data_3IFS
# 
_entry.id   3IFS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3IFS         
RCSB  RCSB054355   
WWPDB D_1000054355 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          idp01650 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3IFS 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Minasov, G.'                                                   1 
'Wawrzak, Z.'                                                   2 
'Onopriyenko, O.'                                               3 
'Gordon, E.'                                                    4 
'Peterson, S.N.'                                                5 
'Savchenko, A.'                                                 6 
'Anderson, W.F.'                                                7 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 8 
# 
_citation.id                        primary 
_citation.title                     
'2.0 Angstrom Resolution Crystal Structure of Glucose-6-phosphate Isomerase (pgi) from Bacillus anthracis.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Minasov, G.'                                                   1 
primary 'Wawrzak, Z.'                                                   2 
primary 'Onopriyenko, O.'                                               3 
primary 'Gordon, E.'                                                    4 
primary 'Peterson, S.N.'                                                5 
primary 'Savchenko, A.'                                                 6 
primary 'Anderson, W.F.'                                                7 
primary 'Center for Structural Genomics of Infectious Diseases (CSGID)' 8 
# 
_cell.entry_id           3IFS 
_cell.length_a           111.802 
_cell.length_b           303.640 
_cell.length_c           72.087 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3IFS 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase' 51096.043 6    5.3.1.9 ? ? ? 
2 non-polymer syn 'SULFATE ION'                   96.063    4    ?       ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                  35.453    1    ?       ? ? ? 
4 non-polymer syn 'TRIETHYLENE GLYCOL'            150.173   1    ?       ? ? ? 
5 non-polymer syn 'LITHIUM ION'                   6.941     1    ?       ? ? ? 
6 water       nat water                           18.015    2356 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;SNA(MSE)STHVTFDYSKALSFIGEHEITYLRDAVKVTHHAIHEKTGAGNDFLGWVDLPLQYDKEEFARIQKCAEKIKND
SDILLVVGIGGSYLGARAAIE(MSE)LNHSFYNTLSKEQRKTPQVLFVGQNISSTY(MSE)KDL(MSE)DVLEGKDFSIN
VISKSGTTTEPALAFRIFRKLLEEKYGKEEARKRIYATTDKARGALKTLADNEGYETFVIPDDVGGRFSVLTPVGLLPIA
VSGLNIEE(MSE)(MSE)KGAAAGRDDFGTSELEENPAYQYAVVRNALYNKGKTIE(MSE)LINYEPALQYFAEWWKQLF
GESEGKDQKGIFPSSANFSTDLHSLGQYVQEGRRDLFETVLKVGKSTHELTIESEENDLDGLNYLAGETVDFVNTKAYEG
TLLAHSDGGVPNLIVNIPELNEYTFGYLVYFFEKACA(MSE)SGYLLGVNPFDQPGVEAYKKN(MSE)FALLGKPGFEEL
KAELEERLK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNAMSTHVTFDYSKALSFIGEHEITYLRDAVKVTHHAIHEKTGAGNDFLGWVDLPLQYDKEEFARIQKCAEKIKNDSDIL
LVVGIGGSYLGARAAIEMLNHSFYNTLSKEQRKTPQVLFVGQNISSTYMKDLMDVLEGKDFSINVISKSGTTTEPALAFR
IFRKLLEEKYGKEEARKRIYATTDKARGALKTLADNEGYETFVIPDDVGGRFSVLTPVGLLPIAVSGLNIEEMMKGAAAG
RDDFGTSELEENPAYQYAVVRNALYNKGKTIEMLINYEPALQYFAEWWKQLFGESEGKDQKGIFPSSANFSTDLHSLGQY
VQEGRRDLFETVLKVGKSTHELTIESEENDLDGLNYLAGETVDFVNTKAYEGTLLAHSDGGVPNLIVNIPELNEYTFGYL
VYFFEKACAMSGYLLGVNPFDQPGVEAYKKNMFALLGKPGFEELKAELEERLK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         idp01650 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   MSE n 
1 5   SER n 
1 6   THR n 
1 7   HIS n 
1 8   VAL n 
1 9   THR n 
1 10  PHE n 
1 11  ASP n 
1 12  TYR n 
1 13  SER n 
1 14  LYS n 
1 15  ALA n 
1 16  LEU n 
1 17  SER n 
1 18  PHE n 
1 19  ILE n 
1 20  GLY n 
1 21  GLU n 
1 22  HIS n 
1 23  GLU n 
1 24  ILE n 
1 25  THR n 
1 26  TYR n 
1 27  LEU n 
1 28  ARG n 
1 29  ASP n 
1 30  ALA n 
1 31  VAL n 
1 32  LYS n 
1 33  VAL n 
1 34  THR n 
1 35  HIS n 
1 36  HIS n 
1 37  ALA n 
1 38  ILE n 
1 39  HIS n 
1 40  GLU n 
1 41  LYS n 
1 42  THR n 
1 43  GLY n 
1 44  ALA n 
1 45  GLY n 
1 46  ASN n 
1 47  ASP n 
1 48  PHE n 
1 49  LEU n 
1 50  GLY n 
1 51  TRP n 
1 52  VAL n 
1 53  ASP n 
1 54  LEU n 
1 55  PRO n 
1 56  LEU n 
1 57  GLN n 
1 58  TYR n 
1 59  ASP n 
1 60  LYS n 
1 61  GLU n 
1 62  GLU n 
1 63  PHE n 
1 64  ALA n 
1 65  ARG n 
1 66  ILE n 
1 67  GLN n 
1 68  LYS n 
1 69  CYS n 
1 70  ALA n 
1 71  GLU n 
1 72  LYS n 
1 73  ILE n 
1 74  LYS n 
1 75  ASN n 
1 76  ASP n 
1 77  SER n 
1 78  ASP n 
1 79  ILE n 
1 80  LEU n 
1 81  LEU n 
1 82  VAL n 
1 83  VAL n 
1 84  GLY n 
1 85  ILE n 
1 86  GLY n 
1 87  GLY n 
1 88  SER n 
1 89  TYR n 
1 90  LEU n 
1 91  GLY n 
1 92  ALA n 
1 93  ARG n 
1 94  ALA n 
1 95  ALA n 
1 96  ILE n 
1 97  GLU n 
1 98  MSE n 
1 99  LEU n 
1 100 ASN n 
1 101 HIS n 
1 102 SER n 
1 103 PHE n 
1 104 TYR n 
1 105 ASN n 
1 106 THR n 
1 107 LEU n 
1 108 SER n 
1 109 LYS n 
1 110 GLU n 
1 111 GLN n 
1 112 ARG n 
1 113 LYS n 
1 114 THR n 
1 115 PRO n 
1 116 GLN n 
1 117 VAL n 
1 118 LEU n 
1 119 PHE n 
1 120 VAL n 
1 121 GLY n 
1 122 GLN n 
1 123 ASN n 
1 124 ILE n 
1 125 SER n 
1 126 SER n 
1 127 THR n 
1 128 TYR n 
1 129 MSE n 
1 130 LYS n 
1 131 ASP n 
1 132 LEU n 
1 133 MSE n 
1 134 ASP n 
1 135 VAL n 
1 136 LEU n 
1 137 GLU n 
1 138 GLY n 
1 139 LYS n 
1 140 ASP n 
1 141 PHE n 
1 142 SER n 
1 143 ILE n 
1 144 ASN n 
1 145 VAL n 
1 146 ILE n 
1 147 SER n 
1 148 LYS n 
1 149 SER n 
1 150 GLY n 
1 151 THR n 
1 152 THR n 
1 153 THR n 
1 154 GLU n 
1 155 PRO n 
1 156 ALA n 
1 157 LEU n 
1 158 ALA n 
1 159 PHE n 
1 160 ARG n 
1 161 ILE n 
1 162 PHE n 
1 163 ARG n 
1 164 LYS n 
1 165 LEU n 
1 166 LEU n 
1 167 GLU n 
1 168 GLU n 
1 169 LYS n 
1 170 TYR n 
1 171 GLY n 
1 172 LYS n 
1 173 GLU n 
1 174 GLU n 
1 175 ALA n 
1 176 ARG n 
1 177 LYS n 
1 178 ARG n 
1 179 ILE n 
1 180 TYR n 
1 181 ALA n 
1 182 THR n 
1 183 THR n 
1 184 ASP n 
1 185 LYS n 
1 186 ALA n 
1 187 ARG n 
1 188 GLY n 
1 189 ALA n 
1 190 LEU n 
1 191 LYS n 
1 192 THR n 
1 193 LEU n 
1 194 ALA n 
1 195 ASP n 
1 196 ASN n 
1 197 GLU n 
1 198 GLY n 
1 199 TYR n 
1 200 GLU n 
1 201 THR n 
1 202 PHE n 
1 203 VAL n 
1 204 ILE n 
1 205 PRO n 
1 206 ASP n 
1 207 ASP n 
1 208 VAL n 
1 209 GLY n 
1 210 GLY n 
1 211 ARG n 
1 212 PHE n 
1 213 SER n 
1 214 VAL n 
1 215 LEU n 
1 216 THR n 
1 217 PRO n 
1 218 VAL n 
1 219 GLY n 
1 220 LEU n 
1 221 LEU n 
1 222 PRO n 
1 223 ILE n 
1 224 ALA n 
1 225 VAL n 
1 226 SER n 
1 227 GLY n 
1 228 LEU n 
1 229 ASN n 
1 230 ILE n 
1 231 GLU n 
1 232 GLU n 
1 233 MSE n 
1 234 MSE n 
1 235 LYS n 
1 236 GLY n 
1 237 ALA n 
1 238 ALA n 
1 239 ALA n 
1 240 GLY n 
1 241 ARG n 
1 242 ASP n 
1 243 ASP n 
1 244 PHE n 
1 245 GLY n 
1 246 THR n 
1 247 SER n 
1 248 GLU n 
1 249 LEU n 
1 250 GLU n 
1 251 GLU n 
1 252 ASN n 
1 253 PRO n 
1 254 ALA n 
1 255 TYR n 
1 256 GLN n 
1 257 TYR n 
1 258 ALA n 
1 259 VAL n 
1 260 VAL n 
1 261 ARG n 
1 262 ASN n 
1 263 ALA n 
1 264 LEU n 
1 265 TYR n 
1 266 ASN n 
1 267 LYS n 
1 268 GLY n 
1 269 LYS n 
1 270 THR n 
1 271 ILE n 
1 272 GLU n 
1 273 MSE n 
1 274 LEU n 
1 275 ILE n 
1 276 ASN n 
1 277 TYR n 
1 278 GLU n 
1 279 PRO n 
1 280 ALA n 
1 281 LEU n 
1 282 GLN n 
1 283 TYR n 
1 284 PHE n 
1 285 ALA n 
1 286 GLU n 
1 287 TRP n 
1 288 TRP n 
1 289 LYS n 
1 290 GLN n 
1 291 LEU n 
1 292 PHE n 
1 293 GLY n 
1 294 GLU n 
1 295 SER n 
1 296 GLU n 
1 297 GLY n 
1 298 LYS n 
1 299 ASP n 
1 300 GLN n 
1 301 LYS n 
1 302 GLY n 
1 303 ILE n 
1 304 PHE n 
1 305 PRO n 
1 306 SER n 
1 307 SER n 
1 308 ALA n 
1 309 ASN n 
1 310 PHE n 
1 311 SER n 
1 312 THR n 
1 313 ASP n 
1 314 LEU n 
1 315 HIS n 
1 316 SER n 
1 317 LEU n 
1 318 GLY n 
1 319 GLN n 
1 320 TYR n 
1 321 VAL n 
1 322 GLN n 
1 323 GLU n 
1 324 GLY n 
1 325 ARG n 
1 326 ARG n 
1 327 ASP n 
1 328 LEU n 
1 329 PHE n 
1 330 GLU n 
1 331 THR n 
1 332 VAL n 
1 333 LEU n 
1 334 LYS n 
1 335 VAL n 
1 336 GLY n 
1 337 LYS n 
1 338 SER n 
1 339 THR n 
1 340 HIS n 
1 341 GLU n 
1 342 LEU n 
1 343 THR n 
1 344 ILE n 
1 345 GLU n 
1 346 SER n 
1 347 GLU n 
1 348 GLU n 
1 349 ASN n 
1 350 ASP n 
1 351 LEU n 
1 352 ASP n 
1 353 GLY n 
1 354 LEU n 
1 355 ASN n 
1 356 TYR n 
1 357 LEU n 
1 358 ALA n 
1 359 GLY n 
1 360 GLU n 
1 361 THR n 
1 362 VAL n 
1 363 ASP n 
1 364 PHE n 
1 365 VAL n 
1 366 ASN n 
1 367 THR n 
1 368 LYS n 
1 369 ALA n 
1 370 TYR n 
1 371 GLU n 
1 372 GLY n 
1 373 THR n 
1 374 LEU n 
1 375 LEU n 
1 376 ALA n 
1 377 HIS n 
1 378 SER n 
1 379 ASP n 
1 380 GLY n 
1 381 GLY n 
1 382 VAL n 
1 383 PRO n 
1 384 ASN n 
1 385 LEU n 
1 386 ILE n 
1 387 VAL n 
1 388 ASN n 
1 389 ILE n 
1 390 PRO n 
1 391 GLU n 
1 392 LEU n 
1 393 ASN n 
1 394 GLU n 
1 395 TYR n 
1 396 THR n 
1 397 PHE n 
1 398 GLY n 
1 399 TYR n 
1 400 LEU n 
1 401 VAL n 
1 402 TYR n 
1 403 PHE n 
1 404 PHE n 
1 405 GLU n 
1 406 LYS n 
1 407 ALA n 
1 408 CYS n 
1 409 ALA n 
1 410 MSE n 
1 411 SER n 
1 412 GLY n 
1 413 TYR n 
1 414 LEU n 
1 415 LEU n 
1 416 GLY n 
1 417 VAL n 
1 418 ASN n 
1 419 PRO n 
1 420 PHE n 
1 421 ASP n 
1 422 GLN n 
1 423 PRO n 
1 424 GLY n 
1 425 VAL n 
1 426 GLU n 
1 427 ALA n 
1 428 TYR n 
1 429 LYS n 
1 430 LYS n 
1 431 ASN n 
1 432 MSE n 
1 433 PHE n 
1 434 ALA n 
1 435 LEU n 
1 436 LEU n 
1 437 GLY n 
1 438 LYS n 
1 439 PRO n 
1 440 GLY n 
1 441 PHE n 
1 442 GLU n 
1 443 GLU n 
1 444 LEU n 
1 445 LYS n 
1 446 ALA n 
1 447 GLU n 
1 448 LEU n 
1 449 GLU n 
1 450 GLU n 
1 451 ARG n 
1 452 LEU n 
1 453 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'anthrax,anthrax bacterium' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BAS4767, BA_5130, GBAA_5130, pgi' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'Ames Ancestor' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus anthracis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     261594 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21-DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMCSG 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_BACAN 
_struct_ref.pdbx_db_accession          Q81K75 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSTHVTFDYSKALSFIGEHEITYLRDAVKVTHHAIHEKTGAGNDFLGWVDLPLQYDKEEFARIQKCAEKIKNDSDILLVV
GIGGSYLGARAAIEMLNHSFYNTLSKEQRKTPQVLFVGQNISSTYMKDLMDVLEGKDFSINVISKSGTTTEPALAFRIFR
KLLEEKYGKEEARKRIYATTDKARGALKTLADNEGYETFVIPDDVGGRFSVLTPVGLLPIAVSGLNIEEMMKGAAAGRDD
FGTSELEENPAYQYAVVRNALYNKGKTIEMLINYEPALQYFAEWWKQLFGESEGKDQKGIFPSSANFSTDLHSLGQYVQE
GRRDLFETVLKVGKSTHELTIESEENDLDGLNYLAGETVDFVNTKAYEGTLLAHSDGGVPNLIVNIPELNEYTFGYLVYF
FEKACAMSGYLLGVNPFDQPGVEAYKKNMFALLGKPGFEELKAELEERLK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3IFS A 4 ? 453 ? Q81K75 1 ? 450 ? 1 450 
2 1 3IFS B 4 ? 453 ? Q81K75 1 ? 450 ? 1 450 
3 1 3IFS C 4 ? 453 ? Q81K75 1 ? 450 ? 1 450 
4 1 3IFS D 4 ? 453 ? Q81K75 1 ? 450 ? 1 450 
5 1 3IFS E 4 ? 453 ? Q81K75 1 ? 450 ? 1 450 
6 1 3IFS F 4 ? 453 ? Q81K75 1 ? 450 ? 1 450 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3IFS SER A 1 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -2 1  
1 3IFS ASN A 2 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -1 2  
1 3IFS ALA A 3 ? UNP Q81K75 ? ? 'EXPRESSION TAG' 0  3  
2 3IFS SER B 1 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -2 4  
2 3IFS ASN B 2 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -1 5  
2 3IFS ALA B 3 ? UNP Q81K75 ? ? 'EXPRESSION TAG' 0  6  
3 3IFS SER C 1 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -2 7  
3 3IFS ASN C 2 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -1 8  
3 3IFS ALA C 3 ? UNP Q81K75 ? ? 'EXPRESSION TAG' 0  9  
4 3IFS SER D 1 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -2 10 
4 3IFS ASN D 2 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -1 11 
4 3IFS ALA D 3 ? UNP Q81K75 ? ? 'EXPRESSION TAG' 0  12 
5 3IFS SER E 1 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -2 13 
5 3IFS ASN E 2 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -1 14 
5 3IFS ALA E 3 ? UNP Q81K75 ? ? 'EXPRESSION TAG' 0  15 
6 3IFS SER F 1 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -2 16 
6 3IFS ASN F 2 ? UNP Q81K75 ? ? 'EXPRESSION TAG' -1 17 
6 3IFS ALA F 3 ? UNP Q81K75 ? ? 'EXPRESSION TAG' 0  18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'       ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LI  non-polymer         . 'LITHIUM ION'        ? 'Li 1'           6.941   
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE     ? 'C5 H11 N O2 Se' 196.106 
PGE non-polymer         . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3IFS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.00 
_exptl_crystal.density_percent_sol   38.36 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;Protein solution: 0.3M NaCl, 10mM HEPES (pH 7.5); 
Screen solution: 20% PEG 3350,0.1M Na Formate, 0.1M Li Sulfate, 0.1M Bis-Tris (pH 6.5)., VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-07-16 
_diffrn_detector.details                'Beryllium lenses' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Diamond 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97856 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97856 
# 
_reflns.entry_id                     3IFS 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.004 
_reflns.number_obs                   163392 
_reflns.number_all                   163392 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.101 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.9 
_reflns.B_iso_Wilson_estimate        20.6 
_reflns.pdbx_redundancy              5.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.004 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.411 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      8095 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3IFS 
_refine.ls_number_reflns_obs                     155079 
_refine.ls_number_reflns_all                     155079 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.87 
_refine.ls_d_res_high                            2.004 
_refine.ls_percent_reflns_obs                    98.69 
_refine.ls_R_factor_obs                          0.14251 
_refine.ls_R_factor_all                          0.14251 
_refine.ls_R_factor_R_work                       0.13996 
_refine.ls_R_factor_R_free                       0.19022 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  8207 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.B_iso_mean                               14.085 
_refine.aniso_B[1][1]                            0.30 
_refine.aniso_B[2][2]                            0.76 
_refine.aniso_B[3][3]                            -1.07 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             'Isotropic, individual' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.185 
_refine.pdbx_overall_ESU_R_Free                  0.154 
_refine.overall_SU_ML                            0.099 
_refine.overall_SU_B                             7.829 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        21260 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             2356 
_refine_hist.number_atoms_total               23648 
_refine_hist.d_res_high                       2.004 
_refine_hist.d_res_low                        29.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.011  0.022  ? 22299 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.001  0.020  ? 15099 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.406  1.968  ? 30195 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      0.853  3.000  ? 36928 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 2.481  5.000  ? 2799  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 29.815 24.940 ? 1075  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 9.490  15.000 ? 3913  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 11.116 15.000 ? 98    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.094  0.200  ? 3261  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.006  0.020  ? 25275 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.001  0.020  ? 4554  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.895  1.500  ? 13655 'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.289  1.500  ? 5644  'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.562  2.000  ? 21960 'X-RAY DIFFRACTION' ? 
r_scbond_it            2.919  3.000  ? 8644  'X-RAY DIFFRACTION' ? 
r_scangle_it           4.503  4.500  ? 8235  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.004 
_refine_ls_shell.d_res_low                        2.055 
_refine_ls_shell.number_reflns_R_work             10654 
_refine_ls_shell.R_factor_R_work                  0.165 
_refine_ls_shell.percent_reflns_obs               93.30 
_refine_ls_shell.R_factor_R_free                  0.224 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             575 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                10654 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3IFS 
_struct.title                     
'2.0 Angstrom Resolution Crystal Structure of Glucose-6-phosphate Isomerase (pgi) from Bacillus anthracis.' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3IFS 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            
;glucose-6-phosphate isomerase, idp01650, pgi family, Gluconeogenesis, Glycolysis, Isomerase, Phosphoprotein, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 2 ? 
K N N 4 ? 
L N N 5 ? 
