data_3IE7
# 
_entry.id   3IE7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.338 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3IE7         
RCSB  RCSB054300   
WWPDB D_1000054300 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      3HIC           'THE CRYSTAL STRUCTURE OF PHOSPHOFRUCTOKINASE(Lin2199)FROM Listeria innocua'           unspecified 
PDB      3H49           'Crystal structure of a putative Ribokinase (Apo Form) from E.coli at 1.8A resolution' unspecified 
PDB      3I3Y           'Crystal structure of Ribokinase in Complex with D-Ribose from Klebsiella pneumoniae'  unspecified 
TargetDB NYSGXRC-11206n .                                                                                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3IE7 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Satyanarayana, L.'                                              1 ?                   
'Burley, S.K.'                                                   2 0000-0002-2487-9713 
'Swaminathan, S.'                                                3 ?                   
'New York SGX Research Center for Structural Genomics (NYSGXRC)' 4 ?                   
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of phosphofructokinase (lin2199) from Listeria innocua in complex with ATP at 1.6A' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Satyanarayana, L.' 1 ?                   
primary 'Burley, S.K.'      2 0000-0002-2487-9713 
primary 'Swaminathan, S.'   3 ?                   
# 
_cell.entry_id           3IE7 
_cell.length_a           146.108 
_cell.length_b           46.244 
_cell.length_c           57.762 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.08 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3IE7 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lin2199 protein'           35338.305 1   2.7.1.- ? ? ? 
2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181   1   ?       ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'             24.305    3   ?       ? ? ? 
4 non-polymer syn GLYCEROL                    92.094    1   ?       ? ? ? 
5 water       nat water                       18.015    272 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)SLIYTITLNPAIDRLLFIRGELEKRKTNRVIKTEFDCGGKGLHVSGVLSKFGIKNEALGIAGSDNLDKLYAILKE
KHINHDFLVEAGTSTRECFVVLSDDTNGST(MSE)IPEAGFTVSQTNKDNLLKQIAKKVKKED(MSE)VVIAGSPPPHYT
LSDFKELLRTVKATGAFLGCDNSGEYLNLAVE(MSE)GVDFIKPNEDEVIAILDEKTNSLEENIRTLAEKIPYLVVSLGA
KGSICAHNGKLYQVIPPKVQERNDTGAGDVFVGAFIAGLA(MSE)N(MSE)PITETLKVATGCSASKV(MSE)QQDSSSF
DLEAAGKLKNQVSIIQLEEREGHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSLIYTITLNPAIDRLLFIRGELEKRKTNRVIKTEFDCGGKGLHVSGVLSKFGIKNEALGIAGSDNLDKLYAILKEKHIN
HDFLVEAGTSTRECFVVLSDDTNGSTMIPEAGFTVSQTNKDNLLKQIAKKVKKEDMVVIAGSPPPHYTLSDFKELLRTVK
ATGAFLGCDNSGEYLNLAVEMGVDFIKPNEDEVIAILDEKTNSLEENIRTLAEKIPYLVVSLGAKGSICAHNGKLYQVIP
PKVQERNDTGAGDVFVGAFIAGLAMNMPITETLKVATGCSASKVMQQDSSSFDLEAAGKLKNQVSIIQLEEREGHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         NYSGXRC-11206n 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   SER n 
1 3   LEU n 
1 4   ILE n 
1 5   TYR n 
1 6   THR n 
1 7   ILE n 
1 8   THR n 
1 9   LEU n 
1 10  ASN n 
1 11  PRO n 
1 12  ALA n 
1 13  ILE n 
1 14  ASP n 
1 15  ARG n 
1 16  LEU n 
1 17  LEU n 
1 18  PHE n 
1 19  ILE n 
1 20  ARG n 
1 21  GLY n 
1 22  GLU n 
1 23  LEU n 
1 24  GLU n 
1 25  LYS n 
1 26  ARG n 
1 27  LYS n 
1 28  THR n 
1 29  ASN n 
1 30  ARG n 
1 31  VAL n 
1 32  ILE n 
1 33  LYS n 
1 34  THR n 
1 35  GLU n 
1 36  PHE n 
1 37  ASP n 
1 38  CYS n 
1 39  GLY n 
1 40  GLY n 
1 41  LYS n 
1 42  GLY n 
1 43  LEU n 
1 44  HIS n 
1 45  VAL n 
1 46  SER n 
1 47  GLY n 
1 48  VAL n 
1 49  LEU n 
1 50  SER n 
1 51  LYS n 
1 52  PHE n 
1 53  GLY n 
1 54  ILE n 
1 55  LYS n 
1 56  ASN n 
1 57  GLU n 
1 58  ALA n 
1 59  LEU n 
1 60  GLY n 
1 61  ILE n 
1 62  ALA n 
1 63  GLY n 
1 64  SER n 
1 65  ASP n 
1 66  ASN n 
1 67  LEU n 
1 68  ASP n 
1 69  LYS n 
1 70  LEU n 
1 71  TYR n 
1 72  ALA n 
1 73  ILE n 
1 74  LEU n 
1 75  LYS n 
1 76  GLU n 
1 77  LYS n 
1 78  HIS n 
1 79  ILE n 
1 80  ASN n 
1 81  HIS n 
1 82  ASP n 
1 83  PHE n 
1 84  LEU n 
1 85  VAL n 
1 86  GLU n 
1 87  ALA n 
1 88  GLY n 
1 89  THR n 
1 90  SER n 
1 91  THR n 
1 92  ARG n 
1 93  GLU n 
1 94  CYS n 
1 95  PHE n 
1 96  VAL n 
1 97  VAL n 
1 98  LEU n 
1 99  SER n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 ASN n 
1 104 GLY n 
1 105 SER n 
1 106 THR n 
1 107 MSE n 
1 108 ILE n 
1 109 PRO n 
1 110 GLU n 
1 111 ALA n 
1 112 GLY n 
1 113 PHE n 
1 114 THR n 
1 115 VAL n 
1 116 SER n 
1 117 GLN n 
1 118 THR n 
1 119 ASN n 
1 120 LYS n 
1 121 ASP n 
1 122 ASN n 
1 123 LEU n 
1 124 LEU n 
1 125 LYS n 
1 126 GLN n 
1 127 ILE n 
1 128 ALA n 
1 129 LYS n 
1 130 LYS n 
1 131 VAL n 
1 132 LYS n 
1 133 LYS n 
1 134 GLU n 
1 135 ASP n 
1 136 MSE n 
1 137 VAL n 
1 138 VAL n 
1 139 ILE n 
1 140 ALA n 
1 141 GLY n 
1 142 SER n 
1 143 PRO n 
1 144 PRO n 
1 145 PRO n 
1 146 HIS n 
1 147 TYR n 
1 148 THR n 
1 149 LEU n 
1 150 SER n 
1 151 ASP n 
1 152 PHE n 
1 153 LYS n 
1 154 GLU n 
1 155 LEU n 
1 156 LEU n 
1 157 ARG n 
1 158 THR n 
1 159 VAL n 
1 160 LYS n 
1 161 ALA n 
1 162 THR n 
1 163 GLY n 
1 164 ALA n 
1 165 PHE n 
1 166 LEU n 
1 167 GLY n 
1 168 CYS n 
1 169 ASP n 
1 170 ASN n 
1 171 SER n 
1 172 GLY n 
1 173 GLU n 
1 174 TYR n 
1 175 LEU n 
1 176 ASN n 
1 177 LEU n 
1 178 ALA n 
1 179 VAL n 
1 180 GLU n 
1 181 MSE n 
1 182 GLY n 
1 183 VAL n 
1 184 ASP n 
1 185 PHE n 
1 186 ILE n 
1 187 LYS n 
1 188 PRO n 
1 189 ASN n 
1 190 GLU n 
1 191 ASP n 
1 192 GLU n 
1 193 VAL n 
1 194 ILE n 
1 195 ALA n 
1 196 ILE n 
1 197 LEU n 
1 198 ASP n 
1 199 GLU n 
1 200 LYS n 
1 201 THR n 
1 202 ASN n 
1 203 SER n 
1 204 LEU n 
1 205 GLU n 
1 206 GLU n 
1 207 ASN n 
1 208 ILE n 
1 209 ARG n 
1 210 THR n 
1 211 LEU n 
1 212 ALA n 
1 213 GLU n 
1 214 LYS n 
1 215 ILE n 
1 216 PRO n 
1 217 TYR n 
1 218 LEU n 
1 219 VAL n 
1 220 VAL n 
1 221 SER n 
1 222 LEU n 
1 223 GLY n 
1 224 ALA n 
1 225 LYS n 
1 226 GLY n 
1 227 SER n 
1 228 ILE n 
1 229 CYS n 
1 230 ALA n 
1 231 HIS n 
1 232 ASN n 
1 233 GLY n 
1 234 LYS n 
1 235 LEU n 
1 236 TYR n 
1 237 GLN n 
1 238 VAL n 
1 239 ILE n 
1 240 PRO n 
1 241 PRO n 
1 242 LYS n 
1 243 VAL n 
1 244 GLN n 
1 245 GLU n 
1 246 ARG n 
1 247 ASN n 
1 248 ASP n 
1 249 THR n 
1 250 GLY n 
1 251 ALA n 
1 252 GLY n 
1 253 ASP n 
1 254 VAL n 
1 255 PHE n 
1 256 VAL n 
1 257 GLY n 
1 258 ALA n 
1 259 PHE n 
1 260 ILE n 
1 261 ALA n 
1 262 GLY n 
1 263 LEU n 
1 264 ALA n 
1 265 MSE n 
1 266 ASN n 
1 267 MSE n 
1 268 PRO n 
1 269 ILE n 
1 270 THR n 
1 271 GLU n 
1 272 THR n 
1 273 LEU n 
1 274 LYS n 
1 275 VAL n 
1 276 ALA n 
1 277 THR n 
1 278 GLY n 
1 279 CYS n 
1 280 SER n 
1 281 ALA n 
1 282 SER n 
1 283 LYS n 
1 284 VAL n 
1 285 MSE n 
1 286 GLN n 
1 287 GLN n 
1 288 ASP n 
1 289 SER n 
1 290 SER n 
1 291 SER n 
1 292 PHE n 
1 293 ASP n 
1 294 LEU n 
1 295 GLU n 
1 296 ALA n 
1 297 ALA n 
1 298 GLY n 
1 299 LYS n 
1 300 LEU n 
1 301 LYS n 
1 302 ASN n 
1 303 GLN n 
1 304 VAL n 
1 305 SER n 
1 306 ILE n 
1 307 ILE n 
1 308 GLN n 
1 309 LEU n 
1 310 GLU n 
1 311 GLU n 
1 312 ARG n 
1 313 GLU n 
1 314 GLY n 
1 315 HIS n 
1 316 HIS n 
1 317 HIS n 
1 318 HIS n 
1 319 HIS n 
1 320 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 lin2199 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'TOP10 Invitrogen' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Listeria innocua' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1642 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) CODON + RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               'BC-pSGX3 (BC)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSGX3 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q929S5_LISIN 
_struct_ref.pdbx_db_accession          Q929S5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;IYTITLNPAIDRLLFIRGELEKRKTNRVIKTEFDCGGKGLHVSGVLSKFGIKNEALGIAGSDNLDKLYAILKEKHINHDF
LVEAGTSTRECFVVLSDDTNGSTMIPEAGFTVSQTNKDNLLKQIAKKVKKEDMVVIAGSPPPHYTLSDFKELLRTVKATG
AFLGCDNSGEYLNLAVEMGVDFIKPNEDEVIAILDEKTNSLEENIRTLAEKIPYLVVSLGAKGSICAHNGKLYQVIPPKV
QERNDTGAGDVFVGAFIAGLAMNMPITETLKVATGCSASKVMQQDSSSFDLEAAGKLKNQVSIIQLEER
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3IE7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 312 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q929S5 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  310 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       310 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3IE7 MSE A 1   ? UNP Q929S5 ? ? insertion -3  1  
1 3IE7 SER A 2   ? UNP Q929S5 ? ? insertion -2  2  
1 3IE7 LEU A 3   ? UNP Q929S5 ? ? insertion -1  3  
1 3IE7 GLU A 313 ? UNP Q929S5 ? ? insertion 311 4  
1 3IE7 GLY A 314 ? UNP Q929S5 ? ? insertion 312 5  
1 3IE7 HIS A 315 ? UNP Q929S5 ? ? insertion 313 6  
1 3IE7 HIS A 316 ? UNP Q929S5 ? ? insertion 314 7  
1 3IE7 HIS A 317 ? UNP Q929S5 ? ? insertion 315 8  
1 3IE7 HIS A 318 ? UNP Q929S5 ? ? insertion 316 9  
1 3IE7 HIS A 319 ? UNP Q929S5 ? ? insertion 317 10 
1 3IE7 HIS A 320 ? UNP Q929S5 ? ? insertion 318 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                               'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ?                               'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ?                               'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                    'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                   ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ?                               'C6 H15 N2 O2 1'    147.195 
MG  non-polymer         . 'MAGNESIUM ION'             ?                               'Mg 2'              24.305  
MSE 'L-peptide linking' n SELENOMETHIONINE            ?                               'C5 H11 N O2 Se'    196.106 
PHE 'L-peptide linking' y PHENYLALANINE               ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ?                               'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                    ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3IE7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   54.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.2M MgCl2,10mMATP,0.1M Hepes 7.5, 20% PEG 3350%, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-07-16 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             0.9792 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3IE7 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.600 
_reflns.number_obs                   48696 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06800 
_reflns.pdbx_netI_over_sigmaI        15.3000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.900 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   78.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.41300 
_reflns_shell.meanI_over_sigI_obs    8.700 
_reflns_shell.pdbx_redundancy        5.50 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3IE7 
_refine.ls_number_reflns_obs                     46781 
_refine.ls_number_reflns_all                     46781 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.85 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    93.7 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1883 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               26.80 
_refine.aniso_B[1][1]                            -3.19000 
_refine.aniso_B[2][2]                            8.99000 
_refine.aniso_B[3][3]                            -5.80000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.79000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3HIC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3IE7 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.23 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2352 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             272 
_refine_hist.number_atoms_total               2664 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        35.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.30  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.90 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.60 
_refine_ls_shell.d_res_low                        1.70 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2970 
_refine_ls_shell.percent_reflns_obs               78.00 
_refine_ls_shell.R_factor_R_free                  0.3240 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             250 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 protein_rep.param ? 
'X-RAY DIFFRACTION' 2 water_rep.param   ? 
'X-RAY DIFFRACTION' 3 ion.param         ? 
'X-RAY DIFFRACTION' 4 ATP.par           ? 
'X-RAY DIFFRACTION' 5 glycerol.param    ? 
# 
_struct.entry_id                  3IE7 
_struct.title                     
'The crystal structure of phosphofructokinase (lin2199) from Listeria innocua in complex with ATP at 1.6A' 
_struct.pdbx_descriptor           'Lin2199 protein (E.C.2.7.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3IE7 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;Phosphofructokinases, Transferase, Listeria innocua, Glycerol, Mg+2 ion, 11206n1, PSI-II, NYSGXRC, Kinase, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 40  ? GLY A 53  ? GLY A 38  GLY A 51  1 ? 14 
HELX_P HELX_P2  2  ASN A 66  ? LYS A 77  ? ASN A 64  LYS A 75  1 ? 12 
HELX_P HELX_P3  3  SER A 116 ? VAL A 131 ? SER A 114 VAL A 129 1 ? 16 
HELX_P HELX_P4  4  THR A 148 ? GLY A 163 ? THR A 146 GLY A 161 1 ? 16 
HELX_P HELX_P5  5  SER A 171 ? GLY A 182 ? SER A 169 GLY A 180 1 ? 12 
HELX_P HELX_P6  6  ASP A 191 ? LEU A 197 ? ASP A 189 LEU A 195 5 ? 7  
HELX_P HELX_P7  7  SER A 203 ? ALA A 212 ? SER A 201 ALA A 210 1 ? 10 
HELX_P HELX_P8  8  GLY A 223 ? LYS A 225 ? GLY A 221 LYS A 223 5 ? 3  
HELX_P HELX_P9  9  GLY A 250 ? MSE A 265 ? GLY A 248 MSE A 263 1 ? 16 
HELX_P HELX_P10 10 PRO A 268 ? MSE A 285 ? PRO A 266 MSE A 283 1 ? 18 
HELX_P HELX_P11 11 ASP A 293 ? LYS A 301 ? ASP A 291 LYS A 299 1 ? 9  
HELX_P HELX_P12 12 ASN A 302 ? VAL A 304 ? ASN A 300 VAL A 302 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A THR 106 C  ? ? ? 1_555 A MSE 107 N   ? ? A THR 104 A MSE 105 1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale2  covale both ? A MSE 107 C  ? ? ? 1_555 A ILE 108 N   ? ? A MSE 105 A ILE 106 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale3  covale both ? A ASP 135 C  ? ? ? 1_555 A MSE 136 N   ? ? A ASP 133 A MSE 134 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale4  covale both ? A MSE 136 C  ? ? ? 1_555 A VAL 137 N   ? ? A MSE 134 A VAL 135 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale5  covale both ? A GLU 180 C  ? ? ? 1_555 A MSE 181 N   ? ? A GLU 178 A MSE 179 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale6  covale both ? A MSE 181 C  ? ? ? 1_555 A GLY 182 N   ? ? A MSE 179 A GLY 180 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale7  covale both ? A ALA 264 C  ? ? ? 1_555 A MSE 265 N   ? ? A ALA 262 A MSE 263 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale8  covale both ? A MSE 265 C  ? ? ? 1_555 A ASN 266 N   ? ? A MSE 263 A ASN 264 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale9  covale both ? A ASN 266 C  ? ? ? 1_555 A MSE 267 N   ? ? A ASN 264 A MSE 265 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale10 covale both ? A MSE 267 C  ? ? ? 1_555 A PRO 268 N   ? ? A MSE 265 A PRO 266 1_555 ? ? ? ? ? ? ? 1.343 ? ? 
covale11 covale both ? A VAL 284 C  ? ? ? 1_555 A MSE 285 N   ? ? A VAL 282 A MSE 283 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale12 covale both ? A MSE 285 C  ? ? ? 1_555 A GLN 286 N   ? ? A MSE 283 A GLN 284 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
metalc1  metalc ?    ? C MG  .   MG ? ? ? 1_555 G HOH .   O   ? ? A MG  1   A HOH 504 1_555 ? ? ? ? ? ? ? 2.089 ? ? 
metalc2  metalc ?    ? C MG  .   MG ? ? ? 1_555 G HOH .   O   ? ? A MG  1   A HOH 505 1_555 ? ? ? ? ? ? ? 2.119 ? ? 
metalc3  metalc ?    ? C MG  .   MG ? ? ? 1_555 B ATP .   O1B ? ? A MG  1   A ATP 900 1_555 ? ? ? ? ? ? ? 2.144 ? ? 
metalc4  metalc ?    ? C MG  .   MG ? ? ? 1_555 B ATP .   O1A ? ? A MG  1   A ATP 900 1_555 ? ? ? ? ? ? ? 2.241 ? ? 
metalc5  metalc ?    ? D MG  .   MG ? ? ? 1_555 G HOH .   O   ? ? A MG  319 A HOH 380 1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc6  metalc ?    ? D MG  .   MG ? ? ? 1_555 G HOH .   O   ? ? A MG  319 A HOH 500 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc7  metalc ?    ? D MG  .   MG ? ? ? 1_555 G HOH .   O   ? ? A MG  319 A HOH 502 1_555 ? ? ? ? ? ? ? 2.048 ? ? 
metalc8  metalc ?    ? D MG  .   MG ? ? ? 1_555 G HOH .   O   ? ? A MG  319 A HOH 503 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc9  metalc ?    ? D MG  .   MG ? ? ? 1_555 B ATP .   O1G ? ? A MG  319 A ATP 900 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc10 metalc ?    ? D MG  .   MG ? ? ? 1_555 B ATP .   O2B ? ? A MG  319 A ATP 900 1_555 ? ? ? ? ? ? ? 2.084 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? parallel      
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
B 1 2  ? anti-parallel 
B 2 3  ? parallel      
B 3 4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 84  ? GLU A 86  ? LEU A 82  GLU A 84  
A 2  ASN A 56  ? GLY A 63  ? ASN A 54  GLY A 61  
A 3  ILE A 4   ? THR A 8   ? ILE A 2   THR A 6   
A 4  MSE A 136 ? ALA A 140 ? MSE A 134 ALA A 138 
A 5  PHE A 165 ? ASP A 169 ? PHE A 163 ASP A 167 
A 6  PHE A 185 ? ILE A 186 ? PHE A 183 ILE A 184 
A 7  TYR A 217 ? SER A 221 ? TYR A 215 SER A 219 
A 8  SER A 227 ? HIS A 231 ? SER A 225 HIS A 229 
A 9  LYS A 234 ? ILE A 239 ? LYS A 232 ILE A 237 
A 10 SER A 305 ? GLN A 308 ? SER A 303 GLN A 306 
B 1  LYS A 33  ? GLY A 39  ? LYS A 31  GLY A 37  
B 2  ALA A 12  ? ILE A 19  ? ALA A 10  ILE A 17  
B 3  ARG A 92  ? SER A 99  ? ARG A 90  SER A 97  
B 4  THR A 106 ? PRO A 109 ? THR A 104 PRO A 107 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O LEU A 84  ? O LEU A 82  N GLY A 60  ? N GLY A 58  
A 2 3  O LEU A 59  ? O LEU A 57  N THR A 6   ? N THR A 4   
A 3 4  N TYR A 5   ? N TYR A 3   O VAL A 138 ? O VAL A 136 
A 4 5  N VAL A 137 ? N VAL A 135 O GLY A 167 ? O GLY A 165 
A 5 6  N CYS A 168 ? N CYS A 166 O PHE A 185 ? O PHE A 183 
A 6 7  N ILE A 186 ? N ILE A 184 O VAL A 219 ? O VAL A 217 
A 7 8  N LEU A 218 ? N LEU A 216 O ALA A 230 ? O ALA A 228 
A 8 9  N SER A 227 ? N SER A 225 O VAL A 238 ? O VAL A 236 
A 9 10 N GLN A 237 ? N GLN A 235 O ILE A 307 ? O ILE A 305 
B 1 2  O GLY A 39  ? O GLY A 37  N ALA A 12  ? N ALA A 10  
B 2 3  N LEU A 17  ? N LEU A 15  O VAL A 96  ? O VAL A 94  
B 3 4  N PHE A 95  ? N PHE A 93  O ILE A 108 ? O ILE A 106 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ATP 900 ? 26 'BINDING SITE FOR RESIDUE ATP A 900' 
AC2 Software A MG  1   ? 3  'BINDING SITE FOR RESIDUE MG A 1'    
AC3 Software A MG  319 ? 5  'BINDING SITE FOR RESIDUE MG A 319'  
AC4 Software A MG  320 ? 4  'BINDING SITE FOR RESIDUE MG A 320'  
AC5 Software A GOL 501 ? 8  'BINDING SITE FOR RESIDUE GOL A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 26 MG  C .   ? MG  A 1   . ? 1_555 ? 
2  AC1 26 LYS A 187 ? LYS A 185 . ? 1_555 ? 
3  AC1 26 ASN A 189 ? ASN A 187 . ? 1_555 ? 
4  AC1 26 SER A 221 ? SER A 219 . ? 1_555 ? 
5  AC1 26 GLY A 223 ? GLY A 221 . ? 1_555 ? 
6  AC1 26 ALA A 224 ? ALA A 222 . ? 1_555 ? 
7  AC1 26 GLY A 226 ? GLY A 224 . ? 1_555 ? 
8  AC1 26 GLU A 245 ? GLU A 243 . ? 1_555 ? 
9  AC1 26 GLY A 250 ? GLY A 248 . ? 1_555 ? 
10 AC1 26 ALA A 251 ? ALA A 249 . ? 1_555 ? 
11 AC1 26 GLY A 252 ? GLY A 250 . ? 1_555 ? 
12 AC1 26 ASP A 253 ? ASP A 251 . ? 1_555 ? 
13 AC1 26 SER A 280 ? SER A 278 . ? 1_555 ? 
14 AC1 26 VAL A 284 ? VAL A 282 . ? 1_555 ? 
15 AC1 26 MG  D .   ? MG  A 319 . ? 1_555 ? 
16 AC1 26 HOH G .   ? HOH A 337 . ? 1_555 ? 
17 AC1 26 HOH G .   ? HOH A 350 . ? 1_555 ? 
18 AC1 26 HOH G .   ? HOH A 360 . ? 1_555 ? 
19 AC1 26 HOH G .   ? HOH A 378 . ? 1_555 ? 
20 AC1 26 HOH G .   ? HOH A 407 . ? 1_555 ? 
21 AC1 26 HOH G .   ? HOH A 477 . ? 1_555 ? 
22 AC1 26 HOH G .   ? HOH A 500 . ? 1_555 ? 
23 AC1 26 HOH G .   ? HOH A 503 . ? 1_555 ? 
24 AC1 26 HOH G .   ? HOH A 504 . ? 1_555 ? 
25 AC1 26 HOH G .   ? HOH A 505 . ? 1_555 ? 
26 AC1 26 HOH G .   ? HOH A 587 . ? 1_555 ? 
27 AC2 3  HOH G .   ? HOH A 504 . ? 1_555 ? 
28 AC2 3  HOH G .   ? HOH A 505 . ? 1_555 ? 
29 AC2 3  ATP B .   ? ATP A 900 . ? 1_555 ? 
30 AC3 5  HOH G .   ? HOH A 380 . ? 1_555 ? 
31 AC3 5  HOH G .   ? HOH A 500 . ? 1_555 ? 
32 AC3 5  HOH G .   ? HOH A 502 . ? 1_555 ? 
33 AC3 5  HOH G .   ? HOH A 503 . ? 1_555 ? 
34 AC3 5  ATP B .   ? ATP A 900 . ? 1_555 ? 
35 AC4 4  GLY A 40  ? GLY A 38  . ? 1_555 ? 
36 AC4 4  LYS A 41  ? LYS A 39  . ? 1_555 ? 
37 AC4 4  GLY A 141 ? GLY A 139 . ? 1_555 ? 
38 AC4 4  GOL F .   ? GOL A 501 . ? 1_555 ? 
39 AC5 8  ASP A 14  ? ASP A 12  . ? 1_555 ? 
40 AC5 8  GLY A 39  ? GLY A 37  . ? 1_555 ? 
41 AC5 8  GLY A 40  ? GLY A 38  . ? 1_555 ? 
42 AC5 8  LYS A 41  ? LYS A 39  . ? 1_555 ? 
43 AC5 8  HIS A 44  ? HIS A 42  . ? 1_555 ? 
44 AC5 8  MSE A 107 ? MSE A 105 . ? 1_555 ? 
45 AC5 8  SER A 289 ? SER A 287 . ? 1_555 ? 
46 AC5 8  MG  E .   ? MG  A 320 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3IE7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3IE7 
_atom_sites.fract_transf_matrix[1][1]   0.006844 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001465 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021624 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017704 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 2   ? 35.086  -15.441 10.456  1.00 32.36 ? -2  SER A N     1 
ATOM   2    C  CA    . SER A 1 2   ? 34.271  -14.336 11.036  1.00 30.64 ? -2  SER A CA    1 
ATOM   3    C  C     . SER A 1 2   ? 33.141  -13.986 10.081  1.00 28.37 ? -2  SER A C     1 
ATOM   4    O  O     . SER A 1 2   ? 33.188  -14.317 8.898   1.00 28.25 ? -2  SER A O     1 
ATOM   5    C  CB    . SER A 1 2   ? 35.145  -13.107 11.279  1.00 33.65 ? -2  SER A CB    1 
ATOM   6    O  OG    . SER A 1 2   ? 35.665  -12.611 10.059  1.00 39.67 ? -2  SER A OG    1 
ATOM   7    N  N     . LEU A 1 3   ? 32.127  -13.308 10.600  1.00 24.06 ? -1  LEU A N     1 
ATOM   8    C  CA    . LEU A 1 3   ? 30.973  -12.939 9.803   1.00 23.64 ? -1  LEU A CA    1 
ATOM   9    C  C     . LEU A 1 3   ? 30.300  -11.724 10.416  1.00 18.79 ? -1  LEU A C     1 
ATOM   10   O  O     . LEU A 1 3   ? 30.539  -11.388 11.578  1.00 17.57 ? -1  LEU A O     1 
ATOM   11   C  CB    . LEU A 1 3   ? 29.978  -14.109 9.768   1.00 28.20 ? -1  LEU A CB    1 
ATOM   12   C  CG    . LEU A 1 3   ? 28.551  -13.846 9.278   1.00 33.35 ? -1  LEU A CG    1 
ATOM   13   C  CD1   . LEU A 1 3   ? 28.609  -13.502 7.827   1.00 35.31 ? -1  LEU A CD1   1 
ATOM   14   C  CD2   . LEU A 1 3   ? 27.655  -15.055 9.476   1.00 34.10 ? -1  LEU A CD2   1 
ATOM   15   N  N     . ILE A 1 4   ? 29.469  -11.062 9.621   1.00 16.78 ? 2   ILE A N     1 
ATOM   16   C  CA    . ILE A 1 4   ? 28.726  -9.906  10.100  1.00 15.22 ? 2   ILE A CA    1 
ATOM   17   C  C     . ILE A 1 4   ? 27.255  -10.279 10.198  1.00 15.33 ? 2   ILE A C     1 
ATOM   18   O  O     . ILE A 1 4   ? 26.677  -10.831 9.255   1.00 16.10 ? 2   ILE A O     1 
ATOM   19   C  CB    . ILE A 1 4   ? 28.837  -8.704  9.142   1.00 14.84 ? 2   ILE A CB    1 
ATOM   20   C  CG1   . ILE A 1 4   ? 30.300  -8.296  8.975   1.00 15.70 ? 2   ILE A CG1   1 
ATOM   21   C  CG2   . ILE A 1 4   ? 28.022  -7.528  9.694   1.00 15.69 ? 2   ILE A CG2   1 
ATOM   22   C  CD1   . ILE A 1 4   ? 30.541  -7.394  7.772   1.00 16.76 ? 2   ILE A CD1   1 
ATOM   23   N  N     . TYR A 1 5   ? 26.654  -9.974  11.341  1.00 13.77 ? 3   TYR A N     1 
ATOM   24   C  CA    . TYR A 1 5   ? 25.242  -10.245 11.556  1.00 15.83 ? 3   TYR A CA    1 
ATOM   25   C  C     . TYR A 1 5   ? 24.515  -8.921  11.702  1.00 16.66 ? 3   TYR A C     1 
ATOM   26   O  O     . TYR A 1 5   ? 25.027  -7.994  12.331  1.00 16.87 ? 3   TYR A O     1 
ATOM   27   C  CB    . TYR A 1 5   ? 25.037  -11.035 12.846  1.00 16.02 ? 3   TYR A CB    1 
ATOM   28   C  CG    . TYR A 1 5   ? 25.550  -12.453 12.806  1.00 17.12 ? 3   TYR A CG    1 
ATOM   29   C  CD1   . TYR A 1 5   ? 24.772  -13.481 12.275  1.00 19.52 ? 3   TYR A CD1   1 
ATOM   30   C  CD2   . TYR A 1 5   ? 26.819  -12.763 13.283  1.00 17.98 ? 3   TYR A CD2   1 
ATOM   31   C  CE1   . TYR A 1 5   ? 25.253  -14.784 12.218  1.00 20.97 ? 3   TYR A CE1   1 
ATOM   32   C  CE2   . TYR A 1 5   ? 27.309  -14.062 13.230  1.00 18.91 ? 3   TYR A CE2   1 
ATOM   33   C  CZ    . TYR A 1 5   ? 26.519  -15.065 12.694  1.00 20.72 ? 3   TYR A CZ    1 
ATOM   34   O  OH    . TYR A 1 5   ? 27.004  -16.350 12.615  1.00 22.77 ? 3   TYR A OH    1 
ATOM   35   N  N     . THR A 1 6   ? 23.336  -8.820  11.105  1.00 15.93 ? 4   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 22.532  -7.620  11.277  1.00 15.66 ? 4   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 21.310  -8.101  12.036  1.00 16.26 ? 4   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 20.894  -9.254  11.898  1.00 15.92 ? 4   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 22.067  -6.992  9.950   1.00 16.74 ? 4   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 21.280  -7.937  9.219   1.00 17.14 ? 4   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 23.258  -6.562  9.119   1.00 16.91 ? 4   THR A CG2   1 
ATOM   42   N  N     . ILE A 1 7   ? 20.752  -7.227  12.859  1.00 15.42 ? 5   ILE A N     1 
ATOM   43   C  CA    . ILE A 1 7   ? 19.567  -7.576  13.625  1.00 16.84 ? 5   ILE A CA    1 
ATOM   44   C  C     . ILE A 1 7   ? 18.479  -6.566  13.310  1.00 16.89 ? 5   ILE A C     1 
ATOM   45   O  O     . ILE A 1 7   ? 18.638  -5.370  13.549  1.00 16.72 ? 5   ILE A O     1 
ATOM   46   C  CB    . ILE A 1 7   ? 19.853  -7.581  15.144  1.00 17.58 ? 5   ILE A CB    1 
ATOM   47   C  CG1   . ILE A 1 7   ? 20.894  -8.662  15.467  1.00 18.67 ? 5   ILE A CG1   1 
ATOM   48   C  CG2   . ILE A 1 7   ? 18.559  -7.852  15.921  1.00 20.50 ? 5   ILE A CG2   1 
ATOM   49   C  CD1   . ILE A 1 7   ? 21.306  -8.729  16.928  1.00 20.14 ? 5   ILE A CD1   1 
ATOM   50   N  N     . THR A 1 8   ? 17.378  -7.062  12.758  1.00 17.34 ? 6   THR A N     1 
ATOM   51   C  CA    . THR A 1 8   ? 16.242  -6.225  12.402  1.00 16.21 ? 6   THR A CA    1 
ATOM   52   C  C     . THR A 1 8   ? 15.059  -6.695  13.234  1.00 16.70 ? 6   THR A C     1 
ATOM   53   O  O     . THR A 1 8   ? 14.415  -7.694  12.911  1.00 18.13 ? 6   THR A O     1 
ATOM   54   C  CB    . THR A 1 8   ? 15.889  -6.366  10.905  1.00 19.00 ? 6   THR A CB    1 
ATOM   55   O  OG1   . THR A 1 8   ? 17.043  -6.062  10.111  1.00 19.16 ? 6   THR A OG1   1 
ATOM   56   C  CG2   . THR A 1 8   ? 14.761  -5.411  10.529  1.00 19.03 ? 6   THR A CG2   1 
ATOM   57   N  N     . LEU A 1 9   ? 14.787  -5.974  14.314  1.00 17.31 ? 7   LEU A N     1 
ATOM   58   C  CA    . LEU A 1 9   ? 13.685  -6.320  15.199  1.00 17.70 ? 7   LEU A CA    1 
ATOM   59   C  C     . LEU A 1 9   ? 12.330  -5.987  14.584  1.00 18.91 ? 7   LEU A C     1 
ATOM   60   O  O     . LEU A 1 9   ? 11.312  -6.563  14.965  1.00 19.67 ? 7   LEU A O     1 
ATOM   61   C  CB    . LEU A 1 9   ? 13.837  -5.583  16.533  1.00 18.29 ? 7   LEU A CB    1 
ATOM   62   C  CG    . LEU A 1 9   ? 15.092  -5.901  17.347  1.00 17.55 ? 7   LEU A CG    1 
ATOM   63   C  CD1   . LEU A 1 9   ? 15.157  -4.985  18.568  1.00 18.38 ? 7   LEU A CD1   1 
ATOM   64   C  CD2   . LEU A 1 9   ? 15.084  -7.362  17.769  1.00 17.62 ? 7   LEU A CD2   1 
ATOM   65   N  N     . ASN A 1 10  ? 12.314  -5.067  13.626  1.00 19.05 ? 8   ASN A N     1 
ATOM   66   C  CA    . ASN A 1 10  ? 11.057  -4.664  13.001  1.00 19.29 ? 8   ASN A CA    1 
ATOM   67   C  C     . ASN A 1 10  ? 11.188  -4.637  11.478  1.00 18.23 ? 8   ASN A C     1 
ATOM   68   O  O     . ASN A 1 10  ? 11.146  -3.576  10.857  1.00 19.36 ? 8   ASN A O     1 
ATOM   69   C  CB    . ASN A 1 10  ? 10.655  -3.282  13.534  1.00 19.75 ? 8   ASN A CB    1 
ATOM   70   C  CG    . ASN A 1 10  ? 9.185   -2.973  13.322  1.00 20.81 ? 8   ASN A CG    1 
ATOM   71   O  OD1   . ASN A 1 10  ? 8.371   -3.876  13.128  1.00 21.58 ? 8   ASN A OD1   1 
ATOM   72   N  ND2   . ASN A 1 10  ? 8.836   -1.691  13.381  1.00 19.96 ? 8   ASN A ND2   1 
ATOM   73   N  N     . PRO A 1 11  ? 11.341  -5.815  10.854  1.00 18.06 ? 9   PRO A N     1 
ATOM   74   C  CA    . PRO A 1 11  ? 11.475  -5.865  9.398   1.00 18.62 ? 9   PRO A CA    1 
ATOM   75   C  C     . PRO A 1 11  ? 10.209  -5.404  8.689   1.00 20.47 ? 9   PRO A C     1 
ATOM   76   O  O     . PRO A 1 11  ? 9.139   -5.305  9.293   1.00 19.90 ? 9   PRO A O     1 
ATOM   77   C  CB    . PRO A 1 11  ? 11.783  -7.335  9.131   1.00 19.85 ? 9   PRO A CB    1 
ATOM   78   C  CG    . PRO A 1 11  ? 10.987  -8.023  10.189  1.00 18.95 ? 9   PRO A CG    1 
ATOM   79   C  CD    . PRO A 1 11  ? 11.264  -7.172  11.420  1.00 18.55 ? 9   PRO A CD    1 
ATOM   80   N  N     . ALA A 1 12  ? 10.346  -5.119  7.404   1.00 20.21 ? 10  ALA A N     1 
ATOM   81   C  CA    . ALA A 1 12  ? 9.218   -4.673  6.608   1.00 21.20 ? 10  ALA A CA    1 
ATOM   82   C  C     . ALA A 1 12  ? 9.397   -5.058  5.156   1.00 21.57 ? 10  ALA A C     1 
ATOM   83   O  O     . ALA A 1 12  ? 10.473  -5.477  4.731   1.00 22.52 ? 10  ALA A O     1 
ATOM   84   C  CB    . ALA A 1 12  ? 9.079   -3.158  6.714   1.00 21.04 ? 10  ALA A CB    1 
ATOM   85   N  N     . ILE A 1 13  ? 8.310   -4.938  4.408   1.00 22.74 ? 11  ILE A N     1 
ATOM   86   C  CA    . ILE A 1 13  ? 8.328   -5.183  2.979   1.00 24.08 ? 11  ILE A CA    1 
ATOM   87   C  C     . ILE A 1 13  ? 7.966   -3.808  2.454   1.00 25.78 ? 11  ILE A C     1 
ATOM   88   O  O     . ILE A 1 13  ? 6.906   -3.277  2.786   1.00 28.28 ? 11  ILE A O     1 
ATOM   89   C  CB    . ILE A 1 13  ? 7.250   -6.192  2.527   1.00 24.55 ? 11  ILE A CB    1 
ATOM   90   C  CG1   . ILE A 1 13  ? 7.626   -7.604  2.983   1.00 25.78 ? 11  ILE A CG1   1 
ATOM   91   C  CG2   . ILE A 1 13  ? 7.109   -6.149  0.999   1.00 26.13 ? 11  ILE A CG2   1 
ATOM   92   C  CD1   . ILE A 1 13  ? 6.617   -8.670  2.584   1.00 26.81 ? 11  ILE A CD1   1 
ATOM   93   N  N     . ASP A 1 14  ? 8.859   -3.205  1.681   1.00 27.04 ? 12  ASP A N     1 
ATOM   94   C  CA    . ASP A 1 14  ? 8.578   -1.888  1.132   1.00 27.83 ? 12  ASP A CA    1 
ATOM   95   C  C     . ASP A 1 14  ? 7.959   -2.027  -0.240  1.00 26.86 ? 12  ASP A C     1 
ATOM   96   O  O     . ASP A 1 14  ? 8.482   -2.742  -1.095  1.00 26.63 ? 12  ASP A O     1 
ATOM   97   C  CB    . ASP A 1 14  ? 9.850   -1.048  0.987   1.00 29.72 ? 12  ASP A CB    1 
ATOM   98   C  CG    . ASP A 1 14  ? 10.484  -0.705  2.315   1.00 32.41 ? 12  ASP A CG    1 
ATOM   99   O  OD1   . ASP A 1 14  ? 9.768   -0.689  3.339   1.00 33.37 ? 12  ASP A OD1   1 
ATOM   100  O  OD2   . ASP A 1 14  ? 11.704  -0.432  2.332   1.00 36.33 ? 12  ASP A OD2   1 
ATOM   101  N  N     . ARG A 1 15  ? 6.838   -1.349  -0.443  1.00 25.71 ? 13  ARG A N     1 
ATOM   102  C  CA    . ARG A 1 15  ? 6.182   -1.365  -1.735  1.00 25.55 ? 13  ARG A CA    1 
ATOM   103  C  C     . ARG A 1 15  ? 6.348   0.040   -2.299  1.00 24.93 ? 13  ARG A C     1 
ATOM   104  O  O     . ARG A 1 15  ? 5.810   1.005   -1.755  1.00 24.16 ? 13  ARG A O     1 
ATOM   105  C  CB    . ARG A 1 15  ? 4.696   -1.708  -1.596  1.00 26.47 ? 13  ARG A CB    1 
ATOM   106  C  CG    . ARG A 1 15  ? 3.997   -1.922  -2.934  1.00 28.42 ? 13  ARG A CG    1 
ATOM   107  C  CD    . ARG A 1 15  ? 2.495   -2.088  -2.764  1.00 30.74 ? 13  ARG A CD    1 
ATOM   108  N  NE    . ARG A 1 15  ? 2.141   -3.337  -2.095  1.00 33.02 ? 13  ARG A NE    1 
ATOM   109  C  CZ    . ARG A 1 15  ? 1.587   -4.382  -2.705  1.00 34.72 ? 13  ARG A CZ    1 
ATOM   110  N  NH1   . ARG A 1 15  ? 1.319   -4.335  -4.005  1.00 35.59 ? 13  ARG A NH1   1 
ATOM   111  N  NH2   . ARG A 1 15  ? 1.298   -5.477  -2.016  1.00 35.89 ? 13  ARG A NH2   1 
ATOM   112  N  N     . LEU A 1 16  ? 7.132   0.157   -3.365  1.00 24.77 ? 14  LEU A N     1 
ATOM   113  C  CA    . LEU A 1 16  ? 7.354   1.447   -3.999  1.00 24.94 ? 14  LEU A CA    1 
ATOM   114  C  C     . LEU A 1 16  ? 6.250   1.676   -5.013  1.00 24.26 ? 14  LEU A C     1 
ATOM   115  O  O     . LEU A 1 16  ? 6.074   0.889   -5.940  1.00 24.69 ? 14  LEU A O     1 
ATOM   116  C  CB    . LEU A 1 16  ? 8.717   1.488   -4.697  1.00 26.86 ? 14  LEU A CB    1 
ATOM   117  C  CG    . LEU A 1 16  ? 9.948   1.718   -3.815  1.00 29.95 ? 14  LEU A CG    1 
ATOM   118  C  CD1   . LEU A 1 16  ? 10.111  0.573   -2.830  1.00 28.66 ? 14  LEU A CD1   1 
ATOM   119  C  CD2   . LEU A 1 16  ? 11.181  1.849   -4.697  1.00 30.83 ? 14  LEU A CD2   1 
ATOM   120  N  N     . LEU A 1 17  ? 5.508   2.759   -4.817  1.00 24.25 ? 15  LEU A N     1 
ATOM   121  C  CA    . LEU A 1 17  ? 4.402   3.116   -5.691  1.00 24.22 ? 15  LEU A CA    1 
ATOM   122  C  C     . LEU A 1 17  ? 4.783   4.336   -6.521  1.00 24.07 ? 15  LEU A C     1 
ATOM   123  O  O     . LEU A 1 17  ? 4.825   5.458   -6.010  1.00 24.51 ? 15  LEU A O     1 
ATOM   124  C  CB    . LEU A 1 17  ? 3.165   3.419   -4.844  1.00 24.95 ? 15  LEU A CB    1 
ATOM   125  C  CG    . LEU A 1 17  ? 2.749   2.306   -3.879  1.00 25.41 ? 15  LEU A CG    1 
ATOM   126  C  CD1   . LEU A 1 17  ? 1.659   2.809   -2.951  1.00 26.82 ? 15  LEU A CD1   1 
ATOM   127  C  CD2   . LEU A 1 17  ? 2.278   1.092   -4.665  1.00 25.78 ? 15  LEU A CD2   1 
ATOM   128  N  N     . PHE A 1 18  ? 5.057   4.103   -7.801  1.00 24.86 ? 16  PHE A N     1 
ATOM   129  C  CA    . PHE A 1 18  ? 5.451   5.164   -8.728  1.00 26.94 ? 16  PHE A CA    1 
ATOM   130  C  C     . PHE A 1 18  ? 4.248   5.849   -9.365  1.00 26.94 ? 16  PHE A C     1 
ATOM   131  O  O     . PHE A 1 18  ? 3.426   5.201   -10.011 1.00 28.50 ? 16  PHE A O     1 
ATOM   132  C  CB    . PHE A 1 18  ? 6.339   4.589   -9.834  1.00 27.67 ? 16  PHE A CB    1 
ATOM   133  C  CG    . PHE A 1 18  ? 7.687   4.133   -9.358  1.00 28.31 ? 16  PHE A CG    1 
ATOM   134  C  CD1   . PHE A 1 18  ? 8.785   4.983   -9.427  1.00 29.28 ? 16  PHE A CD1   1 
ATOM   135  C  CD2   . PHE A 1 18  ? 7.863   2.850   -8.845  1.00 28.08 ? 16  PHE A CD2   1 
ATOM   136  C  CE1   . PHE A 1 18  ? 10.043  4.565   -8.993  1.00 28.15 ? 16  PHE A CE1   1 
ATOM   137  C  CE2   . PHE A 1 18  ? 9.116   2.421   -8.407  1.00 28.49 ? 16  PHE A CE2   1 
ATOM   138  C  CZ    . PHE A 1 18  ? 10.207  3.280   -8.483  1.00 29.71 ? 16  PHE A CZ    1 
ATOM   139  N  N     . ILE A 1 19  ? 4.157   7.162   -9.186  1.00 28.45 ? 17  ILE A N     1 
ATOM   140  C  CA    . ILE A 1 19  ? 3.062   7.943   -9.753  1.00 29.72 ? 17  ILE A CA    1 
ATOM   141  C  C     . ILE A 1 19  ? 3.632   9.047   -10.638 1.00 31.28 ? 17  ILE A C     1 
ATOM   142  O  O     . ILE A 1 19  ? 4.848   9.167   -10.786 1.00 31.38 ? 17  ILE A O     1 
ATOM   143  C  CB    . ILE A 1 19  ? 2.207   8.597   -8.647  1.00 27.93 ? 17  ILE A CB    1 
ATOM   144  C  CG1   . ILE A 1 19  ? 3.049   9.607   -7.862  1.00 28.30 ? 17  ILE A CG1   1 
ATOM   145  C  CG2   . ILE A 1 19  ? 1.670   7.528   -7.705  1.00 27.02 ? 17  ILE A CG2   1 
ATOM   146  C  CD1   . ILE A 1 19  ? 2.261   10.406  -6.840  1.00 28.21 ? 17  ILE A CD1   1 
ATOM   147  N  N     . ARG A 1 20  ? 2.752   9.843   -11.238 1.00 33.78 ? 18  ARG A N     1 
ATOM   148  C  CA    . ARG A 1 20  ? 3.187   10.952  -12.078 1.00 35.99 ? 18  ARG A CA    1 
ATOM   149  C  C     . ARG A 1 20  ? 3.130   12.234  -11.258 1.00 36.04 ? 18  ARG A C     1 
ATOM   150  O  O     . ARG A 1 20  ? 2.130   12.510  -10.597 1.00 36.35 ? 18  ARG A O     1 
ATOM   151  C  CB    . ARG A 1 20  ? 2.284   11.107  -13.307 1.00 39.17 ? 18  ARG A CB    1 
ATOM   152  C  CG    . ARG A 1 20  ? 2.391   9.995   -14.334 1.00 42.53 ? 18  ARG A CG    1 
ATOM   153  C  CD    . ARG A 1 20  ? 1.824   10.454  -15.675 1.00 46.70 ? 18  ARG A CD    1 
ATOM   154  N  NE    . ARG A 1 20  ? 1.890   9.411   -16.695 1.00 48.63 ? 18  ARG A NE    1 
ATOM   155  C  CZ    . ARG A 1 20  ? 1.069   8.368   -16.755 1.00 50.21 ? 18  ARG A CZ    1 
ATOM   156  N  NH1   . ARG A 1 20  ? 0.109   8.224   -15.851 1.00 51.16 ? 18  ARG A NH1   1 
ATOM   157  N  NH2   . ARG A 1 20  ? 1.212   7.464   -17.715 1.00 51.38 ? 18  ARG A NH2   1 
ATOM   158  N  N     . GLY A 1 21  ? 4.206   13.010  -11.300 1.00 36.34 ? 19  GLY A N     1 
ATOM   159  C  CA    . GLY A 1 21  ? 4.244   14.261  -10.564 1.00 36.53 ? 19  GLY A CA    1 
ATOM   160  C  C     . GLY A 1 21  ? 4.159   14.120  -9.057  1.00 36.63 ? 19  GLY A C     1 
ATOM   161  O  O     . GLY A 1 21  ? 4.499   13.078  -8.495  1.00 36.17 ? 19  GLY A O     1 
ATOM   162  N  N     . GLU A 1 22  ? 3.696   15.183  -8.404  1.00 36.01 ? 20  GLU A N     1 
ATOM   163  C  CA    . GLU A 1 22  ? 3.563   15.221  -6.950  1.00 36.63 ? 20  GLU A CA    1 
ATOM   164  C  C     . GLU A 1 22  ? 2.383   14.408  -6.423  1.00 35.68 ? 20  GLU A C     1 
ATOM   165  O  O     . GLU A 1 22  ? 1.402   14.182  -7.130  1.00 35.62 ? 20  GLU A O     1 
ATOM   166  C  CB    . GLU A 1 22  ? 3.404   16.670  -6.478  1.00 38.11 ? 20  GLU A CB    1 
ATOM   167  C  CG    . GLU A 1 22  ? 4.629   17.553  -6.662  1.00 39.95 ? 20  GLU A CG    1 
ATOM   168  C  CD    . GLU A 1 22  ? 5.797   17.122  -5.795  1.00 40.77 ? 20  GLU A CD    1 
