 ?  340  ILE A CG1   1 
ATOM   2522 C  CG2   . ILE C 3 274 ? 10.637  25.001  -6.286  1.00 29.27 ?  340  ILE A CG2   1 
ATOM   2523 C  CD1   . ILE C 3 274 ? 10.201  25.389  -3.325  1.00 32.11 ?  340  ILE A CD1   1 
ATOM   2524 N  N     . GLN C 3 275 ? 13.897  24.358  -2.846  1.00 27.68 ?  341  GLN A N     1 
ATOM   2525 C  CA    . GLN C 3 275 ? 15.003  24.673  -1.945  1.00 27.06 ?  341  GLN A CA    1 
ATOM   2526 C  C     . GLN C 3 275 ? 15.355  23.494  -1.059  1.00 27.01 ?  341  GLN A C     1 
ATOM   2527 O  O     . GLN C 3 275 ? 14.476  22.731  -0.651  1.00 26.35 ?  341  GLN A O     1 
ATOM   2528 C  CB    . GLN C 3 275 ? 14.703  25.907  -1.078  1.00 26.69 ?  341  GLN A CB    1 
ATOM   2529 C  CG    . GLN C 3 275 ? 14.580  27.197  -1.859  1.00 26.86 ?  341  GLN A CG    1 
ATOM   2530 C  CD    . GLN C 3 275 ? 14.510  28.436  -0.975  1.00 27.20 ?  341  GLN A CD    1 
ATOM   2531 O  OE1   . GLN C 3 275 ? 14.297  28.354  0.242   1.00 27.96 ?  341  GLN A OE1   1 
ATOM   2532 N  NE2   . GLN C 3 275 ? 14.676  29.597  -1.591  1.00 27.14 ?  341  GLN A NE2   1 
ATOM   2533 N  N     . ILE C 3 276 ? 16.649  23.345  -0.790  1.00 26.59 ?  342  ILE A N     1 
ATOM   2534 C  CA    . ILE C 3 276 ? 17.117  22.404  0.217   1.00 26.52 ?  342  ILE A CA    1 
ATOM   2535 C  C     . ILE C 3 276 ? 18.134  23.126  1.087   1.00 26.44 ?  342  ILE A C     1 
ATOM   2536 O  O     . ILE C 3 276 ? 19.204  23.542  0.603   1.00 26.20 ?  342  ILE A O     1 
ATOM   2537 C  CB    . ILE C 3 276 ? 17.790  21.167  -0.406  1.00 26.65 ?  342  ILE A CB    1 
ATOM   2538 C  CG1   . ILE C 3 276 ? 16.925  20.590  -1.541  1.00 27.11 ?  342  ILE A CG1   1 
ATOM   2539 C  CG2   . ILE C 3 276 ? 18.082  20.126  0.690   1.00 26.05 ?  342  ILE A CG2   1 
ATOM   2540 C  CD1   . ILE C 3 276 ? 17.572  19.424  -2.269  1.00 27.24 ?  342  ILE A CD1   1 
ATOM   2541 N  N     . ALA C 3 277 ? 17.792  23.301  2.360   1.00 26.09 ?  343  ALA A N     1 
ATOM   2542 C  CA    . ALA C 3 277 ? 18.683  23.945  3.306   1.00 25.75 ?  343  ALA A CA    1 
ATOM   2543 C  C     . ALA C 3 277 ? 19.384  22.884  4.134   1.00 26.01 ?  343  ALA A C     1 
ATOM   2544 O  O     . ALA C 3 277 ? 18.799  21.831  4.453   1.00 26.26 ?  343  ALA A O     1 
ATOM   2545 C  CB    . ALA C 3 277 ? 17.914  24.922  4.191   1.00 26.04 ?  343  ALA A CB    1 
ATOM   2546 N  N     . ASN C 3 278 ? 20.643  23.142  4.468   1.00 25.57 ?  344  ASN A N     1 
ATOM   2547 C  CA    . ASN C 3 278 ? 21.436  22.168  5.188   1.00 26.00 ?  344  ASN A CA    1 
ATOM   2548 C  C     . ASN C 3 278 ? 22.253  22.842  6.256   1.00 25.92 ?  344  ASN A C     1 
ATOM   2549 O  O     . ASN C 3 278 ? 22.740  23.955  6.079   1.00 25.53 ?  344  ASN A O     1 
ATOM   2550 C  CB    . ASN C 3 278 ? 22.386  21.439  4.240   1.00 26.93 ?  344  ASN A CB    1 
ATOM   2551 C  CG    . ASN C 3 278 ? 21.670  20.836  3.043   1.00 27.22 ?  344  ASN A CG    1 
ATOM   2552 O  OD1   . ASN C 3 278 ? 21.175  19.703  3.099   1.00 26.68 ?  344  ASN A OD1   1 
ATOM   2553 N  ND2   . ASN C 3 278 ? 21.630  21.583  1.949   1.00 26.66 ?  344  ASN A ND2   1 
ATOM   2554 N  N     . VAL C 3 279 ? 22.413  22.151  7.371   1.00 26.00 ?  345  VAL A N     1 
ATOM   2555 C  CA    . VAL C 3 279 ? 23.300  22.607  8.407   1.00 26.11 ?  345  VAL A CA    1 
ATOM   2556 C  C     . VAL C 3 279 ? 24.066  21.377  8.830   1.00 26.42 ?  345  VAL A C     1 
ATOM   2557 O  O     . VAL C 3 279 ? 23.488  20.291  8.958   1.00 27.34 ?  345  VAL A O     1 
ATOM   2558 C  CB    . VAL C 3 279 ? 22.497  23.153  9.601   1.00 26.79 ?  345  VAL A CB    1 
ATOM   2559 C  CG1   . VAL C 3 279 ? 23.406  23.362  10.810  1.00 27.41 ?  345  VAL A CG1   1 
ATOM   2560 C  CG2   . VAL C 3 279 ? 21.769  24.435  9.217   1.00 25.34 ?  345  VAL A CG2   1 
ATOM   2561 N  N     . VAL C 3 280 ? 25.363  21.519  9.038   1.00 26.35 ?  346  VAL A N     1 
ATOM   2562 C  CA    . VAL C 3 280 ? 26.156  20.382  9.483   1.00 26.48 ?  346  VAL A CA    1 
ATOM   2563 C  C     . VAL C 3 280 ? 26.972  20.816  10.684  1.00 26.95 ?  346  VAL A C     1 
ATOM   2564 O  O     . VAL C 3 280 ? 27.554  21.915  10.694  1.00 26.20 ?  346  VAL A O     1 
ATOM   2565 C  CB    . VAL C 3 280 ? 27.082  19.800  8.347   1.00 26.88 ?  346  VAL A CB    1 
ATOM   2566 C  CG1   . VAL C 3 280 ? 27.643  18.436  8.760   1.00 26.87 ?  346  VAL A CG1   1 
ATOM   2567 C  CG2   . VAL C 3 280 ? 26.308  19.628  7.063   1.00 25.49 ?  346  VAL A CG2   1 
ATOM   2568 N  N     . SER C 3 281 ? 26.988  19.963  11.705  1.00 27.03 ?  347  SER A N     1 
ATOM   2569 C  CA    . SER C 3 281 ? 27.756  20.226  12.906  1.00 27.49 ?  347  SER A CA    1 
ATOM   2570 C  C     . SER C 3 281 ? 28.384  18.941  13.428  1.00 27.43 ?  347  SER A C     1 
ATOM   2571 O  O     . SER C 3 281 ? 28.020  17.840  13.010  1.00 27.83 ?  347  SER A O     1 
ATOM   2572 C  CB    . SER C 3 281 ? 26.853  20.816  13.986  1.00 27.45 ?  347  SER A CB    1 
ATOM   2573 O  OG    . SER C 3 281 ? 25.877  19.859  14.358  1.00 30.17 ?  347  SER A OG    1 
ATOM   2574 N  N     . ILE C 3 282 ? 29.338  19.086  14.334  1.00 27.31 ?  348  ILE A N     1 
ATOM   2575 C  CA    . ILE C 3 282 ? 29.880  17.951  15.063  1.00 28.03 ?  348  ILE A CA    1 
ATOM   2576 C  C     . ILE C 3 282 ? 29.033  17.711  16.310  1.00 28.69 ?  348  ILE A C     1 
ATOM   2577 O  O     . ILE C 3 282 ? 28.738  18.652  17.068  1.00 28.44 ?  348  ILE A O     1 
ATOM   2578 C  CB    . ILE C 3 282 ? 31.344  18.221  15.494  1.00 28.75 ?  348  ILE A CB    1 
ATOM   2579 C  CG1   . ILE C 3 282 ? 32.232  18.530  14.262  1.00 27.51 ?  348  ILE A CG1   1 
ATOM   2580 C  CG2   . ILE C 3 282 ? 31.878  17.069  16.350  1.00 28.91 ?  348  ILE A CG2   1 
ATOM   2581 C  CD1   . ILE C 3 282 ? 32.188  17.452  13.174  1.00 28.46 ?  348  ILE A CD1   1 
ATOM   2582 N  N     . ALA C 3 283 ? 28.641  16.461  16.530  1.00 28.81 ?  349  ALA A N     1 
ATOM   2583 C  CA    . ALA C 3 283 ? 27.922  16.098  17.742  1.00 29.68 ?  349  ALA A CA    1 
ATOM   2584 C  C     . ALA C 3 283 ? 28.390  16.909  18.946  1.00 30.11 ?  349  ALA A C     1 
ATOM   2585 O  O     . ALA C 3 283 ? 29.567  16.902  19.292  1.00 30.16 ?  349  ALA A O     1 
ATOM   2586 C  CB    . ALA C 3 283 ? 28.074  14.617  18.026  1.00 29.76 ?  349  ALA A CB    1 
ATOM   2587 N  N     . GLY C 3 284 ? 27.454  17.611  19.575  1.00 30.55 ?  350  GLY A N     1 
ATOM   2588 C  CA    . GLY C 3 284 ? 27.728  18.308  20.818  1.00 31.08 ?  350  GLY A CA    1 
ATOM   2589 C  C     . GLY C 3 284 ? 28.349  19.680  20.632  1.00 31.54 ?  350  GLY A C     1 
ATOM   2590 O  O     . GLY C 3 284 ? 28.611  20.373  21.605  1.00 31.91 ?  350  GLY A O     1 
ATOM   2591 N  N     . ALA C 3 285 ? 28.587  20.085  19.390  1.00 31.49 ?  351  ALA A N     1 
ATOM   2592 C  CA    . ALA C 3 285 ? 29.216  21.391  19.148  1.00 31.78 ?  351  ALA A CA    1 
ATOM   2593 C  C     . ALA C 3 285 ? 28.278  22.537  19.497  1.00 32.06 ?  351  ALA A C     1 
ATOM   2594 O  O     . ALA C 3 285 ? 27.060  22.377  19.452  1.00 32.31 ?  351  ALA A O     1 
ATOM   2595 C  CB    . ALA C 3 285 ? 29.680  21.508  17.714  1.00 31.47 ?  351  ALA A CB    1 
ATOM   2596 N  N     . LYS C 3 286 ? 28.841  23.692  19.851  1.00 32.34 ?  352  LYS A N     1 
ATOM   2597 C  CA    . LYS C 3 286 ? 28.027  24.877  20.117  1.00 32.56 ?  352  LYS A CA    1 
ATOM   2598 C  C     . LYS C 3 286 ? 27.324  25.354  18.855  1.00 32.14 ?  352  LYS A C     1 
ATOM   2599 O  O     . LYS C 3 286 ? 26.159  25.727  18.895  1.00 32.64 ?  352  LYS A O     1 
ATOM   2600 C  CB    . LYS C 3 286 ? 28.873  26.017  20.689  1.00 32.89 ?  352  LYS A CB    1 
ATOM   2601 C  CG    . LYS C 3 286 ? 28.815  26.146  22.205  1.00 35.01 ?  352  LYS A CG    1 
ATOM   2602 C  CD    . LYS C 3 286 ? 29.275  24.888  22.907  1.00 37.70 ?  352  LYS A CD    1 
ATOM   2603 C  CE    . LYS C 3 286 ? 29.387  25.132  24.406  1.00 39.85 ?  352  LYS A CE    1 
ATOM   2604 N  NZ    . LYS C 3 286 ? 30.296  26.282  24.687  1.00 40.85 ?  352  LYS A NZ    1 
ATOM   2605 N  N     . LYS C 3 287 ? 28.037  25.342  17.735  1.00 31.38 ?  353  LYS A N     1 
ATOM   2606 C  CA    . LYS C 3 287 ? 27.504  25.862  16.479  1.00 30.46 ?  353  LYS A CA    1 
ATOM   2607 C  C     . LYS C 3 287 ? 27.851  24.935  15.315  1.00 30.09 ?  353  LYS A C     1 
ATOM   2608 O  O     . LYS C 3 287 ? 28.879  24.255  15.357  1.00 30.06 ?  353  LYS A O     1 
ATOM   2609 C  CB    . LYS C 3 287 ? 28.089  27.246  16.200  1.00 30.70 ?  353  LYS A CB    1 
ATOM   2610 N  N     . PRO C 3 288 ? 27.008  24.922  14.265  1.00 29.11 ?  354  PRO A N     1 
ATOM   2611 C  CA    . PRO C 3 288 ? 27.312  24.104  13.097  1.00 28.82 ?  354  PRO A CA    1 
ATOM   2612 C  C     . PRO C 3 288 ? 28.484  24.707  12.314  1.00 28.57 ?  354  PRO A C     1 
ATOM   2613 O  O     . PRO C 3 288 ? 28.718  25.918  12.372  1.00 28.51 ?  354  PRO A O     1 
ATOM   2614 C  CB    . PRO C 3 288 ? 26.016  24.158  12.283  1.00 28.51 ?  354  PRO A CB    1 
ATOM   2615 C  CG    . PRO C 3 288 ? 25.396  25.452  12.651  1.00 28.85 ?  354  PRO A CG    1 
ATOM   2616 C  CD    . PRO C 3 288 ? 25.763  25.692  14.094  1.00 29.09 ?  354  PRO A CD    1 
ATOM   2617 N  N     . PHE C 3 289 ? 29.237  23.858  11.629  1.00 27.94 ?  355  PHE A N     1 
ATOM   2618 C  CA    . PHE C 3 289 ? 30.349  24.334  10.816  1.00 27.77 ?  355  PHE A CA    1 
ATOM   2619 C  C     . PHE C 3 289 ? 29.952  24.537  9.346   1.00 27.20 ?  355  PHE A C     1 
ATOM   2620 O  O     . PHE C 3 289 ? 30.670  25.180  8.597   1.00 26.82 ?  355  PHE A O     1 
ATOM   2621 C  CB    . PHE C 3 289 ? 31.600  23.457  10.986  1.00 27.45 ?  355  PHE A CB    1 
ATOM   2622 C  CG    . PHE C 3 289 ? 31.481  22.081  10.391  1.00 28.42 ?  355  PHE A CG    1 
ATOM   2623 C  CD1   . PHE C 3 289 ? 31.945  21.828  9.107   1.00 29.24 ?  355  PHE A CD1   1 
ATOM   2624 C  CD2   . PHE C 3 289 ? 30.941  21.030  11.124  1.00 28.91 ?  355  PHE A CD2   1 
ATOM   2625 C  CE1   . PHE C 3 289 ? 31.861  20.565  8.553   1.00 28.89 ?  355  PHE A CE1   1 
ATOM   2626 C  CE2   . PHE C 3 289 ? 30.850  19.762  10.576  1.00 29.24 ?  355  PHE A CE2   1 
ATOM   2627 C  CZ    . PHE C 3 289 ? 31.313  19.526  9.286   1.00 28.62 ?  355  PHE A CZ    1 
ATOM   2628 N  N     . ILE C 3 290 ? 28.798  24.005  8.946   1.00 26.66 ?  356  ILE A N     1 
ATOM   2629 C  CA    . ILE C 3 290 ? 28.234  24.314  7.620   1.00 26.23 ?  356  ILE A CA    1 
ATOM   2630 C  C     . ILE C 3 290 ? 26.806  24.845  7.706   1.00 26.07 ?  356  ILE A C     1 
ATOM   2631 O  O     . ILE C 3 290 ? 25.964  24.282  8.405   1.00 25.58 ?  356  ILE A O     1 
ATOM   2632 C  CB    . ILE C 3 290 ? 28.205  23.068  6.686   1.00 26.82 ?  356  ILE A CB    1 
ATOM   2633 C  CG1   . ILE C 3 290 ? 29.623  22.673  6.256   1.00 27.50 ?  356  ILE A CG1   1 
ATOM   2634 C  CG2   . ILE C 3 290 ? 27.334  23.330  5.436   1.00 25.71 ?  356  ILE A CG2   1 
ATOM   2635 C  CD1   . ILE C 3 290 ? 29.710  21.258  5.700   1.00 26.76 ?  356  ILE A CD1   1 
ATOM   2636 N  N     . ARG C 3 291 ? 26.525  25.926  6.992   1.00 25.50 ?  357  ARG A N     1 
ATOM   2637 C  CA    A ARG C 3 291 ? 25.152  26.382  6.839   0.50 25.67 ?  357  ARG A CA    1 
ATOM   2638 C  CA    B ARG C 3 291 ? 25.155  26.393  6.844   0.50 25.70 ?  357  ARG A CA    1 
ATOM   2639 C  C     . ARG C 3 291 ? 24.930  26.856  5.417   1.00 25.62 ?  357  ARG A C     1 
ATOM   2640 O  O     . ARG C 3 291 ? 25.636  27.745  4.924   1.00 25.17 ?  357  ARG A O     1 
ATOM   2641 C  CB    A ARG C 3 291 ? 24.816  27.496  7.835   0.50 25.70 ?  357  ARG A CB    1 
ATOM   2642 C  CB    B ARG C 3 291 ? 24.839  27.524  7.829   0.50 25.76 ?  357  ARG A CB    1 
ATOM   2643 C  CG    A ARG C 3 291 ? 25.587  27.410  9.137   0.50 26.46 ?  357  ARG A CG    1 
ATOM   2644 C  CG    B ARG C 3 291 ? 25.021  27.149  9.296   0.50 26.61 ?  357  ARG A CG    1 
ATOM   2645 C  CD    A ARG C 3 291 ? 26.606  28.531  9.210   0.50 27.76 ?  357  ARG A CD    1 
ATOM   2646 C  CD    B ARG C 3 291 ? 24.262  28.109  10.209  0.50 28.46 ?  357  ARG A CD    1 
ATOM   2647 N  NE    A ARG C 3 291 ? 27.827  28.124  9.890   0.50 27.58 ?  357  ARG A NE    1 
ATOM   2648 N  NE    B ARG C 3 291 ? 25.080  28.556  11.331  0.50 30.14 ?  357  ARG A NE    1 
ATOM   2649 C  CZ    A ARG C 3 291 ? 28.861  28.927  10.091  0.50 26.75 ?  357  ARG A CZ    1 
ATOM   2650 C  CZ    B ARG C 3 291 ? 24.592  28.939  12.505  0.50 30.65 ?  357  ARG A CZ    1 
ATOM   2651 N  NH1   A ARG C 3 291 ? 28.813  30.186  9.673   0.50 26.72 ?  357  ARG A NH1   1 
ATOM   2652 N  NH1   B ARG C 3 291 ? 23.283  28.916  12.721  0.50 31.28 ?  357  ARG A NH1   1 
ATOM   2653 N  NH2   A ARG C 3 291 ? 29.939  28.473  10.709  0.50 26.84 ?  357  ARG A NH2   1 
ATOM   2654 N  NH2   B ARG C 3 291 ? 25.411  29.336  13.464  0.50 30.86 ?  357  ARG A NH2   1 
ATOM   2655 N  N     . ASN C 3 292 ? 23.965  26.257  4.738   1.00 25.37 ?  358  ASN A N     1 
ATOM   2656 C  CA    . ASN C 3 292 ? 23.754  26.665  3.357   1.00 25.77 ?  358  ASN A CA    1 
ATOM   2657 C  C     . ASN C 3 292 ? 22.351  26.386  2.891   1.00 25.88 ?  358  ASN A C     1 
ATOM   2658 O  O     . ASN C 3 292 ? 21.584  25.709  3.577   1.00 25.40 ?  358  ASN A O     1 
ATOM   2659 C  CB    . ASN C 3 292 ? 24.766  25.996  2.414   1.00 25.42 ?  358  ASN A CB    1 
ATOM   2660 C  CG    . ASN C 3 292 ? 24.597  24.475  2.337   1.00 26.12 ?  358  ASN A CG    1 
ATOM   2661 O  OD1   . ASN C 3 292 ? 23.495  23.963  2.136   1.00 25.62 ?  358  ASN A OD1   1 
ATOM   2662 N  ND2   . ASN C 3 292 ? 25.703  23.753  2.464   1.00 26.72 ?  358  ASN A ND2   1 
ATOM   2663 N  N     . VAL C 3 293 ? 22.029  26.913  1.714   1.00 25.78 ?  359  VAL A N     1 
ATOM   2664 C  CA    . VAL C 3 293 ? 20.766  26.624  1.067   1.00 25.79 ?  359  VAL A CA    1 
ATOM   2665 C  C     . VAL C 3 293 ? 21.004  26.428  -0.411  1.00 25.99 ?  359  VAL A C     1 
ATOM   2666 O  O     . VAL C 3 293 ? 21.618  27.276  -1.077  1.00 25.69 ?  359  VAL A O     1 
ATOM   2667 C  CB    . VAL C 3 293 ? 19.727  27.745  1.256   1.00 26.34 ?  359  VAL A CB    1 
ATOM   2668 C  CG1   . VAL C 3 293 ? 18.331  27.265  0.814   1.00 25.14 ?  359  VAL A CG1   1 
ATOM   2669 C  CG2   . VAL C 3 293 ? 19.701  28.208  2.703   1.00 26.25 ?  359  VAL A CG2   1 
ATOM   2670 N  N     . PHE C 3 294 ? 20.537  25.289  -0.913  1.00 26.15 ?  360  PHE A N     1 
ATOM   2671 C  CA    . PHE C 3 294 ? 20.488  25.022  -2.337  1.00 26.01 ?  360  PHE A CA    1 
ATOM   2672 C  C     . PHE C 3 294 ? 19.181  25.599  -2.842  1.00 26.41 ?  360  PHE A C     1 
ATOM   2673 O  O     . PHE C 3 294 ? 18.117  25.297  -2.290  1.00 26.36 ?  360  PHE A O     1 
ATOM   2674 C  CB    . PHE C 3 294 ? 20.505  23.512  -2.597  1.00 25.74 ?  360  PHE A CB    1 
ATOM   2675 C  CG    . PHE C 3 294 ? 21.837  22.877  -2.341  1.00 25.98 ?  360  PHE A CG    1 
ATOM   2676 C  CD1   . PHE C 3 294 ? 22.493  22.184  -3.341  1.00 26.42 ?  360  PHE A CD1   1 
ATOM   2677 C  CD2   . PHE C 3 294 ? 22.449  23.004  -1.110  1.00 25.66 ?  360  PHE A CD2   1 
ATOM   2678 C  CE1   . PHE C 3 294 ? 23.733  21.601  -3.106  1.00 27.25 ?  360  PHE A CE1   1 
ATOM   2679 C  CE2   . PHE C 3 294 ? 23.683  22.428  -0.871  1.00 27.33 ?  360  PHE A CE2   1 
ATOM   2680 C  CZ    . PHE C 3 294 ? 24.327  21.728  -1.869  1.00 26.41 ?  360  PHE A CZ    1 
ATOM   2681 N  N     . THR C 3 295 ? 19.247  26.431  -3.878  1.00 26.00 ?  361  THR A N     1 
ATOM   2682 C  CA    . THR C 3 295 ? 18.037  27.039  -4.411  1.00 26.38 ?  361  THR A CA    1 
ATOM   2683 C  C     . THR C 3 295 ? 17.841  26.778  -5.913  1.00 27.03 ?  361  THR A C     1 
ATOM   2684 O  O     . THR C 3 295 ? 18.804  26.590  -6.663  1.00 26.59 ?  361  THR A O     1 
ATOM   2685 C  CB    . THR C 3 295 ? 18.036  28.557  -4.180  1.00 26.52 ?  361  THR A CB    1 
ATOM   2686 O  OG1   . THR C 3 295 ? 18.926  29.173  -5.110  1.00 25.59 ?  361  THR A OG1   1 
ATOM   2687 C  CG2   . THR C 3 295 ? 18.486  28.884  -2.753  1.00 26.80 ?  361  THR A CG2   1 
ATOM   2688 N  N     . LEU C 3 296 ? 16.584  26.776  -6.342  1.00 27.71 ?  362  LEU A N     1 
ATOM   2689 C  CA    . LEU C 3 296 ? 16.278  26.785  -7.758  1.00 28.00 ?  362  LEU A CA    1 
ATOM   2690 C  C     . LEU C 3 296 ? 16.136  28.251  -8.119  1.00 28.31 ?  362  LEU A C     1 
ATOM   2691 O  O     . LEU C 3 296 ? 15.352  28.970  -7.491  1.00 28.21 ?  362  LEU A O     1 
ATOM   2692 C  CB    . LEU C 3 296 ? 14.973  26.051  -8.051  1.00 28.25 ?  362  LEU A CB    1 
ATOM   2693 C  CG    . LEU C 3 296 ? 14.488  26.205  -9.503  1.00 29.08 ?  362  LEU A CG    1 
ATOM   2694 C  CD1   . LEU C 3 296 ? 15.573  25.747  -10.464 1.00 29.70 ?  362  LEU A CD1   1 
ATOM   2695 C  CD2   . LEU C 3 296 ? 13.194  25.423  -9.737  1.00 29.85 ?  362  LEU A CD2   1 
ATOM   2696 N  N     . ASN C 3 297 ? 16.891  28.692  -9.124  1.00 28.18 ?  363  ASN A N     1 
ATOM   2697 C  CA    . ASN C 3 297 ? 16.900  30.098  -9.510  1.00 28.55 ?  363  ASN A CA    1 
ATOM   2698 C  C     . ASN C 3 297 ? 17.685  30.911  -8.484  1.00 28.92 ?  363  ASN A C     1 
ATOM   2699 O  O     . ASN C 3 297 ? 18.329  30.349  -7.587  1.00 29.23 ?  363  ASN A O     1 
ATOM   2700 C  CB    . ASN C 3 297 ? 15.475  30.638  -9.645  1.00 28.14 ?  363  ASN A CB    1 
ATOM   2701 C  CG    . ASN C 3 297 ? 15.388  31.858  -10.567 1.00 28.97 ?  363  ASN A CG    1 
ATOM   2702 O  OD1   . ASN C 3 297 ? 16.404  32.459  -10.937 1.00 27.44 ?  363  ASN A OD1   1 
ATOM   2703 N  ND2   . ASN C 3 297 ? 14.160  32.224  -10.944 1.00 28.49 ?  363  ASN A ND2   1 
ATOM   2704 N  N     . THR C 3 298 ? 17.616  32.229  -8.601  1.00 28.88 ?  364  THR A N     1 
ATOM   2705 C  CA    . THR C 3 298 ? 18.492  33.102  -7.835  1.00 28.94 ?  364  THR A CA    1 
ATOM   2706 C  C     . THR C 3 298 ? 18.010  33.380  -6.414  1.00 28.91 ?  364  THR A C     1 
ATOM   2707 O  O     . THR C 3 298 ? 16.826  33.318  -6.113  1.00 28.76 ?  364  THR A O     1 
ATOM   2708 C  CB    . THR C 3 298 ? 18.715  34.440  -8.553  1.00 28.95 ?  364  THR A CB    1 
ATOM   2709 O  OG1   . THR C 3 298 ? 17.460  35.119  -8.696  1.00 28.85 ?  364  THR A OG1   1 
ATOM   2710 C  CG2   . THR C 3 298 ? 19.321  34.204  -9.926  1.00 29.20 ?  364  THR A CG2   1 
ATOM   2711 N  N     . CYS C 3 299 ? 18.952  33.707  -5.547  1.00 29.15 ?  365  CYS A N     1 
ATOM   2712 C  CA    . CYS C 3 299 ? 18.648  33.950  -4.158  1.00 29.82 ?  365  CYS A CA    1 
ATOM   2713 C  C     . CYS C 3 299 ? 19.687  34.907  -3.597  1.00 30.13 ?  365  CYS A C     1 
ATOM   2714 O  O     . CYS C 3 299 ? 20.879  34.619  -3.638  1.00 30.60 ?  365  CYS A O     1 
ATOM   2715 C  CB    . CYS C 3 299 ? 18.669  32.620  -3.389  1.00 29.69 ?  365  CYS A CB    1 
ATOM   2716 S  SG    . CYS C 3 299 ? 18.262  32.797  -1.654  1.00 30.76 ?  365  CYS A SG    1 
ATOM   2717 N  N     . SER C 3 300 ? 19.242  36.044  -3.078  1.00 30.86 ?  366  SER A N     1 
ATOM   2718 C  CA    . SER C 3 300 ? 20.156  37.023  -2.492  1.00 31.24 ?  366  SER A CA    1 
ATOM   2719 C  C     . SER C 3 300 ? 20.827  36.482  -1.227  1.00 31.41 ?  366  SER A C     1 
ATOM   2720 O  O     . SER C 3 300 ? 20.269  35.627  -0.534  1.00 30.93 ?  366  SER A O     1 
ATOM   2721 C  CB    . SER C 3 300 ? 19.426  38.329  -2.183  1.00 31.37 ?  366  SER A CB    1 
ATOM   2722 O  OG    . SER C 3 300 ? 18.884  38.894  -3.365  1.00 31.98 ?  366  SER A OG    1 
ATOM   2723 N  N     . PRO C 3 301 ? 22.026  36.999  -0.923  1.00 31.59 ?  367  PRO A N     1 
ATOM   2724 C  CA    . PRO C 3 301 ? 22.923  36.521  0.140   1.00 31.59 ?  367  PRO A CA    1 
ATOM   2725 C  C     . PRO C 3 301 ? 22.290  36.492  1.525   1.00 31.46 ?  367  PRO A C     1 
ATOM   2726 O  O     . PRO C 3 301 ? 21.492  37.357  1.864   1.00 31.06 ?  367  PRO A O     1 
ATOM   2727 C  CB    . PRO C 3 301 ? 24.064  37.550  0.115   1.00 31.54 ?  367  PRO A CB    1 
ATOM   2728 C  CG    . PRO C 3 301 ? 24.050  38.082  -1.277  1.00 31.78 ?  367  PRO A CG    1 
ATOM   2729 C  CD    . PRO C 3 301 ? 22.598  38.149  -1.645  1.00 31.52 ?  367  PRO A CD    1 
ATOM   2730 N  N     . ILE C 3 302 ? 22.650  35.499  2.328   1.00 31.91 ?  368  ILE A N     1 
ATOM   2731 C  CA    . ILE C 3 302 ? 22.176  35.462  3.698   1.00 32.16 ?  368  ILE A CA    1 
ATOM   2732 C  C     . ILE C 3 302 ? 23.348  35.401  4.656   1.00 32.63 ?  368  ILE A C     1 
ATOM   2733 O  O     . ILE C 3 302 ? 24.104  34.429  4.684   1.00 32.77 ?  368  ILE A O     1 
ATOM   2734 C  CB    . ILE C 3 302 ? 21.232  34.298  3.954   1.00 32.31 ?  368  ILE A CB    1 
ATOM   2735 C  CG1   . ILE C 3 302 ? 19.969  34.452  3.103   1.00 32.12 ?  368  ILE A CG1   1 
ATOM   2736 C  CG2   . ILE C 3 302 ? 20.905  34.200  5.463   1.00 31.77 ?  368  ILE A CG2   1 
ATOM   2737 C  CD1   . ILE C 3 302 ? 18.945  33.342  3.340   1.00 33.13 ?  368  ILE A CD1   1 
ATOM   2738 N  N     . THR C 3 303 ? 23.493  36.463  5.432   1.00 33.08 ?  369  THR A N     1 
ATOM   2739 C  CA    . THR C 3 303 ? 24.584  36.584  6.376   1.00 33.54 ?  369  THR A CA    1 
ATOM   2740 C  C     . THR C 3 303 ? 24.800  35.296  7.168   1.00 33.62 ?  369  THR A C     1 
ATOM   2741 O  O     . THR C 3 303 ? 23.949  34.898  7.964   1.00 33.87 ?  369  THR A O     1 
ATOM   2742 C  CB    . THR C 3 303 ? 24.319  37.735  7.352   1.00 33.26 ?  369  THR A CB    1 
ATOM   2743 O  OG1   . THR C 3 303 ? 24.153  38.949  6.608   1.00 33.64 ?  369  THR A OG1   1 
ATOM   2744 C  CG2   . THR C 3 303 ? 25.475  37.887  8.323   1.00 33.85 ?  369  THR A CG2   1 
ATOM   2745 N  N     . GLY C 3 304 ? 25.946  34.661  6.947   1.00 33.67 ?  370  GLY A N     1 
ATOM   2746 C  CA    . GLY C 3 304 ? 26.364  33.514  7.746   1.00 34.38 ?  370  GLY A CA    1 
ATOM   2747 C  C     . GLY C 3 304 ? 25.960  32.169  7.176   1.00 34.88 ?  370  GLY A C     1 
ATOM   2748 O  O     . GLY C 3 304 ? 25.915  31.172  7.897   1.00 34.88 ?  370  GLY A O     1 
ATOM   2749 N  N     . SER C 3 305 ? 25.653  32.145  5.884   1.00 34.95 ?  371  SER A N     1 
ATOM   2750 C  CA    . SER C 3 305 ? 25.343  30.900  5.203   1.00 35.51 ?  371  SER A CA    1 
ATOM   2751 C  C     . SER C 3 305 ? 25.643  31.023  3.713   1.00 35.66 ?  371  SER A C     1 
ATOM   2752 O  O     . SER C 3 305 ? 25.583  32.117  3.132   1.00 35.29 ?  371  SER A O     1 
ATOM   2753 C  CB    . SER C 3 305 ? 23.881  30.512  5.422   1.00 35.77 ?  371  SER A CB    1 
ATOM   2754 O  OG    . SER C 3 305 ? 23.051  31.079  4.424   1.00 37.03 ?  371  SER A OG    1 
ATOM   2755 N  N     . MET C 3 306 ? 25.987  29.900  3.098   1.00 35.68 ?  372  MET A N     1 
ATOM   2756 C  CA    . MET C 3 306 ? 26.278  29.894  1.675   1.00 35.93 ?  372  MET A CA    1 
ATOM   2757 C  C     . MET C 3 306 ? 24.999  29.644  0.889   1.00 35.31 ?  372  MET A C     1 
ATOM   2758 O  O     . MET C 3 306 ? 24.081  28.969  1.366   1.00 34.84 ?  372  MET A O     1 
ATOM   2759 C  CB    . MET C 3 306 ? 27.329  28.831  1.352   1.00 36.73 ?  372  MET A CB    1 
ATOM   2760 C  CG    . MET C 3 306 ? 28.613  29.003  2.135   1.00 39.21 ?  372  MET A CG    1 
ATOM   2761 S  SD    . MET C 3 306 ? 29.907  27.863  1.618   1.00 46.25 ?  372  MET A SD    1 
ATOM   2762 C  CE    . MET C 3 306 ? 31.361  28.708  2.244   1.00 44.62 ?  372  MET A CE    1 
ATOM   2763 N  N     . ILE C 3 307 ? 24.939  30.210  -0.309  1.00 34.44 ?  373  ILE A N     1 
ATOM   2764 C  CA    . ILE C 3 307 ? 23.794  30.042  -1.186  1.00 33.86 ?  373  ILE A CA    1 
ATOM   2765 C  C     . ILE C 3 307 ? 24.258  29.382  -2.472  1.00 33.51 ?  373  ILE A C     1 
ATOM   2766 O  O     . ILE C 3 307 ? 25.112  29.921  -3.163  1.00 33.52 ?  373  ILE A O     1 
ATOM   2767 C  CB    . ILE C 3 307 ? 23.171  31.414  -1.560  1.00 34.10 ?  373  ILE A CB    1 
ATOM   2768 C  CG1   . ILE C 3 307 ? 22.822  32.223  -0.302  1.00 33.95 ?  373  ILE A CG1   1 
ATOM   2769 C  CG2   . ILE C 3 307 ? 21.957  31.222  -2.452  1.00 33.72 ?  373  ILE A CG2   1 
ATOM   2770 C  CD1   . ILE C 3 307 ? 21.815  31.538  0.610   1.00 35.61 ?  373  ILE A CD1   1 
ATOM   2771 N  N     . PHE C 3 308 ? 23.700  28.225  -2.803  1.00 32.82 ?  374  PHE A N     1 
ATOM   2772 C  CA    . PHE C 3 308 ? 24.038  27.567  -4.061  1.00 32.34 ?  374  PHE A CA    1 
ATOM   2773 C  C     . PHE C 3 308 ? 22.817  27.520  -4.973  1.00 32.18 ?  374  PHE A C     1 
ATOM   2774 O  O     . PHE C 3 308 ? 21.966  26.646  -4.837  1.00 31.82 ?  374  PHE A O     1 
ATOM   2775 C  CB    . PHE C 3 308 ? 24.589  26.163  -3.801  1.00 32.31 ?  374  PHE A CB    1 
ATOM   2776 C  CG    . PHE C 3 308 ? 25.739  26.141  -2.832  1.00 32.80 ?  374  PHE A CG    1 
ATOM   2777 C  CD1   . PHE C 3 308 ? 26.953  26.719  -3.163  1.00 33.72 ?  374  PHE A CD1   1 
ATOM   2778 C  CD2   . PHE C 3 308 ? 25.607  25.549  -1.585  1.00 32.86 ?  374  PHE A CD2   1 
ATOM   2779 C  CE1   . PHE C 3 308 ? 28.015  26.703  -2.260  1.00 34.12 ?  374  PHE A CE1   1 
ATOM   2780 C  CE2   . PHE C 3 308 ? 26.657  25.532  -0.694  1.00 31.88 ?  374  PHE A CE2   1 
ATOM   2781 C  CZ    . PHE C 3 308 ? 27.858  26.112  -1.030  1.00 32.93 ?  374  PHE A CZ    1 
ATOM   2782 N  N     . SER C 3 309 ? 22.720  28.481  -5.890  1.00 31.69 ?  375  SER A N     1 
ATOM   2783 C  CA    . SER C 3 309 ? 21.554  28.570  -6.754  1.00 31.69 ?  375  SER A CA    1 
ATOM   2784 C  C     . SER C 3 309 ? 21.816  27.878  -8.089  1.00 31.36 ?  375  SER A C     1 
ATOM   2785 O  O     . SER C 3 309 ? 22.952  27.823  -8.548  1.00 31.46 ?  375  SER A O     1 
ATOM   2786 C  CB    . SER C 3 309 ? 21.135  30.026  -6.946  1.00 31.77 ?  375  SER A CB    1 
ATOM   2787 O  OG    . SER C 3 309 ? 22.241  30.824  -7.327  1.00 33.09 ?  375  SER A OG    1 
ATOM   2788 N  N     . HIS C 3 310 ? 20.758  27.345  -8.695  1.00 31.05 ?  376  HIS A N     1 
ATOM   2789 C  CA    . HIS C 3 310 ? 20.871  26.474  -9.857  1.00 30.58 ?  376  HIS A CA    1 
ATOM   2790 C  C     . HIS C 3 310 ? 19.840  26.889  -10.898 1.00 30.76 ?  376  HIS A C     1 
ATOM   2791 O  O     . HIS C 3 310 ? 18.778  27.405  -10.553 1.00 30.88 ?  376  HIS A O     1 
ATOM   2792 C  CB    . HIS C 3 310 ? 20.616  25.018  -9.446  1.00 30.59 ?  376  HIS A CB    1 
ATOM   2793 C  CG    . HIS C 3 310 ? 21.395  24.586  -8.243  1.00 30.67 ?  376  HIS A CG    1 
ATOM   2794 N  ND1   . HIS C 3 310 ? 22.453  23.705  -8.317  1.00 31.31 ?  376  HIS A ND1   1 
ATOM   2795 C  CD2   . HIS C 3 310 ? 21.276  24.924  -6.938  1.00 30.65 ?  376  HIS A CD2   1 
ATOM   2796 C  CE1   . HIS C 3 310 ? 22.955  23.520  -7.107  1.00 30.90 ?  376  HIS A CE1   1 
ATOM   2797 N  NE2   . HIS C 3 310 ? 22.255  24.246  -6.252  1.00 31.01 ?  376  HIS A NE2   1 
ATOM   2798 N  N     . ALA C 3 311 ? 20.151  26.677  -12.173 1.00 30.46 ?  377  ALA A N     1 
ATOM   2799 C  CA    . ALA C 3 311 ? 19.214  27.025  -13.232 1.00 30.14 ?  377  ALA A CA    1 
ATOM   2800 C  C     . ALA C 3 311 ? 18.110  25.982  -13.342 1.00 29.86 ?  377  ALA A C     1 
ATOM   2801 O  O     . ALA C 3 311 ? 16.983  26.303  -13.713 1.00 29.68 ?  377  ALA A O     1 
ATOM   2802 C  CB    . ALA C 3 311 ? 19.933  27.193  -14.574 1.00 29.89 ?  377  ALA A CB    1 
ATOM   2803 N  N     . THR C 3 312 ? 18.430  24.733  -13.015 1.00 29.51 ?  378  THR A N     1 
ATOM   2804 C  CA    . THR C 3 312 ? 17.431  23.676  -13.080 1.00 29.34 ?  378  THR A CA    1 
ATOM   2805 C  C     . THR C 3 312 ? 17.342  22.886  -11.788 1.00 29.67 ?  378  THR A C     1 
ATOM   2806 O  O     . THR C 3 312 ? 18.319  22.785  -11.031 1.00 29.59 ?  378  THR A O     1 
ATOM   2807 C  CB    . THR C 3 312 ? 17.719  22.701  -14.225 1.00 29.44 ?  378  THR A CB    1 
ATOM   2808 O  OG1   . THR C 3 312 ? 18.975  22.052  -13.983 1.00 28.93 ?  378  THR A OG1   1 
ATOM   2809 C  CG2   . THR C 3 312 ? 17.775  23.457  -15.558 1.00 29.53 ?  378  THR A CG2   1 
ATOM   2810 N  N     . GLU C 3 313 ? 16.159  22.327  -11.549 1.00 29.78 ?  379  GLU A N     1 
ATOM   2811 C  CA    . GLU C 3 313 ? 15.904  21.497  -10.386 1.00 29.83 ?  379  GLU A CA    1 
ATOM   2812 C  C     . GLU C 3 313 ? 16.807  20.264  -10.420 1.00 30.01 ?  379  GLU A C     1 
ATOM   2813 O  O     . GLU C 3 313 ? 17.331  19.844  -9.386  1.00 29.85 ?  379  GLU A O     1 
ATOM   2814 C  CB    . GLU C 3 313 ? 14.428  21.076  -10.353 1.00 29.88 ?  379  GLU A CB    1 
ATOM   2815 C  CG    . GLU C 3 313 ? 14.040  20.163  -9.177  1.00 30.35 ?  379  GLU A CG    1 
ATOM   2816 C  CD    . GLU C 3 313 ? 12.572  19.758  -9.220  1.00 30.55 ?  379  GLU A CD    1 
ATOM   2817 O  OE1   . GLU C 3 313 ? 11.877  20.191  -10.164 1.00 30.21 ?  379  GLU A OE1   1 
ATOM   2818 O  OE2   . GLU C 3 313 ? 12.120  19.004  -8.320  1.00 29.86 ?  379  GLU A OE2   1 
ATOM   2819 N  N     . GLU C 3 314 ? 16.979  19.694  -11.615 1.00 29.73 ?  380  GLU A N     1 
ATOM   2820 C  CA    . GLU C 3 314 ? 17.797  18.497  -11.803 1.00 29.71 ?  380  GLU A CA    1 
ATOM   2821 C  C     . GLU C 3 314 ? 19.214  18.725  -11.318 1.00 29.68 ?  380  GLU A C     1 
ATOM   2822 O  O     . GLU C 3 314 ? 19.804  17.886  -10.644 1.00 29.87 ?  380  GLU A O     1 
ATOM   2823 C  CB    . GLU C 3 314 ? 17.861  18.114  -13.287 1.00 29.77 ?  380  GLU A CB    1 
ATOM   2824 C  CG    . GLU C 3 314 ? 16.556  17.604  -13.877 1.00 29.77 ?  380  GLU A CG    1 
ATOM   2825 C  CD    . GLU C 3 314 ? 15.674  18.717  -14.406 1.00 31.47 ?  380  GLU A CD    1 
ATOM   2826 O  OE1   . GLU C 3 314 ? 16.010  19.907  -14.210 1.00 31.39 ?  380  GLU A OE1   1 
ATOM   2827 O  OE2   . GLU C 3 314 ? 14.635  18.394  -15.016 1.00 31.10 ?  380  GLU A OE2   1 
ATOM   2828 N  N     . GLU C 3 315 ? 19.773  19.859  -11.708 1.00 29.51 ?  381  GLU A N     1 
ATOM   2829 C  CA    . GLU C 3 315 ? 21.109  20.215  -11.303 1.00 29.24 ?  381  GLU A CA    1 
ATOM   2830 C  C     . GLU C 3 315 ? 21.177  20.301  -9.786  1.00 28.70 ?  381  GLU A C     1 
ATOM   2831 O  O     . GLU C 3 315 ? 22.090  19.766  -9.164  1.00 28.54 ?  381  GLU A O     1 
ATOM   2832 C  CB    . GLU C 3 315 ? 21.479  21.563  -11.906 1.00 29.59 ?  381  GLU A CB    1 
ATOM   2833 C  CG    . GLU C 3 315 ? 22.954  21.814  -11.934 1.00 31.69 ?  381  GLU A CG    1 
ATOM   2834 C  CD    . GLU C 3 315 ? 23.279  23.208  -12.378 1.00 36.56 ?  381  GLU A CD    1 
ATOM   2835 O  OE1   . GLU C 3 315 ? 22.609  23.719  -13.313 1.00 39.77 ?  381  GLU A OE1   1 
ATOM   2836 O  OE2   . GLU C 3 315 ? 24.207  23.795  -11.789 1.00 39.83 ?  381  GLU A OE2   1 
ATOM   2837 N  N     . MET C 3 316 ? 20.202  20.987  -9.200  1.00 27.89 ?  382  MET A N     1 
ATOM   2838 C  CA    . MET C 3 316 ? 20.160  21.165  -7.752  1.00 27.68 ?  382  MET A CA    1 
ATOM   2839 C  C     . MET C 3 316 ? 20.204  19.813  -7.040  1.00 27.07 ?  382  MET A C     1 
ATOM   2840 O  O     . MET C 3 316 ? 21.006  19.613  -6.135  1.00 26.49 ?  382  MET A O     1 
ATOM   2841 C  CB    . MET C 3 316 ? 18.927  21.971  -7.336  1.00 27.55 ?  382  MET A CB    1 
ATOM   2842 C  CG    . MET C 3 316 ? 18.871  22.298  -5.838  1.00 28.76 ?  382  MET A CG    1 
ATOM   2843 S  SD    . MET C 3 316 ? 17.463  23.334  -5.373  1.00 31.52 ?  382  MET A SD    1 
ATOM   2844 C  CE    . MET C 3 316 ? 16.111  22.293  -5.915  1.00 30.05 ?  382  MET A CE    1 
ATOM   2845 N  N     . LEU C 3 317 ? 19.358  18.879  -7.471  1.00 27.04 ?  383  LEU A N     1 
ATOM   2846 C  CA    . LEU C 3 317 ? 19.324  17.541  -6.863  1.00 27.31 ?  383  LEU A CA    1 
ATOM   2847 C  C     . LEU C 3 317 ? 20.672  16.810  -6.995  1.00 27.52 ?  383  LEU A C     1 
ATOM   2848 O  O     . LEU C 3 317 ? 21.154  16.225  -6.035  1.00 27.09 ?  383  LEU A O     1 
ATOM   2849 C  CB    . LEU C 3 317 ? 18.182  16.693  -7.454  1.00 27.20 ?  383  LEU A CB    1 
ATOM   2850 C  CG    . LEU C 3 317 ? 16.747  17.226  -7.312  1.00 26.23 ?  383  LEU A CG    1 
ATOM   2851 C  CD1   . LEU C 3 317 ? 15.770  16.434  -8.163  1.00 26.03 ?  383  LEU A CD1   1 
ATOM   2852 C  CD2   . LEU C 3 317 ? 16.298  17.222  -5.847  1.00 27.26 ?  383  LEU A CD2   1 
ATOM   2853 N  N     . SER C 3 318 ? 21.280  16.845  -8.183  1.00 27.84 ?  384  SER A N     1 
ATOM   2854 C  CA    . SER C 3 318 ? 22.560  16.157  -8.381  1.00 27.72 ?  384  SER A CA    1 
ATOM   2855 C  C     . SER C 3 318 ? 23.651  16.766  -7.523  1.00 28.09 ?  384  SER A C     1 
ATOM   2856 O  O     . SER C 3 318 ? 24.474  16.049  -6.943  1.00 27.85 ?  384  SER A O     1 
ATOM   2857 C  CB    . SER C 3 318 ? 22.998  16.186  -9.845  1.00 27.88 ?  384  SER A CB    1 
ATOM   2858 O  OG    . SER C 3 318 ? 22.142  15.397  -10.645 1.00 27.89 ?  384  SER A OG    1 
ATOM   2859 N  N     . ASN C 3 319 ? 23.673  18.094  -7.448  1.00 27.97 ?  385  ASN A N     1 
ATOM   2860 C  CA    . ASN C 3 319 ? 24.628  18.758  -6.572  1.00 28.32 ?  385  ASN A CA    1 
ATOM   2861 C  C     . ASN C 3 319 ? 24.438  18.398  -5.102  1.00 27.53 ?  385  ASN A C     1 
ATOM   2862 O  O     . ASN C 3 319 ? 25.412  18.282  -4.359  1.00 27.37 ?  385  ASN A O     1 
ATOM   2863 C  CB    . ASN C 3 319 ? 24.586  20.274  -6.762  1.00 28.65 ?  385  ASN A CB    1 
ATOM   2864 C  CG    . ASN C 3 319 ? 25.248  20.698  -8.049  1.00 31.61 ?  385  ASN A CG    1 
ATOM   2865 O  OD1   . ASN C 3 319 ? 25.875  19.883  -8.722  1.00 33.25 ?  385  ASN A OD1   1 
ATOM   2866 N  ND2   . ASN C 3 319 ? 25.113  21.969  -8.406  1.00 33.19 ?  385  ASN A ND2   1 
ATOM   2867 N  N     . TRP C 3 320 ? 23.188  18.227  -4.684  1.00 27.42 ?  386  TRP A N     1 
ATOM   2868 C  CA    . TRP C 3 320 ? 22.907  17.922  -3.280  1.00 27.32 ?  386  TRP A CA    1 
ATOM   2869 C  C     . TRP C 3 320 ? 23.411  16.526  -2.929  1.00 27.22 ?  386  TRP A C     1 
ATOM   2870 O  O     . TRP C 3 320 ? 24.011  16.314  -1.883  1.00 27.10 ?  386  TRP A O     1 
ATOM   2871 C  CB    . TRP C 3 320 ? 21.410  18.015  -2.995  1.00 27.42 ?  386  TRP A CB    1 
ATOM   2872 C  CG    . TRP C 3 320 ? 21.086  17.855  -1.545  1.00 27.80 ?  386  TRP A CG    1 
ATOM   2873 C  CD1   . TRP C 3 320 ? 21.396  18.722  -0.531  1.00 28.41 ?  386  TRP A CD1   1 
ATOM   2874 C  CD2   . TRP C 3 320 ? 20.398  16.755  -0.939  1.00 27.95 ?  386  TRP A CD2   1 
ATOM   2875 N  NE1   . TRP C 3 320 ? 20.937  18.223  0.673   1.00 28.63 ?  386  TRP A NE1   1 
ATOM   2876 C  CE2   . TRP C 3 320 ? 20.316  17.022  0.444   1.00 28.98 ?  386  TRP A CE2   1 
ATOM   2877 C  CE3   . TRP C 3 320 ? 19.840  15.574  -1.434  1.00 29.05 ?  386  TRP A CE3   1 
ATOM   2878 C  CZ2   . TRP C 3 320 ? 19.690  16.154  1.335   1.00 29.41 ?  386  TRP A CZ2   1 
ATOM   2879 C  CZ3   . TRP C 3 320 ? 19.231  14.708  -0.550  1.00 30.04 ?  386  TRP A CZ3   1 
ATOM   2880 C  CH2   . TRP C 3 320 ? 19.160  15.004  0.823   1.00 30.43 ?  386  TRP A CH2   1 
ATOM   2881 N  N     . ARG C 3 321 ? 23.161  15.566  -3.815  1.00 27.48 ?  387  ARG A N     1 
ATOM   2882 C  CA    . ARG C 3 321 ? 23.734  14.230  -3.656  1.00 27.88 ?  387  ARG A CA    1 
ATOM   2883 C  C     . ARG C 3 321 ? 25.261  14.264  -3.505  1.00 27.81 ?  387  ARG A C     1 
ATOM   2884 O  O     . ARG C 3 321 ? 25.828  13.583  -2.635  1.00 27.33 ?  387  ARG A O     1 
ATOM   2885 C  CB    . ARG C 3 321 ? 23.373  13.363  -4.854  1.00 28.21 ?  387  ARG A CB    1 
ATOM   2886 C  CG    . ARG C 3 321 ? 24.029  12.010  -4.807  1.00 29.45 ?  387  ARG A CG    1 
ATOM   2887 C  CD    . ARG C 3 321 ? 24.313  11.515  -6.206  1.00 31.76 ?  387  ARG A CD    1 
ATOM   2888 N  NE    . ARG C 3 321 ? 25.239  10.397  -6.201  1.00 35.68 ?  387  ARG A NE    1 
ATOM   2889 C  CZ    . ARG C 3 321 ? 25.950  10.029  -7.262  1.00 36.63 ?  387  ARG A CZ    1 
ATOM   2890 N  NH1   . ARG C 3 321 ? 26.771  8.989   -7.195  1.00 37.89 ?  387  ARG A NH1   1 
ATOM   2891 N  NH2   . ARG C 3 321 ? 25.837  10.711  -8.387  1.00 36.14 ?  387  ARG A NH2   1 
ATOM   2892 N  N     . ASN C 3 322 ? 25.920  15.052  -4.358  1.00 27.50 ?  388  ASN A N     1 
ATOM   2893 C  CA    . ASN C 3 322 ? 27.374  15.197  -4.328  1.00 27.70 ?  388  ASN A CA    1 
ATOM   2894 C  C     . ASN C 3 322 ? 27.838  15.820  -3.024  1.00 27.55 ?  388  ASN A C     1 
ATOM   2895 O  O     . ASN C 3 322 ? 28.858  15.413  -2.453  1.00 27.41 ?  388  ASN A O     1 
ATOM   2896 C  CB    . ASN C 3 322 ? 27.860  16.060  -5.509  1.00 28.58 ?  388  ASN A CB    1 
ATOM   2897 C  CG    . ASN C 3 322 ? 27.740  15.345  -6.846  1.00 30.44 ?  388  ASN A CG    1 
ATOM   2898 O  OD1   . ASN C 3 322 ? 27.635  15.984  -7.895  1.00 34.31 ?  388  ASN A OD1   1 
ATOM   2899 N  ND2   . ASN C 3 322 ? 27.762  14.015  -6.816  1.00 32.08 ?  388  ASN A ND2   1 
ATOM   2900 N  N     . PHE C 3 323 ? 27.071  16.803  -2.561  1.00 26.75 ?  389  PHE A N     1 
ATOM   2901 C  CA    . PHE C 3 323 ? 27.305  17.457  -1.277  1.00 26.72 ?  389  PHE A CA    1 
ATOM   2902 C  C     . PHE C 3 323 ? 27.305  16.453  -0.127  1.00 26.18 ?  389  PHE A C     1 
ATOM   2903 O  O     . PHE C 3 323 ? 28.216  16.450  0.700   1.00 26.52 ?  389  PHE A O     1 
ATOM   2904 C  CB    . PHE C 3 323 ? 26.242  18.543  -1.043  1.00 26.56 ?  389  PHE A CB    1 
ATOM   2905 C  CG    . PHE C 3 323 ? 26.214  19.093  0.368   1.00 27.47 ?  389  PHE A CG    1 
ATOM   2906 C  CD1   . PHE C 3 323 ? 27.134  20.048  0.775   1.00 27.11 ?  389  PHE A CD1   1 
ATOM   2907 C  CD2   . PHE C 3 323 ? 25.239  18.683  1.270   1.00 27.71 ?  389  PHE A CD2   1 
ATOM   2908 C  CE1   . PHE C 3 323 ? 27.094  20.577  2.067   1.00 28.68 ?  389  PHE A CE1   1 
ATOM   2909 C  CE2   . PHE C 3 323 ? 25.192  19.213  2.562   1.00 27.69 ?  389  PHE A CE2   1 
ATOM   2910 C  CZ    . PHE C 3 323 ? 26.123  20.149  2.957   1.00 28.15 ?  389  PHE A CZ    1 
ATOM   2911 N  N     . ILE C 3 324 ? 26.278  15.611  -0.066  1.00 25.53 ?  390  ILE A N     1 
ATOM   2912 C  CA    . ILE C 3 324 ? 26.228  14.579  0.958   1.00 25.14 ?  390  ILE A CA    1 
ATOM   2913 C  C     . ILE C 3 324 ? 27.471  13.700  0.890   1.00 24.95 ?  390  ILE A C     1 
ATOM   2914 O  O     . ILE C 3 324 ? 28.126  13.428  1.902   1.00 24.95 ?  390  ILE A O     1 
ATOM   2915 C  CB    . ILE C 3 324 ? 24.983  13.674  0.814   1.00 24.58 ?  390  ILE A CB    1 
ATOM   2916 C  CG1   . ILE C 3 324 ? 23.708  14.487  0.988   1.00 25.79 ?  390  ILE A CG1   1 
ATOM   2917 C  CG2   . ILE C 3 324 ? 25.027  12.520  1.846   1.00 24.27 ?  390  ILE A CG2   1 
ATOM   2918 C  CD1   . ILE C 3 324 ? 22.424  13.670  0.774   1.00 27.12 ?  390  ILE A CD1   1 
ATOM   2919 N  N     . ILE C 3 325 ? 27.809  13.253  -0.310  1.00 24.58 ?  391  ILE A N     1 
ATOM   2920 C  CA    . ILE C 3 325 ? 28.933  12.336  -0.427  1.00 24.79 ?  391  ILE A CA    1 
ATOM   2921 C  C     . ILE C 3 325 ? 30.218  12.979  0.067   1.00 24.68 ?  391  ILE A C     1 
ATOM   2922 O  O     . ILE C 3 325 ? 30.982  12.362  0.824   1.00 24.00 ?  391  ILE A O     1 
ATOM   2923 C  CB    . ILE C 3 325 ? 29.101  11.818  -1.859  1.00 24.68 ?  391  ILE A CB    1 
ATOM   2924 C  CG1   . ILE C 3 325 ? 27.902  10.932  -2.222  1.00 25.46 ?  391  ILE A CG1   1 
ATOM   2925 C  CG2   . ILE C 3 325 ? 30.447  11.085  -2.006  1.00 24.20 ?  391  ILE A CG2   1 
ATOM   2926 C  CD1   . ILE C 3 325 ? 27.692  10.775  -3.699  1.00 28.41 ?  391  ILE A CD1   1 
ATOM   2927 N  N     . LYS C 3 326 ? 30.459  14.218  -0.348  1.00 24.80 ?  392  LYS A N     1 
ATOM   2928 C  CA    . LYS C 3 326 ? 31.693  14.905  0.072   1.00 25.92 ?  392  LYS A CA    1 
ATOM   2929 C  C     . LYS C 3 326 ? 31.712  15.274  1.565   1.00 25.31 ?  392  LYS A C     1 
ATOM   2930 O  O     . LYS C 3 326 ? 32.729  15.132  2.227   1.00 24.43 ?  392  LYS A O     1 
ATOM   2931 C  CB    . LYS C 3 326 ? 31.972  16.137  -0.792  1.00 26.23 ?  392  LYS A CB    1 
ATOM   2932 C  CG    . LYS C 3 326 ? 32.480  15.786  -2.201  1.00 30.63 ?  392  LYS A CG    1 
ATOM   2933 C  CD    . LYS C 3 326 ? 33.459  16.847  -2.734  1.00 35.48 ?  392  LYS A CD    1 
ATOM   2934 C  CE    . LYS C 3 326 ? 34.256  16.307  -3.920  1.00 38.82 ?  392  LYS A CE    1 
ATOM   2935 N  NZ    . LYS C 3 326 ? 34.983  17.385  -4.665  1.00 41.82 ?  392  LYS A NZ    1 
ATOM   2936 N  N     . VAL C 3 327 ? 30.597  15.770  2.091   1.00 25.82 ?  393  VAL A N     1 
ATOM   2937 C  CA    . VAL C 3 327 ? 30.551  16.120  3.513   1.00 25.96 ?  393  VAL A CA    1 
ATOM   2938 C  C     . VAL C 3 327 ? 30.601  14.864  4.390   1.00 25.93 ?  393  VAL A C     1 
ATOM   2939 O  O     . VAL C 3 327 ? 31.138  14.897  5.500   1.00 25.46 ?  393  VAL A O     1 
ATOM   2940 C  CB    . VAL C 3 327 ? 29.297  16.916  3.865   1.00 26.61 ?  393  VAL A CB    1 
ATOM   2941 C  CG1   . VAL C 3 327 ? 29.136  16.983  5.380   1.00 27.80 ?  393  VAL A CG1   1 
ATOM   2942 C  CG2   . VAL C 3 327 ? 29.378  18.320  3.254   1.00 27.07 ?  393  VAL A CG2   1 
ATOM   2943 N  N     . ASP C 3 328 ? 30.063  13.759  3.868   1.00 25.40 ?  394  ASP A N     1 
ATOM   2944 C  CA    . ASP C 3 328 ? 30.126  12.467  4.543   1.00 26.19 ?  394  ASP A CA    1 
ATOM   2945 C  C     . ASP C 3 328 ? 29.526  12.479  5.954   1.00 25.85 ?  394  ASP A C     1 
ATOM   2946 O  O     . ASP C 3 328 ? 30.178  12.051  6.903   1.00 25.53 ?  394  ASP A O     1 
ATOM   2947 C  CB    . ASP C 3 328 ? 31.576  11.968  4.617   1.00 25.98 ?  394  ASP A CB    1 
ATOM   2948 C  CG    . ASP C 3 328 ? 31.667  10.503  5.022   1.00 26.63 ?  394  ASP A CG    1 
ATOM   2949 O  OD1   . ASP C 3 328 ? 30.791  9.726   4.604   1.00 27.98 ?  394  ASP A OD1   1 
ATOM   2950 O  OD2   . ASP C 3 328 ? 32.617  10.123  5.739   1.00 27.23 ?  394  ASP A OD2   1 
ATOM   2951 N  N     . PRO C 3 329 ? 28.268  12.942  6.092   1.00 26.35 ?  395  PRO A N     1 
ATOM   2952 C  CA    . PRO C 3 329 ? 27.634  12.944  7.410   1.00 26.01 ?  395  PRO A CA    1 
ATOM   2953 C  C     . PRO C 3 329 ? 27.432  11.543  7.991   1.00 26.59 ?  395  PRO A C     1 
ATOM   2954 O  O     . PRO C 3 329 ? 27.115  10.584  7.260   1.00 26.33 ?  395  PRO A O     1 
ATOM   2955 C  CB    . PRO C 3 329 ? 26.260  13.582  7.157   1.00 26.50 ?  395  PRO A CB    1 
ATOM   2956 C  CG    . PRO C 3 329 ? 25.988  13.365  5.680   1.00 26.62 ?  395  PRO A CG    1 
ATOM   2957 C  CD    . PRO C 3 329 ? 27.366  13.426  5.028   1.00 26.21 ?  395  PRO A CD    1 
ATOM   2958 N  N     . ASP C 3 330 ? 27.582  11.452  9.306   1.00 26.36 ?  396  ASP A N     1 
ATOM   2959 C  CA    . ASP C 3 330 ? 27.333  10.225  10.048  1.00 27.09 ?  396  ASP A CA    1 
ATOM   2960 C  C     . ASP C 3 330 ? 25.863  10.048  10.389  1.00 27.10 ?  396  ASP A C     1 
ATOM   2961 O  O     . ASP C 3 330 ? 25.370  8.922   10.517  1.00 27.35 ?  396  ASP A O     1 
ATOM   2962 C  CB    . ASP C 3 330 ? 28.147  10.252  11.337  1.00 26.78 ?  396  ASP A CB    1 
ATOM   2963 C  CG    . ASP C 3 330 ? 29.622  10.137  11.067  1.00 28.86 ?  396  ASP A CG    1 
ATOM   2964 O  OD1   . ASP C 3 330 ? 30.028  9.071   10.564  1.00 29.46 ?  396  ASP A OD1   1 
ATOM   2965 O  OD2   . ASP C 3 330 ? 30.371  11.106  11.339  1.00 28.09 ?  396  ASP A OD2   1 
ATOM   2966 N  N     . VAL C 3 331 ? 25.174  11.172  10.566  1.00 26.70 ?  397  VAL A N     1 
ATOM   2967 C  CA    . VAL C 3 331 ? 23.776  11.158  10.943  1.00 26.06 ?  397  VAL A CA    1 
ATOM   2968 C  C     . VAL C 3 331 ? 23.016  12.206  10.121  1.00 25.53 ?  397  VAL A C     1 
ATOM   2969 O  O     . VAL C 3 331 ? 23.407  13.369  10.062  1.00 25.60 ?  397  VAL A O     1 
ATOM   2970 C  CB    . VAL C 3 331 ? 23.579  11.426  12.454  1.00 26.18 ?  397  VAL A CB    1 
ATOM   2971 C  CG1   . VAL C 3 331 ? 22.126  11.124  12.868  1.00 26.18 ?  397  VAL A CG1   1 
ATOM   2972 C  CG2   . VAL C 3 331 ? 24.567  10.602  13.294  1.00 26.11 ?  397  VAL A CG2   1 
ATOM   2973 N  N     . ILE C 3 332 ? 21.935  11.771  9.493   1.00 24.81 ?  398  ILE A N     1 
ATOM   2974 C  CA    . ILE C 3 332 ? 21.049  12.667  8.763   1.00 24.75 ?  398  ILE A CA    1 
ATOM   2975 C  C     . ILE C 3 332 ? 19.758  12.865  9.563   1.00 24.54 ?  398  ILE A C     1 
ATOM   2976 O  O     . ILE C 3 332 ? 19.059  11.901  9.932   1.00 24.29 ?  398  ILE A O     1 
ATOM   2977 C  CB    . ILE C 3 332 ? 20.759  12.144  7.354   1.00 24.75 ?  398  ILE A CB    1 
ATOM   2978 C  CG1   . ILE C 3 332 ? 22.078  12.078  6.558   1.00 25.61 ?  398  ILE A CG1   1 
ATOM   2979 C  CG2   . ILE C 3 332 ? 19.737  13.071  6.642   1.00 25.68 ?  398  ILE A CG2   1 
ATOM   2980 C  CD1   . ILE C 3 332 ? 21.961  11.512  5.129   1.00 31.08 ?  398  ILE A CD1   1 
ATOM   2981 N  N     . ILE C 3 333 ? 19.479  14.122  9.876   1.00 24.13 ?  399  ILE A N     1 
ATOM   2982 C  CA    . ILE C 3 333 ? 18.345  14.450  10.718  1.00 23.62 ?  399  ILE A CA    1 
ATOM   2983 C  C     . ILE C 3 333 ? 17.496  15.488  10.027  1.00 24.26 ?  399  ILE A C     1 
ATOM   2984 O  O     . ILE C 3 333 ? 17.848  15.979  8.946   1.00 23.73 ?  399  ILE A O     1 
ATOM   2985 C  CB    . ILE C 3 333 ? 18.782  15.000  12.098  1.00 23.80 ?  399  ILE A CB    1 
ATOM   2986 C  CG1   . ILE C 3 333 ? 19.294  16.435  11.978  1.00 22.47 ?  399  ILE A CG1   1 
ATOM   2987 C  CG2   . ILE C 3 333 ? 19.814  14.077  12.756  1.00 21.92 ?  399  ILE A CG2   1 
ATOM   2988 C  CD1   . ILE C 3 333 ? 19.569  17.143  13.358  1.00 24.70 ?  399  ILE A CD1   1 
ATOM   2989 N  N     . GLY C 3 334 ? 16.386  15.823  10.677  1.00 24.45 ?  400  GLY A N     1 
ATOM   2990 C  CA    . GLY C 3 334 ? 15.464  16.861  10.229  1.00 24.59 ?  400  GLY A CA    1 
ATOM   2991 C  C     . GLY C 3 334 ? 14.160  16.648  11.001  1.00 25.39 ?  400  GLY A C     1 
ATOM   2992 O  O     . GLY C 3 334 ? 14.151  16.058  12.092  1.00 24.74 ?  400  GLY A O     1 
ATOM   2993 N  N     . TYR C 3 335 ? 13.058  17.113  10.433  1.00 25.54 ?  401  TYR A N     1 
ATOM   2994 C  CA    . TYR C 3 335 ? 11.774  17.008  11.105  1.00 26.30 ?  401  TYR A CA    1 
ATOM   2995 C  C     . TYR C 3 335 ? 10.740  16.549  10.083  1.00 25.96 ?  401  TYR A C     1 
ATOM   2996 O  O     . TYR C 3 335 ? 10.339  17.305  9.209   1.00 25.72 ?  401  TYR A O     1 
ATOM   2997 C  CB    . TYR C 3 335 ? 11.380  18.349  11.756  1.00 25.91 ?  401  TYR A CB    1 
ATOM   2998 C  CG    . TYR C 3 335 ? 10.425  18.170  12.914  1.00 26.93 ?  401  TYR A CG    1 
ATOM   2999 C  CD1   . TYR C 3 335 ? 10.904  17.875  14.195  1.00 27.71 ?  401  TYR A CD1   1 
ATOM   3000 C  CD2   . TYR C 3 335 ? 9.048   18.250  12.730  1.00 26.91 ?  401  TYR A CD2   1 
ATOM   3001 C  CE1   . TYR C 3 335 ? 10.043  17.675  15.255  1.00 28.07 ?  401  TYR A CE1   1 
ATOM   3002 C  CE2   . TYR C 3 335 ? 8.171   18.054  13.801  1.00 27.62 ?  401  TYR A CE2   1 
ATOM   3003 C  CZ    . TYR C 3 335 ? 8.680   17.764  15.057  1.00 28.00 ?  401  TYR A CZ    1 
ATOM   3004 O  OH    . TYR C 3 335 ? 7.833   17.569  16.130  1.00 28.15 ?  401  TYR A OH    1 
ATOM   3005 N  N     . ASN C 3 336 ? 10.330  15.292  10.206  1.00 26.06 ?  402  ASN A N     1 
ATOM   3006 C  CA    . ASN C 3 336 ? 9.484   14.630  9.215   1.00 25.64 ?  402  ASN A CA    1 
ATOM   3007 C  C     . ASN C 3 336 ? 10.241  14.230  7.948   1.00 25.87 ?  402  ASN A C     1 
ATOM   3008 O  O     . ASN C 3 336 ? 9.640   14.009  6.891   1.00 25.62 ?  402  ASN A O     1 
ATOM   3009 C  CB    . ASN C 3 336 ? 8.257   15.461  8.849   1.00 25.83 ?  402  ASN A CB    1 
ATOM   3010 C  CG    . ASN C 3 336 ? 7.107   14.588  8.354   1.00 26.00 ?  402  ASN A CG    1 
ATOM   3011 O  OD1   . ASN C 3 336 ? 7.076   13.386  8.621   1.00 27.39 ?  402  ASN A OD1   1 
ATOM   3012 N  ND2   . ASN C 3 336 ? 6.171   15.179  7.653   1.00 23.50 ?  402  ASN A ND2   1 
ATOM   3013 N  N     . THR C 3 337 ? 11.559  14.120  8.069   1.00 25.68 ?  403  THR A N     1 
ATOM   3014 C  CA    . THR C 3 337 ? 12.400  13.720  6.953   1.00 25.82 ?  403  THR A CA    1 
ATOM   3015 C  C     . THR C 3 337 ? 12.066  12.295  6.527   1.00 26.60 ?  403  THR A C     1 
ATOM   3016 O  O     . THR C 3 337 ? 12.117  11.973  5.339   1.00 25.35 ?  403  THR A O     1 
ATOM   3017 C  CB    . THR C 3 337 ? 13.884  13.792  7.344   1.00 25.85 ?  403  THR A CB    1 
ATOM   3018 O  OG1   . THR C 3 337 ? 14.007  13.469  8.731   1.00 25.49 ?  403  THR A OG1   1 
ATOM   3019 C  CG2   . THR C 3 337 ? 14.412  15.219  7.132   1.00 25.55 ?  403  THR A CG2   1 
ATOM   3020 N  N     . THR C 3 338 ? 11.715  11.443  7.502   1.00 26.80 ?  404  THR A N     1 
ATOM   3021 C  CA    . THR C 3 338 ? 11.427  10.045  7.189   1.00 27.41 ?  404  THR A CA    1 
ATOM   3022 C  C     . THR C 3 338 ? 10.214  9.886   6.263   1.00 27.46 ?  404  THR A C     1 
ATOM   3023 O  O     . THR C 3 338 ? 10.274  9.208   5.245   1.00 27.76 ?  404  THR A O     1 
ATOM   3024 C  CB    . THR C 3 338 ? 11.207  9.189   8.471   1.00 27.27 ?  404  THR A CB    1 
ATOM   3025 O  OG1   . THR C 3 338 ? 12.398  9.204   9.266   1.00 26.37 ?  404  THR A OG1   1 
ATOM   3026 C  CG2   . THR C 3 338 ? 10.891  7.755   8.089   1.00 27.42 ?  404  THR A CG2   1 
ATOM   3027 N  N     . ASN C 3 339 ? 9.109   10.521  6.611   1.00 28.30 ?  405  ASN A N     1 
ATOM   3028 C  CA    . ASN C 3 339 ? 7.889   10.349  5.834   1.00 28.77 ?  405  ASN A CA    1 
ATOM   3029 C  C     . ASN C 3 339 ? 7.686   11.374  4.751   1.00 28.98 ?  405  ASN A C     1 
ATOM   3030 O  O     . ASN C 3 339 ? 6.849   11.182  3.872   1.00 29.43 ?  405  ASN A O     1 
ATOM   3031 C  CB    . ASN C 3 339 ? 6.668   10.293  6.754   1.00 29.05 ?  405  ASN A CB    1 
ATOM   3032 C  CG    . ASN C 3 339 ? 6.617   9.018   7.536   1.00 30.55 ?  405  ASN A CG    1 
ATOM   3033 O  OD1   . ASN C 3 339 ? 7.229   8.021   7.142   1.00 33.12 ?  405  ASN A OD1   1 
ATOM   3034 N  ND2   . ASN C 3 339 ? 5.902   9.030   8.660   1.00 32.45 ?  405  ASN A ND2   1 
ATOM   3035 N  N     . PHE C 3 340 ? 8.428   12.477  4.803   1.00 28.69 ?  406  PHE A N     1 
ATOM   3036 C  CA    . PHE C 3 340 ? 8.283   13.464  3.740   1.00 28.55 ?  406  PHE A CA    1 
ATOM   3037 C  C     . PHE C 3 340 ? 9.544   13.738  2.913   1.00 28.32 ?  406  PHE A C     1 
ATOM   3038 O  O     . PHE C 3 340 ? 9.654   13.283  1.768   1.00 28.54 ?  406  PHE A O     1 
ATOM   3039 C  CB    . PHE C 3 340 ? 7.711   14.781  4.261   1.00 28.81 ?  406  PHE A CB    1 
ATOM   3040 C  CG    . PHE C 3 340 ? 7.562   15.812  3.186   1.00 28.67 ?  406  PHE A CG    1 
ATOM   3041 C  CD1   . PHE C 3 340 ? 6.568   15.676  2.224   1.00 29.41 ?  406  PHE A CD1   1 
ATOM   3042 C  CD2   . PHE C 3 340 ? 8.432   16.883  3.107   1.00 28.56 ?  406  PHE A CD2   1 
ATOM   3043 C  CE1   . PHE C 3 340 ? 6.433   16.593  1.211   1.00 29.73 ?  406  PHE A CE1   1 
ATOM   3044 C  CE2   . PHE C 3 340 ? 8.299   17.831  2.090   1.00 28.41 ?  406  PHE A CE2   1 
ATOM   3045 C  CZ    . PHE C 3 340 ? 7.303   17.682  1.144   1.00 29.70 ?  406  PHE A CZ    1 
ATOM   3046 N  N     . ASP C 3 341 ? 10.477  14.504  3.483   1.00 28.15 ?  407  ASP A N     1 
ATOM   3047 C  CA    . ASP C 3 341 ? 11.624  15.025  2.720   1.00 28.15 ?  407  ASP A CA    1 
ATOM   3048 C  C     . ASP C 3 341 ? 12.373  13.933  1.957   1.00 28.05 ?  407  ASP A C     1 
ATOM   3049 O  O     . ASP C 3 341 ? 12.657  14.074  0.767   1.00 27.86 ?  407  ASP A O     1 
ATOM   3050 C  CB    . ASP C 3 341 ? 12.611  15.762  3.636   1.00 28.38 ?  407  ASP A CB    1 
ATOM   3051 C  CG    . ASP C 3 341 ? 11.958  16.903  4.417   1.00 28.53 ?  407  ASP A CG    1 
ATOM   3052 O  OD1   . ASP C 3 341 ? 12.267  18.081  4.111   1.00 29.17 ?  407  ASP A OD1   1 
ATOM   3053 O  OD2   . ASP C 3 341 ? 11.143  16.624  5.333   1.00 26.25 ?  407  ASP A OD2   1 
ATOM   3054 N  N     . ILE C 3 342 ? 12.706  12.839  2.633   1.00 28.14 ?  408  ILE A N     1 
ATOM   3055 C  CA    . ILE C 3 342 ? 13.521  11.819  1.966   1.00 27.57 ?  408  ILE A CA    1 
ATOM   3056 C  C     . ILE C 3 342 ? 12.762  11.133  0.821   1.00 28.31 ?  408  ILE A C     1 
ATOM   3057 O  O     . ILE C 3 342 ? 13.235  11.133  -0.324  1.00 28.10 ?  408  ILE A O     1 
ATOM   3058 C  CB    . ILE C 3 342 ? 14.150  10.811  2.966   1.00 27.73 ?  408  ILE A CB    1 
ATOM   3059 C  CG1   . ILE C 3 342 ? 15.150  11.537  3.861   1.00 27.22 ?  408  ILE A CG1   1 
ATOM   3060 C  CG2   . ILE C 3 342 ? 14.874  9.667   2.221   1.00 26.43 ?  408  ILE A CG2   1 
ATOM   3061 C  CD1   . ILE C 3 342 ? 15.451  10.820  5.161   1.00 29.28 ?  408  ILE A CD1   1 
ATOM   3062 N  N     . PRO C 3 343 ? 11.585  10.552  1.114   1.00 28.11 ?  409  PRO A N     1 
ATOM   3063 C  CA    . PRO C 3 343 ? 10.805  9.892   0.054   1.00 28.28 ?  409  PRO A CA    1 
ATOM   3064 C  C     . PRO C 3 343 ? 10.449  10.860  -1.072  1.00 28.20 ?  409  PRO A C     1 
ATOM   3065 O  O     . PRO C 3 343 ? 10.511  10.495  -2.246  1.00 28.17 ?  409  PRO A O     1 
ATOM   3066 C  CB    . PRO C 3 343 ? 9.517   9.436   0.763   1.00 28.20 ?  409  PRO A CB    1 
ATOM   3067 C  CG    . PRO C 3 343 ? 9.829   9.436   2.217   1.00 28.24 ?  409  PRO A CG    1 
ATOM   3068 C  CD    . PRO C 3 343 ? 11.000  10.369  2.454   1.00 28.91 ?  409  PRO A CD    1 
ATOM   3069 N  N     . TYR C 3 344 ? 10.096  12.091  -0.720  1.00 27.98 ?  410  TYR A N     1 
ATOM   3070 C  CA    . TYR C 3 344 ? 9.809   13.093  -1.741  1.00 28.44 ?  410  TYR A CA    1 
ATOM   3071 C  C     . TYR C 3 344 ? 10.965  13.307  -2.720  1.00 28.51 ?  410  TYR A C     1 
ATOM   3072 O  O     . TYR C 3 344 ? 10.754  13.316  -3.930  1.00 28.59 ?  410  TYR A O     1 
ATOM   3073 C  CB    . TYR C 3 344 ? 9.414   14.432  -1.127  1.00 28.44 ?  410  TYR A CB    1 
ATOM   3074 C  CG    . TYR C 3 344 ? 8.679   15.282  -2.117  1.00 28.09 ?  410  TYR A CG    1 
ATOM   3075 C  CD1   . TYR C 3 344 ? 7.291   15.315  -2.124  1.00 29.57 ?  410  TYR A CD1   1 
ATOM   3076 C  CD2   . TYR C 3 344 ? 9.363   16.014  -3.084  1.00 28.01 ?  410  TYR A CD2   1 
ATOM   3077 C  CE1   . TYR C 3 344 ? 6.590   16.089  -3.044  1.00 29.16 ?  410  TYR A CE1   1 
ATOM   3078 C  CE2   . TYR C 3 344 ? 8.668   16.790  -4.014  1.00 29.10 ?  410  TYR A CE2   1 
ATOM   3079 C  CZ    . TYR C 3 344 ? 7.275   16.818  -3.983  1.00 28.97 ?  410  TYR A CZ    1 
ATOM   3080 O  OH    . TYR C 3 344 ? 6.557   17.575  -4.892  1.00 29.59 ?  410  TYR A OH    1 
ATOM   3081 N  N     . LEU C 3 345 ? 12.175  13.498  -2.197  1.00 28.56 ?  411  LEU A N     1 
ATOM   3082 C  CA    . LEU C 3 345 ? 13.360  13.688  -3.040  1.00 29.01 ?  411  LEU A CA    1 
ATOM   3083 C  C     . LEU C 3 345 ? 13.640  12.476  -3.919  1.00 28.72 ?  411  LEU A C     1 
ATOM   3084 O  O     . LEU C 3 345 ? 13.953  12.616  -5.107  1.00 27.98 ?  411  LEU A O     1 
ATOM   3085 C  CB    . LEU C 3 345 ? 14.603  13.968  -2.191  1.00 28.85 ?  411  LEU A CB    1 
ATOM   3086 C  CG    . LEU C 3 345 ? 14.572  15.318  -1.477  1.00 30.07 ?  411  LEU A CG    1 
ATOM   3087 C  CD1   . LEU C 3 345 ? 15.632  15.341  -0.378  1.00 30.00 ?  411  LEU A CD1   1 
ATOM   3088 C  CD2   . LEU C 3 345 ? 14.773  16.463  -2.479  1.00 29.67 ?  411  LEU A CD2   1 
ATOM   3089 N  N     . LEU C 3 346 ? 13.575  11.290  -3.319  1.00 28.70 ?  412  LEU A N     1 
ATOM   3090 C  CA    . LEU C 3 346 ? 13.743  10.053  -4.085  1.00 29.08 ?  412  LEU A CA    1 
ATOM   3091 C  C     . LEU C 3 346 ? 12.718  9.970   -5.214  1.00 29.25 ?  412  LEU A C     1 
ATOM   3092 O  O     . LEU C 3 346 ? 13.065  9.738   -6.379  1.00 29.33 ?  412  LEU A O     1 
ATOM   3093 C  CB    . LEU C 3 346 ? 13.602  8.841   -3.175  1.00 29.02 ?  412  LEU A CB    1 
ATOM   3094 C  CG    . LEU C 3 346 ? 14.767  8.704   -2.192  1.00 29.23 ?  412  LEU A CG    1 
ATOM   3095 C  CD1   . LEU C 3 346 ? 14.549  7.505   -1.279  1.00 29.06 ?  412  LEU A CD1   1 
ATOM   3096 C  CD2   . LEU C 3 346 ? 16.067  8.577   -2.968  1.00 29.15 ?  412  LEU A CD2   1 
ATOM   3097 N  N     . ASN C 3 347 ? 11.452  10.171  -4.867  1.00 29.17 ?  413  ASN A N     1 
ATOM   3098 C  CA    . ASN C 3 347 ? 10.382  10.068  -5.846  1.00 29.32 ?  413  ASN A CA    1 
ATOM   3099 C  C     . ASN C 3 347 ? 10.429  11.194  -6.871  1.00 28.94 ?  413  ASN A C     1 
ATOM   3100 O  O     . ASN C 3 347 ? 10.085  10.995  -8.032  1.00 28.21 ?  413  ASN A O     1 
ATOM   3101 C  CB    . ASN C 3 347 ? 9.023   10.025  -5.158  1.00 29.42 ?  413  ASN A CB    1 
ATOM   3102 C  CG    . ASN C 3 347 ? 8.711   8.656   -4.591  1.00 31.12 ?  413  ASN A CG    1 
ATOM   3103 O  OD1   . ASN C 3 347 ? 9.105   7.638   -5.156  1.00 33.66 ?  413  ASN A OD1   1 
ATOM   3104 N  ND2   . ASN C 3 347 ? 8.001   8.622   -3.481  1.00 29.70 ?  413  ASN A ND2   1 
ATOM   3105 N  N     . ARG C 3 348 ? 10.864  12.374  -6.442  1.00 28.96 ?  414  ARG A N     1 
ATOM   3106 C  CA    . ARG C 3 348 ? 10.969  13.511  -7.367  1.00 29.20 ?  414  ARG A CA    1 
ATOM   3107 C  C     . ARG C 3 348 ? 12.077  13.287  -8.403  1.00 29.53 ?  414  ARG A C     1 
ATOM   3108 O  O     . ARG C 3 348 ? 11.890  13.531  -9.598  1.00 28.57 ?  414  ARG A O     1 
ATOM   3109 C  CB    . ARG C 3 348 ? 11.214  14.821  -6.604  1.00 29.44 ?  414  ARG A CB    1 
ATOM   3110 C  CG    . ARG C 3 348 ? 11.379  16.056  -7.514  1.00 28.60 ?  414  ARG A CG    1 
ATOM   3111 C  CD    . ARG C 3 348 ? 10.194  16.201  -8.461  1.00 27.40 ?  414  ARG A CD    1 
ATOM   3112 N  NE    . ARG C 3 348 ? 10.244  17.437  -9.231  1.00 26.35 ?  414  ARG A NE    1 
ATOM   3113 C  CZ    . ARG C 3 348 ? 9.326   17.800  -10.123 1.00 27.13 ?  414  ARG A CZ    1 
ATOM   3114 N  NH1   . ARG C 3 348 ? 8.263   17.030  -10.332 1.00 26.61 ?  414  ARG A NH1   1 
ATOM   3115 N  NH2   . ARG C 3 348 ? 9.462   18.943  -10.791 1.00 24.85 ?  414  ARG A NH2   1 
ATOM   3116 N  N     . ALA C 3 349 ? 13.240  12.838  -7.933  1.00 30.12 ?  415  ALA A N     1 
ATOM   3117 C  CA    . ALA C 3 349 ? 14.372  12.582  -8.823  1.00 30.74 ?  415  ALA A CA    1 
ATOM   3118 C  C     . ALA C 3 349 ? 14.009  11.498  -9.834  1.00 31.47 ?  415  ALA A C     1 
ATOM   3119 O  O     . ALA C 3 349 ? 14.424  11.553  -10.990 1.00 31.33 ?  415  ALA A O     1 
ATOM   3120 C  CB    . ALA C 3 349 ? 15.604  12.167  -8.017  1.00 30.93 ?  415  ALA A CB    1 
ATOM   3121 N  N     . LYS C 3 350 ? 13.223  10.520  -9.392  1.00 32.37 ?  416  LYS A N     1 
ATOM   3122 C  CA    . LYS C 3 350 ? 12.796  9.433   -10.258 1.00 33.50 ?  416  LYS A CA    1 
ATOM   3123 C  C     . LYS C 3 350 ? 11.863  9.953   -11.342 1.00 33.75 ?  416  LYS A C     1 
ATOM   3124 O  O     . LYS C 3 350 ? 11.985  9.585   -12.513 1.00 34.27 ?  416  LYS A O     1 
ATOM   3125 C  CB    . LYS C 3 350 ? 12.083  8.342   -9.461  1.00 33.74 ?  416  LYS A CB    1 
ATOM   3126 C  CG    . LYS C 3 350 ? 11.347  7.364   -10.371 1.00 35.97 ?  416  LYS A CG    1 
ATOM   3127 C  CD    . LYS C 3 350 ? 10.744  6.218   -9.596  1.00 39.16 ?  416  LYS A CD    1 
ATOM   3128 C  CE    . LYS C 3 350 ? 10.405  5.073   -10.531 1.00 41.83 ?  416  LYS A CE    1 
ATOM   3129 N  NZ    . LYS C 3 350 ? 10.532  3.766   -9.824  1.00 45.38 ?  416  LYS A NZ    1 
ATOM   3130 N  N     . ALA C 3 351 ? 10.940  10.825  -10.946 1.00 33.81 ?  417  ALA A N     1 
ATOM   3131 C  CA    . ALA C 3 351 ? 10.023  11.459  -11.895 1.00 33.44 ?  417  ALA A CA    1 
ATOM   3132 C  C     . ALA C 3 351 ? 10.773  12.323  -12.899 1.00 33.39 ?  417  ALA A C     1 
ATOM   3133 O  O     . ALA C 3 351 ? 10.369  12.437  -14.055 1.00 33.73 ?  417  ALA A O     1 
ATOM   3134 C  CB    . ALA C 3 351 ? 8.988   12.290  -11.159 1.00 33.44 ?  417  ALA A CB    1 
ATOM   3135 N  N     . LEU C 3 352 ? 11.866  12.939  -12.460 1.00 32.78 ?  418  LEU A N     1 
ATOM   3136 C  CA    . LEU C 3 352 ? 12.653  13.794  -13.347 1.00 32.20 ?  418  LEU A CA    1 
ATOM   3137 C  C     . LEU C 3 352 ? 13.717  13.008  -14.103 1.00 31.71 ?  418  LEU A C     1 
ATOM   3138 O  O     . LEU C 3 352 ? 14.477  13.581  -14.867 1.00 32.01 ?  418  LEU A O     1 
ATOM   3139 C  CB    . LEU C 3 352 ? 13.322  14.926  -12.560 1.00 32.14 ?  418  LEU A CB    1 
ATOM   3140 C  CG    . LEU C 3 352 ? 12.389  16.008  -12.015 1.00 32.74 ?  418  LEU A CG    1 
ATOM   3141 C  CD1   . LEU C 3 352 ? 13.173  17.028  -11.206 1.00 33.64 ?  418  LEU A CD1   1 
ATOM   3142 C  CD2   . LEU C 3 352 ? 11.622  16.684  -13.148 1.00 31.12 ?  418  LEU A CD2   1 
ATOM   3143 N  N     . LYS C 3 353 ? 13.778  11.703  -13.870 1.00 31.24 ?  419  LYS A N     1 
ATOM   3144 C  CA    . LYS C 3 353 ? 14.781  10.847  -14.507 1.00 31.19 ?  419  LYS A CA    1 
ATOM   3145 C  C     . LYS C 3 353 ? 16.217  11.283  -14.193 1.00 30.65 ?  419  LYS A C     1 
ATOM   3146 O  O     . LYS C 3 353 ? 17.127  11.097  -14.998 1.00 29.83 ?  419  LYS A O     1 
ATOM   3147 C  CB    . LYS C 3 353 ? 14.550  10.765  -16.022 1.00 31.19 ?  419  LYS A CB    1 
ATOM   3148 C  CG    . LYS C 3 353 ? 13.174  10.233  -16.394 1.00 32.12 ?  419  LYS A CG    1 
ATOM   3149 C  CD    . LYS C 3 353 ? 12.950  10.248  -17.892 1.00 34.23 ?  419  LYS A CD    1 
ATOM   3150 C  CE    . LYS C 3 353 ? 11.502  9.945   -18.228 1.00 36.46 ?  419  LYS A CE    1 
ATOM   3151 N  NZ    . LYS C 3 353 ? 11.009  8.732   -17.508 1.00 38.53 ?  419  LYS A NZ    1 
ATOM   3152 N  N     . VAL C 3 354 ? 16.412  11.872  -13.016 1.00 30.42 ?  420  VAL A N     1 
ATOM   3153 C  CA    . VAL C 3 354 ? 17.758  12.102  -12.517 1.00 30.22 ?  420  VAL A CA    1 
ATOM   3154 C  C     . VAL C 3 354 ? 18.176  10.777  -11.909 1.00 30.26 ?  420  VAL A C     1 
ATOM   3155 O  O     . VAL C 3 354 ? 18.098  10.578  -10.695 1.00 29.97 ?  420  VAL A O     1 
ATOM   3156 C  CB    . VAL C 3 354 ? 17.815  13.217  -11.456 1.00 30.38 ?  420  VAL A CB    1 
ATOM   3157 C  CG1   . VAL C 3 354 ? 19.274  13.455  -11.038 1.00 29.44 ?  420  VAL A CG1   1 
ATOM   3158 C  CG2   . VAL C 3 354 ? 17.193  14.515  -12.011 1.00 30.79 ?  420  VAL A CG2   1 
ATOM   3159 N  N     . ASN C 3 355 ? 18.599  9.861   -12.772 1.00 29.96 ?  421  ASN A N     1 
ATOM   3160 C  CA    . ASN C 3 355 ? 18.698  8.457   -12.400 1.00 29.87 ?  421  ASN A CA    1 
ATOM   3161 C  C     . ASN C 3 355 ? 19.938  8.052   -11.606 1.00 28.93 ?  421  ASN A C     1 
ATOM   3162 O  O     . ASN C 3 355 ? 19.990  6.963   -11.042 1.00 29.40 ?  421  ASN A O     1 
ATOM   3163 C  CB    . ASN C 3 355 ? 18.473  7.573   -13.635 1.00 30.46 ?  421  ASN A CB    1 
ATOM   3164 C  CG    . ASN C 3 355 ? 17.016  7.573   -14.081 1.00 32.12 ?  421  ASN A CG    1 
ATOM   3165 O  OD1   . ASN C 3 355 ? 16.128  7.956   -13.316 1.00 33.94 ?  421  ASN A OD1   1 
ATOM   3166 N  ND2   . ASN C 3 355 ? 16.761  7.138   -15.309 1.00 32.49 ?  421  ASN A ND2   1 
ATOM   3167 N  N     . ASP C 3 356 ? 20.929  8.924   -11.534 1.00 27.92 ?  422  ASP A N     1 
ATOM   3168 C  CA    . ASP C 3 356 ? 22.020  8.693   -10.595 1.00 27.43 ?  422  ASP A CA    1 
ATOM   3169 C  C     . ASP C 3 356 ? 21.815  9.424   -9.256  1.00 27.05 ?  422  ASP A C     1 
ATOM   3170 O  O     . ASP C 3 356 ? 22.716  9.444   -8.408  1.00 27.11 ?  422  ASP A O     1 
ATOM   3171 C  CB    . ASP C 3 356 ? 23.370  9.055   -11.219 1.00 27.66 ?  422  ASP A CB    1 
ATOM   3172 C  CG    . ASP C 3 356 ? 23.493  10.529  -11.520 1.00 28.06 ?  422  ASP A CG    1 
ATOM   3173 O  OD1   . ASP C 3 356 ? 22.457  11.225  -11.604 1.00 29.04 ?  422  ASP A OD1   1 
ATOM   3174 O  OD2   . ASP C 3 356 ? 24.636  10.994  -11.651 1.00 29.77 ?  422  ASP A OD2   1 
ATOM   3175 N  N     . PHE C 3 357 ? 20.631  10.000  -9.038  1.00 26.20 ?  423  PHE A N     1 
ATOM   3176 C  CA    . PHE C 3 357 ? 20.401  10.737  -7.775  1.00 26.12 ?  423  PHE A CA    1 
ATOM   3177 C  C     . PHE C 3 357 ? 20.477  9.850   -6.525  1.00 25.86 ?  423  PHE A C     1 
ATOM   3178 O  O     . PHE C 3 357 ? 21.114  10.211  -5.539  1.00 26.17 ?  423  PHE A O     1 
ATOM   3179 C  CB    . PHE C 3 357 ? 19.058  11.482  -7.771  1.00 26.03 ?  423  PHE A CB    1 
ATOM   3180 C  CG    . PHE C 3 357 ? 18.752  12.142  -6.460  1.00 24.46 ?  423  PHE A CG    1 
ATOM   3181 C  CD1   . PHE C 3 357 ? 19.439  13.275  -6.068  1.00 26.32 ?  423  PHE A CD1   1 
ATOM   3182 C  CD2   . PHE C 3 357 ? 17.810  11.604  -5.602  1.00 26.19 ?  423  PHE A CD2   1 
ATOM   3183 C  CE1   . PHE C 3 357 ? 19.193  13.876  -4.832  1.00 25.47 ?  423  PHE A CE1   1 
ATOM   3184 C  CE2   . PHE C 3 357 ? 17.537  12.207  -4.367  1.00 27.01 ?  423  PHE A CE2   1 
ATOM   3185 C  CZ    . PHE C 3 357 ? 18.234  13.344  -3.986  1.00 24.33 ?  423  PHE A CZ    1 
ATOM   3186 N  N     . PRO C 3 358 ? 19.809  8.688   -6.553  1.00 25.86 ?  424  PRO A N     1 
ATOM   3187 C  CA    . PRO C 3 358 ? 19.634  7.934   -5.296  1.00 26.00 ?  424  PRO A CA    1 
ATOM   3188 C  C     . PRO C 3 358 ? 20.846  7.074   -4.908  1.00 25.79 ?  424  PRO A C     1 
ATOM   3189 O  O     . PRO C 3 358 ? 20.718  5.878   -4.658  1.00 25.98 ?  424  PRO A O     1 
ATOM   3190 C  CB    . PRO C 3 358 ? 18.397  7.069   -5.577  1.00 25.87 ?  424  PRO A CB    1 
ATOM   3191 C  CG    . PRO C 3 358 ? 18.430  6.847   -7.067  1.00 25.75 ?  424  PRO A CG    1 
ATOM   3192 C  CD    . PRO C 3 358 ? 19.172  8.025   -7.701  1.00 25.42 ?  424  PRO A CD    1 
ATOM   3193 N  N     . TYR C 3 359 ? 22.000  7.715   -4.817  1.00 25.66 ?  425  TYR A N     1 
ATOM   3194 C  CA    . TYR C 3 359 ? 23.248  7.061   -4.444  1.00 25.81 ?  425  TYR A CA    1 
ATOM   3195 C  C     . TYR C 3 359 ? 24.019  8.015   -3.534  1.00 26.07 ?  425  TYR A C     1 
ATOM   3196 O  O     . TYR C 3 359 ? 25.058  8.558   -3.911  1.00 26.61 ?  425  TYR A O     1 
ATOM   3197 C  CB    . TYR C 3 359 ? 24.063  6.722   -5.700  1.00 26.18 ?  425  TYR A CB    1 
ATOM   3198 C  CG    . TYR C 3 359 ? 23.392  5.686   -6.582  1.00 25.39 ?  425  TYR A CG    1 
ATOM   3199 C  CD1   . TYR C 3 359 ? 23.573  4.327   -6.342  1.00 24.49 ?  425  TYR A CD1   1 
ATOM   3200 C  CD2   . TYR C 3 359 ? 22.557  6.065   -7.629  1.00 24.43 ?  425  TYR A CD2   1 
ATOM   3201 C  CE1   . TYR C 3 359 ? 22.965  3.367   -7.135  1.00 23.91 ?  425  TYR A CE1   1 
ATOM   3202 C  CE2   . TYR C 3 359 ? 21.931  5.109   -8.445  1.00 24.49 ?  425  TYR A CE2   1 
ATOM   3203 C  CZ    . TYR C 3 359 ? 22.145  3.764   -8.185  1.00 25.47 ?  425  TYR A CZ    1 
ATOM   3204 O  OH    . TYR C 3 359 ? 21.533  2.804   -8.955  1.00 26.25 ?  425  TYR A OH    1 
ATOM   3205 N  N     . PHE C 3 360 ? 23.465  8.270   -2.356  1.00 26.02 ?  426  PHE A N     1 
ATOM   3206 C  CA    . PHE C 3 360 ? 24.137  9.120   -1.384  1.00 26.08 ?  426  PHE A CA    1 
ATOM   3207 C  C     . PHE C 3 360 ? 24.336  8.387   -0.063  1.00 26.36 ?  426  PHE A C     1 
ATOM   3208 O  O     . PHE C 3 360 ? 24.544  9.019   0.972   1.00 26.44 ?  426  PHE A O     1 
ATOM   3209 C  CB    . PHE C 3 360 ? 23.406  10.460  -1.174  1.00 25.79 ?  426  PHE A CB    1 
ATOM   3210 C  CG    . PHE C 3 360 ? 21.929  10.323  -0.918  1.00 25.65 ?  426  PHE A CG    1 
ATOM   3211 C  CD1   . PHE C 3 360 ? 21.019  10.404  -1.974  1.00 25.70 ?  426  PHE A CD1   1 
ATOM   3212 C  CD2   . PHE C 3 360 ? 21.444  10.119  0.380   1.00 25.85 ?  426  PHE A CD2   1 
ATOM   3213 C  CE1   . PHE C 3 360 ? 19.657  10.278  -1.755  1.00 24.87 ?  426  PHE A CE1   1 
ATOM   3214 C  CE2   . PHE C 3 360 ? 20.085  10.004  0.616   1.00 26.95 ?  426  PHE A CE2   1 
ATOM   3215 C  CZ    . PHE C 3 360 ? 19.181  10.086  -0.459  1.00 26.67 ?  426  PHE A CZ    1 
ATOM   3216 N  N     . GLY C 3 361 ? 24.311  7.058   -0.107  1.00 25.79 ?  427  GLY A N     1 
ATOM   3217 C  CA    . GLY C 3 361 ? 24.803  6.282   1.046   1.00 26.41 ?  427  GLY A CA    1 
ATOM   3218 C  C     . GLY C 3 361 ? 26.322  6.250   1.014   1.00 26.50 ?  427  GLY A C     1 
ATOM   3219 O  O     . GLY C 3 361 ? 26.946  6.811   0.106   1.00 26.84 ?  427  GLY A O     1 
ATOM   3220 N  N     . ARG C 3 362 ? 26.933  5.579   1.979   1.00 26.50 ?  428  ARG A N     1 
ATOM   3221 C  CA    . ARG C 3 362 ? 28.385  5.448   1.982   1.00 26.66 ?  428  ARG A CA    1 
ATOM   3222 C  C     . ARG C 3 362 ? 28.860  4.316   1.059   1.00 26.37 ?  428  ARG A C     1 
ATOM   3223 O  O     . ARG C 3 362 ? 30.057  4.120   0.868   1.00 26.54 ?  428  ARG A O     1 
ATOM   3224 C  CB    . ARG C 3 362 ? 28.900  5.258   3.404   1.00 26.00 ?  428  ARG A CB    1 
ATOM   3225 C  CG    . ARG C 3 362 ? 28.948  6.566   4.190   1.00 26.64 ?  428  ARG A CG    1 
ATOM   3226 C  CD    . ARG C 3 362 ? 29.361  6.340   5.639   1.00 26.30 ?  428  ARG A CD    1 
ATOM   3227 N  NE    . ARG C 3 362 ? 30.068  7.497   6.187   1.00 27.75 ?  428  ARG A NE    1 
ATOM   3228 C  CZ    . ARG C 3 362 ? 30.130  7.819   7.481   1.00 26.46 ?  428  ARG A CZ    1 
ATOM   3229 N  NH1   . ARG C 3 362 ? 29.492  7.088   8.387   1.00 25.48 ?  428  ARG A NH1   1 
ATOM   3230 N  NH2   . ARG C 3 362 ? 30.836  8.885   7.873   1.00 24.81 ?  428  ARG A NH2   1 
ATOM   3231 N  N     . LEU C 3 363 ? 27.918  3.575   0.487   1.00 26.14 ?  429  LEU A N     1 
ATOM   3232 C  CA    . LEU C 3 363 ? 28.282  2.573   -0.526  1.00 26.32 ?  429  LEU A CA    1 
ATOM   3233 C  C     . LEU C 3 363 ? 27.978  3.175   -1.876  1.00 26.43 ?  429  LEU A C     1 
ATOM   3234 O  O     . LEU C 3 363 ? 26.818  3.447   -2.182  1.00 26.25 ?  429  LEU A O     1 
ATOM   3235 C  CB    . LEU C 3 363 ? 27.503  1.273   -0.319  1.00 26.18 ?  429  LEU A CB    1 
ATOM   3236 C  CG    . LEU C 3 363 ? 27.853  0.577   1.003   1.00 26.28 ?  429  LEU A CG    1 
ATOM   3237 C  CD1   . LEU C 3 363 ? 26.975  -0.672  1.254   1.00 27.06 ?  429  LEU A CD1   1 
ATOM   3238 C  CD2   . LEU C 3 363 ? 29.358  0.226   1.057   1.00 26.54 ?  429  LEU A CD2   1 
ATOM   3239 N  N     . LYS C 3 364 ? 29.022  3.382   -2.682  1.00 27.11 ?  430  LYS A N     1 
ATOM   3240 C  CA    . LYS C 3 364 ? 28.937  4.199   -3.895  1.00 27.50 ?  430  LYS A CA    1 
ATOM   3241 C  C     . LYS C 3 364 ? 27.865  3.765   -4.880  1.00 27.32 ?  430  LYS A C     1 
ATOM   3242 O  O     . LYS C 3 364 ? 27.218  4.606   -5.504  1.00 27.31 ?  430  LYS A O     1 
ATOM   3243 C  CB    . LYS C 3 364 ? 30.284  4.234   -4.613  1.00 28.47 ?  430  LYS A CB    1 
ATOM   3244 C  CG    . LYS C 3 364 ? 31.388  4.850   -3.761  1.00 31.87 ?  430  LYS A CG    1 
ATOM   3245 C  CD    . LYS C 3 364 ? 32.684  4.068   -3.889  1.00 35.58 ?  430  LYS A CD    1 
ATOM   3246 C  CE    . LYS C 3 364 ? 33.411  4.385   -5.155  1.00 36.70 ?  430  LYS A CE    1 
ATOM   3247 N  NZ    . LYS C 3 364 ? 34.783  3.815   -5.104  1.00 38.72 ?  430  LYS A NZ    1 
ATOM   3248 N  N     . THR C 3 365 ? 27.701  2.463   -5.063  1.00 26.87 ?  431  THR A N     1 
ATOM   3249 C  CA    . THR C 3 365 ? 26.727  1.997   -6.049  1.00 27.34 ?  431  THR A CA    1 
ATOM   3250 C  C     . THR C 3 365 ? 25.543  1.262   -5.414  1.00 27.35 ?  431  THR A C     1 
ATOM   3251 O  O     . THR C 3 365 ? 24.820  0.521   -6.087  1.00 27.11 ?  431  THR A O     1 
ATOM   3252 C  CB    . THR C 3 365 ? 27.371  1.121   -7.157  1.00 27.31 ?  431  THR A CB    1 
ATOM   3253 O  OG1   . THR C 3 365 ? 27.917  -0.062  -6.570  1.00 28.84 ?  431  THR A OG1   1 
ATOM   3254 C  CG2   . THR C 3 365 ? 28.472  1.886   -7.907  1.00 27.60 ?  431  THR A CG2   1 
ATOM   3255 N  N     . VAL C 3 366 ? 25.325  1.463   -4.120  1.00 27.19 ?  432  VAL A N     1 
ATOM   3256 C  CA    . VAL C 3 366 ? 24.123  0.883   -3.525  1.00 26.90 ?  432  VAL A CA    1 
ATOM   3257 C  C     . VAL C 3 366 ? 22.985  1.895   -3.489  1.00 27.12 ?  432  VAL A C     1 
ATOM   3258 O  O     . VAL C 3 366 ? 23.099  2.967   -2.878  1.00 26.67 ?  432  VAL A O     1 
ATOM   3259 C  CB    . VAL C 3 366 ? 24.401  0.245   -2.158  1.00 26.77 ?  432  VAL A CB    1 
ATOM   3260 C  CG1   . VAL C 3 366 ? 23.079  -0.254  -1.521  1.00 26.29 ?  432  VAL A CG1   1 
ATOM   3261 C  CG2   . VAL C 3 366 ? 25.387  -0.921  -2.351  1.00 25.43 ?  432  VAL A CG2   1 
ATOM   3262 N  N     . LYS C 3 367 ? 21.895  1.552   -4.168  1.00 27.14 ?  433  LYS A N     1 
ATOM   3263 C  CA    . LYS C 3 367 ? 20.792  2.485   -4.388  1.00 28.09 ?  433  LYS A CA    1 
ATOM   3264 C  C     . LYS C 3 367 ? 19.931  2.704   -3.129  1.00 27.99 ?  433  LYS A C     1 
ATOM   3265 O  O     . LYS C 3 367 ? 19.595  1.744   -2.429  1.00 28.09 ?  433  LYS A O     1 
ATOM   3266 C  CB    . LYS C 3 367 ? 19.929  1.970   -5.539  1.00 27.86 ?  433  LYS A CB    1 
ATOM   3267 C  CG    . LYS C 3 367 ? 18.936  2.975   -6.105  1.00 29.38 ?  433  LYS A CG    1 
ATOM   3268 C  CD    . LYS C 3 367 ? 18.099  2.316   -7.195  1.00 31.53 ?  433  LYS A CD    1 
ATOM   3269 C  CE    . LYS C 3 367 ? 16.962  3.204   -7.616  1.00 34.07 ?  433  LYS A CE    1 
ATOM   3270 N  NZ    . LYS C 3 367 ? 16.199  2.604   -8.741  1.00 38.20 ?  433  LYS A NZ    1 
ATOM   3271 N  N     . GLN C 3 368 ? 19.587  3.959   -2.830  1.00 28.07 ?  434  GLN A N     1 
ATOM   3272 C  CA    . GLN C 3 368 ? 18.624  4.229   -1.755  1.00 28.76 ?  434  GLN A CA    1 
ATOM   3273 C  C     . GLN C 3 368 ? 17.224  3.868   -2.234  1.00 29.44 ?  434  GLN A C     1 
ATOM   3274 O  O     . GLN C 3 368 ? 16.772  4.367   -3.255  1.00 28.18 ?  434  GLN A O     1 
ATOM   3275 C  CB    . GLN C 3 368 ? 18.649  5.696   -1.311  1.00 28.94 ?  434  GLN A CB    1 
ATOM   3276 C  CG    . GLN C 3 368 ? 19.699  5.978   -0.259  1.00 29.04 ?  434  GLN A CG    1 
ATOM   3277 C  CD    . GLN C 3 368 ? 21.065  5.588   -0.762  1.00 30.03 ?  434  GLN A CD    1 
ATOM   3278 O  OE1   . GLN C 3 368 ? 21.589  6.197   -1.703  1.00 30.38 ?  434  GLN A OE1   1 
ATOM   3279 N  NE2   . GLN C 3 368 ? 21.644  4.557   -0.162  1.00 28.62 ?  434  GLN A NE2   1 
ATOM   3280 N  N     . GLU C 3 369 ? 16.539  2.992   -1.501  1.00 30.04 ?  435  GLU A N     1 
ATOM   3281 C  CA    . GLU C 3 369 ? 15.211  2.567   -1.930  1.00 31.56 ?  435  GLU A CA    1 
ATOM   3282 C  C     . GLU C 3 369 ? 14.207  2.672   -0.796  1.00 31.25 ?  435  GLU A C     1 
ATOM   3283 O  O     . GLU C 3 369 ? 14.530  2.432   0.365   1.00 31.02 ?  435  GLU A O     1 
ATOM   3284 C  CB    . GLU C 3 369 ? 15.230  1.130   -2.455  1.00 31.96 ?  435  GLU A CB    1 
ATOM   3285 C  CG    . GLU C 3 369 ? 16.127  0.931   -3.651  1.00 35.65 ?  435  GLU A CG    1 
ATOM   3286 C  CD    . GLU C 3 369 ? 16.071  -0.481  -4.182  1.00 39.47 ?  435  GLU A CD    1 
ATOM   3287 O  OE1   . GLU C 3 369 ? 15.006  -0.891  -4.693  1.00 43.34 ?  435  GLU A OE1   1 
ATOM   3288 O  OE2   . GLU C 3 369 ? 17.088  -1.186  -4.075  1.00 41.40 ?  435  GLU A OE2   1 
ATOM   3289 N  N     . ILE C 3 370 ? 12.983  3.029   -1.142  1.00 31.77 ?  436  ILE A N     1 
ATOM   3290 C  CA    . ILE C 3 370 ? 11.930  3.056   -0.153  1.00 32.44 ?  436  ILE A CA    1 
ATOM   3291 C  C     . ILE C 3 370 ? 11.398  1.652   0.078   1.00 32.40 ?  436  ILE A C     1 
ATOM   3292 O  O     . ILE C 3 370 ? 10.923  1.002   -0.849  1.00 32.79 ?  436  ILE A O     1 
ATOM   3293 C  CB    . ILE C 3 370 ? 10.770  3.955   -0.594  1.00 32.56 ?  436  ILE A CB    1 
ATOM   3294 C  CG1   . ILE C 3 370 ? 11.230  5.416   -0.626  1.00 32.44 ?  436  ILE A CG1   1 
ATOM   3295 C  CG2   . ILE C 3 370 ? 9.597   3.771   0.367   1.00 33.04 ?  436  ILE A CG2   1 
ATOM   3296 C  CD1   . ILE C 3 370 ? 10.274  6.345   -1.364  1.00 32.14 ?  436  ILE A CD1   1 
ATOM   3297 N  N     . LYS C 3 371 ? 11.510  1.172   1.308   1.00 32.61 ?  437  LYS A N     1 
ATOM   3298 C  CA    . LYS C 3 371 ? 10.859  -0.077  1.695   1.00 32.23 ?  437  LYS A CA    1 
ATOM   3299 C  C     . LYS C 3 371 ? 9.499   0.233   2.334   1.00 32.05 ?  437  LYS A C     1 
ATOM   3300 O  O     . LYS C 3 371 ? 9.416   0.946   3.345   1.00 32.42 ?  437  LYS A O     1 
ATOM   3301 C  CB    . LYS C 3 371 ? 11.742  -0.843  2.678   1.00 32.81 ?  437  LYS A CB    1 
ATOM   3302 N  N     . GLU C 3 372 ? 8.427   -0.276  1.744   1.00 31.25 ?  438  GLU A N     1 
ATOM   3303 C  CA    . GLU C 3 372 ? 7.117   -0.091  2.339   1.00 31.12 ?  438  GLU A CA    1 
ATOM   3304 C  C     . GLU C 3 372 ? 6.900   -1.228  3.330   1.00 30.86 ?  438  GLU A C     1 
ATOM   3305 O  O     . GLU C 3 372 ? 7.040   -2.406  2.987   1.00 31.01 ?  438  GLU A O     1 
ATOM   3306 C  CB    . GLU C 3 372 ? 6.014   -0.087  1.275   1.00 31.40 ?  438  GLU A CB    1 
ATOM   3307 N  N     . SER C 3 373 ? 6.605   -0.882  4.572   1.00 30.17 ?  439  SER A N     1 
ATOM   3308 C  CA    . SER C 3 373 ? 6.301   -1.913  5.553   1.00 29.79 ?  439  SER A CA    1 
ATOM   3309 C  C     . SER C 3 373 ? 5.207   -1.409  6.460   1.00 29.35 ?  439  SER A C     1 
ATOM   3310 O  O     . SER C 3 373 ? 4.596   -0.368  6.193   1.00 29.53 ?  439  SER A O     1 
ATOM   3311 C  CB    . SER C 3 373 ? 7.551   -2.299  6.361   1.00 29.79 ?  439  SER A CB    1 
ATOM   3312 O  OG    . SER C 3 373 ? 7.290   -3.475  7.128   1.00 32.01 ?  439  SER A OG    1 
ATOM   3313 N  N     . VAL C 3 374 ? 4.943   -2.158  7.521   1.00 28.60 ?  440  VAL A N     1 
ATOM   3314 C  CA    . VAL C 3 374 ? 3.914   -1.771  8.488   1.00 27.86 ?  440  VAL A CA    1 
ATOM   3315 C  C     . VAL C 3 374 ? 4.487   -1.994  9.867   1.00 26.81 ?  440  VAL A C     1 
ATOM   3316 O  O     . VAL C 3 374 ? 5.076   -3.044  10.129  1.00 26.03 ?  440  VAL A O     1 
ATOM   3317 C  CB    . VAL C 3 374 ? 2.629   -2.628  8.370   1.00 28.10 ?  440  VAL A CB    1 
ATOM   3318 C  CG1   . VAL C 3 374 ? 1.707   -2.399  9.604   1.00 28.32 ?  440  VAL A CG1   1 
ATOM   3319 C  CG2   . VAL C 3 374 ? 1.856   -2.299  7.080   1.00 28.71 ?  440  VAL A CG2   1 
ATOM   3320 N  N     . PHE C 3 375 ? 4.344   -1.002  10.739  1.00 25.90 ?  441  PHE A N     1 
ATOM   3321 C  CA    . PHE C 3 375 ? 4.720   -1.180  12.136  1.00 25.10 ?  441  PHE A CA    1 
ATOM   3322 C  C     . PHE C 3 375 ? 3.466   -1.244  13.018  1.00 24.55 ?  441  PHE A C     1 
ATOM   3323 O  O     . PHE C 3 375 ? 2.533   -0.459  12.840  1.00 24.96 ?  441  PHE A O     1 
ATOM   3324 C  CB    . PHE C 3 375 ? 5.678   -0.063  12.590  1.00 25.24 ?  441  PHE A CB    1 
ATOM   3325 C  CG    . PHE C 3 375 ? 6.183   -0.254  13.973  1.00 24.96 ?  441  PHE A CG    1 
ATOM   3326 C  CD1   . PHE C 3 375 ? 5.330   -0.052  15.065  1.00 24.11 ?  441  PHE A CD1   1 
ATOM   3327 C  CD2   . PHE C 3 375 ? 7.473   -0.688  14.204  1.00 25.89 ?  441  PHE A CD2   1 
ATOM   3328 C  CE1   . PHE C 3 375 ? 5.772   -0.261  16.352  1.00 23.61 ?  441  PHE A CE1   1 
ATOM   3329 C  CE2   . PHE C 3 375 ? 7.933   -0.876  15.508  1.00 26.05 ?  441  PHE A CE2   1 
ATOM   3330 C  CZ    . PHE C 3 375 ? 7.051   -0.672  16.589  1.00 24.74 ?  441  PHE A CZ    1 
ATOM   3331 N  N     . SER C 3 376 ? 3.413   -2.194  13.953  1.00 23.47 ?  442  SER A N     1 