M N N 2 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   TYR A 12  ? LEU A 16  ? TYR A 9   LEU A 13  5 ? 5  
HELX_P HELX_P2   2   GLY A 20  ? TYR A 26  ? GLY A 17  TYR A 23  1 ? 7  
HELX_P HELX_P3   3   LEU A 27  ? LYS A 41  ? LEU A 24  LYS A 38  1 ? 15 
HELX_P HELX_P4   4   GLY A 45  ? LEU A 49  ? GLY A 42  LEU A 46  5 ? 5  
HELX_P HELX_P5   5   ASP A 53  ? TYR A 58  ? ASP A 50  TYR A 55  1 ? 6  
HELX_P HELX_P6   6   ASP A 59  ? SER A 77  ? ASP A 56  SER A 74  1 ? 19 
HELX_P HELX_P7   7   ILE A 85  ? SER A 88  ? ILE A 82  SER A 85  5 ? 4  
HELX_P HELX_P8   8   TYR A 89  ? ASN A 100 ? TYR A 86  ASN A 97  1 ? 12 
HELX_P HELX_P9   9   PHE A 103 ? LEU A 107 ? PHE A 100 LEU A 104 5 ? 5  
HELX_P HELX_P10  10  SER A 108 ? LYS A 113 ? SER A 105 LYS A 110 1 ? 6  
HELX_P HELX_P11  11  SER A 125 ? GLU A 137 ? SER A 122 GLU A 134 1 ? 13 
HELX_P HELX_P12  12  THR A 152 ? GLY A 171 ? THR A 149 GLY A 168 1 ? 20 
HELX_P HELX_P13  13  GLY A 171 ? LYS A 177 ? GLY A 168 LYS A 174 1 ? 7  
HELX_P HELX_P14  14  GLY A 188 ? GLY A 198 ? GLY A 185 GLY A 195 1 ? 11 
HELX_P HELX_P15  15  GLY A 209 ? SER A 213 ? GLY A 206 SER A 210 5 ? 5  
HELX_P HELX_P16  16  THR A 216 ? SER A 226 ? THR A 213 SER A 223 1 ? 11 
HELX_P HELX_P17  17  ASN A 229 ? PHE A 244 ? ASN A 226 PHE A 241 1 ? 16 
HELX_P HELX_P18  18  GLU A 248 ? GLU A 251 ? GLU A 245 GLU A 248 5 ? 4  
HELX_P HELX_P19  19  ASN A 252 ? LYS A 267 ? ASN A 249 LYS A 264 1 ? 16 
HELX_P HELX_P20  20  GLU A 278 ? ALA A 280 ? GLU A 275 ALA A 277 5 ? 3  
HELX_P HELX_P21  21  LEU A 281 ? GLY A 297 ? LEU A 278 GLY A 294 1 ? 17 
HELX_P HELX_P22  22  SER A 311 ? SER A 316 ? SER A 308 SER A 313 5 ? 6  
HELX_P HELX_P23  23  LEU A 317 ? GLY A 324 ? LEU A 314 GLY A 321 1 ? 8  
HELX_P HELX_P24  24  LEU A 354 ? ALA A 358 ? LEU A 351 ALA A 355 5 ? 5  
HELX_P HELX_P25  25  THR A 361 ? GLY A 380 ? THR A 358 GLY A 377 1 ? 20 
HELX_P HELX_P26  26  ASN A 393 ? GLY A 416 ? ASN A 390 GLY A 413 1 ? 24 
HELX_P HELX_P27  27  GLN A 422 ? GLY A 424 ? GLN A 419 GLY A 421 5 ? 3  
HELX_P HELX_P28  28  VAL A 425 ? GLY A 437 ? VAL A 422 GLY A 434 1 ? 13 
HELX_P HELX_P29  29  PHE A 441 ? LYS A 453 ? PHE A 438 LYS A 450 1 ? 13 
HELX_P HELX_P30  30  TYR B 12  ? LEU B 16  ? TYR B 9   LEU B 13  5 ? 5  
HELX_P HELX_P31  31  GLY B 20  ? TYR B 26  ? GLY B 17  TYR B 23  1 ? 7  
HELX_P HELX_P32  32  LEU B 27  ? LYS B 41  ? LEU B 24  LYS B 38  1 ? 15 
HELX_P HELX_P33  33  GLY B 45  ? LEU B 49  ? GLY B 42  LEU B 46  5 ? 5  
HELX_P HELX_P34  34  ASP B 53  ? TYR B 58  ? ASP B 50  TYR B 55  1 ? 6  
HELX_P HELX_P35  35  ASP B 59  ? SER B 77  ? ASP B 56  SER B 74  1 ? 19 
HELX_P HELX_P36  36  ILE B 85  ? SER B 88  ? ILE B 82  SER B 85  5 ? 4  
HELX_P HELX_P37  37  TYR B 89  ? ASN B 100 ? TYR B 86  ASN B 97  1 ? 12 
HELX_P HELX_P38  38  PHE B 103 ? LEU B 107 ? PHE B 100 LEU B 104 5 ? 5  
HELX_P HELX_P39  39  SER B 108 ? LYS B 113 ? SER B 105 LYS B 110 1 ? 6  
HELX_P HELX_P40  40  SER B 125 ? GLU B 137 ? SER B 122 GLU B 134 1 ? 13 
HELX_P HELX_P41  41  THR B 152 ? GLY B 171 ? THR B 149 GLY B 168 1 ? 20 
HELX_P HELX_P42  42  GLY B 171 ? LYS B 177 ? GLY B 168 LYS B 174 1 ? 7  
HELX_P HELX_P43  43  GLY B 188 ? GLY B 198 ? GLY B 185 GLY B 195 1 ? 11 
HELX_P HELX_P44  44  GLY B 209 ? SER B 213 ? GLY B 206 SER B 210 5 ? 5  
HELX_P HELX_P45  45  THR B 216 ? SER B 226 ? THR B 213 SER B 223 1 ? 11 
HELX_P HELX_P46  46  ASN B 229 ? PHE B 244 ? ASN B 226 PHE B 241 1 ? 16 
HELX_P HELX_P47  47  GLU B 248 ? GLU B 251 ? GLU B 245 GLU B 248 5 ? 4  
HELX_P HELX_P48  48  ASN B 252 ? LYS B 267 ? ASN B 249 LYS B 264 1 ? 16 
HELX_P HELX_P49  49  GLU B 278 ? ALA B 280 ? GLU B 275 ALA B 277 5 ? 3  
HELX_P HELX_P50  50  LEU B 281 ? GLY B 297 ? LEU B 278 GLY B 294 1 ? 17 
HELX_P HELX_P51  51  SER B 311 ? SER B 316 ? SER B 308 SER B 313 5 ? 6  
HELX_P HELX_P52  52  LEU B 317 ? GLY B 324 ? LEU B 314 GLY B 321 1 ? 8  
HELX_P HELX_P53  53  LEU B 354 ? ALA B 358 ? LEU B 351 ALA B 355 5 ? 5  
HELX_P HELX_P54  54  THR B 361 ? GLY B 380 ? THR B 358 GLY B 377 1 ? 20 
HELX_P HELX_P55  55  ASN B 393 ? GLY B 416 ? ASN B 390 GLY B 413 1 ? 24 
HELX_P HELX_P56  56  GLN B 422 ? GLY B 424 ? GLN B 419 GLY B 421 5 ? 3  
HELX_P HELX_P57  57  VAL B 425 ? LEU B 436 ? VAL B 422 LEU B 433 1 ? 12 
HELX_P HELX_P58  58  PHE B 441 ? LYS B 453 ? PHE B 438 LYS B 450 1 ? 13 
HELX_P HELX_P59  59  TYR C 12  ? LEU C 16  ? TYR C 9   LEU C 13  5 ? 5  
HELX_P HELX_P60  60  GLY C 20  ? TYR C 26  ? GLY C 17  TYR C 23  1 ? 7  
HELX_P HELX_P61  61  LEU C 27  ? GLU C 40  ? LEU C 24  GLU C 37  1 ? 14 
HELX_P HELX_P62  62  GLY C 45  ? LEU C 49  ? GLY C 42  LEU C 46  5 ? 5  
HELX_P HELX_P63  63  ASP C 53  ? TYR C 58  ? ASP C 50  TYR C 55  1 ? 6  
HELX_P HELX_P64  64  ASP C 59  ? SER C 77  ? ASP C 56  SER C 74  1 ? 19 
HELX_P HELX_P65  65  ILE C 85  ? SER C 88  ? ILE C 82  SER C 85  5 ? 4  
HELX_P HELX_P66  66  TYR C 89  ? ASN C 100 ? TYR C 86  ASN C 97  1 ? 12 
HELX_P HELX_P67  67  SER C 108 ? LYS C 113 ? SER C 105 LYS C 110 1 ? 6  
HELX_P HELX_P68  68  SER C 125 ? GLU C 137 ? SER C 122 GLU C 134 1 ? 13 
HELX_P HELX_P69  69  THR C 152 ? GLY C 171 ? THR C 149 GLY C 168 1 ? 20 
HELX_P HELX_P70  70  GLY C 171 ? LYS C 177 ? GLY C 168 LYS C 174 1 ? 7  
HELX_P HELX_P71  71  GLY C 188 ? GLY C 198 ? GLY C 185 GLY C 195 1 ? 11 
HELX_P HELX_P72  72  GLY C 209 ? SER C 213 ? GLY C 206 SER C 210 5 ? 5  
HELX_P HELX_P73  73  THR C 216 ? SER C 226 ? THR C 213 SER C 223 1 ? 11 
HELX_P HELX_P74  74  ASN C 229 ? PHE C 244 ? ASN C 226 PHE C 241 1 ? 16 
HELX_P HELX_P75  75  GLU C 248 ? GLU C 251 ? GLU C 245 GLU C 248 5 ? 4  
HELX_P HELX_P76  76  ASN C 252 ? LYS C 267 ? ASN C 249 LYS C 264 1 ? 16 
HELX_P HELX_P77  77  GLU C 278 ? ALA C 280 ? GLU C 275 ALA C 277 5 ? 3  
HELX_P HELX_P78  78  LEU C 281 ? GLY C 297 ? LEU C 278 GLY C 294 1 ? 17 
HELX_P HELX_P79  79  SER C 311 ? HIS C 315 ? SER C 308 HIS C 312 5 ? 5  
HELX_P HELX_P80  80  LEU C 317 ? GLY C 324 ? LEU C 314 GLY C 321 1 ? 8  
HELX_P HELX_P81  81  LEU C 354 ? ALA C 358 ? LEU C 351 ALA C 355 5 ? 5  
HELX_P HELX_P82  82  THR C 361 ? GLY C 380 ? THR C 358 GLY C 377 1 ? 20 
HELX_P HELX_P83  83  ASN C 393 ? GLY C 416 ? ASN C 390 GLY C 413 1 ? 24 
HELX_P HELX_P84  84  GLN C 422 ? GLY C 424 ? GLN C 419 GLY C 421 5 ? 3  
HELX_P HELX_P85  85  VAL C 425 ? GLY C 437 ? VAL C 422 GLY C 434 1 ? 13 
HELX_P HELX_P86  86  PHE C 441 ? LEU C 452 ? PHE C 438 LEU C 449 1 ? 12 
HELX_P HELX_P87  87  TYR D 12  ? LEU D 16  ? TYR D 9   LEU D 13  5 ? 5  
HELX_P HELX_P88  88  GLY D 20  ? TYR D 26  ? GLY D 17  TYR D 23  1 ? 7  
HELX_P HELX_P89  89  LEU D 27  ? LYS D 41  ? LEU D 24  LYS D 38  1 ? 15 
HELX_P HELX_P90  90  GLY D 45  ? LEU D 49  ? GLY D 42  LEU D 46  5 ? 5  
HELX_P HELX_P91  91  ASP D 53  ? TYR D 58  ? ASP D 50  TYR D 55  1 ? 6  
HELX_P HELX_P92  92  ASP D 59  ? SER D 77  ? ASP D 56  SER D 74  1 ? 19 
HELX_P HELX_P93  93  ILE D 85  ? SER D 88  ? ILE D 82  SER D 85  5 ? 4  
HELX_P HELX_P94  94  TYR D 89  ? ASN D 100 ? TYR D 86  ASN D 97  1 ? 12 
HELX_P HELX_P95  95  PHE D 103 ? LEU D 107 ? PHE D 100 LEU D 104 5 ? 5  
HELX_P HELX_P96  96  SER D 108 ? LYS D 113 ? SER D 105 LYS D 110 1 ? 6  
HELX_P HELX_P97  97  SER D 125 ? GLU D 137 ? SER D 122 GLU D 134 1 ? 13 
HELX_P HELX_P98  98  THR D 152 ? GLY D 171 ? THR D 149 GLY D 168 1 ? 20 
HELX_P HELX_P99  99  GLY D 171 ? LYS D 177 ? GLY D 168 LYS D 174 1 ? 7  
HELX_P HELX_P100 100 GLY D 188 ? GLY D 198 ? GLY D 185 GLY D 195 1 ? 11 
HELX_P HELX_P101 101 GLY D 209 ? SER D 213 ? GLY D 206 SER D 210 5 ? 5  
HELX_P HELX_P102 102 THR D 216 ? SER D 226 ? THR D 213 SER D 223 1 ? 11 
HELX_P HELX_P103 103 ASN D 229 ? PHE D 244 ? ASN D 226 PHE D 241 1 ? 16 
HELX_P HELX_P104 104 GLU D 248 ? GLU D 251 ? GLU D 245 GLU D 248 5 ? 4  
HELX_P HELX_P105 105 ASN D 252 ? LYS D 267 ? ASN D 249 LYS D 264 1 ? 16 
HELX_P HELX_P106 106 GLU D 278 ? ALA D 280 ? GLU D 275 ALA D 277 5 ? 3  
HELX_P HELX_P107 107 LEU D 281 ? GLY D 297 ? LEU D 278 GLY D 294 1 ? 17 
HELX_P HELX_P108 108 SER D 311 ? SER D 316 ? SER D 308 SER D 313 5 ? 6  
HELX_P HELX_P109 109 LEU D 317 ? GLY D 324 ? LEU D 314 GLY D 321 1 ? 8  
HELX_P HELX_P110 110 LEU D 354 ? ALA D 358 ? LEU D 351 ALA D 355 5 ? 5  
HELX_P HELX_P111 111 THR D 361 ? GLY D 380 ? THR D 358 GLY D 377 1 ? 20 
HELX_P HELX_P112 112 ASN D 393 ? GLY D 416 ? ASN D 390 GLY D 413 1 ? 24 
HELX_P HELX_P113 113 GLN D 422 ? GLY D 424 ? GLN D 419 GLY D 421 5 ? 3  
HELX_P HELX_P114 114 VAL D 425 ? GLY D 437 ? VAL D 422 GLY D 434 1 ? 13 
HELX_P HELX_P115 115 PHE D 441 ? LYS D 453 ? PHE D 438 LYS D 450 1 ? 13 
HELX_P HELX_P116 116 TYR E 12  ? LEU E 16  ? TYR E 9   LEU E 13  5 ? 5  
HELX_P HELX_P117 117 GLY E 20  ? TYR E 26  ? GLY E 17  TYR E 23  1 ? 7  
HELX_P HELX_P118 118 LEU E 27  ? GLU E 40  ? LEU E 24  GLU E 37  1 ? 14 
HELX_P HELX_P119 119 GLY E 45  ? LEU E 49  ? GLY E 42  LEU E 46  5 ? 5  
HELX_P HELX_P120 120 ASP E 53  ? TYR E 58  ? ASP E 50  TYR E 55  1 ? 6  
HELX_P HELX_P121 121 ASP E 59  ? SER E 77  ? ASP E 56  SER E 74  1 ? 19 
HELX_P HELX_P122 122 ILE E 85  ? SER E 88  ? ILE E 82  SER E 85  5 ? 4  
HELX_P HELX_P123 123 TYR E 89  ? ASN E 100 ? TYR E 86  ASN E 97  1 ? 12 
HELX_P HELX_P124 124 PHE E 103 ? LEU E 107 ? PHE E 100 LEU E 104 5 ? 5  
HELX_P HELX_P125 125 SER E 108 ? LYS E 113 ? SER E 105 LYS E 110 1 ? 6  
HELX_P HELX_P126 126 SER E 125 ? GLU E 137 ? SER E 122 GLU E 134 1 ? 13 
HELX_P HELX_P127 127 THR E 152 ? GLY E 171 ? THR E 149 GLY E 168 1 ? 20 
HELX_P HELX_P128 128 GLY E 171 ? LYS E 177 ? GLY E 168 LYS E 174 1 ? 7  
HELX_P HELX_P129 129 GLY E 188 ? GLY E 198 ? GLY E 185 GLY E 195 1 ? 11 
HELX_P HELX_P130 130 GLY E 209 ? SER E 213 ? GLY E 206 SER E 210 5 ? 5  
HELX_P HELX_P131 131 THR E 216 ? SER E 226 ? THR E 213 SER E 223 1 ? 11 
HELX_P HELX_P132 132 ASN E 229 ? PHE E 244 ? ASN E 226 PHE E 241 1 ? 16 
HELX_P HELX_P133 133 GLU E 248 ? GLU E 251 ? GLU E 245 GLU E 248 5 ? 4  
HELX_P HELX_P134 134 ASN E 252 ? LYS E 267 ? ASN E 249 LYS E 264 1 ? 16 
HELX_P HELX_P135 135 GLU E 278 ? ALA E 280 ? GLU E 275 ALA E 277 5 ? 3  
HELX_P HELX_P136 136 LEU E 281 ? GLY E 297 ? LEU E 278 GLY E 294 1 ? 17 
HELX_P HELX_P137 137 SER E 311 ? SER E 316 ? SER E 308 SER E 313 5 ? 6  
HELX_P HELX_P138 138 LEU E 317 ? GLY E 324 ? LEU E 314 GLY E 321 1 ? 8  
HELX_P HELX_P139 139 LEU E 354 ? ALA E 358 ? LEU E 351 ALA E 355 5 ? 5  
HELX_P HELX_P140 140 THR E 361 ? GLY E 380 ? THR E 358 GLY E 377 1 ? 20 
HELX_P HELX_P141 141 ASN E 393 ? GLY E 416 ? ASN E 390 GLY E 413 1 ? 24 
HELX_P HELX_P142 142 GLN E 422 ? GLY E 424 ? GLN E 419 GLY E 421 5 ? 3  
HELX_P HELX_P143 143 VAL E 425 ? GLY E 437 ? VAL E 422 GLY E 434 1 ? 13 
HELX_P HELX_P144 144 PHE E 441 ? LYS E 453 ? PHE E 438 LYS E 450 1 ? 13 
HELX_P HELX_P145 145 TYR F 12  ? LEU F 16  ? TYR F 9   LEU F 13  5 ? 5  
HELX_P HELX_P146 146 GLY F 20  ? TYR F 26  ? GLY F 17  TYR F 23  1 ? 7  
HELX_P HELX_P147 147 LEU F 27  ? GLU F 40  ? LEU F 24  GLU F 37  1 ? 14 
HELX_P HELX_P148 148 GLY F 45  ? LEU F 49  ? GLY F 42  LEU F 46  5 ? 5  
HELX_P HELX_P149 149 ASP F 53  ? TYR F 58  ? ASP F 50  TYR F 55  1 ? 6  
HELX_P HELX_P150 150 ASP F 59  ? SER F 77  ? ASP F 56  SER F 74  1 ? 19 
HELX_P HELX_P151 151 ILE F 85  ? SER F 88  ? ILE F 82  SER F 85  5 ? 4  
HELX_P HELX_P152 152 TYR F 89  ? ASN F 100 ? TYR F 86  ASN F 97  1 ? 12 
HELX_P HELX_P153 153 SER F 108 ? LYS F 113 ? SER F 105 LYS F 110 1 ? 6  
HELX_P HELX_P154 154 SER F 125 ? GLU F 137 ? SER F 122 GLU F 134 1 ? 13 
HELX_P HELX_P155 155 THR F 152 ? LYS F 177 ? THR F 149 LYS F 174 1 ? 26 
HELX_P HELX_P156 156 GLY F 188 ? GLY F 198 ? GLY F 185 GLY F 195 1 ? 11 
HELX_P HELX_P157 157 GLY F 209 ? SER F 213 ? GLY F 206 SER F 210 5 ? 5  
HELX_P HELX_P158 158 THR F 216 ? SER F 226 ? THR F 213 SER F 223 1 ? 11 
HELX_P HELX_P159 159 ASN F 229 ? PHE F 244 ? ASN F 226 PHE F 241 1 ? 16 
HELX_P HELX_P160 160 GLU F 248 ? GLU F 251 ? GLU F 245 GLU F 248 5 ? 4  
HELX_P HELX_P161 161 ASN F 252 ? LYS F 267 ? ASN F 249 LYS F 264 1 ? 16 
HELX_P HELX_P162 162 GLU F 278 ? ALA F 280 ? GLU F 275 ALA F 277 5 ? 3  
HELX_P HELX_P163 163 LEU F 281 ? GLY F 297 ? LEU F 278 GLY F 294 1 ? 17 
HELX_P HELX_P164 164 SER F 311 ? SER F 316 ? SER F 308 SER F 313 5 ? 6  
HELX_P HELX_P165 165 LEU F 317 ? GLY F 324 ? LEU F 314 GLY F 321 1 ? 8  
HELX_P HELX_P166 166 LEU F 354 ? ALA F 358 ? LEU F 351 ALA F 355 5 ? 5  
HELX_P HELX_P167 167 THR F 361 ? GLY F 380 ? THR F 358 GLY F 377 1 ? 20 
HELX_P HELX_P168 168 ASN F 393 ? GLY F 416 ? ASN F 390 GLY F 413 1 ? 24 
HELX_P HELX_P169 169 GLN F 422 ? GLY F 424 ? GLN F 419 GLY F 421 5 ? 3  
HELX_P HELX_P170 170 VAL F 425 ? GLY F 437 ? VAL F 422 GLY F 434 1 ? 13 
HELX_P HELX_P171 171 PHE F 441 ? LYS F 453 ? PHE F 438 LYS F 450 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A GLU 97  C   ? ? ? 1_555 A MSE 98  N  ? ? A GLU 94  A MSE 95   1_555 ? ? ? ? ? ? ? 1.322 ? 
covale2  covale ? ? A MSE 98  C   ? ? ? 1_555 A LEU 99  N  ? ? A MSE 95  A LEU 96   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale3  covale ? ? A TYR 128 C   ? ? ? 1_555 A MSE 129 N  ? ? A TYR 125 A MSE 126  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale4  covale ? ? A MSE 129 C   ? ? ? 1_555 A LYS 130 N  ? ? A MSE 126 A LYS 127  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale5  covale ? ? A LEU 132 C   ? ? ? 1_555 A MSE 133 N  ? ? A LEU 129 A MSE 130  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale6  covale ? ? A MSE 133 C   ? ? ? 1_555 A ASP 134 N  ? ? A MSE 130 A ASP 131  1_555 ? ? ? ? ? ? ? 1.342 ? 
covale7  covale ? ? A GLU 232 C   ? ? ? 1_555 A MSE 233 N  ? ? A GLU 229 A MSE 230  1_555 ? ? ? ? ? ? ? 1.319 ? 
covale8  covale ? ? A MSE 233 C   ? ? ? 1_555 A MSE 234 N  ? ? A MSE 230 A MSE 231  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale9  covale ? ? A MSE 234 C   ? ? ? 1_555 A LYS 235 N  ? ? A MSE 231 A LYS 232  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale10 covale ? ? A GLU 272 C   ? ? ? 1_555 A MSE 273 N  ? ? A GLU 269 A MSE 270  1_555 ? ? ? ? ? ? ? 1.321 ? 
covale11 covale ? ? A MSE 273 C   ? ? ? 1_555 A LEU 274 N  ? ? A MSE 270 A LEU 271  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale12 covale ? ? A ALA 409 C   ? ? ? 1_555 A MSE 410 N  ? ? A ALA 406 A MSE 407  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale13 covale ? ? A MSE 410 C   ? ? ? 1_555 A SER 411 N  ? ? A MSE 407 A SER 408  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale14 covale ? ? A ASN 431 C   ? ? ? 1_555 A MSE 432 N  ? ? A ASN 428 A MSE 429  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale15 covale ? ? A MSE 432 C   ? ? ? 1_555 A PHE 433 N  ? ? A MSE 429 A PHE 430  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale16 covale ? ? B GLU 97  C   ? ? ? 1_555 B MSE 98  N  ? ? B GLU 94  B MSE 95   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale17 covale ? ? B MSE 98  C   ? ? ? 1_555 B LEU 99  N  ? ? B MSE 95  B LEU 96   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale18 covale ? ? B TYR 128 C   ? ? ? 1_555 B MSE 129 N  ? ? B TYR 125 B MSE 126  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale19 covale ? ? B MSE 129 C   ? ? ? 1_555 B LYS 130 N  ? ? B MSE 126 B LYS 127  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale20 covale ? ? B LEU 132 C   ? ? ? 1_555 B MSE 133 N  ? ? B LEU 129 B MSE 130  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale21 covale ? ? B MSE 133 C   ? ? ? 1_555 B ASP 134 N  ? ? B MSE 130 B ASP 131  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale22 covale ? ? B GLU 232 C   ? ? ? 1_555 B MSE 233 N  ? ? B GLU 229 B MSE 230  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale23 covale ? ? B MSE 233 C   ? ? ? 1_555 B MSE 234 N  ? ? B MSE 230 B MSE 231  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale24 covale ? ? B MSE 234 C   ? ? ? 1_555 B LYS 235 N  ? ? B MSE 231 B LYS 232  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale25 covale ? ? B GLU 272 C   ? ? ? 1_555 B MSE 273 N  ? ? B GLU 269 B MSE 270  1_555 ? ? ? ? ? ? ? 1.323 ? 
covale26 covale ? ? B MSE 273 C   ? ? ? 1_555 B LEU 274 N  ? ? B MSE 270 B LEU 271  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale27 covale ? ? B ALA 409 C   ? ? ? 1_555 B MSE 410 N  ? ? B ALA 406 B MSE 407  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale28 covale ? ? B MSE 410 C   ? ? ? 1_555 B SER 411 N  ? ? B MSE 407 B SER 408  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale29 covale ? ? B ASN 431 C   ? ? ? 1_555 B MSE 432 N  ? ? B ASN 428 B MSE 429  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale30 covale ? ? B MSE 432 C   ? ? ? 1_555 B PHE 433 N  ? ? B MSE 429 B PHE 430  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale31 covale ? ? C GLU 97  C   ? ? ? 1_555 C MSE 98  N  ? ? C GLU 94  C MSE 95   1_555 ? ? ? ? ? ? ? 1.321 ? 
covale32 covale ? ? C MSE 98  C   ? ? ? 1_555 C LEU 99  N  ? ? C MSE 95  C LEU 96   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale33 covale ? ? C TYR 128 C   ? ? ? 1_555 C MSE 129 N  ? ? C TYR 125 C MSE 126  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale34 covale ? ? C MSE 129 C   ? ? ? 1_555 C LYS 130 N  ? ? C MSE 126 C LYS 127  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale35 covale ? ? C LEU 132 C   ? ? ? 1_555 C MSE 133 N  ? ? C LEU 129 C MSE 130  1_555 ? ? ? ? ? ? ? 1.321 ? 
covale36 covale ? ? C MSE 133 C   ? ? ? 1_555 C ASP 134 N  ? ? C MSE 130 C ASP 131  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale37 covale ? ? C GLU 232 C   ? ? ? 1_555 C MSE 233 N  ? ? C GLU 229 C MSE 230  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale38 covale ? ? C MSE 233 C   ? ? ? 1_555 C MSE 234 N  ? ? C MSE 230 C MSE 231  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale39 covale ? ? C MSE 234 C   ? ? ? 1_555 C LYS 235 N  ? ? C MSE 231 C LYS 232  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale40 covale ? ? C GLU 272 C   ? ? ? 1_555 C MSE 273 N  ? ? C GLU 269 C MSE 270  1_555 ? ? ? ? ? ? ? 1.322 ? 
covale41 covale ? ? C MSE 273 C   ? ? ? 1_555 C LEU 274 N  ? ? C MSE 270 C LEU 271  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale42 covale ? ? C ALA 409 C   ? ? ? 1_555 C MSE 410 N  ? ? C ALA 406 C MSE 407  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale43 covale ? ? C MSE 410 C   ? ? ? 1_555 C SER 411 N  ? ? C MSE 407 C SER 408  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale44 covale ? ? C ASN 431 C   ? ? ? 1_555 C MSE 432 N  ? ? C ASN 428 C MSE 429  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale45 covale ? ? C MSE 432 C   ? ? ? 1_555 C PHE 433 N  ? ? C MSE 429 C PHE 430  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale46 covale ? ? D GLU 97  C   ? ? ? 1_555 D MSE 98  N  ? ? D GLU 94  D MSE 95   1_555 ? ? ? ? ? ? ? 1.323 ? 
covale47 covale ? ? D MSE 98  C   ? ? ? 1_555 D LEU 99  N  ? ? D MSE 95  D LEU 96   1_555 ? ? ? ? ? ? ? 1.325 ? 
covale48 covale ? ? D TYR 128 C   ? ? ? 1_555 D MSE 129 N  ? ? D TYR 125 D MSE 126  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale49 covale ? ? D MSE 129 C   ? ? ? 1_555 D LYS 130 N  ? ? D MSE 126 D LYS 127  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale50 covale ? ? D LEU 132 C   ? ? ? 1_555 D MSE 133 N  ? ? D LEU 129 D MSE 130  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale51 covale ? ? D MSE 133 C   ? ? ? 1_555 D ASP 134 N  ? ? D MSE 130 D ASP 131  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale52 covale ? ? D GLU 232 C   ? ? ? 1_555 D MSE 233 N  ? ? D GLU 229 D MSE 230  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale53 covale ? ? D MSE 233 C   ? ? ? 1_555 D MSE 234 N  ? ? D MSE 230 D MSE 231  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale54 covale ? ? D MSE 234 C   ? ? ? 1_555 D LYS 235 N  ? ? D MSE 231 D LYS 232  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale55 covale ? ? D GLU 272 C   ? ? ? 1_555 D MSE 273 N  ? ? D GLU 269 D MSE 270  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale56 covale ? ? D MSE 273 C   ? ? ? 1_555 D LEU 274 N  ? ? D MSE 270 D LEU 271  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale57 covale ? ? D ALA 409 C   ? ? ? 1_555 D MSE 410 N  ? ? D ALA 406 D MSE 407  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale58 covale ? ? D MSE 410 C   ? ? ? 1_555 D SER 411 N  ? ? D MSE 407 D SER 408  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale59 covale ? ? D ASN 431 C   ? ? ? 1_555 D MSE 432 N  ? ? D ASN 428 D MSE 429  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale60 covale ? ? D MSE 432 C   ? ? ? 1_555 D PHE 433 N  ? ? D MSE 429 D PHE 430  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale61 covale ? ? E MSE 4   C   ? ? ? 1_555 E SER 5   N  ? ? E MSE 1   E SER 2    1_555 ? ? ? ? ? ? ? 1.327 ? 
covale62 covale ? ? E GLU 97  C   ? ? ? 1_555 E MSE 98  N  ? ? E GLU 94  E MSE 95   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale63 covale ? ? E MSE 98  C   ? ? ? 1_555 E LEU 99  N  ? ? E MSE 95  E LEU 96   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale64 covale ? ? E TYR 128 C   ? ? ? 1_555 E MSE 129 N  ? ? E TYR 125 E MSE 126  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale65 covale ? ? E MSE 129 C   ? ? ? 1_555 E LYS 130 N  ? ? E MSE 126 E LYS 127  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale66 covale ? ? E LEU 132 C   ? ? ? 1_555 E MSE 133 N  ? ? E LEU 129 E MSE 130  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale67 covale ? ? E MSE 133 C   ? ? ? 1_555 E ASP 134 N  ? ? E MSE 130 E ASP 131  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale68 covale ? ? E GLU 232 C   ? ? ? 1_555 E MSE 233 N  ? ? E GLU 229 E MSE 230  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale69 covale ? ? E MSE 233 C   ? ? ? 1_555 E MSE 234 N  ? ? E MSE 230 E MSE 231  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale70 covale ? ? E MSE 234 C   ? ? ? 1_555 E LYS 235 N  ? ? E MSE 231 E LYS 232  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale71 covale ? ? E GLU 272 C   ? ? ? 1_555 E MSE 273 N  ? ? E GLU 269 E MSE 270  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale72 covale ? ? E MSE 273 C   ? ? ? 1_555 E LEU 274 N  ? ? E MSE 270 E LEU 271  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale73 covale ? ? E ALA 409 C   ? ? ? 1_555 E MSE 410 N  ? ? E ALA 406 E MSE 407  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale74 covale ? ? E MSE 410 C   ? ? ? 1_555 E SER 411 N  ? ? E MSE 407 E SER 408  1_555 ? ? ? ? ? ? ? 1.323 ? 