ATOM   169  O  OE1   . GLU A 1 22  ? 5.586   16.880  -4.588  1.00 40.91 ? 20  GLU A OE1   1 
ATOM   170  O  OE2   . GLU A 1 22  ? 6.927   17.037  -6.318  1.00 42.30 ? 20  GLU A OE2   1 
ATOM   171  N  N     . LEU A 1 23  ? 2.492   13.977  -5.170  1.00 34.88 ? 21  LEU A N     1 
ATOM   172  C  CA    . LEU A 1 23  ? 1.434   13.218  -4.512  1.00 34.49 ? 21  LEU A CA    1 
ATOM   173  C  C     . LEU A 1 23  ? 0.429   14.232  -3.976  1.00 35.53 ? 21  LEU A C     1 
ATOM   174  O  O     . LEU A 1 23  ? 0.707   14.929  -3.000  1.00 36.23 ? 21  LEU A O     1 
ATOM   175  C  CB    . LEU A 1 23  ? 2.007   12.401  -3.352  1.00 33.67 ? 21  LEU A CB    1 
ATOM   176  C  CG    . LEU A 1 23  ? 1.021   11.693  -2.417  1.00 33.52 ? 21  LEU A CG    1 
ATOM   177  C  CD1   . LEU A 1 23  ? 0.225   10.640  -3.172  1.00 33.97 ? 21  LEU A CD1   1 
ATOM   178  C  CD2   . LEU A 1 23  ? 1.794   11.055  -1.274  1.00 34.58 ? 21  LEU A CD2   1 
ATOM   179  N  N     . GLU A 1 24  ? -0.731  14.312  -4.620  1.00 35.88 ? 22  GLU A N     1 
ATOM   180  C  CA    . GLU A 1 24  ? -1.774  15.253  -4.221  1.00 36.39 ? 22  GLU A CA    1 
ATOM   181  C  C     . GLU A 1 24  ? -2.794  14.609  -3.287  1.00 35.85 ? 22  GLU A C     1 
ATOM   182  O  O     . GLU A 1 24  ? -3.494  13.670  -3.670  1.00 34.51 ? 22  GLU A O     1 
ATOM   183  C  CB    . GLU A 1 24  ? -2.495  15.789  -5.461  1.00 38.45 ? 22  GLU A CB    1 
ATOM   184  C  CG    . GLU A 1 24  ? -1.591  16.480  -6.472  1.00 41.47 ? 22  GLU A CG    1 
ATOM   185  C  CD    . GLU A 1 24  ? -0.897  17.702  -5.900  1.00 45.07 ? 22  GLU A CD    1 
ATOM   186  O  OE1   . GLU A 1 24  ? -1.593  18.572  -5.334  1.00 47.05 ? 22  GLU A OE1   1 
ATOM   187  O  OE2   . GLU A 1 24  ? 0.344   17.795  -6.022  1.00 46.51 ? 22  GLU A OE2   1 
ATOM   188  N  N     . LYS A 1 25  ? -2.882  15.115  -2.062  1.00 36.21 ? 23  LYS A N     1 
ATOM   189  C  CA    . LYS A 1 25  ? -3.831  14.568  -1.103  1.00 37.12 ? 23  LYS A CA    1 
ATOM   190  C  C     . LYS A 1 25  ? -5.253  14.884  -1.552  1.00 38.11 ? 23  LYS A C     1 
ATOM   191  O  O     . LYS A 1 25  ? -5.477  15.847  -2.287  1.00 38.49 ? 23  LYS A O     1 
ATOM   192  C  CB    . LYS A 1 25  ? -3.575  15.141  0.297   1.00 37.79 ? 23  LYS A CB    1 
ATOM   193  C  CG    . LYS A 1 25  ? -3.691  16.652  0.413   1.00 38.97 ? 23  LYS A CG    1 
ATOM   194  C  CD    . LYS A 1 25  ? -3.439  17.093  1.851   1.00 40.55 ? 23  LYS A CD    1 
ATOM   195  C  CE    . LYS A 1 25  ? -3.550  18.602  2.015   1.00 41.31 ? 23  LYS A CE    1 
ATOM   196  N  NZ    . LYS A 1 25  ? -2.532  19.337  1.216   1.00 43.26 ? 23  LYS A NZ    1 
ATOM   197  N  N     . ARG A 1 26  ? -6.204  14.060  -1.121  1.00 37.54 ? 24  ARG A N     1 
ATOM   198  C  CA    . ARG A 1 26  ? -7.609  14.240  -1.474  1.00 38.95 ? 24  ARG A CA    1 
ATOM   199  C  C     . ARG A 1 26  ? -7.845  14.134  -2.979  1.00 38.11 ? 24  ARG A C     1 
ATOM   200  O  O     . ARG A 1 26  ? -8.880  14.563  -3.487  1.00 38.60 ? 24  ARG A O     1 
ATOM   201  C  CB    . ARG A 1 26  ? -8.108  15.589  -0.951  1.00 39.99 ? 24  ARG A CB    1 
ATOM   202  C  CG    . ARG A 1 26  ? -8.153  15.661  0.567   1.00 41.93 ? 24  ARG A CG    1 
ATOM   203  C  CD    . ARG A 1 26  ? -8.190  17.097  1.067   1.00 45.35 ? 24  ARG A CD    1 
ATOM   204  N  NE    . ARG A 1 26  ? -8.191  17.157  2.526   1.00 46.60 ? 24  ARG A NE    1 
ATOM   205  C  CZ    . ARG A 1 26  ? -9.216  16.788  3.287   1.00 47.76 ? 24  ARG A CZ    1 
ATOM   206  N  NH1   . ARG A 1 26  ? -10.328 16.335  2.725   1.00 48.32 ? 24  ARG A NH1   1 
ATOM   207  N  NH2   . ARG A 1 26  ? -9.128  16.866  4.608   1.00 47.74 ? 24  ARG A NH2   1 
ATOM   208  N  N     . LYS A 1 27  ? -6.877  13.556  -3.682  1.00 36.80 ? 25  LYS A N     1 
ATOM   209  C  CA    . LYS A 1 27  ? -6.968  13.364  -5.125  1.00 36.41 ? 25  LYS A CA    1 
ATOM   210  C  C     . LYS A 1 27  ? -6.600  11.921  -5.450  1.00 35.73 ? 25  LYS A C     1 
ATOM   211  O  O     . LYS A 1 27  ? -6.071  11.203  -4.601  1.00 34.59 ? 25  LYS A O     1 
ATOM   212  C  CB    . LYS A 1 27  ? -6.003  14.300  -5.862  1.00 37.92 ? 25  LYS A CB    1 
ATOM   213  C  CG    . LYS A 1 27  ? -6.298  15.785  -5.717  1.00 38.31 ? 25  LYS A CG    1 
ATOM   214  C  CD    . LYS A 1 27  ? -7.603  16.166  -6.393  1.00 40.95 ? 25  LYS A CD    1 
ATOM   215  C  CE    . LYS A 1 27  ? -7.820  17.673  -6.352  1.00 43.28 ? 25  LYS A CE    1 
ATOM   216  N  NZ    . LYS A 1 27  ? -9.126  18.066  -6.954  1.00 44.14 ? 25  LYS A NZ    1 
ATOM   217  N  N     . THR A 1 28  ? -6.883  11.502  -6.679  1.00 34.34 ? 26  THR A N     1 
ATOM   218  C  CA    . THR A 1 28  ? -6.555  10.154  -7.122  1.00 34.10 ? 26  THR A CA    1 
ATOM   219  C  C     . THR A 1 28  ? -5.182  10.188  -7.783  1.00 33.23 ? 26  THR A C     1 
ATOM   220  O  O     . THR A 1 28  ? -4.972  10.907  -8.759  1.00 34.23 ? 26  THR A O     1 
ATOM   221  C  CB    . THR A 1 28  ? -7.591  9.630   -8.135  1.00 35.12 ? 26  THR A CB    1 
ATOM   222  O  OG1   . THR A 1 28  ? -8.848  9.443   -7.475  1.00 36.09 ? 26  THR A OG1   1 
ATOM   223  C  CG2   . THR A 1 28  ? -7.131  8.307   -8.736  1.00 36.02 ? 26  THR A CG2   1 
ATOM   224  N  N     . ASN A 1 29  ? -4.252  9.410   -7.241  1.00 31.36 ? 27  ASN A N     1 
ATOM   225  C  CA    . ASN A 1 29  ? -2.890  9.346   -7.759  1.00 30.09 ? 27  ASN A CA    1 
ATOM   226  C  C     . ASN A 1 29  ? -2.650  7.954   -8.341  1.00 30.15 ? 27  ASN A C     1 
ATOM   227  O  O     . ASN A 1 29  ? -2.286  7.022   -7.623  1.00 29.32 ? 27  ASN A O     1 
ATOM   228  C  CB    . ASN A 1 29  ? -1.900  9.629   -6.624  1.00 30.13 ? 27  ASN A CB    1 
ATOM   229  C  CG    . ASN A 1 29  ? -2.106  11.004  -5.993  1.00 30.42 ? 27  ASN A CG    1 
ATOM   230  O  OD1   . ASN A 1 29  ? -1.412  11.966  -6.328  1.00 31.52 ? 27  ASN A OD1   1 
ATOM   231  N  ND2   . ASN A 1 29  ? -3.069  11.101  -5.082  1.00 30.43 ? 27  ASN A ND2   1 
ATOM   232  N  N     . ARG A 1 30  ? -2.862  7.815   -9.645  1.00 29.18 ? 28  ARG A N     1 
ATOM   233  C  CA    . ARG A 1 30  ? -2.690  6.530   -10.313 1.00 30.37 ? 28  ARG A CA    1 
ATOM   234  C  C     . ARG A 1 30  ? -1.255  6.025   -10.243 1.00 28.92 ? 28  ARG A C     1 
ATOM   235  O  O     . ARG A 1 30  ? -0.310  6.778   -10.470 1.00 29.24 ? 28  ARG A O     1 
ATOM   236  C  CB    . ARG A 1 30  ? -3.123  6.631   -11.778 1.00 32.92 ? 28  ARG A CB    1 
ATOM   237  C  CG    . ARG A 1 30  ? -4.565  7.074   -11.968 1.00 37.30 ? 28  ARG A CG    1 
ATOM   238  C  CD    . ARG A 1 30  ? -4.936  7.165   -13.444 1.00 41.23 ? 28  ARG A CD    1 
ATOM   239  N  NE    . ARG A 1 30  ? -5.071  5.851   -14.069 1.00 45.85 ? 28  ARG A NE    1 
ATOM   240  C  CZ    . ARG A 1 30  ? -5.306  5.661   -15.365 1.00 47.40 ? 28  ARG A CZ    1 
ATOM   241  N  NH1   . ARG A 1 30  ? -5.430  6.701   -16.179 1.00 48.74 ? 28  ARG A NH1   1 
ATOM   242  N  NH2   . ARG A 1 30  ? -5.423  4.430   -15.848 1.00 48.01 ? 28  ARG A NH2   1 
ATOM   243  N  N     . VAL A 1 31  ? -1.102  4.742   -9.930  1.00 27.72 ? 29  VAL A N     1 
ATOM   244  C  CA    . VAL A 1 31  ? 0.218   4.125   -9.839  1.00 27.47 ? 29  VAL A CA    1 
ATOM   245  C  C     . VAL A 1 31  ? 0.658   3.615   -11.210 1.00 27.39 ? 29  VAL A C     1 
ATOM   246  O  O     . VAL A 1 31  ? -0.025  2.796   -11.821 1.00 28.13 ? 29  VAL A O     1 
ATOM   247  C  CB    . VAL A 1 31  ? 0.212   2.939   -8.848  1.00 26.33 ? 29  VAL A CB    1 
ATOM   248  C  CG1   . VAL A 1 31  ? 1.603   2.332   -8.753  1.00 27.34 ? 29  VAL A CG1   1 
ATOM   249  C  CG2   . VAL A 1 31  ? -0.246  3.412   -7.481  1.00 26.15 ? 29  VAL A CG2   1 
ATOM   250  N  N     . ILE A 1 32  ? 1.804   4.102   -11.681 1.00 29.24 ? 30  ILE A N     1 
ATOM   251  C  CA    . ILE A 1 32  ? 2.351   3.709   -12.981 1.00 29.62 ? 30  ILE A CA    1 
ATOM   252  C  C     . ILE A 1 32  ? 2.976   2.323   -12.912 1.00 28.38 ? 30  ILE A C     1 
ATOM   253  O  O     . ILE A 1 32  ? 2.882   1.538   -13.855 1.00 29.16 ? 30  ILE A O     1 
ATOM   254  C  CB    . ILE A 1 32  ? 3.432   4.710   -13.454 1.00 31.03 ? 30  ILE A CB    1 
ATOM   255  C  CG1   . ILE A 1 32  ? 2.847   6.122   -13.491 1.00 32.21 ? 30  ILE A CG1   1 
ATOM   256  C  CG2   . ILE A 1 32  ? 3.961   4.309   -14.824 1.00 31.85 ? 30  ILE A CG2   1 
ATOM   257  C  CD1   . ILE A 1 32  ? 1.584   6.236   -14.306 1.00 34.04 ? 30  ILE A CD1   1 
ATOM   258  N  N     . LYS A 1 33  ? 3.627   2.035   -11.792 1.00 28.32 ? 31  LYS A N     1 
ATOM   259  C  CA    . LYS A 1 33  ? 4.260   0.744   -11.583 1.00 27.14 ? 31  LYS A CA    1 
ATOM   260  C  C     . LYS A 1 33  ? 4.526   0.534   -10.100 1.00 26.86 ? 31  LYS A C     1 
ATOM   261  O  O     . LYS A 1 33  ? 4.579   1.491   -9.325  1.00 25.24 ? 31  LYS A O     1 
ATOM   262  C  CB    . LYS A 1 33  ? 5.582   0.648   -12.352 1.00 28.05 ? 31  LYS A CB    1 
ATOM   263  C  CG    . LYS A 1 33  ? 6.656   1.621   -11.895 1.00 29.57 ? 31  LYS A CG    1 
ATOM   264  C  CD    . LYS A 1 33  ? 7.993   1.302   -12.550 1.00 32.75 ? 31  LYS A CD    1 
ATOM   265  C  CE    . LYS A 1 33  ? 9.057   2.307   -12.151 1.00 32.79 ? 31  LYS A CE    1 
ATOM   266  N  NZ    . LYS A 1 33  ? 10.382  1.969   -12.740 1.00 36.09 ? 31  LYS A NZ    1 
ATOM   267  N  N     . THR A 1 34  ? 4.687   -0.728  -9.722  1.00 26.40 ? 32  THR A N     1 
ATOM   268  C  CA    . THR A 1 34  ? 4.951   -1.106  -8.343  1.00 26.61 ? 32  THR A CA    1 
ATOM   269  C  C     . THR A 1 34  ? 6.210   -1.960  -8.268  1.00 26.65 ? 32  THR A C     1 
ATOM   270  O  O     . THR A 1 34  ? 6.385   -2.887  -9.059  1.00 27.12 ? 32  THR A O     1 
ATOM   271  C  CB    . THR A 1 34  ? 3.786   -1.931  -7.760  1.00 26.76 ? 32  THR A CB    1 
ATOM   272  O  OG1   . THR A 1 34  ? 2.575   -1.169  -7.831  1.00 29.36 ? 32  THR A OG1   1 
ATOM   273  C  CG2   . THR A 1 34  ? 4.066   -2.297  -6.311  1.00 27.15 ? 32  THR A CG2   1 
ATOM   274  N  N     . GLU A 1 35  ? 7.082   -1.642  -7.317  1.00 27.17 ? 33  GLU A N     1 
ATOM   275  C  CA    . GLU A 1 35  ? 8.308   -2.403  -7.118  1.00 27.21 ? 33  GLU A CA    1 
ATOM   276  C  C     . GLU A 1 35  ? 8.414   -2.727  -5.632  1.00 27.00 ? 33  GLU A C     1 
ATOM   277  O  O     . GLU A 1 35  ? 7.803   -2.055  -4.797  1.00 26.53 ? 33  GLU A O     1 
ATOM   278  C  CB    . GLU A 1 35  ? 9.529   -1.604  -7.584  1.00 27.94 ? 33  GLU A CB    1 
ATOM   279  C  CG    . GLU A 1 35  ? 9.426   -1.127  -9.029  1.00 30.87 ? 33  GLU A CG    1 
ATOM   280  C  CD    . GLU A 1 35  ? 10.736  -0.586  -9.571  1.00 33.48 ? 33  GLU A CD    1 
ATOM   281  O  OE1   . GLU A 1 35  ? 11.440  0.128   -8.828  1.00 34.40 ? 33  GLU A OE1   1 
ATOM   282  O  OE2   . GLU A 1 35  ? 11.053  -0.865  -10.748 1.00 35.53 ? 33  GLU A OE2   1 
ATOM   283  N  N     . PHE A 1 36  ? 9.177   -3.763  -5.309  1.00 26.50 ? 34  PHE A N     1 
ATOM   284  C  CA    . PHE A 1 36  ? 9.341   -4.186  -3.924  1.00 26.69 ? 34  PHE A CA    1 
ATOM   285  C  C     . PHE A 1 36  ? 10.789  -4.175  -3.478  1.00 27.67 ? 34  PHE A C     1 
ATOM   286  O  O     . PHE A 1 36  ? 11.700  -4.415  -4.269  1.00 28.22 ? 34  PHE A O     1 
ATOM   287  C  CB    . PHE A 1 36  ? 8.761   -5.589  -3.740  1.00 27.91 ? 34  PHE A CB    1 
ATOM   288  C  CG    . PHE A 1 36  ? 7.271   -5.646  -3.889  1.00 28.45 ? 34  PHE A CG    1 
ATOM   289  C  CD1   . PHE A 1 36  ? 6.440   -5.292  -2.831  1.00 29.37 ? 34  PHE A CD1   1 
ATOM   290  C  CD2   . PHE A 1 36  ? 6.695   -6.012  -5.099  1.00 29.32 ? 34  PHE A CD2   1 
ATOM   291  C  CE1   . PHE A 1 36  ? 5.054   -5.302  -2.977  1.00 31.25 ? 34  PHE A CE1   1 
ATOM   292  C  CE2   . PHE A 1 36  ? 5.309   -6.025  -5.255  1.00 30.24 ? 34  PHE A CE2   1 
ATOM   293  C  CZ    . PHE A 1 36  ? 4.490   -5.668  -4.194  1.00 31.55 ? 34  PHE A CZ    1 
ATOM   294  N  N     . ASP A 1 37  ? 10.983  -3.890  -2.195  1.00 27.85 ? 35  ASP A N     1 
ATOM   295  C  CA    . ASP A 1 37  ? 12.306  -3.849  -1.588  1.00 28.18 ? 35  ASP A CA    1 
ATOM   296  C  C     . ASP A 1 37  ? 12.110  -4.317  -0.154  1.00 27.63 ? 35  ASP A C     1 
ATOM   297  O  O     . ASP A 1 37  ? 10.978  -4.415  0.315   1.00 27.54 ? 35  ASP A O     1 
ATOM   298  C  CB    . ASP A 1 37  ? 12.853  -2.417  -1.625  1.00 29.40 ? 35  ASP A CB    1 
ATOM   299  C  CG    . ASP A 1 37  ? 14.270  -2.309  -1.081  1.00 29.87 ? 35  ASP A CG    1 
ATOM   300  O  OD1   . ASP A 1 37  ? 15.012  -3.313  -1.118  1.00 33.16 ? 35  ASP A OD1   1 
ATOM   301  O  OD2   . ASP A 1 37  ? 14.647  -1.207  -0.632  1.00 32.57 ? 35  ASP A OD2   1 
ATOM   302  N  N     . CYS A 1 38  ? 13.192  -4.639  0.541   1.00 28.07 ? 36  CYS A N     1 
ATOM   303  C  CA    . CYS A 1 38  ? 13.039  -5.071  1.921   1.00 29.36 ? 36  CYS A CA    1 
ATOM   304  C  C     . CYS A 1 38  ? 13.043  -3.843  2.816   1.00 28.69 ? 36  CYS A C     1 
ATOM   305  O  O     . CYS A 1 38  ? 13.624  -2.814  2.470   1.00 31.36 ? 36  CYS A O     1 
ATOM   306  C  CB    . CYS A 1 38  ? 14.155  -6.041  2.319   1.00 29.82 ? 36  CYS A CB    1 
ATOM   307  S  SG    . CYS A 1 38  ? 15.824  -5.471  1.984   1.00 33.39 ? 36  CYS A SG    1 
ATOM   308  N  N     . GLY A 1 39  ? 12.371  -3.951  3.955   1.00 27.43 ? 37  GLY A N     1 
ATOM   309  C  CA    . GLY A 1 39  ? 12.300  -2.847  4.893   1.00 24.93 ? 37  GLY A CA    1 
ATOM   310  C  C     . GLY A 1 39  ? 12.957  -3.226  6.201   1.00 22.80 ? 37  GLY A C     1 
ATOM   311  O  O     . GLY A 1 39  ? 13.210  -4.402  6.456   1.00 22.64 ? 37  GLY A O     1 
ATOM   312  N  N     . GLY A 1 40  ? 13.209  -2.237  7.047   1.00 21.88 ? 38  GLY A N     1 
ATOM   313  C  CA    . GLY A 1 40  ? 13.873  -2.512  8.303   1.00 23.08 ? 38  GLY A CA    1 
ATOM   314  C  C     . GLY A 1 40  ? 15.323  -2.156  8.050   1.00 22.18 ? 38  GLY A C     1 
ATOM   315  O  O     . GLY A 1 40  ? 15.946  -2.675  7.120   1.00 23.22 ? 38  GLY A O     1 
ATOM   316  N  N     . LYS A 1 41  ? 15.856  -1.264  8.873   1.00 21.90 ? 39  LYS A N     1 
ATOM   317  C  CA    . LYS A 1 41  ? 17.226  -0.793  8.724   1.00 20.35 ? 39  LYS A CA    1 
ATOM   318  C  C     . LYS A 1 41  ? 18.287  -1.878  8.652   1.00 19.74 ? 39  LYS A C     1 
ATOM   319  O  O     . LYS A 1 41  ? 19.201  -1.804  7.829   1.00 19.77 ? 39  LYS A O     1 
ATOM   320  C  CB    . LYS A 1 41  ? 17.549  0.176   9.856   1.00 21.50 ? 39  LYS A CB    1 
ATOM   321  C  CG    . LYS A 1 41  ? 16.668  1.420   9.843   1.00 24.94 ? 39  LYS A CG    1 
ATOM   322  C  CD    . LYS A 1 41  ? 17.069  2.375   10.949  1.00 30.18 ? 39  LYS A CD    1 
ATOM   323  C  CE    . LYS A 1 41  ? 18.547  2.715   10.856  1.00 30.90 ? 39  LYS A CE    1 
ATOM   324  N  NZ    . LYS A 1 41  ? 19.017  3.449   12.042  1.00 30.67 ? 39  LYS A NZ    1 
ATOM   325  N  N     . GLY A 1 42  ? 18.176  -2.881  9.515   1.00 19.29 ? 40  GLY A N     1 
ATOM   326  C  CA    . GLY A 1 42  ? 19.152  -3.956  9.505   1.00 17.55 ? 40  GLY A CA    1 
ATOM   327  C  C     . GLY A 1 42  ? 19.200  -4.691  8.176   1.00 17.85 ? 40  GLY A C     1 
ATOM   328  O  O     . GLY A 1 42  ? 20.267  -5.114  7.737   1.00 15.98 ? 40  GLY A O     1 
ATOM   329  N  N     . LEU A 1 43  ? 18.044  -4.852  7.535   1.00 17.80 ? 41  LEU A N     1 
ATOM   330  C  CA    . LEU A 1 43  ? 17.987  -5.542  6.247   1.00 17.74 ? 41  LEU A CA    1 
ATOM   331  C  C     . LEU A 1 43  ? 18.637  -4.705  5.154   1.00 18.18 ? 41  LEU A C     1 
ATOM   332  O  O     . LEU A 1 43  ? 19.260  -5.241  4.237   1.00 18.66 ? 41  LEU A O     1 
ATOM   333  C  CB    . LEU A 1 43  ? 16.535  -5.879  5.884   1.00 17.67 ? 41  LEU A CB    1 
ATOM   334  C  CG    . LEU A 1 43  ? 15.962  -7.056  6.681   1.00 17.87 ? 41  LEU A CG    1 
ATOM   335  C  CD1   . LEU A 1 43  ? 14.507  -7.300  6.277   1.00 20.04 ? 41  LEU A CD1   1 
ATOM   336  C  CD2   . LEU A 1 43  ? 16.796  -8.302  6.416   1.00 20.89 ? 41  LEU A CD2   1 
ATOM   337  N  N     . HIS A 1 44  ? 18.491  -3.387  5.247   1.00 19.97 ? 42  HIS A N     1 
ATOM   338  C  CA    . HIS A 1 44  ? 19.119  -2.503  4.277   1.00 21.98 ? 42  HIS A CA    1 
ATOM   339  C  C     . HIS A 1 44  ? 20.629  -2.606  4.439   1.00 20.37 ? 42  HIS A C     1 
ATOM   340  O  O     . HIS A 1 44  ? 21.364  -2.585  3.454   1.00 20.94 ? 42  HIS A O     1 
ATOM   341  C  CB    . HIS A 1 44  ? 18.668  -1.059  4.492   1.00 23.91 ? 42  HIS A CB    1 
ATOM   342  C  CG    . HIS A 1 44  ? 17.293  -0.781  3.975   1.00 28.12 ? 42  HIS A CG    1 
ATOM   343  N  ND1   . HIS A 1 44  ? 16.321  -0.165  4.733   1.00 30.20 ? 42  HIS A ND1   1 
ATOM   344  C  CD2   . HIS A 1 44  ? 16.730  -1.029  2.770   1.00 28.92 ? 42  HIS A CD2   1 
ATOM   345  C  CE1   . HIS A 1 44  ? 15.219  -0.046  4.014   1.00 30.17 ? 42  HIS A CE1   1 
ATOM   346  N  NE2   . HIS A 1 44  ? 15.441  -0.562  2.820   1.00 31.26 ? 42  HIS A NE2   1 
ATOM   347  N  N     . VAL A 1 45  ? 21.093  -2.717  5.681   1.00 18.01 ? 43  VAL A N     1 
ATOM   348  C  CA    . VAL A 1 45  ? 22.523  -2.840  5.928   1.00 16.32 ? 43  VAL A CA    1 
ATOM   349  C  C     . VAL A 1 45  ? 23.022  -4.162  5.346   1.00 16.94 ? 43  VAL A C     1 
ATOM   350  O  O     . VAL A 1 45  ? 24.101  -4.214  4.753   1.00 15.58 ? 43  VAL A O     1 
ATOM   351  C  CB    . VAL A 1 45  ? 22.844  -2.753  7.435   1.00 17.82 ? 43  VAL A CB    1 
ATOM   352  C  CG1   . VAL A 1 45  ? 24.320  -3.042  7.682   1.00 18.38 ? 43  VAL A CG1   1 
ATOM   353  C  CG2   . VAL A 1 45  ? 22.501  -1.349  7.942   1.00 17.54 ? 43  VAL A CG2   1 
ATOM   354  N  N     . SER A 1 46  ? 22.232  -5.223  5.508   1.00 17.24 ? 44  SER A N     1 
ATOM   355  C  CA    . SER A 1 46  ? 22.596  -6.522  4.947   1.00 16.97 ? 44  SER A CA    1 
ATOM   356  C  C     . SER A 1 46  ? 22.681  -6.417  3.427   1.00 16.82 ? 44  SER A C     1 
ATOM   357  O  O     . SER A 1 46  ? 23.587  -6.971  2.810   1.00 16.58 ? 44  SER A O     1 
ATOM   358  C  CB    . SER A 1 46  ? 21.560  -7.588  5.318   1.00 18.34 ? 44  SER A CB    1 
ATOM   359  O  OG    . SER A 1 46  ? 21.814  -8.130  6.603   1.00 20.93 ? 44  SER A OG    1 
ATOM   360  N  N     . GLY A 1 47  ? 21.731  -5.704  2.828   1.00 15.37 ? 45  GLY A N     1 
ATOM   361  C  CA    . GLY A 1 47  ? 21.733  -5.536  1.383   1.00 16.38 ? 45  GLY A CA    1 
ATOM   362  C  C     . GLY A 1 47  ? 23.006  -4.849  0.912   1.00 15.70 ? 45  GLY A C     1 
ATOM   363  O  O     . GLY A 1 47  ? 23.578  -5.209  -0.117  1.00 17.51 ? 45  GLY A O     1 
ATOM   364  N  N     . VAL A 1 48  ? 23.452  -3.851  1.669   1.00 14.90 ? 46  VAL A N     1 
ATOM   365  C  CA    . VAL A 1 48  ? 24.672  -3.131  1.327   1.00 15.57 ? 46  VAL A CA    1 
ATOM   366  C  C     . VAL A 1 48  ? 25.888  -4.049  1.418   1.00 15.15 ? 46  VAL A C     1 
ATOM   367  O  O     . VAL A 1 48  ? 26.728  -4.082  0.512   1.00 16.30 ? 46  VAL A O     1 
ATOM   368  C  CB    . VAL A 1 48  ? 24.883  -1.922  2.265   1.00 15.65 ? 46  VAL A CB    1 
ATOM   369  C  CG1   . VAL A 1 48  ? 26.233  -1.270  1.985   1.00 14.96 ? 46  VAL A CG1   1 
ATOM   370  C  CG2   . VAL A 1 48  ? 23.757  -0.911  2.073   1.00 17.76 ? 46  VAL A CG2   1 
ATOM   371  N  N     . LEU A 1 49  ? 25.983  -4.794  2.512   1.00 15.72 ? 47  LEU A N     1 
ATOM   372  C  CA    . LEU A 1 49  ? 27.095  -5.715  2.711   1.00 17.16 ? 47  LEU A CA    1 
ATOM   373  C  C     . LEU A 1 49  ? 27.138  -6.758  1.600   1.00 17.87 ? 47  LEU A C     1 
ATOM   374  O  O     . LEU A 1 49  ? 28.207  -7.126  1.112   1.00 17.06 ? 47  LEU A O     1 
ATOM   375  C  CB    . LEU A 1 49  ? 26.969  -6.408  4.067   1.00 17.25 ? 47  LEU A CB    1 
ATOM   376  C  CG    . LEU A 1 49  ? 27.165  -5.503  5.291   1.00 19.24 ? 47  LEU A CG    1 
ATOM   377  C  CD1   . LEU A 1 49  ? 26.836  -6.271  6.553   1.00 20.58 ? 47  LEU A CD1   1 
ATOM   378  C  CD2   . LEU A 1 49  ? 28.596  -4.985  5.327   1.00 21.44 ? 47  LEU A CD2   1 
ATOM   379  N  N     . SER A 1 50  ? 25.967  -7.227  1.191   1.00 17.97 ? 48  SER A N     1 
ATOM   380  C  CA    . SER A 1 50  ? 25.911  -8.225  0.134   1.00 17.78 ? 48  SER A CA    1 
ATOM   381  C  C     . SER A 1 50  ? 26.367  -7.663  -1.213  1.00 17.57 ? 48  SER A C     1 
ATOM   382  O  O     . SER A 1 50  ? 26.908  -8.399  -2.044  1.00 19.32 ? 48  SER A O     1 
ATOM   383  C  CB    . SER A 1 50  ? 24.503  -8.807  0.053   1.00 17.60 ? 48  SER A CB    1 
ATOM   384  O  OG    . SER A 1 50  ? 24.219  -9.515  1.252   1.00 21.04 ? 48  SER A OG    1 
ATOM   385  N  N     . LYS A 1 51  ? 26.171  -6.362  -1.428  1.00 17.58 ? 49  LYS A N     1 
ATOM   386  C  CA    . LYS A 1 51  ? 26.612  -5.739  -2.674  1.00 18.13 ? 49  LYS A CA    1 
ATOM   387  C  C     . LYS A 1 51  ? 28.138  -5.773  -2.719  1.00 18.91 ? 49  LYS A C     1 
ATOM   388  O  O     . LYS A 1 51  ? 28.729  -5.864  -3.792  1.00 20.01 ? 49  LYS A O     1 
ATOM   389  C  CB    . LYS A 1 51  ? 26.139  -4.286  -2.779  1.00 20.52 ? 49  LYS A CB    1 
ATOM   390  C  CG    . LYS A 1 51  ? 24.693  -4.109  -3.233  1.00 23.29 ? 49  LYS A CG    1 
ATOM   391  C  CD    . LYS A 1 51  ? 24.336  -2.629  -3.370  1.00 26.28 ? 49  LYS A CD    1 
ATOM   392  C  CE    . LYS A 1 51  ? 25.037  -1.971  -4.560  1.00 26.21 ? 49  LYS A CE    1 
ATOM   393  N  NZ    . LYS A 1 51  ? 24.440  -2.369  -5.873  1.00 25.61 ? 49  LYS A NZ    1 
ATOM   394  N  N     . PHE A 1 52  ? 28.765  -5.687  -1.547  1.00 16.78 ? 50  PHE A N     1 
ATOM   395  C  CA    . PHE A 1 52  ? 30.220  -5.732  -1.441  1.00 18.04 ? 50  PHE A CA    1 
ATOM   396  C  C     . PHE A 1 52  ? 30.722  -7.160  -1.617  1.00 16.92 ? 50  PHE A C     1 
ATOM   397  O  O     . PHE A 1 52  ? 31.878  -7.378  -1.975  1.00 16.46 ? 50  PHE A O     1 
ATOM   398  C  CB    . PHE A 1 52  ? 30.676  -5.234  -0.066  1.00 18.68 ? 50  PHE A CB    1 
ATOM   399  C  CG    . PHE A 1 52  ? 30.841  -3.741  0.027   1.00 21.00 ? 50  PHE A CG    1 
ATOM   400  C  CD1   . PHE A 1 52  ? 32.097  -3.157  -0.135  1.00 22.85 ? 50  PHE A CD1   1 
ATOM   401  C  CD2   . PHE A 1 52  ? 29.752  -2.921  0.301   1.00 24.33 ? 50  PHE A CD2   1 
ATOM   402  C  CE1   . PHE A 1 52  ? 32.266  -1.776  -0.026  1.00 25.15 ? 50  PHE A CE1   1 
ATOM   403  C  CE2   . PHE A 1 52  ? 29.908  -1.533  0.412   1.00 22.00 ? 50  PHE A CE2   1 
ATOM   404  C  CZ    . PHE A 1 52  ? 31.167  -0.963  0.250   1.00 24.73 ? 50  PHE A CZ    1 
ATOM   405  N  N     . GLY A 1 53  ? 29.852  -8.128  -1.348  1.00 19.43 ? 51  GLY A N     1 
ATOM   406  C  CA    . GLY A 1 53  ? 30.240  -9.524  -1.460  1.00 20.57 ? 51  GLY A CA    1 
ATOM   407  C  C     . GLY A 1 53  ? 30.808  -10.059 -0.155  1.00 20.66 ? 51  GLY A C     1 
ATOM   408  O  O     . GLY A 1 53  ? 31.304  -11.183 -0.091  1.00 20.58 ? 51  GLY A O     1 
ATOM   409  N  N     . ILE A 1 54  ? 30.726  -9.248  0.895   1.00 20.23 ? 52  ILE A N     1 
ATOM   410  C  CA    . ILE A 1 54  ? 31.234  -9.617  2.209   1.00 21.61 ? 52  ILE A CA    1 
ATOM   411  C  C     . ILE A 1 54  ? 30.217  -10.495 2.933   1.00 19.80 ? 52  ILE A C     1 
ATOM   412  O  O     . ILE A 1 54  ? 29.030  -10.193 2.932   1.00 19.97 ? 52  ILE A O     1 
ATOM   413  C  CB    . ILE A 1 54  ? 31.520  -8.347  3.032   1.00 23.46 ? 52  ILE A CB    1 
ATOM   414  C  CG1   . ILE A 1 54  ? 32.659  -7.569  2.366   1.00 26.79 ? 52  ILE A CG1   1 
ATOM   415  C  CG2   . ILE A 1 54  ? 31.850  -8.712  4.467   1.00 26.62 ? 52  ILE A CG2   1 
ATOM   416  C  CD1   . ILE A 1 54  ? 32.786  -6.139  2.855   1.00 29.89 ? 52  ILE A CD1   1 
ATOM   417  N  N     . LYS A 1 55  ? 30.698  -11.568 3.556   1.00 20.31 ? 53  LYS A N     1 
ATOM   418  C  CA    . LYS A 1 55  ? 29.835  -12.520 4.257   1.00 20.18 ? 53  LYS A CA    1 
ATOM   419  C  C     . LYS A 1 55  ? 29.009  -11.884 5.366   1.00 18.13 ? 53  LYS A C     1 
ATOM   420  O  O     . LYS A 1 55  ? 29.545  -11.219 6.251   1.00 17.83 ? 53  LYS A O     1 
ATOM   421  C  CB    . LYS A 1 55  ? 30.681  -13.659 4.844   1.00 20.36 ? 53  LYS A CB    1 
ATOM   422  C  CG    . LYS A 1 55  ? 29.879  -14.861 5.338   1.00 26.77 ? 53  LYS A CG    1 
ATOM   423  C  CD    . LYS A 1 55  ? 29.239  -15.611 4.193   1.00 30.08 ? 53  LYS A CD    1 
ATOM   424  C  CE    . LYS A 1 55  ? 28.468  -16.833 4.688   1.00 32.31 ? 53  LYS A CE    1 
ATOM   425  N  NZ    . LYS A 1 55  ? 29.310  -17.717 5.534   1.00 34.58 ? 53  LYS A NZ    1 
ATOM   426  N  N     . ASN A 1 56  ? 27.698  -12.106 5.330   1.00 17.71 ? 54  ASN A N     1 
ATOM   427  C  CA    . ASN A 1 56  ? 26.820  -11.555 6.358   1.00 16.60 ? 54  ASN A CA    1 
ATOM   428  C  C     . ASN A 1 56  ? 25.532  -12.361 6.454   1.00 16.25 ? 54  ASN A C     1 
ATOM   429  O  O     . ASN A 1 56  ? 25.171  -13.075 5.518   1.00 17.54 ? 54  ASN A O     1 
ATOM   430  C  CB    . ASN A 1 56  ? 26.511  -10.082 6.060   1.00 17.00 ? 54  ASN A CB    1 
ATOM   431  C  CG    . ASN A 1 56  ? 25.581  -9.906  4.883   1.00 19.15 ? 54  ASN A CG    1 
ATOM   432  O  OD1   . ASN A 1 56  ? 24.356  -9.903  5.037   1.00 20.21 ? 54  ASN A OD1   1 
ATOM   433  N  ND2   . ASN A 1 56  ? 26.153  -9.771  3.695   1.00 20.06 ? 54  ASN A ND2   1 
ATOM   434  N  N     . GLU A 1 57  ? 24.848  -12.259 7.592   1.00 15.09 ? 55  GLU A N     1 
ATOM   435  C  CA    . GLU A 1 57  ? 23.592  -12.981 7.798   1.00 16.69 ? 55  GLU A CA    1 
ATOM   436  C  C     . GLU A 1 57  ? 22.620  -12.082 8.550   1.00 17.51 ? 55  GLU A C     1 
ATOM   437  O  O     . GLU A 1 57  ? 22.999  -11.431 9.526   1.00 16.70 ? 55  GLU A O     1 
ATOM   438  C  CB    . GLU A 1 57  ? 23.831  -14.262 8.612   1.00 19.75 ? 55  GLU A CB    1 
ATOM   439  C  CG    . GLU A 1 57  ? 22.580  -15.144 8.752   1.00 21.65 ? 55  GLU A CG    1 
ATOM   440  C  CD    . GLU A 1 57  ? 22.862  -16.475 9.432   1.00 25.02 ? 55  GLU A CD    1 
ATOM   441  O  OE1   . GLU A 1 57  ? 22.849  -16.537 10.679  1.00 25.48 ? 55  GLU A OE1   1 
ATOM   442  O  OE2   . GLU A 1 57  ? 23.104  -17.464 8.711   1.00 29.89 ? 55  GLU A OE2   1 
ATOM   443  N  N     . ALA A 1 58  ? 21.372  -12.047 8.094   1.00 15.89 ? 56  ALA A N     1 
ATOM   444  C  CA    . ALA A 1 58  ? 20.350  -11.220 8.722   1.00 16.40 ? 56  ALA A CA    1 
ATOM   445  C  C     . ALA A 1 58  ? 19.541  -11.982 9.764   1.00 17.44 ? 56  ALA A C     1 
ATOM   446  O  O     . ALA A 1 58  ? 19.039  -13.079 9.492   1.00 17.89 ? 56  ALA A O     1 
ATOM   447  C  CB    . ALA A 1 58  ? 19.414  -10.662 7.656   1.00 16.61 ? 56  ALA A CB    1 
ATOM   448  N  N     . LEU A 1 59  ? 19.419  -11.388 10.950  1.00 15.83 ? 57  LEU A N     1 
ATOM   449  C  CA    . LEU A 1 59  ? 18.651  -11.964 12.051  1.00 18.73 ? 57  LEU A CA    1 
ATOM   450  C  C     . LEU A 1 59  ? 17.477  -11.042 12.368  1.00 18.45 ? 57  LEU A C     1 
ATOM   451  O  O     . LEU A 1 59  ? 17.482  -9.872  11.988  1.00 18.82 ? 57  LEU A O     1 
ATOM   452  C  CB    . LEU A 1 59  ? 19.522  -12.109 13.301  1.00 17.92 ? 57  LEU A CB    1 
ATOM   453  C  CG    . LEU A 1 59  ? 20.818  -12.913 13.175  1.00 19.88 ? 57  LEU A CG    1 
ATOM   454  C  CD1   . LEU A 1 59  ? 21.528  -12.915 14.520  1.00 20.68 ? 57  LEU A CD1   1 
ATOM   455  C  CD2   . LEU A 1 59  ? 20.519  -14.345 12.723  1.00 22.44 ? 57  LEU A CD2   1 
ATOM   456  N  N     . GLY A 1 60  ? 16.472  -11.571 13.060  1.00 19.20 ? 58  GLY A N     1 
ATOM   457  C  CA    . GLY A 1 60  ? 15.316  -10.760 13.409  1.00 19.93 ? 58  GLY A CA    1 
ATOM   458  C  C     . GLY A 1 60  ? 14.058  -11.596 13.521  1.00 20.49 ? 58  GLY A C     1 
ATOM   459  O  O     . GLY A 1 60  ? 14.125  -12.824 13.497  1.00 20.97 ? 58  GLY A O     1 
ATOM   460  N  N     . ILE A 1 61  ? 12.912  -10.936 13.640  1.00 19.83 ? 59  ILE A N     1 
ATOM   461  C  CA    . ILE A 1 61  ? 11.643  -11.646 13.761  1.00 20.80 ? 59  ILE A CA    1 
ATOM   462  C  C     . ILE A 1 61  ? 10.686  -11.198 12.661  1.00 19.76 ? 59  ILE A C     1 
ATOM   463  O  O     . ILE A 1 61  ? 10.344  -10.019 12.572  1.00 19.53 ? 59  ILE A O     1 
ATOM   464  C  CB    . ILE A 1 61  ? 10.976  -11.382 15.135  1.00 23.22 ? 59  ILE A CB    1 
ATOM   465  C  CG1   . ILE A 1 61  ? 11.963  -11.661 16.276  1.00 24.86 ? 59  ILE A CG1   1 
ATOM   466  C  CG2   . ILE A 1 61  ? 9.745   -12.266 15.284  1.00 23.89 ? 59  ILE A CG2   1 
ATOM   467  C  CD1   . ILE A 1 61  ? 12.934  -10.534 16.552  1.00 28.80 ? 59  ILE A CD1   1 
ATOM   468  N  N     . ALA A 1 62  ? 10.252  -12.144 11.830  1.00 20.12 ? 60  ALA A N     1 
ATOM   469  C  CA    . ALA A 1 62  ? 9.340   -11.842 10.728  1.00 21.00 ? 60  ALA A CA    1 
ATOM   470  C  C     . ALA A 1 62  ? 7.993   -12.552 10.874  1.00 22.74 ? 60  ALA A C     1 
ATOM   471  O  O     . ALA A 1 62  ? 7.883   -13.558 11.576  1.00 21.85 ? 60  ALA A O     1 
ATOM   472  C  CB    . ALA A 1 62  ? 9.985   -12.232 9.401   1.00 21.90 ? 60  ALA A CB    1 
ATOM   473  N  N     . GLY A 1 63  ? 6.980   -12.019 10.197  1.00 23.81 ? 61  GLY A N     1 
ATOM   474  C  CA    . GLY A 1 63  ? 5.651   -12.606 10.245  1.00 24.84 ? 61  GLY A CA    1 
ATOM   475  C  C     . GLY A 1 63  ? 5.532   -13.834 9.360   1.00 26.52 ? 61  GLY A C     1 
ATOM   476  O  O     . GLY A 1 63  ? 6.088   -13.888 8.262   1.00 26.34 ? 61  GLY A O     1 
ATOM   477  N  N     . SER A 1 64  ? 4.784   -14.824 9.830   1.00 27.89 ? 62  SER A N     1 
ATOM   478  C  CA    . SER A 1 64  ? 4.610   -16.063 9.085   1.00 28.89 ? 62  SER A CA    1 
ATOM   479  C  C     . SER A 1 64  ? 3.730   -15.949 7.845   1.00 28.40 ? 62  SER A C     1 
ATOM   480  O  O     . SER A 1 64  ? 4.004   -16.580 6.823   1.00 28.18 ? 62  SER A O     1 
ATOM   481  C  CB    . SER A 1 64  ? 4.010   -17.134 9.997   1.00 29.00 ? 62  SER A CB    1 
ATOM   482  O  OG    . SER A 1 64  ? 2.704   -16.761 10.414  1.00 29.11 ? 62  SER A OG    1 
ATOM   483  N  N     . ASP A 1 65  ? 2.679   -15.140 7.939   1.00 29.01 ? 63  ASP A N     1 
ATOM   484  C  CA    . ASP A 1 65  ? 1.710   -15.005 6.855   1.00 29.16 ? 63  ASP A CA    1 
ATOM   485  C  C     . ASP A 1 65  ? 2.166   -14.481 5.496   1.00 29.37 ? 63  ASP A C     1 
ATOM   486  O  O     . ASP A 1 65  ? 1.503   -14.729 4.488   1.00 28.35 ? 63  ASP A O     1 
ATOM   487  C  CB    . ASP A 1 65  ? 0.500   -14.212 7.355   1.00 30.71 ? 63  ASP A CB    1 
ATOM   488  C  CG    . ASP A 1 65  ? -0.135  -14.850 8.579   1.00 31.73 ? 63  ASP A CG    1 
ATOM   489  O  OD1   . ASP A 1 65  ? 0.083   -16.061 8.789   1.00 33.37 ? 63  ASP A OD1   1 
ATOM   490  O  OD2   . ASP A 1 65  ? -0.853  -14.153 9.327   1.00 33.44 ? 63  ASP A OD2   1 
ATOM   491  N  N     . ASN A 1 66  ? 3.277   -13.752 5.450   1.00 27.26 ? 64  ASN A N     1 
ATOM   492  C  CA    . ASN A 1 66  ? 3.787   -13.275 4.169   1.00 26.68 ? 64  ASN A CA    1 
ATOM   493  C  C     . ASN A 1 66  ? 5.289   -13.530 4.118   1.00 25.58 ? 64  ASN A C     1 
ATOM   494  O  O     . ASN A 1 66  ? 6.045   -12.772 3.514   1.00 25.55 ? 64  ASN A O     1 
ATOM   495  C  CB    . ASN A 1 66  ? 3.480   -11.787 3.962   1.00 26.62 ? 64  ASN A CB    1 
ATOM   496  C  CG    . ASN A 1 66  ? 4.055   -10.909 5.050   1.00 26.74 ? 64  ASN A CG    1 
ATOM   497  O  OD1   . ASN A 1 66  ? 4.705   -11.390 5.979   1.00 26.96 ? 64  ASN A OD1   1 
ATOM   498  N  ND2   . ASN A 1 66  ? 3.814   -9.609  4.943   1.00 25.36 ? 64  ASN A ND2   1 
ATOM   499  N  N     . LEU A 1 67  ? 5.699   -14.627 4.747   1.00 26.90 ? 65  LEU A N     1 
ATOM   500  C  CA    . LEU A 1 67  ? 7.100   -15.026 4.812   1.00 26.42 ? 65  LEU A CA    1 
ATOM   501  C  C     . LEU A 1 67  ? 7.697   -15.322 3.436   1.00 28.16 ? 65  LEU A C     1 
ATOM   502  O  O     . LEU A 1 67  ? 8.824   -14.918 3.150   1.00 27.47 ? 65  LEU A O     1 
ATOM   503  C  CB    . LEU A 1 67  ? 7.244   -16.255 5.710   1.00 25.56 ? 65  LEU A CB    1 
ATOM   504  C  CG    . LEU A 1 67  ? 8.639   -16.609 6.228   1.00 24.07 ? 65  LEU A CG    1 
ATOM   505  C  CD1   . LEU A 1 67  ? 9.140   -15.494 7.140   1.00 24.05 ? 65  LEU A CD1   1 
ATOM   506  C  CD2   . LEU A 1 67  ? 8.576   -17.928 6.993   1.00 26.18 ? 65  LEU A CD2   1 
ATOM   507  N  N     . ASP A 1 68  ? 6.954   -16.029 2.586   1.00 27.25 ? 66  ASP A N     1 
ATOM   508  C  CA    . ASP A 1 68  ? 7.457   -16.349 1.253   1.00 28.02 ? 66  ASP A CA    1 
ATOM   509  C  C     . ASP A 1 68  ? 7.780   -15.082 0.467   1.00 27.34 ? 66  ASP A C     1 
ATOM   510  O  O     . ASP A 1 68  ? 8.776   -15.026 -0.250  1.00 28.27 ? 66  ASP A O     1 
ATOM   511  C  CB    . ASP A 1 68  ? 6.438   -17.179 0.462   1.00 31.87 ? 66  ASP A CB    1 
ATOM   512  C  CG    . ASP A 1 68  ? 6.220   -18.559 1.051   1.00 35.31 ? 66  ASP A CG    1 
ATOM   513  O  OD1   . ASP A 1 68  ? 7.214   -19.220 1.421   1.00 38.41 ? 66  ASP A OD1   1 
ATOM   514  O  OD2   . ASP A 1 68  ? 5.051   -18.991 1.129   1.00 39.45 ? 66  ASP A OD2   1 
ATOM   515  N  N     . LYS A 1 69  ? 6.932   -14.069 0.605   1.00 26.81 ? 67  LYS A N     1 
ATOM   516  C  CA    . LYS A 1 69  ? 7.121   -12.803 -0.099  1.00 26.90 ? 67  LYS A CA    1 
ATOM   517  C  C     . LYS A 1 69  ? 8.398   -12.123 0.375   1.00 25.64 ? 67  LYS A C     1 
ATOM   518  O  O     . LYS A 1 69  ? 9.216   -11.683 -0.434  1.00 25.58 ? 67  LYS A O     1 
ATOM   519  C  CB    . LYS A 1 69  ? 5.926   -11.880 0.151   1.00 28.59 ? 67  LYS A CB    1 
ATOM   520  C  CG    . LYS A 1 69  ? 5.921   -10.603 -0.673  1.00 32.72 ? 67  LYS A CG    1 
ATOM   521  C  CD    . LYS A 1 69  ? 4.754   -9.710  -0.265  1.00 36.31 ? 67  LYS A CD    1 
ATOM   522  C  CE    . LYS A 1 69  ? 4.605   -8.511  -1.190  1.00 39.09 ? 67  LYS A CE    1 
ATOM   523  N  NZ    . LYS A 1 69  ? 4.169   -8.910  -2.559  1.00 39.36 ? 67  LYS A NZ    1 
ATOM   524  N  N     . LEU A 1 70  ? 8.559   -12.036 1.692   1.00 24.00 ? 68  LEU A N     1 
ATOM   525  C  CA    . LEU A 1 70  ? 9.745   -11.419 2.271   1.00 23.41 ? 68  LEU A CA    1 
ATOM   526  C  C     . LEU A 1 70  ? 11.003  -12.148 1.813   1.00 23.57 ? 68  LEU A C     1 
ATOM   527  O  O     . LEU A 1 70  ? 11.974  -11.517 1.391   1.00 22.93 ? 68  LEU A O     1 
ATOM   528  C  CB    . LEU A 1 70  ? 9.671   -11.446 3.800   1.00 22.92 ? 68  LEU A CB    1 
ATOM   529  C  CG    . LEU A 1 70  ? 10.947  -10.998 4.532   1.00 22.30 ? 68  LEU A CG    1 
ATOM   530  C  CD1   . LEU A 1 70  ? 11.238  -9.545  4.211   1.00 23.02 ? 68  LEU A CD1   1 
ATOM   531  C  CD2   . LEU A 1 70  ? 10.782  -11.187 6.033   1.00 21.99 ? 68  LEU A CD2   1 
ATOM   532  N  N     . TYR A 1 71  ? 10.980  -13.477 1.896   1.00 23.72 ? 69  TYR A N     1 
ATOM   533  C  CA    . TYR A 1 71  ? 12.125  -14.288 1.498   1.00 24.80 ? 69  TYR A CA    1 
ATOM   534  C  C     . TYR A 1 71  ? 12.455  -14.139 0.021   1.00 25.12 ? 69  TYR A C     1 
ATOM   535  O  O     . TYR A 1 71  ? 13.621  -14.179 -0.362  1.00 26.20 ? 69  TYR A O     1 
ATOM   536  C  CB    . TYR A 1 71  ? 11.880  -15.765 1.834   1.00 24.86 ? 69  TYR A CB    1 
ATOM   537  C  CG    . TYR A 1 71  ? 11.972  -16.096 3.313   1.00 25.13 ? 69  TYR A CG    1 
ATOM   538  C  CD1   . TYR A 1 71  ? 12.224  -15.104 4.265   1.00 25.36 ? 69  TYR A CD1   1 
ATOM   539  C  CD2   . TYR A 1 71  ? 11.825  -17.408 3.758   1.00 24.54 ? 69  TYR A CD2   1 
ATOM   540  C  CE1   . TYR A 1 71  ? 12.327  -15.416 5.625   1.00 25.19 ? 69  TYR A CE1   1 
ATOM   541  C  CE2   . TYR A 1 71  ? 11.925  -17.730 5.111   1.00 25.08 ? 69  TYR A CE2   1 
ATOM   542  C  CZ    . TYR A 1 71  ? 12.176  -16.730 6.038   1.00 24.77 ? 69  TYR A CZ    1 
ATOM   543  O  OH    . TYR A 1 71  ? 12.274  -17.049 7.373   1.00 26.81 ? 69  TYR A OH    1 
ATOM   544  N  N     . ALA A 1 72  ? 11.430  -13.968 -0.809  1.00 25.80 ? 70  ALA A N     1 
ATOM   545  C  CA    . ALA A 1 72  ? 11.642  -13.800 -2.240  1.00 26.09 ? 70  ALA A CA    1 
ATOM   546  C  C     . ALA A 1 72  ? 12.384  -12.490 -2.487  1.00 25.93 ? 70  ALA A C     1 
ATOM   547  O  O     . ALA A 1 72  ? 13.275  -12.423 -3.335  1.00 25.64 ? 70  ALA A O     1 
ATOM   548  C  CB    . ALA A 1 72  ? 10.306  -13.796 -2.975  1.00 27.56 ? 70  ALA A CB    1 
ATOM   549  N  N     . ILE A 1 73  ? 12.008  -11.452 -1.745  1.00 24.79 ? 71  ILE A N     1 
ATOM   550  C  CA    . ILE A 1 73  ? 12.651  -10.150 -1.872  1.00 24.71 ? 71  ILE A CA    1 
ATOM   551  C  C     . ILE A 1 73  ? 14.105  -10.251 -1.403  1.00 24.59 ? 71  ILE A C     1 
ATOM   552  O  O     . ILE A 1 73  ? 15.011  -9.712  -2.038  1.00 23.98 ? 71  ILE A O     1 
ATOM   553  C  CB    . ILE A 1 73  ? 11.921  -9.083  -1.026  1.00 25.02 ? 71  ILE A CB    1 
ATOM   554  C  CG1   . ILE A 1 73  ? 10.513  -8.846  -1.586  1.00 24.80 ? 71  ILE A CG1   1 
ATOM   555  C  CG2   . ILE A 1 73  ? 12.723  -7.785  -1.014  1.00 24.67 ? 71  ILE A CG2   1 
ATOM   556  C  CD1   . ILE A 1 73  ? 9.661   -7.924  -0.736  1.00 23.71 ? 71  ILE A CD1   1 
ATOM   557  N  N     . LEU A 1 74  ? 14.317  -10.950 -0.289  1.00 23.76 ? 72  LEU A N     1 
ATOM   558  C  CA    . LEU A 1 74  ? 15.655  -11.127 0.258   1.00 24.17 ? 72  LEU A CA    1 
ATOM   559  C  C     . LEU A 1 74  ? 16.561  -11.873 -0.714  1.00 25.63 ? 72  LEU A C     1 
ATOM   560  O  O     . LEU A 1 74  ? 17.751  -11.573 -0.818  1.00 23.08 ? 72  LEU A O     1 
ATOM   561  C  CB    . LEU A 1 74  ? 15.592  -11.871 1.597   1.00 23.19 ? 72  LEU A CB    1 
ATOM   562  C  CG    . LEU A 1 74  ? 14.919  -11.093 2.730   1.00 24.33 ? 72  LEU A CG    1 
ATOM   563  C  CD1   . LEU A 1 74  ? 14.991  -11.884 4.020   1.00 24.88 ? 72  LEU A CD1   1 
ATOM   564  C  CD2   . LEU A 1 74  ? 15.605  -9.741  2.901   1.00 25.74 ? 72  LEU A CD2   1 
ATOM   565  N  N     . LYS A 1 75  ? 16.008  -12.842 -1.437  1.00 24.35 ? 73  LYS A N     1 
ATOM   566  C  CA    . LYS A 1 75  ? 16.829  -13.576 -2.387  1.00 26.37 ? 73  LYS A CA    1 