ATOM   3332 C  CA    . SER C 3 376 ? 2.254   -2.265  14.853  1.00 22.48 ?  442  SER A CA    1 
ATOM   3333 C  C     . SER C 3 376 ? 2.661   -2.645  16.271  1.00 21.68 ?  442  SER A C     1 
ATOM   3334 O  O     . SER C 3 376 ? 3.273   -3.689  16.491  1.00 20.26 ?  442  SER A O     1 
ATOM   3335 C  CB    . SER C 3 376 ? 1.227   -3.291  14.353  1.00 22.36 ?  442  SER A CB    1 
ATOM   3336 O  OG    . SER C 3 376 ? 0.017   -3.176  15.083  1.00 23.10 ?  442  SER A OG    1 
ATOM   3337 N  N     . SER C 3 377 ? 2.327   -1.799  17.230  1.00 21.44 ?  443  SER A N     1 
ATOM   3338 C  CA    . SER C 3 377 ? 2.404   -2.221  18.636  1.00 20.90 ?  443  SER A CA    1 
ATOM   3339 C  C     . SER C 3 377 ? 1.418   -1.396  19.412  1.00 21.33 ?  443  SER A C     1 
ATOM   3340 O  O     . SER C 3 377 ? 1.040   -0.298  18.978  1.00 21.46 ?  443  SER A O     1 
ATOM   3341 C  CB    . SER C 3 377 ? 3.821   -2.034  19.208  1.00 21.13 ?  443  SER A CB    1 
ATOM   3342 O  OG    . SER C 3 377 ? 4.030   -0.683  19.627  1.00 20.88 ?  443  SER A OG    1 
ATOM   3343 N  N     . LYS C 3 378 ? 0.981   -1.905  20.564  1.00 21.06 ?  444  LYS A N     1 
ATOM   3344 C  CA    . LYS C 3 378 ? 0.047   -1.125  21.348  1.00 22.03 ?  444  LYS A CA    1 
ATOM   3345 C  C     . LYS C 3 378 ? 0.625   0.251   21.679  1.00 22.72 ?  444  LYS A C     1 
ATOM   3346 O  O     . LYS C 3 378 ? -0.046  1.274   21.518  1.00 23.02 ?  444  LYS A O     1 
ATOM   3347 C  CB    . LYS C 3 378 ? -0.351  -1.837  22.645  1.00 21.41 ?  444  LYS A CB    1 
ATOM   3348 C  CG    . LYS C 3 378 ? -1.217  -0.907  23.513  1.00 22.41 ?  444  LYS A CG    1 
ATOM   3349 C  CD    . LYS C 3 378 ? -1.611  -1.516  24.840  1.00 22.47 ?  444  LYS A CD    1 
ATOM   3350 C  CE    . LYS C 3 378 ? -2.079  -0.416  25.830  1.00 22.08 ?  444  LYS A CE    1 
ATOM   3351 N  NZ    . LYS C 3 378 ? -3.301  0.287   25.369  1.00 21.66 ?  444  LYS A NZ    1 
ATOM   3352 N  N     . ALA C 3 379 ? 1.864   0.274   22.154  1.00 23.41 ?  445  ALA A N     1 
ATOM   3353 C  CA    . ALA C 3 379 ? 2.469   1.518   22.623  1.00 24.75 ?  445  ALA A CA    1 
ATOM   3354 C  C     . ALA C 3 379 ? 2.563   2.555   21.514  1.00 25.35 ?  445  ALA A C     1 
ATOM   3355 O  O     . ALA C 3 379 ? 2.332   3.742   21.741  1.00 25.57 ?  445  ALA A O     1 
ATOM   3356 C  CB    . ALA C 3 379 ? 3.870   1.254   23.193  1.00 24.92 ?  445  ALA A CB    1 
ATOM   3357 N  N     . TYR C 3 380 ? 2.941   2.110   20.320  1.00 26.00 ?  446  TYR A N     1 
ATOM   3358 C  CA    . TYR C 3 380 ? 3.244   3.044   19.241  1.00 26.31 ?  446  TYR A CA    1 
ATOM   3359 C  C     . TYR C 3 380 ? 2.196   3.155   18.151  1.00 25.73 ?  446  TYR A C     1 
ATOM   3360 O  O     . TYR C 3 380 ? 2.309   4.005   17.279  1.00 27.04 ?  446  TYR A O     1 
ATOM   3361 C  CB    . TYR C 3 380 ? 4.605   2.743   18.617  1.00 26.39 ?  446  TYR A CB    1 
ATOM   3362 C  CG    . TYR C 3 380 ? 5.726   2.705   19.615  1.00 28.10 ?  446  TYR A CG    1 
ATOM   3363 C  CD1   . TYR C 3 380 ? 5.852   3.692   20.605  1.00 29.48 ?  446  TYR A CD1   1 
ATOM   3364 C  CD2   . TYR C 3 380 ? 6.667   1.696   19.573  1.00 28.05 ?  446  TYR A CD2   1 
ATOM   3365 C  CE1   . TYR C 3 380 ? 6.885   3.640   21.529  1.00 30.77 ?  446  TYR A CE1   1 
ATOM   3366 C  CE2   . TYR C 3 380 ? 7.692   1.638   20.477  1.00 28.87 ?  446  TYR A CE2   1 
ATOM   3367 C  CZ    . TYR C 3 380 ? 7.810   2.608   21.450  1.00 31.44 ?  446  TYR A CZ    1 
ATOM   3368 O  OH    . TYR C 3 380 ? 8.869   2.524   22.337  1.00 31.42 ?  446  TYR A OH    1 
ATOM   3369 N  N     . GLY C 3 381 ? 1.180   2.312   18.196  1.00 25.38 ?  447  GLY A N     1 
ATOM   3370 C  CA    . GLY C 3 381 ? 0.142   2.345   17.177  1.00 24.99 ?  447  GLY A CA    1 
ATOM   3371 C  C     . GLY C 3 381 ? 0.509   1.516   15.959  1.00 24.60 ?  447  GLY A C     1 
ATOM   3372 O  O     . GLY C 3 381 ? 1.536   0.826   15.938  1.00 24.15 ?  447  GLY A O     1 
ATOM   3373 N  N     . THR C 3 382 ? -0.336  1.595   14.941  1.00 24.41 ?  448  THR A N     1 
ATOM   3374 C  CA    . THR C 3 382 ? -0.178  0.807   13.736  1.00 25.10 ?  448  THR A CA    1 
ATOM   3375 C  C     . THR C 3 382 ? -0.165  1.731   12.520  1.00 26.10 ?  448  THR A C     1 
ATOM   3376 O  O     . THR C 3 382 ? -1.063  2.556   12.352  1.00 25.74 ?  448  THR A O     1 
ATOM   3377 C  CB    . THR C 3 382 ? -1.333  -0.206  13.609  1.00 25.34 ?  448  THR A CB    1 
ATOM   3378 O  OG1   . THR C 3 382 ? -1.239  -1.179  14.665  1.00 23.85 ?  448  THR A OG1   1 
ATOM   3379 C  CG2   . THR C 3 382 ? -1.297  -0.918  12.250  1.00 25.95 ?  448  THR A CG2   1 
ATOM   3380 N  N     . ARG C 3 383 ? 0.849   1.600   11.671  1.00 27.26 ?  449  ARG A N     1 
ATOM   3381 C  CA    . ARG C 3 383 ? 0.918   2.422   10.466  1.00 28.79 ?  449  ARG A CA    1 
ATOM   3382 C  C     . ARG C 3 383 ? 1.930   1.913   9.469   1.00 29.43 ?  449  ARG A C     1 
ATOM   3383 O  O     . ARG C 3 383 ? 2.907   1.251   9.835   1.00 29.49 ?  449  ARG A O     1 
ATOM   3384 C  CB    . ARG C 3 383 ? 1.294   3.857   10.818  1.00 28.86 ?  449  ARG A CB    1 
ATOM   3385 C  CG    . ARG C 3 383 ? 2.655   3.983   11.479  1.00 30.41 ?  449  ARG A CG    1 
ATOM   3386 C  CD    . ARG C 3 383 ? 2.887   5.421   11.923  1.00 34.12 ?  449  ARG A CD    1 
ATOM   3387 N  NE    . ARG C 3 383 ? 1.784   5.897   12.760  1.00 35.84 ?  449  ARG A NE    1 
ATOM   3388 C  CZ    . ARG C 3 383 ? 1.657   5.615   14.057  1.00 36.10 ?  449  ARG A CZ    1 
ATOM   3389 N  NH1   . ARG C 3 383 ? 0.626   6.087   14.753  1.00 36.01 ?  449  ARG A NH1   1 
ATOM   3390 N  NH2   . ARG C 3 383 ? 2.565   4.870   14.660  1.00 36.25 ?  449  ARG A NH2   1 
ATOM   3391 N  N     . GLU C 3 384 ? 1.709   2.275   8.206   1.00 30.46 ?  450  GLU A N     1 
ATOM   3392 C  CA    . GLU C 3 384 ? 2.671   2.006   7.146   1.00 30.92 ?  450  GLU A CA    1 
ATOM   3393 C  C     . GLU C 3 384 ? 3.925   2.825   7.404   1.00 30.76 ?  450  GLU A C     1 
ATOM   3394 O  O     . GLU C 3 384 ? 3.846   3.953   7.897   1.00 30.67 ?  450  GLU A O     1 
ATOM   3395 C  CB    . GLU C 3 384 ? 2.092   2.390   5.784   1.00 31.50 ?  450  GLU A CB    1 
ATOM   3396 C  CG    . GLU C 3 384 ? 0.928   1.534   5.323   1.00 35.00 ?  450  GLU A CG    1 
ATOM   3397 C  CD    . GLU C 3 384 ? 0.701   1.667   3.824   1.00 39.21 ?  450  GLU A CD    1 
ATOM   3398 O  OE1   . GLU C 3 384 ? 1.640   1.356   3.052   1.00 43.26 ?  450  GLU A OE1   1 
ATOM   3399 O  OE2   . GLU C 3 384 ? -0.394  2.090   3.417   1.00 40.56 ?  450  GLU A OE2   1 
ATOM   3400 N  N     . THR C 3 385 ? 5.080   2.251   7.079   1.00 30.36 ?  451  THR A N     1 
ATOM   3401 C  CA    . THR C 3 385 ? 6.344   2.941   7.220   1.00 30.64 ?  451  THR A CA    1 
ATOM   3402 C  C     . THR C 3 385 ? 7.037   3.007   5.852   1.00 30.87 ?  451  THR A C     1 
ATOM   3403 O  O     . THR C 3 385 ? 6.768   2.184   4.984   1.00 29.57 ?  451  THR A O     1 
ATOM   3404 C  CB    . THR C 3 385 ? 7.247   2.193   8.228   1.00 31.16 ?  451  THR A CB    1 
ATOM   3405 O  OG1   . THR C 3 385 ? 7.441   0.844   7.781   1.00 31.80 ?  451  THR A OG1   1 
ATOM   3406 C  CG2   . THR C 3 385 ? 6.573   2.146   9.636   1.00 30.24 ?  451  THR A CG2   1 
ATOM   3407 N  N     . LYS C 3 386 ? 7.921   3.986   5.667   1.00 31.82 ?  452  LYS A N     1 
ATOM   3408 C  CA    . LYS C 3 386 ? 8.665   4.124   4.413   1.00 33.07 ?  452  LYS A CA    1 
ATOM   3409 C  C     . LYS C 3 386 ? 10.172  4.246   4.620   1.00 32.87 ?  452  LYS A C     1 
ATOM   3410 O  O     . LYS C 3 386 ? 10.797  5.137   4.058   1.00 33.43 ?  452  LYS A O     1 
ATOM   3411 C  CB    . LYS C 3 386 ? 8.151   5.324   3.619   1.00 33.48 ?  452  LYS A CB    1 
ATOM   3412 C  CG    . LYS C 3 386 ? 6.734   5.142   3.113   1.00 35.71 ?  452  LYS A CG    1 
ATOM   3413 C  CD    . LYS C 3 386 ? 6.221   6.395   2.424   1.00 40.01 ?  452  LYS A CD    1 
ATOM   3414 C  CE    . LYS C 3 386 ? 6.810   6.532   1.027   1.00 43.01 ?  452  LYS A CE    1 
ATOM   3415 N  NZ    . LYS C 3 386 ? 6.181   5.545   0.095   1.00 45.35 ?  452  LYS A NZ    1 
ATOM   3416 N  N     . ASN C 3 387 ? 10.745  3.341   5.409   1.00 32.64 ?  453  ASN A N     1 
ATOM   3417 C  CA    . ASN C 3 387 ? 12.177  3.340   5.710   1.00 32.31 ?  453  ASN A CA    1 
ATOM   3418 C  C     . ASN C 3 387 ? 13.098  3.201   4.484   1.00 31.66 ?  453  ASN A C     1 
ATOM   3419 O  O     . ASN C 3 387 ? 12.854  2.380   3.587   1.00 31.50 ?  453  ASN A O     1 
ATOM   3420 C  CB    . ASN C 3 387 ? 12.500  2.255   6.740   1.00 32.50 ?  453  ASN A CB    1 
ATOM   3421 C  CG    . ASN C 3 387 ? 11.716  2.428   8.040   1.00 34.98 ?  453  ASN A CG    1 
ATOM   3422 O  OD1   . ASN C 3 387 ? 11.307  3.541   8.396   1.00 37.07 ?  453  ASN A OD1   1 
ATOM   3423 N  ND2   . ASN C 3 387 ? 11.505  1.328   8.755   1.00 35.96 ?  453  ASN A ND2   1 
ATOM   3424 N  N     . VAL C 3 388 ? 14.145  4.022   4.455   1.00 30.10 ?  454  VAL A N     1 
ATOM   3425 C  CA    . VAL C 3 388 ? 15.084  4.037   3.348   1.00 29.52 ?  454  VAL A CA    1 
ATOM   3426 C  C     . VAL C 3 388 ? 16.464  3.653   3.857   1.00 29.09 ?  454  VAL A C     1 
ATOM   3427 O  O     . VAL C 3 388 ? 16.904  4.145   4.901   1.00 28.89 ?  454  VAL A O     1 
ATOM   3428 C  CB    . VAL C 3 388 ? 15.161  5.440   2.690   1.00 29.51 ?  454  VAL A CB    1 
ATOM   3429 C  CG1   . VAL C 3 388 ? 16.354  5.534   1.745   1.00 29.20 ?  454  VAL A CG1   1 
ATOM   3430 C  CG2   . VAL C 3 388 ? 13.877  5.766   1.950   1.00 28.18 ?  454  VAL A CG2   1 
ATOM   3431 N  N     . ASN C 3 389 ? 17.131  2.753   3.136   1.00 28.66 ?  455  ASN A N     1 
ATOM   3432 C  CA    . ASN C 3 389 ? 18.520  2.416   3.408   1.00 29.16 ?  455  ASN A CA    1 
ATOM   3433 C  C     . ASN C 3 389 ? 19.485  3.532   2.975   1.00 28.80 ?  455  ASN A C     1 
ATOM   3434 O  O     . ASN C 3 389 ? 19.690  3.729   1.789   1.00 29.37 ?  455  ASN A O     1 
ATOM   3435 C  CB    . ASN C 3 389 ? 18.922  1.141   2.643   1.00 29.06 ?  455  ASN A CB    1 
ATOM   3436 C  CG    . ASN C 3 389 ? 18.823  1.311   1.126   1.00 30.20 ?  455  ASN A CG    1 
ATOM   3437 O  OD1   . ASN C 3 389 ? 17.752  1.645   0.593   1.00 29.51 ?  455  ASN A OD1   1 
ATOM   3438 N  ND2   . ASN C 3 389 ? 19.941  1.071   0.416   1.00 31.30 ?  455  ASN A ND2   1 
ATOM   3439 N  N     . ILE C 3 390 ? 20.078  4.248   3.926   1.00 28.07 ?  456  ILE A N     1 
ATOM   3440 C  CA    . ILE C 3 390 ? 21.171  5.163   3.601   1.00 27.24 ?  456  ILE A CA    1 
ATOM   3441 C  C     . ILE C 3 390 ? 22.427  4.551   4.208   1.00 27.42 ?  456  ILE A C     1 
ATOM   3442 O  O     . ILE C 3 390 ? 22.878  4.939   5.299   1.00 26.59 ?  456  ILE A O     1 
ATOM   3443 C  CB    . ILE C 3 390 ? 20.926  6.604   4.091   1.00 27.76 ?  456  ILE A CB    1 
ATOM   3444 C  CG1   . ILE C 3 390 ? 19.574  7.099   3.579   1.00 25.64 ?  456  ILE A CG1   1 
ATOM   3445 C  CG2   . ILE C 3 390 ? 22.069  7.525   3.617   1.00 26.07 ?  456  ILE A CG2   1 
ATOM   3446 C  CD1   . ILE C 3 390 ? 19.161  8.441   4.136   1.00 28.01 ?  456  ILE A CD1   1 
ATOM   3447 N  N     . ASP C 3 391 ? 22.978  3.575   3.475   1.00 26.59 ?  457  ASP A N     1 
ATOM   3448 C  CA    . ASP C 3 391 ? 23.924  2.624   4.039   1.00 27.14 ?  457  ASP A CA    1 
ATOM   3449 C  C     . ASP C 3 391 ? 25.075  3.333   4.724   1.00 26.24 ?  457  ASP A C     1 
ATOM   3450 O  O     . ASP C 3 391 ? 25.728  4.168   4.118   1.00 26.68 ?  457  ASP A O     1 
ATOM   3451 C  CB    . ASP C 3 391 ? 24.431  1.641   2.952   1.00 26.40 ?  457  ASP A CB    1 
ATOM   3452 C  CG    . ASP C 3 391 ? 23.280  0.996   2.172   1.00 29.67 ?  457  ASP A CG    1 
ATOM   3453 O  OD1   . ASP C 3 391 ? 23.082  -0.239  2.247   1.00 31.61 ?  457  ASP A OD1   1 
ATOM   3454 O  OD2   . ASP C 3 391 ? 22.547  1.736   1.492   1.00 29.86 ?  457  ASP A OD2   1 
ATOM   3455 N  N     . GLY C 3 392 ? 25.307  2.984   5.987   1.00 26.29 ?  458  GLY A N     1 
ATOM   3456 C  CA    . GLY C 3 392 ? 26.435  3.488   6.754   1.00 26.34 ?  458  GLY A CA    1 
ATOM   3457 C  C     . GLY C 3 392 ? 26.206  4.858   7.367   1.00 26.50 ?  458  GLY A C     1 
ATOM   3458 O  O     . GLY C 3 392 ? 27.098  5.410   8.028   1.00 27.09 ?  458  GLY A O     1 
ATOM   3459 N  N     . ARG C 3 393 ? 25.035  5.437   7.131   1.00 25.88 ?  459  ARG A N     1 
ATOM   3460 C  CA    . ARG C 3 393 ? 24.659  6.645   7.865   1.00 26.06 ?  459  ARG A CA    1 
ATOM   3461 C  C     . ARG C 3 393 ? 23.439  6.378   8.743   1.00 26.41 ?  459  ARG A C     1 
ATOM   3462 O  O     . ARG C 3 393 ? 22.537  5.658   8.352   1.00 26.87 ?  459  ARG A O     1 
ATOM   3463 C  CB    . ARG C 3 393 ? 24.349  7.805   6.909   1.00 25.90 ?  459  ARG A CB    1 
ATOM   3464 C  CG    . ARG C 3 393 ? 25.356  7.974   5.780   1.00 24.60 ?  459  ARG A CG    1 
ATOM   3465 C  CD    . ARG C 3 393 ? 25.094  9.282   5.019   1.00 26.65 ?  459  ARG A CD    1 
ATOM   3466 N  NE    . ARG C 3 393 ? 25.722  9.260   3.697   1.00 27.19 ?  459  ARG A NE    1 
ATOM   3467 C  CZ    . ARG C 3 393 ? 27.019  9.472   3.488   1.00 28.90 ?  459  ARG A CZ    1 
ATOM   3468 N  NH1   . ARG C 3 393 ? 27.514  9.405   2.259   1.00 28.69 ?  459  ARG A NH1   1 
ATOM   3469 N  NH2   . ARG C 3 393 ? 27.826  9.727   4.512   1.00 28.98 ?  459  ARG A NH2   1 
ATOM   3470 N  N     . LEU C 3 394 ? 23.425  6.973   9.926   1.00 26.17 ?  460  LEU A N     1 
ATOM   3471 C  CA    . LEU C 3 394 ? 22.246  6.939   10.780  1.00 26.24 ?  460  LEU A CA    1 
ATOM   3472 C  C     . LEU C 3 394 ? 21.243  7.984   10.328  1.00 25.88 ?  460  LEU A C     1 
ATOM   3473 O  O     . LEU C 3 394 ? 21.599  8.970   9.666   1.00 25.68 ?  460  LEU A O     1 
ATOM   3474 C  CB    . LEU C 3 394 ? 22.645  7.227   12.217  1.00 25.64 ?  460  LEU A CB    1 
ATOM   3475 C  CG    . LEU C 3 394 ? 23.617  6.190   12.789  1.00 27.15 ?  460  LEU A CG    1 
ATOM   3476 C  CD1   . LEU C 3 394 ? 23.941  6.540   14.251  1.00 26.54 ?  460  LEU A CD1   1 
ATOM   3477 C  CD2   . LEU C 3 394 ? 22.982  4.804   12.628  1.00 27.12 ?  460  LEU A CD2   1 
ATOM   3478 N  N     . GLN C 3 395 ? 19.992  7.744   10.673  1.00 25.81 ?  461  GLN A N     1 
ATOM   3479 C  CA    . GLN C 3 395 ? 18.931  8.724   10.496  1.00 26.14 ?  461  GLN A CA    1 
ATOM   3480 C  C     . GLN C 3 395 ? 18.327  9.020   11.865  1.00 26.37 ?  461  GLN A C     1 
ATOM   3481 O  O     . GLN C 3 395 ? 18.188  8.127   12.687  1.00 26.54 ?  461  GLN A O     1 
ATOM   3482 C  CB    . GLN C 3 395 ? 17.868  8.180   9.548   1.00 25.44 ?  461  GLN A CB    1 
ATOM   3483 C  CG    . GLN C 3 395 ? 18.392  7.980   8.110   1.00 26.75 ?  461  GLN A CG    1 
ATOM   3484 C  CD    . GLN C 3 395 ? 17.368  7.326   7.199   1.00 27.95 ?  461  GLN A CD    1 
ATOM   3485 O  OE1   . GLN C 3 395 ? 16.240  7.812   7.067   1.00 28.65 ?  461  GLN A OE1   1 
ATOM   3486 N  NE2   . GLN C 3 395 ? 17.749  6.211   6.576   1.00 27.12 ?  461  GLN A NE2   1 
ATOM   3487 N  N     . LEU C 3 396 ? 18.000  10.276  12.123  1.00 26.53 ?  462  LEU A N     1 
ATOM   3488 C  CA    . LEU C 3 396 ? 17.299  10.625  13.348  1.00 26.74 ?  462  LEU A CA    1 
ATOM   3489 C  C     . LEU C 3 396 ? 16.291  11.699  13.009  1.00 26.64 ?  462  LEU A C     1 
ATOM   3490 O  O     . LEU C 3 396 ? 16.601  12.891  13.046  1.00 26.74 ?  462  LEU A O     1 
ATOM   3491 C  CB    . LEU C 3 396 ? 18.268  11.104  14.431  1.00 26.86 ?  462  LEU A CB    1 
ATOM   3492 C  CG    . LEU C 3 396 ? 17.844  10.748  15.879  1.00 28.39 ?  462  LEU A CG    1 
ATOM   3493 C  CD1   . LEU C 3 396 ? 18.863  11.255  16.915  1.00 26.77 ?  462  LEU A CD1   1 
ATOM   3494 C  CD2   . LEU C 3 396 ? 16.459  11.259  16.199  1.00 28.75 ?  462  LEU A CD2   1 
ATOM   3495 N  N     . ASP C 3 397 ? 15.093  11.277  12.622  1.00 26.37 ?  463  ASP A N     1 
ATOM   3496 C  CA    . ASP C 3 397 ? 14.027  12.230  12.333  1.00 26.78 ?  463  ASP A CA    1 
ATOM   3497 C  C     . ASP C 3 397 ? 13.431  12.710  13.673  1.00 26.67 ?  463  ASP A C     1 
ATOM   3498 O  O     . ASP C 3 397 ? 12.838  11.917  14.404  1.00 26.23 ?  463  ASP A O     1 
ATOM   3499 C  CB    . ASP C 3 397 ? 12.956  11.551  11.480  1.00 26.36 ?  463  ASP A CB    1 
ATOM   3500 C  CG    . ASP C 3 397 ? 11.766  12.451  11.209  1.00 27.51 ?  463  ASP A CG    1 
ATOM   3501 O  OD1   . ASP C 3 397 ? 11.631  13.497  11.903  1.00 23.42 ?  463  ASP A OD1   1 
ATOM   3502 O  OD2   . ASP C 3 397 ? 10.982  12.112  10.285  1.00 26.56 ?  463  ASP A OD2   1 
ATOM   3503 N  N     . LEU C 3 398 ? 13.597  13.986  14.004  1.00 26.57 ?  464  LEU A N     1 
ATOM   3504 C  CA    . LEU C 3 398 ? 13.235  14.450  15.348  1.00 26.60 ?  464  LEU A CA    1 
ATOM   3505 C  C     . LEU C 3 398 ? 11.739  14.329  15.621  1.00 26.80 ?  464  LEU A C     1 
ATOM   3506 O  O     . LEU C 3 398 ? 11.328  14.252  16.774  1.00 25.83 ?  464  LEU A O     1 
ATOM   3507 C  CB    . LEU C 3 398 ? 13.699  15.891  15.612  1.00 26.54 ?  464  LEU A CB    1 
ATOM   3508 C  CG    . LEU C 3 398 ? 15.100  16.090  16.198  1.00 27.50 ?  464  LEU A CG    1 
ATOM   3509 C  CD1   . LEU C 3 398 ? 15.210  15.442  17.599  1.00 25.94 ?  464  LEU A CD1   1 
ATOM   3510 C  CD2   . LEU C 3 398 ? 16.174  15.550  15.230  1.00 26.36 ?  464  LEU A CD2   1 
ATOM   3511 N  N     . LEU C 3 399 ? 10.934  14.328  14.564  1.00 27.08 ?  465  LEU A N     1 
ATOM   3512 C  CA    . LEU C 3 399 ? 9.509   14.102  14.712  1.00 28.23 ?  465  LEU A CA    1 
ATOM   3513 C  C     . LEU C 3 399 ? 9.279   12.701  15.272  1.00 29.01 ?  465  LEU A C     1 
ATOM   3514 O  O     . LEU C 3 399 ? 8.456   12.516  16.156  1.00 28.54 ?  465  LEU A O     1 
ATOM   3515 C  CB    . LEU C 3 399 ? 8.781   14.259  13.373  1.00 28.19 ?  465  LEU A CB    1 
ATOM   3516 C  CG    . LEU C 3 399 ? 7.301   13.855  13.423  1.00 29.03 ?  465  LEU A CG    1 
ATOM   3517 C  CD1   . LEU C 3 399 ? 6.580   14.568  14.567  1.00 26.35 ?  465  LEU A CD1   1 
ATOM   3518 C  CD2   . LEU C 3 399 ? 6.588   14.123  12.097  1.00 28.91 ?  465  LEU A CD2   1 
ATOM   3519 N  N     . GLN C 3 400 ? 10.016  11.721  14.757  1.00 29.20 ?  466  GLN A N     1 
ATOM   3520 C  CA    . GLN C 3 400 ? 9.856   10.347  15.229  1.00 30.22 ?  466  GLN A CA    1 
ATOM   3521 C  C     . GLN C 3 400 ? 10.392  10.186  16.649  1.00 30.14 ?  466  GLN A C     1 
ATOM   3522 O  O     . GLN C 3 400 ? 9.781   9.513   17.483  1.00 30.17 ?  466  GLN A O     1 
ATOM   3523 C  CB    . GLN C 3 400 ? 10.509  9.345   14.278  1.00 30.23 ?  466  GLN A CB    1 
ATOM   3524 C  CG    . GLN C 3 400 ? 10.082  9.478   12.809  1.00 33.46 ?  466  GLN A CG    1 
ATOM   3525 C  CD    . GLN C 3 400 ? 8.667   9.002   12.527  1.00 39.51 ?  466  GLN A CD    1 
ATOM   3526 O  OE1   . GLN C 3 400 ? 8.133   9.190   11.415  1.00 41.01 ?  466  GLN A OE1   1 
ATOM   3527 N  NE2   . GLN C 3 400 ? 8.048   8.371   13.519  1.00 40.97 ?  466  GLN A NE2   1 
ATOM   3528 N  N     . PHE C 3 401 ? 11.520  10.822  16.938  1.00 30.08 ?  467  PHE A N     1 
ATOM   3529 C  CA    . PHE C 3 401 ? 12.038  10.827  18.306  1.00 30.24 ?  467  PHE A CA    1 
ATOM   3530 C  C     . PHE C 3 401 ? 11.034  11.420  19.300  1.00 30.98 ?  467  PHE A C     1 
ATOM   3531 O  O     . PHE C 3 401 ? 10.667  10.781  20.299  1.00 30.63 ?  467  PHE A O     1 
ATOM   3532 C  CB    . PHE C 3 401 ? 13.328  11.623  18.389  1.00 30.07 ?  467  PHE A CB    1 
ATOM   3533 C  CG    . PHE C 3 401 ? 13.906  11.682  19.769  1.00 29.30 ?  467  PHE A CG    1 
ATOM   3534 C  CD1   . PHE C 3 401 ? 14.640  10.618  20.269  1.00 27.16 ?  467  PHE A CD1   1 
ATOM   3535 C  CD2   . PHE C 3 401 ? 13.709  12.796  20.568  1.00 28.32 ?  467  PHE A CD2   1 
ATOM   3536 C  CE1   . PHE C 3 401 ? 15.179  10.665  21.543  1.00 27.97 ?  467  PHE A CE1   1 
ATOM   3537 C  CE2   . PHE C 3 401 ? 14.245  12.858  21.842  1.00 29.42 ?  467  PHE A CE2   1 
ATOM   3538 C  CZ    . PHE C 3 401 ? 14.985  11.781  22.334  1.00 28.52 ?  467  PHE A CZ    1 
ATOM   3539 N  N     . ILE C 3 402 ? 10.602  12.650  19.041  1.00 30.94 ?  468  ILE A N     1 
ATOM   3540 C  CA    . ILE C 3 402 ? 9.716   13.341  19.971  1.00 31.41 ?  468  ILE A CA    1 
ATOM   3541 C  C     . ILE C 3 402 ? 8.393   12.590  20.171  1.00 32.10 ?  468  ILE A C     1 
ATOM   3542 O  O     . ILE C 3 402 ? 7.883   12.490  21.297  1.00 32.29 ?  468  ILE A O     1 
ATOM   3543 C  CB    . ILE C 3 402 ? 9.452   14.798  19.537  1.00 31.29 ?  468  ILE A CB    1 
ATOM   3544 C  CG1   . ILE C 3 402 ? 10.746  15.616  19.582  1.00 30.76 ?  468  ILE A CG1   1 
ATOM   3545 C  CG2   . ILE C 3 402 ? 8.393   15.444  20.435  1.00 30.44 ?  468  ILE A CG2   1 
ATOM   3546 C  CD1   . ILE C 3 402 ? 10.571  17.044  19.092  1.00 27.46 ?  468  ILE A CD1   1 
ATOM   3547 N  N     . GLN C 3 403 ? 7.840   12.053  19.088  1.00 32.62 ?  469  GLN A N     1 
ATOM   3548 C  CA    . GLN C 3 403 ? 6.617   11.255  19.192  1.00 33.43 ?  469  GLN A CA    1 
ATOM   3549 C  C     . GLN C 3 403 ? 6.793   10.048  20.122  1.00 34.11 ?  469  GLN A C     1 
ATOM   3550 O  O     . GLN C 3 403 ? 5.893   9.713   20.902  1.00 33.69 ?  469  GLN A O     1 
ATOM   3551 C  CB    . GLN C 3 403 ? 6.143   10.796  17.815  1.00 33.40 ?  469  GLN A CB    1 
ATOM   3552 C  CG    . GLN C 3 403 ? 5.442   11.891  17.020  1.00 35.30 ?  469  GLN A CG    1 
ATOM   3553 C  CD    . GLN C 3 403 ? 4.933   11.417  15.674  1.00 37.02 ?  469  GLN A CD    1 
ATOM   3554 O  OE1   . GLN C 3 403 ? 5.443   10.455  15.101  1.00 39.96 ?  469  GLN A OE1   1 
ATOM   3555 N  NE2   . GLN C 3 403 ? 3.936   12.100  15.154  1.00 38.35 ?  469  GLN A NE2   1 
ATOM   3556 N  N     . ARG C 3 404 ? 7.942   9.386   20.036  1.00 34.33 ?  470  ARG A N     1 
ATOM   3557 C  CA    . ARG C 3 404 ? 8.197   8.254   20.910  1.00 34.97 ?  470  ARG A CA    1 
ATOM   3558 C  C     . ARG C 3 404 ? 8.420   8.654   22.353  1.00 35.03 ?  470  ARG A C     1 
ATOM   3559 O  O     . ARG C 3 404 ? 8.003   7.942   23.266  1.00 35.02 ?  470  ARG A O     1 
ATOM   3560 C  CB    . ARG C 3 404 ? 9.389   7.425   20.429  1.00 35.39 ?  470  ARG A CB    1 
ATOM   3561 C  CG    . ARG C 3 404 ? 9.027   6.481   19.316  1.00 37.46 ?  470  ARG A CG    1 
ATOM   3562 C  CD    . ARG C 3 404 ? 9.658   5.111   19.514  1.00 41.10 ?  470  ARG A CD    1 
ATOM   3563 N  NE    . ARG C 3 404 ? 9.396   4.253   18.361  1.00 42.93 ?  470  ARG A NE    1 
ATOM   3564 C  CZ    . ARG C 3 404 ? 9.908   3.036   18.189  1.00 42.23 ?  470  ARG A CZ    1 
ATOM   3565 N  NH1   . ARG C 3 404 ? 10.717  2.511   19.099  1.00 41.36 ?  470  ARG A NH1   1 
ATOM   3566 N  NH2   . ARG C 3 404 ? 9.605   2.345   17.103  1.00 42.86 ?  470  ARG A NH2   1 
ATOM   3567 N  N     . GLU C 3 405 ? 9.085   9.782   22.571  1.00 34.41 ?  471  GLU A N     1 
ATOM   3568 C  CA    . GLU C 3 405 ? 9.588   10.066  23.907  1.00 34.72 ?  471  GLU A CA    1 
ATOM   3569 C  C     . GLU C 3 405 ? 8.752   11.083  24.689  1.00 34.53 ?  471  GLU A C     1 
ATOM   3570 O  O     . GLU C 3 405 ? 8.978   11.297  25.887  1.00 34.98 ?  471  GLU A O     1 
ATOM   3571 C  CB    . GLU C 3 405 ? 11.056  10.491  23.835  1.00 34.74 ?  471  GLU A CB    1 
ATOM   3572 C  CG    . GLU C 3 405 ? 11.965  9.441   23.199  1.00 35.58 ?  471  GLU A CG    1 
ATOM   3573 C  CD    . GLU C 3 405 ? 12.183  8.236   24.099  1.00 37.37 ?  471  GLU A CD    1 
ATOM   3574 O  OE1   . GLU C 3 405 ? 12.205  8.414   25.335  1.00 38.43 ?  471  GLU A OE1   1 
ATOM   3575 O  OE2   . GLU C 3 405 ? 12.339  7.113   23.573  1.00 38.04 ?  471  GLU A OE2   1 
ATOM   3576 N  N     . TYR C 3 406 ? 7.784   11.704  24.021  1.00 33.97 ?  472  TYR A N     1 
ATOM   3577 C  CA    . TYR C 3 406 ? 6.959   12.706  24.677  1.00 33.88 ?  472  TYR A CA    1 
ATOM   3578 C  C     . TYR C 3 406 ? 5.492   12.587  24.304  1.00 33.72 ?  472  TYR A C     1 
ATOM   3579 O  O     . TYR C 3 406 ? 5.153   12.227  23.178  1.00 33.36 ?  472  TYR A O     1 
ATOM   3580 C  CB    . TYR C 3 406 ? 7.448   14.126  24.370  1.00 33.58 ?  472  TYR A CB    1 
ATOM   3581 C  CG    . TYR C 3 406 ? 8.814   14.430  24.926  1.00 34.42 ?  472  TYR A CG    1 
ATOM   3582 C  CD1   . TYR C 3 406 ? 8.965   14.962  26.200  1.00 35.30 ?  472  TYR A CD1   1 
ATOM   3583 C  CD2   . TYR C 3 406 ? 9.962   14.186  24.173  1.00 34.95 ?  472  TYR A CD2   1 
ATOM   3584 C  CE1   . TYR C 3 406 ? 10.225  15.235  26.715  1.00 36.03 ?  472  TYR A CE1   1 
ATOM   3585 C  CE2   . TYR C 3 406 ? 11.217  14.462  24.672  1.00 35.04 ?  472  TYR A CE2   1 
ATOM   3586 C  CZ    . TYR C 3 406 ? 11.345  14.982  25.942  1.00 36.63 ?  472  TYR A CZ    1 
ATOM   3587 O  OH    . TYR C 3 406 ? 12.598  15.254  26.439  1.00 38.06 ?  472  TYR A OH    1 
ATOM   3588 N  N     . LYS C 3 407 ? 4.634   12.886  25.279  1.00 33.05 ?  473  LYS A N     1 
ATOM   3589 C  CA    . LYS C 3 407 ? 3.203   12.969  25.064  1.00 33.15 ?  473  LYS A CA    1 
ATOM   3590 C  C     . LYS C 3 407 ? 2.827   14.439  24.997  1.00 32.91 ?  473  LYS A C     1 
ATOM   3591 O  O     . LYS C 3 407 ? 2.840   15.131  26.018  1.00 33.03 ?  473  LYS A O     1 
ATOM   3592 C  CB    . LYS C 3 407 ? 2.449   12.310  26.222  1.00 32.66 ?  473  LYS A CB    1 
ATOM   3593 N  N     . LEU C 3 408 ? 2.495   14.908  23.798  1.00 32.48 ?  474  LEU A N     1 
ATOM   3594 C  CA    . LEU C 3 408 ? 2.164   16.312  23.572  1.00 32.04 ?  474  LEU A CA    1 
ATOM   3595 C  C     . LEU C 3 408 ? 0.835   16.434  22.838  1.00 31.89 ?  474  LEU A C     1 
ATOM   3596 O  O     . LEU C 3 408 ? 0.394   15.496  22.178  1.00 31.59 ?  474  LEU A O     1 
ATOM   3597 C  CB    . LEU C 3 408 ? 3.253   16.981  22.728  1.00 31.91 ?  474  LEU A CB    1 
ATOM   3598 C  CG    . LEU C 3 408 ? 4.713   16.830  23.163  1.00 32.36 ?  474  LEU A CG    1 
ATOM   3599 C  CD1   . LEU C 3 408 ? 5.675   17.421  22.108  1.00 30.96 ?  474  LEU A CD1   1 
ATOM   3600 C  CD2   . LEU C 3 408 ? 4.946   17.464  24.526  1.00 32.57 ?  474  LEU A CD2   1 
ATOM   3601 N  N     . ARG C 3 409 ? 0.205   17.600  22.938  1.00 31.93 ?  475  ARG A N     1 
ATOM   3602 C  CA    . ARG C 3 409 ? -1.061  17.830  22.253  1.00 32.31 ?  475  ARG A CA    1 
ATOM   3603 C  C     . ARG C 3 409 ? -0.829  18.012  20.768  1.00 32.07 ?  475  ARG A C     1 
ATOM   3604 O  O     . ARG C 3 409 ? -1.708  17.715  19.958  1.00 32.43 ?  475  ARG A O     1 
ATOM   3605 C  CB    . ARG C 3 409 ? -1.795  19.051  22.818  1.00 32.19 ?  475  ARG A CB    1 
ATOM   3606 C  CG    . ARG C 3 409 ? -2.974  18.729  23.721  1.00 34.50 ?  475  ARG A CG    1 
ATOM   3607 C  CD    . ARG C 3 409 ? -4.036  17.851  23.026  1.00 36.54 ?  475  ARG A CD    1 
ATOM   3608 N  NE    . ARG C 3 409 ? -5.334  17.925  23.706  1.00 34.30 ?  475  ARG A NE    1 
ATOM   3609 C  CZ    . ARG C 3 409 ? -6.353  18.671  23.286  1.00 36.36 ?  475  ARG A CZ    1 
ATOM   3610 N  NH1   . ARG C 3 409 ? -7.498  18.700  23.966  1.00 33.85 ?  475  ARG A NH1   1 
ATOM   3611 N  NH2   . ARG C 3 409 ? -6.227  19.396  22.180  1.00 36.51 ?  475  ARG A NH2   1 
ATOM   3612 N  N     . SER C 3 410 ? 0.359   18.500  20.415  1.00 31.99 ?  476  SER A N     1 
ATOM   3613 C  CA    . SER C 3 410 ? 0.715   18.718  19.015  1.00 31.19 ?  476  SER A CA    1 
ATOM   3614 C  C     . SER C 3 410 ? 2.199   18.460  18.740  1.00 30.95 ?  476  SER A C     1 
ATOM   3615 O  O     . SER C 3 410 ? 3.064   18.764  19.571  1.00 30.54 ?  476  SER A O     1 
ATOM   3616 C  CB    . SER C 3 410 ? 0.344   20.138  18.574  1.00 31.51 ?  476  SER A CB    1 
ATOM   3617 O  OG    . SER C 3 410 ? 0.784   20.381  17.244  1.00 30.46 ?  476  SER A OG    1 
ATOM   3618 N  N     . TYR C 3 411 ? 2.480   17.903  17.563  1.00 30.44 ?  477  TYR A N     1 
ATOM   3619 C  CA    . TYR C 3 411 ? 3.851   17.605  17.154  1.00 30.39 ?  477  TYR A CA    1 
ATOM   3620 C  C     . TYR C 3 411 ? 4.292   18.349  15.888  1.00 30.25 ?  477  TYR A C     1 
ATOM   3621 O  O     . TYR C 3 411 ? 5.174   17.875  15.180  1.00 30.38 ?  477  TYR A O     1 
ATOM   3622 C  CB    . TYR C 3 411 ? 4.039   16.099  16.949  1.00 30.23 ?  477  TYR A CB    1 
ATOM   3623 C  CG    . TYR C 3 411 ? 3.841   15.263  18.204  1.00 31.21 ?  477  TYR A CG    1 
ATOM   3624 C  CD1   . TYR C 3 411 ? 4.909   14.956  19.038  1.00 31.31 ?  477  TYR A CD1   1 
ATOM   3625 C  CD2   . TYR C 3 411 ? 2.579   14.782  18.551  1.00 32.14 ?  477  TYR A CD2   1 
ATOM   3626 C  CE1   . TYR C 3 411 ? 4.727   14.186  20.185  1.00 31.26 ?  477  TYR A CE1   1 
ATOM   3627 C  CE2   . TYR C 3 411 ? 2.387   14.012  19.690  1.00 32.64 ?  477  TYR A CE2   1 
ATOM   3628 C  CZ    . TYR C 3 411 ? 3.464   13.719  20.499  1.00 32.77 ?  477  TYR A CZ    1 
ATOM   3629 O  OH    . TYR C 3 411 ? 3.275   12.959  21.628  1.00 33.65 ?  477  TYR A OH    1 
ATOM   3630 N  N     . THR C 3 412 ? 3.687   19.500  15.589  1.00 30.08 ?  478  THR A N     1 
ATOM   3631 C  CA    . THR C 3 412 ? 4.185   20.321  14.483  1.00 29.93 ?  478  THR A CA    1 
ATOM   3632 C  C     . THR C 3 412 ? 5.522   20.929  14.879  1.00 29.94 ?  478  THR A C     1 
ATOM   3633 O  O     . THR C 3 412 ? 5.783   21.135  16.065  1.00 29.86 ?  478  THR A O     1 
ATOM   3634 C  CB    . THR C 3 412 ? 3.245   21.498  14.120  1.00 29.96 ?  478  THR A CB    1 
ATOM   3635 O  OG1   . THR C 3 412 ? 3.087   22.351  15.259  1.00 30.01 ?  478  THR A OG1   1 
ATOM   3636 C  CG2   . THR C 3 412 ? 1.891   20.998  13.636  1.00 30.27 ?  478  THR A CG2   1 
ATOM   3637 N  N     . LEU C 3 413 ? 6.369   21.225  13.893  1.00 29.65 ?  479  LEU A N     1 
ATOM   3638 C  CA    . LEU C 3 413 ? 7.665   21.812  14.195  1.00 29.43 ?  479  LEU A CA    1 
ATOM   3639 C  C     . LEU C 3 413 ? 7.477   23.075  15.027  1.00 29.38 ?  479  LEU A C     1 
ATOM   3640 O  O     . LEU C 3 413 ? 8.144   23.263  16.045  1.00 29.57 ?  479  LEU A O     1 
ATOM   3641 C  CB    . LEU C 3 413 ? 8.441   22.123  12.919  1.00 29.49 ?  479  LEU A CB    1 
ATOM   3642 C  CG    . LEU C 3 413 ? 9.865   22.668  13.087  1.00 29.43 ?  479  LEU A CG    1 
ATOM   3643 C  CD1   . LEU C 3 413 ? 10.674  21.852  14.088  1.00 29.31 ?  479  LEU A CD1   1 
ATOM   3644 C  CD2   . LEU C 3 413 ? 10.575  22.690  11.735  1.00 29.69 ?  479  LEU A CD2   1 
ATOM   3645 N  N     . ASN C 3 414 ? 6.561   23.934  14.597  1.00 29.15 ?  480  ASN A N     1 
ATOM   3646 C  CA    . ASN C 3 414 ? 6.235   25.145  15.354  1.00 29.10 ?  480  ASN A CA    1 
ATOM   3647 C  C     . ASN C 3 414 ? 5.834   24.846  16.795  1.00 28.87 ?  480  ASN A C     1 
ATOM   3648 O  O     . ASN C 3 414 ? 6.315   25.485  17.732  1.00 28.60 ?  480  ASN A O     1 
ATOM   3649 C  CB    . ASN C 3 414 ? 5.108   25.917  14.668  1.00 29.33 ?  480  ASN A CB    1 
ATOM   3650 N  N     . ALA C 3 415 ? 4.951   23.871  16.974  1.00 28.60 ?  481  ALA A N     1 
ATOM   3651 C  CA    . ALA C 3 415 ? 4.459   23.571  18.314  1.00 28.99 ?  481  ALA A CA    1 
ATOM   3652 C  C     . ALA C 3 415 ? 5.581   23.107  19.234  1.00 29.18 ?  481  ALA A C     1 
ATOM   3653 O  O     . ALA C 3 415 ? 5.715   23.618  20.354  1.00 28.90 ?  481  ALA A O     1 
ATOM   3654 C  CB    . ALA C 3 415 ? 3.334   22.554  18.266  1.00 28.93 ?  481  ALA A CB    1 
ATOM   3655 N  N     . VAL C 3 416 ? 6.394   22.155  18.766  1.00 29.24 ?  482  VAL A N     1 
ATOM   3656 C  CA    . VAL C 3 416 ? 7.450   21.600  19.606  1.00 29.46 ?  482  VAL A CA    1 
ATOM   3657 C  C     . VAL C 3 416 ? 8.621   22.559  19.817  1.00 30.06 ?  482  VAL A C     1 
ATOM   3658 O  O     . VAL C 3 416 ? 9.288   22.504  20.855  1.00 30.46 ?  482  VAL A O     1 
ATOM   3659 C  CB    . VAL C 3 416 ? 7.975   20.227  19.097  1.00 29.84 ?  482  VAL A CB    1 
ATOM   3660 C  CG1   . VAL C 3 416 ? 6.821   19.233  18.918  1.00 29.27 ?  482  VAL A CG1   1 
ATOM   3661 C  CG2   . VAL C 3 416 ? 8.783   20.388  17.825  1.00 28.94 ?  482  VAL A CG2   1 
ATOM   3662 N  N     . SER C 3 417 ? 8.869   23.429  18.839  1.00 30.15 ?  483  SER A N     1 
ATOM   3663 C  CA    . SER C 3 417 ? 9.901   24.456  18.966  1.00 30.55 ?  483  SER A CA    1 
ATOM   3664 C  C     . SER C 3 417 ? 9.510   25.490  20.027  1.00 30.90 ?  483  SER A C     1 
ATOM   3665 O  O     . SER C 3 417 ? 10.340  25.924  20.825  1.00 30.89 ?  483  SER A O     1 
ATOM   3666 C  CB    . SER C 3 417 ? 10.139  25.142  17.620  1.00 30.27 ?  483  SER A CB    1 
ATOM   3667 O  OG    . SER C 3 417 ? 10.588  24.196  16.657  1.00 31.07 ?  483  SER A OG    1 
ATOM   3668 N  N     . ALA C 3 418 ? 8.243   25.882  20.021  1.00 31.30 ?  484  ALA A N     1 
ATOM   3669 C  CA    . ALA C 3 418 ? 7.726   26.813  21.019  1.00 31.87 ?  484  ALA A CA    1 
ATOM   3670 C  C     . ALA C 3 418 ? 7.787   26.167  22.403  1.00 32.34 ?  484  ALA A C     1 
ATOM   3671 O  O     . ALA C 3 418 ? 8.165   26.810  23.378  1.00 32.57 ?  484  ALA A O     1 
ATOM   3672 C  CB    . ALA C 3 418 ? 6.309   27.211  20.678  1.00 31.62 ?  484  ALA A CB    1 
ATOM   3673 N  N     . HIS C 3 419 ? 7.447   24.882  22.464  1.00 33.22 ?  485  HIS A N     1 
ATOM   3674 C  CA    . HIS C 3 419 ? 7.370   24.128  23.719  1.00 33.96 ?  485  HIS A CA    1 
ATOM   3675 C  C     . HIS C 3 419 ? 8.742   23.862  24.343  1.00 34.60 ?  485  HIS A C     1 
ATOM   3676 O  O     . HIS C 3 419 ? 8.952   24.140  25.526  1.00 34.81 ?  485  HIS A O     1 
ATOM   3677 C  CB    . HIS C 3 419 ? 6.629   22.807  23.483  1.00 33.99 ?  485  HIS A CB    1 
ATOM   3678 C  CG    . HIS C 3 419 ? 6.524   21.936  24.695  1.00 34.41 ?  485  HIS A CG    1 
ATOM   3679 N  ND1   . HIS C 3 419 ? 5.626   22.181  25.713  1.00 34.49 ?  485  HIS A ND1   1 
ATOM   3680 C  CD2   . HIS C 3 419 ? 7.186   20.806  25.042  1.00 34.70 ?  485  HIS A CD2   1 
ATOM   3681 C  CE1   . HIS C 3 419 ? 5.751   21.248  26.641  1.00 35.26 ?  485  HIS A CE1   1 
ATOM   3682 N  NE2   . HIS C 3 419 ? 6.693   20.405  26.261  1.00 34.08 ?  485  HIS A NE2   1 
ATOM   3683 N  N     . PHE C 3 420 ? 9.672   23.343  23.542  1.00 34.78 ?  486  PHE A N     1 
ATOM   3684 C  CA    . PHE C 3 420 ? 10.997  22.972  24.037  1.00 35.21 ?  486  PHE A CA    1 
ATOM   3685 C  C     . PHE C 3 420 ? 12.034  24.079  23.921  1.00 35.89 ?  486  PHE A C     1 
ATOM   3686 O  O     . PHE C 3 420 ? 12.964  24.151  24.724  1.00 35.73 ?  486  PHE A O     1 
ATOM   3687 C  CB    . PHE C 3 420 ? 11.527  21.739  23.298  1.00 34.77 ?  486  PHE A CB    1 
ATOM   3688 C  CG    . PHE C 3 420 ? 10.767  20.476  23.591  1.00 33.95 ?  486  PHE A CG    1 
ATOM   3689 C  CD1   . PHE C 3 420 ? 10.659  19.996  24.898  1.00 32.65 ?  486  PHE A CD1   1 
ATOM   3690 C  CD2   . PHE C 3 420 ? 10.179  19.754  22.563  1.00 32.25 ?  486  PHE A CD2   1 
ATOM   3691 C  CE1   . PHE C 3 420 ? 9.972   18.833  25.170  1.00 30.93 ?  486  PHE A CE1   1 
ATOM   3692 C  CE2   . PHE C 3 420 ? 9.482   18.583  22.833  1.00 33.54 ?  486  PHE A CE2   1 
ATOM   3693 C  CZ    . PHE C 3 420 ? 9.379   18.122  24.148  1.00 31.54 ?  486  PHE A CZ    1 
ATOM   3694 N  N     . LEU C 3 421 ? 11.894  24.931  22.911  1.00 37.08 ?  487  LEU A N     1 
ATOM   3695 C  CA    . LEU C 3 421 ? 12.930  25.914  22.617  1.00 38.19 ?  487  LEU A CA    1 
ATOM   3696 C  C     . LEU C 3 421 ? 12.525  27.331  22.983  1.00 39.28 ?  487  LEU A C     1 
ATOM   3697 O  O     . LEU C 3 421 ? 13.367  28.230  23.032  1.00 39.36 ?  487  LEU A O     1 
ATOM   3698 C  CB    . LEU C 3 421 ? 13.320  25.854  21.139  1.00 38.11 ?  487  LEU A CB    1 
ATOM   3699 C  CG    . LEU C 3 421 ? 13.823  24.476  20.707  1.00 38.23 ?  487  LEU A CG    1 
ATOM   3700 C  CD1   . LEU C 3 421 ? 14.320  24.522  19.282  1.00 37.66 ?  487  LEU A CD1   1 
ATOM   3701 C  CD2   . LEU C 3 421 ? 14.912  23.982  21.650  1.00 37.99 ?  487  LEU A CD2   1 
ATOM   3702 N  N     . GLY C 3 422 ? 11.238  27.534  23.232  1.00 40.39 ?  488  GLY A N     1 
ATOM   3703 C  CA    . GLY C 3 422 ? 10.736  28.871  23.524  1.00 41.87 ?  488  GLY A CA    1 
ATOM   3704 C  C     . GLY C 3 422 ? 10.518  29.716  22.281  1.00 42.96 ?  488  GLY A C     1 
ATOM   3705 O  O     . GLY C 3 422 ? 10.537  30.945  22.347  1.00 43.29 ?  488  GLY A O     1 
ATOM   3706 N  N     . GLU C 3 423 ? 10.310  29.066  21.139  1.00 43.86 ?  489  GLU A N     1 
ATOM   3707 C  CA    . GLU C 3 423 ? 9.987   29.796  19.914  1.00 44.96 ?  489  GLU A CA    1 
ATOM   3708 C  C     . GLU C 3 423 ? 8.547   30.308  19.918  1.00 45.20 ?  489  GLU A C     1 
ATOM   3709 O  O     . GLU C 3 423 ? 7.693   29.786  20.635  1.00 45.17 ?  489  GLU A O     1 
ATOM   3710 C  CB    . GLU C 3 423 ? 10.251  28.940  18.671  1.00 45.08 ?  489  GLU A CB    1 
ATOM   3711 C  CG    . GLU C 3 423 ? 11.413  29.438  17.811  1.00 46.96 ?  489  GLU A CG    1 
ATOM   3712 C  CD    . GLU C 3 423 ? 12.764  29.340  18.508  1.00 48.89 ?  489  GLU A CD    1 
ATOM   3713 O  OE1   . GLU C 3 423 ? 13.505  30.349  18.527  1.00 49.52 ?  489  GLU A OE1   1 
ATOM   3714 O  OE2   . GLU C 3 423 ? 13.086  28.251  19.032  1.00 49.71 ?  489  GLU A OE2   1 
ATOM   3715 N  N     . GLN C 3 424 ? 8.289   31.334  19.112  1.00 45.72 ?  490  GLN A N     1 
ATOM   3716 C  CA    . GLN C 3 424 ? 6.958   31.928  19.015  1.00 46.08 ?  490  GLN A CA    1 
ATOM   3717 C  C     . GLN C 3 424 ? 5.969   30.982  18.331  1.00 46.43 ?  490  GLN A C     1 
ATOM   3718 O  O     . GLN C 3 424 ? 4.750   31.158  18.436  1.00 46.66 ?  490  GLN A O     1 
ATOM   3719 C  CB    . GLN C 3 424 ? 7.021   33.255  18.255  1.00 46.22 ?  490  GLN A CB    1 
ATOM   3720 N  N     . SER C 3 431 ? 1.505   27.967  1.466   1.00 41.84 ?  497  SER A N     1 
ATOM   3721 C  CA    . SER C 3 431 ? 0.558   29.063  1.342   1.00 41.70 ?  497  SER A CA    1 
ATOM   3722 C  C     . SER C 3 431 ? 1.113   30.169  0.446   1.00 41.60 ?  497  SER A C     1 
ATOM   3723 O  O     . SER C 3 431 ? 0.542   30.488  -0.603  1.00 41.71 ?  497  SER A O     1 
ATOM   3724 C  CB    . SER C 3 431 ? 0.213   29.626  2.723   1.00 42.03 ?  497  SER A CB    1 
ATOM   3725 N  N     . ILE C 3 432 ? 2.230   30.750  0.869   1.00 41.25 ?  498  ILE A N     1 
ATOM   3726 C  CA    . ILE C 3 432 ? 2.896   31.798  0.107   1.00 40.79 ?  498  ILE A CA    1 
ATOM   3727 C  C     . ILE C 3 432 ? 4.148   31.243  -0.562  1.00 40.58 ?  498  ILE A C     1 
ATOM   3728 O  O     . ILE C 3 432 ? 4.783   31.912  -1.376  1.00 40.59 ?  498  ILE A O     1 
ATOM   3729 C  CB    . ILE C 3 432 ? 3.318   32.948  1.029   1.00 40.82 ?  498  ILE A CB    1 
ATOM   3730 C  CG1   . ILE C 3 432 ? 4.422   32.477  1.981   1.00 40.49 ?  498  ILE A CG1   1 
ATOM   3731 C  CG2   . ILE C 3 432 ? 2.126   33.453  1.815   1.00 41.06 ?  498  ILE A CG2   1 
ATOM   3732 C  CD1   . ILE C 3 432 ? 4.903   33.531  2.953   1.00 40.17 ?  498  ILE A CD1   1 
ATOM   3733 N  N     . ILE C 3 433 ? 4.504   30.010  -0.214  1.00 40.42 ?  499  ILE A N     1 
ATOM   3734 C  CA    . ILE C 3 433 ? 5.771   29.440  -0.666  1.00 40.00 ?  499  ILE A CA    1 
ATOM   3735 C  C     . ILE C 3 433 ? 5.975   29.614  -2.167  1.00 39.99 ?  499  ILE A C     1 
ATOM   3736 O  O     . ILE C 3 433 ? 6.976   30.187  -2.600  1.00 40.00 ?  499  ILE A O     1 
ATOM   3737 C  CB    . ILE C 3 433 ? 5.916   27.964  -0.265  1.00 39.92 ?  499  ILE A CB    1 
ATOM   3738 C  CG1   . ILE C 3 433 ? 5.968   27.846  1.261   1.00 39.64 ?  499  ILE A CG1   1 
ATOM   3739 C  CG2   . ILE C 3 433 ? 7.179   27.367  -0.875  1.00 39.81 ?  499  ILE A CG2   1 
ATOM   3740 C  CD1   . ILE C 3 433 ? 6.338   26.470  1.756   1.00 38.53 ?  499  ILE A CD1   1 
ATOM   3741 N  N     . SER C 3 434 ? 5.018   29.139  -2.958  1.00 39.71 ?  500  SER A N     1 
ATOM   3742 C  CA    . SER C 3 434 ? 5.145   29.177  -4.413  1.00 39.23 ?  500  SER A CA    1 
ATOM   3743 C  C     . SER C 3 434 ? 5.215   30.603  -4.950  1.00 38.95 ?  500  SER A C     1 
ATOM   3744 O  O     . SER C 3 434 ? 5.882   30.860  -5.952  1.00 38.96 ?  500  SER A O     1 
ATOM   3745 C  CB    . SER C 3 434 ? 4.007   28.402  -5.084  1.00 39.29 ?  500  SER A CB    1 
ATOM   3746 O  OG    . SER C 3 434 ? 4.101   27.014  -4.789  1.00 39.41 ?  500  SER A OG    1 
ATOM   3747 N  N     . ASP C 3 435 ? 4.536   31.531  -4.285  1.00 38.48 ?  501  ASP A N     1 
ATOM   3748 C  CA    . ASP C 3 435 ? 4.590   32.932  -4.695  1.00 38.24 ?  501  ASP A CA    1 
ATOM   3749 C  C     . ASP C 3 435 ? 5.980   33.520  -4.475  1.00 37.60 ?  501  ASP A C     1 
ATOM   3750 O  O     . ASP C 3 435 ? 6.536   34.172  -5.360  1.00 37.58 ?  501  ASP A O     1 
ATOM   3751 C  CB    . ASP C 3 435 ? 3.541   33.754  -3.954  1.00 38.59 ?  501  ASP A CB    1 
ATOM   3752 C  CG    . ASP C 3 435 ? 2.131   33.412  -4.384  1.00 39.64 ?  501  ASP A CG    1 
ATOM   3753 O  OD1   . ASP C 3 435 ? 1.908   33.238  -5.604  1.00 40.98 ?  501  ASP A OD1   1 
ATOM   3754 O  OD2   . ASP C 3 435 ? 1.247   33.316  -3.505  1.00 40.66 ?  501  ASP A OD2   1 
ATOM   3755 N  N     . LEU C 3 436 ? 6.540   33.293  -3.290  1.00 36.77 ?  502  LEU A N     1 
ATOM   3756 C  CA    . LEU C 3 436 ? 7.910   33.719  -3.008  1.00 35.90 ?  502  LEU A CA    1 
ATOM   3757 C  C     . LEU C 3 436 ? 8.869   33.185  -4.072  1.00 35.43 ?  502  LEU A C     1 
ATOM   3758 O  O     . LEU C 3 436 ? 9.773   33.896  -4.528  1.00 34.97 ?  502  LEU A O     1 
ATOM   3759 C  CB    . LEU C 3 436 ? 8.347   33.239  -1.624  1.00 35.80 ?  502  LEU A CB    1 
ATOM   3760 C  CG    . LEU C 3 436 ? 7.590   33.828  -0.434  1.00 35.41 ?  502  LEU A CG    1 
ATOM   3761 C  CD1   . LEU C 3 436 ? 8.059   33.191  0.865   1.00 34.55 ?  502  LEU A CD1   1 
ATOM   3762 C  CD2   . LEU C 3 436 ? 7.776   35.334  -0.392  1.00 34.15 ?  502  LEU A CD2   1 
ATOM   3763 N  N     . GLN C 3 437 ? 8.663   31.929  -4.461  1.00 34.87 ?  503  GLN A N     1 
ATOM   3764 C  CA    . GLN C 3 437 ? 9.516   31.281  -5.458  1.00 34.60 ?  503  GLN A CA    1 
ATOM   3765 C  C     . GLN C 3 437 ? 9.461   31.976  -6.819  1.00 34.40 ?  503  GLN A C     1 
ATOM   3766 O  O     . GLN C 3 437 ? 10.460  32.039  -7.535  1.00 34.24 ?  503  GLN A O     1 
ATOM   3767 C  CB    . GLN C 3 437 ? 9.129   29.812  -5.631  1.00 34.31 ?  503  GLN A CB    1 
ATOM   3768 C  CG    . GLN C 3 437 ? 9.990   29.070  -6.637  1.00 33.88 ?  503  GLN A CG    1 
ATOM   3769 C  CD    . GLN C 3 437 ? 11.459  29.104  -6.271  1.00 34.19 ?  503  GLN A CD    1 
ATOM   3770 O  OE1   . GLN C 3 437 ? 11.810  29.197  -5.095  1.00 35.34 ?  503  GLN A OE1   1 
ATOM   3771 N  NE2   . GLN C 3 437 ? 12.327  29.028  -7.271  1.00 33.32 ?  503  GLN A NE2   1 
ATOM   3772 N  N     . ASN C 3 438 ? 8.288   32.482  -7.179  1.00 34.48 ?  504  ASN A N     1 
ATOM   3773 C  CA    . ASN C 3 438 ? 8.092   33.084  -8.502  1.00 34.39 ?  504  ASN A CA    1 
ATOM   3774 C  C     . ASN C 3 438 ? 8.338   34.591  -8.530  1.00 34.04 ?  504  ASN A C     1 
ATOM   3775 O  O     . ASN C 3 438 ? 8.065   35.261  -9.527  1.00 33.71 ?  504  ASN A O     1 
ATOM   3776 C  CB    . ASN C 3 438 ? 6.700   32.746  -9.037  1.00 34.44 ?  504  ASN A CB    1 
ATOM   3777 C  CG    . ASN C 3 438 ? 6.481   31.250  -9.166  1.00 35.84 ?  504  ASN A CG    1 
ATOM   3778 O  OD1   . ASN C 3 438 ? 5.455   30.722  -8.738  1.00 38.19 ?  504  ASN A OD1   1 
ATOM   3779 N  ND2   . ASN C 3 438 ? 7.455   30.556  -9.742  1.00 36.03 ?  504  ASN A ND2   1 
ATOM   3780 N  N     . GLY C 3 439 ? 8.864   35.117  -7.429  1.00 33.67 ?  505  GLY A N     1 
ATOM   3781 C  CA    . GLY C 3 439 ? 9.198   36.535  -7.338  1.00 33.12 ?  505  GLY A CA    1 
ATOM   3782 C  C     . GLY C 3 439 ? 10.574  36.849  -7.894  1.00 32.83 ?  505  GLY A C     1 
ATOM   3783 O  O     . GLY C 3 439 ? 10.795  36.775  -9.103  1.00 33.12 ?  505  GLY A O     1 
ATOM   3784 N  N     . ASP C 3 440 ? 11.502  37.201  -7.009  1.00 32.36 ?  506  ASP A N     1 
ATOM   3785 C  CA    . ASP C 3 440 ? 12.852  37.594  -7.414  1.00 32.16 ?  506  ASP A CA    1 
ATOM   3786 C  C     . ASP C 3 440 ? 13.893  37.064  -6.425  1.00 31.97 ?  506  ASP A C     1 
ATOM   3787 O  O     . ASP C 3 440 ? 13.570  36.279  -5.534  1.00 32.52 ?  506  ASP A O     1 
ATOM   3788 C  CB    . ASP C 3 440 ? 12.949  39.121  -7.520  1.00 31.71 ?  506  ASP A CB    1 
ATOM   3789 C  CG    . ASP C 3 440 ? 12.498  39.823  -6.242  1.00 32.02 ?  506  ASP A CG    1 
ATOM   3790 O  OD1   . ASP C 3 440 ? 12.838  39.329  -5.140  1.00 31.04 ?  506  ASP A OD1   1 
ATOM   3791 O  OD2   . ASP C 3 440 ? 11.805  40.862  -6.334  1.00 30.41 ?  506  ASP A OD2   1 
ATOM   3792 N  N     . SER C 3 441 ? 15.138  37.499  -6.579  1.00 31.73 ?  507  SER A N     1 
ATOM   3793 C  CA    . SER C 3 441 ? 16.212  37.052  -5.700  1.00 31.89 ?  507  SER A CA    1 
ATOM   3794 C  C     . SER C 3 441 ? 15.880  37.323  -4.233  1.00 31.76 ?  507  SER A C     1 
ATOM   3795 O  O     . SER C 3 441 ? 16.279  36.563  -3.342  1.00 31.60 ?  507  SER A O     1 
ATOM   3796 C  CB    . SER C 3 441 ? 17.536  37.725  -6.096  1.00 32.09 ?  507  SER A CB    1 
ATOM   3797 N  N     . GLU C 3 442 ? 15.138  38.398  -3.980  1.00 31.49 ?  508  GLU A N     1 
ATOM   3798 C  CA    . GLU C 3 442 ? 14.791  38.776  -2.606  1.00 31.63 ?  508  GLU A CA    1 
ATOM   3799 C  C     . GLU C 3 442 ? 13.680  37.923  -1.987  1.00 31.34 ?  508  GLU A C     1 
ATOM   3800 O  O     . GLU C 3 442 ? 13.756  37.540  -0.813  1.00 31.16 ?  508  GLU A O     1 
ATOM   3801 C  CB    . GLU C 3 442 ? 14.435  40.267  -2.516  1.00 31.91 ?  508  GLU A CB    1 
ATOM   3802 C  CG    . GLU C 3 442 ? 15.611  41.174  -2.136  1.00 33.25 ?  508  GLU A CG    1 
ATOM   3803 C  CD    . GLU C 3 442 ? 16.013  41.030  -0.665  1.00 36.03 ?  508  GLU A CD    1 
ATOM   3804 O  OE1   . GLU C 3 442 ? 17.147  40.578  -0.394  1.00 36.78 ?  508  GLU A OE1   1 
ATOM   3805 O  OE2   . GLU C 3 442 ? 15.191  41.366  0.224   1.00 36.97 ?  508  GLU A OE2   1 
ATOM   3806 N  N     . THR C 3 443 ? 12.644  37.619  -2.762  1.00 30.86 ?  509  THR A N     1 
ATOM   3807 C  CA    . THR C 3 443 ? 11.549  36.816  -2.215  1.00 30.34 ?  509  THR A CA    1 
ATOM   3808 C  C     . THR C 3 443 ? 12.042  35.384  -1.972  1.00 30.18 ?  509  THR A C     1 
ATOM   3809 O  O     . THR C 3 443 ? 11.681  34.746  -0.985  1.00 30.12 ?  509  THR A O     1 
ATOM   3810 C  CB    . THR C 3 443 ? 10.269  36.875  -3.103  1.00 30.20 ?  509  THR A CB    1 
ATOM   3811 O  OG1   . THR C 3 443 ? 10.514  36.261  -4.377  1.00 29.97 ?  509  THR A OG1   1 
ATOM   3812 C  CG2   . THR C 3 443 ? 9.851   38.330  -3.328  1.00 29.73 ?  509  THR A CG2   1 
ATOM   3813 N  N     . ARG C 3 444 ? 12.897  34.893  -2.861  1.00 30.14 ?  510  ARG A N     1 
ATOM   3814 C  CA    . ARG C 3 444 ? 13.477  33.566  -2.671  1.00 30.14 ?  510  ARG A CA    1 
ATOM   3815 C  C     . ARG C 3 444 ? 14.418  33.547  -1.456  1.00 29.91 ?  510  ARG A C     1 
ATOM   3816 O  O     . ARG C 3 444 ? 14.467  32.565  -0.711  1.00 29.67 ?  510  ARG A O     1 
ATOM   3817 C  CB    . ARG C 3 444 ? 14.156  33.076  -3.957  1.00 30.32 ?  510  ARG A CB    1 
ATOM   3818 C  CG    . ARG C 3 444 ? 13.147  32.778  -5.083  1.00 30.46 ?  510  ARG A CG    1 
ATOM   3819 C  CD    . ARG C 3 444 ? 13.792  32.205  -6.344  1.00 30.21 ?  510  ARG A CD    1 
ATOM   3820 N  NE    . ARG C 3 444 ? 14.462  33.223  -7.147  1.00 29.63 ?  510  ARG A NE    1 
ATOM   3821 C  CZ    . ARG C 3 444 ? 13.886  33.907  -8.135  1.00 30.85 ?  510  ARG A CZ    1 
ATOM   3822 N  NH1   . ARG C 3 444 ? 12.614  33.689  -8.447  1.00 29.61 ?  510  ARG A NH1   1 
ATOM   3823 N  NH2   . ARG C 3 444 ? 14.584  34.817  -8.808  1.00 29.40 ?  510  ARG A NH2   1 
ATOM   3824 N  N     . ARG C 3 445 ? 15.138  34.645  -1.236  1.00 29.71 ?  511  ARG A N     1 
ATOM   3825 C  CA    . ARG C 3 445 ? 15.945  34.785  -0.024  1.00 29.53 ?  511  ARG A CA    1 
ATOM   3826 C  C     . ARG C 3 445 ? 15.073  34.659  1.230   1.00 29.50 ?  511  ARG A C     1 
ATOM   3827 O  O     . ARG C 3 445 ? 15.394  33.901  2.154   1.00 28.64 ?  511  ARG A O     1 
ATOM   3828 C  CB    . ARG C 3 445 ? 16.698  36.117  0.000   1.00 29.63 ?  511  ARG A CB    1 
ATOM   3829 C  CG    . ARG C 3 445 ? 17.619  36.269  1.203   1.00 29.65 ?  511  ARG A CG    1 
ATOM   3830 C  CD    . ARG C 3 445 ? 18.130  37.700  1.376   1.00 30.52 ?  511  ARG A CD    1 
ATOM   3831 N  NE    . ARG C 3 445 ? 18.689  37.884  2.714   1.00 31.34 ?  511  ARG A NE    1 
ATOM   3832 C  CZ    . ARG C 3 445 ? 17.980  38.222  3.787   1.00 31.74 ?  511  ARG A CZ    1 
ATOM   3833 N  NH1   . ARG C 3 445 ? 16.675  38.434  3.696   1.00 31.77 ?  511  ARG A NH1   1 
ATOM   3834 N  NH2   . ARG C 3 445 ? 18.578  38.354  4.961   1.00 33.42 ?  511  ARG A NH2   1 
ATOM   3835 N  N     . ARG C 3 446 ? 13.980  35.416  1.266   1.00 29.35 ?  512  ARG A N     1 
ATOM   3836 C  CA    . ARG C 3 446 ? 13.020  35.302  2.362   1.00 29.52 ?  512  ARG A CA    1 
ATOM   3837 C  C     . ARG C 3 446 ? 12.634  33.839  2.604   1.00 29.34 ?  512  ARG A C     1 
ATOM   3838 O  O     . ARG C 3 446 ? 12.619  33.356  3.740   1.00 29.22 ?  512  ARG A O     1 
ATOM   3839 C  CB    . ARG C 3 446 ? 11.763  36.123  2.064   1.00 29.74 ?  512  ARG A CB    1 
ATOM   3840 C  CG    . ARG C 3 446 ? 10.632  35.845  3.043   1.00 31.19 ?  512  ARG A CG    1 
ATOM   3841 C  CD    . ARG C 3 446 ? 9.418   36.736  2.800   1.00 33.04 ?  512  ARG A CD    1 
ATOM   3842 N  NE    . ARG C 3 446 ? 8.376   36.494  3.799   1.00 34.76 ?  512  ARG A NE    1 
ATOM   3843 C  CZ    . ARG C 3 446 ? 7.144   36.989  3.736   1.00 34.74 ?  512  ARG A CZ    1 
ATOM   3844 N  NH1   . ARG C 3 446 ? 6.790   37.755  2.715   1.00 35.75 ?  512  ARG A NH1   1 
ATOM   3845 N  NH2   . ARG C 3 446 ? 6.267   36.719  4.694   1.00 34.73 ?  512  ARG A NH2   1 
ATOM   3846 N  N     . LEU C 3 447 ? 12.302  33.141  1.525   1.00 29.06 ?  513  LEU A N     1 
ATOM   3847 C  CA    . LEU C 3 447 ? 11.965  31.729  1.603   1.00 28.81 ?  513  LEU A CA    1 
ATOM   3848 C  C     . LEU C 3 447 ? 13.151  30.937  2.158   1.00 28.47 ?  513  LEU A C     1 
ATOM   3849 O  O     . LEU C 3 447 ? 12.978  29.994  2.937   1.00 28.16 ?  513  LEU A O     1 
ATOM   3850 C  CB    . LEU C 3 447 ? 11.562  31.211  0.217   1.00 28.73 ?  513  LEU A CB    1 
ATOM   3851 C  CG    . LEU C 3 447 ? 11.123  29.746  0.090   1.00 30.11 ?  513  LEU A CG    1 
ATOM   3852 C  CD1   . LEU C 3 447 ? 10.046  29.391  1.115   1.00 28.56 ?  513  LEU A CD1   1 
ATOM   3853 C  CD2   . LEU C 3 447 ? 10.655  29.437  -1.336  1.00 30.22 ?  513  LEU A CD2   1 
ATOM   3854 N  N     . ALA C 3 448 ? 14.356  31.341  1.773   1.00 28.20 ?  514  ALA A N     1 
ATOM   3855 C  CA    . ALA C 3 448 ? 15.557  30.607  2.144   1.00 28.37 ?  514  ALA A CA    1 
ATOM   3856 C  C     . ALA C 3 448 ? 15.863  30.730  3.640   1.00 28.69 ?  514  ALA A C     1 
ATOM   3857 O  O     . ALA C 3 448 ? 16.326  29.773  4.257   1.00 28.15 ?  514  ALA A O     1 
ATOM   3858 C  CB    . ALA C 3 448 ? 16.748  31.046  1.297   1.00 28.40 ?  514  ALA A CB    1 
ATOM   3859 N  N     . VAL C 3 449 ? 15.578  31.892  4.228   1.00 28.91 ?  515  VAL A N     1 
ATOM   3860 C  CA    . VAL C 3 449 ? 15.740  32.054  5.669   1.00 29.61 ?  515  VAL A CA    1 
ATOM   3861 C  C     . VAL C 3 449 ? 14.789  31.123  6.408   1.00 29.86 ?  515  VAL A C     1 
ATOM   3862 O  O     . VAL C 3 449 ? 15.159  30.491  7.398   1.00 30.29 ?  515  VAL A O     1 
ATOM   3863 C  CB    . VAL C 3 449 ? 15.509  33.509  6.133   1.00 29.71 ?  515  VAL A CB    1 
ATOM   3864 C  CG1   . VAL C 3 449 ? 16.269  34.474  5.251   1.00 29.32 ?  515  VAL A CG1   1 
ATOM   3865 C  CG2   . VAL C 3 449 ? 14.029  33.839  6.145   1.00 30.53 ?  515  VAL A CG2   1 
ATOM   3866 N  N     . TYR C 3 450 ? 13.563  31.027  5.911   1.00 30.25 ?  516  TYR A N     1 
ATOM   3867 C  CA    . TYR C 3 450 ? 12.563  30.141  6.496   1.00 30.51 ?  516  TYR A CA    1 
ATOM   3868 C  C     . TYR C 3 450 ? 13.048  28.691  6.406   1.00 30.16 ?  516  TYR A C     1 
ATOM   3869 O  O     . TYR C 3 450 ? 12.976  27.918  7.376   1.00 29.56 ?  516  TYR A O     1 
ATOM   3870 C  CB    . TYR C 3 450 ? 11.227  30.329  5.763   1.00 31.46 ?  516  TYR A CB    1 
ATOM   3871 C  CG    . TYR C 3 450 ? 10.185  29.277  6.048   1.00 33.92 ?  516  TYR A CG    1 
ATOM   3872 C  CD1   . TYR C 3 450 ? 9.191   29.493  6.996   1.00 36.70 ?  516  TYR A CD1   1 
ATOM   3873 C  CD2   . TYR C 3 450 ? 10.189  28.059  5.361   1.00 37.26 ?  516  TYR A CD2   1 
ATOM   3874 C  CE1   . TYR C 3 450 ? 8.230   28.522  7.261   1.00 37.91 ?  516  TYR A CE1   1 
ATOM   3875 C  CE2   . TYR C 3 450 ? 9.241   27.086  5.620   1.00 37.65 ?  516  TYR A CE2   1 
ATOM   3876 C  CZ    . TYR C 3 450 ? 8.263   27.326  6.568   1.00 39.35 ?  516  TYR A CZ    1 
ATOM   3877 O  OH    . TYR C 3 450 ? 7.316   26.356  6.827   1.00 42.31 ?  516  TYR A OH    1 
ATOM   3878 N  N     . CYS C 3 451 ? 13.563  28.330  5.238   1.00 29.65 ?  517  CYS A N     1 
ATOM   3879 C  CA    . CYS C 3 451 ? 14.058  26.977  5.014   1.00 29.85 ?  517  CYS A CA    1 
ATOM   3880 C  C     . CYS C 3 451 ? 15.288  26.675  5.869   1.00 29.57 ?  517  CYS A C     1 
ATOM   3881 O  O     . CYS C 3 451 ? 15.402  25.581  6.449   1.00 28.90 ?  517  CYS A O     1 
ATOM   3882 C  CB    . CYS C 3 451 ? 14.368  26.747  3.538   1.00 29.75 ?  517  CYS A CB    1 
ATOM   3883 S  SG    . CYS C 3 451 ? 14.590  25.007  3.161   1.00 31.22 ?  517  CYS A SG    1 
ATOM   3884 N  N     . LEU C 3 452 ? 16.201  27.641  5.958   1.00 29.20 ?  518  LEU A N     1 
ATOM   3885 C  CA    . LEU C 3 452 ? 17.381  27.470  6.809   1.00 29.88 ?  518  LEU A CA    1 
ATOM   3886 C  C     . LEU C 3 452 ? 16.973  27.283  8.273   1.00 29.66 ?  518  LEU A C     1 
ATOM   3887 O  O     . LEU C 3 452 ? 17.498  26.414  8.980   1.00 29.94 ?  518  LEU A O     1 
ATOM   3888 C  CB    . LEU C 3 452 ? 18.318  28.674  6.706   1.00 29.82 ?  518  LEU A CB    1 
ATOM   3889 C  CG    . LEU C 3 452 ? 19.803  28.365  6.477   1.00 31.15 ?  518  LEU A CG    1 
ATOM   3890 C  CD1   . LEU C 3 452 ? 20.695  29.306  7.279   1.00 32.02 ?  518  LEU A CD1   1 
ATOM   3891 C  CD2   . LEU C 3 452 ? 20.138  26.898  6.773   1.00 31.24 ?  518  LEU A CD2   1 
ATOM   3892 N  N     . LYS C 3 453 ? 16.042  28.102  8.731   1.00 29.40 ?  519  LYS A N     1 
ATOM   3893 C  CA    . LYS C 3 453 ? 15.590  28.002  10.114  1.00 29.65 ?  519  LYS A CA    1 
ATOM   3894 C  C     . LYS C 3 453 ? 14.960  26.627  10.357  1.00 29.57 ?  519  LYS A C     1 
ATOM   3895 O  O     . LYS C 3 453 ? 15.181  26.006  11.394  1.00 29.42 ?  519  LYS A O     1 
ATOM   3896 C  CB    . LYS C 3 453 ? 14.596  29.105  10.435  1.00 29.51 ?  519  LYS A CB    1 
ATOM   3897 C  CG    . LYS C 3 453 ? 14.101  29.090  11.877  1.00 31.97 ?  519  LYS A CG    1 
ATOM   3898 C  CD    . LYS C 3 453 ? 13.046  30.160  12.096  1.00 33.77 ?  519  LYS A CD    1 
ATOM   3899 C  CE    . LYS C 3 453 ? 12.518  30.114  13.507  1.00 36.11 ?  519  LYS A CE    1 
ATOM   3900 N  NZ    . LYS C 3 453 ? 13.534  30.610  14.485  1.00 38.52 ?  519  LYS A NZ    1 
ATOM   3901 N  N     . ASP C 3 454 ? 14.183  26.146  9.393   1.00 29.36 ?  520  ASP A N     1 
ATOM   3902 C  CA    . ASP C 3 454 ? 13.594  24.820  9.515   1.00 29.56 ?  520  ASP A CA    1 
ATOM   3903 C  C     . ASP C 3 454 ? 14.643  23.710  9.517   1.00 29.34 ?  520  ASP A C     1 
ATOM   3904 O  O     . ASP C 3 454 ? 14.392  22.609  10.033  1.00 28.77 ?  520  ASP A O     1 
ATOM   3905 C  CB    . ASP C 3 454 ? 12.556  24.582  8.419   1.00 30.00 ?  520  ASP A CB    1 
ATOM   3906 C  CG    . ASP C 3 454 ? 11.197  25.156  8.781   1.00 31.08 ?  520  ASP A CG    1 
ATOM   3907 O  OD1   . ASP C 3 454 ? 11.077  25.733  9.883   1.00 31.24 ?  520  ASP A OD1   1 
ATOM   3908 O  OD2   . ASP C 3 454 ? 10.247  25.015  7.982   1.00 33.04 ?  520  ASP A OD2   1 
ATOM   3909 N  N     . ALA C 3 455 ? 15.811  23.992  8.939   1.00 28.75 ?  521  ALA A N     1 
ATOM   3910 C  CA    . ALA C 3 455 ? 16.912  23.024  8.948   1.00 28.84 ?  521  ALA A CA    1 
ATOM   3911 C  C     . ALA C 3 455 ? 17.665  23.088  10.271  1.00 28.97 ?  521  ALA A C     1 
ATOM   3912 O  O     . ALA C 3 455 ? 18.212  22.086  10.744  1.00 29.50 ?  521  ALA A O     1 
ATOM   3913 C  CB    . ALA C 3 455 ? 17.875  23.282  7.779   1.00 28.73 ?  521  ALA A CB    1 
ATOM   3914 N  N     . TYR C 3 456 ? 17.692  24.272  10.869  1.00 28.25 ?  522  TYR A N     1 
ATOM   3915 C  CA    . TYR C 3 456 ? 18.426  24.480  12.109  1.00 28.69 ?  522  TYR A CA    1 
ATOM   3916 C  C     . TYR C 3 456 ? 17.660  23.943  13.342  1.00 27.76 ?  522  TYR A C     1 
ATOM   3917 O  O     . TYR C 3 456 ? 18.237  23.326  14.239  1.00 26.88 ?  522  TYR A O     1 
ATOM   3918 C  CB    . TYR C 3 456 ? 18.751  25.971  12.265  1.00 29.09 ?  522  TYR A CB    1 
ATOM   3919 C  CG    . TYR C 3 456 ? 19.598  26.295  13.468  1.00 32.41 ?  522  TYR A CG    1 
ATOM   3920 C  CD1   . TYR C 3 456 ? 20.826  25.670  13.664  1.00 35.04 ?  522  TYR A CD1   1 
ATOM   3921 C  CD2   . TYR C 3 456 ? 19.177  27.227  14.412  1.00 34.73 ?  522  TYR A CD2   1 
ATOM   3922 C  CE1   . TYR C 3 456 ? 21.608  25.959  14.760  1.00 36.52 ?  522  TYR A CE1   1 
ATOM   3923 C  CE2   . TYR C 3 456 ? 19.954  27.520  15.517  1.00 37.24 ?  522  TYR A CE2   1 
ATOM   3924 C  CZ    . TYR C 3 456 ? 21.168  26.880  15.684  1.00 37.72 ?  522  TYR A CZ    1 
ATOM   3925 O  OH    . TYR C 3 456 ? 21.956  27.160  16.776  1.00 39.85 ?  522  TYR A OH    1 
ATOM   3926 N  N     . LEU C 3 457 ? 16.355  24.153  13.366  1.00 27.12 ?  523  LEU A N     1 
ATOM   3927 C  CA    . LEU C 3 457 ? 15.574  23.759  14.522  1.00 27.02 ?  523  LEU A CA    1 
ATOM   3928 C  C     . LEU C 3 457 ? 15.764  22.293  14.924  1.00 26.70 ?  523  LEU A C     1 
ATOM   3929 O  O     . LEU C 3 457 ? 15.975  21.997  16.099  1.00 26.55 ?  523  LEU A O     1 
ATOM   3930 C  CB    . LEU C 3 457 ? 14.100  24.126  14.325  1.00 27.26 ?  523  LEU A CB    1 
ATOM   3931 C  CG    . LEU C 3 457 ? 13.849  25.637  14.408  1.00 28.18 ?  523  LEU A CG    1 
ATOM   3932 C  CD1   . LEU C 3 457 ? 12.430  26.017  13.997  1.00 28.48 ?  523  LEU A CD1   1 
ATOM   3933 C  CD2   . LEU C 3 457 ? 14.155  26.157  15.815  1.00 27.67 ?  523  LEU A CD2   1 
ATOM   3934 N  N     . PRO C 3 458 ? 15.722  21.369  13.951  1.00 26.56 ?  524  PRO A N     1 
ATOM   3935 C  CA    . PRO C 3 458 ? 15.911  19.964  14.302  1.00 26.98 ?  524  PRO A CA    1 
ATOM   3936 C  C     . PRO C 3 458 ? 17.242  19.722  14.992  1.00 27.14 ?  524  PRO A C     1 
ATOM   3937 O  O     . PRO C 3 458 ? 17.317  18.920  15.917  1.00 27.60 ?  524  PRO A O     1 
ATOM   3938 C  CB    . PRO C 3 458 ? 15.842  19.263  12.951  1.00 26.76 ?  524  PRO A CB    1 
ATOM   3939 C  CG    . PRO C 3 458 ? 14.920  20.145  12.169  1.00 26.25 ?  524  PRO A CG    1 
ATOM   3940 C  CD    . PRO C 3 458 ? 15.353  21.523  12.535  1.00 26.59 ?  524  PRO A CD    1 
ATOM   3941 N  N     . LEU C 3 459 ? 18.277  20.439  14.579  1.00 27.27 ?  525  LEU A N     1 
ATOM   3942 C  CA    . LEU C 3 459 ? 19.569  20.296  15.237  1.00 27.33 ?  525  LEU A CA    1 
ATOM   3943 C  C     . LEU C 3 459 ? 19.547  20.845  16.674  1.00 27.36 ?  525  LEU A C     1 
ATOM   3944 O  O     . LEU C 3 459 ? 20.098  20.224  17.591  1.00 27.43 ?  525  LEU A O     1 
ATOM   3945 C  CB    . LEU C 3 459 ? 20.680  20.955  14.411  1.00 27.00 ?  525  LEU A CB    1 
ATOM   3946 C  CG    . LEU C 3 459 ? 22.078  20.838  15.022  1.00 27.18 ?  525  LEU A CG    1 
ATOM   3947 C  CD1   . LEU C 3 459 ? 22.499  19.372  15.100  1.00 28.33 ?  525  LEU A CD1   1 
ATOM   3948 C  CD2   . LEU C 3 459 ? 23.106  21.663  14.242  1.00 28.92 ?  525  LEU A CD2   1 
ATOM   3949 N  N     . ARG C 3 460 ? 18.917  22.002  16.873  1.00 27.46 ?  526  ARG A N     1 
ATOM   3950 C  CA    . ARG C 3 460 ? 18.700  22.517  18.237  1.00 28.11 ?  526  ARG A CA    1 
ATOM   3951 C  C     . ARG C 3 460 ? 17.917  21.519  19.097  1.00 27.99 ?  526  ARG A C     1 
ATOM   3952 O  O     . ARG C 3 460 ? 18.272  21.242  20.248  1.00 27.84 ?  526  ARG A O     1 
ATOM   3953 C  CB    . ARG C 3 460 ? 17.954  23.856  18.207  1.00 28.26 ?  526  ARG A CB    1 
ATOM   3954 C  CG    . ARG C 3 460 ? 18.752  24.991  17.558  1.00 30.43 ?  526  ARG A CG    1 
ATOM   3955 C  CD    . ARG C 3 460 ? 18.077  26.358  17.756  1.00 33.68 ?  526  ARG A CD    1 
ATOM   3956 N  NE    . ARG C 3 460 ? 17.661  26.601  19.139  1.00 36.76 ?  526  ARG A NE    1 
ATOM   3957 C  CZ    . ARG C 3 460 ? 17.049  27.716  19.549  1.00 38.38 ?  526  ARG A CZ    1 
ATOM   3958 N  NH1   . ARG C 3 460 ? 16.772  28.684  18.685  1.00 38.17 ?  526  ARG A NH1   1 
ATOM   3959 N  NH2   . ARG C 3 460 ? 16.704  27.860  20.820  1.00 38.58 ?  526  ARG A NH2   1 
ATOM   3960 N  N     . LEU C 3 461 ? 16.831  20.998  18.542  1.00 27.80 ?  527  LEU A N     1 
ATOM   3961 C  CA    . LEU C 3 461 ? 16.050  19.986  19.231  1.00 28.16 ?  527  LEU A CA    1 
ATOM   3962 C  C     . LEU C 3 461 ? 16.890  18.770  19.631  1.00 28.70 ?  527  LEU A C     1 
ATOM   3963 O  O     . LEU C 3 461 ? 16.821  18.300  20.767  1.00 28.72 ?  527  LEU A O     1 
ATOM   3964 C  CB    . LEU C 3 461 ? 14.866  19.549  18.363  1.00 28.08 ?  527  LEU A CB    1 
ATOM   3965 C  CG    . LEU C 3 461 ? 13.770  20.617  18.276  1.00 27.28 ?  527  LEU A CG    1 
ATOM   3966 C  CD1   . LEU C 3 461 ? 12.680  20.218  17.304  1.00 25.68 ?  527  LEU A CD1   1 
ATOM   3967 C  CD2   . LEU C 3 461 ? 13.192  20.934  19.680  1.00 27.78 ?  527  LEU A CD2   1 
ATOM   3968 N  N     . MET C 3 462 ? 17.678  18.257  18.696  1.00 28.60 ?  528  MET A N     1 
ATOM   3969 C  CA    . MET C 3 462 ? 18.460  17.065  18.959  1.00 29.17 ?  528  MET A CA    1 
ATOM   3970 C  C     . MET C 3 462 ? 19.401  17.288  20.136  1.00 29.40 ?  528  MET A C     1 
ATOM   3971 O  O     . MET C 3 462 ? 19.524  16.433  21.022  1.00 28.98 ?  528  MET A O     1 
ATOM   3972 C  CB    . MET C 3 462 ? 19.264  16.665  17.708  1.00 28.84 ?  528  MET A CB    1 
ATOM   3973 C  CG    . MET C 3 462 ? 19.916  15.290  17.820  1.00 30.11 ?  528  MET A CG    1 
ATOM   3974 S  SD    . MET C 3 462 ? 21.181  14.978  16.553  1.00 30.85 ?  528  MET A SD    1 
ATOM   3975 C  CE    . MET C 3 462 ? 22.552  15.904  17.237  1.00 31.99 ?  528  MET A CE    1 
ATOM   3976 N  N     . GLU C 3 463 ? 20.074  18.437  20.134  1.00 29.73 ?  529  GLU A N     1 
ATOM   3977 C  CA    . GLU C 3 463 ? 21.043  18.751  21.174  1.00 30.37 ?  529  GLU A CA    1 
ATOM   3978 C  C     . GLU C 3 463 ? 20.376  19.013  22.532  1.00 30.60 ?  529  GLU A C     1 
ATOM   3979 O  O     . GLU C 3 463 ? 20.788  18.445  23.536  1.00 30.36 ?  529  GLU A O     1 
ATOM   3980 C  CB    . GLU C 3 463 ? 21.938  19.924  20.753  1.00 30.81 ?  529  GLU A CB    1 
ATOM   3981 C  CG    . GLU C 3 463 ? 22.845  19.596  19.545  1.00 31.67 ?  529  GLU A CG    1 
ATOM   3982 C  CD    . GLU C 3 463 ? 23.949  18.599  19.888  1.00 33.84 ?  529  GLU A CD    1 
ATOM   3983 O  OE1   . GLU C 3 463 ? 24.013  18.175  21.062  1.00 35.80 ?  529  GLU A OE1   1 
ATOM   3984 O  OE2   . GLU C 3 463 ? 24.753  18.227  19.002  1.00 32.62 ?  529  GLU A OE2   1 
ATOM   3985 N  N     . LYS C 3 464 ? 19.342  19.852  22.555  1.00 30.48 ?  530  LYS A N     1 
ATOM   3986 C  CA    . LYS C 3 464 ? 18.651  20.184  23.805  1.00 30.77 ?  530  LYS A CA    1 
ATOM   3987 C  C     . LYS C 3 464 ? 17.925  18.978  24.423  1.00 30.68 ?  530  LYS A C     1 
ATOM   3988 O  O     . LYS C 3 464 ? 17.939  18.788  25.639  1.00 30.43 ?  530  LYS A O     1 
ATOM   3989 C  CB    . LYS C 3 464 ? 17.680  21.355  23.588  1.00 30.79 ?  530  LYS A CB    1 
ATOM   3990 N  N     . LEU C 3 465 ? 17.293  18.166  23.581  1.00 30.40 ?  531  LEU A N     1 
ATOM   3991 C  CA    . LEU C 3 465 ? 16.611  16.962  24.048  1.00 30.32 ?  531  LEU A CA    1 
ATOM   3992 C  C     . LEU C 3 465 ? 17.566  15.784  24.269  1.00 29.99 ?  531  LEU A C     1 
ATOM   3993 O  O     . LEU C 3 465 ? 17.138  14.713  24.670  1.00 29.92 ?  531  LEU A O     1 
ATOM   3994 C  CB    . LEU C 3 465 ? 15.511  16.556  23.063  1.00 30.25 ?  531  LEU A CB    1 
ATOM   3995 C  CG    . LEU C 3 465 ? 14.498  17.657  22.782  1.00 30.55 ?  531  LEU A CG    1 
ATOM   3996 C  CD1   . LEU C 3 465 ? 13.475  17.167  21.781  1.00 29.99 ?  531  LEU A CD1   1 
ATOM   3997 C  CD2   . LEU C 3 465 ? 13.817  18.101  24.091  1.00 31.35 ?  531  LEU A CD2   1 
ATOM   3998 N  N     . MET C 3 466 ? 18.851  15.982  24.003  1.00 30.12 ?  532  MET A N     1 
ATOM   3999 C  CA    . MET C 3 466 ? 19.848  14.919  24.167  1.00 30.54 ?  532  MET A CA    1 
ATOM   4000 C  C     . MET C 3 466 ? 19.445  13.633  23.413  1.00 30.05 ?  532  MET A C     1 
ATOM   4001 O  O     . MET C 3 466 ? 19.668  12.510  23.895  1.00 30.31 ?  532  MET A O     1 
ATOM   4002 C  CB    . MET C 3 466 ? 20.077  14.642  25.663  1.00 31.62 ?  532  MET A CB    1 
ATOM   4003 C  CG    . MET C 3 466 ? 20.369  15.905  26.494  1.00 34.64 ?  532  MET A CG    1 
ATOM   4004 S  SD    . MET C 3 466 ? 20.738  15.613  28.254  1.00 42.67 ?  532  MET A SD    1 
ATOM   4005 C  CE    . MET C 3 466 ? 19.520  14.367  28.713  1.00 40.74 ?  532  MET A CE    1 
ATOM   4006 N  N     . ALA C 3 467 ? 18.850  13.795  22.231  1.00 28.75 ?  533  ALA A N     1 
ATOM   4007 C  CA    . ALA C 3 467 ? 18.300  12.656  21.502  1.00 28.44 ?  533  ALA A CA    1 
ATOM   4008 C  C     . ALA C 3 467 ? 19.376  11.640  21.132  1.00 28.44 ?  533  ALA A C     1 
ATOM   4009 O  O     . ALA C 3 467 ? 19.203  10.424  21.317  1.00 27.44 ?  533  ALA A O     1 
ATOM   4010 C  CB    . ALA C 3 467 ? 17.566  13.114  20.266  1.00 28.55 ?  533  ALA A CB    1 
ATOM   4011 N  N     . LEU C 3 468 ? 20.492  12.154  20.613  1.00 27.54 ?  534  LEU A N     1 
ATOM   4012 C  CA    . LEU C 3 468 ? 21.604  11.318  20.187  1.00 27.57 ?  534  LEU A CA    1 
ATOM   4013 C  C     . LEU C 3 468 ? 22.333  10.720  21.398  1.00 27.05 ?  534  LEU A C     1 
ATOM   4014 O  O     . LEU C 3 468 ? 22.742  9.560   21.389  1.00 26.58 ?  534  LEU A O     1 
ATOM   4015 C  CB    . LEU C 3 468 ? 22.577  12.153  19.331  1.00 27.51 ?  534  LEU A CB    1 
ATOM   4016 C  CG    . LEU C 3 468 ? 23.806  11.464  18.729  1.00 28.95 ?  534  LEU A CG    1 
ATOM   4017 C  CD1   . LEU C 3 468 ? 23.372  10.382  17.756  1.00 29.74 ?  534  LEU A CD1   1 
ATOM   4018 C  CD2   . LEU C 3 468 ? 24.738  12.494  18.039  1.00 28.73 ?  534  LEU A CD2   1 
ATOM   4019 N  N     . VAL C 3 469 ? 22.493  11.523  22.443  1.00 26.75 ?  535  VAL A N     1 
ATOM   4020 C  CA    . VAL C 3 469 ? 23.196  11.069  23.633  1.00 26.96 ?  535  VAL A CA    1 
ATOM   4021 C  C     . VAL C 3 469 ? 22.436  9.960   24.379  1.00 26.79 ?  535  VAL A C     1 
ATOM   4022 O  O     . VAL C 3 469 ? 23.027  8.967   24.816  1.00 27.30 ?  535  VAL A O     1 
ATOM   4023 C  CB    . VAL C 3 469 ? 23.436  12.230  24.605  1.00 27.54 ?  535  VAL A CB    1 
ATOM   4024 C  CG1   . VAL C 3 469 ? 24.096  11.704  25.897  1.00 27.48 ?  535  VAL A CG1   1 
ATOM   4025 C  CG2   . VAL C 3 469 ? 24.265  13.344  23.913  1.00 28.60 ?  535  VAL A CG2   1 
ATOM   4026 N  N     . ASN C 3 470 ? 21.131  10.137  24.538  1.00 26.41 ?  536  ASN A N     1 
ATOM   4027 C  CA    . ASN C 3 470 ? 20.338  9.188   25.311  1.00 26.02 ?  536  ASN A CA    1 
ATOM   4028 C  C     . ASN C 3 470 ? 20.111  7.920   24.519  1.00 25.33 ?  536  ASN A C     1 
ATOM   4029 O  O     . ASN C 3 470 ? 20.104  6.838   25.083  1.00 24.46 ?  536  ASN A O     1 
ATOM   4030 C  CB    . ASN C 3 470 ? 19.002  9.785   25.746  1.00 25.77 ?  536  ASN A CB    1 
ATOM   4031 C  CG    . ASN C 3 470 ? 19.176  10.905  26.725  1.00 27.65 ?  536  ASN A CG    1 
ATOM   4032 O  OD1   . ASN C 3 470 ? 20.276  11.139  27.219  1.00 29.15 ?  536  ASN A OD1   1 
ATOM   4033 N  ND2   . ASN C 3 470 ? 18.104  11.622  26.997  1.00 29.74 ?  536  ASN A ND2   1 
ATOM   4034 N  N     . TYR C 3 471 ? 19.929  8.061   23.212  1.00 24.98 ?  537  TYR A N     1 
ATOM   4035 C  CA    . TYR C 3 471 ? 19.785  6.879   22.356  1.00 25.52 ?  537  TYR A CA    1 
ATOM   4036 C  C     . TYR C 3 471 ? 21.110  6.097   22.212  1.00 25.34 ?  537  TYR A C     1 
ATOM   4037 O  O     . TYR C 3 471 ? 21.118  4.863   22.188  1.00 25.55 ?  537  TYR A O     1 
ATOM   4038 C  CB    . TYR C 3 471 ? 19.160  7.255   21.006  1.00 25.71 ?  537  TYR A CB    1 
ATOM   4039 C  CG    . TYR C 3 471 ? 17.643  7.176   21.020  1.00 28.26 ?  537  TYR A CG    1 
ATOM   4040 C  CD1   . TYR C 3 471 ? 16.945  7.181   22.222  1.00 29.92 ?  537  TYR A CD1   1 
ATOM   4041 C  CD2   . TYR C 3 471 ? 16.909  7.116   19.836  1.00 29.32 ?  537  TYR A CD2   1 
ATOM   4042 C  CE1   . TYR C 3 471 ? 15.559  7.122   22.253  1.00 31.71 ?  537  TYR A CE1   1 
ATOM   4043 C  CE2   . TYR C 3 471 ? 15.512  7.042   19.859  1.00 30.97 ?  537  TYR A CE2   1 
ATOM   4044 C  CZ    . TYR C 3 471 ? 14.850  7.045   21.072  1.00 32.28 ?  537  TYR A CZ    1 
ATOM   4045 O  OH    . TYR C 3 471 ? 13.469  6.972   21.126  1.00 34.29 ?  537  TYR A OH    1 
ATOM   4046 N  N     . THR C 3 472 ? 22.228  6.808   22.139  1.00 25.15 ?  538  THR A N     1 
ATOM   4047 C  CA    . THR C 3 472 ? 23.531  6.147   22.290  1.00 25.33 ?  538  THR A CA    1 
ATOM   4048 C  C     . THR C 3 472 ? 23.588  5.286   23.569  1.00 25.30 ?  538  THR A C     1 
ATOM   4049 O  O     . THR C 3 472 ? 23.954  4.098   23.525  1.00 24.97 ?  538  THR A O     1 
ATOM   4050 C  CB    . THR C 3 472 ? 24.701  7.158   22.276  1.00 25.74 ?  538  THR A CB    1 
ATOM   4051 O  OG1   . THR C 3 472 ? 24.751  7.814   20.995  1.00 24.91 ?  538  THR A OG1   1 
ATOM   4052 C  CG2   . THR C 3 472 ? 26.027  6.438   22.526  1.00 26.12 ?  538  THR A CG2   1 
ATOM   4053 N  N     . GLU C 3 473 ? 23.219  5.874   24.706  1.00 25.32 ?  539  GLU A N     1 
ATOM   4054 C  CA    . GLU C 3 473 ? 23.164  5.113   25.948  1.00 25.84 ?  539  GLU A CA    1 
ATOM   4055 C  C     . GLU C 3 473 ? 22.275  3.861   25.810  1.00 25.66 ?  539  GLU A C     1 
ATOM   4056 O  O     . GLU C 3 473 ? 22.674  2.748   26.182  1.00 26.38 ?  539  GLU A O     1 
ATOM   4057 C  CB    . GLU C 3 473 ? 22.662  5.979   27.126  1.00 26.25 ?  539  GLU A CB    1 
ATOM   4058 C  CG    . GLU C 3 473 ? 22.775  5.237   28.434  1.00 28.57 ?  539  GLU A CG    1 
ATOM   4059 C  CD    . GLU C 3 473 ? 22.127  5.948   29.617  1.00 33.25 ?  539  GLU A CD    1 
ATOM   4060 O  OE1   . GLU C 3 473 ? 21.149  6.713   29.436  1.00 34.10 ?  539  GLU A OE1   1 
ATOM   4061 O  OE2   . GLU C 3 473 ? 22.595  5.705   30.747  1.00 35.58 ?  539  GLU A OE2   1 
ATOM   4062 N  N     . MET C 3 474 ? 21.073  4.036   25.273  1.00 24.76 ?  540  MET A N     1 
ATOM   4063 C  CA    . MET C 3 474 ? 20.135  2.920   25.158  1.00 24.73 ?  540  MET A CA    1 
ATOM   4064 C  C     . MET C 3 474 ? 20.709  1.801   24.277  1.00 24.35 ?  540  MET A C     1 
ATOM   4065 O  O     . MET C 3 474 ? 20.619  0.608   24.620  1.00 23.78 ?  540  MET A O     1 
ATOM   4066 C  CB    . MET C 3 474 ? 18.782  3.411   24.611  1.00 25.09 ?  540  MET A CB    1 
ATOM   4067 C  CG    . MET C 3 474 ? 17.685  2.342   24.575  1.00 24.98 ?  540  MET A CG    1 
ATOM   4068 S  SD    . MET C 3 474 ? 17.195  1.800   26.226  1.00 26.88 ?  540  MET A SD    1 
ATOM   4069 C  CE    . MET C 3 474 ? 16.165  3.196   26.677  1.00 25.03 ?  540  MET A CE    1 
ATOM   4070 N  N     . ALA C 3 475 ? 21.318  2.186   23.153  1.00 24.03 ?  541  ALA A N     1 
ATOM   4071 C  CA    . ALA C 3 475 ? 21.917  1.214   22.237  1.00 23.79 ?  541  ALA A CA    1 
ATOM   4072 C  C     . ALA C 3 475 ? 23.005  0.425   22.952  1.00 23.75 ?  541  ALA A C     1 
ATOM   4073 O  O     . ALA C 3 475 ? 23.165  -0.779  22.741  1.00 23.42 ?  541  ALA A O     1 
ATOM   4074 C  CB    . ALA C 3 475 ? 22.496  1.912   21.016  1.00 23.86 ?  541  ALA A CB    1 
ATOM   4075 N  N     . ARG C 3 476 ? 23.766  1.118   23.786  1.00 23.53 ?  542  ARG A N     1 
ATOM   4076 C  CA    . ARG C 3 476 ? 24.870  0.486   24.506  1.00 23.88 ?  542  ARG A CA    1 
ATOM   4077 C  C     . ARG C 3 476 ? 24.391  -0.444  25.596  1.00 23.97 ?  542  ARG A C     1 
ATOM   4078 O  O     . ARG C 3 476 ? 24.897  -1.561  25.726  1.00 23.65 ?  542  ARG A O     1 
ATOM   4079 C  CB    . ARG C 3 476 ? 25.767  1.554   25.120  1.00 24.08 ?  542  ARG A CB    1 
ATOM   4080 C  CG    . ARG C 3 476 ? 26.542  2.340   24.055  1.00 25.06 ?  542  ARG A CG    1 
ATOM   4081 C  CD    . ARG C 3 476 ? 27.263  3.545   24.643  1.00 25.14 ?  542  ARG A CD    1 
ATOM   4082 N  NE    . ARG C 3 476 ? 28.323  3.963   23.719  1.00 27.05 ?  542  ARG A NE    1 
ATOM   4083 C  CZ    . ARG C 3 476 ? 29.257  4.865   24.001  1.00 26.53 ?  542  ARG A CZ    1 
ATOM   4084 N  NH1   . ARG C 3 476 ? 29.251  5.494   25.178  1.00 25.33 ?  542  ARG A NH1   1 
ATOM   4085 N  NH2   . ARG C 3 476 ? 30.182  5.149   23.091  1.00 24.83 ?  542  ARG A NH2   1 
ATOM   4086 N  N     . VAL C 3 477 ? 23.431  0.036   26.390  1.00 23.84 ?  543  VAL A N     1 
ATOM   4087 C  CA    . VAL C 3 477 ? 22.858  -0.741  27.504  1.00 23.94 ?  543  VAL A CA    1 
ATOM   4088 C  C     . VAL C 3 477 ? 22.108  -1.999  27.041  1.00 24.19 ?  543  VAL A C     1 
ATOM   4089 O  O     . VAL C 3 477 ? 22.254  -3.076  27.638  1.00 25.14 ?  543  VAL A O     1 
ATOM   4090 C  CB    . VAL C 3 477 ? 21.922  0.132   28.372  1.00 23.95 ?  543  VAL A CB    1 
ATOM   4091 C  CG1   . VAL C 3 477 ? 21.145  -0.736  29.349  1.00 24.39 ?  543  VAL A CG1   1 
ATOM   4092 C  CG2   . VAL C 3 477 ? 22.727  1.238   29.109  1.00 23.85 ?  543  VAL A CG2   1 
ATOM   4093 N  N     . THR C 3 478 ? 21.325  -1.893  25.972  1.00 23.36 ?  544  THR A N     1 
ATOM   4094 C  CA    . THR C 3 478 ? 20.532  -3.056  25.527  1.00 23.69 ?  544  THR A CA    1 
ATOM   4095 C  C     . THR C 3 478 ? 21.255  -3.862  24.452  1.00 23.73 ?  544  THR A C     1 
ATOM   4096 O  O     . THR C 3 478 ? 20.881  -4.993  24.138  1.00 23.28 ?  544  THR A O     1 
ATOM   4097 C  CB    . THR C 3 478 ? 19.146  -2.632  24.981  1.00 23.56 ?  544  THR A CB    1 
ATOM   4098 O  OG1   . THR C 3 478 ? 19.325  -1.786  23.842  1.00 25.40 ?  544  THR A OG1   1 
ATOM   4099 C  CG2   . THR C 3 478 ? 18.378  -1.861  26.017  1.00 23.90 ?  544  THR A CG2   1 
ATOM   4100 N  N     . GLY C 3 479 ? 22.287  -3.261  23.869  1.00 23.93 ?  545  GLY A N     1 
ATOM   4101 C  CA    . GLY C 3 479 ? 23.085  -3.944  22.867  1.00 24.01 ?  545  GLY A CA    1 
ATOM   4102 C  C     . GLY C 3 479 ? 22.505  -3.941  21.466  1.00 25.07 ?  545  GLY A C     1 
ATOM   4103 O  O     . GLY C 3 479 ? 22.970  -4.692  20.607  1.00 27.08 ?  545  GLY A O     1 
ATOM   4104 N  N     . VAL C 3 480 ? 21.505  -3.111  21.182  1.00 24.89 ?  546  VAL A N     1 
ATOM   4105 C  CA    . VAL C 3 480 ? 21.000  -3.060  19.799  1.00 24.32 ?  546  VAL A CA    1 
ATOM   4106 C  C     . VAL C 3 480 ? 21.692  -1.961  18.989  1.00 24.19 ?  546  VAL A C     1 
ATOM   4107 O  O     . VAL C 3 480 ? 22.125  -0.959  19.545  1.00 23.74 ?  546  VAL A O     1 
ATOM   4108 C  CB    . VAL C 3 480 ? 19.475  -2.840  19.707  1.00 24.35 ?  546  VAL A CB    1 
ATOM   4109 C  CG1   . VAL C 3 480 ? 18.708  -4.029  20.343  1.00 23.58 ?  546  VAL A CG1   1 
ATOM   4110 C  CG2   . VAL C 3 480 ? 19.086  -1.491  20.359  1.00 24.18 ?  546  VAL A CG2   1 
ATOM   4111 N  N     . PRO C 3 481 ? 21.764  -2.142  17.664  1.00 24.14 ?  547  PRO A N     1 
ATOM   4112 C  CA    . PRO C 3 481 ? 22.231  -1.061  16.811  1.00 24.39 ?  547  PRO A CA    1 
ATOM   4113 C  C     . PRO C 3 481 ? 21.362  0.163   17.015  1.00 24.28 ?  547  PRO A C     1 
ATOM   4114 O  O     . PRO C 3 481 ? 20.147  0.038   17.197  1.00 24.81 ?  547  PRO A O     1 
ATOM   4115 C  CB    . PRO C 3 481 ? 22.004  -1.616  15.393  1.00 24.15 ?  547  PRO A CB    1 
ATOM   4116 C  CG    . PRO C 3 481 ? 22.219  -3.098  15.563  1.00 23.95 ?  547  PRO A CG    1 
ATOM   4117 C  CD    . PRO C 3 481 ? 21.550  -3.393  16.906  1.00 24.42 ?  547  PRO A CD    1 
ATOM   4118 N  N     . PHE C 3 482 ? 21.980  1.335   16.979  1.00 24.30 ?  548  PHE A N     1 
ATOM   4119 C  CA    . PHE C 3 482 ? 21.262  2.586   17.079  1.00 24.59 ?  548  PHE A CA    1 
ATOM   4120 C  C     . PHE C 3 482 ? 20.004  2.623   16.213  1.00 25.00 ?  548  PHE A C     1 
ATOM   4121 O  O     . PHE C 3 482 ? 18.962  3.135   16.633  1.00 25.34 ?  548  PHE A O     1 
ATOM   4122 C  CB    . PHE C 3 482 ? 22.173  3.757   16.685  1.00 25.13 ?  548  PHE A CB    1 
ATOM   4123 C  CG    . PHE C 3 482 ? 21.523  5.108   16.860  1.00 25.33 ?  548  PHE A CG    1 
ATOM   4124 C  CD1   . PHE C 3 482 ? 21.748  5.864   18.009  1.00 26.19 ?  548  PHE A CD1   1 
ATOM   4125 C  CD2   . PHE C 3 482 ? 20.686  5.608   15.879  1.00 24.99 ?  548  PHE A CD2   1 
ATOM   4126 C  CE1   . PHE C 3 482 ? 21.143  7.109   18.168  1.00 26.65 ?  548  PHE A CE1   1 
ATOM   4127 C  CE2   . PHE C 3 482 ? 20.069  6.848   16.029  1.00 26.43 ?  548  PHE A CE2   1 
ATOM   4128 C  CZ    . PHE C 3 482 ? 20.300  7.601   17.171  1.00 25.52 ?  548  PHE A CZ    1 
ATOM   4129 N  N     . SER C 3 483 ? 20.093  2.084   15.006  1.00 25.46 ?  549  SER A N     1 
ATOM   4130 C  CA    . SER C 3 483 ? 19.002  2.212   14.049  1.00 25.61 ?  549  SER A CA    1 
ATOM   4131 C  C     . SER C 3 483 ? 17.761  1.454   14.501  1.00 25.64 ?  549  SER A C     1 
ATOM   4132 O  O     . SER C 3 483 ? 16.658  1.738   14.026  1.00 25.45 ?  549  SER A O     1 
ATOM   4133 C  CB    . SER C 3 483 ? 19.441  1.697   12.679  1.00 26.45 ?  549  SER A CB    1 
ATOM   4134 O  OG    . SER C 3 483 ? 19.626  0.294   12.774  1.00 27.66 ?  549  SER A OG    1 
ATOM   4135 N  N     . TYR C 3 484 ? 17.924  0.474   15.397  1.00 24.92 ?  550  TYR A N     1 
ATOM   4136 C  CA    . TYR C 3 484 ? 16.773  -0.294  15.872  1.00 24.97 ?  550  TYR A CA    1 
ATOM   4137 C  C     . TYR C 3 484 ? 15.883  0.550   16.780  1.00 24.78 ?  550  TYR A C     1 
ATOM   4138 O  O     . TYR C 3 484 ? 14.701  0.248   16.936  1.00 24.30 ?  550  TYR A O     1 
ATOM   4139 C  CB    . TYR C 3 484 ? 17.194  -1.527  16.690  1.00 24.85 ?  550  TYR A CB    1 
ATOM   4140 C  CG    . TYR C 3 484 ? 17.764  -2.715  15.932  1.00 26.95 ?  550  TYR A CG    1 