covale75 covale ? ? E ASN 431 C   ? ? ? 1_555 E MSE 432 N  ? ? E ASN 428 E MSE 429  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale76 covale ? ? E MSE 432 C   ? ? ? 1_555 E PHE 433 N  ? ? E MSE 429 E PHE 430  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale77 covale ? ? F GLU 97  C   ? ? ? 1_555 F MSE 98  N  ? ? F GLU 94  F MSE 95   1_555 ? ? ? ? ? ? ? 1.320 ? 
covale78 covale ? ? F MSE 98  C   ? ? ? 1_555 F LEU 99  N  ? ? F MSE 95  F LEU 96   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale79 covale ? ? F TYR 128 C   ? ? ? 1_555 F MSE 129 N  ? ? F TYR 125 F MSE 126  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale80 covale ? ? F MSE 129 C   ? ? ? 1_555 F LYS 130 N  ? ? F MSE 126 F LYS 127  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale81 covale ? ? F LEU 132 C   ? ? ? 1_555 F MSE 133 N  ? ? F LEU 129 F MSE 130  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale82 covale ? ? F MSE 133 C   ? ? ? 1_555 F ASP 134 N  ? ? F MSE 130 F ASP 131  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale83 covale ? ? F GLU 232 C   ? ? ? 1_555 F MSE 233 N  ? ? F GLU 229 F MSE 230  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale84 covale ? ? F MSE 233 C   ? ? ? 1_555 F MSE 234 N  ? ? F MSE 230 F MSE 231  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale85 covale ? ? F MSE 234 C   ? ? ? 1_555 F LYS 235 N  ? ? F MSE 231 F LYS 232  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale86 covale ? ? F GLU 272 C   ? ? ? 1_555 F MSE 273 N  ? ? F GLU 269 F MSE 270  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale87 covale ? ? F MSE 273 C   ? ? ? 1_555 F LEU 274 N  ? ? F MSE 270 F LEU 271  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale88 covale ? ? F ALA 409 C   ? ? ? 1_555 F MSE 410 N  ? ? F ALA 406 F MSE 407  1_555 ? ? ? ? ? ? ? 1.310 ? 
covale89 covale ? ? F MSE 410 C   ? ? ? 1_555 F SER 411 N  ? ? F MSE 407 F SER 408  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale90 covale ? ? F ASN 431 C   ? ? ? 1_555 F MSE 432 N  ? ? F ASN 428 F MSE 429  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale91 covale ? ? F MSE 432 C   ? ? ? 1_555 F PHE 433 N  ? ? F MSE 429 F PHE 430  1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc1  metalc ? ? C HIS 7   NE2 ? ? ? 1_555 L LI  .   LI ? ? C HIS 4   C LI  451  1_555 ? ? ? ? ? ? ? 1.894 ? 
metalc2  metalc ? ? C ASP 243 OD1 ? ? ? 1_555 L LI  .   LI ? ? C ASP 240 C LI  451  1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc3  metalc ? ? C ASP 243 OD2 ? ? ? 1_555 L LI  .   LI ? ? C ASP 240 C LI  451  1_555 ? ? ? ? ? ? ? 1.806 ? 
metalc4  metalc ? ? F GLU 443 OE2 ? ? ? 1_555 L LI  .   LI ? ? F GLU 440 C LI  451  1_555 ? ? ? ? ? ? ? 1.794 ? 
metalc5  metalc ? ? L LI  .   LI  ? ? ? 1_555 P HOH .   O  ? ? C LI  451 C HOH 1214 1_555 ? ? ? ? ? ? ? 2.142 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 310 A . ? PHE 307 A SER 311 A ? SER 308 A 1 -0.55 
2 PHE 310 B . ? PHE 307 B SER 311 B ? SER 308 B 1 -1.64 
3 PHE 310 C . ? PHE 307 C SER 311 C ? SER 308 C 1 -0.63 
4 PHE 310 D . ? PHE 307 D SER 311 D ? SER 308 D 1 -0.95 
5 PHE 310 E . ? PHE 307 E SER 311 E ? SER 308 E 1 -0.71 
6 PHE 310 F . ? PHE 307 F SER 311 F ? SER 308 F 1 0.20  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
F ? 5 ? 
G ? 5 ? 
H ? 5 ? 
I ? 5 ? 
J ? 5 ? 
K ? 5 ? 
L ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 9   ? ASP A 11  ? THR A 6   ASP A 8   
A 2 ASN A 384 ? ILE A 389 ? ASN A 381 ILE A 386 
A 3 LEU A 328 ? VAL A 335 ? LEU A 325 VAL A 332 
A 4 ILE A 271 ? ASN A 276 ? ILE A 268 ASN A 273 
A 5 PHE A 304 ? ASN A 309 ? PHE A 301 ASN A 306 
B 1 GLN A 116 ? VAL A 120 ? GLN A 113 VAL A 117 
B 2 ILE A 79  ? VAL A 83  ? ILE A 76  VAL A 80  
B 3 PHE A 141 ? ILE A 146 ? PHE A 138 ILE A 143 
B 4 ILE A 179 ? THR A 183 ? ILE A 176 THR A 180 
B 5 GLU A 200 ? VAL A 203 ? GLU A 197 VAL A 200 
C 1 THR B 9   ? ASP B 11  ? THR B 6   ASP B 8   
C 2 ASN B 384 ? ILE B 389 ? ASN B 381 ILE B 386 
C 3 LEU B 328 ? VAL B 335 ? LEU B 325 VAL B 332 
C 4 ILE B 271 ? ASN B 276 ? ILE B 268 ASN B 273 
C 5 PHE B 304 ? ASN B 309 ? PHE B 301 ASN B 306 
D 1 GLN B 116 ? VAL B 120 ? GLN B 113 VAL B 117 
D 2 ILE B 79  ? VAL B 83  ? ILE B 76  VAL B 80  
D 3 PHE B 141 ? SER B 147 ? PHE B 138 SER B 144 
D 4 ILE B 179 ? THR B 183 ? ILE B 176 THR B 180 
D 5 GLU B 200 ? VAL B 203 ? GLU B 197 VAL B 200 
E 1 THR C 9   ? ASP C 11  ? THR C 6   ASP C 8   
E 2 ASN C 384 ? GLU C 391 ? ASN C 381 GLU C 388 
E 3 LEU C 328 ? LYS C 337 ? LEU C 325 LYS C 334 
E 4 ILE C 271 ? ASN C 276 ? ILE C 268 ASN C 273 
E 5 PHE C 304 ? ASN C 309 ? PHE C 301 ASN C 306 
F 1 GLN C 116 ? VAL C 120 ? GLN C 113 VAL C 117 
F 2 ILE C 79  ? VAL C 83  ? ILE C 76  VAL C 80  
F 3 PHE C 141 ? ILE C 146 ? PHE C 138 ILE C 143 
F 4 ILE C 179 ? THR C 183 ? ILE C 176 THR C 180 
F 5 GLU C 200 ? VAL C 203 ? GLU C 197 VAL C 200 
G 1 THR D 9   ? ASP D 11  ? THR D 6   ASP D 8   
G 2 ASN D 384 ? GLU D 391 ? ASN D 381 GLU D 388 
G 3 LEU D 328 ? LYS D 337 ? LEU D 325 LYS D 334 
G 4 ILE D 271 ? ASN D 276 ? ILE D 268 ASN D 273 
G 5 PHE D 304 ? ASN D 309 ? PHE D 301 ASN D 306 
H 1 GLN D 116 ? VAL D 120 ? GLN D 113 VAL D 117 
H 2 ILE D 79  ? VAL D 83  ? ILE D 76  VAL D 80  
H 3 PHE D 141 ? ILE D 146 ? PHE D 138 ILE D 143 
H 4 ILE D 179 ? THR D 183 ? ILE D 176 THR D 180 
H 5 GLU D 200 ? VAL D 203 ? GLU D 197 VAL D 200 
I 1 THR E 9   ? ASP E 11  ? THR E 6   ASP E 8   
I 2 ASN E 384 ? ILE E 389 ? ASN E 381 ILE E 386 
I 3 LEU E 328 ? VAL E 335 ? LEU E 325 VAL E 332 
I 4 ILE E 271 ? ASN E 276 ? ILE E 268 ASN E 273 
I 5 PHE E 304 ? ASN E 309 ? PHE E 301 ASN E 306 
J 1 GLN E 116 ? VAL E 120 ? GLN E 113 VAL E 117 
J 2 ILE E 79  ? VAL E 83  ? ILE E 76  VAL E 80  
J 3 PHE E 141 ? ILE E 146 ? PHE E 138 ILE E 143 
J 4 ILE E 179 ? THR E 183 ? ILE E 176 THR E 180 
J 5 GLU E 200 ? VAL E 203 ? GLU E 197 VAL E 200 
K 1 THR F 9   ? ASP F 11  ? THR F 6   ASP F 8   
K 2 ASN F 384 ? ILE F 389 ? ASN F 381 ILE F 386 
K 3 LEU F 328 ? VAL F 335 ? LEU F 325 VAL F 332 
K 4 ILE F 271 ? ASN F 276 ? ILE F 268 ASN F 273 
K 5 PHE F 304 ? ASN F 309 ? PHE F 301 ASN F 306 
L 1 GLN F 116 ? VAL F 120 ? GLN F 113 VAL F 117 
L 2 ILE F 79  ? VAL F 83  ? ILE F 76  VAL F 80  
L 3 PHE F 141 ? ILE F 146 ? PHE F 138 ILE F 143 
L 4 ILE F 179 ? THR F 183 ? ILE F 176 THR F 180 
L 5 GLU F 200 ? VAL F 203 ? GLU F 197 VAL F 200 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 11  ? N ASP A 8   O ILE A 386 ? O ILE A 383 
A 2 3 O LEU A 385 ? O LEU A 382 N VAL A 332 ? N VAL A 329 
A 3 4 O LEU A 333 ? O LEU A 330 N ILE A 275 ? N ILE A 272 
A 4 5 N GLU A 272 ? N GLU A 269 O SER A 306 ? O SER A 303 
B 1 2 O LEU A 118 ? O LEU A 115 N VAL A 82  ? N VAL A 79  
B 2 3 N VAL A 83  ? N VAL A 80  O ILE A 146 ? O ILE A 143 
B 3 4 N VAL A 145 ? N VAL A 142 O THR A 182 ? O THR A 179 
B 4 5 N ALA A 181 ? N ALA A 178 O PHE A 202 ? O PHE A 199 
C 1 2 N ASP B 11  ? N ASP B 8   O ILE B 386 ? O ILE B 383 
C 2 3 O LEU B 385 ? O LEU B 382 N VAL B 332 ? N VAL B 329 
C 3 4 O LEU B 333 ? O LEU B 330 N ILE B 275 ? N ILE B 272 
C 4 5 N GLU B 272 ? N GLU B 269 O SER B 306 ? O SER B 303 
D 1 2 O LEU B 118 ? O LEU B 115 N VAL B 82  ? N VAL B 79  
D 2 3 N VAL B 83  ? N VAL B 80  O ILE B 146 ? O ILE B 143 
D 3 4 N VAL B 145 ? N VAL B 142 O THR B 182 ? O THR B 179 
D 4 5 N ALA B 181 ? N ALA B 178 O GLU B 200 ? O GLU B 197 
E 1 2 N ASP C 11  ? N ASP C 8   O ILE C 386 ? O ILE C 383 
E 2 3 O LEU C 385 ? O LEU C 382 N VAL C 332 ? N VAL C 329 
E 3 4 O LEU C 333 ? O LEU C 330 N ILE C 275 ? N ILE C 272 
E 4 5 N GLU C 272 ? N GLU C 269 O SER C 306 ? O SER C 303 
F 1 2 O LEU C 118 ? O LEU C 115 N VAL C 82  ? N VAL C 79  
F 2 3 N VAL C 83  ? N VAL C 80  O ILE C 146 ? O ILE C 143 
F 3 4 N ILE C 143 ? N ILE C 140 O TYR C 180 ? O TYR C 177 
F 4 5 N THR C 183 ? N THR C 180 O PHE C 202 ? O PHE C 199 
G 1 2 N ASP D 11  ? N ASP D 8   O ILE D 386 ? O ILE D 383 
G 2 3 O ILE D 389 ? O ILE D 386 N GLY D 336 ? N GLY D 333 
G 3 4 O LEU D 333 ? O LEU D 330 N ILE D 275 ? N ILE D 272 
G 4 5 N GLU D 272 ? N GLU D 269 O SER D 306 ? O SER D 303 
H 1 2 O LEU D 118 ? O LEU D 115 N VAL D 82  ? N VAL D 79  
H 2 3 N VAL D 83  ? N VAL D 80  O ILE D 146 ? O ILE D 143 
H 3 4 N VAL D 145 ? N VAL D 142 O THR D 182 ? O THR D 179 
H 4 5 N ALA D 181 ? N ALA D 178 O GLU D 200 ? O GLU D 197 
I 1 2 N ASP E 11  ? N ASP E 8   O ILE E 386 ? O ILE E 383 
I 2 3 O LEU E 385 ? O LEU E 382 N VAL E 332 ? N VAL E 329 
I 3 4 O LEU E 333 ? O LEU E 330 N ILE E 275 ? N ILE E 272 
I 4 5 N GLU E 272 ? N GLU E 269 O SER E 306 ? O SER E 303 
J 1 2 O LEU E 118 ? O LEU E 115 N VAL E 82  ? N VAL E 79  
J 2 3 N VAL E 83  ? N VAL E 80  O ILE E 146 ? O ILE E 143 
J 3 4 N VAL E 145 ? N VAL E 142 O THR E 182 ? O THR E 179 
J 4 5 N ALA E 181 ? N ALA E 178 O PHE E 202 ? O PHE E 199 
K 1 2 N ASP F 11  ? N ASP F 8   O ILE F 386 ? O ILE F 383 
K 2 3 O LEU F 385 ? O LEU F 382 N VAL F 332 ? N VAL F 329 
K 3 4 O LEU F 333 ? O LEU F 330 N ILE F 275 ? N ILE F 272 
K 4 5 N GLU F 272 ? N GLU F 269 O SER F 306 ? O SER F 303 
L 1 2 O LEU F 118 ? O LEU F 115 N VAL F 82  ? N VAL F 79  
L 2 3 N LEU F 81  ? N LEU F 78  O SER F 142 ? O SER F 139 
L 3 4 N VAL F 145 ? N VAL F 142 O THR F 182 ? O THR F 179 
L 4 5 N THR F 183 ? N THR F 180 O PHE F 202 ? O PHE F 199 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 451' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B 451'  
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 B 452' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 453' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PGE B 454' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE LI C 451'  
AC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 F 451' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  SER A 108 ? SER A 105  . ? 1_555 ? 
2  AC1 5  LYS A 109 ? LYS A 106  . ? 1_555 ? 
3  AC1 5  HOH N .   ? HOH A 508  . ? 1_555 ? 
4  AC1 5  HOH N .   ? HOH A 1330 . ? 1_555 ? 
5  AC1 5  HOH N .   ? HOH A 2001 . ? 1_555 ? 
6  AC2 2  HIS B 22  ? HIS B 19   . ? 1_555 ? 
7  AC2 2  ARG B 176 ? ARG B 173  . ? 4_557 ? 
8  AC3 9  HOH N .   ? HOH A 1865 . ? 1_555 ? 
9  AC3 9  SER B 88  ? SER B 85   . ? 1_555 ? 
10 AC3 9  SER B 147 ? SER B 144  . ? 1_555 ? 
11 AC3 9  LYS B 148 ? LYS B 145  . ? 1_555 ? 
12 AC3 9  SER B 149 ? SER B 146  . ? 1_555 ? 
13 AC3 9  THR B 152 ? THR B 149  . ? 1_555 ? 
14 AC3 9  HOH O .   ? HOH B 518  . ? 1_555 ? 
15 AC3 9  HOH O .   ? HOH B 1286 . ? 1_555 ? 
16 AC3 9  HOH O .   ? HOH B 2073 . ? 1_555 ? 
17 AC4 4  ARG B 28  ? ARG B 25   . ? 4_457 ? 
18 AC4 4  GLY B 171 ? GLY B 168  . ? 1_555 ? 
19 AC4 4  LYS B 172 ? LYS B 169  . ? 1_555 ? 
20 AC4 4  HOH O .   ? HOH B 1414 . ? 1_555 ? 
21 AC5 6  LYS B 74  ? LYS B 71   . ? 1_555 ? 
22 AC5 6  ASN B 75  ? ASN B 72   . ? 1_555 ? 
23 AC5 6  ASP B 76  ? ASP B 73   . ? 1_555 ? 
24 AC5 6  SER B 77  ? SER B 74   . ? 1_555 ? 
25 AC5 6  ASP B 140 ? ASP B 137  . ? 1_555 ? 
26 AC5 6  HOH O .   ? HOH B 2266 . ? 1_555 ? 
27 AC6 4  HIS C 7   ? HIS C 4    . ? 1_555 ? 
28 AC6 4  ASP C 243 ? ASP C 240  . ? 1_555 ? 
29 AC6 4  HOH P .   ? HOH C 1214 . ? 1_555 ? 
30 AC6 4  GLU F 443 ? GLU F 440  . ? 1_555 ? 
31 AC7 10 HIS E 39  ? HIS E 36   . ? 1_554 ? 
32 AC7 10 HOH R .   ? HOH E 490  . ? 1_554 ? 
33 AC7 10 HOH R .   ? HOH E 1412 . ? 1_554 ? 
34 AC7 10 HOH R .   ? HOH E 1729 . ? 1_554 ? 
35 AC7 10 HIS F 39  ? HIS F 36   . ? 1_555 ? 
36 AC7 10 HOH S .   ? HOH F 692  . ? 1_555 ? 
37 AC7 10 HOH S .   ? HOH F 770  . ? 1_555 ? 
38 AC7 10 HOH S .   ? HOH F 1224 . ? 1_555 ? 
39 AC7 10 HOH S .   ? HOH F 1302 . ? 1_555 ? 
40 AC7 10 HOH S .   ? HOH F 2143 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3IFS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3IFS 
_atom_sites.fract_transf_matrix[1][1]   0.008944 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003293 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013872 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
LI 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 5   ? 65.490  89.092  21.088  1.00 33.45 ? 2    SER A N   1 
ATOM   2     C  CA  . SER A 1 5   ? 65.135  88.207  22.237  1.00 33.46 ? 2    SER A CA  1 
ATOM   3     C  C   . SER A 1 5   ? 66.178  87.107  22.416  1.00 32.21 ? 2    SER A C   1 
ATOM   4     O  O   . SER A 1 5   ? 66.854  86.711  21.451  1.00 32.41 ? 2    SER A O   1 
ATOM   5     C  CB  . SER A 1 5   ? 63.775  87.548  22.021  1.00 34.31 ? 2    SER A CB  1 
ATOM   6     O  OG  . SER A 1 5   ? 63.858  86.580  20.985  1.00 37.51 ? 2    SER A OG  1 
ATOM   7     N  N   . THR A 1 6   ? 66.300  86.625  23.656  1.00 29.26 ? 3    THR A N   1 
ATOM   8     C  CA  . THR A 1 6   ? 67.248  85.574  24.010  1.00 26.49 ? 3    THR A CA  1 
ATOM   9     C  C   . THR A 1 6   ? 66.541  84.607  24.979  1.00 24.55 ? 3    THR A C   1 
ATOM   10    O  O   . THR A 1 6   ? 65.635  85.014  25.712  1.00 23.77 ? 3    THR A O   1 
ATOM   11    C  CB  . THR A 1 6   ? 68.557  86.157  24.620  1.00 26.36 ? 3    THR A CB  1 
ATOM   12    O  OG1 . THR A 1 6   ? 68.250  86.966  25.756  1.00 26.49 ? 3    THR A OG1 1 
ATOM   13    C  CG2 . THR A 1 6   ? 69.308  87.034  23.587  1.00 26.65 ? 3    THR A CG2 1 
ATOM   14    N  N   . HIS A 1 7   ? 66.947  83.336  24.964  1.00 21.29 ? 4    HIS A N   1 
ATOM   15    C  CA  . HIS A 1 7   ? 66.322  82.289  25.800  1.00 19.11 ? 4    HIS A CA  1 
ATOM   16    C  C   . HIS A 1 7   ? 66.517  82.623  27.281  1.00 17.70 ? 4    HIS A C   1 
ATOM   17    O  O   . HIS A 1 7   ? 65.560  82.676  28.046  1.00 17.08 ? 4    HIS A O   1 
ATOM   18    C  CB  . HIS A 1 7   ? 66.890  80.924  25.429  1.00 18.69 ? 4    HIS A CB  1 
ATOM   19    C  CG  . HIS A 1 7   ? 66.208  79.775  26.110  1.00 19.13 ? 4    HIS A CG  1 
ATOM   20    N  ND1 . HIS A 1 7   ? 64.939  79.352  25.768  1.00 20.59 ? 4    HIS A ND1 1 
ATOM   21    C  CD2 . HIS A 1 7   ? 66.647  78.917  27.060  1.00 16.06 ? 4    HIS A CD2 1 
ATOM   22    C  CE1 . HIS A 1 7   ? 64.609  78.309  26.512  1.00 19.86 ? 4    HIS A CE1 1 
ATOM   23    N  NE2 . HIS A 1 7   ? 65.629  78.021  27.300  1.00 19.26 ? 4    HIS A NE2 1 
ATOM   24    N  N   . VAL A 1 8   ? 67.765  82.840  27.677  1.00 17.20 ? 5    VAL A N   1 
ATOM   25    C  CA  . VAL A 1 8   ? 68.078  83.297  29.015  1.00 16.44 ? 5    VAL A CA  1 
ATOM   26    C  C   . VAL A 1 8   ? 68.209  84.810  28.855  1.00 16.87 ? 5    VAL A C   1 
ATOM   27    O  O   . VAL A 1 8   ? 68.788  85.275  27.873  1.00 16.17 ? 5    VAL A O   1 
ATOM   28    C  CB  . VAL A 1 8   ? 69.386  82.723  29.522  1.00 17.61 ? 5    VAL A CB  1 
ATOM   29    C  CG1 . VAL A 1 8   ? 69.855  83.475  30.777  1.00 16.85 ? 5    VAL A CG1 1 
ATOM   30    C  CG2 . VAL A 1 8   ? 69.244  81.194  29.768  1.00 17.57 ? 5    VAL A CG2 1 
ATOM   31    N  N   . THR A 1 9   ? 67.637  85.580  29.779  1.00 16.66 ? 6    THR A N   1 
ATOM   32    C  CA  . THR A 1 9   ? 67.709  87.031  29.699  1.00 15.07 ? 6    THR A CA  1 
ATOM   33    C  C   . THR A 1 9   ? 68.398  87.594  30.947  1.00 14.92 ? 6    THR A C   1 
ATOM   34    O  O   . THR A 1 9   ? 68.465  86.943  31.992  1.00 13.81 ? 6    THR A O   1 
ATOM   35    C  CB  . THR A 1 9   ? 66.308  87.668  29.538  1.00 15.60 ? 6    THR A CB  1 
ATOM   36    O  OG1 . THR A 1 9   ? 65.506  87.363  30.687  1.00 17.43 ? 6    THR A OG1 1 
ATOM   37    C  CG2 . THR A 1 9   ? 65.592  87.163  28.231  1.00 17.39 ? 6    THR A CG2 1 
ATOM   38    N  N   . PHE A 1 10  ? 68.924  88.811  30.804  1.00 14.31 ? 7    PHE A N   1 
ATOM   39    C  CA  . PHE A 1 10  ? 69.619  89.519  31.852  1.00 13.02 ? 7    PHE A CA  1 
ATOM   40    C  C   . PHE A 1 10  ? 68.887  90.827  32.127  1.00 13.95 ? 7    PHE A C   1 
ATOM   41    O  O   . PHE A 1 10  ? 68.661  91.619  31.219  1.00 13.29 ? 7    PHE A O   1 
ATOM   42    C  CB  . PHE A 1 10  ? 71.069  89.790  31.445  1.00 13.77 ? 7    PHE A CB  1 
ATOM   43    C  CG  . PHE A 1 10  ? 71.810  90.628  32.423  1.00 12.17 ? 7    PHE A CG  1 
ATOM   44    C  CD1 . PHE A 1 10  ? 72.073  90.152  33.689  1.00 12.73 ? 7    PHE A CD1 1 
ATOM   45    C  CD2 . PHE A 1 10  ? 72.270  91.883  32.077  1.00 14.59 ? 7    PHE A CD2 1 
ATOM   46    C  CE1 . PHE A 1 10  ? 72.742  90.930  34.607  1.00 14.64 ? 7    PHE A CE1 1 
ATOM   47    C  CE2 . PHE A 1 10  ? 72.961  92.660  32.994  1.00 15.70 ? 7    PHE A CE2 1 
ATOM   48    C  CZ  . PHE A 1 10  ? 73.198  92.178  34.256  1.00 14.19 ? 7    PHE A CZ  1 
ATOM   49    N  N   . ASP A 1 11  ? 68.504  91.037  33.381  1.00 13.66 ? 8    ASP A N   1 
ATOM   50    C  CA  . ASP A 1 11  ? 67.743  92.205  33.771  1.00 14.62 ? 8    ASP A CA  1 
ATOM   51    C  C   . ASP A 1 11  ? 68.462  92.967  34.895  1.00 13.67 ? 8    ASP A C   1 
ATOM   52    O  O   . ASP A 1 11  ? 68.640  92.444  36.001  1.00 14.04 ? 8    ASP A O   1 
ATOM   53    C  CB  . ASP A 1 11  ? 66.334  91.743  34.208  1.00 14.81 ? 8    ASP A CB  1 
ATOM   54    C  CG  . ASP A 1 11  ? 65.421  92.893  34.659  1.00 17.92 ? 8    ASP A CG  1 
ATOM   55    O  OD1 . ASP A 1 11  ? 65.737  94.082  34.440  1.00 21.91 ? 8    ASP A OD1 1 
ATOM   56    O  OD2 . ASP A 1 11  ? 64.368  92.593  35.255  1.00 17.68 ? 8    ASP A OD2 1 
ATOM   57    N  N   . TYR A 1 12  ? 68.902  94.181  34.581  1.00 13.50 ? 9    TYR A N   1 
ATOM   58    C  CA  . TYR A 1 12  ? 69.558  95.052  35.550  1.00 13.92 ? 9    TYR A CA  1 