ATOM   567  C  C     . LYS A 1 75  ? 17.216  -12.657 -3.543  1.00 26.70 ? 73  LYS A C     1 
ATOM   568  O  O     . LYS A 1 75  ? 18.321  -12.757 -4.073  1.00 28.85 ? 73  LYS A O     1 
ATOM   569  C  CB    . LYS A 1 75  ? 16.094  -14.810 -2.918  1.00 26.93 ? 73  LYS A CB    1 
ATOM   570  C  CG    . LYS A 1 75  ? 17.024  -15.773 -3.646  1.00 30.87 ? 73  LYS A CG    1 
ATOM   571  C  CD    . LYS A 1 75  ? 16.362  -17.095 -3.996  1.00 34.69 ? 73  LYS A CD    1 
ATOM   572  C  CE    . LYS A 1 75  ? 15.500  -16.980 -5.237  1.00 36.17 ? 73  LYS A CE    1 
ATOM   573  N  NZ    . LYS A 1 75  ? 15.100  -18.326 -5.737  1.00 39.15 ? 73  LYS A NZ    1 
ATOM   574  N  N     . GLU A 1 76  ? 16.306  -11.761 -3.919  1.00 27.70 ? 74  GLU A N     1 
ATOM   575  C  CA    . GLU A 1 76  ? 16.548  -10.815 -5.007  1.00 29.25 ? 74  GLU A CA    1 
ATOM   576  C  C     . GLU A 1 76  ? 17.645  -9.827  -4.618  1.00 28.76 ? 74  GLU A C     1 
ATOM   577  O  O     . GLU A 1 76  ? 18.294  -9.235  -5.485  1.00 29.81 ? 74  GLU A O     1 
ATOM   578  C  CB    . GLU A 1 76  ? 15.266  -10.043 -5.345  1.00 32.26 ? 74  GLU A CB    1 
ATOM   579  C  CG    . GLU A 1 76  ? 14.061  -10.932 -5.631  1.00 38.61 ? 74  GLU A CG    1 
ATOM   580  C  CD    . GLU A 1 76  ? 12.813  -10.153 -6.022  1.00 42.03 ? 74  GLU A CD    1 
ATOM   581  O  OE1   . GLU A 1 76  ? 12.485  -9.158  -5.341  1.00 43.32 ? 74  GLU A OE1   1 
ATOM   582  O  OE2   . GLU A 1 76  ? 12.150  -10.546 -7.006  1.00 44.57 ? 74  GLU A OE2   1 
ATOM   583  N  N     . LYS A 1 77  ? 17.847  -9.656  -3.314  1.00 27.15 ? 75  LYS A N     1 
ATOM   584  C  CA    . LYS A 1 77  ? 18.867  -8.742  -2.806  1.00 27.39 ? 75  LYS A CA    1 
ATOM   585  C  C     . LYS A 1 77  ? 20.117  -9.497  -2.362  1.00 26.60 ? 75  LYS A C     1 
ATOM   586  O  O     . LYS A 1 77  ? 21.073  -8.891  -1.879  1.00 26.08 ? 75  LYS A O     1 
ATOM   587  C  CB    . LYS A 1 77  ? 18.321  -7.933  -1.622  1.00 28.78 ? 75  LYS A CB    1 
ATOM   588  C  CG    . LYS A 1 77  ? 17.008  -7.207  -1.886  1.00 31.53 ? 75  LYS A CG    1 
ATOM   589  C  CD    . LYS A 1 77  ? 17.122  -6.205  -3.020  1.00 34.94 ? 75  LYS A CD    1 
ATOM   590  C  CE    . LYS A 1 77  ? 15.784  -5.525  -3.278  1.00 35.94 ? 75  LYS A CE    1 
ATOM   591  N  NZ    . LYS A 1 77  ? 15.853  -4.582  -4.427  1.00 39.49 ? 75  LYS A NZ    1 
ATOM   592  N  N     . HIS A 1 78  ? 20.102  -10.820 -2.522  1.00 25.26 ? 76  HIS A N     1 
ATOM   593  C  CA    . HIS A 1 78  ? 21.234  -11.665 -2.146  1.00 25.66 ? 76  HIS A CA    1 
ATOM   594  C  C     . HIS A 1 78  ? 21.537  -11.586 -0.651  1.00 23.89 ? 76  HIS A C     1 
ATOM   595  O  O     . HIS A 1 78  ? 22.695  -11.623 -0.230  1.00 23.52 ? 76  HIS A O     1 
ATOM   596  C  CB    . HIS A 1 78  ? 22.471  -11.266 -2.956  1.00 28.73 ? 76  HIS A CB    1 
ATOM   597  C  CG    . HIS A 1 78  ? 22.282  -11.397 -4.435  1.00 32.73 ? 76  HIS A CG    1 
ATOM   598  N  ND1   . HIS A 1 78  ? 22.107  -12.615 -5.055  1.00 35.81 ? 76  HIS A ND1   1 
ATOM   599  C  CD2   . HIS A 1 78  ? 22.200  -10.462 -5.411  1.00 35.08 ? 76  HIS A CD2   1 
ATOM   600  C  CE1   . HIS A 1 78  ? 21.924  -12.425 -6.350  1.00 35.69 ? 76  HIS A CE1   1 
ATOM   601  N  NE2   . HIS A 1 78  ? 21.976  -11.128 -6.592  1.00 36.07 ? 76  HIS A NE2   1 
ATOM   602  N  N     . ILE A 1 79  ? 20.479  -11.489 0.146   1.00 21.72 ? 77  ILE A N     1 
ATOM   603  C  CA    . ILE A 1 79  ? 20.613  -11.410 1.594   1.00 19.69 ? 77  ILE A CA    1 
ATOM   604  C  C     . ILE A 1 79  ? 20.338  -12.769 2.227   1.00 21.15 ? 77  ILE A C     1 
ATOM   605  O  O     . ILE A 1 79  ? 19.236  -13.312 2.093   1.00 21.93 ? 77  ILE A O     1 
ATOM   606  C  CB    . ILE A 1 79  ? 19.627  -10.368 2.182   1.00 19.82 ? 77  ILE A CB    1 
ATOM   607  C  CG1   . ILE A 1 79  ? 19.969  -8.975  1.645   1.00 20.06 ? 77  ILE A CG1   1 
ATOM   608  C  CG2   . ILE A 1 79  ? 19.672  -10.395 3.709   1.00 21.21 ? 77  ILE A CG2   1 
ATOM   609  C  CD1   . ILE A 1 79  ? 18.934  -7.920  1.967   1.00 18.10 ? 77  ILE A CD1   1 
ATOM   610  N  N     . ASN A 1 80  ? 21.352  -13.331 2.878   1.00 19.92 ? 78  ASN A N     1 
ATOM   611  C  CA    . ASN A 1 80  ? 21.202  -14.606 3.566   1.00 21.02 ? 78  ASN A CA    1 
ATOM   612  C  C     . ASN A 1 80  ? 20.625  -14.286 4.934   1.00 21.56 ? 78  ASN A C     1 
ATOM   613  O  O     . ASN A 1 80  ? 20.970  -13.264 5.541   1.00 21.64 ? 78  ASN A O     1 
ATOM   614  C  CB    . ASN A 1 80  ? 22.547  -15.315 3.704   1.00 23.85 ? 78  ASN A CB    1 
ATOM   615  C  CG    . ASN A 1 80  ? 23.067  -15.826 2.378   1.00 28.23 ? 78  ASN A CG    1 
ATOM   616  O  OD1   . ASN A 1 80  ? 22.372  -16.554 1.668   1.00 30.01 ? 78  ASN A OD1   1 
ATOM   617  N  ND2   . ASN A 1 80  ? 24.293  -15.451 2.035   1.00 31.78 ? 78  ASN A ND2   1 
ATOM   618  N  N     . HIS A 1 81  ? 19.760  -15.163 5.429   1.00 21.06 ? 79  HIS A N     1 
ATOM   619  C  CA    . HIS A 1 81  ? 19.099  -14.912 6.698   1.00 21.25 ? 79  HIS A CA    1 
ATOM   620  C  C     . HIS A 1 81  ? 18.780  -16.161 7.503   1.00 21.66 ? 79  HIS A C     1 
ATOM   621  O  O     . HIS A 1 81  ? 18.873  -17.282 7.006   1.00 22.74 ? 79  HIS A O     1 
ATOM   622  C  CB    . HIS A 1 81  ? 17.792  -14.168 6.424   1.00 20.91 ? 79  HIS A CB    1 
ATOM   623  C  CG    . HIS A 1 81  ? 16.902  -14.870 5.442   1.00 23.23 ? 79  HIS A CG    1 
ATOM   624  N  ND1   . HIS A 1 81  ? 17.054  -14.749 4.077   1.00 24.08 ? 79  HIS A ND1   1 
ATOM   625  C  CD2   . HIS A 1 81  ? 15.880  -15.738 5.629   1.00 22.62 ? 79  HIS A CD2   1 
ATOM   626  C  CE1   . HIS A 1 81  ? 16.162  -15.509 3.467   1.00 24.71 ? 79  HIS A CE1   1 
ATOM   627  N  NE2   . HIS A 1 81  ? 15.438  -16.121 4.386   1.00 24.75 ? 79  HIS A NE2   1 
ATOM   628  N  N     . ASP A 1 82  ? 18.412  -15.937 8.759   1.00 22.32 ? 80  ASP A N     1 
ATOM   629  C  CA    . ASP A 1 82  ? 18.003  -16.991 9.675   1.00 22.08 ? 80  ASP A CA    1 
ATOM   630  C  C     . ASP A 1 82  ? 17.053  -16.316 10.659  1.00 23.11 ? 80  ASP A C     1 
ATOM   631  O  O     . ASP A 1 82  ? 17.331  -16.201 11.855  1.00 24.29 ? 80  ASP A O     1 
ATOM   632  C  CB    . ASP A 1 82  ? 19.199  -17.604 10.410  1.00 22.44 ? 80  ASP A CB    1 
ATOM   633  C  CG    . ASP A 1 82  ? 18.819  -18.861 11.172  1.00 22.88 ? 80  ASP A CG    1 
ATOM   634  O  OD1   . ASP A 1 82  ? 17.661  -19.305 11.022  1.00 25.71 ? 80  ASP A OD1   1 
ATOM   635  O  OD2   . ASP A 1 82  ? 19.660  -19.407 11.911  1.00 26.92 ? 80  ASP A OD2   1 
ATOM   636  N  N     . PHE A 1 83  ? 15.934  -15.846 10.116  1.00 23.02 ? 81  PHE A N     1 
ATOM   637  C  CA    . PHE A 1 83  ? 14.902  -15.152 10.877  1.00 23.94 ? 81  PHE A CA    1 
ATOM   638  C  C     . PHE A 1 83  ? 14.066  -16.072 11.753  1.00 25.36 ? 81  PHE A C     1 
ATOM   639  O  O     . PHE A 1 83  ? 13.851  -17.240 11.424  1.00 26.12 ? 81  PHE A O     1 
ATOM   640  C  CB    . PHE A 1 83  ? 13.958  -14.423 9.911   1.00 25.68 ? 81  PHE A CB    1 
ATOM   641  C  CG    . PHE A 1 83  ? 14.402  -13.036 9.542   1.00 26.46 ? 81  PHE A CG    1 
ATOM   642  C  CD1   . PHE A 1 83  ? 14.048  -11.949 10.332  1.00 28.82 ? 81  PHE A CD1   1 
ATOM   643  C  CD2   . PHE A 1 83  ? 15.176  -12.813 8.407   1.00 30.35 ? 81  PHE A CD2   1 
ATOM   644  C  CE1   . PHE A 1 83  ? 14.455  -10.657 9.999   1.00 28.22 ? 81  PHE A CE1   1 
ATOM   645  C  CE2   . PHE A 1 83  ? 15.587  -11.524 8.066   1.00 28.08 ? 81  PHE A CE2   1 
ATOM   646  C  CZ    . PHE A 1 83  ? 15.226  -10.446 8.866   1.00 28.89 ? 81  PHE A CZ    1 
ATOM   647  N  N     . LEU A 1 84  ? 13.606  -15.541 12.878  1.00 23.83 ? 82  LEU A N     1 
ATOM   648  C  CA    . LEU A 1 84  ? 12.723  -16.294 13.752  1.00 25.30 ? 82  LEU A CA    1 
ATOM   649  C  C     . LEU A 1 84  ? 11.367  -15.930 13.169  1.00 25.01 ? 82  LEU A C     1 
ATOM   650  O  O     . LEU A 1 84  ? 11.220  -14.867 12.566  1.00 23.23 ? 82  LEU A O     1 
ATOM   651  C  CB    . LEU A 1 84  ? 12.822  -15.805 15.199  1.00 25.21 ? 82  LEU A CB    1 
ATOM   652  C  CG    . LEU A 1 84  ? 14.129  -16.095 15.937  1.00 26.60 ? 82  LEU A CG    1 
ATOM   653  C  CD1   . LEU A 1 84  ? 14.057  -15.513 17.339  1.00 27.37 ? 82  LEU A CD1   1 
ATOM   654  C  CD2   . LEU A 1 84  ? 14.368  -17.600 15.991  1.00 27.29 ? 82  LEU A CD2   1 
ATOM   655  N  N     . VAL A 1 85  ? 10.377  -16.796 13.330  1.00 25.27 ? 83  VAL A N     1 
ATOM   656  C  CA    . VAL A 1 85  ? 9.067   -16.506 12.770  1.00 26.19 ? 83  VAL A CA    1 
ATOM   657  C  C     . VAL A 1 85  ? 7.978   -16.380 13.828  1.00 26.53 ? 83  VAL A C     1 
ATOM   658  O  O     . VAL A 1 85  ? 7.900   -17.190 14.750  1.00 27.71 ? 83  VAL A O     1 
ATOM   659  C  CB    . VAL A 1 85  ? 8.657   -17.591 11.755  1.00 27.08 ? 83  VAL A CB    1 
ATOM   660  C  CG1   . VAL A 1 85  ? 7.276   -17.285 11.199  1.00 27.79 ? 83  VAL A CG1   1 
ATOM   661  C  CG2   . VAL A 1 85  ? 9.684   -17.665 10.632  1.00 27.10 ? 83  VAL A CG2   1 
ATOM   662  N  N     . GLU A 1 86  ? 7.148   -15.351 13.684  1.00 27.36 ? 84  GLU A N     1 
ATOM   663  C  CA    . GLU A 1 86  ? 6.042   -15.098 14.602  1.00 27.61 ? 84  GLU A CA    1 
ATOM   664  C  C     . GLU A 1 86  ? 4.766   -15.601 13.926  1.00 28.36 ? 84  GLU A C     1 
ATOM   665  O  O     . GLU A 1 86  ? 4.308   -15.030 12.933  1.00 26.84 ? 84  GLU A O     1 
ATOM   666  C  CB    . GLU A 1 86  ? 5.936   -13.599 14.887  1.00 28.81 ? 84  GLU A CB    1 
ATOM   667  C  CG    . GLU A 1 86  ? 4.952   -13.221 15.983  1.00 31.10 ? 84  GLU A CG    1 
ATOM   668  C  CD    . GLU A 1 86  ? 5.374   -13.735 17.343  1.00 33.64 ? 84  GLU A CD    1 
ATOM   669  O  OE1   . GLU A 1 86  ? 6.527   -13.474 17.742  1.00 32.41 ? 84  GLU A OE1   1 
ATOM   670  O  OE2   . GLU A 1 86  ? 4.551   -14.395 18.014  1.00 35.59 ? 84  GLU A OE2   1 
ATOM   671  N  N     . ALA A 1 87  ? 4.202   -16.678 14.465  1.00 28.88 ? 85  ALA A N     1 
ATOM   672  C  CA    . ALA A 1 87  ? 2.995   -17.281 13.906  1.00 29.45 ? 85  ALA A CA    1 
ATOM   673  C  C     . ALA A 1 87  ? 1.770   -16.375 13.967  1.00 29.80 ? 85  ALA A C     1 
ATOM   674  O  O     . ALA A 1 87  ? 1.603   -15.596 14.905  1.00 30.13 ? 85  ALA A O     1 
ATOM   675  C  CB    . ALA A 1 87  ? 2.701   -18.595 14.621  1.00 30.00 ? 85  ALA A CB    1 
ATOM   676  N  N     . GLY A 1 88  ? 0.923   -16.483 12.947  1.00 30.89 ? 86  GLY A N     1 
ATOM   677  C  CA    . GLY A 1 88  ? -0.301  -15.701 12.888  1.00 31.31 ? 86  GLY A CA    1 
ATOM   678  C  C     . GLY A 1 88  ? -0.169  -14.203 12.696  1.00 31.92 ? 86  GLY A C     1 
ATOM   679  O  O     . GLY A 1 88  ? -1.106  -13.460 12.985  1.00 32.63 ? 86  GLY A O     1 
ATOM   680  N  N     . THR A 1 89  ? 0.982   -13.748 12.212  1.00 30.51 ? 87  THR A N     1 
ATOM   681  C  CA    . THR A 1 89  ? 1.195   -12.323 11.987  1.00 29.23 ? 87  THR A CA    1 
ATOM   682  C  C     . THR A 1 89  ? 1.817   -12.114 10.613  1.00 26.53 ? 87  THR A C     1 
ATOM   683  O  O     . THR A 1 89  ? 2.286   -13.059 9.986   1.00 26.05 ? 87  THR A O     1 
ATOM   684  C  CB    . THR A 1 89  ? 2.151   -11.714 13.041  1.00 30.21 ? 87  THR A CB    1 
ATOM   685  O  OG1   . THR A 1 89  ? 3.473   -12.228 12.840  1.00 31.81 ? 87  THR A OG1   1 
ATOM   686  C  CG2   . THR A 1 89  ? 1.699   -12.067 14.446  1.00 31.31 ? 87  THR A CG2   1 
ATOM   687  N  N     . SER A 1 90  ? 1.816   -10.868 10.156  1.00 26.61 ? 88  SER A N     1 
ATOM   688  C  CA    . SER A 1 90  ? 2.396   -10.517 8.866   1.00 26.41 ? 88  SER A CA    1 
ATOM   689  C  C     . SER A 1 90  ? 3.467   -9.449  9.056   1.00 25.85 ? 88  SER A C     1 
ATOM   690  O  O     . SER A 1 90  ? 3.313   -8.541  9.876   1.00 25.60 ? 88  SER A O     1 
ATOM   691  C  CB    . SER A 1 90  ? 1.320   -9.974  7.919   1.00 28.02 ? 88  SER A CB    1 
ATOM   692  O  OG    . SER A 1 90  ? 0.386   -10.977 7.560   1.00 31.23 ? 88  SER A OG    1 
ATOM   693  N  N     . THR A 1 91  ? 4.563   -9.574  8.317   1.00 25.09 ? 89  THR A N     1 
ATOM   694  C  CA    . THR A 1 91  ? 5.617   -8.577  8.390   1.00 25.29 ? 89  THR A CA    1 
ATOM   695  C  C     . THR A 1 91  ? 4.974   -7.310  7.853   1.00 24.77 ? 89  THR A C     1 
ATOM   696  O  O     . THR A 1 91  ? 4.298   -7.341  6.820   1.00 26.24 ? 89  THR A O     1 
ATOM   697  C  CB    . THR A 1 91  ? 6.815   -8.952  7.502   1.00 24.84 ? 89  THR A CB    1 
ATOM   698  O  OG1   . THR A 1 91  ? 7.505   -10.063 8.082   1.00 24.88 ? 89  THR A OG1   1 
ATOM   699  C  CG2   . THR A 1 91  ? 7.775   -7.767  7.360   1.00 25.16 ? 89  THR A CG2   1 
ATOM   700  N  N     . ARG A 1 92  ? 5.173   -6.206  8.561   1.00 23.12 ? 90  ARG A N     1 
ATOM   701  C  CA    . ARG A 1 92  ? 4.605   -4.921  8.171   1.00 23.69 ? 90  ARG A CA    1 
ATOM   702  C  C     . ARG A 1 92  ? 5.002   -4.485  6.764   1.00 24.88 ? 90  ARG A C     1 
ATOM   703  O  O     . ARG A 1 92  ? 6.051   -4.868  6.251   1.00 24.12 ? 90  ARG A O     1 
ATOM   704  C  CB    . ARG A 1 92  ? 5.040   -3.849  9.168   1.00 23.14 ? 90  ARG A CB    1 
ATOM   705  C  CG    . ARG A 1 92  ? 6.511   -3.477  9.047   1.00 21.56 ? 90  ARG A CG    1 
ATOM   706  C  CD    . ARG A 1 92  ? 7.010   -2.804  10.317  1.00 19.76 ? 90  ARG A CD    1 
ATOM   707  N  NE    . ARG A 1 92  ? 8.408   -2.393  10.193  1.00 19.93 ? 90  ARG A NE    1 
ATOM   708  C  CZ    . ARG A 1 92  ? 8.809   -1.150  9.951   1.00 22.42 ? 90  ARG A CZ    1 
ATOM   709  N  NH1   . ARG A 1 92  ? 7.923   -0.175  9.808   1.00 23.80 ? 90  ARG A NH1   1 
ATOM   710  N  NH2   . ARG A 1 92  ? 10.103  -0.880  9.845   1.00 23.90 ? 90  ARG A NH2   1 
ATOM   711  N  N     . GLU A 1 93  ? 4.144   -3.688  6.136   1.00 27.06 ? 91  GLU A N     1 
ATOM   712  C  CA    . GLU A 1 93  ? 4.426   -3.174  4.806   1.00 29.33 ? 91  GLU A CA    1 
ATOM   713  C  C     . GLU A 1 93  ? 4.561   -1.658  4.891   1.00 30.30 ? 91  GLU A C     1 
ATOM   714  O  O     . GLU A 1 93  ? 3.759   -0.994  5.547   1.00 31.52 ? 91  GLU A O     1 
ATOM   715  C  CB    . GLU A 1 93  ? 3.303   -3.546  3.831   1.00 31.72 ? 91  GLU A CB    1 
ATOM   716  C  CG    . GLU A 1 93  ? 3.762   -4.430  2.679   1.00 35.16 ? 91  GLU A CG    1 
ATOM   717  C  CD    . GLU A 1 93  ? 2.645   -4.767  1.709   1.00 37.56 ? 91  GLU A CD    1 
ATOM   718  O  OE1   . GLU A 1 93  ? 1.571   -5.205  2.172   1.00 39.17 ? 91  GLU A OE1   1 
ATOM   719  O  OE2   . GLU A 1 93  ? 2.844   -4.603  0.485   1.00 39.04 ? 91  GLU A OE2   1 
ATOM   720  N  N     . CYS A 1 94  ? 5.595   -1.118  4.253   1.00 30.04 ? 92  CYS A N     1 
ATOM   721  C  CA    . CYS A 1 94  ? 5.824   0.323   4.244   1.00 30.55 ? 92  CYS A CA    1 
ATOM   722  C  C     . CYS A 1 94  ? 5.613   0.806   2.819   1.00 28.94 ? 92  CYS A C     1 
ATOM   723  O  O     . CYS A 1 94  ? 6.297   0.367   1.894   1.00 29.59 ? 92  CYS A O     1 
ATOM   724  C  CB    . CYS A 1 94  ? 7.249   0.662   4.692   1.00 31.84 ? 92  CYS A CB    1 
ATOM   725  S  SG    . CYS A 1 94  ? 7.652   2.437   4.582   1.00 40.88 ? 92  CYS A SG    1 
ATOM   726  N  N     . PHE A 1 95  ? 4.656   1.706   2.644   1.00 26.00 ? 93  PHE A N     1 
ATOM   727  C  CA    . PHE A 1 95  ? 4.351   2.228   1.327   1.00 26.08 ? 93  PHE A CA    1 
ATOM   728  C  C     . PHE A 1 95  ? 5.166   3.483   1.060   1.00 27.11 ? 93  PHE A C     1 
ATOM   729  O  O     . PHE A 1 95  ? 5.155   4.429   1.846   1.00 28.47 ? 93  PHE A O     1 
ATOM   730  C  CB    . PHE A 1 95  ? 2.848   2.484   1.237   1.00 24.99 ? 93  PHE A CB    1 
ATOM   731  C  CG    . PHE A 1 95  ? 2.029   1.275   1.591   1.00 25.24 ? 93  PHE A CG    1 
ATOM   732  C  CD1   . PHE A 1 95  ? 1.888   0.224   0.684   1.00 24.83 ? 93  PHE A CD1   1 
ATOM   733  C  CD2   . PHE A 1 95  ? 1.487   1.137   2.867   1.00 23.61 ? 93  PHE A CD2   1 
ATOM   734  C  CE1   . PHE A 1 95  ? 1.227   -0.950  1.048   1.00 25.28 ? 93  PHE A CE1   1 
ATOM   735  C  CE2   . PHE A 1 95  ? 0.826   -0.030  3.241   1.00 25.63 ? 93  PHE A CE2   1 
ATOM   736  C  CZ    . PHE A 1 95  ? 0.696   -1.077  2.332   1.00 25.72 ? 93  PHE A CZ    1 
ATOM   737  N  N     . VAL A 1 96  ? 5.896   3.459   -0.047  1.00 26.98 ? 94  VAL A N     1 
ATOM   738  C  CA    . VAL A 1 96  ? 6.746   4.571   -0.443  1.00 27.14 ? 94  VAL A CA    1 
ATOM   739  C  C     . VAL A 1 96  ? 6.270   5.101   -1.790  1.00 27.37 ? 94  VAL A C     1 
ATOM   740  O  O     . VAL A 1 96  ? 6.385   4.420   -2.812  1.00 27.75 ? 94  VAL A O     1 
ATOM   741  C  CB    . VAL A 1 96  ? 8.218   4.118   -0.558  1.00 27.35 ? 94  VAL A CB    1 
ATOM   742  C  CG1   . VAL A 1 96  ? 9.121   5.322   -0.786  1.00 27.41 ? 94  VAL A CG1   1 
ATOM   743  C  CG2   . VAL A 1 96  ? 8.632   3.367   0.703   1.00 27.11 ? 94  VAL A CG2   1 
ATOM   744  N  N     . VAL A 1 97  ? 5.728   6.315   -1.778  1.00 27.05 ? 95  VAL A N     1 
ATOM   745  C  CA    . VAL A 1 97  ? 5.219   6.942   -2.990  1.00 27.41 ? 95  VAL A CA    1 
ATOM   746  C  C     . VAL A 1 97  ? 6.253   7.886   -3.596  1.00 28.10 ? 95  VAL A C     1 
ATOM   747  O  O     . VAL A 1 97  ? 6.673   8.852   -2.959  1.00 28.73 ? 95  VAL A O     1 
ATOM   748  C  CB    . VAL A 1 97  ? 3.929   7.736   -2.691  1.00 27.41 ? 95  VAL A CB    1 
ATOM   749  C  CG1   . VAL A 1 97  ? 3.361   8.319   -3.978  1.00 27.72 ? 95  VAL A CG1   1 
ATOM   750  C  CG2   . VAL A 1 97  ? 2.905   6.827   -2.015  1.00 28.54 ? 95  VAL A CG2   1 
ATOM   751  N  N     . LEU A 1 98  ? 6.662   7.596   -4.826  1.00 28.95 ? 96  LEU A N     1 
ATOM   752  C  CA    . LEU A 1 98  ? 7.639   8.421   -5.529  1.00 30.63 ? 96  LEU A CA    1 
ATOM   753  C  C     . LEU A 1 98  ? 7.292   8.554   -7.007  1.00 31.50 ? 96  LEU A C     1 
ATOM   754  O  O     . LEU A 1 98  ? 6.365   7.908   -7.497  1.00 29.53 ? 96  LEU A O     1 
ATOM   755  C  CB    . LEU A 1 98  ? 9.051   7.841   -5.372  1.00 32.52 ? 96  LEU A CB    1 
ATOM   756  C  CG    . LEU A 1 98  ? 9.238   6.341   -5.121  1.00 33.84 ? 96  LEU A CG    1 
ATOM   757  C  CD1   . LEU A 1 98  ? 8.470   5.518   -6.130  1.00 33.22 ? 96  LEU A CD1   1 
ATOM   758  C  CD2   . LEU A 1 98  ? 10.723  6.014   -5.178  1.00 33.36 ? 96  LEU A CD2   1 
ATOM   759  N  N     . SER A 1 99  ? 8.037   9.400   -7.714  1.00 32.21 ? 97  SER A N     1 
ATOM   760  C  CA    . SER A 1 99  ? 7.794   9.627   -9.133  1.00 33.72 ? 97  SER A CA    1 
ATOM   761  C  C     . SER A 1 99  ? 9.081   9.856   -9.914  1.00 34.65 ? 97  SER A C     1 
ATOM   762  O  O     . SER A 1 99  ? 10.055  10.383  -9.378  1.00 35.72 ? 97  SER A O     1 
ATOM   763  C  CB    . SER A 1 99  ? 6.880   10.841  -9.316  1.00 33.38 ? 97  SER A CB    1 
ATOM   764  O  OG    . SER A 1 99  ? 6.678   11.116  -10.691 1.00 34.82 ? 97  SER A OG    1 
ATOM   765  N  N     . ASP A 1 100 ? 9.084   9.460   -11.184 1.00 36.14 ? 98  ASP A N     1 
ATOM   766  C  CA    . ASP A 1 100 ? 10.257  9.657   -12.026 1.00 38.34 ? 98  ASP A CA    1 
ATOM   767  C  C     . ASP A 1 100 ? 10.342  11.133  -12.393 1.00 39.45 ? 98  ASP A C     1 
ATOM   768  O  O     . ASP A 1 100 ? 11.336  11.585  -12.961 1.00 41.10 ? 98  ASP A O     1 
ATOM   769  C  CB    . ASP A 1 100 ? 10.163  8.826   -13.312 1.00 39.21 ? 98  ASP A CB    1 
ATOM   770  C  CG    . ASP A 1 100 ? 10.207  7.333   -13.052 1.00 40.69 ? 98  ASP A CG    1 
ATOM   771  O  OD1   . ASP A 1 100 ? 10.943  6.908   -12.137 1.00 41.42 ? 98  ASP A OD1   1 
ATOM   772  O  OD2   . ASP A 1 100 ? 9.520   6.581   -13.777 1.00 42.33 ? 98  ASP A OD2   1 
ATOM   773  N  N     . ASP A 1 101 ? 9.294   11.879  -12.053 1.00 39.99 ? 99  ASP A N     1 
ATOM   774  C  CA    . ASP A 1 101 ? 9.223   13.304  -12.358 1.00 41.18 ? 99  ASP A CA    1 
ATOM   775  C  C     . ASP A 1 101 ? 9.702   14.197  -11.218 1.00 40.48 ? 99  ASP A C     1 
ATOM   776  O  O     . ASP A 1 101 ? 10.014  15.366  -11.438 1.00 41.49 ? 99  ASP A O     1 
ATOM   777  C  CB    . ASP A 1 101 ? 7.782   13.697  -12.712 1.00 42.33 ? 99  ASP A CB    1 
ATOM   778  C  CG    . ASP A 1 101 ? 7.165   12.789  -13.760 1.00 44.16 ? 99  ASP A CG    1 
ATOM   779  O  OD1   . ASP A 1 101 ? 7.762   12.636  -14.846 1.00 45.48 ? 99  ASP A OD1   1 
ATOM   780  O  OD2   . ASP A 1 101 ? 6.077   12.233  -13.497 1.00 44.39 ? 99  ASP A OD2   1 
ATOM   781  N  N     . THR A 1 102 ? 9.760   13.654  -10.005 1.00 38.89 ? 100 THR A N     1 
ATOM   782  C  CA    . THR A 1 102 ? 10.176  14.444  -8.849  1.00 37.93 ? 100 THR A CA    1 
ATOM   783  C  C     . THR A 1 102 ? 11.316  13.821  -8.048  1.00 38.02 ? 100 THR A C     1 
ATOM   784  O  O     . THR A 1 102 ? 11.780  12.726  -8.355  1.00 37.70 ? 100 THR A O     1 
ATOM   785  C  CB    . THR A 1 102 ? 8.995   14.675  -7.892  1.00 37.40 ? 100 THR A CB    1 
ATOM   786  O  OG1   . THR A 1 102 ? 8.658   13.443  -7.245  1.00 35.25 ? 100 THR A OG1   1 
ATOM   787  C  CG2   . THR A 1 102 ? 7.778   15.177  -8.663  1.00 38.27 ? 100 THR A CG2   1 
ATOM   788  N  N     . ASN A 1 103 ? 11.750  14.534  -7.011  1.00 38.43 ? 101 ASN A N     1 
ATOM   789  C  CA    . ASN A 1 103 ? 12.843  14.089  -6.152  1.00 40.09 ? 101 ASN A CA    1 
ATOM   790  C  C     . ASN A 1 103 ? 12.373  13.544  -4.805  1.00 40.34 ? 101 ASN A C     1 
ATOM   791  O  O     . ASN A 1 103 ? 13.032  12.700  -4.199  1.00 39.46 ? 101 ASN A O     1 
ATOM   792  C  CB    . ASN A 1 103 ? 13.811  15.250  -5.903  1.00 42.03 ? 101 ASN A CB    1 
ATOM   793  C  CG    . ASN A 1 103 ? 14.572  15.657  -7.151  1.00 43.52 ? 101 ASN A CG    1 
ATOM   794  O  OD1   . ASN A 1 103 ? 15.117  16.760  -7.225  1.00 45.85 ? 101 ASN A OD1   1 
ATOM   795  N  ND2   . ASN A 1 103 ? 14.627  14.765  -8.132  1.00 43.84 ? 101 ASN A ND2   1 
ATOM   796  N  N     . GLY A 1 104 ? 11.230  14.023  -4.334  1.00 39.34 ? 102 GLY A N     1 
ATOM   797  C  CA    . GLY A 1 104 ? 10.736  13.574  -3.048  1.00 40.56 ? 102 GLY A CA    1 
ATOM   798  C  C     . GLY A 1 104 ? 10.350  12.112  -2.930  1.00 40.47 ? 102 GLY A C     1 
ATOM   799  O  O     . GLY A 1 104 ? 10.550  11.308  -3.841  1.00 40.91 ? 102 GLY A O     1 
ATOM   800  N  N     . SER A 1 105 ? 9.807   11.777  -1.766  1.00 39.88 ? 103 SER A N     1 
ATOM   801  C  CA    . SER A 1 105 ? 9.342   10.433  -1.465  1.00 38.05 ? 103 SER A CA    1 
ATOM   802  C  C     . SER A 1 105 ? 8.478   10.559  -0.223  1.00 36.23 ? 103 SER A C     1 
ATOM   803  O  O     . SER A 1 105 ? 8.905   11.126  0.782   1.00 36.61 ? 103 SER A O     1 
ATOM   804  C  CB    . SER A 1 105 ? 10.518  9.490   -1.187  1.00 39.63 ? 103 SER A CB    1 
ATOM   805  O  OG    . SER A 1 105 ? 11.165  9.810   0.032   1.00 43.89 ? 103 SER A OG    1 
ATOM   806  N  N     . THR A 1 106 ? 7.254   10.055  -0.305  1.00 33.03 ? 104 THR A N     1 
ATOM   807  C  CA    . THR A 1 106 ? 6.341   10.105  0.824   1.00 31.71 ? 104 THR A CA    1 
ATOM   808  C  C     . THR A 1 106 ? 6.260   8.702   1.394   1.00 31.71 ? 104 THR A C     1 
ATOM   809  O  O     . THR A 1 106 ? 5.962   7.746   0.681   1.00 31.08 ? 104 THR A O     1 
ATOM   810  C  CB    . THR A 1 106 ? 4.944   10.565  0.393   1.00 30.68 ? 104 THR A CB    1 
ATOM   811  O  OG1   . THR A 1 106 ? 5.039   11.859  -0.216  1.00 31.51 ? 104 THR A OG1   1 
ATOM   812  C  CG2   . THR A 1 106 ? 4.018   10.644  1.594   1.00 29.51 ? 104 THR A CG2   1 
HETATM 813  N  N     . MSE A 1 107 ? 6.529   8.580   2.684   1.00 32.68 ? 105 MSE A N     1 
HETATM 814  C  CA    . MSE A 1 107 ? 6.517   7.279   3.321   1.00 33.15 ? 105 MSE A CA    1 
HETATM 815  C  C     . MSE A 1 107 ? 5.325   7.067   4.245   1.00 30.31 ? 105 MSE A C     1 
HETATM 816  O  O     . MSE A 1 107 ? 5.016   7.899   5.095   1.00 27.72 ? 105 MSE A O     1 
HETATM 817  C  CB    . MSE A 1 107 ? 7.850   7.092   4.036   1.00 39.46 ? 105 MSE A CB    1 
HETATM 818  C  CG    . MSE A 1 107 ? 9.001   7.179   3.036   1.00 48.49 ? 105 MSE A CG    1 
HETATM 819  SE SE    . MSE A 1 107 ? 10.739  7.387   3.803   1.00 58.63 ? 105 MSE A SE    1 
HETATM 820  C  CE    . MSE A 1 107 ? 11.027  5.573   4.394   1.00 58.85 ? 105 MSE A CE    1 
ATOM   821  N  N     . ILE A 1 108 ? 4.655   5.938   4.039   1.00 27.84 ? 106 ILE A N     1 
ATOM   822  C  CA    . ILE A 1 108 ? 3.467   5.550   4.792   1.00 27.68 ? 106 ILE A CA    1 
ATOM   823  C  C     . ILE A 1 108 ? 3.728   4.148   5.345   1.00 27.03 ? 106 ILE A C     1 
ATOM   824  O  O     . ILE A 1 108 ? 3.345   3.142   4.742   1.00 25.89 ? 106 ILE A O     1 
ATOM   825  C  CB    . ILE A 1 108 ? 2.243   5.528   3.852   1.00 26.87 ? 106 ILE A CB    1 
ATOM   826  C  CG1   . ILE A 1 108 ? 2.184   6.840   3.062   1.00 28.80 ? 106 ILE A CG1   1 
ATOM   827  C  CG2   . ILE A 1 108 ? 0.966   5.331   4.649   1.00 26.65 ? 106 ILE A CG2   1 
ATOM   828  C  CD1   . ILE A 1 108 ? 1.203   6.828   1.904   1.00 28.00 ? 106 ILE A CD1   1 
ATOM   829  N  N     . PRO A 1 109 ? 4.386   4.065   6.509   1.00 26.39 ? 107 PRO A N     1 
ATOM   830  C  CA    . PRO A 1 109 ? 4.701   2.771   7.116   1.00 26.12 ? 107 PRO A CA    1 
ATOM   831  C  C     . PRO A 1 109 ? 3.749   2.213   8.168   1.00 25.96 ? 107 PRO A C     1 
ATOM   832  O  O     . PRO A 1 109 ? 3.203   2.951   8.987   1.00 25.12 ? 107 PRO A O     1 
ATOM   833  C  CB    . PRO A 1 109 ? 6.080   3.020   7.705   1.00 27.98 ? 107 PRO A CB    1 
ATOM   834  C  CG    . PRO A 1 109 ? 5.906   4.406   8.271   1.00 27.21 ? 107 PRO A CG    1 
ATOM   835  C  CD    . PRO A 1 109 ? 5.145   5.147   7.166   1.00 27.04 ? 107 PRO A CD    1 
ATOM   836  N  N     . GLU A 1 110 ? 3.566   0.897   8.136   1.00 25.13 ? 108 GLU A N     1 
ATOM   837  C  CA    . GLU A 1 110 ? 2.747   0.223   9.131   1.00 26.07 ? 108 GLU A CA    1 
ATOM   838  C  C     . GLU A 1 110 ? 3.699   0.032   10.318  1.00 26.50 ? 108 GLU A C     1 
ATOM   839  O  O     . GLU A 1 110 ? 4.912   -0.097  10.131  1.00 24.88 ? 108 GLU A O     1 
ATOM   840  C  CB    . GLU A 1 110 ? 2.239   -1.123  8.604   1.00 27.63 ? 108 GLU A CB    1 
ATOM   841  C  CG    . GLU A 1 110 ? 1.261   -0.983  7.436   1.00 29.00 ? 108 GLU A CG    1 
ATOM   842  C  CD    . GLU A 1 110 ? 0.681   -2.309  6.980   1.00 31.14 ? 108 GLU A CD    1 
ATOM   843  O  OE1   . GLU A 1 110 ? 1.418   -3.317  6.975   1.00 30.59 ? 108 GLU A OE1   1 
ATOM   844  O  OE2   . GLU A 1 110 ? -0.513  -2.342  6.608   1.00 32.69 ? 108 GLU A OE2   1 
ATOM   845  N  N     . ALA A 1 111 ? 3.146   0.021   11.526  1.00 25.96 ? 109 ALA A N     1 
ATOM   846  C  CA    . ALA A 1 111 ? 3.929   -0.082  12.759  1.00 26.39 ? 109 ALA A CA    1 
ATOM   847  C  C     . ALA A 1 111 ? 4.728   -1.352  13.047  1.00 26.95 ? 109 ALA A C     1 
ATOM   848  O  O     . ALA A 1 111 ? 5.844   -1.279  13.568  1.00 26.66 ? 109 ALA A O     1 
ATOM   849  C  CB    . ALA A 1 111 ? 3.022   0.220   13.948  1.00 25.81 ? 109 ALA A CB    1 
ATOM   850  N  N     . GLY A 1 112 ? 4.165   -2.509  12.728  1.00 27.06 ? 110 GLY A N     1 
ATOM   851  C  CA    . GLY A 1 112 ? 4.853   -3.754  13.012  1.00 26.58 ? 110 GLY A CA    1 
ATOM   852  C  C     . GLY A 1 112 ? 4.013   -4.545  13.993  1.00 26.72 ? 110 GLY A C     1 
ATOM   853  O  O     . GLY A 1 112 ? 3.084   -4.002  14.592  1.00 26.81 ? 110 GLY A O     1 
ATOM   854  N  N     . PHE A 1 113 ? 4.335   -5.820  14.174  1.00 26.52 ? 111 PHE A N     1 
ATOM   855  C  CA    . PHE A 1 113 ? 3.561   -6.663  15.072  1.00 26.99 ? 111 PHE A CA    1 
ATOM   856  C  C     . PHE A 1 113 ? 4.159   -6.834  16.462  1.00 27.19 ? 111 PHE A C     1 
ATOM   857  O  O     . PHE A 1 113 ? 5.277   -6.393  16.736  1.00 26.96 ? 111 PHE A O     1 
ATOM   858  C  CB    . PHE A 1 113 ? 3.328   -8.030  14.420  1.00 26.76 ? 111 PHE A CB    1 
ATOM   859  C  CG    . PHE A 1 113 ? 4.595   -8.768  14.060  1.00 26.52 ? 111 PHE A CG    1 
ATOM   860  C  CD1   . PHE A 1 113 ? 5.362   -9.387  15.042  1.00 25.25 ? 111 PHE A CD1   1 
ATOM   861  C  CD2   . PHE A 1 113 ? 5.007   -8.863  12.734  1.00 26.36 ? 111 PHE A CD2   1 
ATOM   862  C  CE1   . PHE A 1 113 ? 6.520   -10.096 14.709  1.00 25.35 ? 111 PHE A CE1   1 
ATOM   863  C  CE2   . PHE A 1 113 ? 6.161   -9.568  12.390  1.00 26.61 ? 111 PHE A CE2   1 
ATOM   864  C  CZ    . PHE A 1 113 ? 6.917   -10.185 13.383  1.00 25.85 ? 111 PHE A CZ    1 
ATOM   865  N  N     . THR A 1 114 ? 3.393   -7.468  17.344  1.00 27.55 ? 112 THR A N     1 
ATOM   866  C  CA    . THR A 1 114 ? 3.832   -7.705  18.709  1.00 29.02 ? 112 THR A CA    1 
ATOM   867  C  C     . THR A 1 114 ? 4.592   -9.020  18.782  1.00 29.19 ? 112 THR A C     1 
ATOM   868  O  O     . THR A 1 114 ? 4.034   -10.088 18.524  1.00 31.32 ? 112 THR A O     1 
ATOM   869  C  CB    . THR A 1 114 ? 2.633   -7.759  19.676  1.00 28.93 ? 112 THR A CB    1 
ATOM   870  O  OG1   . THR A 1 114 ? 2.008   -6.471  19.730  1.00 30.76 ? 112 THR A OG1   1 
ATOM   871  C  CG2   . THR A 1 114 ? 3.089   -8.156  21.069  1.00 30.12 ? 112 THR A CG2   1 
ATOM   872  N  N     . VAL A 1 115 ? 5.872   -8.937  19.125  1.00 27.95 ? 113 VAL A N     1 
ATOM   873  C  CA    . VAL A 1 115 ? 6.700   -10.127 19.225  1.00 28.35 ? 113 VAL A CA    1 
ATOM   874  C  C     . VAL A 1 115 ? 6.391   -10.866 20.518  1.00 28.37 ? 113 VAL A C     1 
ATOM   875  O  O     . VAL A 1 115 ? 6.292   -10.259 21.585  1.00 29.26 ? 113 VAL A O     1 
ATOM   876  C  CB    . VAL A 1 115 ? 8.200   -9.771  19.200  1.00 28.43 ? 113 VAL A CB    1 
ATOM   877  C  CG1   . VAL A 1 115 ? 9.039   -11.041 19.200  1.00 28.23 ? 113 VAL A CG1   1 
ATOM   878  C  CG2   . VAL A 1 115 ? 8.510   -8.931  17.971  1.00 28.74 ? 113 VAL A CG2   1 
ATOM   879  N  N     . SER A 1 116 ? 6.237   -12.181 20.414  1.00 28.33 ? 114 SER A N     1 
ATOM   880  C  CA    . SER A 1 116 ? 5.943   -13.015 21.572  1.00 28.30 ? 114 SER A CA    1 
ATOM   881  C  C     . SER A 1 116 ? 7.174   -13.122 22.463  1.00 28.15 ? 114 SER A C     1 
ATOM   882  O  O     . SER A 1 116 ? 8.304   -13.032 21.984  1.00 27.88 ? 114 SER A O     1 
ATOM   883  C  CB    . SER A 1 116 ? 5.532   -14.411 21.112  1.00 29.21 ? 114 SER A CB    1 
ATOM   884  O  OG    . SER A 1 116 ? 6.597   -15.039 20.420  1.00 30.18 ? 114 SER A OG    1 
ATOM   885  N  N     . GLN A 1 117 ? 6.960   -13.319 23.759  1.00 28.66 ? 115 GLN A N     1 
ATOM   886  C  CA    . GLN A 1 117 ? 8.079   -13.440 24.683  1.00 28.27 ? 115 GLN A CA    1 
ATOM   887  C  C     . GLN A 1 117 ? 8.959   -14.603 24.244  1.00 27.73 ? 115 GLN A C     1 
ATOM   888  O  O     . GLN A 1 117 ? 10.185  -14.544 24.347  1.00 27.52 ? 115 GLN A O     1 
ATOM   889  C  CB    . GLN A 1 117 ? 7.580   -13.684 26.108  1.00 28.37 ? 115 GLN A CB    1 
ATOM   890  C  CG    . GLN A 1 117 ? 8.682   -13.620 27.159  1.00 30.15 ? 115 GLN A CG    1 
ATOM   891  C  CD    . GLN A 1 117 ? 9.332   -12.252 27.233  1.00 30.31 ? 115 GLN A CD    1 
ATOM   892  O  OE1   . GLN A 1 117 ? 8.654   -11.243 27.421  1.00 32.77 ? 115 GLN A OE1   1 
ATOM   893  N  NE2   . GLN A 1 117 ? 10.652  -12.210 27.089  1.00 29.48 ? 115 GLN A NE2   1 
ATOM   894  N  N     . THR A 1 118 ? 8.326   -15.659 23.743  1.00 26.62 ? 116 THR A N     1 
ATOM   895  C  CA    . THR A 1 118 ? 9.061   -16.830 23.295  1.00 27.80 ? 116 THR A CA    1 
ATOM   896  C  C     . THR A 1 118 ? 10.060  -16.466 22.201  1.00 26.84 ? 116 THR A C     1 
ATOM   897  O  O     . THR A 1 118 ? 11.188  -16.957 22.203  1.00 27.33 ? 116 THR A O     1 
ATOM   898  C  CB    . THR A 1 118 ? 8.109   -17.924 22.775  1.00 29.38 ? 116 THR A CB    1 
ATOM   899  O  OG1   . THR A 1 118 ? 7.275   -18.378 23.851  1.00 32.24 ? 116 THR A OG1   1 
ATOM   900  C  CG2   . THR A 1 118 ? 8.901   -19.104 22.233  1.00 29.69 ? 116 THR A CG2   1 
ATOM   901  N  N     . ASN A 1 119 ? 9.655   -15.607 21.270  1.00 27.10 ? 117 ASN A N     1 
ATOM   902  C  CA    . ASN A 1 119 ? 10.567  -15.212 20.203  1.00 25.93 ? 117 ASN A CA    1 
ATOM   903  C  C     . ASN A 1 119 ? 11.621  -14.221 20.673  1.00 25.41 ? 117 ASN A C     1 
ATOM   904  O  O     . ASN A 1 119 ? 12.734  -14.210 20.145  1.00 24.22 ? 117 ASN A O     1 
ATOM   905  C  CB    . ASN A 1 119 ? 9.806   -14.651 18.998  1.00 26.56 ? 117 ASN A CB    1 
ATOM   906  C  CG    . ASN A 1 119 ? 9.418   -15.735 18.011  1.00 28.62 ? 117 ASN A CG    1 
ATOM   907  O  OD1   . ASN A 1 119 ? 10.116  -16.742 17.883  1.00 29.82 ? 117 ASN A OD1   1 
ATOM   908  N  ND2   . ASN A 1 119 ? 8.318   -15.531 17.296  1.00 27.89 ? 117 ASN A ND2   1 
ATOM   909  N  N     . LYS A 1 120 ? 11.284  -13.391 21.657  1.00 24.58 ? 118 LYS A N     1 
ATOM   910  C  CA    . LYS A 1 120 ? 12.261  -12.442 22.187  1.00 24.82 ? 118 LYS A CA    1 
ATOM   911  C  C     . LYS A 1 120 ? 13.350  -13.288 22.822  1.00 25.15 ? 118 LYS A C     1 
ATOM   912  O  O     . LYS A 1 120 ? 14.543  -13.032 22.653  1.00 24.96 ? 118 LYS A O     1 
ATOM   913  C  CB    . LYS A 1 120 ? 11.641  -11.540 23.258  1.00 24.30 ? 118 LYS A CB    1 
ATOM   914  C  CG    . LYS A 1 120 ? 10.627  -10.532 22.744  1.00 24.60 ? 118 LYS A CG    1 
ATOM   915  C  CD    . LYS A 1 120 ? 10.114  -9.663  23.884  1.00 24.89 ? 118 LYS A CD    1 
ATOM   916  C  CE    . LYS A 1 120 ? 9.031   -8.704  23.425  1.00 24.41 ? 118 LYS A CE    1 
ATOM   917  N  NZ    . LYS A 1 120 ? 8.441   -7.974  24.583  1.00 23.73 ? 118 LYS A NZ    1 
ATOM   918  N  N     . ASP A 1 121 ? 12.925  -14.313 23.552  1.00 26.45 ? 119 ASP A N     1 
ATOM   919  C  CA    . ASP A 1 121 ? 13.861  -15.206 24.212  1.00 26.60 ? 119 ASP A CA    1 
ATOM   920  C  C     . ASP A 1 121 ? 14.637  -16.043 23.201  1.00 25.68 ? 119 ASP A C     1 
ATOM   921  O  O     . ASP A 1 121 ? 15.824  -16.289 23.386  1.00 25.69 ? 119 ASP A O     1 
ATOM   922  C  CB    . ASP A 1 121 ? 13.122  -16.115 25.198  1.00 29.01 ? 119 ASP A CB    1 
ATOM   923  C  CG    . ASP A 1 121 ? 12.436  -15.335 26.305  1.00 32.08 ? 119 ASP A CG    1 
ATOM   924  O  OD1   . ASP A 1 121 ? 13.053  -14.395 26.846  1.00 33.13 ? 119 ASP A OD1   1 
ATOM   925  O  OD2   . ASP A 1 121 ? 11.282  -15.669 26.646  1.00 36.83 ? 119 ASP A OD2   1 
ATOM   926  N  N     . ASN A 1 122 ? 13.971  -16.474 22.132  1.00 25.88 ? 120 ASN A N     1 
ATOM   927  C  CA    . ASN A 1 122 ? 14.634  -17.278 21.107  1.00 27.23 ? 120 ASN A CA    1 
ATOM   928  C  C     . ASN A 1 122 ? 15.741  -16.510 20.398  1.00 25.65 ? 120 ASN A C     1 
ATOM   929  O  O     . ASN A 1 122 ? 16.767  -17.088 20.030  1.00 25.60 ? 120 ASN A O     1 
ATOM   930  C  CB    . ASN A 1 122 ? 13.630  -17.777 20.066  1.00 29.12 ? 120 ASN A CB    1 
ATOM   931  C  CG    . ASN A 1 122 ? 12.727  -18.863 20.606  1.00 31.76 ? 120 ASN A CG    1 
ATOM   932  O  OD1   . ASN A 1 122 ? 13.171  -19.740 21.344  1.00 31.82 ? 120 ASN A OD1   1 
ATOM   933  N  ND2   . ASN A 1 122 ? 11.454  -18.820 20.230  1.00 34.59 ? 120 ASN A ND2   1 
ATOM   934  N  N     . LEU A 1 123 ? 15.533  -15.212 20.193  1.00 25.11 ? 121 LEU A N     1 
ATOM   935  C  CA    . LEU A 1 123 ? 16.546  -14.397 19.529  1.00 22.62 ? 121 LEU A CA    1 
ATOM   936  C  C     . LEU A 1 123 ? 17.813  -14.360 20.377  1.00 22.01 ? 121 LEU A C     1 
ATOM   937  O  O     . LEU A 1 123 ? 18.920  -14.463 19.849  1.00 20.01 ? 121 LEU A O     1 
ATOM   938  C  CB    . LEU A 1 123 ? 16.036  -12.968 19.303  1.00 23.50 ? 121 LEU A CB    1 
ATOM   939  C  CG    . LEU A 1 123 ? 16.994  -11.991 18.603  1.00 21.89 ? 121 LEU A CG    1 
ATOM   940  C  CD1   . LEU A 1 123 ? 17.325  -12.484 17.203  1.00 22.91 ? 121 LEU A CD1   1 
ATOM   941  C  CD2   . LEU A 1 123 ? 16.350  -10.611 18.528  1.00 21.53 ? 121 LEU A CD2   1 
ATOM   942  N  N     . LEU A 1 124 ? 17.646  -14.217 21.691  1.00 22.95 ? 122 LEU A N     1 
ATOM   943  C  CA    . LEU A 1 124 ? 18.789  -14.162 22.599  1.00 21.83 ? 122 LEU A CA    1 
ATOM   944  C  C     . LEU A 1 124 ? 19.541  -15.486 22.593  1.00 22.88 ? 122 LEU A C     1 
ATOM   945  O  O     . LEU A 1 124 ? 20.768  -15.508 22.544  1.00 22.23 ? 122 LEU A O     1 
ATOM   946  C  CB    . LEU A 1 124 ? 18.334  -13.826 24.023  1.00 23.52 ? 122 LEU A CB    1 
ATOM   947  C  CG    . LEU A 1 124 ? 17.519  -12.537 24.184  1.00 23.61 ? 122 LEU A CG    1 
ATOM   948  C  CD1   . LEU A 1 124 ? 17.287  -12.267 25.662  1.00 27.13 ? 122 LEU A CD1   1 
ATOM   949  C  CD2   . LEU A 1 124 ? 18.256  -11.365 23.534  1.00 23.89 ? 122 LEU A CD2   1 
ATOM   950  N  N     . LYS A 1 125 ? 18.805  -16.591 22.637  1.00 23.35 ? 123 LYS A N     1 
ATOM   951  C  CA    . LYS A 1 125 ? 19.435  -17.904 22.619  1.00 26.21 ? 123 LYS A CA    1 
ATOM   952  C  C     . LYS A 1 125 ? 20.140  -18.123 21.280  1.00 25.17 ? 123 LYS A C     1 
ATOM   953  O  O     . LYS A 1 125 ? 21.229  -18.696 21.224  1.00 25.39 ? 123 LYS A O     1 
ATOM   954  C  CB    . LYS A 1 125 ? 18.388  -18.996 22.866  1.00 28.54 ? 123 LYS A CB    1 
ATOM   955  C  CG    . LYS A 1 125 ? 17.748  -18.918 24.249  1.00 32.72 ? 123 LYS A CG    1 
ATOM   956  C  CD    . LYS A 1 125 ? 16.746  -20.043 24.492  1.00 36.19 ? 123 LYS A CD    1 
ATOM   957  C  CE    . LYS A 1 125 ? 16.087  -19.897 25.862  1.00 38.12 ? 123 LYS A CE    1 
ATOM   958  N  NZ    . LYS A 1 125 ? 15.110  -20.985 26.149  1.00 41.55 ? 123 LYS A NZ    1 
ATOM   959  N  N     . GLN A 1 126 ? 19.523  -17.644 20.206  1.00 24.94 ? 124 GLN A N     1 
ATOM   960  C  CA    . GLN A 1 126 ? 20.093  -17.778 18.874  1.00 25.53 ? 124 GLN A CA    1 
ATOM   961  C  C     . GLN A 1 126 ? 21.414  -17.022 18.780  1.00 23.99 ? 124 GLN A C     1 
ATOM   962  O  O     . GLN A 1 126 ? 22.402  -17.535 18.258  1.00 25.51 ? 124 GLN A O     1 
ATOM   963  C  CB    . GLN A 1 126 ? 19.109  -17.240 17.835  1.00 28.00 ? 124 GLN A CB    1 
ATOM   964  C  CG    . GLN A 1 126 ? 19.625  -17.265 16.415  1.00 29.70 ? 124 GLN A CG    1 