ATOM   4141 C  CD1   . TYR C 3 484 ? 18.372  -2.573  14.691  1.00 26.44 ?  550  TYR A CD1   1 
ATOM   4142 C  CD2   . TYR C 3 484 ? 17.750  -3.980  16.514  1.00 28.13 ?  550  TYR A CD2   1 
ATOM   4143 C  CE1   . TYR C 3 484 ? 18.929  -3.683  14.025  1.00 27.11 ?  550  TYR A CE1   1 
ATOM   4144 C  CE2   . TYR C 3 484 ? 18.276  -5.078  15.872  1.00 28.23 ?  550  TYR A CE2   1 
ATOM   4145 C  CZ    . TYR C 3 484 ? 18.872  -4.927  14.634  1.00 28.61 ?  550  TYR A CZ    1 
ATOM   4146 O  OH    . TYR C 3 484 ? 19.419  -6.037  14.055  1.00 28.52 ?  550  TYR A OH    1 
ATOM   4147 N  N     . LEU C 3 485 ? 16.448  1.572   17.421  1.00 24.40 ?  551  LEU A N     1 
ATOM   4148 C  CA    . LEU C 3 485 ? 15.669  2.326   18.409  1.00 24.87 ?  551  LEU A CA    1 
ATOM   4149 C  C     . LEU C 3 485 ? 14.419  2.999   17.847  1.00 25.29 ?  551  LEU A C     1 
ATOM   4150 O  O     . LEU C 3 485 ? 13.358  2.931   18.460  1.00 24.69 ?  551  LEU A O     1 
ATOM   4151 C  CB    . LEU C 3 485 ? 16.535  3.304   19.198  1.00 24.40 ?  551  LEU A CB    1 
ATOM   4152 C  CG    . LEU C 3 485 ? 17.681  2.603   19.933  1.00 25.65 ?  551  LEU A CG    1 
ATOM   4153 C  CD1   . LEU C 3 485 ? 18.552  3.614   20.675  1.00 25.96 ?  551  LEU A CD1   1 
ATOM   4154 C  CD2   . LEU C 3 485 ? 17.113  1.529   20.905  1.00 26.87 ?  551  LEU A CD2   1 
ATOM   4155 N  N     . LEU C 3 486 ? 14.522  3.628   16.678  1.00 25.76 ?  552  LEU A N     1 
ATOM   4156 C  CA    . LEU C 3 486 ? 13.348  4.285   16.091  1.00 26.34 ?  552  LEU A CA    1 
ATOM   4157 C  C     . LEU C 3 486 ? 12.607  3.421   15.090  1.00 26.75 ?  552  LEU A C     1 
ATOM   4158 O  O     . LEU C 3 486 ? 11.419  3.653   14.829  1.00 27.81 ?  552  LEU A O     1 
ATOM   4159 C  CB    . LEU C 3 486 ? 13.719  5.633   15.458  1.00 27.11 ?  552  LEU A CB    1 
ATOM   4160 C  CG    . LEU C 3 486 ? 14.077  6.743   16.458  1.00 28.04 ?  552  LEU A CG    1 
ATOM   4161 C  CD1   . LEU C 3 486 ? 14.428  8.020   15.726  1.00 30.69 ?  552  LEU A CD1   1 
ATOM   4162 C  CD2   . LEU C 3 486 ? 12.941  7.006   17.450  1.00 31.09 ?  552  LEU A CD2   1 
ATOM   4163 N  N     . ALA C 3 487 ? 13.275  2.409   14.547  1.00 26.08 ?  553  ALA A N     1 
ATOM   4164 C  CA    . ALA C 3 487 ? 12.652  1.550   13.538  1.00 25.09 ?  553  ALA A CA    1 
ATOM   4165 C  C     . ALA C 3 487 ? 11.977  0.324   14.154  1.00 24.70 ?  553  ALA A C     1 
ATOM   4166 O  O     . ALA C 3 487 ? 11.077  -0.275  13.547  1.00 23.07 ?  553  ALA A O     1 
ATOM   4167 C  CB    . ALA C 3 487 ? 13.705  1.100   12.499  1.00 25.45 ?  553  ALA A CB    1 
ATOM   4168 N  N     . ARG C 3 488 ? 12.419  -0.068  15.348  1.00 23.03 ?  554  ARG A N     1 
ATOM   4169 C  CA    . ARG C 3 488 ? 11.906  -1.307  15.927  1.00 23.61 ?  554  ARG A CA    1 
ATOM   4170 C  C     . ARG C 3 488 ? 11.300  -1.108  17.316  1.00 22.77 ?  554  ARG A C     1 
ATOM   4171 O  O     . ARG C 3 488 ? 11.153  0.019   17.759  1.00 23.07 ?  554  ARG A O     1 
ATOM   4172 C  CB    . ARG C 3 488 ? 13.006  -2.357  15.919  1.00 23.73 ?  554  ARG A CB    1 
ATOM   4173 C  CG    . ARG C 3 488 ? 13.550  -2.509  14.493  1.00 26.68 ?  554  ARG A CG    1 
ATOM   4174 C  CD    . ARG C 3 488 ? 14.381  -3.716  14.349  1.00 32.19 ?  554  ARG A CD    1 
ATOM   4175 N  NE    . ARG C 3 488 ? 13.637  -4.895  14.756  1.00 32.94 ?  554  ARG A NE    1 
ATOM   4176 C  CZ    . ARG C 3 488 ? 14.039  -6.122  14.479  1.00 33.29 ?  554  ARG A CZ    1 
ATOM   4177 N  NH1   . ARG C 3 488 ? 15.169  -6.292  13.764  1.00 32.18 ?  554  ARG A NH1   1 
ATOM   4178 N  NH2   . ARG C 3 488 ? 13.316  -7.150  14.894  1.00 28.54 ?  554  ARG A NH2   1 
ATOM   4179 N  N     . GLY C 3 489 ? 10.938  -2.185  17.992  1.00 22.27 ?  555  GLY A N     1 
ATOM   4180 C  CA    . GLY C 3 489 ? 10.228  -2.036  19.262  1.00 22.44 ?  555  GLY A CA    1 
ATOM   4181 C  C     . GLY C 3 489 ? 11.032  -2.462  20.476  1.00 22.51 ?  555  GLY A C     1 
ATOM   4182 O  O     . GLY C 3 489 ? 12.259  -2.532  20.423  1.00 22.74 ?  555  GLY A O     1 
ATOM   4183 N  N     . GLN C 3 490 ? 10.315  -2.752  21.561  1.00 22.17 ?  556  GLN A N     1 
ATOM   4184 C  CA    . GLN C 3 490 ? 10.917  -3.176  22.826  1.00 21.59 ?  556  GLN A CA    1 
ATOM   4185 C  C     . GLN C 3 490 ? 11.408  -4.626  22.782  1.00 21.10 ?  556  GLN A C     1 
ATOM   4186 O  O     . GLN C 3 490 ? 12.385  -4.971  23.449  1.00 20.12 ?  556  GLN A O     1 
ATOM   4187 C  CB    . GLN C 3 490 ? 9.906   -3.039  23.961  1.00 21.32 ?  556  GLN A CB    1 
ATOM   4188 C  CG    . GLN C 3 490 ? 9.418   -1.619  24.216  1.00 21.01 ?  556  GLN A CG    1 
ATOM   4189 C  CD    . GLN C 3 490 ? 10.539  -0.682  24.691  1.00 23.57 ?  556  GLN A CD    1 
ATOM   4190 O  OE1   . GLN C 3 490 ? 11.649  -1.118  25.041  1.00 20.91 ?  556  GLN A OE1   1 
ATOM   4191 N  NE2   . GLN C 3 490 ? 10.247  0.606   24.701  1.00 24.25 ?  556  GLN A NE2   1 
ATOM   4192 N  N     . GLN C 3 491 ? 10.721  -5.480  22.023  1.00 20.31 ?  557  GLN A N     1 
ATOM   4193 C  CA    . GLN C 3 491 ? 11.090  -6.889  22.018  1.00 20.91 ?  557  GLN A CA    1 
ATOM   4194 C  C     . GLN C 3 491 ? 12.527  -7.188  21.599  1.00 20.97 ?  557  GLN A C     1 
ATOM   4195 O  O     . GLN C 3 491 ? 13.187  -8.031  22.224  1.00 20.70 ?  557  GLN A O     1 
ATOM   4196 C  CB    . GLN C 3 491 ? 10.104  -7.709  21.179  1.00 22.13 ?  557  GLN A CB    1 
ATOM   4197 C  CG    . GLN C 3 491 ? 8.752   -7.818  21.882  1.00 22.36 ?  557  GLN A CG    1 
ATOM   4198 C  CD    . GLN C 3 491 ? 7.903   -8.947  21.347  1.00 28.93 ?  557  GLN A CD    1 
ATOM   4199 O  OE1   . GLN C 3 491 ? 6.701   -8.792  21.145  1.00 31.20 ?  557  GLN A OE1   1 
ATOM   4200 N  NE2   . GLN C 3 491 ? 8.523   -10.099 21.123  1.00 32.17 ?  557  GLN A NE2   1 
ATOM   4201 N  N     . ILE C 3 492 ? 13.016  -6.492  20.559  1.00 20.86 ?  558  ILE A N     1 
ATOM   4202 C  CA    . ILE C 3 492 ? 14.347  -6.751  20.010  1.00 21.16 ?  558  ILE A CA    1 
ATOM   4203 C  C     . ILE C 3 492 ? 15.438  -6.350  20.998  1.00 21.42 ?  558  ILE A C     1 
ATOM   4204 O  O     . ILE C 3 492 ? 16.530  -6.946  21.031  1.00 21.34 ?  558  ILE A O     1 
ATOM   4205 C  CB    . ILE C 3 492 ? 14.545  -6.053  18.617  1.00 21.56 ?  558  ILE A CB    1 
ATOM   4206 C  CG1   . ILE C 3 492 ? 15.767  -6.626  17.884  1.00 21.26 ?  558  ILE A CG1   1 
ATOM   4207 C  CG2   . ILE C 3 492 ? 14.667  -4.524  18.771  1.00 21.33 ?  558  ILE A CG2   1 
ATOM   4208 C  CD1   . ILE C 3 492 ? 15.734  -8.173  17.722  1.00 22.56 ?  558  ILE A CD1   1 
ATOM   4209 N  N     . LYS C 3 493 ? 15.151  -5.329  21.808  1.00 21.21 ?  559  LYS A N     1 
ATOM   4210 C  CA    . LYS C 3 493 ? 16.063  -4.953  22.869  1.00 21.15 ?  559  LYS A CA    1 
ATOM   4211 C  C     . LYS C 3 493 ? 16.134  -6.068  23.912  1.00 21.33 ?  559  LYS A C     1 
ATOM   4212 O  O     . LYS C 3 493 ? 17.228  -6.414  24.386  1.00 21.52 ?  559  LYS A O     1 
ATOM   4213 C  CB    . LYS C 3 493 ? 15.617  -3.653  23.524  1.00 21.25 ?  559  LYS A CB    1 
ATOM   4214 C  CG    . LYS C 3 493 ? 15.746  -2.449  22.585  1.00 20.54 ?  559  LYS A CG    1 
ATOM   4215 C  CD    . LYS C 3 493 ? 14.781  -1.367  23.003  1.00 22.79 ?  559  LYS A CD    1 
ATOM   4216 C  CE    . LYS C 3 493 ? 15.159  -0.845  24.372  1.00 22.18 ?  559  LYS A CE    1 
ATOM   4217 N  NZ    . LYS C 3 493 ? 14.235  0.197   24.874  1.00 21.96 ?  559  LYS A NZ    1 
ATOM   4218 N  N     . VAL C 3 494 ? 14.980  -6.624  24.275  1.00 20.64 ?  560  VAL A N     1 
ATOM   4219 C  CA    . VAL C 3 494 ? 14.987  -7.753  25.214  1.00 20.84 ?  560  VAL A CA    1 
ATOM   4220 C  C     . VAL C 3 494 ? 15.751  -8.932  24.618  1.00 21.42 ?  560  VAL A C     1 
ATOM   4221 O  O     . VAL C 3 494 ? 16.587  -9.538  25.288  1.00 21.44 ?  560  VAL A O     1 
ATOM   4222 C  CB    . VAL C 3 494 ? 13.563  -8.189  25.625  1.00 20.47 ?  560  VAL A CB    1 
ATOM   4223 C  CG1   . VAL C 3 494 ? 13.629  -9.338  26.635  1.00 20.24 ?  560  VAL A CG1   1 
ATOM   4224 C  CG2   . VAL C 3 494 ? 12.811  -7.016  26.247  1.00 19.99 ?  560  VAL A CG2   1 
ATOM   4225 N  N     . VAL C 3 495 ? 15.465  -9.244  23.352  1.00 22.02 ?  561  VAL A N     1 
ATOM   4226 C  CA    . VAL C 3 495 ? 16.131  -10.345 22.642  1.00 22.01 ?  561  VAL A CA    1 
ATOM   4227 C  C     . VAL C 3 495 ? 17.663  -10.219 22.651  1.00 22.60 ?  561  VAL A C     1 
ATOM   4228 O  O     . VAL C 3 495 ? 18.382  -11.171 22.999  1.00 22.29 ?  561  VAL A O     1 
ATOM   4229 C  CB    . VAL C 3 495 ? 15.595  -10.475 21.189  1.00 22.09 ?  561  VAL A CB    1 
ATOM   4230 C  CG1   . VAL C 3 495 ? 16.426  -11.475 20.368  1.00 21.85 ?  561  VAL A CG1   1 
ATOM   4231 C  CG2   . VAL C 3 495 ? 14.145  -10.877 21.213  1.00 22.32 ?  561  VAL A CG2   1 
ATOM   4232 N  N     . SER C 3 496 ? 18.164  -9.039  22.307  1.00 22.05 ?  562  SER A N     1 
ATOM   4233 C  CA    . SER C 3 496 ? 19.608  -8.822  22.326  1.00 22.68 ?  562  SER A CA    1 
ATOM   4234 C  C     . SER C 3 496 ? 20.236  -9.079  23.715  1.00 22.31 ?  562  SER A C     1 
ATOM   4235 O  O     . SER C 3 496 ? 21.249  -9.782  23.822  1.00 21.64 ?  562  SER A O     1 
ATOM   4236 C  CB    . SER C 3 496 ? 19.953  -7.425  21.813  1.00 22.62 ?  562  SER A CB    1 
ATOM   4237 O  OG    . SER C 3 496 ? 21.241  -7.038  22.275  1.00 25.57 ?  562  SER A OG    1 
ATOM   4238 N  N     . GLN C 3 497 ? 19.637  -8.518  24.772  1.00 21.79 ?  563  GLN A N     1 
ATOM   4239 C  CA    . GLN C 3 497 ? 20.115  -8.776  26.133  1.00 21.82 ?  563  GLN A CA    1 
ATOM   4240 C  C     . GLN C 3 497 ? 20.071  -10.251 26.500  1.00 21.54 ?  563  GLN A C     1 
ATOM   4241 O  O     . GLN C 3 497 ? 20.995  -10.778 27.147  1.00 22.38 ?  563  GLN A O     1 
ATOM   4242 C  CB    . GLN C 3 497 ? 19.347  -7.904  27.156  1.00 20.89 ?  563  GLN A CB    1 
ATOM   4243 C  CG    . GLN C 3 497 ? 19.477  -6.396  26.853  1.00 21.76 ?  563  GLN A CG    1 
ATOM   4244 C  CD    . GLN C 3 497 ? 18.520  -5.548  27.659  1.00 21.91 ?  563  GLN A CD    1 
ATOM   4245 O  OE1   . GLN C 3 497 ? 18.813  -5.149  28.795  1.00 22.00 ?  563  GLN A OE1   1 
ATOM   4246 N  NE2   . GLN C 3 497 ? 17.362  -5.264  27.075  1.00 22.98 ?  563  GLN A NE2   1 
ATOM   4247 N  N     . LEU C 3 498 ? 19.006  -10.933 26.097  1.00 21.60 ?  564  LEU A N     1 
ATOM   4248 C  CA    . LEU C 3 498 ? 18.860  -12.342 26.430  1.00 21.81 ?  564  LEU A CA    1 
ATOM   4249 C  C     . LEU C 3 498 ? 19.936  -13.199 25.750  1.00 21.99 ?  564  LEU A C     1 
ATOM   4250 O  O     . LEU C 3 498 ? 20.542  -14.073 26.385  1.00 21.04 ?  564  LEU A O     1 
ATOM   4251 C  CB    . LEU C 3 498 ? 17.476  -12.830 25.998  1.00 22.61 ?  564  LEU A CB    1 
ATOM   4252 C  CG    . LEU C 3 498 ? 16.825  -14.022 26.696  1.00 25.02 ?  564  LEU A CG    1 
ATOM   4253 C  CD1   . LEU C 3 498 ? 16.875  -13.901 28.233  1.00 25.32 ?  564  LEU A CD1   1 
ATOM   4254 C  CD2   . LEU C 3 498 ? 15.369  -14.129 26.223  1.00 27.12 ?  564  LEU A CD2   1 
ATOM   4255 N  N     . PHE C 3 499 ? 20.129  -12.994 24.442  1.00 21.19 ?  565  PHE A N     1 
ATOM   4256 C  CA    . PHE C 3 499 ? 21.153  -13.755 23.710  1.00 21.62 ?  565  PHE A CA    1 
ATOM   4257 C  C     . PHE C 3 499 ? 22.547  -13.518 24.322  1.00 21.66 ?  565  PHE A C     1 
ATOM   4258 O  O     . PHE C 3 499 ? 23.317  -14.451 24.493  1.00 21.15 ?  565  PHE A O     1 
ATOM   4259 C  CB    . PHE C 3 499 ? 21.151  -13.436 22.198  1.00 21.23 ?  565  PHE A CB    1 
ATOM   4260 C  CG    . PHE C 3 499 ? 20.177  -14.287 21.385  1.00 22.24 ?  565  PHE A CG    1 
ATOM   4261 C  CD1   . PHE C 3 499 ? 20.641  -15.303 20.546  1.00 23.17 ?  565  PHE A CD1   1 
ATOM   4262 C  CD2   . PHE C 3 499 ? 18.816  -14.091 21.482  1.00 23.00 ?  565  PHE A CD2   1 
ATOM   4263 C  CE1   . PHE C 3 499 ? 19.748  -16.078 19.797  1.00 22.57 ?  565  PHE A CE1   1 
ATOM   4264 C  CE2   . PHE C 3 499 ? 17.909  -14.866 20.727  1.00 24.17 ?  565  PHE A CE2   1 
ATOM   4265 C  CZ    . PHE C 3 499 ? 18.376  -15.849 19.898  1.00 23.23 ?  565  PHE A CZ    1 
ATOM   4266 N  N     . ARG C 3 500 ? 22.852  -12.267 24.652  1.00 22.56 ?  566  ARG A N     1 
ATOM   4267 C  CA    . ARG C 3 500 ? 24.120  -11.927 25.293  1.00 22.75 ?  566  ARG A CA    1 
ATOM   4268 C  C     . ARG C 3 500 ? 24.324  -12.624 26.658  1.00 23.83 ?  566  ARG A C     1 
ATOM   4269 O  O     . ARG C 3 500 ? 25.401  -13.193 26.919  1.00 23.58 ?  566  ARG A O     1 
ATOM   4270 C  CB    . ARG C 3 500 ? 24.253  -10.410 25.403  1.00 23.00 ?  566  ARG A CB    1 
ATOM   4271 C  CG    . ARG C 3 500 ? 24.445  -9.724  24.027  1.00 21.98 ?  566  ARG A CG    1 
ATOM   4272 C  CD    . ARG C 3 500 ? 24.216  -8.241  24.095  1.00 23.42 ?  566  ARG A CD    1 
ATOM   4273 N  NE    . ARG C 3 500 ? 23.999  -7.638  22.770  1.00 23.42 ?  566  ARG A NE    1 
ATOM   4274 C  CZ    . ARG C 3 500 ? 24.973  -7.297  21.928  1.00 24.76 ?  566  ARG A CZ    1 
ATOM   4275 N  NH1   . ARG C 3 500 ? 24.666  -6.743  20.754  1.00 22.65 ?  566  ARG A NH1   1 
ATOM   4276 N  NH2   . ARG C 3 500 ? 26.254  -7.525  22.244  1.00 23.82 ?  566  ARG A NH2   1 
ATOM   4277 N  N     . LYS C 3 501 ? 23.319  -12.581 27.533  1.00 22.96 ?  567  LYS A N     1 
ATOM   4278 C  CA    . LYS C 3 501 ? 23.416  -13.337 28.791  1.00 23.65 ?  567  LYS A CA    1 
ATOM   4279 C  C     . LYS C 3 501 ? 23.496  -14.858 28.573  1.00 23.83 ?  567  LYS A C     1 
ATOM   4280 O  O     . LYS C 3 501 ? 24.260  -15.541 29.256  1.00 23.73 ?  567  LYS A O     1 
ATOM   4281 C  CB    . LYS C 3 501 ? 22.253  -12.979 29.729  1.00 23.78 ?  567  LYS A CB    1 
ATOM   4282 C  CG    . LYS C 3 501 ? 22.293  -11.519 30.194  1.00 24.82 ?  567  LYS A CG    1 
ATOM   4283 C  CD    . LYS C 3 501 ? 23.540  -11.268 31.003  1.00 29.34 ?  567  LYS A CD    1 
ATOM   4284 C  CE    . LYS C 3 501 ? 23.567  -9.848  31.577  1.00 31.11 ?  567  LYS A CE    1 
ATOM   4285 N  NZ    . LYS C 3 501 ? 23.322  -8.860  30.498  1.00 36.02 ?  567  LYS A NZ    1 
ATOM   4286 N  N     . CYS C 3 502 ? 22.733  -15.394 27.615  1.00 23.47 ?  568  CYS A N     1 
ATOM   4287 C  CA    . CYS C 3 502 ? 22.733  -16.845 27.390  1.00 24.56 ?  568  CYS A CA    1 
ATOM   4288 C  C     . CYS C 3 502 ? 24.077  -17.377 26.874  1.00 25.47 ?  568  CYS A C     1 
ATOM   4289 O  O     . CYS C 3 502 ? 24.515  -18.463 27.251  1.00 24.97 ?  568  CYS A O     1 
ATOM   4290 C  CB    . CYS C 3 502 ? 21.600  -17.269 26.452  1.00 24.22 ?  568  CYS A CB    1 
ATOM   4291 S  SG    . CYS C 3 502 ? 19.977  -17.298 27.256  1.00 25.70 ?  568  CYS A SG    1 
ATOM   4292 N  N     . LEU C 3 503 ? 24.713  -16.608 26.000  1.00 26.68 ?  569  LEU A N     1 
ATOM   4293 C  CA    . LEU C 3 503 ? 26.021  -16.955 25.494  1.00 28.28 ?  569  LEU A CA    1 
ATOM   4294 C  C     . LEU C 3 503 ? 26.981  -17.173 26.654  1.00 28.96 ?  569  LEU A C     1 
ATOM   4295 O  O     . LEU C 3 503 ? 27.740  -18.140 26.655  1.00 28.81 ?  569  LEU A O     1 
ATOM   4296 C  CB    . LEU C 3 503 ? 26.537  -15.852 24.556  1.00 28.31 ?  569  LEU A CB    1 
ATOM   4297 C  CG    . LEU C 3 503 ? 27.851  -16.151 23.831  1.00 28.91 ?  569  LEU A CG    1 
ATOM   4298 C  CD1   . LEU C 3 503 ? 27.751  -17.492 23.069  1.00 27.90 ?  569  LEU A CD1   1 
ATOM   4299 C  CD2   . LEU C 3 503 ? 28.257  -15.002 22.896  1.00 26.61 ?  569  LEU A CD2   1 
ATOM   4300 N  N     . GLU C 3 504 ? 26.918  -16.289 27.656  1.00 29.77 ?  570  GLU A N     1 
ATOM   4301 C  CA    . GLU C 3 504 ? 27.769  -16.392 28.838  1.00 30.19 ?  570  GLU A CA    1 
ATOM   4302 C  C     . GLU C 3 504 ? 27.612  -17.711 29.588  1.00 30.54 ?  570  GLU A C     1 
ATOM   4303 O  O     . GLU C 3 504 ? 28.519  -18.138 30.286  1.00 31.50 ?  570  GLU A O     1 
ATOM   4304 C  CB    . GLU C 3 504 ? 27.471  -15.250 29.820  1.00 30.92 ?  570  GLU A CB    1 
ATOM   4305 C  CG    . GLU C 3 504 ? 27.876  -13.856 29.362  1.00 32.83 ?  570  GLU A CG    1 
ATOM   4306 C  CD    . GLU C 3 504 ? 27.609  -12.794 30.434  1.00 36.89 ?  570  GLU A CD    1 
ATOM   4307 O  OE1   . GLU C 3 504 ? 27.025  -13.122 31.489  1.00 37.62 ?  570  GLU A OE1   1 
ATOM   4308 O  OE2   . GLU C 3 504 ? 27.985  -11.619 30.232  1.00 41.13 ?  570  GLU A OE2   1 
ATOM   4309 N  N     . ILE C 3 505 ? 26.461  -18.355 29.488  1.00 29.97 ?  571  ILE A N     1 
ATOM   4310 C  CA    . ILE C 3 505 ? 26.247  -19.550 30.291  1.00 29.60 ?  571  ILE A CA    1 
ATOM   4311 C  C     . ILE C 3 505 ? 25.928  -20.773 29.438  1.00 28.48 ?  571  ILE A C     1 
ATOM   4312 O  O     . ILE C 3 505 ? 25.274  -21.706 29.896  1.00 28.20 ?  571  ILE A O     1 
ATOM   4313 C  CB    . ILE C 3 505 ? 25.138  -19.326 31.339  1.00 29.71 ?  571  ILE A CB    1 
ATOM   4314 C  CG1   . ILE C 3 505 ? 23.936  -18.652 30.678  1.00 29.76 ?  571  ILE A CG1   1 
ATOM   4315 C  CG2   . ILE C 3 505 ? 25.662  -18.446 32.491  1.00 31.19 ?  571  ILE A CG2   1 
ATOM   4316 C  CD1   . ILE C 3 505 ? 22.611  -18.887 31.368  1.00 29.77 ?  571  ILE A CD1   1 
ATOM   4317 N  N     . ASP C 3 506 ? 26.393  -20.764 28.194  1.00 28.23 ?  572  ASP A N     1 
ATOM   4318 C  CA    . ASP C 3 506 ? 26.233  -21.921 27.301  1.00 27.45 ?  572  ASP A CA    1 
ATOM   4319 C  C     . ASP C 3 506 ? 24.797  -22.360 27.166  1.00 26.09 ?  572  ASP A C     1 
ATOM   4320 O  O     . ASP C 3 506 ? 24.471  -23.550 27.183  1.00 25.52 ?  572  ASP A O     1 
ATOM   4321 C  CB    . ASP C 3 506 ? 27.093  -23.070 27.789  1.00 28.47 ?  572  ASP A CB    1 
ATOM   4322 C  CG    . ASP C 3 506 ? 28.546  -22.738 27.702  1.00 31.72 ?  572  ASP A CG    1 
ATOM   4323 O  OD1   . ASP C 3 506 ? 28.907  -22.020 26.747  1.00 35.57 ?  572  ASP A OD1   1 
ATOM   4324 O  OD2   . ASP C 3 506 ? 29.312  -23.148 28.590  1.00 35.51 ?  572  ASP A OD2   1 
ATOM   4325 N  N     . THR C 3 507 ? 23.934  -21.377 27.001  1.00 24.70 ?  573  THR A N     1 
ATOM   4326 C  CA    . THR C 3 507 ? 22.527  -21.638 26.952  1.00 23.48 ?  573  THR A CA    1 
ATOM   4327 C  C     . THR C 3 507 ? 22.003  -21.228 25.595  1.00 22.83 ?  573  THR A C     1 
ATOM   4328 O  O     . THR C 3 507 ? 22.446  -20.228 25.019  1.00 22.76 ?  573  THR A O     1 
ATOM   4329 C  CB    . THR C 3 507 ? 21.825  -20.860 28.093  1.00 24.01 ?  573  THR A CB    1 
ATOM   4330 O  OG1   . THR C 3 507 ? 22.273  -21.403 29.343  1.00 24.14 ?  573  THR A OG1   1 
ATOM   4331 C  CG2   . THR C 3 507 ? 20.318  -21.004 27.995  1.00 21.27 ?  573  THR A CG2   1 
ATOM   4332 N  N     . VAL C 3 508 ? 21.056  -21.995 25.078  1.00 22.52 ?  574  VAL A N     1 
ATOM   4333 C  CA    . VAL C 3 508 ? 20.475  -21.664 23.784  1.00 22.38 ?  574  VAL A CA    1 
ATOM   4334 C  C     . VAL C 3 508 ? 18.965  -21.536 23.855  1.00 22.57 ?  574  VAL A C     1 
ATOM   4335 O  O     . VAL C 3 508 ? 18.301  -22.177 24.676  1.00 23.09 ?  574  VAL A O     1 
ATOM   4336 C  CB    . VAL C 3 508 ? 20.879  -22.689 22.675  1.00 22.15 ?  574  VAL A CB    1 
ATOM   4337 C  CG1   . VAL C 3 508 ? 22.364  -22.543 22.323  1.00 21.78 ?  574  VAL A CG1   1 
ATOM   4338 C  CG2   . VAL C 3 508 ? 20.563  -24.108 23.118  1.00 21.80 ?  574  VAL A CG2   1 
ATOM   4339 N  N     . ILE C 3 509 ? 18.422  -20.745 22.941  1.00 22.28 ?  575  ILE A N     1 
ATOM   4340 C  CA    . ILE C 3 509 ? 17.020  -20.351 22.972  1.00 22.16 ?  575  ILE A CA    1 
ATOM   4341 C  C     . ILE C 3 509 ? 16.198  -21.020 21.864  1.00 22.66 ?  575  ILE A C     1 
ATOM   4342 O  O     . ILE C 3 509 ? 16.486  -20.815 20.670  1.00 21.62 ?  575  ILE A O     1 
ATOM   4343 C  CB    . ILE C 3 509 ? 16.938  -18.807 22.804  1.00 22.04 ?  575  ILE A CB    1 
ATOM   4344 C  CG1   . ILE C 3 509 ? 17.728  -18.119 23.926  1.00 21.01 ?  575  ILE A CG1   1 
ATOM   4345 C  CG2   . ILE C 3 509 ? 15.477  -18.340 22.755  1.00 22.50 ?  575  ILE A CG2   1 
ATOM   4346 C  CD1   . ILE C 3 509 ? 17.864  -16.571 23.750  1.00 20.57 ?  575  ILE A CD1   1 
ATOM   4347 N  N     . PRO C 3 510 ? 15.157  -21.794 22.252  1.00 23.19 ?  576  PRO A N     1 
ATOM   4348 C  CA    . PRO C 3 510 ? 14.326  -22.504 21.278  1.00 23.78 ?  576  PRO A CA    1 
ATOM   4349 C  C     . PRO C 3 510 ? 13.559  -21.538 20.382  1.00 24.48 ?  576  PRO A C     1 
ATOM   4350 O  O     . PRO C 3 510 ? 13.071  -20.504 20.840  1.00 23.61 ?  576  PRO A O     1 
ATOM   4351 C  CB    . PRO C 3 510 ? 13.364  -23.313 22.156  1.00 24.14 ?  576  PRO A CB    1 
ATOM   4352 C  CG    . PRO C 3 510 ? 13.252  -22.507 23.419  1.00 24.21 ?  576  PRO A CG    1 
ATOM   4353 C  CD    . PRO C 3 510 ? 14.634  -21.925 23.626  1.00 22.73 ?  576  PRO A CD    1 
ATOM   4354 N  N     . ASN C 3 511 ? 13.496  -21.867 19.096  1.00 25.88 ?  577  ASN A N     1 
ATOM   4355 C  CA    . ASN C 3 511 ? 12.770  -21.086 18.119  1.00 27.24 ?  577  ASN A CA    1 
ATOM   4356 C  C     . ASN C 3 511 ? 11.310  -21.522 18.118  1.00 28.87 ?  577  ASN A C     1 
ATOM   4357 O  O     . ASN C 3 511 ? 11.010  -22.671 17.832  1.00 28.46 ?  577  ASN A O     1 
ATOM   4358 C  CB    . ASN C 3 511 ? 13.394  -21.293 16.724  1.00 27.12 ?  577  ASN A CB    1 
ATOM   4359 C  CG    . ASN C 3 511 ? 12.665  -20.522 15.643  1.00 26.64 ?  577  ASN A CG    1 
ATOM   4360 O  OD1   . ASN C 3 511 ? 12.453  -19.323 15.773  1.00 26.69 ?  577  ASN A OD1   1 
ATOM   4361 N  ND2   . ASN C 3 511 ? 12.281  -21.206 14.574  1.00 26.55 ?  577  ASN A ND2   1 
ATOM   4362 N  N     . MET C 3 512 ? 10.407  -20.618 18.487  1.00 31.01 ?  578  MET A N     1 
ATOM   4363 C  CA    A MET C 3 512 ? 8.974   -20.911 18.465  0.50 32.28 ?  578  MET A CA    1 
ATOM   4364 C  CA    B MET C 3 512 ? 8.968   -20.898 18.493  0.50 32.29 ?  578  MET A CA    1 
ATOM   4365 C  C     . MET C 3 512 ? 8.249   -19.947 17.545  1.00 33.09 ?  578  MET A C     1 
ATOM   4366 O  O     . MET C 3 512 ? 8.681   -18.814 17.356  1.00 33.26 ?  578  MET A O     1 
ATOM   4367 C  CB    A MET C 3 512 ? 8.375   -20.788 19.858  0.50 32.33 ?  578  MET A CB    1 
ATOM   4368 C  CB    B MET C 3 512 ? 8.384   -20.708 19.893  0.50 32.37 ?  578  MET A CB    1 
ATOM   4369 C  CG    A MET C 3 512 ? 9.118   -21.532 20.938  0.50 33.95 ?  578  MET A CG    1 
ATOM   4370 C  CG    B MET C 3 512 ? 9.342   -20.963 21.047  0.50 33.99 ?  578  MET A CG    1 
ATOM   4371 S  SD    A MET C 3 512 ? 8.601   -20.897 22.542  0.50 36.45 ?  578  MET A SD    1 
ATOM   4372 S  SD    B MET C 3 512 ? 9.564   -22.714 21.423  0.50 36.95 ?  578  MET A SD    1 
ATOM   4373 C  CE    A MET C 3 512 ? 9.436   -22.015 23.669  0.50 36.19 ?  578  MET A CE    1 
ATOM   4374 C  CE    B MET C 3 512 ? 9.862   -22.641 23.187  0.50 36.64 ?  578  MET A CE    1 
ATOM   4375 N  N     . GLN C 3 513 ? 7.140   -20.396 16.970  1.00 34.49 ?  579  GLN A N     1 
ATOM   4376 C  CA    . GLN C 3 513 ? 6.372   -19.537 16.086  1.00 36.83 ?  579  GLN A CA    1 
ATOM   4377 C  C     . GLN C 3 513 ? 5.431   -18.690 16.930  1.00 38.80 ?  579  GLN A C     1 
ATOM   4378 O  O     . GLN C 3 513 ? 4.858   -19.180 17.908  1.00 39.42 ?  579  GLN A O     1 
ATOM   4379 C  CB    . GLN C 3 513 ? 5.594   -20.358 15.045  1.00 37.02 ?  579  GLN A CB    1 
ATOM   4380 N  N     . SER C 3 514 ? 5.310   -17.411 16.580  1.00 40.39 ?  580  SER A N     1 
ATOM   4381 C  CA    . SER C 3 514 ? 4.348   -16.531 17.224  1.00 42.15 ?  580  SER A CA    1 
ATOM   4382 C  C     . SER C 3 514 ? 2.969   -17.153 17.084  1.00 42.85 ?  580  SER A C     1 
ATOM   4383 O  O     . SER C 3 514 ? 2.612   -17.638 16.017  1.00 42.99 ?  580  SER A O     1 
ATOM   4384 C  CB    . SER C 3 514 ? 4.348   -15.157 16.553  1.00 42.35 ?  580  SER A CB    1 
ATOM   4385 O  OG    . SER C 3 514 ? 5.664   -14.760 16.204  1.00 43.43 ?  580  SER A OG    1 
ATOM   4386 N  N     . GLN C 3 515 ? 2.198   -17.140 18.165  1.00 43.75 ?  581  GLN A N     1 
ATOM   4387 C  CA    . GLN C 3 515 ? 0.821   -17.625 18.124  1.00 44.15 ?  581  GLN A CA    1 
ATOM   4388 C  C     . GLN C 3 515 ? -0.039  -16.762 19.036  1.00 44.34 ?  581  GLN A C     1 
ATOM   4389 O  O     . GLN C 3 515 ? -0.240  -17.087 20.208  1.00 44.62 ?  581  GLN A O     1 
ATOM   4390 C  CB    . GLN C 3 515 ? 0.741   -19.096 18.547  1.00 44.29 ?  581  GLN A CB    1 
ATOM   4391 N  N     . ALA C 3 516 ? -0.527  -15.651 18.495  1.00 44.32 ?  582  ALA A N     1 
ATOM   4392 C  CA    . ALA C 3 516 ? -1.365  -14.730 19.255  1.00 44.64 ?  582  ALA A CA    1 
ATOM   4393 C  C     . ALA C 3 516 ? -2.483  -15.462 19.997  1.00 44.65 ?  582  ALA A C     1 
ATOM   4394 O  O     . ALA C 3 516 ? -3.180  -16.316 19.435  1.00 44.59 ?  582  ALA A O     1 
ATOM   4395 C  CB    . ALA C 3 516 ? -1.948  -13.652 18.342  1.00 44.48 ?  582  ALA A CB    1 
ATOM   4396 N  N     . SER C 3 517 ? -2.654  -15.127 21.269  1.00 44.49 ?  583  SER A N     1 
ATOM   4397 C  CA    . SER C 3 517 ? -3.724  -15.725 22.034  1.00 44.15 ?  583  SER A CA    1 
ATOM   4398 C  C     . SER C 3 517 ? -4.971  -14.878 21.889  1.00 43.66 ?  583  SER A C     1 
ATOM   4399 O  O     . SER C 3 517 ? -4.901  -13.691 21.553  1.00 43.61 ?  583  SER A O     1 
ATOM   4400 C  CB    . SER C 3 517 ? -3.337  -15.867 23.500  1.00 44.42 ?  583  SER A CB    1 
ATOM   4401 O  OG    . SER C 3 517 ? -4.325  -16.609 24.187  1.00 45.17 ?  583  SER A OG    1 
ATOM   4402 N  N     . ASP C 3 518 ? -6.116  -15.500 22.117  1.00 42.72 ?  584  ASP A N     1 
ATOM   4403 C  CA    . ASP C 3 518 ? -7.376  -14.776 22.111  1.00 42.00 ?  584  ASP A CA    1 
ATOM   4404 C  C     . ASP C 3 518 ? -7.705  -14.234 23.497  1.00 40.75 ?  584  ASP A C     1 
ATOM   4405 O  O     . ASP C 3 518 ? -8.673  -13.487 23.672  1.00 41.39 ?  584  ASP A O     1 
ATOM   4406 C  CB    . ASP C 3 518 ? -8.488  -15.689 21.612  1.00 42.54 ?  584  ASP A CB    1 
ATOM   4407 C  CG    . ASP C 3 518 ? -8.408  -15.912 20.121  1.00 43.91 ?  584  ASP A CG    1 
ATOM   4408 O  OD1   . ASP C 3 518 ? -8.251  -14.902 19.403  1.00 45.48 ?  584  ASP A OD1   1 
ATOM   4409 O  OD2   . ASP C 3 518 ? -8.485  -17.079 19.670  1.00 46.28 ?  584  ASP A OD2   1 
ATOM   4410 N  N     . ASP C 3 519 ? -6.892  -14.607 24.478  1.00 38.29 ?  585  ASP A N     1 
ATOM   4411 C  CA    . ASP C 3 519 ? -7.150  -14.220 25.852  1.00 36.28 ?  585  ASP A CA    1 
ATOM   4412 C  C     . ASP C 3 519 ? -5.952  -13.499 26.475  1.00 33.59 ?  585  ASP A C     1 
ATOM   4413 O  O     . ASP C 3 519 ? -4.803  -13.751 26.119  1.00 33.85 ?  585  ASP A O     1 
ATOM   4414 C  CB    . ASP C 3 519 ? -7.524  -15.450 26.685  1.00 36.87 ?  585  ASP A CB    1 
ATOM   4415 C  CG    . ASP C 3 519 ? -8.584  -16.324 26.008  1.00 39.81 ?  585  ASP A CG    1 
ATOM   4416 O  OD1   . ASP C 3 519 ? -9.586  -15.778 25.488  1.00 40.98 ?  585  ASP A OD1   1 
ATOM   4417 O  OD2   . ASP C 3 519 ? -8.412  -17.569 26.001  1.00 42.51 ?  585  ASP A OD2   1 
ATOM   4418 N  N     . GLN C 3 520 ? -6.239  -12.588 27.395  1.00 30.30 ?  586  GLN A N     1 
ATOM   4419 C  CA    . GLN C 3 520 ? -5.217  -11.926 28.182  1.00 27.58 ?  586  GLN A CA    1 
ATOM   4420 C  C     . GLN C 3 520 ? -5.160  -12.674 29.515  1.00 26.20 ?  586  GLN A C     1 
ATOM   4421 O  O     . GLN C 3 520 ? -6.182  -13.177 29.973  1.00 25.98 ?  586  GLN A O     1 
ATOM   4422 C  CB    . GLN C 3 520 ? -5.602  -10.458 28.410  1.00 27.57 ?  586  GLN A CB    1 
ATOM   4423 C  CG    . GLN C 3 520 ? -5.629  -9.587  27.130  1.00 27.34 ?  586  GLN A CG    1 
ATOM   4424 C  CD    . GLN C 3 520 ? -5.998  -8.137  27.434  1.00 27.82 ?  586  GLN A CD    1 
ATOM   4425 O  OE1   . GLN C 3 520 ? -7.130  -7.867  27.831  1.00 26.95 ?  586  GLN A OE1   1 
ATOM   4426 N  NE2   . GLN C 3 520 ? -5.045  -7.203  27.268  1.00 24.92 ?  586  GLN A NE2   1 
ATOM   4427 N  N     . TYR C 3 521 ? -3.988  -12.790 30.121  1.00 23.73 ?  587  TYR A N     1 
ATOM   4428 C  CA    . TYR C 3 521 ? -3.919  -13.399 31.449  1.00 22.48 ?  587  TYR A CA    1 
ATOM   4429 C  C     . TYR C 3 521 ? -4.313  -12.331 32.479  1.00 21.62 ?  587  TYR A C     1 
ATOM   4430 O  O     . TYR C 3 521 ? -4.467  -11.157 32.143  1.00 20.66 ?  587  TYR A O     1 
ATOM   4431 C  CB    . TYR C 3 521 ? -2.530  -13.993 31.743  1.00 22.14 ?  587  TYR A CB    1 
ATOM   4432 C  CG    . TYR C 3 521 ? -1.402  -12.985 31.567  1.00 21.53 ?  587  TYR A CG    1 
ATOM   4433 C  CD1   . TYR C 3 521 ? -0.794  -12.801 30.325  1.00 20.66 ?  587  TYR A CD1   1 
ATOM   4434 C  CD2   . TYR C 3 521 ? -0.976  -12.194 32.640  1.00 20.01 ?  587  TYR A CD2   1 
ATOM   4435 C  CE1   . TYR C 3 521 ? 0.225   -11.862 30.150  1.00 21.79 ?  587  TYR A CE1   1 
ATOM   4436 C  CE2   . TYR C 3 521 ? 0.024   -11.259 32.481  1.00 20.32 ?  587  TYR A CE2   1 
ATOM   4437 C  CZ    . TYR C 3 521 ? 0.623   -11.094 31.232  1.00 21.08 ?  587  TYR A CZ    1 
ATOM   4438 O  OH    . TYR C 3 521 ? 1.623   -10.164 31.082  1.00 19.44 ?  587  TYR A OH    1 
ATOM   4439 N  N     . GLU C 3 522 ? -4.488  -12.735 33.728  1.00 20.31 ?  588  GLU A N     1 
ATOM   4440 C  CA    . GLU C 3 522 ? -5.000  -11.797 34.743  1.00 20.45 ?  588  GLU A CA    1 
ATOM   4441 C  C     . GLU C 3 522 ? -3.936  -10.780 35.181  1.00 19.80 ?  588  GLU A C     1 
ATOM   4442 O  O     . GLU C 3 522 ? -2.786  -11.127 35.346  1.00 19.53 ?  588  GLU A O     1 
ATOM   4443 C  CB    . GLU C 3 522 ? -5.525  -12.570 35.958  1.00 20.25 ?  588  GLU A CB    1 
ATOM   4444 C  CG    . GLU C 3 522 ? -6.175  -11.669 36.991  1.00 21.31 ?  588  GLU A CG    1 
ATOM   4445 C  CD    . GLU C 3 522 ? -6.727  -12.428 38.190  1.00 22.82 ?  588  GLU A CD    1 
ATOM   4446 O  OE1   . GLU C 3 522 ? -6.550  -13.669 38.266  1.00 22.13 ?  588  GLU A OE1   1 
ATOM   4447 O  OE2   . GLU C 3 522 ? -7.329  -11.767 39.060  1.00 22.36 ?  588  GLU A OE2   1 
ATOM   4448 N  N     . GLY C 3 523 ? -4.332  -9.523  35.378  1.00 20.06 ?  589  GLY A N     1 
ATOM   4449 C  CA    . GLY C 3 523 ? -3.373  -8.473  35.686  1.00 19.37 ?  589  GLY A CA    1 
ATOM   4450 C  C     . GLY C 3 523 ? -3.471  -7.931  37.107  1.00 20.61 ?  589  GLY A C     1 
ATOM   4451 O  O     . GLY C 3 523 ? -3.647  -8.698  38.064  1.00 20.79 ?  589  GLY A O     1 
ATOM   4452 N  N     . ALA C 3 524 ? -3.369  -6.612  37.217  1.00 19.54 ?  590  ALA A N     1 
ATOM   4453 C  CA    . ALA C 3 524 ? -3.278  -5.900  38.498  1.00 20.24 ?  590  ALA A CA    1 
ATOM   4454 C  C     . ALA C 3 524 ? -4.606  -5.731  39.217  1.00 19.62 ?  590  ALA A C     1 
ATOM   4455 O  O     . ALA C 3 524 ? -5.666  -5.732  38.598  1.00 19.71 ?  590  ALA A O     1 
ATOM   4456 C  CB    . ALA C 3 524 ? -2.683  -4.512  38.240  1.00 19.52 ?  590  ALA A CB    1 
ATOM   4457 N  N     . THR C 3 525 ? -4.526  -5.506  40.520  1.00 19.95 ?  591  THR A N     1 
ATOM   4458 C  CA    . THR C 3 525 ? -5.659  -5.047  41.300  1.00 20.18 ?  591  THR A CA    1 
ATOM   4459 C  C     . THR C 3 525 ? -5.744  -3.520  41.274  1.00 20.15 ?  591  THR A C     1 
ATOM   4460 O  O     . THR C 3 525 ? -4.769  -2.835  41.533  1.00 19.63 ?  591  THR A O     1 
ATOM   4461 C  CB    . THR C 3 525 ? -5.519  -5.479  42.791  1.00 20.26 ?  591  THR A CB    1 
ATOM   4462 O  OG1   . THR C 3 525 ? -5.572  -6.899  42.873  1.00 19.43 ?  591  THR A OG1   1 
ATOM   4463 C  CG2   . THR C 3 525 ? -6.622  -4.898  43.632  1.00 21.08 ?  591  THR A CG2   1 
ATOM   4464 N  N     . VAL C 3 526 ? -6.923  -2.999  40.954  1.00 19.98 ?  592  VAL A N     1 
ATOM   4465 C  CA    . VAL C 3 526 ? -7.184  -1.592  41.131  1.00 20.77 ?  592  VAL A CA    1 
ATOM   4466 C  C     . VAL C 3 526 ? -8.222  -1.506  42.229  1.00 20.95 ?  592  VAL A C     1 
ATOM   4467 O  O     . VAL C 3 526 ? -9.300  -2.071  42.101  1.00 20.73 ?  592  VAL A O     1 
ATOM   4468 C  CB    . VAL C 3 526 ? -7.727  -0.935  39.835  1.00 21.82 ?  592  VAL A CB    1 
ATOM   4469 C  CG1   . VAL C 3 526 ? -7.868  0.603   40.047  1.00 21.73 ?  592  VAL A CG1   1 
ATOM   4470 C  CG2   . VAL C 3 526 ? -6.798  -1.261  38.657  1.00 21.70 ?  592  VAL A CG2   1 
ATOM   4471 N  N     . ILE C 3 527 ? -7.868  -0.841  43.328  1.00 20.97 ?  593  ILE A N     1 
ATOM   4472 C  CA    . ILE C 3 527 ? -8.714  -0.810  44.521  1.00 21.22 ?  593  ILE A CA    1 
ATOM   4473 C  C     . ILE C 3 527 ? -9.993  -0.013  44.264  1.00 21.32 ?  593  ILE A C     1 
ATOM   4474 O  O     . ILE C 3 527 ? -9.957  1.052   43.630  1.00 19.72 ?  593  ILE A O     1 
ATOM   4475 C  CB    . ILE C 3 527 ? -7.939  -0.204  45.724  1.00 21.07 ?  593  ILE A CB    1 
ATOM   4476 C  CG1   . ILE C 3 527 ? -6.715  -1.065  46.033  1.00 20.13 ?  593  ILE A CG1   1 
ATOM   4477 C  CG2   . ILE C 3 527 ? -8.867  -0.064  46.994  1.00 22.97 ?  593  ILE A CG2   1 
ATOM   4478 C  CD1   . ILE C 3 527 ? -5.924  -0.591  47.225  1.00 22.19 ?  593  ILE A CD1   1 
ATOM   4479 N  N     . GLU C 3 528 ? -11.117 -0.535  44.754  1.00 21.54 ?  594  GLU A N     1 
ATOM   4480 C  CA    . GLU C 3 528 ? -12.413 0.158   44.672  1.00 22.75 ?  594  GLU A CA    1 
ATOM   4481 C  C     . GLU C 3 528 ? -12.324 1.505   45.385  1.00 21.61 ?  594  GLU A C     1 
ATOM   4482 O  O     . GLU C 3 528 ? -12.027 1.557   46.576  1.00 21.09 ?  594  GLU A O     1 
ATOM   4483 C  CB    . GLU C 3 528 ? -13.519 -0.707  45.318  1.00 23.66 ?  594  GLU A CB    1 
ATOM   4484 C  CG    . GLU C 3 528 ? -14.911 -0.126  45.213  1.00 28.02 ?  594  GLU A CG    1 
ATOM   4485 C  CD    . GLU C 3 528 ? -15.423 -0.101  43.793  1.00 32.30 ?  594  GLU A CD    1 
ATOM   4486 O  OE1   . GLU C 3 528 ? -15.015 -0.963  42.981  1.00 34.77 ?  594  GLU A OE1   1 
ATOM   4487 O  OE2   . GLU C 3 528 ? -16.242 0.787   43.491  1.00 36.91 ?  594  GLU A OE2   1 
ATOM   4488 N  N     . PRO C 3 529 ? -12.574 2.607   44.659  1.00 21.16 ?  595  PRO A N     1 
ATOM   4489 C  CA    . PRO C 3 529 ? -12.372 3.896   45.321  1.00 20.90 ?  595  PRO A CA    1 
ATOM   4490 C  C     . PRO C 3 529 ? -13.490 4.273   46.298  1.00 20.76 ?  595  PRO A C     1 
ATOM   4491 O  O     . PRO C 3 529 ? -14.660 4.021   46.026  1.00 20.89 ?  595  PRO A O     1 
ATOM   4492 C  CB    . PRO C 3 529 ? -12.346 4.899   44.164  1.00 20.48 ?  595  PRO A CB    1 
ATOM   4493 C  CG    . PRO C 3 529 ? -13.116 4.205   43.036  1.00 21.75 ?  595  PRO A CG    1 
ATOM   4494 C  CD    . PRO C 3 529 ? -12.854 2.732   43.210  1.00 20.62 ?  595  PRO A CD    1 
ATOM   4495 N  N     . ILE C 3 530 ? -13.117 4.907   47.407  1.00 20.01 ?  596  ILE A N     1 
ATOM   4496 C  CA    . ILE C 3 530 ? -14.073 5.609   48.246  1.00 19.91 ?  596  ILE A CA    1 
ATOM   4497 C  C     . ILE C 3 530 ? -14.173 7.017   47.658  1.00 20.27 ?  596  ILE A C     1 
ATOM   4498 O  O     . ILE C 3 530 ? -13.409 7.901   48.018  1.00 20.20 ?  596  ILE A O     1 
ATOM   4499 C  CB    . ILE C 3 530 ? -13.612 5.618   49.740  1.00 19.87 ?  596  ILE A CB    1 
ATOM   4500 C  CG1   . ILE C 3 530 ? -13.348 4.171   50.203  1.00 20.09 ?  596  ILE A CG1   1 
ATOM   4501 C  CG2   . ILE C 3 530 ? -14.659 6.287   50.645  1.00 18.41 ?  596  ILE A CG2   1 
ATOM   4502 C  CD1   . ILE C 3 530 ? -12.817 4.044   51.692  1.00 20.25 ?  596  ILE A CD1   1 
ATOM   4503 N  N     . ARG C 3 531 ? -15.115 7.202   46.737  1.00 20.12 ?  597  ARG A N     1 
ATOM   4504 C  CA    . ARG C 3 531 ? -15.154 8.370   45.869  1.00 20.27 ?  597  ARG A CA    1 
ATOM   4505 C  C     . ARG C 3 531 ? -15.458 9.631   46.639  1.00 20.55 ?  597  ARG A C     1 
ATOM   4506 O  O     . ARG C 3 531 ? -16.150 9.594   47.655  1.00 19.42 ?  597  ARG A O     1 
ATOM   4507 C  CB    . ARG C 3 531 ? -16.211 8.181   44.783  1.00 20.73 ?  597  ARG A CB    1 
ATOM   4508 C  CG    . ARG C 3 531 ? -15.887 7.066   43.802  1.00 21.25 ?  597  ARG A CG    1 
ATOM   4509 C  CD    . ARG C 3 531 ? -17.136 6.702   42.996  1.00 22.97 ?  597  ARG A CD    1 
ATOM   4510 N  NE    . ARG C 3 531 ? -16.870 5.618   42.063  1.00 25.93 ?  597  ARG A NE    1 
ATOM   4511 C  CZ    . ARG C 3 531 ? -16.789 4.332   42.399  1.00 28.95 ?  597  ARG A CZ    1 
ATOM   4512 N  NH1   . ARG C 3 531 ? -16.955 3.949   43.668  1.00 27.79 ?  597  ARG A NH1   1 
ATOM   4513 N  NH2   . ARG C 3 531 ? -16.553 3.417   41.454  1.00 30.74 ?  597  ARG A NH2   1 
ATOM   4514 N  N     . GLY C 3 532 ? -14.946 10.757  46.158  1.00 20.14 ?  598  GLY A N     1 
ATOM   4515 C  CA    . GLY C 3 532 ? -15.361 12.021  46.740  1.00 20.56 ?  598  GLY A CA    1 
ATOM   4516 C  C     . GLY C 3 532 ? -14.275 13.077  46.849  1.00 20.75 ?  598  GLY A C     1 
ATOM   4517 O  O     . GLY C 3 532 ? -13.147 12.887  46.373  1.00 20.45 ?  598  GLY A O     1 
ATOM   4518 N  N     . TYR C 3 533 ? -14.630 14.194  47.474  1.00 20.35 ?  599  TYR A N     1 
ATOM   4519 C  CA    . TYR C 3 533 ? -13.719 15.318  47.600  1.00 20.93 ?  599  TYR A CA    1 
ATOM   4520 C  C     . TYR C 3 533 ? -13.102 15.277  48.973  1.00 21.09 ?  599  TYR A C     1 
ATOM   4521 O  O     . TYR C 3 533 ? -13.805 15.450  49.967  1.00 21.42 ?  599  TYR A O     1 
ATOM   4522 C  CB    . TYR C 3 533 ? -14.465 16.636  47.435  1.00 20.98 ?  599  TYR A CB    1 
ATOM   4523 C  CG    . TYR C 3 533 ? -13.555 17.841  47.307  1.00 21.94 ?  599  TYR A CG    1 
ATOM   4524 C  CD1   . TYR C 3 533 ? -12.897 18.099  46.120  1.00 24.71 ?  599  TYR A CD1   1 
ATOM   4525 C  CD2   . TYR C 3 533 ? -13.356 18.714  48.367  1.00 23.87 ?  599  TYR A CD2   1 
ATOM   4526 C  CE1   . TYR C 3 533 ? -12.069 19.184  45.982  1.00 25.43 ?  599  TYR A CE1   1 
ATOM   4527 C  CE2   . TYR C 3 533 ? -12.516 19.821  48.239  1.00 25.28 ?  599  TYR A CE2   1 
ATOM   4528 C  CZ    . TYR C 3 533 ? -11.876 20.036  47.036  1.00 25.32 ?  599  TYR A CZ    1 
ATOM   4529 O  OH    . TYR C 3 533 ? -11.041 21.110  46.850  1.00 27.62 ?  599  TYR A OH    1 
ATOM   4530 N  N     . TYR C 3 534 ? -11.797 15.058  49.045  1.00 21.20 ?  600  TYR A N     1 
ATOM   4531 C  CA    . TYR C 3 534 ? -11.137 14.958  50.351  1.00 21.88 ?  600  TYR A CA    1 
ATOM   4532 C  C     . TYR C 3 534 ? -10.461 16.279  50.693  1.00 22.20 ?  600  TYR A C     1 
ATOM   4533 O  O     . TYR C 3 534 ? -9.553  16.714  49.984  1.00 21.68 ?  600  TYR A O     1 
ATOM   4534 C  CB    . TYR C 3 534 ? -10.087 13.842  50.325  1.00 21.46 ?  600  TYR A CB    1 
ATOM   4535 C  CG    . TYR C 3 534 ? -10.696 12.459  50.307  1.00 22.52 ?  600  TYR A CG    1 
ATOM   4536 C  CD1   . TYR C 3 534 ? -10.985 11.801  51.504  1.00 21.84 ?  600  TYR A CD1   1 
ATOM   4537 C  CD2   . TYR C 3 534 ? -11.009 11.826  49.106  1.00 20.97 ?  600  TYR A CD2   1 
ATOM   4538 C  CE1   . TYR C 3 534 ? -11.543 10.532  51.504  1.00 22.27 ?  600  TYR A CE1   1 
ATOM   4539 C  CE2   . TYR C 3 534 ? -11.578 10.555  49.092  1.00 19.70 ?  600  TYR A CE2   1 
ATOM   4540 C  CZ    . TYR C 3 534 ? -11.825 9.915   50.297  1.00 20.79 ?  600  TYR A CZ    1 
ATOM   4541 O  OH    . TYR C 3 534 ? -12.377 8.666   50.314  1.00 20.12 ?  600  TYR A OH    1 
ATOM   4542 N  N     . ASP C 3 535 ? -10.898 16.901  51.777  1.00 22.64 ?  601  ASP A N     1 
ATOM   4543 C  CA    . ASP C 3 535 ? -10.268 18.135  52.268  1.00 23.92 ?  601  ASP A CA    1 
ATOM   4544 C  C     . ASP C 3 535 ? -9.299  17.846  53.434  1.00 23.97 ?  601  ASP A C     1 
ATOM   4545 O  O     . ASP C 3 535 ? -9.107  18.680  54.318  1.00 23.62 ?  601  ASP A O     1 
ATOM   4546 C  CB    . ASP C 3 535 ? -11.339 19.149  52.684  1.00 24.15 ?  601  ASP A CB    1 
ATOM   4547 C  CG    . ASP C 3 535 ? -10.957 20.585  52.344  1.00 27.58 ?  601  ASP A CG    1 
ATOM   4548 O  OD1   . ASP C 3 535 ? -11.606 21.513  52.882  1.00 34.00 ?  601  ASP A OD1   1 
ATOM   4549 O  OD2   . ASP C 3 535 ? -10.007 20.807  51.560  1.00 30.65 ?  601  ASP A OD2   1 
ATOM   4550 N  N     . VAL C 3 536 ? -8.707  16.652  53.417  1.00 23.92 ?  602  VAL A N     1 
ATOM   4551 C  CA    . VAL C 3 536 ? -7.640  16.269  54.337  1.00 23.85 ?  602  VAL A CA    1 
ATOM   4552 C  C     . VAL C 3 536 ? -6.519  15.637  53.506  1.00 23.26 ?  602  VAL A C     1 
ATOM   4553 O  O     . VAL C 3 536 ? -6.744  15.171  52.402  1.00 23.42 ?  602  VAL A O     1 
ATOM   4554 C  CB    . VAL C 3 536 ? -8.108  15.231  55.412  1.00 23.81 ?  602  VAL A CB    1 
ATOM   4555 C  CG1   . VAL C 3 536 ? -9.023  15.876  56.444  1.00 24.88 ?  602  VAL A CG1   1 
ATOM   4556 C  CG2   . VAL C 3 536 ? -8.795  14.029  54.735  1.00 24.43 ?  602  VAL A CG2   1 
ATOM   4557 N  N     . PRO C 3 537 ? -5.295  15.634  54.034  1.00 23.37 ?  603  PRO A N     1 
ATOM   4558 C  CA    . PRO C 3 537 ? -4.182  15.127  53.234  1.00 22.50 ?  603  PRO A CA    1 
ATOM   4559 C  C     . PRO C 3 537 ? -4.312  13.624  52.975  1.00 22.13 ?  603  PRO A C     1 
ATOM   4560 O  O     . PRO C 3 537 ? -4.690  12.870  53.871  1.00 22.53 ?  603  PRO A O     1 
ATOM   4561 C  CB    . PRO C 3 537 ? -2.956  15.409  54.102  1.00 22.64 ?  603  PRO A CB    1 
ATOM   4562 C  CG    . PRO C 3 537 ? -3.410  16.439  55.134  1.00 23.29 ?  603  PRO A CG    1 
ATOM   4563 C  CD    . PRO C 3 537 ? -4.875  16.235  55.320  1.00 22.49 ?  603  PRO A CD    1 
ATOM   4564 N  N     . ILE C 3 538 ? -4.009  13.216  51.754  1.00 21.45 ?  604  ILE A N     1 
ATOM   4565 C  CA    . ILE C 3 538 ? -3.996  11.812  51.354  1.00 20.73 ?  604  ILE A CA    1 
ATOM   4566 C  C     . ILE C 3 538 ? -2.566  11.435  50.966  1.00 21.16 ?  604  ILE A C     1 
ATOM   4567 O  O     . ILE C 3 538 ? -1.981  12.036  50.054  1.00 21.04 ?  604  ILE A O     1 
ATOM   4568 C  CB    . ILE C 3 538 ? -4.947  11.570  50.163  1.00 21.51 ?  604  ILE A CB    1 
ATOM   4569 C  CG1   . ILE C 3 538 ? -6.382  11.998  50.518  1.00 20.73 ?  604  ILE A CG1   1 
ATOM   4570 C  CG2   . ILE C 3 538 ? -4.875  10.092  49.663  1.00 18.88 ?  604  ILE A CG2   1 
ATOM   4571 C  CD1   . ILE C 3 538 ? -7.014  11.215  51.699  1.00 19.32 ?  604  ILE A CD1   1 
ATOM   4572 N  N     . ALA C 3 539 ? -1.989  10.455  51.662  1.00 20.53 ?  605  ALA A N     1 
ATOM   4573 C  CA    . ALA C 3 539 ? -0.596  10.074  51.417  1.00 20.53 ?  605  ALA A CA    1 
ATOM   4574 C  C     . ALA C 3 539 ? -0.545  8.976   50.372  1.00 20.44 ?  605  ALA A C     1 
ATOM   4575 O  O     . ALA C 3 539 ? -1.244  7.970   50.515  1.00 20.41 ?  605  ALA A O     1 
ATOM   4576 C  CB    . ALA C 3 539 ? 0.064   9.603   52.733  1.00 20.53 ?  605  ALA A CB    1 
ATOM   4577 N  N     . THR C 3 540 ? 0.235   9.181   49.303  1.00 20.33 ?  606  THR A N     1 
ATOM   4578 C  CA    . THR C 3 540 ? 0.364   8.177   48.250  1.00 20.73 ?  606  THR A CA    1 
ATOM   4579 C  C     . THR C 3 540 ? 1.690   7.424   48.371  1.00 21.91 ?  606  THR A C     1 
ATOM   4580 O  O     . THR C 3 540 ? 2.772   8.032   48.377  1.00 21.97 ?  606  THR A O     1 
ATOM   4581 C  CB    . THR C 3 540 ? 0.211   8.794   46.823  1.00 21.03 ?  606  THR A CB    1 
ATOM   4582 O  OG1   . THR C 3 540 ? -1.019  9.519   46.764  1.00 20.28 ?  606  THR A OG1   1 
ATOM   4583 C  CG2   . THR C 3 540 ? 0.168   7.683   45.778  1.00 19.54 ?  606  THR A CG2   1 
ATOM   4584 N  N     . LEU C 3 541 ? 1.584   6.099   48.503  1.00 22.29 ?  607  LEU A N     1 
ATOM   4585 C  CA    . LEU C 3 541 ? 2.725   5.225   48.652  1.00 22.59 ?  607  LEU A CA    1 
ATOM   4586 C  C     . LEU C 3 541 ? 2.753   4.326   47.425  1.00 23.41 ?  607  LEU A C     1 
ATOM   4587 O  O     . LEU C 3 541 ? 1.701   3.842   46.992  1.00 23.29 ?  607  LEU A O     1 
ATOM   4588 C  CB    . LEU C 3 541 ? 2.557   4.304   49.853  1.00 22.29 ?  607  LEU A CB    1 
ATOM   4589 C  CG    . LEU C 3 541 ? 2.086   4.856   51.206  1.00 23.85 ?  607  LEU A CG    1 
ATOM   4590 C  CD1   . LEU C 3 541 ? 2.209   3.768   52.283  1.00 24.38 ?  607  LEU A CD1   1 
ATOM   4591 C  CD2   . LEU C 3 541 ? 2.862   6.092   51.565  1.00 21.26 ?  607  LEU A CD2   1 
ATOM   4592 N  N     . ASP C 3 542 ? 3.939   4.084   46.885  1.00 23.58 ?  608  ASP A N     1 
ATOM   4593 C  CA    . ASP C 3 542 ? 4.059   3.125   45.779  1.00 24.13 ?  608  ASP A CA    1 
ATOM   4594 C  C     . ASP C 3 542 ? 5.414   2.422   45.671  1.00 23.31 ?  608  ASP A C     1 
ATOM   4595 O  O     . ASP C 3 542 ? 6.441   2.952   46.086  1.00 22.39 ?  608  ASP A O     1 
ATOM   4596 C  CB    . ASP C 3 542 ? 3.568   3.691   44.445  1.00 25.77 ?  608  ASP A CB    1 
ATOM   4597 C  CG    . ASP C 3 542 ? 4.640   4.373   43.662  1.00 27.08 ?  608  ASP A CG    1 
ATOM   4598 O  OD1   . ASP C 3 542 ? 5.170   3.735   42.730  1.00 25.54 ?  608  ASP A OD1   1 
ATOM   4599 O  OD2   . ASP C 3 542 ? 4.936   5.559   43.959  1.00 30.50 ?  608  ASP A OD2   1 
ATOM   4600 N  N     . PHE C 3 543 ? 5.385   1.208   45.132  1.00 23.16 ?  609  PHE A N     1 
ATOM   4601 C  CA    . PHE C 3 543 ? 6.572   0.367   45.053  1.00 22.65 ?  609  PHE A CA    1 
ATOM   4602 C  C     . PHE C 3 543 ? 7.492   0.852   43.932  1.00 22.80 ?  609  PHE A C     1 
ATOM   4603 O  O     . PHE C 3 543 ? 7.032   1.079   42.788  1.00 22.73 ?  609  PHE A O     1 
ATOM   4604 C  CB    . PHE C 3 543 ? 6.163   -1.099  44.803  1.00 22.58 ?  609  PHE A CB    1 
ATOM   4605 C  CG    . PHE C 3 543 ? 5.577   -1.810  46.032  1.00 22.22 ?  609  PHE A CG    1 
ATOM   4606 C  CD1   . PHE C 3 543 ? 4.201   -1.933  46.192  1.00 24.94 ?  609  PHE A CD1   1 
ATOM   4607 C  CD2   . PHE C 3 543 ? 6.404   -2.376  46.983  1.00 22.37 ?  609  PHE A CD2   1 
ATOM   4608 C  CE1   . PHE C 3 543 ? 3.648   -2.587  47.300  1.00 24.00 ?  609  PHE A CE1   1 
ATOM   4609 C  CE2   . PHE C 3 543 ? 5.870   -3.042  48.108  1.00 22.08 ?  609  PHE A CE2   1 
ATOM   4610 C  CZ    . PHE C 3 543 ? 4.493   -3.155  48.252  1.00 23.32 ?  609  PHE A CZ    1 
ATOM   4611 N  N     . ASN C 3 544 ? 8.778   1.006   44.251  1.00 21.95 ?  610  ASN A N     1 
ATOM   4612 C  CA    . ASN C 3 544 ? 9.791   1.302   43.244  1.00 22.96 ?  610  ASN A CA    1 
ATOM   4613 C  C     . ASN C 3 544 ? 9.887   0.124   42.264  1.00 22.92 ?  610  ASN A C     1 
ATOM   4614 O  O     . ASN C 3 544 ? 10.010  -1.032  42.697  1.00 22.23 ?  610  ASN A O     1 
ATOM   4615 C  CB    . ASN C 3 544 ? 11.166  1.462   43.882  1.00 23.35 ?  610  ASN A CB    1 
ATOM   4616 C  CG    . ASN C 3 544 ? 11.230  2.602   44.876  1.00 26.25 ?  610  ASN A CG    1 
ATOM   4617 O  OD1   . ASN C 3 544 ? 10.798  3.718   44.596  1.00 33.01 ?  610  ASN A OD1   1 
ATOM   4618 N  ND2   . ASN C 3 544 ? 11.797  2.333   46.035  1.00 27.26 ?  610  ASN A ND2   1 
ATOM   4619 N  N     . SER C 3 545 ? 9.849   0.407   40.960  1.00 22.40 ?  611  SER A N     1 
ATOM   4620 C  CA    . SER C 3 545 ? 10.085  -0.651  39.972  1.00 22.57 ?  611  SER A CA    1 
ATOM   4621 C  C     . SER C 3 545 ? 9.353   -1.951  40.319  1.00 22.18 ?  611  SER A C     1 
ATOM   4622 O  O     . SER C 3 545 ? 9.985   -2.978  40.443  1.00 22.98 ?  611  SER A O     1 
ATOM   4623 C  CB    . SER C 3 545 ? 11.590  -0.957  39.880  1.00 23.24 ?  611  SER A CB    1 
ATOM   4624 O  OG    . SER C 3 545 ? 12.377  0.190   39.549  1.00 23.47 ?  611  SER A OG    1 
ATOM   4625 N  N     . LEU C 3 546 ? 8.029   -1.938  40.478  1.00 22.23 ?  612  LEU A N     1 
ATOM   4626 C  CA    . LEU C 3 546 ? 7.401   -3.104  41.116  1.00 21.91 ?  612  LEU A CA    1 
ATOM   4627 C  C     . LEU C 3 546 ? 7.661   -4.426  40.390  1.00 21.85 ?  612  LEU A C     1 
ATOM   4628 O  O     . LEU C 3 546 ? 8.225   -5.341  40.979  1.00 22.63 ?  612  LEU A O     1 
ATOM   4629 C  CB    . LEU C 3 546 ? 5.889   -2.938  41.330  1.00 21.40 ?  612  LEU A CB    1 
ATOM   4630 C  CG    . LEU C 3 546 ? 5.276   -4.217  41.949  1.00 20.83 ?  612  LEU A CG    1 
ATOM   4631 C  CD1   . LEU C 3 546 ? 5.746   -4.418  43.409  1.00 18.01 ?  612  LEU A CD1   1 
ATOM   4632 C  CD2   . LEU C 3 546 ? 3.750   -4.250  41.849  1.00 19.88 ?  612  LEU A CD2   1 
ATOM   4633 N  N     . TYR C 3 547 ? 7.218   -4.552  39.144  1.00 21.41 ?  613  TYR A N     1 
ATOM   4634 C  CA    . TYR C 3 547 ? 7.285   -5.868  38.488  1.00 21.34 ?  613  TYR A CA    1 
ATOM   4635 C  C     . TYR C 3 547 ? 8.715   -6.431  38.354  1.00 21.17 ?  613  TYR A C     1 
ATOM   4636 O  O     . TYR C 3 547 ? 8.951   -7.599  38.648  1.00 21.29 ?  613  TYR A O     1 
ATOM   4637 C  CB    . TYR C 3 547 ? 6.555   -5.861  37.154  1.00 20.55 ?  613  TYR A CB    1 
ATOM   4638 C  CG    . TYR C 3 547 ? 5.047   -5.914  37.285  1.00 20.84 ?  613  TYR A CG    1 
ATOM   4639 C  CD1   . TYR C 3 547 ? 4.418   -5.696  38.509  1.00 18.81 ?  613  TYR A CD1   1 
ATOM   4640 C  CD2   . TYR C 3 547 ? 4.250   -6.142  36.168  1.00 21.40 ?  613  TYR A CD2   1 
ATOM   4641 C  CE1   . TYR C 3 547 ? 3.018   -5.725  38.619  1.00 21.52 ?  613  TYR A CE1   1 
ATOM   4642 C  CE2   . TYR C 3 547 ? 2.863   -6.156  36.257  1.00 20.31 ?  613  TYR A CE2   1 
ATOM   4643 C  CZ    . TYR C 3 547 ? 2.249   -5.964  37.491  1.00 22.34 ?  613  TYR A CZ    1 
ATOM   4644 O  OH    . TYR C 3 547 ? 0.866   -5.981  37.572  1.00 22.69 ?  613  TYR A OH    1 
ATOM   4645 N  N     . PRO C 3 548 ? 9.672   -5.592  37.946  1.00 21.13 ?  614  PRO A N     1 
ATOM   4646 C  CA    . PRO C 3 548 ? 11.078  -6.025  38.035  1.00 20.81 ?  614  PRO A CA    1 
ATOM   4647 C  C     . PRO C 3 548 ? 11.533  -6.449  39.454  1.00 21.26 ?  614  PRO A C     1 
ATOM   4648 O  O     . PRO C 3 548 ? 12.258  -7.435  39.596  1.00 19.84 ?  614  PRO A O     1 
ATOM   4649 C  CB    . PRO C 3 548 ? 11.856  -4.789  37.585  1.00 20.30 ?  614  PRO A CB    1 
ATOM   4650 C  CG    . PRO C 3 548 ? 10.896  -4.041  36.658  1.00 20.81 ?  614  PRO A CG    1 
ATOM   4651 C  CD    . PRO C 3 548 ? 9.526   -4.262  37.316  1.00 20.48 ?  614  PRO A CD    1 
ATOM   4652 N  N     . SER C 3 549 ? 11.125  -5.715  40.493  1.00 21.00 ?  615  SER A N     1 
ATOM   4653 C  CA    . SER C 3 549 ? 11.565  -6.079  41.837  1.00 20.66 ?  615  SER A CA    1 
ATOM   4654 C  C     . SER C 3 549 ? 10.976  -7.428  42.227  1.00 20.49 ?  615  SER A C     1 
ATOM   4655 O  O     . SER C 3 549 ? 11.582  -8.179  42.971  1.00 20.25 ?  615  SER A O     1 
ATOM   4656 C  CB    . SER C 3 549 ? 11.213  -5.011  42.884  1.00 20.58 ?  615  SER A CB    1 
ATOM   4657 O  OG    . SER C 3 549 ? 9.822   -4.991  43.174  1.00 22.03 ?  615  SER A OG    1 
ATOM   4658 N  N     . ILE C 3 550 ? 9.784   -7.723  41.733  1.00 20.48 ?  616  ILE A N     1 
ATOM   4659 C  CA    . ILE C 3 550 ? 9.184   -9.029  41.973  1.00 21.16 ?  616  ILE A CA    1 
ATOM   4660 C  C     . ILE C 3 550 ? 9.989   -10.144 41.279  1.00 21.24 ?  616  ILE A C     1 
ATOM   4661 O  O     . ILE C 3 550 ? 10.250  -11.184 41.874  1.00 21.62 ?  616  ILE A O     1 
ATOM   4662 C  CB    . ILE C 3 550 ? 7.704   -9.052  41.504  1.00 21.22 ?  616  ILE A CB    1 
ATOM   4663 C  CG1   . ILE C 3 550 ? 6.805   -8.230  42.444  1.00 22.03 ?  616  ILE A CG1   1 
ATOM   4664 C  CG2   . ILE C 3 550 ? 7.175   -10.490 41.393  1.00 19.86 ?  616  ILE A CG2   1 
ATOM   4665 C  CD1   . ILE C 3 550 ? 5.368   -7.995  41.846  1.00 19.98 ?  616  ILE A CD1   1 
ATOM   4666 N  N     . MET C 3 551 ? 10.364  -9.932  40.014  1.00 21.28 ?  617  MET A N     1 
ATOM   4667 C  CA    . MET C 3 551 ? 11.193  -10.900 39.278  1.00 21.65 ?  617  MET A CA    1 
ATOM   4668 C  C     . MET C 3 551 ? 12.560  -11.114 39.921  1.00 22.03 ?  617  MET A C     1 
ATOM   4669 O  O     . MET C 3 551 ? 13.080  -12.228 39.942  1.00 22.13 ?  617  MET A O     1 
ATOM   4670 C  CB    . MET C 3 551 ? 11.347  -10.484 37.804  1.00 21.71 ?  617  MET A CB    1 
ATOM   4671 C  CG    . MET C 3 551 ? 9.990   -10.442 37.071  1.00 23.19 ?  617  MET A CG    1 
ATOM   4672 S  SD    . MET C 3 551 ? 10.008  -9.790  35.393  1.00 24.41 ?  617  MET A SD    1 
ATOM   4673 C  CE    . MET C 3 551 ? 10.900  -11.068 34.495  1.00 22.04 ?  617  MET A CE    1 
ATOM   4674 N  N     . MET C 3 552 ? 13.135  -10.055 40.467  1.00 22.20 ?  618  MET A N     1 
ATOM   4675 C  CA    . MET C 3 552 ? 14.396  -10.198 41.175  1.00 22.86 ?  618  MET A CA    1 
ATOM   4676 C  C     . MET C 3 552 ? 14.214  -10.861 42.530  1.00 22.69 ?  618  MET A C     1 
ATOM   4677 O  O     . MET C 3 552 ? 14.957  -11.776 42.865  1.00 22.60 ?  618  MET A O     1 
ATOM   4678 C  CB    . MET C 3 552 ? 15.090  -8.841  41.317  1.00 23.00 ?  618  MET A CB    1 
ATOM   4679 C  CG    . MET C 3 552 ? 15.378  -8.205  39.927  1.00 26.00 ?  618  MET A CG    1 
ATOM   4680 S  SD    . MET C 3 552 ? 15.917  -6.493  40.031  1.00 31.71 ?  618  MET A SD    1 
ATOM   4681 C  CE    . MET C 3 552 ? 14.380  -5.729  40.464  1.00 31.61 ?  618  MET A CE    1 
ATOM   4682 N  N     . ALA C 3 553 ? 13.233  -10.411 43.308  1.00 21.77 ?  619  ALA A N     1 
ATOM   4683 C  CA    . ALA C 3 553 ? 13.077  -10.952 44.658  1.00 21.90 ?  619  ALA A CA    1 
ATOM   4684 C  C     . ALA C 3 553 ? 12.865  -12.452 44.589  1.00 21.83 ?  619  ALA A C     1 
ATOM   4685 O  O     . ALA C 3 553 ? 13.420  -13.214 45.391  1.00 21.48 ?  619  ALA A O     1 
ATOM   4686 C  CB    . ALA C 3 553 ? 11.912  -10.278 45.388  1.00 20.90 ?  619  ALA A CB    1 
ATOM   4687 N  N     . HIS C 3 554 ? 12.072  -12.876 43.608  1.00 22.28 ?  620  HIS A N     1 
ATOM   4688 C  CA    . HIS C 3 554 ? 11.662  -14.274 43.531  1.00 22.31 ?  620  HIS A CA    1 
ATOM   4689 C  C     . HIS C 3 554 ? 12.347  -15.082 42.438  1.00 21.78 ?  620  HIS A C     1 
ATOM   4690 O  O     . HIS C 3 554 ? 11.906  -16.185 42.121  1.00 22.52 ?  620  HIS A O     1 
ATOM   4691 C  CB    . HIS C 3 554 ? 10.144  -14.353 43.409  1.00 22.67 ?  620  HIS A CB    1 
ATOM   4692 C  CG    . HIS C 3 554 ? 9.435   -13.639 44.522  1.00 22.91 ?  620  HIS A CG    1 
ATOM   4693 N  ND1   . HIS C 3 554 ? 9.555   -14.017 45.843  1.00 23.70 ?  620  HIS A ND1   1 
ATOM   4694 C  CD2   . HIS C 3 554 ? 8.620   -12.558 44.509  1.00 21.52 ?  620  HIS A CD2   1 
ATOM   4695 C  CE1   . HIS C 3 554 ? 8.833   -13.204 46.597  1.00 24.44 ?  620  HIS A CE1   1 
ATOM   4696 N  NE2   . HIS C 3 554 ? 8.256   -12.310 45.811  1.00 22.35 ?  620  HIS A NE2   1 
ATOM   4697 N  N     . ASN C 3 555 ? 13.436  -14.555 41.898  1.00 20.69 ?  621  ASN A N     1 
ATOM   4698 C  CA    . ASN C 3 555 ? 14.297  -15.340 40.985  1.00 21.03 ?  621  ASN A CA    1 
ATOM   4699 C  C     . ASN C 3 555 ? 13.529  -15.910 39.791  1.00 20.62 ?  621  ASN A C     1 
ATOM   4700 O  O     . ASN C 3 555 ? 13.691  -17.065 39.413  1.00 20.17 ?  621  ASN A O     1 
ATOM   4701 C  CB    . ASN C 3 555 ? 15.019  -16.452 41.754  1.00 20.03 ?  621  ASN A CB    1 
ATOM   4702 C  CG    . ASN C 3 555 ? 16.239  -16.991 41.010  1.00 21.28 ?  621  ASN A CG    1 
ATOM   4703 O  OD1   . ASN C 3 555 ? 16.967  -16.234 40.361  1.00 18.39 ?  621  ASN A OD1   1 
ATOM   4704 N  ND2   . ASN C 3 555 ? 16.484  -18.306 41.129  1.00 20.12 ?  621  ASN A ND2   1 
ATOM   4705 N  N     . LEU C 3 556 ? 12.709  -15.061 39.188  1.00 21.28 ?  622  LEU A N     1 
ATOM   4706 C  CA    . LEU C 3 556 ? 11.800  -15.455 38.132  1.00 21.69 ?  622  LEU A CA    1 
ATOM   4707 C  C     . LEU C 3 556 ? 12.490  -15.341 36.776  1.00 22.05 ?  622  LEU A C     1 
ATOM   4708 O  O     . LEU C 3 556 ? 12.854  -14.237 36.347  1.00 22.00 ?  622  LEU A O     1 
ATOM   4709 C  CB    . LEU C 3 556 ? 10.603  -14.511 38.168  1.00 22.33 ?  622  LEU A CB    1 
ATOM   4710 C  CG    . LEU C 3 556 ? 9.290   -14.929 38.855  1.00 24.27 ?  622  LEU A CG    1 
ATOM   4711 C  CD1   . LEU C 3 556 ? 9.441   -15.987 39.957  1.00 21.68 ?  622  LEU A CD1   1 
ATOM   4712 C  CD2   . LEU C 3 556 ? 8.405   -13.744 39.248  1.00 19.90 ?  622  LEU A CD2   1 
ATOM   4713 N  N     . CYS C 3 557 ? 12.636  -16.466 36.085  1.00 21.63 ?  623  CYS A N     1 
ATOM   4714 C  CA    . CYS C 3 557 ? 13.344  -16.478 34.793  1.00 21.39 ?  623  CYS A CA    1 
ATOM   4715 C  C     . CYS C 3 557 ? 12.944  -17.732 34.046  1.00 21.26 ?  623  CYS A C     1 
ATOM   4716 O  O     . CYS C 3 557 ? 12.479  -18.701 34.652  1.00 20.60 ?  623  CYS A O     1 
ATOM   4717 C  CB    . CYS C 3 557 ? 14.870  -16.499 35.018  1.00 21.45 ?  623  CYS A CB    1 
ATOM   4718 S  SG    . CYS C 3 557 ? 15.951  -16.520 33.529  1.00 22.86 ?  623  CYS A SG    1 
ATOM   4719 N  N     . TYR C 3 558 ? 13.135  -17.714 32.727  1.00 21.51 ?  624  TYR A N     1 
ATOM   4720 C  CA    . TYR C 3 558 ? 12.994  -18.924 31.934  1.00 21.53 ?  624  TYR A CA    1 
ATOM   4721 C  C     . TYR C 3 558 ? 13.829  -20.052 32.528  1.00 21.10 ?  624  TYR A C     1 
ATOM   4722 O  O     . TYR C 3 558 ? 13.388  -21.193 32.557  1.00 21.52 ?  624  TYR A O     1 
ATOM   4723 C  CB    . TYR C 3 558 ? 13.458  -18.677 30.495  1.00 22.13 ?  624  TYR A CB    1 
ATOM   4724 C  CG    . TYR C 3 558 ? 12.691  -17.600 29.751  1.00 21.99 ?  624  TYR A CG    1 
ATOM   4725 C  CD1   . TYR C 3 558 ? 11.479  -17.888 29.136  1.00 22.65 ?  624  TYR A CD1   1 
ATOM   4726 C  CD2   . TYR C 3 558 ? 13.187  -16.307 29.656  1.00 22.03 ?  624  TYR A CD2   1 
ATOM   4727 C  CE1   . TYR C 3 558 ? 10.783  -16.919 28.441  1.00 23.49 ?  624  TYR A CE1   1 
ATOM   4728 C  CE2   . TYR C 3 558 ? 12.488  -15.309 28.962  1.00 22.52 ?  624  TYR A CE2   1 
ATOM   4729 C  CZ    . TYR C 3 558 ? 11.290  -15.630 28.361  1.00 22.90 ?  624  TYR A CZ    1 
ATOM   4730 O  OH    . TYR C 3 558 ? 10.583  -14.679 27.662  1.00 23.61 ?  624  TYR A OH    1 
ATOM   4731 N  N     . THR C 3 559 ? 15.041  -19.730 32.975  1.00 20.84 ?  625  THR A N     1 
ATOM   4732 C  CA    . THR C 3 559 ? 16.025  -20.741 33.399  1.00 20.43 ?  625  THR A CA    1 
ATOM   4733 C  C     . THR C 3 559 ? 15.741  -21.332 34.786  1.00 20.69 ?  625  THR A C     1 
ATOM   4734 O  O     . THR C 3 559 ? 16.329  -22.355 35.171  1.00 20.36 ?  625  THR A O     1 
ATOM   4735 C  CB    . THR C 3 559 ? 17.460  -20.158 33.444  1.00 20.47 ?  625  THR A CB    1 
ATOM   4736 O  OG1   . THR C 3 559 ? 17.502  -19.035 34.348  1.00 18.90 ?  625  THR A OG1   1 
ATOM   4737 C  CG2   . THR C 3 559 ? 17.926  -19.716 32.052  1.00 20.76 ?  625  THR A CG2   1 
ATOM   4738 N  N     . THR C 3 560 ? 14.854  -20.688 35.539  1.00 20.58 ?  626  THR A N     1 
ATOM   4739 C  CA    . THR C 3 560 ? 14.577  -21.128 36.900  1.00 21.31 ?  626  THR A CA    1 
ATOM   4740 C  C     . THR C 3 560 ? 13.198  -21.790 37.041  1.00 21.88 ?  626  THR A C     1 
ATOM   4741 O  O     . THR C 3 560 ? 12.862  -22.318 38.096  1.00 21.68 ?  626  THR A O     1 
ATOM   4742 C  CB    . THR C 3 560 ? 14.725  -19.961 37.893  1.00 21.29 ?  626  THR A CB    1 
ATOM   4743 O  OG1   . THR C 3 560 ? 13.819  -18.906 37.536  1.00 21.78 ?  626  THR A OG1   1 
ATOM   4744 C  CG2   . THR C 3 560 ? 16.158  -19.409 37.846  1.00 21.26 ?  626  THR A CG2   1 
ATOM   4745 N  N     . LEU C 3 561 ? 12.423  -21.781 35.962  1.00 22.66 ?  627  LEU A N     1 
ATOM   4746 C  CA    . LEU C 3 561 ? 11.114  -22.430 35.937  1.00 23.80 ?  627  LEU A CA    1 
ATOM   4747 C  C     . LEU C 3 561 ? 11.236  -23.948 36.120  1.00 24.78 ?  627  LEU A C     1 
ATOM   4748 O  O     . LEU C 3 561 ? 12.018  -24.598 35.440  1.00 24.76 ?  627  LEU A O     1 
ATOM   4749 C  CB    . LEU C 3 561 ? 10.428  -22.134 34.602  1.00 23.61 ?  627  LEU A CB    1 
ATOM   4750 C  CG    . LEU C 3 561 ? 9.043   -22.736 34.385  1.00 23.89 ?  627  LEU A CG    1 
ATOM   4751 C  CD1   . LEU C 3 561 ? 8.068   -22.230 35.456  1.00 23.00 ?  627  LEU A CD1   1 
ATOM   4752 C  CD2   . LEU C 3 561 ? 8.544   -22.397 32.981  1.00 25.16 ?  627  LEU A CD2   1 
ATOM   4753 N  N     . CYS C 3 562 ? 10.444  -24.520 37.014  1.00 25.73 ?  628  CYS A N     1 
ATOM   4754 C  CA    . CYS C 3 562 ? 10.570  -25.933 37.318  1.00 27.38 ?  628  CYS A CA    1 
ATOM   4755 C  C     . CYS C 3 562 ? 9.194   -26.579 37.303  1.00 27.76 ?  628  CYS A C     1 
ATOM   4756 O  O     . CYS C 3 562 ? 8.243   -26.003 36.792  1.00 26.86 ?  628  CYS A O     1 
ATOM   4757 C  CB    . CYS C 3 562 ? 11.219  -26.120 38.689  1.00 27.82 ?  628  CYS A CB    1 
ATOM   4758 S  SG    . CYS C 3 562 ? 12.077  -27.681 38.856  1.00 32.65 ?  628  CYS A SG    1 
ATOM   4759 N  N     . ASN C 3 563 ? 9.077   -27.767 37.883  1.00 29.04 ?  629  ASN A N     1 
ATOM   4760 C  CA    . ASN C 3 563 ? 7.765   -28.407 37.997  1.00 30.71 ?  629  ASN A CA    1 
ATOM   4761 C  C     . ASN C 3 563 ? 7.736   -29.499 39.057  1.00 31.50 ?  629  ASN A C     1 
ATOM   4762 O  O     . ASN C 3 563 ? 8.780   -29.943 39.527  1.00 31.44 ?  629  ASN A O     1 
ATOM   4763 C  CB    . ASN C 3 563 ? 7.288   -28.955 36.641  1.00 30.47 ?  629  ASN A CB    1 
ATOM   4764 C  CG    . ASN C 3 563 ? 8.234   -29.987 36.054  1.00 31.65 ?  629  ASN A CG    1 
ATOM   4765 O  OD1   . ASN C 3 563 ? 8.374   -30.088 34.837  1.00 33.77 ?  629  ASN A OD1   1 
ATOM   4766 N  ND2   . ASN C 3 563 ? 8.891   -30.749 36.911  1.00 31.55 ?  629  ASN A ND2   1 
ATOM   4767 N  N     . LYS C 3 564 ? 6.529   -29.917 39.426  1.00 32.64 ?  630  LYS A N     1 
ATOM   4768 C  CA    . LYS C 3 564 ? 6.338   -30.923 40.464  1.00 33.55 ?  630  LYS A CA    1 
ATOM   4769 C  C     . LYS C 3 564 ? 7.208   -32.151 40.233  1.00 34.10 ?  630  LYS A C     1 
ATOM   4770 O  O     . LYS C 3 564 ? 7.824   -32.670 41.167  1.00 34.58 ?  630  LYS A O     1 
ATOM   4771 C  CB    . LYS C 3 564 ? 4.861   -31.324 40.544  1.00 33.97 ?  630  LYS A CB    1 
ATOM   4772 N  N     . ALA C 3 565 ? 7.259   -32.604 38.982  1.00 34.64 ?  631  ALA A N     1 
ATOM   4773 C  CA    . ALA C 3 565 ? 7.999   -33.807 38.603  1.00 34.66 ?  631  ALA A CA    1 
ATOM   4774 C  C     . ALA C 3 565 ? 9.491   -33.679 38.876  1.00 34.90 ?  631  ALA A C     1 
ATOM   4775 O  O     . ALA C 3 565 ? 10.137  -34.620 39.344  1.00 34.86 ?  631  ALA A O     1 
ATOM   4776 C  CB    . ALA C 3 565 ? 7.783   -34.106 37.128  1.00 34.83 ?  631  ALA A CB    1 
ATOM   4777 N  N     . THR C 3 566 ? 10.040  -32.512 38.562  1.00 34.52 ?  632  THR A N     1 
ATOM   4778 C  CA    . THR C 3 566 ? 11.469  -32.280 38.710  1.00 34.51 ?  632  THR A CA    1 
ATOM   4779 C  C     . THR C 3 566 ? 11.868  -32.174 40.179  1.00 34.51 ?  632  THR A C     1 
ATOM   4780 O  O     . THR C 3 566 ? 12.834  -32.794 40.607  1.00 34.29 ?  632  THR A O     1 
ATOM   4781 C  CB    . THR C 3 566 ? 11.888  -31.003 37.972  1.00 34.24 ?  632  THR A CB    1 
ATOM   4782 O  OG1   . THR C 3 566 ? 11.512  -31.123 36.597  1.00 34.72 ?  632  THR A OG1   1 
ATOM   4783 C  CG2   . THR C 3 566 ? 13.395  -30.781 38.075  1.00 33.59 ?  632  THR A CG2   1 
ATOM   4784 N  N     . VAL C 3 567 ? 11.126  -31.374 40.935  1.00 34.74 ?  633  VAL A N     1 
ATOM   4785 C  CA    . VAL C 3 567 ? 11.396  -31.182 42.355  1.00 35.68 ?  633  VAL A CA    1 
ATOM   4786 C  C     . VAL C 3 567 ? 11.439  -32.515 43.113  1.00 36.38 ?  633  VAL A C     1 
ATOM   4787 O  O     . VAL C 3 567 ? 12.080  -32.631 44.158  1.00 35.97 ?  633  VAL A O     1 
ATOM   4788 C  CB    . VAL C 3 567 ? 10.339  -30.248 43.004  1.00 35.71 ?  633  VAL A CB    1 
ATOM   4789 C  CG1   . VAL C 3 567 ? 10.534  -28.805 42.539  1.00 35.27 ?  633  VAL A CG1   1 
ATOM   4790 C  CG2   . VAL C 3 567 ? 8.937   -30.733 42.674  1.00 36.21 ?  633  VAL A CG2   1 
ATOM   4791 N  N     . GLU C 3 568 ? 10.759  -33.518 42.568  1.00 37.35 ?  634  GLU A N     1 
ATOM   4792 C  CA    . GLU C 3 568 ? 10.698  -34.826 43.198  1.00 38.37 ?  634  GLU A CA    1 
ATOM   4793 C  C     . GLU C 3 568 ? 11.812  -35.730 42.702  1.00 38.59 ?  634  GLU A C     1 
ATOM   4794 O  O     . GLU C 3 568 ? 12.490  -36.366 43.500  1.00 38.92 ?  634  GLU A O     1 
ATOM   4795 C  CB    . GLU C 3 568 ? 9.316   -35.452 43.004  1.00 38.69 ?  634  GLU A CB    1 
ATOM   4796 C  CG    . GLU C 3 568 ? 8.278   -34.846 43.941  1.00 40.04 ?  634  GLU A CG    1 
ATOM   4797 C  CD    . GLU C 3 568 ? 6.852   -35.203 43.580  1.00 42.36 ?  634  GLU A CD    1 
ATOM   4798 O  OE1   . GLU C 3 568 ? 6.644   -35.944 42.597  1.00 43.60 ?  634  GLU A OE1   1 
ATOM   4799 O  OE2   . GLU C 3 568 ? 5.933   -34.729 44.287  1.00 43.73 ?  634  GLU A OE2   1 
ATOM   4800 N  N     . ARG C 3 569 ? 12.026  -35.766 41.391  1.00 38.68 ?  635  ARG A N     1 
ATOM   4801 C  CA    . ARG C 3 569 ? 13.150  -36.514 40.854  1.00 38.52 ?  635  ARG A CA    1 
ATOM   4802 C  C     . ARG C 3 569 ? 14.452  -36.028 41.473  1.00 38.37 ?  635  ARG A C     1 
ATOM   4803 O  O     . ARG C 3 569 ? 15.409  -36.793 41.609  1.00 38.31 ?  635  ARG A O     1 
ATOM   4804 C  CB    . ARG C 3 569 ? 13.229  -36.372 39.338  1.00 38.68 ?  635  ARG A CB    1 
ATOM   4805 C  CG    . ARG C 3 569 ? 14.541  -36.860 38.760  1.00 39.21 ?  635  ARG A CG    1 
ATOM   4806 C  CD    . ARG C 3 569 ? 14.516  -36.822 37.251  1.00 40.81 ?  635  ARG A CD    1 
ATOM   4807 N  NE    . ARG C 3 569 ? 14.271  -35.479 36.734  1.00 42.62 ?  635  ARG A NE    1 
ATOM   4808 C  CZ    . ARG C 3 569 ? 15.220  -34.667 36.279  1.00 43.71 ?  635  ARG A CZ    1 
ATOM   4809 N  NH1   . ARG C 3 569 ? 16.489  -35.061 36.283  1.00 44.27 ?  635  ARG A NH1   1 
ATOM   4810 N  NH2   . ARG C 3 569 ? 14.901  -33.462 35.815  1.00 44.19 ?  635  ARG A NH2   1 
ATOM   4811 N  N     . LEU C 3 570 ? 14.489  -34.746 41.830  1.00 37.94 ?  636  LEU A N     1 
ATOM   4812 C  CA    . LEU C 3 570 ? 15.695  -34.147 42.396  1.00 37.46 ?  636  LEU A CA    1 
ATOM   4813 C  C     . LEU C 3 570 ? 15.623  -34.013 43.909  1.00 37.15 ?  636  LEU A C     1 
ATOM   4814 O  O     . LEU C 3 570 ? 16.597  -33.618 44.545  1.00 37.07 ?  636  LEU A O     1 
ATOM   4815 C  CB    . LEU C 3 570 ? 15.977  -32.781 41.763  1.00 37.36 ?  636  LEU A CB    1 
ATOM   4816 C  CG    . LEU C 3 570 ? 16.245  -32.786 40.259  1.00 37.32 ?  636  LEU A CG    1 
ATOM   4817 C  CD1   . LEU C 3 570 ? 16.506  -31.375 39.752  1.00 37.56 ?  636  LEU A CD1   1 
ATOM   4818 C  CD2   . LEU C 3 570 ? 17.409  -33.693 39.925  1.00 37.41 ?  636  LEU A CD2   1 
ATOM   4819 N  N     . ASN C 3 571 ? 14.472  -34.338 44.488  1.00 36.88 ?  637  ASN A N     1 
ATOM   4820 C  CA    . ASN C 3 571 ? 14.325  -34.257 45.934  1.00 36.49 ?  637  ASN A CA    1 
ATOM   4821 C  C     . ASN C 3 571 ? 14.696  -32.869 46.458  1.00 36.19 ?  637  ASN A C     1 
ATOM   4822 O  O     . ASN C 3 571 ? 15.499  -32.741 47.385  1.00 36.15 ?  637  ASN A O     1 
ATOM   4823 C  CB    . ASN C 3 571 ? 15.189  -35.326 46.618  1.00 36.66 ?  637  ASN A CB    1 
ATOM   4824 C  CG    . ASN C 3 571 ? 14.394  -36.559 47.022  1.00 37.51 ?  637  ASN A CG    1 
ATOM   4825 O  OD1   . ASN C 3 571 ? 13.346  -36.456 47.662  1.00 37.49 ?  637  ASN A OD1   1 
ATOM   4826 N  ND2   . ASN C 3 571 ? 14.905  -37.737 46.673  1.00 38.47 ?  637  ASN A ND2   1 
ATOM   4827 N  N     . LEU C 3 572 ? 14.113  -31.832 45.860  1.00 35.37 ?  638  LEU A N     1 
ATOM   4828 C  CA    . LEU C 3 572 ? 14.345  -30.466 46.313  1.00 34.94 ?  638  LEU A CA    1 
ATOM   4829 C  C     . LEU C 3 572 ? 13.378  -30.104 47.432  1.00 34.62 ?  638  LEU A C     1 
ATOM   4830 O  O     . LEU C 3 572 ? 12.258  -30.611 47.489  1.00 34.72 ?  638  LEU A O     1 
ATOM   4831 C  CB    . LEU C 3 572 ? 14.202  -29.477 45.150  1.00 34.79 ?  638  LEU A CB    1 
ATOM   4832 C  CG    . LEU C 3 572 ? 15.129  -29.684 43.947  1.00 35.00 ?  638  LEU A CG    1 
ATOM   4833 C  CD1   . LEU C 3 572 ? 14.842  -28.639 42.866  1.00 34.66 ?  638  LEU A CD1   1 
ATOM   4834 C  CD2   . LEU C 3 572 ? 16.583  -29.622 44.383  1.00 34.15 ?  638  LEU A CD2   1 
ATOM   4835 N  N     . LYS C 3 573 ? 13.807  -29.223 48.325  1.00 34.32 ?  639  LYS A N     1 
ATOM   4836 C  CA    . LYS C 3 573 ? 12.972  -28.853 49.460  1.00 34.22 ?  639  LYS A CA    1 
ATOM   4837 C  C     . LYS C 3 573 ? 12.291  -27.520 49.235  1.00 34.15 ?  639  LYS A C     1 
ATOM   4838 O  O     . LYS C 3 573 ? 12.939  -26.536 48.871  1.00 33.90 ?  639  LYS A O     1 
ATOM   4839 C  CB    . LYS C 3 573 ? 13.796  -28.793 50.745  1.00 34.36 ?  639  LYS A CB    1 
ATOM   4840 N  N     . ILE C 3 574 ? 10.985  -27.480 49.475  1.00 34.06 ?  640  ILE A N     1 
ATOM   4841 C  CA    . ILE C 3 574 ? 10.248  -26.242 49.318  1.00 34.32 ?  640  ILE A CA    1 
ATOM   4842 C  C     . ILE C 3 574 ? 10.852  -25.104 50.138  1.00 34.38 ?  640  ILE A C     1 
ATOM   4843 O  O     . ILE C 3 574 ? 11.239  -25.283 51.292  1.00 34.16 ?  640  ILE A O     1 
ATOM   4844 C  CB    . ILE C 3 574 ? 8.758   -26.390 49.657  1.00 34.38 ?  640  ILE A CB    1 
ATOM   4845 C  CG1   . ILE C 3 574 ? 8.044   -25.070 49.353  1.00 35.05 ?  640  ILE A CG1   1 
ATOM   4846 C  CG2   . ILE C 3 574 ? 8.583   -26.763 51.123  1.00 34.76 ?  640  ILE A CG2   1 
ATOM   4847 C  CD1   . ILE C 3 574 ? 6.730   -25.208 48.618  1.00 36.08 ?  640  ILE A CD1   1 
ATOM   4848 N  N     . ASP C 3 575 ? 10.928  -23.933 49.518  1.00 34.30 ?  641  ASP A N     1 
ATOM   4849 C  CA    . ASP C 3 575 ? 11.452  -22.724 50.156  1.00 34.35 ?  641  ASP A CA    1 
ATOM   4850 C  C     . ASP C 3 575 ? 12.976  -22.656 50.201  1.00 34.08 ?  641  ASP A C     1 
ATOM   4851 O  O     . ASP C 3 575 ? 13.548  -21.582 50.068  1.00 34.61 ?  641  ASP A O     1 
ATOM   4852 C  CB    . ASP C 3 575 ? 10.839  -22.518 51.540  1.00 34.91 ?  641  ASP A CB    1 
ATOM   4853 C  CG    . ASP C 3 575 ? 9.422   -22.009 51.457  1.00 35.41 ?  641  ASP A CG    1 
ATOM   4854 O  OD1   . ASP C 3 575 ? 9.147   -21.167 50.571  1.00 38.46 ?  641  ASP A OD1   1 
ATOM   4855 O  OD2   . ASP C 3 575 ? 8.576   -22.460 52.249  1.00 37.54 ?  641  ASP A OD2   1 
ATOM   4856 N  N     . GLU C 3 576 ? 13.636  -23.789 50.383  1.00 33.33 ?  642  GLU A N     1 
ATOM   4857 C  CA    . GLU C 3 576 ? 15.088  -23.802 50.264  1.00 32.79 ?  642  GLU A CA    1 
ATOM   4858 C  C     . GLU C 3 576 ? 15.535  -23.881 48.801  1.00 31.26 ?  642  GLU A C     1 
ATOM   4859 O  O     . GLU C 3 576 ? 16.350  -23.079 48.360  1.00 30.93 ?  642  GLU A O     1 
ATOM   4860 C  CB    . GLU C 3 576 ? 15.698  -24.944 51.069  1.00 32.76 ?  642  GLU A CB    1 
ATOM   4861 C  CG    . GLU C 3 576 ? 16.256  -24.515 52.412  1.00 36.18 ?  642  GLU A CG    1 
ATOM   4862 C  CD    . GLU C 3 576 ? 17.774  -24.396 52.412  1.00 39.64 ?  642  GLU A CD    1 
ATOM   4863 O  OE1   . GLU C 3 576 ? 18.328  -23.899 53.420  1.00 40.31 ?  642  GLU A OE1   1 
ATOM   4864 O  OE2   . GLU C 3 576 ? 18.412  -24.815 51.415  1.00 40.99 ?  642  GLU A OE2   1 
ATOM   4865 N  N     . ASP C 3 577 ? 14.988  -24.847 48.070  1.00 30.05 ?  643  ASP A N     1 
ATOM   4866 C  CA    . ASP C 3 577 ? 15.415  -25.145 46.703  1.00 29.50 ?  643  ASP A CA    1 
ATOM   4867 C  C     . ASP C 3 577 ? 14.463  -24.580 45.665  1.00 28.86 ?  643  ASP A C     1 
ATOM   4868 O  O     . ASP C 3 577 ? 14.836  -24.391 44.506  1.00 28.27 ?  643  ASP A O     1 
ATOM   4869 C  CB    . ASP C 3 577 ? 15.503  -26.654 46.499  1.00 29.41 ?  643  ASP A CB    1 
ATOM   4870 C  CG    . ASP C 3 577 ? 16.525  -27.291 47.392  1.00 30.45 ?  643  ASP A CG    1 
ATOM   4871 O  OD1   . ASP C 3 577 ? 17.552  -26.628 47.664  1.00 31.12 ?  643  ASP A OD1   1 
ATOM   4872 O  OD2   . ASP C 3 577 ? 16.300  -28.448 47.819  1.00 30.74 ?  643  ASP A OD2   1 
ATOM   4873 N  N     . TYR C 3 578 ? 13.222  -24.348 46.077  1.00 28.21 ?  644  TYR A N     1 
ATOM   4874 C  CA    . TYR C 3 578 ? 12.224  -23.784 45.178  1.00 27.70 ?  644  TYR A CA    1 
ATOM   4875 C  C     . TYR C 3 578 ? 11.070  -23.175 45.933  1.00 27.36 ?  644  TYR A C     1 
ATOM   4876 O  O     . TYR C 3 578 ? 10.942  -23.298 47.160  1.00 26.91 ?  644  TYR A O     1 
ATOM   4877 C  CB    . TYR C 3 578 ? 11.674  -24.830 44.206  1.00 27.92 ?  644  TYR A CB    1 
ATOM   4878 C  CG    . TYR C 3 578 ? 10.681  -25.772 44.846  1.00 29.22 ?  644  TYR A CG    1 
ATOM   4879 C  CD1   . TYR C 3 578 ? 9.306   -25.570 44.717  1.00 29.33 ?  644  TYR A CD1   1 
ATOM   4880 C  CD2   . TYR C 3 578 ? 11.123  -26.850 45.599  1.00 29.47 ?  644  TYR A CD2   1 
ATOM   4881 C  CE1   . TYR C 3 578 ? 8.402   -26.440 45.313  1.00 29.71 ?  644  TYR A CE1   1 
ATOM   4882 C  CE2   . TYR C 3 578 ? 10.238  -27.711 46.200  1.00 30.81 ?  644  TYR A CE2   1 
ATOM   4883 C  CZ    . TYR C 3 578 ? 8.883   -27.511 46.054  1.00 31.31 ?  644  TYR A CZ    1 
ATOM   4884 O  OH    . TYR C 3 578 ? 8.020   -28.394 46.674  1.00 31.74 ?  644  TYR A OH    1 
ATOM   4885 N  N     . VAL C 3 579 ? 10.211  -22.546 45.153  1.00 26.58 ?  645  VAL A N     1 
ATOM   4886 C  CA    . VAL C 3 579 ? 9.155   -21.724 45.640  1.00 26.28 ?  645  VAL A CA    1 
ATOM   4887 C  C     . VAL C 3 579 ? 7.951   -22.007 44.763  1.00 25.71 ?  645  VAL A C     1 
ATOM   4888 O  O     . VAL C 3 579 ? 8.116   -22.407 43.605  1.00 25.30 ?  645  VAL A O     1 
ATOM   4889 C  CB    . VAL C 3 579 ? 9.604   -20.262 45.522  1.00 26.94 ?  645  VAL A CB    1 
ATOM   4890 C  CG1   . VAL C 3 579 ? 8.623   -19.426 44.729  1.00 27.66 ?  645  VAL A CG1   1 
ATOM   4891 C  CG2   . VAL C 3 579 ? 9.924   -19.688 46.888  1.00 26.74 ?  645  VAL A CG2   1 
ATOM   4892 N  N     . ILE C 3 580 ? 6.750   -21.855 45.324  1.00 24.68 ?  646  ILE A N     1 
ATOM   4893 C  CA    . ILE C 3 580 ? 5.515   -21.968 44.544  1.00 24.06 ?  646  ILE A CA    1 
ATOM   4894 C  C     . ILE C 3 580 ? 4.813   -20.620 44.522  1.00 23.52 ?  646  ILE A C     1 
ATOM   4895 O  O     . ILE C 3 580 ? 4.463   -20.103 45.564  1.00 23.09 ?  646  ILE A O     1 
ATOM   4896 C  CB    . ILE C 3 580 ? 4.560   -23.068 45.089  1.00 24.02 ?  646  ILE A CB    1 
ATOM   4897 C  CG1   . ILE C 3 580 ? 5.271   -24.428 45.059  1.00 23.92 ?  646  ILE A CG1   1 
ATOM   4898 C  CG2   . ILE C 3 580 ? 3.293   -23.124 44.246  1.00 23.15 ?  646  ILE A CG2   1 
ATOM   4899 C  CD1   . ILE C 3 580 ? 4.545   -25.569 45.807  1.00 25.37 ?  646  ILE A CD1   1 
ATOM   4900 N  N     . THR C 3 581 ? 4.641   -20.038 43.339  1.00 23.08 ?  647  THR A N     1 
ATOM   4901 C  CA    . THR C 3 581 ? 4.149   -18.668 43.260  1.00 22.98 ?  647  THR A CA    1 
ATOM   4902 C  C     . THR C 3 581 ? 2.662   -18.675 43.526  1.00 22.46 ?  647  THR A C     1 
ATOM   4903 O  O     . THR C 3 581 ? 2.031   -19.727 43.506  1.00 22.30 ?  647  THR A O     1 
ATOM   4904 C  CB    . THR C 3 581 ? 4.373   -18.031 41.861  1.00 22.96 ?  647  THR A CB    1 
ATOM   4905 O  OG1   . THR C 3 581 ? 3.394   -18.531 40.939  1.00 24.03 ?  647  THR A OG1   1 
ATOM   4906 C  CG2   . THR C 3 581 ? 5.787   -18.323 41.335  1.00 22.56 ?  647  THR A CG2   1 
ATOM   4907 N  N     . PRO C 3 582 ? 2.091   -17.495 43.751  1.00 23.04 ?  648  PRO A N     1 
ATOM   4908 C  CA    . PRO C 3 582 ? 0.646   -17.404 43.932  1.00 23.08 ?  648  PRO A CA    1 
ATOM   4909 C  C     . PRO C 3 582 ? -0.118  -17.793 42.662  1.00 23.13 ?  648  PRO A C     1 
ATOM   4910 O  O     . PRO C 3 582 ? -1.318  -18.025 42.723  1.00 23.06 ?  648  PRO A O     1 
ATOM   4911 C  CB    . PRO C 3 582 ? 0.428   -15.937 44.267  1.00 22.96 ?  648  PRO A CB    1 
ATOM   4912 C  CG    . PRO C 3 582 ? 1.745   -15.514 44.891  1.00 24.28 ?  648  PRO A CG    1 
ATOM   4913 C  CD    . PRO C 3 582 ? 2.781   -16.240 44.098  1.00 22.58 ?  648  PRO A CD    1 
ATOM   4914 N  N     . ASN C 3 583 ? 0.571   -17.857 41.527  1.00 23.15 ?  649  ASN A N     1 
ATOM   4915 C  CA    . ASN C 3 583 ? -0.034  -18.398 40.297  1.00 23.28 ?  649  ASN A CA    1 
ATOM   4916 C  C     . ASN C 3 583 ? 0.033   -19.920 40.246  1.00 23.04 ?  649  ASN A C     1 
ATOM   4917 O  O     . ASN C 3 583 ? -0.557  -20.538 39.365  1.00 23.65 ?  649  ASN A O     1 
ATOM   4918 C  CB    . ASN C 3 583 ? 0.627   -17.828 39.020  1.00 22.45 ?  649  ASN A CB    1 
ATOM   4919 C  CG    . ASN C 3 583 ? -0.191  -18.139 37.759  1.00 23.55 ?  649  ASN A CG    1 
ATOM   4920 O  OD1   . ASN C 3 583 ? -1.361  -17.764 37.670  1.00 24.29 ?  649  ASN A OD1   1 
ATOM   4921 N  ND2   . ASN C 3 583 ? 0.406   -18.853 36.806  1.00 22.92 ?  649  ASN A ND2   1 
ATOM   4922 N  N     . GLY C 3 584 ? 0.775   -20.521 41.174  1.00 23.48 ?  650  GLY A N     1 
ATOM   4923 C  CA    . GLY C 3 584 ? 0.890   -21.984 41.258  1.00 22.57 ?  650  GLY A CA    1 
ATOM   4924 C  C     . GLY C 3 584 ? 2.070   -22.590 40.515  1.00 23.31 ?  650  GLY A C     1 
ATOM   4925 O  O     . GLY C 3 584 ? 2.194   -23.816 40.440  1.00 22.39 ?  650  GLY A O     1 
ATOM   4926 N  N     . ASP C 3 585 ? 2.927   -21.733 39.950  1.00 22.86 ?  651  ASP A N     1 
ATOM   4927 C  CA    . ASP C 3 585 ? 4.140   -22.152 39.244  1.00 24.08 ?  651  ASP A CA    1 
ATOM   4928 C  C     . ASP C 3 585 ? 5.321   -22.395 40.181  1.00 24.09 ?  651  ASP A C     1 
ATOM   4929 O  O     . ASP C 3 585 ? 5.455   -21.723 41.206  1.00 24.60 ?  651  ASP A O     1 
ATOM   4930 C  CB    . ASP C 3 585 ? 4.555   -21.061 38.226  1.00 24.16 ?  651  ASP A CB    1 
ATOM   4931 C  CG    . ASP C 3 585 ? 3.432   -20.686 37.285  1.00 24.39 ?  651  ASP A CG    1 
ATOM   4932 O  OD1   . ASP C 3 585 ? 3.049   -21.541 36.450  1.00 24.77 ?  651  ASP A OD1   1 
ATOM   4933 O  OD2   . ASP C 3 585 ? 2.935   -19.540 37.385  1.00 26.06 ?  651  ASP A OD2   1 
ATOM   4934 N  N     . TYR C 3 586 ? 6.199   -23.329 39.811  1.00 24.04 ?  652  TYR A N     1 
ATOM   4935 C  CA    . TYR C 3 586 ? 7.398   -23.639 40.602  1.00 24.08 ?  652  TYR A CA    1 
ATOM   4936 C  C     . TYR C 3 586 ? 8.609   -22.939 39.990  1.00 23.92 ?  652  TYR A C     1 
ATOM   4937 O  O     . TYR C 3 586 ? 8.898   -23.140 38.812  1.00 24.15 ?  652  TYR A O     1 
ATOM   4938 C  CB    . TYR C 3 586 ? 7.705   -25.140 40.559  1.00 24.13 ?  652  TYR A CB    1 
ATOM   4939 C  CG    . TYR C 3 586 ? 6.720   -26.028 41.261  1.00 26.01 ?  652  TYR A CG    1 
ATOM   4940 C  CD1   . TYR C 3 586 ? 7.152   -26.989 42.171  1.00 27.73 ?  652  TYR A CD1   1 
ATOM   4941 C  CD2   . TYR C 3 586 ? 5.362   -25.919 41.019  1.00 27.53 ?  652  TYR A CD2   1 
ATOM   4942 C  CE1   . TYR C 3 586 ? 6.258   -27.812 42.824  1.00 28.66 ?  652  TYR A CE1   1 
ATOM   4943 C  CE2   . TYR C 3 586 ? 4.454   -26.740 41.677  1.00 29.30 ?  652  TYR A CE2   1 
ATOM   4944 C  CZ    . TYR C 3 586 ? 4.914   -27.681 42.574  1.00 28.58 ?  652  TYR A CZ    1 
ATOM   4945 O  OH    . TYR C 3 586 ? 4.019   -28.494 43.220  1.00 29.88 ?  652  TYR A OH    1 
ATOM   4946 N  N     . PHE C 3 587 ? 9.331   -22.151 40.778  1.00 22.83 ?  653  PHE A N     1 
ATOM   4947 C  CA    . PHE C 3 587 ? 10.605  -21.607 40.338  1.00 22.33 ?  653  PHE A CA    1 
ATOM   4948 C  C     . PHE C 3 587 ? 11.676  -21.976 41.351  1.00 22.36 ?  653  PHE A C     1 
ATOM   4949 O  O     . PHE C 3 587 ? 11.428  -21.910 42.556  1.00 21.60 ?  653  PHE A O     1 
ATOM   4950 C  CB    . PHE C 3 587 ? 10.535  -20.094 40.219  1.00 21.86 ?  653  PHE A CB    1 