ATOM   59    C  C   . TYR A 1 12  ? 68.650  96.242  35.908  1.00 14.56 ? 9    TYR A C   1 
ATOM   60    O  O   . TYR A 1 12  ? 69.046  97.141  36.650  1.00 14.50 ? 9    TYR A O   1 
ATOM   61    C  CB  . TYR A 1 12  ? 70.908  95.543  35.024  1.00 14.74 ? 9    TYR A CB  1 
ATOM   62    C  CG  . TYR A 1 12  ? 70.873  96.337  33.743  1.00 16.27 ? 9    TYR A CG  1 
ATOM   63    C  CD1 . TYR A 1 12  ? 70.710  97.718  33.761  1.00 16.71 ? 9    TYR A CD1 1 
ATOM   64    C  CD2 . TYR A 1 12  ? 71.037  95.712  32.515  1.00 18.01 ? 9    TYR A CD2 1 
ATOM   65    C  CE1 . TYR A 1 12  ? 70.679  98.448  32.591  1.00 20.74 ? 9    TYR A CE1 1 
ATOM   66    C  CE2 . TYR A 1 12  ? 71.009  96.427  31.335  1.00 20.81 ? 9    TYR A CE2 1 
ATOM   67    C  CZ  . TYR A 1 12  ? 70.832  97.797  31.371  1.00 22.55 ? 9    TYR A CZ  1 
ATOM   68    O  OH  . TYR A 1 12  ? 70.823  98.519  30.189  1.00 19.67 ? 9    TYR A OH  1 
ATOM   69    N  N   . SER A 1 13  ? 67.418  96.220  35.418  1.00 15.16 ? 10   SER A N   1 
ATOM   70    C  CA  . SER A 1 13  ? 66.492  97.327  35.650  1.00 15.61 ? 10   SER A CA  1 
ATOM   71    C  C   . SER A 1 13  ? 66.162  97.531  37.120  1.00 16.32 ? 10   SER A C   1 
ATOM   72    O  O   . SER A 1 13  ? 65.875  98.651  37.533  1.00 17.20 ? 10   SER A O   1 
ATOM   73    C  CB  . SER A 1 13  ? 65.198  97.157  34.834  1.00 16.66 ? 10   SER A CB  1 
ATOM   74    O  OG  . SER A 1 13  ? 64.379  96.108  35.335  1.00 16.33 ? 10   SER A OG  1 
ATOM   75    N  N   . LYS A 1 14  ? 66.228  96.477  37.927  1.00 15.61 ? 11   LYS A N   1 
ATOM   76    C  CA  . LYS A 1 14  ? 65.936  96.623  39.351  1.00 15.82 ? 11   LYS A CA  1 
ATOM   77    C  C   . LYS A 1 14  ? 67.117  97.240  40.114  1.00 15.20 ? 11   LYS A C   1 
ATOM   78    O  O   . LYS A 1 14  ? 67.005  97.515  41.312  1.00 14.89 ? 11   LYS A O   1 
ATOM   79    C  CB  . LYS A 1 14  ? 65.563  95.273  39.985  1.00 16.47 ? 11   LYS A CB  1 
ATOM   80    C  CG  . LYS A 1 14  ? 64.506  94.471  39.249  1.00 21.38 ? 11   LYS A CG  1 
ATOM   81    C  CD  . LYS A 1 14  ? 63.205  95.180  39.079  1.00 26.80 ? 11   LYS A CD  1 
ATOM   82    C  CE  . LYS A 1 14  ? 62.126  94.189  38.566  1.00 31.60 ? 11   LYS A CE  1 
ATOM   83    N  NZ  . LYS A 1 14  ? 62.452  93.560  37.247  1.00 31.40 ? 11   LYS A NZ  1 
ATOM   84    N  N   . ALA A 1 15  ? 68.249  97.444  39.429  1.00 14.08 ? 12   ALA A N   1 
ATOM   85    C  CA  . ALA A 1 15  ? 69.441  98.053  40.050  1.00 14.27 ? 12   ALA A CA  1 
ATOM   86    C  C   . ALA A 1 15  ? 69.716  99.478  39.530  1.00 15.24 ? 12   ALA A C   1 
ATOM   87    O  O   . ALA A 1 15  ? 70.790  100.052 39.759  1.00 15.10 ? 12   ALA A O   1 
ATOM   88    C  CB  . ALA A 1 15  ? 70.643  97.177  39.816  1.00 9.40  ? 12   ALA A CB  1 
ATOM   89    N  N   . LEU A 1 16  ? 68.737  100.079 38.867  1.00 16.31 ? 13   LEU A N   1 
ATOM   90    C  CA  . LEU A 1 16  ? 68.968  101.400 38.281  1.00 16.68 ? 13   LEU A CA  1 
ATOM   91    C  C   . LEU A 1 16  ? 69.211  102.515 39.309  1.00 16.27 ? 13   LEU A C   1 
ATOM   92    O  O   . LEU A 1 16  ? 69.737  103.558 38.962  1.00 16.65 ? 13   LEU A O   1 
ATOM   93    C  CB  . LEU A 1 16  ? 67.859  101.766 37.285  1.00 17.48 ? 13   LEU A CB  1 
ATOM   94    C  CG  . LEU A 1 16  ? 67.864  100.954 35.969  1.00 16.84 ? 13   LEU A CG  1 
ATOM   95    C  CD1 . LEU A 1 16  ? 66.556  101.181 35.137  1.00 18.37 ? 13   LEU A CD1 1 
ATOM   96    C  CD2 . LEU A 1 16  ? 69.090  101.281 35.113  1.00 19.00 ? 13   LEU A CD2 1 
ATOM   97    N  N   . SER A 1 17  ? 68.827  102.317 40.560  1.00 14.99 ? 14   SER A N   1 
ATOM   98    C  CA  . SER A 1 17  ? 69.113  103.343 41.545  1.00 16.00 ? 14   SER A CA  1 
ATOM   99    C  C   . SER A 1 17  ? 70.600  103.282 41.933  1.00 14.22 ? 14   SER A C   1 
ATOM   100   O  O   . SER A 1 17  ? 71.104  104.201 42.555  1.00 14.48 ? 14   SER A O   1 
ATOM   101   C  CB  . SER A 1 17  ? 68.204  103.227 42.763  1.00 15.76 ? 14   SER A CB  1 
ATOM   102   O  OG  . SER A 1 17  ? 68.367  101.963 43.374  1.00 23.19 ? 14   SER A OG  1 
ATOM   103   N  N   . PHE A 1 18  ? 71.290  102.205 41.544  1.00 14.84 ? 15   PHE A N   1 
ATOM   104   C  CA  . PHE A 1 18  ? 72.726  102.036 41.815  1.00 15.74 ? 15   PHE A CA  1 
ATOM   105   C  C   . PHE A 1 18  ? 73.615  102.265 40.582  1.00 16.46 ? 15   PHE A C   1 
ATOM   106   O  O   . PHE A 1 18  ? 74.772  102.667 40.715  1.00 15.91 ? 15   PHE A O   1 
ATOM   107   C  CB  . PHE A 1 18  ? 73.009  100.617 42.331  1.00 15.80 ? 15   PHE A CB  1 
ATOM   108   C  CG  . PHE A 1 18  ? 72.310  100.296 43.624  1.00 16.75 ? 15   PHE A CG  1 
ATOM   109   C  CD1 . PHE A 1 18  ? 71.127  99.578  43.630  1.00 16.55 ? 15   PHE A CD1 1 
ATOM   110   C  CD2 . PHE A 1 18  ? 72.833  100.739 44.832  1.00 18.66 ? 15   PHE A CD2 1 
ATOM   111   C  CE1 . PHE A 1 18  ? 70.475  99.287  44.825  1.00 19.33 ? 15   PHE A CE1 1 
ATOM   112   C  CE2 . PHE A 1 18  ? 72.197  100.459 46.029  1.00 19.78 ? 15   PHE A CE2 1 
ATOM   113   C  CZ  . PHE A 1 18  ? 71.007  99.733  46.026  1.00 19.34 ? 15   PHE A CZ  1 
ATOM   114   N  N   . ILE A 1 19  ? 73.076  101.972 39.399  1.00 16.69 ? 16   ILE A N   1 
ATOM   115   C  CA  . ILE A 1 19  ? 73.810  102.097 38.152  1.00 18.73 ? 16   ILE A CA  1 
ATOM   116   C  C   . ILE A 1 19  ? 72.920  102.728 37.078  1.00 19.53 ? 16   ILE A C   1 
ATOM   117   O  O   . ILE A 1 19  ? 71.808  102.276 36.827  1.00 20.80 ? 16   ILE A O   1 
ATOM   118   C  CB  . ILE A 1 19  ? 74.353  100.707 37.700  1.00 19.22 ? 16   ILE A CB  1 
ATOM   119   C  CG1 . ILE A 1 19  ? 75.354  100.852 36.546  1.00 21.05 ? 16   ILE A CG1 1 
ATOM   120   C  CG2 . ILE A 1 19  ? 73.211  99.753  37.349  1.00 21.42 ? 16   ILE A CG2 1 
ATOM   121   C  CD1 . ILE A 1 19  ? 76.013  99.535  36.152  1.00 18.12 ? 16   ILE A CD1 1 
ATOM   122   N  N   . GLY A 1 20  ? 73.387  103.823 36.489  1.00 18.16 ? 17   GLY A N   1 
ATOM   123   C  CA  . GLY A 1 20  ? 72.617  104.490 35.457  1.00 17.89 ? 17   GLY A CA  1 
ATOM   124   C  C   . GLY A 1 20  ? 72.862  103.877 34.097  1.00 17.68 ? 17   GLY A C   1 
ATOM   125   O  O   . GLY A 1 20  ? 73.930  103.309 33.846  1.00 16.15 ? 17   GLY A O   1 
ATOM   126   N  N   . GLU A 1 21  ? 71.885  104.011 33.201  1.00 16.74 ? 18   GLU A N   1 
ATOM   127   C  CA  . GLU A 1 21  ? 72.021  103.463 31.852  1.00 16.81 ? 18   GLU A CA  1 
ATOM   128   C  C   . GLU A 1 21  ? 73.256  103.997 31.136  1.00 15.09 ? 18   GLU A C   1 
ATOM   129   O  O   . GLU A 1 21  ? 73.844  103.291 30.344  1.00 13.73 ? 18   GLU A O   1 
ATOM   130   C  CB  . GLU A 1 21  ? 70.775  103.766 31.006  1.00 17.79 ? 18   GLU A CB  1 
ATOM   131   C  CG  . GLU A 1 21  ? 69.510  103.029 31.432  1.00 22.01 ? 18   GLU A CG  1 
ATOM   132   C  CD  . GLU A 1 21  ? 69.516  101.529 31.084  1.00 23.97 ? 18   GLU A CD  1 
ATOM   133   O  OE1 . GLU A 1 21  ? 70.532  101.015 30.528  1.00 22.08 ? 18   GLU A OE1 1 
ATOM   134   O  OE2 . GLU A 1 21  ? 68.465  100.881 31.344  1.00 21.30 ? 18   GLU A OE2 1 
ATOM   135   N  N   . HIS A 1 22  ? 73.627  105.251 31.391  1.00 14.93 ? 19   HIS A N   1 
ATOM   136   C  CA  . HIS A 1 22  ? 74.781  105.853 30.732  1.00 14.55 ? 19   HIS A CA  1 
ATOM   137   C  C   . HIS A 1 22  ? 76.085  105.120 31.044  1.00 14.38 ? 19   HIS A C   1 
ATOM   138   O  O   . HIS A 1 22  ? 76.996  105.156 30.234  1.00 12.64 ? 19   HIS A O   1 
ATOM   139   C  CB  . HIS A 1 22  ? 74.936  107.335 31.099  1.00 16.48 ? 19   HIS A CB  1 
ATOM   140   C  CG  . HIS A 1 22  ? 75.264  107.573 32.543  1.00 16.50 ? 19   HIS A CG  1 
ATOM   141   N  ND1 . HIS A 1 22  ? 74.294  107.688 33.516  1.00 16.84 ? 19   HIS A ND1 1 
ATOM   142   C  CD2 . HIS A 1 22  ? 76.453  107.718 33.177  1.00 19.78 ? 19   HIS A CD2 1 
ATOM   143   C  CE1 . HIS A 1 22  ? 74.873  107.895 34.688  1.00 19.91 ? 19   HIS A CE1 1 
ATOM   144   N  NE2 . HIS A 1 22  ? 76.182  107.920 34.511  1.00 17.92 ? 19   HIS A NE2 1 
ATOM   145   N  N   . GLU A 1 23  ? 76.171  104.472 32.215  1.00 14.12 ? 20   GLU A N   1 
ATOM   146   C  CA  . GLU A 1 23  ? 77.372  103.738 32.606  1.00 15.20 ? 20   GLU A CA  1 
ATOM   147   C  C   . GLU A 1 23  ? 77.578  102.548 31.679  1.00 14.91 ? 20   GLU A C   1 
ATOM   148   O  O   . GLU A 1 23  ? 78.702  102.157 31.417  1.00 13.93 ? 20   GLU A O   1 
ATOM   149   C  CB  . GLU A 1 23  ? 77.309  103.263 34.066  1.00 15.39 ? 20   GLU A CB  1 
ATOM   150   C  CG  . GLU A 1 23  ? 77.166  104.388 35.068  1.00 18.11 ? 20   GLU A CG  1 
ATOM   151   C  CD  . GLU A 1 23  ? 77.205  103.910 36.491  1.00 17.29 ? 20   GLU A CD  1 
ATOM   152   O  OE1 . GLU A 1 23  ? 78.078  103.075 36.820  1.00 16.97 ? 20   GLU A OE1 1 
ATOM   153   O  OE2 . GLU A 1 23  ? 76.364  104.380 37.280  1.00 14.72 ? 20   GLU A OE2 1 
ATOM   154   N  N   . ILE A 1 24  ? 76.483  101.993 31.173  1.00 14.14 ? 21   ILE A N   1 
ATOM   155   C  CA  . ILE A 1 24  ? 76.567  100.887 30.255  1.00 15.76 ? 21   ILE A CA  1 
ATOM   156   C  C   . ILE A 1 24  ? 76.866  101.453 28.864  1.00 16.59 ? 21   ILE A C   1 
ATOM   157   O  O   . ILE A 1 24  ? 77.795  101.008 28.188  1.00 15.40 ? 21   ILE A O   1 
ATOM   158   C  CB  . ILE A 1 24  ? 75.262  100.065 30.250  1.00 16.73 ? 21   ILE A CB  1 
ATOM   159   C  CG1 . ILE A 1 24  ? 75.002  99.501  31.648  1.00 17.57 ? 21   ILE A CG1 1 
ATOM   160   C  CG2 . ILE A 1 24  ? 75.325  98.967  29.185  1.00 16.73 ? 21   ILE A CG2 1 
ATOM   161   C  CD1 . ILE A 1 24  ? 73.720  98.754  31.770  1.00 22.49 ? 21   ILE A CD1 1 
ATOM   162   N  N   . THR A 1 25  ? 76.094  102.465 28.461  1.00 16.98 ? 22   THR A N   1 
ATOM   163   C  CA  . THR A 1 25  ? 76.289  103.115 27.163  1.00 18.63 ? 22   THR A CA  1 
ATOM   164   C  C   . THR A 1 25  ? 77.736  103.546 26.918  1.00 18.67 ? 22   THR A C   1 
ATOM   165   O  O   . THR A 1 25  ? 78.241  103.387 25.805  1.00 19.20 ? 22   THR A O   1 
ATOM   166   C  CB  . THR A 1 25  ? 75.385  104.356 27.019  1.00 18.64 ? 22   THR A CB  1 
ATOM   167   O  OG1 . THR A 1 25  ? 74.020  103.947 27.087  1.00 23.02 ? 22   THR A OG1 1 
ATOM   168   C  CG2 . THR A 1 25  ? 75.637  105.082 25.691  1.00 22.20 ? 22   THR A CG2 1 
ATOM   169   N  N   . TYR A 1 26  ? 78.413  104.071 27.939  1.00 17.07 ? 23   TYR A N   1 
ATOM   170   C  CA  . TYR A 1 26  ? 79.791  104.541 27.741  1.00 17.40 ? 23   TYR A CA  1 
ATOM   171   C  C   . TYR A 1 26  ? 80.819  103.472 27.374  1.00 17.01 ? 23   TYR A C   1 
ATOM   172   O  O   . TYR A 1 26  ? 81.918  103.812 26.945  1.00 16.30 ? 23   TYR A O   1 
ATOM   173   C  CB  . TYR A 1 26  ? 80.323  105.324 28.950  1.00 17.35 ? 23   TYR A CB  1 
ATOM   174   C  CG  . TYR A 1 26  ? 79.590  106.601 29.292  1.00 16.33 ? 23   TYR A CG  1 
ATOM   175   C  CD1 . TYR A 1 26  ? 78.815  107.268 28.347  1.00 22.00 ? 23   TYR A CD1 1 
ATOM   176   C  CD2 . TYR A 1 26  ? 79.824  107.239 30.502  1.00 21.06 ? 23   TYR A CD2 1 
ATOM   177   C  CE1 . TYR A 1 26  ? 78.184  108.461 28.657  1.00 22.71 ? 23   TYR A CE1 1 
ATOM   178   C  CE2 . TYR A 1 26  ? 79.211  108.441 30.815  1.00 17.65 ? 23   TYR A CE2 1 
ATOM   179   C  CZ  . TYR A 1 26  ? 78.394  109.043 29.898  1.00 21.39 ? 23   TYR A CZ  1 
ATOM   180   O  OH  . TYR A 1 26  ? 77.799  110.253 30.210  1.00 27.33 ? 23   TYR A OH  1 
ATOM   181   N  N   . LEU A 1 27  ? 80.480  102.203 27.570  1.00 16.60 ? 24   LEU A N   1 
ATOM   182   C  CA  . LEU A 1 27  ? 81.380  101.080 27.252  1.00 17.11 ? 24   LEU A CA  1 
ATOM   183   C  C   . LEU A 1 27  ? 81.162  100.417 25.890  1.00 16.93 ? 24   LEU A C   1 
ATOM   184   O  O   . LEU A 1 27  ? 81.871  99.473  25.528  1.00 15.66 ? 24   LEU A O   1 
ATOM   185   C  CB  . LEU A 1 27  ? 81.331  100.018 28.366  1.00 16.40 ? 24   LEU A CB  1 
ATOM   186   C  CG  . LEU A 1 27  ? 82.283  100.263 29.553  1.00 17.46 ? 24   LEU A CG  1 
ATOM   187   C  CD1 . LEU A 1 27  ? 83.718  100.099 29.095  1.00 16.69 ? 24   LEU A CD1 1 
ATOM   188   C  CD2 . LEU A 1 27  ? 82.102  101.633 30.202  1.00 12.98 ? 24   LEU A CD2 1 
ATOM   189   N  N   . ARG A 1 28  ? 80.231  100.947 25.113  1.00 17.46 ? 25   ARG A N   1 
ATOM   190   C  CA  . ARG A 1 28  ? 79.927  100.403 23.792  1.00 18.67 ? 25   ARG A CA  1 
ATOM   191   C  C   . ARG A 1 28  ? 81.158  100.199 22.891  1.00 17.57 ? 25   ARG A C   1 
ATOM   192   O  O   . ARG A 1 28  ? 81.377  99.100  22.359  1.00 16.09 ? 25   ARG A O   1 
ATOM   193   C  CB  . ARG A 1 28  ? 78.926  101.310 23.091  1.00 19.90 ? 25   ARG A CB  1 
ATOM   194   C  CG  . ARG A 1 28  ? 78.502  100.801 21.739  1.00 25.38 ? 25   ARG A CG  1 
ATOM   195   C  CD  . ARG A 1 28  ? 77.557  101.756 21.024  1.00 31.77 ? 25   ARG A CD  1 
ATOM   196   N  NE  . ARG A 1 28  ? 77.200  101.235 19.704  1.00 37.82 ? 25   ARG A NE  1 
ATOM   197   C  CZ  . ARG A 1 28  ? 77.989  101.308 18.632  1.00 41.46 ? 25   ARG A CZ  1 
ATOM   198   N  NH1 . ARG A 1 28  ? 79.197  101.854 18.716  1.00 44.93 ? 25   ARG A NH1 1 
ATOM   199   N  NH2 . ARG A 1 28  ? 77.585  100.805 17.473  1.00 42.52 ? 25   ARG A NH2 1 
ATOM   200   N  N   . ASP A 1 29  ? 81.952  101.252 22.711  1.00 16.73 ? 26   ASP A N   1 
ATOM   201   C  CA  . ASP A 1 29  ? 83.127  101.166 21.847  1.00 16.76 ? 26   ASP A CA  1 
ATOM   202   C  C   . ASP A 1 29  ? 84.135  100.143 22.355  1.00 15.83 ? 26   ASP A C   1 
ATOM   203   O  O   . ASP A 1 29  ? 84.703  99.393  21.573  1.00 16.47 ? 26   ASP A O   1 
ATOM   204   C  CB  . ASP A 1 29  ? 83.796  102.531 21.698  1.00 17.41 ? 26   ASP A CB  1 
ATOM   205   C  CG  . ASP A 1 29  ? 82.943  103.537 20.911  1.00 20.99 ? 26   ASP A CG  1 
ATOM   206   O  OD1 . ASP A 1 29  ? 81.910  103.156 20.321  1.00 23.56 ? 26   ASP A OD1 1 
ATOM   207   O  OD2 . ASP A 1 29  ? 83.337  104.727 20.865  1.00 25.71 ? 26   ASP A OD2 1 
ATOM   208   N  N   . ALA A 1 30  ? 84.366  100.134 23.665  1.00 14.56 ? 27   ALA A N   1 
ATOM   209   C  CA  . ALA A 1 30  ? 85.302  99.197  24.283  1.00 13.96 ? 27   ALA A CA  1 
ATOM   210   C  C   . ALA A 1 30  ? 84.820  97.755  24.137  1.00 13.18 ? 27   ALA A C   1 
ATOM   211   O  O   . ALA A 1 30  ? 85.623  96.846  23.891  1.00 12.24 ? 27   ALA A O   1 
ATOM   212   C  CB  . ALA A 1 30  ? 85.486  99.539  25.748  1.00 14.51 ? 27   ALA A CB  1 
ATOM   213   N  N   . VAL A 1 31  ? 83.510  97.541  24.288  1.00 12.15 ? 28   VAL A N   1 
ATOM   214   C  CA  . VAL A 1 31  ? 82.948  96.192  24.133  1.00 11.28 ? 28   VAL A CA  1 
ATOM   215   C  C   . VAL A 1 31  ? 83.102  95.714  22.686  1.00 12.50 ? 28   VAL A C   1 
ATOM   216   O  O   . VAL A 1 31  ? 83.458  94.562  22.453  1.00 11.65 ? 28   VAL A O   1 
ATOM   217   C  CB  . VAL A 1 31  ? 81.477  96.130  24.553  1.00 11.50 ? 28   VAL A CB  1 
ATOM   218   C  CG1 . VAL A 1 31  ? 80.824  94.789  24.113  1.00 7.84  ? 28   VAL A CG1 1 
ATOM   219   C  CG2 . VAL A 1 31  ? 81.355  96.341  26.072  1.00 13.03 ? 28   VAL A CG2 1 
ATOM   220   N  N   . LYS A 1 32  ? 82.848  96.593  21.721  1.00 13.15 ? 29   LYS A N   1 
ATOM   221   C  CA  . LYS A 1 32  ? 82.977  96.202  20.313  1.00 14.24 ? 29   LYS A CA  1 
ATOM   222   C  C   . LYS A 1 32  ? 84.390  95.732  19.967  1.00 13.44 ? 29   LYS A C   1 
ATOM   223   O  O   . LYS A 1 32  ? 84.561  94.665  19.367  1.00 12.60 ? 29   LYS A O   1 
ATOM   224   C  CB  . LYS A 1 32  ? 82.528  97.317  19.350  1.00 15.25 ? 29   LYS A CB  1 
ATOM   225   C  CG  . LYS A 1 32  ? 82.861  96.948  17.872  1.00 19.70 ? 29   LYS A CG  1 
ATOM   226   C  CD  . LYS A 1 32  ? 82.330  97.901  16.806  1.00 27.39 ? 29   LYS A CD  1 
ATOM   227   C  CE  . LYS A 1 32  ? 80.837  97.728  16.578  1.00 32.23 ? 29   LYS A CE  1 
ATOM   228   N  NZ  . LYS A 1 32  ? 80.358  98.496  15.356  1.00 34.84 ? 29   LYS A NZ  1 
ATOM   229   N  N   . VAL A 1 33  ? 85.402  96.497  20.369  1.00 14.12 ? 30   VAL A N   1 
ATOM   230   C  CA  . VAL A 1 33  ? 86.790  96.127  20.051  1.00 14.56 ? 30   VAL A CA  1 
ATOM   231   C  C   . VAL A 1 33  ? 87.211  94.863  20.792  1.00 14.15 ? 30   VAL A C   1 
ATOM   232   O  O   . VAL A 1 33  ? 87.983  94.050  20.280  1.00 13.36 ? 30   VAL A O   1 
ATOM   233   C  CB  . VAL A 1 33  ? 87.802  97.312  20.284  1.00 16.63 ? 30   VAL A CB  1 
ATOM   234   C  CG1 . VAL A 1 33  ? 87.905  97.691  21.760  1.00 17.61 ? 30   VAL A CG1 1 
ATOM   235   C  CG2 . VAL A 1 33  ? 89.185  96.943  19.749  1.00 18.49 ? 30   VAL A CG2 1 
ATOM   236   N  N   . THR A 1 34  ? 86.681  94.674  21.989  1.00 13.08 ? 31   THR A N   1 
ATOM   237   C  CA  . THR A 1 34  ? 87.009  93.489  22.771  1.00 12.93 ? 31   THR A CA  1 
ATOM   238   C  C   . THR A 1 34  ? 86.347  92.247  22.173  1.00 12.95 ? 31   THR A C   1 
ATOM   239   O  O   . THR A 1 34  ? 86.926  91.157  22.181  1.00 11.58 ? 31   THR A O   1 
ATOM   240   C  CB  . THR A 1 34  ? 86.612  93.676  24.227  1.00 13.85 ? 31   THR A CB  1 
ATOM   241   O  OG1 . THR A 1 34  ? 87.262  94.853  24.737  1.00 15.17 ? 31   THR A OG1 1 
ATOM   242   C  CG2 . THR A 1 34  ? 87.014  92.487  25.041  1.00 9.85  ? 31   THR A CG2 1 
ATOM   243   N  N   . HIS A 1 35  ? 85.121  92.420  21.687  1.00 12.68 ? 32   HIS A N   1 
ATOM   244   C  CA  . HIS A 1 35  ? 84.401  91.353  21.024  1.00 13.82 ? 32   HIS A CA  1 
ATOM   245   C  C   . HIS A 1 35  ? 85.226  90.846  19.838  1.00 14.56 ? 32   HIS A C   1 
ATOM   246   O  O   . HIS A 1 35  ? 85.398  89.649  19.650  1.00 13.29 ? 32   HIS A O   1 