ATOM   965  C  CD    . GLN A 1 126 ? 18.585  -16.775 15.434  1.00 31.54 ? 124 GLN A CD    1 
ATOM   966  O  OE1   . GLN A 1 126 ? 18.020  -15.697 15.607  1.00 32.34 ? 124 GLN A OE1   1 
ATOM   967  N  NE2   . GLN A 1 126 ? 18.325  -17.564 14.397  1.00 30.35 ? 124 GLN A NE2   1 
ATOM   968  N  N     . ILE A 1 127 ? 21.430  -15.797 19.292  1.00 21.02 ? 125 ILE A N     1 
ATOM   969  C  CA    . ILE A 1 127 ? 22.640  -14.987 19.272  1.00 20.60 ? 125 ILE A CA    1 
ATOM   970  C  C     . ILE A 1 127 ? 23.754  -15.654 20.084  1.00 19.93 ? 125 ILE A C     1 
ATOM   971  O  O     . ILE A 1 127 ? 24.897  -15.718 19.644  1.00 20.45 ? 125 ILE A O     1 
ATOM   972  C  CB    . ILE A 1 127 ? 22.362  -13.574 19.844  1.00 19.36 ? 125 ILE A CB    1 
ATOM   973  C  CG1   . ILE A 1 127 ? 21.448  -12.807 18.881  1.00 20.15 ? 125 ILE A CG1   1 
ATOM   974  C  CG2   . ILE A 1 127 ? 23.674  -12.833 20.083  1.00 21.81 ? 125 ILE A CG2   1 
ATOM   975  C  CD1   . ILE A 1 127 ? 20.870  -11.529 19.457  1.00 23.14 ? 125 ILE A CD1   1 
ATOM   976  N  N     . ALA A 1 128 ? 23.407  -16.164 21.260  1.00 21.69 ? 126 ALA A N     1 
ATOM   977  C  CA    . ALA A 1 128 ? 24.382  -16.808 22.134  1.00 23.03 ? 126 ALA A CA    1 
ATOM   978  C  C     . ALA A 1 128 ? 25.070  -18.002 21.487  1.00 23.47 ? 126 ALA A C     1 
ATOM   979  O  O     . ALA A 1 128 ? 26.255  -18.243 21.719  1.00 24.32 ? 126 ALA A O     1 
ATOM   980  C  CB    . ALA A 1 128 ? 23.713  -17.239 23.439  1.00 24.01 ? 126 ALA A CB    1 
ATOM   981  N  N     . LYS A 1 129 ? 24.333  -18.741 20.667  1.00 23.63 ? 127 LYS A N     1 
ATOM   982  C  CA    . LYS A 1 129 ? 24.889  -19.922 20.018  1.00 26.42 ? 127 LYS A CA    1 
ATOM   983  C  C     . LYS A 1 129 ? 25.540  -19.646 18.670  1.00 25.38 ? 127 LYS A C     1 
ATOM   984  O  O     . LYS A 1 129 ? 26.426  -20.384 18.244  1.00 26.44 ? 127 LYS A O     1 
ATOM   985  C  CB    . LYS A 1 129 ? 23.792  -20.978 19.848  1.00 28.03 ? 127 LYS A CB    1 
ATOM   986  C  CG    . LYS A 1 129 ? 23.243  -21.508 21.168  1.00 33.23 ? 127 LYS A CG    1 
ATOM   987  C  CD    . LYS A 1 129 ? 22.071  -22.463 20.958  1.00 37.56 ? 127 LYS A CD    1 
ATOM   988  C  CE    . LYS A 1 129 ? 22.466  -23.676 20.121  1.00 40.12 ? 127 LYS A CE    1 
ATOM   989  N  NZ    . LYS A 1 129 ? 21.363  -24.677 20.040  1.00 42.96 ? 127 LYS A NZ    1 
ATOM   990  N  N     . LYS A 1 130 ? 25.105  -18.578 18.008  1.00 24.57 ? 128 LYS A N     1 
ATOM   991  C  CA    . LYS A 1 130 ? 25.616  -18.214 16.690  1.00 25.19 ? 128 LYS A CA    1 
ATOM   992  C  C     . LYS A 1 130 ? 26.855  -17.330 16.658  1.00 24.80 ? 128 LYS A C     1 
ATOM   993  O  O     . LYS A 1 130 ? 27.862  -17.659 16.032  1.00 24.92 ? 128 LYS A O     1 
ATOM   994  C  CB    . LYS A 1 130 ? 24.533  -17.483 15.894  1.00 26.24 ? 128 LYS A CB    1 
ATOM   995  C  CG    . LYS A 1 130 ? 23.530  -18.349 15.185  1.00 29.21 ? 128 LYS A CG    1 
ATOM   996  C  CD    . LYS A 1 130 ? 22.535  -17.460 14.451  1.00 28.03 ? 128 LYS A CD    1 
ATOM   997  C  CE    . LYS A 1 130 ? 21.647  -18.252 13.521  1.00 28.12 ? 128 LYS A CE    1 
ATOM   998  N  NZ    . LYS A 1 130 ? 22.383  -18.761 12.334  1.00 25.42 ? 128 LYS A NZ    1 
ATOM   999  N  N     . VAL A 1 131 ? 26.751  -16.191 17.329  1.00 22.68 ? 129 VAL A N     1 
ATOM   1000 C  CA    . VAL A 1 131 ? 27.794  -15.178 17.347  1.00 21.36 ? 129 VAL A CA    1 
ATOM   1001 C  C     . VAL A 1 131 ? 29.046  -15.483 18.152  1.00 21.76 ? 129 VAL A C     1 
ATOM   1002 O  O     . VAL A 1 131 ? 28.980  -15.864 19.320  1.00 22.43 ? 129 VAL A O     1 
ATOM   1003 C  CB    . VAL A 1 131 ? 27.185  -13.835 17.812  1.00 21.69 ? 129 VAL A CB    1 
ATOM   1004 C  CG1   . VAL A 1 131 ? 28.197  -12.702 17.676  1.00 20.16 ? 129 VAL A CG1   1 
ATOM   1005 C  CG2   . VAL A 1 131 ? 25.937  -13.549 16.992  1.00 21.66 ? 129 VAL A CG2   1 
ATOM   1006 N  N     . LYS A 1 132 ? 30.190  -15.306 17.501  1.00 22.42 ? 130 LYS A N     1 
ATOM   1007 C  CA    . LYS A 1 132 ? 31.486  -15.543 18.116  1.00 22.99 ? 130 LYS A CA    1 
ATOM   1008 C  C     . LYS A 1 132 ? 32.188  -14.208 18.336  1.00 22.90 ? 130 LYS A C     1 
ATOM   1009 O  O     . LYS A 1 132 ? 31.825  -13.202 17.726  1.00 22.33 ? 130 LYS A O     1 
ATOM   1010 C  CB    . LYS A 1 132 ? 32.331  -16.445 17.218  1.00 24.95 ? 130 LYS A CB    1 
ATOM   1011 C  CG    . LYS A 1 132 ? 31.679  -17.789 16.916  1.00 28.08 ? 130 LYS A CG    1 
ATOM   1012 C  CD    . LYS A 1 132 ? 31.287  -18.531 18.191  1.00 31.50 ? 130 LYS A CD    1 
ATOM   1013 C  CE    . LYS A 1 132 ? 32.492  -18.843 19.068  1.00 35.35 ? 130 LYS A CE    1 
ATOM   1014 N  NZ    . LYS A 1 132 ? 32.113  -19.598 20.305  1.00 37.76 ? 130 LYS A NZ    1 
ATOM   1015 N  N     . LYS A 1 133 ? 33.196  -14.195 19.200  1.00 23.48 ? 131 LYS A N     1 
ATOM   1016 C  CA    . LYS A 1 133 ? 33.904  -12.955 19.496  1.00 24.03 ? 131 LYS A CA    1 
ATOM   1017 C  C     . LYS A 1 133 ? 34.555  -12.287 18.287  1.00 22.93 ? 131 LYS A C     1 
ATOM   1018 O  O     . LYS A 1 133 ? 34.730  -11.074 18.274  1.00 22.91 ? 131 LYS A O     1 
ATOM   1019 C  CB    . LYS A 1 133 ? 34.954  -13.190 20.586  1.00 25.77 ? 131 LYS A CB    1 
ATOM   1020 C  CG    . LYS A 1 133 ? 36.018  -14.199 20.220  1.00 30.75 ? 131 LYS A CG    1 
ATOM   1021 C  CD    . LYS A 1 133 ? 37.060  -14.303 21.325  1.00 35.42 ? 131 LYS A CD    1 
ATOM   1022 C  CE    . LYS A 1 133 ? 38.160  -15.287 20.961  1.00 37.93 ? 131 LYS A CE    1 
ATOM   1023 N  NZ    . LYS A 1 133 ? 39.192  -15.380 22.031  1.00 41.61 ? 131 LYS A NZ    1 
ATOM   1024 N  N     . GLU A 1 134 ? 34.908  -13.066 17.270  1.00 23.19 ? 132 GLU A N     1 
ATOM   1025 C  CA    . GLU A 1 134 ? 35.541  -12.493 16.087  1.00 23.41 ? 132 GLU A CA    1 
ATOM   1026 C  C     . GLU A 1 134 ? 34.521  -11.896 15.109  1.00 21.16 ? 132 GLU A C     1 
ATOM   1027 O  O     . GLU A 1 134 ? 34.900  -11.300 14.098  1.00 23.18 ? 132 GLU A O     1 
ATOM   1028 C  CB    . GLU A 1 134 ? 36.370  -13.558 15.361  1.00 27.10 ? 132 GLU A CB    1 
ATOM   1029 C  CG    . GLU A 1 134 ? 35.533  -14.642 14.712  1.00 30.49 ? 132 GLU A CG    1 
ATOM   1030 C  CD    . GLU A 1 134 ? 35.376  -15.884 15.569  1.00 35.14 ? 132 GLU A CD    1 
ATOM   1031 O  OE1   . GLU A 1 134 ? 35.574  -15.809 16.806  1.00 33.66 ? 132 GLU A OE1   1 
ATOM   1032 O  OE2   . GLU A 1 134 ? 35.042  -16.944 14.993  1.00 38.46 ? 132 GLU A OE2   1 
ATOM   1033 N  N     . ASP A 1 135 ? 33.235  -12.048 15.410  1.00 17.98 ? 133 ASP A N     1 
ATOM   1034 C  CA    . ASP A 1 135 ? 32.188  -11.540 14.527  1.00 16.87 ? 133 ASP A CA    1 
ATOM   1035 C  C     . ASP A 1 135 ? 31.848  -10.078 14.791  1.00 16.12 ? 133 ASP A C     1 
ATOM   1036 O  O     . ASP A 1 135 ? 32.371  -9.463  15.720  1.00 16.06 ? 133 ASP A O     1 
ATOM   1037 C  CB    . ASP A 1 135 ? 30.904  -12.365 14.682  1.00 18.65 ? 133 ASP A CB    1 
ATOM   1038 C  CG    . ASP A 1 135 ? 31.079  -13.813 14.269  1.00 18.33 ? 133 ASP A CG    1 
ATOM   1039 O  OD1   . ASP A 1 135 ? 31.882  -14.073 13.348  1.00 21.01 ? 133 ASP A OD1   1 
ATOM   1040 O  OD2   . ASP A 1 135 ? 30.397  -14.689 14.849  1.00 21.02 ? 133 ASP A OD2   1 
HETATM 1041 N  N     . MSE A 1 136 ? 30.978  -9.532  13.947  1.00 15.48 ? 134 MSE A N     1 
HETATM 1042 C  CA    . MSE A 1 136 ? 30.502  -8.161  14.098  1.00 15.40 ? 134 MSE A CA    1 
HETATM 1043 C  C     . MSE A 1 136 ? 28.980  -8.242  14.078  1.00 16.16 ? 134 MSE A C     1 
HETATM 1044 O  O     . MSE A 1 136 ? 28.404  -9.033  13.326  1.00 15.74 ? 134 MSE A O     1 
HETATM 1045 C  CB    . MSE A 1 136 ? 30.988  -7.278  12.947  1.00 17.08 ? 134 MSE A CB    1 
HETATM 1046 C  CG    . MSE A 1 136 ? 32.500  -7.131  12.875  1.00 17.30 ? 134 MSE A CG    1 
HETATM 1047 SE SE    . MSE A 1 136 ? 32.993  -6.017  11.369  1.00 24.37 ? 134 MSE A SE    1 
HETATM 1048 C  CE    . MSE A 1 136 ? 32.755  -4.306  12.193  1.00 15.65 ? 134 MSE A CE    1 
ATOM   1049 N  N     . VAL A 1 137 ? 28.335  -7.439  14.915  1.00 13.23 ? 135 VAL A N     1 
ATOM   1050 C  CA    . VAL A 1 137 ? 26.882  -7.428  14.993  1.00 14.75 ? 135 VAL A CA    1 
ATOM   1051 C  C     . VAL A 1 137 ? 26.394  -6.001  14.853  1.00 14.66 ? 135 VAL A C     1 
ATOM   1052 O  O     . VAL A 1 137 ? 26.876  -5.101  15.546  1.00 15.71 ? 135 VAL A O     1 
ATOM   1053 C  CB    . VAL A 1 137 ? 26.378  -7.980  16.352  1.00 16.59 ? 135 VAL A CB    1 
ATOM   1054 C  CG1   . VAL A 1 137 ? 24.868  -7.820  16.449  1.00 17.29 ? 135 VAL A CG1   1 
ATOM   1055 C  CG2   . VAL A 1 137 ? 26.749  -9.452  16.493  1.00 17.88 ? 135 VAL A CG2   1 
ATOM   1056 N  N     . VAL A 1 138 ? 25.444  -5.790  13.952  1.00 13.96 ? 136 VAL A N     1 
ATOM   1057 C  CA    . VAL A 1 138 ? 24.893  -4.462  13.759  1.00 15.78 ? 136 VAL A CA    1 
ATOM   1058 C  C     . VAL A 1 138 ? 23.400  -4.472  14.029  1.00 15.06 ? 136 VAL A C     1 
ATOM   1059 O  O     . VAL A 1 138 ? 22.651  -5.174  13.365  1.00 16.90 ? 136 VAL A O     1 
ATOM   1060 C  CB    . VAL A 1 138 ? 25.133  -3.950  12.320  1.00 16.38 ? 136 VAL A CB    1 
ATOM   1061 C  CG1   . VAL A 1 138 ? 24.550  -2.545  12.168  1.00 17.01 ? 136 VAL A CG1   1 
ATOM   1062 C  CG2   . VAL A 1 138 ? 26.624  -3.942  12.012  1.00 17.12 ? 136 VAL A CG2   1 
ATOM   1063 N  N     . ILE A 1 139 ? 22.980  -3.712  15.034  1.00 15.45 ? 137 ILE A N     1 
ATOM   1064 C  CA    . ILE A 1 139 ? 21.563  -3.592  15.354  1.00 15.46 ? 137 ILE A CA    1 
ATOM   1065 C  C     . ILE A 1 139 ? 21.150  -2.256  14.748  1.00 16.73 ? 137 ILE A C     1 
ATOM   1066 O  O     . ILE A 1 139 ? 21.784  -1.239  15.022  1.00 18.74 ? 137 ILE A O     1 
ATOM   1067 C  CB    . ILE A 1 139 ? 21.328  -3.544  16.875  1.00 15.91 ? 137 ILE A CB    1 
ATOM   1068 C  CG1   . ILE A 1 139 ? 21.795  -4.855  17.515  1.00 16.20 ? 137 ILE A CG1   1 
ATOM   1069 C  CG2   . ILE A 1 139 ? 19.843  -3.309  17.166  1.00 16.73 ? 137 ILE A CG2   1 
ATOM   1070 C  CD1   . ILE A 1 139 ? 21.700  -4.867  19.024  1.00 17.05 ? 137 ILE A CD1   1 
ATOM   1071 N  N     . ALA A 1 140 ? 20.115  -2.250  13.911  1.00 18.12 ? 138 ALA A N     1 
ATOM   1072 C  CA    . ALA A 1 140 ? 19.675  -1.000  13.292  1.00 20.05 ? 138 ALA A CA    1 
ATOM   1073 C  C     . ALA A 1 140 ? 18.158  -0.940  13.186  1.00 21.22 ? 138 ALA A C     1 
ATOM   1074 O  O     . ALA A 1 140 ? 17.518  -1.930  12.844  1.00 23.65 ? 138 ALA A O     1 
ATOM   1075 C  CB    . ALA A 1 140 ? 20.296  -0.854  11.908  1.00 20.62 ? 138 ALA A CB    1 
ATOM   1076 N  N     . GLY A 1 141 ? 17.591  0.229   13.469  1.00 23.53 ? 139 GLY A N     1 
ATOM   1077 C  CA    . GLY A 1 141 ? 16.148  0.385   13.394  1.00 24.22 ? 139 GLY A CA    1 
ATOM   1078 C  C     . GLY A 1 141 ? 15.504  0.292   14.761  1.00 27.13 ? 139 GLY A C     1 
ATOM   1079 O  O     . GLY A 1 141 ? 16.008  -0.406  15.644  1.00 28.25 ? 139 GLY A O     1 
ATOM   1080 N  N     . SER A 1 142 ? 14.389  0.992   14.944  1.00 27.51 ? 140 SER A N     1 
ATOM   1081 C  CA    . SER A 1 142 ? 13.692  0.977   16.223  1.00 29.20 ? 140 SER A CA    1 
ATOM   1082 C  C     . SER A 1 142 ? 12.938  -0.329  16.427  1.00 27.44 ? 140 SER A C     1 
ATOM   1083 O  O     . SER A 1 142 ? 12.482  -0.956  15.468  1.00 26.61 ? 140 SER A O     1 
ATOM   1084 C  CB    . SER A 1 142 ? 12.725  2.157   16.314  1.00 30.86 ? 140 SER A CB    1 
ATOM   1085 O  OG    . SER A 1 142 ? 13.429  3.386   16.229  1.00 35.41 ? 140 SER A OG    1 
ATOM   1086 N  N     . PRO A 1 143 ? 12.814  -0.769  17.686  1.00 25.84 ? 141 PRO A N     1 
ATOM   1087 C  CA    . PRO A 1 143 ? 12.103  -2.016  17.971  1.00 25.01 ? 141 PRO A CA    1 
ATOM   1088 C  C     . PRO A 1 143 ? 10.623  -1.895  17.627  1.00 24.39 ? 141 PRO A C     1 
ATOM   1089 O  O     . PRO A 1 143 ? 10.076  -0.791  17.559  1.00 24.43 ? 141 PRO A O     1 
ATOM   1090 C  CB    . PRO A 1 143 ? 12.315  -2.205  19.471  1.00 25.31 ? 141 PRO A CB    1 
ATOM   1091 C  CG    . PRO A 1 143 ? 13.609  -1.493  19.735  1.00 26.91 ? 141 PRO A CG    1 
ATOM   1092 C  CD    . PRO A 1 143 ? 13.467  -0.248  18.900  1.00 27.41 ? 141 PRO A CD    1 
ATOM   1093 N  N     . PRO A 1 144 ? 9.956   -3.035  17.405  1.00 24.19 ? 142 PRO A N     1 
ATOM   1094 C  CA    . PRO A 1 144 ? 8.530   -3.046  17.074  1.00 24.35 ? 142 PRO A CA    1 
ATOM   1095 C  C     . PRO A 1 144 ? 7.728   -2.678  18.316  1.00 26.08 ? 142 PRO A C     1 
ATOM   1096 O  O     . PRO A 1 144 ? 8.283   -2.580  19.410  1.00 24.53 ? 142 PRO A O     1 
ATOM   1097 C  CB    . PRO A 1 144 ? 8.294   -4.488  16.643  1.00 23.62 ? 142 PRO A CB    1 
ATOM   1098 C  CG    . PRO A 1 144 ? 9.236   -5.245  17.537  1.00 25.23 ? 142 PRO A CG    1 
ATOM   1099 C  CD    . PRO A 1 144 ? 10.495  -4.406  17.463  1.00 24.08 ? 142 PRO A CD    1 
ATOM   1100 N  N     . PRO A 1 145 ? 6.411   -2.474  18.165  1.00 26.99 ? 143 PRO A N     1 
ATOM   1101 C  CA    . PRO A 1 145 ? 5.573   -2.117  19.312  1.00 27.56 ? 143 PRO A CA    1 
ATOM   1102 C  C     . PRO A 1 145 ? 5.685   -3.126  20.450  1.00 27.64 ? 143 PRO A C     1 
ATOM   1103 O  O     . PRO A 1 145 ? 5.663   -4.339  20.226  1.00 28.41 ? 143 PRO A O     1 
ATOM   1104 C  CB    . PRO A 1 145 ? 4.167   -2.091  18.717  1.00 28.49 ? 143 PRO A CB    1 
ATOM   1105 C  CG    . PRO A 1 145 ? 4.406   -1.704  17.293  1.00 27.21 ? 143 PRO A CG    1 
ATOM   1106 C  CD    . PRO A 1 145 ? 5.609   -2.540  16.931  1.00 27.91 ? 143 PRO A CD    1 
ATOM   1107 N  N     . HIS A 1 146 ? 5.817   -2.608  21.666  1.00 28.44 ? 144 HIS A N     1 
ATOM   1108 C  CA    . HIS A 1 146 ? 5.897   -3.424  22.870  1.00 28.79 ? 144 HIS A CA    1 
ATOM   1109 C  C     . HIS A 1 146 ? 7.215   -4.160  23.101  1.00 28.59 ? 144 HIS A C     1 
ATOM   1110 O  O     . HIS A 1 146 ? 7.304   -5.032  23.968  1.00 27.55 ? 144 HIS A O     1 
ATOM   1111 C  CB    . HIS A 1 146 ? 4.711   -4.391  22.904  1.00 30.71 ? 144 HIS A CB    1 
ATOM   1112 C  CG    . HIS A 1 146 ? 3.384   -3.696  22.835  1.00 33.43 ? 144 HIS A CG    1 
ATOM   1113 N  ND1   . HIS A 1 146 ? 2.969   -2.799  23.792  1.00 34.40 ? 144 HIS A ND1   1 
ATOM   1114 C  CD2   . HIS A 1 146 ? 2.408   -3.730  21.897  1.00 34.93 ? 144 HIS A CD2   1 
ATOM   1115 C  CE1   . HIS A 1 146 ? 1.789   -2.306  23.448  1.00 36.02 ? 144 HIS A CE1   1 
ATOM   1116 N  NE2   . HIS A 1 146 ? 1.429   -2.853  22.304  1.00 35.53 ? 144 HIS A NE2   1 
ATOM   1117 N  N     . TYR A 1 147 ? 8.234   -3.820  22.317  1.00 26.79 ? 145 TYR A N     1 
ATOM   1118 C  CA    . TYR A 1 147 ? 9.557   -4.404  22.512  1.00 26.37 ? 145 TYR A CA    1 
ATOM   1119 C  C     . TYR A 1 147 ? 10.191  -3.282  23.330  1.00 25.74 ? 145 TYR A C     1 
ATOM   1120 O  O     . TYR A 1 147 ? 10.684  -2.289  22.790  1.00 25.38 ? 145 TYR A O     1 
ATOM   1121 C  CB    . TYR A 1 147 ? 10.288  -4.599  21.180  1.00 24.83 ? 145 TYR A CB    1 
ATOM   1122 C  CG    . TYR A 1 147 ? 11.568  -5.402  21.311  1.00 24.27 ? 145 TYR A CG    1 
ATOM   1123 C  CD1   . TYR A 1 147 ? 11.613  -6.750  20.950  1.00 23.99 ? 145 TYR A CD1   1 
ATOM   1124 C  CD2   . TYR A 1 147 ? 12.734  -4.812  21.800  1.00 24.19 ? 145 TYR A CD2   1 
ATOM   1125 C  CE1   . TYR A 1 147 ? 12.794  -7.491  21.072  1.00 24.00 ? 145 TYR A CE1   1 
ATOM   1126 C  CE2   . TYR A 1 147 ? 13.913  -5.541  21.928  1.00 24.13 ? 145 TYR A CE2   1 
ATOM   1127 C  CZ    . TYR A 1 147 ? 13.937  -6.877  21.560  1.00 22.51 ? 145 TYR A CZ    1 
ATOM   1128 O  OH    . TYR A 1 147 ? 15.110  -7.590  21.671  1.00 23.35 ? 145 TYR A OH    1 
ATOM   1129 N  N     . THR A 1 148 ? 10.137  -3.451  24.645  1.00 24.90 ? 146 THR A N     1 
ATOM   1130 C  CA    . THR A 1 148 ? 10.600  -2.463  25.616  1.00 25.33 ? 146 THR A CA    1 
ATOM   1131 C  C     . THR A 1 148 ? 12.085  -2.149  25.720  1.00 24.47 ? 146 THR A C     1 
ATOM   1132 O  O     . THR A 1 148 ? 12.926  -2.828  25.135  1.00 21.43 ? 146 THR A O     1 
ATOM   1133 C  CB    . THR A 1 148 ? 10.138  -2.865  27.020  1.00 25.21 ? 146 THR A CB    1 
ATOM   1134 O  OG1   . THR A 1 148 ? 10.876  -4.020  27.442  1.00 25.55 ? 146 THR A OG1   1 
ATOM   1135 C  CG2   . THR A 1 148 ? 8.653   -3.207  27.011  1.00 25.70 ? 146 THR A CG2   1 
ATOM   1136 N  N     . LEU A 1 149 ? 12.387  -1.108  26.496  1.00 25.03 ? 147 LEU A N     1 
ATOM   1137 C  CA    . LEU A 1 149 ? 13.762  -0.697  26.738  1.00 24.95 ? 147 LEU A CA    1 
ATOM   1138 C  C     . LEU A 1 149 ? 14.450  -1.823  27.490  1.00 24.45 ? 147 LEU A C     1 
ATOM   1139 O  O     . LEU A 1 149 ? 15.636  -2.085  27.289  1.00 22.36 ? 147 LEU A O     1 
ATOM   1140 C  CB    . LEU A 1 149 ? 13.819  0.590   27.566  1.00 26.51 ? 147 LEU A CB    1 
ATOM   1141 C  CG    . LEU A 1 149 ? 13.343  1.863   26.865  1.00 28.99 ? 147 LEU A CG    1 
ATOM   1142 C  CD1   . LEU A 1 149 ? 13.312  3.018   27.860  1.00 29.15 ? 147 LEU A CD1   1 
ATOM   1143 C  CD2   . LEU A 1 149 ? 14.272  2.180   25.700  1.00 29.68 ? 147 LEU A CD2   1 
ATOM   1144 N  N     . SER A 1 150 ? 13.691  -2.490  28.353  1.00 24.32 ? 148 SER A N     1 
ATOM   1145 C  CA    . SER A 1 150 ? 14.220  -3.602  29.126  1.00 25.02 ? 148 SER A CA    1 
ATOM   1146 C  C     . SER A 1 150 ? 14.584  -4.742  28.184  1.00 23.74 ? 148 SER A C     1 
ATOM   1147 O  O     . SER A 1 150 ? 15.627  -5.377  28.344  1.00 23.24 ? 148 SER A O     1 
ATOM   1148 C  CB    . SER A 1 150 ? 13.185  -4.089  30.143  1.00 26.43 ? 148 SER A CB    1 
ATOM   1149 O  OG    . SER A 1 150 ? 13.718  -5.150  30.918  1.00 32.53 ? 148 SER A OG    1 
ATOM   1150 N  N     . ASP A 1 151 ? 13.724  -5.000  27.201  1.00 23.75 ? 149 ASP A N     1 
ATOM   1151 C  CA    . ASP A 1 151 ? 13.990  -6.064  26.237  1.00 22.48 ? 149 ASP A CA    1 
ATOM   1152 C  C     . ASP A 1 151 ? 15.251  -5.733  25.444  1.00 21.17 ? 149 ASP A C     1 
ATOM   1153 O  O     . ASP A 1 151 ? 16.075  -6.609  25.189  1.00 21.15 ? 149 ASP A O     1 
ATOM   1154 C  CB    . ASP A 1 151 ? 12.833  -6.233  25.243  1.00 22.61 ? 149 ASP A CB    1 
ATOM   1155 C  CG    . ASP A 1 151 ? 11.555  -6.727  25.892  1.00 23.66 ? 149 ASP A CG    1 
ATOM   1156 O  OD1   . ASP A 1 151 ? 11.626  -7.485  26.881  1.00 25.59 ? 149 ASP A OD1   1 
ATOM   1157 O  OD2   . ASP A 1 151 ? 10.471  -6.368  25.385  1.00 25.51 ? 149 ASP A OD2   1 
ATOM   1158 N  N     . PHE A 1 152 ? 15.389  -4.467  25.048  1.00 20.60 ? 150 PHE A N     1 
ATOM   1159 C  CA    . PHE A 1 152 ? 16.544  -4.026  24.267  1.00 19.26 ? 150 PHE A CA    1 
ATOM   1160 C  C     . PHE A 1 152 ? 17.809  -4.151  25.096  1.00 18.79 ? 150 PHE A C     1 
ATOM   1161 O  O     . PHE A 1 152 ? 18.864  -4.514  24.579  1.00 18.93 ? 150 PHE A O     1 
ATOM   1162 C  CB    . PHE A 1 152 ? 16.365  -2.571  23.829  1.00 18.16 ? 150 PHE A CB    1 
ATOM   1163 C  CG    . PHE A 1 152 ? 17.242  -2.154  22.677  1.00 16.71 ? 150 PHE A CG    1 
ATOM   1164 C  CD1   . PHE A 1 152 ? 17.029  -2.669  21.403  1.00 17.91 ? 150 PHE A CD1   1 
ATOM   1165 C  CD2   . PHE A 1 152 ? 18.256  -1.220  22.861  1.00 18.06 ? 150 PHE A CD2   1 
ATOM   1166 C  CE1   . PHE A 1 152 ? 17.812  -2.256  20.326  1.00 18.97 ? 150 PHE A CE1   1 
ATOM   1167 C  CE2   . PHE A 1 152 ? 19.045  -0.800  21.789  1.00 17.23 ? 150 PHE A CE2   1 
ATOM   1168 C  CZ    . PHE A 1 152 ? 18.819  -1.321  20.522  1.00 18.29 ? 150 PHE A CZ    1 
ATOM   1169 N  N     . LYS A 1 153 ? 17.707  -3.832  26.384  1.00 19.82 ? 151 LYS A N     1 
ATOM   1170 C  CA    . LYS A 1 153 ? 18.850  -3.939  27.275  1.00 21.66 ? 151 LYS A CA    1 
ATOM   1171 C  C     . LYS A 1 153 ? 19.335  -5.390  27.275  1.00 19.74 ? 151 LYS A C     1 
ATOM   1172 O  O     . LYS A 1 153 ? 20.533  -5.643  27.165  1.00 21.08 ? 151 LYS A O     1 
ATOM   1173 C  CB    . LYS A 1 153 ? 18.464  -3.516  28.695  1.00 22.17 ? 151 LYS A CB    1 
ATOM   1174 C  CG    . LYS A 1 153 ? 19.645  -3.381  29.641  1.00 30.23 ? 151 LYS A CG    1 
ATOM   1175 C  CD    . LYS A 1 153 ? 19.196  -2.944  31.027  1.00 33.01 ? 151 LYS A CD    1 
ATOM   1176 C  CE    . LYS A 1 153 ? 20.388  -2.630  31.916  1.00 36.97 ? 151 LYS A CE    1 
ATOM   1177 N  NZ    . LYS A 1 153 ? 21.192  -1.504  31.367  1.00 38.34 ? 151 LYS A NZ    1 
ATOM   1178 N  N     . GLU A 1 154 ? 18.404  -6.339  27.386  1.00 21.32 ? 152 GLU A N     1 
ATOM   1179 C  CA    . GLU A 1 154 ? 18.759  -7.762  27.396  1.00 21.95 ? 152 GLU A CA    1 
ATOM   1180 C  C     . GLU A 1 154 ? 19.459  -8.149  26.101  1.00 20.72 ? 152 GLU A C     1 
ATOM   1181 O  O     . GLU A 1 154 ? 20.427  -8.918  26.105  1.00 19.50 ? 152 GLU A O     1 
ATOM   1182 C  CB    . GLU A 1 154 ? 17.517  -8.646  27.552  1.00 25.23 ? 152 GLU A CB    1 
ATOM   1183 C  CG    . GLU A 1 154 ? 16.696  -8.408  28.805  1.00 32.98 ? 152 GLU A CG    1 
ATOM   1184 C  CD    . GLU A 1 154 ? 15.568  -9.414  28.944  1.00 34.76 ? 152 GLU A CD    1 
ATOM   1185 O  OE1   . GLU A 1 154 ? 15.087  -9.921  27.905  1.00 39.15 ? 152 GLU A OE1   1 
ATOM   1186 O  OE2   . GLU A 1 154 ? 15.153  -9.690  30.087  1.00 38.46 ? 152 GLU A OE2   1 
ATOM   1187 N  N     . LEU A 1 155 ? 18.948  -7.620  24.992  1.00 19.46 ? 153 LEU A N     1 
ATOM   1188 C  CA    . LEU A 1 155 ? 19.521  -7.890  23.676  1.00 17.61 ? 153 LEU A CA    1 
ATOM   1189 C  C     . LEU A 1 155 ? 20.960  -7.391  23.606  1.00 18.18 ? 153 LEU A C     1 
ATOM   1190 O  O     . LEU A 1 155 ? 21.864  -8.125  23.198  1.00 17.34 ? 153 LEU A O     1 
ATOM   1191 C  CB    . LEU A 1 155 ? 18.692  -7.207  22.582  1.00 17.63 ? 153 LEU A CB    1 
ATOM   1192 C  CG    . LEU A 1 155 ? 19.246  -7.330  21.160  1.00 18.49 ? 153 LEU A CG    1 
ATOM   1193 C  CD1   . LEU A 1 155 ? 19.277  -8.792  20.742  1.00 19.51 ? 153 LEU A CD1   1 
ATOM   1194 C  CD2   . LEU A 1 155 ? 18.380  -6.528  20.208  1.00 18.86 ? 153 LEU A CD2   1 
ATOM   1195 N  N     . LEU A 1 156 ? 21.175  -6.137  23.999  1.00 16.72 ? 154 LEU A N     1 
ATOM   1196 C  CA    . LEU A 1 156 ? 22.518  -5.571  23.971  1.00 17.89 ? 154 LEU A CA    1 
ATOM   1197 C  C     . LEU A 1 156 ? 23.461  -6.368  24.864  1.00 17.80 ? 154 LEU A C     1 
ATOM   1198 O  O     . LEU A 1 156 ? 24.602  -6.639  24.487  1.00 18.08 ? 154 LEU A O     1 
ATOM   1199 C  CB    . LEU A 1 156 ? 22.504  -4.106  24.425  1.00 18.39 ? 154 LEU A CB    1 
ATOM   1200 C  CG    . LEU A 1 156 ? 21.795  -3.079  23.534  1.00 18.98 ? 154 LEU A CG    1 
ATOM   1201 C  CD1   . LEU A 1 156 ? 21.840  -1.702  24.201  1.00 21.63 ? 154 LEU A CD1   1 
ATOM   1202 C  CD2   . LEU A 1 156 ? 22.472  -3.025  22.171  1.00 21.29 ? 154 LEU A CD2   1 
ATOM   1203 N  N     . ARG A 1 157 ? 22.980  -6.747  26.044  1.00 17.98 ? 155 ARG A N     1 
ATOM   1204 C  CA    . ARG A 1 157 ? 23.800  -7.511  26.982  1.00 19.06 ? 155 ARG A CA    1 
ATOM   1205 C  C     . ARG A 1 157 ? 24.170  -8.878  26.413  1.00 18.26 ? 155 ARG A C     1 
ATOM   1206 O  O     . ARG A 1 157 ? 25.301  -9.334  26.573  1.00 18.57 ? 155 ARG A O     1 
ATOM   1207 C  CB    . ARG A 1 157 ? 23.065  -7.684  28.313  1.00 19.14 ? 155 ARG A CB    1 
ATOM   1208 C  CG    . ARG A 1 157 ? 23.865  -8.453  29.357  1.00 21.32 ? 155 ARG A CG    1 
ATOM   1209 C  CD    . ARG A 1 157 ? 23.235  -8.295  30.734  1.00 22.74 ? 155 ARG A CD    1 
ATOM   1210 N  NE    . ARG A 1 157 ? 23.273  -6.904  31.176  1.00 23.28 ? 155 ARG A NE    1 
ATOM   1211 C  CZ    . ARG A 1 157 ? 22.328  -6.323  31.910  1.00 24.74 ? 155 ARG A CZ    1 
ATOM   1212 N  NH1   . ARG A 1 157 ? 21.263  -7.011  32.292  1.00 25.56 ? 155 ARG A NH1   1 
ATOM   1213 N  NH2   . ARG A 1 157 ? 22.444  -5.050  32.254  1.00 28.83 ? 155 ARG A NH2   1 
ATOM   1214 N  N     . THR A 1 158 ? 23.216  -9.523  25.750  1.00 18.27 ? 156 THR A N     1 
ATOM   1215 C  CA    . THR A 1 158 ? 23.462  -10.834 25.154  1.00 17.83 ? 156 THR A CA    1 
ATOM   1216 C  C     . THR A 1 158 ? 24.547  -10.717 24.087  1.00 18.00 ? 156 THR A C     1 
ATOM   1217 O  O     . THR A 1 158 ? 25.443  -11.561 24.004  1.00 16.94 ? 156 THR A O     1 
ATOM   1218 C  CB    . THR A 1 158 ? 22.173  -11.403 24.539  1.00 18.03 ? 156 THR A CB    1 
ATOM   1219 O  OG1   . THR A 1 158 ? 21.187  -11.531 25.569  1.00 21.00 ? 156 THR A OG1   1 
ATOM   1220 C  CG2   . THR A 1 158 ? 22.427  -12.779 23.914  1.00 18.36 ? 156 THR A CG2   1 
ATOM   1221 N  N     . VAL A 1 159 ? 24.475  -9.664  23.273  1.00 17.35 ? 157 VAL A N     1 
ATOM   1222 C  CA    . VAL A 1 159 ? 25.485  -9.460  22.237  1.00 17.22 ? 157 VAL A CA    1 
ATOM   1223 C  C     . VAL A 1 159 ? 26.839  -9.166  22.881  1.00 15.89 ? 157 VAL A C     1 
ATOM   1224 O  O     . VAL A 1 159 ? 27.865  -9.700  22.463  1.00 17.26 ? 157 VAL A O     1 
ATOM   1225 C  CB    . VAL A 1 159 ? 25.106  -8.290  21.290  1.00 15.71 ? 157 VAL A CB    1 
ATOM   1226 C  CG1   . VAL A 1 159 ? 26.226  -8.053  20.284  1.00 18.22 ? 157 VAL A CG1   1 
ATOM   1227 C  CG2   . VAL A 1 159 ? 23.807  -8.613  20.552  1.00 17.88 ? 157 VAL A CG2   1 
ATOM   1228 N  N     . LYS A 1 160 ? 26.848  -8.334  23.918  1.00 16.21 ? 158 LYS A N     1 
ATOM   1229 C  CA    . LYS A 1 160 ? 28.103  -7.996  24.579  1.00 17.37 ? 158 LYS A CA    1 
ATOM   1230 C  C     . LYS A 1 160 ? 28.809  -9.226  25.156  1.00 16.69 ? 158 LYS A C     1 
ATOM   1231 O  O     . LYS A 1 160 ? 30.035  -9.320  25.115  1.00 18.85 ? 158 LYS A O     1 
ATOM   1232 C  CB    . LYS A 1 160 ? 27.856  -6.969  25.685  1.00 18.71 ? 158 LYS A CB    1 
ATOM   1233 C  CG    . LYS A 1 160 ? 27.493  -5.581  25.162  1.00 22.44 ? 158 LYS A CG    1 
ATOM   1234 C  CD    . LYS A 1 160 ? 27.226  -4.612  26.305  1.00 26.29 ? 158 LYS A CD    1 
ATOM   1235 C  CE    . LYS A 1 160 ? 28.477  -4.355  27.137  1.00 30.73 ? 158 LYS A CE    1 
ATOM   1236 N  NZ    . LYS A 1 160 ? 28.174  -3.579  28.376  1.00 32.54 ? 158 LYS A NZ    1 
ATOM   1237 N  N     . ALA A 1 161 ? 28.033  -10.163 25.682  1.00 18.61 ? 159 ALA A N     1 
ATOM   1238 C  CA    . ALA A 1 161 ? 28.610  -11.367 26.269  1.00 18.29 ? 159 ALA A CA    1 
ATOM   1239 C  C     . ALA A 1 161 ? 29.365  -12.236 25.262  1.00 19.89 ? 159 ALA A C     1 
ATOM   1240 O  O     . ALA A 1 161 ? 30.263  -12.988 25.649  1.00 19.38 ? 159 ALA A O     1 
ATOM   1241 C  CB    . ALA A 1 161 ? 27.519  -12.183 26.962  1.00 18.35 ? 159 ALA A CB    1 
ATOM   1242 N  N     . THR A 1 162 ? 29.016  -12.129 23.979  1.00 20.21 ? 160 THR A N     1 
ATOM   1243 C  CA    . THR A 1 162 ? 29.683  -12.916 22.936  1.00 21.79 ? 160 THR A CA    1 
ATOM   1244 C  C     . THR A 1 162 ? 31.081  -12.378 22.632  1.00 22.15 ? 160 THR A C     1 
ATOM   1245 O  O     . THR A 1 162 ? 31.929  -13.095 22.094  1.00 25.41 ? 160 THR A O     1 
ATOM   1246 C  CB    . THR A 1 162 ? 28.878  -12.922 21.603  1.00 21.18 ? 160 THR A CB    1 
ATOM   1247 O  OG1   . THR A 1 162 ? 28.961  -11.633 20.975  1.00 20.02 ? 160 THR A OG1   1 
ATOM   1248 C  CG2   . THR A 1 162 ? 27.416  -13.256 21.858  1.00 20.81 ? 160 THR A CG2   1 
ATOM   1249 N  N     . GLY A 1 163 ? 31.318  -11.119 22.985  1.00 21.37 ? 161 GLY A N     1 
ATOM   1250 C  CA    . GLY A 1 163 ? 32.606  -10.500 22.727  1.00 20.58 ? 161 GLY A CA    1 
ATOM   1251 C  C     . GLY A 1 163 ? 32.679  -9.858  21.349  1.00 19.18 ? 161 GLY A C     1 
ATOM   1252 O  O     . GLY A 1 163 ? 33.651  -9.180  21.018  1.00 20.53 ? 161 GLY A O     1 
ATOM   1253 N  N     . ALA A 1 164 ? 31.641  -10.053 20.544  1.00 18.92 ? 162 ALA A N     1 
ATOM   1254 C  CA    . ALA A 1 164 ? 31.623  -9.494  19.198  1.00 17.47 ? 162 ALA A CA    1 
ATOM   1255 C  C     . ALA A 1 164 ? 31.603  -7.970  19.163  1.00 16.78 ? 162 ALA A C     1 
ATOM   1256 O  O     . ALA A 1 164 ? 31.197  -7.312  20.122  1.00 16.51 ? 162 ALA A O     1 
ATOM   1257 C  CB    . ALA A 1 164 ? 30.419  -10.027 18.429  1.00 17.95 ? 162 ALA A CB    1 
ATOM   1258 N  N     . PHE A 1 165 ? 32.067  -7.424  18.043  1.00 16.61 ? 163 PHE A N     1 
ATOM   1259 C  CA    . PHE A 1 165 ? 32.046  -5.983  17.810  1.00 16.08 ? 163 PHE A CA    1 
ATOM   1260 C  C     . PHE A 1 165 ? 30.545  -5.664  17.750  1.00 16.12 ? 163 PHE A C     1 
ATOM   1261 O  O     . PHE A 1 165 ? 29.779  -6.418  17.152  1.00 16.43 ? 163 PHE A O     1 
ATOM   1262 C  CB    . PHE A 1 165 ? 32.713  -5.689  16.463  1.00 16.86 ? 163 PHE A CB    1 
ATOM   1263 C  CG    . PHE A 1 165 ? 32.637  -4.253  16.030  1.00 16.87 ? 163 PHE A CG    1 
ATOM   1264 C  CD1   . PHE A 1 165 ? 33.744  -3.418  16.149  1.00 18.93 ? 163 PHE A CD1   1 
ATOM   1265 C  CD2   . PHE A 1 165 ? 31.476  -3.751  15.458  1.00 16.25 ? 163 PHE A CD2   1 
ATOM   1266 C  CE1   . PHE A 1 165 ? 33.693  -2.093  15.689  1.00 19.51 ? 163 PHE A CE1   1 
ATOM   1267 C  CE2   . PHE A 1 165 ? 31.418  -2.430  14.998  1.00 19.77 ? 163 PHE A CE2   1 
ATOM   1268 C  CZ    . PHE A 1 165 ? 32.530  -1.606  15.117  1.00 19.53 ? 163 PHE A CZ    1 
ATOM   1269 N  N     . LEU A 1 166 ? 30.119  -4.569  18.374  1.00 13.86 ? 164 LEU A N     1 
ATOM   1270 C  CA    . LEU A 1 166 ? 28.702  -4.208  18.376  1.00 14.59 ? 164 LEU A CA    1 
ATOM   1271 C  C     . LEU A 1 166 ? 28.477  -2.783  17.886  1.00 14.97 ? 164 LEU A C     1 
ATOM   1272 O  O     . LEU A 1 166 ? 29.006  -1.831  18.457  1.00 14.85 ? 164 LEU A O     1 
ATOM   1273 C  CB    . LEU A 1 166 ? 28.121  -4.361  19.787  1.00 15.19 ? 164 LEU A CB    1 
ATOM   1274 C  CG    . LEU A 1 166 ? 26.683  -3.907  20.055  1.00 15.53 ? 164 LEU A CG    1 
ATOM   1275 C  CD1   . LEU A 1 166 ? 25.712  -4.591  19.096  1.00 15.74 ? 164 LEU A CD1   1 
ATOM   1276 C  CD2   . LEU A 1 166 ? 26.334  -4.236  21.509  1.00 16.85 ? 164 LEU A CD2   1 
ATOM   1277 N  N     . GLY A 1 167 ? 27.704  -2.660  16.813  1.00 15.55 ? 165 GLY A N     1 
ATOM   1278 C  CA    . GLY A 1 167 ? 27.391  -1.361  16.251  1.00 16.83 ? 165 GLY A CA    1 
ATOM   1279 C  C     . GLY A 1 167 ? 25.897  -1.146  16.365  1.00 17.85 ? 165 GLY A C     1 
ATOM   1280 O  O     . GLY A 1 167 ? 25.119  -2.080  16.172  1.00 17.14 ? 165 GLY A O     1 
ATOM   1281 N  N     . CYS A 1 168 ? 25.488  0.073   16.696  1.00 15.79 ? 166 CYS A N     1 
ATOM   1282 C  CA    . CYS A 1 168 ? 24.073  0.377   16.834  1.00 18.19 ? 166 CYS A CA    1 
ATOM   1283 C  C     . CYS A 1 168 ? 23.688  1.641   16.097  1.00 18.99 ? 166 CYS A C     1 
ATOM   1284 O  O     . CYS A 1 168 ? 24.255  2.695   16.352  1.00 22.46 ? 166 CYS A O     1 
ATOM   1285 C  CB    . CYS A 1 168 ? 23.706  0.577   18.304  1.00 19.10 ? 166 CYS A CB    1 
ATOM   1286 S  SG    . CYS A 1 168 ? 23.666  -0.905  19.324  1.00 24.22 ? 166 CYS A SG    1 
ATOM   1287 N  N     . ASP A 1 169 ? 22.737  1.537   15.177  1.00 18.91 ? 167 ASP A N     1 
ATOM   1288 C  CA    . ASP A 1 169 ? 22.255  2.728   14.488  1.00 20.06 ? 167 ASP A CA    1 
ATOM   1289 C  C     . ASP A 1 169 ? 20.810  2.844   14.948  1.00 19.84 ? 167 ASP A C     1 
ATOM   1290 O  O     . ASP A 1 169 ? 19.886  2.378   14.278  1.00 20.53 ? 167 ASP A O     1 
ATOM   1291 C  CB    . ASP A 1 169 ? 22.311  2.590   12.966  1.00 18.32 ? 167 ASP A CB    1 
ATOM   1292 C  CG    . ASP A 1 169 ? 21.950  3.896   12.259  1.00 22.62 ? 167 ASP A CG    1 
ATOM   1293 O  OD1   . ASP A 1 169 ? 21.557  4.853   12.962  1.00 20.82 ? 167 ASP A OD1   1 
ATOM   1294 O  OD2   . ASP A 1 169 ? 22.056  3.971   11.017  1.00 22.79 ? 167 ASP A OD2   1 
ATOM   1295 N  N     . ASN A 1 170 ? 20.641  3.442   16.123  1.00 21.12 ? 168 ASN A N     1 
ATOM   1296 C  CA    . ASN A 1 170 ? 19.337  3.627   16.749  1.00 21.32 ? 168 ASN A CA    1 
ATOM   1297 C  C     . ASN A 1 170 ? 19.161  5.079   17.177  1.00 21.36 ? 168 ASN A C     1 
ATOM   1298 O  O     . ASN A 1 170 ? 20.081  5.887   17.060  1.00 21.89 ? 168 ASN A O     1 
ATOM   1299 C  CB    . ASN A 1 170 ? 19.228  2.719   17.978  1.00 23.33 ? 168 ASN A CB    1 
ATOM   1300 C  CG    . ASN A 1 170 ? 19.119  1.252   17.611  1.00 23.12 ? 168 ASN A CG    1 
ATOM   1301 O  OD1   . ASN A 1 170 ? 18.037  0.760   17.299  1.00 25.96 ? 168 ASN A OD1   1 
ATOM   1302 N  ND2   . ASN A 1 170 ? 20.243  0.550   17.633  1.00 21.77 ? 168 ASN A ND2   1 
ATOM   1303 N  N     . SER A 1 171 ? 17.983  5.401   17.698  1.00 22.88 ? 169 SER A N     1 
ATOM   1304 C  CA    . SER A 1 171 ? 17.703  6.762   18.135  1.00 23.28 ? 169 SER A CA    1 
ATOM   1305 C  C     . SER A 1 171 ? 17.035  6.795   19.503  1.00 23.91 ? 169 SER A C     1 
ATOM   1306 O  O     . SER A 1 171 ? 16.769  5.754   20.103  1.00 23.25 ? 169 SER A O     1 
ATOM   1307 C  CB    . SER A 1 171 ? 16.795  7.452   17.121  1.00 25.53 ? 169 SER A CB    1 
ATOM   1308 O  OG    . SER A 1 171 ? 15.593  6.719   16.964  1.00 26.66 ? 169 SER A OG    1 
ATOM   1309 N  N     . GLY A 1 172 ? 16.774  8.008   19.983  1.00 23.92 ? 170 GLY A N     1 
ATOM   1310 C  CA    . GLY A 1 172 ? 16.113  8.193   21.263  1.00 23.63 ? 170 GLY A CA    1 
ATOM   1311 C  C     . GLY A 1 172 ? 16.677  7.421   22.442  1.00 22.94 ? 170 GLY A C     1 
ATOM   1312 O  O     . GLY A 1 172 ? 17.889  7.334   22.623  1.00 20.12 ? 170 GLY A O     1 
ATOM   1313 N  N     . GLU A 1 173 ? 15.778  6.869   23.251  1.00 24.28 ? 171 GLU A N     1 
ATOM   1314 C  CA    . GLU A 1 173 ? 16.150  6.111   24.439  1.00 24.88 ? 171 GLU A CA    1 
ATOM   1315 C  C     . GLU A 1 173 ? 16.952  4.856   24.116  1.00 23.20 ? 171 GLU A C     1 
ATOM   1316 O  O     . GLU A 1 173 ? 17.764  4.400   24.927  1.00 23.88 ? 171 GLU A O     1 
ATOM   1317 C  CB    . GLU A 1 173 ? 14.893  5.727   25.219  1.00 28.76 ? 171 GLU A CB    1 
ATOM   1318 C  CG    . GLU A 1 173 ? 14.063  6.914   25.667  1.00 34.91 ? 171 GLU A CG    1 
ATOM   1319 C  CD    . GLU A 1 173 ? 14.832  7.843   26.579  1.00 38.75 ? 171 GLU A CD    1 
ATOM   1320 O  OE1   . GLU A 1 173 ? 15.295  7.381   27.643  1.00 41.90 ? 171 GLU A OE1   1 
ATOM   1321 O  OE2   . GLU A 1 173 ? 14.976  9.034   26.232  1.00 41.32 ? 171 GLU A OE2   1 
ATOM   1322 N  N     . TYR A 1 174 ? 16.718  4.291   22.939  1.00 22.07 ? 172 TYR A N     1 
ATOM   1323 C  CA    . TYR A 1 174 ? 17.428  3.089   22.522  1.00 21.59 ? 172 TYR A CA    1 
ATOM   1324 C  C     . TYR A 1 174 ? 18.893  3.420   22.274  1.00 20.39 ? 172 TYR A C     1 
ATOM   1325 O  O     . TYR A 1 174 ? 19.785  2.665   22.664  1.00 18.19 ? 172 TYR A O     1 
ATOM   1326 C  CB    . TYR A 1 174 ? 16.758  2.510   21.275  1.00 22.97 ? 172 TYR A CB    1 
ATOM   1327 C  CG    . TYR A 1 174 ? 15.359  2.024   21.576  1.00 24.99 ? 172 TYR A CG    1 
ATOM   1328 C  CD1   . TYR A 1 174 ? 15.160  0.881   22.338  1.00 25.42 ? 172 TYR A CD1   1 
ATOM   1329 C  CD2   . TYR A 1 174 ? 14.235  2.748   21.172  1.00 29.13 ? 172 TYR A CD2   1 
ATOM   1330 C  CE1   . TYR A 1 174 ? 13.889  0.471   22.697  1.00 27.98 ? 172 TYR A CE1   1 
ATOM   1331 C  CE2   . TYR A 1 174 ? 12.947  2.337   21.536  1.00 29.57 ? 172 TYR A CE2   1 
ATOM   1332 C  CZ    . TYR A 1 174 ? 12.790  1.196   22.303  1.00 30.93 ? 172 TYR A CZ    1 
ATOM   1333 O  OH    . TYR A 1 174 ? 11.543  0.768   22.710  1.00 33.94 ? 172 TYR A OH    1 
ATOM   1334 N  N     . LEU A 1 175 ? 19.138  4.566   21.648  1.00 19.37 ? 173 LEU A N     1 
ATOM   1335 C  CA    . LEU A 1 175 ? 20.500  5.019   21.381  1.00 20.12 ? 173 LEU A CA    1 
ATOM   1336 C  C     . LEU A 1 175 ? 21.189  5.352   22.707  1.00 20.46 ? 173 LEU A C     1 
ATOM   1337 O  O     . LEU A 1 175 ? 22.350  5.001   22.923  1.00 21.84 ? 173 LEU A O     1 
ATOM   1338 C  CB    . LEU A 1 175 ? 20.475  6.265   20.489  1.00 19.97 ? 173 LEU A CB    1 
ATOM   1339 C  CG    . LEU A 1 175 ? 21.806  6.992   20.268  1.00 21.48 ? 173 LEU A CG    1 
ATOM   1340 C  CD1   . LEU A 1 175 ? 22.806  6.079   19.577  1.00 21.34 ? 173 LEU A CD1   1 
ATOM   1341 C  CD2   . LEU A 1 175 ? 21.563  8.240   19.430  1.00 21.56 ? 173 LEU A CD2   1 
ATOM   1342 N  N     . ASN A 1 176 ? 20.464  6.041   23.587  1.00 22.08 ? 174 ASN A N     1 
ATOM   1343 C  CA    . ASN A 1 176 ? 20.991  6.419   24.894  1.00 21.96 ? 174 ASN A CA    1 
ATOM   1344 C  C     . ASN A 1 176 ? 21.451  5.178   25.660  1.00 21.01 ? 174 ASN A C     1 
ATOM   1345 O  O     . ASN A 1 176 ? 22.541  5.151   26.233  1.00 20.77 ? 174 ASN A O     1 
ATOM   1346 C  CB    . ASN A 1 176 ? 19.913  7.144   25.710  1.00 26.45 ? 174 ASN A CB    1 
ATOM   1347 C  CG    . ASN A 1 176 ? 19.487  8.456   25.078  1.00 30.96 ? 174 ASN A CG    1 
ATOM   1348 O  OD1   . ASN A 1 176 ? 20.324  9.256   24.671  1.00 38.21 ? 174 ASN A OD1   1 
ATOM   1349 N  ND2   . ASN A 1 176 ? 18.180  8.686   25.005  1.00 36.39 ? 174 ASN A ND2   1 
ATOM   1350 N  N     . LEU A 1 177 ? 20.611  4.152   25.649  1.00 20.90 ? 175 LEU A N     1 
ATOM   1351 C  CA    . LEU A 1 177 ? 20.909  2.905   26.342  1.00 22.17 ? 175 LEU A CA    1 
ATOM   1352 C  C     . LEU A 1 177 ? 22.138  2.216   25.759  1.00 22.94 ? 175 LEU A C     1 
ATOM   1353 O  O     . LEU A 1 177 ? 22.984  1.718   26.500  1.00 22.56 ? 175 LEU A O     1 
ATOM   1354 C  CB    . LEU A 1 177 ? 19.699  1.970   26.270  1.00 24.56 ? 175 LEU A CB    1 
ATOM   1355 C  CG    . LEU A 1 177 ? 19.814  0.636   27.012  1.00 25.06 ? 175 LEU A CG    1 
ATOM   1356 C  CD1   . LEU A 1 177 ? 20.045  0.888   28.493  1.00 25.40 ? 175 LEU A CD1   1 
ATOM   1357 C  CD2   . LEU A 1 177 ? 18.545  -0.171  26.801  1.00 26.92 ? 175 LEU A CD2   1 
ATOM   1358 N  N     . ALA A 1 178 ? 22.236  2.187   24.431  1.00 22.95 ? 176 ALA A N     1 
ATOM   1359 C  CA    . ALA A 1 178 ? 23.374  1.555   23.773  1.00 22.81 ? 176 ALA A CA    1 
ATOM   1360 C  C     . ALA A 1 178 ? 24.667  2.227   24.215  1.00 22.22 ? 176 ALA A C     1 
ATOM   1361 O  O     . ALA A 1 178 ? 25.657  1.560   24.505  1.00 23.15 ? 176 ALA A O     1 
ATOM   1362 C  CB    . ALA A 1 178 ? 23.227  1.646   22.261  1.00 23.60 ? 176 ALA A CB    1 
ATOM   1363 N  N     . VAL A 1 179 ? 24.659  3.555   24.266  1.00 20.78 ? 177 VAL A N     1 