ATOM   4951 C  CG    . PHE C 3 587 ? 9.741   -19.613 39.055  1.00 22.38 ?  653  PHE A CG    1 
ATOM   4952 C  CD1   . PHE C 3 587 ? 10.370  -19.321 37.837  1.00 21.81 ?  653  PHE A CD1   1 
ATOM   4953 C  CD2   . PHE C 3 587 ? 8.366   -19.433 39.166  1.00 19.71 ?  653  PHE A CD2   1 
ATOM   4954 C  CE1   . PHE C 3 587 ? 9.632   -18.842 36.758  1.00 22.31 ?  653  PHE A CE1   1 
ATOM   4955 C  CE2   . PHE C 3 587 ? 7.619   -18.984 38.086  1.00 22.08 ?  653  PHE A CE2   1 
ATOM   4956 C  CZ    . PHE C 3 587 ? 8.252   -18.685 36.875  1.00 21.57 ?  653  PHE A CZ    1 
ATOM   4957 N  N     . VAL C 3 588 ? 12.862  -22.372 40.887  1.00 22.09 ?  654  VAL A N     1 
ATOM   4958 C  CA    . VAL C 3 588 ? 13.938  -22.682 41.840  1.00 22.19 ?  654  VAL A CA    1 
ATOM   4959 C  C     . VAL C 3 588 ? 14.507  -21.387 42.413  1.00 22.56 ?  654  VAL A C     1 
ATOM   4960 O  O     . VAL C 3 588 ? 14.365  -20.307 41.825  1.00 22.55 ?  654  VAL A O     1 
ATOM   4961 C  CB    . VAL C 3 588 ? 15.081  -23.567 41.251  1.00 22.46 ?  654  VAL A CB    1 
ATOM   4962 C  CG1   . VAL C 3 588 ? 14.543  -24.911 40.758  1.00 21.71 ?  654  VAL A CG1   1 
ATOM   4963 C  CG2   . VAL C 3 588 ? 15.857  -22.830 40.145  1.00 21.10 ?  654  VAL A CG2   1 
ATOM   4964 N  N     . THR C 3 589 ? 15.132  -21.506 43.572  1.00 23.05 ?  655  THR A N     1 
ATOM   4965 C  CA    . THR C 3 589 ? 15.730  -20.381 44.286  1.00 23.14 ?  655  THR A CA    1 
ATOM   4966 C  C     . THR C 3 589 ? 17.151  -20.134 43.779  1.00 23.62 ?  655  THR A C     1 
ATOM   4967 O  O     . THR C 3 589 ? 17.733  -20.981 43.108  1.00 23.04 ?  655  THR A O     1 
ATOM   4968 C  CB    . THR C 3 589 ? 15.852  -20.717 45.787  1.00 23.11 ?  655  THR A CB    1 
ATOM   4969 O  OG1   . THR C 3 589 ? 16.635  -21.906 45.927  1.00 22.47 ?  655  THR A OG1   1 
ATOM   4970 C  CG2   . THR C 3 589 ? 14.465  -20.955 46.432  1.00 22.53 ?  655  THR A CG2   1 
ATOM   4971 N  N     . THR C 3 590 ? 17.724  -18.987 44.139  1.00 24.57 ?  656  THR A N     1 
ATOM   4972 C  CA    . THR C 3 590 ? 19.080  -18.644 43.718  1.00 24.93 ?  656  THR A CA    1 
ATOM   4973 C  C     . THR C 3 590 ? 20.074  -19.658 44.271  1.00 25.83 ?  656  THR A C     1 
ATOM   4974 O  O     . THR C 3 590 ? 21.188  -19.782 43.772  1.00 26.42 ?  656  THR A O     1 
ATOM   4975 C  CB    . THR C 3 590 ? 19.483  -17.248 44.228  1.00 25.27 ?  656  THR A CB    1 
ATOM   4976 O  OG1   . THR C 3 590 ? 19.363  -17.222 45.654  1.00 23.65 ?  656  THR A OG1   1 
ATOM   4977 C  CG2   . THR C 3 590 ? 18.583  -16.151 43.619  1.00 23.90 ?  656  THR A CG2   1 
ATOM   4978 N  N     . LYS C 3 591 ? 19.668  -20.387 45.306  1.00 26.14 ?  657  LYS A N     1 
ATOM   4979 C  CA    . LYS C 3 591 ? 20.454  -21.504 45.805  1.00 26.57 ?  657  LYS A CA    1 
ATOM   4980 C  C     . LYS C 3 591 ? 20.755  -22.481 44.673  1.00 26.69 ?  657  LYS A C     1 
ATOM   4981 O  O     . LYS C 3 591 ? 21.882  -22.953 44.533  1.00 26.98 ?  657  LYS A O     1 
ATOM   4982 C  CB    . LYS C 3 591 ? 19.692  -22.232 46.917  1.00 26.66 ?  657  LYS A CB    1 
ATOM   4983 C  CG    . LYS C 3 591 ? 20.304  -23.546 47.372  1.00 28.34 ?  657  LYS A CG    1 
ATOM   4984 C  CD    . LYS C 3 591 ? 19.679  -23.989 48.694  1.00 30.04 ?  657  LYS A CD    1 
ATOM   4985 C  CE    . LYS C 3 591 ? 20.525  -25.051 49.404  1.00 31.60 ?  657  LYS A CE    1 
ATOM   4986 N  NZ    . LYS C 3 591 ? 20.252  -26.424 48.894  1.00 32.02 ?  657  LYS A NZ    1 
ATOM   4987 N  N     . ARG C 3 592 ? 19.743  -22.797 43.875  1.00 26.02 ?  658  ARG A N     1 
ATOM   4988 C  CA    . ARG C 3 592 ? 19.908  -23.807 42.841  1.00 26.21 ?  658  ARG A CA    1 
ATOM   4989 C  C     . ARG C 3 592 ? 20.383  -23.170 41.532  1.00 25.61 ?  658  ARG A C     1 
ATOM   4990 O  O     . ARG C 3 592 ? 21.193  -23.749 40.803  1.00 25.15 ?  658  ARG A O     1 
ATOM   4991 C  CB    . ARG C 3 592 ? 18.604  -24.587 42.635  1.00 26.16 ?  658  ARG A CB    1 
ATOM   4992 C  CG    . ARG C 3 592 ? 18.270  -25.517 43.795  1.00 28.55 ?  658  ARG A CG    1 
ATOM   4993 C  CD    . ARG C 3 592 ? 19.297  -26.618 43.940  1.00 30.40 ?  658  ARG A CD    1 
ATOM   4994 N  NE    . ARG C 3 592 ? 19.006  -27.436 45.110  1.00 34.24 ?  658  ARG A NE    1 
ATOM   4995 C  CZ    . ARG C 3 592 ? 19.737  -28.472 45.505  1.00 35.15 ?  658  ARG A CZ    1 
ATOM   4996 N  NH1   . ARG C 3 592 ? 20.817  -28.827 44.822  1.00 35.71 ?  658  ARG A NH1   1 
ATOM   4997 N  NH2   . ARG C 3 592 ? 19.386  -29.153 46.589  1.00 35.67 ?  658  ARG A NH2   1 
ATOM   4998 N  N     . ARG C 3 593 ? 19.890  -21.971 41.255  1.00 25.36 ?  659  ARG A N     1 
ATOM   4999 C  CA    . ARG C 3 593 ? 20.278  -21.259 40.033  1.00 25.88 ?  659  ARG A CA    1 
ATOM   5000 C  C     . ARG C 3 593 ? 19.904  -19.792 40.084  1.00 25.39 ?  659  ARG A C     1 
ATOM   5001 O  O     . ARG C 3 593 ? 18.767  -19.462 40.385  1.00 25.35 ?  659  ARG A O     1 
ATOM   5002 C  CB    . ARG C 3 593 ? 19.604  -21.879 38.811  1.00 25.54 ?  659  ARG A CB    1 
ATOM   5003 C  CG    . ARG C 3 593 ? 19.955  -21.170 37.502  1.00 27.35 ?  659  ARG A CG    1 
ATOM   5004 C  CD    . ARG C 3 593 ? 20.458  -22.205 36.504  1.00 30.70 ?  659  ARG A CD    1 
ATOM   5005 N  NE    . ARG C 3 593 ? 19.391  -22.666 35.634  1.00 32.43 ?  659  ARG A NE    1 
ATOM   5006 C  CZ    . ARG C 3 593 ? 19.401  -23.817 34.973  1.00 31.26 ?  659  ARG A CZ    1 
ATOM   5007 N  NH1   . ARG C 3 593 ? 20.423  -24.658 35.111  1.00 31.87 ?  659  ARG A NH1   1 
ATOM   5008 N  NH2   . ARG C 3 593 ? 18.376  -24.128 34.184  1.00 29.21 ?  659  ARG A NH2   1 
ATOM   5009 N  N     . ARG C 3 594 ? 20.869  -18.933 39.766  1.00 25.27 ?  660  ARG A N     1 
ATOM   5010 C  CA    . ARG C 3 594 ? 20.642  -17.506 39.589  1.00 25.51 ?  660  ARG A CA    1 
ATOM   5011 C  C     . ARG C 3 594 ? 20.007  -17.293 38.222  1.00 24.44 ?  660  ARG A C     1 
ATOM   5012 O  O     . ARG C 3 594 ? 20.638  -17.564 37.213  1.00 24.05 ?  660  ARG A O     1 
ATOM   5013 C  CB    . ARG C 3 594 ? 21.980  -16.782 39.586  1.00 25.83 ?  660  ARG A CB    1 
ATOM   5014 C  CG    . ARG C 3 594 ? 22.793  -16.948 40.860  1.00 29.60 ?  660  ARG A CG    1 
ATOM   5015 C  CD    . ARG C 3 594 ? 22.299  -15.932 41.860  1.00 35.00 ?  660  ARG A CD    1 
ATOM   5016 N  NE    . ARG C 3 594 ? 23.126  -15.849 43.057  1.00 37.68 ?  660  ARG A NE    1 
ATOM   5017 C  CZ    . ARG C 3 594 ? 23.013  -14.873 43.950  1.00 39.14 ?  660  ARG A CZ    1 
ATOM   5018 N  NH1   . ARG C 3 594 ? 22.122  -13.909 43.755  1.00 38.97 ?  660  ARG A NH1   1 
ATOM   5019 N  NH2   . ARG C 3 594 ? 23.796  -14.853 45.021  1.00 40.60 ?  660  ARG A NH2   1 
ATOM   5020 N  N     . GLY C 3 595 ? 18.782  -16.790 38.169  1.00 23.58 ?  661  GLY A N     1 
ATOM   5021 C  CA    . GLY C 3 595 ? 18.155  -16.563 36.857  1.00 22.89 ?  661  GLY A CA    1 
ATOM   5022 C  C     . GLY C 3 595 ? 18.780  -15.427 36.069  1.00 22.62 ?  661  GLY A C     1 
ATOM   5023 O  O     . GLY C 3 595 ? 19.480  -14.588 36.619  1.00 22.69 ?  661  GLY A O     1 
ATOM   5024 N  N     . ILE C 3 596 ? 18.537  -15.396 34.768  1.00 22.52 ?  662  ILE A N     1 
ATOM   5025 C  CA    . ILE C 3 596 ? 19.138  -14.385 33.909  1.00 22.33 ?  662  ILE A CA    1 
ATOM   5026 C  C     . ILE C 3 596 ? 18.277  -13.130 33.813  1.00 22.07 ?  662  ILE A C     1 
ATOM   5027 O  O     . ILE C 3 596 ? 18.795  -12.019 33.717  1.00 21.58 ?  662  ILE A O     1 
ATOM   5028 C  CB    . ILE C 3 596 ? 19.303  -14.923 32.480  1.00 23.34 ?  662  ILE A CB    1 
ATOM   5029 C  CG1   . ILE C 3 596 ? 20.431  -15.951 32.427  1.00 24.52 ?  662  ILE A CG1   1 
ATOM   5030 C  CG2   . ILE C 3 596 ? 19.603  -13.777 31.532  1.00 23.67 ?  662  ILE A CG2   1 
ATOM   5031 C  CD1   . ILE C 3 596 ? 20.253  -16.914 31.244  1.00 30.60 ?  662  ILE A CD1   1 
ATOM   5032 N  N     . LEU C 3 597 ? 16.959  -13.305 33.800  1.00 21.22 ?  663  LEU A N     1 
ATOM   5033 C  CA    . LEU C 3 597 ? 16.090  -12.125 33.770  1.00 21.25 ?  663  LEU A CA    1 
ATOM   5034 C  C     . LEU C 3 597 ? 16.413  -11.156 34.925  1.00 21.08 ?  663  LEU A C     1 
ATOM   5035 O  O     . LEU C 3 597 ? 16.520  -9.967  34.700  1.00 20.89 ?  663  LEU A O     1 
ATOM   5036 C  CB    . LEU C 3 597 ? 14.601  -12.503 33.711  1.00 20.75 ?  663  LEU A CB    1 
ATOM   5037 C  CG    . LEU C 3 597 ? 14.129  -13.249 32.456  1.00 20.51 ?  663  LEU A CG    1 
ATOM   5038 C  CD1   . LEU C 3 597 ? 12.570  -13.322 32.359  1.00 18.41 ?  663  LEU A CD1   1 
ATOM   5039 C  CD2   . LEU C 3 597 ? 14.755  -12.648 31.171  1.00 19.35 ?  663  LEU A CD2   1 
ATOM   5040 N  N     . PRO C 3 598 ? 16.588  -11.667 36.154  1.00 21.60 ?  664  PRO A N     1 
ATOM   5041 C  CA    . PRO C 3 598 ? 16.967  -10.798 37.279  1.00 22.22 ?  664  PRO A CA    1 
ATOM   5042 C  C     . PRO C 3 598 ? 18.228  -9.971  37.029  1.00 22.39 ?  664  PRO A C     1 
ATOM   5043 O  O     . PRO C 3 598 ? 18.303  -8.822  37.463  1.00 22.56 ?  664  PRO A O     1 
ATOM   5044 C  CB    . PRO C 3 598 ? 17.193  -11.783 38.436  1.00 22.30 ?  664  PRO A CB    1 
ATOM   5045 C  CG    . PRO C 3 598 ? 16.192  -12.923 38.121  1.00 22.39 ?  664  PRO A CG    1 
ATOM   5046 C  CD    . PRO C 3 598 ? 16.169  -13.012 36.599  1.00 22.56 ?  664  PRO A CD    1 
ATOM   5047 N  N     . ILE C 3 599 ? 19.210  -10.549 36.344  1.00 22.86 ?  665  ILE A N     1 
ATOM   5048 C  CA    . ILE C 3 599 ? 20.452  -9.843  36.046  1.00 23.08 ?  665  ILE A CA    1 
ATOM   5049 C  C     . ILE C 3 599 ? 20.219  -8.745  35.004  1.00 22.62 ?  665  ILE A C     1 
ATOM   5050 O  O     . ILE C 3 599 ? 20.711  -7.628  35.146  1.00 22.44 ?  665  ILE A O     1 
ATOM   5051 C  CB    . ILE C 3 599 ? 21.558  -10.812 35.578  1.00 23.03 ?  665  ILE A CB    1 
ATOM   5052 C  CG1   . ILE C 3 599 ? 21.905  -11.807 36.694  1.00 24.75 ?  665  ILE A CG1   1 
ATOM   5053 C  CG2   . ILE C 3 599 ? 22.812  -10.041 35.160  1.00 23.95 ?  665  ILE A CG2   1 
ATOM   5054 C  CD1   . ILE C 3 599 ? 22.881  -12.933 36.252  1.00 24.63 ?  665  ILE A CD1   1 
ATOM   5055 N  N     . ILE C 3 600 ? 19.464  -9.066  33.956  1.00 22.73 ?  666  ILE A N     1 
ATOM   5056 C  CA    . ILE C 3 600 ? 19.114  -8.063  32.947  1.00 22.39 ?  666  ILE A CA    1 
ATOM   5057 C  C     . ILE C 3 600 ? 18.364  -6.895  33.603  1.00 22.45 ?  666  ILE A C     1 
ATOM   5058 O  O     . ILE C 3 600 ? 18.640  -5.719  33.329  1.00 21.66 ?  666  ILE A O     1 
ATOM   5059 C  CB    . ILE C 3 600 ? 18.248  -8.682  31.833  1.00 22.54 ?  666  ILE A CB    1 
ATOM   5060 C  CG1   . ILE C 3 600 ? 19.103  -9.634  30.983  1.00 22.28 ?  666  ILE A CG1   1 
ATOM   5061 C  CG2   . ILE C 3 600 ? 17.605  -7.574  30.992  1.00 22.61 ?  666  ILE A CG2   1 
ATOM   5062 C  CD1   . ILE C 3 600 ? 18.331  -10.488 30.012  1.00 23.38 ?  666  ILE A CD1   1 
ATOM   5063 N  N     . LEU C 3 601 ? 17.409  -7.220  34.475  1.00 22.03 ?  667  LEU A N     1 
ATOM   5064 C  CA    . LEU C 3 601 ? 16.663  -6.170  35.181  1.00 22.40 ?  667  LEU A CA    1 
ATOM   5065 C  C     . LEU C 3 601 ? 17.581  -5.355  36.100  1.00 23.09 ?  667  LEU A C     1 
ATOM   5066 O  O     . LEU C 3 601 ? 17.452  -4.137  36.186  1.00 23.28 ?  667  LEU A O     1 
ATOM   5067 C  CB    . LEU C 3 601 ? 15.505  -6.774  35.973  1.00 21.78 ?  667  LEU A CB    1 
ATOM   5068 C  CG    . LEU C 3 601 ? 14.419  -7.417  35.096  1.00 21.48 ?  667  LEU A CG    1 
ATOM   5069 C  CD1   . LEU C 3 601 ? 13.561  -8.376  35.938  1.00 20.16 ?  667  LEU A CD1   1 
ATOM   5070 C  CD2   . LEU C 3 601 ? 13.565  -6.339  34.438  1.00 20.25 ?  667  LEU A CD2   1 
ATOM   5071 N  N     . ASP C 3 602 ? 18.495  -6.032  36.796  1.00 23.48 ?  668  ASP A N     1 
ATOM   5072 C  CA    . ASP C 3 602 ? 19.427  -5.349  37.682  1.00 24.39 ?  668  ASP A CA    1 
ATOM   5073 C  C     . ASP C 3 602 ? 20.233  -4.305  36.914  1.00 24.41 ?  668  ASP A C     1 
ATOM   5074 O  O     . ASP C 3 602 ? 20.421  -3.185  37.382  1.00 24.55 ?  668  ASP A O     1 
ATOM   5075 C  CB    . ASP C 3 602 ? 20.371  -6.350  38.359  1.00 25.10 ?  668  ASP A CB    1 
ATOM   5076 C  CG    . ASP C 3 602 ? 21.109  -5.749  39.561  1.00 27.86 ?  668  ASP A CG    1 
ATOM   5077 O  OD1   . ASP C 3 602 ? 20.701  -4.681  40.034  1.00 32.74 ?  668  ASP A OD1   1 
ATOM   5078 O  OD2   . ASP C 3 602 ? 22.090  -6.353  40.049  1.00 31.53 ?  668  ASP A OD2   1 
ATOM   5079 N  N     . GLU C 3 603 ? 20.704  -4.668  35.730  1.00 24.30 ?  669  GLU A N     1 
ATOM   5080 C  CA    . GLU C 3 603 ? 21.500  -3.752  34.916  1.00 24.47 ?  669  GLU A CA    1 
ATOM   5081 C  C     . GLU C 3 603 ? 20.665  -2.578  34.407  1.00 24.37 ?  669  GLU A C     1 
ATOM   5082 O  O     . GLU C 3 603 ? 21.140  -1.442  34.377  1.00 24.27 ?  669  GLU A O     1 
ATOM   5083 C  CB    . GLU C 3 603 ? 22.147  -4.497  33.748  1.00 24.87 ?  669  GLU A CB    1 
ATOM   5084 C  CG    . GLU C 3 603 ? 23.248  -5.443  34.206  1.00 25.62 ?  669  GLU A CG    1 
ATOM   5085 C  CD    . GLU C 3 603 ? 23.840  -6.245  33.072  1.00 29.15 ?  669  GLU A CD    1 
ATOM   5086 O  OE1   . GLU C 3 603 ? 23.378  -6.094  31.915  1.00 29.93 ?  669  GLU A OE1   1 
ATOM   5087 O  OE2   . GLU C 3 603 ? 24.775  -7.024  33.340  1.00 30.70 ?  669  GLU A OE2   1 
ATOM   5088 N  N     . LEU C 3 604 ? 19.418  -2.849  34.025  1.00 23.66 ?  670  LEU A N     1 
ATOM   5089 C  CA    . LEU C 3 604 ? 18.537  -1.786  33.545  1.00 23.37 ?  670  LEU A CA    1 
ATOM   5090 C  C     . LEU C 3 604 ? 18.172  -0.816  34.674  1.00 23.54 ?  670  LEU A C     1 
ATOM   5091 O  O     . LEU C 3 604 ? 18.127  0.393   34.481  1.00 23.11 ?  670  LEU A O     1 
ATOM   5092 C  CB    . LEU C 3 604 ? 17.271  -2.370  32.913  1.00 23.19 ?  670  LEU A CB    1 
ATOM   5093 C  CG    . LEU C 3 604 ? 17.457  -3.104  31.578  1.00 22.65 ?  670  LEU A CG    1 
ATOM   5094 C  CD1   . LEU C 3 604 ? 16.176  -3.784  31.147  1.00 22.20 ?  670  LEU A CD1   1 
ATOM   5095 C  CD2   . LEU C 3 604 ? 17.937  -2.156  30.498  1.00 21.94 ?  670  LEU A CD2   1 
ATOM   5096 N  N     . ILE C 3 605 ? 17.913  -1.357  35.854  1.00 23.76 ?  671  ILE A N     1 
ATOM   5097 C  CA    . ILE C 3 605 ? 17.582  -0.521  37.010  1.00 24.61 ?  671  ILE A CA    1 
ATOM   5098 C  C     . ILE C 3 605 ? 18.786  0.310   37.491  1.00 24.66 ?  671  ILE A C     1 
ATOM   5099 O  O     . ILE C 3 605 ? 18.623  1.463   37.893  1.00 24.95 ?  671  ILE A O     1 
ATOM   5100 C  CB    . ILE C 3 605 ? 16.970  -1.374  38.137  1.00 24.61 ?  671  ILE A CB    1 
ATOM   5101 C  CG1   . ILE C 3 605 ? 15.571  -1.847  37.702  1.00 26.27 ?  671  ILE A CG1   1 
ATOM   5102 C  CG2   . ILE C 3 605 ? 16.910  -0.583  39.448  1.00 25.20 ?  671  ILE A CG2   1 
ATOM   5103 C  CD1   . ILE C 3 605 ? 15.004  -3.014  38.540  1.00 27.87 ?  671  ILE A CD1   1 
ATOM   5104 N  N     . SER C 3 606 ? 19.982  -0.267  37.432  1.00 24.60 ?  672  SER A N     1 
ATOM   5105 C  CA    . SER C 3 606 ? 21.218  0.484   37.701  1.00 25.74 ?  672  SER A CA    1 
ATOM   5106 C  C     . SER C 3 606 ? 21.341  1.686   36.775  1.00 25.39 ?  672  SER A C     1 
ATOM   5107 O  O     . SER C 3 606 ? 21.562  2.805   37.213  1.00 25.62 ?  672  SER A O     1 
ATOM   5108 C  CB    . SER C 3 606 ? 22.446  -0.402  37.503  1.00 25.84 ?  672  SER A CB    1 
ATOM   5109 O  OG    . SER C 3 606 ? 22.429  -1.486  38.410  1.00 27.78 ?  672  SER A OG    1 
ATOM   5110 N  N     . ALA C 3 607 ? 21.197  1.450   35.481  1.00 25.25 ?  673  ALA A N     1 
ATOM   5111 C  CA    . ALA C 3 607 ? 21.223  2.549   34.523  1.00 25.19 ?  673  ALA A CA    1 
ATOM   5112 C  C     . ALA C 3 607 ? 20.166  3.593   34.909  1.00 25.28 ?  673  ALA A C     1 
ATOM   5113 O  O     . ALA C 3 607 ? 20.457  4.797   34.996  1.00 25.26 ?  673  ALA A O     1 
ATOM   5114 C  CB    . ALA C 3 607 ? 20.975  2.019   33.117  1.00 25.29 ?  673  ALA A CB    1 
ATOM   5115 N  N     . ARG C 3 608 ? 18.941  3.132   35.161  1.00 24.92 ?  674  ARG A N     1 
ATOM   5116 C  CA    . ARG C 3 608 ? 17.858  4.054   35.496  1.00 25.48 ?  674  ARG A CA    1 
ATOM   5117 C  C     . ARG C 3 608 ? 18.225  4.879   36.729  1.00 25.80 ?  674  ARG A C     1 
ATOM   5118 O  O     . ARG C 3 608 ? 17.978  6.084   36.791  1.00 24.77 ?  674  ARG A O     1 
ATOM   5119 C  CB    . ARG C 3 608 ? 16.538  3.304   35.726  1.00 25.51 ?  674  ARG A CB    1 
ATOM   5120 C  CG    . ARG C 3 608 ? 15.357  4.239   35.922  1.00 25.65 ?  674  ARG A CG    1 
ATOM   5121 C  CD    . ARG C 3 608 ? 14.044  3.519   36.273  1.00 22.85 ?  674  ARG A CD    1 
ATOM   5122 N  NE    . ARG C 3 608 ? 13.060  4.521   36.675  1.00 22.47 ?  674  ARG A NE    1 
ATOM   5123 C  CZ    . ARG C 3 608 ? 11.991  4.300   37.431  1.00 21.55 ?  674  ARG A CZ    1 
ATOM   5124 N  NH1   . ARG C 3 608 ? 11.706  3.080   37.874  1.00 20.90 ?  674  ARG A NH1   1 
ATOM   5125 N  NH2   . ARG C 3 608 ? 11.187  5.315   37.729  1.00 21.56 ?  674  ARG A NH2   1 
ATOM   5126 N  N     . LYS C 3 609 ? 18.812  4.212   37.717  1.00 26.69 ?  675  LYS A N     1 
ATOM   5127 C  CA    . LYS C 3 609 ? 19.230  4.873   38.937  1.00 27.54 ?  675  LYS A CA    1 
ATOM   5128 C  C     . LYS C 3 609 ? 20.298  5.926   38.690  1.00 27.64 ?  675  LYS A C     1 
ATOM   5129 O  O     . LYS C 3 609 ? 20.345  6.943   39.371  1.00 28.32 ?  675  LYS A O     1 
ATOM   5130 C  CB    . LYS C 3 609 ? 19.738  3.850   39.940  1.00 28.03 ?  675  LYS A CB    1 
ATOM   5131 C  CG    . LYS C 3 609 ? 18.641  2.955   40.492  1.00 29.45 ?  675  LYS A CG    1 
ATOM   5132 C  CD    . LYS C 3 609 ? 19.163  2.124   41.647  1.00 31.35 ?  675  LYS A CD    1 
ATOM   5133 C  CE    . LYS C 3 609 ? 18.024  1.538   42.453  1.00 33.05 ?  675  LYS A CE    1 
ATOM   5134 N  NZ    . LYS C 3 609 ? 18.550  0.491   43.383  1.00 35.09 ?  675  LYS A NZ    1 
ATOM   5135 N  N     . ARG C 3 610 ? 21.167  5.684   37.723  1.00 28.05 ?  676  ARG A N     1 
ATOM   5136 C  CA    . ARG C 3 610 ? 22.161  6.689   37.363  1.00 28.00 ?  676  ARG A CA    1 
ATOM   5137 C  C     . ARG C 3 610 ? 21.457  7.896   36.748  1.00 27.69 ?  676  ARG A C     1 
ATOM   5138 O  O     . ARG C 3 610 ? 21.790  9.036   37.055  1.00 27.19 ?  676  ARG A O     1 
ATOM   5139 C  CB    . ARG C 3 610 ? 23.220  6.109   36.421  1.00 28.37 ?  676  ARG A CB    1 
ATOM   5140 C  CG    . ARG C 3 610 ? 24.205  5.162   37.112  1.00 29.71 ?  676  ARG A CG    1 
ATOM   5141 C  CD    . ARG C 3 610 ? 25.401  4.800   36.213  1.00 32.45 ?  676  ARG A CD    1 
ATOM   5142 N  NE    . ARG C 3 610 ? 25.026  3.899   35.120  1.00 34.95 ?  676  ARG A NE    1 
ATOM   5143 C  CZ    . ARG C 3 610 ? 24.849  2.584   35.254  1.00 35.81 ?  676  ARG A CZ    1 
ATOM   5144 N  NH1   . ARG C 3 610 ? 25.006  2.004   36.440  1.00 36.54 ?  676  ARG A NH1   1 
ATOM   5145 N  NH2   . ARG C 3 610 ? 24.517  1.844   34.205  1.00 35.36 ?  676  ARG A NH2   1 
ATOM   5146 N  N     . ALA C 3 611 ? 20.466  7.642   35.899  1.00 27.16 ?  677  ALA A N     1 
ATOM   5147 C  CA    . ALA C 3 611 ? 19.702  8.725   35.300  1.00 27.18 ?  677  ALA A CA    1 
ATOM   5148 C  C     . ALA C 3 611 ? 18.937  9.535   36.368  1.00 27.57 ?  677  ALA A C     1 
ATOM   5149 O  O     . ALA C 3 611 ? 18.919  10.770  36.326  1.00 27.17 ?  677  ALA A O     1 
ATOM   5150 C  CB    . ALA C 3 611 ? 18.755  8.185   34.230  1.00 26.60 ?  677  ALA A CB    1 
ATOM   5151 N  N     . LYS C 3 612 ? 18.339  8.843   37.331  1.00 27.57 ?  678  LYS A N     1 
ATOM   5152 C  CA    . LYS C 3 612 ? 17.580  9.505   38.384  1.00 29.21 ?  678  LYS A CA    1 
ATOM   5153 C  C     . LYS C 3 612 ? 18.470  10.402  39.231  1.00 29.83 ?  678  LYS A C     1 
ATOM   5154 O  O     . LYS C 3 612 ? 18.063  11.499  39.626  1.00 30.15 ?  678  LYS A O     1 
ATOM   5155 C  CB    . LYS C 3 612 ? 16.918  8.486   39.297  1.00 28.74 ?  678  LYS A CB    1 
ATOM   5156 C  CG    . LYS C 3 612 ? 15.687  7.829   38.740  1.00 30.71 ?  678  LYS A CG    1 
ATOM   5157 C  CD    . LYS C 3 612 ? 15.246  6.744   39.708  1.00 33.41 ?  678  LYS A CD    1 
ATOM   5158 C  CE    . LYS C 3 612 ? 13.809  6.365   39.499  1.00 35.09 ?  678  LYS A CE    1 
ATOM   5159 N  NZ    . LYS C 3 612 ? 12.903  7.155   40.370  1.00 35.06 ?  678  LYS A NZ    1 
ATOM   5160 N  N     . LYS C 3 613 ? 19.673  9.920   39.535  1.00 30.69 ?  679  LYS A N     1 
ATOM   5161 C  CA    . LYS C 3 613 ? 20.607  10.722  40.297  1.00 32.02 ?  679  LYS A CA    1 
ATOM   5162 C  C     . LYS C 3 613 ? 20.948  11.988  39.514  1.00 32.53 ?  679  LYS A C     1 
ATOM   5163 O  O     . LYS C 3 613 ? 21.024  13.076  40.089  1.00 32.46 ?  679  LYS A O     1 
ATOM   5164 C  CB    . LYS C 3 613 ? 21.882  9.947   40.650  1.00 32.13 ?  679  LYS A CB    1 
ATOM   5165 C  CG    . LYS C 3 613 ? 22.960  10.845  41.296  1.00 33.59 ?  679  LYS A CG    1 
ATOM   5166 C  CD    . LYS C 3 613 ? 24.045  10.027  41.984  1.00 35.33 ?  679  LYS A CD    1 
ATOM   5167 C  CE    . LYS C 3 613 ? 25.232  10.889  42.384  1.00 36.39 ?  679  LYS A CE    1 
ATOM   5168 N  NZ    . LYS C 3 613 ? 24.877  11.912  43.410  1.00 36.63 ?  679  LYS A NZ    1 
ATOM   5169 N  N     . ASP C 3 614 ? 21.149  11.838  38.204  1.00 32.94 ?  680  ASP A N     1 
ATOM   5170 C  CA    . ASP C 3 614 ? 21.403  12.984  37.331  1.00 33.49 ?  680  ASP A CA    1 
ATOM   5171 C  C     . ASP C 3 614 ? 20.243  13.965  37.407  1.00 34.20 ?  680  ASP A C     1 
ATOM   5172 O  O     . ASP C 3 614 ? 20.441  15.178  37.439  1.00 34.02 ?  680  ASP A O     1 
ATOM   5173 C  CB    . ASP C 3 614 ? 21.600  12.535  35.880  1.00 33.15 ?  680  ASP A CB    1 
ATOM   5174 C  CG    . ASP C 3 614 ? 22.977  11.956  35.630  1.00 32.75 ?  680  ASP A CG    1 
ATOM   5175 O  OD1   . ASP C 3 614 ? 23.852  12.104  36.503  1.00 32.56 ?  680  ASP A OD1   1 
ATOM   5176 O  OD2   . ASP C 3 614 ? 23.193  11.352  34.560  1.00 32.04 ?  680  ASP A OD2   1 
ATOM   5177 N  N     . LEU C 3 615 ? 19.029  13.421  37.426  1.00 35.15 ?  681  LEU A N     1 
ATOM   5178 C  CA    . LEU C 3 615 ? 17.818  14.221  37.546  1.00 36.31 ?  681  LEU A CA    1 
ATOM   5179 C  C     . LEU C 3 615 ? 17.775  14.927  38.900  1.00 37.32 ?  681  LEU A C     1 
ATOM   5180 O  O     . LEU C 3 615 ? 17.399  16.090  38.995  1.00 37.37 ?  681  LEU A O     1 
ATOM   5181 C  CB    . LEU C 3 615 ? 16.581  13.345  37.378  1.00 35.87 ?  681  LEU A CB    1 
ATOM   5182 C  CG    . LEU C 3 615 ? 15.231  14.050  37.515  1.00 36.08 ?  681  LEU A CG    1 
ATOM   5183 C  CD1   . LEU C 3 615 ? 15.174  15.274  36.633  1.00 35.97 ?  681  LEU A CD1   1 
ATOM   5184 C  CD2   . LEU C 3 615 ? 14.090  13.109  37.177  1.00 35.45 ?  681  LEU A CD2   1 
ATOM   5185 N  N     . ARG C 3 616 ? 18.170  14.208  39.943  1.00 38.51 ?  682  ARG A N     1 
ATOM   5186 C  CA    . ARG C 3 616 ? 18.184  14.743  41.300  1.00 39.54 ?  682  ARG A CA    1 
ATOM   5187 C  C     . ARG C 3 616 ? 19.173  15.900  41.404  1.00 39.98 ?  682  ARG A C     1 
ATOM   5188 O  O     . ARG C 3 616 ? 18.948  16.848  42.152  1.00 40.42 ?  682  ARG A O     1 
ATOM   5189 C  CB    . ARG C 3 616 ? 18.564  13.628  42.279  1.00 39.70 ?  682  ARG A CB    1 
ATOM   5190 C  CG    . ARG C 3 616 ? 18.022  13.772  43.683  1.00 40.89 ?  682  ARG A CG    1 
ATOM   5191 C  CD    . ARG C 3 616 ? 17.923  12.411  44.361  1.00 41.69 ?  682  ARG A CD    1 
ATOM   5192 N  NE    . ARG C 3 616 ? 16.772  11.644  43.884  1.00 43.23 ?  682  ARG A NE    1 
ATOM   5193 C  CZ    . ARG C 3 616 ? 16.852  10.509  43.189  1.00 44.00 ?  682  ARG A CZ    1 
ATOM   5194 N  NH1   . ARG C 3 616 ? 18.037  9.987   42.889  1.00 43.97 ?  682  ARG A NH1   1 
ATOM   5195 N  NH2   . ARG C 3 616 ? 15.743  9.888   42.805  1.00 42.95 ?  682  ARG A NH2   1 
ATOM   5196 N  N     . ASP C 3 617 ? 20.257  15.824  40.637  1.00 40.52 ?  683  ASP A N     1 
ATOM   5197 C  CA    . ASP C 3 617 ? 21.350  16.798  40.723  1.00 40.88 ?  683  ASP A CA    1 
ATOM   5198 C  C     . ASP C 3 617 ? 21.207  17.998  39.790  1.00 40.94 ?  683  ASP A C     1 
ATOM   5199 O  O     . ASP C 3 617 ? 22.117  18.826  39.713  1.00 40.95 ?  683  ASP A O     1 
ATOM   5200 C  CB    . ASP C 3 617 ? 22.697  16.130  40.404  1.00 41.07 ?  683  ASP A CB    1 
ATOM   5201 C  CG    . ASP C 3 617 ? 23.132  15.131  41.460  1.00 41.97 ?  683  ASP A CG    1 
ATOM   5202 O  OD1   . ASP C 3 617 ? 22.444  15.006  42.499  1.00 41.73 ?  683  ASP A OD1   1 
ATOM   5203 O  OD2   . ASP C 3 617 ? 24.174  14.465  41.239  1.00 42.40 ?  683  ASP A OD2   1 
ATOM   5204 N  N     . GLU C 3 618 ? 20.095  18.096  39.069  1.00 40.89 ?  684  GLU A N     1 
ATOM   5205 C  CA    . GLU C 3 618 ? 19.974  19.139  38.045  1.00 41.01 ?  684  GLU A CA    1 
ATOM   5206 C  C     . GLU C 3 618 ? 18.997  20.253  38.415  1.00 40.99 ?  684  GLU A C     1 
ATOM   5207 O  O     . GLU C 3 618 ? 17.898  19.995  38.903  1.00 41.23 ?  684  GLU A O     1 
ATOM   5208 C  CB    . GLU C 3 618 ? 19.608  18.538  36.687  1.00 40.98 ?  684  GLU A CB    1 
ATOM   5209 C  CG    . GLU C 3 618 ? 19.134  19.557  35.670  1.00 40.98 ?  684  GLU A CG    1 
ATOM   5210 C  CD    . GLU C 3 618 ? 20.188  20.599  35.340  1.00 41.70 ?  684  GLU A CD    1 
ATOM   5211 O  OE1   . GLU C 3 618 ? 21.298  20.223  34.909  1.00 41.19 ?  684  GLU A OE1   1 
ATOM   5212 O  OE2   . GLU C 3 618 ? 19.899  21.804  35.501  1.00 42.64 ?  684  GLU A OE2   1 
ATOM   5213 N  N     . LYS C 3 619 ? 19.412  21.491  38.160  1.00 41.17 ?  685  LYS A N     1 
ATOM   5214 C  CA    . LYS C 3 619 ? 18.635  22.673  38.530  1.00 41.01 ?  685  LYS A CA    1 
ATOM   5215 C  C     . LYS C 3 619 ? 17.601  23.057  37.472  1.00 40.78 ?  685  LYS A C     1 
ATOM   5216 O  O     . LYS C 3 619 ? 16.403  23.132  37.756  1.00 40.85 ?  685  LYS A O     1 
ATOM   5217 C  CB    . LYS C 3 619 ? 19.567  23.856  38.793  1.00 40.86 ?  685  LYS A CB    1 
ATOM   5218 N  N     . ASP C 3 620 ? 18.068  23.298  36.252  1.00 40.32 ?  686  ASP A N     1 
ATOM   5219 C  CA    . ASP C 3 620 ? 17.191  23.769  35.187  1.00 39.76 ?  686  ASP A CA    1 
ATOM   5220 C  C     . ASP C 3 620 ? 15.980  22.867  34.940  1.00 38.98 ?  686  ASP A C     1 
ATOM   5221 O  O     . ASP C 3 620 ? 16.124  21.679  34.637  1.00 38.92 ?  686  ASP A O     1 
ATOM   5222 C  CB    . ASP C 3 620 ? 17.969  23.979  33.887  1.00 39.98 ?  686  ASP A CB    1 
ATOM   5223 C  CG    . ASP C 3 620 ? 17.072  24.397  32.741  1.00 40.56 ?  686  ASP A CG    1 
ATOM   5224 O  OD1   . ASP C 3 620 ? 16.252  23.569  32.286  1.00 41.28 ?  686  ASP A OD1   1 
ATOM   5225 O  OD2   . ASP C 3 620 ? 17.179  25.558  32.303  1.00 41.31 ?  686  ASP A OD2   1 
ATOM   5226 N  N     . PRO C 3 621 ? 14.778  23.450  35.051  1.00 38.10 ?  687  PRO A N     1 
ATOM   5227 C  CA    . PRO C 3 621 ? 13.487  22.797  34.836  1.00 37.30 ?  687  PRO A CA    1 
ATOM   5228 C  C     . PRO C 3 621 ? 13.428  22.050  33.504  1.00 36.57 ?  687  PRO A C     1 
ATOM   5229 O  O     . PRO C 3 621 ? 12.862  20.951  33.421  1.00 36.21 ?  687  PRO A O     1 
ATOM   5230 C  CB    . PRO C 3 621 ? 12.498  23.972  34.809  1.00 37.42 ?  687  PRO A CB    1 
ATOM   5231 C  CG    . PRO C 3 621 ? 13.346  25.205  34.625  1.00 37.82 ?  687  PRO A CG    1 
ATOM   5232 C  CD    . PRO C 3 621 ? 14.629  24.892  35.303  1.00 38.03 ?  687  PRO A CD    1 
ATOM   5233 N  N     . PHE C 3 622 ? 14.001  22.647  32.470  1.00 35.64 ?  688  PHE A N     1 
ATOM   5234 C  CA    . PHE C 3 622 ? 13.948  22.052  31.146  1.00 34.95 ?  688  PHE A CA    1 
ATOM   5235 C  C     . PHE C 3 622 ? 14.857  20.838  31.052  1.00 33.79 ?  688  PHE A C     1 
ATOM   5236 O  O     . PHE C 3 622 ? 14.490  19.821  30.474  1.00 33.42 ?  688  PHE A O     1 
ATOM   5237 C  CB    . PHE C 3 622 ? 14.332  23.063  30.070  1.00 35.25 ?  688  PHE A CB    1 
ATOM   5238 C  CG    . PHE C 3 622 ? 14.541  22.439  28.726  1.00 37.36 ?  688  PHE A CG    1 
ATOM   5239 C  CD1   . PHE C 3 622 ? 15.743  21.819  28.416  1.00 38.89 ?  688  PHE A CD1   1 
ATOM   5240 C  CD2   . PHE C 3 622 ? 13.524  22.426  27.782  1.00 39.18 ?  688  PHE A CD2   1 
ATOM   5241 C  CE1   . PHE C 3 622 ? 15.935  21.224  27.183  1.00 38.49 ?  688  PHE A CE1   1 
ATOM   5242 C  CE2   . PHE C 3 622 ? 13.714  21.827  26.545  1.00 38.60 ?  688  PHE A CE2   1 
ATOM   5243 C  CZ    . PHE C 3 622 ? 14.918  21.230  26.250  1.00 38.80 ?  688  PHE A CZ    1 
ATOM   5244 N  N     . LYS C 3 623 ? 16.054  20.957  31.615  1.00 32.87 ?  689  LYS A N     1 
ATOM   5245 C  CA    . LYS C 3 623 ? 16.992  19.850  31.610  1.00 31.99 ?  689  LYS A CA    1 
ATOM   5246 C  C     . LYS C 3 623 ? 16.425  18.687  32.422  1.00 31.62 ?  689  LYS A C     1 
ATOM   5247 O  O     . LYS C 3 623 ? 16.505  17.532  32.001  1.00 30.94 ?  689  LYS A O     1 
ATOM   5248 C  CB    . LYS C 3 623 ? 18.350  20.279  32.157  1.00 32.01 ?  689  LYS A CB    1 
ATOM   5249 N  N     . ARG C 3 624 ? 15.838  18.997  33.574  1.00 31.03 ?  690  ARG A N     1 
ATOM   5250 C  CA    . ARG C 3 624 ? 15.214  17.969  34.407  1.00 31.45 ?  690  ARG A CA    1 
ATOM   5251 C  C     . ARG C 3 624 ? 14.154  17.192  33.639  1.00 30.85 ?  690  ARG A C     1 
ATOM   5252 O  O     . ARG C 3 624 ? 14.033  15.977  33.770  1.00 30.54 ?  690  ARG A O     1 
ATOM   5253 C  CB    . ARG C 3 624 ? 14.600  18.593  35.661  1.00 31.29 ?  690  ARG A CB    1 
ATOM   5254 C  CG    . ARG C 3 624 ? 15.631  18.950  36.695  1.00 33.41 ?  690  ARG A CG    1 
ATOM   5255 C  CD    . ARG C 3 624 ? 14.997  19.657  37.883  1.00 36.48 ?  690  ARG A CD    1 
ATOM   5256 N  NE    . ARG C 3 624 ? 15.364  18.988  39.123  1.00 38.06 ?  690  ARG A NE    1 
ATOM   5257 C  CZ    . ARG C 3 624 ? 14.705  17.951  39.622  1.00 38.62 ?  690  ARG A CZ    1 
ATOM   5258 N  NH1   . ARG C 3 624 ? 13.642  17.471  38.991  1.00 40.20 ?  690  ARG A NH1   1 
ATOM   5259 N  NH2   . ARG C 3 624 ? 15.108  17.394  40.752  1.00 40.47 ?  690  ARG A NH2   1 
ATOM   5260 N  N     . ASP C 3 625 ? 13.377  17.922  32.853  1.00 30.77 ?  691  ASP A N     1 
ATOM   5261 C  CA    . ASP C 3 625 ? 12.370  17.345  31.983  1.00 30.79 ?  691  ASP A CA    1 
ATOM   5262 C  C     . ASP C 3 625 ? 13.010  16.252  31.123  1.00 29.95 ?  691  ASP A C     1 
ATOM   5263 O  O     . ASP C 3 625 ? 12.633  15.077  31.174  1.00 30.22 ?  691  ASP A O     1 
ATOM   5264 C  CB    . ASP C 3 625 ? 11.861  18.458  31.077  1.00 31.58 ?  691  ASP A CB    1 
ATOM   5265 C  CG    . ASP C 3 625 ? 10.390  18.357  30.806  1.00 34.88 ?  691  ASP A CG    1 
ATOM   5266 O  OD1   . ASP C 3 625 ? 9.663   19.334  31.135  1.00 38.58 ?  691  ASP A OD1   1 
ATOM   5267 O  OD2   . ASP C 3 625 ? 9.964   17.305  30.279  1.00 36.95 ?  691  ASP A OD2   1 
ATOM   5268 N  N     . VAL C 3 626 ? 13.998  16.653  30.343  1.00 28.63 ?  692  VAL A N     1 
ATOM   5269 C  CA    . VAL C 3 626 ? 14.723  15.727  29.496  1.00 27.65 ?  692  VAL A CA    1 
ATOM   5270 C  C     . VAL C 3 626 ? 15.279  14.559  30.303  1.00 27.24 ?  692  VAL A C     1 
ATOM   5271 O  O     . VAL C 3 626 ? 15.139  13.415  29.896  1.00 26.41 ?  692  VAL A O     1 
ATOM   5272 C  CB    . VAL C 3 626 ? 15.859  16.430  28.756  1.00 27.38 ?  692  VAL A CB    1 
ATOM   5273 C  CG1   . VAL C 3 626 ? 16.501  15.474  27.750  1.00 27.67 ?  692  VAL A CG1   1 
ATOM   5274 C  CG2   . VAL C 3 626 ? 15.323  17.675  28.053  1.00 26.59 ?  692  VAL A CG2   1 
ATOM   5275 N  N     . LEU C 3 627 ? 15.908  14.841  31.444  1.00 26.59 ?  693  LEU A N     1 
ATOM   5276 C  CA    . LEU C 3 627 ? 16.407  13.755  32.292  1.00 26.46 ?  693  LEU A CA    1 
ATOM   5277 C  C     . LEU C 3 627 ? 15.269  12.880  32.782  1.00 26.28 ?  693  LEU A C     1 
ATOM   5278 O  O     . LEU C 3 627 ? 15.448  11.676  33.024  1.00 26.37 ?  693  LEU A O     1 
ATOM   5279 C  CB    . LEU C 3 627 ? 17.207  14.293  33.479  1.00 26.65 ?  693  LEU A CB    1 
ATOM   5280 C  CG    . LEU C 3 627 ? 18.521  14.962  33.077  1.00 26.50 ?  693  LEU A CG    1 
ATOM   5281 C  CD1   . LEU C 3 627 ? 19.128  15.750  34.237  1.00 27.22 ?  693  LEU A CD1   1 
ATOM   5282 C  CD2   . LEU C 3 627 ? 19.488  13.924  32.541  1.00 26.88 ?  693  LEU A CD2   1 
ATOM   5283 N  N     . ASN C 3 628 ? 14.084  13.463  32.926  1.00 26.15 ?  694  ASN A N     1 
ATOM   5284 C  CA    . ASN C 3 628 ? 12.950  12.645  33.339  1.00 25.95 ?  694  ASN A CA    1 
ATOM   5285 C  C     . ASN C 3 628 ? 12.554  11.622  32.266  1.00 25.18 ?  694  ASN A C     1 
ATOM   5286 O  O     . ASN C 3 628 ? 12.238  10.487  32.592  1.00 25.22 ?  694  ASN A O     1 
ATOM   5287 C  CB    . ASN C 3 628 ? 11.744  13.482  33.754  1.00 26.18 ?  694  ASN A CB    1 
ATOM   5288 C  CG    . ASN C 3 628 ? 10.708  12.654  34.489  1.00 27.98 ?  694  ASN A CG    1 
ATOM   5289 O  OD1   . ASN C 3 628 ? 11.033  11.951  35.443  1.00 27.67 ?  694  ASN A OD1   1 
ATOM   5290 N  ND2   . ASN C 3 628 ? 9.464   12.712  34.032  1.00 29.24 ?  694  ASN A ND2   1 
ATOM   5291 N  N     . GLY C 3 629 ? 12.569  12.031  30.999  1.00 24.86 ?  695  GLY A N     1 
ATOM   5292 C  CA    . GLY C 3 629 ? 12.323  11.098  29.876  1.00 24.07 ?  695  GLY A CA    1 
ATOM   5293 C  C     . GLY C 3 629 ? 13.374  9.998   29.795  1.00 23.82 ?  695  GLY A C     1 
ATOM   5294 O  O     . GLY C 3 629 ? 13.055  8.822   29.561  1.00 24.22 ?  695  GLY A O     1 
ATOM   5295 N  N     . ARG C 3 630 ? 14.633  10.364  30.000  1.00 23.13 ?  696  ARG A N     1 
ATOM   5296 C  CA    . ARG C 3 630 ? 15.704  9.377   30.014  1.00 22.99 ?  696  ARG A CA    1 
ATOM   5297 C  C     . ARG C 3 630 ? 15.412  8.266   31.030  1.00 23.17 ?  696  ARG A C     1 
ATOM   5298 O  O     . ARG C 3 630 ? 15.457  7.087   30.691  1.00 22.76 ?  696  ARG A O     1 
ATOM   5299 C  CB    . ARG C 3 630 ? 17.042  10.056  30.316  1.00 23.16 ?  696  ARG A CB    1 
ATOM   5300 C  CG    . ARG C 3 630 ? 18.266  9.149   30.336  1.00 23.54 ?  696  ARG A CG    1 
ATOM   5301 C  CD    . ARG C 3 630 ? 19.513  9.994   30.634  1.00 27.38 ?  696  ARG A CD    1 
ATOM   5302 N  NE    . ARG C 3 630 ? 20.645  9.180   31.064  1.00 28.81 ?  696  ARG A NE    1 
ATOM   5303 C  CZ    . ARG C 3 630 ? 21.516  9.558   31.991  1.00 30.38 ?  696  ARG A CZ    1 
ATOM   5304 N  NH1   . ARG C 3 630 ? 21.375  10.730  32.597  1.00 31.35 ?  696  ARG A NH1   1 
ATOM   5305 N  NH2   . ARG C 3 630 ? 22.519  8.761   32.325  1.00 31.51 ?  696  ARG A NH2   1 
ATOM   5306 N  N     . GLN C 3 631 ? 15.113  8.638   32.275  1.00 22.95 ?  697  GLN A N     1 
ATOM   5307 C  CA    . GLN C 3 631 ? 14.853  7.626   33.308  1.00 23.69 ?  697  GLN A CA    1 
ATOM   5308 C  C     . GLN C 3 631 ? 13.566  6.850   33.015  1.00 23.84 ?  697  GLN A C     1 
ATOM   5309 O  O     . GLN C 3 631 ? 13.493  5.636   33.251  1.00 24.06 ?  697  GLN A O     1 
ATOM   5310 C  CB    . GLN C 3 631 ? 14.886  8.227   34.732  1.00 23.51 ?  697  GLN A CB    1 
ATOM   5311 C  CG    . GLN C 3 631 ? 13.727  9.146   35.091  1.00 23.70 ?  697  GLN A CG    1 
ATOM   5312 C  CD    . GLN C 3 631 ? 12.519  8.368   35.604  1.00 25.37 ?  697  GLN A CD    1 
ATOM   5313 O  OE1   . GLN C 3 631 ? 12.648  7.230   36.056  1.00 24.85 ?  697  GLN A OE1   1 
ATOM   5314 N  NE2   . GLN C 3 631 ? 11.344  8.968   35.503  1.00 23.69 ?  697  GLN A NE2   1 
ATOM   5315 N  N     . LEU C 3 632 ? 12.566  7.529   32.458  1.00 23.87 ?  698  LEU A N     1 
ATOM   5316 C  CA    . LEU C 3 632 ? 11.332  6.837   32.079  1.00 24.65 ?  698  LEU A CA    1 
ATOM   5317 C  C     . LEU C 3 632 ? 11.591  5.819   30.963  1.00 23.77 ?  698  LEU A C     1 
ATOM   5318 O  O     . LEU C 3 632 ? 11.037  4.726   30.967  1.00 23.80 ?  698  LEU A O     1 
ATOM   5319 C  CB    . LEU C 3 632 ? 10.272  7.835   31.611  1.00 24.74 ?  698  LEU A CB    1 
ATOM   5320 C  CG    . LEU C 3 632 ? 9.273   8.417   32.622  1.00 28.79 ?  698  LEU A CG    1 
ATOM   5321 C  CD1   . LEU C 3 632 ? 9.675   8.166   34.078  1.00 30.83 ?  698  LEU A CD1   1 
ATOM   5322 C  CD2   . LEU C 3 632 ? 9.151   9.899   32.360  1.00 30.09 ?  698  LEU A CD2   1 
ATOM   5323 N  N     . ALA C 3 633 ? 12.410  6.195   29.990  1.00 23.70 ?  699  ALA A N     1 
ATOM   5324 C  CA    . ALA C 3 633 ? 12.692  5.296   28.886  1.00 23.49 ?  699  ALA A CA    1 
ATOM   5325 C  C     . ALA C 3 633 ? 13.296  4.004   29.439  1.00 23.38 ?  699  ALA A C     1 
ATOM   5326 O  O     . ALA C 3 633 ? 13.004  2.914   28.959  1.00 23.82 ?  699  ALA A O     1 
ATOM   5327 C  CB    . ALA C 3 633 ? 13.625  5.953   27.880  1.00 23.28 ?  699  ALA A CB    1 
ATOM   5328 N  N     . LEU C 3 634 ? 14.139  4.129   30.456  1.00 23.12 ?  700  LEU A N     1 
ATOM   5329 C  CA    . LEU C 3 634 ? 14.817  2.961   30.996  1.00 23.34 ?  700  LEU A CA    1 
ATOM   5330 C  C     . LEU C 3 634 ? 13.859  2.120   31.848  1.00 23.00 ?  700  LEU A C     1 
ATOM   5331 O  O     . LEU C 3 634 ? 14.008  0.891   31.956  1.00 22.23 ?  700  LEU A O     1 
ATOM   5332 C  CB    . LEU C 3 634 ? 16.048  3.383   31.801  1.00 23.42 ?  700  LEU A CB    1 
ATOM   5333 C  CG    . LEU C 3 634 ? 17.235  3.843   30.941  1.00 24.80 ?  700  LEU A CG    1 
ATOM   5334 C  CD1   . LEU C 3 634 ? 18.255  4.634   31.754  1.00 25.39 ?  700  LEU A CD1   1 
ATOM   5335 C  CD2   . LEU C 3 634 ? 17.894  2.633   30.301  1.00 24.65 ?  700  LEU A CD2   1 
ATOM   5336 N  N     . LYS C 3 635 ? 12.885  2.798   32.454  1.00 22.56 ?  701  LYS A N     1 
ATOM   5337 C  CA    . LYS C 3 635 ? 11.831  2.128   33.212  1.00 23.20 ?  701  LYS A CA    1 
ATOM   5338 C  C     . LYS C 3 635 ? 10.968  1.290   32.259  1.00 22.76 ?  701  LYS A C     1 
ATOM   5339 O  O     . LYS C 3 635 ? 10.677  0.129   32.516  1.00 22.17 ?  701  LYS A O     1 
ATOM   5340 C  CB    . LYS C 3 635 ? 10.981  3.165   33.966  1.00 23.27 ?  701  LYS A CB    1 
ATOM   5341 C  CG    . LYS C 3 635 ? 9.639   2.624   34.500  1.00 25.48 ?  701  LYS A CG    1 
ATOM   5342 C  CD    . LYS C 3 635 ? 8.783   3.770   35.080  1.00 28.88 ?  701  LYS A CD    1 
ATOM   5343 C  CE    . LYS C 3 635 ? 7.316   3.353   35.186  1.00 31.38 ?  701  LYS A CE    1 
ATOM   5344 N  NZ    . LYS C 3 635 ? 6.544   4.393   35.921  1.00 34.35 ?  701  LYS A NZ    1 
ATOM   5345 N  N     . ILE C 3 636 ? 10.573  1.873   31.136  1.00 23.29 ?  702  ILE A N     1 
ATOM   5346 C  CA    . ILE C 3 636 ? 9.783   1.120   30.175  1.00 23.48 ?  702  ILE A CA    1 
ATOM   5347 C  C     . ILE C 3 636 ? 10.585  -0.082  29.654  1.00 23.41 ?  702  ILE A C     1 
ATOM   5348 O  O     . ILE C 3 636 ? 10.019  -1.136  29.391  1.00 22.91 ?  702  ILE A O     1 
ATOM   5349 C  CB    . ILE C 3 636 ? 9.328   1.998   28.998  1.00 24.26 ?  702  ILE A CB    1 
ATOM   5350 C  CG1   . ILE C 3 636 ? 8.228   2.964   29.470  1.00 24.98 ?  702  ILE A CG1   1 
ATOM   5351 C  CG2   . ILE C 3 636 ? 8.825   1.110   27.848  1.00 24.51 ?  702  ILE A CG2   1 
ATOM   5352 C  CD1   . ILE C 3 636 ? 8.155   4.255   28.652  1.00 27.14 ?  702  ILE A CD1   1 
ATOM   5353 N  N     . SER C 3 637 ? 11.901  0.080   29.539  1.00 22.68 ?  703  SER A N     1 
ATOM   5354 C  CA    . SER C 3 637 ? 12.759  -1.003  29.036  1.00 22.82 ?  703  SER A CA    1 
ATOM   5355 C  C     . SER C 3 637 ? 12.722  -2.160  30.020  1.00 22.44 ?  703  SER A C     1 
ATOM   5356 O  O     . SER C 3 637 ? 12.661  -3.308  29.632  1.00 22.18 ?  703  SER A O     1 
ATOM   5357 C  CB    . SER C 3 637 ? 14.198  -0.534  28.873  1.00 21.79 ?  703  SER A CB    1 
ATOM   5358 O  OG    . SER C 3 637 ? 14.280  0.446   27.862  1.00 24.41 ?  703  SER A OG    1 
ATOM   5359 N  N     . ALA C 3 638 ? 12.748  -1.836  31.306  1.00 22.13 ?  704  ALA A N     1 
ATOM   5360 C  CA    . ALA C 3 638 ? 12.710  -2.870  32.335  1.00 21.79 ?  704  ALA A CA    1 
ATOM   5361 C  C     . ALA C 3 638 ? 11.328  -3.529  32.373  1.00 21.17 ?  704  ALA A C     1 
ATOM   5362 O  O     . ALA C 3 638 ? 11.206  -4.741  32.452  1.00 20.62 ?  704  ALA A O     1 
ATOM   5363 C  CB    . ALA C 3 638 ? 13.075  -2.262  33.711  1.00 21.32 ?  704  ALA A CB    1 
ATOM   5364 N  N     . ASN C 3 639 ? 10.279  -2.721  32.304  1.00 20.89 ?  705  ASN A N     1 
ATOM   5365 C  CA    . ASN C 3 639 ? 8.937   -3.274  32.347  1.00 20.72 ?  705  ASN A CA    1 
ATOM   5366 C  C     . ASN C 3 639 ? 8.674   -4.104  31.091  1.00 20.99 ?  705  ASN A C     1 
ATOM   5367 O  O     . ASN C 3 639 ? 7.900   -5.066  31.113  1.00 20.44 ?  705  ASN A O     1 
ATOM   5368 C  CB    . ASN C 3 639 ? 7.900   -2.171  32.571  1.00 20.33 ?  705  ASN A CB    1 
ATOM   5369 C  CG    . ASN C 3 639 ? 7.921   -1.651  34.023  1.00 20.51 ?  705  ASN A CG    1 
ATOM   5370 O  OD1   . ASN C 3 639 ? 8.384   -2.346  34.922  1.00 21.46 ?  705  ASN A OD1   1 
ATOM   5371 N  ND2   . ASN C 3 639 ? 7.475   -0.419  34.233  1.00 18.29 ?  705  ASN A ND2   1 
ATOM   5372 N  N     . SER C 3 640 ? 9.348   -3.752  29.999  1.00 20.60 ?  706  SER A N     1 
ATOM   5373 C  CA    . SER C 3 640 ? 9.219   -4.536  28.763  1.00 21.05 ?  706  SER A CA    1 
ATOM   5374 C  C     . SER C 3 640 ? 9.824   -5.938  28.823  1.00 21.32 ?  706  SER A C     1 
ATOM   5375 O  O     . SER C 3 640 ? 9.471   -6.805  28.001  1.00 21.92 ?  706  SER A O     1 
ATOM   5376 C  CB    . SER C 3 640 ? 9.839   -3.774  27.586  1.00 21.66 ?  706  SER A CB    1 
ATOM   5377 O  OG    . SER C 3 640 ? 9.066   -2.633  27.287  1.00 21.73 ?  706  SER A OG    1 
ATOM   5378 N  N     . VAL C 3 641 ? 10.766  -6.156  29.740  1.00 21.36 ?  707  VAL A N     1 
ATOM   5379 C  CA    . VAL C 3 641 ? 11.291  -7.512  29.971  1.00 22.13 ?  707  VAL A CA    1 
ATOM   5380 C  C     . VAL C 3 641 ? 10.166  -8.373  30.571  1.00 22.40 ?  707  VAL A C     1 
ATOM   5381 O  O     . VAL C 3 641 ? 9.952   -9.510  30.148  1.00 22.96 ?  707  VAL A O     1 
ATOM   5382 C  CB    . VAL C 3 641 ? 12.496  -7.510  30.953  1.00 22.10 ?  707  VAL A CB    1 
ATOM   5383 C  CG1   . VAL C 3 641 ? 12.884  -8.941  31.330  1.00 21.82 ?  707  VAL A CG1   1 
ATOM   5384 C  CG2   . VAL C 3 641 ? 13.706  -6.761  30.339  1.00 21.61 ?  707  VAL A CG2   1 
ATOM   5385 N  N     . TYR C 3 642 ? 9.448   -7.830  31.560  1.00 21.99 ?  708  TYR A N     1 
ATOM   5386 C  CA    . TYR C 3 642 ? 8.218   -8.501  32.040  1.00 21.38 ?  708  TYR A CA    1 
ATOM   5387 C  C     . TYR C 3 642 ? 7.235   -8.696  30.866  1.00 21.60 ?  708  TYR A C     1 
ATOM   5388 O  O     . TYR C 3 642 ? 6.746   -9.810  30.646  1.00 21.22 ?  708  TYR A O     1 
ATOM   5389 C  CB    . TYR C 3 642 ? 7.544   -7.717  33.182  1.00 21.97 ?  708  TYR A CB    1 
ATOM   5390 C  CG    . TYR C 3 642 ? 6.031   -7.877  33.207  1.00 19.93 ?  708  TYR A CG    1 
ATOM   5391 C  CD1   . TYR C 3 642 ? 5.439   -9.050  33.674  1.00 19.58 ?  708  TYR A CD1   1 
ATOM   5392 C  CD2   . TYR C 3 642 ? 5.214   -6.863  32.747  1.00 20.06 ?  708  TYR A CD2   1 
ATOM   5393 C  CE1   . TYR C 3 642 ? 4.065   -9.213  33.682  1.00 20.21 ?  708  TYR A CE1   1 
ATOM   5394 C  CE2   . TYR C 3 642 ? 3.821   -6.997  32.760  1.00 21.36 ?  708  TYR A CE2   1 
ATOM   5395 C  CZ    . TYR C 3 642 ? 3.262   -8.174  33.213  1.00 19.18 ?  708  TYR A CZ    1 
ATOM   5396 O  OH    . TYR C 3 642 ? 1.908   -8.299  33.193  1.00 21.16 ?  708  TYR A OH    1 
ATOM   5397 N  N     . GLY C 3 643 ? 6.967   -7.627  30.106  1.00 20.35 ?  709  GLY A N     1 
ATOM   5398 C  CA    . GLY C 3 643 ? 5.991   -7.706  28.997  1.00 21.19 ?  709  GLY A CA    1 
ATOM   5399 C  C     . GLY C 3 643 ? 6.339   -8.764  27.948  1.00 21.65 ?  709  GLY A C     1 
ATOM   5400 O  O     . GLY C 3 643 ? 5.469   -9.473  27.412  1.00 21.44 ?  709  GLY A O     1 
ATOM   5401 N  N     . PHE C 3 644 ? 7.631   -8.865  27.653  1.00 21.98 ?  710  PHE A N     1 
ATOM   5402 C  CA    . PHE C 3 644 ? 8.128   -9.850  26.701  1.00 22.16 ?  710  PHE A CA    1 
ATOM   5403 C  C     . PHE C 3 644 ? 7.678   -11.258 27.117  1.00 22.01 ?  710  PHE A C     1 
ATOM   5404 O  O     . PHE C 3 644 ? 7.260   -12.045 26.268  1.00 22.60 ?  710  PHE A O     1 
ATOM   5405 C  CB    . PHE C 3 644 ? 9.652   -9.743  26.649  1.00 21.70 ?  710  PHE A CB    1 
ATOM   5406 C  CG    . PHE C 3 644 ? 10.311  -10.693 25.679  1.00 23.16 ?  710  PHE A CG    1 
ATOM   5407 C  CD1   . PHE C 3 644 ? 10.381  -10.393 24.321  1.00 24.23 ?  710  PHE A CD1   1 
ATOM   5408 C  CD2   . PHE C 3 644 ? 10.888  -11.869 26.135  1.00 21.58 ?  710  PHE A CD2   1 
ATOM   5409 C  CE1   . PHE C 3 644 ? 11.023  -11.260 23.434  1.00 22.97 ?  710  PHE A CE1   1 
ATOM   5410 C  CE2   . PHE C 3 644 ? 11.521  -12.733 25.264  1.00 22.02 ?  710  PHE A CE2   1 
ATOM   5411 C  CZ    . PHE C 3 644 ? 11.600  -12.426 23.912  1.00 21.47 ?  710  PHE A CZ    1 
ATOM   5412 N  N     . THR C 3 645 ? 7.761   -11.578 28.415  1.00 22.27 ?  711  THR A N     1 
ATOM   5413 C  CA    . THR C 3 645 ? 7.359   -12.907 28.882  1.00 22.03 ?  711  THR A CA    1 
ATOM   5414 C  C     . THR C 3 645 ? 5.853   -13.103 28.736  1.00 22.03 ?  711  THR A C     1 
ATOM   5415 O  O     . THR C 3 645 ? 5.380   -14.237 28.668  1.00 21.58 ?  711  THR A O     1 
ATOM   5416 C  CB    . THR C 3 645 ? 7.777   -13.225 30.357  1.00 21.97 ?  711  THR A CB    1 
ATOM   5417 O  OG1   . THR C 3 645 ? 7.012   -12.431 31.287  1.00 23.30 ?  711  THR A OG1   1 
ATOM   5418 C  CG2   . THR C 3 645 ? 9.301   -13.008 30.568  1.00 22.18 ?  711  THR A CG2   1 
ATOM   5419 N  N     . GLY C 3 646 ? 5.103   -12.001 28.690  1.00 20.91 ?  712  GLY A N     1 
ATOM   5420 C  CA    . GLY C 3 646 ? 3.664   -12.092 28.499  1.00 21.31 ?  712  GLY A CA    1 
ATOM   5421 C  C     . GLY C 3 646 ? 3.189   -11.914 27.064  1.00 21.98 ?  712  GLY A C     1 
ATOM   5422 O  O     . GLY C 3 646 ? 1.998   -11.920 26.807  1.00 22.65 ?  712  GLY A O     1 
ATOM   5423 N  N     . ALA C 3 647 ? 4.113   -11.777 26.118  1.00 21.40 ?  713  ALA A N     1 
ATOM   5424 C  CA    . ALA C 3 647 ? 3.724   -11.488 24.754  1.00 22.26 ?  713  ALA A CA    1 
ATOM   5425 C  C     . ALA C 3 647 ? 3.606   -12.774 23.912  1.00 23.15 ?  713  ALA A C     1 
ATOM   5426 O  O     . ALA C 3 647 ? 4.612   -13.321 23.481  1.00 23.11 ?  713  ALA A O     1 
ATOM   5427 C  CB    . ALA C 3 647 ? 4.723   -10.530 24.133  1.00 21.22 ?  713  ALA A CB    1 
ATOM   5428 N  N     . THR C 3 648 ? 2.380   -13.252 23.698  1.00 24.76 ?  714  THR A N     1 
ATOM   5429 C  CA    . THR C 3 648 ? 2.133   -14.357 22.756  1.00 26.57 ?  714  THR A CA    1 
ATOM   5430 C  C     . THR C 3 648 ? 2.249   -13.867 21.310  1.00 27.26 ?  714  THR A C     1 
ATOM   5431 O  O     . THR C 3 648 ? 2.435   -14.657 20.372  1.00 27.80 ?  714  THR A O     1 
ATOM   5432 C  CB    . THR C 3 648 ? 0.762   -15.026 22.986  1.00 26.53 ?  714  THR A CB    1 
ATOM   5433 O  OG1   . THR C 3 648 ? -0.287  -14.096 22.672  1.00 27.52 ?  714  THR A OG1   1 
ATOM   5434 C  CG2   . THR C 3 648 ? 0.628   -15.454 24.449  1.00 27.71 ?  714  THR A CG2   1 
ATOM   5435 N  N     . VAL C 3 649 ? 2.138   -12.556 21.134  1.00 27.86 ?  715  VAL A N     1 
ATOM   5436 C  CA    . VAL C 3 649 ? 2.494   -11.926 19.875  1.00 28.42 ?  715  VAL A CA    1 
ATOM   5437 C  C     . VAL C 3 649 ? 3.971   -11.572 20.010  1.00 28.46 ?  715  VAL A C     1 
ATOM   5438 O  O     . VAL C 3 649 ? 4.340   -10.421 20.273  1.00 28.70 ?  715  VAL A O     1 
ATOM   5439 C  CB    . VAL C 3 649 ? 1.680   -10.650 19.639  1.00 28.93 ?  715  VAL A CB    1 
ATOM   5440 C  CG1   . VAL C 3 649 ? 2.038   -10.037 18.301  1.00 28.02 ?  715  VAL A CG1   1 
ATOM   5441 C  CG2   . VAL C 3 649 ? 0.167   -10.945 19.727  1.00 30.40 ?  715  VAL A CG2   1 
ATOM   5442 N  N     . GLY C 3 650 ? 4.805   -12.594 19.862  1.00 28.13 ?  716  GLY A N     1 
ATOM   5443 C  CA    . GLY C 3 650 ? 6.217   -12.538 20.232  1.00 27.76 ?  716  GLY A CA    1 
ATOM   5444 C  C     . GLY C 3 650 ? 6.703   -13.974 20.139  1.00 27.49 ?  716  GLY A C     1 
ATOM   5445 O  O     . GLY C 3 650 ? 5.910   -14.874 19.838  1.00 28.47 ?  716  GLY A O     1 
ATOM   5446 N  N     . LYS C 3 651 ? 7.978   -14.224 20.397  1.00 26.20 ?  717  LYS A N     1 
ATOM   5447 C  CA    . LYS C 3 651 ? 8.486   -15.564 20.100  1.00 25.66 ?  717  LYS A CA    1 
ATOM   5448 C  C     . LYS C 3 651 ? 9.041   -16.347 21.291  1.00 24.61 ?  717  LYS A C     1 
ATOM   5449 O  O     . LYS C 3 651 ? 9.503   -17.473 21.118  1.00 24.50 ?  717  LYS A O     1 
ATOM   5450 C  CB    . LYS C 3 651 ? 9.492   -15.529 18.938  1.00 25.97 ?  717  LYS A CB    1 
ATOM   5451 C  CG    . LYS C 3 651 ? 8.837   -15.514 17.553  1.00 27.17 ?  717  LYS A CG    1 
ATOM   5452 C  CD    . LYS C 3 651 ? 9.839   -15.184 16.440  1.00 28.75 ?  717  LYS A CD    1 
ATOM   5453 C  CE    . LYS C 3 651 ? 10.874  -16.276 16.298  1.00 29.82 ?  717  LYS A CE    1 
ATOM   5454 N  NZ    . LYS C 3 651 ? 10.216  -17.549 15.884  1.00 30.71 ?  717  LYS A NZ    1 
ATOM   5455 N  N     . LEU C 3 652 ? 8.980   -15.771 22.492  1.00 23.11 ?  718  LEU A N     1 
ATOM   5456 C  CA    . LEU C 3 652 ? 9.343   -16.528 23.696  1.00 22.78 ?  718  LEU A CA    1 
ATOM   5457 C  C     . LEU C 3 652 ? 8.432   -16.214 24.894  1.00 22.28 ?  718  LEU A C     1 
ATOM   5458 O  O     . LEU C 3 652 ? 8.914   -15.813 25.962  1.00 22.06 ?  718  LEU A O     1 
ATOM   5459 C  CB    . LEU C 3 652 ? 10.823  -16.308 24.068  1.00 22.19 ?  718  LEU A CB    1 
ATOM   5460 C  CG    . LEU C 3 652 ? 11.467  -17.409 24.938  1.00 23.21 ?  718  LEU A CG    1 
ATOM   5461 C  CD1   . LEU C 3 652 ? 11.581  -18.736 24.184  1.00 23.41 ?  718  LEU A CD1   1 
ATOM   5462 C  CD2   . LEU C 3 652 ? 12.837  -16.996 25.491  1.00 21.86 ?  718  LEU A CD2   1 
ATOM   5463 N  N     . PRO C 3 653 ? 7.109   -16.387 24.717  1.00 22.46 ?  719  PRO A N     1 
ATOM   5464 C  CA    . PRO C 3 653 ? 6.211   -16.185 25.863  1.00 22.31 ?  719  PRO A CA    1 
ATOM   5465 C  C     . PRO C 3 653 ? 6.485   -17.199 26.969  1.00 22.40 ?  719  PRO A C     1 
ATOM   5466 O  O     . PRO C 3 653 ? 6.842   -18.333 26.701  1.00 21.58 ?  719  PRO A O     1 
ATOM   5467 C  CB    . PRO C 3 653 ? 4.812   -16.433 25.277  1.00 22.11 ?  719  PRO A CB    1 
ATOM   5468 C  CG    . PRO C 3 653 ? 5.044   -17.264 24.024  1.00 23.37 ?  719  PRO A CG    1 
ATOM   5469 C  CD    . PRO C 3 653 ? 6.387   -16.779 23.488  1.00 21.98 ?  719  PRO A CD    1 
ATOM   5470 N  N     . CYS C 3 654 ? 6.367   -16.772 28.213  1.00 22.41 ?  720  CYS A N     1 
ATOM   5471 C  CA    . CYS C 3 654 ? 6.338   -17.719 29.306  1.00 22.99 ?  720  CYS A CA    1 
ATOM   5472 C  C     . CYS C 3 654 ? 5.371   -17.165 30.330  1.00 22.34 ?  720  CYS A C     1 
ATOM   5473 O  O     . CYS C 3 654 ? 5.765   -16.396 31.210  1.00 21.92 ?  720  CYS A O     1 
ATOM   5474 C  CB    . CYS C 3 654 ? 7.722   -17.918 29.917  1.00 22.74 ?  720  CYS A CB    1 
ATOM   5475 S  SG    . CYS C 3 654 ? 7.768   -19.163 31.245  1.00 25.08 ?  720  CYS A SG    1 
ATOM   5476 N  N     . LEU C 3 655 ? 4.105   -17.543 30.191  1.00 22.44 ?  721  LEU A N     1 
ATOM   5477 C  CA    . LEU C 3 655 ? 3.024   -17.011 31.052  1.00 23.40 ?  721  LEU A CA    1 
ATOM   5478 C  C     . LEU C 3 655 ? 3.184   -17.457 32.506  1.00 22.74 ?  721  LEU A C     1 
ATOM   5479 O  O     . LEU C 3 655 ? 2.659   -16.818 33.415  1.00 22.76 ?  721  LEU A O     1 
ATOM   5480 C  CB    . LEU C 3 655 ? 1.636   -17.397 30.523  1.00 23.43 ?  721  LEU A CB    1 
ATOM   5481 C  CG    . LEU C 3 655 ? 1.371   -17.037 29.054  1.00 27.75 ?  721  LEU A CG    1 
ATOM   5482 C  CD1   . LEU C 3 655 ? -0.121  -17.106 28.738  1.00 31.34 ?  721  LEU A CD1   1 
ATOM   5483 C  CD2   . LEU C 3 655 ? 1.922   -15.662 28.681  1.00 29.26 ?  721  LEU A CD2   1 
ATOM   5484 N  N     . ALA C 3 656 ? 3.917   -18.543 32.735  1.00 21.73 ?  722  ALA A N     1 
ATOM   5485 C  CA    . ALA C 3 656 ? 4.281   -18.877 34.107  1.00 21.31 ?  722  ALA A CA    1 
ATOM   5486 C  C     . ALA C 3 656 ? 4.934   -17.657 34.767  1.00 21.47 ?  722  ALA A C     1 
ATOM   5487 O  O     . ALA C 3 656 ? 4.637   -17.314 35.914  1.00 20.75 ?  722  ALA A O     1 
ATOM   5488 C  CB    . ALA C 3 656 ? 5.225   -20.090 34.148  1.00 20.93 ?  722  ALA A CB    1 
ATOM   5489 N  N     . ILE C 3 657 ? 5.842   -16.999 34.042  1.00 20.80 ?  723  ILE A N     1 
ATOM   5490 C  CA    . ILE C 3 657 ? 6.532   -15.839 34.617  1.00 20.42 ?  723  ILE A CA    1 
ATOM   5491 C  C     . ILE C 3 657 ? 5.579   -14.645 34.676  1.00 20.74 ?  723  ILE A C     1 
ATOM   5492 O  O     . ILE C 3 657 ? 5.398   -14.037 35.739  1.00 21.05 ?  723  ILE A O     1 
ATOM   5493 C  CB    . ILE C 3 657 ? 7.789   -15.437 33.779  1.00 20.27 ?  723  ILE A CB    1 
ATOM   5494 C  CG1   . ILE C 3 657 ? 8.821   -16.589 33.747  1.00 19.90 ?  723  ILE A CG1   1 
ATOM   5495 C  CG2   . ILE C 3 657 ? 8.404   -14.128 34.302  1.00 18.94 ?  723  ILE A CG2   1 
ATOM   5496 C  CD1   . ILE C 3 657 ? 9.958   -16.398 32.663  1.00 18.62 ?  723  ILE A CD1   1 
ATOM   5497 N  N     . SER C 3 658 ? 4.988   -14.290 33.536  1.00 20.44 ?  724  SER A N     1 
ATOM   5498 C  CA    . SER C 3 658 ? 4.178   -13.064 33.487  1.00 20.37 ?  724  SER A CA    1 
ATOM   5499 C  C     . SER C 3 658 ? 3.011   -13.124 34.491  1.00 20.10 ?  724  SER A C     1 
ATOM   5500 O  O     . SER C 3 658 ? 2.794   -12.170 35.245  1.00 19.49 ?  724  SER A O     1 
ATOM   5501 C  CB    . SER C 3 658 ? 3.701   -12.753 32.058  1.00 19.91 ?  724  SER A CB    1 
ATOM   5502 O  OG    . SER C 3 658 ? 2.827   -13.745 31.527  1.00 23.11 ?  724  SER A OG    1 
ATOM   5503 N  N     . SER C 3 659 ? 2.284   -14.244 34.490  1.00 20.34 ?  725  SER A N     1 
ATOM   5504 C  CA    . SER C 3 659 ? 1.205   -14.503 35.455  1.00 21.70 ?  725  SER A CA    1 
ATOM   5505 C  C     . SER C 3 659 ? 1.651   -14.618 36.912  1.00 21.92 ?  725  SER A C     1 
ATOM   5506 O  O     . SER C 3 659 ? 0.930   -14.185 37.805  1.00 22.81 ?  725  SER A O     1 
ATOM   5507 C  CB    . SER C 3 659 ? 0.429   -15.773 35.084  1.00 21.78 ?  725  SER A CB    1 
ATOM   5508 O  OG    . SER C 3 659 ? -0.275  -15.553 33.889  1.00 24.06 ?  725  SER A OG    1 
ATOM   5509 N  N     . SER C 3 660 ? 2.801   -15.231 37.169  1.00 21.83 ?  726  SER A N     1 
ATOM   5510 C  CA    . SER C 3 660 ? 3.324   -15.219 38.530  1.00 21.40 ?  726  SER A CA    1 
ATOM   5511 C  C     . SER C 3 660 ? 3.603   -13.783 38.971  1.00 21.46 ?  726  SER A C     1 
ATOM   5512 O  O     . SER C 3 660 ? 3.265   -13.390 40.096  1.00 21.44 ?  726  SER A O     1 
ATOM   5513 C  CB    . SER C 3 660 ? 4.573   -16.086 38.671  1.00 21.31 ?  726  SER A CB    1 
ATOM   5514 O  OG    . SER C 3 660 ? 4.244   -17.468 38.660  1.00 21.09 ?  726  SER A OG    1 
ATOM   5515 N  N     . VAL C 3 661 ? 4.195   -12.980 38.082  1.00 20.92 ?  727  VAL A N     1 
ATOM   5516 C  CA    . VAL C 3 661 ? 4.477   -11.588 38.409  1.00 19.94 ?  727  VAL A CA    1 
ATOM   5517 C  C     . VAL C 3 661 ? 3.205   -10.811 38.793  1.00 20.63 ?  727  VAL A C     1 
ATOM   5518 O  O     . VAL C 3 661 ? 3.169   -10.107 39.811  1.00 20.30 ?  727  VAL A O     1 
ATOM   5519 C  CB    . VAL C 3 661 ? 5.186   -10.823 37.250  1.00 20.26 ?  727  VAL A CB    1 
ATOM   5520 C  CG1   . VAL C 3 661 ? 5.230   -9.335  37.566  1.00 19.47 ?  727  VAL A CG1   1 
ATOM   5521 C  CG2   . VAL C 3 661 ? 6.581   -11.372 36.988  1.00 18.72 ?  727  VAL A CG2   1 
ATOM   5522 N  N     . THR C 3 662 ? 2.168   -10.884 37.966  1.00 20.48 ?  728  THR A N     1 
ATOM   5523 C  CA    . THR C 3 662 ? 0.954   -10.135 38.303  1.00 20.54 ?  728  THR A CA    1 
ATOM   5524 C  C     . THR C 3 662 ? 0.283   -10.689 39.574  1.00 20.19 ?  728  THR A C     1 
ATOM   5525 O  O     . THR C 3 662 ? -0.277  -9.927  40.372  1.00 19.56 ?  728  THR A O     1 
ATOM   5526 C  CB    . THR C 3 662 ? -0.042  -10.087 37.136  1.00 19.68 ?  728  THR A CB    1 
ATOM   5527 O  OG1   . THR C 3 662 ? -0.403  -11.410 36.735  1.00 20.10 ?  728  THR A OG1   1 
ATOM   5528 C  CG2   . THR C 3 662 ? 0.583   -9.339  35.919  1.00 19.36 ?  728  THR A CG2   1 
ATOM   5529 N  N     . ALA C 3 663 ? 0.346   -12.009 39.739  1.00 20.35 ?  729  ALA A N     1 
ATOM   5530 C  CA    . ALA C 3 663 ? -0.172  -12.666 40.949  1.00 20.62 ?  729  ALA A CA    1 
ATOM   5531 C  C     . ALA C 3 663 ? 0.530   -12.152 42.226  1.00 21.01 ?  729  ALA A C     1 
ATOM   5532 O  O     . ALA C 3 663 ? -0.129  -11.750 43.201  1.00 21.18 ?  729  ALA A O     1 
ATOM   5533 C  CB    . ALA C 3 663 ? -0.020  -14.190 40.820  1.00 21.00 ?  729  ALA A CB    1 
ATOM   5534 N  N     . TYR C 3 664 ? 1.862   -12.173 42.231  1.00 21.06 ?  730  TYR A N     1 
ATOM   5535 C  CA    . TYR C 3 664 ? 2.598   -11.593 43.340  1.00 21.28 ?  730  TYR A CA    1 
ATOM   5536 C  C     . TYR C 3 664 ? 2.104   -10.168 43.579  1.00 22.10 ?  730  TYR A C     1 
ATOM   5537 O  O     . TYR C 3 664 ? 1.860   -9.774  44.725  1.00 22.29 ?  730  TYR A O     1 
ATOM   5538 C  CB    . TYR C 3 664 ? 4.100   -11.572 43.077  1.00 20.85 ?  730  TYR A CB    1 
ATOM   5539 C  CG    . TYR C 3 664 ? 4.839   -12.857 43.440  1.00 21.45 ?  730  TYR A CG    1 
ATOM   5540 C  CD1   . TYR C 3 664 ? 4.910   -13.307 44.762  1.00 21.27 ?  730  TYR A CD1   1 
ATOM   5541 C  CD2   . TYR C 3 664 ? 5.482   -13.610 42.459  1.00 21.58 ?  730  TYR A CD2   1 
ATOM   5542 C  CE1   . TYR C 3 664 ? 5.593   -14.490 45.089  1.00 22.10 ?  730  TYR A CE1   1 
ATOM   5543 C  CE2   . TYR C 3 664 ? 6.165   -14.783 42.779  1.00 22.84 ?  730  TYR A CE2   1 
ATOM   5544 C  CZ    . TYR C 3 664 ? 6.220   -15.220 44.086  1.00 21.83 ?  730  TYR A CZ    1 
ATOM   5545 O  OH    . TYR C 3 664 ? 6.920   -16.384 44.382  1.00 22.13 ?  730  TYR A OH    1 
ATOM   5546 N  N     . GLY C 3 665 ? 1.929   -9.400  42.498  1.00 21.02 ?  731  GLY A N     1 
ATOM   5547 C  CA    . GLY C 3 665 ? 1.527   -8.007  42.633  1.00 21.18 ?  731  GLY A CA    1 
ATOM   5548 C  C     . GLY C 3 665 ? 0.200   -7.802  43.343  1.00 21.10 ?  731  GLY A C     1 
ATOM   5549 O  O     . GLY C 3 665 ? 0.074   -6.935  44.218  1.00 20.98 ?  731  GLY A O     1 
ATOM   5550 N  N     . ARG C 3 666 ? -0.800  -8.581  42.948  1.00 21.50 ?  732  ARG A N     1 
ATOM   5551 C  CA    . ARG C 3 666 ? -2.089  -8.577  43.628  1.00 21.30 ?  732  ARG A CA    1 
ATOM   5552 C  C     . ARG C 3 666 ? -1.952  -8.896  45.130  1.00 21.67 ?  732  ARG A C     1 
ATOM   5553 O  O     . ARG C 3 666 ? -2.562  -8.214  45.976  1.00 20.97 ?  732  ARG A O     1 
ATOM   5554 C  CB    . ARG C 3 666 ? -3.046  -9.573  42.959  1.00 21.41 ?  732  ARG A CB    1 
ATOM   5555 C  CG    . ARG C 3 666 ? -3.365  -9.223  41.521  1.00 21.30 ?  732  ARG A CG    1 
ATOM   5556 C  CD    . ARG C 3 666 ? -4.497  -10.052 40.960  1.00 21.75 ?  732  ARG A CD    1 
ATOM   5557 N  NE    . ARG C 3 666 ? -4.219  -11.486 40.977  1.00 20.48 ?  732  ARG A NE    1 
ATOM   5558 C  CZ    . ARG C 3 666 ? -3.630  -12.154 39.982  1.00 21.21 ?  732  ARG A CZ    1 
ATOM   5559 N  NH1   . ARG C 3 666 ? -3.214  -11.522 38.880  1.00 19.30 ?  732  ARG A NH1   1 
ATOM   5560 N  NH2   . ARG C 3 666 ? -3.453  -13.457 40.087  1.00 19.12 ?  732  ARG A NH2   1 
ATOM   5561 N  N     . THR C 3 667 ? -1.155  -9.907  45.465  1.00 21.65 ?  733  THR A N     1 
ATOM   5562 C  CA    . THR C 3 667 ? -0.961  -10.262 46.870  1.00 22.76 ?  733  THR A CA    1 
ATOM   5563 C  C     . THR C 3 667 ? -0.271  -9.130  47.644  1.00 22.65 ?  733  THR A C     1 
ATOM   5564 O  O     . THR C 3 667 ? -0.594  -8.871  48.799  1.00 22.46 ?  733  THR A O     1 
ATOM   5565 C  CB    . THR C 3 667 ? -0.160  -11.575 47.062  1.00 23.08 ?  733  THR A CB    1 
ATOM   5566 O  OG1   . THR C 3 667 ? 1.204   -11.384 46.665  1.00 24.23 ?  733  THR A OG1   1 
ATOM   5567 C  CG2   . THR C 3 667 ? -0.769  -12.711 46.261  1.00 22.46 ?  733  THR A CG2   1 
ATOM   5568 N  N     . MET C 3 668 ? 0.646   -8.435  46.984  1.00 22.87 ?  734  MET A N     1 
ATOM   5569 C  CA    . MET C 3 668 ? 1.411   -7.390  47.638  1.00 22.80 ?  734  MET A CA    1 
ATOM   5570 C  C     . MET C 3 668 ? 0.598   -6.142  47.956  1.00 23.19 ?  734  MET A C     1 
ATOM   5571 O  O     . MET C 3 668 ? 0.745   -5.558  49.045  1.00 23.48 ?  734  MET A O     1 
ATOM   5572 C  CB    . MET C 3 668 ? 2.653   -7.047  46.822  1.00 22.89 ?  734  MET A CB    1 
ATOM   5573 C  CG    . MET C 3 668 ? 3.633   -8.225  46.721  1.00 22.25 ?  734  MET A CG    1 
ATOM   5574 S  SD    . MET C 3 668 ? 4.995   -7.863  45.583  1.00 23.42 ?  734  MET A SD    1 
ATOM   5575 C  CE    . MET C 3 668 ? 5.808   -6.468  46.377  1.00 19.14 ?  734  MET A CE    1 
ATOM   5576 N  N     . ILE C 3 669 ? -0.256  -5.728  47.027  1.00 22.80 ?  735  ILE A N     1 
ATOM   5577 C  CA    . ILE C 3 669 ? -1.095  -4.569  47.278  1.00 23.11 ?  735  ILE A CA    1 
ATOM   5578 C  C     . ILE C 3 669 ? -2.135  -4.889  48.377  1.00 22.93 ?  735  ILE A C     1 
ATOM   5579 O  O     . ILE C 3 669 ? -2.394  -4.057  49.252  1.00 22.04 ?  735  ILE A O     1 
ATOM   5580 C  CB    . ILE C 3 669 ? -1.718  -3.992  45.960  1.00 23.39 ?  735  ILE A CB    1 
ATOM   5581 C  CG1   . ILE C 3 669 ? -2.443  -2.665  46.242  1.00 25.11 ?  735  ILE A CG1   1 
ATOM   5582 C  CG2   . ILE C 3 669 ? -2.628  -5.025  45.269  1.00 22.34 ?  735  ILE A CG2   1 
ATOM   5583 C  CD1   . ILE C 3 669 ? -2.832  -1.884  44.983  1.00 26.89 ?  735  ILE A CD1   1 
ATOM   5584 N  N     . LEU C 3 670 ? -2.708  -6.094  48.345  1.00 22.69 ?  736  LEU A N     1 
ATOM   5585 C  CA    . LEU C 3 670 ? -3.568  -6.563  49.431  1.00 23.32 ?  736  LEU A CA    1 
ATOM   5586 C  C     . LEU C 3 670 ? -2.853  -6.559  50.796  1.00 23.15 ?  736  LEU A C     1 
ATOM   5587 O  O     . LEU C 3 670 ? -3.374  -6.038  51.800  1.00 22.94 ?  736  LEU A O     1 
ATOM   5588 C  CB    . LEU C 3 670 ? -4.127  -7.953  49.112  1.00 23.06 ?  736  LEU A CB    1 
ATOM   5589 C  CG    . LEU C 3 670 ? -5.072  -8.558  50.163  1.00 23.76 ?  736  LEU A CG    1 
ATOM   5590 C  CD1   . LEU C 3 670 ? -6.231  -7.625  50.452  1.00 24.01 ?  736  LEU A CD1   1 
ATOM   5591 C  CD2   . LEU C 3 670 ? -5.581  -9.933  49.705  1.00 24.37 ?  736  LEU A CD2   1 
ATOM   5592 N  N     . LYS C 3 671 ? -1.654  -7.128  50.834  1.00 22.91 ?  737  LYS A N     1 
ATOM   5593 C  CA    . LYS C 3 671 ? -0.853  -7.137  52.056  1.00 22.95 ?  737  LYS A CA    1 
ATOM   5594 C  C     . LYS C 3 671 ? -0.487  -5.723  52.528  1.00 22.47 ?  737  LYS A C     1 
ATOM   5595 O  O     . LYS C 3 671 ? -0.498  -5.438  53.723  1.00 21.98 ?  737  LYS A O     1 
ATOM   5596 C  CB    . LYS C 3 671 ? 0.413   -7.952  51.843  1.00 23.05 ?  737  LYS A CB    1 
ATOM   5597 C  CG    . LYS C 3 671 ? 1.344   -7.990  53.050  1.00 26.58 ?  737  LYS A CG    1 
ATOM   5598 C  CD    . LYS C 3 671 ? 2.437   -9.046  52.834  1.00 31.27 ?  737  LYS A CD    1 
ATOM   5599 C  CE    . LYS C 3 671 ? 3.387   -9.078  54.008  1.00 33.66 ?  737  LYS A CE    1 
ATOM   5600 N  NZ    . LYS C 3 671 ? 4.051   -10.406 54.157  1.00 37.10 ?  737  LYS A NZ    1 
ATOM   5601 N  N     . THR C 3 672 ? -0.165  -4.848  51.588  1.00 21.42 ?  738  THR A N     1 
ATOM   5602 C  CA    . THR C 3 672 ? 0.141   -3.455  51.895  1.00 21.14 ?  738  THR A CA    1 
ATOM   5603 C  C     . THR C 3 672 ? -1.077  -2.750  52.513  1.00 20.85 ?  738  THR A C     1 
ATOM   5604 O  O     . THR C 3 672 ? -0.968  -2.103  53.559  1.00 20.89 ?  738  THR A O     1 
ATOM   5605 C  CB    . THR C 3 672 ? 0.632   -2.704  50.619  1.00 21.39 ?  738  THR A CB    1 
ATOM   5606 O  OG1   . THR C 3 672 ? 1.849   -3.302  50.164  1.00 20.97 ?  738  THR A OG1   1 
ATOM   5607 C  CG2   . THR C 3 672 ? 0.867   -1.233  50.908  1.00 21.73 ?  738  THR A CG2   1 
ATOM   5608 N  N     . LYS C 3 673 ? -2.236  -2.882  51.875  1.00 20.46 ?  739  LYS A N     1 
ATOM   5609 C  CA    . LYS C 3 673 ? -3.455  -2.274  52.398  1.00 21.28 ?  739  LYS A CA    1 
ATOM   5610 C  C     . LYS C 3 673 ? -3.754  -2.816  53.797  1.00 21.42 ?  739  LYS A C     1 
ATOM   5611 O  O     . LYS C 3 673 ? -4.023  -2.057  54.724  1.00 20.99 ?  739  LYS A O     1 
ATOM   5612 C  CB    . LYS C 3 673 ? -4.632  -2.547  51.455  1.00 22.30 ?  739  LYS A CB    1 
ATOM   5613 C  CG    . LYS C 3 673 ? -6.014  -2.039  51.936  1.00 22.98 ?  739  LYS A CG    1 
ATOM   5614 C  CD    . LYS C 3 673 ? -7.078  -2.386  50.884  1.00 27.44 ?  739  LYS A CD    1 
ATOM   5615 C  CE    . LYS C 3 673 ? -8.502  -2.074  51.337  1.00 29.89 ?  739  LYS A CE    1 
ATOM   5616 N  NZ    . LYS C 3 673 ? -9.461  -2.741  50.380  1.00 31.86 ?  739  LYS A NZ    1 
ATOM   5617 N  N     . THR C 3 674 ? -3.671  -4.133  53.952  1.00 21.42 ?  740  THR A N     1 
ATOM   5618 C  CA    . THR C 3 674 ? -3.970  -4.759  55.230  1.00 21.32 ?  740  THR A CA    1 
ATOM   5619 C  C     . THR C 3 674 ? -2.979  -4.288  56.301  1.00 21.41 ?  740  THR A C     1 
ATOM   5620 O  O     . THR C 3 674 ? -3.367  -3.939  57.409  1.00 21.17 ?  740  THR A O     1 
ATOM   5621 C  CB    . THR C 3 674 ? -3.915  -6.286  55.122  1.00 21.50 ?  740  THR A CB    1 
ATOM   5622 O  OG1   . THR C 3 674 ? -4.791  -6.732  54.079  1.00 22.54 ?  740  THR A OG1   1 
ATOM   5623 C  CG2   . THR C 3 674 ? -4.351  -6.940  56.460  1.00 22.09 ?  740  THR A CG2   1 
ATOM   5624 N  N     . ALA C 3 675 ? -1.695  -4.271  55.970  1.00 21.39 ?  741  ALA A N     1 
ATOM   5625 C  CA    . ALA C 3 675 ? -0.692  -3.911  56.955  1.00 22.22 ?  741  ALA A CA    1 
ATOM   5626 C  C     . ALA C 3 675 ? -0.838  -2.453  57.408  1.00 22.40 ?  741  ALA A C     1 
ATOM   5627 O  O     . ALA C 3 675 ? -0.741  -2.163  58.590  1.00 21.88 ?  741  ALA A O     1 
ATOM   5628 C  CB    . ALA C 3 675 ? 0.718   -4.189  56.429  1.00 22.21 ?  741  ALA A CB    1 
ATOM   5629 N  N     . VAL C 3 676 ? -1.072  -1.543  56.470  1.00 22.43 ?  742  VAL A N     1 
ATOM   5630 C  CA    . VAL C 3 676 ? -1.320  -0.147  56.836  1.00 22.95 ?  742  VAL A CA    1 
ATOM   5631 C  C     . VAL C 3 676 ? -2.542  0.009   57.742  1.00 23.12 ?  742  VAL A C     1 
ATOM   5632 O  O     . VAL C 3 676 ? -2.483  0.721   58.762  1.00 22.35 ?  742  VAL A O     1 
ATOM   5633 C  CB    . VAL C 3 676 ? -1.477  0.755   55.596  1.00 23.20 ?  742  VAL A CB    1 
ATOM   5634 C  CG1   . VAL C 3 676 ? -2.004  2.131   55.984  1.00 23.81 ?  742  VAL A CG1   1 
ATOM   5635 C  CG2   . VAL C 3 676 ? -0.146  0.853   54.841  1.00 22.93 ?  742  VAL A CG2   1 
ATOM   5636 N  N     . GLN C 3 677 ? -3.647  -0.643  57.387  1.00 22.52 ?  743  GLN A N     1 
ATOM   5637 C  CA    . GLN C 3 677 ? -4.857  -0.507  58.200  1.00 23.48 ?  743  GLN A CA    1 
ATOM   5638 C  C     . GLN C 3 677 ? -4.722  -1.129  59.608  1.00 22.95 ?  743  GLN A C     1 
ATOM   5639 O  O     . GLN C 3 677 ? -5.235  -0.578  60.603  1.00 21.47 ?  743  GLN A O     1 
ATOM   5640 C  CB    . GLN C 3 677 ? -6.099  -1.009  57.438  1.00 23.39 ?  743  GLN A CB    1 
ATOM   5641 C  CG    . GLN C 3 677 ? -6.375  -0.095  56.240  1.00 26.18 ?  743  GLN A CG    1 
ATOM   5642 C  CD    . GLN C 3 677 ? -7.638  -0.407  55.462  1.00 29.01 ?  743  GLN A CD    1 
ATOM   5643 O  OE1   . GLN C 3 677 ? -8.196  0.486   54.784  1.00 30.09 ?  743  GLN A OE1   1 
ATOM   5644 N  NE2   . GLN C 3 677 ? -8.098  -1.661  55.531  1.00 25.52 ?  743  GLN A NE2   1 
ATOM   5645 N  N     . GLU C 3 678 ? -4.002  -2.240  59.695  1.00 22.46 ?  744  GLU A N     1 
ATOM   5646 C  CA    . GLU C 3 678 ? -3.815  -2.893  60.982  1.00 23.26 ?  744  GLU A CA    1 
ATOM   5647 C  C     . GLU C 3 678 ? -2.839  -2.160  61.890  1.00 23.00 ?  744  GLU A C     1 
ATOM   5648 O  O     . GLU C 3 678 ? -2.976  -2.193  63.102  1.00 23.29 ?  744  GLU A O     1 
ATOM   5649 C  CB    . GLU C 3 678 ? -3.373  -4.335  60.808  1.00 23.27 ?  744  GLU A CB    1 
ATOM   5650 C  CG    . GLU C 3 678 ? -4.452  -5.226  60.221  1.00 26.55 ?  744  GLU A CG    1 
ATOM   5651 C  CD    . GLU C 3 678 ? -4.034  -6.685  60.195  1.00 30.55 ?  744  GLU A CD    1 
ATOM   5652 O  OE1   . GLU C 3 678 ? -2.823  -6.953  60.321  1.00 31.37 ?  744  GLU A OE1   1 
ATOM   5653 O  OE2   . GLU C 3 678 ? -4.910  -7.563  60.055  1.00 32.50 ?  744  GLU A OE2   1 
ATOM   5654 N  N     . LYS C 3 679 ? -1.848  -1.502  61.313  1.00 22.60 ?  745  LYS A N     1 
ATOM   5655 C  CA    . LYS C 3 679 ? -0.876  -0.808  62.143  1.00 22.55 ?  745  LYS A CA    1 
ATOM   5656 C  C     . LYS C 3 679 ? -1.411  0.539   62.637  1.00 21.98 ?  745  LYS A C     1 
ATOM   5657 O  O     . LYS C 3 679 ? -1.427  0.823   63.832  1.00 21.29 ?  745  LYS A O     1 
ATOM   5658 C  CB    . LYS C 3 679 ? 0.436   -0.596  61.385  1.00 22.77 ?  745  LYS A CB    1 
ATOM   5659 C  CG    . LYS C 3 679 ? 1.472   0.166   62.222  1.00 25.35 ?  745  LYS A CG    1 
ATOM   5660 C  CD    . LYS C 3 679 ? 2.824   0.204   61.535  1.00 28.66 ?  745  LYS A CD    1 
ATOM   5661 C  CE    . LYS C 3 679 ? 3.829   1.046   62.338  1.00 29.11 ?  745  LYS A CE    1 
ATOM   5662 N  NZ    . LYS C 3 679 ? 4.123   0.465   63.683  1.00 31.09 ?  745  LYS A NZ    1 
ATOM   5663 N  N     . TYR C 3 680 ? -1.846  1.366   61.696  1.00 21.47 ?  746  TYR A N     1 
ATOM   5664 C  CA    . TYR C 3 680 ? -2.157  2.756   61.985  1.00 21.42 ?  746  TYR A CA    1 
ATOM   5665 C  C     . TYR C 3 680 ? -3.617  2.890   62.385  1.00 21.45 ?  746  TYR A C     1 
ATOM   5666 O  O     . TYR C 3 680 ? -4.464  3.307   61.588  1.00 21.80 ?  746  TYR A O     1 
ATOM   5667 C  CB    . TYR C 3 680 ? -1.809  3.606   60.752  1.00 21.60 ?  746  TYR A CB    1 
ATOM   5668 C  CG    . TYR C 3 680 ? -0.318  3.619   60.536  1.00 22.11 ?  746  TYR A CG    1 
ATOM   5669 C  CD1   . TYR C 3 680 ? 0.493   4.431   61.315  1.00 23.25 ?  746  TYR A CD1   1 
ATOM   5670 C  CD2   . TYR C 3 680 ? 0.288   2.789   59.590  1.00 23.48 ?  746  TYR A CD2   1 
ATOM   5671 C  CE1   . TYR C 3 680 ? 1.851   4.440   61.159  1.00 25.17 ?  746  TYR A CE1   1 
ATOM   5672 C  CE2   . TYR C 3 680 ? 1.657   2.787   59.432  1.00 24.49 ?  746  TYR A CE2   1 
ATOM   5673 C  CZ    . TYR C 3 680 ? 2.431   3.618   60.214  1.00 26.37 ?  746  TYR A CZ    1 
ATOM   5674 O  OH    . TYR C 3 680 ? 3.801   3.653   60.070  1.00 29.34 ?  746  TYR A OH    1 
ATOM   5675 N  N     . CYS C 3 681 ? -3.907  2.483   63.621  1.00 20.70 ?  747  CYS A N     1 
ATOM   5676 C  CA    . CYS C 3 681 ? -5.262  2.494   64.129  1.00 20.65 ?  747  CYS A CA    1 
ATOM   5677 C  C     . CYS C 3 681 ? -5.332  2.932   65.605  1.00 20.64 ?  747  CYS A C     1 
ATOM   5678 O  O     . CYS C 3 681 ? -4.338  2.899   66.362  1.00 18.91 ?  747  CYS A O     1 
ATOM   5679 C  CB    . CYS C 3 681 ? -5.900  1.121   63.947  1.00 20.89 ?  747  CYS A CB    1 
ATOM   5680 S  SG    . CYS C 3 681 ? -5.168  -0.094  65.038  1.00 22.56 ?  747  CYS A SG    1 
ATOM   5681 N  N     . ILE C 3 682 ? -6.520  3.351   66.018  1.00 20.99 ?  748  ILE A N     1 
ATOM   5682 C  CA    . ILE C 3 682 ? -6.660  3.954   67.343  1.00 20.88 ?  748  ILE A CA    1 
ATOM   5683 C  C     . ILE C 3 682 ? -6.262  2.982   68.440  1.00 21.71 ?  748  ILE A C     1 
ATOM   5684 O  O     . ILE C 3 682 ? -5.623  3.381   69.412  1.00 20.70 ?  748  ILE A O     1 
ATOM   5685 C  CB    . ILE C 3 682 ? -8.078  4.484   67.593  1.00 20.79 ?  748  ILE A CB    1 
ATOM   5686 C  CG1   . ILE C 3 682 ? -8.338  5.713   66.721  1.00 21.61 ?  748  ILE A CG1   1 
ATOM   5687 C  CG2   . ILE C 3 682 ? -8.276  4.811   69.086  1.00 21.65 ?  748  ILE A CG2   1 
ATOM   5688 C  CD1   . ILE C 3 682 ? -9.802  5.980   66.448  1.00 23.48 ?  748  ILE A CD1   1 
ATOM   5689 N  N     . LYS C 3 683 ? -6.615  1.709   68.278  1.00 22.72 ?  749  LYS A N     1 
ATOM   5690 C  CA    . LYS C 3 683 ? -6.347  0.741   69.331  1.00 24.60 ?  749  LYS A CA    1 
ATOM   5691 C  C     . LYS C 3 683 ? -4.857  0.429   69.458  1.00 24.79 ?  749  LYS A C     1 
ATOM   5692 O  O     . LYS C 3 683 ? -4.427  -0.201  70.423  1.00 25.45 ?  749  LYS A O     1 
ATOM   5693 C  CB    . LYS C 3 683 ? -7.171  -0.531  69.160  1.00 24.96 ?  749  LYS A CB    1 
ATOM   5694 C  CG    . LYS C 3 683 ? -6.512  -1.591  68.325  1.00 28.30 ?  749  LYS A CG    1 
ATOM   5695 C  CD    . LYS C 3 683 ? -7.419  -2.808  68.230  1.00 33.17 ?  749  LYS A CD    1 
ATOM   5696 C  CE    . LYS C 3 683 ? -8.812  -2.383  67.780  1.00 34.81 ?  749  LYS A CE    1 
ATOM   5697 N  NZ    . LYS C 3 683 ? -9.362  -1.358  68.729  1.00 36.62 ?  749  LYS A NZ    1 
ATOM   5698 N  N     . ASN C 3 684 ? -4.074  0.897   68.494  1.00 24.66 ?  750  ASN A N     1 
ATOM   5699 C  CA    . ASN C 3 684 ? -2.623  0.821   68.585  1.00 24.49 ?  750  ASN A CA    1 
ATOM   5700 C  C     . ASN C 3 684 ? -2.003  2.141   69.028  1.00 24.31 ?  750  ASN A C     1 
ATOM   5701 O  O     . ASN C 3 684 ? -0.795  2.320   68.923  1.00 24.77 ?  750  ASN A O     1 
ATOM   5702 C  CB    . ASN C 3 684 ? -2.019  0.417   67.243  1.00 24.68 ?  750  ASN A CB    1 
ATOM   5703 C  CG    . ASN C 3 684 ? -2.011  -1.064  67.044  1.00 25.14 ?  750  ASN A CG    1 
ATOM   5704 O  OD1   . ASN C 3 684 ? -2.110  -1.831  68.012  1.00 25.67 ?  750  ASN A OD1   1 
ATOM   5705 N  ND2   . ASN C 3 684 ? -1.898  -1.492  65.790  1.00 25.31 ?  750  ASN A ND2   1 
ATOM   5706 N  N     . GLY C 3 685 ? -2.832  3.073   69.492  1.00 23.93 ?  751  GLY A N     1 
ATOM   5707 C  CA    . GLY C 3 685 ? -2.331  4.327   70.060  1.00 23.37 ?  751  GLY A CA    1 
ATOM   5708 C  C     . GLY C 3 685 ? -2.256  5.487   69.074  1.00 23.35 ?  751  GLY A C     1 
ATOM   5709 O  O     . GLY C 3 685 ? -1.715  6.545   69.397  1.00 23.18 ?  751  GLY A O     1 
ATOM   5710 N  N     . TYR C 3 686 ? -2.813  5.303   67.880  1.00 22.59 ?  752  TYR A N     1 
ATOM   5711 C  CA    . TYR C 3 686 ? -2.889  6.398   66.919  1.00 23.17 ?  752  TYR A CA    1 
ATOM   5712 C  C     . TYR C 3 686 ? -4.175  7.185   67.104  1.00 22.92 ?  752  TYR A C     1 
ATOM   5713 O  O     . TYR C 3 686 ? -5.128  6.706   67.718  1.00 22.25 ?  752  TYR A O     1 
ATOM   5714 C  CB    . TYR C 3 686 ? -2.754  5.900   65.465  1.00 22.83 ?  752  TYR A CB    1 
ATOM   5715 C  CG    . TYR C 3 686 ? -1.386  5.341   65.208  1.00 24.05 ?  752  TYR A CG    1 
ATOM   5716 C  CD1   . TYR C 3 686 ? -0.352  6.162   64.765  1.00 24.04 ?  752  TYR A CD1   1 
ATOM   5717 C  CD2   . TYR C 3 686 ? -1.107  3.998   65.454  1.00 23.08 ?  752  TYR A CD2   1 
ATOM   5718 C  CE1   . TYR C 3 686 ? 0.914   5.660   64.569  1.00 24.79 ?  752  TYR A CE1   1 
ATOM   5719 C  CE2   . TYR C 3 686 ? 0.151   3.489   65.263  1.00 23.28 ?  752  TYR A CE2   1 
ATOM   5720 C  CZ    . TYR C 3 686 ? 1.160   4.324   64.816  1.00 25.62 ?  752  TYR A CZ    1 
ATOM   5721 O  OH    . TYR C 3 686 ? 2.422   3.826   64.606  1.00 26.18 ?  752  TYR A OH    1 
ATOM   5722 N  N     . LYS C 3 687 ? -4.196  8.390   66.549  1.00 22.92 ?  753  LYS A N     1 
ATOM   5723 C  CA    . LYS C 3 687 ? -5.317  9.287   66.766  1.00 23.47 ?  753  LYS A CA    1 
ATOM   5724 C  C     . LYS C 3 687 ? -6.530  8.864   65.958  1.00 22.65 ?  753  LYS A C     1 
ATOM   5725 O  O     . LYS C 3 687 ? -7.652  9.089   66.390  1.00 22.66 ?  753  LYS A O     1 
ATOM   5726 C  CB    . LYS C 3 687 ? -4.924  10.728  66.439  1.00 24.07 ?  753  LYS A CB    1 
ATOM   5727 C  CG    . LYS C 3 687 ? -4.038  11.369  67.499  1.00 26.45 ?  753  LYS A CG    1 
ATOM   5728 C  CD    . LYS C 3 687 ? -3.362  12.616  66.938  1.00 30.88 ?  753  LYS A CD    1 
ATOM   5729 C  CE    . LYS C 3 687 ? -2.388  13.227  67.937  1.00 32.84 ?  753  LYS A CE    1 
ATOM   5730 N  NZ    . LYS C 3 687 ? -1.609  14.330  67.284  1.00 35.81 ?  753  LYS A NZ    1 
ATOM   5731 N  N     . HIS C 3 688 ? -6.286  8.238   64.803  1.00 21.65 ?  754  HIS A N     1 
ATOM   5732 C  CA    . HIS C 3 688 ? -7.329  7.824   63.880  1.00 21.15 ?  754  HIS A CA    1 
ATOM   5733 C  C     . HIS C 3 688 ? -7.052  6.433   63.321  1.00 20.99 ?  754  HIS A C     1 
ATOM   5734 O  O     . HIS C 3 688 ? -5.922  5.952   63.358  1.00 20.45 ?  754  HIS A O     1 
ATOM   5735 C  CB    . HIS C 3 688 ? -7.398  8.798   62.694  1.00 21.46 ?  754  HIS A CB    1 
ATOM   5736 C  CG    . HIS C 3 688 ? -7.631  10.221  63.099  1.00 21.67 ?  754  HIS A CG    1 
ATOM   5737 N  ND1   . HIS C 3 688 ? -6.607  11.137  63.226  1.00 23.25 ?  754  HIS A ND1   1 
ATOM   5738 C  CD2   . HIS C 3 688 ? -8.771  10.881  63.414  1.00 20.36 ?  754  HIS A CD2   1 
ATOM   5739 C  CE1   . HIS C 3 688 ? -7.107  12.303  63.597  1.00 23.72 ?  754  HIS A CE1   1 
ATOM   5740 N  NE2   . HIS C 3 688 ? -8.417  12.174  63.725  1.00 23.91 ?  754  HIS A NE2   1 
ATOM   5741 N  N     . ASP C 3 689 ? -8.096  5.797   62.802  1.00 20.85 ?  755  ASP A N     1 
ATOM   5742 C  CA    . ASP C 3 689 ? -7.954  4.555   62.060  1.00 21.30 ?  755  ASP A CA    1 
ATOM   5743 C  C     . ASP C 3 689 ? -7.672  4.922   60.614  1.00 20.80 ?  755  ASP A C     1 
ATOM   5744 O  O     . ASP C 3 689 ? -8.528  5.502   59.927  1.00 20.90 ?  755  ASP A O     1 
ATOM   5745 C  CB    . ASP C 3 689 ? -9.240  3.728   62.131  1.00 21.58 ?  755  ASP A CB    1 
ATOM   5746 C  CG    . ASP C 3 689 ? -9.483  3.125   63.505  1.00 22.19 ?  755  ASP A CG    1 
ATOM   5747 O  OD1   . ASP C 3 689 ? -8.549  3.023   64.326  1.00 23.55 ?  755  ASP A OD1   1 
ATOM   5748 O  OD2   . ASP C 3 689 ? -10.634 2.738   63.770  1.00 25.81 ?  755  ASP A OD2   1 
ATOM   5749 N  N     . ALA C 3 690 ? -6.467  4.614   60.154  1.00 20.61 ?  756  ALA A N     1 
ATOM   5750 C  CA    . ALA C 3 690 ? -6.089  4.890   58.771  1.00 19.79 ?  756  ALA A CA    1 
ATOM   5751 C  C     . ALA C 3 690 ? -7.009  4.151   57.812  1.00 19.95 ?  756  ALA A C     1 
ATOM   5752 O  O     . ALA C 3 690 ? -7.390  3.003   58.057  1.00 20.34 ?  756  ALA A O     1 
ATOM   5753 C  CB    . ALA C 3 690 ? -4.635  4.484   58.524  1.00 19.73 ?  756  ALA A CB    1 
ATOM   5754 N  N     . VAL C 3 691 ? -7.351  4.814   56.711  1.00 20.13 ?  757  VAL A N     1 
ATOM   5755 C  CA    . VAL C 3 691 ? -8.215  4.246   55.688  1.00 21.18 ?  757  VAL A CA    1 
ATOM   5756 C  C     . VAL C 3 691 ? -7.475  4.332   54.335  1.00 21.01 ?  757  VAL A C     1 
ATOM   5757 O  O     . VAL C 3 691 ? -6.971  5.397   53.948  1.00 20.61 ?  757  VAL A O     1 
ATOM   5758 C  CB    . VAL C 3 691 ? -9.551  5.041   55.581  1.00 20.81 ?  757  VAL A CB    1 
ATOM   5759 C  CG1   . VAL C 3 691 ? -10.342 4.581   54.366  1.00 23.13 ?  757  VAL A CG1   1 
ATOM   5760 C  CG2   . VAL C 3 691 ? -10.399 4.895   56.853  1.00 23.13 ?  757  VAL A CG2   1 