ATOM   247   C  CB  . HIS A 1 35  ? 83.056  91.884  20.542  1.00 14.16 ? 32   HIS A CB  1 
ATOM   248   C  CG  . HIS A 1 35  ? 82.334  90.957  19.614  1.00 12.44 ? 32   HIS A CG  1 
ATOM   249   N  ND1 . HIS A 1 35  ? 81.580  89.896  20.060  1.00 14.23 ? 32   HIS A ND1 1 
ATOM   250   C  CD2 . HIS A 1 35  ? 82.229  90.955  18.267  1.00 15.08 ? 32   HIS A CD2 1 
ATOM   251   C  CE1 . HIS A 1 35  ? 81.044  89.275  19.027  1.00 14.35 ? 32   HIS A CE1 1 
ATOM   252   N  NE2 . HIS A 1 35  ? 81.430  89.894  17.926  1.00 14.34 ? 32   HIS A NE2 1 
ATOM   253   N  N   . HIS A 1 36  ? 85.757  91.765  19.043  1.00 16.72 ? 33   HIS A N   1 
ATOM   254   C  CA  . HIS A 1 36  ? 86.559  91.348  17.885  1.00 18.66 ? 33   HIS A CA  1 
ATOM   255   C  C   . HIS A 1 36  ? 87.845  90.651  18.347  1.00 19.76 ? 33   HIS A C   1 
ATOM   256   O  O   . HIS A 1 36  ? 88.225  89.641  17.788  1.00 20.96 ? 33   HIS A O   1 
ATOM   257   C  CB  . HIS A 1 36  ? 86.797  92.501  16.910  1.00 19.13 ? 33   HIS A CB  1 
ATOM   258   C  CG  . HIS A 1 36  ? 85.541  92.976  16.236  1.00 17.67 ? 33   HIS A CG  1 
ATOM   259   N  ND1 . HIS A 1 36  ? 85.148  94.295  16.232  1.00 21.14 ? 33   HIS A ND1 1 
ATOM   260   C  CD2 . HIS A 1 36  ? 84.550  92.289  15.617  1.00 17.42 ? 33   HIS A CD2 1 
ATOM   261   C  CE1 . HIS A 1 36  ? 84.005  94.411  15.578  1.00 20.14 ? 33   HIS A CE1 1 
ATOM   262   N  NE2 . HIS A 1 36  ? 83.615  93.209  15.203  1.00 18.58 ? 33   HIS A NE2 1 
ATOM   263   N  N   . ALA A 1 37  ? 88.453  91.133  19.428  1.00 20.00 ? 34   ALA A N   1 
ATOM   264   C  CA  . ALA A 1 37  ? 89.652  90.483  19.965  1.00 20.01 ? 34   ALA A CA  1 
ATOM   265   C  C   . ALA A 1 37  ? 89.358  89.026  20.361  1.00 18.78 ? 34   ALA A C   1 
ATOM   266   O  O   . ALA A 1 37  ? 90.202  88.141  20.175  1.00 19.68 ? 34   ALA A O   1 
ATOM   267   C  CB  . ALA A 1 37  ? 90.190  91.262  21.148  1.00 19.31 ? 34   ALA A CB  1 
ATOM   268   N  N   . ILE A 1 38  ? 88.170  88.779  20.910  1.00 18.31 ? 35   ILE A N   1 
ATOM   269   C  CA  . ILE A 1 38  ? 87.754  87.420  21.302  1.00 18.74 ? 35   ILE A CA  1 
ATOM   270   C  C   . ILE A 1 38  ? 87.560  86.539  20.079  1.00 19.59 ? 35   ILE A C   1 
ATOM   271   O  O   . ILE A 1 38  ? 88.062  85.404  20.021  1.00 20.78 ? 35   ILE A O   1 
ATOM   272   C  CB  . ILE A 1 38  ? 86.420  87.422  22.101  1.00 18.89 ? 35   ILE A CB  1 
ATOM   273   C  CG1 . ILE A 1 38  ? 86.601  88.076  23.472  1.00 18.67 ? 35   ILE A CG1 1 
ATOM   274   C  CG2 . ILE A 1 38  ? 85.889  85.993  22.287  1.00 18.61 ? 35   ILE A CG2 1 
ATOM   275   C  CD1 . ILE A 1 38  ? 85.293  88.297  24.243  1.00 17.53 ? 35   ILE A CD1 1 
ATOM   276   N  N   . HIS A 1 39  ? 86.827  87.050  19.102  1.00 19.20 ? 36   HIS A N   1 
ATOM   277   C  CA  . HIS A 1 39  ? 86.553  86.279  17.895  1.00 19.77 ? 36   HIS A CA  1 
ATOM   278   C  C   . HIS A 1 39  ? 87.738  86.142  16.946  1.00 20.17 ? 36   HIS A C   1 
ATOM   279   O  O   . HIS A 1 39  ? 87.857  85.121  16.286  1.00 21.85 ? 36   HIS A O   1 
ATOM   280   C  CB  . HIS A 1 39  ? 85.275  86.762  17.200  1.00 19.06 ? 36   HIS A CB  1 
ATOM   281   C  CG  . HIS A 1 39  ? 84.043  86.440  17.987  1.00 16.78 ? 36   HIS A CG  1 
ATOM   282   N  ND1 . HIS A 1 39  ? 83.376  85.239  17.861  1.00 18.52 ? 36   HIS A ND1 1 
ATOM   283   C  CD2 . HIS A 1 39  ? 83.426  87.110  18.988  1.00 15.51 ? 36   HIS A CD2 1 
ATOM   284   C  CE1 . HIS A 1 39  ? 82.377  85.201  18.722  1.00 17.92 ? 36   HIS A CE1 1 
ATOM   285   N  NE2 . HIS A 1 39  ? 82.382  86.324  19.417  1.00 15.33 ? 36   HIS A NE2 1 
ATOM   286   N  N   . GLU A 1 40  ? 88.607  87.153  16.891  1.00 19.49 ? 37   GLU A N   1 
ATOM   287   C  CA  . GLU A 1 40  ? 89.815  87.099  16.050  1.00 19.96 ? 37   GLU A CA  1 
ATOM   288   C  C   . GLU A 1 40  ? 90.990  86.403  16.777  1.00 19.88 ? 37   GLU A C   1 
ATOM   289   O  O   . GLU A 1 40  ? 91.991  86.059  16.149  1.00 21.07 ? 37   GLU A O   1 
ATOM   290   C  CB  . GLU A 1 40  ? 90.258  88.515  15.623  1.00 18.94 ? 37   GLU A CB  1 
ATOM   291   C  CG  . GLU A 1 40  ? 89.297  89.206  14.638  1.00 21.20 ? 37   GLU A CG  1 
ATOM   292   C  CD  . GLU A 1 40  ? 89.569  90.691  14.462  1.00 23.46 ? 37   GLU A CD  1 
ATOM   293   O  OE1 . GLU A 1 40  ? 90.686  91.163  14.791  1.00 23.03 ? 37   GLU A OE1 1 
ATOM   294   O  OE2 . GLU A 1 40  ? 88.653  91.403  13.994  1.00 28.46 ? 37   GLU A OE2 1 
ATOM   295   N  N   A LYS A 1 41  ? 90.855  86.199  18.085  0.50 18.93 ? 38   LYS A N   1 
ATOM   296   N  N   B LYS A 1 41  ? 90.861  86.220  18.089  0.50 18.80 ? 38   LYS A N   1 
ATOM   297   C  CA  A LYS A 1 41  ? 91.901  85.570  18.900  0.50 18.75 ? 38   LYS A CA  1 
ATOM   298   C  CA  B LYS A 1 41  ? 91.898  85.575  18.898  0.50 18.54 ? 38   LYS A CA  1 
ATOM   299   C  C   A LYS A 1 41  ? 93.199  86.378  18.920  0.50 18.07 ? 38   LYS A C   1 
ATOM   300   C  C   B LYS A 1 41  ? 93.199  86.377  18.926  0.50 17.94 ? 38   LYS A C   1 
ATOM   301   O  O   A LYS A 1 41  ? 94.268  85.838  18.665  0.50 17.61 ? 38   LYS A O   1 
ATOM   302   O  O   B LYS A 1 41  ? 94.268  85.833  18.684  0.50 17.49 ? 38   LYS A O   1 
ATOM   303   C  CB  A LYS A 1 41  ? 92.213  84.133  18.438  0.50 18.92 ? 38   LYS A CB  1 
ATOM   304   C  CB  B LYS A 1 41  ? 92.195  84.160  18.383  0.50 18.56 ? 38   LYS A CB  1 
ATOM   305   C  CG  A LYS A 1 41  ? 91.085  83.118  18.615  0.50 19.94 ? 38   LYS A CG  1 
ATOM   306   C  CG  B LYS A 1 41  ? 91.008  83.208  18.386  0.50 19.28 ? 38   LYS A CG  1 
ATOM   307   C  CD  A LYS A 1 41  ? 90.013  83.246  17.568  0.50 21.63 ? 38   LYS A CD  1 
ATOM   308   C  CD  B LYS A 1 41  ? 91.456  81.805  17.979  0.50 19.85 ? 38   LYS A CD  1 
ATOM   309   C  CE  A LYS A 1 41  ? 88.892  82.257  17.820  0.50 23.00 ? 38   LYS A CE  1 
ATOM   310   C  CE  B LYS A 1 41  ? 90.287  80.845  17.898  0.50 23.29 ? 38   LYS A CE  1 
ATOM   311   N  NZ  A LYS A 1 41  ? 89.348  80.838  17.962  0.50 23.75 ? 38   LYS A NZ  1 
ATOM   312   N  NZ  B LYS A 1 41  ? 89.299  81.274  16.865  0.50 25.97 ? 38   LYS A NZ  1 
ATOM   313   N  N   . THR A 1 42  ? 93.111  87.665  19.234  1.00 18.09 ? 39   THR A N   1 
ATOM   314   C  CA  . THR A 1 42  ? 94.302  88.510  19.267  1.00 17.81 ? 39   THR A CA  1 
ATOM   315   C  C   . THR A 1 42  ? 94.713  88.990  20.672  1.00 18.38 ? 39   THR A C   1 
ATOM   316   O  O   . THR A 1 42  ? 95.791  89.563  20.842  1.00 17.46 ? 39   THR A O   1 
ATOM   317   C  CB  . THR A 1 42  ? 94.114  89.741  18.371  1.00 19.10 ? 39   THR A CB  1 
ATOM   318   O  OG1 . THR A 1 42  ? 92.974  90.472  18.811  1.00 16.36 ? 39   THR A OG1 1 
ATOM   319   C  CG2 . THR A 1 42  ? 93.915  89.330  16.905  1.00 18.85 ? 39   THR A CG2 1 
ATOM   320   N  N   . GLY A 1 43  ? 93.882  88.736  21.679  1.00 17.81 ? 40   GLY A N   1 
ATOM   321   C  CA  . GLY A 1 43  ? 94.181  89.203  23.035  1.00 17.99 ? 40   GLY A CA  1 
ATOM   322   C  C   . GLY A 1 43  ? 94.932  88.211  23.908  1.00 17.90 ? 40   GLY A C   1 
ATOM   323   O  O   . GLY A 1 43  ? 95.365  87.152  23.445  1.00 16.92 ? 40   GLY A O   1 
ATOM   324   N  N   . ALA A 1 44  ? 95.085  88.560  25.182  1.00 16.40 ? 41   ALA A N   1 
ATOM   325   C  CA  . ALA A 1 44  ? 95.777  87.699  26.132  1.00 15.77 ? 41   ALA A CA  1 
ATOM   326   C  C   . ALA A 1 44  ? 95.047  86.378  26.250  1.00 14.25 ? 41   ALA A C   1 
ATOM   327   O  O   . ALA A 1 44  ? 93.811  86.349  26.233  1.00 13.59 ? 41   ALA A O   1 
ATOM   328   C  CB  . ALA A 1 44  ? 95.849  88.383  27.500  1.00 14.81 ? 41   ALA A CB  1 
ATOM   329   N  N   . GLY A 1 45  ? 95.804  85.292  26.365  1.00 14.68 ? 42   GLY A N   1 
ATOM   330   C  CA  . GLY A 1 45  ? 95.231  83.947  26.511  1.00 15.66 ? 42   GLY A CA  1 
ATOM   331   C  C   . GLY A 1 45  ? 94.482  83.456  25.274  1.00 15.48 ? 42   GLY A C   1 
ATOM   332   O  O   . GLY A 1 45  ? 93.658  82.539  25.357  1.00 13.36 ? 42   GLY A O   1 
ATOM   333   N  N   . ASN A 1 46  ? 94.806  84.031  24.115  1.00 15.26 ? 43   ASN A N   1 
ATOM   334   C  CA  . ASN A 1 46  ? 94.109  83.661  22.880  1.00 17.07 ? 43   ASN A CA  1 
ATOM   335   C  C   . ASN A 1 46  ? 94.276  82.185  22.436  1.00 17.27 ? 43   ASN A C   1 
ATOM   336   O  O   . ASN A 1 46  ? 93.545  81.724  21.548  1.00 16.93 ? 43   ASN A O   1 
ATOM   337   C  CB  . ASN A 1 46  ? 94.428  84.641  21.750  1.00 16.32 ? 43   ASN A CB  1 
ATOM   338   C  CG  . ASN A 1 46  ? 95.837  84.555  21.290  1.00 20.39 ? 43   ASN A CG  1 
ATOM   339   O  OD1 . ASN A 1 46  ? 96.272  83.519  20.792  1.00 24.00 ? 43   ASN A OD1 1 
ATOM   340   N  ND2 . ASN A 1 46  ? 96.541  85.674  21.355  1.00 16.75 ? 43   ASN A ND2 1 
ATOM   341   N  N   . ASP A 1 47  ? 95.228  81.454  23.029  1.00 16.28 ? 44   ASP A N   1 
ATOM   342   C  CA  . ASP A 1 47  ? 95.349  80.036  22.723  1.00 17.27 ? 44   ASP A CA  1 
ATOM   343   C  C   . ASP A 1 47  ? 94.298  79.197  23.459  1.00 16.42 ? 44   ASP A C   1 
ATOM   344   O  O   . ASP A 1 47  ? 94.256  77.988  23.298  1.00 17.28 ? 44   ASP A O   1 
ATOM   345   C  CB  . ASP A 1 47  ? 96.732  79.487  23.055  1.00 18.38 ? 44   ASP A CB  1 
ATOM   346   C  CG  . ASP A 1 47  ? 97.708  79.634  21.915  1.00 23.58 ? 44   ASP A CG  1 
ATOM   347   O  OD1 . ASP A 1 47  ? 98.170  78.582  21.434  1.00 26.70 ? 44   ASP A OD1 1 
ATOM   348   O  OD2 . ASP A 1 47  ? 97.960  80.765  21.457  1.00 32.20 ? 44   ASP A OD2 1 
ATOM   349   N  N   . PHE A 1 48  ? 93.445  79.836  24.258  1.00 15.90 ? 45   PHE A N   1 
ATOM   350   C  CA  . PHE A 1 48  ? 92.457  79.096  25.018  1.00 15.53 ? 45   PHE A CA  1 
ATOM   351   C  C   . PHE A 1 48  ? 91.041  79.564  24.747  1.00 14.39 ? 45   PHE A C   1 
ATOM   352   O  O   . PHE A 1 48  ? 90.231  79.682  25.673  1.00 14.12 ? 45   PHE A O   1 
ATOM   353   C  CB  . PHE A 1 48  ? 92.810  79.160  26.513  1.00 15.03 ? 45   PHE A CB  1 
ATOM   354   C  CG  . PHE A 1 48  ? 94.167  78.620  26.815  1.00 16.67 ? 45   PHE A CG  1 
ATOM   355   C  CD1 . PHE A 1 48  ? 94.366  77.256  26.921  1.00 21.13 ? 45   PHE A CD1 1 
ATOM   356   C  CD2 . PHE A 1 48  ? 95.259  79.473  26.944  1.00 16.73 ? 45   PHE A CD2 1 
ATOM   357   C  CE1 . PHE A 1 48  ? 95.639  76.743  27.164  1.00 21.48 ? 45   PHE A CE1 1 
ATOM   358   C  CE2 . PHE A 1 48  ? 96.523  78.976  27.193  1.00 20.25 ? 45   PHE A CE2 1 
ATOM   359   C  CZ  . PHE A 1 48  ? 96.713  77.598  27.297  1.00 20.75 ? 45   PHE A CZ  1 
ATOM   360   N  N   . LEU A 1 49  ? 90.739  79.752  23.460  1.00 14.26 ? 46   LEU A N   1 
ATOM   361   C  CA  . LEU A 1 49  ? 89.434  80.224  23.008  1.00 14.48 ? 46   LEU A CA  1 
ATOM   362   C  C   . LEU A 1 49  ? 88.639  79.188  22.234  1.00 14.85 ? 46   LEU A C   1 
ATOM   363   O  O   . LEU A 1 49  ? 87.674  79.536  21.557  1.00 16.63 ? 46   LEU A O   1 
ATOM   364   C  CB  . LEU A 1 49  ? 89.612  81.481  22.142  1.00 14.32 ? 46   LEU A CB  1 
ATOM   365   C  CG  . LEU A 1 49  ? 90.058  82.694  22.956  1.00 13.72 ? 46   LEU A CG  1 
ATOM   366   C  CD1 . LEU A 1 49  ? 90.471  83.859  22.097  1.00 12.29 ? 46   LEU A CD1 1 
ATOM   367   C  CD2 . LEU A 1 49  ? 88.907  83.068  23.867  1.00 12.72 ? 46   LEU A CD2 1 
ATOM   368   N  N   . GLY A 1 50  ? 89.004  77.920  22.363  1.00 14.59 ? 47   GLY A N   1 
ATOM   369   C  CA  . GLY A 1 50  ? 88.320  76.852  21.629  1.00 14.02 ? 47   GLY A CA  1 
ATOM   370   C  C   . GLY A 1 50  ? 86.857  76.667  22.006  1.00 13.74 ? 47   GLY A C   1 
ATOM   371   O  O   . GLY A 1 50  ? 86.073  76.107  21.244  1.00 13.66 ? 47   GLY A O   1 
ATOM   372   N  N   . TRP A 1 51  ? 86.494  77.130  23.198  1.00 14.07 ? 48   TRP A N   1 
ATOM   373   C  CA  . TRP A 1 51  ? 85.133  77.001  23.691  1.00 13.29 ? 48   TRP A CA  1 
ATOM   374   C  C   . TRP A 1 51  ? 84.161  77.969  22.986  1.00 13.95 ? 48   TRP A C   1 
ATOM   375   O  O   . TRP A 1 51  ? 82.935  77.793  23.069  1.00 14.03 ? 48   TRP A O   1 
ATOM   376   C  CB  . TRP A 1 51  ? 85.099  77.249  25.206  1.00 13.41 ? 48   TRP A CB  1 
ATOM   377   C  CG  . TRP A 1 51  ? 85.667  78.559  25.565  1.00 10.60 ? 48   TRP A CG  1 
ATOM   378   C  CD1 . TRP A 1 51  ? 86.966  78.819  25.863  1.00 11.39 ? 48   TRP A CD1 1 
ATOM   379   C  CD2 . TRP A 1 51  ? 84.990  79.824  25.569  1.00 12.45 ? 48   TRP A CD2 1 
ATOM   380   N  NE1 . TRP A 1 51  ? 87.141  80.158  26.068  1.00 11.64 ? 48   TRP A NE1 1 
ATOM   381   C  CE2 . TRP A 1 51  ? 85.942  80.799  25.890  1.00 9.65  ? 48   TRP A CE2 1 
ATOM   382   C  CE3 . TRP A 1 51  ? 83.667  80.225  25.316  1.00 10.51 ? 48   TRP A CE3 1 
ATOM   383   C  CZ2 . TRP A 1 51  ? 85.618  82.157  26.025  1.00 10.97 ? 48   TRP A CZ2 1 
ATOM   384   C  CZ3 . TRP A 1 51  ? 83.346  81.572  25.441  1.00 10.78 ? 48   TRP A CZ3 1 
ATOM   385   C  CH2 . TRP A 1 51  ? 84.327  82.525  25.779  1.00 10.84 ? 48   TRP A CH2 1 
ATOM   386   N  N   . VAL A 1 52  ? 84.696  78.979  22.299  1.00 13.11 ? 49   VAL A N   1 
ATOM   387   C  CA  . VAL A 1 52  ? 83.837  79.961  21.633  1.00 13.63 ? 49   VAL A CA  1 
ATOM   388   C  C   . VAL A 1 52  ? 82.968  79.348  20.507  1.00 12.56 ? 49   VAL A C   1 
ATOM   389   O  O   . VAL A 1 52  ? 81.759  79.588  20.467  1.00 11.21 ? 49   VAL A O   1 
ATOM   390   C  CB  . VAL A 1 52  ? 84.640  81.183  21.093  1.00 13.50 ? 49   VAL A CB  1 
ATOM   391   C  CG1 . VAL A 1 52  ? 83.742  82.080  20.262  1.00 13.71 ? 49   VAL A CG1 1 
ATOM   392   C  CG2 . VAL A 1 52  ? 85.274  81.991  22.251  1.00 13.14 ? 49   VAL A CG2 1 
ATOM   393   N  N   . ASP A 1 53  ? 83.584  78.571  19.610  1.00 12.96 ? 50   ASP A N   1 
ATOM   394   C  CA  . ASP A 1 53  ? 82.861  77.917  18.491  1.00 11.88 ? 50   ASP A CA  1 
ATOM   395   C  C   . ASP A 1 53  ? 82.578  76.417  18.733  1.00 12.18 ? 50   ASP A C   1 
ATOM   396   O  O   . ASP A 1 53  ? 82.007  75.727  17.872  1.00 13.37 ? 50   ASP A O   1 
ATOM   397   C  CB  . ASP A 1 53  ? 83.630  78.113  17.189  1.00 12.46 ? 50   ASP A CB  1 
ATOM   398   C  CG  . ASP A 1 53  ? 83.688  79.580  16.768  1.00 16.42 ? 50   ASP A CG  1 
ATOM   399   O  OD1 . ASP A 1 53  ? 82.698  80.293  16.996  1.00 18.15 ? 50   ASP A OD1 1 
ATOM   400   O  OD2 . ASP A 1 53  ? 84.706  80.007  16.184  1.00 27.20 ? 50   ASP A OD2 1 
ATOM   401   N  N   . LEU A 1 54  ? 82.978  75.921  19.896  1.00 13.62 ? 51   LEU A N   1 
ATOM   402   C  CA  . LEU A 1 54  ? 82.758  74.519  20.280  1.00 13.44 ? 51   LEU A CA  1 
ATOM   403   C  C   . LEU A 1 54  ? 81.308  74.049  20.073  1.00 14.57 ? 51   LEU A C   1 
ATOM   404   O  O   . LEU A 1 54  ? 81.076  72.959  19.549  1.00 16.08 ? 51   LEU A O   1 
ATOM   405   C  CB  . LEU A 1 54  ? 83.154  74.336  21.752  1.00 13.94 ? 51   LEU A CB  1 
ATOM   406   C  CG  . LEU A 1 54  ? 82.982  72.964  22.400  1.00 14.25 ? 51   LEU A CG  1 
ATOM   407   C  CD1 . LEU A 1 54  ? 83.765  71.918  21.623  1.00 16.76 ? 51   LEU A CD1 1 
ATOM   408   C  CD2 . LEU A 1 54  ? 83.416  73.010  23.882  1.00 17.05 ? 51   LEU A CD2 1 
ATOM   409   N  N   . PRO A 1 55  ? 80.319  74.869  20.473  1.00 15.32 ? 52   PRO A N   1 
ATOM   410   C  CA  . PRO A 1 55  ? 78.914  74.420  20.306  1.00 16.67 ? 52   PRO A CA  1 
ATOM   411   C  C   . PRO A 1 55  ? 78.503  74.086  18.885  1.00 15.96 ? 52   PRO A C   1 
ATOM   412   O  O   . PRO A 1 55  ? 77.611  73.248  18.676  1.00 17.35 ? 52   PRO A O   1 
ATOM   413   C  CB  . PRO A 1 55  ? 78.096  75.611  20.825  1.00 16.36 ? 52   PRO A CB  1 
ATOM   414   C  CG  . PRO A 1 55  ? 79.006  76.251  21.835  1.00 16.39 ? 52   PRO A CG  1 
ATOM   415   C  CD  . PRO A 1 55  ? 80.391  76.144  21.200  1.00 15.58 ? 52   PRO A CD  1 
ATOM   416   N  N   . LEU A 1 56  ? 79.158  74.719  17.929  1.00 16.01 ? 53   LEU A N   1 
ATOM   417   C  CA  . LEU A 1 56  ? 78.884  74.531  16.514  1.00 17.44 ? 53   LEU A CA  1 
ATOM   418   C  C   . LEU A 1 56  ? 79.808  73.492  15.870  1.00 17.73 ? 53   LEU A C   1 
ATOM   419   O  O   . LEU A 1 56  ? 79.349  72.609  15.144  1.00 18.11 ? 53   LEU A O   1 
ATOM   420   C  CB  . LEU A 1 56  ? 79.103  75.881  15.809  1.00 18.11 ? 53   LEU A CB  1 
ATOM   421   C  CG  . LEU A 1 56  ? 78.773  76.104  14.331  1.00 21.23 ? 53   LEU A CG  1 
ATOM   422   C  CD1 . LEU A 1 56  ? 77.287  75.997  14.084  1.00 25.37 ? 53   LEU A CD1 1 
ATOM   423   C  CD2 . LEU A 1 56  ? 79.263  77.476  13.895  1.00 21.76 ? 53   LEU A CD2 1 
ATOM   424   N  N   . GLN A 1 57  ? 81.099  73.565  16.204  1.00 17.33 ? 54   GLN A N   1 
ATOM   425   C  CA  . GLN A 1 57  ? 82.125  72.732  15.567  1.00 17.55 ? 54   GLN A CA  1 
ATOM   426   C  C   . GLN A 1 57  ? 82.701  71.545  16.342  1.00 17.62 ? 54   GLN A C   1 
ATOM   427   O  O   . GLN A 1 57  ? 83.742  71.001  15.961  1.00 18.26 ? 54   GLN A O   1 
ATOM   428   C  CB  . GLN A 1 57  ? 83.265  73.664  15.129  1.00 17.49 ? 54   GLN A CB  1 
ATOM   429   C  CG  . GLN A 1 57  ? 82.786  74.693  14.079  1.00 21.53 ? 54   GLN A CG  1 
ATOM   430   C  CD  . GLN A 1 57  ? 83.852  75.725  13.698  1.00 25.05 ? 54   GLN A CD  1 
ATOM   431   O  OE1 . GLN A 1 57  ? 84.512  76.292  14.556  1.00 35.16 ? 54   GLN A OE1 1 
ATOM   432   N  NE2 . GLN A 1 57  ? 83.979  75.993  12.416  1.00 27.17 ? 54   GLN A NE2 1 
ATOM   433   N  N   . TYR A 1 58  ? 82.036  71.127  17.402  1.00 16.89 ? 55   TYR A N   1 
ATOM   434   C  CA  . TYR A 1 58  ? 82.502  69.993  18.183  1.00 17.02 ? 55   TYR A CA  1 