ATOM   1364 C  CA    . VAL A 1 179 ? 25.845  4.292   24.681  1.00 21.16 ? 177 VAL A CA    1 
ATOM   1365 C  C     . VAL A 1 179 ? 26.195  4.006   26.143  1.00 21.25 ? 177 VAL A C     1 
ATOM   1366 O  O     . VAL A 1 179 ? 27.366  3.818   26.482  1.00 21.19 ? 177 VAL A O     1 
ATOM   1367 C  CB    . VAL A 1 179 ? 25.649  5.813   24.503  1.00 21.33 ? 177 VAL A CB    1 
ATOM   1368 C  CG1   . VAL A 1 179 ? 26.856  6.559   25.039  1.00 22.45 ? 177 VAL A CG1   1 
ATOM   1369 C  CG2   . VAL A 1 179 ? 25.454  6.142   23.033  1.00 21.10 ? 177 VAL A CG2   1 
ATOM   1370 N  N     . GLU A 1 180 ? 25.178  3.983   27.001  1.00 22.80 ? 178 GLU A N     1 
ATOM   1371 C  CA    . GLU A 1 180 ? 25.372  3.722   28.429  1.00 26.71 ? 178 GLU A CA    1 
ATOM   1372 C  C     . GLU A 1 180 ? 25.904  2.311   28.635  1.00 26.50 ? 178 GLU A C     1 
ATOM   1373 O  O     . GLU A 1 180 ? 26.763  2.075   29.484  1.00 26.50 ? 178 GLU A O     1 
ATOM   1374 C  CB    . GLU A 1 180 ? 24.045  3.862   29.184  1.00 28.73 ? 178 GLU A CB    1 
ATOM   1375 C  CG    . GLU A 1 180 ? 23.347  5.201   29.002  1.00 36.72 ? 178 GLU A CG    1 
ATOM   1376 C  CD    . GLU A 1 180 ? 22.001  5.263   29.706  1.00 39.44 ? 178 GLU A CD    1 
ATOM   1377 O  OE1   . GLU A 1 180 ? 21.154  4.375   29.465  1.00 44.03 ? 178 GLU A OE1   1 
ATOM   1378 O  OE2   . GLU A 1 180 ? 21.784  6.206   30.498  1.00 42.75 ? 178 GLU A OE2   1 
HETATM 1379 N  N     . MSE A 1 181 ? 25.370  1.381   27.852  1.00 28.05 ? 179 MSE A N     1 
HETATM 1380 C  CA    . MSE A 1 181 ? 25.749  -0.023  27.918  1.00 29.11 ? 179 MSE A CA    1 
HETATM 1381 C  C     . MSE A 1 181 ? 27.171  -0.254  27.465  1.00 29.17 ? 179 MSE A C     1 
HETATM 1382 O  O     . MSE A 1 181 ? 27.883  -1.091  28.019  1.00 29.57 ? 179 MSE A O     1 
HETATM 1383 C  CB    . MSE A 1 181 ? 24.812  -0.855  27.041  1.00 31.84 ? 179 MSE A CB    1 
HETATM 1384 C  CG    . MSE A 1 181 ? 23.495  -1.166  27.697  1.00 36.38 ? 179 MSE A CG    1 
HETATM 1385 SE SE    . MSE A 1 181 ? 23.915  -2.084  29.310  1.00 44.51 ? 179 MSE A SE    1 
HETATM 1386 C  CE    . MSE A 1 181 ? 24.794  -3.633  28.563  1.00 43.32 ? 179 MSE A CE    1 
ATOM   1387 N  N     . GLY A 1 182 ? 27.572  0.497   26.450  1.00 27.71 ? 180 GLY A N     1 
ATOM   1388 C  CA    . GLY A 1 182 ? 28.898  0.354   25.904  1.00 25.41 ? 180 GLY A CA    1 
ATOM   1389 C  C     . GLY A 1 182 ? 28.820  -0.427  24.607  1.00 25.65 ? 180 GLY A C     1 
ATOM   1390 O  O     . GLY A 1 182 ? 28.632  -1.649  24.609  1.00 27.22 ? 180 GLY A O     1 
ATOM   1391 N  N     . VAL A 1 183 ? 28.918  0.289   23.493  1.00 21.13 ? 181 VAL A N     1 
ATOM   1392 C  CA    . VAL A 1 183 ? 28.908  -0.329  22.174  1.00 19.27 ? 181 VAL A CA    1 
ATOM   1393 C  C     . VAL A 1 183 ? 30.139  0.193   21.446  1.00 17.78 ? 181 VAL A C     1 
ATOM   1394 O  O     . VAL A 1 183 ? 30.751  1.171   21.877  1.00 18.43 ? 181 VAL A O     1 
ATOM   1395 C  CB    . VAL A 1 183 ? 27.624  0.009   21.379  1.00 19.82 ? 181 VAL A CB    1 
ATOM   1396 C  CG1   . VAL A 1 183 ? 26.418  -0.629  22.059  1.00 18.95 ? 181 VAL A CG1   1 
ATOM   1397 C  CG2   . VAL A 1 183 ? 27.449  1.516   21.266  1.00 18.85 ? 181 VAL A CG2   1 
ATOM   1398 N  N     . ASP A 1 184 ? 30.507  -0.459  20.349  1.00 14.87 ? 182 ASP A N     1 
ATOM   1399 C  CA    . ASP A 1 184 ? 31.691  -0.080  19.590  1.00 14.03 ? 182 ASP A CA    1 
ATOM   1400 C  C     . ASP A 1 184 ? 31.477  1.011   18.553  1.00 15.12 ? 182 ASP A C     1 
ATOM   1401 O  O     . ASP A 1 184 ? 32.396  1.768   18.251  1.00 15.37 ? 182 ASP A O     1 
ATOM   1402 C  CB    . ASP A 1 184 ? 32.253  -1.312  18.883  1.00 15.54 ? 182 ASP A CB    1 
ATOM   1403 C  CG    . ASP A 1 184 ? 32.772  -2.347  19.852  1.00 17.85 ? 182 ASP A CG    1 
ATOM   1404 O  OD1   . ASP A 1 184 ? 33.867  -2.123  20.409  1.00 18.89 ? 182 ASP A OD1   1 
ATOM   1405 O  OD2   . ASP A 1 184 ? 32.087  -3.372  20.068  1.00 16.91 ? 182 ASP A OD2   1 
ATOM   1406 N  N     . PHE A 1 185 ? 30.265  1.083   18.016  1.00 14.87 ? 183 PHE A N     1 
ATOM   1407 C  CA    . PHE A 1 185 ? 29.964  2.045   16.964  1.00 14.79 ? 183 PHE A CA    1 
ATOM   1408 C  C     . PHE A 1 185 ? 28.526  2.547   16.974  1.00 14.61 ? 183 PHE A C     1 
ATOM   1409 O  O     . PHE A 1 185 ? 27.592  1.783   17.211  1.00 15.05 ? 183 PHE A O     1 
ATOM   1410 C  CB    . PHE A 1 185 ? 30.253  1.377   15.612  1.00 15.57 ? 183 PHE A CB    1 
ATOM   1411 C  CG    . PHE A 1 185 ? 29.645  2.078   14.428  1.00 17.52 ? 183 PHE A CG    1 
ATOM   1412 C  CD1   . PHE A 1 185 ? 30.266  3.178   13.861  1.00 15.48 ? 183 PHE A CD1   1 
ATOM   1413 C  CD2   . PHE A 1 185 ? 28.468  1.605   13.852  1.00 20.63 ? 183 PHE A CD2   1 
ATOM   1414 C  CE1   . PHE A 1 185 ? 29.735  3.799   12.725  1.00 17.99 ? 183 PHE A CE1   1 
ATOM   1415 C  CE2   . PHE A 1 185 ? 27.928  2.220   12.714  1.00 22.46 ? 183 PHE A CE2   1 
ATOM   1416 C  CZ    . PHE A 1 185 ? 28.570  3.320   12.153  1.00 20.03 ? 183 PHE A CZ    1 
ATOM   1417 N  N     . ILE A 1 186 ? 28.360  3.845   16.743  1.00 15.92 ? 184 ILE A N     1 
ATOM   1418 C  CA    . ILE A 1 186 ? 27.034  4.441   16.629  1.00 15.45 ? 184 ILE A CA    1 
ATOM   1419 C  C     . ILE A 1 186 ? 27.141  5.505   15.542  1.00 14.99 ? 184 ILE A C     1 
ATOM   1420 O  O     . ILE A 1 186 ? 28.230  6.016   15.276  1.00 16.38 ? 184 ILE A O     1 
ATOM   1421 C  CB    . ILE A 1 186 ? 26.530  5.112   17.932  1.00 16.86 ? 184 ILE A CB    1 
ATOM   1422 C  CG1   . ILE A 1 186 ? 27.444  6.264   18.338  1.00 17.04 ? 184 ILE A CG1   1 
ATOM   1423 C  CG2   . ILE A 1 186 ? 26.408  4.072   19.037  1.00 17.16 ? 184 ILE A CG2   1 
ATOM   1424 C  CD1   . ILE A 1 186 ? 26.810  7.163   19.406  1.00 17.42 ? 184 ILE A CD1   1 
ATOM   1425 N  N     . LYS A 1 187 ? 26.023  5.805   14.888  1.00 14.24 ? 185 LYS A N     1 
ATOM   1426 C  CA    . LYS A 1 187 ? 26.023  6.828   13.848  1.00 15.50 ? 185 LYS A CA    1 
ATOM   1427 C  C     . LYS A 1 187 ? 24.776  7.685   13.925  1.00 15.68 ? 185 LYS A C     1 
ATOM   1428 O  O     . LYS A 1 187 ? 23.896  7.605   13.071  1.00 17.32 ? 185 LYS A O     1 
ATOM   1429 C  CB    . LYS A 1 187 ? 26.092  6.235   12.436  1.00 17.67 ? 185 LYS A CB    1 
ATOM   1430 C  CG    . LYS A 1 187 ? 26.249  7.338   11.366  1.00 16.43 ? 185 LYS A CG    1 
ATOM   1431 C  CD    . LYS A 1 187 ? 25.658  6.966   10.014  1.00 16.25 ? 185 LYS A CD    1 
ATOM   1432 C  CE    . LYS A 1 187 ? 24.134  6.863   10.062  1.00 15.83 ? 185 LYS A CE    1 
ATOM   1433 N  NZ    . LYS A 1 187 ? 23.483  8.165   10.441  1.00 17.04 ? 185 LYS A NZ    1 
ATOM   1434 N  N     . PRO A 1 188 ? 24.667  8.506   14.966  1.00 17.11 ? 186 PRO A N     1 
ATOM   1435 C  CA    . PRO A 1 188 ? 23.465  9.336   15.020  1.00 18.51 ? 186 PRO A CA    1 
ATOM   1436 C  C     . PRO A 1 188 ? 23.589  10.427  13.963  1.00 20.19 ? 186 PRO A C     1 
ATOM   1437 O  O     . PRO A 1 188 ? 24.700  10.895  13.695  1.00 19.16 ? 186 PRO A O     1 
ATOM   1438 C  CB    . PRO A 1 188 ? 23.509  9.911   16.432  1.00 18.27 ? 186 PRO A CB    1 
ATOM   1439 C  CG    . PRO A 1 188 ? 24.980  9.974   16.734  1.00 18.16 ? 186 PRO A CG    1 
ATOM   1440 C  CD    . PRO A 1 188 ? 25.492  8.664   16.175  1.00 17.46 ? 186 PRO A CD    1 
ATOM   1441 N  N     . ASN A 1 189 ? 22.478  10.811  13.341  1.00 20.55 ? 187 ASN A N     1 
ATOM   1442 C  CA    . ASN A 1 189 ? 22.547  11.895  12.373  1.00 21.74 ? 187 ASN A CA    1 
ATOM   1443 C  C     . ASN A 1 189 ? 22.496  13.198  13.167  1.00 22.60 ? 187 ASN A C     1 
ATOM   1444 O  O     . ASN A 1 189 ? 22.480  13.175  14.401  1.00 21.95 ? 187 ASN A O     1 
ATOM   1445 C  CB    . ASN A 1 189 ? 21.415  11.828  11.331  1.00 22.28 ? 187 ASN A CB    1 
ATOM   1446 C  CG    . ASN A 1 189 ? 20.032  11.976  11.933  1.00 22.40 ? 187 ASN A CG    1 
ATOM   1447 O  OD1   . ASN A 1 189 ? 19.845  12.622  12.962  1.00 25.78 ? 187 ASN A OD1   1 
ATOM   1448 N  ND2   . ASN A 1 189 ? 19.041  11.393  11.262  1.00 25.35 ? 187 ASN A ND2   1 
ATOM   1449 N  N     . GLU A 1 190 ? 22.472  14.330  12.474  1.00 24.45 ? 188 GLU A N     1 
ATOM   1450 C  CA    . GLU A 1 190 ? 22.481  15.622  13.151  1.00 26.36 ? 188 GLU A CA    1 
ATOM   1451 C  C     . GLU A 1 190 ? 21.347  15.860  14.148  1.00 26.28 ? 188 GLU A C     1 
ATOM   1452 O  O     . GLU A 1 190 ? 21.532  16.566  15.138  1.00 26.71 ? 188 GLU A O     1 
ATOM   1453 C  CB    . GLU A 1 190 ? 22.531  16.746  12.113  1.00 27.91 ? 188 GLU A CB    1 
ATOM   1454 C  CG    . GLU A 1 190 ? 22.631  18.140  12.708  1.00 34.13 ? 188 GLU A CG    1 
ATOM   1455 C  CD    . GLU A 1 190 ? 23.324  19.116  11.776  1.00 34.73 ? 188 GLU A CD    1 
ATOM   1456 O  OE1   . GLU A 1 190 ? 22.991  19.129  10.572  1.00 37.77 ? 188 GLU A OE1   1 
ATOM   1457 O  OE2   . GLU A 1 190 ? 24.195  19.876  12.252  1.00 36.04 ? 188 GLU A OE2   1 
ATOM   1458 N  N     . ASP A 1 191 ? 20.183  15.270  13.903  1.00 26.52 ? 189 ASP A N     1 
ATOM   1459 C  CA    . ASP A 1 191 ? 19.054  15.438  14.816  1.00 28.32 ? 189 ASP A CA    1 
ATOM   1460 C  C     . ASP A 1 191 ? 19.074  14.412  15.946  1.00 27.94 ? 189 ASP A C     1 
ATOM   1461 O  O     . ASP A 1 191 ? 18.831  14.749  17.108  1.00 27.64 ? 189 ASP A O     1 
ATOM   1462 C  CB    . ASP A 1 191 ? 17.728  15.324  14.059  1.00 30.70 ? 189 ASP A CB    1 
ATOM   1463 C  CG    . ASP A 1 191 ? 17.501  16.480  13.109  1.00 34.74 ? 189 ASP A CG    1 
ATOM   1464 O  OD1   . ASP A 1 191 ? 17.717  17.636  13.528  1.00 36.58 ? 189 ASP A OD1   1 
ATOM   1465 O  OD2   . ASP A 1 191 ? 17.097  16.236  11.952  1.00 37.58 ? 189 ASP A OD2   1 
ATOM   1466 N  N     . GLU A 1 192 ? 19.370  13.164  15.597  1.00 26.49 ? 190 GLU A N     1 
ATOM   1467 C  CA    . GLU A 1 192 ? 19.405  12.070  16.566  1.00 25.50 ? 190 GLU A CA    1 
ATOM   1468 C  C     . GLU A 1 192 ? 20.463  12.237  17.648  1.00 25.59 ? 190 GLU A C     1 
ATOM   1469 O  O     . GLU A 1 192 ? 20.260  11.823  18.788  1.00 26.01 ? 190 GLU A O     1 
ATOM   1470 C  CB    . GLU A 1 192 ? 19.644  10.741  15.846  1.00 24.05 ? 190 GLU A CB    1 
ATOM   1471 C  CG    . GLU A 1 192 ? 18.656  10.455  14.724  1.00 25.85 ? 190 GLU A CG    1 
ATOM   1472 C  CD    . GLU A 1 192 ? 19.006  9.200   13.953  1.00 24.34 ? 190 GLU A CD    1 
ATOM   1473 O  OE1   . GLU A 1 192 ? 20.200  9.018   13.629  1.00 22.78 ? 190 GLU A OE1   1 
ATOM   1474 O  OE2   . GLU A 1 192 ? 18.090  8.404   13.660  1.00 24.73 ? 190 GLU A OE2   1 
ATOM   1475 N  N     . VAL A 1 193 ? 21.590  12.844  17.293  1.00 26.45 ? 191 VAL A N     1 
ATOM   1476 C  CA    . VAL A 1 193 ? 22.675  13.025  18.246  1.00 25.56 ? 191 VAL A CA    1 
ATOM   1477 C  C     . VAL A 1 193 ? 22.277  13.868  19.455  1.00 26.18 ? 191 VAL A C     1 
ATOM   1478 O  O     . VAL A 1 193 ? 22.902  13.771  20.506  1.00 24.67 ? 191 VAL A O     1 
ATOM   1479 C  CB    . VAL A 1 193 ? 23.921  13.654  17.567  1.00 25.45 ? 191 VAL A CB    1 
ATOM   1480 C  CG1   . VAL A 1 193 ? 23.697  15.137  17.318  1.00 27.46 ? 191 VAL A CG1   1 
ATOM   1481 C  CG2   . VAL A 1 193 ? 25.155  13.422  18.429  1.00 24.32 ? 191 VAL A CG2   1 
ATOM   1482 N  N     . ILE A 1 194 ? 21.231  14.679  19.310  1.00 26.58 ? 192 ILE A N     1 
ATOM   1483 C  CA    . ILE A 1 194 ? 20.772  15.522  20.410  1.00 28.37 ? 192 ILE A CA    1 
ATOM   1484 C  C     . ILE A 1 194 ? 20.469  14.683  21.655  1.00 29.26 ? 192 ILE A C     1 
ATOM   1485 O  O     . ILE A 1 194 ? 20.766  15.084  22.784  1.00 28.77 ? 192 ILE A O     1 
ATOM   1486 C  CB    . ILE A 1 194 ? 19.502  16.314  20.015  1.00 30.38 ? 192 ILE A CB    1 
ATOM   1487 C  CG1   . ILE A 1 194 ? 19.830  17.286  18.876  1.00 31.10 ? 192 ILE A CG1   1 
ATOM   1488 C  CG2   . ILE A 1 194 ? 18.958  17.063  21.227  1.00 30.02 ? 192 ILE A CG2   1 
ATOM   1489 C  CD1   . ILE A 1 194 ? 18.642  18.099  18.385  1.00 34.53 ? 192 ILE A CD1   1 
ATOM   1490 N  N     . ALA A 1 195 ? 19.888  13.509  21.441  1.00 29.32 ? 193 ALA A N     1 
ATOM   1491 C  CA    . ALA A 1 195 ? 19.539  12.618  22.541  1.00 29.43 ? 193 ALA A CA    1 
ATOM   1492 C  C     . ALA A 1 195 ? 20.702  12.279  23.472  1.00 30.25 ? 193 ALA A C     1 
ATOM   1493 O  O     . ALA A 1 195 ? 20.490  12.015  24.655  1.00 31.15 ? 193 ALA A O     1 
ATOM   1494 C  CB    . ALA A 1 195 ? 18.936  11.339  21.991  1.00 30.16 ? 193 ALA A CB    1 
ATOM   1495 N  N     . ILE A 1 196 ? 21.926  12.282  22.951  1.00 29.78 ? 194 ILE A N     1 
ATOM   1496 C  CA    . ILE A 1 196 ? 23.085  11.948  23.775  1.00 29.47 ? 194 ILE A CA    1 
ATOM   1497 C  C     . ILE A 1 196 ? 24.033  13.118  24.024  1.00 30.47 ? 194 ILE A C     1 
ATOM   1498 O  O     . ILE A 1 196 ? 25.141  12.933  24.527  1.00 30.32 ? 194 ILE A O     1 
ATOM   1499 C  CB    . ILE A 1 196 ? 23.889  10.776  23.158  1.00 27.25 ? 194 ILE A CB    1 
ATOM   1500 C  CG1   . ILE A 1 196 ? 24.378  11.146  21.758  1.00 28.45 ? 194 ILE A CG1   1 
ATOM   1501 C  CG2   . ILE A 1 196 ? 23.019  9.536   23.085  1.00 27.64 ? 194 ILE A CG2   1 
ATOM   1502 C  CD1   . ILE A 1 196 ? 25.257  10.079  21.117  1.00 27.33 ? 194 ILE A CD1   1 
ATOM   1503 N  N     . LEU A 1 197 ? 23.590  14.323  23.681  1.00 32.58 ? 195 LEU A N     1 
ATOM   1504 C  CA    . LEU A 1 197 ? 24.395  15.525  23.878  1.00 34.95 ? 195 LEU A CA    1 
ATOM   1505 C  C     . LEU A 1 197 ? 24.215  16.074  25.292  1.00 35.76 ? 195 LEU A C     1 
ATOM   1506 O  O     . LEU A 1 197 ? 23.173  15.869  25.914  1.00 35.97 ? 195 LEU A O     1 
ATOM   1507 C  CB    . LEU A 1 197 ? 23.974  16.600  22.872  1.00 37.44 ? 195 LEU A CB    1 
ATOM   1508 C  CG    . LEU A 1 197 ? 24.930  17.031  21.757  1.00 39.22 ? 195 LEU A CG    1 
ATOM   1509 C  CD1   . LEU A 1 197 ? 25.401  15.827  20.959  1.00 39.18 ? 195 LEU A CD1   1 
ATOM   1510 C  CD2   . LEU A 1 197 ? 24.209  18.028  20.856  1.00 39.24 ? 195 LEU A CD2   1 
ATOM   1511 N  N     . ASP A 1 198 ? 25.236  16.759  25.802  1.00 36.48 ? 196 ASP A N     1 
ATOM   1512 C  CA    . ASP A 1 198 ? 25.149  17.377  27.121  1.00 37.22 ? 196 ASP A CA    1 
ATOM   1513 C  C     . ASP A 1 198 ? 24.694  18.813  26.896  1.00 37.98 ? 196 ASP A C     1 
ATOM   1514 O  O     . ASP A 1 198 ? 25.420  19.621  26.317  1.00 36.79 ? 196 ASP A O     1 
ATOM   1515 C  CB    . ASP A 1 198 ? 26.504  17.372  27.836  1.00 36.74 ? 196 ASP A CB    1 
ATOM   1516 C  CG    . ASP A 1 198 ? 26.495  18.215  29.103  1.00 37.81 ? 196 ASP A CG    1 
ATOM   1517 O  OD1   . ASP A 1 198 ? 25.405  18.395  29.686  1.00 36.96 ? 196 ASP A OD1   1 
ATOM   1518 O  OD2   . ASP A 1 198 ? 27.574  18.691  29.525  1.00 35.46 ? 196 ASP A OD2   1 
ATOM   1519 N  N     . GLU A 1 199 ? 23.484  19.118  27.350  1.00 40.27 ? 197 GLU A N     1 
ATOM   1520 C  CA    . GLU A 1 199 ? 22.896  20.445  27.192  1.00 43.38 ? 197 GLU A CA    1 
ATOM   1521 C  C     . GLU A 1 199 ? 23.801  21.579  27.659  1.00 43.90 ? 197 GLU A C     1 
ATOM   1522 O  O     . GLU A 1 199 ? 23.828  22.649  27.047  1.00 44.30 ? 197 GLU A O     1 
ATOM   1523 C  CB    . GLU A 1 199 ? 21.568  20.509  27.943  1.00 45.23 ? 197 GLU A CB    1 
ATOM   1524 C  CG    . GLU A 1 199 ? 20.563  19.466  27.496  1.00 48.07 ? 197 GLU A CG    1 
ATOM   1525 C  CD    . GLU A 1 199 ? 19.334  19.427  28.380  1.00 50.18 ? 197 GLU A CD    1 
ATOM   1526 O  OE1   . GLU A 1 199 ? 19.491  19.232  29.605  1.00 51.44 ? 197 GLU A OE1   1 
ATOM   1527 O  OE2   . GLU A 1 199 ? 18.211  19.587  27.852  1.00 51.00 ? 197 GLU A OE2   1 
ATOM   1528 N  N     . LYS A 1 200 ? 24.535  21.343  28.743  1.00 44.49 ? 198 LYS A N     1 
ATOM   1529 C  CA    . LYS A 1 200 ? 25.434  22.354  29.282  1.00 44.38 ? 198 LYS A CA    1 
ATOM   1530 C  C     . LYS A 1 200 ? 26.740  22.506  28.523  1.00 44.04 ? 198 LYS A C     1 
ATOM   1531 O  O     . LYS A 1 200 ? 27.568  23.355  28.850  1.00 44.67 ? 198 LYS A O     1 
ATOM   1532 C  CB    . LYS A 1 200 ? 25.695  22.087  30.771  1.00 45.35 ? 198 LYS A CB    1 
ATOM   1533 C  CG    . LYS A 1 200 ? 24.427  22.154  31.616  1.00 46.45 ? 198 LYS A CG    1 
ATOM   1534 C  CD    . LYS A 1 200 ? 24.731  22.129  33.100  1.00 46.76 ? 198 LYS A CD    1 
ATOM   1535 C  CE    . LYS A 1 200 ? 23.461  22.361  33.904  1.00 46.98 ? 198 LYS A CE    1 
ATOM   1536 N  NZ    . LYS A 1 200 ? 22.820  23.670  33.570  1.00 48.19 ? 198 LYS A NZ    1 
ATOM   1537 N  N     . THR A 1 201 ? 26.927  21.667  27.515  1.00 43.39 ? 199 THR A N     1 
ATOM   1538 C  CA    . THR A 1 201 ? 28.114  21.734  26.677  1.00 41.79 ? 199 THR A CA    1 
ATOM   1539 C  C     . THR A 1 201 ? 27.573  22.153  25.301  1.00 40.71 ? 199 THR A C     1 
ATOM   1540 O  O     . THR A 1 201 ? 26.955  21.361  24.582  1.00 41.16 ? 199 THR A O     1 
ATOM   1541 C  CB    . THR A 1 201 ? 28.820  20.360  26.568  1.00 42.35 ? 199 THR A CB    1 
ATOM   1542 O  OG1   . THR A 1 201 ? 29.333  19.973  27.844  1.00 43.35 ? 199 THR A OG1   1 
ATOM   1543 C  CG2   . THR A 1 201 ? 29.943  20.392  25.559  1.00 41.54 ? 199 THR A CG2   1 
ATOM   1544 N  N     . ASN A 1 202 ? 27.833  23.407  24.944  1.00 39.65 ? 200 ASN A N     1 
ATOM   1545 C  CA    . ASN A 1 202 ? 27.377  23.987  23.662  1.00 37.98 ? 200 ASN A CA    1 
ATOM   1546 C  C     . ASN A 1 202 ? 28.083  23.476  22.379  1.00 36.64 ? 200 ASN A C     1 
ATOM   1547 O  O     . ASN A 1 202 ? 27.402  23.232  21.357  1.00 36.64 ? 200 ASN A O     1 
ATOM   1548 C  CB    . ASN A 1 202 ? 27.542  25.499  23.724  1.00 19.57 ? 200 ASN A CB    1 
ATOM   1549 C  CG    . ASN A 1 202 ? 26.668  26.112  24.765  1.00 19.57 ? 200 ASN A CG    1 
ATOM   1550 O  OD1   . ASN A 1 202 ? 27.092  27.008  25.506  1.00 19.57 ? 200 ASN A OD1   1 
ATOM   1551 N  ND2   . ASN A 1 202 ? 25.443  25.620  24.865  1.00 19.57 ? 200 ASN A ND2   1 
ATOM   1552 N  N     . SER A 1 203 ? 29.426  23.363  22.431  1.00 35.41 ? 201 SER A N     1 
ATOM   1553 C  CA    . SER A 1 203 ? 30.233  22.911  21.285  1.00 34.81 ? 201 SER A CA    1 
ATOM   1554 C  C     . SER A 1 203 ? 29.959  21.470  20.869  1.00 34.27 ? 201 SER A C     1 
ATOM   1555 O  O     . SER A 1 203 ? 30.051  20.542  21.678  1.00 32.84 ? 201 SER A O     1 
ATOM   1556 C  CB    . SER A 1 203 ? 31.755  23.076  21.564  1.00 35.41 ? 201 SER A CB    1 
ATOM   1557 O  OG    . SER A 1 203 ? 32.550  22.691  20.449  1.00 34.54 ? 201 SER A OG    1 
ATOM   1558 N  N     . LEU A 1 204 ? 29.637  21.293  19.591  1.00 32.22 ? 202 LEU A N     1 
ATOM   1559 C  CA    . LEU A 1 204 ? 29.361  19.965  19.068  1.00 30.76 ? 202 LEU A CA    1 
ATOM   1560 C  C     . LEU A 1 204 ? 30.649  19.163  19.076  1.00 29.31 ? 202 LEU A C     1 
ATOM   1561 O  O     . LEU A 1 204 ? 30.656  17.994  19.464  1.00 28.40 ? 202 LEU A O     1 
ATOM   1562 C  CB    . LEU A 1 204 ? 28.793  20.037  17.648  1.00 30.11 ? 202 LEU A CB    1 
ATOM   1563 C  CG    . LEU A 1 204 ? 28.593  18.679  16.962  1.00 28.49 ? 202 LEU A CG    1 
ATOM   1564 C  CD1   . LEU A 1 204 ? 27.602  17.837  17.758  1.00 30.90 ? 202 LEU A CD1   1 
ATOM   1565 C  CD2   . LEU A 1 204 ? 28.099  18.881  15.539  1.00 30.15 ? 202 LEU A CD2   1 
ATOM   1566 N  N     . GLU A 1 205 ? 31.743  19.796  18.661  1.00 28.43 ? 203 GLU A N     1 
ATOM   1567 C  CA    . GLU A 1 205 ? 33.036  19.119  18.643  1.00 29.66 ? 203 GLU A CA    1 
ATOM   1568 C  C     . GLU A 1 205 ? 33.401  18.604  20.029  1.00 28.43 ? 203 GLU A C     1 
ATOM   1569 O  O     . GLU A 1 205 ? 33.832  17.456  20.189  1.00 26.79 ? 203 GLU A O     1 
ATOM   1570 C  CB    . GLU A 1 205 ? 34.151  20.058  18.182  1.00 32.87 ? 203 GLU A CB    1 
ATOM   1571 C  CG    . GLU A 1 205 ? 34.437  20.053  16.695  1.00 38.61 ? 203 GLU A CG    1 
ATOM   1572 C  CD    . GLU A 1 205 ? 35.754  20.734  16.374  1.00 41.50 ? 203 GLU A CD    1 
ATOM   1573 O  OE1   . GLU A 1 205 ? 35.895  21.935  16.689  1.00 45.33 ? 203 GLU A OE1   1 
ATOM   1574 O  OE2   . GLU A 1 205 ? 36.653  20.070  15.816  1.00 44.60 ? 203 GLU A OE2   1 
ATOM   1575 N  N     . GLU A 1 206 ? 33.244  19.465  21.029  1.00 27.30 ? 204 GLU A N     1 
ATOM   1576 C  CA    . GLU A 1 206 ? 33.573  19.089  22.395  1.00 26.60 ? 204 GLU A CA    1 
ATOM   1577 C  C     . GLU A 1 206 ? 32.685  17.943  22.860  1.00 24.45 ? 204 GLU A C     1 
ATOM   1578 O  O     . GLU A 1 206 ? 33.162  17.010  23.506  1.00 23.82 ? 204 GLU A O     1 
ATOM   1579 C  CB    . GLU A 1 206 ? 33.424  20.283  23.336  1.00 28.26 ? 204 GLU A CB    1 
ATOM   1580 C  CG    . GLU A 1 206 ? 33.976  20.015  24.730  1.00 31.25 ? 204 GLU A CG    1 
ATOM   1581 C  CD    . GLU A 1 206 ? 35.371  19.411  24.689  1.00 33.38 ? 204 GLU A CD    1 
ATOM   1582 O  OE1   . GLU A 1 206 ? 36.255  19.993  24.023  1.00 36.51 ? 204 GLU A OE1   1 
ATOM   1583 O  OE2   . GLU A 1 206 ? 35.584  18.352  25.321  1.00 34.94 ? 204 GLU A OE2   1 
ATOM   1584 N  N     . ASN A 1 207 ? 31.396  18.020  22.539  1.00 23.69 ? 205 ASN A N     1 
ATOM   1585 C  CA    . ASN A 1 207 ? 30.462  16.964  22.910  1.00 22.96 ? 205 ASN A CA    1 
ATOM   1586 C  C     . ASN A 1 207 ? 30.907  15.656  22.267  1.00 20.84 ? 205 ASN A C     1 
ATOM   1587 O  O     . ASN A 1 207 ? 30.891  14.604  22.905  1.00 20.71 ? 205 ASN A O     1 
ATOM   1588 C  CB    . ASN A 1 207 ? 29.044  17.299  22.440  1.00 27.15 ? 205 ASN A CB    1 
ATOM   1589 C  CG    . ASN A 1 207 ? 28.228  18.002  23.502  1.00 30.39 ? 205 ASN A CG    1 
ATOM   1590 O  OD1   . ASN A 1 207 ? 27.909  17.422  24.543  1.00 34.62 ? 205 ASN A OD1   1 
ATOM   1591 N  ND2   . ASN A 1 207 ? 27.883  19.260  23.248  1.00 31.38 ? 205 ASN A ND2   1 
ATOM   1592 N  N     . ILE A 1 208 ? 31.307  15.723  21.002  1.00 19.94 ? 206 ILE A N     1 
ATOM   1593 C  CA    . ILE A 1 208 ? 31.749  14.522  20.303  1.00 19.33 ? 206 ILE A CA    1 
ATOM   1594 C  C     . ILE A 1 208 ? 33.025  13.968  20.925  1.00 19.39 ? 206 ILE A C     1 
ATOM   1595 O  O     . ILE A 1 208 ? 33.152  12.759  21.117  1.00 20.53 ? 206 ILE A O     1 
ATOM   1596 C  CB    . ILE A 1 208 ? 31.964  14.798  18.795  1.00 18.56 ? 206 ILE A CB    1 
ATOM   1597 C  CG1   . ILE A 1 208 ? 30.601  15.035  18.130  1.00 20.26 ? 206 ILE A CG1   1 
ATOM   1598 C  CG2   . ILE A 1 208 ? 32.689  13.619  18.133  1.00 20.01 ? 206 ILE A CG2   1 
ATOM   1599 C  CD1   . ILE A 1 208 ? 30.682  15.356  16.647  1.00 20.30 ? 206 ILE A CD1   1 
ATOM   1600 N  N     . ARG A 1 209 ? 33.971  14.845  21.246  1.00 17.89 ? 207 ARG A N     1 
ATOM   1601 C  CA    . ARG A 1 209 ? 35.210  14.395  21.865  1.00 18.27 ? 207 ARG A CA    1 
ATOM   1602 C  C     . ARG A 1 209 ? 34.926  13.763  23.234  1.00 18.85 ? 207 ARG A C     1 
ATOM   1603 O  O     . ARG A 1 209 ? 35.585  12.798  23.623  1.00 19.72 ? 207 ARG A O     1 
ATOM   1604 C  CB    . ARG A 1 209 ? 36.195  15.561  22.018  1.00 20.29 ? 207 ARG A CB    1 
ATOM   1605 C  CG    . ARG A 1 209 ? 36.778  16.074  20.700  1.00 21.42 ? 207 ARG A CG    1 
ATOM   1606 C  CD    . ARG A 1 209 ? 37.696  17.271  20.948  1.00 24.56 ? 207 ARG A CD    1 
ATOM   1607 N  NE    . ARG A 1 209 ? 38.252  17.833  19.717  1.00 27.19 ? 207 ARG A NE    1 
ATOM   1608 C  CZ    . ARG A 1 209 ? 39.218  17.267  18.999  1.00 26.28 ? 207 ARG A CZ    1 
ATOM   1609 N  NH1   . ARG A 1 209 ? 39.747  16.117  19.380  1.00 27.04 ? 207 ARG A NH1   1 
ATOM   1610 N  NH2   . ARG A 1 209 ? 39.659  17.859  17.895  1.00 29.94 ? 207 ARG A NH2   1 
ATOM   1611 N  N     . THR A 1 210 ? 33.943  14.296  23.956  1.00 18.84 ? 208 THR A N     1 
ATOM   1612 C  CA    . THR A 1 210 ? 33.598  13.756  25.276  1.00 19.45 ? 208 THR A CA    1 
ATOM   1613 C  C     . THR A 1 210 ? 32.957  12.376  25.141  1.00 19.11 ? 208 THR A C     1 
ATOM   1614 O  O     . THR A 1 210 ? 33.334  11.436  25.845  1.00 20.61 ? 208 THR A O     1 
ATOM   1615 C  CB    . THR A 1 210 ? 32.621  14.681  26.030  1.00 21.07 ? 208 THR A CB    1 
ATOM   1616 O  OG1   . THR A 1 210 ? 33.225  15.969  26.202  1.00 21.40 ? 208 THR A OG1   1 
ATOM   1617 C  CG2   . THR A 1 210 ? 32.293  14.100  27.405  1.00 19.24 ? 208 THR A CG2   1 
ATOM   1618 N  N     . LEU A 1 211 ? 31.992  12.262  24.236  1.00 19.53 ? 209 LEU A N     1 
ATOM   1619 C  CA    . LEU A 1 211 ? 31.314  10.989  23.999  1.00 20.93 ? 209 LEU A CA    1 
ATOM   1620 C  C     . LEU A 1 211 ? 32.287  9.948   23.449  1.00 19.96 ? 209 LEU A C     1 
ATOM   1621 O  O     . LEU A 1 211 ? 32.106  8.749   23.673  1.00 21.08 ? 209 LEU A O     1 
ATOM   1622 C  CB    . LEU A 1 211 ? 30.151  11.187  23.021  1.00 21.17 ? 209 LEU A CB    1 
ATOM   1623 C  CG    . LEU A 1 211 ? 28.942  11.924  23.604  1.00 23.16 ? 209 LEU A CG    1 
ATOM   1624 C  CD1   . LEU A 1 211 ? 27.998  12.348  22.492  1.00 24.39 ? 209 LEU A CD1   1 
ATOM   1625 C  CD2   . LEU A 1 211 ? 28.231  11.019  24.608  1.00 25.94 ? 209 LEU A CD2   1 
ATOM   1626 N  N     . ALA A 1 212 ? 33.318  10.404  22.737  1.00 20.27 ? 210 ALA A N     1 
ATOM   1627 C  CA    . ALA A 1 212 ? 34.317  9.501   22.159  1.00 19.45 ? 210 ALA A CA    1 
ATOM   1628 C  C     . ALA A 1 212 ? 35.058  8.702   23.228  1.00 21.01 ? 210 ALA A C     1 
ATOM   1629 O  O     . ALA A 1 212 ? 35.701  7.698   22.929  1.00 20.18 ? 210 ALA A O     1 
ATOM   1630 C  CB    . ALA A 1 212 ? 35.317  10.287  21.306  1.00 19.46 ? 210 ALA A CB    1 
ATOM   1631 N  N     . GLU A 1 213 ? 34.979  9.161   24.474  1.00 21.72 ? 211 GLU A N     1 
ATOM   1632 C  CA    . GLU A 1 213 ? 35.623  8.464   25.586  1.00 23.19 ? 211 GLU A CA    1 
ATOM   1633 C  C     . GLU A 1 213 ? 34.956  7.107   25.806  1.00 23.84 ? 211 GLU A C     1 
ATOM   1634 O  O     . GLU A 1 213 ? 35.595  6.156   26.265  1.00 24.99 ? 211 GLU A O     1 
ATOM   1635 C  CB    . GLU A 1 213 ? 35.490  9.285   26.874  1.00 25.56 ? 211 GLU A CB    1 
ATOM   1636 C  CG    . GLU A 1 213 ? 36.320  10.557  26.918  1.00 28.05 ? 211 GLU A CG    1 
ATOM   1637 C  CD    . GLU A 1 213 ? 37.797  10.272  27.063  1.00 28.36 ? 211 GLU A CD    1 
ATOM   1638 O  OE1   . GLU A 1 213 ? 38.167  9.539   28.005  1.00 31.63 ? 211 GLU A OE1   1 
ATOM   1639 O  OE2   . GLU A 1 213 ? 38.590  10.777  26.243  1.00 31.66 ? 211 GLU A OE2   1 
ATOM   1640 N  N     . LYS A 1 214 ? 33.671  7.034   25.468  1.00 22.93 ? 212 LYS A N     1 
ATOM   1641 C  CA    . LYS A 1 214 ? 32.864  5.830   25.657  1.00 25.70 ? 212 LYS A CA    1 
ATOM   1642 C  C     . LYS A 1 214 ? 32.545  5.045   24.386  1.00 23.81 ? 212 LYS A C     1 
ATOM   1643 O  O     . LYS A 1 214 ? 32.001  3.942   24.462  1.00 25.00 ? 212 LYS A O     1 
ATOM   1644 C  CB    . LYS A 1 214 ? 31.534  6.208   26.320  1.00 28.32 ? 212 LYS A CB    1 
ATOM   1645 C  CG    . LYS A 1 214 ? 31.658  6.985   27.624  1.00 33.18 ? 212 LYS A CG    1 
ATOM   1646 C  CD    . LYS A 1 214 ? 30.322  7.601   28.029  1.00 36.47 ? 212 LYS A CD    1 
ATOM   1647 C  CE    . LYS A 1 214 ? 29.250  6.549   28.296  1.00 38.87 ? 212 LYS A CE    1 
ATOM   1648 N  NZ    . LYS A 1 214 ? 29.532  5.728   29.512  1.00 40.79 ? 212 LYS A NZ    1 
ATOM   1649 N  N     . ILE A 1 215 ? 32.866  5.605   23.223  1.00 19.72 ? 213 ILE A N     1 
ATOM   1650 C  CA    . ILE A 1 215 ? 32.563  4.933   21.959  1.00 19.10 ? 213 ILE A CA    1 
ATOM   1651 C  C     . ILE A 1 215 ? 33.772  4.907   21.033  1.00 18.34 ? 213 ILE A C     1 
ATOM   1652 O  O     . ILE A 1 215 ? 34.214  5.947   20.546  1.00 18.07 ? 213 ILE A O     1 
ATOM   1653 C  CB    . ILE A 1 215 ? 31.403  5.637   21.223  1.00 18.78 ? 213 ILE A CB    1 
ATOM   1654 C  CG1   . ILE A 1 215 ? 30.205  5.767   22.166  1.00 19.94 ? 213 ILE A CG1   1 
ATOM   1655 C  CG2   . ILE A 1 215 ? 31.020  4.847   19.971  1.00 18.27 ? 213 ILE A CG2   1 
ATOM   1656 C  CD1   . ILE A 1 215 ? 29.108  6.654   21.653  1.00 26.76 ? 213 ILE A CD1   1 
ATOM   1657 N  N     . PRO A 1 216 ? 34.314  3.708   20.772  1.00 17.86 ? 214 PRO A N     1 
ATOM   1658 C  CA    . PRO A 1 216 ? 35.479  3.475   19.912  1.00 18.44 ? 214 PRO A CA    1 
ATOM   1659 C  C     . PRO A 1 216 ? 35.389  4.110   18.519  1.00 15.86 ? 214 PRO A C     1 
ATOM   1660 O  O     . PRO A 1 216 ? 36.341  4.729   18.041  1.00 16.97 ? 214 PRO A O     1 
ATOM   1661 C  CB    . PRO A 1 216 ? 35.541  1.952   19.837  1.00 19.80 ? 214 PRO A CB    1 
ATOM   1662 C  CG    . PRO A 1 216 ? 35.042  1.535   21.164  1.00 20.13 ? 214 PRO A CG    1 
ATOM   1663 C  CD    . PRO A 1 216 ? 33.861  2.445   21.387  1.00 18.80 ? 214 PRO A CD    1 
ATOM   1664 N  N     . TYR A 1 217 ? 34.253  3.916   17.862  1.00 15.40 ? 215 TYR A N     1 
ATOM   1665 C  CA    . TYR A 1 217 ? 34.021  4.455   16.523  1.00 14.71 ? 215 TYR A CA    1 
ATOM   1666 C  C     . TYR A 1 217 ? 32.765  5.298   16.584  1.00 14.50 ? 215 TYR A C     1 
ATOM   1667 O  O     . TYR A 1 217 ? 31.657  4.773   16.514  1.00 16.13 ? 215 TYR A O     1 
ATOM   1668 C  CB    . TYR A 1 217 ? 33.808  3.326   15.512  1.00 15.29 ? 215 TYR A CB    1 
ATOM   1669 C  CG    . TYR A 1 217 ? 35.047  2.512   15.227  1.00 16.92 ? 215 TYR A CG    1 
ATOM   1670 C  CD1   . TYR A 1 217 ? 35.940  2.899   14.228  1.00 17.32 ? 215 TYR A CD1   1 
ATOM   1671 C  CD2   . TYR A 1 217 ? 35.334  1.369   15.966  1.00 17.83 ? 215 TYR A CD2   1 
ATOM   1672 C  CE1   . TYR A 1 217 ? 37.083  2.166   13.965  1.00 17.88 ? 215 TYR A CE1   1 
ATOM   1673 C  CE2   . TYR A 1 217 ? 36.484  0.627   15.720  1.00 18.76 ? 215 TYR A CE2   1 
ATOM   1674 C  CZ    . TYR A 1 217 ? 37.353  1.031   14.716  1.00 18.38 ? 215 TYR A CZ    1 
ATOM   1675 O  OH    . TYR A 1 217 ? 38.498  0.312   14.463  1.00 22.57 ? 215 TYR A OH    1 
ATOM   1676 N  N     . LEU A 1 218 ? 32.939  6.606   16.718  1.00 15.01 ? 216 LEU A N     1 
ATOM   1677 C  CA    . LEU A 1 218 ? 31.806  7.505   16.805  1.00 14.77 ? 216 LEU A CA    1 
ATOM   1678 C  C     . LEU A 1 218 ? 31.681  8.344   15.545  1.00 14.83 ? 216 LEU A C     1 
ATOM   1679 O  O     . LEU A 1 218 ? 32.614  9.052   15.157  1.00 16.33 ? 216 LEU A O     1 
ATOM   1680 C  CB    . LEU A 1 218 ? 31.949  8.421   18.026  1.00 17.08 ? 216 LEU A CB    1 
ATOM   1681 C  CG    . LEU A 1 218 ? 30.969  9.598   18.125  1.00 20.50 ? 216 LEU A CG    1 
ATOM   1682 C  CD1   . LEU A 1 218 ? 29.530  9.110   18.160  1.00 21.90 ? 216 LEU A CD1   1 
ATOM   1683 C  CD2   . LEU A 1 218 ? 31.296  10.398  19.379  1.00 22.72 ? 216 LEU A CD2   1 
ATOM   1684 N  N     . VAL A 1 219 ? 30.529  8.229   14.900  1.00 13.98 ? 217 VAL A N     1 
ATOM   1685 C  CA    . VAL A 1 219 ? 30.246  8.990   13.693  1.00 15.19 ? 217 VAL A CA    1 
ATOM   1686 C  C     . VAL A 1 219 ? 28.970  9.797   13.873  1.00 16.32 ? 217 VAL A C     1 
ATOM   1687 O  O     . VAL A 1 219 ? 27.918  9.252   14.203  1.00 16.25 ? 217 VAL A O     1 
ATOM   1688 C  CB    . VAL A 1 219 ? 30.038  8.074   12.454  1.00 14.07 ? 217 VAL A CB    1 
ATOM   1689 C  CG1   . VAL A 1 219 ? 29.659  8.925   11.239  1.00 17.17 ? 217 VAL A CG1   1 
ATOM   1690 C  CG2   . VAL A 1 219 ? 31.301  7.287   12.161  1.00 15.30 ? 217 VAL A CG2   1 
ATOM   1691 N  N     . VAL A 1 220 ? 29.067  11.108  13.691  1.00 15.61 ? 218 VAL A N     1 
ATOM   1692 C  CA    . VAL A 1 220 ? 27.879  11.948  13.750  1.00 14.23 ? 218 VAL A CA    1 
ATOM   1693 C  C     . VAL A 1 220 ? 27.696  12.354  12.284  1.00 14.49 ? 218 VAL A C     1 
ATOM   1694 O  O     . VAL A 1 220 ? 28.547  13.053  11.721  1.00 15.16 ? 218 VAL A O     1 
ATOM   1695 C  CB    . VAL A 1 220 ? 28.097  13.193  14.632  1.00 17.36 ? 218 VAL A CB    1 
ATOM   1696 C  CG1   . VAL A 1 220 ? 26.852  14.050  14.611  1.00 17.90 ? 218 VAL A CG1   1 
ATOM   1697 C  CG2   . VAL A 1 220 ? 28.417  12.761  16.065  1.00 18.81 ? 218 VAL A CG2   1 
ATOM   1698 N  N     . SER A 1 221 ? 26.626  11.883  11.647  1.00 13.78 ? 219 SER A N     1 
ATOM   1699 C  CA    . SER A 1 221 ? 26.433  12.221  10.241  1.00 15.49 ? 219 SER A CA    1 
ATOM   1700 C  C     . SER A 1 221 ? 25.688  13.542  10.102  1.00 16.99 ? 219 SER A C     1 
ATOM   1701 O  O     . SER A 1 221 ? 24.767  13.835  10.865  1.00 17.29 ? 219 SER A O     1 
ATOM   1702 C  CB    . SER A 1 221 ? 25.733  11.081  9.476   1.00 16.24 ? 219 SER A CB    1 
ATOM   1703 O  OG    . SER A 1 221 ? 24.406  10.851  9.900   1.00 17.84 ? 219 SER A OG    1 
ATOM   1704 N  N     . LEU A 1 222 ? 26.119  14.339  9.128   1.00 17.47 ? 220 LEU A N     1 
ATOM   1705 C  CA    . LEU A 1 222 ? 25.560  15.668  8.899   1.00 18.69 ? 220 LEU A CA    1 
ATOM   1706 C  C     . LEU A 1 222 ? 24.963  15.880  7.507   1.00 20.51 ? 220 LEU A C     1 
ATOM   1707 O  O     . LEU A 1 222 ? 25.049  16.976  6.944   1.00 17.79 ? 220 LEU A O     1 
ATOM   1708 C  CB    . LEU A 1 222 ? 26.652  16.709  9.156   1.00 18.39 ? 220 LEU A CB    1 
ATOM   1709 C  CG    . LEU A 1 222 ? 27.383  16.530  10.491  1.00 19.29 ? 220 LEU A CG    1 
ATOM   1710 C  CD1   . LEU A 1 222 ? 28.621  17.426  10.530  1.00 20.57 ? 220 LEU A CD1   1 
ATOM   1711 C  CD2   . LEU A 1 222 ? 26.436  16.835  11.650  1.00 18.17 ? 220 LEU A CD2   1 
ATOM   1712 N  N     . GLY A 1 223 ? 24.355  14.836  6.957   1.00 17.63 ? 221 GLY A N     1 
ATOM   1713 C  CA    . GLY A 1 223 ? 23.742  14.951  5.643   1.00 19.15 ? 221 GLY A CA    1 
ATOM   1714 C  C     . GLY A 1 223 ? 24.697  15.379  4.546   1.00 19.69 ? 221 GLY A C     1 
ATOM   1715 O  O     . GLY A 1 223 ? 25.775  14.813  4.389   1.00 19.61 ? 221 GLY A O     1 
ATOM   1716 N  N     . ALA A 1 224 ? 24.299  16.393  3.785   1.00 20.63 ? 222 ALA A N     1 
ATOM   1717 C  CA    . ALA A 1 224 ? 25.113  16.896  2.687   1.00 22.21 ? 222 ALA A CA    1 
ATOM   1718 C  C     . ALA A 1 224 ? 26.456  17.460  3.136   1.00 22.14 ? 222 ALA A C     1 
ATOM   1719 O  O     . ALA A 1 224 ? 27.375  17.605  2.329   1.00 23.75 ? 222 ALA A O     1 
ATOM   1720 C  CB    . ALA A 1 224 ? 24.336  17.959  1.915   1.00 22.73 ? 222 ALA A CB    1 
ATOM   1721 N  N     . LYS A 1 225 ? 26.569  17.785  4.419   1.00 21.17 ? 223 LYS A N     1 
ATOM   1722 C  CA    . LYS A 1 225 ? 27.814  18.329  4.941   1.00 21.73 ? 223 LYS A CA    1 
ATOM   1723 C  C     . LYS A 1 225 ? 28.847  17.233  5.178   1.00 21.03 ? 223 LYS A C     1 
ATOM   1724 O  O     . LYS A 1 225 ? 30.024  17.514  5.380   1.00 23.13 ? 223 LYS A O     1 
ATOM   1725 C  CB    . LYS A 1 225 ? 27.562  19.089  6.244   1.00 22.71 ? 223 LYS A CB    1 
ATOM   1726 C  CG    . LYS A 1 225 ? 26.721  20.346  6.073   1.00 26.51 ? 223 LYS A CG    1 
ATOM   1727 C  CD    . LYS A 1 225 ? 26.490  21.060  7.400   1.00 32.14 ? 223 LYS A CD    1 
ATOM   1728 C  CE    . LYS A 1 225 ? 25.725  20.183  8.391   1.00 33.31 ? 223 LYS A CE    1 
ATOM   1729 N  NZ    . LYS A 1 225 ? 24.394  19.745  7.874   1.00 34.69 ? 223 LYS A NZ    1 
ATOM   1730 N  N     . GLY A 1 226 ? 28.402  15.984  5.138   1.00 17.95 ? 224 GLY A N     1 
ATOM   1731 C  CA    . GLY A 1 226 ? 29.319  14.882  5.357   1.00 16.38 ? 224 GLY A CA    1 
ATOM   1732 C  C     . GLY A 1 226 ? 29.148  14.321  6.753   1.00 16.01 ? 224 GLY A C     1 
ATOM   1733 O  O     . GLY A 1 226 ? 28.039  13.965  7.145   1.00 16.38 ? 224 GLY A O     1 
ATOM   1734 N  N     . SER A 1 227 ? 30.241  14.244  7.507   1.00 14.25 ? 225 SER A N     1 
ATOM   1735 C  CA    . SER A 1 227 ? 30.177  13.715  8.861   1.00 14.83 ? 225 SER A CA    1 
ATOM   1736 C  C     . SER A 1 227 ? 31.419  14.101  9.655   1.00 14.93 ? 225 SER A C     1 
ATOM   1737 O  O     . SER A 1 227 ? 32.366  14.676  9.116   1.00 14.26 ? 225 SER A O     1 
ATOM   1738 C  CB    . SER A 1 227 ? 30.065  12.183  8.807   1.00 16.58 ? 225 SER A CB    1 
ATOM   1739 O  OG    . SER A 1 227 ? 31.183  11.605  8.139   1.00 15.55 ? 225 SER A OG    1 
ATOM   1740 N  N     . ILE A 1 228 ? 31.389  13.795  10.949  1.00 16.01 ? 226 ILE A N     1 
ATOM   1741 C  CA    . ILE A 1 228 ? 32.522  14.025  11.839  1.00 14.83 ? 226 ILE A CA    1 
ATOM   1742 C  C     . ILE A 1 228 ? 32.700  12.677  12.526  1.00 15.12 ? 226 ILE A C     1 
ATOM   1743 O  O     . ILE A 1 228 ? 31.734  12.104  13.032  1.00 15.80 ? 226 ILE A O     1 
ATOM   1744 C  CB    . ILE A 1 228 ? 32.231  15.091  12.913  1.00 16.86 ? 226 ILE A CB    1 
ATOM   1745 C  CG1   . ILE A 1 228 ? 32.014  16.458  12.255  1.00 18.47 ? 226 ILE A CG1   1 
ATOM   1746 C  CG2   . ILE A 1 228 ? 33.408  15.169  13.882  1.00 16.67 ? 226 ILE A CG2   1 
ATOM   1747 C  CD1   . ILE A 1 228 ? 31.496  17.509  13.221  1.00 23.57 ? 226 ILE A CD1   1 
ATOM   1748 N  N     . CYS A 1 229 ? 33.921  12.160  12.520  1.00 14.74 ? 227 CYS A N     1 
ATOM   1749 C  CA    . CYS A 1 229 ? 34.185  10.867  13.133  1.00 15.80 ? 227 CYS A CA    1 
ATOM   1750 C  C     . CYS A 1 229 ? 35.296  10.943  14.160  1.00 16.03 ? 227 CYS A C     1 
ATOM   1751 O  O     . CYS A 1 229 ? 36.351  11.517  13.896  1.00 15.16 ? 227 CYS A O     1 
ATOM   1752 C  CB    . CYS A 1 229 ? 34.566  9.844   12.058  1.00 15.83 ? 227 CYS A CB    1 
ATOM   1753 S  SG    . CYS A 1 229 ? 35.182  8.262   12.714  1.00 17.41 ? 227 CYS A SG    1 
ATOM   1754 N  N     . ALA A 1 230 ? 35.046  10.358  15.332  1.00 14.94 ? 228 ALA A N     1 
ATOM   1755 C  CA    . ALA A 1 230 ? 36.049  10.326  16.388  1.00 17.78 ? 228 ALA A CA    1 
ATOM   1756 C  C     . ALA A 1 230 ? 36.537  8.893   16.529  1.00 15.97 ? 228 ALA A C     1 
ATOM   1757 O  O     . ALA A 1 230 ? 35.731  7.965   16.640  1.00 15.69 ? 228 ALA A O     1 
ATOM   1758 C  CB    . ALA A 1 230 ? 35.457  10.796  17.709  1.00 16.29 ? 228 ALA A CB    1 
ATOM   1759 N  N     . HIS A 1 231 ? 37.852  8.715   16.515  1.00 16.54 ? 229 HIS A N     1 
ATOM   1760 C  CA    . HIS A 1 231 ? 38.445  7.390   16.671  1.00 17.09 ? 229 HIS A CA    1 
ATOM   1761 C  C     . HIS A 1 231 ? 39.912  7.477   17.085  1.00 19.95 ? 229 HIS A C     1 