ATOM   5761 N  N     . VAL C 3 692 ? -7.378  3.203   53.644  1.00 21.32 ?  758  VAL A N     1 
ATOM   5762 C  CA    . VAL C 3 692 ? -6.878  3.180   52.256  1.00 20.96 ?  758  VAL A CA    1 
ATOM   5763 C  C     . VAL C 3 692 ? -8.077  3.494   51.394  1.00 20.16 ?  758  VAL A C     1 
ATOM   5764 O  O     . VAL C 3 692 ? -9.019  2.697   51.316  1.00 20.77 ?  758  VAL A O     1 
ATOM   5765 C  CB    . VAL C 3 692 ? -6.264  1.809   51.906  1.00 20.50 ?  758  VAL A CB    1 
ATOM   5766 C  CG1   . VAL C 3 692 ? -5.933  1.674   50.375  1.00 22.00 ?  758  VAL A CG1   1 
ATOM   5767 C  CG2   . VAL C 3 692 ? -5.006  1.594   52.734  1.00 22.56 ?  758  VAL A CG2   1 
ATOM   5768 N  N     . VAL C 3 693 ? -8.085  4.680   50.795  1.00 19.68 ?  759  VAL A N     1 
ATOM   5769 C  CA    . VAL C 3 693 ? -9.269  5.132   50.060  1.00 19.52 ?  759  VAL A CA    1 
ATOM   5770 C  C     . VAL C 3 693 ? -9.227  4.712   48.594  1.00 20.13 ?  759  VAL A C     1 
ATOM   5771 O  O     . VAL C 3 693 ? -10.258 4.692   47.905  1.00 19.69 ?  759  VAL A O     1 
ATOM   5772 C  CB    . VAL C 3 693 ? -9.449  6.656   50.128  1.00 19.88 ?  759  VAL A CB    1 
ATOM   5773 C  CG1   . VAL C 3 693 ? -9.601  7.141   51.597  1.00 19.02 ?  759  VAL A CG1   1 
ATOM   5774 C  CG2   . VAL C 3 693 ? -8.298  7.387   49.418  1.00 20.44 ?  759  VAL A CG2   1 
ATOM   5775 N  N     . TYR C 3 694 ? -8.025  4.394   48.128  1.00 20.06 ?  760  TYR A N     1 
ATOM   5776 C  CA    . TYR C 3 694 ? -7.808  4.042   46.716  1.00 21.37 ?  760  TYR A CA    1 
ATOM   5777 C  C     . TYR C 3 694 ? -6.421  3.408   46.535  1.00 21.05 ?  760  TYR A C     1 
ATOM   5778 O  O     . TYR C 3 694 ? -5.586  3.410   47.455  1.00 21.43 ?  760  TYR A O     1 
ATOM   5779 C  CB    . TYR C 3 694 ? -7.957  5.289   45.806  1.00 20.65 ?  760  TYR A CB    1 
ATOM   5780 C  CG    . TYR C 3 694 ? -7.824  4.977   44.305  1.00 22.05 ?  760  TYR A CG    1 
ATOM   5781 C  CD1   . TYR C 3 694 ? -8.702  4.108   43.683  1.00 21.69 ?  760  TYR A CD1   1 
ATOM   5782 C  CD2   . TYR C 3 694 ? -6.835  5.568   43.536  1.00 22.60 ?  760  TYR A CD2   1 
ATOM   5783 C  CE1   . TYR C 3 694 ? -8.586  3.796   42.331  1.00 22.64 ?  760  TYR A CE1   1 
ATOM   5784 C  CE2   . TYR C 3 694 ? -6.704  5.274   42.158  1.00 21.54 ?  760  TYR A CE2   1 
ATOM   5785 C  CZ    . TYR C 3 694 ? -7.580  4.394   41.575  1.00 21.71 ?  760  TYR A CZ    1 
ATOM   5786 O  OH    . TYR C 3 694 ? -7.462  4.092   40.237  1.00 21.88 ?  760  TYR A OH    1 
ATOM   5787 N  N     . GLY C 3 695 ? -6.180  2.857   45.351  1.00 20.99 ?  761  GLY A N     1 
ATOM   5788 C  CA    . GLY C 3 695 ? -4.850  2.355   44.997  1.00 21.08 ?  761  GLY A CA    1 
ATOM   5789 C  C     . GLY C 3 695 ? -4.942  1.662   43.648  1.00 21.14 ?  761  GLY A C     1 
ATOM   5790 O  O     . GLY C 3 695 ? -6.004  1.177   43.279  1.00 21.18 ?  761  GLY A O     1 
ATOM   5791 N  N     . ASP C 3 696 ? -3.837  1.618   42.910  1.00 20.99 ?  762  ASP A N     1 
ATOM   5792 C  CA    . ASP C 3 696 ? -3.843  1.028   41.572  1.00 21.33 ?  762  ASP A CA    1 
ATOM   5793 C  C     . ASP C 3 696 ? -2.545  0.268   41.378  1.00 21.54 ?  762  ASP A C     1 
ATOM   5794 O  O     . ASP C 3 696 ? -1.486  0.875   41.285  1.00 21.16 ?  762  ASP A O     1 
ATOM   5795 C  CB    . ASP C 3 696 ? -3.921  2.159   40.531  1.00 21.08 ?  762  ASP A CB    1 
ATOM   5796 C  CG    . ASP C 3 696 ? -4.079  1.642   39.096  1.00 23.37 ?  762  ASP A CG    1 
ATOM   5797 O  OD1   . ASP C 3 696 ? -3.572  0.540   38.801  1.00 20.66 ?  762  ASP A OD1   1 
ATOM   5798 O  OD2   . ASP C 3 696 ? -4.693  2.370   38.272  1.00 23.35 ?  762  ASP A OD2   1 
ATOM   5799 N  N     . THR C 3 697 ? -2.645  -1.054  41.336  1.00 21.85 ?  763  THR A N     1 
ATOM   5800 C  CA    . THR C 3 697 ? -1.535  -1.945  40.975  1.00 22.13 ?  763  THR A CA    1 
ATOM   5801 C  C     . THR C 3 697 ? -0.467  -2.092  42.059  1.00 22.05 ?  763  THR A C     1 
ATOM   5802 O  O     . THR C 3 697 ? -0.239  -3.197  42.555  1.00 21.73 ?  763  THR A O     1 
ATOM   5803 C  CB    . THR C 3 697 ? -0.866  -1.546  39.624  1.00 22.33 ?  763  THR A CB    1 
ATOM   5804 O  OG1   . THR C 3 697 ? -1.864  -1.479  38.589  1.00 23.00 ?  763  THR A OG1   1 
ATOM   5805 C  CG2   . THR C 3 697 ? 0.210   -2.583  39.236  1.00 21.66 ?  763  THR A CG2   1 
ATOM   5806 N  N     . ASP C 3 698 ? 0.183   -0.985  42.412  1.00 21.82 ?  764  ASP A N     1 
ATOM   5807 C  CA    . ASP C 3 698 ? 1.300   -1.018  43.338  1.00 22.53 ?  764  ASP A CA    1 
ATOM   5808 C  C     . ASP C 3 698 ? 1.326   0.221   44.233  1.00 22.54 ?  764  ASP A C     1 
ATOM   5809 O  O     . ASP C 3 698 ? 2.367   0.557   44.782  1.00 22.22 ?  764  ASP A O     1 
ATOM   5810 C  CB    . ASP C 3 698 ? 2.623   -1.074  42.575  1.00 22.74 ?  764  ASP A CB    1 
ATOM   5811 C  CG    . ASP C 3 698 ? 2.953   0.245   41.878  1.00 24.34 ?  764  ASP A CG    1 
ATOM   5812 O  OD1   . ASP C 3 698 ? 4.155   0.521   41.708  1.00 25.14 ?  764  ASP A OD1   1 
ATOM   5813 O  OD2   . ASP C 3 698 ? 2.023   1.011   41.513  1.00 24.54 ?  764  ASP A OD2   1 
ATOM   5814 N  N     . SER C 3 699 ? 0.181   0.892   44.365  1.00 22.26 ?  765  SER A N     1 
ATOM   5815 C  CA    . SER C 3 699 ? 0.112   2.101   45.154  1.00 22.51 ?  765  SER A CA    1 
ATOM   5816 C  C     . SER C 3 699 ? -1.068  2.024   46.112  1.00 22.03 ?  765  SER A C     1 
ATOM   5817 O  O     . SER C 3 699 ? -2.047  1.296   45.858  1.00 21.46 ?  765  SER A O     1 
ATOM   5818 C  CB    . SER C 3 699 ? -0.034  3.313   44.226  1.00 23.47 ?  765  SER A CB    1 
ATOM   5819 O  OG    . SER C 3 699 ? -1.239  3.220   43.470  1.00 24.03 ?  765  SER A OG    1 
ATOM   5820 N  N     . VAL C 3 700 ? -0.982  2.762   47.218  1.00 21.45 ?  766  VAL A N     1 
ATOM   5821 C  CA    . VAL C 3 700 ? -2.156  2.954   48.063  1.00 21.26 ?  766  VAL A CA    1 
ATOM   5822 C  C     . VAL C 3 700 ? -2.267  4.423   48.388  1.00 21.05 ?  766  VAL A C     1 
ATOM   5823 O  O     . VAL C 3 700 ? -1.262  5.090   48.629  1.00 20.77 ?  766  VAL A O     1 
ATOM   5824 C  CB    . VAL C 3 700 ? -2.092  2.131   49.392  1.00 21.57 ?  766  VAL A CB    1 
ATOM   5825 C  CG1   . VAL C 3 700 ? -2.422  0.642   49.130  1.00 22.73 ?  766  VAL A CG1   1 
ATOM   5826 C  CG2   . VAL C 3 700 ? -0.726  2.288   50.030  1.00 21.96 ?  766  VAL A CG2   1 
ATOM   5827 N  N     . MET C 3 701 ? -3.487  4.936   48.362  1.00 20.71 ?  767  MET A N     1 
ATOM   5828 C  CA    . MET C 3 701 ? -3.743  6.286   48.831  1.00 21.54 ?  767  MET A CA    1 
ATOM   5829 C  C     . MET C 3 701 ? -4.319  6.159   50.238  1.00 21.08 ?  767  MET A C     1 
ATOM   5830 O  O     . MET C 3 701 ? -5.398  5.590   50.412  1.00 20.91 ?  767  MET A O     1 
ATOM   5831 C  CB    . MET C 3 701 ? -4.754  6.997   47.925  1.00 21.02 ?  767  MET A CB    1 
ATOM   5832 C  CG    . MET C 3 701 ? -4.172  7.505   46.614  1.00 24.49 ?  767  MET A CG    1 
ATOM   5833 S  SD    . MET C 3 701 ? -3.675  6.136   45.563  1.00 25.74 ?  767  MET A SD    1 
ATOM   5834 C  CE    . MET C 3 701 ? -3.265  7.051   44.054  1.00 27.20 ?  767  MET A CE    1 
ATOM   5835 N  N     . VAL C 3 702 ? -3.613  6.710   51.227  1.00 21.28 ?  768  VAL A N     1 
ATOM   5836 C  CA    . VAL C 3 702 ? -3.951  6.494   52.634  1.00 20.38 ?  768  VAL A CA    1 
ATOM   5837 C  C     . VAL C 3 702 ? -4.434  7.789   53.294  1.00 21.24 ?  768  VAL A C     1 
ATOM   5838 O  O     . VAL C 3 702 ? -3.761  8.840   53.231  1.00 20.20 ?  768  VAL A O     1 
ATOM   5839 C  CB    . VAL C 3 702 ? -2.742  5.955   53.467  1.00 20.83 ?  768  VAL A CB    1 
ATOM   5840 C  CG1   . VAL C 3 702 ? -3.187  5.667   54.917  1.00 20.29 ?  768  VAL A CG1   1 
ATOM   5841 C  CG2   . VAL C 3 702 ? -2.131  4.682   52.823  1.00 20.19 ?  768  VAL A CG2   1 
ATOM   5842 N  N     . LYS C 3 703 ? -5.604  7.706   53.919  1.00 20.50 ?  769  LYS A N     1 
ATOM   5843 C  CA    . LYS C 3 703 ? -6.105  8.798   54.734  1.00 21.14 ?  769  LYS A CA    1 
ATOM   5844 C  C     . LYS C 3 703 ? -5.764  8.430   56.156  1.00 20.87 ?  769  LYS A C     1 
ATOM   5845 O  O     . LYS C 3 703 ? -6.456  7.601   56.777  1.00 20.55 ?  769  LYS A O     1 
ATOM   5846 C  CB    . LYS C 3 703 ? -7.623  8.932   54.627  1.00 20.64 ?  769  LYS A CB    1 
ATOM   5847 C  CG    . LYS C 3 703 ? -8.147  10.142  55.398  1.00 21.82 ?  769  LYS A CG    1 
ATOM   5848 C  CD    . LYS C 3 703 ? -9.641  10.292  55.224  1.00 25.35 ?  769  LYS A CD    1 
ATOM   5849 C  CE    . LYS C 3 703 ? -10.345 8.981   55.472  1.00 28.38 ?  769  LYS A CE    1 
ATOM   5850 N  NZ    . LYS C 3 703 ? -11.525 9.149   56.355  1.00 32.13 ?  769  LYS A NZ    1 
ATOM   5851 N  N     . PHE C 3 704 ? -4.694  9.015   56.673  1.00 21.07 ?  770  PHE A N     1 
ATOM   5852 C  CA    . PHE C 3 704 ? -4.272  8.673   58.027  1.00 21.02 ?  770  PHE A CA    1 
ATOM   5853 C  C     . PHE C 3 704 ? -5.264  9.277   59.003  1.00 21.44 ?  770  PHE A C     1 
ATOM   5854 O  O     . PHE C 3 704 ? -5.475  8.759   60.095  1.00 21.78 ?  770  PHE A O     1 
ATOM   5855 C  CB    . PHE C 3 704 ? -2.844  9.174   58.305  1.00 20.89 ?  770  PHE A CB    1 
ATOM   5856 C  CG    . PHE C 3 704 ? -1.782  8.300   57.705  1.00 20.11 ?  770  PHE A CG    1 
ATOM   5857 C  CD1   . PHE C 3 704 ? -1.435  7.106   58.317  1.00 18.58 ?  770  PHE A CD1   1 
ATOM   5858 C  CD2   . PHE C 3 704 ? -1.150  8.660   56.510  1.00 18.75 ?  770  PHE A CD2   1 
ATOM   5859 C  CE1   . PHE C 3 704 ? -0.465  6.280   57.766  1.00 19.18 ?  770  PHE A CE1   1 
ATOM   5860 C  CE2   . PHE C 3 704 ? -0.188  7.841   55.954  1.00 18.15 ?  770  PHE A CE2   1 
ATOM   5861 C  CZ    . PHE C 3 704 ? 0.156   6.649   56.583  1.00 18.58 ?  770  PHE A CZ    1 
ATOM   5862 N  N     . GLY C 3 705 ? -5.894  10.372  58.593  1.00 21.95 ?  771  GLY A N     1 
ATOM   5863 C  CA    . GLY C 3 705 ? -6.912  11.005  59.429  1.00 21.62 ?  771  GLY A CA    1 
ATOM   5864 C  C     . GLY C 3 705 ? -6.550  12.391  59.919  1.00 21.65 ?  771  GLY A C     1 
ATOM   5865 O  O     . GLY C 3 705 ? -7.424  13.186  60.214  1.00 21.29 ?  771  GLY A O     1 
ATOM   5866 N  N     . THR C 3 706 ? -5.258  12.685  60.020  1.00 22.59 ?  772  THR A N     1 
ATOM   5867 C  CA    . THR C 3 706 ? -4.808  14.019  60.398  1.00 22.86 ?  772  THR A CA    1 
ATOM   5868 C  C     . THR C 3 706 ? -5.146  15.075  59.349  1.00 23.53 ?  772  THR A C     1 
ATOM   5869 O  O     . THR C 3 706 ? -5.199  14.799  58.140  1.00 23.63 ?  772  THR A O     1 
ATOM   5870 C  CB    . THR C 3 706 ? -3.288  14.071  60.612  1.00 23.44 ?  772  THR A CB    1 
ATOM   5871 O  OG1   . THR C 3 706 ? -2.907  15.413  60.955  1.00 23.08 ?  772  THR A OG1   1 
ATOM   5872 C  CG2   . THR C 3 706 ? -2.562  13.661  59.340  1.00 21.78 ?  772  THR A CG2   1 
ATOM   5873 N  N     . THR C 3 707 ? -5.347  16.299  59.820  1.00 23.63 ?  773  THR A N     1 
ATOM   5874 C  CA    . THR C 3 707 ? -5.639  17.423  58.945  1.00 24.12 ?  773  THR A CA    1 
ATOM   5875 C  C     . THR C 3 707 ? -4.344  18.131  58.590  1.00 23.78 ?  773  THR A C     1 
ATOM   5876 O  O     . THR C 3 707 ? -4.341  19.041  57.788  1.00 24.97 ?  773  THR A O     1 
ATOM   5877 C  CB    . THR C 3 707 ? -6.565  18.455  59.637  1.00 24.52 ?  773  THR A CB    1 
ATOM   5878 O  OG1   . THR C 3 707 ? -5.972  18.845  60.876  1.00 24.32 ?  773  THR A OG1   1 
ATOM   5879 C  CG2   . THR C 3 707 ? -7.939  17.864  59.915  1.00 24.86 ?  773  THR A CG2   1 
ATOM   5880 N  N     . ASP C 3 708 ? -3.244  17.718  59.203  1.00 23.42 ?  774  ASP A N     1 
ATOM   5881 C  CA    . ASP C 3 708 ? -1.964  18.373  58.985  1.00 23.43 ?  774  ASP A CA    1 
ATOM   5882 C  C     . ASP C 3 708 ? -1.168  17.690  57.879  1.00 23.12 ?  774  ASP A C     1 
ATOM   5883 O  O     . ASP C 3 708 ? -0.984  16.464  57.887  1.00 22.46 ?  774  ASP A O     1 
ATOM   5884 C  CB    . ASP C 3 708 ? -1.133  18.401  60.276  1.00 24.09 ?  774  ASP A CB    1 
ATOM   5885 C  CG    . ASP C 3 708 ? 0.171   19.140  60.096  1.00 25.72 ?  774  ASP A CG    1 
ATOM   5886 O  OD1   . ASP C 3 708 ? 0.124   20.375  59.885  1.00 29.06 ?  774  ASP A OD1   1 
ATOM   5887 O  OD2   . ASP C 3 708 ? 1.238   18.499  60.149  1.00 25.18 ?  774  ASP A OD2   1 
ATOM   5888 N  N     . LEU C 3 709 ? -0.713  18.488  56.916  1.00 22.64 ?  775  LEU A N     1 
ATOM   5889 C  CA    . LEU C 3 709 ? 0.005   17.958  55.751  1.00 22.33 ?  775  LEU A CA    1 
ATOM   5890 C  C     . LEU C 3 709 ? 1.331   17.290  56.113  1.00 22.34 ?  775  LEU A C     1 
ATOM   5891 O  O     . LEU C 3 709 ? 1.599   16.162  55.694  1.00 21.49 ?  775  LEU A O     1 
ATOM   5892 C  CB    . LEU C 3 709 ? 0.255   19.059  54.727  1.00 22.32 ?  775  LEU A CB    1 
ATOM   5893 C  CG    . LEU C 3 709 ? 0.984   18.620  53.458  1.00 22.16 ?  775  LEU A CG    1 
ATOM   5894 C  CD1   . LEU C 3 709 ? 0.270   17.403  52.776  1.00 19.71 ?  775  LEU A CD1   1 
ATOM   5895 C  CD2   . LEU C 3 709 ? 1.091   19.801  52.503  1.00 22.66 ?  775  LEU A CD2   1 
ATOM   5896 N  N     . LYS C 3 710 ? 2.164   17.976  56.887  1.00 22.16 ?  776  LYS A N     1 
ATOM   5897 C  CA    . LYS C 3 710 ? 3.474   17.415  57.229  1.00 23.34 ?  776  LYS A CA    1 
ATOM   5898 C  C     . LYS C 3 710 ? 3.352   16.093  57.986  1.00 23.31 ?  776  LYS A C     1 
ATOM   5899 O  O     . LYS C 3 710 ? 4.123   15.163  57.775  1.00 23.18 ?  776  LYS A O     1 
ATOM   5900 C  CB    . LYS C 3 710 ? 4.296   18.374  58.075  1.00 23.86 ?  776  LYS A CB    1 
ATOM   5901 C  CG    . LYS C 3 710 ? 5.672   17.813  58.400  1.00 26.07 ?  776  LYS A CG    1 
ATOM   5902 C  CD    . LYS C 3 710 ? 6.474   18.798  59.235  1.00 29.88 ?  776  LYS A CD    1 
ATOM   5903 C  CE    . LYS C 3 710 ? 7.810   18.201  59.650  1.00 32.58 ?  776  LYS A CE    1 
ATOM   5904 N  NZ    . LYS C 3 710 ? 7.629   17.000  60.516  1.00 34.41 ?  776  LYS A NZ    1 
ATOM   5905 N  N     . GLU C 3 711 ? 2.383   16.029  58.885  1.00 23.49 ?  777  GLU A N     1 
ATOM   5906 C  CA    . GLU C 3 711 ? 2.196   14.834  59.677  1.00 23.46 ?  777  GLU A CA    1 
ATOM   5907 C  C     . GLU C 3 711 ? 1.782   13.681  58.788  1.00 22.59 ?  777  GLU A C     1 
ATOM   5908 O  O     . GLU C 3 711 ? 2.193   12.544  58.998  1.00 21.53 ?  777  GLU A O     1 
ATOM   5909 C  CB    . GLU C 3 711 ? 1.137   15.058  60.738  1.00 23.54 ?  777  GLU A CB    1 
ATOM   5910 C  CG    . GLU C 3 711 ? 0.798   13.793  61.472  1.00 26.45 ?  777  GLU A CG    1 
ATOM   5911 C  CD    . GLU C 3 711 ? 0.096   14.064  62.771  1.00 30.85 ?  777  GLU A CD    1 
ATOM   5912 O  OE1   . GLU C 3 711 ? 0.235   13.230  63.697  1.00 32.21 ?  777  GLU A OE1   1 
ATOM   5913 O  OE2   . GLU C 3 711 ? -0.575  15.122  62.863  1.00 32.39 ?  777  GLU A OE2   1 
ATOM   5914 N  N     . ALA C 3 712 ? 0.945   13.978  57.803  1.00 22.58 ?  778  ALA A N     1 
ATOM   5915 C  CA    . ALA C 3 712 ? 0.513   12.963  56.858  1.00 22.76 ?  778  ALA A CA    1 
ATOM   5916 C  C     . ALA C 3 712 ? 1.714   12.447  56.060  1.00 23.56 ?  778  ALA A C     1 
ATOM   5917 O  O     . ALA C 3 712 ? 1.825   11.247  55.769  1.00 23.96 ?  778  ALA A O     1 
ATOM   5918 C  CB    . ALA C 3 712 ? -0.540  13.542  55.924  1.00 22.60 ?  778  ALA A CB    1 
ATOM   5919 N  N     . MET C 3 713 ? 2.602   13.358  55.678  1.00 23.67 ?  779  MET A N     1 
ATOM   5920 C  CA    . MET C 3 713 ? 3.803   12.983  54.926  1.00 24.43 ?  779  MET A CA    1 
ATOM   5921 C  C     . MET C 3 713 ? 4.761   12.170  55.780  1.00 24.28 ?  779  MET A C     1 
ATOM   5922 O  O     . MET C 3 713 ? 5.363   11.216  55.294  1.00 24.94 ?  779  MET A O     1 
ATOM   5923 C  CB    . MET C 3 713 ? 4.499   14.230  54.370  1.00 24.92 ?  779  MET A CB    1 
ATOM   5924 C  CG    . MET C 3 713 ? 3.594   15.021  53.438  1.00 27.42 ?  779  MET A CG    1 
ATOM   5925 S  SD    . MET C 3 713 ? 4.327   16.568  52.836  1.00 31.00 ?  779  MET A SD    1 
ATOM   5926 C  CE    . MET C 3 713 ? 5.333   15.975  51.479  1.00 29.75 ?  779  MET A CE    1 
ATOM   5927 N  N     . ASP C 3 714 ? 4.873   12.535  57.060  1.00 23.24 ?  780  ASP A N     1 
ATOM   5928 C  CA    . ASP C 3 714 ? 5.705   11.800  58.005  1.00 22.88 ?  780  ASP A CA    1 
ATOM   5929 C  C     . ASP C 3 714 ? 5.165   10.397  58.260  1.00 22.22 ?  780  ASP A C     1 
ATOM   5930 O  O     . ASP C 3 714 ? 5.917   9.423   58.285  1.00 21.92 ?  780  ASP A O     1 
ATOM   5931 C  CB    . ASP C 3 714 ? 5.835   12.592  59.316  1.00 23.39 ?  780  ASP A CB    1 
ATOM   5932 C  CG    . ASP C 3 714 ? 6.779   13.770  59.174  1.00 24.41 ?  780  ASP A CG    1 
ATOM   5933 O  OD1   . ASP C 3 714 ? 7.563   13.757  58.210  1.00 27.92 ?  780  ASP A OD1   1 
ATOM   5934 O  OD2   . ASP C 3 714 ? 6.737   14.708  59.991  1.00 27.26 ?  780  ASP A OD2   1 
ATOM   5935 N  N     . LEU C 3 715 ? 3.858   10.291  58.451  1.00 21.45 ?  781  LEU A N     1 
ATOM   5936 C  CA    . LEU C 3 715 ? 3.249   8.981   58.621  1.00 21.16 ?  781  LEU A CA    1 
ATOM   5937 C  C     . LEU C 3 715 ? 3.425   8.157   57.334  1.00 20.44 ?  781  LEU A C     1 
ATOM   5938 O  O     . LEU C 3 715 ? 3.725   6.966   57.382  1.00 20.15 ?  781  LEU A O     1 
ATOM   5939 C  CB    . LEU C 3 715 ? 1.771   9.115   59.016  1.00 20.79 ?  781  LEU A CB    1 
ATOM   5940 C  CG    . LEU C 3 715 ? 1.517   9.573   60.466  1.00 21.28 ?  781  LEU A CG    1 
ATOM   5941 C  CD1   . LEU C 3 715 ? 0.091   10.124  60.656  1.00 18.51 ?  781  LEU A CD1   1 
ATOM   5942 C  CD2   . LEU C 3 715 ? 1.811   8.447   61.456  1.00 19.99 ?  781  LEU A CD2   1 
ATOM   5943 N  N     . GLY C 3 716 ? 3.242   8.800   56.190  1.00 20.62 ?  782  GLY A N     1 
ATOM   5944 C  CA    . GLY C 3 716 ? 3.360   8.098   54.901  1.00 20.77 ?  782  GLY A CA    1 
ATOM   5945 C  C     . GLY C 3 716 ? 4.743   7.480   54.755  1.00 21.12 ?  782  GLY A C     1 
ATOM   5946 O  O     . GLY C 3 716 ? 4.883   6.314   54.357  1.00 21.85 ?  782  GLY A O     1 
ATOM   5947 N  N     . THR C 3 717 ? 5.767   8.270   55.066  1.00 20.41 ?  783  THR A N     1 
ATOM   5948 C  CA    . THR C 3 717 ? 7.155   7.823   55.024  1.00 21.07 ?  783  THR A CA    1 
ATOM   5949 C  C     . THR C 3 717 ? 7.419   6.689   56.015  1.00 21.12 ?  783  THR A C     1 
ATOM   5950 O  O     . THR C 3 717 ? 8.023   5.686   55.674  1.00 20.46 ?  783  THR A O     1 
ATOM   5951 C  CB    . THR C 3 717 ? 8.099   8.999   55.337  1.00 21.59 ?  783  THR A CB    1 
ATOM   5952 O  OG1   . THR C 3 717 ? 7.943   9.994   54.324  1.00 20.26 ?  783  THR A OG1   1 
ATOM   5953 C  CG2   . THR C 3 717 ? 9.552   8.553   55.396  1.00 20.69 ?  783  THR A CG2   1 
ATOM   5954 N  N     . GLU C 3 718 ? 6.988   6.860   57.258  1.00 21.81 ?  784  GLU A N     1 
ATOM   5955 C  CA    . GLU C 3 718 ? 7.133   5.777   58.236  1.00 22.10 ?  784  GLU A CA    1 
ATOM   5956 C  C     . GLU C 3 718 ? 6.399   4.510   57.781  1.00 21.89 ?  784  GLU A C     1 
ATOM   5957 O  O     . GLU C 3 718 ? 6.927   3.409   57.885  1.00 21.62 ?  784  GLU A O     1 
ATOM   5958 C  CB    . GLU C 3 718 ? 6.616   6.230   59.593  1.00 22.55 ?  784  GLU A CB    1 
ATOM   5959 C  CG    . GLU C 3 718 ? 6.677   5.165   60.651  1.00 25.14 ?  784  GLU A CG    1 
ATOM   5960 C  CD    . GLU C 3 718 ? 5.967   5.597   61.903  1.00 27.19 ?  784  GLU A CD    1 
ATOM   5961 O  OE1   . GLU C 3 718 ? 6.605   6.284   62.724  1.00 30.21 ?  784  GLU A OE1   1 
ATOM   5962 O  OE2   . GLU C 3 718 ? 4.776   5.259   62.050  1.00 27.41 ?  784  GLU A OE2   1 
ATOM   5963 N  N     . ALA C 3 719 ? 5.185   4.659   57.262  1.00 21.84 ?  785  ALA A N     1 
ATOM   5964 C  CA    . ALA C 3 719 ? 4.429   3.484   56.842  1.00 22.79 ?  785  ALA A CA    1 
ATOM   5965 C  C     . ALA C 3 719 ? 5.123   2.722   55.696  1.00 22.75 ?  785  ALA A C     1 
ATOM   5966 O  O     . ALA C 3 719 ? 5.164   1.492   55.698  1.00 22.53 ?  785  ALA A O     1 
ATOM   5967 C  CB    . ALA C 3 719 ? 2.997   3.859   56.457  1.00 22.65 ?  785  ALA A CB    1 
ATOM   5968 N  N     . ALA C 3 720 ? 5.656   3.450   54.716  1.00 23.02 ?  786  ALA A N     1 
ATOM   5969 C  CA    . ALA C 3 720 ? 6.341   2.800   53.591  1.00 23.57 ?  786  ALA A CA    1 
ATOM   5970 C  C     . ALA C 3 720 ? 7.586   2.041   54.060  1.00 24.11 ?  786  ALA A C     1 
ATOM   5971 O  O     . ALA C 3 720 ? 7.926   0.984   53.517  1.00 23.86 ?  786  ALA A O     1 
ATOM   5972 C  CB    . ALA C 3 720 ? 6.709   3.820   52.514  1.00 23.31 ?  786  ALA A CB    1 
ATOM   5973 N  N     . LYS C 3 721 ? 8.260   2.593   55.067  1.00 24.41 ?  787  LYS A N     1 
ATOM   5974 C  CA    . LYS C 3 721 ? 9.475   1.995   55.607  1.00 25.11 ?  787  LYS A CA    1 
ATOM   5975 C  C     . LYS C 3 721 ? 9.118   0.706   56.333  1.00 25.26 ?  787  LYS A C     1 
ATOM   5976 O  O     . LYS C 3 721 ? 9.793   -0.314  56.188  1.00 25.02 ?  787  LYS A O     1 
ATOM   5977 C  CB    . LYS C 3 721 ? 10.190  2.976   56.555  1.00 25.69 ?  787  LYS A CB    1 
ATOM   5978 C  CG    . LYS C 3 721 ? 11.444  2.417   57.248  1.00 26.78 ?  787  LYS A CG    1 
ATOM   5979 C  CD    . LYS C 3 721 ? 12.211  3.527   58.011  1.00 31.13 ?  787  LYS A CD    1 
ATOM   5980 C  CE    . LYS C 3 721 ? 13.376  2.972   58.828  1.00 31.76 ?  787  LYS A CE    1 
ATOM   5981 N  NZ    . LYS C 3 721 ? 14.059  4.029   59.664  1.00 33.83 ?  787  LYS A NZ    1 
ATOM   5982 N  N     . TYR C 3 722 ? 8.045   0.760   57.119  1.00 25.23 ?  788  TYR A N     1 
ATOM   5983 C  CA    . TYR C 3 722 ? 7.571   -0.422  57.825  1.00 24.67 ?  788  TYR A CA    1 
ATOM   5984 C  C     . TYR C 3 722 ? 7.105   -1.481  56.824  1.00 24.12 ?  788  TYR A C     1 
ATOM   5985 O  O     . TYR C 3 722 ? 7.513   -2.648  56.895  1.00 23.37 ?  788  TYR A O     1 
ATOM   5986 C  CB    . TYR C 3 722 ? 6.441   -0.057  58.792  1.00 24.73 ?  788  TYR A CB    1 
ATOM   5987 C  CG    . TYR C 3 722 ? 5.575   -1.243  59.157  1.00 25.29 ?  788  TYR A CG    1 
ATOM   5988 C  CD1   . TYR C 3 722 ? 6.070   -2.275  59.942  1.00 25.28 ?  788  TYR A CD1   1 
ATOM   5989 C  CD2   . TYR C 3 722 ? 4.273   -1.328  58.707  1.00 25.61 ?  788  TYR A CD2   1 
ATOM   5990 C  CE1   . TYR C 3 722 ? 5.288   -3.363  60.256  1.00 27.87 ?  788  TYR A CE1   1 
ATOM   5991 C  CE2   . TYR C 3 722 ? 3.480   -2.406  59.019  1.00 27.00 ?  788  TYR A CE2   1 
ATOM   5992 C  CZ    . TYR C 3 722 ? 3.992   -3.422  59.788  1.00 28.00 ?  788  TYR A CZ    1 
ATOM   5993 O  OH    . TYR C 3 722 ? 3.196   -4.502  60.095  1.00 31.39 ?  788  TYR A OH    1 
ATOM   5994 N  N     . VAL C 3 723 ? 6.249   -1.082  55.885  1.00 23.82 ?  789  VAL A N     1 
ATOM   5995 C  CA    . VAL C 3 723 ? 5.720   -2.053  54.941  1.00 23.27 ?  789  VAL A CA    1 
ATOM   5996 C  C     . VAL C 3 723 ? 6.839   -2.734  54.147  1.00 23.36 ?  789  VAL A C     1 
ATOM   5997 O  O     . VAL C 3 723 ? 6.749   -3.922  53.845  1.00 23.08 ?  789  VAL A O     1 
ATOM   5998 C  CB    . VAL C 3 723 ? 4.653   -1.447  53.999  1.00 23.73 ?  789  VAL A CB    1 
ATOM   5999 C  CG1   . VAL C 3 723 ? 4.301   -2.437  52.901  1.00 22.34 ?  789  VAL A CG1   1 
ATOM   6000 C  CG2   . VAL C 3 723 ? 3.400   -1.066  54.798  1.00 23.08 ?  789  VAL A CG2   1 
ATOM   6001 N  N     . SER C 3 724 ? 7.895   -1.983  53.821  1.00 23.39 ?  790  SER A N     1 
ATOM   6002 C  CA    . SER C 3 724 ? 9.016   -2.528  53.060  1.00 23.66 ?  790  SER A CA    1 
ATOM   6003 C  C     . SER C 3 724 ? 9.732   -3.673  53.798  1.00 23.62 ?  790  SER A C     1 
ATOM   6004 O  O     . SER C 3 724 ? 10.277  -4.568  53.154  1.00 24.03 ?  790  SER A O     1 
ATOM   6005 C  CB    . SER C 3 724 ? 10.030  -1.444  52.667  1.00 23.01 ?  790  SER A CB    1 
ATOM   6006 O  OG    . SER C 3 724 ? 9.422   -0.447  51.859  1.00 23.58 ?  790  SER A OG    1 
ATOM   6007 N  N     . THR C 3 725 ? 9.720   -3.653  55.127  1.00 22.99 ?  791  THR A N     1 
ATOM   6008 C  CA    . THR C 3 725 ? 10.321  -4.740  55.912  1.00 22.63 ?  791  THR A CA    1 
ATOM   6009 C  C     . THR C 3 725 ? 9.543   -6.041  55.781  1.00 22.72 ?  791  THR A C     1 
ATOM   6010 O  O     . THR C 3 725 ? 10.032  -7.104  56.150  1.00 22.35 ?  791  THR A O     1 
ATOM   6011 C  CB    . THR C 3 725 ? 10.390  -4.398  57.406  1.00 23.02 ?  791  THR A CB    1 
ATOM   6012 O  OG1   . THR C 3 725 ? 9.061   -4.367  57.947  1.00 21.51 ?  791  THR A OG1   1 
ATOM   6013 C  CG2   . THR C 3 725 ? 11.091  -3.058  57.628  1.00 22.94 ?  791  THR A CG2   1 
ATOM   6014 N  N     . LEU C 3 726 ? 8.322   -5.965  55.268  1.00 22.85 ?  792  LEU A N     1 
ATOM   6015 C  CA    . LEU C 3 726 ? 7.505   -7.177  55.113  1.00 23.80 ?  792  LEU A CA    1 
ATOM   6016 C  C     . LEU C 3 726 ? 7.769   -7.936  53.816  1.00 24.42 ?  792  LEU A C     1 
ATOM   6017 O  O     . LEU C 3 726 ? 7.207   -9.013  53.604  1.00 24.88 ?  792  LEU A O     1 
ATOM   6018 C  CB    . LEU C 3 726 ? 6.020   -6.830  55.155  1.00 24.12 ?  792  LEU A CB    1 
ATOM   6019 C  CG    . LEU C 3 726 ? 5.281   -6.703  56.490  1.00 24.91 ?  792  LEU A CG    1 
ATOM   6020 C  CD1   . LEU C 3 726 ? 6.186   -6.633  57.729  1.00 25.00 ?  792  LEU A CD1   1 
ATOM   6021 C  CD2   . LEU C 3 726 ? 4.314   -5.543  56.410  1.00 25.54 ?  792  LEU A CD2   1 
ATOM   6022 N  N     . PHE C 3 727 ? 8.583   -7.373  52.926  1.00 24.12 ?  793  PHE A N     1 
ATOM   6023 C  CA    . PHE C 3 727 ? 8.871   -8.052  51.662  1.00 24.12 ?  793  PHE A CA    1 
ATOM   6024 C  C     . PHE C 3 727 ? 10.359  -8.359  51.457  1.00 24.39 ?  793  PHE A C     1 
ATOM   6025 O  O     . PHE C 3 727 ? 11.225  -7.740  52.074  1.00 24.36 ?  793  PHE A O     1 
ATOM   6026 C  CB    . PHE C 3 727 ? 8.336   -7.218  50.483  1.00 24.00 ?  793  PHE A CB    1 
ATOM   6027 C  CG    . PHE C 3 727 ? 6.852   -6.987  50.543  1.00 22.72 ?  793  PHE A CG    1 
ATOM   6028 C  CD1   . PHE C 3 727 ? 6.339   -5.773  50.998  1.00 23.72 ?  793  PHE A CD1   1 
ATOM   6029 C  CD2   . PHE C 3 727 ? 5.971   -7.997  50.179  1.00 21.42 ?  793  PHE A CD2   1 
ATOM   6030 C  CE1   . PHE C 3 727 ? 4.962   -5.570  51.059  1.00 23.74 ?  793  PHE A CE1   1 
ATOM   6031 C  CE2   . PHE C 3 727 ? 4.604   -7.812  50.236  1.00 22.72 ?  793  PHE A CE2   1 
ATOM   6032 C  CZ    . PHE C 3 727 ? 4.091   -6.593  50.676  1.00 24.24 ?  793  PHE A CZ    1 
ATOM   6033 N  N     . LYS C 3 728 ? 10.633  -9.301  50.560  1.00 24.13 ?  794  LYS A N     1 
ATOM   6034 C  CA    . LYS C 3 728 ? 11.989  -9.733  50.241  1.00 24.62 ?  794  LYS A CA    1 
ATOM   6035 C  C     . LYS C 3 728 ? 12.722  -8.697  49.380  1.00 24.14 ?  794  LYS A C     1 
ATOM   6036 O  O     . LYS C 3 728 ? 12.137  -8.095  48.472  1.00 23.44 ?  794  LYS A O     1 
ATOM   6037 C  CB    . LYS C 3 728 ? 11.907  -11.083 49.509  1.00 24.83 ?  794  LYS A CB    1 
ATOM   6038 C  CG    . LYS C 3 728 ? 13.212  -11.795 49.218  1.00 27.35 ?  794  LYS A CG    1 
ATOM   6039 C  CD    . LYS C 3 728 ? 12.910  -13.195 48.656  1.00 31.40 ?  794  LYS A CD    1 
ATOM   6040 C  CE    . LYS C 3 728 ? 14.180  -13.983 48.353  1.00 32.12 ?  794  LYS A CE    1 
ATOM   6041 N  NZ    . LYS C 3 728 ? 15.036  -13.228 47.392  1.00 36.07 ?  794  LYS A NZ    1 
ATOM   6042 N  N     . HIS C 3 729 ? 13.998  -8.475  49.681  1.00 23.59 ?  795  HIS A N     1 
ATOM   6043 C  CA    A HIS C 3 729 ? 14.847  -7.589  48.893  0.50 23.71 ?  795  HIS A CA    1 
ATOM   6044 C  CA    B HIS C 3 729 ? 14.805  -7.564  48.879  0.50 23.63 ?  795  HIS A CA    1 
ATOM   6045 C  C     . HIS C 3 729 ? 14.776  -8.033  47.429  1.00 23.47 ?  795  HIS A C     1 
ATOM   6046 O  O     . HIS C 3 729 ? 14.763  -9.232  47.162  1.00 23.27 ?  795  HIS A O     1 
ATOM   6047 C  CB    A HIS C 3 729 ? 16.278  -7.721  49.419  0.50 23.94 ?  795  HIS A CB    1 
ATOM   6048 C  CB    B HIS C 3 729 ? 16.248  -7.521  49.383  0.50 23.85 ?  795  HIS A CB    1 
ATOM   6049 C  CG    A HIS C 3 729 ? 17.292  -6.933  48.653  0.50 25.22 ?  795  HIS A CG    1 
ATOM   6050 C  CG    B HIS C 3 729 ? 16.401  -6.879  50.726  0.50 24.75 ?  795  HIS A CG    1 
ATOM   6051 N  ND1   A HIS C 3 729 ? 17.555  -5.605  48.915  0.50 26.26 ?  795  HIS A ND1   1 
ATOM   6052 N  ND1   B HIS C 3 729 ? 15.497  -5.961  51.221  0.50 24.59 ?  795  HIS A ND1   1 
ATOM   6053 C  CD2   A HIS C 3 729 ? 18.131  -7.293  47.653  0.50 25.44 ?  795  HIS A CD2   1 
ATOM   6054 C  CD2   B HIS C 3 729 ? 17.364  -7.007  51.670  0.50 25.17 ?  795  HIS A CD2   1 
ATOM   6055 C  CE1   A HIS C 3 729 ? 18.500  -5.177  48.098  0.50 26.50 ?  795  HIS A CE1   1 
ATOM   6056 C  CE1   B HIS C 3 729 ? 15.892  -5.562  52.417  0.50 25.98 ?  795  HIS A CE1   1 
ATOM   6057 N  NE2   A HIS C 3 729 ? 18.869  -6.182  47.325  0.50 25.88 ?  795  HIS A NE2   1 
ATOM   6058 N  NE2   B HIS C 3 729 ? 17.024  -6.179  52.711  0.50 25.34 ?  795  HIS A NE2   1 
ATOM   6059 N  N     . PRO C 3 730 ? 14.770  -7.078  46.472  1.00 22.90 ?  796  PRO A N     1 
ATOM   6060 C  CA    . PRO C 3 730 ? 14.883  -5.623  46.606  1.00 22.67 ?  796  PRO A CA    1 
ATOM   6061 C  C     . PRO C 3 730 ? 13.550  -4.892  46.523  1.00 22.54 ?  796  PRO A C     1 
ATOM   6062 O  O     . PRO C 3 730 ? 13.492  -3.743  46.079  1.00 22.33 ?  796  PRO A O     1 
ATOM   6063 C  CB    . PRO C 3 730 ? 15.735  -5.246  45.390  1.00 22.16 ?  796  PRO A CB    1 
ATOM   6064 C  CG    . PRO C 3 730 ? 15.221  -6.198  44.322  1.00 23.19 ?  796  PRO A CG    1 
ATOM   6065 C  CD    . PRO C 3 730 ? 14.890  -7.501  45.063  1.00 22.59 ?  796  PRO A CD    1 
ATOM   6066 N  N     . ILE C 3 731 ? 12.471  -5.549  46.922  1.00 22.79 ?  797  ILE A N     1 
ATOM   6067 C  CA    . ILE C 3 731 ? 11.181  -4.870  46.954  1.00 22.79 ?  797  ILE A CA    1 
ATOM   6068 C  C     . ILE C 3 731 ? 11.257  -3.688  47.937  1.00 23.03 ?  797  ILE A C     1 
ATOM   6069 O  O     . ILE C 3 731 ? 11.863  -3.797  48.993  1.00 23.25 ?  797  ILE A O     1 
ATOM   6070 C  CB    . ILE C 3 731 ? 10.072  -5.856  47.357  1.00 23.08 ?  797  ILE A CB    1 
ATOM   6071 C  CG1   . ILE C 3 731 ? 9.858   -6.876  46.221  1.00 22.08 ?  797  ILE A CG1   1 
ATOM   6072 C  CG2   . ILE C 3 731 ? 8.778   -5.102  47.724  1.00 22.89 ?  797  ILE A CG2   1 
ATOM   6073 C  CD1   . ILE C 3 731 ? 9.102   -8.133  46.641  1.00 21.76 ?  797  ILE A CD1   1 
ATOM   6074 N  N     . ASN C 3 732 ? 10.670  -2.555  47.566  1.00 23.64 ?  798  ASN A N     1 
ATOM   6075 C  CA    . ASN C 3 732 ? 10.746  -1.340  48.364  1.00 23.89 ?  798  ASN A CA    1 
ATOM   6076 C  C     . ASN C 3 732 ? 9.533   -0.474  48.141  1.00 23.81 ?  798  ASN A C     1 
ATOM   6077 O  O     . ASN C 3 732 ? 9.253   -0.092  47.013  1.00 23.51 ?  798  ASN A O     1 
ATOM   6078 C  CB    . ASN C 3 732 ? 11.992  -0.517  48.002  1.00 24.08 ?  798  ASN A CB    1 
ATOM   6079 C  CG    . ASN C 3 732 ? 12.299  0.579   49.037  1.00 26.12 ?  798  ASN A CG    1 
ATOM   6080 O  OD1   . ASN C 3 732 ? 12.359  1.771   48.708  1.00 27.73 ?  798  ASN A OD1   1 
ATOM   6081 N  ND2   . ASN C 3 732 ? 12.514  0.172   50.280  1.00 25.88 ?  798  ASN A ND2   1 
ATOM   6082 N  N     . LEU C 3 733 ? 8.829   -0.148  49.224  1.00 24.09 ?  799  LEU A N     1 
ATOM   6083 C  CA    . LEU C 3 733 ? 7.716   0.782   49.166  1.00 24.92 ?  799  LEU A CA    1 
ATOM   6084 C  C     . LEU C 3 733 ? 8.182   2.170   49.595  1.00 25.42 ?  799  LEU A C     1 
ATOM   6085 O  O     . LEU C 3 733 ? 8.823   2.314   50.623  1.00 25.74 ?  799  LEU A O     1 
ATOM   6086 C  CB    . LEU C 3 733 ? 6.583   0.307   50.090  1.00 24.84 ?  799  LEU A CB    1 
ATOM   6087 C  CG    . LEU C 3 733 ? 5.232   1.041   50.005  1.00 25.69 ?  799  LEU A CG    1 
ATOM   6088 C  CD1   . LEU C 3 733 ? 4.565   0.878   48.625  1.00 26.08 ?  799  LEU A CD1   1 
ATOM   6089 C  CD2   . LEU C 3 733 ? 4.259   0.603   51.120  1.00 25.47 ?  799  LEU A CD2   1 
ATOM   6090 N  N     . GLU C 3 734 ? 7.843   3.197   48.825  1.00 25.96 ?  800  GLU A N     1 
ATOM   6091 C  CA    . GLU C 3 734 ? 8.161   4.540   49.247  1.00 26.83 ?  800  GLU A CA    1 
ATOM   6092 C  C     . GLU C 3 734 ? 6.956   5.494   49.262  1.00 26.22 ?  800  GLU A C     1 
ATOM   6093 O  O     . GLU C 3 734 ? 5.987   5.332   48.493  1.00 26.32 ?  800  GLU A O     1 
ATOM   6094 C  CB    . GLU C 3 734 ? 9.301   5.115   48.397  1.00 27.71 ?  800  GLU A CB    1 
ATOM   6095 C  CG    . GLU C 3 734 ? 8.904   5.396   46.989  1.00 32.81 ?  800  GLU A CG    1 
ATOM   6096 C  CD    . GLU C 3 734 ? 10.029  6.062   46.191  1.00 38.59 ?  800  GLU A CD    1 
ATOM   6097 O  OE1   . GLU C 3 734 ? 9.725   6.594   45.100  1.00 41.07 ?  800  GLU A OE1   1 
ATOM   6098 O  OE2   . GLU C 3 734 ? 11.194  6.064   46.667  1.00 40.23 ?  800  GLU A OE2   1 
ATOM   6099 N  N     . PHE C 3 735 ? 7.023   6.475   50.160  1.00 25.15 ?  801  PHE A N     1 
ATOM   6100 C  CA    . PHE C 3 735 ? 6.095   7.595   50.152  1.00 24.89 ?  801  PHE A CA    1 
ATOM   6101 C  C     . PHE C 3 735 ? 6.446   8.440   48.940  1.00 24.95 ?  801  PHE A C     1 
ATOM   6102 O  O     . PHE C 3 735 ? 7.590   8.855   48.780  1.00 24.05 ?  801  PHE A O     1 
ATOM   6103 C  CB    . PHE C 3 735 ? 6.179   8.421   51.459  1.00 25.30 ?  801  PHE A CB    1 
ATOM   6104 C  CG    . PHE C 3 735 ? 5.496   9.762   51.367  1.00 24.84 ?  801  PHE A CG    1 
ATOM   6105 C  CD1   . PHE C 3 735 ? 4.115   9.846   51.317  1.00 23.12 ?  801  PHE A CD1   1 
ATOM   6106 C  CD2   . PHE C 3 735 ? 6.240   10.928  51.283  1.00 24.75 ?  801  PHE A CD2   1 
ATOM   6107 C  CE1   . PHE C 3 735 ? 3.476   11.071  51.191  1.00 24.11 ?  801  PHE A CE1   1 
ATOM   6108 C  CE2   . PHE C 3 735 ? 5.612   12.156  51.157  1.00 25.29 ?  801  PHE A CE2   1 
ATOM   6109 C  CZ    . PHE C 3 735 ? 4.221   12.228  51.107  1.00 23.83 ?  801  PHE A CZ    1 
ATOM   6110 N  N     . GLU C 3 736 ? 5.463   8.680   48.076  1.00 24.70 ?  802  GLU A N     1 
ATOM   6111 C  CA    . GLU C 3 736 ? 5.699   9.360   46.808  1.00 25.65 ?  802  GLU A CA    1 
ATOM   6112 C  C     . GLU C 3 736 ? 5.299   10.832  46.881  1.00 25.34 ?  802  GLU A C     1 
ATOM   6113 O  O     . GLU C 3 736 ? 6.078   11.722  46.532  1.00 26.04 ?  802  GLU A O     1 
ATOM   6114 C  CB    . GLU C 3 736 ? 4.899   8.639   45.702  1.00 25.95 ?  802  GLU A CB    1 
ATOM   6115 C  CG    . GLU C 3 736 ? 5.227   8.990   44.292  1.00 30.25 ?  802  GLU A CG    1 
ATOM   6116 C  CD    . GLU C 3 736 ? 4.547   8.022   43.316  1.00 35.78 ?  802  GLU A CD    1 
ATOM   6117 O  OE1   . GLU C 3 736 ? 3.387   7.584   43.578  1.00 35.87 ?  802  GLU A OE1   1 
ATOM   6118 O  OE2   . GLU C 3 736 ? 5.184   7.688   42.297  1.00 38.95 ?  802  GLU A OE2   1 
ATOM   6119 N  N     . LYS C 3 737 ? 4.085   11.098  47.338  1.00 24.67 ?  803  LYS A N     1 
ATOM   6120 C  CA    . LYS C 3 737 ? 3.630   12.471  47.467  1.00 23.88 ?  803  LYS A CA    1 
ATOM   6121 C  C     . LYS C 3 737 ? 2.332   12.457  48.248  1.00 23.57 ?  803  LYS A C     1 
ATOM   6122 O  O     . LYS C 3 737 ? 1.765   11.390  48.516  1.00 22.73 ?  803  LYS A O     1 
ATOM   6123 C  CB    . LYS C 3 737 ? 3.400   13.108  46.079  1.00 24.06 ?  803  LYS A CB    1 
ATOM   6124 C  CG    . LYS C 3 737 ? 2.160   12.593  45.347  1.00 23.12 ?  803  LYS A CG    1 
ATOM   6125 C  CD    . LYS C 3 737 ? 2.431   11.305  44.573  1.00 21.81 ?  803  LYS A CD    1 
ATOM   6126 C  CE    . LYS C 3 737 ? 1.247   10.962  43.643  1.00 21.81 ?  803  LYS A CE    1 
ATOM   6127 N  NZ    . LYS C 3 737 ? 1.545   9.766   42.782  1.00 19.77 ?  803  LYS A NZ    1 
ATOM   6128 N  N     . ALA C 3 738 ? 1.863   13.641  48.614  1.00 22.77 ?  804  ALA A N     1 
ATOM   6129 C  CA    . ALA C 3 738 ? 0.584   13.761  49.271  1.00 23.21 ?  804  ALA A CA    1 
ATOM   6130 C  C     . ALA C 3 738 ? -0.327  14.574  48.366  1.00 23.57 ?  804  ALA A C     1 
ATOM   6131 O  O     . ALA C 3 738 ? 0.123   15.528  47.726  1.00 24.46 ?  804  ALA A O     1 
ATOM   6132 C  CB    . ALA C 3 738 ? 0.735   14.456  50.627  1.00 22.27 ?  804  ALA A CB    1 
ATOM   6133 N  N     . TYR C 3 739 ? -1.599  14.197  48.317  1.00 23.35 ?  805  TYR A N     1 
ATOM   6134 C  CA    . TYR C 3 739 ? -2.619  15.000  47.674  1.00 23.00 ?  805  TYR A CA    1 
ATOM   6135 C  C     . TYR C 3 739 ? -3.438  15.728  48.750  1.00 23.08 ?  805  TYR A C     1 
ATOM   6136 O  O     . TYR C 3 739 ? -3.917  15.097  49.707  1.00 22.85 ?  805  TYR A O     1 
ATOM   6137 C  CB    . TYR C 3 739 ? -3.559  14.118  46.866  1.00 22.95 ?  805  TYR A CB    1 
ATOM   6138 C  CG    . TYR C 3 739 ? -2.980  13.564  45.573  1.00 23.85 ?  805  TYR A CG    1 
ATOM   6139 C  CD1   . TYR C 3 739 ? -2.580  14.411  44.540  1.00 23.11 ?  805  TYR A CD1   1 
ATOM   6140 C  CD2   . TYR C 3 739 ? -2.857  12.201  45.386  1.00 23.84 ?  805  TYR A CD2   1 
ATOM   6141 C  CE1   . TYR C 3 739 ? -2.074  13.898  43.340  1.00 23.90 ?  805  TYR A CE1   1 
ATOM   6142 C  CE2   . TYR C 3 739 ? -2.359  11.682  44.211  1.00 25.44 ?  805  TYR A CE2   1 
ATOM   6143 C  CZ    . TYR C 3 739 ? -1.963  12.531  43.190  1.00 25.28 ?  805  TYR A CZ    1 
ATOM   6144 O  OH    . TYR C 3 739 ? -1.454  11.991  42.029  1.00 23.78 ?  805  TYR A OH    1 
ATOM   6145 N  N     . PHE C 3 740 ? -3.621  17.036  48.568  1.00 22.38 ?  806  PHE A N     1 
ATOM   6146 C  CA    . PHE C 3 740 ? -4.330  17.876  49.541  1.00 22.41 ?  806  PHE A CA    1 
ATOM   6147 C  C     . PHE C 3 740 ? -4.735  19.186  48.862  1.00 22.13 ?  806  PHE A C     1 
ATOM   6148 O  O     . PHE C 3 740 ? -3.910  20.073  48.671  1.00 22.07 ?  806  PHE A O     1 
ATOM   6149 C  CB    . PHE C 3 740 ? -3.401  18.150  50.725  1.00 22.86 ?  806  PHE A CB    1 
ATOM   6150 C  CG    . PHE C 3 740 ? -4.045  18.894  51.873  1.00 23.36 ?  806  PHE A CG    1 
ATOM   6151 C  CD1   . PHE C 3 740 ? -5.375  18.677  52.221  1.00 24.25 ?  806  PHE A CD1   1 
ATOM   6152 C  CD2   . PHE C 3 740 ? -3.297  19.783  52.634  1.00 24.91 ?  806  PHE A CD2   1 
ATOM   6153 C  CE1   . PHE C 3 740 ? -5.951  19.360  53.299  1.00 25.58 ?  806  PHE A CE1   1 
ATOM   6154 C  CE2   . PHE C 3 740 ? -3.862  20.456  53.713  1.00 24.95 ?  806  PHE A CE2   1 
ATOM   6155 C  CZ    . PHE C 3 740 ? -5.195  20.240  54.044  1.00 24.23 ?  806  PHE A CZ    1 
ATOM   6156 N  N     . PRO C 3 741 ? -5.999  19.299  48.448  1.00 22.07 ?  807  PRO A N     1 
ATOM   6157 C  CA    . PRO C 3 741 ? -7.054  18.299  48.543  1.00 21.20 ?  807  PRO A CA    1 
ATOM   6158 C  C     . PRO C 3 741 ? -6.954  17.226  47.457  1.00 21.17 ?  807  PRO A C     1 
ATOM   6159 O  O     . PRO C 3 741 ? -6.050  17.269  46.614  1.00 20.25 ?  807  PRO A O     1 
ATOM   6160 C  CB    . PRO C 3 741 ? -8.343  19.104  48.335  1.00 22.12 ?  807  PRO A CB    1 
ATOM   6161 C  CG    . PRO C 3 741 ? -7.927  20.456  47.779  1.00 23.05 ?  807  PRO A CG    1 
ATOM   6162 C  CD    . PRO C 3 741 ? -6.424  20.526  47.744  1.00 22.18 ?  807  PRO A CD    1 
ATOM   6163 N  N     . TYR C 3 742 ? -7.883  16.278  47.500  1.00 20.53 ?  808  TYR A N     1 
ATOM   6164 C  CA    . TYR C 3 742 ? -7.873  15.118  46.609  1.00 20.91 ?  808  TYR A CA    1 
ATOM   6165 C  C     . TYR C 3 742 ? -9.298  14.840  46.157  1.00 20.88 ?  808  TYR A C     1 
ATOM   6166 O  O     . TYR C 3 742 ? -10.181 14.595  46.975  1.00 20.96 ?  808  TYR A O     1 
ATOM   6167 C  CB    . TYR C 3 742 ? -7.322  13.890  47.353  1.00 20.48 ?  808  TYR A CB    1 
ATOM   6168 C  CG    . TYR C 3 742 ? -7.157  12.654  46.494  1.00 21.35 ?  808  TYR A CG    1 
ATOM   6169 C  CD1   . TYR C 3 742 ? -6.365  12.679  45.348  1.00 22.60 ?  808  TYR A CD1   1 
ATOM   6170 C  CD2   . TYR C 3 742 ? -7.749  11.455  46.849  1.00 22.41 ?  808  TYR A CD2   1 
ATOM   6171 C  CE1   . TYR C 3 742 ? -6.186  11.553  44.579  1.00 23.40 ?  808  TYR A CE1   1 
ATOM   6172 C  CE2   . TYR C 3 742 ? -7.578  10.316  46.079  1.00 22.94 ?  808  TYR A CE2   1 
ATOM   6173 C  CZ    . TYR C 3 742 ? -6.794  10.376  44.945  1.00 24.00 ?  808  TYR A CZ    1 
ATOM   6174 O  OH    . TYR C 3 742 ? -6.605  9.262   44.160  1.00 25.07 ?  808  TYR A OH    1 
ATOM   6175 N  N     . LEU C 3 743 ? -9.512  14.888  44.851  1.00 21.25 ?  809  LEU A N     1 
ATOM   6176 C  CA    . LEU C 3 743 ? -10.816 14.689  44.268  1.00 21.10 ?  809  LEU A CA    1 
ATOM   6177 C  C     . LEU C 3 743 ? -10.821 13.357  43.527  1.00 21.50 ?  809  LEU A C     1 
ATOM   6178 O  O     . LEU C 3 743 ? -10.310 13.239  42.409  1.00 21.54 ?  809  LEU A O     1 
ATOM   6179 C  CB    . LEU C 3 743 ? -11.123 15.839  43.303  1.00 20.91 ?  809  LEU A CB    1 
ATOM   6180 C  CG    . LEU C 3 743 ? -12.346 15.700  42.395  1.00 21.72 ?  809  LEU A CG    1 
ATOM   6181 C  CD1   . LEU C 3 743 ? -13.587 15.431  43.247  1.00 22.27 ?  809  LEU A CD1   1 
ATOM   6182 C  CD2   . LEU C 3 743 ? -12.522 16.983  41.516  1.00 21.16 ?  809  LEU A CD2   1 
ATOM   6183 N  N     . LEU C 3 744 ? -11.414 12.351  44.145  1.00 21.51 ?  810  LEU A N     1 
ATOM   6184 C  CA    . LEU C 3 744 ? -11.370 11.001  43.613  1.00 21.82 ?  810  LEU A CA    1 
ATOM   6185 C  C     . LEU C 3 744 ? -12.688 10.700  42.909  1.00 21.79 ?  810  LEU A C     1 
ATOM   6186 O  O     . LEU C 3 744 ? -13.722 10.568  43.548  1.00 21.87 ?  810  LEU A O     1 
ATOM   6187 C  CB    . LEU C 3 744 ? -11.100 9.994   44.754  1.00 21.74 ?  810  LEU A CB    1 
ATOM   6188 C  CG    . LEU C 3 744 ? -11.106 8.498   44.388  1.00 23.04 ?  810  LEU A CG    1 
ATOM   6189 C  CD1   . LEU C 3 744 ? -10.088 8.204   43.277  1.00 22.72 ?  810  LEU A CD1   1 
ATOM   6190 C  CD2   . LEU C 3 744 ? -10.821 7.601   45.604  1.00 23.13 ?  810  LEU A CD2   1 
ATOM   6191 N  N     . ILE C 3 745 ? -12.645 10.562  41.591  1.00 21.61 ?  811  ILE A N     1 
ATOM   6192 C  CA    . ILE C 3 745 ? -13.865 10.482  40.797  1.00 22.27 ?  811  ILE A CA    1 
ATOM   6193 C  C     . ILE C 3 745 ? -14.242 9.032   40.488  1.00 22.36 ?  811  ILE A C     1 
ATOM   6194 O  O     . ILE C 3 745 ? -15.401 8.639   40.626  1.00 21.89 ?  811  ILE A O     1 
ATOM   6195 C  CB    . ILE C 3 745 ? -13.679 11.257  39.472  1.00 22.14 ?  811  ILE A CB    1 
ATOM   6196 C  CG1   . ILE C 3 745 ? -13.366 12.730  39.758  1.00 22.96 ?  811  ILE A CG1   1 
ATOM   6197 C  CG2   . ILE C 3 745 ? -14.870 11.089  38.531  1.00 21.86 ?  811  ILE A CG2   1 
ATOM   6198 C  CD1   . ILE C 3 745 ? -14.514 13.495  40.279  1.00 27.87 ?  811  ILE A CD1   1 
ATOM   6199 N  N     . ASN C 3 746 ? -13.257 8.247   40.066  1.00 22.69 ?  812  ASN A N     1 
ATOM   6200 C  CA    . ASN C 3 746 ? -13.465 6.844   39.781  1.00 23.63 ?  812  ASN A CA    1 
ATOM   6201 C  C     . ASN C 3 746 ? -12.120 6.163   39.674  1.00 22.96 ?  812  ASN A C     1 
ATOM   6202 O  O     . ASN C 3 746 ? -11.088 6.815   39.830  1.00 22.79 ?  812  ASN A O     1 
ATOM   6203 C  CB    . ASN C 3 746 ? -14.202 6.689   38.454  1.00 24.74 ?  812  ASN A CB    1 
ATOM   6204 C  CG    . ASN C 3 746 ? -15.271 5.633   38.512  1.00 30.96 ?  812  ASN A CG    1 
ATOM   6205 O  OD1   . ASN C 3 746 ? -14.996 4.415   38.535  1.00 36.05 ?  812  ASN A OD1   1 
ATOM   6206 N  ND2   . ASN C 3 746 ? -16.507 6.086   38.551  1.00 34.41 ?  812  ASN A ND2   1 
ATOM   6207 N  N     . LYS C 3 747 ? -12.122 4.856   39.401  1.00 22.00 ?  813  LYS A N     1 
ATOM   6208 C  CA    . LYS C 3 747 ? -10.872 4.163   39.154  1.00 21.93 ?  813  LYS A CA    1 
ATOM   6209 C  C     . LYS C 3 747 ? -10.176 4.904   38.006  1.00 21.33 ?  813  LYS A C     1 
ATOM   6210 O  O     . LYS C 3 747 ? -10.808 5.172   36.988  1.00 21.25 ?  813  LYS A O     1 
ATOM   6211 C  CB    . LYS C 3 747 ? -11.129 2.692   38.747  1.00 21.77 ?  813  LYS A CB    1 
ATOM   6212 C  CG    . LYS C 3 747 ? -11.593 1.787   39.922  1.00 22.43 ?  813  LYS A CG    1 
ATOM   6213 C  CD    . LYS C 3 747 ? -11.654 0.326   39.478  1.00 22.93 ?  813  LYS A CD    1 
ATOM   6214 C  CE    . LYS C 3 747 ? -12.063 -0.599  40.616  1.00 24.46 ?  813  LYS A CE    1 
ATOM   6215 N  NZ    . LYS C 3 747 ? -12.151 -2.006  40.044  1.00 23.82 ?  813  LYS A NZ    1 
ATOM   6216 N  N     . LYS C 3 748 ? -8.906  5.241   38.201  1.00 21.06 ?  814  LYS A N     1 
ATOM   6217 C  CA    . LYS C 3 748 ? -8.046  5.848   37.174  1.00 21.16 ?  814  LYS A CA    1 
ATOM   6218 C  C     . LYS C 3 748 ? -8.513  7.254   36.780  1.00 21.51 ?  814  LYS A C     1 
ATOM   6219 O  O     . LYS C 3 748 ? -8.100  7.787   35.748  1.00 20.56 ?  814  LYS A O     1 
ATOM   6220 C  CB    . LYS C 3 748 ? -7.915  4.920   35.925  1.00 21.57 ?  814  LYS A CB    1 
ATOM   6221 C  CG    . LYS C 3 748 ? -7.116  3.616   36.201  1.00 20.39 ?  814  LYS A CG    1 
ATOM   6222 C  CD    . LYS C 3 748 ? -7.200  2.603   35.058  1.00 22.57 ?  814  LYS A CD    1 
ATOM   6223 C  CE    . LYS C 3 748 ? -6.682  1.211   35.471  1.00 19.93 ?  814  LYS A CE    1 
ATOM   6224 N  NZ    . LYS C 3 748 ? -5.247  1.200   35.913  1.00 20.70 ?  814  LYS A NZ    1 
ATOM   6225 N  N     . ARG C 3 749 ? -9.349  7.856   37.627  1.00 20.83 ?  815  ARG A N     1 
ATOM   6226 C  CA    . ARG C 3 749 ? -9.892  9.166   37.352  1.00 20.30 ?  815  ARG A CA    1 
ATOM   6227 C  C     . ARG C 3 749 ? -9.848  10.009  38.634  1.00 20.72 ?  815  ARG A C     1 
ATOM   6228 O  O     . ARG C 3 749 ? -10.640 9.795   39.536  1.00 21.16 ?  815  ARG A O     1 
ATOM   6229 C  CB    . ARG C 3 749 ? -11.338 9.044   36.855  1.00 19.88 ?  815  ARG A CB    1 
ATOM   6230 C  CG    . ARG C 3 749 ? -11.534 8.218   35.540  1.00 19.26 ?  815  ARG A CG    1 
ATOM   6231 C  CD    . ARG C 3 749 ? -10.986 8.994   34.352  1.00 19.82 ?  815  ARG A CD    1 
ATOM   6232 N  NE    . ARG C 3 749 ? -11.041 8.269   33.087  1.00 20.66 ?  815  ARG A NE    1 
ATOM   6233 C  CZ    . ARG C 3 749 ? -11.772 8.636   32.044  1.00 20.46 ?  815  ARG A CZ    1 
ATOM   6234 N  NH1   . ARG C 3 749 ? -12.539 9.731   32.108  1.00 23.04 ?  815  ARG A NH1   1 
ATOM   6235 N  NH2   . ARG C 3 749 ? -11.720 7.918   30.925  1.00 20.19 ?  815  ARG A NH2   1 
ATOM   6236 N  N     . TYR C 3 750 ? -8.912  10.946  38.721  1.00 20.59 ?  816  TYR A N     1 
ATOM   6237 C  CA    . TYR C 3 750 ? -8.822  11.802  39.900  1.00 20.45 ?  816  TYR A CA    1 
ATOM   6238 C  C     . TYR C 3 750 ? -7.986  13.035  39.642  1.00 20.12 ?  816  TYR A C     1 
ATOM   6239 O  O     . TYR C 3 750 ? -7.295  13.102  38.640  1.00 18.87 ?  816  TYR A O     1 
ATOM   6240 C  CB    . TYR C 3 750 ? -8.259  11.009  41.101  1.00 20.70 ?  816  TYR A CB    1 
ATOM   6241 C  CG    . TYR C 3 750 ? -6.874  10.390  40.941  1.00 21.14 ?  816  TYR A CG    1 
ATOM   6242 C  CD1   . TYR C 3 750 ? -6.722  9.042   40.573  1.00 22.60 ?  816  TYR A CD1   1 
ATOM   6243 C  CD2   . TYR C 3 750 ? -5.718  11.135  41.186  1.00 21.87 ?  816  TYR A CD2   1 
ATOM   6244 C  CE1   . TYR C 3 750 ? -5.454  8.467   40.454  1.00 21.50 ?  816  TYR A CE1   1 
ATOM   6245 C  CE2   . TYR C 3 750 ? -4.454  10.575  41.061  1.00 20.19 ?  816  TYR A CE2   1 
ATOM   6246 C  CZ    . TYR C 3 750 ? -4.328  9.240   40.700  1.00 22.49 ?  816  TYR A CZ    1 
ATOM   6247 O  OH    . TYR C 3 750 ? -3.064  8.677   40.574  1.00 21.67 ?  816  TYR A OH    1 
ATOM   6248 N  N     . ALA C 3 751 ? -8.024  13.994  40.579  1.00 20.06 ?  817  ALA A N     1 
ATOM   6249 C  CA    . ALA C 3 751 ? -7.162  15.161  40.523  1.00 19.73 ?  817  ALA A CA    1 
ATOM   6250 C  C     . ALA C 3 751 ? -6.769  15.523  41.944  1.00 20.63 ?  817  ALA A C     1 
ATOM   6251 O  O     . ALA C 3 751 ? -7.456  15.142  42.906  1.00 20.83 ?  817  ALA A O     1 
ATOM   6252 C  CB    . ALA C 3 751 ? -7.882  16.331  39.873  1.00 19.65 ?  817  ALA A CB    1 
ATOM   6253 N  N     . GLY C 3 752 ? -5.684  16.271  42.091  1.00 20.93 ?  818  GLY A N     1 
ATOM   6254 C  CA    . GLY C 3 752 ? -5.319  16.752  43.426  1.00 21.31 ?  818  GLY A CA    1 
ATOM   6255 C  C     . GLY C 3 752 ? -4.110  17.656  43.414  1.00 21.84 ?  818  GLY A C     1 
ATOM   6256 O  O     . GLY C 3 752 ? -3.248  17.541  42.529  1.00 22.01 ?  818  GLY A O     1 
ATOM   6257 N  N     . LEU C 3 753 ? -4.040  18.557  44.394  1.00 21.73 ?  819  LEU A N     1 
ATOM   6258 C  CA    . LEU C 3 753 ? -2.831  19.324  44.598  1.00 22.44 ?  819  LEU A CA    1 
ATOM   6259 C  C     . LEU C 3 753 ? -1.788  18.373  45.161  1.00 22.19 ?  819  LEU A C     1 
ATOM   6260 O  O     . LEU C 3 753 ? -2.023  17.683  46.152  1.00 22.34 ?  819  LEU A O     1 
ATOM   6261 C  CB    . LEU C 3 753 ? -3.064  20.513  45.544  1.00 22.97 ?  819  LEU A CB    1 
ATOM   6262 C  CG    . LEU C 3 753 ? -3.895  21.669  44.995  1.00 24.78 ?  819  LEU A CG    1 
ATOM   6263 C  CD1   . LEU C 3 753 ? -3.961  22.843  45.996  1.00 25.93 ?  819  LEU A CD1   1 
ATOM   6264 C  CD2   . LEU C 3 753 ? -3.330  22.128  43.643  1.00 27.69 ?  819  LEU A CD2   1 
ATOM   6265 N  N     . PHE C 3 754 ? -0.635  18.366  44.508  1.00 22.33 ?  820  PHE A N     1 
ATOM   6266 C  CA    . PHE C 3 754 ? 0.395   17.346  44.599  1.00 22.44 ?  820  PHE A CA    1 
ATOM   6267 C  C     . PHE C 3 754 ? 1.557   17.963  45.399  1.00 23.22 ?  820  PHE A C     1 
ATOM   6268 O  O     . PHE C 3 754 ? 2.169   18.954  44.960  1.00 23.35 ?  820  PHE A O     1 
ATOM   6269 C  CB    . PHE C 3 754 ? 0.771   17.040  43.131  1.00 22.52 ?  820  PHE A CB    1 
ATOM   6270 C  CG    . PHE C 3 754 ? 1.822   15.968  42.917  1.00 22.46 ?  820  PHE A CG    1 
ATOM   6271 C  CD1   . PHE C 3 754 ? 1.496   14.785  42.240  1.00 22.40 ?  820  PHE A CD1   1 
ATOM   6272 C  CD2   . PHE C 3 754 ? 3.149   16.185  43.266  1.00 22.98 ?  820  PHE A CD2   1 
ATOM   6273 C  CE1   . PHE C 3 754 ? 2.462   13.814  41.993  1.00 21.26 ?  820  PHE A CE1   1 
ATOM   6274 C  CE2   . PHE C 3 754 ? 4.124   15.223  43.005  1.00 23.38 ?  820  PHE A CE2   1 
ATOM   6275 C  CZ    . PHE C 3 754 ? 3.779   14.036  42.367  1.00 22.38 ?  820  PHE A CZ    1 
ATOM   6276 N  N     . TRP C 3 755 ? 1.827   17.420  46.589  1.00 22.84 ?  821  TRP A N     1 
ATOM   6277 C  CA    . TRP C 3 755 ? 2.847   17.983  47.486  1.00 23.84 ?  821  TRP A CA    1 
ATOM   6278 C  C     . TRP C 3 755 ? 3.970   16.985  47.708  1.00 24.45 ?  821  TRP A C     1 
ATOM   6279 O  O     . TRP C 3 755 ? 3.711   15.821  47.985  1.00 24.16 ?  821  TRP A O     1 
ATOM   6280 C  CB    . TRP C 3 755 ? 2.255   18.344  48.857  1.00 23.13 ?  821  TRP A CB    1 
ATOM   6281 C  CG    . TRP C 3 755 ? 1.040   19.243  48.846  1.00 23.39 ?  821  TRP A CG    1 
ATOM   6282 C  CD1   . TRP C 3 755 ? -0.237  18.900  48.483  1.00 23.05 ?  821  TRP A CD1   1 
ATOM   6283 C  CD2   . TRP C 3 755 ? 0.979   20.622  49.258  1.00 24.12 ?  821  TRP A CD2   1 
ATOM   6284 N  NE1   . TRP C 3 755 ? -1.078  19.974  48.641  1.00 22.80 ?  821  TRP A NE1   1 
ATOM   6285 C  CE2   . TRP C 3 755 ? -0.358  21.045  49.106  1.00 23.83 ?  821  TRP A CE2   1 
ATOM   6286 C  CE3   . TRP C 3 755 ? 1.925   21.534  49.740  1.00 26.12 ?  821  TRP A CE3   1 
ATOM   6287 C  CZ2   . TRP C 3 755 ? -0.771  22.340  49.408  1.00 24.68 ?  821  TRP A CZ2   1 
ATOM   6288 C  CZ3   . TRP C 3 755 ? 1.514   22.825  50.051  1.00 26.40 ?  821  TRP A CZ3   1 
ATOM   6289 C  CH2   . TRP C 3 755 ? 0.177   23.216  49.881  1.00 27.72 ?  821  TRP A CH2   1 
ATOM   6290 N  N     . THR C 3 756 ? 5.214   17.446  47.594  1.00 25.51 ?  822  THR A N     1 
ATOM   6291 C  CA    . THR C 3 756 ? 6.371   16.621  47.925  1.00 26.33 ?  822  THR A CA    1 
ATOM   6292 C  C     . THR C 3 756 ? 7.104   17.298  49.070  1.00 27.40 ?  822  THR A C     1 
ATOM   6293 O  O     . THR C 3 756 ? 8.042   16.755  49.632  1.00 27.84 ?  822  THR A O     1 
ATOM   6294 C  CB    . THR C 3 756 ? 7.332   16.404  46.724  1.00 26.60 ?  822  THR A CB    1 
ATOM   6295 O  OG1   . THR C 3 756 ? 7.595   17.654  46.079  1.00 26.75 ?  822  THR A OG1   1 
ATOM   6296 C  CG2   . THR C 3 756 ? 6.739   15.431  45.703  1.00 25.57 ?  822  THR A CG2   1 
ATOM   6297 N  N     . ASN C 3 757 ? 6.665   18.501  49.408  1.00 27.94 ?  823  ASN A N     1 
ATOM   6298 C  CA    . ASN C 3 757 ? 7.072   19.140  50.644  1.00 28.88 ?  823  ASN A CA    1 
ATOM   6299 C  C     . ASN C 3 757 ? 5.863   19.886  51.189  1.00 29.22 ?  823  ASN A C     1 
ATOM   6300 O  O     . ASN C 3 757 ? 4.963   20.231  50.428  1.00 28.78 ?  823  ASN A O     1 
ATOM   6301 C  CB    . ASN C 3 757 ? 8.267   20.079  50.426  1.00 29.11 ?  823  ASN A CB    1 
ATOM   6302 C  CG    . ASN C 3 757 ? 7.900   21.307  49.623  1.00 29.42 ?  823  ASN A CG    1 
ATOM   6303 O  OD1   . ASN C 3 757 ? 7.206   22.193  50.113  1.00 28.46 ?  823  ASN A OD1   1 
ATOM   6304 N  ND2   . ASN C 3 757 ? 8.361   21.360  48.382  1.00 29.68 ?  823  ASN A ND2   1 
ATOM   6305 N  N     . PRO C 3 758 ? 5.828   20.120  52.511  1.00 29.70 ?  824  PRO A N     1 
ATOM   6306 C  CA    . PRO C 3 758 ? 4.647   20.699  53.166  1.00 30.26 ?  824  PRO A CA    1 
ATOM   6307 C  C     . PRO C 3 758 ? 4.475   22.211  53.006  1.00 30.57 ?  824  PRO A C     1 
ATOM   6308 O  O     . PRO C 3 758 ? 3.517   22.773  53.536  1.00 30.28 ?  824  PRO A O     1 
ATOM   6309 C  CB    . PRO C 3 758 ? 4.882   20.382  54.650  1.00 30.43 ?  824  PRO A CB    1 
ATOM   6310 C  CG    . PRO C 3 758 ? 6.383   20.338  54.784  1.00 30.24 ?  824  PRO A CG    1 
ATOM   6311 C  CD    . PRO C 3 758 ? 6.894   19.779  53.469  1.00 29.67 ?  824  PRO A CD    1 
ATOM   6312 N  N     . ASP C 3 759 ? 5.383   22.870  52.295  1.00 30.94 ?  825  ASP A N     1 
ATOM   6313 C  CA    . ASP C 3 759 ? 5.359   24.327  52.235  1.00 31.46 ?  825  ASP A CA    1 
ATOM   6314 C  C     . ASP C 3 759 ? 4.712   24.894  50.972  1.00 31.32 ?  825  ASP A C     1 
ATOM   6315 O  O     . ASP C 3 759 ? 3.983   25.881  51.040  1.00 31.73 ?  825  ASP A O     1 
ATOM   6316 C  CB    . ASP C 3 759 ? 6.769   24.883  52.410  1.00 31.99 ?  825  ASP A CB    1 
ATOM   6317 C  CG    . ASP C 3 759 ? 7.406   24.430  53.711  1.00 34.01 ?  825  ASP A CG    1 
ATOM   6318 O  OD1   . ASP C 3 759 ? 6.802   24.655  54.782  1.00 35.46 ?  825  ASP A OD1   1 
ATOM   6319 O  OD2   . ASP C 3 759 ? 8.499   23.827  53.664  1.00 37.32 ?  825  ASP A OD2   1 
ATOM   6320 N  N     . LYS C 3 760 ? 4.990   24.281  49.825  1.00 30.07 ?  826  LYS A N     1 
ATOM   6321 C  CA    . LYS C 3 760 ? 4.452   24.747  48.553  1.00 29.79 ?  826  LYS A CA    1 
ATOM   6322 C  C     . LYS C 3 760 ? 4.133   23.535  47.684  1.00 28.71 ?  826  LYS A C     1 
ATOM   6323 O  O     . LYS C 3 760 ? 4.970   22.653  47.546  1.00 28.44 ?  826  LYS A O     1 
ATOM   6324 C  CB    . LYS C 3 760 ? 5.477   25.623  47.820  1.00 29.77 ?  826  LYS A CB    1 
ATOM   6325 C  CG    . LYS C 3 760 ? 6.100   26.739  48.664  1.00 32.96 ?  826  LYS A CG    1 
ATOM   6326 C  CD    . LYS C 3 760 ? 7.301   26.245  49.483  1.00 36.15 ?  826  LYS A CD    1 
ATOM   6327 C  CE    . LYS C 3 760 ? 8.190   25.298  48.663  1.00 36.91 ?  826  LYS A CE    1 
ATOM   6328 N  NZ    . LYS C 3 760 ? 9.439   24.940  49.394  1.00 37.96 ?  826  LYS A NZ    1 
ATOM   6329 N  N     . PHE C 3 761 ? 2.943   23.491  47.093  1.00 27.99 ?  827  PHE A N     1 
ATOM   6330 C  CA    . PHE C 3 761 ? 2.572   22.340  46.259  1.00 27.91 ?  827  PHE A CA    1 
ATOM   6331 C  C     . PHE C 3 761 ? 3.308   22.364  44.914  1.00 27.51 ?  827  PHE A C     1 
ATOM   6332 O  O     . PHE C 3 761 ? 3.677   23.427  44.439  1.00 27.20 ?  827  PHE A O     1 
ATOM   6333 C  CB    . PHE C 3 761 ? 1.046   22.250  46.072  1.00 27.73 ?  827  PHE A CB    1 
ATOM   6334 C  CG    . PHE C 3 761 ? 0.441   23.418  45.331  1.00 29.46 ?  827  PHE A CG    1 
ATOM   6335 C  CD1   . PHE C 3 761 ? -0.209  24.432  46.018  1.00 29.31 ?  827  PHE A CD1   1 
ATOM   6336 C  CD2   . PHE C 3 761 ? 0.512   23.494  43.943  1.00 30.91 ?  827  PHE A CD2   1 
ATOM   6337 C  CE1   . PHE C 3 761 ? -0.777  25.502  45.345  1.00 30.48 ?  827  PHE A CE1   1 
ATOM   6338 C  CE2   . PHE C 3 761 ? -0.052  24.569  43.260  1.00 31.00 ?  827  PHE A CE2   1 
ATOM   6339 C  CZ    . PHE C 3 761 ? -0.702  25.569  43.962  1.00 30.53 ?  827  PHE A CZ    1 
ATOM   6340 N  N     . ASP C 3 762 ? 3.519   21.196  44.309  1.00 27.16 ?  828  ASP A N     1 
ATOM   6341 C  CA    . ASP C 3 762 ? 4.268   21.092  43.053  1.00 27.52 ?  828  ASP A CA    1 
ATOM   6342 C  C     . ASP C 3 762 ? 3.419   21.410  41.823  1.00 27.57 ?  828  ASP A C     1 
ATOM   6343 O  O     . ASP C 3 762 ? 3.883   22.073  40.885  1.00 27.24 ?  828  ASP A O     1 
ATOM   6344 C  CB    . ASP C 3 762 ? 4.848   19.687  42.887  1.00 27.35 ?  828  ASP A CB    1 
ATOM   6345 C  CG    . ASP C 3 762 ? 5.962   19.395  43.872  1.00 28.35 ?  828  ASP A CG    1 
ATOM   6346 O  OD1   . ASP C 3 762 ? 6.554   20.352  44.411  1.00 28.45 ?  828  ASP A OD1   1 
ATOM   6347 O  OD2   . ASP C 3 762 ? 6.260   18.208  44.104  1.00 29.29 ?  828  ASP A OD2   1 
ATOM   6348 N  N     . LYS C 3 763 ? 2.182   20.917  41.819  1.00 26.79 ?  829  LYS A N     1 
ATOM   6349 C  CA    . LYS C 3 763 ? 1.307   21.081  40.665  1.00 26.20 ?  829  LYS A CA    1 
ATOM   6350 C  C     . LYS C 3 763 ? -0.110  20.626  41.026  1.00 26.00 ?  829  LYS A C     1 
ATOM   6351 O  O     . LYS C 3 763 ? -0.323  19.976  42.066  1.00 25.04 ?  829  LYS A O     1 
ATOM   6352 C  CB    . LYS C 3 763 ? 1.831   20.226  39.501  1.00 26.52 ?  829  LYS A CB    1 
ATOM   6353 C  CG    . LYS C 3 763 ? 1.692   18.730  39.767  1.00 27.44 ?  829  LYS A CG    1 
ATOM   6354 C  CD    . LYS C 3 763 ? 2.313   17.854  38.654  1.00 30.27 ?  829  LYS A CD    1 
ATOM   6355 C  CE    . LYS C 3 763 ? 2.462   16.415  39.158  1.00 31.17 ?  829  LYS A CE    1 
ATOM   6356 N  NZ    . LYS C 3 763 ? 3.340   15.589  38.281  1.00 36.34 ?  829  LYS A NZ    1 
ATOM   6357 N  N     . LEU C 3 764 ? -1.071  21.003  40.187  1.00 25.49 ?  830  LEU A N     1 
ATOM   6358 C  CA    . LEU C 3 764 ? -2.394  20.398  40.206  1.00 26.36 ?  830  LEU A CA    1 
ATOM   6359 C  C     . LEU C 3 764 ? -2.330  19.172  39.303  1.00 25.85 ?  830  LEU A C     1 
ATOM   6360 O  O     . LEU C 3 764 ? -2.322  19.302  38.091  1.00 26.15 ?  830  LEU A O     1 
ATOM   6361 C  CB    . LEU C 3 764 ? -3.454  21.359  39.665  1.00 26.67 ?  830  LEU A CB    1 
ATOM   6362 C  CG    . LEU C 3 764 ? -4.919  21.025  40.006  1.00 29.25 ?  830  LEU A CG    1 
ATOM   6363 C  CD1   . LEU C 3 764 ? -5.460  19.883  39.186  1.00 30.87 ?  830  LEU A CD1   1 
ATOM   6364 C  CD2   . LEU C 3 764 ? -5.078  20.690  41.463  1.00 33.00 ?  830  LEU A CD2   1 
ATOM   6365 N  N     . ASP C 3 765 ? -2.284  17.992  39.900  1.00 24.71 ?  831  ASP A N     1 
ATOM   6366 C  CA    . ASP C 3 765 ? -2.132  16.751  39.150  1.00 24.48 ?  831  ASP A CA    1 
ATOM   6367 C  C     . ASP C 3 765 ? -3.504  16.218  38.724  1.00 24.16 ?  831  ASP A C     1 
ATOM   6368 O  O     . ASP C 3 765 ? -4.456  16.264  39.498  1.00 23.57 ?  831  ASP A O     1 
ATOM   6369 C  CB    . ASP C 3 765 ? -1.417  15.711  40.024  1.00 24.22 ?  831  ASP A CB    1 
ATOM   6370 C  CG    . ASP C 3 765 ? -0.993  14.488  39.237  1.00 26.17 ?  831  ASP A CG    1 
ATOM   6371 O  OD1   . ASP C 3 765 ? -0.837  14.622  38.008  1.00 24.80 ?  831  ASP A OD1   1 
ATOM   6372 O  OD2   . ASP C 3 765 ? -0.842  13.399  39.840  1.00 26.90 ?  831  ASP A OD2   1 
ATOM   6373 N  N     . GLN C 3 766 ? -3.605  15.730  37.492  1.00 23.37 ?  832  GLN A N     1 
ATOM   6374 C  CA    . GLN C 3 766 ? -4.839  15.147  36.990  1.00 23.36 ?  832  GLN A CA    1 
ATOM   6375 C  C     . GLN C 3 766 ? -4.500  13.814  36.356  1.00 23.56 ?  832  GLN A C     1 
ATOM   6376 O  O     . GLN C 3 766 ? -3.589  13.744  35.521  1.00 23.04 ?  832  GLN A O     1 
ATOM   6377 C  CB    . GLN C 3 766 ? -5.473  16.045  35.916  1.00 23.99 ?  832  GLN A CB    1 
ATOM   6378 C  CG    . GLN C 3 766 ? -5.669  17.490  36.324  1.00 24.25 ?  832  GLN A CG    1 
ATOM   6379 C  CD    . GLN C 3 766 ? -6.429  18.267  35.268  1.00 25.82 ?  832  GLN A CD    1 
ATOM   6380 O  OE1   . GLN C 3 766 ? -6.143  19.417  35.017  1.00 26.64 ?  832  GLN A OE1   1 
ATOM   6381 N  NE2   . GLN C 3 766 ? -7.403  17.624  34.639  1.00 27.81 ?  832  GLN A NE2   1 
ATOM   6382 N  N     . LYS C 3 767 ? -5.202  12.757  36.765  1.00 22.63 ?  833  LYS A N     1 
ATOM   6383 C  CA    . LYS C 3 767 ? -5.033  11.464  36.136  1.00 22.31 ?  833  LYS A CA    1 
ATOM   6384 C  C     . LYS C 3 767 ? -6.318  11.038  35.441  1.00 21.32 ?  833  LYS A C     1 
ATOM   6385 O  O     . LYS C 3 767 ? -7.387  11.068  36.037  1.00 21.15 ?  833  LYS A O     1 
ATOM   6386 C  CB    . LYS C 3 767 ? -4.557  10.414  37.154  1.00 22.49 ?  833  LYS A CB    1 
ATOM   6387 C  CG    . LYS C 3 767 ? -3.218  10.812  37.845  1.00 25.53 ?  833  LYS A CG    1 
ATOM   6388 C  CD    . LYS C 3 767 ? -2.019  10.318  37.060  1.00 28.87 ?  833  LYS A CD    1 
ATOM   6389 C  CE    . LYS C 3 767 ? -0.780  10.233  37.935  1.00 31.54 ?  833  LYS A CE    1 
ATOM   6390 N  NZ    . LYS C 3 767 ? 0.006   11.475  37.868  1.00 33.77 ?  833  LYS A NZ    1 
ATOM   6391 N  N     . GLY C 3 768 ? -6.204  10.713  34.152  1.00 20.69 ?  834  GLY A N     1 
ATOM   6392 C  CA    . GLY C 3 768 ? -7.262  10.024  33.410  1.00 19.63 ?  834  GLY A CA    1 
ATOM   6393 C  C     . GLY C 3 768 ? -8.392  10.893  32.907  1.00 19.77 ?  834  GLY A C     1 
ATOM   6394 O  O     . GLY C 3 768 ? -9.083  10.524  31.960  1.00 19.10 ?  834  GLY A O     1 
ATOM   6395 N  N     . LEU C 3 769 ? -8.588  12.045  33.547  1.00 20.06 ?  835  LEU A N     1 
ATOM   6396 C  CA    . LEU C 3 769 ? -9.698  12.939  33.223  1.00 20.53 ?  835  LEU A CA    1 
ATOM   6397 C  C     . LEU C 3 769 ? -9.663  13.437  31.775  1.00 21.43 ?  835  LEU A C     1 
ATOM   6398 O  O     . LEU C 3 769 ? -8.594  13.520  31.147  1.00 20.88 ?  835  LEU A O     1 
ATOM   6399 C  CB    . LEU C 3 769 ? -9.700  14.141  34.171  1.00 20.35 ?  835  LEU A CB    1 
ATOM   6400 C  CG    . LEU C 3 769 ? -9.620  13.858  35.675  1.00 21.50 ?  835  LEU A CG    1 
ATOM   6401 C  CD1   . LEU C 3 769 ? -9.806  15.152  36.465  1.00 21.91 ?  835  LEU A CD1   1 
ATOM   6402 C  CD2   . LEU C 3 769 ? -10.652 12.846  36.109  1.00 21.53 ?  835  LEU A CD2   1 
ATOM   6403 N  N     . ALA C 3 770 ? -10.832 13.781  31.251  1.00 21.98 ?  836  ALA A N     1 
ATOM   6404 C  CA    . ALA C 3 770 ? -10.929 14.245  29.873  1.00 23.32 ?  836  ALA A CA    1 
ATOM   6405 C  C     . ALA C 3 770 ? -9.925  15.361  29.613  1.00 23.78 ?  836  ALA A C     1 
ATOM   6406 O  O     . ALA C 3 770 ? -9.451  15.537  28.474  1.00 24.24 ?  836  ALA A O     1 
ATOM   6407 C  CB    . ALA C 3 770 ? -12.344 14.716  29.555  1.00 23.21 ?  836  ALA A CB    1 
ATOM   6408 N  N     . SER C 3 771 ? -9.586  16.103  30.663  1.00 23.87 ?  837  SER A N     1 
ATOM   6409 C  CA    . SER C 3 771 ? -8.713  17.253  30.505  1.00 24.23 ?  837  SER A CA    1 
ATOM   6410 C  C     . SER C 3 771 ? -7.263  16.866  30.237  1.00 24.25 ?  837  SER A C     1 
ATOM   6411 O  O     . SER C 3 771 ? -6.456  17.723  29.916  1.00 24.88 ?  837  SER A O     1 
ATOM   6412 C  CB    . SER C 3 771 ? -8.795  18.186  31.711  1.00 24.34 ?  837  SER A CB    1 
ATOM   6413 O  OG    . SER C 3 771 ? -8.680  17.457  32.928  1.00 26.18 ?  837  SER A OG    1 
ATOM   6414 N  N     . VAL C 3 772 ? -6.929  15.591  30.375  1.00 23.30 ?  838  VAL A N     1 
ATOM   6415 C  CA    . VAL C 3 772 ? -5.599  15.119  30.014  1.00 23.92 ?  838  VAL A CA    1 
ATOM   6416 C  C     . VAL C 3 772 ? -5.680  14.026  28.919  1.00 23.98 ?  838  VAL A C     1 
ATOM   6417 O  O     . VAL C 3 772 ? -4.703  13.337  28.655  1.00 25.34 ?  838  VAL A O     1 
ATOM   6418 C  CB    . VAL C 3 772 ? -4.774  14.603  31.243  1.00 23.92 ?  838  VAL A CB    1 
ATOM   6419 C  CG1   . VAL C 3 772 ? -4.586  15.707  32.331  1.00 24.28 ?  838  VAL A CG1   1 
ATOM   6420 C  CG2   . VAL C 3 772 ? -5.419  13.372  31.873  1.00 24.74 ?  838  VAL A CG2   1 
ATOM   6421 N  N     . ARG C 3 773 ? -6.838  13.845  28.296  1.00 23.10 ?  839  ARG A N     1 
ATOM   6422 C  CA    . ARG C 3 773 ? -6.932  12.897  27.181  1.00 22.66 ?  839  ARG A CA    1 
ATOM   6423 C  C     . ARG C 3 773 ? -6.827  13.677  25.868  1.00 22.92 ?  839  ARG A C     1 
ATOM   6424 O  O     . ARG C 3 773 ? -7.503  14.677  25.672  1.00 22.08 ?  839  ARG A O     1 
ATOM   6425 C  CB    . ARG C 3 773 ? -8.245  12.107  27.215  1.00 22.53 ?  839  ARG A CB    1 
ATOM   6426 C  CG    . ARG C 3 773 ? -8.428  11.184  28.452  1.00 21.32 ?  839  ARG A CG    1 
ATOM   6427 C  CD    . ARG C 3 773 ? -9.792  10.480  28.392  1.00 21.86 ?  839  ARG A CD    1 
ATOM   6428 N  NE    . ARG C 3 773 ? -9.983  9.804   27.110  1.00 21.59 ?  839  ARG A NE    1 
ATOM   6429 C  CZ    . ARG C 3 773 ? -9.697  8.528   26.886  1.00 22.26 ?  839  ARG A CZ    1 
ATOM   6430 N  NH1   . ARG C 3 773 ? -9.222  7.781   27.872  1.00 21.48 ?  839  ARG A NH1   1 
ATOM   6431 N  NH2   . ARG C 3 773 ? -9.887  7.998   25.678  1.00 20.20 ?  839  ARG A NH2   1 
ATOM   6432 N  N     . ARG C 3 774 ? -5.995  13.198  24.953  1.00 23.63 ?  840  ARG A N     1 
ATOM   6433 C  CA    . ARG C 3 774 ? -5.779  13.927  23.705  1.00 24.79 ?  840  ARG A CA    1 
ATOM   6434 C  C     . ARG C 3 774 ? -6.919  13.802  22.700  1.00 24.14 ?  840  ARG A C     1 
ATOM   6435 O  O     . ARG C 3 774 ? -6.922  14.470  21.688  1.00 24.71 ?  840  ARG A O     1 
ATOM   6436 C  CB    . ARG C 3 774 ? -4.409  13.588  23.119  1.00 24.62 ?  840  ARG A CB    1 
ATOM   6437 C  CG    . ARG C 3 774 ? -3.314  14.299  23.951  1.00 29.65 ?  840  ARG A CG    1 
ATOM   6438 C  CD    . ARG C 3 774 ? -1.897  13.875  23.585  1.00 33.34 ?  840  ARG A CD    1 
ATOM   6439 N  NE    . ARG C 3 774 ? -1.701  12.448  23.802  1.00 36.03 ?  840  ARG A NE    1 
ATOM   6440 C  CZ    . ARG C 3 774 ? -0.618  11.782  23.417  1.00 37.27 ?  840  ARG A CZ    1 
ATOM   6441 N  NH1   . ARG C 3 774 ? 0.377   12.419  22.795  1.00 36.62 ?  840  ARG A NH1   1 
ATOM   6442 N  NH2   . ARG C 3 774 ? -0.534  10.481  23.656  1.00 36.68 ?  840  ARG A NH2   1 
ATOM   6443 N  N     . ASP C 3 775 ? -7.907  12.967  22.999  1.00 24.41 ?  841  ASP A N     1 
ATOM   6444 C  CA    . ASP C 3 775 ? -9.139  12.956  22.195  1.00 24.29 ?  841  ASP A CA    1 
ATOM   6445 C  C     . ASP C 3 775 ? -10.248 13.908  22.691  1.00 24.20 ?  841  ASP A C     1 
ATOM   6446 O  O     . ASP C 3 775 ? -11.314 13.950  22.098  1.00 25.66 ?  841  ASP A O     1 
ATOM   6447 C  CB    . ASP C 3 775 ? -9.679  11.528  22.026  1.00 23.81 ?  841  ASP A CB    1 
ATOM   6448 C  CG    . ASP C 3 775 ? -9.998  10.869  23.354  1.00 25.76 ?  841  ASP A CG    1 
ATOM   6449 O  OD1   . ASP C 3 775 ? -9.605  11.413  24.405  1.00 26.48 ?  841  ASP A OD1   1 
ATOM   6450 O  OD2   . ASP C 3 775 ? -10.646 9.811   23.357  1.00 28.43 ?  841  ASP A OD2   1 
ATOM   6451 N  N     . SER C 3 776 ? -10.017 14.689  23.748  1.00 24.28 ?  842  SER A N     1 
ATOM   6452 C  CA    . SER C 3 776 ? -10.999 15.710  24.146  1.00 23.47 ?  842  SER A CA    1 
ATOM   6453 C  C     . SER C 3 776 ? -10.895 16.908  23.209  1.00 23.00 ?  842  SER A C     1 
ATOM   6454 O  O     . SER C 3 776 ? -9.809  17.216  22.720  1.00 23.06 ?  842  SER A O     1 
ATOM   6455 C  CB    . SER C 3 776 ? -10.741 16.223  25.575  1.00 23.61 ?  842  SER A CB    1 
ATOM   6456 O  OG    . SER C 3 776 ? -10.905 15.204  26.554  1.00 25.65 ?  842  SER A OG    1 
ATOM   6457 N  N     . CYS C 3 777 ? -11.999 17.602  22.962  1.00 22.10 ?  843  CYS A N     1 
ATOM   6458 C  CA    . CYS C 3 777 ? -11.881 18.914  22.321  1.00 21.93 ?  843  CYS A CA    1 
ATOM   6459 C  C     . CYS C 3 777 ? -11.322 19.915  23.362  1.00 22.35 ?  843  CYS A C     1 
ATOM   6460 O  O     . CYS C 3 777 ? -11.480 19.702  24.568  1.00 21.60 ?  843  CYS A O     1 
ATOM   6461 C  CB    . CYS C 3 777 ? -13.227 19.354  21.721  1.00 21.94 ?  843  CYS A CB    1 
ATOM   6462 S  SG    . CYS C 3 777 ? -14.543 19.793  22.886  1.00 24.58 ?  843  CYS A SG    1 
ATOM   6463 N  N     . SER C 3 778 ? -10.636 20.976  22.928  1.00 22.09 ?  844  SER A N     1 
ATOM   6464 C  CA    . SER C 3 778 ? -9.967  21.833  23.909  1.00 22.67 ?  844  SER A CA    1 
ATOM   6465 C  C     . SER C 3 778 ? -10.974 22.646  24.720  1.00 23.59 ?  844  SER A C     1 
ATOM   6466 O  O     . SER C 3 778 ? -10.675 23.067  25.838  1.00 24.32 ?  844  SER A O     1 
ATOM   6467 C  CB    . SER C 3 778 ? -8.937  22.744  23.254  1.00 22.64 ?  844  SER A CB    1 
ATOM   6468 O  OG    . SER C 3 778 ? -9.586  23.666  22.408  1.00 22.95 ?  844  SER A OG    1 
ATOM   6469 N  N     . LEU C 3 779 ? -12.168 22.854  24.165  1.00 23.94 ?  845  LEU A N     1 
ATOM   6470 C  CA    . LEU C 3 779 ? -13.248 23.481  24.918  1.00 24.88 ?  845  LEU A CA    1 
ATOM   6471 C  C     . LEU C 3 779 ? -13.430 22.741  26.260  1.00 24.46 ?  845  LEU A C     1 
ATOM   6472 O  O     . LEU C 3 779 ? -13.457 23.351  27.317  1.00 23.96 ?  845  LEU A O     1 
ATOM   6473 C  CB    . LEU C 3 779 ? -14.548 23.454  24.110  1.00 25.26 ?  845  LEU A CB    1 
ATOM   6474 C  CG    . LEU C 3 779 ? -15.883 23.664  24.851  1.00 27.51 ?  845  LEU A CG    1 
ATOM   6475 C  CD1   . LEU C 3 779 ? -16.073 25.108  25.281  1.00 27.13 ?  845  LEU A CD1   1 
ATOM   6476 C  CD2   . LEU C 3 779 ? -17.063 23.214  23.976  1.00 30.83 ?  845  LEU A CD2   1 
ATOM   6477 N  N     . VAL C 3 780 ? -13.550 21.423  26.205  1.00 23.84 ?  846  VAL A N     1 
ATOM   6478 C  CA    . VAL C 3 780 ? -13.699 20.644  27.432  1.00 23.87 ?  846  VAL A CA    1 
ATOM   6479 C  C     . VAL C 3 780 ? -12.460 20.645  28.331  1.00 23.48 ?  846  VAL A C     1 
ATOM   6480 O  O     . VAL C 3 780 ? -12.568 20.859  29.534  1.00 23.65 ?  846  VAL A O     1 
ATOM   6481 C  CB    . VAL C 3 780 ? -14.113 19.208  27.113  1.00 24.50 ?  846  VAL A CB    1 
ATOM   6482 C  CG1   . VAL C 3 780 ? -14.108 18.354  28.383  1.00 24.23 ?  846  VAL A CG1   1 
ATOM   6483 C  CG2   . VAL C 3 780 ? -15.483 19.228  26.479  1.00 23.94 ?  846  VAL A CG2   1 
ATOM   6484 N  N     . SER C 3 781 ? -11.287 20.402  27.761  1.00 23.18 ?  847  SER A N     1 
ATOM   6485 C  CA    . SER C 3 781 ? -10.050 20.407  28.544  1.00 23.92 ?  847  SER A CA    1 
ATOM   6486 C  C     . SER C 3 781 ? -9.822  21.750  29.255  1.00 23.55 ?  847  SER A C     1 
ATOM   6487 O  O     . SER C 3 781 ? -9.505  21.795  30.435  1.00 23.80 ?  847  SER A O     1 
ATOM   6488 C  CB    . SER C 3 781 ? -8.861  20.117  27.644  1.00 23.67 ?  847  SER A CB    1 
ATOM   6489 O  OG    . SER C 3 781 ? -8.972  18.783  27.190  1.00 29.59 ?  847  SER A OG    1 
ATOM   6490 N  N     . ILE C 3 782 ? -9.960  22.839  28.521  1.00 23.14 ?  848  ILE A N     1 
ATOM   6491 C  CA    . ILE C 3 782 ? -9.704  24.144  29.094  1.00 24.09 ?  848  ILE A CA    1 
ATOM   6492 C  C     . ILE C 3 782 ? -10.673 24.452  30.235  1.00 24.02 ?  848  ILE A C     1 
ATOM   6493 O  O     . ILE C 3 782 ? -10.283 24.948  31.284  1.00 24.23 ?  848  ILE A O     1 
ATOM   6494 C  CB    . ILE C 3 782 ? -9.814  25.244  28.033  1.00 23.69 ?  848  ILE A CB    1 
ATOM   6495 C  CG1   . ILE C 3 782 ? -8.669  25.102  27.011  1.00 25.50 ?  848  ILE A CG1   1 
ATOM   6496 C  CG2   . ILE C 3 782 ? -9.811  26.615  28.691  1.00 24.96 ?  848  ILE A CG2   1 
ATOM   6497 C  CD1   . ILE C 3 782 ? -8.827  26.030  25.813  1.00 25.50 ?  848  ILE A CD1   1 
ATOM   6498 N  N     . VAL C 3 783 ? -11.949 24.184  30.017  1.00 24.60 ?  849  VAL A N     1 
ATOM   6499 C  CA    . VAL C 3 783 ? -12.934 24.513  31.026  1.00 24.24 ?  849  VAL A CA    1 
ATOM   6500 C  C     . VAL C 3 783 ? -12.706 23.654  32.273  1.00 24.80 ?  849  VAL A C     1 
ATOM   6501 O  O     . VAL C 3 783 ? -12.671 24.162  33.410  1.00 23.94 ?  849  VAL A O     1 
ATOM   6502 C  CB    . VAL C 3 783 ? -14.354 24.315  30.478  1.00 25.10 ?  849  VAL A CB    1 
ATOM   6503 C  CG1   . VAL C 3 783 ? -15.389 24.458  31.604  1.00 26.36 ?  849  VAL A CG1   1 
ATOM   6504 C  CG2   . VAL C 3 783 ? -14.626 25.337  29.356  1.00 24.04 ?  849  VAL A CG2   1 
ATOM   6505 N  N     . MET C 3 784 ? -12.527 22.350  32.066  1.00 24.17 ?  850  MET A N     1 
ATOM   6506 C  CA    . MET C 3 784 ? -12.209 21.469  33.181  1.00 24.67 ?  850  MET A CA    1 
ATOM   6507 C  C     . MET C 3 784 ? -10.989 21.950  33.952  1.00 24.57 ?  850  MET A C     1 
ATOM   6508 O  O     . MET C 3 784 ? -11.004 21.979  35.195  1.00 23.81 ?  850  MET A O     1 
ATOM   6509 C  CB    . MET C 3 784 ? -11.949 20.046  32.704  1.00 24.77 ?  850  MET A CB    1 
ATOM   6510 C  CG    . MET C 3 784 ? -13.189 19.333  32.270  1.00 27.46 ?  850  MET A CG    1 
ATOM   6511 S  SD    . MET C 3 784 ? -12.763 17.687  31.737  1.00 34.44 ?  850  MET A SD    1 
ATOM   6512 C  CE    . MET C 3 784 ? -12.193 17.031  33.310  1.00 26.03 ?  850  MET A CE    1 
ATOM   6513 N  N     . ASN C 3 785 ? -9.925  22.288  33.224  1.00 24.59 ?  851  ASN A N     1 
ATOM   6514 C  CA    . ASN C 3 785 ? -8.689  22.791  33.845  1.00 25.51 ?  851  ASN A CA    1 
ATOM   6515 C  C     . ASN C 3 785 ? -8.959  24.014  34.730  1.00 25.35 ?  851  ASN A C     1 
ATOM   6516 O  O     . ASN C 3 785 ? -8.472  24.115  35.852  1.00 25.54 ?  851  ASN A O     1 
ATOM   6517 C  CB    . ASN C 3 785 ? -7.640  23.185  32.783  1.00 25.36 ?  851  ASN A CB    1 
ATOM   6518 C  CG    . ASN C 3 785 ? -6.913  21.989  32.183  1.00 28.10 ?  851  ASN A CG    1 
ATOM   6519 O  OD1   . ASN C 3 785 ? -6.168  22.133  31.205  1.00 31.01 ?  851  ASN A OD1   1 
ATOM   6520 N  ND2   . ASN C 3 785 ? -7.135  20.802  32.745  1.00 28.42 ?  851  ASN A ND2   1 
ATOM   6521 N  N     . LYS C 3 786 ? -9.702  24.966  34.193  1.00 25.39 ?  852  LYS A N     1 
ATOM   6522 C  CA    . LYS C 3 786 ? -9.989  26.186  34.926  1.00 25.37 ?  852  LYS A CA    1 
ATOM   6523 C  C     . LYS C 3 786 ? -10.889 25.933  36.136  1.00 24.54 ?  852  LYS A C     1 
ATOM   6524 O  O     . LYS C 3 786 ? -10.670 26.515  37.203  1.00 24.37 ?  852  LYS A O     1 
ATOM   6525 C  CB    . LYS C 3 786 ? -10.578 27.256  33.991  1.00 25.67 ?  852  LYS A CB    1 
ATOM   6526 C  CG    . LYS C 3 786 ? -9.600  27.656  32.862  1.00 28.46 ?  852  LYS A CG    1 
ATOM   6527 C  CD    . LYS C 3 786 ? -10.038 28.914  32.096  1.00 33.06 ?  852  LYS A CD    1 
ATOM   6528 C  CE    . LYS C 3 786 ? -8.939  29.374  31.127  1.00 35.84 ?  852  LYS A CE    1 
ATOM   6529 N  NZ    . LYS C 3 786 ? -9.422  30.414  30.148  1.00 38.83 ?  852  LYS A NZ    1 
ATOM   6530 N  N     . VAL C 3 787 ? -11.885 25.064  35.978  1.00 23.47 ?  853  VAL A N     1 
ATOM   6531 C  CA    . VAL C 3 787 ? -12.777 24.703  37.094  1.00 23.07 ?  853  VAL A CA    1 
ATOM   6532 C  C     . VAL C 3 787 ? -11.993 24.037  38.225  1.00 23.31 ?  853  VAL A C     1 
ATOM   6533 O  O     . VAL C 3 787 ? -12.183 24.350  39.415  1.00 22.82 ?  853  VAL A O     1 
ATOM   6534 C  CB    . VAL C 3 787 ? -13.930 23.773  36.631  1.00 23.18 ?  853  VAL A CB    1 
ATOM   6535 C  CG1   . VAL C 3 787 ? -14.620 23.132  37.823  1.00 22.31 ?  853  VAL A CG1   1 
ATOM   6536 C  CG2   . VAL C 3 787 ? -14.938 24.554  35.783  1.00 21.62 ?  853  VAL A CG2   1 
ATOM   6537 N  N     . LEU C 3 788 ? -11.094 23.125  37.856  1.00 23.05 ?  854  LEU A N     1 
ATOM   6538 C  CA    . LEU C 3 788 ? -10.266 22.452  38.851  1.00 22.89 ?  854  LEU A CA    1 
ATOM   6539 C  C     . LEU C 3 788 ? -9.369  23.447  39.599  1.00 23.29 ?  854  LEU A C     1 
ATOM   6540 O  O     . LEU C 3 788 ? -9.215  23.369  40.827  1.00 22.70 ?  854  LEU A O     1 
ATOM   6541 C  CB    . LEU C 3 788 ? -9.460  21.318  38.219  1.00 22.02 ?  854  LEU A CB    1 
ATOM   6542 C  CG    . LEU C 3 788 ? -10.284 20.073  37.873  1.00 22.11 ?  854  LEU A CG    1 
ATOM   6543 C  CD1   . LEU C 3 788 ? -9.482  19.132  36.980  1.00 20.76 ?  854  LEU A CD1   1 
ATOM   6544 C  CD2   . LEU C 3 788 ? -10.782 19.317  39.140  1.00 20.28 ?  854  LEU A CD2   1 
ATOM   6545 N  N     . LYS C 3 789 ? -8.769  24.373  38.856  1.00 23.75 ?  855  LYS A N     1 
ATOM   6546 C  CA    . LYS C 3 789 ? -7.941  25.407  39.460  1.00 24.16 ?  855  LYS A CA    1 
ATOM   6547 C  C     . LYS C 3 789 ? -8.765  26.295  40.412  1.00 24.03 ?  855  LYS A C     1 
ATOM   6548 O  O     . LYS C 3 789 ? -8.363  26.546  41.550  1.00 23.25 ?  855  LYS A O     1 
ATOM   6549 C  CB    . LYS C 3 789 ? -7.251  26.259  38.374  1.00 24.80 ?  855  LYS A CB    1 
ATOM   6550 C  CG    . LYS C 3 789 ? -6.673  27.581  38.911  1.00 28.49 ?  855  LYS A CG    1 
ATOM   6551 C  CD    . LYS C 3 789 ? -6.063  28.436  37.792  1.00 33.05 ?  855  LYS A CD    1 
ATOM   6552 C  CE    . LYS C 3 789 ? -5.244  29.592  38.366  1.00 36.32 ?  855  LYS A CE    1 
ATOM   6553 N  NZ    . LYS C 3 789 ? -4.328  30.187  37.329  1.00 38.71 ?  855  LYS A NZ    1 
ATOM   6554 N  N     . LYS C 3 790 ? -9.927  26.748  39.959  1.00 24.06 ?  856  LYS A N     1 
ATOM   6555 C  CA    . LYS C 3 790 ? -10.764 27.608  40.789  1.00 24.18 ?  856  LYS A CA    1 
ATOM   6556 C  C     . LYS C 3 790 ? -11.211 26.906  42.067  1.00 24.43 ?  856  LYS A C     1 
ATOM   6557 O  O     . LYS C 3 790 ? -11.357 27.542  43.116  1.00 24.30 ?  856  LYS A O     1 
ATOM   6558 C  CB    . LYS C 3 790 ? -11.975 28.136  40.007  1.00 23.92 ?  856  LYS A CB    1 
ATOM   6559 C  CG    . LYS C 3 790 ? -11.604 29.144  38.905  1.00 24.66 ?  856  LYS A CG    1 
ATOM   6560 C  CD    . LYS C 3 790 ? -12.798 29.406  37.985  1.00 26.95 ?  856  LYS A CD    1 
ATOM   6561 C  CE    . LYS C 3 790 ? -12.398 30.212  36.737  1.00 28.81 ?  856  LYS A CE    1 
ATOM   6562 N  NZ    . LYS C 3 790 ? -11.951 31.572  37.135  1.00 29.23 ?  856  LYS A NZ    1 
ATOM   6563 N  N     . ILE C 3 791 ? -11.435 25.599  41.994  1.00 24.34 ?  857  ILE A N     1 
ATOM   6564 C  CA    . ILE C 3 791 ? -11.896 24.886  43.179  1.00 24.87 ?  857  ILE A CA    1 
ATOM   6565 C  C     . ILE C 3 791 ? -10.735 24.474  44.079  1.00 24.75 ?  857  ILE A C     1 
ATOM   6566 O  O     . ILE C 3 791 ? -10.661 24.888  45.231  1.00 24.77 ?  857  ILE A O     1 
ATOM   6567 C  CB    . ILE C 3 791 ? -12.785 23.672  42.822  1.00 25.19 ?  857  ILE A CB    1 
ATOM   6568 C  CG1   . ILE C 3 791 ? -14.129 24.168  42.271  1.00 25.75 ?  857  ILE A CG1   1 
ATOM   6569 C  CG2   . ILE C 3 791 ? -13.035 22.794  44.063  1.00 24.87 ?  857  ILE A CG2   1 
ATOM   6570 C  CD1   . ILE C 3 791 ? -14.903 23.102  41.538  1.00 25.50 ?  857  ILE A CD1   1 