ATOM   435   C  C   . TYR A 1 58  ? 82.676  68.754  17.284  1.00 18.04 ? 55   TYR A C   1 
ATOM   436   O  O   . TYR A 1 58  ? 81.987  68.605  16.263  1.00 17.29 ? 55   TYR A O   1 
ATOM   437   C  CB  . TYR A 1 58  ? 81.530  69.712  19.336  1.00 16.82 ? 55   TYR A CB  1 
ATOM   438   C  CG  . TYR A 1 58  ? 80.165  69.293  18.875  1.00 15.15 ? 55   TYR A CG  1 
ATOM   439   C  CD1 . TYR A 1 58  ? 79.178  70.235  18.585  1.00 14.34 ? 55   TYR A CD1 1 
ATOM   440   C  CD2 . TYR A 1 58  ? 79.854  67.949  18.725  1.00 17.28 ? 55   TYR A CD2 1 
ATOM   441   C  CE1 . TYR A 1 58  ? 77.903  69.837  18.148  1.00 14.86 ? 55   TYR A CE1 1 
ATOM   442   C  CE2 . TYR A 1 58  ? 78.589  67.541  18.281  1.00 15.39 ? 55   TYR A CE2 1 
ATOM   443   C  CZ  . TYR A 1 58  ? 77.620  68.485  18.011  1.00 16.63 ? 55   TYR A CZ  1 
ATOM   444   O  OH  . TYR A 1 58  ? 76.378  68.073  17.582  1.00 20.16 ? 55   TYR A OH  1 
ATOM   445   N  N   . ASP A 1 59  ? 83.608  67.877  17.655  1.00 16.50 ? 56   ASP A N   1 
ATOM   446   C  CA  . ASP A 1 59  ? 83.888  66.661  16.877  1.00 17.06 ? 56   ASP A CA  1 
ATOM   447   C  C   . ASP A 1 59  ? 82.656  65.749  16.901  1.00 15.13 ? 56   ASP A C   1 
ATOM   448   O  O   . ASP A 1 59  ? 82.323  65.188  17.935  1.00 15.59 ? 56   ASP A O   1 
ATOM   449   C  CB  . ASP A 1 59  ? 85.110  65.979  17.498  1.00 17.49 ? 56   ASP A CB  1 
ATOM   450   C  CG  . ASP A 1 59  ? 85.544  64.719  16.768  1.00 20.07 ? 56   ASP A CG  1 
ATOM   451   O  OD1 . ASP A 1 59  ? 84.713  64.002  16.150  1.00 15.63 ? 56   ASP A OD1 1 
ATOM   452   O  OD2 . ASP A 1 59  ? 86.753  64.428  16.880  1.00 23.73 ? 56   ASP A OD2 1 
ATOM   453   N  N   . LYS A 1 60  ? 81.980  65.616  15.763  1.00 16.74 ? 57   LYS A N   1 
ATOM   454   C  CA  . LYS A 1 60  ? 80.770  64.803  15.666  1.00 17.40 ? 57   LYS A CA  1 
ATOM   455   C  C   . LYS A 1 60  ? 80.962  63.297  15.814  1.00 17.15 ? 57   LYS A C   1 
ATOM   456   O  O   . LYS A 1 60  ? 80.110  62.632  16.406  1.00 17.46 ? 57   LYS A O   1 
ATOM   457   C  CB  . LYS A 1 60  ? 80.007  65.100  14.378  1.00 19.61 ? 57   LYS A CB  1 
ATOM   458   C  CG  . LYS A 1 60  ? 79.342  66.474  14.372  1.00 23.30 ? 57   LYS A CG  1 
ATOM   459   C  CD  . LYS A 1 60  ? 78.495  66.668  13.098  1.00 30.00 ? 57   LYS A CD  1 
ATOM   460   C  CE  . LYS A 1 60  ? 77.407  65.588  12.950  1.00 33.72 ? 57   LYS A CE  1 
ATOM   461   N  NZ  . LYS A 1 60  ? 76.451  65.870  11.834  1.00 35.45 ? 57   LYS A NZ  1 
ATOM   462   N  N   A GLU A 1 61  ? 82.038  62.745  15.275  0.60 17.07 ? 58   GLU A N   1 
ATOM   463   N  N   B GLU A 1 61  ? 82.053  62.765  15.267  0.40 16.70 ? 58   GLU A N   1 
ATOM   464   C  CA  A GLU A 1 61  ? 82.273  61.305  15.422  0.60 17.35 ? 58   GLU A CA  1 
ATOM   465   C  CA  B GLU A 1 61  ? 82.350  61.338  15.399  0.40 16.57 ? 58   GLU A CA  1 
ATOM   466   C  C   A GLU A 1 61  ? 82.528  60.948  16.882  0.60 15.83 ? 58   GLU A C   1 
ATOM   467   C  C   B GLU A 1 61  ? 82.510  60.977  16.867  0.40 15.44 ? 58   GLU A C   1 
ATOM   468   O  O   A GLU A 1 61  ? 82.079  59.901  17.360  0.60 15.51 ? 58   GLU A O   1 
ATOM   469   O  O   B GLU A 1 61  ? 81.967  59.978  17.340  0.40 15.32 ? 58   GLU A O   1 
ATOM   470   C  CB  A GLU A 1 61  ? 83.429  60.814  14.567  0.60 18.21 ? 58   GLU A CB  1 
ATOM   471   C  CB  B GLU A 1 61  ? 83.649  60.948  14.691  0.40 17.01 ? 58   GLU A CB  1 
ATOM   472   C  CG  A GLU A 1 61  ? 83.087  60.603  13.111  0.60 23.33 ? 58   GLU A CG  1 
ATOM   473   C  CG  B GLU A 1 61  ? 83.579  60.750  13.191  0.40 20.13 ? 58   GLU A CG  1 
ATOM   474   C  CD  A GLU A 1 61  ? 82.808  61.878  12.368  0.60 27.80 ? 58   GLU A CD  1 
ATOM   475   C  CD  B GLU A 1 61  ? 84.833  60.050  12.655  0.40 21.27 ? 58   GLU A CD  1 
ATOM   476   O  OE1 A GLU A 1 61  ? 83.094  62.975  12.911  0.60 30.14 ? 58   GLU A OE1 1 
ATOM   477   O  OE1 B GLU A 1 61  ? 85.922  60.210  13.251  0.40 21.66 ? 58   GLU A OE1 1 
ATOM   478   O  OE2 A GLU A 1 61  ? 82.325  61.776  11.219  0.60 34.41 ? 58   GLU A OE2 1 
ATOM   479   O  OE2 B GLU A 1 61  ? 84.726  59.328  11.642  0.40 24.66 ? 58   GLU A OE2 1 
ATOM   480   N  N   . GLU A 1 62  ? 83.288  61.791  17.572  1.00 14.39 ? 59   GLU A N   1 
ATOM   481   C  CA  . GLU A 1 62  ? 83.559  61.576  18.975  1.00 12.87 ? 59   GLU A CA  1 
ATOM   482   C  C   . GLU A 1 62  ? 82.262  61.690  19.773  1.00 12.49 ? 59   GLU A C   1 
ATOM   483   O  O   . GLU A 1 62  ? 82.017  60.910  20.682  1.00 11.25 ? 59   GLU A O   1 
ATOM   484   C  CB  . GLU A 1 62  ? 84.538  62.617  19.484  1.00 14.15 ? 59   GLU A CB  1 
ATOM   485   C  CG  . GLU A 1 62  ? 84.930  62.424  20.954  1.00 14.17 ? 59   GLU A CG  1 
ATOM   486   C  CD  . GLU A 1 62  ? 85.856  63.512  21.445  1.00 17.37 ? 59   GLU A CD  1 
ATOM   487   O  OE1 . GLU A 1 62  ? 85.527  64.704  21.264  1.00 19.25 ? 59   GLU A OE1 1 
ATOM   488   O  OE2 . GLU A 1 62  ? 86.890  63.171  22.069  1.00 18.20 ? 59   GLU A OE2 1 
ATOM   489   N  N   . PHE A 1 63  ? 81.460  62.699  19.451  1.00 11.60 ? 60   PHE A N   1 
ATOM   490   C  CA  . PHE A 1 63  ? 80.195  62.919  20.129  1.00 11.37 ? 60   PHE A CA  1 
ATOM   491   C  C   . PHE A 1 63  ? 79.320  61.651  20.021  1.00 12.79 ? 60   PHE A C   1 
ATOM   492   O  O   . PHE A 1 63  ? 78.705  61.222  21.011  1.00 12.21 ? 60   PHE A O   1 
ATOM   493   C  CB  . PHE A 1 63  ? 79.511  64.148  19.521  1.00 12.71 ? 60   PHE A CB  1 
ATOM   494   C  CG  . PHE A 1 63  ? 78.260  64.579  20.227  1.00 12.79 ? 60   PHE A CG  1 
ATOM   495   C  CD1 . PHE A 1 63  ? 77.028  64.066  19.856  1.00 17.37 ? 60   PHE A CD1 1 
ATOM   496   C  CD2 . PHE A 1 63  ? 78.304  65.550  21.205  1.00 16.30 ? 60   PHE A CD2 1 
ATOM   497   C  CE1 . PHE A 1 63  ? 75.867  64.486  20.486  1.00 20.08 ? 60   PHE A CE1 1 
ATOM   498   C  CE2 . PHE A 1 63  ? 77.129  65.988  21.837  1.00 16.90 ? 60   PHE A CE2 1 
ATOM   499   C  CZ  . PHE A 1 63  ? 75.924  65.444  21.475  1.00 20.66 ? 60   PHE A CZ  1 
ATOM   500   N  N   . ALA A 1 64  ? 79.286  61.034  18.841  1.00 12.03 ? 61   ALA A N   1 
ATOM   501   C  CA  . ALA A 1 64  ? 78.482  59.818  18.655  1.00 13.29 ? 61   ALA A CA  1 
ATOM   502   C  C   . ALA A 1 64  ? 79.029  58.695  19.519  1.00 13.42 ? 61   ALA A C   1 
ATOM   503   O  O   . ALA A 1 64  ? 78.276  57.880  20.055  1.00 12.88 ? 61   ALA A O   1 
ATOM   504   C  CB  . ALA A 1 64  ? 78.450  59.410  17.203  1.00 13.75 ? 61   ALA A CB  1 
ATOM   505   N  N   . ARG A 1 65  ? 80.343  58.675  19.685  1.00 12.89 ? 62   ARG A N   1 
ATOM   506   C  CA  . ARG A 1 65  ? 80.978  57.650  20.497  1.00 15.32 ? 62   ARG A CA  1 
ATOM   507   C  C   . ARG A 1 65  ? 80.710  57.914  22.006  1.00 12.88 ? 62   ARG A C   1 
ATOM   508   O  O   . ARG A 1 65  ? 80.593  56.981  22.791  1.00 12.95 ? 62   ARG A O   1 
ATOM   509   C  CB  . ARG A 1 65  ? 82.471  57.529  20.123  1.00 16.81 ? 62   ARG A CB  1 
ATOM   510   C  CG  . ARG A 1 65  ? 83.180  56.312  20.719  1.00 21.05 ? 62   ARG A CG  1 
ATOM   511   C  CD  . ARG A 1 65  ? 84.516  56.033  20.000  1.00 21.02 ? 62   ARG A CD  1 
ATOM   512   N  NE  . ARG A 1 65  ? 85.328  57.231  19.979  1.00 20.72 ? 62   ARG A NE  1 
ATOM   513   C  CZ  . ARG A 1 65  ? 86.157  57.584  20.955  1.00 22.12 ? 62   ARG A CZ  1 
ATOM   514   N  NH1 . ARG A 1 65  ? 86.325  56.801  22.018  1.00 19.85 ? 62   ARG A NH1 1 
ATOM   515   N  NH2 . ARG A 1 65  ? 86.823  58.722  20.862  1.00 23.37 ? 62   ARG A NH2 1 
ATOM   516   N  N   . ILE A 1 66  ? 80.593  59.176  22.405  1.00 13.06 ? 63   ILE A N   1 
ATOM   517   C  CA  . ILE A 1 66  ? 80.233  59.506  23.794  1.00 12.39 ? 63   ILE A CA  1 
ATOM   518   C  C   . ILE A 1 66  ? 78.867  58.873  24.079  1.00 13.09 ? 63   ILE A C   1 
ATOM   519   O  O   . ILE A 1 66  ? 78.677  58.199  25.086  1.00 14.51 ? 63   ILE A O   1 
ATOM   520   C  CB  . ILE A 1 66  ? 80.127  61.027  24.017  1.00 12.11 ? 63   ILE A CB  1 
ATOM   521   C  CG1 . ILE A 1 66  ? 81.509  61.692  23.887  1.00 12.53 ? 63   ILE A CG1 1 
ATOM   522   C  CG2 . ILE A 1 66  ? 79.522  61.325  25.390  1.00 11.18 ? 63   ILE A CG2 1 
ATOM   523   C  CD1 . ILE A 1 66  ? 81.475  63.257  23.862  1.00 12.72 ? 63   ILE A CD1 1 
ATOM   524   N  N   . GLN A 1 67  ? 77.923  59.081  23.168  1.00 14.60 ? 64   GLN A N   1 
ATOM   525   C  CA  . GLN A 1 67  ? 76.566  58.538  23.323  1.00 15.71 ? 64   GLN A CA  1 
ATOM   526   C  C   . GLN A 1 67  ? 76.593  57.005  23.408  1.00 14.99 ? 64   GLN A C   1 
ATOM   527   O  O   . GLN A 1 67  ? 75.934  56.410  24.254  1.00 14.53 ? 64   GLN A O   1 
ATOM   528   C  CB  . GLN A 1 67  ? 75.675  58.988  22.155  1.00 16.13 ? 64   GLN A CB  1 
ATOM   529   C  CG  . GLN A 1 67  ? 75.481  60.485  22.082  1.00 21.39 ? 64   GLN A CG  1 
ATOM   530   C  CD  . GLN A 1 67  ? 74.577  60.908  20.948  1.00 28.23 ? 64   GLN A CD  1 
ATOM   531   O  OE1 . GLN A 1 67  ? 74.812  60.540  19.796  1.00 28.67 ? 64   GLN A OE1 1 
ATOM   532   N  NE2 . GLN A 1 67  ? 73.547  61.724  21.262  1.00 22.72 ? 64   GLN A NE2 1 
ATOM   533   N  N   . LYS A 1 68  ? 77.372  56.386  22.528  1.00 15.46 ? 65   LYS A N   1 
ATOM   534   C  CA  . LYS A 1 68  ? 77.528  54.932  22.496  1.00 16.00 ? 65   LYS A CA  1 
ATOM   535   C  C   . LYS A 1 68  ? 78.107  54.394  23.819  1.00 15.45 ? 65   LYS A C   1 
ATOM   536   O  O   . LYS A 1 68  ? 77.608  53.396  24.364  1.00 15.60 ? 65   LYS A O   1 
ATOM   537   C  CB  . LYS A 1 68  ? 78.430  54.522  21.335  1.00 15.91 ? 65   LYS A CB  1 
ATOM   538   C  CG  . LYS A 1 68  ? 78.688  52.992  21.245  1.00 18.54 ? 65   LYS A CG  1 
ATOM   539   C  CD  . LYS A 1 68  ? 79.634  52.678  20.063  1.00 23.72 ? 65   LYS A CD  1 
ATOM   540   C  CE  . LYS A 1 68  ? 79.907  51.182  19.881  1.00 27.40 ? 65   LYS A CE  1 
ATOM   541   N  NZ  . LYS A 1 68  ? 80.642  50.607  21.029  1.00 30.86 ? 65   LYS A NZ  1 
ATOM   542   N  N   . CYS A 1 69  ? 79.176  55.019  24.298  1.00 13.84 ? 66   CYS A N   1 
ATOM   543   C  CA  . CYS A 1 69  ? 79.779  54.622  25.578  1.00 14.66 ? 66   CYS A CA  1 
ATOM   544   C  C   . CYS A 1 69  ? 78.814  54.838  26.736  1.00 13.83 ? 66   CYS A C   1 
ATOM   545   O  O   . CYS A 1 69  ? 78.735  54.006  27.637  1.00 11.92 ? 66   CYS A O   1 
ATOM   546   C  CB  . CYS A 1 69  ? 81.093  55.365  25.828  1.00 14.89 ? 66   CYS A CB  1 
ATOM   547   S  SG  . CYS A 1 69  ? 82.371  54.758  24.709  1.00 17.82 ? 66   CYS A SG  1 
ATOM   548   N  N   . ALA A 1 70  ? 78.081  55.957  26.710  1.00 12.55 ? 67   ALA A N   1 
ATOM   549   C  CA  . ALA A 1 70  ? 77.102  56.234  27.754  1.00 12.43 ? 67   ALA A CA  1 
ATOM   550   C  C   . ALA A 1 70  ? 76.034  55.123  27.812  1.00 12.52 ? 67   ALA A C   1 
ATOM   551   O  O   . ALA A 1 70  ? 75.614  54.710  28.899  1.00 12.37 ? 67   ALA A O   1 
ATOM   552   C  CB  . ALA A 1 70  ? 76.442  57.617  27.533  1.00 10.81 ? 67   ALA A CB  1 
ATOM   553   N  N   . GLU A 1 71  ? 75.595  54.646  26.654  1.00 13.75 ? 68   GLU A N   1 
ATOM   554   C  CA  . GLU A 1 71  ? 74.575  53.597  26.609  1.00 13.82 ? 68   GLU A CA  1 
ATOM   555   C  C   . GLU A 1 71  ? 75.149  52.287  27.140  1.00 13.82 ? 68   GLU A C   1 
ATOM   556   O  O   . GLU A 1 71  ? 74.464  51.566  27.852  1.00 10.56 ? 68   GLU A O   1 
ATOM   557   C  CB  . GLU A 1 71  ? 74.007  53.397  25.210  1.00 14.28 ? 68   GLU A CB  1 
ATOM   558   C  CG  . GLU A 1 71  ? 73.313  54.602  24.635  1.00 18.40 ? 68   GLU A CG  1 
ATOM   559   C  CD  . GLU A 1 71  ? 72.075  55.021  25.430  1.00 24.68 ? 68   GLU A CD  1 
ATOM   560   O  OE1 . GLU A 1 71  ? 71.521  54.199  26.192  1.00 28.07 ? 68   GLU A OE1 1 
ATOM   561   O  OE2 . GLU A 1 71  ? 71.638  56.170  25.266  1.00 32.34 ? 68   GLU A OE2 1 
ATOM   562   N  N   . LYS A 1 72  ? 76.413  52.006  26.831  1.00 12.14 ? 69   LYS A N   1 
ATOM   563   C  CA  . LYS A 1 72  ? 77.043  50.795  27.348  1.00 13.39 ? 69   LYS A CA  1 
ATOM   564   C  C   . LYS A 1 72  ? 77.033  50.816  28.870  1.00 12.72 ? 69   LYS A C   1 
ATOM   565   O  O   . LYS A 1 72  ? 76.635  49.839  29.518  1.00 10.85 ? 69   LYS A O   1 
ATOM   566   C  CB  . LYS A 1 72  ? 78.489  50.651  26.868  1.00 13.43 ? 69   LYS A CB  1 
ATOM   567   C  CG  . LYS A 1 72  ? 79.186  49.370  27.399  1.00 16.03 ? 69   LYS A CG  1 
ATOM   568   C  CD  . LYS A 1 72  ? 80.619  49.196  26.841  1.00 18.56 ? 69   LYS A CD  1 
ATOM   569   C  CE  . LYS A 1 72  ? 81.297  47.942  27.413  1.00 19.07 ? 69   LYS A CE  1 
ATOM   570   N  NZ  . LYS A 1 72  ? 81.516  48.034  28.902  1.00 16.75 ? 69   LYS A NZ  1 
ATOM   571   N  N   . ILE A 1 73  ? 77.445  51.952  29.432  1.00 11.88 ? 70   ILE A N   1 
ATOM   572   C  CA  . ILE A 1 73  ? 77.521  52.126  30.890  1.00 12.55 ? 70   ILE A CA  1 
ATOM   573   C  C   . ILE A 1 73  ? 76.159  52.012  31.544  1.00 12.14 ? 70   ILE A C   1 
ATOM   574   O  O   . ILE A 1 73  ? 76.013  51.340  32.576  1.00 13.98 ? 70   ILE A O   1 
ATOM   575   C  CB  . ILE A 1 73  ? 78.182  53.493  31.260  1.00 12.12 ? 70   ILE A CB  1 
ATOM   576   C  CG1 . ILE A 1 73  ? 79.637  53.523  30.767  1.00 11.29 ? 70   ILE A CG1 1 
ATOM   577   C  CG2 . ILE A 1 73  ? 78.163  53.733  32.763  1.00 10.78 ? 70   ILE A CG2 1 
ATOM   578   C  CD1 . ILE A 1 73  ? 80.218  54.921  30.728  1.00 10.78 ? 70   ILE A CD1 1 
ATOM   579   N  N   . LYS A 1 74  ? 75.163  52.665  30.955  1.00 11.89 ? 71   LYS A N   1 
ATOM   580   C  CA  . LYS A 1 74  ? 73.813  52.634  31.497  1.00 12.71 ? 71   LYS A CA  1 
ATOM   581   C  C   . LYS A 1 74  ? 73.269  51.201  31.570  1.00 13.05 ? 71   LYS A C   1 
ATOM   582   O  O   . LYS A 1 74  ? 72.464  50.877  32.424  1.00 12.91 ? 71   LYS A O   1 
ATOM   583   C  CB  . LYS A 1 74  ? 72.846  53.435  30.626  1.00 11.76 ? 71   LYS A CB  1 
ATOM   584   C  CG  . LYS A 1 74  ? 72.980  54.977  30.608  1.00 15.10 ? 71   LYS A CG  1 
ATOM   585   C  CD  . LYS A 1 74  ? 71.816  55.447  29.750  1.00 21.93 ? 71   LYS A CD  1 
ATOM   586   C  CE  . LYS A 1 74  ? 71.898  56.835  29.314  1.00 28.81 ? 71   LYS A CE  1 
ATOM   587   N  NZ  . LYS A 1 74  ? 70.684  57.093  28.455  1.00 29.90 ? 71   LYS A NZ  1 
ATOM   588   N  N   . ASN A 1 75  ? 73.685  50.366  30.642  1.00 12.60 ? 72   ASN A N   1 
ATOM   589   C  CA  . ASN A 1 75  ? 73.192  48.992  30.617  1.00 14.40 ? 72   ASN A CA  1 
ATOM   590   C  C   . ASN A 1 75  ? 74.063  47.951  31.327  1.00 14.25 ? 72   ASN A C   1 
ATOM   591   O  O   . ASN A 1 75  ? 73.641  46.822  31.477  1.00 14.79 ? 72   ASN A O   1 
ATOM   592   C  CB  . ASN A 1 75  ? 72.911  48.585  29.169  1.00 14.69 ? 72   ASN A CB  1 
ATOM   593   C  CG  . ASN A 1 75  ? 71.790  49.404  28.555  1.00 16.18 ? 72   ASN A CG  1 
ATOM   594   O  OD1 . ASN A 1 75  ? 70.749  49.605  29.179  1.00 15.62 ? 72   ASN A OD1 1 
ATOM   595   N  ND2 . ASN A 1 75  ? 71.995  49.873  27.329  1.00 19.19 ? 72   ASN A ND2 1 
ATOM   596   N  N   . ASP A 1 76  ? 75.255  48.314  31.785  1.00 14.44 ? 73   ASP A N   1 
ATOM   597   C  CA  . ASP A 1 76  ? 76.089  47.325  32.474  1.00 14.56 ? 73   ASP A CA  1 
ATOM   598   C  C   . ASP A 1 76  ? 76.640  47.794  33.819  1.00 14.73 ? 73   ASP A C   1 
ATOM   599   O  O   . ASP A 1 76  ? 77.423  47.079  34.453  1.00 15.26 ? 73   ASP A O   1 
ATOM   600   C  CB  . ASP A 1 76  ? 77.227  46.811  31.581  1.00 14.65 ? 73   ASP A CB  1 
ATOM   601   C  CG  . ASP A 1 76  ? 78.327  47.856  31.307  1.00 14.26 ? 73   ASP A CG  1 
ATOM   602   O  OD1 . ASP A 1 76  ? 78.407  48.915  31.975  1.00 15.54 ? 73   ASP A OD1 1 
ATOM   603   O  OD2 . ASP A 1 76  ? 79.166  47.564  30.423  1.00 16.81 ? 73   ASP A OD2 1 
ATOM   604   N  N   . SER A 1 77  ? 76.196  48.958  34.278  1.00 14.29 ? 74   SER A N   1 
ATOM   605   C  CA  . SER A 1 77  ? 76.688  49.504  35.526  1.00 14.17 ? 74   SER A CA  1 
ATOM   606   C  C   . SER A 1 77  ? 75.586  50.071  36.418  1.00 14.88 ? 74   SER A C   1 
ATOM   607   O  O   . SER A 1 77  ? 74.643  50.693  35.945  1.00 13.63 ? 74   SER A O   1 
ATOM   608   C  CB  . SER A 1 77  ? 77.682  50.635  35.245  1.00 13.91 ? 74   SER A CB  1 
ATOM   609   O  OG  . SER A 1 77  ? 78.749  50.210  34.426  1.00 15.25 ? 74   SER A OG  1 
ATOM   610   N  N   . ASP A 1 78  ? 75.732  49.841  37.720  1.00 14.55 ? 75   ASP A N   1 
ATOM   611   C  CA  . ASP A 1 78  ? 74.820  50.371  38.708  1.00 13.08 ? 75   ASP A CA  1 
ATOM   612   C  C   . ASP A 1 78  ? 75.315  51.760  39.090  1.00 12.43 ? 75   ASP A C   1 
ATOM   613   O  O   . ASP A 1 78  ? 74.543  52.615  39.506  1.00 11.06 ? 75   ASP A O   1 
ATOM   614   C  CB  . ASP A 1 78  ? 74.850  49.504  39.950  1.00 11.44 ? 75   ASP A CB  1 
ATOM   615   C  CG  . ASP A 1 78  ? 74.227  48.157  39.723  1.00 15.56 ? 75   ASP A CG  1 
ATOM   616   O  OD1 . ASP A 1 78  ? 73.120  48.126  39.132  1.00 13.46 ? 75   ASP A OD1 1 
ATOM   617   O  OD2 . ASP A 1 78  ? 74.828  47.144  40.158  1.00 17.56 ? 75   ASP A OD2 1 
ATOM   618   N  N   . ILE A 1 79  ? 76.622  51.947  38.931  1.00 11.97 ? 76   ILE A N   1 
ATOM   619   C  CA  . ILE A 1 79  ? 77.309  53.174  39.307  1.00 12.47 ? 76   ILE A CA  1 
ATOM   620   C  C   . ILE A 1 79  ? 78.399  53.613  38.327  1.00 12.59 ? 76   ILE A C   1 
ATOM   621   O  O   . ILE A 1 79  ? 79.137  52.789  37.785  1.00 12.28 ? 76   ILE A O   1 
ATOM   622   C  CB  . ILE A 1 79  ? 78.042  52.947  40.671  1.00 12.17 ? 76   ILE A CB  1 