ATOM   1762 O  O     . HIS A 1 231 ? 40.685  8.253   16.521  1.00 17.10 ? 229 HIS A O     1 
ATOM   1763 C  CB    . HIS A 1 231 ? 38.320  6.578   15.373  1.00 20.27 ? 229 HIS A CB    1 
ATOM   1764 C  CG    . HIS A 1 231 ? 38.950  5.221   15.455  1.00 20.26 ? 229 HIS A CG    1 
ATOM   1765 N  ND1   . HIS A 1 231 ? 40.137  4.912   14.829  1.00 24.60 ? 229 HIS A ND1   1 
ATOM   1766 C  CD2   . HIS A 1 231 ? 38.583  4.109   16.135  1.00 21.70 ? 229 HIS A CD2   1 
ATOM   1767 C  CE1   . HIS A 1 231 ? 40.475  3.666   15.119  1.00 23.53 ? 229 HIS A CE1   1 
ATOM   1768 N  NE2   . HIS A 1 231 ? 39.550  3.158   15.910  1.00 23.49 ? 229 HIS A NE2   1 
ATOM   1769 N  N     . ASN A 1 232 ? 40.278  6.676   18.083  1.00 18.84 ? 230 ASN A N     1 
ATOM   1770 C  CA    . ASN A 1 232 ? 41.645  6.621   18.595  1.00 22.71 ? 230 ASN A CA    1 
ATOM   1771 C  C     . ASN A 1 232 ? 42.198  7.995   18.976  1.00 21.43 ? 230 ASN A C     1 
ATOM   1772 O  O     . ASN A 1 232 ? 43.359  8.308   18.711  1.00 22.63 ? 230 ASN A O     1 
ATOM   1773 C  CB    . ASN A 1 232 ? 42.558  5.945   17.565  1.00 24.48 ? 230 ASN A CB    1 
ATOM   1774 C  CG    . ASN A 1 232 ? 43.904  5.547   18.149  1.00 27.84 ? 230 ASN A CG    1 
ATOM   1775 O  OD1   . ASN A 1 232 ? 43.976  5.015   19.257  1.00 28.91 ? 230 ASN A OD1   1 
ATOM   1776 N  ND2   . ASN A 1 232 ? 44.972  5.788   17.398  1.00 28.41 ? 230 ASN A ND2   1 
ATOM   1777 N  N     . GLY A 1 233 ? 41.354  8.815   19.594  1.00 21.36 ? 231 GLY A N     1 
ATOM   1778 C  CA    . GLY A 1 233 ? 41.782  10.133  20.027  1.00 20.95 ? 231 GLY A CA    1 
ATOM   1779 C  C     . GLY A 1 233 ? 41.890  11.188  18.946  1.00 22.26 ? 231 GLY A C     1 
ATOM   1780 O  O     . GLY A 1 233 ? 42.347  12.305  19.207  1.00 21.95 ? 231 GLY A O     1 
ATOM   1781 N  N     . LYS A 1 234 ? 41.477  10.845  17.730  1.00 19.89 ? 232 LYS A N     1 
ATOM   1782 C  CA    . LYS A 1 234 ? 41.526  11.787  16.617  1.00 20.05 ? 232 LYS A CA    1 
ATOM   1783 C  C     . LYS A 1 234 ? 40.106  12.156  16.209  1.00 19.55 ? 232 LYS A C     1 
ATOM   1784 O  O     . LYS A 1 234 ? 39.166  11.407  16.467  1.00 19.72 ? 232 LYS A O     1 
ATOM   1785 C  CB    . LYS A 1 234 ? 42.262  11.167  15.421  1.00 22.54 ? 232 LYS A CB    1 
ATOM   1786 C  CG    . LYS A 1 234 ? 43.724  10.850  15.686  1.00 26.57 ? 232 LYS A CG    1 
ATOM   1787 C  CD    . LYS A 1 234 ? 44.384  10.258  14.451  1.00 28.42 ? 232 LYS A CD    1 
ATOM   1788 C  CE    . LYS A 1 234 ? 45.881  10.068  14.658  1.00 34.24 ? 232 LYS A CE    1 
ATOM   1789 N  NZ    . LYS A 1 234 ? 46.183  9.168   15.806  1.00 36.10 ? 232 LYS A NZ    1 
ATOM   1790 N  N     . LEU A 1 235 ? 39.953  13.319  15.587  1.00 19.18 ? 233 LEU A N     1 
ATOM   1791 C  CA    . LEU A 1 235 ? 38.645  13.773  15.138  1.00 18.34 ? 233 LEU A CA    1 
ATOM   1792 C  C     . LEU A 1 235 ? 38.780  14.108  13.657  1.00 19.82 ? 233 LEU A C     1 
ATOM   1793 O  O     . LEU A 1 235 ? 39.669  14.866  13.264  1.00 20.30 ? 233 LEU A O     1 
ATOM   1794 C  CB    . LEU A 1 235 ? 38.207  15.005  15.936  1.00 19.73 ? 233 LEU A CB    1 
ATOM   1795 C  CG    . LEU A 1 235 ? 36.724  15.377  15.873  1.00 19.22 ? 233 LEU A CG    1 
ATOM   1796 C  CD1   . LEU A 1 235 ? 35.880  14.266  16.491  1.00 20.34 ? 233 LEU A CD1   1 
ATOM   1797 C  CD2   . LEU A 1 235 ? 36.494  16.678  16.620  1.00 21.94 ? 233 LEU A CD2   1 
ATOM   1798 N  N     . TYR A 1 236 ? 37.904  13.532  12.838  1.00 16.91 ? 234 TYR A N     1 
ATOM   1799 C  CA    . TYR A 1 236 ? 37.958  13.752  11.397  1.00 16.92 ? 234 TYR A CA    1 
ATOM   1800 C  C     . TYR A 1 236 ? 36.734  14.476  10.854  1.00 18.28 ? 234 TYR A C     1 
ATOM   1801 O  O     . TYR A 1 236 ? 35.601  14.152  11.214  1.00 15.94 ? 234 TYR A O     1 
ATOM   1802 C  CB    . TYR A 1 236 ? 38.066  12.410  10.667  1.00 17.47 ? 234 TYR A CB    1 
ATOM   1803 C  CG    . TYR A 1 236 ? 39.231  11.547  11.084  1.00 18.28 ? 234 TYR A CG    1 
ATOM   1804 C  CD1   . TYR A 1 236 ? 40.489  11.711  10.506  1.00 18.95 ? 234 TYR A CD1   1 
ATOM   1805 C  CD2   . TYR A 1 236 ? 39.076  10.571  12.064  1.00 19.19 ? 234 TYR A CD2   1 
ATOM   1806 C  CE1   . TYR A 1 236 ? 41.569  10.922  10.894  1.00 18.99 ? 234 TYR A CE1   1 
ATOM   1807 C  CE2   . TYR A 1 236 ? 40.143  9.778   12.461  1.00 18.72 ? 234 TYR A CE2   1 
ATOM   1808 C  CZ    . TYR A 1 236 ? 41.389  9.957   11.873  1.00 19.77 ? 234 TYR A CZ    1 
ATOM   1809 O  OH    . TYR A 1 236 ? 42.451  9.177   12.270  1.00 20.03 ? 234 TYR A OH    1 
ATOM   1810 N  N     . GLN A 1 237 ? 36.970  15.471  10.003  1.00 17.85 ? 235 GLN A N     1 
ATOM   1811 C  CA    . GLN A 1 237 ? 35.871  16.175  9.348   1.00 18.99 ? 235 GLN A CA    1 
ATOM   1812 C  C     . GLN A 1 237 ? 35.844  15.548  7.956   1.00 16.37 ? 235 GLN A C     1 
ATOM   1813 O  O     . GLN A 1 237 ? 36.819  15.622  7.212   1.00 18.18 ? 235 GLN A O     1 
ATOM   1814 C  CB    . GLN A 1 237 ? 36.132  17.683  9.244   1.00 21.96 ? 235 GLN A CB    1 
ATOM   1815 C  CG    . GLN A 1 237 ? 35.093  18.411  8.379   1.00 24.75 ? 235 GLN A CG    1 
ATOM   1816 C  CD    . GLN A 1 237 ? 35.115  19.923  8.557   1.00 30.23 ? 235 GLN A CD    1 
ATOM   1817 O  OE1   . GLN A 1 237 ? 36.173  20.542  8.560   1.00 29.08 ? 235 GLN A OE1   1 
ATOM   1818 N  NE2   . GLN A 1 237 ? 33.937  20.520  8.694   1.00 32.36 ? 235 GLN A NE2   1 
ATOM   1819 N  N     . VAL A 1 238 ? 34.733  14.906  7.618   1.00 16.49 ? 236 VAL A N     1 
ATOM   1820 C  CA    . VAL A 1 238 ? 34.602  14.231  6.337   1.00 16.77 ? 236 VAL A CA    1 
ATOM   1821 C  C     . VAL A 1 238 ? 33.648  15.004  5.438   1.00 15.82 ? 236 VAL A C     1 
ATOM   1822 O  O     . VAL A 1 238 ? 32.503  15.256  5.803   1.00 16.35 ? 236 VAL A O     1 
ATOM   1823 C  CB    . VAL A 1 238 ? 34.080  12.785  6.549   1.00 14.93 ? 236 VAL A CB    1 
ATOM   1824 C  CG1   . VAL A 1 238 ? 34.074  12.033  5.235   1.00 16.89 ? 236 VAL A CG1   1 
ATOM   1825 C  CG2   . VAL A 1 238 ? 34.945  12.065  7.573   1.00 17.69 ? 236 VAL A CG2   1 
ATOM   1826 N  N     . ILE A 1 239 ? 34.133  15.389  4.261   1.00 18.00 ? 237 ILE A N     1 
ATOM   1827 C  CA    . ILE A 1 239 ? 33.328  16.163  3.317   1.00 18.90 ? 237 ILE A CA    1 
ATOM   1828 C  C     . ILE A 1 239 ? 33.158  15.434  1.996   1.00 16.56 ? 237 ILE A C     1 
ATOM   1829 O  O     . ILE A 1 239 ? 34.132  15.101  1.332   1.00 15.34 ? 237 ILE A O     1 
ATOM   1830 C  CB    . ILE A 1 239 ? 33.977  17.528  3.045   1.00 20.30 ? 237 ILE A CB    1 
ATOM   1831 C  CG1   . ILE A 1 239 ? 34.094  18.304  4.358   1.00 23.88 ? 237 ILE A CG1   1 
ATOM   1832 C  CG2   . ILE A 1 239 ? 33.150  18.315  2.025   1.00 21.56 ? 237 ILE A CG2   1 
ATOM   1833 C  CD1   . ILE A 1 239 ? 34.783  19.638  4.224   1.00 25.63 ? 237 ILE A CD1   1 
ATOM   1834 N  N     . PRO A 1 240 ? 31.907  15.198  1.582   1.00 18.42 ? 238 PRO A N     1 
ATOM   1835 C  CA    . PRO A 1 240 ? 31.673  14.497  0.321   1.00 17.06 ? 238 PRO A CA    1 
ATOM   1836 C  C     . PRO A 1 240 ? 31.746  15.422  -0.880  1.00 18.27 ? 238 PRO A C     1 
ATOM   1837 O  O     . PRO A 1 240 ? 31.671  16.640  -0.740  1.00 18.84 ? 238 PRO A O     1 
ATOM   1838 C  CB    . PRO A 1 240 ? 30.259  13.969  0.491   1.00 19.15 ? 238 PRO A CB    1 
ATOM   1839 C  CG    . PRO A 1 240 ? 29.595  15.112  1.188   1.00 21.54 ? 238 PRO A CG    1 
ATOM   1840 C  CD    . PRO A 1 240 ? 30.628  15.535  2.238   1.00 19.84 ? 238 PRO A CD    1 
ATOM   1841 N  N     . PRO A 1 241 ? 31.920  14.849  -2.074  1.00 17.52 ? 239 PRO A N     1 
ATOM   1842 C  CA    . PRO A 1 241 ? 31.965  15.688  -3.270  1.00 18.10 ? 239 PRO A CA    1 
ATOM   1843 C  C     . PRO A 1 241 ? 30.504  16.093  -3.464  1.00 18.56 ? 239 PRO A C     1 
ATOM   1844 O  O     . PRO A 1 241 ? 29.608  15.451  -2.911  1.00 20.94 ? 239 PRO A O     1 
ATOM   1845 C  CB    . PRO A 1 241 ? 32.441  14.722  -4.351  1.00 17.97 ? 239 PRO A CB    1 
ATOM   1846 C  CG    . PRO A 1 241 ? 31.906  13.387  -3.864  1.00 19.46 ? 239 PRO A CG    1 
ATOM   1847 C  CD    . PRO A 1 241 ? 32.256  13.452  -2.400  1.00 17.22 ? 239 PRO A CD    1 
ATOM   1848 N  N     . LYS A 1 242 ? 30.256  17.150  -4.222  1.00 18.75 ? 240 LYS A N     1 
ATOM   1849 C  CA    . LYS A 1 242 ? 28.884  17.589  -4.455  1.00 21.25 ? 240 LYS A CA    1 
ATOM   1850 C  C     . LYS A 1 242 ? 28.229  16.716  -5.510  1.00 20.70 ? 240 LYS A C     1 
ATOM   1851 O  O     . LYS A 1 242 ? 28.785  16.512  -6.586  1.00 19.82 ? 240 LYS A O     1 
ATOM   1852 C  CB    . LYS A 1 242 ? 28.862  19.043  -4.927  1.00 23.99 ? 240 LYS A CB    1 
ATOM   1853 C  CG    . LYS A 1 242 ? 29.608  19.973  -4.011  1.00 29.71 ? 240 LYS A CG    1 
ATOM   1854 C  CD    . LYS A 1 242 ? 29.275  21.409  -4.308  1.00 36.03 ? 240 LYS A CD    1 
ATOM   1855 C  CE    . LYS A 1 242 ? 29.908  22.304  -3.271  1.00 38.66 ? 240 LYS A CE    1 
ATOM   1856 N  NZ    . LYS A 1 242 ? 29.004  23.425  -2.902  1.00 42.57 ? 240 LYS A NZ    1 
ATOM   1857 N  N     . VAL A 1 243 ? 27.048  16.194  -5.195  1.00 21.60 ? 241 VAL A N     1 
ATOM   1858 C  CA    . VAL A 1 243 ? 26.320  15.356  -6.139  1.00 22.93 ? 241 VAL A CA    1 
ATOM   1859 C  C     . VAL A 1 243 ? 24.891  15.859  -6.283  1.00 25.00 ? 241 VAL A C     1 
ATOM   1860 O  O     . VAL A 1 243 ? 24.378  16.568  -5.415  1.00 24.01 ? 241 VAL A O     1 
ATOM   1861 C  CB    . VAL A 1 243 ? 26.277  13.870  -5.692  1.00 22.47 ? 241 VAL A CB    1 
ATOM   1862 C  CG1   . VAL A 1 243 ? 27.684  13.291  -5.672  1.00 19.81 ? 241 VAL A CG1   1 
ATOM   1863 C  CG2   . VAL A 1 243 ? 25.627  13.753  -4.316  1.00 22.26 ? 241 VAL A CG2   1 
ATOM   1864 N  N     . GLN A 1 244 ? 24.268  15.498  -7.398  1.00 29.08 ? 242 GLN A N     1 
ATOM   1865 C  CA    . GLN A 1 244 ? 22.892  15.881  -7.671  1.00 33.38 ? 242 GLN A CA    1 
ATOM   1866 C  C     . GLN A 1 244 ? 22.000  14.973  -6.838  1.00 32.47 ? 242 GLN A C     1 
ATOM   1867 O  O     . GLN A 1 244 ? 21.853  13.791  -7.141  1.00 33.73 ? 242 GLN A O     1 
ATOM   1868 C  CB    . GLN A 1 244 ? 22.583  15.703  -9.158  1.00 36.24 ? 242 GLN A CB    1 
ATOM   1869 C  CG    . GLN A 1 244 ? 21.128  15.933  -9.527  1.00 42.98 ? 242 GLN A CG    1 
ATOM   1870 C  CD    . GLN A 1 244 ? 20.887  15.824  -11.018 1.00 45.65 ? 242 GLN A CD    1 
ATOM   1871 O  OE1   . GLN A 1 244 ? 21.381  16.638  -11.799 1.00 48.37 ? 242 GLN A OE1   1 
ATOM   1872 N  NE2   . GLN A 1 244 ? 20.127  14.810  -11.424 1.00 47.77 ? 242 GLN A NE2   1 
ATOM   1873 N  N     . GLU A 1 245 ? 21.424  15.528  -5.779  1.00 34.11 ? 243 GLU A N     1 
ATOM   1874 C  CA    . GLU A 1 245 ? 20.555  14.767  -4.894  1.00 35.66 ? 243 GLU A CA    1 
ATOM   1875 C  C     . GLU A 1 245 ? 19.196  14.490  -5.527  1.00 35.69 ? 243 GLU A C     1 
ATOM   1876 O  O     . GLU A 1 245 ? 18.616  15.355  -6.184  1.00 35.71 ? 243 GLU A O     1 
ATOM   1877 C  CB    . GLU A 1 245 ? 20.367  15.519  -3.568  1.00 37.97 ? 243 GLU A CB    1 
ATOM   1878 C  CG    . GLU A 1 245 ? 19.331  14.901  -2.636  1.00 41.25 ? 243 GLU A CG    1 
ATOM   1879 C  CD    . GLU A 1 245 ? 19.323  15.532  -1.251  1.00 44.05 ? 243 GLU A CD    1 
ATOM   1880 O  OE1   . GLU A 1 245 ? 20.318  15.370  -0.510  1.00 44.16 ? 243 GLU A OE1   1 
ATOM   1881 O  OE2   . GLU A 1 245 ? 18.320  16.190  -0.901  1.00 44.86 ? 243 GLU A OE2   1 
ATOM   1882 N  N     . ARG A 1 246 ? 18.707  13.269  -5.339  1.00 34.05 ? 244 ARG A N     1 
ATOM   1883 C  CA    . ARG A 1 246 ? 17.404  12.868  -5.855  1.00 34.20 ? 244 ARG A CA    1 
ATOM   1884 C  C     . ARG A 1 246 ? 16.553  12.358  -4.698  1.00 32.76 ? 244 ARG A C     1 
ATOM   1885 O  O     . ARG A 1 246 ? 15.372  12.677  -4.599  1.00 34.10 ? 244 ARG A O     1 
ATOM   1886 C  CB    . ARG A 1 246 ? 17.550  11.786  -6.932  1.00 36.36 ? 244 ARG A CB    1 
ATOM   1887 C  CG    . ARG A 1 246 ? 18.006  12.327  -8.284  1.00 41.55 ? 244 ARG A CG    1 
ATOM   1888 C  CD    . ARG A 1 246 ? 17.912  11.275  -9.385  1.00 45.48 ? 244 ARG A CD    1 
ATOM   1889 N  NE    . ARG A 1 246 ? 18.205  11.836  -10.704 1.00 49.06 ? 244 ARG A NE    1 
ATOM   1890 C  CZ    . ARG A 1 246 ? 18.142  11.150  -11.843 1.00 50.93 ? 244 ARG A CZ    1 
ATOM   1891 N  NH1   . ARG A 1 246 ? 17.798  9.869   -11.832 1.00 51.37 ? 244 ARG A NH1   1 
ATOM   1892 N  NH2   . ARG A 1 246 ? 18.421  11.747  -12.996 1.00 52.11 ? 244 ARG A NH2   1 
ATOM   1893 N  N     . ASN A 1 247 ? 17.166  11.579  -3.815  1.00 30.49 ? 245 ASN A N     1 
ATOM   1894 C  CA    . ASN A 1 247 ? 16.473  11.038  -2.651  1.00 29.06 ? 245 ASN A CA    1 
ATOM   1895 C  C     . ASN A 1 247 ? 17.522  10.627  -1.625  1.00 28.09 ? 245 ASN A C     1 
ATOM   1896 O  O     . ASN A 1 247 ? 18.236  9.641   -1.821  1.00 27.98 ? 245 ASN A O     1 
ATOM   1897 C  CB    . ASN A 1 247 ? 15.628  9.820   -3.043  1.00 29.19 ? 245 ASN A CB    1 
ATOM   1898 C  CG    . ASN A 1 247 ? 14.695  9.379   -1.931  1.00 29.24 ? 245 ASN A CG    1 
ATOM   1899 O  OD1   . ASN A 1 247 ? 14.845  9.792   -0.781  1.00 29.50 ? 245 ASN A OD1   1 
ATOM   1900 N  ND2   . ASN A 1 247 ? 13.728  8.531   -2.267  1.00 30.04 ? 245 ASN A ND2   1 
ATOM   1901 N  N     . ASP A 1 248 ? 17.619  11.383  -0.536  1.00 27.81 ? 246 ASP A N     1 
ATOM   1902 C  CA    . ASP A 1 248 ? 18.602  11.085  0.495   1.00 28.75 ? 246 ASP A CA    1 
ATOM   1903 C  C     . ASP A 1 248 ? 18.117  10.092  1.542   1.00 28.96 ? 246 ASP A C     1 
ATOM   1904 O  O     . ASP A 1 248 ? 18.790  9.867   2.547   1.00 27.69 ? 246 ASP A O     1 
ATOM   1905 C  CB    . ASP A 1 248 ? 19.078  12.375  1.175   1.00 30.15 ? 246 ASP A CB    1 
ATOM   1906 C  CG    . ASP A 1 248 ? 17.945  13.175  1.784   1.00 33.25 ? 246 ASP A CG    1 
ATOM   1907 O  OD1   . ASP A 1 248 ? 18.207  14.320  2.213   1.00 33.96 ? 246 ASP A OD1   1 
ATOM   1908 O  OD2   . ASP A 1 248 ? 16.802  12.669  1.843   1.00 33.01 ? 246 ASP A OD2   1 
ATOM   1909 N  N     . THR A 1 249 ? 16.951  9.498   1.311   1.00 27.64 ? 247 THR A N     1 
ATOM   1910 C  CA    . THR A 1 249 ? 16.428  8.511   2.244   1.00 28.37 ? 247 THR A CA    1 
ATOM   1911 C  C     . THR A 1 249 ? 17.304  7.275   2.106   1.00 26.74 ? 247 THR A C     1 
ATOM   1912 O  O     . THR A 1 249 ? 17.570  6.818   0.996   1.00 26.02 ? 247 THR A O     1 
ATOM   1913 C  CB    . THR A 1 249 ? 14.983  8.109   1.904   1.00 31.68 ? 247 THR A CB    1 
ATOM   1914 O  OG1   . THR A 1 249 ? 14.157  9.278   1.876   1.00 35.47 ? 247 THR A OG1   1 
ATOM   1915 C  CG2   . THR A 1 249 ? 14.444  7.136   2.949   1.00 32.27 ? 247 THR A CG2   1 
ATOM   1916 N  N     . GLY A 1 250 ? 17.757  6.736   3.231   1.00 25.32 ? 248 GLY A N     1 
ATOM   1917 C  CA    . GLY A 1 250 ? 18.597  5.555   3.181   1.00 24.11 ? 248 GLY A CA    1 
ATOM   1918 C  C     . GLY A 1 250 ? 20.082  5.852   3.074   1.00 22.62 ? 248 GLY A C     1 
ATOM   1919 O  O     . GLY A 1 250 ? 20.889  4.925   3.076   1.00 21.74 ? 248 GLY A O     1 
ATOM   1920 N  N     . ALA A 1 251 ? 20.455  7.127   2.968   1.00 21.29 ? 249 ALA A N     1 
ATOM   1921 C  CA    . ALA A 1 251 ? 21.869  7.479   2.867   1.00 19.91 ? 249 ALA A CA    1 
ATOM   1922 C  C     . ALA A 1 251 ? 22.613  6.970   4.098   1.00 19.11 ? 249 ALA A C     1 
ATOM   1923 O  O     . ALA A 1 251 ? 23.743  6.502   3.998   1.00 17.79 ? 249 ALA A O     1 
ATOM   1924 C  CB    . ALA A 1 251 ? 22.041  8.990   2.744   1.00 21.15 ? 249 ALA A CB    1 
ATOM   1925 N  N     . GLY A 1 252 ? 21.965  7.067   5.255   1.00 20.05 ? 250 GLY A N     1 
ATOM   1926 C  CA    . GLY A 1 252 ? 22.574  6.614   6.493   1.00 18.42 ? 250 GLY A CA    1 
ATOM   1927 C  C     . GLY A 1 252 ? 22.772  5.110   6.541   1.00 17.71 ? 250 GLY A C     1 
ATOM   1928 O  O     . GLY A 1 252 ? 23.802  4.643   7.019   1.00 16.47 ? 250 GLY A O     1 
ATOM   1929 N  N     . ASP A 1 253 ? 21.796  4.349   6.054   1.00 18.57 ? 251 ASP A N     1 
ATOM   1930 C  CA    . ASP A 1 253 ? 21.904  2.893   6.049   1.00 18.59 ? 251 ASP A CA    1 
ATOM   1931 C  C     . ASP A 1 253 ? 23.051  2.445   5.146   1.00 17.32 ? 251 ASP A C     1 
ATOM   1932 O  O     . ASP A 1 253 ? 23.778  1.505   5.466   1.00 17.82 ? 251 ASP A O     1 
ATOM   1933 C  CB    . ASP A 1 253 ? 20.593  2.254   5.581   1.00 21.55 ? 251 ASP A CB    1 
ATOM   1934 C  CG    . ASP A 1 253 ? 19.407  2.669   6.433   1.00 24.32 ? 251 ASP A CG    1 
ATOM   1935 O  OD1   . ASP A 1 253 ? 19.609  2.946   7.633   1.00 27.38 ? 251 ASP A OD1   1 
ATOM   1936 O  OD2   . ASP A 1 253 ? 18.274  2.709   5.907   1.00 27.87 ? 251 ASP A OD2   1 
ATOM   1937 N  N     . VAL A 1 254 ? 23.205  3.112   4.008   1.00 15.87 ? 252 VAL A N     1 
ATOM   1938 C  CA    . VAL A 1 254 ? 24.282  2.787   3.088   1.00 14.57 ? 252 VAL A CA    1 
ATOM   1939 C  C     . VAL A 1 254 ? 25.617  3.151   3.742   1.00 14.31 ? 252 VAL A C     1 
ATOM   1940 O  O     . VAL A 1 254 ? 26.593  2.402   3.649   1.00 13.92 ? 252 VAL A O     1 
ATOM   1941 C  CB    . VAL A 1 254 ? 24.114  3.548   1.748   1.00 14.15 ? 252 VAL A CB    1 
ATOM   1942 C  CG1   . VAL A 1 254 ? 25.373  3.416   0.904   1.00 14.88 ? 252 VAL A CG1   1 
ATOM   1943 C  CG2   . VAL A 1 254 ? 22.917  2.984   0.986   1.00 14.35 ? 252 VAL A CG2   1 
ATOM   1944 N  N     . PHE A 1 255 ? 25.662  4.300   4.409   1.00 14.16 ? 253 PHE A N     1 
ATOM   1945 C  CA    . PHE A 1 255 ? 26.891  4.710   5.084   1.00 15.05 ? 253 PHE A CA    1 
ATOM   1946 C  C     . PHE A 1 255 ? 27.291  3.635   6.101   1.00 14.58 ? 253 PHE A C     1 
ATOM   1947 O  O     . PHE A 1 255 ? 28.439  3.193   6.131   1.00 16.23 ? 253 PHE A O     1 
ATOM   1948 C  CB    . PHE A 1 255 ? 26.687  6.039   5.822   1.00 15.07 ? 253 PHE A CB    1 
ATOM   1949 C  CG    . PHE A 1 255 ? 27.940  6.582   6.458   1.00 13.87 ? 253 PHE A CG    1 
ATOM   1950 C  CD1   . PHE A 1 255 ? 28.697  7.551   5.808   1.00 15.31 ? 253 PHE A CD1   1 
ATOM   1951 C  CD2   . PHE A 1 255 ? 28.372  6.117   7.697   1.00 13.72 ? 253 PHE A CD2   1 
ATOM   1952 C  CE1   . PHE A 1 255 ? 29.866  8.051   6.384   1.00 16.20 ? 253 PHE A CE1   1 
ATOM   1953 C  CE2   . PHE A 1 255 ? 29.540  6.609   8.281   1.00 15.06 ? 253 PHE A CE2   1 
ATOM   1954 C  CZ    . PHE A 1 255 ? 30.289  7.579   7.621   1.00 15.51 ? 253 PHE A CZ    1 
ATOM   1955 N  N     . VAL A 1 256 ? 26.338  3.211   6.928   1.00 14.97 ? 254 VAL A N     1 
ATOM   1956 C  CA    . VAL A 1 256 ? 26.618  2.200   7.946   1.00 15.22 ? 254 VAL A CA    1 
ATOM   1957 C  C     . VAL A 1 256 ? 27.104  0.888   7.342   1.00 14.65 ? 254 VAL A C     1 
ATOM   1958 O  O     . VAL A 1 256 ? 28.096  0.324   7.804   1.00 14.67 ? 254 VAL A O     1 
ATOM   1959 C  CB    . VAL A 1 256 ? 25.374  1.945   8.824   1.00 15.23 ? 254 VAL A CB    1 
ATOM   1960 C  CG1   . VAL A 1 256 ? 25.590  0.735   9.728   1.00 14.40 ? 254 VAL A CG1   1 
ATOM   1961 C  CG2   . VAL A 1 256 ? 25.097  3.177   9.673   1.00 17.28 ? 254 VAL A CG2   1 
ATOM   1962 N  N     . GLY A 1 257 ? 26.410  0.403   6.317   1.00 14.91 ? 255 GLY A N     1 
ATOM   1963 C  CA    . GLY A 1 257 ? 26.824  -0.836  5.681   1.00 16.31 ? 255 GLY A CA    1 
ATOM   1964 C  C     . GLY A 1 257 ? 28.231  -0.729  5.115   1.00 15.54 ? 255 GLY A C     1 
ATOM   1965 O  O     . GLY A 1 257 ? 29.052  -1.629  5.290   1.00 16.14 ? 255 GLY A O     1 
ATOM   1966 N  N     . ALA A 1 258 ? 28.524  0.378   4.437   1.00 15.49 ? 256 ALA A N     1 
ATOM   1967 C  CA    . ALA A 1 258 ? 29.851  0.572   3.855   1.00 14.17 ? 256 ALA A CA    1 
ATOM   1968 C  C     . ALA A 1 258 ? 30.930  0.745   4.928   1.00 13.87 ? 256 ALA A C     1 
ATOM   1969 O  O     . ALA A 1 258 ? 32.057  0.262   4.770   1.00 14.43 ? 256 ALA A O     1 
ATOM   1970 C  CB    . ALA A 1 258 ? 29.839  1.792   2.916   1.00 15.19 ? 256 ALA A CB    1 
ATOM   1971 N  N     . PHE A 1 259 ? 30.586  1.453   6.002   1.00 14.01 ? 257 PHE A N     1 
ATOM   1972 C  CA    . PHE A 1 259 ? 31.524  1.691   7.104   1.00 13.93 ? 257 PHE A CA    1 
ATOM   1973 C  C     . PHE A 1 259 ? 31.905  0.354   7.731   1.00 14.21 ? 257 PHE A C     1 
ATOM   1974 O  O     . PHE A 1 259 ? 33.082  0.078   7.967   1.00 14.14 ? 257 PHE A O     1 
ATOM   1975 C  CB    . PHE A 1 259 ? 30.877  2.593   8.166   1.00 13.96 ? 257 PHE A CB    1 
ATOM   1976 C  CG    . PHE A 1 259 ? 31.823  3.042   9.255   1.00 15.19 ? 257 PHE A CG    1 
ATOM   1977 C  CD1   . PHE A 1 259 ? 32.535  4.233   9.130   1.00 15.70 ? 257 PHE A CD1   1 
ATOM   1978 C  CD2   . PHE A 1 259 ? 31.993  2.280   10.409  1.00 16.90 ? 257 PHE A CD2   1 
ATOM   1979 C  CE1   . PHE A 1 259 ? 33.402  4.663   10.145  1.00 16.26 ? 257 PHE A CE1   1 
ATOM   1980 C  CE2   . PHE A 1 259 ? 32.861  2.702   11.431  1.00 16.69 ? 257 PHE A CE2   1 
ATOM   1981 C  CZ    . PHE A 1 259 ? 33.563  3.897   11.292  1.00 15.90 ? 257 PHE A CZ    1 
ATOM   1982 N  N     . ILE A 1 260 ? 30.897  -0.468  8.003   1.00 13.63 ? 258 ILE A N     1 
ATOM   1983 C  CA    . ILE A 1 260 ? 31.114  -1.778  8.605   1.00 15.34 ? 258 ILE A CA    1 
ATOM   1984 C  C     . ILE A 1 260 ? 31.946  -2.665  7.679   1.00 15.52 ? 258 ILE A C     1 
ATOM   1985 O  O     . ILE A 1 260 ? 32.814  -3.416  8.136   1.00 16.22 ? 258 ILE A O     1 
ATOM   1986 C  CB    . ILE A 1 260 ? 29.759  -2.460  8.913   1.00 15.59 ? 258 ILE A CB    1 
ATOM   1987 C  CG1   . ILE A 1 260 ? 29.048  -1.701  10.041  1.00 15.92 ? 258 ILE A CG1   1 
ATOM   1988 C  CG2   . ILE A 1 260 ? 29.969  -3.939  9.270   1.00 16.43 ? 258 ILE A CG2   1 
ATOM   1989 C  CD1   . ILE A 1 260 ? 29.777  -1.717  11.392  1.00 17.15 ? 258 ILE A CD1   1 
ATOM   1990 N  N     . ALA A 1 261 ? 31.672  -2.581  6.381   1.00 15.66 ? 259 ALA A N     1 
ATOM   1991 C  CA    . ALA A 1 261 ? 32.410  -3.356  5.391   1.00 16.10 ? 259 ALA A CA    1 
ATOM   1992 C  C     . ALA A 1 261 ? 33.887  -2.956  5.456   1.00 15.26 ? 259 ALA A C     1 
ATOM   1993 O  O     . ALA A 1 261 ? 34.780  -3.804  5.425   1.00 16.00 ? 259 ALA A O     1 
ATOM   1994 C  CB    . ALA A 1 261 ? 31.854  -3.084  4.001   1.00 16.36 ? 259 ALA A CB    1 
ATOM   1995 N  N     . GLY A 1 262 ? 34.133  -1.654  5.548   1.00 15.19 ? 260 GLY A N     1 
ATOM   1996 C  CA    . GLY A 1 262 ? 35.500  -1.173  5.630   1.00 14.71 ? 260 GLY A CA    1 
ATOM   1997 C  C     . GLY A 1 262 ? 36.215  -1.738  6.844   1.00 15.87 ? 260 GLY A C     1 
ATOM   1998 O  O     . GLY A 1 262 ? 37.360  -2.183  6.750   1.00 16.15 ? 260 GLY A O     1 
ATOM   1999 N  N     . LEU A 1 263 ? 35.541  -1.725  7.994   1.00 15.08 ? 261 LEU A N     1 
ATOM   2000 C  CA    . LEU A 1 263 ? 36.141  -2.244  9.218   1.00 15.35 ? 261 LEU A CA    1 
ATOM   2001 C  C     . LEU A 1 263 ? 36.399  -3.739  9.100   1.00 16.19 ? 261 LEU A C     1 
ATOM   2002 O  O     . LEU A 1 263 ? 37.427  -4.240  9.558   1.00 16.70 ? 261 LEU A O     1 
ATOM   2003 C  CB    . LEU A 1 263 ? 35.238  -1.974  10.427  1.00 16.45 ? 261 LEU A CB    1 
ATOM   2004 C  CG    . LEU A 1 263 ? 35.114  -0.506  10.850  1.00 19.79 ? 261 LEU A CG    1 
ATOM   2005 C  CD1   . LEU A 1 263 ? 34.441  -0.434  12.215  1.00 17.81 ? 261 LEU A CD1   1 
ATOM   2006 C  CD2   . LEU A 1 263 ? 36.487  0.133   10.910  1.00 19.03 ? 261 LEU A CD2   1 
ATOM   2007 N  N     . ALA A 1 264 ? 35.460  -4.444  8.481   1.00 16.94 ? 262 ALA A N     1 
ATOM   2008 C  CA    . ALA A 1 264 ? 35.594  -5.881  8.297   1.00 16.93 ? 262 ALA A CA    1 
ATOM   2009 C  C     . ALA A 1 264 ? 36.815  -6.190  7.433   1.00 18.26 ? 262 ALA A C     1 
ATOM   2010 O  O     . ALA A 1 264 ? 37.490  -7.201  7.649   1.00 19.72 ? 262 ALA A O     1 
ATOM   2011 C  CB    . ALA A 1 264 ? 34.325  -6.446  7.650   1.00 18.22 ? 262 ALA A CB    1 
HETATM 2012 N  N     . MSE A 1 265 ? 37.111  -5.311  6.476   1.00 16.81 ? 263 MSE A N     1 
HETATM 2013 C  CA    . MSE A 1 265 ? 38.251  -5.491  5.580   1.00 17.58 ? 263 MSE A CA    1 
HETATM 2014 C  C     . MSE A 1 265 ? 39.548  -4.888  6.124   1.00 17.75 ? 263 MSE A C     1 
HETATM 2015 O  O     . MSE A 1 265 ? 40.556  -4.795  5.414   1.00 18.44 ? 263 MSE A O     1 
HETATM 2016 C  CB    . MSE A 1 265 ? 37.923  -4.904  4.205   1.00 18.15 ? 263 MSE A CB    1 
HETATM 2017 C  CG    . MSE A 1 265 ? 36.744  -5.598  3.531   1.00 20.23 ? 263 MSE A CG    1 
HETATM 2018 SE SE    . MSE A 1 265 ? 36.352  -4.906  1.790   1.00 27.44 ? 263 MSE A SE    1 
HETATM 2019 C  CE    . MSE A 1 265 ? 37.800  -5.753  0.842   1.00 21.76 ? 263 MSE A CE    1 
ATOM   2020 N  N     . ASN A 1 266 ? 39.509  -4.481  7.389   1.00 16.82 ? 264 ASN A N     1 
ATOM   2021 C  CA    . ASN A 1 266 ? 40.667  -3.910  8.065   1.00 19.15 ? 264 ASN A CA    1 
ATOM   2022 C  C     . ASN A 1 266 ? 41.230  -2.670  7.381   1.00 18.35 ? 264 ASN A C     1 
ATOM   2023 O  O     . ASN A 1 266 ? 42.439  -2.437  7.394   1.00 17.54 ? 264 ASN A O     1 
ATOM   2024 C  CB    . ASN A 1 266 ? 41.762  -4.981  8.210   1.00 19.96 ? 264 ASN A CB    1 
ATOM   2025 C  CG    . ASN A 1 266 ? 42.837  -4.592  9.212   1.00 23.85 ? 264 ASN A CG    1 
ATOM   2026 O  OD1   . ASN A 1 266 ? 42.547  -3.980  10.244  1.00 26.96 ? 264 ASN A OD1   1 
ATOM   2027 N  ND2   . ASN A 1 266 ? 44.084  -4.963  8.923   1.00 23.88 ? 264 ASN A ND2   1 
HETATM 2028 N  N     . MSE A 1 267 ? 40.351  -1.868  6.789   1.00 18.43 ? 265 MSE A N     1 
HETATM 2029 C  CA    . MSE A 1 267 ? 40.777  -0.638  6.134   1.00 19.60 ? 265 MSE A CA    1 
HETATM 2030 C  C     . MSE A 1 267 ? 41.051  0.436   7.176   1.00 20.05 ? 265 MSE A C     1 
HETATM 2031 O  O     . MSE A 1 267 ? 40.321  0.553   8.158   1.00 20.49 ? 265 MSE A O     1 
HETATM 2032 C  CB    . MSE A 1 267 ? 39.688  -0.108  5.202   1.00 21.07 ? 265 MSE A CB    1 
HETATM 2033 C  CG    . MSE A 1 267 ? 39.527  -0.859  3.903   1.00 26.30 ? 265 MSE A CG    1 
HETATM 2034 SE SE    . MSE A 1 267 ? 38.152  -0.003  2.858   1.00 33.19 ? 265 MSE A SE    1 
HETATM 2035 C  CE    . MSE A 1 267 ? 37.510  -1.550  1.904   1.00 34.98 ? 265 MSE A CE    1 
ATOM   2036 N  N     . PRO A 1 268 ? 42.109  1.238   6.973   1.00 19.86 ? 266 PRO A N     1 
ATOM   2037 C  CA    . PRO A 1 268 ? 42.408  2.297   7.938   1.00 20.61 ? 266 PRO A CA    1 
ATOM   2038 C  C     . PRO A 1 268 ? 41.158  3.162   8.067   1.00 20.47 ? 266 PRO A C     1 
ATOM   2039 O  O     . PRO A 1 268 ? 40.366  3.258   7.124   1.00 20.87 ? 266 PRO A O     1 
ATOM   2040 C  CB    . PRO A 1 268 ? 43.560  3.042   7.278   1.00 23.30 ? 266 PRO A CB    1 
ATOM   2041 C  CG    . PRO A 1 268 ? 44.276  1.945   6.544   1.00 24.62 ? 266 PRO A CG    1 
ATOM   2042 C  CD    . PRO A 1 268 ? 43.128  1.191   5.912   1.00 22.31 ? 266 PRO A CD    1 
ATOM   2043 N  N     . ILE A 1 269 ? 40.985  3.802   9.215   1.00 18.56 ? 267 ILE A N     1 
ATOM   2044 C  CA    . ILE A 1 269 ? 39.798  4.617   9.435   1.00 18.34 ? 267 ILE A CA    1 
ATOM   2045 C  C     . ILE A 1 269 ? 39.530  5.664   8.350   1.00 17.18 ? 267 ILE A C     1 
ATOM   2046 O  O     . ILE A 1 269 ? 38.387  5.837   7.948   1.00 15.83 ? 267 ILE A O     1 
ATOM   2047 C  CB    . ILE A 1 269 ? 39.829  5.291   10.837  1.00 17.36 ? 267 ILE A CB    1 
ATOM   2048 C  CG1   . ILE A 1 269 ? 38.487  5.971   11.121  1.00 16.96 ? 267 ILE A CG1   1 
ATOM   2049 C  CG2   . ILE A 1 269 ? 40.969  6.302   10.922  1.00 18.03 ? 267 ILE A CG2   1 
ATOM   2050 C  CD1   . ILE A 1 269 ? 37.290  5.037   11.067  1.00 21.72 ? 267 ILE A CD1   1 
ATOM   2051 N  N     . THR A 1 270 ? 40.556  6.349   7.854   1.00 17.03 ? 268 THR A N     1 
ATOM   2052 C  CA    . THR A 1 270 ? 40.290  7.352   6.824   1.00 17.99 ? 268 THR A CA    1 
ATOM   2053 C  C     . THR A 1 270 ? 39.748  6.735   5.531   1.00 17.89 ? 268 THR A C     1 
ATOM   2054 O  O     . THR A 1 270 ? 38.855  7.301   4.902   1.00 17.81 ? 268 THR A O     1 
ATOM   2055 C  CB    . THR A 1 270 ? 41.537  8.209   6.500   1.00 19.36 ? 268 THR A CB    1 
ATOM   2056 O  OG1   . THR A 1 270 ? 42.623  7.367   6.104   1.00 22.37 ? 268 THR A OG1   1 
ATOM   2057 C  CG2   . THR A 1 270 ? 41.927  9.032   7.715   1.00 20.35 ? 268 THR A CG2   1 
ATOM   2058 N  N     . GLU A 1 271 ? 40.276  5.581   5.136   1.00 17.17 ? 269 GLU A N     1 
ATOM   2059 C  CA    . GLU A 1 271 ? 39.799  4.928   3.920   1.00 18.30 ? 269 GLU A CA    1 
ATOM   2060 C  C     . GLU A 1 271 ? 38.371  4.432   4.127   1.00 16.57 ? 269 GLU A C     1 
ATOM   2061 O  O     . GLU A 1 271 ? 37.538  4.535   3.228   1.00 16.31 ? 269 GLU A O     1 
ATOM   2062 C  CB    . GLU A 1 271 ? 40.704  3.753   3.541   1.00 19.67 ? 269 GLU A CB    1 
ATOM   2063 C  CG    . GLU A 1 271 ? 40.160  2.910   2.397   1.00 26.53 ? 269 GLU A CG    1 
ATOM   2064 C  CD    . GLU A 1 271 ? 41.224  2.051   1.749   1.00 31.29 ? 269 GLU A CD    1 
ATOM   2065 O  OE1   . GLU A 1 271 ? 42.135  1.606   2.472   1.00 33.29 ? 269 GLU A OE1   1 
ATOM   2066 O  OE2   . GLU A 1 271 ? 41.144  1.812   0.524   1.00 33.53 ? 269 GLU A OE2   1 
ATOM   2067 N  N     . THR A 1 272 ? 38.092  3.898   5.313   1.00 15.04 ? 270 THR A N     1 
ATOM   2068 C  CA    . THR A 1 272 ? 36.752  3.404   5.631   1.00 15.51 ? 270 THR A CA    1 
ATOM   2069 C  C     . THR A 1 272 ? 35.751  4.551   5.506   1.00 14.11 ? 270 THR A C     1 
ATOM   2070 O  O     . THR A 1 272 ? 34.665  4.377   4.952   1.00 15.37 ? 270 THR A O     1 
ATOM   2071 C  CB    . THR A 1 272 ? 36.708  2.816   7.063   1.00 15.26 ? 270 THR A CB    1 
ATOM   2072 O  OG1   . THR A 1 272 ? 37.505  1.627   7.106   1.00 17.42 ? 270 THR A OG1   1 
ATOM   2073 C  CG2   . THR A 1 272 ? 35.280  2.476   7.478   1.00 17.19 ? 270 THR A CG2   1 
ATOM   2074 N  N     . LEU A 1 273 ? 36.132  5.725   6.012   1.00 14.39 ? 271 LEU A N     1 
ATOM   2075 C  CA    . LEU A 1 273 ? 35.272  6.897   5.940   1.00 13.24 ? 271 LEU A CA    1 
ATOM   2076 C  C     . LEU A 1 273 ? 35.066  7.341   4.496   1.00 13.87 ? 271 LEU A C     1 
ATOM   2077 O  O     . LEU A 1 273 ? 33.964  7.740   4.121   1.00 13.64 ? 271 LEU A O     1 
ATOM   2078 C  CB    . LEU A 1 273 ? 35.861  8.046   6.761   1.00 13.87 ? 271 LEU A CB    1 
ATOM   2079 C  CG    . LEU A 1 273 ? 35.766  7.864   8.280   1.00 14.83 ? 271 LEU A CG    1 
ATOM   2080 C  CD1   . LEU A 1 273 ? 36.676  8.874   8.970   1.00 14.64 ? 271 LEU A CD1   1 
ATOM   2081 C  CD2   . LEU A 1 273 ? 34.314  8.023   8.732   1.00 14.60 ? 271 LEU A CD2   1 
ATOM   2082 N  N     . LYS A 1 274 ? 36.113  7.262   3.679   1.00 12.81 ? 272 LYS A N     1 
ATOM   2083 C  CA    . LYS A 1 274 ? 35.972  7.664   2.280   1.00 14.03 ? 272 LYS A CA    1 
ATOM   2084 C  C     . LYS A 1 274 ? 35.034  6.702   1.560   1.00 14.74 ? 272 LYS A C     1 
ATOM   2085 O  O     . LYS A 1 274 ? 34.171  7.126   0.791   1.00 14.50 ? 272 LYS A O     1 
ATOM   2086 C  CB    . LYS A 1 274 ? 37.337  7.708   1.594   1.00 14.76 ? 272 LYS A CB    1 
ATOM   2087 C  CG    . LYS A 1 274 ? 38.200  8.852   2.110   1.00 16.81 ? 272 LYS A CG    1 
ATOM   2088 C  CD    . LYS A 1 274 ? 39.594  8.828   1.525   1.00 20.59 ? 272 LYS A CD    1 
ATOM   2089 C  CE    . LYS A 1 274 ? 40.455  9.902   2.179   1.00 21.90 ? 272 LYS A CE    1 
ATOM   2090 N  NZ    . LYS A 1 274 ? 41.892  9.750   1.818   1.00 23.99 ? 272 LYS A NZ    1 
ATOM   2091 N  N     . VAL A 1 275 ? 35.182  5.409   1.835   1.00 14.75 ? 273 VAL A N     1 
ATOM   2092 C  CA    . VAL A 1 275 ? 34.320  4.408   1.208   1.00 13.99 ? 273 VAL A CA    1 
ATOM   2093 C  C     . VAL A 1 275 ? 32.862  4.609   1.620   1.00 15.11 ? 273 VAL A C     1 
ATOM   2094 O  O     . VAL A 1 275 ? 31.965  4.576   0.775   1.00 14.88 ? 273 VAL A O     1 
ATOM   2095 C  CB    . VAL A 1 275 ? 34.772  2.964   1.565   1.00 15.15 ? 273 VAL A CB    1 
ATOM   2096 C  CG1   . VAL A 1 275 ? 33.717  1.947   1.092   1.00 18.75 ? 273 VAL A CG1   1 
ATOM   2097 C  CG2   . VAL A 1 275 ? 36.111  2.664   0.885   1.00 16.20 ? 273 VAL A CG2   1 
ATOM   2098 N  N     . ALA A 1 276 ? 32.622  4.834   2.910   1.00 13.79 ? 274 ALA A N     1 
ATOM   2099 C  CA    . ALA A 1 276 ? 31.258  5.036   3.399   1.00 14.35 ? 274 ALA A CA    1 
ATOM   2100 C  C     . ALA A 1 276 ? 30.632  6.286   2.793   1.00 16.03 ? 274 ALA A C     1 
ATOM   2101 O  O     . ALA A 1 276 ? 29.453  6.300   2.438   1.00 15.47 ? 274 ALA A O     1 
ATOM   2102 C  CB    . ALA A 1 276 ? 31.260  5.146   4.921   1.00 15.99 ? 274 ALA A CB    1 
ATOM   2103 N  N     . THR A 1 277 ? 31.432  7.337   2.680   1.00 13.63 ? 275 THR A N     1 
ATOM   2104 C  CA    . THR A 1 277 ? 30.953  8.589   2.130   1.00 13.99 ? 275 THR A CA    1 
ATOM   2105 C  C     . THR A 1 277 ? 30.683  8.459   0.629   1.00 14.62 ? 275 THR A C     1 
ATOM   2106 O  O     . THR A 1 277 ? 29.686  8.978   0.129   1.00 14.78 ? 275 THR A O     1 
ATOM   2107 C  CB    . THR A 1 277 ? 31.969  9.705   2.432   1.00 13.40 ? 275 THR A CB    1 
ATOM   2108 O  OG1   . THR A 1 277 ? 32.114  9.815   3.855   1.00 13.77 ? 275 THR A OG1   1 
ATOM   2109 C  CG2   . THR A 1 277 ? 31.492  11.042  1.878   1.00 17.33 ? 275 THR A CG2   1 
ATOM   2110 N  N     . GLY A 1 278 ? 31.560  7.753   -0.081  1.00 13.27 ? 276 GLY A N     1 
ATOM   2111 C  CA    . GLY A 1 278 ? 31.368  7.564   -1.509  1.00 14.54 ? 276 GLY A CA    1 
ATOM   2112 C  C     . GLY A 1 278 ? 30.095  6.787   -1.808  1.00 14.64 ? 276 GLY A C     1 
ATOM   2113 O  O     . GLY A 1 278 ? 29.340  7.135   -2.720  1.00 14.73 ? 276 GLY A O     1 
ATOM   2114 N  N     . CYS A 1 279 ? 29.853  5.734   -1.035  1.00 14.60 ? 277 CYS A N     1 
ATOM   2115 C  CA    . CYS A 1 279 ? 28.666  4.902   -1.226  1.00 16.05 ? 277 CYS A CA    1 
ATOM   2116 C  C     . CYS A 1 279 ? 27.385  5.661   -0.908  1.00 15.53 ? 277 CYS A C     1 
ATOM   2117 O  O     . CYS A 1 279 ? 26.411  5.592   -1.667  1.00 16.84 ? 277 CYS A O     1 
ATOM   2118 C  CB    . CYS A 1 279 ? 28.756  3.634   -0.362  1.00 14.57 ? 277 CYS A CB    1 
ATOM   2119 S  SG    . CYS A 1 279 ? 29.971  2.418   -0.955  1.00 18.04 ? 277 CYS A SG    1 
ATOM   2120 N  N     . SER A 1 280 ? 27.376  6.390   0.204   1.00 15.09 ? 278 SER A N     1 
ATOM   2121 C  CA    . SER A 1 280 ? 26.191  7.146   0.575   1.00 15.51 ? 278 SER A CA    1 
ATOM   2122 C  C     . SER A 1 280 ? 25.946  8.294   -0.407  1.00 15.61 ? 278 SER A C     1 
ATOM   2123 O  O     . SER A 1 280 ? 24.803  8.653   -0.668  1.00 16.84 ? 278 SER A O     1 
ATOM   2124 C  CB    . SER A 1 280 ? 26.307  7.654   2.020   1.00 16.94 ? 278 SER A CB    1 
ATOM   2125 O  OG    . SER A 1 280 ? 27.476  8.425   2.218   1.00 20.93 ? 278 SER A OG    1 
ATOM   2126 N  N     . ALA A 1 281 ? 27.010  8.865   -0.966  1.00 15.58 ? 279 ALA A N     1 
ATOM   2127 C  CA    . ALA A 1 281 ? 26.829  9.938   -1.941  1.00 15.56 ? 279 ALA A CA    1 
ATOM   2128 C  C     . ALA A 1 281 ? 26.141  9.347   -3.176  1.00 18.65 ? 279 ALA A C     1 
ATOM   2129 O  O     . ALA A 1 281 ? 25.250  9.966   -3.759  1.00 19.05 ? 279 ALA A O     1 
ATOM   2130 C  CB    . ALA A 1 281 ? 28.183  10.555  -2.319  1.00 16.36 ? 279 ALA A CB    1 
ATOM   2131 N  N     . SER A 1 282 ? 26.552  8.148   -3.575  1.00 16.86 ? 280 SER A N     1 
ATOM   2132 C  CA    . SER A 1 282 ? 25.936  7.496   -4.731  1.00 19.48 ? 280 SER A CA    1 
ATOM   2133 C  C     . SER A 1 282 ? 24.463  7.200   -4.437  1.00 19.28 ? 280 SER A C     1 
ATOM   2134 O  O     . SER A 1 282 ? 23.605  7.336   -5.311  1.00 19.31 ? 280 SER A O     1 
ATOM   2135 C  CB    . SER A 1 282 ? 26.669  6.196   -5.071  1.00 18.66 ? 280 SER A CB    1 
ATOM   2136 O  OG    . SER A 1 282 ? 25.965  5.466   -6.072  1.00 20.19 ? 280 SER A OG    1 
ATOM   2137 N  N     . LYS A 1 283 ? 24.167  6.806   -3.201  1.00 18.38 ? 281 LYS A N     1 
ATOM   2138 C  CA    . LYS A 1 283 ? 22.787  6.514   -2.824  1.00 18.90 ? 281 LYS A CA    1 
ATOM   2139 C  C     . LYS A 1 283 ? 21.864  7.715   -3.013  1.00 20.75 ? 281 LYS A C     1 
ATOM   2140 O  O     . LYS A 1 283 ? 20.760  7.587   -3.549  1.00 20.39 ? 281 LYS A O     1 
ATOM   2141 C  CB    . LYS A 1 283 ? 22.716  6.055   -1.362  1.00 20.33 ? 281 LYS A CB    1 
ATOM   2142 C  CG    . LYS A 1 283 ? 21.303  6.093   -0.772  1.00 23.44 ? 281 LYS A CG    1 
ATOM   2143 C  CD    . LYS A 1 283 ? 20.360  5.167   -1.527  1.00 27.56 ? 281 LYS A CD    1 
ATOM   2144 C  CE    . LYS A 1 283 ? 18.907  5.459   -1.207  1.00 28.88 ? 281 LYS A CE    1 
ATOM   2145 N  NZ    . LYS A 1 283 ? 18.465  6.800   -1.699  1.00 27.14 ? 281 LYS A NZ    1 
ATOM   2146 N  N     . VAL A 1 284 ? 22.319  8.883   -2.571  1.00 19.68 ? 282 VAL A N     1 
ATOM   2147 C  CA    . VAL A 1 284 ? 21.521  10.100  -2.656  1.00 23.16 ? 282 VAL A CA    1 
ATOM   2148 C  C     . VAL A 1 284 ? 21.198  10.485  -4.098  1.00 23.64 ? 282 VAL A C     1 
ATOM   2149 O  O     . VAL A 1 284 ? 20.262  11.241  -4.355  1.00 24.42 ? 282 VAL A O     1 
ATOM   2150 C  CB    . VAL A 1 284 ? 22.244  11.264  -1.934  1.00 25.38 ? 282 VAL A CB    1 
ATOM   2151 C  CG1   . VAL A 1 284 ? 21.437  12.539  -2.041  1.00 28.69 ? 282 VAL A CG1   1 
ATOM   2152 C  CG2   . VAL A 1 284 ? 22.446  10.905  -0.459  1.00 23.36 ? 282 VAL A CG2   1 
HETATM 2153 N  N     . MSE A 1 285 ? 21.967  9.947   -5.035  1.00 23.34 ? 283 MSE A N     1 
HETATM 2154 C  CA    . MSE A 1 285 ? 21.758  10.230  -6.450  1.00 26.85 ? 283 MSE A CA    1 
HETATM 2155 C  C     . MSE A 1 285 ? 20.663  9.354   -7.053  1.00 27.83 ? 283 MSE A C     1 
HETATM 2156 O  O     . MSE A 1 285 ? 20.232  9.585   -8.184  1.00 27.54 ? 283 MSE A O     1 
HETATM 2157 C  CB    . MSE A 1 285 ? 23.060  10.012  -7.217  1.00 27.46 ? 283 MSE A CB    1 
HETATM 2158 C  CG    . MSE A 1 285 ? 24.141  11.017  -6.890  1.00 27.50 ? 283 MSE A CG    1 
HETATM 2159 SE SE    . MSE A 1 285 ? 25.805  10.566  -7.754  1.00 30.89 ? 283 MSE A SE    1 
HETATM 2160 C  CE    . MSE A 1 285 ? 25.244  10.768  -9.598  1.00 27.65 ? 283 MSE A CE    1 