ATOM   6571 N  N     . LEU C 3 792 ? -9.807  23.693  43.541  1.00 24.73 ?  858  LEU A N     1 
ATOM   6572 C  CA    . LEU C 3 792 ? -8.750  23.113  44.373  1.00 24.95 ?  858  LEU A CA    1 
ATOM   6573 C  C     . LEU C 3 792 ? -7.701  24.125  44.839  1.00 25.28 ?  858  LEU A C     1 
ATOM   6574 O  O     . LEU C 3 792 ? -7.155  24.002  45.929  1.00 25.53 ?  858  LEU A O     1 
ATOM   6575 C  CB    . LEU C 3 792 ? -8.092  21.930  43.673  1.00 24.81 ?  858  LEU A CB    1 
ATOM   6576 C  CG    . LEU C 3 792 ? -8.876  20.614  43.743  1.00 25.53 ?  858  LEU A CG    1 
ATOM   6577 C  CD1   . LEU C 3 792 ? -10.098 20.702  42.858  1.00 25.76 ?  858  LEU A CD1   1 
ATOM   6578 C  CD2   . LEU C 3 792 ? -8.007  19.443  43.312  1.00 28.30 ?  858  LEU A CD2   1 
ATOM   6579 N  N     . ILE C 3 793 ? -7.437  25.138  44.026  1.00 25.82 ?  859  ILE A N     1 
ATOM   6580 C  CA    . ILE C 3 793 ? -6.406  26.109  44.355  1.00 26.00 ?  859  ILE A CA    1 
ATOM   6581 C  C     . ILE C 3 793 ? -7.034  27.353  44.955  1.00 26.59 ?  859  ILE A C     1 
ATOM   6582 O  O     . ILE C 3 793 ? -6.668  27.775  46.057  1.00 26.31 ?  859  ILE A O     1 
ATOM   6583 C  CB    . ILE C 3 793 ? -5.529  26.444  43.123  1.00 26.31 ?  859  ILE A CB    1 
ATOM   6584 C  CG1   . ILE C 3 793 ? -4.707  25.214  42.729  1.00 26.76 ?  859  ILE A CG1   1 
ATOM   6585 C  CG2   . ILE C 3 793 ? -4.596  27.641  43.407  1.00 26.61 ?  859  ILE A CG2   1 
ATOM   6586 C  CD1   . ILE C 3 793 ? -3.888  25.388  41.438  1.00 25.53 ?  859  ILE A CD1   1 
ATOM   6587 N  N     . GLU C 3 794 ? -8.020  27.912  44.262  1.00 26.63 ?  860  GLU A N     1 
ATOM   6588 C  CA    . GLU C 3 794 ? -8.624  29.167  44.703  1.00 27.00 ?  860  GLU A CA    1 
ATOM   6589 C  C     . GLU C 3 794 ? -9.796  28.934  45.650  1.00 26.89 ?  860  GLU A C     1 
ATOM   6590 O  O     . GLU C 3 794 ? -10.307 29.869  46.233  1.00 26.46 ?  860  GLU A O     1 
ATOM   6591 C  CB    . GLU C 3 794 ? -9.037  30.022  43.489  1.00 26.99 ?  860  GLU A CB    1 
ATOM   6592 C  CG    . GLU C 3 794 ? -7.878  30.257  42.527  1.00 28.67 ?  860  GLU A CG    1 
ATOM   6593 C  CD    . GLU C 3 794 ? -8.298  30.864  41.199  1.00 31.22 ?  860  GLU A CD    1 
ATOM   6594 O  OE1   . GLU C 3 794 ? -9.479  31.228  41.022  1.00 31.84 ?  860  GLU A OE1   1 
ATOM   6595 O  OE2   . GLU C 3 794 ? -7.428  30.984  40.323  1.00 33.81 ?  860  GLU A OE2   1 
ATOM   6596 N  N     . ARG C 3 795 ? -10.218 27.684  45.814  1.00 26.88 ?  861  ARG A N     1 
ATOM   6597 C  CA    . ARG C 3 795 ? -11.325 27.393  46.727  1.00 27.09 ?  861  ARG A CA    1 
ATOM   6598 C  C     . ARG C 3 795 ? -12.470 28.354  46.449  1.00 26.69 ?  861  ARG A C     1 
ATOM   6599 O  O     . ARG C 3 795 ? -13.007 28.998  47.359  1.00 26.11 ?  861  ARG A O     1 
ATOM   6600 C  CB    . ARG C 3 795 ? -10.874 27.524  48.190  1.00 27.66 ?  861  ARG A CB    1 
ATOM   6601 C  CG    . ARG C 3 795 ? -9.749  26.554  48.572  1.00 30.03 ?  861  ARG A CG    1 
ATOM   6602 C  CD    . ARG C 3 795 ? -9.187  26.869  49.957  1.00 35.08 ?  861  ARG A CD    1 
ATOM   6603 N  NE    . ARG C 3 795 ? -10.230 26.803  50.977  1.00 40.32 ?  861  ARG A NE    1 
ATOM   6604 C  CZ    . ARG C 3 795 ? -10.640 25.679  51.560  1.00 43.33 ?  861  ARG A CZ    1 
ATOM   6605 N  NH1   . ARG C 3 795 ? -11.598 25.716  52.482  1.00 45.90 ?  861  ARG A NH1   1 
ATOM   6606 N  NH2   . ARG C 3 795 ? -10.089 24.519  51.231  1.00 44.47 ?  861  ARG A NH2   1 
ATOM   6607 N  N     . ASN C 3 796 ? -12.847 28.457  45.182  1.00 25.62 ?  862  ASN A N     1 
ATOM   6608 C  CA    . ASN C 3 796 ? -13.907 29.372  44.806  1.00 25.64 ?  862  ASN A CA    1 
ATOM   6609 C  C     . ASN C 3 796 ? -14.929 28.655  43.921  1.00 25.91 ?  862  ASN A C     1 
ATOM   6610 O  O     . ASN C 3 796 ? -14.907 28.774  42.690  1.00 24.90 ?  862  ASN A O     1 
ATOM   6611 C  CB    . ASN C 3 796 ? -13.300 30.594  44.120  1.00 25.38 ?  862  ASN A CB    1 
ATOM   6612 C  CG    . ASN C 3 796 ? -14.336 31.618  43.726  1.00 26.33 ?  862  ASN A CG    1 
ATOM   6613 O  OD1   . ASN C 3 796 ? -15.497 31.540  44.132  1.00 27.22 ?  862  ASN A OD1   1 
ATOM   6614 N  ND2   . ASN C 3 796 ? -13.919 32.597  42.936  1.00 26.90 ?  862  ASN A ND2   1 
ATOM   6615 N  N     . VAL C 3 797 ? -15.801 27.884  44.563  1.00 25.83 ?  863  VAL A N     1 
ATOM   6616 C  CA    . VAL C 3 797 ? -16.807 27.102  43.858  1.00 26.15 ?  863  VAL A CA    1 
ATOM   6617 C  C     . VAL C 3 797 ? -17.745 27.999  43.051  1.00 26.24 ?  863  VAL A C     1 
ATOM   6618 O  O     . VAL C 3 797 ? -18.067 27.702  41.899  1.00 26.55 ?  863  VAL A O     1 
ATOM   6619 C  CB    . VAL C 3 797 ? -17.611 26.221  44.857  1.00 26.45 ?  863  VAL A CB    1 
ATOM   6620 C  CG1   . VAL C 3 797 ? -18.742 25.491  44.153  1.00 26.02 ?  863  VAL A CG1   1 
ATOM   6621 C  CG2   . VAL C 3 797 ? -16.675 25.198  45.527  1.00 27.11 ?  863  VAL A CG2   1 
ATOM   6622 N  N     . ASP C 3 798 ? -18.159 29.103  43.664  1.00 26.45 ?  864  ASP A N     1 
ATOM   6623 C  CA    . ASP C 3 798 ? -19.008 30.104  43.017  1.00 26.49 ?  864  ASP A CA    1 
ATOM   6624 C  C     . ASP C 3 798 ? -18.416 30.570  41.698  1.00 25.07 ?  864  ASP A C     1 
ATOM   6625 O  O     . ASP C 3 798 ? -19.118 30.660  40.694  1.00 24.73 ?  864  ASP A O     1 
ATOM   6626 C  CB    . ASP C 3 798 ? -19.166 31.345  43.902  1.00 27.15 ?  864  ASP A CB    1 
ATOM   6627 C  CG    . ASP C 3 798 ? -20.047 31.114  45.135  1.00 30.01 ?  864  ASP A CG    1 
ATOM   6628 O  OD1   . ASP C 3 798 ? -20.869 30.174  45.164  1.00 32.52 ?  864  ASP A OD1   1 
ATOM   6629 O  OD2   . ASP C 3 798 ? -19.936 31.936  46.076  1.00 33.36 ?  864  ASP A OD2   1 
ATOM   6630 N  N     . GLY C 3 799 ? -17.137 30.935  41.720  1.00 24.12 ?  865  GLY A N     1 
ATOM   6631 C  CA    . GLY C 3 799 ? -16.473 31.394  40.516  1.00 23.34 ?  865  GLY A CA    1 
ATOM   6632 C  C     . GLY C 3 799 ? -16.407 30.280  39.480  1.00 23.21 ?  865  GLY A C     1 
ATOM   6633 O  O     . GLY C 3 799 ? -16.582 30.522  38.289  1.00 22.66 ?  865  GLY A O     1 
ATOM   6634 N  N     . ALA C 3 800 ? -16.144 29.052  39.924  1.00 22.18 ?  866  ALA A N     1 
ATOM   6635 C  CA    . ALA C 3 800 ? -16.146 27.929  38.984  1.00 21.72 ?  866  ALA A CA    1 
ATOM   6636 C  C     . ALA C 3 800 ? -17.518 27.775  38.316  1.00 21.55 ?  866  ALA A C     1 
ATOM   6637 O  O     . ALA C 3 800 ? -17.616 27.587  37.095  1.00 20.74 ?  866  ALA A O     1 
ATOM   6638 C  CB    . ALA C 3 800 ? -15.720 26.625  39.685  1.00 21.28 ?  866  ALA A CB    1 
ATOM   6639 N  N     . LEU C 3 801 ? -18.587 27.877  39.110  1.00 21.40 ?  867  LEU A N     1 
ATOM   6640 C  CA    . LEU C 3 801 ? -19.932 27.686  38.547  1.00 21.24 ?  867  LEU A CA    1 
ATOM   6641 C  C     . LEU C 3 801 ? -20.295 28.824  37.585  1.00 20.79 ?  867  LEU A C     1 
ATOM   6642 O  O     . LEU C 3 801 ? -20.917 28.600  36.552  1.00 21.44 ?  867  LEU A O     1 
ATOM   6643 C  CB    . LEU C 3 801 ? -20.993 27.552  39.649  1.00 20.67 ?  867  LEU A CB    1 
ATOM   6644 C  CG    . LEU C 3 801 ? -20.854 26.378  40.621  1.00 21.97 ?  867  LEU A CG    1 
ATOM   6645 C  CD1   . LEU C 3 801 ? -22.000 26.398  41.677  1.00 21.39 ?  867  LEU A CD1   1 
ATOM   6646 C  CD2   . LEU C 3 801 ? -20.819 25.046  39.873  1.00 19.94 ?  867  LEU A CD2   1 
ATOM   6647 N  N     . ALA C 3 802 ? -19.923 30.046  37.930  1.00 20.71 ?  868  ALA A N     1 
ATOM   6648 C  CA    . ALA C 3 802 ? -20.179 31.189  37.041  1.00 20.30 ?  868  ALA A CA    1 
ATOM   6649 C  C     . ALA C 3 802 ? -19.462 30.976  35.699  1.00 20.52 ?  868  ALA A C     1 
ATOM   6650 O  O     . ALA C 3 802 ? -19.971 31.312  34.626  1.00 19.70 ?  868  ALA A O     1 
ATOM   6651 C  CB    . ALA C 3 802 ? -19.715 32.490  37.699  1.00 20.27 ?  868  ALA A CB    1 
ATOM   6652 N  N     . PHE C 3 803 ? -18.258 30.437  35.769  1.00 20.51 ?  869  PHE A N     1 
ATOM   6653 C  CA    . PHE C 3 803 ? -17.507 30.187  34.558  1.00 21.18 ?  869  PHE A CA    1 
ATOM   6654 C  C     . PHE C 3 803 ? -18.162 29.093  33.700  1.00 20.39 ?  869  PHE A C     1 
ATOM   6655 O  O     . PHE C 3 803 ? -18.274 29.249  32.472  1.00 20.72 ?  869  PHE A O     1 
ATOM   6656 C  CB    . PHE C 3 803 ? -16.055 29.861  34.893  1.00 21.45 ?  869  PHE A CB    1 
ATOM   6657 C  CG    . PHE C 3 803 ? -15.231 29.514  33.694  1.00 23.64 ?  869  PHE A CG    1 
ATOM   6658 C  CD1   . PHE C 3 803 ? -14.889 30.490  32.758  1.00 25.37 ?  869  PHE A CD1   1 
ATOM   6659 C  CD2   . PHE C 3 803 ? -14.787 28.211  33.500  1.00 24.26 ?  869  PHE A CD2   1 
ATOM   6660 C  CE1   . PHE C 3 803 ? -14.107 30.158  31.646  1.00 24.91 ?  869  PHE A CE1   1 
ATOM   6661 C  CE2   . PHE C 3 803 ? -14.012 27.883  32.379  1.00 25.42 ?  869  PHE A CE2   1 
ATOM   6662 C  CZ    . PHE C 3 803 ? -13.682 28.854  31.467  1.00 25.49 ?  869  PHE A CZ    1 
ATOM   6663 N  N     . VAL C 3 804 ? -18.628 28.018  34.333  1.00 19.68 ?  870  VAL A N     1 
ATOM   6664 C  CA    . VAL C 3 804 ? -19.328 26.946  33.619  1.00 19.35 ?  870  VAL A CA    1 
ATOM   6665 C  C     . VAL C 3 804 ? -20.612 27.475  32.957  1.00 19.10 ?  870  VAL A C     1 
ATOM   6666 O  O     . VAL C 3 804 ? -20.885 27.195  31.783  1.00 19.60 ?  870  VAL A O     1 
ATOM   6667 C  CB    . VAL C 3 804 ? -19.680 25.748  34.562  1.00 20.46 ?  870  VAL A CB    1 
ATOM   6668 C  CG1   . VAL C 3 804 ? -20.582 24.729  33.834  1.00 19.67 ?  870  VAL A CG1   1 
ATOM   6669 C  CG2   . VAL C 3 804 ? -18.407 25.056  35.079  1.00 20.44 ?  870  VAL A CG2   1 
ATOM   6670 N  N     . ARG C 3 805 ? -21.387 28.276  33.686  1.00 18.17 ?  871  ARG A N     1 
ATOM   6671 C  CA    . ARG C 3 805 ? -22.632 28.836  33.142  1.00 17.58 ?  871  ARG A CA    1 
ATOM   6672 C  C     . ARG C 3 805 ? -22.363 29.747  31.947  1.00 18.13 ?  871  ARG A C     1 
ATOM   6673 O  O     . ARG C 3 805 ? -23.100 29.729  30.947  1.00 16.80 ?  871  ARG A O     1 
ATOM   6674 C  CB    . ARG C 3 805 ? -23.370 29.638  34.219  1.00 17.77 ?  871  ARG A CB    1 
ATOM   6675 C  CG    . ARG C 3 805 ? -23.886 28.786  35.357  1.00 16.75 ?  871  ARG A CG    1 
ATOM   6676 C  CD    . ARG C 3 805 ? -23.850 29.578  36.670  1.00 18.52 ?  871  ARG A CD    1 
ATOM   6677 N  NE    . ARG C 3 805 ? -24.404 28.823  37.796  1.00 17.37 ?  871  ARG A NE    1 
ATOM   6678 C  CZ    . ARG C 3 805 ? -24.316 29.214  39.059  1.00 18.67 ?  871  ARG A CZ    1 
ATOM   6679 N  NH1   . ARG C 3 805 ? -23.686 30.338  39.347  1.00 18.27 ?  871  ARG A NH1   1 
ATOM   6680 N  NH2   . ARG C 3 805 ? -24.864 28.486  40.034  1.00 18.38 ?  871  ARG A NH2   1 
ATOM   6681 N  N     . GLU C 3 806 ? -21.309 30.551  32.057  1.00 18.33 ?  872  GLU A N     1 
ATOM   6682 C  CA    . GLU C 3 806 ? -20.918 31.415  30.945  1.00 19.46 ?  872  GLU A CA    1 
ATOM   6683 C  C     . GLU C 3 806 ? -20.549 30.557  29.720  1.00 19.61 ?  872  GLU A C     1 
ATOM   6684 O  O     . GLU C 3 806 ? -20.896 30.890  28.570  1.00 19.55 ?  872  GLU A O     1 
ATOM   6685 C  CB    . GLU C 3 806 ? -19.736 32.303  31.347  1.00 19.87 ?  872  GLU A CB    1 
ATOM   6686 C  CG    . GLU C 3 806 ? -19.437 33.436  30.355  1.00 21.38 ?  872  GLU A CG    1 
ATOM   6687 C  CD    . GLU C 3 806 ? -20.540 34.472  30.337  1.00 26.06 ?  872  GLU A CD    1 
ATOM   6688 O  OE1   . GLU C 3 806 ? -21.323 34.521  31.320  1.00 26.76 ?  872  GLU A OE1   1 
ATOM   6689 O  OE2   . GLU C 3 806 ? -20.617 35.249  29.362  1.00 26.87 ?  872  GLU A OE2   1 
ATOM   6690 N  N     . THR C 3 807 ? -19.845 29.464  29.981  1.00 19.33 ?  873  THR A N     1 
ATOM   6691 C  CA    . THR C 3 807 ? -19.371 28.573  28.934  1.00 20.37 ?  873  THR A CA    1 
ATOM   6692 C  C     . THR C 3 807 ? -20.566 27.939  28.240  1.00 19.92 ?  873  THR A C     1 
ATOM   6693 O  O     . THR C 3 807 ? -20.596 27.854  27.021  1.00 19.99 ?  873  THR A O     1 
ATOM   6694 C  CB    . THR C 3 807 ? -18.468 27.462  29.493  1.00 20.00 ?  873  THR A CB    1 
ATOM   6695 O  OG1   . THR C 3 807 ? -17.289 28.036  30.073  1.00 21.43 ?  873  THR A OG1   1 
ATOM   6696 C  CG2   . THR C 3 807 ? -18.070 26.476  28.393  1.00 21.54 ?  873  THR A CG2   1 
ATOM   6697 N  N     . ILE C 3 808 ? -21.555 27.516  29.026  1.00 19.72 ?  874  ILE A N     1 
ATOM   6698 C  CA    . ILE C 3 808 ? -22.770 26.908  28.486  1.00 19.39 ?  874  ILE A CA    1 
ATOM   6699 C  C     . ILE C 3 808 ? -23.465 27.911  27.560  1.00 19.00 ?  874  ILE A C     1 
ATOM   6700 O  O     . ILE C 3 808 ? -23.898 27.566  26.460  1.00 18.08 ?  874  ILE A O     1 
ATOM   6701 C  CB    . ILE C 3 808 ? -23.731 26.481  29.642  1.00 19.25 ?  874  ILE A CB    1 
ATOM   6702 C  CG1   . ILE C 3 808 ? -23.149 25.297  30.410  1.00 19.22 ?  874  ILE A CG1   1 
ATOM   6703 C  CG2   . ILE C 3 808 ? -25.114 26.150  29.119  1.00 20.04 ?  874  ILE A CG2   1 
ATOM   6704 C  CD1   . ILE C 3 808 ? -23.945 24.934  31.696  1.00 20.78 ?  874  ILE A CD1   1 
ATOM   6705 N  N     . ASN C 3 809 ? -23.550 29.162  28.012  1.00 18.77 ?  875  ASN A N     1 
ATOM   6706 C  CA    . ASN C 3 809 ? -24.153 30.235  27.219  1.00 18.49 ?  875  ASN A CA    1 
ATOM   6707 C  C     . ASN C 3 809 ? -23.403 30.444  25.898  1.00 18.66 ?  875  ASN A C     1 
ATOM   6708 O  O     . ASN C 3 809 ? -24.010 30.656  24.849  1.00 18.09 ?  875  ASN A O     1 
ATOM   6709 C  CB    . ASN C 3 809 ? -24.171 31.547  28.004  1.00 18.15 ?  875  ASN A CB    1 
ATOM   6710 C  CG    . ASN C 3 809 ? -25.213 32.528  27.484  1.00 18.10 ?  875  ASN A CG    1 
ATOM   6711 O  OD1   . ASN C 3 809 ? -26.386 32.184  27.341  1.00 18.73 ?  875  ASN A OD1   1 
ATOM   6712 N  ND2   . ASN C 3 809 ? -24.787 33.752  27.185  1.00 16.80 ?  875  ASN A ND2   1 
ATOM   6713 N  N     . ASP C 3 810 ? -22.078 30.387  25.968  1.00 19.53 ?  876  ASP A N     1 
ATOM   6714 C  CA    . ASP C 3 810 ? -21.244 30.624  24.788  1.00 20.21 ?  876  ASP A CA    1 
ATOM   6715 C  C     . ASP C 3 810 ? -21.485 29.505  23.767  1.00 20.10 ?  876  ASP A C     1 
ATOM   6716 O  O     . ASP C 3 810 ? -21.635 29.772  22.579  1.00 19.76 ?  876  ASP A O     1 
ATOM   6717 C  CB    . ASP C 3 810 ? -19.771 30.671  25.179  1.00 20.41 ?  876  ASP A CB    1 
ATOM   6718 C  CG    . ASP C 3 810 ? -19.378 31.987  25.842  1.00 22.06 ?  876  ASP A CG    1 
ATOM   6719 O  OD1   . ASP C 3 810 ? -20.108 32.996  25.700  1.00 22.93 ?  876  ASP A OD1   1 
ATOM   6720 O  OD2   . ASP C 3 810 ? -18.319 32.013  26.499  1.00 25.28 ?  876  ASP A OD2   1 
ATOM   6721 N  N     . ILE C 3 811 ? -21.556 28.269  24.244  1.00 20.35 ?  877  ILE A N     1 
ATOM   6722 C  CA    . ILE C 3 811 ? -21.819 27.131  23.347  1.00 20.97 ?  877  ILE A CA    1 
ATOM   6723 C  C     . ILE C 3 811 ? -23.143 27.346  22.635  1.00 21.30 ?  877  ILE A C     1 
ATOM   6724 O  O     . ILE C 3 811 ? -23.215 27.303  21.405  1.00 21.81 ?  877  ILE A O     1 
ATOM   6725 C  CB    . ILE C 3 811 ? -21.835 25.775  24.104  1.00 21.01 ?  877  ILE A CB    1 
ATOM   6726 C  CG1   . ILE C 3 811 ? -20.437 25.431  24.630  1.00 20.63 ?  877  ILE A CG1   1 
ATOM   6727 C  CG2   . ILE C 3 811 ? -22.315 24.632  23.167  1.00 21.63 ?  877  ILE A CG2   1 
ATOM   6728 C  CD1   . ILE C 3 811 ? -20.416 24.222  25.558  1.00 21.07 ?  877  ILE A CD1   1 
ATOM   6729 N  N     . LEU C 3 812 ? -24.187 27.630  23.409  1.00 21.44 ?  878  LEU A N     1 
ATOM   6730 C  CA    . LEU C 3 812 ? -25.530 27.704  22.873  1.00 21.83 ?  878  LEU A CA    1 
ATOM   6731 C  C     . LEU C 3 812 ? -25.740 28.926  21.987  1.00 22.39 ?  878  LEU A C     1 
ATOM   6732 O  O     . LEU C 3 812 ? -26.629 28.931  21.141  1.00 22.40 ?  878  LEU A O     1 
ATOM   6733 C  CB    . LEU C 3 812 ? -26.563 27.690  24.008  1.00 22.33 ?  878  LEU A CB    1 
ATOM   6734 C  CG    . LEU C 3 812 ? -26.649 26.333  24.714  1.00 23.64 ?  878  LEU A CG    1 
ATOM   6735 C  CD1   . LEU C 3 812 ? -27.754 26.336  25.759  1.00 23.85 ?  878  LEU A CD1   1 
ATOM   6736 C  CD2   . LEU C 3 812 ? -26.904 25.255  23.663  1.00 24.67 ?  878  LEU A CD2   1 
ATOM   6737 N  N     . HIS C 3 813 ? -24.947 29.973  22.187  1.00 21.99 ?  879  HIS A N     1 
ATOM   6738 C  CA    . HIS C 3 813 ? -25.061 31.140  21.317  1.00 22.32 ?  879  HIS A CA    1 
ATOM   6739 C  C     . HIS C 3 813 ? -23.932 31.195  20.272  1.00 23.10 ?  879  HIS A C     1 
ATOM   6740 O  O     . HIS C 3 813 ? -23.625 32.248  19.752  1.00 22.92 ?  879  HIS A O     1 
ATOM   6741 C  CB    . HIS C 3 813 ? -25.176 32.433  22.145  1.00 22.86 ?  879  HIS A CB    1 
ATOM   6742 C  CG    . HIS C 3 813 ? -26.517 32.597  22.796  1.00 20.62 ?  879  HIS A CG    1 
ATOM   6743 N  ND1   . HIS C 3 813 ? -26.869 31.932  23.951  1.00 20.41 ?  879  HIS A ND1   1 
ATOM   6744 C  CD2   . HIS C 3 813 ? -27.617 33.285  22.411  1.00 19.68 ?  879  HIS A CD2   1 
ATOM   6745 C  CE1   . HIS C 3 813 ? -28.117 32.229  24.269  1.00 18.10 ?  879  HIS A CE1   1 
ATOM   6746 N  NE2   . HIS C 3 813 ? -28.595 33.048  23.349  1.00 21.38 ?  879  HIS A NE2   1 
ATOM   6747 N  N     . ASN C 3 814 ? -23.323 30.048  19.971  1.00 23.64 ?  880  ASN A N     1 
ATOM   6748 C  CA    A ASN C 3 814 ? -22.307 29.981  18.909  0.50 23.91 ?  880  ASN A CA    1 
ATOM   6749 C  CA    B ASN C 3 814 ? -22.294 29.966  18.930  0.50 24.32 ?  880  ASN A CA    1 
ATOM   6750 C  C     . ASN C 3 814 ? -21.171 30.985  19.089  1.00 24.19 ?  880  ASN A C     1 
ATOM   6751 O  O     . ASN C 3 814 ? -20.750 31.635  18.127  1.00 24.71 ?  880  ASN A O     1 
ATOM   6752 C  CB    A ASN C 3 814 ? -22.958 30.196  17.536  0.50 23.80 ?  880  ASN A CB    1 
ATOM   6753 C  CB    B ASN C 3 814 ? -22.946 30.078  17.552  0.50 24.65 ?  880  ASN A CB    1 
ATOM   6754 C  CG    A ASN C 3 814 ? -22.134 29.613  16.396  0.50 23.34 ?  880  ASN A CG    1 
ATOM   6755 C  CG    B ASN C 3 814 ? -23.964 28.981  17.315  0.50 25.66 ?  880  ASN A CG    1 
ATOM   6756 O  OD1   A ASN C 3 814 ? -21.472 28.587  16.548  0.50 23.09 ?  880  ASN A OD1   1 
ATOM   6757 O  OD1   B ASN C 3 814 ? -25.167 29.182  17.497  0.50 28.44 ?  880  ASN A OD1   1 
ATOM   6758 N  ND2   A ASN C 3 814 ? -22.185 30.262  15.245  0.50 22.95 ?  880  ASN A ND2   1 
ATOM   6759 N  ND2   B ASN C 3 814 ? -23.485 27.800  16.947  0.50 27.33 ?  880  ASN A ND2   1 
ATOM   6760 N  N     . ARG C 3 815 ? -20.673 31.122  20.311  1.00 23.85 ?  881  ARG A N     1 
ATOM   6761 C  CA    A ARG C 3 815 ? -19.600 32.071  20.580  0.50 23.89 ?  881  ARG A CA    1 
ATOM   6762 C  CA    B ARG C 3 815 ? -19.611 32.076  20.599  0.50 23.77 ?  881  ARG A CA    1 
ATOM   6763 C  C     . ARG C 3 815 ? -18.269 31.363  20.810  1.00 23.92 ?  881  ARG A C     1 
ATOM   6764 O  O     . ARG C 3 815 ? -17.296 31.972  21.232  1.00 24.18 ?  881  ARG A O     1 
ATOM   6765 C  CB    A ARG C 3 815 ? -19.945 32.948  21.788  0.50 23.99 ?  881  ARG A CB    1 
ATOM   6766 C  CB    B ARG C 3 815 ? -19.975 32.917  21.835  0.50 23.79 ?  881  ARG A CB    1 
ATOM   6767 C  CG    A ARG C 3 815 ? -20.732 34.203  21.434  0.50 24.30 ?  881  ARG A CG    1 
ATOM   6768 C  CG    B ARG C 3 815 ? -21.240 33.779  21.671  0.50 23.45 ?  881  ARG A CG    1 
ATOM   6769 C  CD    A ARG C 3 815 ? -21.259 34.912  22.686  0.50 25.38 ?  881  ARG A CD    1 
ATOM   6770 C  CD    B ARG C 3 815 ? -21.576 34.571  22.955  0.50 24.10 ?  881  ARG A CD    1 
ATOM   6771 N  NE    A ARG C 3 815 ? -20.406 34.711  23.859  0.50 26.21 ?  881  ARG A NE    1 
ATOM   6772 N  NE    B ARG C 3 815 ? -22.374 35.773  22.691  0.50 23.57 ?  881  ARG A NE    1 
ATOM   6773 C  CZ    A ARG C 3 815 ? -19.525 35.602  24.306  0.50 25.98 ?  881  ARG A CZ    1 
ATOM   6774 C  CZ    B ARG C 3 815 ? -22.923 36.547  23.630  0.50 23.59 ?  881  ARG A CZ    1 
ATOM   6775 N  NH1   A ARG C 3 815 ? -18.792 35.337  25.380  0.50 25.45 ?  881  ARG A NH1   1 
ATOM   6776 N  NH1   B ARG C 3 815 ? -23.628 37.614  23.285  0.50 23.88 ?  881  ARG A NH1   1 
ATOM   6777 N  NH2   A ARG C 3 815 ? -19.371 36.754  23.674  0.50 25.55 ?  881  ARG A NH2   1 
ATOM   6778 N  NH2   B ARG C 3 815 ? -22.781 36.258  24.918  0.50 23.85 ?  881  ARG A NH2   1 
ATOM   6779 N  N     . VAL C 3 816 ? -18.229 30.066  20.533  1.00 23.50 ?  882  VAL A N     1 
ATOM   6780 C  CA    . VAL C 3 816 ? -17.009 29.289  20.728  1.00 23.31 ?  882  VAL A CA    1 
ATOM   6781 C  C     . VAL C 3 816 ? -16.285 29.077  19.383  1.00 23.35 ?  882  VAL A C     1 
ATOM   6782 O  O     . VAL C 3 816 ? -16.848 28.505  18.461  1.00 23.41 ?  882  VAL A O     1 
ATOM   6783 C  CB    . VAL C 3 816 ? -17.323 27.925  21.387  1.00 23.42 ?  882  VAL A CB    1 
ATOM   6784 C  CG1   . VAL C 3 816 ? -16.052 27.108  21.595  1.00 23.57 ?  882  VAL A CG1   1 
ATOM   6785 C  CG2   . VAL C 3 816 ? -18.051 28.113  22.740  1.00 22.42 ?  882  VAL A CG2   1 
ATOM   6786 N  N     . ASP C 3 817 ? -15.042 29.532  19.280  1.00 22.80 ?  883  ASP A N     1 
ATOM   6787 C  CA    . ASP C 3 817 ? -14.253 29.319  18.062  1.00 23.56 ?  883  ASP A CA    1 
ATOM   6788 C  C     . ASP C 3 817 ? -14.165 27.840  17.662  1.00 23.07 ?  883  ASP A C     1 
ATOM   6789 O  O     . ASP C 3 817 ? -13.951 26.964  18.515  1.00 22.89 ?  883  ASP A O     1 
ATOM   6790 C  CB    . ASP C 3 817 ? -12.835 29.859  18.248  1.00 23.75 ?  883  ASP A CB    1 
ATOM   6791 C  CG    . ASP C 3 817 ? -12.063 29.877  16.957  1.00 24.85 ?  883  ASP A CG    1 
ATOM   6792 O  OD1   . ASP C 3 817 ? -12.212 30.862  16.218  1.00 25.95 ?  883  ASP A OD1   1 
ATOM   6793 O  OD2   . ASP C 3 817 ? -11.350 28.890  16.666  1.00 26.85 ?  883  ASP A OD2   1 
ATOM   6794 N  N     . ILE C 3 818 ? -14.311 27.559  16.370  1.00 22.54 ?  884  ILE A N     1 
ATOM   6795 C  CA    . ILE C 3 818 ? -14.304 26.165  15.899  1.00 22.37 ?  884  ILE A CA    1 
ATOM   6796 C  C     . ILE C 3 818 ? -13.065 25.392  16.351  1.00 21.55 ?  884  ILE A C     1 
ATOM   6797 O  O     . ILE C 3 818 ? -13.105 24.175  16.488  1.00 21.87 ?  884  ILE A O     1 
ATOM   6798 C  CB    . ILE C 3 818 ? -14.418 26.086  14.358  1.00 22.83 ?  884  ILE A CB    1 
ATOM   6799 C  CG1   . ILE C 3 818 ? -14.635 24.635  13.884  1.00 23.11 ?  884  ILE A CG1   1 
ATOM   6800 C  CG2   . ILE C 3 818 ? -13.188 26.674  13.714  1.00 21.88 ?  884  ILE A CG2   1 
ATOM   6801 C  CD1   . ILE C 3 818 ? -14.967 24.535  12.377  1.00 24.62 ?  884  ILE A CD1   1 
ATOM   6802 N  N     . SER C 3 819 ? -11.964 26.091  16.596  1.00 21.69 ?  885  SER A N     1 
ATOM   6803 C  CA    . SER C 3 819 ? -10.740 25.418  17.013  1.00 22.17 ?  885  SER A CA    1 
ATOM   6804 C  C     . SER C 3 819 ? -10.912 24.655  18.333  1.00 21.91 ?  885  SER A C     1 
ATOM   6805 O  O     . SER C 3 819 ? -10.289 23.615  18.531  1.00 21.73 ?  885  SER A O     1 
ATOM   6806 C  CB    . SER C 3 819 ? -9.577  26.405  17.127  1.00 22.22 ?  885  SER A CB    1 
ATOM   6807 O  OG    . SER C 3 819 ? -9.848  27.382  18.116  1.00 24.56 ?  885  SER A OG    1 
ATOM   6808 N  N     . LYS C 3 820 ? -11.753 25.174  19.229  1.00 21.17 ?  886  LYS A N     1 
ATOM   6809 C  CA    . LYS C 3 820 ? -12.015 24.513  20.507  1.00 21.47 ?  886  LYS A CA    1 
ATOM   6810 C  C     . LYS C 3 820 ? -12.999 23.358  20.409  1.00 20.95 ?  886  LYS A C     1 
ATOM   6811 O  O     . LYS C 3 820 ? -13.202 22.631  21.380  1.00 21.03 ?  886  LYS A O     1 
ATOM   6812 C  CB    . LYS C 3 820 ? -12.509 25.535  21.538  1.00 21.78 ?  886  LYS A CB    1 
ATOM   6813 C  CG    . LYS C 3 820 ? -11.459 26.595  21.874  1.00 24.37 ?  886  LYS A CG    1 
ATOM   6814 C  CD    . LYS C 3 820 ? -12.145 27.767  22.534  1.00 31.30 ?  886  LYS A CD    1 
ATOM   6815 C  CE    . LYS C 3 820 ? -11.346 28.316  23.688  1.00 33.83 ?  886  LYS A CE    1 
ATOM   6816 N  NZ    . LYS C 3 820 ? -10.286 29.206  23.182  1.00 34.31 ?  886  LYS A NZ    1 
ATOM   6817 N  N     . LEU C 3 821 ? -13.623 23.192  19.247  1.00 21.08 ?  887  LEU A N     1 
ATOM   6818 C  CA    . LEU C 3 821 ? -14.585 22.101  19.032  1.00 21.11 ?  887  LEU A CA    1 
ATOM   6819 C  C     . LEU C 3 821 ? -13.994 20.888  18.290  1.00 21.27 ?  887  LEU A C     1 
ATOM   6820 O  O     . LEU C 3 821 ? -14.642 19.818  18.178  1.00 21.29 ?  887  LEU A O     1 
ATOM   6821 C  CB    . LEU C 3 821 ? -15.830 22.620  18.285  1.00 20.86 ?  887  LEU A CB    1 
ATOM   6822 C  CG    . LEU C 3 821 ? -16.475 23.875  18.906  1.00 22.26 ?  887  LEU A CG    1 
ATOM   6823 C  CD1   . LEU C 3 821 ? -17.605 24.434  18.026  1.00 23.50 ?  887  LEU A CD1   1 
ATOM   6824 C  CD2   . LEU C 3 821 ? -16.971 23.590  20.345  1.00 20.84 ?  887  LEU A CD2   1 
ATOM   6825 N  N     . ILE C 3 822 ? -12.782 21.062  17.763  1.00 20.73 ?  888  ILE A N     1 
ATOM   6826 C  CA    . ILE C 3 822 ? -12.096 19.993  17.038  1.00 20.25 ?  888  ILE A CA    1 
ATOM   6827 C  C     . ILE C 3 822 ? -11.722 18.864  17.987  1.00 20.48 ?  888  ILE A C     1 
ATOM   6828 O  O     . ILE C 3 822 ? -11.101 19.081  19.034  1.00 19.68 ?  888  ILE A O     1 
ATOM   6829 C  CB    . ILE C 3 822 ? -10.822 20.499  16.313  1.00 20.51 ?  888  ILE A CB    1 
ATOM   6830 C  CG1   . ILE C 3 822 ? -11.192 21.527  15.222  1.00 19.28 ?  888  ILE A CG1   1 
ATOM   6831 C  CG2   . ILE C 3 822 ? -10.065 19.337  15.698  1.00 19.85 ?  888  ILE A CG2   1 
ATOM   6832 C  CD1   . ILE C 3 822 ? -9.965  22.250  14.577  1.00 20.33 ?  888  ILE A CD1   1 
ATOM   6833 N  N     . ILE C 3 823 ? -12.143 17.667  17.616  1.00 20.18 ?  889  ILE A N     1 
ATOM   6834 C  CA    . ILE C 3 823 ? -11.818 16.448  18.322  1.00 21.34 ?  889  ILE A CA    1 
ATOM   6835 C  C     . ILE C 3 823 ? -10.861 15.671  17.397  1.00 21.74 ?  889  ILE A C     1 
ATOM   6836 O  O     . ILE C 3 823 ? -11.075 15.662  16.189  1.00 20.76 ?  889  ILE A O     1 
ATOM   6837 C  CB    . ILE C 3 823 ? -13.102 15.636  18.522  1.00 21.55 ?  889  ILE A CB    1 
ATOM   6838 C  CG1   . ILE C 3 823 ? -14.093 16.405  19.423  1.00 22.61 ?  889  ILE A CG1   1 
ATOM   6839 C  CG2   . ILE C 3 823 ? -12.789 14.233  19.034  1.00 22.35 ?  889  ILE A CG2   1 
ATOM   6840 C  CD1   . ILE C 3 823 ? -15.571 15.932  19.261  1.00 23.17 ?  889  ILE A CD1   1 
ATOM   6841 N  N     . SER C 3 824 ? -9.799  15.077  17.944  1.00 21.55 ?  890  SER A N     1 
ATOM   6842 C  CA    . SER C 3 824 ? -8.846  14.304  17.127  1.00 22.79 ?  890  SER A CA    1 
ATOM   6843 C  C     . SER C 3 824 ? -8.780  12.871  17.620  1.00 22.84 ?  890  SER A C     1 
ATOM   6844 O  O     . SER C 3 824 ? -8.623  12.645  18.825  1.00 22.81 ?  890  SER A O     1 
ATOM   6845 C  CB    . SER C 3 824 ? -7.435  14.901  17.214  1.00 22.99 ?  890  SER A CB    1 
ATOM   6846 O  OG    . SER C 3 824 ? -7.450  16.278  16.905  1.00 27.31 ?  890  SER A OG    1 
ATOM   6847 N  N     . LYS C 3 825 ? -8.901  11.910  16.702  1.00 22.16 ?  891  LYS A N     1 
ATOM   6848 C  CA    . LYS C 3 825 ? -8.735  10.493  17.041  1.00 22.04 ?  891  LYS A CA    1 
ATOM   6849 C  C     . LYS C 3 825 ? -7.940  9.777   15.960  1.00 21.94 ?  891  LYS A C     1 
ATOM   6850 O  O     . LYS C 3 825 ? -8.108  10.054  14.771  1.00 21.36 ?  891  LYS A O     1 
ATOM   6851 C  CB    . LYS C 3 825 ? -10.083 9.779   17.203  1.00 22.30 ?  891  LYS A CB    1 
ATOM   6852 C  CG    . LYS C 3 825 ? -10.848 10.207  18.438  1.00 23.32 ?  891  LYS A CG    1 
ATOM   6853 C  CD    . LYS C 3 825 ? -12.132 9.425   18.646  1.00 25.80 ?  891  LYS A CD    1 
ATOM   6854 C  CE    . LYS C 3 825 ? -13.013 10.182  19.623  1.00 25.48 ?  891  LYS A CE    1 
ATOM   6855 N  NZ    . LYS C 3 825 ? -14.141 9.338   20.105  1.00 30.20 ?  891  LYS A NZ    1 
ATOM   6856 N  N     . THR C 3 826 ? -7.098  8.843   16.392  1.00 21.68 ?  892  THR A N     1 
ATOM   6857 C  CA    . THR C 3 826 ? -6.317  7.986   15.502  1.00 21.58 ?  892  THR A CA    1 
ATOM   6858 C  C     . THR C 3 826 ? -7.160  7.023   14.674  1.00 21.55 ?  892  THR A C     1 
ATOM   6859 O  O     . THR C 3 826 ? -8.038  6.326   15.200  1.00 21.62 ?  892  THR A O     1 
ATOM   6860 C  CB    . THR C 3 826 ? -5.319  7.154   16.321  1.00 21.40 ?  892  THR A CB    1 
ATOM   6861 O  OG1   . THR C 3 826 ? -4.612  8.031   17.200  1.00 22.52 ?  892  THR A OG1   1 
ATOM   6862 C  CG2   . THR C 3 826 ? -4.323  6.410   15.424  1.00 20.85 ?  892  THR A CG2   1 
ATOM   6863 N  N     . LEU C 3 827 ? -6.861  6.976   13.382  1.00 21.24 ?  893  LEU A N     1 
ATOM   6864 C  CA    . LEU C 3 827 ? -7.510  6.050   12.453  1.00 21.29 ?  893  LEU A CA    1 
ATOM   6865 C  C     . LEU C 3 827 ? -6.921  4.645   12.609  1.00 21.32 ?  893  LEU A C     1 
ATOM   6866 O  O     . LEU C 3 827 ? -5.710  4.449   12.451  1.00 21.67 ?  893  LEU A O     1 
ATOM   6867 C  CB    . LEU C 3 827 ? -7.294  6.540   11.018  1.00 20.76 ?  893  LEU A CB    1 
ATOM   6868 C  CG    . LEU C 3 827 ? -8.042  5.820   9.891   1.00 20.72 ?  893  LEU A CG    1 
ATOM   6869 C  CD1   . LEU C 3 827 ? -9.547  5.911   10.147  1.00 19.06 ?  893  LEU A CD1   1 
ATOM   6870 C  CD2   . LEU C 3 827 ? -7.674  6.415   8.533   1.00 19.06 ?  893  LEU A CD2   1 
ATOM   6871 N  N     . ALA C 3 828 ? -7.770  3.672   12.918  1.00 21.91 ?  894  ALA A N     1 
ATOM   6872 C  CA    . ALA C 3 828 ? -7.333  2.295   13.125  1.00 22.83 ?  894  ALA A CA    1 
ATOM   6873 C  C     . ALA C 3 828 ? -7.295  1.604   11.770  1.00 24.49 ?  894  ALA A C     1 
ATOM   6874 O  O     . ALA C 3 828 ? -7.967  2.049   10.855  1.00 24.46 ?  894  ALA A O     1 
ATOM   6875 C  CB    . ALA C 3 828 ? -8.295  1.556   14.065  1.00 22.39 ?  894  ALA A CB    1 
ATOM   6876 N  N     . PRO C 3 829 ? -6.534  0.502   11.653  1.00 25.91 ?  895  PRO A N     1 
ATOM   6877 C  CA    . PRO C 3 829 ? -6.382  -0.197  10.365  1.00 28.25 ?  895  PRO A CA    1 
ATOM   6878 C  C     . PRO C 3 829 ? -7.695  -0.797  9.878   1.00 29.84 ?  895  PRO A C     1 
ATOM   6879 O  O     . PRO C 3 829 ? -8.027  -0.706  8.685   1.00 30.59 ?  895  PRO A O     1 
ATOM   6880 C  CB    . PRO C 3 829 ? -5.352  -1.298  10.664  1.00 27.43 ?  895  PRO A CB    1 
ATOM   6881 C  CG    . PRO C 3 829 ? -5.327  -1.432  12.141  1.00 27.39 ?  895  PRO A CG    1 
ATOM   6882 C  CD    . PRO C 3 829 ? -5.766  -0.129  12.736  1.00 25.86 ?  895  PRO A CD    1 
ATOM   6883 N  N     . ASN C 3 830 ? -8.451  -1.396  10.790  1.00 31.20 ?  896  ASN A N     1 
ATOM   6884 C  CA    . ASN C 3 830 ? -9.765  -1.920  10.404  1.00 31.97 ?  896  ASN A CA    1 
ATOM   6885 C  C     . ASN C 3 830 ? -10.822 -1.704  11.488  1.00 31.54 ?  896  ASN A C     1 
ATOM   6886 O  O     . ASN C 3 830 ? -10.504 -1.356  12.624  1.00 31.64 ?  896  ASN A O     1 
ATOM   6887 C  CB    . ASN C 3 830 ? -9.672  -3.386  9.959   1.00 32.63 ?  896  ASN A CB    1 
ATOM   6888 C  CG    . ASN C 3 830 ? -8.591  -4.157  10.696  1.00 35.40 ?  896  ASN A CG    1 
ATOM   6889 O  OD1   . ASN C 3 830 ? -8.620  -4.266  11.921  1.00 38.75 ?  896  ASN A OD1   1 
ATOM   6890 N  ND2   . ASN C 3 830 ? -7.631  -4.711  9.943   1.00 38.37 ?  896  ASN A ND2   1 
ATOM   6891 N  N     . TYR C 3 831 ? -12.080 -1.874  11.112  1.00 30.96 ?  897  TYR A N     1 
ATOM   6892 C  CA    . TYR C 3 831 ? -13.197 -1.522  11.964  1.00 30.07 ?  897  TYR A CA    1 
ATOM   6893 C  C     . TYR C 3 831 ? -14.283 -2.569  11.874  1.00 30.70 ?  897  TYR A C     1 
ATOM   6894 O  O     . TYR C 3 831 ? -14.543 -3.114  10.790  1.00 30.35 ?  897  TYR A O     1 
ATOM   6895 C  CB    . TYR C 3 831 ? -13.767 -0.170  11.541  1.00 29.83 ?  897  TYR A CB    1 
ATOM   6896 C  CG    . TYR C 3 831 ? -12.933 0.985   12.039  1.00 27.52 ?  897  TYR A CG    1 
ATOM   6897 C  CD1   . TYR C 3 831 ? -12.999 1.382   13.369  1.00 26.32 ?  897  TYR A CD1   1 
ATOM   6898 C  CD2   . TYR C 3 831 ? -12.065 1.657   11.188  1.00 24.57 ?  897  TYR A CD2   1 
ATOM   6899 C  CE1   . TYR C 3 831 ? -12.226 2.422   13.844  1.00 23.85 ?  897  TYR A CE1   1 
ATOM   6900 C  CE2   . TYR C 3 831 ? -11.293 2.699   11.649  1.00 24.70 ?  897  TYR A CE2   1 
ATOM   6901 C  CZ    . TYR C 3 831 ? -11.381 3.074   12.984  1.00 21.00 ?  897  TYR A CZ    1 
ATOM   6902 O  OH    . TYR C 3 831 ? -10.621 4.099   13.450  1.00 21.83 ?  897  TYR A OH    1 
ATOM   6903 N  N     . THR C 3 832 ? -14.909 -2.845  13.016  1.00 30.07 ?  898  THR A N     1 
ATOM   6904 C  CA    . THR C 3 832 ? -16.137 -3.627  13.060  1.00 29.67 ?  898  THR A CA    1 
ATOM   6905 C  C     . THR C 3 832 ? -17.305 -2.655  13.201  1.00 29.15 ?  898  THR A C     1 
ATOM   6906 O  O     . THR C 3 832 ? -18.312 -2.761  12.502  1.00 29.02 ?  898  THR A O     1 
ATOM   6907 C  CB    . THR C 3 832 ? -16.126 -4.614  14.250  1.00 29.76 ?  898  THR A CB    1 
ATOM   6908 O  OG1   . THR C 3 832 ? -15.238 -5.701  13.960  1.00 29.26 ?  898  THR A OG1   1 
ATOM   6909 C  CG2   . THR C 3 832 ? -17.509 -5.158  14.504  1.00 30.37 ?  898  THR A CG2   1 
ATOM   6910 N  N     . ASN C 3 833 ? -17.152 -1.688  14.098  1.00 28.73 ?  899  ASN A N     1 
ATOM   6911 C  CA    . ASN C 3 833 ? -18.154 -0.659  14.294  1.00 28.59 ?  899  ASN A CA    1 
ATOM   6912 C  C     . ASN C 3 833 ? -17.705 0.647   13.616  1.00 29.22 ?  899  ASN A C     1 
ATOM   6913 O  O     . ASN C 3 833 ? -16.594 1.116   13.843  1.00 29.84 ?  899  ASN A O     1 
ATOM   6914 C  CB    . ASN C 3 833 ? -18.354 -0.385  15.792  1.00 28.02 ?  899  ASN A CB    1 
ATOM   6915 C  CG    . ASN C 3 833 ? -18.962 -1.568  16.558  1.00 27.05 ?  899  ASN A CG    1 
ATOM   6916 O  OD1   . ASN C 3 833 ? -18.989 -1.568  17.794  1.00 27.21 ?  899  ASN A OD1   1 
ATOM   6917 N  ND2   . ASN C 3 833 ? -19.455 -2.550  15.845  1.00 22.48 ?  899  ASN A ND2   1 
ATOM   6918 N  N     . PRO C 3 834 ? -18.588 1.273   12.834  1.00 29.41 ?  900  PRO A N     1 
ATOM   6919 C  CA    . PRO C 3 834 ? -18.184 2.502   12.159  1.00 28.62 ?  900  PRO A CA    1 
ATOM   6920 C  C     . PRO C 3 834 ? -17.969 3.652   13.137  1.00 27.27 ?  900  PRO A C     1 
ATOM   6921 O  O     . PRO C 3 834 ? -18.832 3.934   13.970  1.00 27.39 ?  900  PRO A O     1 
ATOM   6922 C  CB    . PRO C 3 834 ? -19.379 2.822   11.230  1.00 29.11 ?  900  PRO A CB    1 
ATOM   6923 C  CG    . PRO C 3 834 ? -20.383 1.686   11.400  1.00 29.93 ?  900  PRO A CG    1 
ATOM   6924 C  CD    . PRO C 3 834 ? -20.027 0.979   12.674  1.00 30.04 ?  900  PRO A CD    1 
ATOM   6925 N  N     . GLN C 3 835 ? -16.825 4.317   13.039  1.00 25.77 ?  901  GLN A N     1 
ATOM   6926 C  CA    . GLN C 3 835 ? -16.557 5.440   13.909  1.00 24.84 ?  901  GLN A CA    1 
ATOM   6927 C  C     . GLN C 3 835 ? -16.607 6.717   13.094  1.00 24.46 ?  901  GLN A C     1 
ATOM   6928 O  O     . GLN C 3 835 ? -16.236 6.714   11.919  1.00 24.32 ?  901  GLN A O     1 
ATOM   6929 C  CB    . GLN C 3 835 ? -15.192 5.275   14.590  1.00 25.06 ?  901  GLN A CB    1 
ATOM   6930 C  CG    . GLN C 3 835 ? -15.033 3.963   15.365  1.00 23.21 ?  901  GLN A CG    1 
ATOM   6931 C  CD    . GLN C 3 835 ? -16.017 3.823   16.526  1.00 23.54 ?  901  GLN A CD    1 
ATOM   6932 O  OE1   . GLN C 3 835 ? -16.165 4.729   17.351  1.00 23.26 ?  901  GLN A OE1   1 
ATOM   6933 N  NE2   . GLN C 3 835 ? -16.668 2.678   16.609  1.00 24.47 ?  901  GLN A NE2   1 
ATOM   6934 N  N     . PRO C 3 836 ? -17.065 7.815   13.713  1.00 23.90 ?  902  PRO A N     1 
ATOM   6935 C  CA    . PRO C 3 836 ? -17.223 9.085   12.996  1.00 23.64 ?  902  PRO A CA    1 
ATOM   6936 C  C     . PRO C 3 836 ? -15.945 9.527   12.274  1.00 23.34 ?  902  PRO A C     1 
ATOM   6937 O  O     . PRO C 3 836 ? -16.027 9.956   11.127  1.00 23.56 ?  902  PRO A O     1 
ATOM   6938 C  CB    . PRO C 3 836 ? -17.602 10.089  14.110  1.00 22.89 ?  902  PRO A CB    1 
ATOM   6939 C  CG    . PRO C 3 836 ? -18.264 9.212   15.185  1.00 24.19 ?  902  PRO A CG    1 
ATOM   6940 C  CD    . PRO C 3 836 ? -17.553 7.878   15.109  1.00 24.00 ?  902  PRO A CD    1 
ATOM   6941 N  N     . HIS C 3 837 ? -14.776 9.429   12.911  1.00 22.80 ?  903  HIS A N     1 
ATOM   6942 C  CA    . HIS C 3 837 ? -13.537 9.899   12.234  1.00 22.40 ?  903  HIS A CA    1 
ATOM   6943 C  C     . HIS C 3 837 ? -13.062 8.990   11.098  1.00 22.36 ?  903  HIS A C     1 
ATOM   6944 O  O     . HIS C 3 837 ? -12.373 9.448   10.176  1.00 21.71 ?  903  HIS A O     1 
ATOM   6945 C  CB    . HIS C 3 837 ? -12.393 10.129  13.225  1.00 22.24 ?  903  HIS A CB    1 
ATOM   6946 C  CG    . HIS C 3 837 ? -11.938 8.891   13.936  1.00 23.39 ?  903  HIS A CG    1 
ATOM   6947 N  ND1   . HIS C 3 837 ? -12.739 8.211   14.830  1.00 22.51 ?  903  HIS A ND1   1 
ATOM   6948 C  CD2   . HIS C 3 837 ? -10.756 8.229   13.909  1.00 23.76 ?  903  HIS A CD2   1 
ATOM   6949 C  CE1   . HIS C 3 837 ? -12.072 7.179   15.319  1.00 22.73 ?  903  HIS A CE1   1 
ATOM   6950 N  NE2   . HIS C 3 837 ? -10.864 7.172   14.783  1.00 23.09 ?  903  HIS A NE2   1 
ATOM   6951 N  N     . ALA C 3 838 ? -13.409 7.706   11.185  1.00 22.10 ?  904  ALA A N     1 
ATOM   6952 C  CA    . ALA C 3 838 ? -13.065 6.740   10.155  1.00 21.76 ?  904  ALA A CA    1 
ATOM   6953 C  C     . ALA C 3 838 ? -13.966 6.911   8.944   1.00 21.73 ?  904  ALA A C     1 
ATOM   6954 O  O     . ALA C 3 838 ? -13.517 6.789   7.797   1.00 21.63 ?  904  ALA A O     1 
ATOM   6955 C  CB    . ALA C 3 838 ? -13.173 5.312   10.692  1.00 22.37 ?  904  ALA A CB    1 
ATOM   6956 N  N     . VAL C 3 839 ? -15.246 7.166   9.199   1.00 21.28 ?  905  VAL A N     1 
ATOM   6957 C  CA    . VAL C 3 839 ? -16.201 7.472   8.138   1.00 21.34 ?  905  VAL A CA    1 
ATOM   6958 C  C     . VAL C 3 839 ? -15.781 8.760   7.431   1.00 20.66 ?  905  VAL A C     1 
ATOM   6959 O  O     . VAL C 3 839 ? -15.833 8.852   6.205   1.00 21.03 ?  905  VAL A O     1 
ATOM   6960 C  CB    . VAL C 3 839 ? -17.640 7.637   8.714   1.00 22.00 ?  905  VAL A CB    1 
ATOM   6961 C  CG1   . VAL C 3 839 ? -18.574 8.281   7.691   1.00 22.12 ?  905  VAL A CG1   1 
ATOM   6962 C  CG2   . VAL C 3 839 ? -18.181 6.290   9.148   1.00 21.73 ?  905  VAL A CG2   1 
ATOM   6963 N  N     . LEU C 3 840 ? -15.353 9.747   8.207   1.00 19.68 ?  906  LEU A N     1 
ATOM   6964 C  CA    . LEU C 3 840 ? -14.881 11.007  7.637   1.00 20.15 ?  906  LEU A CA    1 
ATOM   6965 C  C     . LEU C 3 840 ? -13.591 10.812  6.817   1.00 20.04 ?  906  LEU A C     1 
ATOM   6966 O  O     . LEU C 3 840 ? -13.452 11.377  5.740   1.00 19.30 ?  906  LEU A O     1 
ATOM   6967 C  CB    . LEU C 3 840 ? -14.683 12.081  8.730   1.00 19.40 ?  906  LEU A CB    1 
ATOM   6968 C  CG    . LEU C 3 840 ? -13.922 13.327  8.248   1.00 20.69 ?  906  LEU A CG    1 
ATOM   6969 C  CD1   . LEU C 3 840 ? -14.679 14.082  7.116   1.00 18.60 ?  906  LEU A CD1   1 
ATOM   6970 C  CD2   . LEU C 3 840 ? -13.572 14.265  9.415   1.00 19.54 ?  906  LEU A CD2   1 
ATOM   6971 N  N     . ALA C 3 841 ? -12.651 10.016  7.321   1.00 19.83 ?  907  ALA A N     1 
ATOM   6972 C  CA    . ALA C 3 841 ? -11.400 9.787   6.582   1.00 20.64 ?  907  ALA A CA    1 
ATOM   6973 C  C     . ALA C 3 841 ? -11.663 9.235   5.157   1.00 20.45 ?  907  ALA A C     1 
ATOM   6974 O  O     . ALA C 3 841 ? -11.009 9.641   4.194   1.00 19.41 ?  907  ALA A O     1 
ATOM   6975 C  CB    . ALA C 3 841 ? -10.459 8.841   7.379   1.00 20.87 ?  907  ALA A CB    1 
ATOM   6976 N  N     . GLU C 3 842 ? -12.647 8.346   5.014   1.00 21.26 ?  908  GLU A N     1 
ATOM   6977 C  CA    . GLU C 3 842 ? -12.948 7.729   3.707   1.00 22.45 ?  908  GLU A CA    1 
ATOM   6978 C  C     . GLU C 3 842 ? -13.577 8.802   2.838   1.00 21.95 ?  908  GLU A C     1 
ATOM   6979 O  O     . GLU C 3 842 ? -13.269 8.923   1.649   1.00 20.77 ?  908  GLU A O     1 
ATOM   6980 C  CB    . GLU C 3 842 ? -13.947 6.568   3.862   1.00 23.87 ?  908  GLU A CB    1 
ATOM   6981 C  CG    . GLU C 3 842 ? -13.958 5.429   2.774   1.00 29.22 ?  908  GLU A CG    1 
ATOM   6982 C  CD    . GLU C 3 842 ? -13.779 5.853   1.298   1.00 37.57 ?  908  GLU A CD    1 
ATOM   6983 O  OE1   . GLU C 3 842 ? -14.721 5.630   0.472   1.00 38.00 ?  908  GLU A OE1   1 
ATOM   6984 O  OE2   . GLU C 3 842 ? -12.681 6.356   0.943   1.00 40.27 ?  908  GLU A OE2   1 
ATOM   6985 N  N     . ARG C 3 843 ? -14.469 9.578   3.453   1.00 20.86 ?  909  ARG A N     1 
ATOM   6986 C  CA    . ARG C 3 843 ? -15.171 10.651  2.751   1.00 20.80 ?  909  ARG A CA    1 
ATOM   6987 C  C     . ARG C 3 843 ? -14.186 11.659  2.157   1.00 20.67 ?  909  ARG A C     1 
ATOM   6988 O  O     . ARG C 3 843 ? -14.353 12.128  1.030   1.00 20.56 ?  909  ARG A O     1 
ATOM   6989 C  CB    . ARG C 3 843 ? -16.186 11.353  3.683   1.00 19.97 ?  909  ARG A CB    1 
ATOM   6990 C  CG    . ARG C 3 843 ? -17.190 12.226  2.914   1.00 22.61 ?  909  ARG A CG    1 
ATOM   6991 C  CD    . ARG C 3 843 ? -18.135 13.047  3.836   1.00 24.23 ?  909  ARG A CD    1 
ATOM   6992 N  NE    . ARG C 3 843 ? -18.756 12.175  4.823   1.00 24.89 ?  909  ARG A NE    1 
ATOM   6993 C  CZ    . ARG C 3 843 ? -18.771 12.396  6.134   1.00 27.63 ?  909  ARG A CZ    1 
ATOM   6994 N  NH1   . ARG C 3 843 ? -18.248 13.510  6.643   1.00 25.92 ?  909  ARG A NH1   1 
ATOM   6995 N  NH2   . ARG C 3 843 ? -19.343 11.504  6.930   1.00 28.36 ?  909  ARG A NH2   1 
ATOM   6996 N  N     . MET C 3 844 ? -13.154 11.980  2.923   1.00 20.59 ?  910  MET A N     1 
ATOM   6997 C  CA    . MET C 3 844 ? -12.125 12.924  2.480   1.00 21.41 ?  910  MET A CA    1 
ATOM   6998 C  C     . MET C 3 844 ? -11.353 12.380  1.278   1.00 21.49 ?  910  MET A C     1 
ATOM   6999 O  O     . MET C 3 844 ? -11.006 13.115  0.341   1.00 21.57 ?  910  MET A O     1 
ATOM   7000 C  CB    . MET C 3 844 ? -11.162 13.239  3.636   1.00 20.78 ?  910  MET A CB    1 
ATOM   7001 C  CG    . MET C 3 844 ? -11.723 14.233  4.661   1.00 22.71 ?  910  MET A CG    1 
ATOM   7002 S  SD    . MET C 3 844 ? -10.754 14.330  6.204   1.00 25.92 ?  910  MET A SD    1 
ATOM   7003 C  CE    . MET C 3 844 ? -9.383  15.370  5.690   1.00 25.08 ?  910  MET A CE    1 
ATOM   7004 N  N     . LYS C 3 845 ? -11.058 11.091  1.307   1.00 21.99 ?  911  LYS A N     1 
ATOM   7005 C  CA    . LYS C 3 845 ? -10.411 10.470  0.140   1.00 23.25 ?  911  LYS A CA    1 
ATOM   7006 C  C     . LYS C 3 845 ? -11.295 10.496  -1.107  1.00 23.01 ?  911  LYS A C     1 
ATOM   7007 O  O     . LYS C 3 845 ? -10.814 10.711  -2.228  1.00 22.44 ?  911  LYS A O     1 
ATOM   7008 C  CB    . LYS C 3 845 ? -9.968  9.060   0.484   1.00 23.16 ?  911  LYS A CB    1 
ATOM   7009 C  CG    . LYS C 3 845 ? -8.888  9.086   1.523   1.00 27.53 ?  911  LYS A CG    1 
ATOM   7010 C  CD    . LYS C 3 845 ? -8.779  7.795   2.334   1.00 33.05 ?  911  LYS A CD    1 
ATOM   7011 C  CE    . LYS C 3 845 ? -7.979  8.061   3.597   1.00 33.93 ?  911  LYS A CE    1 
ATOM   7012 N  NZ    . LYS C 3 845 ? -7.558  6.791   4.247   1.00 39.59 ?  911  LYS A NZ    1 
ATOM   7013 N  N     . ARG C 3 846 ? -12.593 10.263  -0.922  1.00 23.34 ?  912  ARG A N     1 
ATOM   7014 C  CA    . ARG C 3 846 ? -13.524 10.366  -2.040  1.00 23.86 ?  912  ARG A CA    1 
ATOM   7015 C  C     . ARG C 3 846 ? -13.505 11.777  -2.637  1.00 23.58 ?  912  ARG A C     1 
ATOM   7016 O  O     . ARG C 3 846 ? -13.523 11.924  -3.844  1.00 22.57 ?  912  ARG A O     1 
ATOM   7017 C  CB    . ARG C 3 846 ? -14.944 10.001  -1.612  1.00 23.87 ?  912  ARG A CB    1 
ATOM   7018 C  CG    . ARG C 3 846 ? -15.062 8.574   -1.171  1.00 26.47 ?  912  ARG A CG    1 
ATOM   7019 C  CD    . ARG C 3 846 ? -16.457 8.102   -1.309  1.00 30.93 ?  912  ARG A CD    1 
ATOM   7020 N  NE    . ARG C 3 846 ? -17.322 8.825   -0.412  1.00 35.00 ?  912  ARG A NE    1 
ATOM   7021 C  CZ    . ARG C 3 846 ? -18.161 8.240   0.433   1.00 38.79 ?  912  ARG A CZ    1 
ATOM   7022 N  NH1   . ARG C 3 846 ? -18.249 6.916   0.460   1.00 39.10 ?  912  ARG A NH1   1 
ATOM   7023 N  NH2   . ARG C 3 846 ? -18.917 8.983   1.237   1.00 37.96 ?  912  ARG A NH2   1 
ATOM   7024 N  N     . ARG C 3 847 ? -13.471 12.801  -1.782  1.00 24.02 ?  913  ARG A N     1 
ATOM   7025 C  CA    . ARG C 3 847 ? -13.499 14.188  -2.259  1.00 24.80 ?  913  ARG A CA    1 
ATOM   7026 C  C     . ARG C 3 847 ? -12.182 14.642  -2.869  1.00 25.78 ?  913  ARG A C     1 
ATOM   7027 O  O     . ARG C 3 847 ? -12.196 15.382  -3.838  1.00 25.01 ?  913  ARG A O     1 
ATOM   7028 C  CB    . ARG C 3 847 ? -13.867 15.168  -1.141  1.00 24.64 ?  913  ARG A CB    1 
ATOM   7029 C  CG    . ARG C 3 847 ? -15.231 14.941  -0.561  1.00 25.40 ?  913  ARG A CG    1 
ATOM   7030 C  CD    . ARG C 3 847 ? -15.746 16.185  0.153   1.00 29.30 ?  913  ARG A CD    1 
ATOM   7031 N  NE    . ARG C 3 847 ? -15.093 16.443  1.428   1.00 27.28 ?  913  ARG A NE    1 
ATOM   7032 C  CZ    . ARG C 3 847 ? -15.708 16.388  2.613   1.00 27.70 ?  913  ARG A CZ    1 
ATOM   7033 N  NH1   . ARG C 3 847 ? -15.026 16.650  3.715   1.00 24.88 ?  913  ARG A NH1   1 
ATOM   7034 N  NH2   . ARG C 3 847 ? -16.998 16.089  2.699   1.00 25.11 ?  913  ARG A NH2   1 
ATOM   7035 N  N     . GLU C 3 848 ? -11.053 14.199  -2.307  1.00 26.81 ?  914  GLU A N     1 
ATOM   7036 C  CA    . GLU C 3 848 ? -9.751  14.763  -2.680  1.00 28.91 ?  914  GLU A CA    1 
ATOM   7037 C  C     . GLU C 3 848 ? -8.743  13.757  -3.253  1.00 29.45 ?  914  GLU A C     1 
ATOM   7038 O  O     . GLU C 3 848 ? -7.630  14.127  -3.647  1.00 28.78 ?  914  GLU A O     1 
ATOM   7039 C  CB    . GLU C 3 848 ? -9.124  15.451  -1.466  1.00 29.42 ?  914  GLU A CB    1 
ATOM   7040 C  CG    . GLU C 3 848 ? -10.033 16.422  -0.787  1.00 34.21 ?  914  GLU A CG    1 
ATOM   7041 C  CD    . GLU C 3 848 ? -9.902  17.822  -1.334  1.00 40.02 ?  914  GLU A CD    1 
ATOM   7042 O  OE1   . GLU C 3 848 ? -9.673  17.977  -2.551  1.00 42.17 ?  914  GLU A OE1   1 
ATOM   7043 O  OE2   . GLU C 3 848 ? -10.028 18.777  -0.537  1.00 44.66 ?  914  GLU A OE2   1 
ATOM   7044 N  N     . GLY C 3 849 ? -9.109  12.483  -3.274  1.00 30.06 ?  915  GLY A N     1 
ATOM   7045 C  CA    . GLY C 3 849 ? -8.186  11.471  -3.745  1.00 30.86 ?  915  GLY A CA    1 
ATOM   7046 C  C     . GLY C 3 849 ? -7.187  11.073  -2.675  1.00 31.89 ?  915  GLY A C     1 
ATOM   7047 O  O     . GLY C 3 849 ? -6.577  10.012  -2.757  1.00 32.87 ?  915  GLY A O     1 
ATOM   7048 N  N     . VAL C 3 850 ? -7.006  11.921  -1.671  1.00 31.91 ?  916  VAL A N     1 
ATOM   7049 C  CA    . VAL C 3 850 ? -6.173  11.554  -0.535  1.00 32.41 ?  916  VAL A CA    1 
ATOM   7050 C  C     . VAL C 3 850 ? -6.812  12.008  0.755   1.00 31.92 ?  916  VAL A C     1 
ATOM   7051 O  O     . VAL C 3 850 ? -7.669  12.894  0.768   1.00 31.91 ?  916  VAL A O     1 
ATOM   7052 C  CB    . VAL C 3 850 ? -4.740  12.151  -0.621  1.00 33.15 ?  916  VAL A CB    1 
ATOM   7053 C  CG1   . VAL C 3 850 ? -4.043  11.688  -1.904  1.00 33.39 ?  916  VAL A CG1   1 
ATOM   7054 C  CG2   . VAL C 3 850 ? -4.790  13.680  -0.536  1.00 33.67 ?  916  VAL A CG2   1 
ATOM   7055 N  N     . GLY C 3 851 ? -6.376  11.401  1.852   1.00 31.54 ?  917  GLY A N     1 
ATOM   7056 C  CA    . GLY C 3 851 ? -6.937  11.692  3.157   1.00 30.18 ?  917  GLY A CA    1 
ATOM   7057 C  C     . GLY C 3 851 ? -6.075  11.008  4.185   1.00 29.52 ?  917  GLY A C     1 
ATOM   7058 O  O     . GLY C 3 851 ? -5.059  10.419  3.846   1.00 29.05 ?  917  GLY A O     1 
ATOM   7059 N  N     . PRO C 3 852 ? -6.481  11.083  5.450   1.00 29.02 ?  918  PRO A N     1 
ATOM   7060 C  CA    . PRO C 3 852 ? -5.697  10.534  6.539   1.00 28.29 ?  918  PRO A CA    1 
ATOM   7061 C  C     . PRO C 3 852 ? -5.425  9.052   6.303   1.00 28.18 ?  918  PRO A C     1 
ATOM   7062 O  O     . PRO C 3 852 ? -6.307  8.307   5.888   1.00 28.17 ?  918  PRO A O     1 
ATOM   7063 C  CB    . PRO C 3 852 ? -6.620  10.717  7.745   1.00 28.43 ?  918  PRO A CB    1 
ATOM   7064 C  CG    . PRO C 3 852 ? -7.547  11.842  7.349   1.00 27.57 ?  918  PRO A CG    1 
ATOM   7065 C  CD    . PRO C 3 852 ? -7.777  11.619  5.905   1.00 28.98 ?  918  PRO A CD    1 
ATOM   7066 N  N     . ASN C 3 853 ? -4.209  8.617   6.575   1.00 27.95 ?  919  ASN A N     1 
ATOM   7067 C  CA    . ASN C 3 853 ? -3.917  7.196   6.490   1.00 27.51 ?  919  ASN A CA    1 
ATOM   7068 C  C     . ASN C 3 853 ? -4.036  6.517   7.845   1.00 26.61 ?  919  ASN A C     1 
ATOM   7069 O  O     . ASN C 3 853 ? -4.062  7.174   8.889   1.00 26.07 ?  919  ASN A O     1 
ATOM   7070 C  CB    . ASN C 3 853 ? -2.524  6.989   5.913   1.00 27.97 ?  919  ASN A CB    1 
ATOM   7071 C  CG    . ASN C 3 853 ? -2.392  7.570   4.525   1.00 30.21 ?  919  ASN A CG    1 
ATOM   7072 O  OD1   . ASN C 3 853 ? -1.532  8.418   4.283   1.00 33.15 ?  919  ASN A OD1   1 
ATOM   7073 N  ND2   . ASN C 3 853 ? -3.264  7.146   3.612   1.00 32.53 ?  919  ASN A ND2   1 
ATOM   7074 N  N     . VAL C 3 854 ? -4.113  5.199   7.820   1.00 25.81 ?  920  VAL A N     1 
ATOM   7075 C  CA    . VAL C 3 854 ? -4.114  4.436   9.042   1.00 25.21 ?  920  VAL A CA    1 
ATOM   7076 C  C     . VAL C 3 854 ? -2.986  4.925   9.941   1.00 25.17 ?  920  VAL A C     1 
ATOM   7077 O  O     . VAL C 3 854 ? -1.831  5.049   9.500   1.00 24.48 ?  920  VAL A O     1 
ATOM   7078 C  CB    . VAL C 3 854 ? -3.933  2.944   8.745   1.00 25.64 ?  920  VAL A CB    1 
ATOM   7079 C  CG1   . VAL C 3 854 ? -3.793  2.144   10.060  1.00 25.49 ?  920  VAL A CG1   1 
ATOM   7080 C  CG2   . VAL C 3 854 ? -5.085  2.446   7.865   1.00 26.51 ?  920  VAL A CG2   1 
ATOM   7081 N  N     . GLY C 3 855 ? -3.323  5.221   11.195  1.00 23.80 ?  921  GLY A N     1 
ATOM   7082 C  CA    . GLY C 3 855 ? -2.322  5.667   12.149  1.00 24.37 ?  921  GLY A CA    1 
ATOM   7083 C  C     . GLY C 3 855 ? -2.201  7.177   12.285  1.00 24.18 ?  921  GLY A C     1 
ATOM   7084 O  O     . GLY C 3 855 ? -1.542  7.646   13.197  1.00 24.25 ?  921  GLY A O     1 
ATOM   7085 N  N     . ASP C 3 856 ? -2.813  7.938   11.380  1.00 23.93 ?  922  ASP A N     1 
ATOM   7086 C  CA    . ASP C 3 856 ? -2.869  9.404   11.508  1.00 24.50 ?  922  ASP A CA    1 
ATOM   7087 C  C     . ASP C 3 856 ? -3.990  9.788   12.461  1.00 23.99 ?  922  ASP A C     1 
ATOM   7088 O  O     . ASP C 3 856 ? -4.974  9.071   12.585  1.00 23.18 ?  922  ASP A O     1 
ATOM   7089 C  CB    . ASP C 3 856 ? -3.195  10.072  10.160  1.00 23.99 ?  922  ASP A CB    1 
ATOM   7090 C  CG    . ASP C 3 856 ? -2.091  9.905   9.125   1.00 27.08 ?  922  ASP A CG    1 
ATOM   7091 O  OD1   . ASP C 3 856 ? -0.933  9.630   9.492   1.00 27.25 ?  922  ASP A OD1   1 
ATOM   7092 O  OD2   . ASP C 3 856 ? -2.398  10.065  7.932   1.00 28.42 ?  922  ASP A OD2   1 
ATOM   7093 N  N     . ARG C 3 857 ? -3.855  10.936  13.112  1.00 24.59 ?  923  ARG A N     1 
ATOM   7094 C  CA    . ARG C 3 857 ? -4.954  11.483  13.884  1.00 25.35 ?  923  ARG A CA    1 
ATOM   7095 C  C     . ARG C 3 857 ? -5.876  12.201  12.908  1.00 24.70 ?  923  ARG A C     1 
ATOM   7096 O  O     . ARG C 3 857 ? -5.407  12.895  12.019  1.00 25.58 ?  923  ARG A O     1 
ATOM   7097 C  CB    . ARG C 3 857 ? -4.435  12.436  14.974  1.00 26.69 ?  923  ARG A CB    1 
ATOM   7098 C  CG    . ARG C 3 857 ? -3.619  11.727  16.067  1.00 29.26 ?  923  ARG A CG    1 
ATOM   7099 C  CD    . ARG C 3 857 ? -3.692  12.436  17.433  1.00 34.65 ?  923  ARG A CD    1 
ATOM   7100 N  NE    . ARG C 3 857 ? -4.699  11.795  18.274  1.00 38.74 ?  923  ARG A NE    1 
ATOM   7101 C  CZ    . ARG C 3 857 ? -5.260  12.353  19.342  1.00 41.50 ?  923  ARG A CZ    1 
ATOM   7102 N  NH1   . ARG C 3 857 ? -6.177  11.680  20.048  1.00 36.25 ?  923  ARG A NH1   1 
ATOM   7103 N  NH2   . ARG C 3 857 ? -4.908  13.592  19.693  1.00 43.03 ?  923  ARG A NH2   1 
ATOM   7104 N  N     . VAL C 3 858 ? -7.176  11.986  13.034  1.00 23.57 ?  924  VAL A N     1 
ATOM   7105 C  CA    . VAL C 3 858 ? -8.158  12.653  12.185  1.00 22.69 ?  924  VAL A CA    1 
ATOM   7106 C  C     . VAL C 3 858 ? -8.858  13.744  12.998  1.00 22.43 ?  924  VAL A C     1 
ATOM   7107 O  O     . VAL C 3 858 ? -9.423  13.460  14.044  1.00 21.54 ?  924  VAL A O     1 
ATOM   7108 C  CB    . VAL C 3 858 ? -9.224  11.661  11.702  1.00 22.38 ?  924  VAL A CB    1 
ATOM   7109 C  CG1   . VAL C 3 858 ? -10.292 12.378  10.865  1.00 23.05 ?  924  VAL A CG1   1 
ATOM   7110 C  CG2   . VAL C 3 858 ? -8.576  10.516  10.897  1.00 22.01 ?  924  VAL A CG2   1 
ATOM   7111 N  N     . ASP C 3 859 ? -8.815  14.977  12.507  1.00 22.47 ?  925  ASP A N     1 
ATOM   7112 C  CA    . ASP C 3 859 ? -9.498  16.105  13.139  1.00 22.43 ?  925  ASP A CA    1 
ATOM   7113 C  C     . ASP C 3 859 ? -10.907 16.259  12.596  1.00 22.24 ?  925  ASP A C     1 
ATOM   7114 O  O     . ASP C 3 859 ? -11.114 16.213  11.371  1.00 21.70 ?  925  ASP A O     1 
ATOM   7115 C  CB    . ASP C 3 859 ? -8.774  17.395  12.809  1.00 23.05 ?  925  ASP A CB    1 
ATOM   7116 C  CG    . ASP C 3 859 ? -7.418  17.491  13.452  1.00 24.98 ?  925  ASP A CG    1 
ATOM   7117 O  OD1   . ASP C 3 859 ? -6.639  18.318  12.974  1.00 26.56 ?  925  ASP A OD1   1 
ATOM   7118 O  OD2   . ASP C 3 859 ? -7.130  16.772  14.427  1.00 29.11 ?  925  ASP A OD2   1 
ATOM   7119 N  N     . TYR C 3 860 ? -11.874 16.489  13.485  1.00 21.32 ?  926  TYR A N     1 
ATOM   7120 C  CA    . TYR C 3 860 ? -13.249 16.676  13.057  1.00 21.11 ?  926  TYR A CA    1 
ATOM   7121 C  C     . TYR C 3 860 ? -14.063 17.496  14.042  1.00 21.36 ?  926  TYR A C     1 
ATOM   7122 O  O     . TYR C 3 860 ? -13.649 17.688  15.194  1.00 21.04 ?  926  TYR A O     1 
ATOM   7123 C  CB    . TYR C 3 860 ? -13.937 15.334  12.815  1.00 21.29 ?  926  TYR A CB    1 
ATOM   7124 C  CG    . TYR C 3 860 ? -14.122 14.443  14.048  1.00 22.52 ?  926  TYR A CG    1 
ATOM   7125 C  CD1   . TYR C 3 860 ? -13.136 13.544  14.426  1.00 21.69 ?  926  TYR A CD1   1 
ATOM   7126 C  CD2   . TYR C 3 860 ? -15.294 14.497  14.811  1.00 21.85 ?  926  TYR A CD2   1 
ATOM   7127 C  CE1   . TYR C 3 860 ? -13.307 12.710  15.525  1.00 24.77 ?  926  TYR A CE1   1 
ATOM   7128 C  CE2   . TYR C 3 860 ? -15.474 13.672  15.941  1.00 22.87 ?  926  TYR A CE2   1 
ATOM   7129 C  CZ    . TYR C 3 860 ? -14.466 12.780  16.277  1.00 24.59 ?  926  TYR A CZ    1 
ATOM   7130 O  OH    . TYR C 3 860 ? -14.598 11.936  17.350  1.00 27.60 ?  926  TYR A OH    1 
ATOM   7131 N  N     . VAL C 3 861 ? -15.205 17.995  13.572  1.00 20.48 ?  927  VAL A N     1 
ATOM   7132 C  CA    . VAL C 3 861 ? -16.208 18.575  14.451  1.00 20.53 ?  927  VAL A CA    1 
ATOM   7133 C  C     . VAL C 3 861 ? -17.505 17.864  14.131  1.00 20.88 ?  927  VAL A C     1 
ATOM   7134 O  O     . VAL C 3 861 ? -17.653 17.340  13.028  1.00 21.93 ?  927  VAL A O     1 
ATOM   7135 C  CB    . VAL C 3 861 ? -16.378 20.114  14.271  1.00 20.35 ?  927  VAL A CB    1 
ATOM   7136 C  CG1   . VAL C 3 861 ? -15.042 20.845  14.575  1.00 18.43 ?  927  VAL A CG1   1 
ATOM   7137 C  CG2   . VAL C 3 861 ? -16.852 20.430  12.869  1.00 21.66 ?  927  VAL A CG2   1 
ATOM   7138 N  N     . ILE C 3 862 ? -18.423 17.816  15.098  1.00 20.96 ?  928  ILE A N     1 
ATOM   7139 C  CA    . ILE C 3 862 ? -19.745 17.212  14.875  1.00 20.91 ?  928  ILE A CA    1 
ATOM   7140 C  C     . ILE C 3 862 ? -20.702 18.274  14.348  1.00 21.01 ?  928  ILE A C     1 
ATOM   7141 O  O     . ILE C 3 862 ? -20.889 19.334  14.972  1.00 20.18 ?  928  ILE A O     1 
ATOM   7142 C  CB    . ILE C 3 862 ? -20.287 16.540  16.178  1.00 21.19 ?  928  ILE A CB    1 
ATOM   7143 C  CG1   . ILE C 3 862 ? -19.368 15.387  16.604  1.00 21.01 ?  928  ILE A CG1   1 
ATOM   7144 C  CG2   . ILE C 3 862 ? -21.732 16.044  16.009  1.00 21.36 ?  928  ILE A CG2   1 
ATOM   7145 C  CD1   . ILE C 3 862 ? -19.252 14.262  15.541  1.00 19.68 ?  928  ILE A CD1   1 
ATOM   7146 N  N     . ILE C 3 863 ? -21.291 18.007  13.186  1.00 21.17 ?  929  ILE A N     1 
ATOM   7147 C  CA    . ILE C 3 863 ? -22.185 18.969  12.554  1.00 21.77 ?  929  ILE A CA    1 
ATOM   7148 C  C     . ILE C 3 863 ? -23.632 18.604  12.811  1.00 23.25 ?  929  ILE A C     1 
ATOM   7149 O  O     . ILE C 3 863 ? -23.922 17.466  13.148  1.00 23.41 ?  929  ILE A O     1 
ATOM   7150 C  CB    . ILE C 3 863 ? -21.920 19.100  11.042  1.00 21.65 ?  929  ILE A CB    1 
ATOM   7151 C  CG1   . ILE C 3 863 ? -22.216 17.773  10.307  1.00 20.80 ?  929  ILE A CG1   1 
ATOM   7152 C  CG2   . ILE C 3 863 ? -20.499 19.564  10.836  1.00 20.02 ?  929  ILE A CG2   1 
ATOM   7153 C  CD1   . ILE C 3 863 ? -22.289 17.912  8.766   1.00 24.24 ?  929  ILE A CD1   1 
ATOM   7154 N  N     . GLY C 3 864 ? -24.535 19.572  12.656  1.00 24.14 ?  930  GLY A N     1 
ATOM   7155 C  CA    . GLY C 3 864 ? -25.960 19.345  12.933  1.00 25.55 ?  930  GLY A CA    1 
ATOM   7156 C  C     . GLY C 3 864 ? -26.643 18.534  11.849  1.00 26.33 ?  930  GLY A C     1 
ATOM   7157 O  O     . GLY C 3 864 ? -26.202 18.506  10.712  1.00 26.72 ?  930  GLY A O     1 
ATOM   7158 N  N     . GLY C 3 865 ? -27.729 17.858  12.181  1.00 27.04 ?  931  GLY A N     1 
ATOM   7159 C  CA    . GLY C 3 865 ? -28.431 17.083  11.163  1.00 28.20 ?  931  GLY A CA    1 
ATOM   7160 C  C     . GLY C 3 865 ? -29.109 15.851  11.724  1.00 28.73 ?  931  GLY A C     1 
ATOM   7161 O  O     . GLY C 3 865 ? -28.970 15.552  12.906  1.00 28.95 ?  931  GLY A O     1 
ATOM   7162 N  N     . ASN C 3 866 ? -29.823 15.132  10.856  1.00 29.50 ?  932  ASN A N     1 
ATOM   7163 C  CA    . ASN C 3 866 ? -30.710 14.037  11.258  1.00 30.41 ?  932  ASN A CA    1 
ATOM   7164 C  C     . ASN C 3 866 ? -30.071 12.639  11.190  1.00 30.18 ?  932  ASN A C     1 
ATOM   7165 O  O     . ASN C 3 866 ? -30.620 11.661  11.724  1.00 31.10 ?  932  ASN A O     1 
ATOM   7166 C  CB    . ASN C 3 866 ? -31.981 14.070  10.397  1.00 30.68 ?  932  ASN A CB    1 
ATOM   7167 C  CG    . ASN C 3 866 ? -33.109 13.268  11.002  1.00 33.21 ?  932  ASN A CG    1 
ATOM   7168 O  OD1   . ASN C 3 866 ? -34.231 13.224  10.469  1.00 35.24 ?  932  ASN A OD1   1 
ATOM   7169 N  ND2   . ASN C 3 866 ? -32.820 12.614  12.121  1.00 35.25 ?  932  ASN A ND2   1 
ATOM   7170 N  N     . ASP C 3 867 ? -28.928 12.551  10.529  1.00 29.06 ?  933  ASP A N     1 
ATOM   7171 C  CA    . ASP C 3 867 ? -28.177 11.299  10.397  1.00 28.30 ?  933  ASP A CA    1 
ATOM   7172 C  C     . ASP C 3 867 ? -27.598 10.790  11.722  1.00 26.67 ?  933  ASP A C     1 
ATOM   7173 O  O     . ASP C 3 867 ? -27.452 11.553  12.689  1.00 25.81 ?  933  ASP A O     1 
ATOM   7174 C  CB    . ASP C 3 867 ? -26.997 11.511  9.440   1.00 28.84 ?  933  ASP A CB    1 
ATOM   7175 C  CG    . ASP C 3 867 ? -27.424 11.671  7.988   1.00 32.40 ?  933  ASP A CG    1 
ATOM   7176 O  OD1   . ASP C 3 867 ? -28.621 11.487  7.663   1.00 33.49 ?  933  ASP A OD1   1 
ATOM   7177 O  OD2   . ASP C 3 867 ? -26.533 11.977  7.159   1.00 37.56 ?  933  ASP A OD2   1 
ATOM   7178 N  N     . LYS C 3 868 ? -27.225 9.510   11.738  1.00 24.88 ?  934  LYS A N     1 
ATOM   7179 C  CA    . LYS C 3 868 ? -26.461 8.937   12.848  1.00 24.09 ?  934  LYS A CA    1 
ATOM   7180 C  C     . LYS C 3 868 ? -25.204 9.778   13.118  1.00 24.16 ?  934  LYS A C     1 
ATOM   7181 O  O     . LYS C 3 868 ? -24.607 10.345  12.195  1.00 22.86 ?  934  LYS A O     1 
ATOM   7182 C  CB    . LYS C 3 868 ? -26.043 7.496   12.513  1.00 23.49 ?  934  LYS A CB    1 
ATOM   7183 C  CG    . LYS C 3 868 ? -27.215 6.560   12.247  1.00 24.21 ?  934  LYS A CG    1 
ATOM   7184 C  CD    . LYS C 3 868 ? -28.069 6.370   13.507  1.00 23.79 ?  934  LYS A CD    1 
ATOM   7185 C  CE    . LYS C 3 868 ? -28.868 5.090   13.429  1.00 25.10 ?  934  LYS A CE    1 
ATOM   7186 N  NZ    . LYS C 3 868 ? -29.731 4.963   14.652  1.00 24.12 ?  934  LYS A NZ    1 
ATOM   7187 N  N     . LEU C 3 869 ? -24.777 9.815   14.375  1.00 24.13 ?  935  LEU A N     1 
ATOM   7188 C  CA    . LEU C 3 869 ? -23.560 10.524  14.772  1.00 25.28 ?  935  LEU A CA    1 
ATOM   7189 C  C     . LEU C 3 869 ? -22.347 10.186  13.921  1.00 25.17 ?  935  LEU A C     1 
ATOM   7190 O  O     . LEU C 3 869 ? -21.567 11.079  13.558  1.00 24.99 ?  935  LEU A O     1 
ATOM   7191 C  CB    . LEU C 3 869 ? -23.184 10.118  16.180  1.00 26.19 ?  935  LEU A CB    1 
ATOM   7192 C  CG    . LEU C 3 869 ? -23.030 11.149  17.276  1.00 29.63 ?  935  LEU A CG    1 
ATOM   7193 C  CD1   . LEU C 3 869 ? -22.205 10.490  18.392  1.00 32.66 ?  935  LEU A CD1   1 
ATOM   7194 C  CD2   . LEU C 3 869 ? -22.408 12.462  16.813  1.00 28.95 ?  935  LEU A CD2   1 
ATOM   7195 N  N     . TYR C 3 870 ? -22.137 8.900   13.650  1.00 25.09 ?  936  TYR A N     1 
ATOM   7196 C  CA    . TYR C 3 870 ? -20.923 8.533   12.931  1.00 25.98 ?  936  TYR A CA    1 
ATOM   7197 C  C     . TYR C 3 870 ? -20.946 9.024   11.490  1.00 24.68 ?  936  TYR A C     1 
ATOM   7198 O  O     . TYR C 3 870 ? -19.918 9.021   10.826  1.00 24.97 ?  936  TYR A O     1 
ATOM   7199 C  CB    . TYR C 3 870 ? -20.594 7.046   13.021  1.00 26.48 ?  936  TYR A CB    1 
ATOM   7200 C  CG    . TYR C 3 870 ? -21.575 6.146   12.325  1.00 30.08 ?  936  TYR A CG    1 
ATOM   7201 C  CD1   . TYR C 3 870 ? -21.617 6.082   10.952  1.00 32.22 ?  936  TYR A CD1   1 
ATOM   7202 C  CD2   . TYR C 3 870 ? -22.445 5.347   13.048  1.00 33.24 ?  936  TYR A CD2   1 
ATOM   7203 C  CE1   . TYR C 3 870 ? -22.496 5.267   10.310  1.00 35.56 ?  936  TYR A CE1   1 
ATOM   7204 C  CE2   . TYR C 3 870 ? -23.340 4.517   12.405  1.00 34.95 ?  936  TYR A CE2   1 
ATOM   7205 C  CZ    . TYR C 3 870 ? -23.358 4.487   11.039  1.00 36.66 ?  936  TYR A CZ    1 
ATOM   7206 O  OH    . TYR C 3 870 ? -24.227 3.661   10.373  1.00 40.34 ?  936  TYR A OH    1 
ATOM   7207 N  N     . ASN C 3 871 ? -22.109 9.477   11.025  1.00 23.38 ?  937  ASN A N     1 
ATOM   7208 C  CA    . ASN C 3 871 ? -22.183 10.135  9.734   1.00 22.76 ?  937  ASN A CA    1 
ATOM   7209 C  C     . ASN C 3 871 ? -22.105 11.657  9.850   1.00 23.44 ?  937  ASN A C     1 
ATOM   7210 O  O     . ASN C 3 871 ? -22.233 12.355  8.844   1.00 23.12 ?  937  ASN A O     1 
ATOM   7211 C  CB    . ASN C 3 871 ? -23.461 9.746   8.980   1.00 21.96 ?  937  ASN A CB    1 
ATOM   7212 C  CG    . ASN C 3 871 ? -23.361 8.369   8.343   1.00 21.08 ?  937  ASN A CG    1 
ATOM   7213 O  OD1   . ASN C 3 871 ? -22.308 7.978   7.828   1.00 18.42 ?  937  ASN A OD1   1 
ATOM   7214 N  ND2   . ASN C 3 871 ? -24.447 7.622   8.394   1.00 18.77 ?  937  ASN A ND2   1 
ATOM   7215 N  N     . ARG C 3 872 ? -21.890 12.171  11.061  1.00 22.84 ?  938  ARG A N     1 
ATOM   7216 C  CA    . ARG C 3 872 ? -21.919 13.623  11.240  1.00 22.70 ?  938  ARG A CA    1 
ATOM   7217 C  C     . ARG C 3 872 ? -20.594 14.229  11.706  1.00 22.42 ?  938  ARG A C     1 
ATOM   7218 O  O     . ARG C 3 872 ? -20.570 15.325  12.255  1.00 22.57 ?  938  ARG A O     1 
ATOM   7219 C  CB    . ARG C 3 872 ? -23.090 14.058  12.143  1.00 22.76 ?  938  ARG A CB    1 
ATOM   7220 C  CG    . ARG C 3 872 ? -24.471 13.771  11.550  1.00 23.46 ?  938  ARG A CG    1 
ATOM   7221 C  CD    . ARG C 3 872 ? -25.617 14.418  12.357  1.00 23.52 ?  938  ARG A CD    1 
ATOM   7222 N  NE    . ARG C 3 872 ? -25.967 13.765  13.626  1.00 25.87 ?  938  ARG A NE    1 
ATOM   7223 C  CZ    . ARG C 3 872 ? -25.787 14.306  14.830  1.00 26.50 ?  938  ARG A CZ    1 
ATOM   7224 N  NH1   . ARG C 3 872 ? -26.193 13.663  15.916  1.00 26.33 ?  938  ARG A NH1   1 
ATOM   7225 N  NH2   . ARG C 3 872 ? -25.223 15.500  14.947  1.00 26.25 ?  938  ARG A NH2   1 
ATOM   7226 N  N     . ALA C 3 873 ? -19.496 13.532  11.452  1.00 21.91 ?  939  ALA A N     1 
ATOM   7227 C  CA    . ALA C 3 873 ? -18.177 14.113  11.686  1.00 22.07 ?  939  ALA A CA    1 
ATOM   7228 C  C     . ALA C 3 873 ? -17.676 14.693  10.377  1.00 22.29 ?  939  ALA A C     1 
ATOM   7229 O  O     . ALA C 3 873 ? -17.717 14.023  9.345   1.00 21.93 ?  939  ALA A O     1 
ATOM   7230 C  CB    . ALA C 3 873 ? -17.204 13.071  12.208  1.00 21.81 ?  939  ALA A CB    1 
ATOM   7231 N  N     . GLU C 3 874 ? -17.188 15.928  10.428  1.00 21.82 ?  940  GLU A N     1 
ATOM   7232 C  CA    . GLU C 3 874 ? -16.748 16.615  9.241   1.00 22.21 ?  940  GLU A CA    1 
ATOM   7233 C  C     . GLU C 3 874 ? -15.423 17.354  9.466   1.00 22.06 ?  940  GLU A C     1 
ATOM   7234 O  O     . GLU C 3 874 ? -15.104 17.770  10.579  1.00 20.86 ?  940  GLU A O     1 
ATOM   7235 C  CB    . GLU C 3 874 ? -17.849 17.582  8.804   1.00 22.59 ?  940  GLU A CB    1 
ATOM   7236 C  CG    . GLU C 3 874 ? -17.862 18.003  7.367   1.00 23.87 ?  940  GLU A CG    1 
ATOM   7237 C  CD    . GLU C 3 874 ? -17.362 16.953  6.362   1.00 25.40 ?  940  GLU A CD    1 
ATOM   7238 O  OE1   . GLU C 3 874 ? -18.176 16.212  5.795   1.00 28.88 ?  940  GLU A OE1   1 
ATOM   7239 O  OE2   . GLU C 3 874 ? -16.152 16.903  6.101   1.00 24.37 ?  940  GLU A OE2   1 
ATOM   7240 N  N     . ASP C 3 875 ? -14.660 17.473  8.382   1.00 21.72 ?  941  ASP A N     1 
ATOM   7241 C  CA    . ASP C 3 875 ? -13.423 18.228  8.303   1.00 22.45 ?  941  ASP A CA    1 
ATOM   7242 C  C     . ASP C 3 875 ? -13.700 19.689  8.653   1.00 21.97 ?  941  ASP A C     1 
ATOM   7243 O  O     . ASP C 3 875 ? -14.557 20.317  8.044   1.00 22.19 ?  941  ASP A O     1 
ATOM   7244 C  CB    . ASP C 3 875 ? -12.922 18.084  6.858   1.00 23.22 ?  941  ASP A CB    1 
ATOM   7245 C  CG    . ASP C 3 875 ? -11.665 18.878  6.556   1.00 26.18 ?  941  ASP A CG    1 
ATOM   7246 O  OD1   . ASP C 3 875 ? -11.028 19.436  7.461   1.00 27.48 ?  941  ASP A OD1   1 
ATOM   7247 O  OD2   . ASP C 3 875 ? -11.315 18.918  5.360   1.00 30.94 ?  941  ASP A OD2   1 
ATOM   7248 N  N     . PRO C 3 876 ? -12.982 20.235  9.645   1.00 22.33 ?  942  PRO A N     1 
ATOM   7249 C  CA    . PRO C 3 876 ? -13.180 21.626  10.076  1.00 22.80 ?  942  PRO A CA    1 
ATOM   7250 C  C     . PRO C 3 876 ? -13.040 22.630  8.936   1.00 22.94 ?  942  PRO A C     1 
ATOM   7251 O  O     . PRO C 3 876 ? -13.798 23.584  8.871   1.00 22.23 ?  942  PRO A O     1 
ATOM   7252 C  CB    . PRO C 3 876 ? -12.057 21.846  11.107  1.00 23.15 ?  942  PRO A CB    1 
ATOM   7253 C  CG    . PRO C 3 876 ? -11.667 20.484  11.541  1.00 23.90 ?  942  PRO A CG    1 
ATOM   7254 C  CD    . PRO C 3 876 ? -11.867 19.592  10.359  1.00 22.19 ?  942  PRO A CD    1 
ATOM   7255 N  N     . LEU C 3 877 ? -12.089 22.408  8.032   1.00 24.01 ?  943  LEU A N     1 
ATOM   7256 C  CA    . LEU C 3 877 ? -11.941 23.298  6.877   1.00 24.83 ?  943  LEU A CA    1 
ATOM   7257 C  C     . LEU C 3 877 ? -13.135 23.211  5.939   1.00 24.86 ?  943  LEU A C     1 
ATOM   7258 O  O     . LEU C 3 877 ? -13.587 24.227  5.391   1.00 24.86 ?  943  LEU A O     1 
ATOM   7259 C  CB    . LEU C 3 877 ? -10.659 22.987  6.112   1.00 25.71 ?  943  LEU A CB    1 
ATOM   7260 C  CG    . LEU C 3 877 ? -9.378  23.636  6.651   1.00 28.32 ?  943  LEU A CG    1 
ATOM   7261 C  CD1   . LEU C 3 877 ? -9.351  25.155  6.389   1.00 29.48 ?  943  LEU A CD1   1 
ATOM   7262 C  CD2   . LEU C 3 877 ? -9.216  23.363  8.108   1.00 30.77 ?  943  LEU A CD2   1 
ATOM   7263 N  N     . PHE C 3 878 ? -13.639 21.998  5.734   1.00 24.44 ?  944  PHE A N     1 
ATOM   7264 C  CA    . PHE C 3 878 ? -14.826 21.807  4.905   1.00 24.66 ?  944  PHE A CA    1 
ATOM   7265 C  C     . PHE C 3 878 ? -16.009 22.548  5.557   1.00 24.92 ?  944  PHE A C     1 
ATOM   7266 O  O     . PHE C 3 878 ? -16.751 23.271  4.890   1.00 24.79 ?  944  PHE A O     1 
ATOM   7267 C  CB    . PHE C 3 878 ? -15.104 20.311  4.733   1.00 24.70 ?  944  PHE A CB    1 
ATOM   7268 C  CG    . PHE C 3 878 ? -16.244 19.993  3.799   1.00 25.49 ?  944  PHE A CG    1 
ATOM   7269 C  CD1   . PHE C 3 878 ? -16.038 19.913  2.433   1.00 27.00 ?  944  PHE A CD1   1 
ATOM   7270 C  CD2   . PHE C 3 878 ? -17.513 19.737  4.298   1.00 25.74 ?  944  PHE A CD2   1 
ATOM   7271 C  CE1   . PHE C 3 878 ? -17.092 19.605  1.576   1.00 28.95 ?  944  PHE A CE1   1 
ATOM   7272 C  CE2   . PHE C 3 878 ? -18.555 19.427  3.460   1.00 26.24 ?  944  PHE A CE2   1 
ATOM   7273 C  CZ    . PHE C 3 878 ? -18.349 19.361  2.094   1.00 27.81 ?  944  PHE A CZ    1 
ATOM   7274 N  N     . VAL C 3 879 ? -16.149 22.388  6.872   1.00 24.86 ?  945  VAL A N     1 
ATOM   7275 C  CA    . VAL C 3 879 ? -17.157 23.122  7.654   1.00 24.58 ?  945  VAL A CA    1 
ATOM   7276 C  C     . VAL C 3 879 ? -17.072 24.649  7.464   1.00 24.69 ?  945  VAL A C     1 
ATOM   7277 O  O     . VAL C 3 879 ? -18.085 25.308  7.250   1.00 23.93 ?  945  VAL A O     1 
ATOM   7278 C  CB    . VAL C 3 879 ? -17.056 22.792  9.156   1.00 23.90 ?  945  VAL A CB    1 
ATOM   7279 C  CG1   . VAL C 3 879 ? -17.925 23.752  9.967   1.00 24.45 ?  945  VAL A CG1   1 
ATOM   7280 C  CG2   . VAL C 3 879 ? -17.475 21.317  9.414   1.00 22.81 ?  945  VAL A CG2   1 
ATOM   7281 N  N     . LEU C 3 880 ? -15.869 25.204  7.562   1.00 25.26 ?  946  LEU A N     1 
ATOM   7282 C  CA    . LEU C 3 880 ? -15.711 26.645  7.405   1.00 26.64 ?  946  LEU A CA    1 
ATOM   7283 C  C     . LEU C 3 880 ? -16.031 27.092  5.978   1.00 27.15 ?  946  LEU A C     1 
ATOM   7284 O  O     . LEU C 3 880 ? -16.768 28.055  5.775   1.00 27.31 ?  946  LEU A O     1 
ATOM   7285 C  CB    . LEU C 3 880 ? -14.308 27.092  7.824   1.00 26.74 ?  946  LEU A CB    1 
ATOM   7286 C  CG    . LEU C 3 880 ? -14.082 26.971  9.332   1.00 27.54 ?  946  LEU A CG    1 
ATOM   7287 C  CD1   . LEU C 3 880 ? -12.674 27.420  9.721   1.00 27.94 ?  946  LEU A CD1   1 
ATOM   7288 C  CD2   . LEU C 3 880 ? -15.157 27.805  10.082  1.00 26.23 ?  946  LEU A CD2   1 
ATOM   7289 N  N     . GLU C 3 881 ? -15.497 26.366  5.002   1.00 27.64 ?  947  GLU A N     1 
ATOM   7290 C  CA    . GLU C 3 881 ? -15.683 26.691  3.594   1.00 28.33 ?  947  GLU A CA    1 
ATOM   7291 C  C     . GLU C 3 881 ? -17.153 26.795  3.211   1.00 28.46 ?  947  GLU A C     1 
ATOM   7292 O  O     . GLU C 3 881 ? -17.540 27.668  2.428   1.00 27.64 ?  947  GLU A O     1 
ATOM   7293 C  CB    . GLU C 3 881 ? -15.000 25.632  2.718   1.00 28.57 ?  947  GLU A CB    1 
ATOM   7294 C  CG    . GLU C 3 881 ? -15.155 25.839  1.208   1.00 32.30 ?  947  GLU A CG    1 
ATOM   7295 C  CD    . GLU C 3 881 ? -14.573 24.677  0.415   1.00 36.16 ?  947  GLU A CD    1 
ATOM   7296 O  OE1   . GLU C 3 881 ? -14.208 23.655  1.042   1.00 40.72 ?  947  GLU A OE1   1 
ATOM   7297 O  OE2   . GLU C 3 881 ? -14.483 24.770  -0.825  1.00 37.64 ?  947  GLU A OE2   1 
ATOM   7298 N  N     . ASN C 3 882 ? -17.971 25.894  3.752   1.00 27.91 ?  948  ASN A N     1 
ATOM   7299 C  CA    . ASN C 3 882 ? -19.351 25.777  3.307   1.00 27.84 ?  948  ASN A CA    1 
ATOM   7300 C  C     . ASN C 3 882 ? -20.347 26.284  4.320   1.00 27.70 ?  948  ASN A C     1 
ATOM   7301 O  O     . ASN C 3 882 ? -21.550 26.067  4.184   1.00 27.65 ?  948  ASN A O     1 
ATOM   7302 C  CB    . ASN C 3 882 ? -19.650 24.333  2.917   1.00 27.76 ?  948  ASN A CB    1 
ATOM   7303 C  CG    . ASN C 3 882 ? -18.774 23.865  1.768   1.00 27.98 ?  948  ASN A CG    1 
ATOM   7304 O  OD1   . ASN C 3 882 ? -18.935 24.321  0.646   1.00 29.01 ?  948  ASN A OD1   1 
ATOM   7305 N  ND2   . ASN C 3 882 ? -17.819 22.997  2.054   1.00 27.26 ?  948  ASN A ND2   1 
ATOM   7306 N  N     . ASN C 3 883 ? -19.844 26.959  5.342   1.00 28.28 ?  949  ASN A N     1 
ATOM   7307 C  CA    . ASN C 3 883 ? -20.728 27.567  6.319   1.00 29.28 ?  949  ASN A CA    1 
ATOM   7308 C  C     . ASN C 3 883 ? -21.661 26.544  6.966   1.00 28.88 ?  949  ASN A C     1 
ATOM   7309 O  O     . ASN C 3 883 ? -22.849 26.799  7.153   1.00 28.87 ?  949  ASN A O     1 
ATOM   7310 C  CB    . ASN C 3 883 ? -21.552 28.654  5.626   1.00 30.08 ?  949  ASN A CB    1 
ATOM   7311 C  CG    . ASN C 3 883 ? -20.681 29.686  4.929   1.00 32.53 ?  949  ASN A CG    1 
ATOM   7312 O  OD1   . ASN C 3 883 ? -19.830 30.319  5.556   1.00 37.25 ?  949  ASN A OD1   1 
ATOM   7313 N  ND2   . ASN C 3 883 ? -20.888 29.860  3.628   1.00 35.02 ?  949  ASN A ND2   1 
ATOM   7314 N  N     . ILE C 3 884 ? -21.120 25.382  7.305   1.00 28.53 ?  950  ILE A N     1 
ATOM   7315 C  CA    . ILE C 3 884 ? -21.929 24.306  7.852   1.00 28.26 ?  950  ILE A CA    1 
ATOM   7316 C  C     . ILE C 3 884 ? -22.117 24.507  9.360   1.00 28.09 ?  950  ILE A C     1 
ATOM   7317 O  O     . ILE C 3 884 ? -21.160 24.794  10.072  1.00 28.21 ?  950  ILE A O     1 
ATOM   7318 C  CB    . ILE C 3 884 ? -21.279 22.936  7.545   1.00 28.13 ?  950  ILE A CB    1 
ATOM   7319 C  CG1   . ILE C 3 884 ? -21.233 22.707  6.027   1.00 27.93 ?  950  ILE A CG1   1 
ATOM   7320 C  CG2   . ILE C 3 884 ? -22.017 21.809  8.260   1.00 27.97 ?  950  ILE A CG2   1 
ATOM   7321 C  CD1   . ILE C 3 884 ? -20.417 21.480  5.590   1.00 26.52 ?  950  ILE A CD1   1 
ATOM   7322 N  N     . GLN C 3 885 ? -23.341 24.364  9.853   1.00 27.92 ?  951  GLN A N     1 
ATOM   7323 C  CA    . GLN C 3 885 ? -23.581 24.597  11.281  1.00 28.34 ?  951  GLN A CA    1 
ATOM   7324 C  C     . GLN C 3 885 ? -23.105 23.420  12.111  1.00 27.45 ?  951  GLN A C     1 
ATOM   7325 O  O     . GLN C 3 885 ? -23.445 22.275  11.823  1.00 27.70 ?  951  GLN A O     1 
ATOM   7326 C  CB    . GLN C 3 885 ? -25.062 24.900  11.568  1.00 28.63 ?  951  GLN A CB    1 
ATOM   7327 C  CG    . GLN C 3 885 ? -25.462 24.899  13.063  1.00 31.89 ?  951  GLN A CG    1 
ATOM   7328 C  CD    . GLN C 3 885 ? -25.012 26.127  13.874  1.00 36.37 ?  951  GLN A CD    1 
ATOM   7329 O  OE1   . GLN C 3 885 ? -25.458 27.251  13.634  1.00 39.08 ?  951  GLN A OE1   1 
ATOM   7330 N  NE2   . GLN C 3 885 ? -24.167 25.898  14.875  1.00 36.99 ?  951  GLN A NE2   1 
ATOM   7331 N  N     . VAL C 3 886 ? -22.300 23.711  13.125  1.00 26.96 ?  952  VAL A N     1 
ATOM   7332 C  CA    . VAL C 3 886 ? -21.847 22.704  14.077  1.00 26.76 ?  952  VAL A CA    1 
ATOM   7333 C  C     . VAL C 3 886 ? -22.978 22.359  15.065  1.00 26.37 ?  952  VAL A C     1 
ATOM   7334 O  O     . VAL C 3 886 ? -23.832 23.206  15.362  1.00 26.33 ?  952  VAL A O     1 
ATOM   7335 C  CB    . VAL C 3 886 ? -20.591 23.215  14.819  1.00 27.26 ?  952  VAL A CB    1 
ATOM   7336 C  CG1   . VAL C 3 886 ? -20.131 22.226  15.870  1.00 27.87 ?  952  VAL A CG1   1 
ATOM   7337 C  CG2   . VAL C 3 886 ? -19.449 23.475  13.813  1.00 27.54 ?  952  VAL A CG2   1 
ATOM   7338 N  N     . ASP C 3 887 ? -22.996 21.118  15.551  1.00 25.52 ?  953  ASP A N     1 
ATOM   7339 C  CA    . ASP C 3 887 ? -24.032 20.675  16.475  1.00 24.99 ?  953  ASP A CA    1 
ATOM   7340 C  C     . ASP C 3 887 ? -23.726 21.198  17.883  1.00 24.37 ?  953  ASP A C     1 
ATOM   7341 O  O     . ASP C 3 887 ? -23.211 20.470  18.740  1.00 24.47 ?  953  ASP A O     1 
ATOM   7342 C  CB    . ASP C 3 887 ? -24.140 19.146  16.477  1.00 24.59 ?  953  ASP A CB    1 
ATOM   7343 C  CG    . ASP C 3 887 ? -25.422 18.649  17.137  1.00 25.63 ?  953  ASP A CG    1 
ATOM   7344 O  OD1   . ASP C 3 887 ? -25.991 19.380  17.970  1.00 24.40 ?  953  ASP A OD1   1 
ATOM   7345 O  OD2   . ASP C 3 887 ? -25.859 17.522  16.826  1.00 26.05 ?  953  ASP A OD2   1 
ATOM   7346 N  N     . SER C 3 888 ? -24.053 22.464  18.117  1.00 24.21 ?  954  SER A N     1 
ATOM   7347 C  CA    . SER C 3 888 ? -23.807 23.109  19.414  1.00 23.54 ?  954  SER A CA    1 
ATOM   7348 C  C     . SER C 3 888 ? -24.379 22.368  20.619  1.00 23.30 ?  954  SER A C     1 
ATOM   7349 O  O     . SER C 3 888 ? -23.712 22.228  21.658  1.00 22.72 ?  954  SER A O     1 
ATOM   7350 C  CB    . SER C 3 888 ? -24.363 24.529  19.388  1.00 23.89 ?  954  SER A CB    1 
ATOM   7351 O  OG    . SER C 3 888 ? -23.652 25.273  18.428  1.00 24.40 ?  954  SER A OG    1 
ATOM   7352 N  N     . ARG C 3 889 ? -25.617 21.913  20.509  1.00 23.37 ?  955  ARG A N     1 
ATOM   7353 C  CA    . ARG C 3 889 ? -26.221 21.186  21.626  1.00 24.52 ?  955  ARG A CA    1 
ATOM   7354 C  C     . ARG C 3 889 ? -25.455 19.906  21.915  1.00 23.81 ?  955  ARG A C     1 
ATOM   7355 O  O     . ARG C 3 889 ? -25.340 19.483  23.078  1.00 24.15 ?  955  ARG A O     1 
ATOM   7356 C  CB    . ARG C 3 889 ? -27.685 20.857  21.342  1.00 25.23 ?  955  ARG A CB    1 
ATOM   7357 C  CG    . ARG C 3 889 ? -28.606 22.037  21.430  1.00 29.06 ?  955  ARG A CG    1 
ATOM   7358 C  CD    . ARG C 3 889 ? -29.108 22.227  22.854  1.00 33.71 ?  955  ARG A CD    1 
ATOM   7359 N  NE    . ARG C 3 889 ? -30.084 23.310  22.886  1.00 37.05 ?  955  ARG A NE    1 
ATOM   7360 C  CZ    . ARG C 3 889 ? -30.626 23.804  23.988  1.00 38.65 ?  955  ARG A CZ    1 
ATOM   7361 N  NH1   . ARG C 3 889 ? -31.497 24.798  23.898  1.00 41.76 ?  955  ARG A NH1   1 
ATOM   7362 N  NH2   . ARG C 3 889 ? -30.303 23.306  25.174  1.00 39.62 ?  955  ARG A NH2   1 
ATOM   7363 N  N     . TYR C 3 890 ? -24.945 19.272  20.858  1.00 23.18 ?  956  TYR A N     1 
ATOM   7364 C  CA    . TYR C 3 890 ? -24.125 18.069  21.026  1.00 22.39 ?  956  TYR A CA    1 
ATOM   7365 C  C     . TYR C 3 890 ? -22.903 18.371  21.905  1.00 21.47 ?  956  TYR A C     1 
ATOM   7366 O  O     . TYR C 3 890 ? -22.559 17.612  22.817  1.00 21.16 ?  956  TYR A O     1 
ATOM   7367 C  CB    . TYR C 3 890 ? -23.663 17.502  19.665  1.00 22.62 ?  956  TYR A CB    1 
ATOM   7368 C  CG    . TYR C 3 890 ? -22.636 16.423  19.846  1.00 22.72 ?  956  TYR A CG    1 
ATOM   7369 C  CD1   . TYR C 3 890 ? -23.023 15.113  20.092  1.00 24.64 ?  956  TYR A CD1   1 
ATOM   7370 C  CD2   . TYR C 3 890 ? -21.284 16.717  19.824  1.00 23.37 ?  956  TYR A CD2   1 
ATOM   7371 C  CE1   . TYR C 3 890 ? -22.086 14.112  20.286  1.00 24.12 ?  956  TYR A CE1   1 
ATOM   7372 C  CE2   . TYR C 3 890 ? -20.348 15.731  20.023  1.00 24.13 ?  956  TYR A CE2   1 
ATOM   7373 C  CZ    . TYR C 3 890 ? -20.759 14.431  20.258  1.00 23.26 ?  956  TYR A CZ    1 
ATOM   7374 O  OH    . TYR C 3 890 ? -19.820 13.452  20.461  1.00 27.81 ?  956  TYR A OH    1 
ATOM   7375 N  N     . TYR C 3 891 ? -22.230 19.478  21.630  1.00 20.89 ?  957  TYR A N     1 
ATOM   7376 C  CA    . TYR C 3 891 ? -21.063 19.808  22.430  1.00 21.25 ?  957  TYR A CA    1 
ATOM   7377 C  C     . TYR C 3 891 ? -21.424 20.074  23.891  1.00 21.13 ?  957  TYR A C     1 
ATOM   7378 O  O     . TYR C 3 891 ? -20.661 19.743  24.798  1.00 22.60 ?  957  TYR A O     1 
ATOM   7379 C  CB    . TYR C 3 891 ? -20.296 20.985  21.837  1.00 20.48 ?  957  TYR A CB    1 