ATOM   623   C  CG1 . ILE A 1 79  ? 77.036  52.623  41.782  1.00 13.48 ? 76   ILE A CG1 1 
ATOM   624   C  CG2 . ILE A 1 79  ? 78.882  54.177  41.044  1.00 14.73 ? 76   ILE A CG2 1 
ATOM   625   C  CD1 . ILE A 1 79  ? 77.663  52.234  43.113  1.00 15.96 ? 76   ILE A CD1 1 
ATOM   626   N  N   . LEU A 1 80  ? 78.473  54.915  38.079  1.00 11.73 ? 77   LEU A N   1 
ATOM   627   C  CA  . LEU A 1 80  ? 79.564  55.472  37.303  1.00 12.22 ? 77   LEU A CA  1 
ATOM   628   C  C   . LEU A 1 80  ? 80.346  56.297  38.304  1.00 12.99 ? 77   LEU A C   1 
ATOM   629   O  O   . LEU A 1 80  ? 79.774  57.177  38.976  1.00 13.72 ? 77   LEU A O   1 
ATOM   630   C  CB  . LEU A 1 80  ? 79.124  56.376  36.152  1.00 12.91 ? 77   LEU A CB  1 
ATOM   631   C  CG  . LEU A 1 80  ? 80.304  57.085  35.466  1.00 12.27 ? 77   LEU A CG  1 
ATOM   632   C  CD1 . LEU A 1 80  ? 81.269  56.087  34.769  1.00 10.79 ? 77   LEU A CD1 1 
ATOM   633   C  CD2 . LEU A 1 80  ? 79.830  58.169  34.503  1.00 14.02 ? 77   LEU A CD2 1 
ATOM   634   N  N   . LEU A 1 81  ? 81.628  55.971  38.428  1.00 11.40 ? 78   LEU A N   1 
ATOM   635   C  CA  . LEU A 1 81  ? 82.538  56.660  39.292  1.00 12.23 ? 78   LEU A CA  1 
ATOM   636   C  C   . LEU A 1 81  ? 83.342  57.621  38.437  1.00 11.37 ? 78   LEU A C   1 
ATOM   637   O  O   . LEU A 1 81  ? 84.077  57.205  37.538  1.00 12.19 ? 78   LEU A O   1 
ATOM   638   C  CB  . LEU A 1 81  ? 83.475  55.654  39.979  1.00 11.98 ? 78   LEU A CB  1 
ATOM   639   C  CG  . LEU A 1 81  ? 84.452  56.213  41.007  1.00 14.31 ? 78   LEU A CG  1 
ATOM   640   C  CD1 . LEU A 1 81  ? 83.699  56.987  42.079  1.00 13.72 ? 78   LEU A CD1 1 
ATOM   641   C  CD2 . LEU A 1 81  ? 85.268  55.055  41.633  1.00 14.37 ? 78   LEU A CD2 1 
ATOM   642   N  N   . VAL A 1 82  ? 83.158  58.909  38.680  1.00 10.90 ? 79   VAL A N   1 
ATOM   643   C  CA  . VAL A 1 82  ? 83.883  59.933  37.957  1.00 11.48 ? 79   VAL A CA  1 
ATOM   644   C  C   . VAL A 1 82  ? 85.109  60.332  38.766  1.00 11.68 ? 79   VAL A C   1 
ATOM   645   O  O   . VAL A 1 82  ? 84.988  60.695  39.930  1.00 13.62 ? 79   VAL A O   1 
ATOM   646   C  CB  . VAL A 1 82  ? 83.006  61.176  37.733  1.00 11.71 ? 79   VAL A CB  1 
ATOM   647   C  CG1 . VAL A 1 82  ? 83.829  62.320  37.073  1.00 10.27 ? 79   VAL A CG1 1 
ATOM   648   C  CG2 . VAL A 1 82  ? 81.760  60.790  36.909  1.00 10.64 ? 79   VAL A CG2 1 
ATOM   649   N  N   . VAL A 1 83  ? 86.290  60.250  38.155  1.00 12.34 ? 80   VAL A N   1 
ATOM   650   C  CA  . VAL A 1 83  ? 87.536  60.621  38.822  1.00 11.30 ? 80   VAL A CA  1 
ATOM   651   C  C   . VAL A 1 83  ? 88.064  61.900  38.188  1.00 12.83 ? 80   VAL A C   1 
ATOM   652   O  O   . VAL A 1 83  ? 88.443  61.930  37.007  1.00 13.23 ? 80   VAL A O   1 
ATOM   653   C  CB  . VAL A 1 83  ? 88.561  59.516  38.725  1.00 12.73 ? 80   VAL A CB  1 
ATOM   654   C  CG1 . VAL A 1 83  ? 89.813  59.884  39.540  1.00 10.89 ? 80   VAL A CG1 1 
ATOM   655   C  CG2 . VAL A 1 83  ? 87.940  58.203  39.230  1.00 9.39  ? 80   VAL A CG2 1 
ATOM   656   N  N   . GLY A 1 84  ? 88.028  62.977  38.949  1.00 13.23 ? 81   GLY A N   1 
ATOM   657   C  CA  . GLY A 1 84  ? 88.471  64.268  38.432  1.00 13.53 ? 81   GLY A CA  1 
ATOM   658   C  C   . GLY A 1 84  ? 88.348  65.365  39.461  1.00 12.54 ? 81   GLY A C   1 
ATOM   659   O  O   . GLY A 1 84  ? 87.703  65.195  40.499  1.00 12.61 ? 81   GLY A O   1 
ATOM   660   N  N   . ILE A 1 85  ? 88.957  66.507  39.165  1.00 12.65 ? 82   ILE A N   1 
ATOM   661   C  CA  . ILE A 1 85  ? 88.928  67.644  40.067  1.00 11.80 ? 82   ILE A CA  1 
ATOM   662   C  C   . ILE A 1 85  ? 88.804  68.920  39.214  1.00 12.55 ? 82   ILE A C   1 
ATOM   663   O  O   . ILE A 1 85  ? 89.051  68.878  38.004  1.00 10.80 ? 82   ILE A O   1 
ATOM   664   C  CB  . ILE A 1 85  ? 90.207  67.646  40.946  1.00 12.61 ? 82   ILE A CB  1 
ATOM   665   C  CG1 . ILE A 1 85  ? 90.077  68.600  42.147  1.00 13.59 ? 82   ILE A CG1 1 
ATOM   666   C  CG2 . ILE A 1 85  ? 91.455  67.967  40.086  1.00 11.93 ? 82   ILE A CG2 1 
ATOM   667   C  CD1 . ILE A 1 85  ? 91.140  68.338  43.283  1.00 11.74 ? 82   ILE A CD1 1 
ATOM   668   N  N   . GLY A 1 86  ? 88.346  70.011  39.821  1.00 13.01 ? 83   GLY A N   1 
ATOM   669   C  CA  . GLY A 1 86  ? 88.216  71.303  39.131  1.00 13.66 ? 83   GLY A CA  1 
ATOM   670   C  C   . GLY A 1 86  ? 87.304  71.303  37.917  1.00 14.69 ? 83   GLY A C   1 
ATOM   671   O  O   . GLY A 1 86  ? 86.152  70.895  37.998  1.00 14.06 ? 83   GLY A O   1 
ATOM   672   N  N   . GLY A 1 87  ? 87.828  71.758  36.780  1.00 14.98 ? 84   GLY A N   1 
ATOM   673   C  CA  . GLY A 1 87  ? 87.064  71.773  35.523  1.00 15.25 ? 84   GLY A CA  1 
ATOM   674   C  C   . GLY A 1 87  ? 86.639  70.372  35.083  1.00 16.33 ? 84   GLY A C   1 
ATOM   675   O  O   . GLY A 1 87  ? 85.646  70.218  34.355  1.00 17.53 ? 84   GLY A O   1 
ATOM   676   N  N   . SER A 1 88  ? 87.389  69.353  35.511  1.00 15.06 ? 85   SER A N   1 
ATOM   677   C  CA  . SER A 1 88  ? 87.051  67.968  35.200  1.00 16.25 ? 85   SER A CA  1 
ATOM   678   C  C   . SER A 1 88  ? 86.056  67.366  36.185  1.00 16.83 ? 85   SER A C   1 
ATOM   679   O  O   . SER A 1 88  ? 85.861  66.154  36.188  1.00 17.51 ? 85   SER A O   1 
ATOM   680   C  CB  . SER A 1 88  ? 88.307  67.101  35.219  1.00 15.42 ? 85   SER A CB  1 
ATOM   681   O  OG  . SER A 1 88  ? 89.213  67.529  34.220  1.00 17.66 ? 85   SER A OG  1 
ATOM   682   N  N   . TYR A 1 89  ? 85.437  68.211  37.009  1.00 16.88 ? 86   TYR A N   1 
ATOM   683   C  CA  . TYR A 1 89  ? 84.497  67.781  38.051  1.00 16.52 ? 86   TYR A CA  1 
ATOM   684   C  C   . TYR A 1 89  ? 83.224  68.630  38.209  1.00 17.28 ? 86   TYR A C   1 
ATOM   685   O  O   . TYR A 1 89  ? 82.111  68.094  38.175  1.00 17.13 ? 86   TYR A O   1 
ATOM   686   C  CB  . TYR A 1 89  ? 85.267  67.711  39.398  1.00 16.75 ? 86   TYR A CB  1 
ATOM   687   C  CG  . TYR A 1 89  ? 84.442  67.687  40.679  1.00 16.11 ? 86   TYR A CG  1 
ATOM   688   C  CD1 . TYR A 1 89  ? 83.527  66.675  40.921  1.00 18.64 ? 86   TYR A CD1 1 
ATOM   689   C  CD2 . TYR A 1 89  ? 84.651  68.630  41.682  1.00 16.91 ? 86   TYR A CD2 1 
ATOM   690   C  CE1 . TYR A 1 89  ? 82.801  66.634  42.075  1.00 20.22 ? 86   TYR A CE1 1 
ATOM   691   C  CE2 . TYR A 1 89  ? 83.930  68.586  42.881  1.00 17.00 ? 86   TYR A CE2 1 
ATOM   692   C  CZ  . TYR A 1 89  ? 83.007  67.582  43.065  1.00 20.42 ? 86   TYR A CZ  1 
ATOM   693   O  OH  . TYR A 1 89  ? 82.261  67.497  44.214  1.00 23.07 ? 86   TYR A OH  1 
ATOM   694   N  N   . LEU A 1 90  ? 83.389  69.946  38.332  1.00 15.44 ? 87   LEU A N   1 
ATOM   695   C  CA  . LEU A 1 90  ? 82.256  70.838  38.614  1.00 14.74 ? 87   LEU A CA  1 
ATOM   696   C  C   . LEU A 1 90  ? 81.164  70.959  37.546  1.00 14.97 ? 87   LEU A C   1 
ATOM   697   O  O   . LEU A 1 90  ? 79.986  71.002  37.888  1.00 15.83 ? 87   LEU A O   1 
ATOM   698   C  CB  . LEU A 1 90  ? 82.759  72.236  38.994  1.00 14.63 ? 87   LEU A CB  1 
ATOM   699   C  CG  . LEU A 1 90  ? 83.589  72.401  40.270  1.00 15.27 ? 87   LEU A CG  1 
ATOM   700   C  CD1 . LEU A 1 90  ? 84.009  73.865  40.446  1.00 15.57 ? 87   LEU A CD1 1 
ATOM   701   C  CD2 . LEU A 1 90  ? 82.782  71.932  41.487  1.00 16.54 ? 87   LEU A CD2 1 
ATOM   702   N  N   . GLY A 1 91  ? 81.538  71.074  36.279  1.00 13.17 ? 88   GLY A N   1 
ATOM   703   C  CA  . GLY A 1 91  ? 80.545  71.213  35.213  1.00 14.85 ? 88   GLY A CA  1 
ATOM   704   C  C   . GLY A 1 91  ? 79.607  70.018  35.135  1.00 13.91 ? 88   GLY A C   1 
ATOM   705   O  O   . GLY A 1 91  ? 78.390  70.173  35.060  1.00 14.20 ? 88   GLY A O   1 
ATOM   706   N  N   . ALA A 1 92  ? 80.178  68.822  35.198  1.00 13.72 ? 89   ALA A N   1 
ATOM   707   C  CA  . ALA A 1 92  ? 79.386  67.597  35.131  1.00 14.18 ? 89   ALA A CA  1 
ATOM   708   C  C   . ALA A 1 92  ? 78.474  67.498  36.342  1.00 13.81 ? 89   ALA A C   1 
ATOM   709   O  O   . ALA A 1 92  ? 77.306  67.210  36.208  1.00 12.40 ? 89   ALA A O   1 
ATOM   710   C  CB  . ALA A 1 92  ? 80.296  66.379  35.062  1.00 13.96 ? 89   ALA A CB  1 
ATOM   711   N  N   . ARG A 1 93  ? 79.015  67.753  37.529  1.00 14.72 ? 90   ARG A N   1 
ATOM   712   C  CA  . ARG A 1 93  ? 78.203  67.658  38.714  1.00 14.63 ? 90   ARG A CA  1 
ATOM   713   C  C   . ARG A 1 93  ? 77.090  68.718  38.693  1.00 14.70 ? 90   ARG A C   1 
ATOM   714   O  O   . ARG A 1 93  ? 75.949  68.434  39.070  1.00 13.19 ? 90   ARG A O   1 
ATOM   715   C  CB  . ARG A 1 93  ? 79.048  67.721  39.984  1.00 15.67 ? 90   ARG A CB  1 
ATOM   716   C  CG  . ARG A 1 93  ? 78.224  67.362  41.193  1.00 16.69 ? 90   ARG A CG  1 
ATOM   717   C  CD  . ARG A 1 93  ? 79.029  67.183  42.437  1.00 22.33 ? 90   ARG A CD  1 
ATOM   718   N  NE  . ARG A 1 93  ? 78.137  66.804  43.533  1.00 22.52 ? 90   ARG A NE  1 
ATOM   719   C  CZ  . ARG A 1 93  ? 78.537  66.370  44.726  1.00 29.12 ? 90   ARG A CZ  1 
ATOM   720   N  NH1 . ARG A 1 93  ? 79.834  66.212  44.997  1.00 30.82 ? 90   ARG A NH1 1 
ATOM   721   N  NH2 . ARG A 1 93  ? 77.629  66.055  45.643  1.00 26.79 ? 90   ARG A NH2 1 
ATOM   722   N  N   . ALA A 1 94  ? 77.413  69.922  38.227  1.00 14.42 ? 91   ALA A N   1 
ATOM   723   C  CA  . ALA A 1 94  ? 76.423  70.998  38.128  1.00 14.58 ? 91   ALA A CA  1 
ATOM   724   C  C   . ALA A 1 94  ? 75.221  70.585  37.263  1.00 14.93 ? 91   ALA A C   1 
ATOM   725   O  O   . ALA A 1 94  ? 74.054  70.795  37.650  1.00 14.66 ? 91   ALA A O   1 
ATOM   726   C  CB  . ALA A 1 94  ? 77.047  72.256  37.541  1.00 13.45 ? 91   ALA A CB  1 
ATOM   727   N  N   . ALA A 1 95  ? 75.513  70.020  36.094  1.00 13.67 ? 92   ALA A N   1 
ATOM   728   C  CA  . ALA A 1 95  ? 74.471  69.601  35.155  1.00 14.36 ? 92   ALA A CA  1 
ATOM   729   C  C   . ALA A 1 95  ? 73.663  68.426  35.689  1.00 14.90 ? 92   ALA A C   1 
ATOM   730   O  O   . ALA A 1 95  ? 72.428  68.438  35.630  1.00 14.36 ? 92   ALA A O   1 
ATOM   731   C  CB  . ALA A 1 95  ? 75.092  69.268  33.773  1.00 14.77 ? 92   ALA A CB  1 
ATOM   732   N  N   . ILE A 1 96  ? 74.352  67.421  36.231  1.00 15.36 ? 93   ILE A N   1 
ATOM   733   C  CA  . ILE A 1 96  ? 73.683  66.210  36.767  1.00 14.78 ? 93   ILE A CA  1 
ATOM   734   C  C   . ILE A 1 96  ? 72.745  66.535  37.928  1.00 15.85 ? 93   ILE A C   1 
ATOM   735   O  O   . ILE A 1 96  ? 71.597  66.027  37.992  1.00 16.02 ? 93   ILE A O   1 
ATOM   736   C  CB  . ILE A 1 96  ? 74.725  65.152  37.207  1.00 13.66 ? 93   ILE A CB  1 
ATOM   737   C  CG1 . ILE A 1 96  ? 75.428  64.590  35.967  1.00 15.16 ? 93   ILE A CG1 1 
ATOM   738   C  CG2 . ILE A 1 96  ? 74.066  64.048  37.987  1.00 13.21 ? 93   ILE A CG2 1 
ATOM   739   C  CD1 . ILE A 1 96  ? 76.679  63.763  36.226  1.00 14.07 ? 93   ILE A CD1 1 
ATOM   740   N  N   . GLU A 1 97  ? 73.186  67.406  38.832  1.00 15.20 ? 94   GLU A N   1 
ATOM   741   C  CA  . GLU A 1 97  ? 72.330  67.773  39.948  1.00 16.70 ? 94   GLU A CA  1 
ATOM   742   C  C   . GLU A 1 97  ? 71.204  68.740  39.561  1.00 15.00 ? 94   GLU A C   1 
ATOM   743   O  O   . GLU A 1 97  ? 70.098  68.643  40.085  1.00 13.91 ? 94   GLU A O   1 
ATOM   744   C  CB  . GLU A 1 97  ? 73.148  68.316  41.135  1.00 17.65 ? 94   GLU A CB  1 
ATOM   745   C  CG  . GLU A 1 97  ? 74.083  67.252  41.687  1.00 19.99 ? 94   GLU A CG  1 
ATOM   746   C  CD  . GLU A 1 97  ? 74.570  67.546  43.074  1.00 27.30 ? 94   GLU A CD  1 
ATOM   747   O  OE1 . GLU A 1 97  ? 74.198  68.612  43.629  1.00 31.62 ? 94   GLU A OE1 1 
ATOM   748   O  OE2 . GLU A 1 97  ? 75.323  66.697  43.615  1.00 30.32 ? 94   GLU A OE2 1 
HETATM 749   N  N   . MSE A 1 98  ? 71.481  69.681  38.674  1.00 15.69 ? 95   MSE A N   1 
HETATM 750   C  CA  . MSE A 1 98  ? 70.461  70.618  38.247  1.00 15.84 ? 95   MSE A CA  1 
HETATM 751   C  C   . MSE A 1 98  ? 69.305  69.959  37.487  1.00 15.36 ? 95   MSE A C   1 
HETATM 752   O  O   . MSE A 1 98  ? 68.137  70.339  37.643  1.00 14.89 ? 95   MSE A O   1 
HETATM 753   C  CB  . MSE A 1 98  ? 71.059  71.670  37.315  1.00 16.84 ? 95   MSE A CB  1 
HETATM 754   C  CG  . MSE A 1 98  ? 69.996  72.605  36.728  1.00 20.69 ? 95   MSE A CG  1 
HETATM 755   SE SE  . MSE A 1 98  ? 70.683  73.867  35.396  1.00 27.39 ? 95   MSE A SE  1 
HETATM 756   C  CE  . MSE A 1 98  ? 71.977  74.559  36.605  1.00 13.63 ? 95   MSE A CE  1 
ATOM   757   N  N   . LEU A 1 99  ? 69.621  68.931  36.715  1.00 15.42 ? 96   LEU A N   1 
ATOM   758   C  CA  . LEU A 1 99  ? 68.628  68.347  35.820  1.00 13.59 ? 96   LEU A CA  1 
ATOM   759   C  C   . LEU A 1 99  ? 68.036  66.981  36.165  1.00 13.85 ? 96   LEU A C   1 
ATOM   760   O  O   . LEU A 1 99  ? 67.190  66.494  35.434  1.00 16.14 ? 96   LEU A O   1 
ATOM   761   C  CB  . LEU A 1 99  ? 69.228  68.308  34.420  1.00 12.77 ? 96   LEU A CB  1 
ATOM   762   C  CG  . LEU A 1 99  ? 69.746  69.653  33.909  1.00 13.51 ? 96   LEU A CG  1 
ATOM   763   C  CD1 . LEU A 1 99  ? 70.368  69.508  32.505  1.00 15.03 ? 96   LEU A CD1 1 
ATOM   764   C  CD2 . LEU A 1 99  ? 68.627  70.709  33.905  1.00 12.22 ? 96   LEU A CD2 1 
ATOM   765   N  N   . ASN A 1 100 ? 68.487  66.375  37.247  1.00 12.59 ? 97   ASN A N   1 
ATOM   766   C  CA  . ASN A 1 100 ? 67.983  65.088  37.697  1.00 13.16 ? 97   ASN A CA  1 
ATOM   767   C  C   . ASN A 1 100 ? 67.228  65.235  39.011  1.00 14.09 ? 97   ASN A C   1 
ATOM   768   O  O   . ASN A 1 100 ? 67.240  66.301  39.626  1.00 13.74 ? 97   ASN A O   1 
ATOM   769   C  CB  . ASN A 1 100 ? 69.120  64.092  37.858  1.00 12.51 ? 97   ASN A CB  1 
ATOM   770   C  CG  . ASN A 1 100 ? 69.581  63.532  36.533  1.00 13.89 ? 97   ASN A CG  1 
ATOM   771   O  OD1 . ASN A 1 100 ? 68.898  62.688  35.943  1.00 17.52 ? 97   ASN A OD1 1 
ATOM   772   N  ND2 . ASN A 1 100 ? 70.746  63.966  36.072  1.00 11.66 ? 97   ASN A ND2 1 
ATOM   773   N  N   . HIS A 1 101 ? 66.583  64.147  39.415  1.00 14.38 ? 98   HIS A N   1 
ATOM   774   C  CA  . HIS A 1 101 ? 65.815  64.068  40.651  1.00 14.51 ? 98   HIS A CA  1 
ATOM   775   C  C   . HIS A 1 101 ? 66.651  64.613  41.812  1.00 14.97 ? 98   HIS A C   1 
ATOM   776   O  O   . HIS A 1 101 ? 67.852  64.356  41.896  1.00 12.35 ? 98   HIS A O   1 
ATOM   777   C  CB  . HIS A 1 101 ? 65.458  62.605  40.886  1.00 15.08 ? 98   HIS A CB  1 
ATOM   778   C  CG  . HIS A 1 101 ? 64.413  62.373  41.925  1.00 12.15 ? 98   HIS A CG  1 
ATOM   779   N  ND1 . HIS A 1 101 ? 64.690  62.383  43.276  1.00 10.40 ? 98   HIS A ND1 1 
ATOM   780   C  CD2 . HIS A 1 101 ? 63.111  62.021  41.809  1.00 11.89 ? 98   HIS A CD2 1 
ATOM   781   C  CE1 . HIS A 1 101 ? 63.594  62.087  43.949  1.00 9.97  ? 98   HIS A CE1 1 
ATOM   782   N  NE2 . HIS A 1 101 ? 62.621  61.858  43.084  1.00 11.97 ? 98   HIS A NE2 1 
ATOM   783   N  N   . SER A 1 102 ? 65.997  65.352  42.711  1.00 13.68 ? 99   SER A N   1 
ATOM   784   C  CA  . SER A 1 102 ? 66.665  65.952  43.865  1.00 13.50 ? 99   SER A CA  1 
ATOM   785   C  C   . SER A 1 102 ? 67.369  64.942  44.761  1.00 13.91 ? 99   SER A C   1 
ATOM   786   O  O   . SER A 1 102 ? 68.331  65.298  45.439  1.00 13.50 ? 99   SER A O   1 
ATOM   787   C  CB  . SER A 1 102 ? 65.663  66.783  44.687  1.00 14.03 ? 99   SER A CB  1 
ATOM   788   O  OG  . SER A 1 102 ? 65.059  67.758  43.860  1.00 13.77 ? 99   SER A OG  1 
ATOM   789   N  N   . PHE A 1 103 ? 66.894  63.696  44.775  1.00 12.82 ? 100  PHE A N   1 
ATOM   790   C  CA  . PHE A 1 103 ? 67.525  62.640  45.578  1.00 13.82 ? 100  PHE A CA  1 
ATOM   791   C  C   . PHE A 1 103 ? 67.990  61.485  44.680  1.00 13.36 ? 100  PHE A C   1 
ATOM   792   O  O   . PHE A 1 103 ? 67.951  60.322  45.060  1.00 13.74 ? 100  PHE A O   1 
ATOM   793   C  CB  . PHE A 1 103 ? 66.567  62.159  46.665  1.00 14.06 ? 100  PHE A CB  1 
ATOM   794   C  CG  . PHE A 1 103 ? 66.182  63.238  47.639  1.00 15.43 ? 100  PHE A CG  1 
ATOM   795   C  CD1 . PHE A 1 103 ? 65.145  64.107  47.352  1.00 17.87 ? 100  PHE A CD1 1 
ATOM   796   C  CD2 . PHE A 1 103 ? 66.874  63.403  48.830  1.00 18.69 ? 100  PHE A CD2 1 
ATOM   797   C  CE1 . PHE A 1 103 ? 64.794  65.125  48.239  1.00 17.11 ? 100  PHE A CE1 1 
ATOM   798   C  CE2 . PHE A 1 103 ? 66.525  64.419  49.725  1.00 16.21 ? 100  PHE A CE2 1 
ATOM   799   C  CZ  . PHE A 1 103 ? 65.491  65.278  49.416  1.00 18.51 ? 100  PHE A CZ  1 
ATOM   800   N  N   . TYR A 1 104 ? 68.510  61.854  43.513  1.00 13.55 ? 101  TYR A N   1 
ATOM   801   C  CA  . TYR A 1 104 ? 68.986  60.926  42.490  1.00 13.72 ? 101  TYR A CA  1 
ATOM   802   C  C   . TYR A 1 104 ? 69.712  59.683  43.034  1.00 14.97 ? 101  TYR A C   1 
ATOM   803   O  O   . TYR A 1 104 ? 69.241  58.550  42.852  1.00 14.18 ? 101  TYR A O   1 
ATOM   804   C  CB  . TYR A 1 104 ? 69.884  61.689  41.522  1.00 13.52 ? 101  TYR A CB  1 
ATOM   805   C  CG  . TYR A 1 104 ? 70.352  60.879  40.340  1.00 14.75 ? 101  TYR A CG  1 
ATOM   806   C  CD1 . TYR A 1 104 ? 69.502  60.623  39.276  1.00 11.71 ? 101  TYR A CD1 1 
ATOM   807   C  CD2 . TYR A 1 104 ? 71.665  60.419  40.256  1.00 11.63 ? 101  TYR A CD2 1 
ATOM   808   C  CE1 . TYR A 1 104 ? 69.927  59.906  38.172  1.00 13.98 ? 101  TYR A CE1 1 
ATOM   809   C  CE2 . TYR A 1 104 ? 72.103  59.715  39.159  1.00 12.47 ? 101  TYR A CE2 1 
ATOM   810   C  CZ  . TYR A 1 104 ? 71.234  59.454  38.114  1.00 15.94 ? 101  TYR A CZ  1 