ATOM   2161 N  N     . GLN A 1 286 ? 20.208  8.362   -6.289  1.00 29.31 ? 284 GLN A N     1 
ATOM   2162 C  CA    . GLN A 1 286 ? 19.179  7.433   -6.754  1.00 31.38 ? 284 GLN A CA    1 
ATOM   2163 C  C     . GLN A 1 286 ? 17.758  7.805   -6.331  1.00 32.97 ? 284 GLN A C     1 
ATOM   2164 O  O     . GLN A 1 286 ? 17.554  8.572   -5.391  1.00 34.15 ? 284 GLN A O     1 
ATOM   2165 C  CB    . GLN A 1 286 ? 19.484  6.022   -6.249  1.00 30.70 ? 284 GLN A CB    1 
ATOM   2166 C  CG    . GLN A 1 286 ? 20.926  5.579   -6.416  1.00 29.64 ? 284 GLN A CG    1 
ATOM   2167 C  CD    . GLN A 1 286 ? 21.411  5.680   -7.847  1.00 31.10 ? 284 GLN A CD    1 
ATOM   2168 O  OE1   . GLN A 1 286 ? 20.752  5.208   -8.770  1.00 32.57 ? 284 GLN A OE1   1 
ATOM   2169 N  NE2   . GLN A 1 286 ? 22.578  6.289   -8.037  1.00 30.56 ? 284 GLN A NE2   1 
ATOM   2170 N  N     . GLN A 1 287 ? 16.779  7.229   -7.025  1.00 35.15 ? 285 GLN A N     1 
ATOM   2171 C  CA    . GLN A 1 287 ? 15.367  7.481   -6.744  1.00 37.28 ? 285 GLN A CA    1 
ATOM   2172 C  C     . GLN A 1 287 ? 14.834  6.808   -5.481  1.00 37.93 ? 285 GLN A C     1 
ATOM   2173 O  O     . GLN A 1 287 ? 14.219  7.462   -4.638  1.00 38.71 ? 285 GLN A O     1 
ATOM   2174 C  CB    . GLN A 1 287 ? 14.502  7.030   -7.920  1.00 39.96 ? 285 GLN A CB    1 
ATOM   2175 C  CG    . GLN A 1 287 ? 14.590  7.900   -9.155  1.00 43.94 ? 285 GLN A CG    1 
ATOM   2176 C  CD    . GLN A 1 287 ? 13.554  7.512   -10.193 1.00 46.54 ? 285 GLN A CD    1 
ATOM   2177 O  OE1   . GLN A 1 287 ? 13.574  6.400   -10.722 1.00 48.71 ? 285 GLN A OE1   1 
ATOM   2178 N  NE2   . GLN A 1 287 ? 12.635  8.426   -10.480 1.00 47.20 ? 285 GLN A NE2   1 
ATOM   2179 N  N     . ASP A 1 288 ? 15.056  5.503   -5.355  1.00 37.43 ? 286 ASP A N     1 
ATOM   2180 C  CA    . ASP A 1 288 ? 14.553  4.764   -4.203  1.00 37.52 ? 286 ASP A CA    1 
ATOM   2181 C  C     . ASP A 1 288 ? 15.226  5.122   -2.886  1.00 37.65 ? 286 ASP A C     1 
ATOM   2182 O  O     . ASP A 1 288 ? 15.942  6.120   -2.786  1.00 35.98 ? 286 ASP A O     1 
ATOM   2183 C  CB    . ASP A 1 288 ? 14.651  3.252   -4.444  1.00 38.54 ? 286 ASP A CB    1 
ATOM   2184 C  CG    . ASP A 1 288 ? 16.078  2.773   -4.617  1.00 40.12 ? 286 ASP A CG    1 
ATOM   2185 O  OD1   . ASP A 1 288 ? 16.923  3.092   -3.756  1.00 39.64 ? 286 ASP A OD1   1 
ATOM   2186 O  OD2   . ASP A 1 288 ? 16.352  2.064   -5.610  1.00 43.36 ? 286 ASP A OD2   1 
ATOM   2187 N  N     . SER A 1 289 ? 14.996  4.295   -1.872  1.00 37.63 ? 287 SER A N     1 
ATOM   2188 C  CA    . SER A 1 289 ? 15.557  4.553   -0.555  1.00 38.05 ? 287 SER A CA    1 
ATOM   2189 C  C     . SER A 1 289 ? 16.635  3.582   -0.076  1.00 36.62 ? 287 SER A C     1 
ATOM   2190 O  O     . SER A 1 289 ? 16.884  3.489   1.126   1.00 36.19 ? 287 SER A O     1 
ATOM   2191 C  CB    . SER A 1 289 ? 14.422  4.617   0.473   1.00 40.63 ? 287 SER A CB    1 
ATOM   2192 O  OG    . SER A 1 289 ? 13.484  3.572   0.268   1.00 42.94 ? 287 SER A OG    1 
ATOM   2193 N  N     . SER A 1 290 ? 17.296  2.880   -0.995  1.00 35.81 ? 288 SER A N     1 
ATOM   2194 C  CA    . SER A 1 290 ? 18.333  1.935   -0.578  1.00 34.59 ? 288 SER A CA    1 
ATOM   2195 C  C     . SER A 1 290 ? 19.435  1.632   -1.593  1.00 32.71 ? 288 SER A C     1 
ATOM   2196 O  O     . SER A 1 290 ? 20.565  1.319   -1.211  1.00 32.98 ? 288 SER A O     1 
ATOM   2197 C  CB    . SER A 1 290 ? 17.688  0.614   -0.152  1.00 36.44 ? 288 SER A CB    1 
ATOM   2198 O  OG    . SER A 1 290 ? 17.040  -0.010  -1.247  1.00 37.25 ? 288 SER A OG    1 
ATOM   2199 N  N     . SER A 1 291 ? 19.112  1.719   -2.878  1.00 30.67 ? 289 SER A N     1 
ATOM   2200 C  CA    . SER A 1 291 ? 20.082  1.411   -3.927  1.00 29.17 ? 289 SER A CA    1 
ATOM   2201 C  C     . SER A 1 291 ? 21.202  2.431   -4.098  1.00 27.58 ? 289 SER A C     1 
ATOM   2202 O  O     . SER A 1 291 ? 21.055  3.604   -3.762  1.00 27.34 ? 289 SER A O     1 
ATOM   2203 C  CB    . SER A 1 291 ? 19.365  1.251   -5.274  1.00 30.61 ? 289 SER A CB    1 
ATOM   2204 O  OG    . SER A 1 291 ? 18.389  0.228   -5.220  1.00 35.09 ? 289 SER A OG    1 
ATOM   2205 N  N     . PHE A 1 292 ? 22.331  1.958   -4.612  1.00 25.46 ? 290 PHE A N     1 
ATOM   2206 C  CA    . PHE A 1 292 ? 23.468  2.817   -4.896  1.00 24.04 ? 290 PHE A CA    1 
ATOM   2207 C  C     . PHE A 1 292 ? 24.327  2.115   -5.936  1.00 24.97 ? 290 PHE A C     1 
ATOM   2208 O  O     . PHE A 1 292 ? 24.263  0.893   -6.091  1.00 22.90 ? 290 PHE A O     1 
ATOM   2209 C  CB    . PHE A 1 292 ? 24.265  3.154   -3.619  1.00 22.31 ? 290 PHE A CB    1 
ATOM   2210 C  CG    . PHE A 1 292 ? 25.096  2.025   -3.075  1.00 20.95 ? 290 PHE A CG    1 
ATOM   2211 C  CD1   . PHE A 1 292 ? 26.452  1.927   -3.384  1.00 21.28 ? 290 PHE A CD1   1 
ATOM   2212 C  CD2   . PHE A 1 292 ? 24.540  1.091   -2.210  1.00 22.08 ? 290 PHE A CD2   1 
ATOM   2213 C  CE1   . PHE A 1 292 ? 27.240  0.916   -2.834  1.00 20.34 ? 290 PHE A CE1   1 
ATOM   2214 C  CE2   . PHE A 1 292 ? 25.318  0.076   -1.655  1.00 21.29 ? 290 PHE A CE2   1 
ATOM   2215 C  CZ    . PHE A 1 292 ? 26.674  -0.010  -1.968  1.00 22.00 ? 290 PHE A CZ    1 
ATOM   2216 N  N     . ASP A 1 293 ? 25.101  2.897   -6.678  1.00 25.63 ? 291 ASP A N     1 
ATOM   2217 C  CA    . ASP A 1 293 ? 25.948  2.346   -7.722  1.00 27.86 ? 291 ASP A CA    1 
ATOM   2218 C  C     . ASP A 1 293 ? 27.352  2.103   -7.200  1.00 29.56 ? 291 ASP A C     1 
ATOM   2219 O  O     . ASP A 1 293 ? 28.059  3.037   -6.835  1.00 28.16 ? 291 ASP A O     1 
ATOM   2220 C  CB    . ASP A 1 293 ? 26.005  3.305   -8.907  1.00 28.39 ? 291 ASP A CB    1 
ATOM   2221 C  CG    . ASP A 1 293 ? 26.743  2.720   -10.089 1.00 29.87 ? 291 ASP A CG    1 
ATOM   2222 O  OD1   . ASP A 1 293 ? 27.608  1.838   -9.884  1.00 31.74 ? 291 ASP A OD1   1 
ATOM   2223 O  OD2   . ASP A 1 293 ? 26.466  3.150   -11.223 1.00 33.80 ? 291 ASP A OD2   1 
ATOM   2224 N  N     . LEU A 1 294 ? 27.750  0.840   -7.179  1.00 32.04 ? 292 LEU A N     1 
ATOM   2225 C  CA    . LEU A 1 294 ? 29.065  0.458   -6.698  1.00 34.99 ? 292 LEU A CA    1 
ATOM   2226 C  C     . LEU A 1 294 ? 30.156  1.103   -7.558  1.00 36.90 ? 292 LEU A C     1 
ATOM   2227 O  O     . LEU A 1 294 ? 31.222  1.464   -7.053  1.00 36.80 ? 292 LEU A O     1 
ATOM   2228 C  CB    . LEU A 1 294 ? 29.182  -1.066  -6.721  1.00 36.85 ? 292 LEU A CB    1 
ATOM   2229 C  CG    . LEU A 1 294 ? 29.991  -1.743  -5.614  1.00 37.71 ? 292 LEU A CG    1 
ATOM   2230 C  CD1   . LEU A 1 294 ? 29.743  -1.071  -4.280  1.00 38.03 ? 292 LEU A CD1   1 
ATOM   2231 C  CD2   . LEU A 1 294 ? 29.597  -3.213  -5.551  1.00 40.83 ? 292 LEU A CD2   1 
ATOM   2232 N  N     . GLU A 1 295 ? 29.873  1.259   -8.849  1.00 37.31 ? 293 GLU A N     1 
ATOM   2233 C  CA    . GLU A 1 295 ? 30.814  1.864   -9.791  1.00 38.25 ? 293 GLU A CA    1 
ATOM   2234 C  C     . GLU A 1 295 ? 31.010  3.347   -9.495  1.00 36.15 ? 293 GLU A C     1 
ATOM   2235 O  O     . GLU A 1 295 ? 32.141  3.824   -9.383  1.00 37.68 ? 293 GLU A O     1 
ATOM   2236 C  CB    . GLU A 1 295 ? 30.308  1.685   -11.229 1.00 40.63 ? 293 GLU A CB    1 
ATOM   2237 C  CG    . GLU A 1 295 ? 31.170  2.356   -12.297 1.00 44.88 ? 293 GLU A CG    1 
ATOM   2238 C  CD    . GLU A 1 295 ? 30.662  2.105   -13.710 1.00 47.34 ? 293 GLU A CD    1 
ATOM   2239 O  OE1   . GLU A 1 295 ? 29.594  1.473   -13.865 1.00 49.43 ? 293 GLU A OE1   1 
ATOM   2240 O  OE2   . GLU A 1 295 ? 31.330  2.544   -14.669 1.00 48.33 ? 293 GLU A OE2   1 
ATOM   2241 N  N     . ALA A 1 296 ? 29.907  4.076   -9.377  1.00 33.82 ? 294 ALA A N     1 
ATOM   2242 C  CA    . ALA A 1 296 ? 29.968  5.498   -9.082  1.00 31.44 ? 294 ALA A CA    1 
ATOM   2243 C  C     . ALA A 1 296 ? 30.630  5.725   -7.721  1.00 28.75 ? 294 ALA A C     1 
ATOM   2244 O  O     . ALA A 1 296 ? 31.437  6.640   -7.562  1.00 27.40 ? 294 ALA A O     1 
ATOM   2245 C  CB    . ALA A 1 296 ? 28.566  6.093   -9.086  1.00 32.11 ? 294 ALA A CB    1 
ATOM   2246 N  N     . ALA A 1 297 ? 30.299  4.875   -6.751  1.00 26.42 ? 295 ALA A N     1 
ATOM   2247 C  CA    . ALA A 1 297 ? 30.848  4.996   -5.397  1.00 23.91 ? 295 ALA A CA    1 
ATOM   2248 C  C     . ALA A 1 297 ? 32.365  4.840   -5.346  1.00 25.13 ? 295 ALA A C     1 
ATOM   2249 O  O     . ALA A 1 297 ? 33.048  5.595   -4.649  1.00 22.80 ? 295 ALA A O     1 
ATOM   2250 C  CB    . ALA A 1 297 ? 30.186  3.980   -4.471  1.00 21.70 ? 295 ALA A CB    1 
ATOM   2251 N  N     . GLY A 1 298 ? 32.890  3.862   -6.079  1.00 24.67 ? 296 GLY A N     1 
ATOM   2252 C  CA    . GLY A 1 298 ? 34.328  3.640   -6.101  1.00 27.35 ? 296 GLY A CA    1 
ATOM   2253 C  C     . GLY A 1 298 ? 35.088  4.847   -6.621  1.00 27.92 ? 296 GLY A C     1 
ATOM   2254 O  O     . GLY A 1 298 ? 36.263  5.037   -6.301  1.00 30.58 ? 296 GLY A O     1 
ATOM   2255 N  N     . LYS A 1 299 ? 34.420  5.665   -7.425  1.00 27.05 ? 297 LYS A N     1 
ATOM   2256 C  CA    . LYS A 1 299 ? 35.030  6.869   -7.976  1.00 27.51 ? 297 LYS A CA    1 
ATOM   2257 C  C     . LYS A 1 299 ? 34.804  8.031   -7.013  1.00 25.59 ? 297 LYS A C     1 
ATOM   2258 O  O     . LYS A 1 299 ? 35.715  8.815   -6.738  1.00 23.34 ? 297 LYS A O     1 
ATOM   2259 C  CB    . LYS A 1 299 ? 34.412  7.202   -9.335  1.00 30.55 ? 297 LYS A CB    1 
ATOM   2260 C  CG    . LYS A 1 299 ? 34.591  6.114   -10.383 1.00 34.15 ? 297 LYS A CG    1 
ATOM   2261 C  CD    . LYS A 1 299 ? 33.826  6.447   -11.659 1.00 37.17 ? 297 LYS A CD    1 
ATOM   2262 C  CE    . LYS A 1 299 ? 34.311  7.745   -12.285 1.00 39.06 ? 297 LYS A CE    1 
ATOM   2263 N  NZ    . LYS A 1 299 ? 33.493  8.128   -13.472 1.00 39.40 ? 297 LYS A NZ    1 
ATOM   2264 N  N     . LEU A 1 300 ? 33.581  8.137   -6.502  1.00 23.00 ? 298 LEU A N     1 
ATOM   2265 C  CA    . LEU A 1 300 ? 33.239  9.197   -5.567  1.00 20.74 ? 298 LEU A CA    1 
ATOM   2266 C  C     . LEU A 1 300 ? 34.120  9.135   -4.325  1.00 19.20 ? 298 LEU A C     1 
ATOM   2267 O  O     . LEU A 1 300 ? 34.479  10.170  -3.755  1.00 18.66 ? 298 LEU A O     1 
ATOM   2268 C  CB    . LEU A 1 300 ? 31.759  9.101   -5.174  1.00 21.51 ? 298 LEU A CB    1 
ATOM   2269 C  CG    . LEU A 1 300 ? 30.772  9.531   -6.268  1.00 21.51 ? 298 LEU A CG    1 
ATOM   2270 C  CD1   . LEU A 1 300 ? 29.344  9.224   -5.845  1.00 20.27 ? 298 LEU A CD1   1 
ATOM   2271 C  CD2   . LEU A 1 300 ? 30.934  11.019  -6.540  1.00 21.84 ? 298 LEU A CD2   1 
ATOM   2272 N  N     . LYS A 1 301 ? 34.464  7.921   -3.906  1.00 18.31 ? 299 LYS A N     1 
ATOM   2273 C  CA    . LYS A 1 301 ? 35.314  7.726   -2.731  1.00 19.09 ? 299 LYS A CA    1 
ATOM   2274 C  C     . LYS A 1 301 ? 36.622  8.506   -2.882  1.00 18.98 ? 299 LYS A C     1 
ATOM   2275 O  O     . LYS A 1 301 ? 37.173  9.011   -1.899  1.00 17.84 ? 299 LYS A O     1 
ATOM   2276 C  CB    . LYS A 1 301 ? 35.616  6.230   -2.561  1.00 23.84 ? 299 LYS A CB    1 
ATOM   2277 C  CG    . LYS A 1 301 ? 36.848  5.915   -1.718  1.00 30.30 ? 299 LYS A CG    1 
ATOM   2278 C  CD    . LYS A 1 301 ? 37.304  4.466   -1.911  1.00 34.03 ? 299 LYS A CD    1 
ATOM   2279 C  CE    . LYS A 1 301 ? 38.613  4.193   -1.171  1.00 37.09 ? 299 LYS A CE    1 
ATOM   2280 N  NZ    . LYS A 1 301 ? 39.141  2.817   -1.407  1.00 38.96 ? 299 LYS A NZ    1 
ATOM   2281 N  N     . ASN A 1 302 ? 37.104  8.616   -4.119  1.00 18.59 ? 300 ASN A N     1 
ATOM   2282 C  CA    . ASN A 1 302 ? 38.360  9.307   -4.403  1.00 17.36 ? 300 ASN A CA    1 
ATOM   2283 C  C     . ASN A 1 302 ? 38.244  10.825  -4.406  1.00 17.18 ? 300 ASN A C     1 
ATOM   2284 O  O     . ASN A 1 302 ? 39.242  11.517  -4.581  1.00 16.55 ? 300 ASN A O     1 
ATOM   2285 C  CB    . ASN A 1 302 ? 38.928  8.865   -5.759  1.00 19.99 ? 300 ASN A CB    1 
ATOM   2286 C  CG    . ASN A 1 302 ? 39.352  7.410   -5.776  1.00 22.24 ? 300 ASN A CG    1 
ATOM   2287 O  OD1   . ASN A 1 302 ? 39.641  6.820   -4.736  1.00 23.24 ? 300 ASN A OD1   1 
ATOM   2288 N  ND2   . ASN A 1 302 ? 39.416  6.830   -6.970  1.00 23.23 ? 300 ASN A ND2   1 
ATOM   2289 N  N     . GLN A 1 303 ? 37.032  11.336  -4.214  1.00 15.65 ? 301 GLN A N     1 
ATOM   2290 C  CA    . GLN A 1 303 ? 36.800  12.774  -4.228  1.00 17.44 ? 301 GLN A CA    1 
ATOM   2291 C  C     . GLN A 1 303 ? 36.239  13.238  -2.895  1.00 16.98 ? 301 GLN A C     1 
ATOM   2292 O  O     . GLN A 1 303 ? 35.557  14.254  -2.812  1.00 18.69 ? 301 GLN A O     1 
ATOM   2293 C  CB    . GLN A 1 303 ? 35.842  13.110  -5.372  1.00 16.58 ? 301 GLN A CB    1 
ATOM   2294 C  CG    . GLN A 1 303 ? 36.309  12.475  -6.685  1.00 20.43 ? 301 GLN A CG    1 
ATOM   2295 C  CD    . GLN A 1 303 ? 35.260  12.481  -7.773  1.00 23.55 ? 301 GLN A CD    1 
ATOM   2296 O  OE1   . GLN A 1 303 ? 34.065  12.364  -7.505  1.00 27.63 ? 301 GLN A OE1   1 
ATOM   2297 N  NE2   . GLN A 1 303 ? 35.707  12.596  -9.021  1.00 28.96 ? 301 GLN A NE2   1 
ATOM   2298 N  N     . VAL A 1 304 ? 36.521  12.459  -1.859  1.00 15.85 ? 302 VAL A N     1 
ATOM   2299 C  CA    . VAL A 1 304 ? 36.084  12.775  -0.510  1.00 15.70 ? 302 VAL A CA    1 
ATOM   2300 C  C     . VAL A 1 304 ? 37.264  13.382  0.222   1.00 15.74 ? 302 VAL A C     1 
ATOM   2301 O  O     . VAL A 1 304 ? 38.367  12.831  0.200   1.00 17.75 ? 302 VAL A O     1 
ATOM   2302 C  CB    . VAL A 1 304 ? 35.650  11.512  0.258   1.00 15.32 ? 302 VAL A CB    1 
ATOM   2303 C  CG1   . VAL A 1 304 ? 35.400  11.862  1.733   1.00 14.79 ? 302 VAL A CG1   1 
ATOM   2304 C  CG2   . VAL A 1 304 ? 34.394  10.924  -0.380  1.00 15.35 ? 302 VAL A CG2   1 
ATOM   2305 N  N     . SER A 1 305 ? 37.034  14.526  0.855   1.00 15.42 ? 303 SER A N     1 
ATOM   2306 C  CA    . SER A 1 305 ? 38.083  15.187  1.615   1.00 17.23 ? 303 SER A CA    1 
ATOM   2307 C  C     . SER A 1 305 ? 37.969  14.807  3.079   1.00 17.86 ? 303 SER A C     1 
ATOM   2308 O  O     . SER A 1 305 ? 36.870  14.743  3.629   1.00 17.55 ? 303 SER A O     1 
ATOM   2309 C  CB    . SER A 1 305 ? 37.971  16.707  1.503   1.00 18.12 ? 303 SER A CB    1 
ATOM   2310 O  OG    . SER A 1 305 ? 38.850  17.326  2.432   1.00 20.41 ? 303 SER A OG    1 
ATOM   2311 N  N     . ILE A 1 306 ? 39.110  14.542  3.701   1.00 19.12 ? 304 ILE A N     1 
ATOM   2312 C  CA    . ILE A 1 306 ? 39.135  14.209  5.115   1.00 23.14 ? 304 ILE A CA    1 
ATOM   2313 C  C     . ILE A 1 306 ? 40.239  15.017  5.757   1.00 24.52 ? 304 ILE A C     1 
ATOM   2314 O  O     . ILE A 1 306 ? 41.404  14.929  5.360   1.00 25.87 ? 304 ILE A O     1 
ATOM   2315 C  CB    . ILE A 1 306 ? 39.391  12.716  5.366   1.00 23.53 ? 304 ILE A CB    1 
ATOM   2316 C  CG1   . ILE A 1 306 ? 38.163  11.904  4.943   1.00 26.04 ? 304 ILE A CG1   1 
ATOM   2317 C  CG2   . ILE A 1 306 ? 39.692  12.485  6.850   1.00 26.47 ? 304 ILE A CG2   1 
ATOM   2318 C  CD1   . ILE A 1 306 ? 38.204  10.453  5.364   1.00 27.73 ? 304 ILE A CD1   1 
ATOM   2319 N  N     . ILE A 1 307 ? 39.854  15.812  6.745   1.00 24.98 ? 305 ILE A N     1 
ATOM   2320 C  CA    . ILE A 1 307 ? 40.784  16.659  7.461   1.00 27.82 ? 305 ILE A CA    1 
ATOM   2321 C  C     . ILE A 1 307 ? 40.689  16.366  8.946   1.00 27.05 ? 305 ILE A C     1 
ATOM   2322 O  O     . ILE A 1 307 ? 39.598  16.267  9.507   1.00 26.92 ? 305 ILE A O     1 
ATOM   2323 C  CB    . ILE A 1 307 ? 40.454  18.141  7.233   1.00 28.49 ? 305 ILE A CB    1 
ATOM   2324 C  CG1   . ILE A 1 307 ? 40.545  18.460  5.738   1.00 30.26 ? 305 ILE A CG1   1 
ATOM   2325 C  CG2   . ILE A 1 307 ? 41.400  19.023  8.039   1.00 32.49 ? 305 ILE A CG2   1 
ATOM   2326 C  CD1   . ILE A 1 307 ? 40.091  19.862  5.380   1.00 32.33 ? 305 ILE A CD1   1 
ATOM   2327 N  N     . GLN A 1 308 ? 41.842  16.229  9.579   1.00 26.60 ? 306 GLN A N     1 
ATOM   2328 C  CA    . GLN A 1 308 ? 41.884  15.969  11.003  1.00 26.27 ? 306 GLN A CA    1 
ATOM   2329 C  C     . GLN A 1 308 ? 41.691  17.308  11.711  1.00 26.72 ? 306 GLN A C     1 
ATOM   2330 O  O     . GLN A 1 308 ? 42.334  18.304  11.359  1.00 26.00 ? 306 GLN A O     1 
ATOM   2331 C  CB    . GLN A 1 308 ? 43.235  15.359  11.367  1.00 29.48 ? 306 GLN A CB    1 
ATOM   2332 C  CG    . GLN A 1 308 ? 43.182  14.363  12.502  1.00 34.53 ? 306 GLN A CG    1 
ATOM   2333 C  CD    . GLN A 1 308 ? 44.559  13.885  12.913  1.00 35.27 ? 306 GLN A CD    1 
ATOM   2334 O  OE1   . GLN A 1 308 ? 45.315  13.352  12.100  1.00 37.54 ? 306 GLN A OE1   1 
ATOM   2335 N  NE2   . GLN A 1 308 ? 44.892  14.077  14.182  1.00 36.61 ? 306 GLN A NE2   1 
ATOM   2336 N  N     . LEU A 1 309 ? 40.789  17.336  12.688  1.00 24.57 ? 307 LEU A N     1 
ATOM   2337 C  CA    . LEU A 1 309 ? 40.513  18.550  13.452  1.00 24.88 ? 307 LEU A CA    1 
ATOM   2338 C  C     . LEU A 1 309 ? 41.397  18.531  14.692  1.00 27.96 ? 307 LEU A C     1 
ATOM   2339 O  O     . LEU A 1 309 ? 41.303  17.614  15.510  1.00 26.71 ? 307 LEU A O     1 
ATOM   2340 C  CB    . LEU A 1 309 ? 39.037  18.600  13.862  1.00 24.53 ? 307 LEU A CB    1 
ATOM   2341 C  CG    . LEU A 1 309 ? 38.007  18.585  12.727  1.00 25.41 ? 307 LEU A CG    1 
ATOM   2342 C  CD1   . LEU A 1 309 ? 36.597  18.516  13.307  1.00 25.14 ? 307 LEU A CD1   1 
ATOM   2343 C  CD2   . LEU A 1 309 ? 38.173  19.832  11.862  1.00 25.21 ? 307 LEU A CD2   1 
ATOM   2344 N  N     . GLU A 1 310 ? 42.259  19.535  14.824  1.00 29.19 ? 308 GLU A N     1 
ATOM   2345 C  CA    . GLU A 1 310 ? 43.171  19.620  15.963  1.00 34.62 ? 308 GLU A CA    1 
ATOM   2346 C  C     . GLU A 1 310 ? 42.518  20.217  17.203  1.00 35.81 ? 308 GLU A C     1 
ATOM   2347 O  O     . GLU A 1 310 ? 41.374  20.708  17.100  1.00 38.07 ? 308 GLU A O     1 
ATOM   2348 C  CB    . GLU A 1 310 ? 44.402  20.452  15.596  1.00 36.82 ? 308 GLU A CB    1 
ATOM   2349 C  CG    . GLU A 1 310 ? 45.698  19.661  15.551  1.00 42.13 ? 308 GLU A CG    1 
ATOM   2350 C  CD    . GLU A 1 310 ? 45.760  18.700  14.383  1.00 44.37 ? 308 GLU A CD    1 
ATOM   2351 O  OE1   . GLU A 1 310 ? 45.782  19.172  13.228  1.00 46.23 ? 308 GLU A OE1   1 
ATOM   2352 O  OE2   . GLU A 1 310 ? 45.788  17.474  14.619  1.00 46.72 ? 308 GLU A OE2   1 
HETATM 2353 P  PG    . ATP B 2 .   ? 18.802  7.541   6.866   1.00 33.13 ? 900 ATP A PG    1 
HETATM 2354 O  O1G   . ATP B 2 .   ? 18.246  7.445   8.260   1.00 38.76 ? 900 ATP A O1G   1 
HETATM 2355 O  O2G   . ATP B 2 .   ? 19.266  6.200   6.344   1.00 40.11 ? 900 ATP A O2G   1 
HETATM 2356 O  O3G   . ATP B 2 .   ? 17.789  8.192   5.918   1.00 39.20 ? 900 ATP A O3G   1 
HETATM 2357 P  PB    . ATP B 2 .   ? 20.510  9.583   8.136   1.00 22.80 ? 900 ATP A PB    1 
HETATM 2358 O  O1B   . ATP B 2 .   ? 19.588  10.789  8.122   1.00 21.87 ? 900 ATP A O1B   1 
HETATM 2359 O  O2B   . ATP B 2 .   ? 20.703  8.776   9.369   1.00 21.89 ? 900 ATP A O2B   1 
HETATM 2360 O  O3B   . ATP B 2 .   ? 20.104  8.485   7.016   1.00 27.63 ? 900 ATP A O3B   1 
HETATM 2361 P  PA    . ATP B 2 .   ? 22.446  11.488  7.011   1.00 22.86 ? 900 ATP A PA    1 
HETATM 2362 O  O1A   . ATP B 2 .   ? 21.342  12.138  6.227   1.00 22.24 ? 900 ATP A O1A   1 
HETATM 2363 O  O2A   . ATP B 2 .   ? 23.119  12.237  8.106   1.00 23.68 ? 900 ATP A O2A   1 
HETATM 2364 O  O3A   . ATP B 2 .   ? 21.955  10.031  7.581   1.00 17.98 ? 900 ATP A O3A   1 
HETATM 2365 O  "O5'" . ATP B 2 .   ? 23.735  10.508  6.127   1.00 27.67 ? 900 ATP A "O5'" 1 
HETATM 2366 C  "C5'" . ATP B 2 .   ? 24.375  9.450   5.510   1.00 23.75 ? 900 ATP A "C5'" 1 
HETATM 2367 C  "C4'" . ATP B 2 .   ? 25.674  9.964   4.945   1.00 22.13 ? 900 ATP A "C4'" 1 
HETATM 2368 O  "O4'" . ATP B 2 .   ? 25.265  10.030  3.577   1.00 20.67 ? 900 ATP A "O4'" 1 
HETATM 2369 C  "C3'" . ATP B 2 .   ? 26.110  11.428  5.187   1.00 20.33 ? 900 ATP A "C3'" 1 
HETATM 2370 O  "O3'" . ATP B 2 .   ? 26.968  11.583  6.312   1.00 20.23 ? 900 ATP A "O3'" 1 
HETATM 2371 C  "C2'" . ATP B 2 .   ? 26.751  11.767  3.896   1.00 19.47 ? 900 ATP A "C2'" 1 
HETATM 2372 O  "O2'" . ATP B 2 .   ? 28.097  11.291  3.821   1.00 21.71 ? 900 ATP A "O2'" 1 
HETATM 2373 C  "C1'" . ATP B 2 .   ? 25.878  11.102  2.884   1.00 19.95 ? 900 ATP A "C1'" 1 
HETATM 2374 N  N9    . ATP B 2 .   ? 24.899  12.115  2.365   1.00 21.05 ? 900 ATP A N9    1 
HETATM 2375 C  C8    . ATP B 2 .   ? 23.634  12.420  2.795   1.00 21.72 ? 900 ATP A C8    1 
HETATM 2376 N  N7    . ATP B 2 .   ? 23.081  13.407  2.049   1.00 21.20 ? 900 ATP A N7    1 
HETATM 2377 C  C5    . ATP B 2 .   ? 23.988  13.755  1.121   1.00 21.18 ? 900 ATP A C5    1 
HETATM 2378 C  C6    . ATP B 2 .   ? 24.087  14.726  -0.006  1.00 22.83 ? 900 ATP A C6    1 
HETATM 2379 N  N6    . ATP B 2 .   ? 23.062  15.543  -0.277  1.00 23.24 ? 900 ATP A N6    1 
HETATM 2380 N  N1    . ATP B 2 .   ? 25.255  14.764  -0.753  1.00 21.93 ? 900 ATP A N1    1 
HETATM 2381 C  C2    . ATP B 2 .   ? 26.334  13.945  -0.513  1.00 22.38 ? 900 ATP A C2    1 
HETATM 2382 N  N3    . ATP B 2 .   ? 26.310  13.030  0.504   1.00 21.69 ? 900 ATP A N3    1 
HETATM 2383 C  C4    . ATP B 2 .   ? 25.188  12.900  1.328   1.00 21.89 ? 900 ATP A C4    1 
HETATM 2384 MG MG    . MG  C 3 .   ? 19.159  12.329  6.694   1.00 40.70 ? 1   MG  A MG    1 
HETATM 2385 MG MG    . MG  D 3 .   ? 19.641  7.103   10.014  1.00 24.05 ? 319 MG  A MG    1 
HETATM 2386 MG MG    . MG  E 3 .   ? 13.537  -0.373  11.129  1.00 27.11 ? 320 MG  A MG    1 
HETATM 2387 C  C1    . GOL F 4 .   ? 13.142  1.736   6.937   1.00 54.02 ? 501 GOL A C1    1 
HETATM 2388 O  O1    . GOL F 4 .   ? 13.285  0.622   7.816   1.00 54.62 ? 501 GOL A O1    1 
HETATM 2389 C  C2    . GOL F 4 .   ? 12.772  1.233   5.547   1.00 54.30 ? 501 GOL A C2    1 
HETATM 2390 O  O2    . GOL F 4 .   ? 11.549  0.491   5.616   1.00 53.77 ? 501 GOL A O2    1 
HETATM 2391 C  C3    . GOL F 4 .   ? 12.624  2.425   4.595   1.00 53.94 ? 501 GOL A C3    1 
HETATM 2392 O  O3    . GOL F 4 .   ? 12.290  1.967   3.285   1.00 54.48 ? 501 GOL A O3    1 
HETATM 2393 O  O     . HOH G 5 .   ? 30.365  10.799  6.020   1.00 46.63 ? 321 HOH A O     1 
HETATM 2394 O  O     . HOH G 5 .   ? 36.224  7.503   19.512  1.00 20.79 ? 322 HOH A O     1 
HETATM 2395 O  O     . HOH G 5 .   ? 39.274  10.707  -1.338  1.00 21.71 ? 323 HOH A O     1 
HETATM 2396 O  O     . HOH G 5 .   ? 18.588  -8.219  9.851   1.00 18.93 ? 324 HOH A O     1 
HETATM 2397 O  O     . HOH G 5 .   ? 7.082   -6.314  13.498  1.00 22.61 ? 325 HOH A O     1 
HETATM 2398 O  O     . HOH G 5 .   ? 7.255   -12.314 6.607   1.00 22.02 ? 326 HOH A O     1 
HETATM 2399 O  O     . HOH G 5 .   ? 38.620  8.782   20.182  1.00 21.19 ? 327 HOH A O     1 
HETATM 2400 O  O     . HOH G 5 .   ? 38.490  11.447  19.285  1.00 21.38 ? 328 HOH A O     1 
HETATM 2401 O  O     . HOH G 5 .   ? 25.574  -14.302 24.680  1.00 25.30 ? 329 HOH A O     1 
HETATM 2402 O  O     . HOH G 5 .   ? 9.158   -8.018  14.270  1.00 24.06 ? 330 HOH A O     1 
HETATM 2403 O  O     . HOH G 5 .   ? 38.633  4.942   19.566  1.00 22.95 ? 331 HOH A O     1 
HETATM 2404 O  O     . HOH G 5 .   ? 16.842  -14.298 13.788  1.00 22.96 ? 332 HOH A O     1 
HETATM 2405 O  O     . HOH G 5 .   ? 14.954  -10.261 22.201  1.00 23.82 ? 333 HOH A O     1 
HETATM 2406 O  O     . HOH G 5 .   ? 42.693  7.145   2.908   1.00 29.72 ? 334 HOH A O     1 
HETATM 2407 O  O     . HOH G 5 .   ? 15.535  -15.818 0.595   1.00 23.01 ? 335 HOH A O     1 
HETATM 2408 O  O     . HOH G 5 .   ? 26.561  -13.283 2.736   1.00 21.78 ? 336 HOH A O     1 
HETATM 2409 O  O     . HOH G 5 .   ? 28.524  11.281  1.192   1.00 21.15 ? 337 HOH A O     1 
HETATM 2410 O  O     . HOH G 5 .   ? 32.304  -10.789 6.882   1.00 21.18 ? 338 HOH A O     1 
HETATM 2411 O  O     . HOH G 5 .   ? 23.727  -11.940 2.939   1.00 25.06 ? 339 HOH A O     1 
HETATM 2412 O  O     . HOH G 5 .   ? 43.612  6.269   8.726   1.00 22.55 ? 340 HOH A O     1 
HETATM 2413 O  O     . HOH G 5 .   ? 14.116  -2.829  13.163  1.00 25.98 ? 341 HOH A O     1 
HETATM 2414 O  O     . HOH G 5 .   ? 42.319  14.971  15.445  1.00 26.66 ? 342 HOH A O     1 
HETATM 2415 O  O     . HOH G 5 .   ? 7.014   -6.522  10.681  1.00 23.44 ? 343 HOH A O     1 
HETATM 2416 O  O     . HOH G 5 .   ? 29.354  -16.777 13.782  1.00 23.57 ? 344 HOH A O     1 
HETATM 2417 O  O     . HOH G 5 .   ? 38.938  -3.089  11.414  1.00 25.19 ? 345 HOH A O     1 
HETATM 2418 O  O     . HOH G 5 .   ? 25.839  -15.722 5.030   1.00 27.23 ? 346 HOH A O     1 
HETATM 2419 O  O     . HOH G 5 .   ? 11.350  -1.153  29.844  1.00 28.02 ? 347 HOH A O     1 
HETATM 2420 O  O     . HOH G 5 .   ? 0.347   0.023   11.665  1.00 29.41 ? 348 HOH A O     1 
HETATM 2421 O  O     . HOH G 5 .   ? 42.022  7.458   14.225  1.00 25.00 ? 349 HOH A O     1 
HETATM 2422 O  O     . HOH G 5 .   ? 26.316  16.752  -2.285  1.00 25.89 ? 350 HOH A O     1 
HETATM 2423 O  O     . HOH G 5 .   ? 42.208  21.973  13.003  1.00 30.74 ? 351 HOH A O     1 
HETATM 2424 O  O     . HOH G 5 .   ? 19.562  -17.536 3.680   1.00 32.02 ? 352 HOH A O     1 
HETATM 2425 O  O     . HOH G 5 .   ? 21.774  -1.289  -5.634  1.00 28.12 ? 353 HOH A O     1 
HETATM 2426 O  O     . HOH G 5 .   ? 40.331  -0.774  10.591  1.00 27.41 ? 354 HOH A O     1 
HETATM 2427 O  O     . HOH G 5 .   ? 31.337  -13.851 1.367   1.00 26.82 ? 355 HOH A O     1 
HETATM 2428 O  O     . HOH G 5 .   ? 42.682  3.199   11.652  1.00 25.82 ? 356 HOH A O     1 
HETATM 2429 O  O     . HOH G 5 .   ? 27.591  -6.206  -6.173  1.00 27.54 ? 357 HOH A O     1 
HETATM 2430 O  O     . HOH G 5 .   ? 9.872   -17.330 -1.192  1.00 28.49 ? 358 HOH A O     1 
HETATM 2431 O  O     . HOH G 5 .   ? 6.207   -7.739  22.602  1.00 35.05 ? 359 HOH A O     1 
HETATM 2432 O  O     . HOH G 5 .   ? 21.763  14.289  9.128   1.00 24.73 ? 360 HOH A O     1 
HETATM 2433 O  O     . HOH G 5 .   ? 31.577  17.333  7.820   1.00 23.04 ? 361 HOH A O     1 
HETATM 2434 O  O     . HOH G 5 .   ? 13.109  9.574   -5.468  1.00 31.38 ? 362 HOH A O     1 
HETATM 2435 O  O     . HOH G 5 .   ? 22.670  5.945   15.479  1.00 28.02 ? 363 HOH A O     1 
HETATM 2436 O  O     . HOH G 5 .   ? 12.893  6.578   22.135  1.00 28.19 ? 364 HOH A O     1 
HETATM 2437 O  O     . HOH G 5 .   ? 11.972  -19.720 8.106   1.00 28.36 ? 365 HOH A O     1 
HETATM 2438 O  O     . HOH G 5 .   ? 11.126  0.280   13.354  1.00 32.97 ? 366 HOH A O     1 
HETATM 2439 O  O     . HOH G 5 .   ? 36.083  -1.510  18.760  1.00 26.41 ? 367 HOH A O     1 
HETATM 2440 O  O     . HOH G 5 .   ? 38.116  11.656  23.526  1.00 31.49 ? 368 HOH A O     1 
HETATM 2441 O  O     . HOH G 5 .   ? 22.331  -6.538  -2.195  1.00 23.81 ? 369 HOH A O     1 
HETATM 2442 O  O     . HOH G 5 .   ? 17.763  10.348  18.830  1.00 29.19 ? 370 HOH A O     1 
HETATM 2443 O  O     . HOH G 5 .   ? 44.589  6.449   14.491  1.00 29.47 ? 371 HOH A O     1 
HETATM 2444 O  O     . HOH G 5 .   ? 33.935  -10.425 8.911   1.00 31.33 ? 372 HOH A O     1 
HETATM 2445 O  O     . HOH G 5 .   ? 16.500  -3.665  14.870  1.00 23.30 ? 373 HOH A O     1 
HETATM 2446 O  O     . HOH G 5 .   ? 25.779  14.398  -9.489  1.00 37.36 ? 374 HOH A O     1 
HETATM 2447 O  O     . HOH G 5 .   ? 30.151  18.703  -0.357  1.00 31.36 ? 375 HOH A O     1 
HETATM 2448 O  O     . HOH G 5 .   ? -0.024  9.316   -11.500 1.00 34.25 ? 376 HOH A O     1 
HETATM 2449 O  O     . HOH G 5 .   ? 33.658  -16.634 20.821  1.00 29.18 ? 377 HOH A O     1 
HETATM 2450 O  O     . HOH G 5 .   ? 20.908  14.784  3.164   1.00 29.29 ? 378 HOH A O     1 
HETATM 2451 O  O     . HOH G 5 .   ? 44.132  8.463   10.427  1.00 34.02 ? 379 HOH A O     1 
HETATM 2452 O  O     . HOH G 5 .   ? 18.355  5.640   10.855  1.00 26.20 ? 380 HOH A O     1 
HETATM 2453 O  O     . HOH G 5 .   ? 36.984  8.001   29.939  1.00 27.61 ? 381 HOH A O     1 
HETATM 2454 O  O     . HOH G 5 .   ? 5.286   -16.397 24.158  1.00 32.11 ? 382 HOH A O     1 
HETATM 2455 O  O     . HOH G 5 .   ? 32.767  11.101  -9.697  1.00 41.08 ? 383 HOH A O     1 
HETATM 2456 O  O     . HOH G 5 .   ? 20.982  1.838   9.736   1.00 28.77 ? 384 HOH A O     1 
HETATM 2457 O  O     . HOH G 5 .   ? 22.595  -19.806 9.603   1.00 40.87 ? 385 HOH A O     1 
HETATM 2458 O  O     . HOH G 5 .   ? 37.774  -2.284  13.837  1.00 44.41 ? 386 HOH A O     1 
HETATM 2459 O  O     . HOH G 5 .   ? 26.315  -18.107 10.725  1.00 41.45 ? 387 HOH A O     1 
HETATM 2460 O  O     . HOH G 5 .   ? 40.089  1.329   12.411  1.00 30.18 ? 388 HOH A O     1 
HETATM 2461 O  O     . HOH G 5 .   ? 14.959  -9.096  24.744  1.00 27.17 ? 389 HOH A O     1 
HETATM 2462 O  O     . HOH G 5 .   ? 18.180  -15.160 0.387   1.00 29.78 ? 390 HOH A O     1 
HETATM 2463 O  O     . HOH G 5 .   ? 40.624  6.740   -2.252  1.00 36.04 ? 391 HOH A O     1 
HETATM 2464 O  O     . HOH G 5 .   ? 21.130  -16.341 25.449  1.00 34.00 ? 392 HOH A O     1 
HETATM 2465 O  O     . HOH G 5 .   ? 9.948   10.950  -6.555  1.00 43.53 ? 393 HOH A O     1 
HETATM 2466 O  O     . HOH G 5 .   ? 17.935  5.379   27.604  1.00 31.49 ? 394 HOH A O     1 
HETATM 2467 O  O     . HOH G 5 .   ? 10.209  -5.194  -7.471  1.00 32.63 ? 395 HOH A O     1 
HETATM 2468 O  O     . HOH G 5 .   ? 15.930  3.179   17.265  1.00 30.89 ? 396 HOH A O     1 
HETATM 2469 O  O     . HOH G 5 .   ? 6.798   1.060   14.534  1.00 34.02 ? 397 HOH A O     1 
HETATM 2470 O  O     . HOH G 5 .   ? 4.134   -2.633  -11.830 1.00 43.44 ? 398 HOH A O     1 
HETATM 2471 O  O     . HOH G 5 .   ? 27.575  -11.242 0.712   1.00 32.12 ? 399 HOH A O     1 
HETATM 2472 O  O     . HOH G 5 .   ? 10.176  0.844   27.289  1.00 39.10 ? 400 HOH A O     1 
HETATM 2473 O  O     . HOH G 5 .   ? 26.005  -1.210  -8.135  1.00 29.19 ? 401 HOH A O     1 
HETATM 2474 O  O     . HOH G 5 .   ? 34.380  -9.825  11.823  1.00 38.11 ? 402 HOH A O     1 
HETATM 2475 O  O     . HOH G 5 .   ? 27.484  18.094  -0.387  1.00 31.85 ? 403 HOH A O     1 
HETATM 2476 O  O     . HOH G 5 .   ? 12.593  -7.240  29.499  1.00 35.72 ? 404 HOH A O     1 
HETATM 2477 O  O     . HOH G 5 .   ? 19.124  -20.428 14.556  1.00 36.91 ? 405 HOH A O     1 
HETATM 2478 O  O     . HOH G 5 .   ? 9.438   -8.434  27.882  1.00 33.48 ? 406 HOH A O     1 
HETATM 2479 O  O     . HOH G 5 .   ? 23.316  17.498  -2.424  1.00 29.77 ? 407 HOH A O     1 
HETATM 2480 O  O     . HOH G 5 .   ? 7.175   -6.480  20.537  1.00 34.53 ? 408 HOH A O     1 
HETATM 2481 O  O     . HOH G 5 .   ? 32.954  14.590  -7.700  1.00 32.73 ? 409 HOH A O     1 
HETATM 2482 O  O     . HOH G 5 .   ? -0.136  -10.959 4.693   1.00 43.86 ? 410 HOH A O     1 
HETATM 2483 O  O     . HOH G 5 .   ? 25.400  -12.400 -0.754  1.00 35.31 ? 411 HOH A O     1 
HETATM 2484 O  O     . HOH G 5 .   ? 24.390  -17.550 6.400   1.00 37.19 ? 412 HOH A O     1 
HETATM 2485 O  O     . HOH G 5 .   ? 1.520   -1.211  -10.300 1.00 32.89 ? 413 HOH A O     1 
HETATM 2486 O  O     . HOH G 5 .   ? 30.606  17.216  27.182  1.00 50.16 ? 414 HOH A O     1 
HETATM 2487 O  O     . HOH G 5 .   ? 15.086  -17.395 7.755   1.00 30.01 ? 415 HOH A O     1 
HETATM 2488 O  O     . HOH G 5 .   ? 20.412  -14.666 -4.028  1.00 47.35 ? 416 HOH A O     1 
HETATM 2489 O  O     . HOH G 5 .   ? 35.348  -4.006  21.441  1.00 39.81 ? 417 HOH A O     1 
HETATM 2490 O  O     . HOH G 5 .   ? 34.917  -8.814  16.553  1.00 36.06 ? 418 HOH A O     1 
HETATM 2491 O  O     . HOH G 5 .   ? 6.178   -5.697  26.266  1.00 31.51 ? 419 HOH A O     1 
HETATM 2492 O  O     . HOH G 5 .   ? 26.805  24.123  -3.447  1.00 44.16 ? 420 HOH A O     1 
HETATM 2493 O  O     . HOH G 5 .   ? 44.752  -1.361  8.044   1.00 31.29 ? 421 HOH A O     1 
HETATM 2494 O  O     . HOH G 5 .   ? 16.602  -16.345 26.298  1.00 32.15 ? 422 HOH A O     1 
HETATM 2495 O  O     . HOH G 5 .   ? 13.318  -14.067 -5.537  1.00 32.74 ? 423 HOH A O     1 
HETATM 2496 O  O     . HOH G 5 .   ? 0.598   -8.046  16.689  1.00 37.27 ? 424 HOH A O     1 
HETATM 2497 O  O     . HOH G 5 .   ? 20.161  -2.306  0.846   1.00 27.54 ? 425 HOH A O     1 
HETATM 2498 O  O     . HOH G 5 .   ? 42.284  14.953  18.118  1.00 39.05 ? 426 HOH A O     1 
HETATM 2499 O  O     . HOH G 5 .   ? 37.291  19.362  6.607   1.00 47.18 ? 427 HOH A O     1 
HETATM 2500 O  O     . HOH G 5 .   ? 18.740  5.595   13.910  1.00 25.40 ? 428 HOH A O     1 
HETATM 2501 O  O     . HOH G 5 .   ? 20.712  -10.330 28.846  1.00 41.81 ? 429 HOH A O     1 
HETATM 2502 O  O     . HOH G 5 .   ? 21.579  8.953   26.940  1.00 47.09 ? 430 HOH A O     1 
HETATM 2503 O  O     . HOH G 5 .   ? 22.571  22.758  36.699  1.00 34.49 ? 431 HOH A O     1 
HETATM 2504 O  O     . HOH G 5 .   ? 5.051   -19.234 6.993   1.00 39.35 ? 432 HOH A O     1 
HETATM 2505 O  O     . HOH G 5 .   ? -1.566  -11.898 8.673   1.00 44.97 ? 433 HOH A O     1 
HETATM 2506 O  O     . HOH G 5 .   ? 23.226  18.570  16.147  1.00 48.94 ? 434 HOH A O     1 
HETATM 2507 O  O     . HOH G 5 .   ? 29.129  2.983   24.412  1.00 30.39 ? 435 HOH A O     1 
HETATM 2508 O  O     . HOH G 5 .   ? 39.433  13.643  20.863  1.00 29.11 ? 436 HOH A O     1 
HETATM 2509 O  O     . HOH G 5 .   ? 13.834  1.323   -2.024  1.00 39.96 ? 437 HOH A O     1 
HETATM 2510 O  O     . HOH G 5 .   ? 6.245   -11.222 29.288  1.00 48.14 ? 438 HOH A O     1 
HETATM 2511 O  O     . HOH G 5 .   ? 30.094  14.776  -7.871  1.00 36.86 ? 439 HOH A O     1 
HETATM 2512 O  O     . HOH G 5 .   ? 4.093   -13.152 24.735  1.00 39.76 ? 440 HOH A O     1 
HETATM 2513 O  O     . HOH G 5 .   ? -0.351  16.567  -1.295  1.00 31.74 ? 441 HOH A O     1 
HETATM 2514 O  O     . HOH G 5 .   ? 12.558  -9.847  27.228  1.00 40.01 ? 442 HOH A O     1 
HETATM 2515 O  O     . HOH G 5 .   ? 29.260  -20.448 20.144  1.00 54.17 ? 443 HOH A O     1 
HETATM 2516 O  O     . HOH G 5 .   ? 1.900   -3.744  11.301  1.00 36.30 ? 444 HOH A O     1 
HETATM 2517 O  O     . HOH G 5 .   ? 37.369  17.353  5.027   1.00 29.13 ? 445 HOH A O     1 
HETATM 2518 O  O     . HOH G 5 .   ? 2.147   -6.493  11.046  1.00 47.07 ? 446 HOH A O     1 
HETATM 2519 O  O     . HOH G 5 .   ? 31.667  19.446  9.195   1.00 42.32 ? 447 HOH A O     1 
HETATM 2520 O  O     . HOH G 5 .   ? 18.733  -3.034  35.888  1.00 52.32 ? 448 HOH A O     1 
HETATM 2521 O  O     . HOH G 5 .   ? 44.735  22.381  19.595  1.00 51.28 ? 449 HOH A O     1 
HETATM 2522 O  O     . HOH G 5 .   ? 5.092   -17.675 16.967  1.00 41.01 ? 450 HOH A O     1 
HETATM 2523 O  O     . HOH G 5 .   ? 2.740   -8.689  2.008   1.00 43.98 ? 451 HOH A O     1 
HETATM 2524 O  O     . HOH G 5 .   ? 25.445  7.319   -8.309  1.00 31.94 ? 452 HOH A O     1 
HETATM 2525 O  O     . HOH G 5 .   ? 44.671  19.071  10.372  1.00 40.04 ? 453 HOH A O     1 
HETATM 2526 O  O     . HOH G 5 .   ? 44.699  9.331   5.432   1.00 48.50 ? 454 HOH A O     1 
HETATM 2527 O  O     . HOH G 5 .   ? 44.561  16.394  8.423   1.00 41.01 ? 455 HOH A O     1 
HETATM 2528 O  O     . HOH G 5 .   ? 16.620  -19.974 19.465  1.00 36.72 ? 456 HOH A O     1 
HETATM 2529 O  O     . HOH G 5 .   ? 26.940  0.705   31.891  1.00 44.73 ? 457 HOH A O     1 
HETATM 2530 O  O     . HOH G 5 .   ? 20.849  12.358  -9.169  1.00 51.20 ? 458 HOH A O     1 
HETATM 2531 O  O     . HOH G 5 .   ? 10.432  1.458   19.395  1.00 38.31 ? 459 HOH A O     1 
HETATM 2532 O  O     . HOH G 5 .   ? 18.412  -19.848 7.389   1.00 54.16 ? 460 HOH A O     1 
HETATM 2533 O  O     . HOH G 5 .   ? 43.591  13.516  5.089   1.00 45.44 ? 461 HOH A O     1 
HETATM 2534 O  O     . HOH G 5 .   ? 37.499  5.817   22.203  1.00 38.61 ? 462 HOH A O     1 
HETATM 2535 O  O     . HOH G 5 .   ? 13.342  -6.845  -4.871  1.00 43.98 ? 463 HOH A O     1 
HETATM 2536 O  O     . HOH G 5 .   ? 31.026  24.148  24.648  1.00 43.34 ? 464 HOH A O     1 
HETATM 2537 O  O     . HOH G 5 .   ? -3.546  10.116  -11.302 1.00 43.97 ? 465 HOH A O     1 
HETATM 2538 O  O     . HOH G 5 .   ? 31.704  22.472  17.159  1.00 37.57 ? 466 HOH A O     1 
HETATM 2539 O  O     . HOH G 5 .   ? 18.104  -1.682  -3.313  1.00 40.36 ? 467 HOH A O     1 
HETATM 2540 O  O     . HOH G 5 .   ? 10.667  -19.228 14.162  1.00 38.26 ? 468 HOH A O     1 
HETATM 2541 O  O     . HOH G 5 .   ? 32.869  0.658   24.171  1.00 36.12 ? 469 HOH A O     1 
HETATM 2542 O  O     . HOH G 5 .   ? 14.826  9.914   -11.535 1.00 51.86 ? 470 HOH A O     1 
HETATM 2543 O  O     . HOH G 5 .   ? 43.039  -1.624  11.290  1.00 51.19 ? 471 HOH A O     1 
HETATM 2544 O  O     . HOH G 5 .   ? 15.209  13.499  -0.482  1.00 48.22 ? 472 HOH A O     1 
HETATM 2545 O  O     . HOH G 5 .   ? 21.196  20.755  12.032  1.00 55.04 ? 473 HOH A O     1 
HETATM 2546 O  O     . HOH G 5 .   ? -8.798  12.789  -8.588  1.00 48.47 ? 474 HOH A O     1 
HETATM 2547 O  O     . HOH G 5 .   ? 0.114   -18.503 10.903  1.00 49.37 ? 475 HOH A O     1 
HETATM 2548 O  O     . HOH G 5 .   ? 12.398  -16.985 -4.807  1.00 47.66 ? 476 HOH A O     1 
HETATM 2549 O  O     . HOH G 5 .   ? 16.093  10.160  6.456   1.00 37.99 ? 477 HOH A O     1 
HETATM 2550 O  O     . HOH G 5 .   ? 1.503   -8.200  -1.471  1.00 48.67 ? 478 HOH A O     1 
HETATM 2551 O  O     . HOH G 5 .   ? 46.799  -5.943  10.159  1.00 47.41 ? 479 HOH A O     1 
HETATM 2552 O  O     . HOH G 5 .   ? 20.319  -13.315 27.426  1.00 33.62 ? 480 HOH A O     1 
HETATM 2553 O  O     . HOH G 5 .   ? 39.854  22.320  15.456  1.00 39.56 ? 481 HOH A O     1 
HETATM 2554 O  O     . HOH G 5 .   ? 21.954  17.087  28.974  1.00 44.95 ? 482 HOH A O     1 
HETATM 2555 O  O     . HOH G 5 .   ? 9.555   7.914   -16.634 1.00 56.30 ? 483 HOH A O     1 
HETATM 2556 O  O     . HOH G 5 .   ? 9.142   10.542  3.369   1.00 56.67 ? 484 HOH A O     1 
HETATM 2557 O  O     . HOH G 5 .   ? 38.389  6.249   26.703  1.00 47.44 ? 485 HOH A O     1 
HETATM 2558 O  O     . HOH G 5 .   ? 45.025  17.601  18.310  1.00 46.73 ? 486 HOH A O     1 