ATOM   7380 C  CG    . TYR C 3 891 ? -19.453 20.514  20.680  1.00 21.25 ?  957  TYR A CG    1 
ATOM   7381 C  CD1   . TYR C 3 891 ? -18.157 20.047  20.892  1.00 20.12 ?  957  TYR A CD1   1 
ATOM   7382 C  CD2   . TYR C 3 891 ? -19.977 20.477  19.391  1.00 19.60 ?  957  TYR A CD2   1 
ATOM   7383 C  CE1   . TYR C 3 891 ? -17.368 19.579  19.837  1.00 20.25 ?  957  TYR A CE1   1 
ATOM   7384 C  CE2   . TYR C 3 891 ? -19.200 20.000  18.315  1.00 21.45 ?  957  TYR A CE2   1 
ATOM   7385 C  CZ    . TYR C 3 891 ? -17.896 19.564  18.547  1.00 20.34 ?  957  TYR A CZ    1 
ATOM   7386 O  OH    . TYR C 3 891 ? -17.109 19.103  17.500  1.00 22.02 ?  957  TYR A OH    1 
ATOM   7387 N  N     . LEU C 3 892 ? -22.586 20.659  24.110  1.00 20.67 ?  958  LEU A N     1 
ATOM   7388 C  CA    . LEU C 3 892 ? -23.029 20.870  25.489  1.00 21.19 ?  958  LEU A CA    1 
ATOM   7389 C  C     . LEU C 3 892 ? -23.297 19.526  26.187  1.00 21.60 ?  958  LEU A C     1 
ATOM   7390 O  O     . LEU C 3 892 ? -22.729 19.216  27.244  1.00 22.02 ?  958  LEU A O     1 
ATOM   7391 C  CB    . LEU C 3 892 ? -24.281 21.743  25.507  1.00 19.67 ?  958  LEU A CB    1 
ATOM   7392 C  CG    . LEU C 3 892 ? -24.947 21.915  26.896  1.00 20.23 ?  958  LEU A CG    1 
ATOM   7393 C  CD1   . LEU C 3 892 ? -23.972 22.525  27.894  1.00 17.87 ?  958  LEU A CD1   1 
ATOM   7394 C  CD2   . LEU C 3 892 ? -26.193 22.768  26.784  1.00 19.92 ?  958  LEU A CD2   1 
ATOM   7395 N  N     . THR C 3 893 ? -24.163 18.722  25.596  1.00 22.54 ?  959  THR A N     1 
ATOM   7396 C  CA    . THR C 3 893 ? -24.698 17.570  26.327  1.00 23.54 ?  959  THR A CA    1 
ATOM   7397 C  C     . THR C 3 893 ? -23.821 16.345  26.259  1.00 23.75 ?  959  THR A C     1 
ATOM   7398 O  O     . THR C 3 893 ? -23.789 15.554  27.208  1.00 22.11 ?  959  THR A O     1 
ATOM   7399 C  CB    . THR C 3 893 ? -26.085 17.191  25.820  1.00 23.79 ?  959  THR A CB    1 
ATOM   7400 O  OG1   . THR C 3 893 ? -26.010 16.945  24.408  1.00 23.71 ?  959  THR A OG1   1 
ATOM   7401 C  CG2   . THR C 3 893 ? -27.073 18.334  26.101  1.00 23.92 ?  959  THR A CG2   1 
ATOM   7402 N  N     . ASN C 3 894 ? -23.092 16.201  25.145  1.00 24.19 ?  960  ASN A N     1 
ATOM   7403 C  CA    . ASN C 3 894 ? -22.334 14.978  24.899  1.00 24.90 ?  960  ASN A CA    1 
ATOM   7404 C  C     . ASN C 3 894 ? -20.828 15.193  25.001  1.00 25.07 ?  960  ASN A C     1 
ATOM   7405 O  O     . ASN C 3 894 ? -20.057 14.254  24.879  1.00 25.58 ?  960  ASN A O     1 
ATOM   7406 C  CB    . ASN C 3 894 ? -22.673 14.390  23.510  1.00 25.10 ?  960  ASN A CB    1 
ATOM   7407 C  CG    . ASN C 3 894 ? -24.118 13.880  23.415  1.00 26.84 ?  960  ASN A CG    1 
ATOM   7408 O  OD1   . ASN C 3 894 ? -25.067 14.618  23.652  1.00 29.23 ?  960  ASN A OD1   1 
ATOM   7409 N  ND2   . ASN C 3 894 ? -24.277 12.609  23.060  1.00 25.55 ?  960  ASN A ND2   1 
ATOM   7410 N  N     . GLN C 3 895 ? -20.391 16.426  25.210  1.00 24.31 ?  961  GLN A N     1 
ATOM   7411 C  CA    . GLN C 3 895 ? -18.972 16.639  25.450  1.00 23.37 ?  961  GLN A CA    1 
ATOM   7412 C  C     . GLN C 3 895 ? -18.720 17.292  26.815  1.00 22.17 ?  961  GLN A C     1 
ATOM   7413 O  O     . GLN C 3 895 ? -17.984 16.767  27.632  1.00 21.20 ?  961  GLN A O     1 
ATOM   7414 C  CB    . GLN C 3 895 ? -18.352 17.494  24.326  1.00 23.56 ?  961  GLN A CB    1 
ATOM   7415 C  CG    . GLN C 3 895 ? -18.291 16.781  22.964  1.00 24.82 ?  961  GLN A CG    1 
ATOM   7416 C  CD    . GLN C 3 895 ? -17.189 15.741  22.915  1.00 28.06 ?  961  GLN A CD    1 
ATOM   7417 O  OE1   . GLN C 3 895 ? -17.407 14.592  22.515  1.00 30.70 ?  961  GLN A OE1   1 
ATOM   7418 N  NE2   . GLN C 3 895 ? -15.994 16.142  23.299  1.00 27.08 ?  961  GLN A NE2   1 
ATOM   7419 N  N     . LEU C 3 896 ? -19.309 18.454  27.044  1.00 22.18 ?  962  LEU A N     1 
ATOM   7420 C  CA    . LEU C 3 896 ? -19.017 19.217  28.280  1.00 21.89 ?  962  LEU A CA    1 
ATOM   7421 C  C     . LEU C 3 896 ? -19.692 18.671  29.528  1.00 22.17 ?  962  LEU A C     1 
ATOM   7422 O  O     . LEU C 3 896 ? -19.095 18.623  30.612  1.00 21.49 ?  962  LEU A O     1 
ATOM   7423 C  CB    . LEU C 3 896 ? -19.457 20.674  28.120  1.00 22.17 ?  962  LEU A CB    1 
ATOM   7424 C  CG    . LEU C 3 896 ? -19.112 21.604  29.290  1.00 21.38 ?  962  LEU A CG    1 
ATOM   7425 C  CD1   . LEU C 3 896 ? -17.600 21.744  29.428  1.00 20.77 ?  962  LEU A CD1   1 
ATOM   7426 C  CD2   . LEU C 3 896 ? -19.765 22.975  29.119  1.00 21.75 ?  962  LEU A CD2   1 
ATOM   7427 N  N     . GLN C 3 897 ? -20.948 18.284  29.372  1.00 22.75 ?  963  GLN A N     1 
ATOM   7428 C  CA    . GLN C 3 897 ? -21.824 18.091  30.511  1.00 23.43 ?  963  GLN A CA    1 
ATOM   7429 C  C     . GLN C 3 897 ? -21.331 17.011  31.496  1.00 23.77 ?  963  GLN A C     1 
ATOM   7430 O  O     . GLN C 3 897 ? -21.200 17.273  32.696  1.00 22.74 ?  963  GLN A O     1 
ATOM   7431 C  CB    . GLN C 3 897 ? -23.246 17.779  30.042  1.00 23.65 ?  963  GLN A CB    1 
ATOM   7432 C  CG    . GLN C 3 897 ? -24.157 17.244  31.144  1.00 24.82 ?  963  GLN A CG    1 
ATOM   7433 C  CD    . GLN C 3 897 ? -25.618 17.234  30.733  1.00 27.60 ?  963  GLN A CD    1 
ATOM   7434 O  OE1   . GLN C 3 897 ? -26.015 17.923  29.807  1.00 28.27 ?  963  GLN A OE1   1 
ATOM   7435 N  NE2   . GLN C 3 897 ? -26.420 16.442  31.422  1.00 30.14 ?  963  GLN A NE2   1 
ATOM   7436 N  N     . ASN C 3 898 ? -21.057 15.805  30.997  1.00 23.31 ?  964  ASN A N     1 
ATOM   7437 C  CA    . ASN C 3 898 ? -20.687 14.705  31.907  1.00 23.73 ?  964  ASN A CA    1 
ATOM   7438 C  C     . ASN C 3 898 ? -19.386 14.896  32.685  1.00 23.46 ?  964  ASN A C     1 
ATOM   7439 O  O     . ASN C 3 898 ? -19.343 14.675  33.884  1.00 23.45 ?  964  ASN A O     1 
ATOM   7440 C  CB    . ASN C 3 898 ? -20.697 13.342  31.183  1.00 23.40 ?  964  ASN A CB    1 
ATOM   7441 C  CG    . ASN C 3 898 ? -22.112 12.860  30.881  1.00 26.38 ?  964  ASN A CG    1 
ATOM   7442 O  OD1   . ASN C 3 898 ? -23.079 13.470  31.334  1.00 26.22 ?  964  ASN A OD1   1 
ATOM   7443 N  ND2   . ASN C 3 898 ? -22.239 11.773  30.094  1.00 25.33 ?  964  ASN A ND2   1 
ATOM   7444 N  N     . PRO C 3 899 ? -18.314 15.316  32.000  1.00 24.01 ?  965  PRO A N     1 
ATOM   7445 C  CA    . PRO C 3 899 ? -17.061 15.540  32.718  1.00 23.36 ?  965  PRO A CA    1 
ATOM   7446 C  C     . PRO C 3 899 ? -17.185 16.661  33.777  1.00 23.30 ?  965  PRO A C     1 
ATOM   7447 O  O     . PRO C 3 899 ? -16.614 16.536  34.867  1.00 22.30 ?  965  PRO A O     1 
ATOM   7448 C  CB    . PRO C 3 899 ? -16.086 15.974  31.626  1.00 23.70 ?  965  PRO A CB    1 
ATOM   7449 C  CG    . PRO C 3 899 ? -16.740 15.552  30.303  1.00 24.92 ?  965  PRO A CG    1 
ATOM   7450 C  CD    . PRO C 3 899 ? -18.208 15.546  30.546  1.00 23.80 ?  965  PRO A CD    1 
ATOM   7451 N  N     . ILE C 3 900 ? -17.914 17.729  33.460  1.00 21.48 ?  966  ILE A N     1 
ATOM   7452 C  CA    . ILE C 3 900 ? -18.086 18.818  34.415  1.00 22.49 ?  966  ILE A CA    1 
ATOM   7453 C  C     . ILE C 3 900 ? -18.913 18.372  35.631  1.00 22.53 ?  966  ILE A C     1 
ATOM   7454 O  O     . ILE C 3 900 ? -18.557 18.630  36.764  1.00 23.14 ?  966  ILE A O     1 
ATOM   7455 C  CB    . ILE C 3 900 ? -18.742 20.061  33.777  1.00 22.52 ?  966  ILE A CB    1 
ATOM   7456 C  CG1   . ILE C 3 900 ? -17.784 20.732  32.784  1.00 22.87 ?  966  ILE A CG1   1 
ATOM   7457 C  CG2   . ILE C 3 900 ? -19.220 21.046  34.883  1.00 22.97 ?  966  ILE A CG2   1 
ATOM   7458 C  CD1   . ILE C 3 900 ? -16.370 21.000  33.323  1.00 23.98 ?  966  ILE A CD1   1 
ATOM   7459 N  N     . ILE C 3 901 ? -20.018 17.694  35.388  1.00 22.48 ?  967  ILE A N     1 
ATOM   7460 C  CA    . ILE C 3 901 ? -20.815 17.169  36.496  1.00 22.32 ?  967  ILE A CA    1 
ATOM   7461 C  C     . ILE C 3 901 ? -19.949 16.263  37.382  1.00 22.66 ?  967  ILE A C     1 
ATOM   7462 O  O     . ILE C 3 901 ? -19.981 16.371  38.619  1.00 22.04 ?  967  ILE A O     1 
ATOM   7463 C  CB    . ILE C 3 901 ? -22.067 16.414  35.959  1.00 21.89 ?  967  ILE A CB    1 
ATOM   7464 C  CG1   . ILE C 3 901 ? -23.050 17.424  35.350  1.00 22.63 ?  967  ILE A CG1   1 
ATOM   7465 C  CG2   . ILE C 3 901 ? -22.736 15.552  37.080  1.00 23.73 ?  967  ILE A CG2   1 
ATOM   7466 C  CD1   . ILE C 3 901 ? -24.342 16.808  34.789  1.00 19.86 ?  967  ILE A CD1   1 
ATOM   7467 N  N     . SER C 3 902 ? -19.149 15.386  36.762  1.00 22.74 ?  968  SER A N     1 
ATOM   7468 C  CA    . SER C 3 902 ? -18.332 14.459  37.557  1.00 24.05 ?  968  SER A CA    1 
ATOM   7469 C  C     . SER C 3 902 ? -17.332 15.173  38.469  1.00 24.89 ?  968  SER A C     1 
ATOM   7470 O  O     . SER C 3 902 ? -16.907 14.612  39.500  1.00 24.22 ?  968  SER A O     1 
ATOM   7471 C  CB    . SER C 3 902 ? -17.581 13.453  36.679  1.00 24.48 ?  968  SER A CB    1 
ATOM   7472 O  OG    . SER C 3 902 ? -16.381 14.030  36.185  1.00 27.92 ?  968  SER A OG    1 
ATOM   7473 N  N     . ILE C 3 903 ? -16.919 16.384  38.103  1.00 24.47 ?  969  ILE A N     1 
ATOM   7474 C  CA    . ILE C 3 903 ? -15.999 17.063  38.991  1.00 25.59 ?  969  ILE A CA    1 
ATOM   7475 C  C     . ILE C 3 903 ? -16.673 17.950  40.032  1.00 24.58 ?  969  ILE A C     1 
ATOM   7476 O  O     . ILE C 3 903 ? -16.164 18.077  41.142  1.00 24.34 ?  969  ILE A O     1 
ATOM   7477 C  CB    . ILE C 3 903 ? -14.785 17.752  38.288  1.00 26.34 ?  969  ILE A CB    1 
ATOM   7478 C  CG1   . ILE C 3 903 ? -15.187 18.904  37.405  1.00 28.69 ?  969  ILE A CG1   1 
ATOM   7479 C  CG2   . ILE C 3 903 ? -13.974 16.753  37.461  1.00 27.55 ?  969  ILE A CG2   1 
ATOM   7480 C  CD1   . ILE C 3 903 ? -14.031 19.272  36.457  1.00 33.19 ?  969  ILE A CD1   1 
ATOM   7481 N  N     . VAL C 3 904 ? -17.839 18.514  39.717  1.00 24.10 ?  970  VAL A N     1 
ATOM   7482 C  CA    . VAL C 3 904 ? -18.496 19.401  40.695  1.00 23.46 ?  970  VAL A CA    1 
ATOM   7483 C  C     . VAL C 3 904 ? -19.546 18.744  41.603  1.00 23.29 ?  970  VAL A C     1 
ATOM   7484 O  O     . VAL C 3 904 ? -19.782 19.220  42.720  1.00 22.75 ?  970  VAL A O     1 
ATOM   7485 C  CB    . VAL C 3 904 ? -19.105 20.656  40.038  1.00 23.99 ?  970  VAL A CB    1 
ATOM   7486 C  CG1   . VAL C 3 904 ? -18.058 21.412  39.228  1.00 23.86 ?  970  VAL A CG1   1 
ATOM   7487 C  CG2   . VAL C 3 904 ? -20.305 20.287  39.171  1.00 23.93 ?  970  VAL A CG2   1 
ATOM   7488 N  N     . ALA C 3 905 ? -20.168 17.661  41.144  1.00 22.95 ?  971  ALA A N     1 
ATOM   7489 C  CA    . ALA C 3 905 ? -21.162 16.955  41.962  1.00 23.09 ?  971  ALA A CA    1 
ATOM   7490 C  C     . ALA C 3 905 ? -20.625 16.552  43.342  1.00 23.49 ?  971  ALA A C     1 
ATOM   7491 O  O     . ALA C 3 905 ? -21.332 16.658  44.335  1.00 22.38 ?  971  ALA A O     1 
ATOM   7492 C  CB    . ALA C 3 905 ? -21.721 15.711  41.226  1.00 22.02 ?  971  ALA A CB    1 
ATOM   7493 N  N     . PRO C 3 906 ? -19.379 16.065  43.405  1.00 24.21 ?  972  PRO A N     1 
ATOM   7494 C  CA    . PRO C 3 906 ? -18.871 15.720  44.728  1.00 24.78 ?  972  PRO A CA    1 
ATOM   7495 C  C     . PRO C 3 906 ? -18.821 16.911  45.686  1.00 25.40 ?  972  PRO A C     1 
ATOM   7496 O  O     . PRO C 3 906 ? -18.596 16.714  46.876  1.00 25.83 ?  972  PRO A O     1 
ATOM   7497 C  CB    . PRO C 3 906 ? -17.451 15.238  44.436  1.00 24.67 ?  972  PRO A CB    1 
ATOM   7498 C  CG    . PRO C 3 906 ? -17.539 14.672  43.055  1.00 24.83 ?  972  PRO A CG    1 
ATOM   7499 C  CD    . PRO C 3 906 ? -18.468 15.629  42.331  1.00 24.38 ?  972  PRO A CD    1 
ATOM   7500 N  N     . ILE C 3 907 ? -18.992 18.131  45.175  1.00 25.45 ?  973  ILE A N     1 
ATOM   7501 C  CA    . ILE C 3 907 ? -18.913 19.326  46.024  1.00 26.00 ?  973  ILE A CA    1 
ATOM   7502 C  C     . ILE C 3 907 ? -20.278 19.951  46.234  1.00 25.57 ?  973  ILE A C     1 
ATOM   7503 O  O     . ILE C 3 907 ? -20.685 20.214  47.377  1.00 26.02 ?  973  ILE A O     1 
ATOM   7504 C  CB    . ILE C 3 907 ? -17.961 20.395  45.413  1.00 26.33 ?  973  ILE A CB    1 
ATOM   7505 C  CG1   . ILE C 3 907 ? -16.576 19.792  45.184  1.00 28.43 ?  973  ILE A CG1   1 
ATOM   7506 C  CG2   . ILE C 3 907 ? -17.875 21.644  46.313  1.00 27.37 ?  973  ILE A CG2   1 
ATOM   7507 C  CD1   . ILE C 3 907 ? -15.864 20.370  43.966  1.00 31.25 ?  973  ILE A CD1   1 
ATOM   7508 N  N     . ILE C 3 908 ? -21.002 20.183  45.142  1.00 24.91 ?  974  ILE A N     1 
ATOM   7509 C  CA    . ILE C 3 908 ? -22.311 20.831  45.226  1.00 24.78 ?  974  ILE A CA    1 
ATOM   7510 C  C     . ILE C 3 908 ? -23.465 19.829  45.238  1.00 24.95 ?  974  ILE A C     1 
ATOM   7511 O  O     . ILE C 3 908 ? -24.610 20.209  45.455  1.00 25.17 ?  974  ILE A O     1 
ATOM   7512 C  CB    . ILE C 3 908 ? -22.548 21.828  44.070  1.00 24.94 ?  974  ILE A CB    1 
ATOM   7513 C  CG1   . ILE C 3 908 ? -22.647 21.090  42.725  1.00 23.87 ?  974  ILE A CG1   1 
ATOM   7514 C  CG2   . ILE C 3 908 ? -21.443 22.895  44.025  1.00 24.75 ?  974  ILE A CG2   1 
ATOM   7515 C  CD1   . ILE C 3 908 ? -22.996 22.063  41.546  1.00 23.94 ?  974  ILE A CD1   1 
ATOM   7516 N  N     . GLY C 3 909 ? -23.162 18.559  44.984  1.00 25.08 ?  975  GLY A N     1 
ATOM   7517 C  CA    . GLY C 3 909 ? -24.178 17.495  44.966  1.00 25.16 ?  975  GLY A CA    1 
ATOM   7518 C  C     . GLY C 3 909 ? -24.755 17.261  43.575  1.00 25.26 ?  975  GLY A C     1 
ATOM   7519 O  O     . GLY C 3 909 ? -24.744 18.160  42.714  1.00 25.20 ?  975  GLY A O     1 
ATOM   7520 N  N     . ASP C 3 910 ? -25.265 16.052  43.358  1.00 25.59 ?  976  ASP A N     1 
ATOM   7521 C  CA    . ASP C 3 910 ? -25.796 15.614  42.056  1.00 25.76 ?  976  ASP A CA    1 
ATOM   7522 C  C     . ASP C 3 910 ? -26.934 16.481  41.518  1.00 25.16 ?  976  ASP A C     1 
ATOM   7523 O  O     . ASP C 3 910 ? -27.038 16.726  40.315  1.00 25.17 ?  976  ASP A O     1 
ATOM   7524 C  CB    . ASP C 3 910 ? -26.338 14.185  42.187  1.00 26.66 ?  976  ASP A CB    1 
ATOM   7525 C  CG    . ASP C 3 910 ? -25.250 13.158  42.439  1.00 29.73 ?  976  ASP A CG    1 
ATOM   7526 O  OD1   . ASP C 3 910 ? -24.053 13.466  42.234  1.00 33.44 ?  976  ASP A OD1   1 
ATOM   7527 O  OD2   . ASP C 3 910 ? -25.600 12.021  42.825  1.00 34.15 ?  976  ASP A OD2   1 
ATOM   7528 N  N     . LYS C 3 911 ? -27.808 16.911  42.414  1.00 24.58 ?  977  LYS A N     1 
ATOM   7529 C  CA    . LYS C 3 911 ? -29.010 17.639  42.031  1.00 25.07 ?  977  LYS A CA    1 
ATOM   7530 C  C     . LYS C 3 911 ? -28.662 18.989  41.416  1.00 24.63 ?  977  LYS A C     1 
ATOM   7531 O  O     . LYS C 3 911 ? -29.110 19.307  40.317  1.00 23.68 ?  977  LYS A O     1 
ATOM   7532 C  CB    . LYS C 3 911 ? -29.931 17.832  43.235  1.00 24.91 ?  977  LYS A CB    1 
ATOM   7533 C  CG    . LYS C 3 911 ? -31.258 18.508  42.895  1.00 27.33 ?  977  LYS A CG    1 
ATOM   7534 C  CD    . LYS C 3 911 ? -32.262 18.381  44.021  1.00 30.35 ?  977  LYS A CD    1 
ATOM   7535 C  CE    . LYS C 3 911 ? -31.862 19.202  45.226  1.00 33.10 ?  977  LYS A CE    1 
ATOM   7536 N  NZ    . LYS C 3 911 ? -31.839 20.667  44.925  1.00 34.28 ?  977  LYS A NZ    1 
ATOM   7537 N  N     . GLN C 3 912 ? -27.863 19.775  42.138  1.00 24.17 ?  978  GLN A N     1 
ATOM   7538 C  CA    . GLN C 3 912 ? -27.415 21.066  41.630  1.00 24.50 ?  978  GLN A CA    1 
ATOM   7539 C  C     . GLN C 3 912 ? -26.575 20.948  40.373  1.00 23.85 ?  978  GLN A C     1 
ATOM   7540 O  O     . GLN C 3 912 ? -26.747 21.701  39.432  1.00 23.87 ?  978  GLN A O     1 
ATOM   7541 C  CB    . GLN C 3 912 ? -26.579 21.781  42.680  1.00 24.39 ?  978  GLN A CB    1 
ATOM   7542 C  CG    . GLN C 3 912 ? -27.173 23.040  43.175  1.00 28.28 ?  978  GLN A CG    1 
ATOM   7543 C  CD    . GLN C 3 912 ? -26.093 23.964  43.718  1.00 30.71 ?  978  GLN A CD    1 
ATOM   7544 O  OE1   . GLN C 3 912 ? -25.818 23.938  44.908  1.00 28.90 ?  978  GLN A OE1   1 
ATOM   7545 N  NE2   . GLN C 3 912 ? -25.421 24.725  42.822  1.00 27.97 ?  978  GLN A NE2   1 
ATOM   7546 N  N     . ALA C 3 913 ? -25.627 20.028  40.394  1.00 23.79 ?  979  ALA A N     1 
ATOM   7547 C  CA    . ALA C 3 913 ? -24.769 19.796  39.247  1.00 24.08 ?  979  ALA A CA    1 
ATOM   7548 C  C     . ALA C 3 913 ? -25.618 19.547  37.998  1.00 24.49 ?  979  ALA A C     1 
ATOM   7549 O  O     . ALA C 3 913 ? -25.424 20.202  36.966  1.00 25.39 ?  979  ALA A O     1 
ATOM   7550 C  CB    . ALA C 3 913 ? -23.808 18.639  39.538  1.00 23.09 ?  979  ALA A CB    1 
ATOM   7551 N  N     . ASN C 3 914 ? -26.587 18.640  38.098  1.00 24.71 ?  980  ASN A N     1 
ATOM   7552 C  CA    . ASN C 3 914 ? -27.502 18.357  36.986  1.00 24.82 ?  980  ASN A CA    1 
ATOM   7553 C  C     . ASN C 3 914 ? -28.421 19.529  36.597  1.00 24.87 ?  980  ASN A C     1 
ATOM   7554 O  O     . ASN C 3 914 ? -28.665 19.796  35.406  1.00 24.02 ?  980  ASN A O     1 
ATOM   7555 C  CB    . ASN C 3 914 ? -28.307 17.093  37.292  1.00 25.57 ?  980  ASN A CB    1 
ATOM   7556 C  CG    . ASN C 3 914 ? -27.472 15.823  37.116  1.00 27.32 ?  980  ASN A CG    1 
ATOM   7557 O  OD1   . ASN C 3 914 ? -27.244 15.390  36.003  1.00 31.39 ?  980  ASN A OD1   1 
ATOM   7558 N  ND2   . ASN C 3 914 ? -27.013 15.237  38.213  1.00 30.00 ?  980  ASN A ND2   1 
ATOM   7559 N  N     . GLY C 3 915 ? -28.935 20.236  37.600  1.00 24.02 ?  981  GLY A N     1 
ATOM   7560 C  CA    . GLY C 3 915 ? -29.746 21.411  37.326  1.00 24.15 ?  981  GLY A CA    1 
ATOM   7561 C  C     . GLY C 3 915 ? -29.018 22.461  36.513  1.00 23.75 ?  981  GLY A C     1 
ATOM   7562 O  O     . GLY C 3 915 ? -29.610 23.114  35.662  1.00 24.01 ?  981  GLY A O     1 
ATOM   7563 N  N     . MET C 3 916 ? -27.726 22.622  36.764  1.00 24.22 ?  982  MET A N     1 
ATOM   7564 C  CA    . MET C 3 916 ? -26.933 23.612  36.034  1.00 24.88 ?  982  MET A CA    1 
ATOM   7565 C  C     . MET C 3 916 ? -26.979 23.363  34.522  1.00 25.33 ?  982  MET A C     1 
ATOM   7566 O  O     . MET C 3 916 ? -26.807 24.297  33.724  1.00 24.54 ?  982  MET A O     1 
ATOM   7567 C  CB    . MET C 3 916 ? -25.482 23.597  36.531  1.00 25.23 ?  982  MET A CB    1 
ATOM   7568 C  CG    . MET C 3 916 ? -24.597 24.645  35.876  1.00 26.01 ?  982  MET A CG    1 
ATOM   7569 S  SD    . MET C 3 916 ? -23.080 24.899  36.817  1.00 28.10 ?  982  MET A SD    1 
ATOM   7570 C  CE    . MET C 3 916 ? -22.584 23.237  37.185  1.00 28.67 ?  982  MET A CE    1 
ATOM   7571 N  N     . PHE C 3 917 ? -27.208 22.106  34.132  1.00 25.29 ?  983  PHE A N     1 
ATOM   7572 C  CA    . PHE C 3 917 ? -27.269 21.737  32.710  1.00 26.03 ?  983  PHE A CA    1 
ATOM   7573 C  C     . PHE C 3 917 ? -28.674 21.670  32.084  1.00 27.56 ?  983  PHE A C     1 
ATOM   7574 O  O     . PHE C 3 917 ? -28.825 21.241  30.926  1.00 27.48 ?  983  PHE A O     1 
ATOM   7575 C  CB    . PHE C 3 917 ? -26.441 20.472  32.439  1.00 25.09 ?  983  PHE A CB    1 
ATOM   7576 C  CG    . PHE C 3 917 ? -24.970 20.727  32.492  1.00 23.35 ?  983  PHE A CG    1 
ATOM   7577 C  CD1   . PHE C 3 917 ? -24.287 20.663  33.704  1.00 22.01 ?  983  PHE A CD1   1 
ATOM   7578 C  CD2   . PHE C 3 917 ? -24.272 21.090  31.337  1.00 21.38 ?  983  PHE A CD2   1 
ATOM   7579 C  CE1   . PHE C 3 917 ? -22.916 20.953  33.765  1.00 21.59 ?  983  PHE A CE1   1 
ATOM   7580 C  CE2   . PHE C 3 917 ? -22.914 21.359  31.374  1.00 21.40 ?  983  PHE A CE2   1 
ATOM   7581 C  CZ    . PHE C 3 917 ? -22.223 21.295  32.590  1.00 22.14 ?  983  PHE A CZ    1 
ATOM   7582 N  N     . VAL C 3 918 ? -29.685 22.119  32.828  1.00 28.80 ?  984  VAL A N     1 
ATOM   7583 C  CA    . VAL C 3 918 ? -31.034 22.295  32.278  1.00 31.01 ?  984  VAL A CA    1 
ATOM   7584 C  C     . VAL C 3 918 ? -31.349 23.748  31.898  1.00 32.58 ?  984  VAL A C     1 
ATOM   7585 O  O     . VAL C 3 918 ? -31.695 24.515  32.785  1.00 33.47 ?  984  VAL A O     1 
ATOM   7586 C  CB    . VAL C 3 918 ? -32.134 21.986  33.356  1.00 30.77 ?  984  VAL A CB    1 
ATOM   7587 C  CG1   . VAL C 3 918 ? -33.529 22.127  32.748  1.00 30.49 ?  984  VAL A CG1   1 
ATOM   7588 C  CG2   . VAL C 3 918 ? -31.949 20.618  34.024  1.00 29.99 ?  984  VAL A CG2   1 
ATOM   7589 N  N     . VAL C 3 919 ? -31.241 24.189  30.648  1.00 34.68 ?  985  VAL A N     1 
ATOM   7590 C  CA    . VAL C 3 919 ? -30.418 23.657  29.608  1.00 36.93 ?  985  VAL A CA    1 
ATOM   7591 C  C     . VAL C 3 919 ? -29.116 24.447  29.725  1.00 37.08 ?  985  VAL A C     1 
ATOM   7592 O  O     . VAL C 3 919 ? -28.125 24.116  29.081  1.00 38.17 ?  985  VAL A O     1 
ATOM   7593 C  CB    . VAL C 3 919 ? -30.990 23.997  28.201  1.00 36.90 ?  985  VAL A CB    1 
ATOM   7594 C  CG1   . VAL C 3 919 ? -32.391 23.438  28.024  1.00 38.15 ?  985  VAL A CG1   1 
ATOM   7595 C  CG2   . VAL C 3 919 ? -30.993 25.497  28.002  1.00 37.95 ?  985  VAL A CG2   1 
HETATM 7596 CA CA    . CA  D 4 .   ? -15.854 -1.983  31.256  1.00 47.42 ?  17   CA  T CA    1 
HETATM 7597 N  N1    . DCP E 5 .   ? 3.670   -1.387  34.191  1.00 19.13 ?  986  DCP A N1    1 
HETATM 7598 C  C2    . DCP E 5 .   ? 4.002   -1.937  32.929  1.00 20.99 ?  986  DCP A C2    1 
HETATM 7599 N  N3    . DCP E 5 .   ? 4.259   -1.123  31.865  1.00 20.67 ?  986  DCP A N3    1 
HETATM 7600 C  C4    . DCP E 5 .   ? 4.189   0.222   32.000  1.00 22.30 ?  986  DCP A C4    1 
HETATM 7601 C  C5    . DCP E 5 .   ? 3.858   0.786   33.245  1.00 22.38 ?  986  DCP A C5    1 
HETATM 7602 C  C6    . DCP E 5 .   ? 3.603   -0.056  34.339  1.00 19.16 ?  986  DCP A C6    1 
HETATM 7603 O  O2    . DCP E 5 .   ? 4.075   -3.191  32.810  1.00 18.60 ?  986  DCP A O2    1 
HETATM 7604 N  N4    . DCP E 5 .   ? 4.443   1.015   30.930  1.00 21.81 ?  986  DCP A N4    1 
HETATM 7605 C  "C1'" . DCP E 5 .   ? 3.451   -2.318  35.321  1.00 17.68 ?  986  DCP A "C1'" 1 
HETATM 7606 C  "C2'" . DCP E 5 .   ? 4.834   -2.781  35.767  1.00 15.82 ?  986  DCP A "C2'" 1 
HETATM 7607 C  "C3'" . DCP E 5 .   ? 5.182   -1.761  36.849  1.00 17.53 ?  986  DCP A "C3'" 1 
HETATM 7608 C  "C4'" . DCP E 5 .   ? 3.834   -1.605  37.532  1.00 18.78 ?  986  DCP A "C4'" 1 
HETATM 7609 O  "O4'" . DCP E 5 .   ? 2.893   -1.621  36.450  1.00 17.55 ?  986  DCP A "O4'" 1 
HETATM 7610 O  "O3'" . DCP E 5 .   ? 6.270   -2.181  37.702  1.00 16.04 ?  986  DCP A "O3'" 1 
HETATM 7611 C  "C5'" . DCP E 5 .   ? 3.676   -0.327  38.355  1.00 18.42 ?  986  DCP A "C5'" 1 
HETATM 7612 O  "O5'" . DCP E 5 .   ? 3.697   0.779   37.462  1.00 20.44 ?  986  DCP A "O5'" 1 
HETATM 7613 P  PA    . DCP E 5 .   ? 4.580   2.075   37.814  1.00 21.91 ?  986  DCP A PA    1 
HETATM 7614 O  O1A   . DCP E 5 .   ? 4.492   2.410   39.286  1.00 20.91 ?  986  DCP A O1A   1 
HETATM 7615 O  O2A   . DCP E 5 .   ? 4.223   3.150   36.846  1.00 21.10 ?  986  DCP A O2A   1 
HETATM 7616 O  O3A   . DCP E 5 .   ? 6.063   1.614   37.446  1.00 21.93 ?  986  DCP A O3A   1 
HETATM 7617 P  PB    . DCP E 5 .   ? 7.236   1.054   38.375  1.00 21.14 ?  986  DCP A PB    1 
HETATM 7618 O  O1B   . DCP E 5 .   ? 7.870   -0.012  37.536  1.00 21.71 ?  986  DCP A O1B   1 
HETATM 7619 O  O2B   . DCP E 5 .   ? 6.837   0.590   39.774  1.00 20.26 ?  986  DCP A O2B   1 
HETATM 7620 O  O3B   . DCP E 5 .   ? 8.266   2.276   38.394  1.00 21.91 ?  986  DCP A O3B   1 
HETATM 7621 P  PG    . DCP E 5 .   ? 8.523   3.454   39.480  1.00 21.92 ?  986  DCP A PG    1 
HETATM 7622 O  O1G   . DCP E 5 .   ? 8.695   4.674   38.609  1.00 20.37 ?  986  DCP A O1G   1 
HETATM 7623 O  O2G   . DCP E 5 .   ? 9.817   3.031   40.122  1.00 20.21 ?  986  DCP A O2G   1 
HETATM 7624 O  O3G   . DCP E 5 .   ? 7.313   3.516   40.374  1.00 22.00 ?  986  DCP A O3G   1 
HETATM 7625 CA CA    . CA  F 4 .   ? 5.773   2.007   41.219  1.00 20.18 ?  1    CA  A CA    1 
HETATM 7626 CA CA    . CA  G 4 .   ? 2.379   3.353   40.626  1.00 43.33 ?  2    CA  A CA    1 
HETATM 7627 CA CA    . CA  H 4 .   ? 6.918   5.519   42.183  1.00 40.65 ?  3    CA  A CA    1 
HETATM 7628 CA CA    . CA  I 4 .   ? 9.475   20.579  6.409   1.00 55.02 ?  4    CA  A CA    1 
HETATM 7629 C  C     . ACT J 6 .   ? -8.921  -12.448 32.315  1.00 34.69 ?  987  ACT A C     1 
HETATM 7630 O  O     . ACT J 6 .   ? -8.649  -12.549 31.085  1.00 33.63 ?  987  ACT A O     1 
HETATM 7631 O  OXT   . ACT J 6 .   ? -9.850  -11.648 32.634  1.00 34.26 ?  987  ACT A OXT   1 
HETATM 7632 C  CH3   . ACT J 6 .   ? -8.176  -13.260 33.352  1.00 33.98 ?  987  ACT A CH3   1 
HETATM 7633 C  C     . ACT K 6 .   ? 25.219  -32.587 -4.792  1.00 53.28 ?  988  ACT A C     1 
HETATM 7634 O  O     . ACT K 6 .   ? 26.127  -32.980 -4.021  1.00 53.14 ?  988  ACT A O     1 
HETATM 7635 O  OXT   . ACT K 6 .   ? 25.444  -31.528 -5.425  1.00 53.24 -1 988  ACT A OXT   1 
HETATM 7636 C  CH3   . ACT K 6 .   ? 23.930  -33.341 -4.948  1.00 52.98 ?  988  ACT A CH3   1 
HETATM 7637 O  O     . HOH L 7 .   ? -14.262 5.527   21.333  1.00 31.62 ?  32   HOH P O     1 
HETATM 7638 O  O     . HOH L 7 .   ? -9.796  -1.762  24.398  1.00 28.10 ?  61   HOH P O     1 
HETATM 7639 O  O     . HOH L 7 .   ? -7.436  3.801   16.506  1.00 25.85 ?  90   HOH P O     1 
HETATM 7640 O  O     . HOH L 7 .   ? -17.921 0.975   18.773  1.00 25.69 ?  106  HOH P O     1 
HETATM 7641 O  O     . HOH L 7 .   ? -4.107  5.417   21.865  1.00 37.49 ?  112  HOH P O     1 
HETATM 7642 O  O     . HOH L 7 .   ? 0.939   7.647   39.337  1.00 24.86 ?  113  HOH P O     1 
HETATM 7643 O  O     . HOH L 7 .   ? 0.009   6.933   32.910  1.00 29.82 ?  120  HOH P O     1 
HETATM 7644 O  O     . HOH L 7 .   ? -20.342 -3.059  19.890  1.00 28.76 ?  124  HOH P O     1 
HETATM 7645 O  O     . HOH L 7 .   ? -5.682  4.023   18.621  1.00 26.35 ?  199  HOH P O     1 
HETATM 7646 O  O     . HOH L 7 .   ? -23.417 -6.439  22.837  1.00 36.41 ?  208  HOH P O     1 
HETATM 7647 O  O     . HOH L 7 .   ? -12.750 6.890   23.222  1.00 36.14 ?  240  HOH P O     1 
HETATM 7648 O  O     . HOH L 7 .   ? -1.528  7.318   26.310  1.00 39.17 ?  256  HOH P O     1 
HETATM 7649 O  O     . HOH L 7 .   ? 0.696   7.188   35.900  1.00 31.68 ?  259  HOH P O     1 
HETATM 7650 O  O     . HOH L 7 .   ? -18.462 0.108   28.802  1.00 34.86 ?  317  HOH P O     1 
HETATM 7651 O  O     . HOH L 7 .   ? -12.858 -3.241  25.813  1.00 33.15 ?  347  HOH P O     1 
HETATM 7652 O  O     . HOH L 7 .   ? -25.893 -8.578  29.329  1.00 54.16 ?  364  HOH P O     1 
HETATM 7653 O  O     . HOH L 7 .   ? -0.419  4.619   29.036  1.00 29.91 ?  367  HOH P O     1 
HETATM 7654 O  O     . HOH L 7 .   ? -0.362  2.739   27.921  1.00 31.93 ?  368  HOH P O     1 
HETATM 7655 O  O     . HOH L 7 .   ? 1.830   4.382   29.860  1.00 34.07 ?  369  HOH P O     1 
HETATM 7656 O  O     . HOH L 7 .   ? -15.483 -3.075  27.215  1.00 35.22 ?  389  HOH P O     1 
HETATM 7657 O  O     . HOH L 7 .   ? -15.793 -6.060  26.667  1.00 46.88 ?  390  HOH P O     1 
HETATM 7658 O  O     . HOH L 7 .   ? -9.829  -0.293  16.617  1.00 42.65 ?  522  HOH P O     1 
HETATM 7659 O  O     . HOH L 7 .   ? -12.611 -7.012  17.493  1.00 59.03 ?  523  HOH P O     1 
HETATM 7660 O  O     . HOH L 7 .   ? -8.418  1.395   19.695  1.00 43.13 ?  526  HOH P O     1 
HETATM 7661 O  O     . HOH L 7 .   ? -3.151  3.836   18.301  1.00 31.66 ?  528  HOH P O     1 
HETATM 7662 O  O     . HOH L 7 .   ? -1.844  12.629  27.396  1.00 44.00 ?  551  HOH P O     1 
HETATM 7663 O  O     . HOH M 7 .   ? 5.910   -1.030  21.841  1.00 22.42 ?  18   HOH T O     1 
HETATM 7664 O  O     . HOH M 7 .   ? -2.837  -4.559  35.042  1.00 15.82 ?  19   HOH T O     1 
HETATM 7665 O  O     . HOH M 7 .   ? -4.670  -1.605  35.819  1.00 18.60 ?  20   HOH T O     1 
HETATM 7666 O  O     . HOH M 7 .   ? 5.182   -4.327  13.683  1.00 19.72 ?  21   HOH T O     1 
HETATM 7667 O  O     . HOH M 7 .   ? -10.036 3.616   32.991  1.00 22.59 ?  31   HOH T O     1 
HETATM 7668 O  O     . HOH M 7 .   ? -5.649  -4.388  28.077  1.00 25.59 ?  47   HOH T O     1 
HETATM 7669 O  O     . HOH M 7 .   ? -8.965  -4.627  39.994  1.00 22.25 ?  49   HOH T O     1 
HETATM 7670 O  O     . HOH M 7 .   ? -16.883 0.723   31.118  1.00 24.75 ?  51   HOH T O     1 
HETATM 7671 O  O     . HOH M 7 .   ? 6.819   0.483   24.143  1.00 28.04 ?  55   HOH T O     1 
HETATM 7672 O  O     . HOH M 7 .   ? 17.016  -11.036 14.912  1.00 19.57 ?  64   HOH T O     1 
HETATM 7673 O  O     . HOH M 7 .   ? -12.672 -1.486  28.333  1.00 38.68 ?  82   HOH T O     1 
HETATM 7674 O  O     . HOH M 7 .   ? 1.035   -10.722 22.907  1.00 28.58 ?  89   HOH T O     1 
HETATM 7675 O  O     . HOH M 7 .   ? 2.183   -4.332  21.617  1.00 23.54 ?  102  HOH T O     1 
HETATM 7676 O  O     . HOH M 7 .   ? -7.872  -2.674  26.562  1.00 41.09 ?  135  HOH T O     1 
HETATM 7677 O  O     . HOH M 7 .   ? 1.842   -6.203  19.459  1.00 33.63 ?  145  HOH T O     1 
HETATM 7678 O  O     . HOH M 7 .   ? -20.127 3.323   28.995  1.00 30.32 ?  152  HOH T O     1 
HETATM 7679 O  O     . HOH M 7 .   ? 6.298   3.028   25.181  1.00 30.44 ?  158  HOH T O     1 
HETATM 7680 O  O     . HOH M 7 .   ? -13.851 10.745  34.498  1.00 29.52 ?  164  HOH T O     1 
HETATM 7681 O  O     . HOH M 7 .   ? 0.927   -6.438  16.978  1.00 41.87 ?  168  HOH T O     1 
HETATM 7682 O  O     . HOH M 7 .   ? 10.144  -2.979  12.891  1.00 28.36 ?  173  HOH T O     1 
HETATM 7683 O  O     . HOH M 7 .   ? -22.164 -0.852  19.568  1.00 45.75 ?  179  HOH T O     1 
HETATM 7684 O  O     . HOH M 7 .   ? -14.165 -1.417  37.910  1.00 29.59 ?  186  HOH T O     1 
HETATM 7685 O  O     . HOH M 7 .   ? -18.191 4.333   33.374  1.00 29.90 ?  192  HOH T O     1 
HETATM 7686 O  O     . HOH M 7 .   ? 2.423   -2.681  25.209  1.00 33.22 ?  196  HOH T O     1 
HETATM 7687 O  O     . HOH M 7 .   ? -22.750 4.490   27.453  1.00 40.25 ?  215  HOH T O     1 
HETATM 7688 O  O     . HOH M 7 .   ? -1.383  -5.449  23.520  1.00 39.55 ?  225  HOH T O     1 
HETATM 7689 O  O     . HOH M 7 .   ? 7.668   -11.545 16.757  1.00 37.12 ?  248  HOH T O     1 
HETATM 7690 O  O     . HOH M 7 .   ? -27.561 -3.842  15.134  1.00 43.74 ?  250  HOH T O     1 
HETATM 7691 O  O     . HOH M 7 .   ? 5.166   2.239   27.212  1.00 34.71 ?  251  HOH T O     1 
HETATM 7692 O  O     . HOH M 7 .   ? -2.288  -8.138  24.541  1.00 38.36 ?  286  HOH T O     1 
HETATM 7693 O  O     . HOH M 7 .   ? -11.290 -4.651  32.042  1.00 41.23 ?  289  HOH T O     1 
HETATM 7694 O  O     . HOH M 7 .   ? -25.381 4.089   25.990  1.00 42.02 ?  307  HOH T O     1 
HETATM 7695 O  O     . HOH M 7 .   ? -27.931 -9.423  27.076  1.00 43.12 ?  320  HOH T O     1 
HETATM 7696 O  O     . HOH M 7 .   ? -9.198  -4.076  29.018  1.00 34.52 ?  326  HOH T O     1 
HETATM 7697 O  O     . HOH M 7 .   ? -15.074 7.811   26.883  1.00 40.32 ?  353  HOH T O     1 
HETATM 7698 O  O     . HOH M 7 .   ? 10.918  -5.131  18.588  1.00 14.65 ?  356  HOH T O     1 
HETATM 7699 O  O     . HOH M 7 .   ? -26.317 8.346   16.323  1.00 26.61 ?  359  HOH T O     1 
HETATM 7700 O  O     . HOH M 7 .   ? -22.737 6.713   15.582  1.00 44.22 ?  360  HOH T O     1 
HETATM 7701 O  O     . HOH M 7 .   ? -18.449 10.155  18.800  1.00 35.27 ?  382  HOH T O     1 
HETATM 7702 O  O     . HOH M 7 .   ? -22.172 11.610  26.069  1.00 40.66 ?  385  HOH T O     1 
HETATM 7703 O  O     . HOH M 7 .   ? -19.533 7.621   18.103  1.00 42.96 ?  387  HOH T O     1 
HETATM 7704 O  O     . HOH M 7 .   ? 2.033   0.494   26.659  1.00 42.37 ?  394  HOH T O     1 
HETATM 7705 O  O     . HOH M 7 .   ? 5.870   -6.405  8.908   1.00 47.75 ?  438  HOH T O     1 
HETATM 7706 O  O     . HOH M 7 .   ? 8.297   -10.843 9.504   1.00 59.39 ?  439  HOH T O     1 
HETATM 7707 O  O     . HOH M 7 .   ? -13.781 -0.748  30.489  1.00 38.27 ?  461  HOH T O     1 
HETATM 7708 O  O     . HOH M 7 .   ? -18.425 -1.118  31.953  1.00 45.04 ?  462  HOH T O     1 
HETATM 7709 O  O     . HOH M 7 .   ? -16.529 -0.793  29.131  1.00 35.31 ?  463  HOH T O     1 
HETATM 7710 O  O     . HOH M 7 .   ? -30.340 -6.509  19.761  1.00 37.95 ?  464  HOH T O     1 
HETATM 7711 O  O     . HOH M 7 .   ? -26.771 0.301   14.060  1.00 37.21 ?  467  HOH T O     1 
HETATM 7712 O  O     . HOH M 7 .   ? -29.499 -4.425  16.954  1.00 26.84 ?  492  HOH T O     1 
HETATM 7713 O  O     . HOH M 7 .   ? -0.266  -7.320  20.918  1.00 42.68 ?  520  HOH T O     1 
HETATM 7714 O  O     . HOH M 7 .   ? -5.095  -2.894  25.837  1.00 44.18 ?  525  HOH T O     1 
HETATM 7715 O  O     . HOH M 7 .   ? 0.173   -0.152  26.707  1.00 46.23 ?  527  HOH T O     1 
HETATM 7716 O  O     . HOH M 7 .   ? -4.822  -8.257  23.679  1.00 49.23 ?  529  HOH T O     1 
HETATM 7717 O  O     . HOH M 7 .   ? 4.660   4.942   24.719  1.00 52.75 ?  540  HOH T O     1 
HETATM 7718 O  O     . HOH M 7 .   ? -20.808 6.588   16.741  1.00 50.88 ?  543  HOH T O     1 
HETATM 7719 O  O     . HOH M 7 .   ? -25.674 3.763   15.411  1.00 45.43 ?  544  HOH T O     1 
HETATM 7720 O  O     . HOH M 7 .   ? -17.055 6.328   21.624  1.00 47.62 ?  545  HOH T O     1 
HETATM 7721 O  O     . HOH M 7 .   ? -23.885 7.247   25.106  1.00 43.81 ?  546  HOH T O     1 
HETATM 7722 O  O     . HOH M 7 .   ? -24.127 9.226   23.763  1.00 48.50 ?  547  HOH T O     1 
HETATM 7723 O  O     . HOH M 7 .   ? -20.255 1.779   19.602  1.00 32.31 ?  552  HOH T O     1 
HETATM 7724 O  O     . HOH M 7 .   ? -28.230 0.923   22.891  1.00 35.21 ?  553  HOH T O     1 
HETATM 7725 O  O     . HOH M 7 .   ? -19.986 12.816  27.401  1.00 27.36 ?  1408 HOH T O     1 
HETATM 7726 O  O     . HOH N 7 .   ? -1.886  -5.582  41.661  1.00 15.80 ?  5    HOH A O     1 
HETATM 7727 O  O     . HOH N 7 .   ? 9.477   -2.829  44.840  1.00 20.61 ?  6    HOH A O     1 
HETATM 7728 O  O     . HOH N 7 .   ? 12.095  -24.866 16.763  1.00 24.11 ?  8    HOH A O     1 
HETATM 7729 O  O     . HOH N 7 .   ? 29.199  0.541   -3.735  1.00 31.69 ?  10   HOH A O     1 
HETATM 7730 O  O     . HOH N 7 .   ? 10.288  -0.700  36.278  1.00 26.16 ?  11   HOH A O     1 
HETATM 7731 O  O     . HOH N 7 .   ? 30.076  21.942  14.486  1.00 23.92 ?  12   HOH A O     1 
HETATM 7732 O  O     . HOH N 7 .   ? 22.126  -6.548  7.236   1.00 32.57 ?  13   HOH A O     1 
HETATM 7733 O  O     . HOH N 7 .   ? 14.771  -3.995  27.676  1.00 18.48 ?  14   HOH A O     1 
HETATM 7734 O  O     . HOH N 7 .   ? -0.711  -12.426 26.836  1.00 20.13 ?  15   HOH A O     1 
HETATM 7735 O  O     . HOH N 7 .   ? -5.583  12.414  56.641  1.00 16.75 ?  16   HOH A O     1 
HETATM 7736 O  O     . HOH N 7 .   ? -17.229 7.488   4.326   1.00 22.40 ?  17   HOH A O     1 
HETATM 7737 O  O     . HOH N 7 .   ? 32.244  -12.541 8.146   1.00 20.37 ?  18   HOH A O     1 
HETATM 7738 O  O     . HOH N 7 .   ? 15.585  -18.925 18.993  1.00 11.79 ?  20   HOH A O     1 
HETATM 7739 O  O     . HOH N 7 .   ? 32.925  0.770   23.434  1.00 28.69 ?  22   HOH A O     1 
HETATM 7740 O  O     . HOH N 7 .   ? 12.689  0.399   36.790  1.00 21.30 ?  23   HOH A O     1 
HETATM 7741 O  O     . HOH N 7 .   ? 22.682  1.621   13.673  1.00 20.40 ?  24   HOH A O     1 
HETATM 7742 O  O     . HOH N 7 .   ? -21.322 15.014  28.336  1.00 22.78 ?  25   HOH A O     1 
HETATM 7743 O  O     . HOH N 7 .   ? -18.723 11.136  9.807   1.00 26.09 ?  26   HOH A O     1 
HETATM 7744 O  O     . HOH N 7 .   ? 21.415  -18.113 23.151  1.00 21.56 ?  27   HOH A O     1 
HETATM 7745 O  O     . HOH N 7 .   ? 23.319  -16.480 22.486  1.00 22.63 ?  28   HOH A O     1 
HETATM 7746 O  O     . HOH N 7 .   ? -3.012  10.892  55.030  1.00 20.37 ?  29   HOH A O     1 
HETATM 7747 O  O     . HOH N 7 .   ? 25.590  -0.903  15.497  1.00 27.89 ?  30   HOH A O     1 
HETATM 7748 O  O     . HOH N 7 .   ? 24.821  5.199   -2.222  1.00 25.65 ?  33   HOH A O     1 
HETATM 7749 O  O     . HOH N 7 .   ? 20.851  -27.563 -3.586  1.00 32.67 ?  34   HOH A O     1 
HETATM 7750 O  O     . HOH N 7 .   ? 14.302  -1.089  19.621  1.00 29.19 ?  35   HOH A O     1 
HETATM 7751 O  O     . HOH N 7 .   ? 26.505  -19.300 20.159  1.00 25.40 ?  36   HOH A O     1 
HETATM 7752 O  O     . HOH N 7 .   ? -3.323  -15.123 35.213  1.00 30.06 ?  37   HOH A O     1 
HETATM 7753 O  O     . HOH N 7 .   ? -3.920  6.697   61.221  1.00 21.42 ?  38   HOH A O     1 
HETATM 7754 O  O     . HOH N 7 .   ? 30.288  9.996   1.738   1.00 22.13 ?  39   HOH A O     1 
HETATM 7755 O  O     . HOH N 7 .   ? 12.477  -18.707 43.243  1.00 21.69 ?  40   HOH A O     1 
HETATM 7756 O  O     . HOH N 7 .   ? -1.535  21.264  56.710  1.00 26.85 ?  41   HOH A O     1 
HETATM 7757 O  O     . HOH N 7 .   ? -23.507 32.542  37.841  1.00 20.74 ?  42   HOH A O     1 
HETATM 7758 O  O     . HOH N 7 .   ? 48.534  3.610   15.715  1.00 26.76 ?  43   HOH A O     1 
HETATM 7759 O  O     . HOH N 7 .   ? -3.103  -16.411 39.338  1.00 25.03 ?  44   HOH A O     1 
HETATM 7760 O  O     . HOH N 7 .   ? -5.297  4.816   39.114  1.00 14.04 ?  45   HOH A O     1 
HETATM 7761 O  O     . HOH N 7 .   ? -5.146  -7.604  45.460  1.00 17.91 ?  46   HOH A O     1 
HETATM 7762 O  O     . HOH N 7 .   ? 29.055  -15.738 6.428   1.00 22.54 ?  48   HOH A O     1 
HETATM 7763 O  O     . HOH N 7 .   ? -17.425 5.340   46.300  1.00 23.96 ?  50   HOH A O     1 
HETATM 7764 O  O     . HOH N 7 .   ? 32.573  -2.883  20.353  1.00 29.32 ?  52   HOH A O     1 
HETATM 7765 O  O     . HOH N 7 .   ? 3.552   -19.514 28.204  1.00 27.64 ?  53   HOH A O     1 
HETATM 7766 O  O     . HOH N 7 .   ? -8.758  15.925  20.538  1.00 26.29 ?  54   HOH A O     1 
HETATM 7767 O  O     . HOH N 7 .   ? -3.491  10.979  61.278  1.00 36.88 ?  56   HOH A O     1 
HETATM 7768 O  O     . HOH N 7 .   ? 22.454  -8.376  28.432  1.00 37.45 ?  57   HOH A O     1 
HETATM 7769 O  O     . HOH N 7 .   ? -13.373 13.201  32.470  1.00 26.13 ?  58   HOH A O     1 
HETATM 7770 O  O     . HOH N 7 .   ? 27.307  -17.657 6.522   1.00 27.97 ?  59   HOH A O     1 
HETATM 7771 O  O     . HOH N 7 .   ? 5.395   20.140  46.977  1.00 25.87 ?  60   HOH A O     1 
HETATM 7772 O  O     . HOH N 7 .   ? 29.100  6.689   -1.435  1.00 30.16 ?  62   HOH A O     1 
HETATM 7773 O  O     . HOH N 7 .   ? 12.664  -17.051 17.285  1.00 30.67 ?  63   HOH A O     1 
HETATM 7774 O  O     . HOH N 7 .   ? 13.854  -26.181 24.739  1.00 26.50 ?  65   HOH A O     1 
HETATM 7775 O  O     . HOH N 7 .   ? 14.123  6.301   6.189   1.00 31.16 ?  66   HOH A O     1 
HETATM 7776 O  O     . HOH N 7 .   ? 3.359   -2.048  22.984  1.00 18.36 ?  989  HOH A O     1 
HETATM 7777 O  O     . HOH N 7 .   ? -0.293  -7.139  39.906  1.00 19.91 ?  990  HOH A O     1 
HETATM 7778 O  O     . HOH N 7 .   ? -1.788  -2.221  35.986  1.00 11.80 ?  991  HOH A O     1 
HETATM 7779 O  O     . HOH N 7 .   ? 12.879  -3.405  25.718  1.00 17.68 ?  992  HOH A O     1 
HETATM 7780 O  O     . HOH N 7 .   ? 31.721  -30.995 9.992   1.00 25.63 ?  993  HOH A O     1 
HETATM 7781 O  O     . HOH N 7 .   ? -17.467 14.542  48.095  1.00 22.21 ?  994  HOH A O     1 
HETATM 7782 O  O     . HOH N 7 .   ? 35.012  -3.395  0.682   1.00 22.56 ?  995  HOH A O     1 
HETATM 7783 O  O     . HOH N 7 .   ? 0.148   -6.517  32.612  1.00 20.27 ?  996  HOH A O     1 
HETATM 7784 O  O     . HOH N 7 .   ? 5.841   -24.737 37.345  1.00 30.20 ?  997  HOH A O     1 
HETATM 7785 O  O     . HOH N 7 .   ? -1.285  5.338   41.829  1.00 17.93 ?  998  HOH A O     1 
HETATM 7786 O  O     . HOH N 7 .   ? -1.940  12.332  33.874  1.00 19.23 ?  999  HOH A O     1 
HETATM 7787 O  O     . HOH N 7 .   ? 24.916  1.369   16.516  1.00 22.20 ?  1000 HOH A O     1 
HETATM 7788 O  O     . HOH N 7 .   ? 19.579  -17.878 13.095  1.00 25.61 ?  1001 HOH A O     1 
HETATM 7789 O  O     . HOH N 7 .   ? 27.603  -8.596  24.400  1.00 34.20 ?  1002 HOH A O     1 
HETATM 7790 O  O     . HOH N 7 .   ? -7.824  -8.091  41.803  1.00 23.80 ?  1003 HOH A O     1 
HETATM 7791 O  O     . HOH N 7 .   ? -3.735  2.791   13.506  1.00 21.14 ?  1004 HOH A O     1 
HETATM 7792 O  O     . HOH N 7 .   ? 33.383  -18.979 13.439  1.00 32.14 ?  1005 HOH A O     1 
HETATM 7793 O  O     . HOH N 7 .   ? 21.613  -9.530  9.192   1.00 36.35 ?  1006 HOH A O     1 
HETATM 7794 O  O     . HOH N 7 .   ? -13.718 30.640  21.416  1.00 31.06 ?  1007 HOH A O     1 
HETATM 7795 O  O     . HOH N 7 .   ? -17.979 12.416  40.553  1.00 27.74 ?  1008 HOH A O     1 
HETATM 7796 O  O     . HOH N 7 .   ? 21.838  -0.891  -5.648  1.00 35.49 ?  1009 HOH A O     1 
HETATM 7797 O  O     . HOH N 7 .   ? 19.011  6.119   27.487  1.00 33.38 ?  1010 HOH A O     1 
HETATM 7798 O  O     . HOH N 7 .   ? -24.934 25.379  39.675  1.00 20.97 ?  1011 HOH A O     1 
HETATM 7799 O  O     . HOH N 7 .   ? -11.065 -3.014  46.132  1.00 27.01 ?  1012 HOH A O     1 
HETATM 7800 O  O     . HOH N 7 .   ? 16.878  4.874   15.804  1.00 28.24 ?  1013 HOH A O     1 
HETATM 7801 O  O     . HOH N 7 .   ? -19.380 8.430   3.812   1.00 35.82 ?  1014 HOH A O     1 
HETATM 7802 O  O     . HOH N 7 .   ? -0.828  8.830   41.977  1.00 37.11 ?  1015 HOH A O     1 
HETATM 7803 O  O     . HOH N 7 .   ? 6.617   -10.573 47.016  1.00 22.34 ?  1016 HOH A O     1 
HETATM 7804 O  O     . HOH N 7 .   ? 24.408  -18.916 21.797  1.00 22.55 ?  1017 HOH A O     1 
HETATM 7805 O  O     . HOH N 7 .   ? 40.309  6.672   17.269  1.00 23.24 ?  1018 HOH A O     1 
HETATM 7806 O  O     . HOH N 7 .   ? 35.534  -4.661  -1.791  1.00 26.06 ?  1019 HOH A O     1 
HETATM 7807 O  O     . HOH N 7 .   ? 15.021  9.757   8.511   1.00 33.51 ?  1020 HOH A O     1 
HETATM 7808 O  O     . HOH N 7 .   ? -4.440  -11.578 45.854  1.00 24.52 ?  1021 HOH A O     1 
HETATM 7809 O  O     . HOH N 7 .   ? 54.149  4.472   5.586   1.00 26.30 ?  1022 HOH A O     1 
HETATM 7810 O  O     . HOH N 7 .   ? -7.546  -9.154  38.804  1.00 46.16 ?  1023 HOH A O     1 
HETATM 7811 O  O     . HOH N 7 .   ? -7.177  1.406   60.288  1.00 20.81 ?  1024 HOH A O     1 
HETATM 7812 O  O     . HOH N 7 .   ? -0.433  -5.810  35.229  1.00 21.81 ?  1025 HOH A O     1 
HETATM 7813 O  O     . HOH N 7 .   ? 23.074  -14.732 2.959   1.00 31.06 ?  1026 HOH A O     1 
HETATM 7814 O  O     . HOH N 7 .   ? -7.976  14.533  2.107   1.00 30.06 ?  1027 HOH A O     1 
HETATM 7815 O  O     . HOH N 7 .   ? -22.017 37.477  29.044  1.00 27.58 ?  1028 HOH A O     1 
HETATM 7816 O  O     . HOH N 7 .   ? 10.388  3.245   52.423  1.00 24.84 ?  1029 HOH A O     1 
HETATM 7817 O  O     . HOH N 7 .   ? -0.448  4.017   7.409   1.00 26.29 ?  1030 HOH A O     1 
HETATM 7818 O  O     . HOH N 7 .   ? 20.058  -13.569 9.031   1.00 37.09 ?  1031 HOH A O     1 
HETATM 7819 O  O     . HOH N 7 .   ? 11.666  -18.274 19.834  1.00 24.47 ?  1032 HOH A O     1 
HETATM 7820 O  O     . HOH N 7 .   ? -27.698 17.897  19.472  1.00 34.25 ?  1033 HOH A O     1 
HETATM 7821 O  O     . HOH N 7 .   ? 34.973  15.952  11.014  1.00 27.85 ?  1034 HOH A O     1 
HETATM 7822 O  O     . HOH N 7 .   ? 20.318  4.685   7.166   1.00 35.96 ?  1035 HOH A O     1 
HETATM 7823 O  O     . HOH N 7 .   ? -29.754 26.076  34.342  1.00 33.84 ?  1036 HOH A O     1 
HETATM 7824 O  O     . HOH N 7 .   ? -11.701 12.594  25.983  1.00 36.30 ?  1037 HOH A O     1 
HETATM 7825 O  O     . HOH N 7 .   ? 33.295  -18.809 10.924  1.00 26.10 ?  1038 HOH A O     1 
HETATM 7826 O  O     . HOH N 7 .   ? 27.364  8.784   20.085  1.00 27.79 ?  1039 HOH A O     1 
HETATM 7827 O  O     . HOH N 7 .   ? 7.823   5.319   8.014   1.00 41.09 ?  1040 HOH A O     1 
HETATM 7828 O  O     . HOH N 7 .   ? -8.427  -3.853  47.680  1.00 32.83 ?  1041 HOH A O     1 
HETATM 7829 O  O     . HOH N 7 .   ? -1.901  -13.935 37.490  1.00 22.80 ?  1042 HOH A O     1 
HETATM 7830 O  O     . HOH N 7 .   ? 12.234  7.252   4.666   1.00 32.01 ?  1043 HOH A O     1 
HETATM 7831 O  O     . HOH N 7 .   ? 41.174  1.102   0.677   1.00 41.81 ?  1044 HOH A O     1 
HETATM 7832 O  O     . HOH N 7 .   ? -2.493  -14.540 27.196  1.00 28.00 ?  1045 HOH A O     1 
HETATM 7833 O  O     . HOH N 7 .   ? 22.367  13.230  -9.428  1.00 45.22 ?  1046 HOH A O     1 
HETATM 7834 O  O     . HOH N 7 .   ? -21.344 9.649   5.818   1.00 26.63 ?  1047 HOH A O     1 
HETATM 7835 O  O     . HOH N 7 .   ? 8.485   11.443  9.542   1.00 30.90 ?  1048 HOH A O     1 
HETATM 7836 O  O     . HOH N 7 .   ? 34.034  -13.325 5.126   1.00 24.23 ?  1049 HOH A O     1 
HETATM 7837 O  O     . HOH N 7 .   ? 9.851   0.812   11.342  1.00 33.51 ?  1050 HOH A O     1 
HETATM 7838 O  O     . HOH N 7 .   ? 31.012  -3.533  22.727  1.00 28.50 ?  1051 HOH A O     1 
HETATM 7839 O  O     . HOH N 7 .   ? 20.315  -15.724 10.750  1.00 30.07 ?  1052 HOH A O     1 
HETATM 7840 O  O     . HOH N 7 .   ? 16.983  -18.187 11.420  1.00 33.20 ?  1053 HOH A O     1 
HETATM 7841 O  O     . HOH N 7 .   ? 16.268  12.153  9.079   1.00 31.14 ?  1054 HOH A O     1 
HETATM 7842 O  O     . HOH N 7 .   ? 26.655  5.937   26.727  1.00 38.48 ?  1055 HOH A O     1 
HETATM 7843 O  O     . HOH N 7 .   ? -16.027 11.754  43.595  1.00 27.47 ?  1056 HOH A O     1 
HETATM 7844 O  O     . HOH N 7 .   ? -7.746  15.303  9.813   1.00 30.78 ?  1057 HOH A O     1 
HETATM 7845 O  O     . HOH N 7 .   ? 24.617  3.232   0.197   1.00 32.35 ?  1058 HOH A O     1 
HETATM 7846 O  O     . HOH N 7 .   ? 23.794  -0.799  33.979  1.00 30.43 ?  1059 HOH A O     1 
HETATM 7847 O  O     . HOH N 7 .   ? -27.225 22.032  18.187  1.00 31.50 ?  1060 HOH A O     1 
HETATM 7848 O  O     . HOH N 7 .   ? -3.838  -18.163 41.504  1.00 25.02 ?  1061 HOH A O     1 
HETATM 7849 O  O     . HOH N 7 .   ? 15.559  8.146   26.014  1.00 42.47 ?  1062 HOH A O     1 
HETATM 7850 O  O     . HOH N 7 .   ? 30.611  -18.111 13.383  1.00 38.95 ?  1063 HOH A O     1 
HETATM 7851 O  O     . HOH N 7 .   ? -27.348 26.814  34.349  1.00 25.80 ?  1064 HOH A O     1 
HETATM 7852 O  O     . HOH N 7 .   ? 8.441   -10.513 49.298  1.00 27.37 ?  1065 HOH A O     1 
HETATM 7853 O  O     . HOH N 7 .   ? 8.236   -0.662  9.797   1.00 39.91 ?  1066 HOH A O     1 
HETATM 7854 O  O     . HOH N 7 .   ? 9.489   0.655   6.008   1.00 32.19 ?  1067 HOH A O     1 
HETATM 7855 O  O     . HOH N 7 .   ? -10.922 -3.986  43.321  1.00 36.86 ?  1068 HOH A O     1 
HETATM 7856 O  O     . HOH N 7 .   ? 12.470  20.783  9.570   1.00 26.79 ?  1069 HOH A O     1 
HETATM 7857 O  O     . HOH N 7 .   ? 1.808   20.860  57.578  1.00 31.72 ?  1070 HOH A O     1 
HETATM 7858 O  O     . HOH N 7 .   ? 1.406   5.889   41.693  1.00 41.06 ?  1071 HOH A O     1 
HETATM 7859 O  O     . HOH N 7 .   ? 3.532   -8.346  21.049  1.00 30.40 ?  1072 HOH A O     1 
HETATM 7860 O  O     . HOH N 7 .   ? -18.331 11.311  44.913  1.00 27.99 ?  1073 HOH A O     1 
HETATM 7861 O  O     . HOH N 7 .   ? -12.246 18.163  0.815   1.00 38.96 ?  1074 HOH A O     1 
HETATM 7862 O  O     . HOH N 7 .   ? -9.843  16.189  8.978   1.00 28.63 ?  1075 HOH A O     1 
HETATM 7863 O  O     . HOH N 7 .   ? -21.073 12.843  34.982  1.00 34.11 ?  1076 HOH A O     1 
HETATM 7864 O  O     . HOH N 7 .   ? -21.275 26.228  19.579  1.00 27.55 ?  1077 HOH A O     1 
HETATM 7865 O  O     . HOH N 7 .   ? 19.466  4.848   11.487  1.00 28.91 ?  1078 HOH A O     1 
HETATM 7866 O  O     . HOH N 7 .   ? 44.775  12.320  11.506  1.00 39.44 ?  1079 HOH A O     1 
HETATM 7867 O  O     . HOH N 7 .   ? 22.399  -18.701 15.908  1.00 23.78 ?  1080 HOH A O     1 
HETATM 7868 O  O     . HOH N 7 .   ? 21.094  -6.647  29.913  1.00 39.98 ?  1081 HOH A O     1 
HETATM 7869 O  O     . HOH N 7 .   ? 40.090  -10.110 6.426   1.00 34.90 ?  1082 HOH A O     1 
HETATM 7870 O  O     . HOH N 7 .   ? 36.541  10.617  20.439  1.00 31.89 ?  1083 HOH A O     1 
HETATM 7871 O  O     . HOH N 7 .   ? 25.295  -43.054 6.172   1.00 37.88 ?  1084 HOH A O     1 
HETATM 7872 O  O     . HOH N 7 .   ? -13.262 -3.246  42.362  1.00 35.97 ?  1085 HOH A O     1 
HETATM 7873 O  O     . HOH N 7 .   ? 10.846  5.351   25.653  1.00 35.22 ?  1086 HOH A O     1 
HETATM 7874 O  O     . HOH N 7 .   ? 20.862  -13.272 6.449   1.00 36.46 ?  1087 HOH A O     1 
HETATM 7875 O  O     . HOH N 7 .   ? 15.452  8.636   -6.794  1.00 28.29 ?  1088 HOH A O     1 
HETATM 7876 O  O     . HOH N 7 .   ? 21.257  -21.137 34.274  1.00 29.61 ?  1089 HOH A O     1 
HETATM 7877 O  O     . HOH N 7 .   ? 22.155  -16.794 13.595  1.00 38.38 ?  1090 HOH A O     1 
HETATM 7878 O  O     . HOH N 7 .   ? 27.413  -35.971 18.299  1.00 37.30 ?  1091 HOH A O     1 
HETATM 7879 O  O     . HOH N 7 .   ? -4.170  15.832  14.552  1.00 45.36 ?  1092 HOH A O     1 
HETATM 7880 O  O     . HOH N 7 .   ? 49.173  0.292   19.325  1.00 28.00 ?  1093 HOH A O     1 
HETATM 7881 O  O     . HOH N 7 .   ? 26.927  9.636   -10.432 1.00 33.19 ?  1094 HOH A O     1 
HETATM 7882 O  O     . HOH N 7 .   ? 9.895   5.481   53.647  1.00 30.91 ?  1095 HOH A O     1 
HETATM 7883 O  O     . HOH N 7 .   ? -10.321 0.631   52.953  1.00 37.65 ?  1096 HOH A O     1 
HETATM 7884 O  O     . HOH N 7 .   ? 25.191  -20.393 24.038  1.00 26.43 ?  1097 HOH A O     1 
HETATM 7885 O  O     . HOH N 7 .   ? 12.540  3.894   -3.845  1.00 41.90 ?  1098 HOH A O     1 
HETATM 7886 O  O     . HOH N 7 .   ? 5.266   3.941   31.631  1.00 34.71 ?  1099 HOH A O     1 
HETATM 7887 O  O     . HOH N 7 .   ? 37.151  -8.262  21.743  1.00 27.93 ?  1100 HOH A O     1 
HETATM 7888 O  O     . HOH N 7 .   ? 22.474  -3.314  11.966  1.00 31.56 ?  1101 HOH A O     1 
HETATM 7889 O  O     . HOH N 7 .   ? 9.416   6.895   51.533  1.00 29.81 ?  1102 HOH A O     1 
HETATM 7890 O  O     . HOH N 7 .   ? 23.919  -5.437  26.468  1.00 40.45 ?  1103 HOH A O     1 
HETATM 7891 O  O     . HOH N 7 .   ? 15.948  -16.990 45.470  1.00 25.74 ?  1104 HOH A O     1 
HETATM 7892 O  O     . HOH N 7 .   ? 7.968   9.536   -8.592  1.00 42.41 ?  1105 HOH A O     1 
HETATM 7893 O  O     . HOH N 7 .   ? 0.518   -3.820  60.237  1.00 31.60 ?  1106 HOH A O     1 
HETATM 7894 O  O     . HOH N 7 .   ? 27.248  7.269   -5.003  1.00 33.75 ?  1107 HOH A O     1 
HETATM 7895 O  O     . HOH N 7 .   ? 49.779  -1.935  20.087  1.00 12.77 ?  1108 HOH A O     1 
HETATM 7896 O  O     . HOH N 7 .   ? 12.124  2.600   26.078  1.00 30.09 ?  1109 HOH A O     1 
HETATM 7897 O  O     . HOH N 7 .   ? 20.524  -22.334 31.725  1.00 35.75 ?  1110 HOH A O     1 
HETATM 7898 O  O     . HOH N 7 .   ? 13.432  18.739  8.080   1.00 34.08 ?  1111 HOH A O     1 
HETATM 7899 O  O     . HOH N 7 .   ? -21.874 34.154  27.240  1.00 28.37 ?  1112 HOH A O     1 
HETATM 7900 O  O     . HOH N 7 .   ? 4.286   -23.647 35.225  1.00 27.72 ?  1113 HOH A O     1 
HETATM 7901 O  O     . HOH N 7 .   ? 9.222   -31.281 47.757  1.00 38.08 ?  1114 HOH A O     1 
HETATM 7902 O  O     . HOH N 7 .   ? 6.315   -21.244 48.166  1.00 30.19 ?  1115 HOH A O     1 
HETATM 7903 O  O     . HOH N 7 .   ? -28.057 15.925  45.297  1.00 31.79 ?  1116 HOH A O     1 
HETATM 7904 O  O     . HOH N 7 .   ? 13.843  1.380   41.402  1.00 36.15 ?  1117 HOH A O     1 
HETATM 7905 O  O     . HOH N 7 .   ? -13.180 8.276   28.615  1.00 37.15 ?  1118 HOH A O     1 
HETATM 7906 O  O     . HOH N 7 .   ? 48.356  -2.689  18.263  1.00 32.13 ?  1119 HOH A O     1 
HETATM 7907 O  O     . HOH N 7 .   ? -19.577 28.053  18.585  1.00 31.78 ?  1120 HOH A O     1 
HETATM 7908 O  O     . HOH N 7 .   ? -8.849  1.158   66.163  1.00 21.25 ?  1121 HOH A O     1 
HETATM 7909 O  O     . HOH N 7 .   ? -23.881 37.654  27.291  1.00 26.58 ?  1122 HOH A O     1 
HETATM 7910 O  O     . HOH N 7 .   ? 46.755  -4.035  3.232   1.00 32.23 ?  1123 HOH A O     1 
HETATM 7911 O  O     . HOH N 7 .   ? -25.746 29.144  31.016  1.00 26.33 ?  1124 HOH A O     1 
HETATM 7912 O  O     . HOH N 7 .   ? 16.101  8.643   -9.514  1.00 33.73 ?  1125 HOH A O     1 
HETATM 7913 O  O     . HOH N 7 .   ? 48.983  -4.732  16.587  1.00 26.39 ?  1126 HOH A O     1 
HETATM 7914 O  O     . HOH N 7 .   ? 51.167  9.272   13.504  1.00 26.63 ?  1127 HOH A O     1 
HETATM 7915 O  O     . HOH N 7 .   ? 28.733  26.898  5.365   1.00 30.44 ?  1128 HOH A O     1 
HETATM 7916 O  O     . HOH N 7 .   ? 27.993  -10.837 24.298  1.00 38.61 ?  1129 HOH A O     1 
HETATM 7917 O  O     . HOH N 7 .   ? 0.582   17.405  15.731  1.00 38.77 ?  1130 HOH A O     1 
HETATM 7918 O  O     . HOH N 7 .   ? -14.940 12.741  34.240  1.00 32.95 ?  1131 HOH A O     1 
HETATM 7919 O  O     . HOH N 7 .   ? 41.119  7.663   1.766   1.00 35.64 ?  1132 HOH A O     1 
HETATM 7920 O  O     . HOH N 7 .   ? 11.496  4.336   41.447  1.00 29.81 ?  1133 HOH A O     1 
HETATM 7921 O  O     . HOH N 7 .   ? 6.709   10.891  -1.889  1.00 38.42 ?  1134 HOH A O     1 
HETATM 7922 O  O     . HOH N 7 .   ? -8.605  7.986   58.584  1.00 31.93 ?  1135 HOH A O     1 
HETATM 7923 O  O     . HOH N 7 .   ? -14.247 6.427   18.625  1.00 44.64 ?  1136 HOH A O     1 
HETATM 7924 O  O     . HOH N 7 .   ? 14.839  8.717   11.679  1.00 40.20 ?  1137 HOH A O     1 
HETATM 7925 O  O     . HOH N 7 .   ? -12.404 0.078   48.604  1.00 35.76 ?  1138 HOH A O     1 
HETATM 7926 O  O     . HOH N 7 .   ? -24.637 5.124   6.859   1.00 32.00 ?  1139 HOH A O     1 
HETATM 7927 O  O     . HOH N 7 .   ? 37.319  -6.452  -2.344  1.00 39.07 ?  1140 HOH A O     1 
HETATM 7928 O  O     . HOH N 7 .   ? 42.512  5.108   15.214  1.00 32.35 ?  1141 HOH A O     1 
HETATM 7929 O  O     . HOH N 7 .   ? -13.212 32.767  39.035  1.00 55.82 ?  1142 HOH A O     1 
HETATM 7930 O  O     . HOH N 7 .   ? 14.046  23.283  -13.118 1.00 28.96 ?  1143 HOH A O     1 
HETATM 7931 O  O     . HOH N 7 .   ? 6.964   -16.996 46.901  1.00 31.42 ?  1144 HOH A O     1 
HETATM 7932 O  O     . HOH N 7 .   ? 12.492  6.322   54.808  1.00 38.56 ?  1145 HOH A O     1 
HETATM 7933 O  O     . HOH N 7 .   ? -5.214  -15.726 37.325  1.00 27.02 ?  1146 HOH A O     1 
HETATM 7934 O  O     . HOH N 7 .   ? 27.841  -12.599 26.092  1.00 35.95 ?  1147 HOH A O     1 
HETATM 7935 O  O     . HOH N 7 .   ? 35.316  -9.831  20.313  1.00 39.57 ?  1148 HOH A O     1 
HETATM 7936 O  O     . HOH N 7 .   ? -17.455 29.673  46.522  1.00 30.34 ?  1149 HOH A O     1 
HETATM 7937 O  O     . HOH N 7 .   ? 37.856  0.114   29.835  1.00 62.91 ?  1150 HOH A O     1 
HETATM 7938 O  O     . HOH N 7 .   ? 21.450  -26.362 40.766  1.00 29.81 ?  1151 HOH A O     1 
HETATM 7939 O  O     . HOH N 7 .   ? 36.834  -10.446 18.362  1.00 36.48 ?  1152 HOH A O     1 
HETATM 7940 O  O     . HOH N 7 .   ? -28.831 33.164  28.224  1.00 29.40 ?  1153 HOH A O     1 
HETATM 7941 O  O     . HOH N 7 .   ? 15.602  10.604  25.870  1.00 40.54 ?  1154 HOH A O     1 
HETATM 7942 O  O     . HOH N 7 .   ? -18.900 27.420  15.228  1.00 45.58 ?  1155 HOH A O     1 
HETATM 7943 O  O     . HOH N 7 .   ? 51.774  2.254   2.406   1.00 57.81 ?  1156 HOH A O     1 
HETATM 7944 O  O     . HOH N 7 .   ? 21.902  14.673  21.459  1.00 34.41 ?  1157 HOH A O     1 
HETATM 7945 O  O     . HOH N 7 .   ? 28.653  -15.498 0.499   1.00 41.76 ?  1158 HOH A O     1 
HETATM 7946 O  O     . HOH N 7 .   ? -12.394 17.647  3.532   1.00 37.28 ?  1159 HOH A O     1 
HETATM 7947 O  O     . HOH N 7 .   ? 37.373  14.777  9.968   1.00 37.45 ?  1160 HOH A O     1 
HETATM 7948 O  O     . HOH N 7 .   ? 23.510  -19.963 38.747  1.00 42.33 ?  1161 HOH A O     1 
HETATM 7949 O  O     . HOH N 7 .   ? 43.300  17.849  6.924   1.00 35.28 ?  1162 HOH A O     1 
HETATM 7950 O  O     . HOH N 7 .   ? -9.502  1.931   8.283   1.00 47.79 ?  1163 HOH A O     1 
HETATM 7951 O  O     . HOH N 7 .   ? 40.644  -18.885 6.241   1.00 51.09 ?  1164 HOH A O     1 
HETATM 7952 O  O     . HOH N 7 .   ? 12.773  -5.399  50.679  1.00 38.85 ?  1165 HOH A O     1 
HETATM 7953 O  O     . HOH N 7 .   ? 19.380  -0.871  -2.819  1.00 35.94 ?  1166 HOH A O     1 
HETATM 7954 O  O     . HOH N 7 .   ? 1.418   24.836  15.350  1.00 42.48 ?  1167 HOH A O     1 
HETATM 7955 O  O     . HOH N 7 .   ? -10.567 7.121   62.817  1.00 30.16 ?  1168 HOH A O     1 
HETATM 7956 O  O     . HOH N 7 .   ? -7.915  -6.491  29.872  1.00 37.27 ?  1169 HOH A O     1 
HETATM 7957 O  O     . HOH N 7 .   ? 16.063  -14.673 44.827  1.00 40.09 ?  1170 HOH A O     1 
HETATM 7958 O  O     . HOH N 7 .   ? 23.964  -3.766  38.146  1.00 41.65 ?  1171 HOH A O     1 
HETATM 7959 O  O     . HOH N 7 .   ? 13.129  -17.372 45.254  1.00 33.33 ?  1172 HOH A O     1 
HETATM 7960 O  O     . HOH N 7 .   ? 11.499  -21.342 11.291  1.00 49.34 ?  1173 HOH A O     1 
HETATM 7961 O  O     . HOH N 7 .   ? 30.447  12.487  20.393  1.00 31.42 ?  1174 HOH A O     1 
HETATM 7962 O  O     . HOH N 7 .   ? -7.643  20.381  20.336  1.00 29.94 ?  1175 HOH A O     1 
HETATM 7963 O  O     . HOH N 7 .   ? -27.688 29.581  28.315  1.00 47.20 ?  1176 HOH A O     1 
HETATM 7964 O  O     . HOH N 7 .   ? 1.980   9.743   39.005  1.00 46.87 ?  1177 HOH A O     1 
HETATM 7965 O  O     . HOH N 7 .   ? 12.533  7.622   57.279  1.00 43.29 ?  1178 HOH A O     1 
HETATM 7966 O  O     . HOH N 7 .   ? 12.379  1.495   52.870  1.00 39.27 ?  1179 HOH A O     1 
HETATM 7967 O  O     . HOH N 7 .   ? 10.012  5.815   15.103  1.00 42.34 ?  1180 HOH A O     1 
HETATM 7968 O  O     . HOH N 7 .   ? -1.808  -10.690 50.434  1.00 29.79 ?  1181 HOH A O     1 
HETATM 7969 O  O     . HOH N 7 .   ? 14.991  1.245   45.815  1.00 52.18 ?  1182 HOH A O     1 
HETATM 7970 O  O     . HOH N 7 .   ? -27.733 17.383  22.062  1.00 33.56 ?  1183 HOH A O     1 
HETATM 7971 O  O     . HOH N 7 .   ? -15.971 28.026  47.575  1.00 32.62 ?  1184 HOH A O     1 
HETATM 7972 O  O     . HOH N 7 .   ? 28.229  -3.851  -1.781  1.00 44.38 ?  1185 HOH A O     1 
HETATM 7973 O  O     . HOH N 7 .   ? 38.531  -19.908 3.250   1.00 29.00 ?  1186 HOH A O     1 
HETATM 7974 O  O     . HOH N 7 .   ? 8.015   -3.552  11.915  1.00 48.38 ?  1187 HOH A O     1 
HETATM 7975 O  O     . HOH N 7 .   ? 21.698  16.366  -13.131 1.00 38.92 ?  1188 HOH A O     1 
HETATM 7976 O  O     . HOH N 7 .   ? 0.979   -12.161 51.117  1.00 38.37 ?  1189 HOH A O     1 
HETATM 7977 O  O     . HOH N 7 .   ? 50.561  -7.470  14.025  1.00 52.53 ?  1190 HOH A O     1 
HETATM 7978 O  O     . HOH N 7 .   ? 51.591  -3.326  4.824   1.00 50.09 ?  1191 HOH A O     1 
HETATM 7979 O  O     . HOH N 7 .   ? 31.929  14.654  20.135  1.00 55.86 ?  1192 HOH A O     1 
HETATM 7980 O  O     . HOH N 7 .   ? -7.831  25.418  21.669  1.00 48.04 ?  1193 HOH A O     1 
HETATM 7981 O  O     . HOH N 7 .   ? 4.760   11.891  9.276   1.00 36.21 ?  1194 HOH A O     1 
HETATM 7982 O  O     . HOH N 7 .   ? 9.515   19.218  47.137  1.00 36.62 ?  1195 HOH A O     1 
HETATM 7983 O  O     . HOH N 7 .   ? 1.229   8.799   21.814  1.00 50.23 ?  1196 HOH A O     1 
HETATM 7984 O  O     . HOH N 7 .   ? 40.306  6.518   20.275  1.00 52.05 ?  1197 HOH A O     1 
HETATM 7985 O  O     . HOH N 7 .   ? 28.962  -20.291 21.788  1.00 47.73 ?  1198 HOH A O     1 
HETATM 7986 O  O     . HOH N 7 .   ? 41.051  3.168   2.511   1.00 35.64 ?  1199 HOH A O     1 
HETATM 7987 O  O     . HOH N 7 .   ? 12.694  -16.917 11.023  1.00 54.73 ?  1200 HOH A O     1 
HETATM 7988 O  O     . HOH N 7 .   ? 26.990  -22.187 -2.641  1.00 52.83 ?  1201 HOH A O     1 
HETATM 7989 O  O     . HOH N 7 .   ? 23.970  -5.383  41.699  1.00 60.85 ?  1202 HOH A O     1 
HETATM 7990 O  O     . HOH N 7 .   ? 15.246  -9.099  14.288  1.00 45.17 ?  1203 HOH A O     1 
HETATM 7991 O  O     . HOH N 7 .   ? 23.496  -8.447  38.799  1.00 46.69 ?  1204 HOH A O     1 
HETATM 7992 O  O     . HOH N 7 .   ? 30.582  -17.769 17.214  1.00 51.68 ?  1205 HOH A O     1 
HETATM 7993 O  O     . HOH N 7 .   ? 30.687  -33.918 4.065   1.00 48.04 ?  1206 HOH A O     1 
HETATM 7994 O  O     . HOH N 7 .   ? 5.463   6.057   39.390  1.00 70.75 ?  1207 HOH A O     1 
HETATM 7995 O  O     . HOH N 7 .   ? -24.902 22.512  46.920  1.00 34.71 ?  1208 HOH A O     1 
HETATM 7996 O  O     . HOH N 7 .   ? 47.464  8.322   3.300   1.00 46.64 ?  1209 HOH A O     1 
HETATM 7997 O  O     . HOH N 7 .   ? 7.505   -13.416 23.552  1.00 23.42 ?  1210 HOH A O     1 
HETATM 7998 O  O     . HOH N 7 .   ? -14.263 16.638  24.364  1.00 31.73 ?  1211 HOH A O     1 
HETATM 7999 O  O     . HOH N 7 .   ? -14.967 2.605   38.803  1.00 36.73 ?  1212 HOH A O     1 
HETATM 8000 O  O     . HOH N 7 .   ? 31.888  -15.603 21.319  1.00 34.39 ?  1213 HOH A O     1 
HETATM 8001 O  O     . HOH N 7 .   ? -2.429  3.624   15.626  1.00 36.98 ?  1214 HOH A O     1 
HETATM 8002 O  O     . HOH N 7 .   ? -3.448  8.665   63.189  1.00 24.01 ?  1215 HOH A O     1 
HETATM 8003 O  O     . HOH N 7 .   ? 9.188   -23.852 10.563  1.00 35.81 ?  1216 HOH A O     1 
HETATM 8004 O  O     . HOH N 7 .   ? -1.477  12.432  12.620  1.00 34.09 ?  1217 HOH A O     1 
HETATM 8005 O  O     . HOH N 7 .   ? -4.516  8.954   1.188   1.00 42.88 ?  1218 HOH A O     1 
HETATM 8006 O  O     . HOH N 7 .   ? 0.222   7.106   10.380  1.00 37.17 ?  1219 HOH A O     1 
HETATM 8007 O  O     . HOH N 7 .   ? 14.463  29.268  -4.656  1.00 27.02 ?  1220 HOH A O     1 
HETATM 8008 O  O     . HOH N 7 .   ? -15.026 9.377   16.092  1.00 29.92 ?  1221 HOH A O     1 
HETATM 8009 O  O     . HOH N 7 .   ? -1.551  15.421  -2.651  1.00 29.39 ?  1222 HOH A O     1 
HETATM 8010 O  O     . HOH N 7 .   ? 24.733  34.256  1.883   1.00 30.14 ?  1223 HOH A O     1 
HETATM 8011 O  O     . HOH N 7 .   ? 42.540  -10.251 10.382  1.00 24.77 ?  1224 HOH A O     1 
HETATM 8012 O  O     . HOH N 7 .   ? -27.413 14.819  8.968   1.00 39.08 ?  1225 HOH A O     1 
HETATM 8013 O  O     . HOH N 7 .   ? -15.203 29.524  14.545  1.00 26.37 ?  1226 HOH A O     1 
HETATM 8014 O  O     . HOH N 7 .   ? 25.883  22.656  17.204  1.00 42.82 ?  1227 HOH A O     1 
HETATM 8015 O  O     . HOH N 7 .   ? 17.906  -23.338 31.476  1.00 25.61 ?  1228 HOH A O     1 
HETATM 8016 O  O     . HOH N 7 .   ? 18.124  -13.907 40.908  1.00 29.63 ?  1229 HOH A O     1 
HETATM 8017 O  O     . HOH N 7 .   ? 27.134  11.076  20.460  1.00 41.61 ?  1230 HOH A O     1 
HETATM 8018 O  O     . HOH N 7 .   ? 24.532  15.595  20.770  1.00 39.96 ?  1231 HOH A O     1 
HETATM 8019 O  O     . HOH N 7 .   ? -9.027  -10.198 34.643  1.00 36.84 ?  1232 HOH A O     1 
HETATM 8020 O  O     . HOH N 7 .   ? 20.415  -18.899 34.762  1.00 25.55 ?  1233 HOH A O     1 
HETATM 8021 O  O     . HOH N 7 .   ? -6.497  -9.931  45.945  1.00 22.49 ?  1234 HOH A O     1 
HETATM 8022 O  O     . HOH N 7 .   ? -17.859 3.338   37.346  1.00 47.94 ?  1235 HOH A O     1 
HETATM 8023 O  O     . HOH N 7 .   ? 13.872  -25.264 3.762   1.00 36.45 ?  1236 HOH A O     1 
HETATM 8024 O  O     . HOH N 7 .   ? 13.627  -32.665 9.038   1.00 28.01 ?  1237 HOH A O     1 
HETATM 8025 O  O     . HOH N 7 .   ? -27.224 19.445  44.999  1.00 22.15 ?  1238 HOH A O     1 
HETATM 8026 O  O     . HOH N 7 .   ? 4.164   13.845  6.444   1.00 53.82 ?  1239 HOH A O     1 
HETATM 8027 O  O     . HOH N 7 .   ? -15.295 3.222   10.951  1.00 34.59 ?  1240 HOH A O     1 
HETATM 8028 O  O     . HOH N 7 .   ? -1.494  16.459  35.321  1.00 36.68 ?  1241 HOH A O     1 
HETATM 8029 O  O     . HOH N 7 .   ? -0.794  13.454  31.671  1.00 29.54 ?  1242 HOH A O     1 
HETATM 8030 O  O     . HOH N 7 .   ? 21.021  -1.354  11.130  1.00 42.55 ?  1243 HOH A O     1 
HETATM 8031 O  O     . HOH N 7 .   ? 13.264  1.377   20.833  1.00 34.29 ?  1244 HOH A O     1 
HETATM 8032 O  O     . HOH N 7 .   ? -26.473 15.367  18.427  1.00 33.53 ?  1245 HOH A O     1 
HETATM 8033 O  O     . HOH N 7 .   ? 25.467  38.822  3.908   1.00 36.21 ?  1246 HOH A O     1 
HETATM 8034 O  O     . HOH N 7 .   ? 16.936  -26.463 30.304  1.00 42.90 ?  1247 HOH A O     1 
HETATM 8035 O  O     . HOH N 7 .   ? -7.703  23.123  17.790  1.00 29.64 ?  1248 HOH A O     1 
HETATM 8036 O  O     . HOH N 7 .   ? -7.731  18.167  18.948  1.00 37.38 ?  1249 HOH A O     1 
HETATM 8037 O  O     . HOH N 7 .   ? -4.867  17.869  26.325  1.00 33.23 ?  1250 HOH A O     1 
HETATM 8038 O  O     . HOH N 7 .   ? -21.807 36.949  32.108  1.00 38.40 ?  1251 HOH A O     1 
HETATM 8039 O  O     . HOH N 7 .   ? -10.587 0.405   50.226  1.00 52.08 ?  1252 HOH A O     1 
HETATM 8040 O  O     . HOH N 7 .   ? -17.722 7.680   48.816  1.00 33.31 ?  1253 HOH A O     1 
HETATM 8041 O  O     . HOH N 7 .   ? -15.188 12.090  50.554  1.00 46.62 ?  1254 HOH A O     1 
HETATM 8042 O  O     . HOH N 7 .   ? -17.814 9.941   41.171  1.00 51.82 ?  1255 HOH A O     1 
HETATM 8043 O  O     . HOH N 7 .   ? -18.869 10.781  33.609  1.00 40.26 ?  1256 HOH A O     1 
HETATM 8044 O  O     . HOH N 7 .   ? -14.113 11.374  30.385  1.00 41.75 ?  1257 HOH A O     1 
HETATM 8045 O  O     . HOH N 7 .   ? -14.981 15.058  26.399  1.00 50.52 ?  1258 HOH A O     1 
HETATM 8046 O  O     . HOH N 7 .   ? -16.869 14.116  27.426  1.00 53.18 ?  1259 HOH A O     1 
HETATM 8047 O  O     . HOH N 7 .   ? -14.993 12.547  22.135  1.00 47.92 ?  1260 HOH A O     1 
HETATM 8048 O  O     . HOH N 7 .   ? -17.286 11.983  18.522  1.00 38.61 ?  1261 HOH A O     1 
HETATM 8049 O  O     . HOH N 7 .   ? -28.048 11.577  15.557  1.00 39.96 ?  1262 HOH A O     1 
HETATM 8050 O  O     . HOH N 7 .   ? -29.546 13.412  14.835  1.00 34.66 ?  1263 HOH A O     1 
HETATM 8051 O  O     . HOH N 7 .   ? -20.896 3.082   16.024  1.00 50.94 ?  1264 HOH A O     1 
HETATM 8052 O  O     . HOH N 7 .   ? -18.025 5.083   19.370  1.00 34.04 ?  1265 HOH A O     1 
HETATM 8053 O  O     . HOH N 7 .   ? -8.952  -12.144 28.024  1.00 41.80 ?  1266 HOH A O     1 
HETATM 8054 O  O     . HOH N 7 .   ? -0.800  -11.670 24.290  1.00 39.27 ?  1267 HOH A O     1 
HETATM 8055 O  O     . HOH N 7 .   ? -2.229  1.376   19.808  1.00 26.69 ?  1268 HOH A O     1 
HETATM 8056 O  O     . HOH N 7 .   ? 2.559   5.072   36.107  1.00 44.19 ?  1269 HOH A O     1 
HETATM 8057 O  O     . HOH N 7 .   ? 0.147   3.409   40.906  1.00 32.56 ?  1270 HOH A O     1 
HETATM 8058 O  O     . HOH N 7 .   ? 7.163   7.617   43.233  1.00 56.66 ?  1271 HOH A O     1 
HETATM 8059 O  O     . HOH N 7 .   ? 8.005   4.333   43.502  1.00 37.24 ?  1272 HOH A O     1 
HETATM 8060 O  O     . HOH N 7 .   ? 13.125  -1.543  43.847  1.00 40.69 ?  1273 HOH A O     1 
HETATM 8061 O  O     . HOH N 7 .   ? 20.663  -10.090 40.446  1.00 55.04 ?  1274 HOH A O     1 
HETATM 8062 O  O     . HOH N 7 .   ? 24.821  -1.502  31.505  1.00 39.37 ?  1275 HOH A O     1 
HETATM 8063 O  O     . HOH N 7 .   ? 23.061  -3.651  30.244  1.00 36.84 ?  1276 HOH A O     1 
HETATM 8064 O  O     . HOH N 7 .   ? 26.982  -2.125  27.176  1.00 43.55 ?  1277 HOH A O     1 
HETATM 8065 O  O     . HOH N 7 .   ? 29.446  -2.606  26.658  1.00 37.04 ?  1278 HOH A O     1 
HETATM 8066 O  O     . HOH N 7 .   ? 25.866  -5.076  27.738  1.00 44.04 ?  1279 HOH A O     1 
HETATM 8067 O  O     . HOH N 7 .   ? 25.710  -8.889  28.739  1.00 43.26 ?  1280 HOH A O     1 
HETATM 8068 O  O     . HOH N 7 .   ? 24.991  -3.043  14.151  1.00 35.21 ?  1281 HOH A O     1 
HETATM 8069 O  O     . HOH N 7 .   ? 16.270  -5.032  12.075  1.00 63.32 ?  1282 HOH A O     1 
HETATM 8070 O  O     . HOH N 7 .   ? 16.200  -1.519  11.417  1.00 59.55 ?  1283 HOH A O     1 
HETATM 8071 O  O     . HOH N 7 .   ? 9.372   -12.662 20.466  1.00 52.46 ?  1284 HOH A O     1 
HETATM 8072 O  O     . HOH N 7 .   ? 13.425  -20.089 9.048   1.00 43.68 ?  1285 HOH A O     1 
HETATM 8073 O  O     . HOH N 7 .   ? 10.990  -19.184 12.465  1.00 52.45 ?  1286 HOH A O     1 
HETATM 8074 O  O     . HOH N 7 .   ? 12.183  -20.924 5.133   1.00 44.68 ?  1287 HOH A O     1 
HETATM 8075 O  O     . HOH N 7 .   ? -10.069 21.232  20.140  1.00 19.05 ?  1288 HOH A O     1 
HETATM 8076 O  O     . HOH N 7 .   ? 7.228   19.490  5.280   1.00 54.36 ?  1289 HOH A O     1 
HETATM 8077 O  O     . HOH N 7 .   ? 10.484  18.488  6.683   1.00 31.82 ?  1290 HOH A O     1 
HETATM 8078 O  O     . HOH N 7 .   ? 9.721   22.977  5.831   1.00 44.50 ?  1291 HOH A O     1 
HETATM 8079 O  O     . HOH N 7 .   ? 6.696   21.159  2.208   1.00 61.49 ?  1292 HOH A O     1 
HETATM 8080 O  O     . HOH N 7 .   ? 23.523  24.512  17.243  1.00 57.72 ?  1293 HOH A O     1 
HETATM 8081 O  O     . HOH N 7 .   ? 30.796  25.242  17.975  1.00 46.16 ?  1294 HOH A O     1 
HETATM 8082 O  O     . HOH N 7 .   ? 10.991  0.478   21.737  1.00 40.22 ?  1295 HOH A O     1 
HETATM 8083 O  O     . HOH N 7 .   ? 17.634  -7.769  11.095  1.00 50.91 ?  1296 HOH A O     1 
HETATM 8084 O  O     . HOH N 7 .   ? 25.072  -4.687  0.298   1.00 52.28 ?  1297 HOH A O     1 
HETATM 8085 O  O     . HOH N 7 .   ? 21.303  -1.909  1.527   1.00 41.32 ?  1298 HOH A O     1 
HETATM 8086 O  O     . HOH N 7 .   ? 24.213  0.937   7.572   1.00 59.11 ?  1299 HOH A O     1 
HETATM 8087 O  O     . HOH N 7 .   ? 20.721  1.566   5.758   1.00 53.10 ?  1300 HOH A O     1 
HETATM 8088 O  O     . HOH N 7 .   ? 17.115  5.832   13.176  1.00 44.62 ?  1301 HOH A O     1 
HETATM 8089 O  O     . HOH N 7 .   ? 13.015  7.052   10.997  1.00 50.37 ?  1302 HOH A O     1 
HETATM 8090 O  O     . HOH N 7 .   ? 13.684  5.220   8.670   1.00 40.73 ?  1303 HOH A O     1 
HETATM 8091 O  O     . HOH N 7 .   ? 9.412   3.340   12.494  1.00 37.67 ?  1304 HOH A O     1 
HETATM 8092 O  O     . HOH N 7 .   ? 20.998  -5.493  12.075  1.00 37.45 ?  1305 HOH A O     1 
HETATM 8093 O  O     . HOH N 7 .   ? 39.290  -8.029  1.924   1.00 43.70 ?  1306 HOH A O     1 
HETATM 8094 O  O     . HOH N 7 .   ? 41.870  -6.700  1.857   1.00 49.73 ?  1307 HOH A O     1 
HETATM 8095 O  O     . HOH N 7 .   ? 33.235  -5.891  -2.196  1.00 38.05 ?  1308 HOH A O     1 
HETATM 8096 O  O     . HOH N 7 .   ? 24.533  -0.660  -8.636  1.00 43.64 ?  1309 HOH A O     1 
HETATM 8097 O  O     . HOH N 7 .   ? 14.809  4.346   -4.833  1.00 43.50 ?  1310 HOH A O     1 
HETATM 8098 O  O     . HOH N 7 .   ? -11.507 5.206   6.926   1.00 33.35 ?  1311 HOH A O     1 
HETATM 8099 O  O     . HOH N 7 .   ? -9.367  30.987  19.833  1.00 54.06 ?  1312 HOH A O     1 
HETATM 8100 O  O     . HOH N 7 .   ? -18.675 35.499  28.084  1.00 57.25 ?  1313 HOH A O     1 
HETATM 8101 O  O     . HOH N 7 .   ? 10.242  19.787  4.231   1.00 34.39 ?  1314 HOH A O     1 
HETATM 8102 O  O     . HOH N 7 .   ? 31.625  24.006  20.119  1.00 55.61 ?  1315 HOH A O     1 
HETATM 8103 O  O     . HOH N 7 .   ? 26.294  13.864  21.089  1.00 32.02 ?  1316 HOH A O     1 
HETATM 8104 O  O     . HOH N 7 .   ? 38.140  -2.481  26.386  1.00 36.96 ?  1317 HOH A O     1 
HETATM 8105 O  O     . HOH N 7 .   ? 34.350  -22.893 11.610  1.00 54.38 ?  1318 HOH A O     1 
HETATM 8106 O  O     . HOH N 7 .   ? 31.801  -23.437 20.174  1.00 54.12 ?  1319 HOH A O     1 
HETATM 8107 O  O     . HOH N 7 .   ? 32.782  -31.275 16.744  1.00 28.27 ?  1320 HOH A O     1 
HETATM 8108 O  O     . HOH N 7 .   ? 30.515  -19.281 23.603  1.00 40.53 ?  1321 HOH A O     1 
HETATM 8109 O  O     . HOH N 7 .   ? 28.393  -21.595 31.983  1.00 53.43 ?  1322 HOH A O     1 
HETATM 8110 O  O     . HOH N 7 .   ? 12.315  -0.583  55.312  1.00 32.57 ?  1323 HOH A O     1 
HETATM 8111 O  O     . HOH N 7 .   ? 10.289  7.263   58.842  1.00 35.45 ?  1324 HOH A O     1 
HETATM 8112 O  O     . HOH N 7 .   ? 13.140  -2.274  51.311  1.00 41.22 ?  1325 HOH A O     1 
HETATM 8113 O  O     . HOH N 7 .   ? 15.347  -10.124 51.707  1.00 33.64 ?  1326 HOH A O     1 
HETATM 8114 O  O     . HOH N 7 .   ? 11.348  -15.934 46.851  1.00 36.82 ?  1327 HOH A O     1 
HETATM 8115 O  O     . HOH N 7 .   ? -29.309 17.633  33.428  1.00 39.86 ?  1328 HOH A O     1 
HETATM 8116 O  O     . HOH N 7 .   ? -28.867 15.763  33.973  1.00 41.01 ?  1329 HOH A O     1 
HETATM 8117 O  O     . HOH N 7 .   ? -30.565 17.990  31.226  1.00 51.64 ?  1330 HOH A O     1 
HETATM 8118 O  O     . HOH N 7 .   ? -21.004 35.437  35.415  1.00 36.63 ?  1331 HOH A O     1 
HETATM 8119 O  O     . HOH N 7 .   ? -21.873 28.399  44.829  1.00 39.36 ?  1332 HOH A O     1 
HETATM 8120 O  O     . HOH N 7 .   ? 51.677  -2.181  18.745  1.00 27.12 ?  1333 HOH A O     1 
HETATM 8121 O  O     . HOH N 7 .   ? 50.859  -2.693  22.166  1.00 36.11 ?  1334 HOH A O     1 
HETATM 8122 O  O     . HOH N 7 .   ? 29.809  -31.853 2.189   1.00 39.97 ?  1335 HOH A O     1 
HETATM 8123 O  O     . HOH N 7 .   ? 34.692  -38.615 5.938   1.00 52.16 ?  1336 HOH A O     1 
HETATM 8124 O  O     . HOH N 7 .   ? 31.855  -6.135  29.784  1.00 54.43 ?  1337 HOH A O     1 
HETATM 8125 O  O     . HOH N 7 .   ? -7.747  24.044  48.575  1.00 31.09 ?  1338 HOH A O     1 
HETATM 8126 O  O     . HOH N 7 .   ? -10.804 22.729  48.886  1.00 34.40 ?  1339 HOH A O     1 
HETATM 8127 O  O     . HOH N 7 .   ? -13.208 24.299  48.369  1.00 42.36 ?  1340 HOH A O     1 
HETATM 8128 O  O     . HOH N 7 .   ? 15.868  -2.243  47.809  1.00 54.94 ?  1341 HOH A O     1 
HETATM 8129 O  O     . HOH N 7 .   ? 30.857  -17.611 0.695   1.00 40.55 ?  1342 HOH A O     1 
HETATM 8130 O  O     . HOH N 7 .   ? 14.535  14.028  25.473  1.00 40.12 ?  1343 HOH A O     1 
HETATM 8131 O  O     . HOH N 7 .   ? 29.691  7.918   -3.754  1.00 32.14 ?  1344 HOH A O     1 
HETATM 8132 O  O     . HOH N 7 .   ? 36.108  6.634   -3.259  1.00 61.38 ?  1345 HOH A O     1 
HETATM 8133 O  O     . HOH N 7 .   ? 28.682  -2.098  -3.694  1.00 43.37 ?  1346 HOH A O     1 
HETATM 8134 O  O     . HOH N 7 .   ? 0.661   20.563  -5.177  1.00 40.33 ?  1347 HOH A O     1 
HETATM 8135 O  O     . HOH N 7 .   ? -12.380 21.457  2.008   1.00 49.25 ?  1348 HOH A O     1 
HETATM 8136 O  O     . HOH N 7 .   ? 21.466  38.338  5.739   1.00 34.53 ?  1349 HOH A O     1 
HETATM 8137 O  O     . HOH N 7 .   ? 15.531  -0.378  1.280   1.00 42.28 ?  1350 HOH A O     1 
HETATM 8138 O  O     . HOH N 7 .   ? 11.143  -1.413  7.223   1.00 46.94 ?  1351 HOH A O     1 
HETATM 8139 O  O     . HOH N 7 .   ? -7.149  17.048  26.917  1.00 35.41 ?  1352 HOH A O     1 
HETATM 8140 O  O     . HOH N 7 .   ? -9.978  5.677   4.635   1.00 43.43 ?  1353 HOH A O     1 
HETATM 8141 O  O     . HOH N 7 .   ? -11.415 6.404   59.929  1.00 36.57 ?  1354 HOH A O     1 
HETATM 8142 O  O     . HOH N 7 .   ? -10.105 9.508   60.070  1.00 49.93 ?  1355 HOH A O     1 
HETATM 8143 O  O     . HOH N 7 .   ? 15.985  38.757  -8.806  1.00 24.71 ?  1356 HOH A O     1 
HETATM 8144 O  O     . HOH N 7 .   ? 6.948   1.572   32.388  1.00 46.15 ?  1357 HOH A O     1 
HETATM 8145 O  O     . HOH N 7 .   ? -27.768 4.249   16.375  1.00 33.45 ?  1358 HOH A O     1 
HETATM 8146 O  O     . HOH N 7 .   ? 17.405  36.519  -10.889 1.00 42.64 ?  1359 HOH A O     1 
HETATM 8147 O  O     . HOH N 7 .   ? -28.314 17.702  15.319  1.00 44.41 ?  1360 HOH A O     1 
HETATM 8148 O  O     . HOH N 7 .   ? -21.594 26.552  13.296  1.00 38.08 ?  1361 HOH A O     1 
HETATM 8149 O  O     . HOH N 7 .   ? 33.927  13.298  12.215  1.00 33.69 ?  1362 HOH A O     1 
HETATM 8150 O  O     . HOH N 7 .   ? 3.414   -17.161 20.878  1.00 40.37 ?  1363 HOH A O     1 
HETATM 8151 O  O     . HOH N 7 .   ? 1.686   26.273  47.744  1.00 33.16 ?  1364 HOH A O     1 
HETATM 8152 O  O     . HOH N 7 .   ? -0.284  22.712  38.139  1.00 37.65 ?  1365 HOH A O     1 
HETATM 8153 O  O     . HOH N 7 .   ? -17.201 32.264  16.800  1.00 54.71 ?  1366 HOH A O     1 
HETATM 8154 O  O     . HOH N 7 .   ? -14.390 33.028  16.691  1.00 54.49 ?  1367 HOH A O     1 
HETATM 8155 O  O     . HOH N 7 .   ? 4.373   -21.079 31.117  1.00 39.36 ?  1368 HOH A O     1 
HETATM 8156 O  O     . HOH N 7 .   ? 34.797  14.454  4.027   1.00 47.61 ?  1369 HOH A O     1 
HETATM 8157 O  O     . HOH N 7 .   ? 34.742  9.940   3.872   1.00 39.91 ?  1370 HOH A O     1 
HETATM 8158 O  O     . HOH N 7 .   ? -30.579 13.066  8.532   1.00 51.54 ?  1371 HOH A O     1 
HETATM 8159 O  O     . HOH N 7 .   ? 30.198  -26.421 1.466   1.00 51.48 ?  1372 HOH A O     1 
HETATM 8160 O  O     . HOH N 7 .   ? 32.025  -29.845 2.567   1.00 62.88 ?  1373 HOH A O     1 
HETATM 8161 O  O     . HOH N 7 .   ? 36.229  -21.549 10.768  1.00 43.24 ?  1374 HOH A O     1 
HETATM 8162 O  O     . HOH N 7 .   ? 43.256  -12.564 9.048   1.00 35.58 ?  1375 HOH A O     1 
HETATM 8163 O  O     . HOH N 7 .   ? 42.325  -9.118  6.296   1.00 48.95 ?  1376 HOH A O     1 
HETATM 8164 O  O     . HOH N 7 .   ? 8.785   13.713  49.413  1.00 57.77 ?  1377 HOH A O     1 
HETATM 8165 O  O     . HOH N 7 .   ? 9.577   5.863   41.867  1.00 44.21 ?  1378 HOH A O     1 
HETATM 8166 O  O     . HOH N 7 .   ? 14.563  3.293   40.458  1.00 49.99 ?  1379 HOH A O     1 
HETATM 8167 O  O     . HOH N 7 .   ? 14.776  -2.139  42.608  1.00 42.32 ?  1380 HOH A O     1 
HETATM 8168 O  O     . HOH N 7 .   ? -1.545  9.551   64.870  1.00 39.83 ?  1381 HOH A O     1 
HETATM 8169 O  O     . HOH N 7 .   ? 0.564   -25.183 41.763  1.00 34.62 ?  1382 HOH A O     1 
HETATM 8170 O  O     . HOH N 7 .   ? 1.947   -18.835 25.478  1.00 43.02 ?  1383 HOH A O     1 
HETATM 8171 O  O     . HOH N 7 .   ? 8.967   -22.764 14.983  1.00 48.52 ?  1384 HOH A O     1 
HETATM 8172 O  O     . HOH N 7 .   ? 21.115  40.037  1.208   1.00 37.34 ?  1385 HOH A O     1 
HETATM 8173 O  O     . HOH N 7 .   ? -0.591  -3.465  17.928  1.00 45.74 ?  1386 HOH A O     1 
HETATM 8174 O  O     . HOH N 7 .   ? -8.452  -5.970  25.393  1.00 69.88 ?  1387 HOH A O     1 
HETATM 8175 O  O     . HOH N 7 .   ? -7.888  -10.620 31.537  1.00 40.38 ?  1388 HOH A O     1 
HETATM 8176 O  O     . HOH N 7 .   ? 15.048  11.897  40.300  1.00 44.24 ?  1389 HOH A O     1 
HETATM 8177 O  O     . HOH N 7 .   ? 22.991  2.658   39.743  1.00 38.64 ?  1390 HOH A O     1 
HETATM 8178 O  O     . HOH N 7 .   ? 24.466  3.556   31.655  1.00 54.90 ?  1391 HOH A O     1 
HETATM 8179 O  O     . HOH N 7 .   ? 25.590  8.420   25.704  1.00 34.67 ?  1392 HOH A O     1 
HETATM 8180 O  O     . HOH N 7 .   ? 24.090  9.682   28.688  1.00 62.93 ?  1393 HOH A O     1 
HETATM 8181 O  O     . HOH N 7 .   ? 16.447  6.573   28.175  1.00 44.31 ?  1394 HOH A O     1 
HETATM 8182 O  O     . HOH N 7 .   ? 14.190  2.362   22.963  1.00 30.52 ?  1395 HOH A O     1 
HETATM 8183 O  O     . HOH N 7 .   ? 12.790  4.075   22.212  1.00 50.46 ?  1396 HOH A O     1 
HETATM 8184 O  O     . HOH N 7 .   ? 10.287  7.694   27.874  1.00 51.62 ?  1397 HOH A O     1 
HETATM 8185 O  O     . HOH N 7 .   ? 17.633  -8.215  13.772  1.00 48.09 ?  1398 HOH A O     1 
HETATM 8186 O  O     . HOH N 7 .   ? 14.584  -29.741 21.950  1.00 44.41 ?  1399 HOH A O     1 
HETATM 8187 O  O     . HOH N 7 .   ? -21.525 5.740   6.615   1.00 41.71 ?  1400 HOH A O     1 
HETATM 8188 O  O     . HOH N 7 .   ? -8.919  6.141   32.192  1.00 33.81 ?  1401 HOH A O     1 
HETATM 8189 O  O     . HOH N 7 .   ? -8.376  8.090   30.631  1.00 20.15 ?  1402 HOH A O     1 
HETATM 8190 O  O     . HOH N 7 .   ? 18.447  -26.854 34.131  1.00 42.69 ?  1403 HOH A O     1 
HETATM 8191 O  O     . HOH N 7 .   ? -26.934 27.203  37.200  1.00 21.51 ?  1404 HOH A O     1 
HETATM 8192 O  O     . HOH N 7 .   ? -27.380 29.789  37.594  1.00 16.07 ?  1405 HOH A O     1 
HETATM 8193 O  O     . HOH N 7 .   ? 22.820  -31.014 -5.417  1.00 40.67 ?  1406 HOH A O     1 
HETATM 8194 O  O     . HOH N 7 .   ? 26.074  -35.892 -4.080  1.00 42.42 ?  1407 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   P . n 
A 1 2   DT  2   2   2   DT  T   P . n 
A 1 3   DC  3   3   3   DC  C   P . n 
A 1 4   DC  4   4   4   DC  C   P . n 
A 1 5   DT  5   5   5   DT  T   P . n 
A 1 6   DC  6   6   6   DC  C   P . n 
A 1 7   DC  7   7   7   DC  C   P . n 
A 1 8   DC  8   8   8   DC  C   P . n 
A 1 9   DC  9   9   9   DC  C   P . n 
A 1 10  DT  10  10  10  DT  T   P . n 
A 1 11  DA  11  11  11  DA  A   P . n 
A 1 12  DOC 12  12  12  DOC DOC P . n 
B 2 1   DT  1   1   1   DT  T   T . n 
B 2 2   DA  2   2   2   DA  A   T . n 
B 2 3   DA  3   3   3   DA  A   T . n 
B 2 4   DG  4   4   4   DG  G   T . n 
B 2 5   DG  5   5   5   DG  G   T . n 
B 2 6   DT  6   6   6   DT  T   T . n 
B 2 7   DA  7   7   7   DA  A   T . n 
B 2 8   DG  8   8   8   DG  G   T . n 
B 2 9   DG  9   9   9   DG  G   T . n 
B 2 10  DG  10  10  10  DG  G   T . n 
B 2 11  DG  11  11  11  DG  G   T . n 
B 2 12  DA  12  12  12  DA  A   T . n 
B 2 13  DG  13  13  13  DG  G   T . n 
B 2 14  DG  14  14  14  DG  G   T . n 
B 2 15  DA  15  15  15  DA  A   T . n 
B 2 16  DT  16  16  16  DT  T   T . n 
C 3 1   MET 1   67  ?   ?   ?   A . n 
C 3 2   GLY 2   68  ?   ?   ?   A . n 
C 3 3   THR 3   69  ?   ?   ?   A . n 
C 3 4   GLN 4   70  ?   ?   ?   A . n 
C 3 5   LEU 5   71  ?   ?   ?   A . n 
C 3 6   GLU 6   72  ?   ?   ?   A . n 
C 3 7   SER 7   73  ?   ?   ?   A . n 
C 3 8   THR 8   74  ?   ?   ?   A . n 
C 3 9   PHE 9   75  ?   ?   ?   A . n 
C 3 10  GLU 10  76  ?   ?   ?   A . n 
C 3 11  GLN 11  77  ?   ?   ?   A . n 
C 3 12  ASP 12  78  ?   ?   ?   A . n 
C 3 13  VAL 13  79  ?   ?   ?   A . n 
C 3 14  SER 14  80  ?   ?   ?   A . n 
C 3 15  GLN 15  81  ?   ?   ?   A . n 
C 3 16  MET 16  82  ?   ?   ?   A . n 
C 3 17  GLU 17  83  ?   ?   ?   A . n 
C 3 18  HIS 18  84  ?   ?   ?   A . n 
C 3 19  ASP 19  85  ?   ?   ?   A . n 
C 3 20  MET 20  86  ?   ?   ?   A . n 
C 3 21  ALA 21  87  ?   ?   ?   A . n 
C 3 22  ASP 22  88  ?   ?   ?   A . n 
C 3 23  GLN 23  89  ?   ?   ?   A . n 
C 3 24  GLU 24  90  ?   ?   ?   A . n 
C 3 25  GLU 25  91  ?   ?   ?   A . n 
C 3 26  HIS 26  92  ?   ?   ?   A . n 
C 3 27  ASP 27  93  ?   ?   ?   A . n 
C 3 28  LEU 28  94  ?   ?   ?   A . n 
C 3 29  SER 29  95  95  SER SER A . n 
C 3 30  SER 30  96  96  SER SER A . n 
C 3 31  PHE 31  97  97  PHE PHE A . n 
C 3 32  GLU 32  98  98  GLU GLU A . n 
C 3 33  ARG 33  99  99  ARG ARG A . n 
C 3 34  LYS 34  100 100 LYS LYS A . n 
C 3 35  LYS 35  101 101 LYS LYS A . n 
C 3 36  LEU 36  102 102 LEU LEU A . n 
C 3 37  PRO 37  103 103 PRO PRO A . n 
C 3 38  THR 38  104 104 THR THR A . n 
C 3 39  ASP 39  105 105 ASP ASP A . n 
C 3 40  PHE 40  106 106 PHE PHE A . n 
C 3 41  ASP 41  107 107 ASP ASP A . n 
C 3 42  PRO 42  108 108 PRO PRO A . n 
C 3 43  SER 43  109 109 SER SER A . n 
C 3 44  LEU 44  110 110 LEU LEU A . n 
C 3 45  TYR 45  111 111 TYR TYR A . n 
C 3 46  ASP 46  112 112 ASP ASP A . n 
C 3 47  ILE 47  113 113 ILE ILE A . n 
C 3 48  SER 48  114 114 SER SER A . n 
C 3 49  PHE 49  115 115 PHE PHE A . n 
C 3 50  GLN 50  116 116 GLN GLN A . n 
C 3 51  GLN 51  117 117 GLN GLN A . n 
C 3 52  ILE 52  118 118 ILE ILE A . n 
C 3 53  ASP 53  119 119 ASP ASP A . n 
C 3 54  ALA 54  120 120 ALA ALA A . n 
C 3 55  GLU 55  121 121 GLU GLU A . n 
C 3 56  GLN 56  122 122 GLN GLN A . n 
C 3 57  SER 57  123 123 SER SER A . n 
C 3 58  VAL 58  124 124 VAL VAL A . n 
C 3 59  LEU 59  125 125 LEU LEU A . n 
C 3 60  ASN 60  126 126 ASN ASN A . n 
C 3 61  GLY 61  127 127 GLY GLY A . n 
C 3 62  ILE 62  128 128 ILE ILE A . n 
C 3 63  LYS 63  129 129 LYS LYS A . n 
C 3 64  ASP 64  130 130 ASP ASP A . n 
C 3 65  GLU 65  131 131 GLU GLU A . n 
C 3 66  ASN 66  132 132 ASN ASN A . n 
C 3 67  THR 67  133 133 THR THR A . n 
C 3 68  SER 68  134 134 SER SER A . n 
C 3 69  THR 69  135 135 THR THR A . n 
C 3 70  VAL 70  136 136 VAL VAL A . n 
C 3 71  VAL 71  137 137 VAL VAL A . n 
C 3 72  ARG 72  138 138 ARG ARG A . n 
C 3 73  PHE 73  139 139 PHE PHE A . n 
C 3 74  PHE 74  140 140 PHE PHE A . n 
C 3 75  GLY 75  141 141 GLY GLY A . n 
C 3 76  VAL 76  142 142 VAL VAL A . n 
C 3 77  THR 77  143 143 THR THR A . n 
C 3 78  SER 78  144 144 SER SER A . n 
C 3 79  GLU 79  145 145 GLU GLU A . n 
C 3 80  GLY 80  146 146 GLY GLY A . n 
C 3 81  HIS 81  147 147 HIS HIS A . n 
C 3 82  SER 82  148 148 SER SER A . n 
C 3 83  VAL 83  149 149 VAL VAL A . n 
C 3 84  LEU 84  150 150 LEU LEU A . n 
C 3 85  CYS 85  151 151 CYS CYS A . n 
C 3 86  ASN 86  152 152 ASN ASN A . n 
C 3 87  VAL 87  153 153 VAL VAL A . n 
C 3 88  THR 88  154 154 THR THR A . n 
C 3 89  GLY 89  155 155 GLY GLY A . n 
C 3 90  PHE 90  156 156 PHE PHE A . n 
C 3 91  LYS 91  157 157 LYS LYS A . n 
C 3 92  ASN 92  158 158 ASN ASN A . n 
C 3 93  TYR 93  159 159 TYR TYR A . n 
C 3 94  LEU 94  160 160 LEU LEU A . n 
C 3 95  TYR 95  161 161 TYR TYR A . n 
C 3 96  VAL 96  162 162 VAL VAL A . n 
C 3 97  PRO 97  163 163 PRO PRO A . n 
C 3 98  ALA 98  164 164 ALA ALA A . n 
C 3 99  PRO 99  165 165 PRO PRO A . n 
C 3 100 ASN 100 166 166 ASN ASN A . n 
C 3 101 SER 101 167 167 SER SER A . n 
C 3 102 SER 102 168 168 SER SER A . n 
C 3 103 ASP 103 169 169 ASP ASP A . n 
C 3 104 ALA 104 170 170 ALA ALA A . n 
C 3 105 ASN 105 171 171 ASN ASN A . n 
C 3 106 ASP 106 172 172 ASP ASP A . n 
C 3 107 GLN 107 173 173 GLN GLN A . n 
C 3 108 GLU 108 174 174 GLU GLU A . n 
C 3 109 GLN 109 175 175 GLN GLN A . n 
C 3 110 ILE 110 176 176 ILE ILE A . n 
C 3 111 ASN 111 177 177 ASN ASN A . n 
C 3 112 LYS 112 178 178 LYS LYS A . n 
C 3 113 PHE 113 179 179 PHE PHE A . n 
C 3 114 VAL 114 180 180 VAL VAL A . n 
C 3 115 HIS 115 181 181 HIS HIS A . n 
C 3 116 TYR 116 182 182 TYR TYR A . n 
C 3 117 LEU 117 183 183 LEU LEU A . n 
C 3 118 ASN 118 184 184 ASN ASN A . n 
C 3 119 GLU 119 185 185 GLU GLU A . n 
C 3 120 THR 120 186 186 THR THR A . n 
C 3 121 PHE 121 187 187 PHE PHE A . n 
C 3 122 ASP 122 188 188 ASP ASP A . n 
C 3 123 HIS 123 189 189 HIS HIS A . n 
C 3 124 ALA 124 190 190 ALA ALA A . n 
C 3 125 ILE 125 191 191 ILE ILE A . n 
C 3 126 ASP 126 192 192 ASP ASP A . n 
C 3 127 SER 127 193 193 SER SER A . n 
C 3 128 ILE 128 194 194 ILE ILE A . n 
C 3 129 GLU 129 195 195 GLU GLU A . n 
C 3 130 VAL 130 196 196 VAL VAL A . n 
C 3 131 VAL 131 197 197 VAL VAL A . n 
C 3 132 SER 132 198 198 SER SER A . n 
C 3 133 LYS 133 199 199 LYS LYS A . n 
C 3 134 GLN 134 200 200 GLN GLN A . n 
C 3 135 SER 135 201 201 SER SER A . n 
C 3 136 ILE 136 202 202 ILE ILE A . n 
C 3 137 TRP 137 203 203 TRP TRP A . n 
C 3 138 GLY 138 204 204 GLY GLY A . n 
C 3 139 TYR 139 205 205 TYR TYR A . n 
C 3 140 SER 140 206 206 SER SER A . n 
C 3 141 GLY 141 207 207 GLY GLY A . n 
C 3 142 ASP 142 208 208 ASP ASP A . n 
C 3 143 THR 143 209 209 THR THR A . n 
C 3 144 LYS 144 210 210 LYS LYS A . n 
C 3 145 LEU 145 211 211 LEU LEU A . n 
C 3 146 PRO 146 212 212 PRO PRO A . n 
C 3 147 PHE 147 213 213 PHE PHE A . n 
C 3 148 TRP 148 214 214 TRP TRP A . n 
C 3 149 LYS 149 215 215 LYS LYS A . n 
C 3 150 ILE 150 216 216 ILE ILE A . n 
C 3 151 TYR 151 217 217 TYR TYR A . n 
C 3 152 VAL 152 218 218 VAL VAL A . n 
C 3 153 THR 153 219 219 THR THR A . n 
C 3 154 TYR 154 220 220 TYR TYR A . n 
C 3 155 PRO 155 221 221 PRO PRO A . n 
C 3 156 HIS 156 222 222 HIS HIS A . n 
C 3 157 MET 157 223 223 MET MET A . n 
C 3 158 VAL 158 224 224 VAL VAL A . n 
C 3 159 ASN 159 225 225 ASN ASN A . n 
C 3 160 LYS 160 226 226 LYS LYS A . n 
C 3 161 LEU 161 227 227 LEU LEU A . n 
C 3 162 ARG 162 228 228 ARG ARG A . n 
C 3 163 THR 163 229 229 THR THR A . n 
C 3 164 ALA 164 230 230 ALA ALA A . n 
C 3 165 PHE 165 231 231 PHE PHE A . n 
C 3 166 GLU 166 232 232 GLU GLU A . n 
C 3 167 ARG 167 233 233 ARG ARG A . n 
C 3 168 GLY 168 234 234 GLY GLY A . n 
C 3 169 HIS 169 235 235 HIS HIS A . n 
C 3 170 LEU 170 236 236 LEU LEU A . n 
C 3 171 SER 171 237 237 SER SER A . n 
C 3 172 PHE 172 238 238 PHE PHE A . n 
C 3 173 ASN 173 239 239 ASN ASN A . n 
C 3 174 SER 174 240 240 SER SER A . n 
C 3 175 TRP 175 241 241 TRP TRP A . n 
C 3 176 PHE 176 242 242 PHE PHE A . n 
C 3 177 SER 177 243 243 SER SER A . n 
C 3 178 ASN 178 244 244 ASN ASN A . n 
C 3 179 GLY 179 245 245 GLY GLY A . n 
C 3 180 THR 180 246 246 THR THR A . n 
C 3 181 THR 181 247 247 THR THR A . n 
C 3 182 THR 182 248 248 THR THR A . n 
C 3 183 TYR 183 249 249 TYR TYR A . n 
C 3 184 ASP 184 250 250 ASP ASP A . n 
C 3 185 ASN 185 251 251 ASN ASN A . n 
C 3 186 ILE 186 252 252 ILE ILE A . n 
C 3 187 ALA 187 253 253 ALA ALA A . n 
C 3 188 TYR 188 254 254 TYR TYR A . n 
C 3 189 THR 189 255 255 THR THR A . n 
C 3 190 LEU 190 256 256 LEU LEU A . n 
C 3 191 ARG 191 257 257 ARG ARG A . n 
C 3 192 LEU 192 258 258 LEU LEU A . n 
C 3 193 MET 193 259 259 MET MET A . n 
C 3 194 VAL 194 260 260 VAL VAL A . n 
C 3 195 ASP 195 261 261 ASP ASP A . n 
C 3 196 CYS 196 262 262 CYS CYS A . n 
C 3 197 GLY 197 263 263 GLY GLY A . n 
C 3 198 ILE 198 264 264 ILE ILE A . n 
C 3 199 VAL 199 265 265 VAL VAL A . n 
C 3 200 GLY 200 266 266 GLY GLY A . n 
C 3 201 MET 201 267 267 MET MET A . n 
C 3 202 SER 202 268 268 SER SER A . n 
C 3 203 TRP 203 269 269 TRP TRP A . n 
C 3 204 ILE 204 270 270 ILE ILE A . n 
C 3 205 THR 205 271 271 THR THR A . n 
C 3 206 LEU 206 272 272 LEU LEU A . n 
C 3 207 PRO 207 273 273 PRO PRO A . n 
C 3 208 LYS 208 274 274 LYS LYS A . n 
C 3 209 GLY 209 275 275 GLY GLY A . n 
C 3 210 LYS 210 276 276 LYS LYS A . n 
C 3 211 TYR 211 277 277 TYR TYR A . n 
C 3 212 SER 212 278 278 SER SER A . n 
C 3 213 MET 213 279 279 MET MET A . n 
C 3 214 ILE 214 280 280 ILE ILE A . n 
C 3 215 GLU 215 281 281 GLU GLU A . n 
C 3 216 PRO 216 282 282 PRO PRO A . n 
C 3 217 ASN 217 283 283 ASN ASN A . n 
C 3 218 ASN 218 284 284 ASN ASN A . n 
C 3 219 ARG 219 285 285 ARG ARG A . n 
C 3 220 VAL 220 286 286 VAL VAL A . n 
C 3 221 SER 221 287 287 SER SER A . n 
C 3 222 SER 222 288 288 SER SER A . n 
C 3 223 CYS 223 289 289 CYS CYS A . n 
C 3 224 GLN 224 290 290 GLN GLN A . n 
C 3 225 LEU 225 291 291 LEU LEU A . n 
C 3 226 GLU 226 292 292 GLU GLU A . n 
C 3 227 VAL 227 293 293 VAL VAL A . n 
C 3 228 SER 228 294 294 SER SER A . n 
C 3 229 ILE 229 295 295 ILE ILE A . n 
C 3 230 ASN 230 296 296 ASN ASN A . n 
C 3 231 TYR 231 297 297 TYR TYR A . n 
C 3 232 ARG 232 298 298 ARG ARG A . n 
C 3 233 ASN 233 299 299 ASN ASN A . n 
C 3 234 LEU 234 300 300 LEU LEU A . n 
C 3 235 ILE 235 301 301 ILE ILE A . n 
C 3 236 ALA 236 302 302 ALA ALA A . n 
C 3 237 HIS 237 303 303 HIS HIS A . n 
C 3 238 PRO 238 304 304 PRO PRO A . n 
C 3 239 ALA 239 305 305 ALA ALA A . n 
C 3 240 GLU 240 306 306 GLU GLU A . n 
C 3 241 GLY 241 307 307 GLY GLY A . n 
C 3 242 ASP 242 308 308 ASP ASP A . n 
C 3 243 TRP 243 309 309 TRP TRP A . n 
C 3 244 SER 244 310 310 SER SER A . n 
C 3 245 HIS 245 311 311 HIS HIS A . n 
C 3 246 THR 246 312 312 THR THR A . n 
C 3 247 ALA 247 313 313 ALA ALA A . n 
C 3 248 PRO 248 314 314 PRO PRO A . n 
C 3 249 LEU 249 315 315 LEU LEU A . n 
C 3 250 ARG 250 316 316 ARG ARG A . n 
C 3 251 ILE 251 317 317 ILE ILE A . n 
C 3 252 MET 252 318 318 MET MET A . n 
C 3 253 SER 253 319 319 SER SER A . n 
C 3 254 PHE 254 320 320 PHE PHE A . n 
C 3 255 ASP 255 321 321 ASP ASP A . n 
C 3 256 ILE 256 322 322 ILE ILE A . n 
C 3 257 GLU 257 323 323 GLU GLU A . n 
C 3 258 CYS 258 324 324 CYS CYS A . n 
C 3 259 ALA 259 325 325 ALA ALA A . n 
C 3 260 GLY 260 326 326 GLY GLY A . n 
C 3 261 ARG 261 327 327 ARG ARG A . n 
C 3 262 ILE 262 328 328 ILE ILE A . n 
C 3 263 GLY 263 329 329 GLY GLY A . n 
C 3 264 VAL 264 330 330 VAL VAL A . n 
C 3 265 PHE 265 331 331 PHE PHE A . n 
C 3 266 PRO 266 332 332 PRO PRO A . n 
C 3 267 GLU 267 333 333 GLU GLU A . n 
C 3 268 PRO 268 334 334 PRO PRO A . n 
C 3 269 GLU 269 335 335 GLU GLU A . n 
C 3 270 TYR 270 336 336 TYR TYR A . n 
C 3 271 ASP 271 337 337 ASP ASP A . n 
C 3 272 PRO 272 338 338 PRO PRO A . n 
C 3 273 VAL 273 339 339 VAL VAL A . n 
C 3 274 ILE 274 340 340 ILE ILE A . n 
C 3 275 GLN 275 341 341 GLN GLN A . n 
C 3 276 ILE 276 342 342 ILE ILE A . n 
C 3 277 ALA 277 343 343 ALA ALA A . n 
C 3 278 ASN 278 344 344 ASN ASN A . n 
C 3 279 VAL 279 345 345 VAL VAL A . n 
C 3 280 VAL 280 346 346 VAL VAL A . n 
C 3 281 SER 281 347 347 SER SER A . n 
C 3 282 ILE 282 348 348 ILE ILE A . n 
C 3 283 ALA 283 349 349 ALA ALA A . n 
C 3 284 GLY 284 350 350 GLY GLY A . n 
C 3 285 ALA 285 351 351 ALA ALA A . n 
C 3 286 LYS 286 352 352 LYS LYS A . n 
C 3 287 LYS 287 353 353 LYS LYS A . n 
C 3 288 PRO 288 354 354 PRO PRO A . n 
C 3 289 PHE 289 355 355 PHE PHE A . n 
C 3 290 ILE 290 356 356 ILE ILE A . n 
C 3 291 ARG 291 357 357 ARG ARG A . n 
C 3 292 ASN 292 358 358 ASN ASN A . n 
C 3 293 VAL 293 359 359 VAL VAL A . n 
C 3 294 PHE 294 360 360 PHE PHE A . n 
C 3 295 THR 295 361 361 THR THR A . n 
C 3 296 LEU 296 362 362 LEU LEU A . n 
C 3 297 ASN 297 363 363 ASN ASN A . n 
C 3 298 THR 298 364 364 THR THR A . n 
C 3 299 CYS 299 365 365 CYS CYS A . n 
C 3 300 SER 300 366 366 SER SER A . n 
C 3 301 PRO 301 367 367 PRO PRO A . n 
C 3 302 ILE 302 368 368 ILE ILE A . n 
C 3 303 THR 303 369 369 THR THR A . n 
C 3 304 GLY 304 370 370 GLY GLY A . n 
C 3 305 SER 305 371 371 SER SER A . n 
C 3 306 MET 306 372 372 MET MET A . n 
C 3 307 ILE 307 373 373 ILE ILE A . n 
C 3 308 PHE 308 374 374 PHE PHE A . n 
C 3 309 SER 309 375 375 SER SER A . n 
C 3 310 HIS 310 376 376 HIS HIS A . n 
C 3 311 ALA 311 377 377 ALA ALA A . n 
C 3 312 THR 312 378 378 THR THR A . n 
C 3 313 GLU 313 379 379 GLU GLU A . n 
C 3 314 GLU 314 380 380 GLU GLU A . n 
C 3 315 GLU 315 381 381 GLU GLU A . n 
C 3 316 MET 316 382 382 MET MET A . n 
C 3 317 LEU 317 383 383 LEU LEU A . n 
C 3 318 SER 318 384 384 SER SER A . n 
C 3 319 ASN 319 385 385 ASN ASN A . n 
C 3 320 TRP 320 386 386 TRP TRP A . n 
C 3 321 ARG 321 387 387 ARG ARG A . n 
C 3 322 ASN 322 388 388 ASN ASN A . n 
C 3 323 PHE 323 389 389 PHE PHE A . n 
C 3 324 ILE 324 390 390 ILE ILE A . n 
C 3 325 ILE 325 391 391 ILE ILE A . n 
C 3 326 LYS 326 392 392 LYS LYS A . n 
C 3 327 VAL 327 393 393 VAL VAL A . n 
C 3 328 ASP 328 394 394 ASP ASP A . n 
C 3 329 PRO 329 395 395 PRO PRO A . n 
C 3 330 ASP 330 396 396 ASP ASP A . n 
C 3 331 VAL 331 397 397 VAL VAL A . n 
C 3 332 ILE 332 398 398 ILE ILE A . n 
C 3 333 ILE 333 399 399 ILE ILE A . n 
C 3 334 GLY 334 400 400 GLY GLY A . n 
C 3 335 TYR 335 401 401 TYR TYR A . n 
C 3 336 ASN 336 402 402 ASN ASN A . n 
C 3 337 THR 337 403 403 THR THR A . n 
C 3 338 THR 338 404 404 THR THR A . n 
C 3 339 ASN 339 405 405 ASN ASN A . n 
C 3 340 PHE 340 406 406 PHE PHE A . n 
C 3 341 ASP 341 407 407 ASP ASP A . n 
C 3 342 ILE 342 408 408 ILE ILE A . n 
C 3 343 PRO 343 409 409 PRO PRO A . n 
C 3 344 TYR 344 410 410 TYR TYR A . n 
C 3 345 LEU 345 411 411 LEU LEU A . n 
C 3 346 LEU 346 412 412 LEU LEU A . n 
C 3 347 ASN 347 413 413 ASN ASN A . n 
C 3 348 ARG 348 414 414 ARG ARG A . n 
C 3 349 ALA 349 415 415 ALA ALA A . n 
C 3 350 LYS 350 416 416 LYS LYS A . n 
C 3 351 ALA 351 417 417 ALA ALA A . n 
C 3 352 LEU 352 418 418 LEU LEU A . n 
C 3 353 LYS 353 419 419 LYS LYS A . n 
C 3 354 VAL 354 420 420 VAL VAL A . n 
C 3 355 ASN 355 421 421 ASN ASN A . n 
C 3 356 ASP 356 422 422 ASP ASP A . n 
C 3 357 PHE 357 423 423 PHE PHE A . n 
C 3 358 PRO 358 424 424 PRO PRO A . n 
C 3 359 TYR 359 425 425 TYR TYR A . n 
C 3 360 PHE 360 426 426 PHE PHE A . n 
C 3 361 GLY 361 427 427 GLY GLY A . n 
C 3 362 ARG 362 428 428 ARG ARG A . n 
C 3 363 LEU 363 429 429 LEU LEU A . n 
C 3 364 LYS 364 430 430 LYS LYS A . n 
C 3 365 THR 365 431 431 THR THR A . n 
C 3 366 VAL 366 432 432 VAL VAL A . n 
C 3 367 LYS 367 433 433 LYS LYS A . n 
C 3 368 GLN 368 434 434 GLN GLN A . n 
C 3 369 GLU 369 435 435 GLU GLU A . n 
C 3 370 ILE 370 436 436 ILE ILE A . n 
C 3 371 LYS 371 437 437 LYS LYS A . n 
C 3 372 GLU 372 438 438 GLU GLU A . n 
C 3 373 SER 373 439 439 SER SER A . n 
C 3 374 VAL 374 440 440 VAL VAL A . n 
C 3 375 PHE 375 441 441 PHE PHE A . n 
C 3 376 SER 376 442 442 SER SER A . n 
C 3 377 SER 377 443 443 SER SER A . n 
C 3 378 LYS 378 444 444 LYS LYS A . n 
C 3 379 ALA 379 445 445 ALA ALA A . n 
C 3 380 TYR 380 446 446 TYR TYR A . n 
C 3 381 GLY 381 447 447 GLY GLY A . n 
C 3 382 THR 382 448 448 THR THR A . n 
C 3 383 ARG 383 449 449 ARG ARG A . n 
C 3 384 GLU 384 450 450 GLU GLU A . n 
C 3 385 THR 385 451 451 THR THR A . n 
C 3 386 LYS 386 452 452 LYS LYS A . n 
C 3 387 ASN 387 453 453 ASN ASN A . n 
C 3 388 VAL 388 454 454 VAL VAL A . n 
C 3 389 ASN 389 455 455 ASN ASN A . n 
C 3 390 ILE 390 456 456 ILE ILE A . n 
C 3 391 ASP 391 457 457 ASP ASP A . n 
C 3 392 GLY 392 458 458 GLY GLY A . n 
C 3 393 ARG 393 459 459 ARG ARG A . n 
C 3 394 LEU 394 460 460 LEU LEU A . n 
C 3 395 GLN 395 461 461 GLN GLN A . n 
C 3 396 LEU 396 462 462 LEU LEU A . n 
C 3 397 ASP 397 463 463 ASP ASP A . n 
C 3 398 LEU 398 464 464 LEU LEU A . n 
C 3 399 LEU 399 465 465 LEU LEU A . n 
C 3 400 GLN 400 466 466 GLN GLN A . n 
C 3 401 PHE 401 467 467 PHE PHE A . n 
C 3 402 ILE 402 468 468 ILE ILE A . n 
C 3 403 GLN 403 469 469 GLN GLN A . n 
C 3 404 ARG 404 470 470 ARG ARG A . n 
C 3 405 GLU 405 471 471 GLU GLU A . n 
C 3 406 TYR 406 472 472 TYR TYR A . n 
C 3 407 LYS 407 473 473 LYS LYS A . n 
C 3 408 LEU 408 474 474 LEU LEU A . n 
C 3 409 ARG 409 475 475 ARG ARG A . n 
C 3 410 SER 410 476 476 SER SER A . n 
C 3 411 TYR 411 477 477 TYR TYR A . n 
C 3 412 THR 412 478 478 THR THR A . n 
C 3 413 LEU 413 479 479 LEU LEU A . n 
C 3 414 ASN 414 480 480 ASN ASN A . n 
C 3 415 ALA 415 481 481 ALA ALA A . n 
C 3 416 VAL 416 482 482 VAL VAL A . n 
C 3 417 SER 417 483 483 SER SER A . n 
C 3 418 ALA 418 484 484 ALA ALA A . n 
C 3 419 HIS 419 485 485 HIS HIS A . n 
C 3 420 PHE 420 486 486 PHE PHE A . n 
C 3 421 LEU 421 487 487 LEU LEU A . n 
C 3 422 GLY 422 488 488 GLY GLY A . n 
C 3 423 GLU 423 489 489 GLU GLU A . n 
C 3 424 GLN 424 490 490 GLN GLN A . n 
C 3 425 LYS 425 491 ?   ?   ?   A . n 
C 3 426 GLU 426 492 ?   ?   ?   A . n 
C 3 427 ASP 427 493 ?   ?   ?   A . n 
C 3 428 VAL 428 494 ?   ?   ?   A . n 
C 3 429 HIS 429 495 ?   ?   ?   A . n 
C 3 430 TYR 430 496 ?   ?   ?   A . n 
C 3 431 SER 431 497 497 SER SER A . n 
C 3 432 ILE 432 498 498 ILE ILE A . n 
C 3 433 ILE 433 499 499 ILE ILE A . n 
C 3 434 SER 434 500 500 SER SER A . n 
C 3 435 ASP 435 501 501 ASP ASP A . n 
C 3 436 LEU 436 502 502 LEU LEU A . n 
C 3 437 GLN 437 503 503 GLN GLN A . n 
C 3 438 ASN 438 504 504 ASN ASN A . n 
C 3 439 GLY 439 505 505 GLY GLY A . n 
C 3 440 ASP 440 506 506 ASP ASP A . n 
C 3 441 SER 441 507 507 SER SER A . n 
C 3 442 GLU 442 508 508 GLU GLU A . n 
C 3 443 THR 443 509 509 THR THR A . n 
C 3 444 ARG 444 510 510 ARG ARG A . n 
C 3 445 ARG 445 511 511 ARG ARG A . n 
C 3 446 ARG 446 512 512 ARG ARG A . n 
C 3 447 LEU 447 513 513 LEU LEU A . n 
C 3 448 ALA 448 514 514 ALA ALA A . n 
C 3 449 VAL 449 515 515 VAL VAL A . n 
C 3 450 TYR 450 516 516 TYR TYR A . n 
C 3 451 CYS 451 517 517 CYS CYS A . n 
C 3 452 LEU 452 518 518 LEU LEU A . n 
C 3 453 LYS 453 519 519 LYS LYS A . n 
C 3 454 ASP 454 520 520 ASP ASP A . n 
C 3 455 ALA 455 521 521 ALA ALA A . n 
C 3 456 TYR 456 522 522 TYR TYR A . n 
C 3 457 LEU 457 523 523 LEU LEU A . n 
C 3 458 PRO 458 524 524 PRO PRO A . n 
C 3 459 LEU 459 525 525 LEU LEU A . n 
C 3 460 ARG 460 526 526 ARG ARG A . n 
C 3 461 LEU 461 527 527 LEU LEU A . n 
C 3 462 MET 462 528 528 MET MET A . n 
C 3 463 GLU 463 529 529 GLU GLU A . n 
C 3 464 LYS 464 530 530 LYS LYS A . n 
C 3 465 LEU 465 531 531 LEU LEU A . n 
C 3 466 MET 466 532 532 MET MET A . n 
C 3 467 ALA 467 533 533 ALA ALA A . n 
C 3 468 LEU 468 534 534 LEU LEU A . n 
C 3 469 VAL 469 535 535 VAL VAL A . n 
C 3 470 ASN 470 536 536 ASN ASN A . n 
C 3 471 TYR 471 537 537 TYR TYR A . n 
C 3 472 THR 472 538 538 THR THR A . n 
C 3 473 GLU 473 539 539 GLU GLU A . n 
C 3 474 MET 474 540 540 MET MET A . n 
C 3 475 ALA 475 541 541 ALA ALA A . n 
C 3 476 ARG 476 542 542 ARG ARG A . n 
C 3 477 VAL 477 543 543 VAL VAL A . n 
C 3 478 THR 478 544 544 THR THR A . n 
C 3 479 GLY 479 545 545 GLY GLY A . n 
C 3 480 VAL 480 546 546 VAL VAL A . n 
C 3 481 PRO 481 547 547 PRO PRO A . n 
C 3 482 PHE 482 548 548 PHE PHE A . n 
C 3 483 SER 483 549 549 SER SER A . n 
C 3 484 TYR 484 550 550 TYR TYR A . n 
C 3 485 LEU 485 551 551 LEU LEU A . n 
C 3 486 LEU 486 552 552 LEU LEU A . n 
C 3 487 ALA 487 553 553 ALA ALA A . n 
C 3 488 ARG 488 554 554 ARG ARG A . n 
C 3 489 GLY 489 555 555 GLY GLY A . n 
C 3 490 GLN 490 556 556 GLN GLN A . n 
C 3 491 GLN 491 557 557 GLN GLN A . n 
C 3 492 ILE 492 558 558 ILE ILE A . n 
C 3 493 LYS 493 559 559 LYS LYS A . n 
C 3 494 VAL 494 560 560 VAL VAL A . n 
C 3 495 VAL 495 561 561 VAL VAL A . n 
C 3 496 SER 496 562 562 SER SER A . n 
C 3 497 GLN 497 563 563 GLN GLN A . n 
C 3 498 LEU 498 564 564 LEU LEU A . n 
C 3 499 PHE 499 565 565 PHE PHE A . n 
C 3 500 ARG 500 566 566 ARG ARG A . n 
C 3 501 LYS 501 567 567 LYS LYS A . n 
C 3 502 CYS 502 568 568 CYS CYS A . n 
C 3 503 LEU 503 569 569 LEU LEU A . n 
C 3 504 GLU 504 570 570 GLU GLU A . n 
C 3 505 ILE 505 571 571 ILE ILE A . n 
C 3 506 ASP 506 572 572 ASP ASP A . n 
C 3 507 THR 507 573 573 THR THR A . n 
C 3 508 VAL 508 574 574 VAL VAL A . n 
C 3 509 ILE 509 575 575 ILE ILE A . n 
C 3 510 PRO 510 576 576 PRO PRO A . n 
C 3 511 ASN 511 577 577 ASN ASN A . n 
C 3 512 MET 512 578 578 MET MET A . n 
C 3 513 GLN 513 579 579 GLN GLN A . n 
C 3 514 SER 514 580 580 SER SER A . n 
C 3 515 GLN 515 581 581 GLN GLN A . n 
C 3 516 ALA 516 582 582 ALA ALA A . n 
C 3 517 SER 517 583 583 SER SER A . n 
C 3 518 ASP 518 584 584 ASP ASP A . n 
C 3 519 ASP 519 585 585 ASP ASP A . n 
C 3 520 GLN 520 586 586 GLN GLN A . n 
C 3 521 TYR 521 587 587 TYR TYR A . n 
C 3 522 GLU 522 588 588 GLU GLU A . n 
C 3 523 GLY 523 589 589 GLY GLY A . n 
C 3 524 ALA 524 590 590 ALA ALA A . n 
C 3 525 THR 525 591 591 THR THR A . n 
C 3 526 VAL 526 592 592 VAL VAL A . n 
C 3 527 ILE 527 593 593 ILE ILE A . n 
C 3 528 GLU 528 594 594 GLU GLU A . n 
C 3 529 PRO 529 595 595 PRO PRO A . n 
C 3 530 ILE 530 596 596 ILE ILE A . n 
C 3 531 ARG 531 597 597 ARG ARG A . n 
C 3 532 GLY 532 598 598 GLY GLY A . n 
C 3 533 TYR 533 599 599 TYR TYR A . n 
C 3 534 TYR 534 600 600 TYR TYR A . n 
C 3 535 ASP 535 601 601 ASP ASP A . n 
C 3 536 VAL 536 602 602 VAL VAL A . n 
C 3 537 PRO 537 603 603 PRO PRO A . n 
C 3 538 ILE 538 604 604 ILE ILE A . n 
C 3 539 ALA 539 605 605 ALA ALA A . n 
C 3 540 THR 540 606 606 THR THR A . n 
C 3 541 LEU 541 607 607 LEU LEU A . n 
C 3 542 ASP 542 608 608 ASP ASP A . n 
C 3 543 PHE 543 609 609 PHE PHE A . n 
C 3 544 ASN 544 610 610 ASN ASN A . n 
C 3 545 SER 545 611 611 SER SER A . n 
C 3 546 LEU 546 612 612 LEU LEU A . n 
C 3 547 TYR 547 613 613 TYR TYR A . n 
C 3 548 PRO 548 614 614 PRO PRO A . n 
C 3 549 SER 549 615 615 SER SER A . n 
C 3 550 ILE 550 616 616 ILE ILE A . n 
C 3 551 MET 551 617 617 MET MET A . n 
C 3 552 MET 552 618 618 MET MET A . n 
C 3 553 ALA 553 619 619 ALA ALA A . n 
C 3 554 HIS 554 620 620 HIS HIS A . n 
C 3 555 ASN 555 621 621 ASN ASN A . n 
C 3 556 LEU 556 622 622 LEU LEU A . n 
C 3 557 CYS 557 623 623 CYS CYS A . n 
C 3 558 TYR 558 624 624 TYR TYR A . n 
C 3 559 THR 559 625 625 THR THR A . n 
C 3 560 THR 560 626 626 THR THR A . n 
C 3 561 LEU 561 627 627 LEU LEU A . n 
C 3 562 CYS 562 628 628 CYS CYS A . n 
C 3 563 ASN 563 629 629 ASN ASN A . n 
C 3 564 LYS 564 630 630 LYS LYS A . n 
C 3 565 ALA 565 631 631 ALA ALA A . n 
C 3 566 THR 566 632 632 THR THR A . n 
C 3 567 VAL 567 633 633 VAL VAL A . n 
C 3 568 GLU 568 634 634 GLU GLU A . n 
C 3 569 ARG 569 635 635 ARG ARG A . n 
C 3 570 LEU 570 636 636 LEU LEU A . n 
C 3 571 ASN 571 637 637 ASN ASN A . n 
C 3 572 LEU 572 638 638 LEU LEU A . n 
C 3 573 LYS 573 639 639 LYS LYS A . n 
C 3 574 ILE 574 640 640 ILE ILE A . n 
C 3 575 ASP 575 641 641 ASP ASP A . n 
C 3 576 GLU 576 642 642 GLU GLU A . n 
C 3 577 ASP 577 643 643 ASP ASP A . n 
C 3 578 TYR 578 644 644 TYR TYR A . n 
C 3 579 VAL 579 645 645 VAL VAL A . n 
C 3 580 ILE 580 646 646 ILE ILE A . n 
C 3 581 THR 581 647 647 THR THR A . n 
C 3 582 PRO 582 648 648 PRO PRO A . n 
C 3 583 ASN 583 649 649 ASN ASN A . n 
C 3 584 GLY 584 650 650 GLY GLY A . n 
C 3 585 ASP 585 651 651 ASP ASP A . n 
C 3 586 TYR 586 652 652 TYR TYR A . n 
C 3 587 PHE 587 653 653 PHE PHE A . n 
C 3 588 VAL 588 654 654 VAL VAL A . n 
C 3 589 THR 589 655 655 THR THR A . n 
C 3 590 THR 590 656 656 THR THR A . n 
C 3 591 LYS 591 657 657 LYS LYS A . n 
C 3 592 ARG 592 658 658 ARG ARG A . n 
C 3 593 ARG 593 659 659 ARG ARG A . n 
C 3 594 ARG 594 660 660 ARG ARG A . n 
C 3 595 GLY 595 661 661 GLY GLY A . n 
C 3 596 ILE 596 662 662 ILE ILE A . n 
C 3 597 LEU 597 663 663 LEU LEU A . n 
C 3 598 PRO 598 664 664 PRO PRO A . n 
C 3 599 ILE 599 665 665 ILE ILE A . n 
C 3 600 ILE 600 666 666 ILE ILE A . n 
C 3 601 LEU 601 667 667 LEU LEU A . n 
C 3 602 ASP 602 668 668 ASP ASP A . n 
C 3 603 GLU 603 669 669 GLU GLU A . n 
C 3 604 LEU 604 670 670 LEU LEU A . n 
C 3 605 ILE 605 671 671 ILE ILE A . n 
C 3 606 SER 606 672 672 SER SER A . n 
C 3 607 ALA 607 673 673 ALA ALA A . n 
C 3 608 ARG 608 674 674 ARG ARG A . n 
C 3 609 LYS 609 675 675 LYS LYS A . n 
C 3 610 ARG 610 676 676 ARG ARG A . n 
C 3 611 ALA 611 677 677 ALA ALA A . n 
C 3 612 LYS 612 678 678 LYS LYS A . n 
C 3 613 LYS 613 679 679 LYS LYS A . n 
C 3 614 ASP 614 680 680 ASP ASP A . n 
C 3 615 LEU 615 681 681 LEU LEU A . n 
C 3 616 ARG 616 682 682 ARG ARG A . n 
C 3 617 ASP 617 683 683 ASP ASP A . n 
C 3 618 GLU 618 684 684 GLU GLU A . n 
C 3 619 LYS 619 685 685 LYS LYS A . n 
C 3 620 ASP 620 686 686 ASP ASP A . n 
C 3 621 PRO 621 687 687 PRO PRO A . n 
C 3 622 PHE 622 688 688 PHE PHE A . n 
C 3 623 LYS 623 689 689 LYS LYS A . n 
C 3 624 ARG 624 690 690 ARG ARG A . n 
C 3 625 ASP 625 691 691 ASP ASP A . n 
C 3 626 VAL 626 692 692 VAL VAL A . n 
C 3 627 LEU 627 693 693 LEU LEU A . n 
C 3 628 ASN 628 694 694 ASN ASN A . n 
C 3 629 GLY 629 695 695 GLY GLY A . n 
C 3 630 ARG 630 696 696 ARG ARG A . n 
C 3 631 GLN 631 697 697 GLN GLN A . n 
C 3 632 LEU 632 698 698 LEU LEU A . n 
C 3 633 ALA 633 699 699 ALA ALA A . n 
C 3 634 LEU 634 700 700 LEU LEU A . n 
C 3 635 LYS 635 701 701 LYS LYS A . n 
C 3 636 ILE 636 702 702 ILE ILE A . n 
C 3 637 SER 637 703 703 SER SER A . n 
C 3 638 ALA 638 704 704 ALA ALA A . n 
C 3 639 ASN 639 705 705 ASN ASN A . n 
C 3 640 SER 640 706 706 SER SER A . n 
C 3 641 VAL 641 707 707 VAL VAL A . n 
C 3 642 TYR 642 708 708 TYR TYR A . n 
C 3 643 GLY 643 709 709 GLY GLY A . n 
C 3 644 PHE 644 710 710 PHE PHE A . n 
C 3 645 THR 645 711 711 THR THR A . n 
C 3 646 GLY 646 712 712 GLY GLY A . n 
C 3 647 ALA 647 713 713 ALA ALA A . n 
C 3 648 THR 648 714 714 THR THR A . n 
C 3 649 VAL 649 715 715 VAL VAL A . n 
C 3 650 GLY 650 716 716 GLY GLY A . n 
C 3 651 LYS 651 717 717 LYS LYS A . n 
C 3 652 LEU 652 718 718 LEU LEU A . n 
C 3 653 PRO 653 719 719 PRO PRO A . n 
C 3 654 CYS 654 720 720 CYS CYS A . n 
C 3 655 LEU 655 721 721 LEU LEU A . n 
C 3 656 ALA 656 722 722 ALA ALA A . n 
C 3 657 ILE 657 723 723 ILE ILE A . n 
C 3 658 SER 658 724 724 SER SER A . n 
C 3 659 SER 659 725 725 SER SER A . n 
C 3 660 SER 660 726 726 SER SER A . n 
C 3 661 VAL 661 727 727 VAL VAL A . n 
C 3 662 THR 662 728 728 THR THR A . n 
C 3 663 ALA 663 729 729 ALA ALA A . n 
C 3 664 TYR 664 730 730 TYR TYR A . n 
C 3 665 GLY 665 731 731 GLY GLY A . n 
C 3 666 ARG 666 732 732 ARG ARG A . n 
C 3 667 THR 667 733 733 THR THR A . n 
C 3 668 MET 668 734 734 MET MET A . n 
C 3 669 ILE 669 735 735 ILE ILE A . n 
C 3 670 LEU 670 736 736 LEU LEU A . n 
C 3 671 LYS 671 737 737 LYS LYS A . n 
C 3 672 THR 672 738 738 THR THR A . n 
C 3 673 LYS 673 739 739 LYS LYS A . n 
C 3 674 THR 674 740 740 THR THR A . n 
C 3 675 ALA 675 741 741 ALA ALA A . n 
C 3 676 VAL 676 742 742 VAL VAL A . n 
C 3 677 GLN 677 743 743 GLN GLN A . n 
C 3 678 GLU 678 744 744 GLU GLU A . n 
C 3 679 LYS 679 745 745 LYS LYS A . n 
C 3 680 TYR 680 746 746 TYR TYR A . n 
C 3 681 CYS 681 747 747 CYS CYS A . n 
C 3 682 ILE 682 748 748 ILE ILE A . n 
C 3 683 LYS 683 749 749 LYS LYS A . n 
C 3 684 ASN 684 750 750 ASN ASN A . n 
C 3 685 GLY 685 751 751 GLY GLY A . n 
C 3 686 TYR 686 752 752 TYR TYR A . n 
C 3 687 LYS 687 753 753 LYS LYS A . n 
C 3 688 HIS 688 754 754 HIS HIS A . n 
C 3 689 ASP 689 755 755 ASP ASP A . n 
C 3 690 ALA 690 756 756 ALA ALA A . n 
C 3 691 VAL 691 757 757 VAL VAL A . n 
C 3 692 VAL 692 758 758 VAL VAL A . n 
C 3 693 VAL 693 759 759 VAL VAL A . n 
C 3 694 TYR 694 760 760 TYR TYR A . n 
C 3 695 GLY 695 761 761 GLY GLY A . n 
C 3 696 ASP 696 762 762 ASP ASP A . n 
C 3 697 THR 697 763 763 THR THR A . n 
C 3 698 ASP 698 764 764 ASP ASP A . n 
C 3 699 SER 699 765 765 SER SER A . n 
C 3 700 VAL 700 766 766 VAL VAL A . n 
C 3 701 MET 701 767 767 MET MET A . n 
C 3 702 VAL 702 768 768 VAL VAL A . n 
C 3 703 LYS 703 769 769 LYS LYS A . n 
C 3 704 PHE 704 770 770 PHE PHE A . n 
C 3 705 GLY 705 771 771 GLY GLY A . n 
C 3 706 THR 706 772 772 THR THR A . n 
C 3 707 THR 707 773 773 THR THR A . n 
C 3 708 ASP 708 774 774 ASP ASP A . n 
C 3 709 LEU 709 775 775 LEU LEU A . n 
C 3 710 LYS 710 776 776 LYS LYS A . n 
C 3 711 GLU 711 777 777 GLU GLU A . n 
C 3 712 ALA 712 778 778 ALA ALA A . n 
C 3 713 MET 713 779 779 MET MET A . n 
C 3 714 ASP 714 780 780 ASP ASP A . n 
C 3 715 LEU 715 781 781 LEU LEU A . n 
C 3 716 GLY 716 782 782 GLY GLY A . n 
C 3 717 THR 717 783 783 THR THR A . n 
C 3 718 GLU 718 784 784 GLU GLU A . n 
C 3 719 ALA 719 785 785 ALA ALA A . n 
C 3 720 ALA 720 786 786 ALA ALA A . n 
C 3 721 LYS 721 787 787 LYS LYS A . n 
C 3 722 TYR 722 788 788 TYR TYR A . n 
C 3 723 VAL 723 789 789 VAL VAL A . n 
C 3 724 SER 724 790 790 SER SER A . n 
C 3 725 THR 725 791 791 THR THR A . n 
C 3 726 LEU 726 792 792 LEU LEU A . n 
C 3 727 PHE 727 793 793 PHE PHE A . n 
C 3 728 LYS 728 794 794 LYS LYS A . n 
C 3 729 HIS 729 795 795 HIS HIS A . n 
C 3 730 PRO 730 796 796 PRO PRO A . n 
C 3 731 ILE 731 797 797 ILE ILE A . n 
C 3 732 ASN 732 798 798 ASN ASN A . n 
C 3 733 LEU 733 799 799 LEU LEU A . n 
C 3 734 GLU 734 800 800 GLU GLU A . n 
C 3 735 PHE 735 801 801 PHE PHE A . n 
C 3 736 GLU 736 802 802 GLU GLU A . n 
C 3 737 LYS 737 803 803 LYS LYS A . n 
C 3 738 ALA 738 804 804 ALA ALA A . n 
C 3 739 TYR 739 805 805 TYR TYR A . n 
C 3 740 PHE 740 806 806 PHE PHE A . n 
C 3 741 PRO 741 807 807 PRO PRO A . n 
C 3 742 TYR 742 808 808 TYR TYR A . n 
C 3 743 LEU 743 809 809 LEU LEU A . n 
C 3 744 LEU 744 810 810 LEU LEU A . n 
C 3 745 ILE 745 811 811 ILE ILE A . n 
C 3 746 ASN 746 812 812 ASN ASN A . n 
C 3 747 LYS 747 813 813 LYS LYS A . n 
C 3 748 LYS 748 814 814 LYS LYS A . n 
C 3 749 ARG 749 815 815 ARG ARG A . n 
C 3 750 TYR 750 816 816 TYR TYR A . n 
C 3 751 ALA 751 817 817 ALA ALA A . n 
C 3 752 GLY 752 818 818 GLY GLY A . n 
C 3 753 LEU 753 819 819 LEU LEU A . n 
C 3 754 PHE 754 820 820 PHE PHE A . n 
C 3 755 TRP 755 821 821 TRP TRP A . n 
C 3 756 THR 756 822 822 THR THR A . n 
C 3 757 ASN 757 823 823 ASN ASN A . n 
C 3 758 PRO 758 824 824 PRO PRO A . n 
C 3 759 ASP 759 825 825 ASP ASP A . n 
C 3 760 LYS 760 826 826 LYS LYS A . n 
C 3 761 PHE 761 827 827 PHE PHE A . n 
C 3 762 ASP 762 828 828 ASP ASP A . n 
C 3 763 LYS 763 829 829 LYS LYS A . n 
C 3 764 LEU 764 830 830 LEU LEU A . n 
C 3 765 ASP 765 831 831 ASP ASP A . n 
C 3 766 GLN 766 832 832 GLN GLN A . n 
C 3 767 LYS 767 833 833 LYS LYS A . n 
C 3 768 GLY 768 834 834 GLY GLY A . n 
C 3 769 LEU 769 835 835 LEU LEU A . n 
C 3 770 ALA 770 836 836 ALA ALA A . n 
C 3 771 SER 771 837 837 SER SER A . n 
C 3 772 VAL 772 838 838 VAL VAL A . n 
C 3 773 ARG 773 839 839 ARG ARG A . n 
C 3 774 ARG 774 840 840 ARG ARG A . n 
C 3 775 ASP 775 841 841 ASP ASP A . n 
C 3 776 SER 776 842 842 SER SER A . n 
C 3 777 CYS 777 843 843 CYS CYS A . n 
C 3 778 SER 778 844 844 SER SER A . n 
C 3 779 LEU 779 845 845 LEU LEU A . n 
C 3 780 VAL 780 846 846 VAL VAL A . n 
C 3 781 SER 781 847 847 SER SER A . n 
C 3 782 ILE 782 848 848 ILE ILE A . n 
C 3 783 VAL 783 849 849 VAL VAL A . n 
C 3 784 MET 784 850 850 MET MET A . n 
C 3 785 ASN 785 851 851 ASN ASN A . n 
C 3 786 LYS 786 852 852 LYS LYS A . n 
C 3 787 VAL 787 853 853 VAL VAL A . n 
C 3 788 LEU 788 854 854 LEU LEU A . n 
C 3 789 LYS 789 855 855 LYS LYS A . n 
C 3 790 LYS 790 856 856 LYS LYS A . n 
C 3 791 ILE 791 857 857 ILE ILE A . n 
C 3 792 LEU 792 858 858 LEU LEU A . n 
C 3 793 ILE 793 859 859 ILE ILE A . n 
C 3 794 GLU 794 860 860 GLU GLU A . n 
C 3 795 ARG 795 861 861 ARG ARG A . n 
C 3 796 ASN 796 862 862 ASN ASN A . n 
C 3 797 VAL 797 863 863 VAL VAL A . n 
C 3 798 ASP 798 864 864 ASP ASP A . n 
C 3 799 GLY 799 865 865 GLY GLY A . n 
C 3 800 ALA 800 866 866 ALA ALA A . n 
C 3 801 LEU 801 867 867 LEU LEU A . n 
C 3 802 ALA 802 868 868 ALA ALA A . n 
C 3 803 PHE 803 869 869 PHE PHE A . n 
C 3 804 VAL 804 870 870 VAL VAL A . n 
C 3 805 ARG 805 871 871 ARG ARG A . n 
C 3 806 GLU 806 872 872 GLU GLU A . n 
C 3 807 THR 807 873 873 THR THR A . n 
C 3 808 ILE 808 874 874 ILE ILE A . n 
C 3 809 ASN 809 875 875 ASN ASN A . n 
C 3 810 ASP 810 876 876 ASP ASP A . n 
C 3 811 ILE 811 877 877 ILE ILE A . n 
C 3 812 LEU 812 878 878 LEU LEU A . n 
C 3 813 HIS 813 879 879 HIS HIS A . n 
C 3 814 ASN 814 880 880 ASN ASN A . n 
C 3 815 ARG 815 881 881 ARG ARG A . n 
C 3 816 VAL 816 882 882 VAL VAL A . n 
C 3 817 ASP 817 883 883 ASP ASP A . n 
C 3 818 ILE 818 884 884 ILE ILE A . n 
C 3 819 SER 819 885 885 SER SER A . n 
C 3 820 LYS 820 886 886 LYS LYS A . n 
C 3 821 LEU 821 887 887 LEU LEU A . n 
C 3 822 ILE 822 888 888 ILE ILE A . n 
C 3 823 ILE 823 889 889 ILE ILE A . n 
C 3 824 SER 824 890 890 SER SER A . n 
C 3 825 LYS 825 891 891 LYS LYS A . n 
C 3 826 THR 826 892 892 THR THR A . n 
C 3 827 LEU 827 893 893 LEU LEU A . n 
C 3 828 ALA 828 894 894 ALA ALA A . n 
C 3 829 PRO 829 895 895 PRO PRO A . n 
C 3 830 ASN 830 896 896 ASN ASN A . n 
C 3 831 TYR 831 897 897 TYR TYR A . n 
C 3 832 THR 832 898 898 THR THR A . n 
C 3 833 ASN 833 899 899 ASN ASN A . n 
C 3 834 PRO 834 900 900 PRO PRO A . n 
C 3 835 GLN 835 901 901 GLN GLN A . n 
C 3 836 PRO 836 902 902 PRO PRO A . n 
C 3 837 HIS 837 903 903 HIS HIS A . n 
C 3 838 ALA 838 904 904 ALA ALA A . n 
C 3 839 VAL 839 905 905 VAL VAL A . n 
C 3 840 LEU 840 906 906 LEU LEU A . n 
C 3 841 ALA 841 907 907 ALA ALA A . n 
C 3 842 GLU 842 908 908 GLU GLU A . n 
C 3 843 ARG 843 909 909 ARG ARG A . n 
C 3 844 MET 844 910 910 MET MET A . n 
C 3 845 LYS 845 911 911 LYS LYS A . n 
C 3 846 ARG 846 912 912 ARG ARG A . n 
C 3 847 ARG 847 913 913 ARG ARG A . n 
C 3 848 GLU 848 914 914 GLU GLU A . n 
C 3 849 GLY 849 915 915 GLY GLY A . n 
C 3 850 VAL 850 916 916 VAL VAL A . n 
C 3 851 GLY 851 917 917 GLY GLY A . n 
C 3 852 PRO 852 918 918 PRO PRO A . n 
C 3 853 ASN 853 919 919 ASN ASN A . n 
C 3 854 VAL 854 920 920 VAL VAL A . n 
C 3 855 GLY 855 921 921 GLY GLY A . n 
C 3 856 ASP 856 922 922 ASP ASP A . n 
C 3 857 ARG 857 923 923 ARG ARG A . n 
C 3 858 VAL 858 924 924 VAL VAL A . n 
C 3 859 ASP 859 925 925 ASP ASP A . n 
C 3 860 TYR 860 926 926 TYR TYR A . n 
C 3 861 VAL 861 927 927 VAL VAL A . n 
C 3 862 ILE 862 928 928 ILE ILE A . n 
C 3 863 ILE 863 929 929 ILE ILE A . n 
C 3 864 GLY 864 930 930 GLY GLY A . n 
C 3 865 GLY 865 931 931 GLY GLY A . n 
C 3 866 ASN 866 932 932 ASN ASN A . n 
C 3 867 ASP 867 933 933 ASP ASP A . n 
C 3 868 LYS 868 934 934 LYS LYS A . n 
C 3 869 LEU 869 935 935 LEU LEU A . n 
C 3 870 TYR 870 936 936 TYR TYR A . n 
C 3 871 ASN 871 937 937 ASN ASN A . n 
C 3 872 ARG 872 938 938 ARG ARG A . n 
C 3 873 ALA 873 939 939 ALA ALA A . n 
C 3 874 GLU 874 940 940 GLU GLU A . n 
C 3 875 ASP 875 941 941 ASP ASP A . n 
C 3 876 PRO 876 942 942 PRO PRO A . n 
C 3 877 LEU 877 943 943 LEU LEU A . n 
C 3 878 PHE 878 944 944 PHE PHE A . n 
C 3 879 VAL 879 945 945 VAL VAL A . n 
C 3 880 LEU 880 946 946 LEU LEU A . n 
C 3 881 GLU 881 947 947 GLU GLU A . n 
C 3 882 ASN 882 948 948 ASN ASN A . n 
C 3 883 ASN 883 949 949 ASN ASN A . n 
C 3 884 ILE 884 950 950 ILE ILE A . n 
C 3 885 GLN 885 951 951 GLN GLN A . n 
C 3 886 VAL 886 952 952 VAL VAL A . n 
C 3 887 ASP 887 953 953 ASP ASP A . n 
C 3 888 SER 888 954 954 SER SER A . n 
C 3 889 ARG 889 955 955 ARG ARG A . n 
C 3 890 TYR 890 956 956 TYR TYR A . n 
C 3 891 TYR 891 957 957 TYR TYR A . n 
C 3 892 LEU 892 958 958 LEU LEU A . n 
C 3 893 THR 893 959 959 THR THR A . n 
C 3 894 ASN 894 960 960 ASN ASN A . n 
C 3 895 GLN 895 961 961 GLN GLN A . n 
C 3 896 LEU 896 962 962 LEU LEU A . n 
C 3 897 GLN 897 963 963 GLN GLN A . n 
C 3 898 ASN 898 964 964 ASN ASN A . n 
C 3 899 PRO 899 965 965 PRO PRO A . n 
C 3 900 ILE 900 966 966 ILE ILE A . n 
C 3 901 ILE 901 967 967 ILE ILE A . n 
C 3 902 SER 902 968 968 SER SER A . n 
C 3 903 ILE 903 969 969 ILE ILE A . n 
C 3 904 VAL 904 970 970 VAL VAL A . n 
C 3 905 ALA 905 971 971 ALA ALA A . n 
C 3 906 PRO 906 972 972 PRO PRO A . n 
C 3 907 ILE 907 973 973 ILE ILE A . n 
C 3 908 ILE 908 974 974 ILE ILE A . n 
C 3 909 GLY 909 975 975 GLY GLY A . n 
C 3 910 ASP 910 976 976 ASP ASP A . n 
C 3 911 LYS 911 977 977 LYS LYS A . n 
C 3 912 GLN 912 978 978 GLN GLN A . n 
C 3 913 ALA 913 979 979 ALA ALA A . n 
C 3 914 ASN 914 980 980 ASN ASN A . n 
C 3 915 GLY 915 981 981 GLY GLY A . n 
C 3 916 MET 916 982 982 MET MET A . n 
C 3 917 PHE 917 983 983 PHE PHE A . n 
C 3 918 VAL 918 984 984 VAL VAL A . n 
C 3 919 VAL 919 985 985 VAL VAL A . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    DOC 
_pdbx_struct_mod_residue.label_seq_id     12 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     DOC 
_pdbx_struct_mod_residue.auth_seq_id      12 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DC 
_pdbx_struct_mod_residue.details          "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7640  ? 
1 MORE         -74   ? 
1 'SSA (A^2)'  40100 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? C ASP 255 ? A ASP 321  ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1289 ? 1_555 145.8 ? 
2  OD1 ? C ASP 255 ? A ASP 321  ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1314 ? 1_555 69.8  ? 
3  O   ? N HOH .   ? A HOH 1289 ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1314 ? 1_555 76.2  ? 
4  OD1 ? C ASP 255 ? A ASP 321  ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1291 ? 1_555 75.4  ? 
5  O   ? N HOH .   ? A HOH 1289 ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1291 ? 1_555 111.7 ? 
6  O   ? N HOH .   ? A HOH 1314 ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1291 ? 1_555 94.3  ? 
7  OD1 ? C ASP 255 ? A ASP 321  ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1290 ? 1_555 73.0  ? 
8  O   ? N HOH .   ? A HOH 1289 ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1290 ? 1_555 92.7  ? 
9  O   ? N HOH .   ? A HOH 1314 ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1290 ? 1_555 71.3  ? 
10 O   ? N HOH .   ? A HOH 1291 ? 1_555 CA ? I CA . ? A CA 4  ? 1_555 O   ? N HOH .   ? A HOH 1290 ? 1_555 148.2 ? 
11 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O   ? C PHE 543 ? A PHE 609  ? 1_555 89.9  ? 
12 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 OD1 ? C ASP 698 ? A ASP 764  ? 1_555 99.2  ? 
13 O   ? C PHE 543 ? A PHE 609  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 OD1 ? C ASP 698 ? A ASP 764  ? 1_555 88.7  ? 
14 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O1A ? E DCP .   ? A DCP 986  ? 1_555 105.1 ? 
15 O   ? C PHE 543 ? A PHE 609  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O1A ? E DCP .   ? A DCP 986  ? 1_555 164.3 ? 
16 OD1 ? C ASP 698 ? A ASP 764  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O1A ? E DCP .   ? A DCP 986  ? 1_555 84.3  ? 
17 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O2B ? E DCP .   ? A DCP 986  ? 1_555 166.4 ? 
18 O   ? C PHE 543 ? A PHE 609  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O2B ? E DCP .   ? A DCP 986  ? 1_555 85.6  ? 
19 OD1 ? C ASP 698 ? A ASP 764  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O2B ? E DCP .   ? A DCP 986  ? 1_555 93.6  ? 
20 O1A ? E DCP .   ? A DCP 986  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O2B ? E DCP .   ? A DCP 986  ? 1_555 80.8  ? 
21 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O3G ? E DCP .   ? A DCP 986  ? 1_555 85.8  ? 
22 O   ? C PHE 543 ? A PHE 609  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O3G ? E DCP .   ? A DCP 986  ? 1_555 98.8  ? 
23 OD1 ? C ASP 698 ? A ASP 764  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O3G ? E DCP .   ? A DCP 986  ? 1_555 171.0 ? 
24 O1A ? E DCP .   ? A DCP 986  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O3G ? E DCP .   ? A DCP 986  ? 1_555 87.2  ? 
25 O2B ? E DCP .   ? A DCP 986  ? 1_555 CA ? F CA . ? A CA 1  ? 1_555 O3G ? E DCP .   ? A DCP 986  ? 1_555 82.2  ? 
26 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 OD2 ? C ASP 542 ? A ASP 608  ? 1_555 50.1  ? 
27 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 OE2 ? C GLU 736 ? A GLU 802  ? 1_555 96.3  ? 
28 OD2 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 OE2 ? C GLU 736 ? A GLU 802  ? 1_555 59.8  ? 
29 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O3G ? E DCP .   ? A DCP 986  ? 1_555 74.2  ? 
30 OD2 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O3G ? E DCP .   ? A DCP 986  ? 1_555 124.2 ? 
31 OE2 ? C GLU 736 ? A GLU 802  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O3G ? E DCP .   ? A DCP 986  ? 1_555 133.7 ? 
32 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1272 ? 1_555 79.9  ? 
33 OD2 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1272 ? 1_555 88.5  ? 
34 OE2 ? C GLU 736 ? A GLU 802  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1272 ? 1_555 138.2 ? 
35 O3G ? E DCP .   ? A DCP 986  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1272 ? 1_555 85.8  ? 
36 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1378 ? 1_555 141.9 ? 
37 OD2 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1378 ? 1_555 144.1 ? 
38 OE2 ? C GLU 736 ? A GLU 802  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1378 ? 1_555 121.3 ? 
39 O3G ? E DCP .   ? A DCP 986  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1378 ? 1_555 82.7  ? 
40 O   ? N HOH .   ? A HOH 1272 ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1378 ? 1_555 68.4  ? 
41 OD1 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1271 ? 1_555 126.6 ? 
42 OD2 ? C ASP 542 ? A ASP 608  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1271 ? 1_555 76.5  ? 
43 OE2 ? C GLU 736 ? A GLU 802  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1271 ? 1_555 49.6  ? 
44 O3G ? E DCP .   ? A DCP 986  ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1271 ? 1_555 159.0 ? 
45 O   ? N HOH .   ? A HOH 1272 ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1271 ? 1_555 99.8  ? 
46 O   ? N HOH .   ? A HOH 1378 ? 1_555 CA ? H CA . ? A CA 3  ? 1_555 O   ? N HOH .   ? A HOH 1271 ? 1_555 80.6  ? 
47 OD2 ? C ASP 698 ? A ASP 764  ? 1_555 CA ? G CA . ? A CA 2  ? 1_555 O1A ? E DCP .   ? A DCP 986  ? 1_555 87.7  ? 
48 OD2 ? C ASP 698 ? A ASP 764  ? 1_555 CA ? G CA . ? A CA 2  ? 1_555 O   ? N HOH .   ? A HOH 1071 ? 1_555 129.0 ? 
49 O1A ? E DCP .   ? A DCP 986  ? 1_555 CA ? G CA . ? A CA 2  ? 1_555 O   ? N HOH .   ? A HOH 1071 ? 1_555 138.9 ? 
50 OD2 ? C ASP 698 ? A ASP 764  ? 1_555 CA ? G CA . ? A CA 2  ? 1_555 O   ? N HOH .   ? A HOH 1270 ? 1_555 80.8  ? 
51 O1A ? E DCP .   ? A DCP 986  ? 1_555 CA ? G CA . ? A CA 2  ? 1_555 O   ? N HOH .   ? A HOH 1270 ? 1_555 148.8 ? 
52 O   ? N HOH .   ? A HOH 1071 ? 1_555 CA ? G CA . ? A CA 2  ? 1_555 O   ? N HOH .   ? A HOH 1270 ? 1_555 66.6  ? 
53 O   ? M HOH .   ? T HOH 463  ? 1_555 CA ? D CA . ? T CA 17 ? 1_555 O   ? M HOH .   ? T HOH 461  ? 1_555 74.6  ? 
54 O   ? M HOH .   ? T HOH 463  ? 1_555 CA ? D CA . ? T CA 17 ? 1_555 O   ? M HOH .   ? T HOH 51   ? 1_555 54.9  ? 
55 O   ? M HOH .   ? T HOH 461  ? 1_555 CA ? D CA . ? T CA 17 ? 1_555 O   ? M HOH .   ? T HOH 51   ? 1_555 79.7  ? 
56 O   ? M HOH .   ? T HOH 463  ? 1_555 CA ? D CA . ? T CA 17 ? 1_555 O   ? M HOH .   ? T HOH 462  ? 1_555 79.6  ? 
57 O   ? M HOH .   ? T HOH 461  ? 1_555 CA ? D CA . ? T CA 17 ? 1_555 O   ? M HOH .   ? T HOH 462  ? 1_555 132.6 ? 
58 O   ? M HOH .   ? T HOH 51   ? 1_555 CA ? D CA . ? T CA 17 ? 1_555 O   ? M HOH .   ? T HOH 462  ? 1_555 53.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-09-22 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 34.2880  -5.9420  9.5240  -0.0540 0.0217  -0.0679 -0.0260 0.0093  -0.0251 1.2328 1.3079 0.7275 
0.9729  -0.3981 -0.5161 -0.0225 0.1234  -0.0910 0.0165  -0.0223 -0.1337 -0.0153 0.1406  0.0448  
'X-RAY DIFFRACTION' 2 ? refined 22.3000  -29.1690 12.0460 -0.0437 -0.0573 -0.0489 0.0400  -0.0098 -0.0442 1.4092 2.0532 5.2032 
-0.3874 -1.0576 1.5422  -0.0707 -0.0247 -0.1200 0.1410  0.1659  -0.0905 0.4192  0.2776  -0.0953 
'X-RAY DIFFRACTION' 3 ? refined 19.5930  9.1060   9.1610  -0.0057 -0.0167 -0.1013 -0.0035 0.0584  -0.0125 0.6619 1.0905 0.8888 
0.2189  -0.1146 -0.4258 0.0546  0.0965  0.1075  0.1522  0.0193  0.1257  -0.2408 -0.0131 -0.0740 
'X-RAY DIFFRACTION' 4 ? refined 9.2540   -6.5150  38.1590 -0.0037 -0.0053 -0.1242 -0.0219 0.0165  -0.0137 1.2836 1.3988 1.3758 
-0.7221 -0.8198 0.7277  -0.0362 -0.1865 -0.0068 0.0709  0.0918  -0.1484 -0.0332 0.2293  -0.0557 
'X-RAY DIFFRACTION' 5 ? refined -0.1100  4.2570   47.8410 0.0293  -0.0061 -0.1326 -0.0429 0.0179  -0.0214 0.8384 1.2955 0.9435 
-0.3001 -0.0968 0.3398  -0.0262 -0.1830 0.0510  0.1500  0.0205  -0.0415 -0.1037 0.1069  0.0056  
'X-RAY DIFFRACTION' 6 ? refined -16.6290 18.4470  21.8540 0.0168  -0.0561 -0.0733 -0.0044 0.0442  -0.0069 0.4802 0.4423 2.1634 
-0.4222 -0.0631 0.1616  0.0162  0.0774  0.0534  0.0536  0.0200  0.0406  -0.1557 -0.0368 -0.0363 
'X-RAY DIFFRACTION' 7 ? refined -13.6970 0.0820   27.4870 0.0398  0.0049  -0.0480 0.0190  0.0322  0.0133  0.4303 1.3377 2.9249 
0.2355  0.8487  -0.7653 -0.0779 -0.1256 -0.0212 0.0247  0.2398  0.1537  0.0470  -0.1653 -0.1618 
'X-RAY DIFFRACTION' 8 ? refined -10.5350 -2.6930  24.8870 -0.0047 -0.0462 -0.0555 -0.0469 0.0108  -0.0283 0.9731 0.9211 1.4884 
-0.3949 0.4403  -0.4465 -0.0831 -0.0829 -0.1890 -0.0028 0.0822  0.1899  0.1075  -0.0921 0.0010  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 96  ? ? A 171 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 172 ? ? A 241 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 242 ? ? A 577 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 578 ? ? A 711 ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 A 712 ? ? A 838 ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 A 839 ? ? A 985 ? ? ? ? 
'X-RAY DIFFRACTION' 7 7 P 2   ? ? P 12  ? ? ? ? 
'X-RAY DIFFRACTION' 8 8 T 1   ? ? T 16  ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum  ? 1 
SHARP    phasing           .        ? 2 
REFMAC   refinement        5.5.0066 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OD1 A ASN 812  ? ? O   A HOH 1212 ? ? 1.83 
2  1 O   T HOH 394  ? ? O   T HOH 527  ? ? 1.97 
3  1 O   A HOH 1328 ? ? O   A HOH 1329 ? ? 2.00 
4  1 OD1 A ASP 864  ? ? O   A HOH 1332 ? ? 2.07 
5  1 NE2 A GLN 961  ? ? O   A HOH 1211 ? ? 2.09 
6  1 N   A LYS 717  ? ? O   A HOH 1284 ? ? 2.09 
7  1 O   A ACT 987  ? ? O   A HOH 1388 ? ? 2.12 
8  1 O   T HOH 387  ? ? O   T HOH 543  ? ? 2.13 
9  1 O   A VAL 916  ? ? O   A HOH 1027 ? ? 2.14 
10 1 NE2 A GLN 832  ? ? OG  A SER 837  ? ? 2.14 
11 1 O   A HOH 1273 ? ? O   A HOH 1380 ? ? 2.15 
12 1 O   P HOH 317  ? ? O   T HOH 463  ? ? 2.16 
13 1 O   A ASP 308  ? ? CE1 A HIS 311  ? A 2.18 
14 1 O   T HOH 382  ? ? O   A HOH 1261 ? ? 2.18 
15 1 CE  A LYS 717  ? ? O   A HOH 63   ? ? 2.19 
16 1 O   P HOH 367  ? ? O   P HOH 368  ? ? 2.19 
17 1 OE2 A GLU 802  ? ? O   A HOH 1271 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OD2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ASP 
_pdbx_validate_symm_contact.auth_seq_id_1     933 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OXT 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ACT 
_pdbx_validate_symm_contact.auth_seq_id_2     988 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              2.12 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" P DT 5  ? ? "C1'" P DT 5  ? ? N1 P DT 5  ? ? 103.58 108.00 -4.42 0.70 N 
2 1 "O4'" T DT 1  ? ? "C1'" T DT 1  ? ? N1 T DT 1  ? ? 111.32 108.30 3.02  0.30 N 
3 1 "O4'" T DT 6  ? ? "C1'" T DT 6  ? ? N1 T DT 6  ? ? 111.01 108.30 2.71  0.30 N 
4 1 "O4'" T DG 8  ? ? "C1'" T DG 8  ? ? N9 T DG 8  ? ? 112.65 108.30 4.35  0.30 N 
5 1 "O4'" T DG 9  ? ? "C1'" T DG 9  ? ? N9 T DG 9  ? ? 102.13 108.00 -5.87 0.70 N 
6 1 "O4'" T DA 12 ? ? "C1'" T DA 12 ? ? N9 T DA 12 ? ? 110.89 108.30 2.59  0.30 N 
7 1 "O4'" T DG 13 ? ? "C1'" T DG 13 ? ? N9 T DG 13 ? ? 111.50 108.30 3.20  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 96  ? ? 148.49  16.36   
2  1 PHE A 97  ? ? -35.70  141.20  
3  1 ILE A 128 ? ? -33.42  143.06  
4  1 ASN A 244 ? ? 175.25  133.33  
5  1 TYR A 336 ? ? -131.95 -31.81  
6  1 ALA A 349 ? ? -34.52  122.42  
7  1 ASN A 363 ? ? 74.36   -170.64 
8  1 PHE A 406 ? ? -118.62 -76.67  
9  1 ASP A 601 ? ? -99.57  30.05   
10 1 ASP A 641 ? ? 79.51   -35.69  
11 1 LEU A 718 ? ? -141.36 55.92   
12 1 THR A 763 ? ? 74.05   -61.72  
13 1 ASP A 764 ? ? -144.50 20.90   
14 1 PHE A 806 ? ? -162.96 100.37  
15 1 GLN A 961 ? ? -120.44 -57.46  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 95  ? OG  ? C SER 29  OG  
2  1 Y 1 A SER 96  ? OG  ? C SER 30  OG  
3  1 Y 1 A PHE 97  ? CG  ? C PHE 31  CG  
4  1 Y 1 A PHE 97  ? CD1 ? C PHE 31  CD1 
5  1 Y 1 A PHE 97  ? CD2 ? C PHE 31  CD2 
6  1 Y 1 A PHE 97  ? CE1 ? C PHE 31  CE1 
7  1 Y 1 A PHE 97  ? CE2 ? C PHE 31  CE2 
8  1 Y 1 A PHE 97  ? CZ  ? C PHE 31  CZ  
9  1 Y 1 A LYS 101 ? CG  ? C LYS 35  CG  
10 1 Y 1 A LYS 101 ? CD  ? C LYS 35  CD  
11 1 Y 1 A LYS 101 ? CE  ? C LYS 35  CE  
12 1 Y 1 A LYS 101 ? NZ  ? C LYS 35  NZ  
13 1 Y 1 A ILE 128 ? CG1 ? C ILE 62  CG1 
14 1 Y 1 A ILE 128 ? CG2 ? C ILE 62  CG2 
15 1 Y 1 A ILE 128 ? CD1 ? C ILE 62  CD1 
16 1 Y 1 A ASN 166 ? CG  ? C ASN 100 CG  
17 1 Y 1 A ASN 166 ? OD1 ? C ASN 100 OD1 
18 1 Y 1 A ASN 166 ? ND2 ? C ASN 100 ND2 
19 1 Y 1 A SER 168 ? OG  ? C SER 102 OG  
20 1 Y 1 A SER 206 ? OG  ? C SER 140 OG  
21 1 Y 1 A ASN 244 ? CG  ? C ASN 178 CG  
22 1 Y 1 A ASN 244 ? OD1 ? C ASN 178 OD1 
23 1 Y 1 A ASN 244 ? ND2 ? C ASN 178 ND2 
24 1 Y 1 A ILE 328 ? CG1 ? C ILE 262 CG1 
25 1 Y 1 A ILE 328 ? CG2 ? C ILE 262 CG2 
26 1 Y 1 A ILE 328 ? CD1 ? C ILE 262 CD1 
27 1 Y 1 A LYS 353 ? CG  ? C LYS 287 CG  
28 1 Y 1 A LYS 353 ? CD  ? C LYS 287 CD  
29 1 Y 1 A LYS 353 ? CE  ? C LYS 287 CE  
30 1 Y 1 A LYS 353 ? NZ  ? C LYS 287 NZ  
31 1 Y 1 A LYS 437 ? CG  ? C LYS 371 CG  
32 1 Y 1 A LYS 437 ? CD  ? C LYS 371 CD  
33 1 Y 1 A LYS 437 ? CE  ? C LYS 371 CE  
34 1 Y 1 A LYS 437 ? NZ  ? C LYS 371 NZ  
35 1 Y 1 A GLU 438 ? CG  ? C GLU 372 CG  
36 1 Y 1 A GLU 438 ? CD  ? C GLU 372 CD  
37 1 Y 1 A GLU 438 ? OE1 ? C GLU 372 OE1 
38 1 Y 1 A GLU 438 ? OE2 ? C GLU 372 OE2 
39 1 Y 1 A LYS 473 ? CG  ? C LYS 407 CG  
40 1 Y 1 A LYS 473 ? CD  ? C LYS 407 CD  
41 1 Y 1 A LYS 473 ? CE  ? C LYS 407 CE  
42 1 Y 1 A LYS 473 ? NZ  ? C LYS 407 NZ  
43 1 Y 1 A ASN 480 ? CG  ? C ASN 414 CG  
44 1 Y 1 A ASN 480 ? OD1 ? C ASN 414 OD1 
45 1 Y 1 A ASN 480 ? ND2 ? C ASN 414 ND2 
46 1 Y 1 A GLN 490 ? CG  ? C GLN 424 CG  
47 1 Y 1 A GLN 490 ? CD  ? C GLN 424 CD  
48 1 Y 1 A GLN 490 ? OE1 ? C GLN 424 OE1 
49 1 Y 1 A GLN 490 ? NE2 ? C GLN 424 NE2 
50 1 Y 1 A SER 497 ? OG  ? C SER 431 OG  
51 1 Y 1 A SER 507 ? OG  ? C SER 441 OG  
52 1 Y 1 A LYS 530 ? CG  ? C LYS 464 CG  
53 1 Y 1 A LYS 530 ? CD  ? C LYS 464 CD  
54 1 Y 1 A LYS 530 ? CE  ? C LYS 464 CE  
55 1 Y 1 A LYS 530 ? NZ  ? C LYS 464 NZ  
56 1 Y 1 A GLN 579 ? CG  ? C GLN 513 CG  
57 1 Y 1 A GLN 579 ? CD  ? C GLN 513 CD  
58 1 Y 1 A GLN 579 ? OE1 ? C GLN 513 OE1 
59 1 Y 1 A GLN 579 ? NE2 ? C GLN 513 NE2 
60 1 Y 1 A GLN 581 ? CG  ? C GLN 515 CG  
61 1 Y 1 A GLN 581 ? CD  ? C GLN 515 CD  
62 1 Y 1 A GLN 581 ? OE1 ? C GLN 515 OE1 
63 1 Y 1 A GLN 581 ? NE2 ? C GLN 515 NE2 
64 1 Y 1 A LYS 630 ? CG  ? C LYS 564 CG  
65 1 Y 1 A LYS 630 ? CD  ? C LYS 564 CD  
66 1 Y 1 A LYS 630 ? CE  ? C LYS 564 CE  
67 1 Y 1 A LYS 630 ? NZ  ? C LYS 564 NZ  
68 1 Y 1 A LYS 639 ? CG  ? C LYS 573 CG  
69 1 Y 1 A LYS 639 ? CD  ? C LYS 573 CD  
70 1 Y 1 A LYS 639 ? CE  ? C LYS 573 CE  
71 1 Y 1 A LYS 639 ? NZ  ? C LYS 573 NZ  
72 1 Y 1 A LYS 685 ? CG  ? C LYS 619 CG  
73 1 Y 1 A LYS 685 ? CD  ? C LYS 619 CD  
74 1 Y 1 A LYS 685 ? CE  ? C LYS 619 CE  
75 1 Y 1 A LYS 685 ? NZ  ? C LYS 619 NZ  
76 1 Y 1 A LYS 689 ? CG  ? C LYS 623 CG  
77 1 Y 1 A LYS 689 ? CD  ? C LYS 623 CD  
78 1 Y 1 A LYS 689 ? CE  ? C LYS 623 CE  
79 1 Y 1 A LYS 689 ? NZ  ? C LYS 623 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 67  ? C MET 1   
2  1 Y 1 A GLY 68  ? C GLY 2   
3  1 Y 1 A THR 69  ? C THR 3   
4  1 Y 1 A GLN 70  ? C GLN 4   
5  1 Y 1 A LEU 71  ? C LEU 5   
6  1 Y 1 A GLU 72  ? C GLU 6   
7  1 Y 1 A SER 73  ? C SER 7   
8  1 Y 1 A THR 74  ? C THR 8   
9  1 Y 1 A PHE 75  ? C PHE 9   
10 1 Y 1 A GLU 76  ? C GLU 10  
11 1 Y 1 A GLN 77  ? C GLN 11  
12 1 Y 1 A ASP 78  ? C ASP 12  
13 1 Y 1 A VAL 79  ? C VAL 13  
14 1 Y 1 A SER 80  ? C SER 14  
15 1 Y 1 A GLN 81  ? C GLN 15  
16 1 Y 1 A MET 82  ? C MET 16  
17 1 Y 1 A GLU 83  ? C GLU 17  
18 1 Y 1 A HIS 84  ? C HIS 18  
19 1 Y 1 A ASP 85  ? C ASP 19  
20 1 Y 1 A MET 86  ? C MET 20  
21 1 Y 1 A ALA 87  ? C ALA 21  
22 1 Y 1 A ASP 88  ? C ASP 22  
23 1 Y 1 A GLN 89  ? C GLN 23  
24 1 Y 1 A GLU 90  ? C GLU 24  
25 1 Y 1 A GLU 91  ? C GLU 25  
26 1 Y 1 A HIS 92  ? C HIS 26  
27 1 Y 1 A ASP 93  ? C ASP 27  
28 1 Y 1 A LEU 94  ? C LEU 28  
29 1 Y 1 A LYS 491 ? C LYS 425 
30 1 Y 1 A GLU 492 ? C GLU 426 
31 1 Y 1 A ASP 493 ? C ASP 427 
32 1 Y 1 A VAL 494 ? C VAL 428 
33 1 Y 1 A HIS 495 ? C HIS 429 
34 1 Y 1 A TYR 496 ? C TYR 430 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3IAY 'double helix'        
3IAY 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA  1  1_555 B DT 16 1_555 -0.104 -0.332 -0.596 -3.849  2.643   1.970  1  P_DA1:DT16_T  P 1  ? T 16 ? 20 1 
1 A DT  2  1_555 B DA 15 1_555 0.067  -0.319 -0.612 7.218   -8.963  0.752  2  P_DT2:DA15_T  P 2  ? T 15 ? 20 1 
1 A DC  3  1_555 B DG 14 1_555 0.243  -0.473 -0.630 16.307  -10.019 -2.469 3  P_DC3:DG14_T  P 3  ? T 14 ? 19 1 
1 A DC  4  1_555 B DG 13 1_555 0.297  -0.204 0.088  -4.186  -6.506  1.920  4  P_DC4:DG13_T  P 4  ? T 13 ? 19 1 
1 A DT  5  1_555 B DA 12 1_555 -0.237 -0.208 -0.075 1.934   -8.649  -3.119 5  P_DT5:DA12_T  P 5  ? T 12 ? 20 1 
1 A DC  6  1_555 B DG 11 1_555 0.458  -0.092 -0.075 1.713   -12.731 0.779  6  P_DC6:DG11_T  P 6  ? T 11 ? 19 1 
1 A DC  7  1_555 B DG 10 1_555 0.291  -0.130 0.190  -11.899 -10.967 1.558  7  P_DC7:DG10_T  P 7  ? T 10 ? 19 1 
1 A DC  8  1_555 B DG 9  1_555 0.202  -0.126 0.252  -4.067  -3.349  -2.027 8  P_DC8:DG9_T   P 8  ? T 9  ? 19 1 
1 A DC  9  1_555 B DG 8  1_555 0.241  -0.156 -0.119 1.423   -1.663  -2.607 9  P_DC9:DG8_T   P 9  ? T 8  ? 19 1 
1 A DT  10 1_555 B DA 7  1_555 -0.093 -0.072 -0.181 6.215   -3.166  0.101  10 P_DT10:DA7_T  P 10 ? T 7  ? 20 1 
1 A DA  11 1_555 B DT 6  1_555 0.109  -0.110 -0.192 -0.683  1.311   -1.017 11 P_DA11:DT6_T  P 11 ? T 6  ? 20 1 
1 A DOC 12 1_555 B DG 5  1_555 0.353  -0.164 -0.129 7.826   -9.593  0.646  12 P_DOC12:DG5_T P 12 ? T 5  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 1  1_555 B DT 16 1_555 A DT  2  1_555 B DA 15 1_555 -0.359 -0.407 2.971 -2.029 -1.440 33.335 -0.490 0.317  3.002 -2.505 
3.531   33.425 1  PP_DA1DT2:DA15DT16_TT  P 1  ? T 16 ? P 2  ? T 15 ? 
1 A DT 2  1_555 B DA 15 1_555 A DC  3  1_555 B DG 14 1_555 0.446  -0.203 3.114 1.216  2.773  32.671 -0.812 -0.591 3.101 4.916  
-2.156  32.808 2  PP_DT2DC3:DG14DA15_TT  P 2  ? T 15 ? P 3  ? T 14 ? 
1 A DC 3  1_555 B DG 14 1_555 A DC  4  1_555 B DG 13 1_555 0.431  -0.875 3.814 -4.698 3.962  40.451 -1.751 -1.208 3.646 5.690  
6.747   40.895 3  PP_DC3DC4:DG13DG14_TT  P 3  ? T 14 ? P 4  ? T 13 ? 
1 A DC 4  1_555 B DG 13 1_555 A DT  5  1_555 B DA 12 1_555 -1.010 -0.751 3.189 0.783  5.379  27.626 -2.741 2.251  2.963 11.127 
-1.620  28.145 4  PP_DC4DT5:DA12DG13_TT  P 4  ? T 13 ? P 5  ? T 12 ? 
1 A DT 5  1_555 B DA 12 1_555 A DC  6  1_555 B DG 11 1_555 -0.270 -0.268 3.258 -1.406 4.413  33.675 -1.159 0.239  3.206 7.573  
2.413   33.983 5  PP_DT5DC6:DG11DA12_TT  P 5  ? T 12 ? P 6  ? T 11 ? 
1 A DC 6  1_555 B DG 11 1_555 A DC  7  1_555 B DG 10 1_555 0.893  -0.366 3.477 3.532  11.342 36.559 -2.061 -0.890 3.293 17.520 
-5.456  38.378 6  PP_DC6DC7:DG10DG11_TT  P 6  ? T 11 ? P 7  ? T 10 ? 
1 A DC 7  1_555 B DG 10 1_555 A DC  8  1_555 B DG 9  1_555 -0.360 0.124  3.217 0.818  9.841  25.914 -2.099 0.949  3.046 20.999 
-1.746  27.702 7  PP_DC7DC8:DG9DG10_TT   P 7  ? T 10 ? P 8  ? T 9  ? 
1 A DC 8  1_555 B DG 9  1_555 A DC  9  1_555 B DG 8  1_555 1.391  0.154  3.152 6.997  2.374  34.949 -0.094 -1.250 3.362 3.899  
-11.491 35.697 8  PP_DC8DC9:DG8DG9_TT    P 8  ? T 9  ? P 9  ? T 8  ? 
1 A DC 9  1_555 B DG 8  1_555 A DT  10 1_555 B DA 7  1_555 -0.070 -0.661 3.275 1.772  3.820  23.150 -2.886 0.759  3.112 9.418  
-4.369  23.525 9  PP_DC9DT10:DA7DG8_TT   P 9  ? T 8  ? P 10 ? T 7  ? 
1 A DT 10 1_555 B DA 7  1_555 A DA  11 1_555 B DT 6  1_555 -0.077 -0.592 3.396 -0.651 4.503  43.342 -1.244 0.039  3.322 6.077  
0.879   43.569 10 PP_DT10DA11:DT6DA7_TT  P 10 ? T 7  ? P 11 ? T 6  ? 
1 A DA 11 1_555 B DT 6  1_555 A DOC 12 1_555 B DG 5  1_555 0.786  -1.011 3.182 -2.690 3.584  28.501 -2.783 -2.143 2.951 7.222  
5.421   28.843 11 PP_DA11DOC12:DG5DT6_TT P 11 ? T 6  ? P 12 ? T 5  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                      CA  
5 "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" DCP 
6 'ACETATE ION'                      ACT 
7 water                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1   17   5   CA  CA  T . 
E 5 DCP 1   986  101 DCP DCP A . 
F 4 CA  1   1    1   CA  CA  A . 
G 4 CA  1   2    2   CA  CA  A . 
H 4 CA  1   3    3   CA  CA  A . 
I 4 CA  1   4    4   CA  CA  A . 
J 6 ACT 1   987  1   ACT ACT A . 
K 6 ACT 1   988  2   ACT ACT A . 
L 7 HOH 1   32   32  HOH HOH P . 
L 7 HOH 2   61   61  HOH HOH P . 
L 7 HOH 3   90   90  HOH HOH P . 
L 7 HOH 4   106  106 HOH HOH P . 
L 7 HOH 5   112  112 HOH HOH P . 
L 7 HOH 6   113  113 HOH HOH P . 
L 7 HOH 7   120  120 HOH HOH P . 
L 7 HOH 8   124  124 HOH HOH P . 
L 7 HOH 9   199  199 HOH HOH P . 
L 7 HOH 10  208  208 HOH HOH P . 
L 7 HOH 11  240  240 HOH HOH P . 
L 7 HOH 12  256  256 HOH HOH P . 
L 7 HOH 13  259  259 HOH HOH P . 
L 7 HOH 14  317  317 HOH HOH P . 
L 7 HOH 15  347  347 HOH HOH P . 
L 7 HOH 16  364  364 HOH HOH P . 
L 7 HOH 17  367  367 HOH HOH P . 
L 7 HOH 18  368  368 HOH HOH P . 
L 7 HOH 19  369  369 HOH HOH P . 
L 7 HOH 20  389  389 HOH HOH P . 
L 7 HOH 21  390  390 HOH HOH P . 
L 7 HOH 22  522  522 HOH HOH P . 
L 7 HOH 23  523  523 HOH HOH P . 
L 7 HOH 24  526  526 HOH HOH P . 
L 7 HOH 25  528  528 HOH HOH P . 
L 7 HOH 26  551  551 HOH HOH P . 
M 7 HOH 1   18   7   HOH HOH T . 
M 7 HOH 2   19   19  HOH HOH T . 
M 7 HOH 3   20   9   HOH HOH T . 
M 7 HOH 4   21   21  HOH HOH T . 
M 7 HOH 5   31   31  HOH HOH T . 
M 7 HOH 6   47   47  HOH HOH T . 
M 7 HOH 7   49   49  HOH HOH T . 
M 7 HOH 8   51   51  HOH HOH T . 
M 7 HOH 9   55   55  HOH HOH T . 
M 7 HOH 10  64   64  HOH HOH T . 
M 7 HOH 11  82   82  HOH HOH T . 
M 7 HOH 12  89   89  HOH HOH T . 
M 7 HOH 13  102  102 HOH HOH T . 
M 7 HOH 14  135  135 HOH HOH T . 
M 7 HOH 15  145  145 HOH HOH T . 
M 7 HOH 16  152  152 HOH HOH T . 
M 7 HOH 17  158  158 HOH HOH T . 
M 7 HOH 18  164  164 HOH HOH T . 
M 7 HOH 19  168  168 HOH HOH T . 
M 7 HOH 20  173  173 HOH HOH T . 
M 7 HOH 21  179  179 HOH HOH T . 
M 7 HOH 22  186  186 HOH HOH T . 
M 7 HOH 23  192  192 HOH HOH T . 
M 7 HOH 24  196  196 HOH HOH T . 
M 7 HOH 25  215  215 HOH HOH T . 
M 7 HOH 26  225  225 HOH HOH T . 
M 7 HOH 27  248  248 HOH HOH T . 
M 7 HOH 28  250  250 HOH HOH T . 
M 7 HOH 29  251  251 HOH HOH T . 
M 7 HOH 30  286  286 HOH HOH T . 
M 7 HOH 31  289  289 HOH HOH T . 
M 7 HOH 32  307  307 HOH HOH T . 
M 7 HOH 33  320  320 HOH HOH T . 
M 7 HOH 34  326  326 HOH HOH T . 
M 7 HOH 35  353  353 HOH HOH T . 
M 7 HOH 36  356  356 HOH HOH T . 
M 7 HOH 37  359  359 HOH HOH T . 
M 7 HOH 38  360  360 HOH HOH T . 
M 7 HOH 39  382  382 HOH HOH T . 
M 7 HOH 40  385  385 HOH HOH T . 
M 7 HOH 41  387  387 HOH HOH T . 
M 7 HOH 42  394  394 HOH HOH T . 
M 7 HOH 43  438  438 HOH HOH T . 
M 7 HOH 44  439  439 HOH HOH T . 
M 7 HOH 45  461  461 HOH HOH T . 
M 7 HOH 46  462  462 HOH HOH T . 
M 7 HOH 47  463  463 HOH HOH T . 
M 7 HOH 48  464  464 HOH HOH T . 
M 7 HOH 49  467  467 HOH HOH T . 
M 7 HOH 50  492  492 HOH HOH T . 
M 7 HOH 51  520  520 HOH HOH T . 
M 7 HOH 52  525  525 HOH HOH T . 
M 7 HOH 53  527  527 HOH HOH T . 
M 7 HOH 54  529  529 HOH HOH T . 
M 7 HOH 55  540  540 HOH HOH T . 
M 7 HOH 56  543  543 HOH HOH T . 
M 7 HOH 57  544  544 HOH HOH T . 
M 7 HOH 58  545  545 HOH HOH T . 
M 7 HOH 59  546  546 HOH HOH T . 
M 7 HOH 60  547  547 HOH HOH T . 
M 7 HOH 61  552  552 HOH HOH T . 
M 7 HOH 62  553  553 HOH HOH T . 
M 7 HOH 63  1408 74  HOH HOH T . 
N 7 HOH 1   5    5   HOH HOH A . 
N 7 HOH 2   6    6   HOH HOH A . 
N 7 HOH 3   8    8   HOH HOH A . 
N 7 HOH 4   10   10  HOH HOH A . 
N 7 HOH 5   11   11  HOH HOH A . 
N 7 HOH 6   12   12  HOH HOH A . 
N 7 HOH 7   13   13  HOH HOH A . 
N 7 HOH 8   14   14  HOH HOH A . 
N 7 HOH 9   15   15  HOH HOH A . 
N 7 HOH 10  16   16  HOH HOH A . 
N 7 HOH 11  17   17  HOH HOH A . 
N 7 HOH 12  18   18  HOH HOH A . 
N 7 HOH 13  20   20  HOH HOH A . 
N 7 HOH 14  22   22  HOH HOH A . 
N 7 HOH 15  23   23  HOH HOH A . 
N 7 HOH 16  24   24  HOH HOH A . 
N 7 HOH 17  25   25  HOH HOH A . 
N 7 HOH 18  26   26  HOH HOH A . 
N 7 HOH 19  27   27  HOH HOH A . 
N 7 HOH 20  28   28  HOH HOH A . 
N 7 HOH 21  29   29  HOH HOH A . 
N 7 HOH 22  30   30  HOH HOH A . 
N 7 HOH 23  33   33  HOH HOH A . 
N 7 HOH 24  34   34  HOH HOH A . 
N 7 HOH 25  35   35  HOH HOH A . 
N 7 HOH 26  36   36  HOH HOH A . 
N 7 HOH 27  37   37  HOH HOH A . 
N 7 HOH 28  38   38  HOH HOH A . 
N 7 HOH 29  39   39  HOH HOH A . 
N 7 HOH 30  40   40  HOH HOH A . 
N 7 HOH 31  41   41  HOH HOH A . 
N 7 HOH 32  42   42  HOH HOH A . 
N 7 HOH 33  43   43  HOH HOH A . 
N 7 HOH 34  44   44  HOH HOH A . 
N 7 HOH 35  45   45  HOH HOH A . 
N 7 HOH 36  46   46  HOH HOH A . 
N 7 HOH 37  48   48  HOH HOH A . 
N 7 HOH 38  50   50  HOH HOH A . 
N 7 HOH 39  52   52  HOH HOH A . 
N 7 HOH 40  53   53  HOH HOH A . 
N 7 HOH 41  54   54  HOH HOH A . 
N 7 HOH 42  56   56  HOH HOH A . 
N 7 HOH 43  57   57  HOH HOH A . 
N 7 HOH 44  58   58  HOH HOH A . 
N 7 HOH 45  59   59  HOH HOH A . 
N 7 HOH 46  60   60  HOH HOH A . 
N 7 HOH 47  62   62  HOH HOH A . 
N 7 HOH 48  63   63  HOH HOH A . 
N 7 HOH 49  65   65  HOH HOH A . 
N 7 HOH 50  66   66  HOH HOH A . 
N 7 HOH 51  989  1   HOH HOH A . 
N 7 HOH 52  990  2   HOH HOH A . 
N 7 HOH 53  991  3   HOH HOH A . 
N 7 HOH 54  992  4   HOH HOH A . 
N 7 HOH 55  993  67  HOH HOH A . 
N 7 HOH 56  994  68  HOH HOH A . 
N 7 HOH 57  995  69  HOH HOH A . 
N 7 HOH 58  996  70  HOH HOH A . 
N 7 HOH 59  997  71  HOH HOH A . 
N 7 HOH 60  998  72  HOH HOH A . 
N 7 HOH 61  999  73  HOH HOH A . 
N 7 HOH 62  1000 75  HOH HOH A . 
N 7 HOH 63  1001 76  HOH HOH A . 
N 7 HOH 64  1002 77  HOH HOH A . 
N 7 HOH 65  1003 78  HOH HOH A . 
N 7 HOH 66  1004 79  HOH HOH A . 
N 7 HOH 67  1005 80  HOH HOH A . 
N 7 HOH 68  1006 81  HOH HOH A . 
N 7 HOH 69  1007 83  HOH HOH A . 
N 7 HOH 70  1008 84  HOH HOH A . 
N 7 HOH 71  1009 85  HOH HOH A . 
N 7 HOH 72  1010 86  HOH HOH A . 
N 7 HOH 73  1011 87  HOH HOH A . 
N 7 HOH 74  1012 88  HOH HOH A . 
N 7 HOH 75  1013 91  HOH HOH A . 
N 7 HOH 76  1014 92  HOH HOH A . 
N 7 HOH 77  1015 93  HOH HOH A . 
N 7 HOH 78  1016 94  HOH HOH A . 
N 7 HOH 79  1017 95  HOH HOH A . 
N 7 HOH 80  1018 96  HOH HOH A . 
N 7 HOH 81  1019 97  HOH HOH A . 
N 7 HOH 82  1020 98  HOH HOH A . 
N 7 HOH 83  1021 99  HOH HOH A . 
N 7 HOH 84  1022 100 HOH HOH A . 
N 7 HOH 85  1023 101 HOH HOH A . 
N 7 HOH 86  1024 103 HOH HOH A . 
N 7 HOH 87  1025 104 HOH HOH A . 
N 7 HOH 88  1026 105 HOH HOH A . 
N 7 HOH 89  1027 107 HOH HOH A . 
N 7 HOH 90  1028 108 HOH HOH A . 
N 7 HOH 91  1029 109 HOH HOH A . 
N 7 HOH 92  1030 110 HOH HOH A . 
N 7 HOH 93  1031 111 HOH HOH A . 
N 7 HOH 94  1032 114 HOH HOH A . 
N 7 HOH 95  1033 115 HOH HOH A . 
N 7 HOH 96  1034 116 HOH HOH A . 
N 7 HOH 97  1035 117 HOH HOH A . 
N 7 HOH 98  1036 118 HOH HOH A . 
N 7 HOH 99  1037 119 HOH HOH A . 
N 7 HOH 100 1038 121 HOH HOH A . 
N 7 HOH 101 1039 122 HOH HOH A . 
N 7 HOH 102 1040 123 HOH HOH A . 
N 7 HOH 103 1041 125 HOH HOH A . 
N 7 HOH 104 1042 126 HOH HOH A . 
N 7 HOH 105 1043 127 HOH HOH A . 
N 7 HOH 106 1044 128 HOH HOH A . 
N 7 HOH 107 1045 129 HOH HOH A . 
N 7 HOH 108 1046 130 HOH HOH A . 
N 7 HOH 109 1047 131 HOH HOH A . 
N 7 HOH 110 1048 132 HOH HOH A . 
N 7 HOH 111 1049 133 HOH HOH A . 
N 7 HOH 112 1050 134 HOH HOH A . 
N 7 HOH 113 1051 136 HOH HOH A . 
N 7 HOH 114 1052 137 HOH HOH A . 
N 7 HOH 115 1053 138 HOH HOH A . 
N 7 HOH 116 1054 139 HOH HOH A . 
N 7 HOH 117 1055 140 HOH HOH A . 
N 7 HOH 118 1056 141 HOH HOH A . 
N 7 HOH 119 1057 142 HOH HOH A . 
N 7 HOH 120 1058 143 HOH HOH A . 
N 7 HOH 121 1059 144 HOH HOH A . 
N 7 HOH 122 1060 146 HOH HOH A . 
N 7 HOH 123 1061 147 HOH HOH A . 
N 7 HOH 124 1062 148 HOH HOH A . 
N 7 HOH 125 1063 149 HOH HOH A . 
N 7 HOH 126 1064 150 HOH HOH A . 
N 7 HOH 127 1065 151 HOH HOH A . 
N 7 HOH 128 1066 153 HOH HOH A . 
N 7 HOH 129 1067 154 HOH HOH A . 
N 7 HOH 130 1068 155 HOH HOH A . 
N 7 HOH 131 1069 156 HOH HOH A . 
N 7 HOH 132 1070 157 HOH HOH A . 
N 7 HOH 133 1071 159 HOH HOH A . 
N 7 HOH 134 1072 160 HOH HOH A . 
N 7 HOH 135 1073 161 HOH HOH A . 
N 7 HOH 136 1074 162 HOH HOH A . 
N 7 HOH 137 1075 163 HOH HOH A . 
N 7 HOH 138 1076 165 HOH HOH A . 
N 7 HOH 139 1077 166 HOH HOH A . 
N 7 HOH 140 1078 167 HOH HOH A . 
N 7 HOH 141 1079 169 HOH HOH A . 
N 7 HOH 142 1080 170 HOH HOH A . 
N 7 HOH 143 1081 171 HOH HOH A . 
N 7 HOH 144 1082 172 HOH HOH A . 
N 7 HOH 145 1083 174 HOH HOH A . 
N 7 HOH 146 1084 175 HOH HOH A . 
N 7 HOH 147 1085 176 HOH HOH A . 
N 7 HOH 148 1086 177 HOH HOH A . 
N 7 HOH 149 1087 178 HOH HOH A . 
N 7 HOH 150 1088 180 HOH HOH A . 
N 7 HOH 151 1089 181 HOH HOH A . 
N 7 HOH 152 1090 182 HOH HOH A . 
N 7 HOH 153 1091 183 HOH HOH A . 
N 7 HOH 154 1092 184 HOH HOH A . 
N 7 HOH 155 1093 185 HOH HOH A . 
N 7 HOH 156 1094 187 HOH HOH A . 
N 7 HOH 157 1095 188 HOH HOH A . 
N 7 HOH 158 1096 189 HOH HOH A . 
N 7 HOH 159 1097 190 HOH HOH A . 
N 7 HOH 160 1098 191 HOH HOH A . 
N 7 HOH 161 1099 193 HOH HOH A . 
N 7 HOH 162 1100 194 HOH HOH A . 
N 7 HOH 163 1101 195 HOH HOH A . 
N 7 HOH 164 1102 197 HOH HOH A . 
N 7 HOH 165 1103 198 HOH HOH A . 
N 7 HOH 166 1104 200 HOH HOH A . 
N 7 HOH 167 1105 201 HOH HOH A . 
N 7 HOH 168 1106 202 HOH HOH A . 
N 7 HOH 169 1107 203 HOH HOH A . 
N 7 HOH 170 1108 204 HOH HOH A . 
N 7 HOH 171 1109 205 HOH HOH A . 
N 7 HOH 172 1110 206 HOH HOH A . 
N 7 HOH 173 1111 207 HOH HOH A . 
N 7 HOH 174 1112 209 HOH HOH A . 
N 7 HOH 175 1113 210 HOH HOH A . 
N 7 HOH 176 1114 211 HOH HOH A . 
N 7 HOH 177 1115 212 HOH HOH A . 
N 7 HOH 178 1116 213 HOH HOH A . 
N 7 HOH 179 1117 214 HOH HOH A . 
N 7 HOH 180 1118 216 HOH HOH A . 
N 7 HOH 181 1119 217 HOH HOH A . 
N 7 HOH 182 1120 218 HOH HOH A . 
N 7 HOH 183 1121 219 HOH HOH A . 
N 7 HOH 184 1122 220 HOH HOH A . 
N 7 HOH 185 1123 221 HOH HOH A . 
N 7 HOH 186 1124 222 HOH HOH A . 
N 7 HOH 187 1125 223 HOH HOH A . 
N 7 HOH 188 1126 224 HOH HOH A . 
N 7 HOH 189 1127 226 HOH HOH A . 
N 7 HOH 190 1128 227 HOH HOH A . 
N 7 HOH 191 1129 228 HOH HOH A . 
N 7 HOH 192 1130 229 HOH HOH A . 
N 7 HOH 193 1131 230 HOH HOH A . 
N 7 HOH 194 1132 231 HOH HOH A . 
N 7 HOH 195 1133 232 HOH HOH A . 
N 7 HOH 196 1134 233 HOH HOH A . 
N 7 HOH 197 1135 234 HOH HOH A . 
N 7 HOH 198 1136 235 HOH HOH A . 
N 7 HOH 199 1137 236 HOH HOH A . 
N 7 HOH 200 1138 237 HOH HOH A . 
N 7 HOH 201 1139 238 HOH HOH A . 
N 7 HOH 202 1140 239 HOH HOH A . 
N 7 HOH 203 1141 241 HOH HOH A . 
N 7 HOH 204 1142 242 HOH HOH A . 
N 7 HOH 205 1143 243 HOH HOH A . 
N 7 HOH 206 1144 244 HOH HOH A . 
N 7 HOH 207 1145 245 HOH HOH A . 
N 7 HOH 208 1146 246 HOH HOH A . 
N 7 HOH 209 1147 247 HOH HOH A . 
N 7 HOH 210 1148 249 HOH HOH A . 
N 7 HOH 211 1149 252 HOH HOH A . 
N 7 HOH 212 1150 253 HOH HOH A . 
N 7 HOH 213 1151 254 HOH HOH A . 
N 7 HOH 214 1152 255 HOH HOH A . 
N 7 HOH 215 1153 257 HOH HOH A . 
N 7 HOH 216 1154 258 HOH HOH A . 
N 7 HOH 217 1155 260 HOH HOH A . 
N 7 HOH 218 1156 261 HOH HOH A . 
N 7 HOH 219 1157 262 HOH HOH A . 
N 7 HOH 220 1158 263 HOH HOH A . 
N 7 HOH 221 1159 264 HOH HOH A . 
N 7 HOH 222 1160 265 HOH HOH A . 
N 7 HOH 223 1161 266 HOH HOH A . 
N 7 HOH 224 1162 267 HOH HOH A . 
N 7 HOH 225 1163 268 HOH HOH A . 
N 7 HOH 226 1164 269 HOH HOH A . 
N 7 HOH 227 1165 270 HOH HOH A . 
N 7 HOH 228 1166 271 HOH HOH A . 
N 7 HOH 229 1167 272 HOH HOH A . 
N 7 HOH 230 1168 273 HOH HOH A . 
N 7 HOH 231 1169 274 HOH HOH A . 
N 7 HOH 232 1170 275 HOH HOH A . 
N 7 HOH 233 1171 276 HOH HOH A . 
N 7 HOH 234 1172 277 HOH HOH A . 
N 7 HOH 235 1173 278 HOH HOH A . 
N 7 HOH 236 1174 279 HOH HOH A . 
N 7 HOH 237 1175 280 HOH HOH A . 
N 7 HOH 238 1176 281 HOH HOH A . 
N 7 HOH 239 1177 282 HOH HOH A . 
N 7 HOH 240 1178 283 HOH HOH A . 
N 7 HOH 241 1179 284 HOH HOH A . 
N 7 HOH 242 1180 285 HOH HOH A . 
N 7 HOH 243 1181 287 HOH HOH A . 
N 7 HOH 244 1182 288 HOH HOH A . 
N 7 HOH 245 1183 290 HOH HOH A . 
N 7 HOH 246 1184 291 HOH HOH A . 
N 7 HOH 247 1185 292 HOH HOH A . 
N 7 HOH 248 1186 293 HOH HOH A . 
N 7 HOH 249 1187 294 HOH HOH A . 
N 7 HOH 250 1188 295 HOH HOH A . 
N 7 HOH 251 1189 296 HOH HOH A . 
N 7 HOH 252 1190 297 HOH HOH A . 
N 7 HOH 253 1191 298 HOH HOH A . 
N 7 HOH 254 1192 299 HOH HOH A . 
N 7 HOH 255 1193 300 HOH HOH A . 
N 7 HOH 256 1194 301 HOH HOH A . 
N 7 HOH 257 1195 302 HOH HOH A . 
N 7 HOH 258 1196 303 HOH HOH A . 
N 7 HOH 259 1197 304 HOH HOH A . 
N 7 HOH 260 1198 305 HOH HOH A . 
N 7 HOH 261 1199 306 HOH HOH A . 
N 7 HOH 262 1200 308 HOH HOH A . 
N 7 HOH 263 1201 309 HOH HOH A . 
N 7 HOH 264 1202 310 HOH HOH A . 
N 7 HOH 265 1203 311 HOH HOH A . 
N 7 HOH 266 1204 312 HOH HOH A . 
N 7 HOH 267 1205 313 HOH HOH A . 
N 7 HOH 268 1206 314 HOH HOH A . 
N 7 HOH 269 1207 315 HOH HOH A . 
N 7 HOH 270 1208 316 HOH HOH A . 
N 7 HOH 271 1209 318 HOH HOH A . 
N 7 HOH 272 1210 319 HOH HOH A . 
N 7 HOH 273 1211 321 HOH HOH A . 
N 7 HOH 274 1212 322 HOH HOH A . 
N 7 HOH 275 1213 323 HOH HOH A . 
N 7 HOH 276 1214 324 HOH HOH A . 
N 7 HOH 277 1215 325 HOH HOH A . 
N 7 HOH 278 1216 327 HOH HOH A . 
N 7 HOH 279 1217 328 HOH HOH A . 
N 7 HOH 280 1218 329 HOH HOH A . 
N 7 HOH 281 1219 330 HOH HOH A . 
N 7 HOH 282 1220 331 HOH HOH A . 
N 7 HOH 283 1221 332 HOH HOH A . 
N 7 HOH 284 1222 333 HOH HOH A . 
N 7 HOH 285 1223 334 HOH HOH A . 
N 7 HOH 286 1224 335 HOH HOH A . 
N 7 HOH 287 1225 336 HOH HOH A . 
N 7 HOH 288 1226 337 HOH HOH A . 
N 7 HOH 289 1227 338 HOH HOH A . 
N 7 HOH 290 1228 339 HOH HOH A . 
N 7 HOH 291 1229 340 HOH HOH A . 
N 7 HOH 292 1230 341 HOH HOH A . 
N 7 HOH 293 1231 342 HOH HOH A . 
N 7 HOH 294 1232 343 HOH HOH A . 
N 7 HOH 295 1233 344 HOH HOH A . 
N 7 HOH 296 1234 345 HOH HOH A . 
N 7 HOH 297 1235 346 HOH HOH A . 
N 7 HOH 298 1236 348 HOH HOH A . 
N 7 HOH 299 1237 349 HOH HOH A . 
N 7 HOH 300 1238 350 HOH HOH A . 
N 7 HOH 301 1239 351 HOH HOH A . 
N 7 HOH 302 1240 352 HOH HOH A . 
N 7 HOH 303 1241 354 HOH HOH A . 
N 7 HOH 304 1242 355 HOH HOH A . 
N 7 HOH 305 1243 357 HOH HOH A . 
N 7 HOH 306 1244 358 HOH HOH A . 
N 7 HOH 307 1245 361 HOH HOH A . 
N 7 HOH 308 1246 362 HOH HOH A . 
N 7 HOH 309 1247 363 HOH HOH A . 
N 7 HOH 310 1248 365 HOH HOH A . 
N 7 HOH 311 1249 366 HOH HOH A . 
N 7 HOH 312 1250 370 HOH HOH A . 
N 7 HOH 313 1251 371 HOH HOH A . 
N 7 HOH 314 1252 372 HOH HOH A . 
N 7 HOH 315 1253 373 HOH HOH A . 
N 7 HOH 316 1254 374 HOH HOH A . 
N 7 HOH 317 1255 375 HOH HOH A . 
N 7 HOH 318 1256 376 HOH HOH A . 
N 7 HOH 319 1257 377 HOH HOH A . 
N 7 HOH 320 1258 378 HOH HOH A . 
N 7 HOH 321 1259 379 HOH HOH A . 
N 7 HOH 322 1260 380 HOH HOH A . 
N 7 HOH 323 1261 381 HOH HOH A . 
N 7 HOH 324 1262 383 HOH HOH A . 
N 7 HOH 325 1263 384 HOH HOH A . 
N 7 HOH 326 1264 386 HOH HOH A . 
N 7 HOH 327 1265 388 HOH HOH A . 
N 7 HOH 328 1266 391 HOH HOH A . 
N 7 HOH 329 1267 392 HOH HOH A . 
N 7 HOH 330 1268 393 HOH HOH A . 
N 7 HOH 331 1269 395 HOH HOH A . 
N 7 HOH 332 1270 396 HOH HOH A . 
N 7 HOH 333 1271 397 HOH HOH A . 
N 7 HOH 334 1272 398 HOH HOH A . 
N 7 HOH 335 1273 399 HOH HOH A . 
N 7 HOH 336 1274 400 HOH HOH A . 
N 7 HOH 337 1275 401 HOH HOH A . 
N 7 HOH 338 1276 402 HOH HOH A . 
N 7 HOH 339 1277 403 HOH HOH A . 
N 7 HOH 340 1278 404 HOH HOH A . 
N 7 HOH 341 1279 405 HOH HOH A . 
N 7 HOH 342 1280 406 HOH HOH A . 
N 7 HOH 343 1281 407 HOH HOH A . 
N 7 HOH 344 1282 408 HOH HOH A . 
N 7 HOH 345 1283 409 HOH HOH A . 
N 7 HOH 346 1284 410 HOH HOH A . 
N 7 HOH 347 1285 411 HOH HOH A . 
N 7 HOH 348 1286 412 HOH HOH A . 
N 7 HOH 349 1287 413 HOH HOH A . 
N 7 HOH 350 1288 414 HOH HOH A . 
N 7 HOH 351 1289 415 HOH HOH A . 
N 7 HOH 352 1290 416 HOH HOH A . 
N 7 HOH 353 1291 417 HOH HOH A . 
N 7 HOH 354 1292 418 HOH HOH A . 
N 7 HOH 355 1293 419 HOH HOH A . 
N 7 HOH 356 1294 420 HOH HOH A . 
N 7 HOH 357 1295 421 HOH HOH A . 
N 7 HOH 358 1296 422 HOH HOH A . 
N 7 HOH 359 1297 423 HOH HOH A . 
N 7 HOH 360 1298 424 HOH HOH A . 
N 7 HOH 361 1299 425 HOH HOH A . 
N 7 HOH 362 1300 426 HOH HOH A . 
N 7 HOH 363 1301 427 HOH HOH A . 
N 7 HOH 364 1302 428 HOH HOH A . 
N 7 HOH 365 1303 429 HOH HOH A . 
N 7 HOH 366 1304 430 HOH HOH A . 
N 7 HOH 367 1305 431 HOH HOH A . 
N 7 HOH 368 1306 432 HOH HOH A . 
N 7 HOH 369 1307 433 HOH HOH A . 
N 7 HOH 370 1308 434 HOH HOH A . 
N 7 HOH 371 1309 435 HOH HOH A . 
N 7 HOH 372 1310 436 HOH HOH A . 
N 7 HOH 373 1311 437 HOH HOH A . 
N 7 HOH 374 1312 440 HOH HOH A . 
N 7 HOH 375 1313 441 HOH HOH A . 
N 7 HOH 376 1314 442 HOH HOH A . 
N 7 HOH 377 1315 443 HOH HOH A . 
N 7 HOH 378 1316 444 HOH HOH A . 
N 7 HOH 379 1317 445 HOH HOH A . 
N 7 HOH 380 1318 446 HOH HOH A . 
N 7 HOH 381 1319 447 HOH HOH A . 
N 7 HOH 382 1320 448 HOH HOH A . 
N 7 HOH 383 1321 449 HOH HOH A . 
N 7 HOH 384 1322 450 HOH HOH A . 
N 7 HOH 385 1323 451 HOH HOH A . 
N 7 HOH 386 1324 452 HOH HOH A . 
N 7 HOH 387 1325 453 HOH HOH A . 
N 7 HOH 388 1326 454 HOH HOH A . 
N 7 HOH 389 1327 455 HOH HOH A . 
N 7 HOH 390 1328 456 HOH HOH A . 
N 7 HOH 391 1329 457 HOH HOH A . 
N 7 HOH 392 1330 458 HOH HOH A . 
N 7 HOH 393 1331 459 HOH HOH A . 
N 7 HOH 394 1332 460 HOH HOH A . 
N 7 HOH 395 1333 465 HOH HOH A . 
N 7 HOH 396 1334 466 HOH HOH A . 
N 7 HOH 397 1335 468 HOH HOH A . 
N 7 HOH 398 1336 469 HOH HOH A . 
N 7 HOH 399 1337 470 HOH HOH A . 
N 7 HOH 400 1338 471 HOH HOH A . 
N 7 HOH 401 1339 472 HOH HOH A . 
N 7 HOH 402 1340 473 HOH HOH A . 
N 7 HOH 403 1341 474 HOH HOH A . 
N 7 HOH 404 1342 475 HOH HOH A . 
N 7 HOH 405 1343 476 HOH HOH A . 
N 7 HOH 406 1344 477 HOH HOH A . 
N 7 HOH 407 1345 478 HOH HOH A . 
N 7 HOH 408 1346 479 HOH HOH A . 
N 7 HOH 409 1347 480 HOH HOH A . 
N 7 HOH 410 1348 481 HOH HOH A . 
N 7 HOH 411 1349 482 HOH HOH A . 
N 7 HOH 412 1350 483 HOH HOH A . 
N 7 HOH 413 1351 484 HOH HOH A . 
N 7 HOH 414 1352 485 HOH HOH A . 
N 7 HOH 415 1353 486 HOH HOH A . 
N 7 HOH 416 1354 487 HOH HOH A . 
N 7 HOH 417 1355 488 HOH HOH A . 
N 7 HOH 418 1356 489 HOH HOH A . 
N 7 HOH 419 1357 490 HOH HOH A . 
N 7 HOH 420 1358 491 HOH HOH A . 
N 7 HOH 421 1359 493 HOH HOH A . 
N 7 HOH 422 1360 494 HOH HOH A . 
N 7 HOH 423 1361 495 HOH HOH A . 
N 7 HOH 424 1362 496 HOH HOH A . 
N 7 HOH 425 1363 497 HOH HOH A . 
N 7 HOH 426 1364 498 HOH HOH A . 
N 7 HOH 427 1365 499 HOH HOH A . 
N 7 HOH 428 1366 500 HOH HOH A . 
N 7 HOH 429 1367 501 HOH HOH A . 
N 7 HOH 430 1368 502 HOH HOH A . 
N 7 HOH 431 1369 503 HOH HOH A . 
N 7 HOH 432 1370 504 HOH HOH A . 
N 7 HOH 433 1371 505 HOH HOH A . 
N 7 HOH 434 1372 506 HOH HOH A . 
N 7 HOH 435 1373 507 HOH HOH A . 
N 7 HOH 436 1374 508 HOH HOH A . 
N 7 HOH 437 1375 509 HOH HOH A . 
N 7 HOH 438 1376 510 HOH HOH A . 
N 7 HOH 439 1377 511 HOH HOH A . 
N 7 HOH 440 1378 512 HOH HOH A . 
N 7 HOH 441 1379 513 HOH HOH A . 
N 7 HOH 442 1380 514 HOH HOH A . 
N 7 HOH 443 1381 515 HOH HOH A . 
N 7 HOH 444 1382 516 HOH HOH A . 
N 7 HOH 445 1383 517 HOH HOH A . 
N 7 HOH 446 1384 518 HOH HOH A . 
N 7 HOH 447 1385 519 HOH HOH A . 
N 7 HOH 448 1386 521 HOH HOH A . 
N 7 HOH 449 1387 524 HOH HOH A . 
N 7 HOH 450 1388 530 HOH HOH A . 
N 7 HOH 451 1389 531 HOH HOH A . 
N 7 HOH 452 1390 532 HOH HOH A . 
N 7 HOH 453 1391 533 HOH HOH A . 
N 7 HOH 454 1392 534 HOH HOH A . 
N 7 HOH 455 1393 535 HOH HOH A . 
N 7 HOH 456 1394 536 HOH HOH A . 
N 7 HOH 457 1395 537 HOH HOH A . 
N 7 HOH 458 1396 538 HOH HOH A . 
N 7 HOH 459 1397 539 HOH HOH A . 
N 7 HOH 460 1398 541 HOH HOH A . 
N 7 HOH 461 1399 542 HOH HOH A . 
N 7 HOH 462 1400 548 HOH HOH A . 
N 7 HOH 463 1401 549 HOH HOH A . 
N 7 HOH 464 1402 550 HOH HOH A . 
N 7 HOH 465 1403 554 HOH HOH A . 
N 7 HOH 466 1404 555 HOH HOH A . 
N 7 HOH 467 1405 556 HOH HOH A . 
N 7 HOH 468 1406 557 HOH HOH A . 
N 7 HOH 469 1407 558 HOH HOH A . 
#