HETATM 2559 O  O     . HOH G 5 .   ? 0.220   -3.225  13.983  1.00 47.71 ? 487 HOH A O     1 
HETATM 2560 O  O     . HOH G 5 .   ? 24.434  20.581  23.793  1.00 43.10 ? 488 HOH A O     1 
HETATM 2561 O  O     . HOH G 5 .   ? 17.735  -18.976 4.673   1.00 53.62 ? 489 HOH A O     1 
HETATM 2562 O  O     . HOH G 5 .   ? 16.546  9.945   9.418   1.00 36.17 ? 490 HOH A O     1 
HETATM 2563 O  O     . HOH G 5 .   ? 23.838  -9.228  7.466   1.00 32.52 ? 491 HOH A O     1 
HETATM 2564 O  O     . HOH G 5 .   ? 32.779  -16.591 13.171  1.00 34.51 ? 492 HOH A O     1 
HETATM 2565 O  O     . HOH G 5 .   ? 38.321  -14.414 24.296  1.00 51.82 ? 493 HOH A O     1 
HETATM 2566 O  O     . HOH G 5 .   ? 37.499  -10.711 13.380  1.00 44.49 ? 494 HOH A O     1 
HETATM 2567 O  O     . HOH G 5 .   ? 3.466   -1.497  -14.420 1.00 42.15 ? 495 HOH A O     1 
HETATM 2568 O  O     . HOH G 5 .   ? 29.216  23.699  17.589  1.00 52.32 ? 496 HOH A O     1 
HETATM 2569 O  O     . HOH G 5 .   ? 26.552  19.298  32.368  1.00 59.37 ? 497 HOH A O     1 
HETATM 2570 O  O     . HOH G 5 .   ? 16.214  12.428  11.580  1.00 38.51 ? 498 HOH A O     1 
HETATM 2571 O  O     . HOH G 5 .   ? 30.936  -7.824  22.683  1.00 34.82 ? 499 HOH A O     1 
HETATM 2572 O  O     . HOH G 5 .   ? 20.813  7.168   11.673  1.00 17.45 ? 500 HOH A O     1 
HETATM 2573 O  O     . HOH G 5 .   ? 20.840  5.606   9.296   1.00 19.88 ? 502 HOH A O     1 
HETATM 2574 O  O     . HOH G 5 .   ? 18.198  8.403   10.883  1.00 26.90 ? 503 HOH A O     1 
HETATM 2575 O  O     . HOH G 5 .   ? 18.836  11.046  5.078   1.00 29.18 ? 504 HOH A O     1 
HETATM 2576 O  O     . HOH G 5 .   ? 19.511  14.036  5.488   1.00 36.59 ? 505 HOH A O     1 
HETATM 2577 O  O     . HOH G 5 .   ? 19.783  -4.735  34.306  1.00 27.00 ? 506 HOH A O     1 
HETATM 2578 O  O     . HOH G 5 .   ? 38.917  9.276   22.793  1.00 28.03 ? 507 HOH A O     1 
HETATM 2579 O  O     . HOH G 5 .   ? 5.694   11.387  -2.834  1.00 36.11 ? 508 HOH A O     1 
HETATM 2580 O  O     . HOH G 5 .   ? 16.596  3.977   14.351  1.00 28.57 ? 509 HOH A O     1 
HETATM 2581 O  O     . HOH G 5 .   ? 21.330  0.631   19.794  1.00 72.71 ? 510 HOH A O     1 
HETATM 2582 O  O     . HOH G 5 .   ? 19.155  -15.975 26.916  1.00 38.92 ? 511 HOH A O     1 
HETATM 2583 O  O     . HOH G 5 .   ? 33.904  -6.941  23.602  1.00 47.20 ? 512 HOH A O     1 
HETATM 2584 O  O     . HOH G 5 .   ? 18.295  -12.057 29.159  1.00 36.57 ? 513 HOH A O     1 
HETATM 2585 O  O     . HOH G 5 .   ? 5.887   12.864  -6.064  1.00 43.22 ? 514 HOH A O     1 
HETATM 2586 O  O     . HOH G 5 .   ? 41.054  5.046   0.692   1.00 37.10 ? 515 HOH A O     1 
HETATM 2587 O  O     . HOH G 5 .   ? 45.550  5.856   6.812   1.00 41.34 ? 516 HOH A O     1 
HETATM 2588 O  O     . HOH G 5 .   ? 44.865  11.390  9.287   1.00 49.00 ? 517 HOH A O     1 
HETATM 2589 O  O     . HOH G 5 .   ? 14.378  -1.287  24.414  1.00 62.92 ? 518 HOH A O     1 
HETATM 2590 O  O     . HOH G 5 .   ? 12.422  -17.452 -2.186  1.00 39.34 ? 519 HOH A O     1 
HETATM 2591 O  O     . HOH G 5 .   ? 7.350   -6.954  28.241  1.00 41.95 ? 520 HOH A O     1 
HETATM 2592 O  O     . HOH G 5 .   ? 25.640  6.211   -10.719 1.00 40.86 ? 521 HOH A O     1 
HETATM 2593 O  O     . HOH G 5 .   ? 21.881  -1.376  -1.173  1.00 41.85 ? 522 HOH A O     1 
HETATM 2594 O  O     . HOH G 5 .   ? 10.164  -19.399 0.647   1.00 45.63 ? 523 HOH A O     1 
HETATM 2595 O  O     . HOH G 5 .   ? 40.995  -4.576  12.260  1.00 46.77 ? 524 HOH A O     1 
HETATM 2596 O  O     . HOH G 5 .   ? 31.270  -1.008  23.657  1.00 67.27 ? 525 HOH A O     1 
HETATM 2597 O  O     . HOH G 5 .   ? 13.030  9.555   3.943   1.00 62.27 ? 526 HOH A O     1 
HETATM 2598 O  O     . HOH G 5 .   ? 21.654  -18.876 4.912   1.00 54.45 ? 527 HOH A O     1 
HETATM 2599 O  O     . HOH G 5 .   ? 15.795  11.911  17.613  1.00 50.89 ? 528 HOH A O     1 
HETATM 2600 O  O     . HOH G 5 .   ? 14.727  -18.246 -0.309  1.00 46.88 ? 529 HOH A O     1 
HETATM 2601 O  O     . HOH G 5 .   ? 1.712   -4.386  17.275  1.00 47.51 ? 530 HOH A O     1 
HETATM 2602 O  O     . HOH G 5 .   ? 28.671  25.920  -3.380  1.00 58.39 ? 531 HOH A O     1 
HETATM 2603 O  O     . HOH G 5 .   ? 9.156   -21.227 8.473   1.00 53.16 ? 532 HOH A O     1 
HETATM 2604 O  O     . HOH G 5 .   ? 16.538  4.420   8.611   1.00 44.61 ? 533 HOH A O     1 
HETATM 2605 O  O     . HOH G 5 .   ? 11.617  -19.544 23.794  1.00 49.08 ? 534 HOH A O     1 
HETATM 2606 O  O     . HOH G 5 .   ? 19.113  -21.151 18.645  1.00 55.59 ? 535 HOH A O     1 
HETATM 2607 O  O     . HOH G 5 .   ? 1.645   -6.200  6.248   1.00 46.65 ? 536 HOH A O     1 
HETATM 2608 O  O     . HOH G 5 .   ? 20.636  17.109  6.475   1.00 42.82 ? 537 HOH A O     1 
HETATM 2609 O  O     . HOH G 5 .   ? 11.710  4.516   -11.941 1.00 51.10 ? 538 HOH A O     1 
HETATM 2610 O  O     . HOH G 5 .   ? 37.353  -4.661  15.567  1.00 48.37 ? 539 HOH A O     1 
HETATM 2611 O  O     . HOH G 5 .   ? 28.407  -18.127 20.190  1.00 48.27 ? 540 HOH A O     1 
HETATM 2612 O  O     . HOH G 5 .   ? 27.613  -16.000 1.839   1.00 49.01 ? 541 HOH A O     1 
HETATM 2613 O  O     . HOH G 5 .   ? 15.719  6.639   11.297  1.00 42.56 ? 542 HOH A O     1 
HETATM 2614 O  O     . HOH G 5 .   ? 45.213  13.119  18.859  1.00 45.85 ? 543 HOH A O     1 
HETATM 2615 O  O     . HOH G 5 .   ? 5.248   -16.994 19.373  1.00 54.98 ? 544 HOH A O     1 
HETATM 2616 O  O     . HOH G 5 .   ? 28.883  -13.423 0.467   1.00 37.38 ? 545 HOH A O     1 
HETATM 2617 O  O     . HOH G 5 .   ? 24.644  22.214  21.915  1.00 56.71 ? 546 HOH A O     1 
HETATM 2618 O  O     . HOH G 5 .   ? 2.244   -20.313 7.741   1.00 48.82 ? 547 HOH A O     1 
HETATM 2619 O  O     . HOH G 5 .   ? 24.766  19.763  -1.504  1.00 48.94 ? 548 HOH A O     1 
HETATM 2620 O  O     . HOH G 5 .   ? 7.534   -19.322 17.841  1.00 55.87 ? 549 HOH A O     1 
HETATM 2621 O  O     . HOH G 5 .   ? 20.635  -2.277  -3.242  1.00 39.52 ? 550 HOH A O     1 
HETATM 2622 O  O     . HOH G 5 .   ? 8.267   -17.760 -3.174  1.00 45.05 ? 551 HOH A O     1 
HETATM 2623 O  O     . HOH G 5 .   ? 37.199  -3.697  18.099  1.00 48.56 ? 552 HOH A O     1 
HETATM 2624 O  O     . HOH G 5 .   ? 29.841  17.256  29.753  1.00 49.50 ? 553 HOH A O     1 
HETATM 2625 O  O     . HOH G 5 .   ? 29.930  20.692  11.379  1.00 43.37 ? 554 HOH A O     1 
HETATM 2626 O  O     . HOH G 5 .   ? 17.265  -1.828  -6.802  1.00 53.23 ? 555 HOH A O     1 
HETATM 2627 O  O     . HOH G 5 .   ? 28.251  3.509   -12.883 1.00 58.65 ? 556 HOH A O     1 
HETATM 2628 O  O     . HOH G 5 .   ? 16.586  4.095   -7.072  1.00 53.61 ? 557 HOH A O     1 
HETATM 2629 O  O     . HOH G 5 .   ? 17.678  5.931   -9.529  1.00 45.38 ? 558 HOH A O     1 
HETATM 2630 O  O     . HOH G 5 .   ? 0.343   -13.250 2.267   1.00 49.07 ? 559 HOH A O     1 
HETATM 2631 O  O     . HOH G 5 .   ? 42.316  1.237   14.550  1.00 51.84 ? 560 HOH A O     1 
HETATM 2632 O  O     . HOH G 5 .   ? 23.285  -7.398  -4.401  1.00 46.56 ? 561 HOH A O     1 
HETATM 2633 O  O     . HOH G 5 .   ? 14.994  -20.921 17.744  1.00 45.06 ? 562 HOH A O     1 
HETATM 2634 O  O     . HOH G 5 .   ? 10.480  -7.905  31.011  1.00 49.71 ? 563 HOH A O     1 
HETATM 2635 O  O     . HOH G 5 .   ? 3.896   -7.941  24.447  1.00 43.33 ? 564 HOH A O     1 
HETATM 2636 O  O     . HOH G 5 .   ? 30.508  20.976  -0.990  1.00 54.62 ? 565 HOH A O     1 
HETATM 2637 O  O     . HOH G 5 .   ? 21.671  19.789  23.612  1.00 40.41 ? 566 HOH A O     1 
HETATM 2638 O  O     . HOH G 5 .   ? 13.998  8.265   -13.346 1.00 55.81 ? 567 HOH A O     1 
HETATM 2639 O  O     . HOH G 5 .   ? 29.333  21.934  29.796  1.00 61.48 ? 568 HOH A O     1 
HETATM 2640 O  O     . HOH G 5 .   ? 18.182  5.139   -3.993  1.00 55.00 ? 569 HOH A O     1 
HETATM 2641 O  O     . HOH G 5 .   ? 17.557  -2.854  0.741   1.00 43.27 ? 570 HOH A O     1 
HETATM 2642 O  O     . HOH G 5 .   ? 23.399  23.671  24.490  1.00 51.74 ? 571 HOH A O     1 
HETATM 2643 O  O     . HOH G 5 .   ? 9.292   -0.495  20.991  1.00 41.91 ? 572 HOH A O     1 
HETATM 2644 O  O     . HOH G 5 .   ? -1.271  9.130   -18.753 1.00 57.66 ? 573 HOH A O     1 
HETATM 2645 O  O     . HOH G 5 .   ? 31.035  20.702  6.129   1.00 55.60 ? 574 HOH A O     1 
HETATM 2646 O  O     . HOH G 5 .   ? 30.877  26.742  24.344  1.00 44.77 ? 575 HOH A O     1 
HETATM 2647 O  O     . HOH G 5 .   ? 2.667   -11.856 22.389  1.00 55.71 ? 576 HOH A O     1 
HETATM 2648 O  O     . HOH G 5 .   ? 32.789  -5.512  21.457  1.00 40.35 ? 577 HOH A O     1 
HETATM 2649 O  O     . HOH G 5 .   ? 35.915  -7.041  14.329  1.00 53.12 ? 578 HOH A O     1 
HETATM 2650 O  O     . HOH G 5 .   ? 6.247   -20.139 9.178   1.00 48.93 ? 579 HOH A O     1 
HETATM 2651 O  O     . HOH G 5 .   ? 15.711  -14.128 -7.117  1.00 43.78 ? 580 HOH A O     1 
HETATM 2652 O  O     . HOH G 5 .   ? 9.710   -5.467  29.565  1.00 45.28 ? 581 HOH A O     1 
HETATM 2653 O  O     . HOH G 5 .   ? 23.891  -21.467 13.129  1.00 51.62 ? 582 HOH A O     1 
HETATM 2654 O  O     . HOH G 5 .   ? 26.409  22.200  -4.956  1.00 54.25 ? 583 HOH A O     1 
HETATM 2655 O  O     . HOH G 5 .   ? 21.411  18.671  -4.876  1.00 56.12 ? 584 HOH A O     1 
HETATM 2656 O  O     . HOH G 5 .   ? 2.548   16.950  -10.367 1.00 59.43 ? 585 HOH A O     1 
HETATM 2657 O  O     . HOH G 5 .   ? 3.525   -14.501 1.031   1.00 31.55 ? 586 HOH A O     1 
HETATM 2658 O  O     . HOH G 5 .   ? 30.453  12.828  3.960   1.00 54.85 ? 587 HOH A O     1 
HETATM 2659 O  O     . HOH G 5 .   ? 3.820   -17.322 3.450   1.00 41.92 ? 588 HOH A O     1 
HETATM 2660 O  O     . HOH G 5 .   ? 26.689  -19.886 5.965   1.00 43.67 ? 589 HOH A O     1 
HETATM 2661 O  O     . HOH G 5 .   ? 30.201  -17.472 10.848  1.00 72.11 ? 590 HOH A O     1 
HETATM 2662 O  O     . HOH G 5 .   ? 4.318   3.375   11.680  1.00 39.18 ? 591 HOH A O     1 
HETATM 2663 O  O     . HOH G 5 .   ? 6.717   3.314   12.258  1.00 55.39 ? 592 HOH A O     1 
HETATM 2664 O  O     . HOH G 5 .   ? 8.472   2.679   10.344  1.00 47.99 ? 593 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   -3  ?   ?   ?   A . n 
A 1 2   SER 2   -2  -2  SER SER A . n 
A 1 3   LEU 3   -1  -1  LEU LEU A . n 
A 1 4   ILE 4   2   2   ILE ILE A . n 
A 1 5   TYR 5   3   3   TYR TYR A . n 
A 1 6   THR 6   4   4   THR THR A . n 
A 1 7   ILE 7   5   5   ILE ILE A . n 
A 1 8   THR 8   6   6   THR THR A . n 
A 1 9   LEU 9   7   7   LEU LEU A . n 
A 1 10  ASN 10  8   8   ASN ASN A . n 
A 1 11  PRO 11  9   9   PRO PRO A . n 
A 1 12  ALA 12  10  10  ALA ALA A . n 
A 1 13  ILE 13  11  11  ILE ILE A . n 
A 1 14  ASP 14  12  12  ASP ASP A . n 
A 1 15  ARG 15  13  13  ARG ARG A . n 
A 1 16  LEU 16  14  14  LEU LEU A . n 
A 1 17  LEU 17  15  15  LEU LEU A . n 
A 1 18  PHE 18  16  16  PHE PHE A . n 
A 1 19  ILE 19  17  17  ILE ILE A . n 
A 1 20  ARG 20  18  18  ARG ARG A . n 
A 1 21  GLY 21  19  19  GLY GLY A . n 
A 1 22  GLU 22  20  20  GLU GLU A . n 
A 1 23  LEU 23  21  21  LEU LEU A . n 
A 1 24  GLU 24  22  22  GLU GLU A . n 
A 1 25  LYS 25  23  23  LYS LYS A . n 
A 1 26  ARG 26  24  24  ARG ARG A . n 
A 1 27  LYS 27  25  25  LYS LYS A . n 
A 1 28  THR 28  26  26  THR THR A . n 
A 1 29  ASN 29  27  27  ASN ASN A . n 
A 1 30  ARG 30  28  28  ARG ARG A . n 
A 1 31  VAL 31  29  29  VAL VAL A . n 
A 1 32  ILE 32  30  30  ILE ILE A . n 
A 1 33  LYS 33  31  31  LYS LYS A . n 
A 1 34  THR 34  32  32  THR THR A . n 
A 1 35  GLU 35  33  33  GLU GLU A . n 
A 1 36  PHE 36  34  34  PHE PHE A . n 
A 1 37  ASP 37  35  35  ASP ASP A . n 
A 1 38  CYS 38  36  36  CYS CYS A . n 
A 1 39  GLY 39  37  37  GLY GLY A . n 
A 1 40  GLY 40  38  38  GLY GLY A . n 
A 1 41  LYS 41  39  39  LYS LYS A . n 
A 1 42  GLY 42  40  40  GLY GLY A . n 
A 1 43  LEU 43  41  41  LEU LEU A . n 
A 1 44  HIS 44  42  42  HIS HIS A . n 
A 1 45  VAL 45  43  43  VAL VAL A . n 
A 1 46  SER 46  44  44  SER SER A . n 
A 1 47  GLY 47  45  45  GLY GLY A . n 
A 1 48  VAL 48  46  46  VAL VAL A . n 
A 1 49  LEU 49  47  47  LEU LEU A . n 
A 1 50  SER 50  48  48  SER SER A . n 
A 1 51  LYS 51  49  49  LYS LYS A . n 
A 1 52  PHE 52  50  50  PHE PHE A . n 
A 1 53  GLY 53  51  51  GLY GLY A . n 
A 1 54  ILE 54  52  52  ILE ILE A . n 
A 1 55  LYS 55  53  53  LYS LYS A . n 
A 1 56  ASN 56  54  54  ASN ASN A . n 
A 1 57  GLU 57  55  55  GLU GLU A . n 
A 1 58  ALA 58  56  56  ALA ALA A . n 
A 1 59  LEU 59  57  57  LEU LEU A . n 
A 1 60  GLY 60  58  58  GLY GLY A . n 
A 1 61  ILE 61  59  59  ILE ILE A . n 
A 1 62  ALA 62  60  60  ALA ALA A . n 
A 1 63  GLY 63  61  61  GLY GLY A . n 
A 1 64  SER 64  62  62  SER SER A . n 
A 1 65  ASP 65  63  63  ASP ASP A . n 
A 1 66  ASN 66  64  64  ASN ASN A . n 
A 1 67  LEU 67  65  65  LEU LEU A . n 
A 1 68  ASP 68  66  66  ASP ASP A . n 
A 1 69  LYS 69  67  67  LYS LYS A . n 
A 1 70  LEU 70  68  68  LEU LEU A . n 
A 1 71  TYR 71  69  69  TYR TYR A . n 
A 1 72  ALA 72  70  70  ALA ALA A . n 
A 1 73  ILE 73  71  71  ILE ILE A . n 
A 1 74  LEU 74  72  72  LEU LEU A . n 
A 1 75  LYS 75  73  73  LYS LYS A . n 
A 1 76  GLU 76  74  74  GLU GLU A . n 
A 1 77  LYS 77  75  75  LYS LYS A . n 
A 1 78  HIS 78  76  76  HIS HIS A . n 
A 1 79  ILE 79  77  77  ILE ILE A . n 
A 1 80  ASN 80  78  78  ASN ASN A . n 
A 1 81  HIS 81  79  79  HIS HIS A . n 
A 1 82  ASP 82  80  80  ASP ASP A . n 
A 1 83  PHE 83  81  81  PHE PHE A . n 
A 1 84  LEU 84  82  82  LEU LEU A . n 
A 1 85  VAL 85  83  83  VAL VAL A . n 
A 1 86  GLU 86  84  84  GLU GLU A . n 
A 1 87  ALA 87  85  85  ALA ALA A . n 
A 1 88  GLY 88  86  86  GLY GLY A . n 
A 1 89  THR 89  87  87  THR THR A . n 
A 1 90  SER 90  88  88  SER SER A . n 
A 1 91  THR 91  89  89  THR THR A . n 
A 1 92  ARG 92  90  90  ARG ARG A . n 
A 1 93  GLU 93  91  91  GLU GLU A . n 
A 1 94  CYS 94  92  92  CYS CYS A . n 
A 1 95  PHE 95  93  93  PHE PHE A . n 
A 1 96  VAL 96  94  94  VAL VAL A . n 
A 1 97  VAL 97  95  95  VAL VAL A . n 
A 1 98  LEU 98  96  96  LEU LEU A . n 
A 1 99  SER 99  97  97  SER SER A . n 
A 1 100 ASP 100 98  98  ASP ASP A . n 
A 1 101 ASP 101 99  99  ASP ASP A . n 
A 1 102 THR 102 100 100 THR THR A . n 
A 1 103 ASN 103 101 101 ASN ASN A . n 
A 1 104 GLY 104 102 102 GLY GLY A . n 
A 1 105 SER 105 103 103 SER SER A . n 
A 1 106 THR 106 104 104 THR THR A . n 
A 1 107 MSE 107 105 105 MSE MSE A . n 
A 1 108 ILE 108 106 106 ILE ILE A . n 
A 1 109 PRO 109 107 107 PRO PRO A . n 
A 1 110 GLU 110 108 108 GLU GLU A . n 
A 1 111 ALA 111 109 109 ALA ALA A . n 
A 1 112 GLY 112 110 110 GLY GLY A . n 
A 1 113 PHE 113 111 111 PHE PHE A . n 
A 1 114 THR 114 112 112 THR THR A . n 
A 1 115 VAL 115 113 113 VAL VAL A . n 
A 1 116 SER 116 114 114 SER SER A . n 
A 1 117 GLN 117 115 115 GLN GLN A . n 
A 1 118 THR 118 116 116 THR THR A . n 
A 1 119 ASN 119 117 117 ASN ASN A . n 
A 1 120 LYS 120 118 118 LYS LYS A . n 
A 1 121 ASP 121 119 119 ASP ASP A . n 
A 1 122 ASN 122 120 120 ASN ASN A . n 
A 1 123 LEU 123 121 121 LEU LEU A . n 
A 1 124 LEU 124 122 122 LEU LEU A . n 
A 1 125 LYS 125 123 123 LYS LYS A . n 
A 1 126 GLN 126 124 124 GLN GLN A . n 
A 1 127 ILE 127 125 125 ILE ILE A . n 
A 1 128 ALA 128 126 126 ALA ALA A . n 
A 1 129 LYS 129 127 127 LYS LYS A . n 
A 1 130 LYS 130 128 128 LYS LYS A . n 
A 1 131 VAL 131 129 129 VAL VAL A . n 
A 1 132 LYS 132 130 130 LYS LYS A . n 
A 1 133 LYS 133 131 131 LYS LYS A . n 
A 1 134 GLU 134 132 132 GLU GLU A . n 
A 1 135 ASP 135 133 133 ASP ASP A . n 
A 1 136 MSE 136 134 134 MSE MSE A . n 
A 1 137 VAL 137 135 135 VAL VAL A . n 
A 1 138 VAL 138 136 136 VAL VAL A . n 
A 1 139 ILE 139 137 137 ILE ILE A . n 
A 1 140 ALA 140 138 138 ALA ALA A . n 
A 1 141 GLY 141 139 139 GLY GLY A . n 
A 1 142 SER 142 140 140 SER SER A . n 
A 1 143 PRO 143 141 141 PRO PRO A . n 
A 1 144 PRO 144 142 142 PRO PRO A . n 
A 1 145 PRO 145 143 143 PRO PRO A . n 
A 1 146 HIS 146 144 144 HIS HIS A . n 
A 1 147 TYR 147 145 145 TYR TYR A . n 
A 1 148 THR 148 146 146 THR THR A . n 
A 1 149 LEU 149 147 147 LEU LEU A . n 
A 1 150 SER 150 148 148 SER SER A . n 
A 1 151 ASP 151 149 149 ASP ASP A . n 
A 1 152 PHE 152 150 150 PHE PHE A . n 
A 1 153 LYS 153 151 151 LYS LYS A . n 
A 1 154 GLU 154 152 152 GLU GLU A . n 
A 1 155 LEU 155 153 153 LEU LEU A . n 
A 1 156 LEU 156 154 154 LEU LEU A . n 
A 1 157 ARG 157 155 155 ARG ARG A . n 
A 1 158 THR 158 156 156 THR THR A . n 
A 1 159 VAL 159 157 157 VAL VAL A . n 
A 1 160 LYS 160 158 158 LYS LYS A . n 
A 1 161 ALA 161 159 159 ALA ALA A . n 
A 1 162 THR 162 160 160 THR THR A . n 
A 1 163 GLY 163 161 161 GLY GLY A . n 
A 1 164 ALA 164 162 162 ALA ALA A . n 
A 1 165 PHE 165 163 163 PHE PHE A . n 
A 1 166 LEU 166 164 164 LEU LEU A . n 
A 1 167 GLY 167 165 165 GLY GLY A . n 
A 1 168 CYS 168 166 166 CYS CYS A . n 
A 1 169 ASP 169 167 167 ASP ASP A . n 
A 1 170 ASN 170 168 168 ASN ASN A . n 
A 1 171 SER 171 169 169 SER SER A . n 
A 1 172 GLY 172 170 170 GLY GLY A . n 
A 1 173 GLU 173 171 171 GLU GLU A . n 
A 1 174 TYR 174 172 172 TYR TYR A . n 
A 1 175 LEU 175 173 173 LEU LEU A . n 
A 1 176 ASN 176 174 174 ASN ASN A . n 
A 1 177 LEU 177 175 175 LEU LEU A . n 
A 1 178 ALA 178 176 176 ALA ALA A . n 
A 1 179 VAL 179 177 177 VAL VAL A . n 
A 1 180 GLU 180 178 178 GLU GLU A . n 
A 1 181 MSE 181 179 179 MSE MSE A . n 
A 1 182 GLY 182 180 180 GLY GLY A . n 
A 1 183 VAL 183 181 181 VAL VAL A . n 
A 1 184 ASP 184 182 182 ASP ASP A . n 
A 1 185 PHE 185 183 183 PHE PHE A . n 
A 1 186 ILE 186 184 184 ILE ILE A . n 
A 1 187 LYS 187 185 185 LYS LYS A . n 
A 1 188 PRO 188 186 186 PRO PRO A . n 
A 1 189 ASN 189 187 187 ASN ASN A . n 
A 1 190 GLU 190 188 188 GLU GLU A . n 
A 1 191 ASP 191 189 189 ASP ASP A . n 
A 1 192 GLU 192 190 190 GLU GLU A . n 
A 1 193 VAL 193 191 191 VAL VAL A . n 
A 1 194 ILE 194 192 192 ILE ILE A . n 
A 1 195 ALA 195 193 193 ALA ALA A . n 
A 1 196 ILE 196 194 194 ILE ILE A . n 
A 1 197 LEU 197 195 195 LEU LEU A . n 
A 1 198 ASP 198 196 196 ASP ASP A . n 
A 1 199 GLU 199 197 197 GLU GLU A . n 
A 1 200 LYS 200 198 198 LYS LYS A . n 
A 1 201 THR 201 199 199 THR THR A . n 
A 1 202 ASN 202 200 200 ASN ASN A . n 
A 1 203 SER 203 201 201 SER SER A . n 
A 1 204 LEU 204 202 202 LEU LEU A . n 
A 1 205 GLU 205 203 203 GLU GLU A . n 
A 1 206 GLU 206 204 204 GLU GLU A . n 
A 1 207 ASN 207 205 205 ASN ASN A . n 
A 1 208 ILE 208 206 206 ILE ILE A . n 
A 1 209 ARG 209 207 207 ARG ARG A . n 
A 1 210 THR 210 208 208 THR THR A . n 
A 1 211 LEU 211 209 209 LEU LEU A . n 
A 1 212 ALA 212 210 210 ALA ALA A . n 
A 1 213 GLU 213 211 211 GLU GLU A . n 
A 1 214 LYS 214 212 212 LYS LYS A . n 
A 1 215 ILE 215 213 213 ILE ILE A . n 
A 1 216 PRO 216 214 214 PRO PRO A . n 
A 1 217 TYR 217 215 215 TYR TYR A . n 
A 1 218 LEU 218 216 216 LEU LEU A . n 
A 1 219 VAL 219 217 217 VAL VAL A . n 
A 1 220 VAL 220 218 218 VAL VAL A . n 
A 1 221 SER 221 219 219 SER SER A . n 
A 1 222 LEU 222 220 220 LEU LEU A . n 
A 1 223 GLY 223 221 221 GLY GLY A . n 
A 1 224 ALA 224 222 222 ALA ALA A . n 
A 1 225 LYS 225 223 223 LYS LYS A . n 
A 1 226 GLY 226 224 224 GLY GLY A . n 
A 1 227 SER 227 225 225 SER SER A . n 
A 1 228 ILE 228 226 226 ILE ILE A . n 
A 1 229 CYS 229 227 227 CYS CYS A . n 
A 1 230 ALA 230 228 228 ALA ALA A . n 
A 1 231 HIS 231 229 229 HIS HIS A . n 
A 1 232 ASN 232 230 230 ASN ASN A . n 
A 1 233 GLY 233 231 231 GLY GLY A . n 
A 1 234 LYS 234 232 232 LYS LYS A . n 
A 1 235 LEU 235 233 233 LEU LEU A . n 
A 1 236 TYR 236 234 234 TYR TYR A . n 
A 1 237 GLN 237 235 235 GLN GLN A . n 
A 1 238 VAL 238 236 236 VAL VAL A . n 
A 1 239 ILE 239 237 237 ILE ILE A . n 
A 1 240 PRO 240 238 238 PRO PRO A . n 
A 1 241 PRO 241 239 239 PRO PRO A . n 
A 1 242 LYS 242 240 240 LYS LYS A . n 
A 1 243 VAL 243 241 241 VAL VAL A . n 
A 1 244 GLN 244 242 242 GLN GLN A . n 
A 1 245 GLU 245 243 243 GLU GLU A . n 
A 1 246 ARG 246 244 244 ARG ARG A . n 
A 1 247 ASN 247 245 245 ASN ASN A . n 
A 1 248 ASP 248 246 246 ASP ASP A . n 
A 1 249 THR 249 247 247 THR THR A . n 
A 1 250 GLY 250 248 248 GLY GLY A . n 
A 1 251 ALA 251 249 249 ALA ALA A . n 
A 1 252 GLY 252 250 250 GLY GLY A . n 
A 1 253 ASP 253 251 251 ASP ASP A . n 
A 1 254 VAL 254 252 252 VAL VAL A . n 
A 1 255 PHE 255 253 253 PHE PHE A . n 
A 1 256 VAL 256 254 254 VAL VAL A . n 
A 1 257 GLY 257 255 255 GLY GLY A . n 
A 1 258 ALA 258 256 256 ALA ALA A . n 
A 1 259 PHE 259 257 257 PHE PHE A . n 
A 1 260 ILE 260 258 258 ILE ILE A . n 
A 1 261 ALA 261 259 259 ALA ALA A . n 
A 1 262 GLY 262 260 260 GLY GLY A . n 
A 1 263 LEU 263 261 261 LEU LEU A . n 
A 1 264 ALA 264 262 262 ALA ALA A . n 
A 1 265 MSE 265 263 263 MSE MSE A . n 
A 1 266 ASN 266 264 264 ASN ASN A . n 
A 1 267 MSE 267 265 265 MSE MSE A . n 
A 1 268 PRO 268 266 266 PRO PRO A . n 
A 1 269 ILE 269 267 267 ILE ILE A . n 
A 1 270 THR 270 268 268 THR THR A . n 
A 1 271 GLU 271 269 269 GLU GLU A . n 
A 1 272 THR 272 270 270 THR THR A . n 
A 1 273 LEU 273 271 271 LEU LEU A . n 
A 1 274 LYS 274 272 272 LYS LYS A . n 
A 1 275 VAL 275 273 273 VAL VAL A . n 
A 1 276 ALA 276 274 274 ALA ALA A . n 
A 1 277 THR 277 275 275 THR THR A . n 
A 1 278 GLY 278 276 276 GLY GLY A . n 
A 1 279 CYS 279 277 277 CYS CYS A . n 
A 1 280 SER 280 278 278 SER SER A . n 
A 1 281 ALA 281 279 279 ALA ALA A . n 
A 1 282 SER 282 280 280 SER SER A . n 
A 1 283 LYS 283 281 281 LYS LYS A . n 
A 1 284 VAL 284 282 282 VAL VAL A . n 
A 1 285 MSE 285 283 283 MSE MSE A . n 
A 1 286 GLN 286 284 284 GLN GLN A . n 
A 1 287 GLN 287 285 285 GLN GLN A . n 
A 1 288 ASP 288 286 286 ASP ASP A . n 
A 1 289 SER 289 287 287 SER SER A . n 
A 1 290 SER 290 288 288 SER SER A . n 
A 1 291 SER 291 289 289 SER SER A . n 
A 1 292 PHE 292 290 290 PHE PHE A . n 
A 1 293 ASP 293 291 291 ASP ASP A . n 
A 1 294 LEU 294 292 292 LEU LEU A . n 
A 1 295 GLU 295 293 293 GLU GLU A . n 
A 1 296 ALA 296 294 294 ALA ALA A . n 
A 1 297 ALA 297 295 295 ALA ALA A . n 
A 1 298 GLY 298 296 296 GLY GLY A . n 
A 1 299 LYS 299 297 297 LYS LYS A . n 
A 1 300 LEU 300 298 298 LEU LEU A . n 
A 1 301 LYS 301 299 299 LYS LYS A . n 
A 1 302 ASN 302 300 300 ASN ASN A . n 
A 1 303 GLN 303 301 301 GLN GLN A . n 
A 1 304 VAL 304 302 302 VAL VAL A . n 
A 1 305 SER 305 303 303 SER SER A . n 
A 1 306 ILE 306 304 304 ILE ILE A . n 
A 1 307 ILE 307 305 305 ILE ILE A . n 
A 1 308 GLN 308 306 306 GLN GLN A . n 
A 1 309 LEU 309 307 307 LEU LEU A . n 
A 1 310 GLU 310 308 308 GLU GLU A . n 
A 1 311 GLU 311 309 ?   ?   ?   A . n 
A 1 312 ARG 312 310 ?   ?   ?   A . n 
A 1 313 GLU 313 311 ?   ?   ?   A . n 
A 1 314 GLY 314 312 ?   ?   ?   A . n 
A 1 315 HIS 315 313 ?   ?   ?   A . n 
A 1 316 HIS 316 314 ?   ?   ?   A . n 
A 1 317 HIS 317 315 ?   ?   ?   A . n 
A 1 318 HIS 318 316 ?   ?   ?   A . n 
A 1 319 HIS 319 317 ?   ?   ?   A . n 
A 1 320 HIS 320 318 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'New York SGX Research Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     NYSGXRC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ATP 1   900 900 ATP ATP A . 
C 3 MG  1   1   1   MG  MG2 A . 
D 3 MG  1   319 2   MG  MG2 A . 
E 3 MG  1   320 3   MG  MG2 A . 
F 4 GOL 1   501 501 GOL GOL A . 
G 5 HOH 1   321 1   HOH TIP A . 
G 5 HOH 2   322 2   HOH TIP A . 
G 5 HOH 3   323 3   HOH TIP A . 
G 5 HOH 4   324 4   HOH TIP A . 
G 5 HOH 5   325 5   HOH TIP A . 
G 5 HOH 6   326 6   HOH TIP A . 
G 5 HOH 7   327 7   HOH TIP A . 
G 5 HOH 8   328 8   HOH TIP A . 
G 5 HOH 9   329 9   HOH TIP A . 
G 5 HOH 10  330 10  HOH TIP A . 
G 5 HOH 11  331 11  HOH TIP A . 
G 5 HOH 12  332 12  HOH TIP A . 
G 5 HOH 13  333 13  HOH TIP A . 
G 5 HOH 14  334 14  HOH TIP A . 
G 5 HOH 15  335 15  HOH TIP A . 
G 5 HOH 16  336 16  HOH TIP A . 
G 5 HOH 17  337 17  HOH TIP A . 
G 5 HOH 18  338 18  HOH TIP A . 
G 5 HOH 19  339 19  HOH TIP A . 
G 5 HOH 20  340 20  HOH TIP A . 
G 5 HOH 21  341 21  HOH TIP A . 
G 5 HOH 22  342 22  HOH TIP A . 
G 5 HOH 23  343 23  HOH TIP A . 
G 5 HOH 24  344 24  HOH TIP A . 
G 5 HOH 25  345 25  HOH TIP A . 
G 5 HOH 26  346 26  HOH TIP A . 
G 5 HOH 27  347 27  HOH TIP A . 
G 5 HOH 28  348 28  HOH TIP A . 
G 5 HOH 29  349 29  HOH TIP A . 
G 5 HOH 30  350 30  HOH TIP A . 
G 5 HOH 31  351 31  HOH TIP A . 
G 5 HOH 32  352 32  HOH TIP A . 
G 5 HOH 33  353 33  HOH TIP A . 
G 5 HOH 34  354 34  HOH TIP A . 
G 5 HOH 35  355 35  HOH TIP A . 
G 5 HOH 36  356 36  HOH TIP A . 
G 5 HOH 37  357 37  HOH TIP A . 
G 5 HOH 38  358 38  HOH TIP A . 
G 5 HOH 39  359 39  HOH TIP A . 
G 5 HOH 40  360 40  HOH TIP A . 
G 5 HOH 41  361 41  HOH TIP A . 
G 5 HOH 42  362 42  HOH TIP A . 
G 5 HOH 43  363 43  HOH TIP A . 
G 5 HOH 44  364 44  HOH TIP A . 
G 5 HOH 45  365 45  HOH TIP A . 
G 5 HOH 46  366 46  HOH TIP A . 
G 5 HOH 47  367 47  HOH TIP A . 
G 5 HOH 48  368 48  HOH TIP A . 
G 5 HOH 49  369 49  HOH TIP A . 
G 5 HOH 50  370 50  HOH TIP A . 
G 5 HOH 51  371 51  HOH TIP A . 
G 5 HOH 52  372 52  HOH TIP A . 
G 5 HOH 53  373 53  HOH TIP A . 
G 5 HOH 54  374 54  HOH TIP A . 
G 5 HOH 55  375 55  HOH TIP A . 
G 5 HOH 56  376 56  HOH TIP A . 
G 5 HOH 57  377 57  HOH TIP A . 
G 5 HOH 58  378 58  HOH TIP A . 
G 5 HOH 59  379 59  HOH TIP A . 
G 5 HOH 60  380 60  HOH TIP A . 
G 5 HOH 61  381 61  HOH TIP A . 
G 5 HOH 62  382 63  HOH TIP A . 
G 5 HOH 63  383 64  HOH TIP A . 
G 5 HOH 64  384 65  HOH TIP A . 
G 5 HOH 65  385 66  HOH TIP A . 
G 5 HOH 66  386 67  HOH TIP A . 
G 5 HOH 67  387 68  HOH TIP A . 
G 5 HOH 68  388 69  HOH TIP A . 
G 5 HOH 69  389 70  HOH TIP A . 
G 5 HOH 70  390 71  HOH TIP A . 
G 5 HOH 71  391 72  HOH TIP A . 
G 5 HOH 72  392 73  HOH TIP A . 
G 5 HOH 73  393 74  HOH TIP A . 
G 5 HOH 74  394 75  HOH TIP A . 
G 5 HOH 75  395 76  HOH TIP A . 
G 5 HOH 76  396 77  HOH TIP A . 
G 5 HOH 77  397 78  HOH TIP A . 
G 5 HOH 78  398 79  HOH TIP A . 
G 5 HOH 79  399 80  HOH TIP A . 
G 5 HOH 80  400 81  HOH TIP A . 
G 5 HOH 81  401 82  HOH TIP A . 
G 5 HOH 82  402 83  HOH TIP A . 
G 5 HOH 83  403 84  HOH TIP A . 
G 5 HOH 84  404 85  HOH TIP A . 
G 5 HOH 85  405 86  HOH TIP A . 
G 5 HOH 86  406 87  HOH TIP A . 
G 5 HOH 87  407 88  HOH TIP A . 
G 5 HOH 88  408 89  HOH TIP A . 
G 5 HOH 89  409 90  HOH TIP A . 
G 5 HOH 90  410 91  HOH TIP A . 
G 5 HOH 91  411 92  HOH TIP A . 
G 5 HOH 92  412 93  HOH TIP A . 
G 5 HOH 93  413 94  HOH TIP A . 
G 5 HOH 94  414 95  HOH TIP A . 
G 5 HOH 95  415 96  HOH TIP A . 
G 5 HOH 96  416 97  HOH TIP A . 
G 5 HOH 97  417 98  HOH TIP A . 
G 5 HOH 98  418 99  HOH TIP A . 
G 5 HOH 99  419 100 HOH TIP A . 
G 5 HOH 100 420 101 HOH TIP A . 
G 5 HOH 101 421 102 HOH TIP A . 
G 5 HOH 102 422 103 HOH TIP A . 
G 5 HOH 103 423 104 HOH TIP A . 
G 5 HOH 104 424 105 HOH TIP A . 
G 5 HOH 105 425 106 HOH TIP A . 
G 5 HOH 106 426 107 HOH TIP A . 
G 5 HOH 107 427 108 HOH TIP A . 
G 5 HOH 108 428 109 HOH TIP A . 
G 5 HOH 109 429 110 HOH TIP A . 
G 5 HOH 110 430 111 HOH TIP A . 
G 5 HOH 111 431 112 HOH TIP A . 
G 5 HOH 112 432 113 HOH TIP A . 
G 5 HOH 113 433 114 HOH TIP A . 
G 5 HOH 114 434 115 HOH TIP A . 
G 5 HOH 115 435 116 HOH TIP A . 
G 5 HOH 116 436 117 HOH TIP A . 
G 5 HOH 117 437 118 HOH TIP A . 
G 5 HOH 118 438 119 HOH TIP A . 
G 5 HOH 119 439 120 HOH TIP A . 
G 5 HOH 120 440 121 HOH TIP A . 
G 5 HOH 121 441 122 HOH TIP A . 
G 5 HOH 122 442 123 HOH TIP A . 
G 5 HOH 123 443 124 HOH TIP A . 
G 5 HOH 124 444 125 HOH TIP A . 
G 5 HOH 125 445 126 HOH TIP A . 
G 5 HOH 126 446 127 HOH TIP A . 
G 5 HOH 127 447 128 HOH TIP A . 
G 5 HOH 128 448 129 HOH TIP A . 
G 5 HOH 129 449 130 HOH TIP A . 
G 5 HOH 130 450 131 HOH TIP A . 
G 5 HOH 131 451 132 HOH TIP A . 
G 5 HOH 132 452 133 HOH TIP A . 
G 5 HOH 133 453 134 HOH TIP A . 
G 5 HOH 134 454 135 HOH TIP A . 
G 5 HOH 135 455 136 HOH TIP A . 
G 5 HOH 136 456 137 HOH TIP A . 
G 5 HOH 137 457 138 HOH TIP A . 
G 5 HOH 138 458 139 HOH TIP A . 
G 5 HOH 139 459 140 HOH TIP A . 
G 5 HOH 140 460 142 HOH TIP A . 
G 5 HOH 141 461 143 HOH TIP A . 
G 5 HOH 142 462 145 HOH TIP A . 
G 5 HOH 143 463 146 HOH TIP A . 
G 5 HOH 144 464 147 HOH TIP A . 
G 5 HOH 145 465 148 HOH TIP A . 
G 5 HOH 146 466 150 HOH TIP A . 
G 5 HOH 147 467 152 HOH TIP A . 
G 5 HOH 148 468 153 HOH TIP A . 
G 5 HOH 149 469 154 HOH TIP A . 
G 5 HOH 150 470 155 HOH TIP A . 
G 5 HOH 151 471 159 HOH TIP A . 
G 5 HOH 152 472 160 HOH TIP A . 
G 5 HOH 153 473 161 HOH TIP A . 
G 5 HOH 154 474 162 HOH TIP A . 
G 5 HOH 155 475 163 HOH TIP A . 
G 5 HOH 156 476 164 HOH TIP A . 
G 5 HOH 157 477 165 HOH TIP A . 
G 5 HOH 158 478 166 HOH TIP A . 
G 5 HOH 159 479 167 HOH TIP A . 
G 5 HOH 160 480 168 HOH TIP A . 
G 5 HOH 161 481 169 HOH TIP A . 
G 5 HOH 162 482 170 HOH TIP A . 
G 5 HOH 163 483 171 HOH TIP A . 
G 5 HOH 164 484 172 HOH TIP A . 
G 5 HOH 165 485 173 HOH TIP A . 
G 5 HOH 166 486 174 HOH TIP A . 
G 5 HOH 167 487 175 HOH TIP A . 
G 5 HOH 168 488 176 HOH TIP A . 
G 5 HOH 169 489 177 HOH TIP A . 
G 5 HOH 170 490 178 HOH TIP A . 
G 5 HOH 171 491 180 HOH TIP A . 
G 5 HOH 172 492 181 HOH TIP A . 
G 5 HOH 173 493 182 HOH TIP A . 
G 5 HOH 174 494 183 HOH TIP A . 
G 5 HOH 175 495 184 HOH TIP A . 
G 5 HOH 176 496 187 HOH TIP A . 
G 5 HOH 177 497 189 HOH TIP A . 
G 5 HOH 178 498 190 HOH TIP A . 
G 5 HOH 179 499 191 HOH TIP A . 
G 5 HOH 180 500 192 HOH TIP A . 
G 5 HOH 181 502 193 HOH TIP A . 
G 5 HOH 182 503 194 HOH TIP A . 
G 5 HOH 183 504 195 HOH TIP A . 
G 5 HOH 184 505 196 HOH TIP A . 
G 5 HOH 185 506 197 HOH TIP A . 
G 5 HOH 186 507 198 HOH TIP A . 
G 5 HOH 187 508 199 HOH TIP A . 
G 5 HOH 188 509 200 HOH TIP A . 
G 5 HOH 189 510 201 HOH TIP A . 
G 5 HOH 190 511 203 HOH TIP A . 
G 5 HOH 191 512 204 HOH TIP A . 
G 5 HOH 192 513 205 HOH TIP A . 
G 5 HOH 193 514 206 HOH TIP A . 
G 5 HOH 194 515 207 HOH TIP A . 
G 5 HOH 195 516 208 HOH TIP A . 
G 5 HOH 196 517 209 HOH TIP A . 
G 5 HOH 197 518 210 HOH TIP A . 
G 5 HOH 198 519 212 HOH TIP A . 
G 5 HOH 199 520 213 HOH TIP A . 
G 5 HOH 200 521 214 HOH TIP A . 
G 5 HOH 201 522 215 HOH TIP A . 
G 5 HOH 202 523 216 HOH TIP A . 
G 5 HOH 203 524 217 HOH TIP A . 
G 5 HOH 204 525 218 HOH TIP A . 
G 5 HOH 205 526 220 HOH TIP A . 
G 5 HOH 206 527 221 HOH TIP A . 
G 5 HOH 207 528 223 HOH TIP A . 
G 5 HOH 208 529 224 HOH TIP A . 
G 5 HOH 209 530 227 HOH TIP A . 
G 5 HOH 210 531 228 HOH TIP A . 
G 5 HOH 211 532 229 HOH TIP A . 
G 5 HOH 212 533 230 HOH TIP A . 
G 5 HOH 213 534 232 HOH TIP A . 
G 5 HOH 214 535 233 HOH TIP A . 
G 5 HOH 215 536 234 HOH TIP A . 
G 5 HOH 216 537 235 HOH TIP A . 
G 5 HOH 217 538 236 HOH TIP A . 
G 5 HOH 218 539 237 HOH TIP A . 
G 5 HOH 219 540 238 HOH TIP A . 
G 5 HOH 220 541 239 HOH TIP A . 
G 5 HOH 221 542 240 HOH TIP A . 
G 5 HOH 222 543 241 HOH TIP A . 
G 5 HOH 223 544 242 HOH TIP A . 
G 5 HOH 224 545 243 HOH TIP A . 
G 5 HOH 225 546 244 HOH TIP A . 
G 5 HOH 226 547 245 HOH TIP A . 
G 5 HOH 227 548 248 HOH TIP A . 
G 5 HOH 228 549 249 HOH TIP A . 
G 5 HOH 229 550 250 HOH TIP A . 
G 5 HOH 230 551 251 HOH TIP A . 
G 5 HOH 231 552 252 HOH TIP A . 
G 5 HOH 232 553 253 HOH TIP A . 
G 5 HOH 233 554 254 HOH TIP A . 
G 5 HOH 234 555 255 HOH TIP A . 
G 5 HOH 235 556 256 HOH TIP A . 
G 5 HOH 236 557 257 HOH TIP A . 
G 5 HOH 237 558 259 HOH TIP A . 
G 5 HOH 238 559 260 HOH TIP A . 
G 5 HOH 239 560 261 HOH TIP A . 
G 5 HOH 240 561 262 HOH TIP A . 
G 5 HOH 241 562 263 HOH TIP A . 
G 5 HOH 242 563 264 HOH TIP A . 
G 5 HOH 243 564 265 HOH TIP A . 
G 5 HOH 244 565 266 HOH TIP A . 
G 5 HOH 245 566 267 HOH TIP A . 
G 5 HOH 246 567 268 HOH TIP A . 
G 5 HOH 247 568 269 HOH TIP A . 
G 5 HOH 248 569 270 HOH TIP A . 
G 5 HOH 249 570 271 HOH TIP A . 
G 5 HOH 250 571 272 HOH TIP A . 
G 5 HOH 251 572 273 HOH TIP A . 
G 5 HOH 252 573 274 HOH TIP A . 
G 5 HOH 253 574 275 HOH TIP A . 
G 5 HOH 254 575 277 HOH TIP A . 
G 5 HOH 255 576 278 HOH TIP A . 
G 5 HOH 256 577 279 HOH TIP A . 
G 5 HOH 257 578 280 HOH TIP A . 
G 5 HOH 258 579 281 HOH TIP A . 
G 5 HOH 259 580 282 HOH TIP A . 
G 5 HOH 260 581 283 HOH TIP A . 
G 5 HOH 261 582 284 HOH TIP A . 
G 5 HOH 262 583 286 HOH TIP A . 
G 5 HOH 263 584 287 HOH TIP A . 
G 5 HOH 264 585 288 HOH TIP A . 
G 5 HOH 265 586 289 HOH TIP A . 
G 5 HOH 266 587 290 HOH TIP A . 
G 5 HOH 267 588 291 HOH TIP A . 
G 5 HOH 268 589 292 HOH TIP A . 
G 5 HOH 269 590 293 HOH TIP A . 
G 5 HOH 270 591 294 HOH TIP A . 
G 5 HOH 271 592 295 HOH TIP A . 
G 5 HOH 272 593 296 HOH TIP A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 107 A MSE 105 ? MET SELENOMETHIONINE 
2 A MSE 136 A MSE 134 ? MET SELENOMETHIONINE 
3 A MSE 181 A MSE 179 ? MET SELENOMETHIONINE 
4 A MSE 265 A MSE 263 ? MET SELENOMETHIONINE 
5 A MSE 267 A MSE 265 ? MET SELENOMETHIONINE 
6 A MSE 285 A MSE 283 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5370  ? 
1 MORE         -73   ? 
1 'SSA (A^2)'  25510 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? G HOH . ? A HOH 504 ? 1_555 MG ? C MG . ? A MG 1   ? 1_555 O   ? G HOH . ? A HOH 505 ? 1_555 94.6  ? 
2  O   ? G HOH . ? A HOH 504 ? 1_555 MG ? C MG . ? A MG 1   ? 1_555 O1B ? B ATP . ? A ATP 900 ? 1_555 96.0  ? 
3  O   ? G HOH . ? A HOH 505 ? 1_555 MG ? C MG . ? A MG 1   ? 1_555 O1B ? B ATP . ? A ATP 900 ? 1_555 157.6 ? 
4  O   ? G HOH . ? A HOH 504 ? 1_555 MG ? C MG . ? A MG 1   ? 1_555 O1A ? B ATP . ? A ATP 900 ? 1_555 86.4  ? 
5  O   ? G HOH . ? A HOH 505 ? 1_555 MG ? C MG . ? A MG 1   ? 1_555 O1A ? B ATP . ? A ATP 900 ? 1_555 77.8  ? 
6  O1B ? B ATP . ? A ATP 900 ? 1_555 MG ? C MG . ? A MG 1   ? 1_555 O1A ? B ATP . ? A ATP 900 ? 1_555 83.3  ? 
7  O   ? G HOH . ? A HOH 380 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O   ? G HOH . ? A HOH 500 ? 1_555 92.8  ? 
8  O   ? G HOH . ? A HOH 380 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O   ? G HOH . ? A HOH 502 ? 1_555 89.4  ? 
9  O   ? G HOH . ? A HOH 500 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O   ? G HOH . ? A HOH 502 ? 1_555 88.4  ? 
10 O   ? G HOH . ? A HOH 380 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O   ? G HOH . ? A HOH 503 ? 1_555 81.3  ? 
11 O   ? G HOH . ? A HOH 500 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O   ? G HOH . ? A HOH 503 ? 1_555 92.2  ? 
12 O   ? G HOH . ? A HOH 502 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O   ? G HOH . ? A HOH 503 ? 1_555 170.7 ? 
13 O   ? G HOH . ? A HOH 380 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O1G ? B ATP . ? A ATP 900 ? 1_555 92.2  ? 
14 O   ? G HOH . ? A HOH 500 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O1G ? B ATP . ? A ATP 900 ? 1_555 169.0 ? 
15 O   ? G HOH . ? A HOH 502 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O1G ? B ATP . ? A ATP 900 ? 1_555 101.5 ? 
16 O   ? G HOH . ? A HOH 503 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O1G ? B ATP . ? A ATP 900 ? 1_555 78.8  ? 
17 O   ? G HOH . ? A HOH 380 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O2B ? B ATP . ? A ATP 900 ? 1_555 170.1 ? 
18 O   ? G HOH . ? A HOH 500 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O2B ? B ATP . ? A ATP 900 ? 1_555 86.2  ? 
19 O   ? G HOH . ? A HOH 502 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O2B ? B ATP . ? A ATP 900 ? 1_555 100.4 ? 
20 O   ? G HOH . ? A HOH 503 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O2B ? B ATP . ? A ATP 900 ? 1_555 88.9  ? 
21 O1G ? B ATP . ? A ATP 900 ? 1_555 MG ? D MG . ? A MG 319 ? 1_555 O2B ? B ATP . ? A ATP 900 ? 1_555 87.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-08-04 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-02-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' audit_author           
2 3 'Structure model' citation_author        
3 3 'Structure model' pdbx_struct_conn_angle 
4 3 'Structure model' struct_conn            
5 3 'Structure model' struct_ref_seq_dif     
6 3 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_audit_author.identifier_ORCID'              
2  3 'Structure model' '_citation_author.identifier_ORCID'           
3  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
9  3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
15 3 'Structure model' '_pdbx_struct_conn_angle.value'               
16 3 'Structure model' '_struct_conn.pdbx_dist_value'                
17 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
18 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
19 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
21 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
24 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
25 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
26 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
27 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
28 3 'Structure model' '_struct_ref_seq_dif.details'                 
29 3 'Structure model' '_struct_site.pdbx_auth_asym_id'              
30 3 'Structure model' '_struct_site.pdbx_auth_comp_id'              
31 3 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS    'data collection' .   ? 1 
MOLREP   phasing           .   ? 2 
CNS      refinement        1.1 ? 3 
DENZO    'data reduction'  .   ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 80  ? ? -152.40 63.95   
2 1 ASN A 245 ? ? -160.38 108.46  
3 1 ASP A 286 ? ? -68.44  -166.87 
4 1 SER A 288 ? ? -154.04 -29.21  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE -3  ? A MSE 1   
2  1 Y 1 A GLU 309 ? A GLU 311 
3  1 Y 1 A ARG 310 ? A ARG 312 
4  1 Y 1 A GLU 311 ? A GLU 313 
5  1 Y 1 A GLY 312 ? A GLY 314 
6  1 Y 1 A HIS 313 ? A HIS 315 
7  1 Y 1 A HIS 314 ? A HIS 316 
8  1 Y 1 A HIS 315 ? A HIS 317 
9  1 Y 1 A HIS 316 ? A HIS 318 
10 1 Y 1 A HIS 317 ? A HIS 319 
11 1 Y 1 A HIS 318 ? A HIS 320 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
3 'MAGNESIUM ION'             MG  
4 GLYCEROL                    GOL 
5 water                       HOH 
#