ATOM   811   O  OH  . TYR A 1 104 ? 71.655  58.730  37.010  1.00 13.41 ? 101  TYR A OH  1 
ATOM   812   N  N   . ASN A 1 105 ? 70.809  59.899  43.749  1.00 15.47 ? 102  ASN A N   1 
ATOM   813   C  CA  . ASN A 1 105 ? 71.597  58.792  44.275  1.00 17.52 ? 102  ASN A CA  1 
ATOM   814   C  C   . ASN A 1 105 ? 70.965  58.016  45.444  1.00 17.25 ? 102  ASN A C   1 
ATOM   815   O  O   . ASN A 1 105 ? 71.367  56.893  45.721  1.00 17.51 ? 102  ASN A O   1 
ATOM   816   C  CB  . ASN A 1 105 ? 73.007  59.278  44.668  1.00 18.53 ? 102  ASN A CB  1 
ATOM   817   C  CG  . ASN A 1 105 ? 73.903  59.575  43.448  1.00 21.14 ? 102  ASN A CG  1 
ATOM   818   O  OD1 . ASN A 1 105 ? 73.800  58.925  42.398  1.00 18.68 ? 102  ASN A OD1 1 
ATOM   819   N  ND2 . ASN A 1 105 ? 74.805  60.526  43.604  1.00 22.05 ? 102  ASN A ND2 1 
ATOM   820   N  N   . THR A 1 106 ? 69.976  58.599  46.109  1.00 17.94 ? 103  THR A N   1 
ATOM   821   C  CA  . THR A 1 106 ? 69.340  57.952  47.266  1.00 17.52 ? 103  THR A CA  1 
ATOM   822   C  C   . THR A 1 106 ? 68.187  57.052  46.853  1.00 17.08 ? 103  THR A C   1 
ATOM   823   O  O   . THR A 1 106 ? 67.816  56.151  47.589  1.00 18.68 ? 103  THR A O   1 
ATOM   824   C  CB  . THR A 1 106 ? 68.855  59.010  48.273  1.00 18.58 ? 103  THR A CB  1 
ATOM   825   O  OG1 . THR A 1 106 ? 69.901  59.964  48.485  1.00 21.34 ? 103  THR A OG1 1 
ATOM   826   C  CG2 . THR A 1 106 ? 68.456  58.372  49.603  1.00 19.30 ? 103  THR A CG2 1 
ATOM   827   N  N   . LEU A 1 107 ? 67.629  57.299  45.671  1.00 15.89 ? 104  LEU A N   1 
ATOM   828   C  CA  . LEU A 1 107 ? 66.541  56.487  45.130  1.00 15.57 ? 104  LEU A CA  1 
ATOM   829   C  C   . LEU A 1 107 ? 67.039  55.073  44.876  1.00 15.91 ? 104  LEU A C   1 
ATOM   830   O  O   . LEU A 1 107 ? 68.258  54.846  44.781  1.00 14.31 ? 104  LEU A O   1 
ATOM   831   C  CB  . LEU A 1 107 ? 66.061  57.050  43.777  1.00 14.46 ? 104  LEU A CB  1 
ATOM   832   C  CG  . LEU A 1 107 ? 65.395  58.430  43.679  1.00 16.25 ? 104  LEU A CG  1 
ATOM   833   C  CD1 . LEU A 1 107 ? 65.249  58.819  42.216  1.00 15.47 ? 104  LEU A CD1 1 
ATOM   834   C  CD2 . LEU A 1 107 ? 64.043  58.465  44.398  1.00 15.06 ? 104  LEU A CD2 1 
ATOM   835   N  N   . SER A 1 108 ? 66.106  54.124  44.742  1.00 16.39 ? 105  SER A N   1 
ATOM   836   C  CA  . SER A 1 108 ? 66.493  52.761  44.409  1.00 16.79 ? 105  SER A CA  1 
ATOM   837   C  C   . SER A 1 108 ? 66.772  52.685  42.911  1.00 18.18 ? 105  SER A C   1 
ATOM   838   O  O   . SER A 1 108 ? 66.441  53.611  42.145  1.00 15.58 ? 105  SER A O   1 
ATOM   839   C  CB  . SER A 1 108 ? 65.377  51.762  44.726  1.00 18.00 ? 105  SER A CB  1 
ATOM   840   O  OG  . SER A 1 108 ? 64.250  52.007  43.910  1.00 16.71 ? 105  SER A OG  1 
ATOM   841   N  N   . LYS A 1 109 ? 67.343  51.564  42.482  1.00 19.20 ? 106  LYS A N   1 
ATOM   842   C  CA  . LYS A 1 109 ? 67.623  51.346  41.068  1.00 21.11 ? 106  LYS A CA  1 
ATOM   843   C  C   . LYS A 1 109 ? 66.312  51.386  40.280  1.00 21.06 ? 106  LYS A C   1 
ATOM   844   O  O   . LYS A 1 109 ? 66.257  51.978  39.206  1.00 21.01 ? 106  LYS A O   1 
ATOM   845   C  CB  . LYS A 1 109 ? 68.278  49.974  40.838  1.00 23.08 ? 106  LYS A CB  1 
ATOM   846   C  CG  . LYS A 1 109 ? 69.605  49.737  41.501  1.00 29.74 ? 106  LYS A CG  1 
ATOM   847   C  CD  . LYS A 1 109 ? 70.039  48.261  41.309  1.00 35.99 ? 106  LYS A CD  1 
ATOM   848   C  CE  . LYS A 1 109 ? 71.365  47.931  42.013  1.00 38.19 ? 106  LYS A CE  1 
ATOM   849   N  NZ  . LYS A 1 109 ? 71.739  46.480  41.881  1.00 39.19 ? 106  LYS A NZ  1 
ATOM   850   N  N   . GLU A 1 110 ? 65.256  50.763  40.818  1.00 21.37 ? 107  GLU A N   1 
ATOM   851   C  CA  . GLU A 1 110 ? 63.949  50.740  40.145  1.00 22.32 ? 107  GLU A CA  1 
ATOM   852   C  C   . GLU A 1 110 ? 63.360  52.130  39.919  1.00 21.19 ? 107  GLU A C   1 
ATOM   853   O  O   . GLU A 1 110 ? 62.753  52.396  38.884  1.00 20.17 ? 107  GLU A O   1 
ATOM   854   C  CB  . GLU A 1 110 ? 62.939  49.848  40.883  1.00 24.18 ? 107  GLU A CB  1 
ATOM   855   C  CG  . GLU A 1 110 ? 63.273  48.354  40.760  1.00 31.24 ? 107  GLU A CG  1 
ATOM   856   C  CD  . GLU A 1 110 ? 62.183  47.437  41.296  1.00 39.91 ? 107  GLU A CD  1 
ATOM   857   O  OE1 . GLU A 1 110 ? 60.994  47.848  41.318  1.00 46.17 ? 107  GLU A OE1 1 
ATOM   858   O  OE2 . GLU A 1 110 ? 62.513  46.280  41.659  1.00 47.54 ? 107  GLU A OE2 1 
ATOM   859   N  N   . GLN A 1 111 ? 63.551  53.017  40.880  1.00 19.17 ? 108  GLN A N   1 
ATOM   860   C  CA  . GLN A 1 111 ? 63.058  54.381  40.766  1.00 17.93 ? 108  GLN A CA  1 
ATOM   861   C  C   . GLN A 1 111 ? 63.937  55.256  39.860  1.00 17.75 ? 108  GLN A C   1 
ATOM   862   O  O   . GLN A 1 111 ? 63.433  55.959  38.983  1.00 16.90 ? 108  GLN A O   1 
ATOM   863   C  CB  . GLN A 1 111 ? 63.014  55.019  42.159  1.00 18.48 ? 108  GLN A CB  1 
ATOM   864   C  CG  . GLN A 1 111 ? 61.929  54.492  43.114  1.00 16.94 ? 108  GLN A CG  1 
ATOM   865   C  CD  . GLN A 1 111 ? 62.132  55.062  44.523  1.00 21.63 ? 108  GLN A CD  1 
ATOM   866   O  OE1 . GLN A 1 111 ? 63.245  55.009  45.074  1.00 15.11 ? 108  GLN A OE1 1 
ATOM   867   N  NE2 . GLN A 1 111 ? 61.069  55.628  45.096  1.00 19.89 ? 108  GLN A NE2 1 
ATOM   868   N  N   . ARG A 1 112 ? 65.255  55.206  40.076  1.00 16.81 ? 109  ARG A N   1 
ATOM   869   C  CA  . ARG A 1 112 ? 66.196  56.053  39.330  1.00 16.67 ? 109  ARG A CA  1 
ATOM   870   C  C   . ARG A 1 112 ? 66.375  55.669  37.862  1.00 17.84 ? 109  ARG A C   1 
ATOM   871   O  O   . ARG A 1 112 ? 66.476  56.551  36.999  1.00 17.78 ? 109  ARG A O   1 
ATOM   872   C  CB  . ARG A 1 112 ? 67.562  56.082  40.050  1.00 16.64 ? 109  ARG A CB  1 
ATOM   873   C  CG  . ARG A 1 112 ? 68.645  56.907  39.361  1.00 15.26 ? 109  ARG A CG  1 
ATOM   874   C  CD  . ARG A 1 112 ? 69.982  56.877  40.140  1.00 15.21 ? 109  ARG A CD  1 
ATOM   875   N  NE  . ARG A 1 112 ? 70.360  55.499  40.455  1.00 14.63 ? 109  ARG A NE  1 
ATOM   876   C  CZ  . ARG A 1 112 ? 70.151  54.923  41.628  1.00 16.15 ? 109  ARG A CZ  1 
ATOM   877   N  NH1 . ARG A 1 112 ? 69.634  55.620  42.615  1.00 18.47 ? 109  ARG A NH1 1 
ATOM   878   N  NH2 . ARG A 1 112 ? 70.477  53.652  41.825  1.00 18.85 ? 109  ARG A NH2 1 
ATOM   879   N  N   . LYS A 1 113 ? 66.459  54.359  37.604  1.00 18.28 ? 110  LYS A N   1 
ATOM   880   C  CA  . LYS A 1 113 ? 66.623  53.788  36.258  1.00 18.49 ? 110  LYS A CA  1 
ATOM   881   C  C   . LYS A 1 113 ? 68.056  53.832  35.722  1.00 18.16 ? 110  LYS A C   1 
ATOM   882   O  O   . LYS A 1 113 ? 68.614  52.793  35.327  1.00 19.54 ? 110  LYS A O   1 
ATOM   883   C  CB  . LYS A 1 113 ? 65.630  54.398  35.272  1.00 19.99 ? 110  LYS A CB  1 
ATOM   884   C  CG  . LYS A 1 113 ? 64.200  54.166  35.741  1.00 23.41 ? 110  LYS A CG  1 
ATOM   885   C  CD  . LYS A 1 113 ? 63.168  54.616  34.769  1.00 26.30 ? 110  LYS A CD  1 
ATOM   886   C  CE  . LYS A 1 113 ? 61.783  54.298  35.330  1.00 28.90 ? 110  LYS A CE  1 
ATOM   887   N  NZ  . LYS A 1 113 ? 61.657  52.864  35.707  1.00 29.82 ? 110  LYS A NZ  1 
ATOM   888   N  N   . THR A 1 114 ? 68.663  55.015  35.743  1.00 15.57 ? 111  THR A N   1 
ATOM   889   C  CA  . THR A 1 114 ? 70.016  55.198  35.265  1.00 13.86 ? 111  THR A CA  1 
ATOM   890   C  C   . THR A 1 114 ? 71.008  55.002  36.422  1.00 14.61 ? 111  THR A C   1 
ATOM   891   O  O   . THR A 1 114 ? 70.619  54.985  37.594  1.00 12.72 ? 111  THR A O   1 
ATOM   892   C  CB  . THR A 1 114 ? 70.173  56.600  34.643  1.00 13.85 ? 111  THR A CB  1 
ATOM   893   O  OG1 . THR A 1 114 ? 69.686  57.576  35.579  1.00 14.79 ? 111  THR A OG1 1 
ATOM   894   C  CG2 . THR A 1 114 ? 69.363  56.720  33.310  1.00 9.34  ? 111  THR A CG2 1 
ATOM   895   N  N   . PRO A 1 115 ? 72.298  54.864  36.099  1.00 14.74 ? 112  PRO A N   1 
ATOM   896   C  CA  . PRO A 1 115 ? 73.271  54.616  37.155  1.00 15.07 ? 112  PRO A CA  1 
ATOM   897   C  C   . PRO A 1 115 ? 73.458  55.740  38.157  1.00 15.38 ? 112  PRO A C   1 
ATOM   898   O  O   . PRO A 1 115 ? 73.213  56.907  37.831  1.00 13.91 ? 112  PRO A O   1 
ATOM   899   C  CB  . PRO A 1 115 ? 74.590  54.456  36.377  1.00 15.09 ? 112  PRO A CB  1 
ATOM   900   C  CG  . PRO A 1 115 ? 74.171  54.086  34.965  1.00 15.14 ? 112  PRO A CG  1 
ATOM   901   C  CD  . PRO A 1 115 ? 72.901  54.805  34.750  1.00 15.46 ? 112  PRO A CD  1 
ATOM   902   N  N   . GLN A 1 116 ? 73.882  55.386  39.375  1.00 15.16 ? 113  GLN A N   1 
ATOM   903   C  CA  . GLN A 1 116 ? 74.246  56.409  40.342  1.00 15.27 ? 113  GLN A CA  1 
ATOM   904   C  C   . GLN A 1 116 ? 75.503  57.047  39.755  1.00 15.15 ? 113  GLN A C   1 
ATOM   905   O  O   . GLN A 1 116 ? 76.245  56.381  39.025  1.00 14.37 ? 113  GLN A O   1 
ATOM   906   C  CB  . GLN A 1 116 ? 74.605  55.824  41.714  1.00 15.39 ? 113  GLN A CB  1 
ATOM   907   C  CG  . GLN A 1 116 ? 73.458  55.308  42.568  1.00 18.06 ? 113  GLN A CG  1 
ATOM   908   C  CD  . GLN A 1 116 ? 73.957  54.588  43.845  1.00 21.39 ? 113  GLN A CD  1 
ATOM   909   O  OE1 . GLN A 1 116 ? 74.744  53.660  43.762  1.00 23.99 ? 113  GLN A OE1 1 
ATOM   910   N  NE2 . GLN A 1 116 ? 73.433  54.981  45.015  1.00 25.93 ? 113  GLN A NE2 1 
ATOM   911   N  N   . VAL A 1 117 ? 75.723  58.338  40.004  1.00 15.17 ? 114  VAL A N   1 
ATOM   912   C  CA  . VAL A 1 117 ? 76.957  58.971  39.561  1.00 15.24 ? 114  VAL A CA  1 
ATOM   913   C  C   . VAL A 1 117 ? 77.670  59.519  40.799  1.00 16.19 ? 114  VAL A C   1 
ATOM   914   O  O   . VAL A 1 117 ? 77.187  60.470  41.444  1.00 17.94 ? 114  VAL A O   1 
ATOM   915   C  CB  . VAL A 1 117 ? 76.770  60.091  38.520  1.00 15.98 ? 114  VAL A CB  1 
ATOM   916   C  CG1 . VAL A 1 117 ? 78.134  60.703  38.161  1.00 17.02 ? 114  VAL A CG1 1 
ATOM   917   C  CG2 . VAL A 1 117 ? 76.080  59.572  37.262  1.00 13.96 ? 114  VAL A CG2 1 
ATOM   918   N  N   . LEU A 1 118 ? 78.813  58.920  41.126  1.00 15.37 ? 115  LEU A N   1 
ATOM   919   C  CA  . LEU A 1 118 ? 79.599  59.305  42.289  1.00 15.38 ? 115  LEU A CA  1 
ATOM   920   C  C   . LEU A 1 118 ? 80.899  59.931  41.829  1.00 15.68 ? 115  LEU A C   1 
ATOM   921   O  O   . LEU A 1 118 ? 81.373  59.642  40.734  1.00 17.00 ? 115  LEU A O   1 
ATOM   922   C  CB  . LEU A 1 118 ? 79.857  58.083  43.180  1.00 15.74 ? 115  LEU A CB  1 
ATOM   923   C  CG  . LEU A 1 118 ? 78.580  57.324  43.608  1.00 17.36 ? 115  LEU A CG  1 
ATOM   924   C  CD1 . LEU A 1 118 ? 78.939  56.009  44.303  1.00 20.59 ? 115  LEU A CD1 1 
ATOM   925   C  CD2 . LEU A 1 118 ? 77.679  58.174  44.499  1.00 18.27 ? 115  LEU A CD2 1 
ATOM   926   N  N   . PHE A 1 119 ? 81.455  60.821  42.653  1.00 13.83 ? 116  PHE A N   1 
ATOM   927   C  CA  . PHE A 1 119 ? 82.693  61.511  42.325  1.00 13.29 ? 116  PHE A CA  1 
ATOM   928   C  C   . PHE A 1 119 ? 83.799  61.210  43.340  1.00 13.91 ? 116  PHE A C   1 
ATOM   929   O  O   . PHE A 1 119 ? 83.549  61.116  44.547  1.00 14.46 ? 116  PHE A O   1 
ATOM   930   C  CB  . PHE A 1 119 ? 82.448  63.021  42.277  1.00 13.51 ? 116  PHE A CB  1 
ATOM   931   C  CG  . PHE A 1 119 ? 81.427  63.428  41.275  1.00 13.64 ? 116  PHE A CG  1 
ATOM   932   C  CD1 . PHE A 1 119 ? 80.082  63.512  41.620  1.00 16.62 ? 116  PHE A CD1 1 
ATOM   933   C  CD2 . PHE A 1 119 ? 81.793  63.675  39.964  1.00 13.16 ? 116  PHE A CD2 1 
ATOM   934   C  CE1 . PHE A 1 119 ? 79.132  63.875  40.665  1.00 18.03 ? 116  PHE A CE1 1 
ATOM   935   C  CE2 . PHE A 1 119 ? 80.847  64.030  39.018  1.00 15.17 ? 116  PHE A CE2 1 
ATOM   936   C  CZ  . PHE A 1 119 ? 79.533  64.125  39.366  1.00 17.32 ? 116  PHE A CZ  1 
ATOM   937   N  N   . VAL A 1 120 ? 85.020  61.018  42.847  1.00 13.09 ? 117  VAL A N   1 
ATOM   938   C  CA  . VAL A 1 120 ? 86.163  60.800  43.723  1.00 12.25 ? 117  VAL A CA  1 
ATOM   939   C  C   . VAL A 1 120 ? 87.372  61.440  43.038  1.00 12.76 ? 117  VAL A C   1 
ATOM   940   O  O   . VAL A 1 120 ? 87.329  61.761  41.850  1.00 13.18 ? 117  VAL A O   1 
ATOM   941   C  CB  . VAL A 1 120 ? 86.393  59.302  43.986  1.00 13.38 ? 117  VAL A CB  1 
ATOM   942   C  CG1 . VAL A 1 120 ? 86.972  58.657  42.744  1.00 11.77 ? 117  VAL A CG1 1 
ATOM   943   C  CG2 . VAL A 1 120 ? 87.304  59.096  45.222  1.00 13.33 ? 117  VAL A CG2 1 
ATOM   944   N  N   . GLY A 1 121 ? 88.436  61.681  43.787  1.00 12.80 ? 118  GLY A N   1 
ATOM   945   C  CA  . GLY A 1 121 ? 89.623  62.286  43.225  1.00 12.25 ? 118  GLY A CA  1 
ATOM   946   C  C   . GLY A 1 121 ? 89.523  63.801  43.206  1.00 12.42 ? 118  GLY A C   1 
ATOM   947   O  O   . GLY A 1 121 ? 90.376  64.465  42.606  1.00 12.03 ? 118  GLY A O   1 
ATOM   948   N  N   . GLN A 1 122 ? 88.481  64.347  43.843  1.00 12.08 ? 119  GLN A N   1 
ATOM   949   C  CA  . GLN A 1 122 ? 88.311  65.798  43.942  1.00 12.42 ? 119  GLN A CA  1 
ATOM   950   C  C   . GLN A 1 122 ? 88.798  66.328  45.294  1.00 12.99 ? 119  GLN A C   1 
ATOM   951   O  O   . GLN A 1 122 ? 88.732  67.532  45.545  1.00 13.79 ? 119  GLN A O   1 
ATOM   952   C  CB  . GLN A 1 122 ? 86.854  66.249  43.709  1.00 13.47 ? 119  GLN A CB  1 
ATOM   953   C  CG  . GLN A 1 122 ? 85.861  66.070  44.878  1.00 13.30 ? 119  GLN A CG  1 
ATOM   954   C  CD  . GLN A 1 122 ? 85.361  64.648  45.075  1.00 17.49 ? 119  GLN A CD  1 
ATOM   955   O  OE1 . GLN A 1 122 ? 86.097  63.679  44.939  1.00 20.27 ? 119  GLN A OE1 1 
ATOM   956   N  NE2 . GLN A 1 122 ? 84.111  64.534  45.475  1.00 16.22 ? 119  GLN A NE2 1 
ATOM   957   N  N   . ASN A 1 123 ? 89.259  65.420  46.158  1.00 13.33 ? 120  ASN A N   1 
ATOM   958   C  CA  . ASN A 1 123 ? 89.804  65.740  47.470  1.00 13.08 ? 120  ASN A CA  1 
ATOM   959   C  C   . ASN A 1 123 ? 90.910  64.740  47.791  1.00 13.00 ? 120  ASN A C   1 
ATOM   960   O  O   . ASN A 1 123 ? 91.188  63.828  46.991  1.00 13.79 ? 120  ASN A O   1 
ATOM   961   C  CB  . ASN A 1 123 ? 88.699  65.701  48.552  1.00 13.26 ? 120  ASN A CB  1 
ATOM   962   C  CG  . ASN A 1 123 ? 88.037  64.331  48.678  1.00 14.62 ? 120  ASN A CG  1 
ATOM   963   O  OD1 . ASN A 1 123 ? 88.719  63.315  48.839  1.00 16.05 ? 120  ASN A OD1 1 
ATOM   964   N  ND2 . ASN A 1 123 ? 86.687  64.299  48.628  1.00 12.80 ? 120  ASN A ND2 1 
ATOM   965   N  N   . ILE A 1 124 ? 91.550  64.915  48.941  1.00 12.09 ? 121  ILE A N   1 
ATOM   966   C  CA  . ILE A 1 124 ? 92.588  63.987  49.376  1.00 12.76 ? 121  ILE A CA  1 
ATOM   967   C  C   . ILE A 1 124 ? 92.163  63.443  50.747  1.00 11.50 ? 121  ILE A C   1 
ATOM   968   O  O   . ILE A 1 124 ? 92.978  63.345  51.668  1.00 12.25 ? 121  ILE A O   1 
ATOM   969   C  CB  . ILE A 1 124 ? 93.978  64.653  49.485  1.00 12.96 ? 121  ILE A CB  1 
ATOM   970   C  CG1 . ILE A 1 124 ? 94.241  65.602  48.326  1.00 15.35 ? 121  ILE A CG1 1 
ATOM   971   C  CG2 . ILE A 1 124 ? 95.066  63.579  49.556  1.00 14.79 ? 121  ILE A CG2 1 
ATOM   972   C  CD1 . ILE A 1 124 ? 95.574  66.378  48.449  1.00 13.65 ? 121  ILE A CD1 1 
ATOM   973   N  N   . SER A 1 125 ? 90.882  63.087  50.872  1.00 10.20 ? 122  SER A N   1 
ATOM   974   C  CA  . SER A 1 125 ? 90.324  62.589  52.137  1.00 9.38  ? 122  SER A CA  1 
ATOM   975   C  C   . SER A 1 125 ? 90.255  61.072  52.168  1.00 9.96  ? 122  SER A C   1 
ATOM   976   O  O   . SER A 1 125 ? 89.453  60.473  51.460  1.00 10.80 ? 122  SER A O   1 
ATOM   977   C  CB  . SER A 1 125 ? 88.914  63.125  52.316  1.00 9.75  ? 122  SER A CB  1 
ATOM   978   O  OG  . SER A 1 125 ? 88.255  62.532  53.410  1.00 10.67 ? 122  SER A OG  1 
ATOM   979   N  N   . SER A 1 126 ? 91.040  60.451  53.030  1.00 10.25 ? 123  SER A N   1 
ATOM   980   C  CA  . SER A 1 126 ? 91.019  59.001  53.106  1.00 10.67 ? 123  SER A CA  1 
ATOM   981   C  C   . SER A 1 126 ? 89.664  58.534  53.701  1.00 11.18 ? 123  SER A C   1 
ATOM   982   O  O   . SER A 1 126 ? 89.150  57.485  53.331  1.00 10.73 ? 123  SER A O   1 
ATOM   983   C  CB  . SER A 1 126 ? 92.250  58.482  53.842  1.00 11.32 ? 123  SER A CB  1 
ATOM   984   O  OG  . SER A 1 126 ? 92.294  58.905  55.170  1.00 14.18 ? 123  SER A OG  1 
ATOM   985   N  N   . THR A 1 127 ? 89.070  59.338  54.585  1.00 11.46 ? 124  THR A N   1 
ATOM   986   C  CA  . THR A 1 127 ? 87.755  59.017  55.147  1.00 11.44 ? 124  THR A CA  1 
ATOM   987   C  C   . THR A 1 127 ? 86.684  58.998  54.020  1.00 11.83 ? 124  THR A C   1 
ATOM   988   O  O   . THR A 1 127 ? 85.868  58.068  53.925  1.00 11.09 ? 124  THR A O   1 
ATOM   989   C  CB  . THR A 1 127 ? 87.384  59.989  56.271  1.00 11.74 ? 124  THR A CB  1 
ATOM   990   O  OG1 . THR A 1 127 ? 88.310  59.826  57.353  1.00 12.29 ? 124  THR A OG1 1 
ATOM   991   C  CG2 . THR A 1 127 ? 85.970  59.738  56.784  1.00 11.24 ? 124  THR A CG2 1 
ATOM   992   N  N   . TYR A 1 128 ? 86.702  59.999  53.151  1.00 12.45 ? 125  TYR A N   1 
ATOM   993   C  CA  . TYR A 1 128 ? 85.757  60.041  52.037  1.00 11.55 ? 125  TYR A CA  1 
ATOM   994   C  C   . TYR A 1 128 ? 85.914  58.812  51.132  1.00 13.40 ? 125  TYR A C   1 
ATOM   995   O  O   . TYR A 1 128 ? 84.926  58.120  50.823  1.00 10.54 ? 125  TYR A O   1 
ATOM   996   C  CB  . TYR A 1 128 ? 85.948  61.323  51.225  1.00 13.51 ? 125  TYR A CB  1 
ATOM   997   C  CG  . TYR A 1 128 ? 85.022  61.473  50.056  1.00 11.59 ? 125  TYR A CG  1 
ATOM   998   C  CD1 . TYR A 1 128 ? 85.383  60.989  48.805  1.00 14.04 ? 125  TYR A CD1 1 
ATOM   999   C  CD2 . TYR A 1 128 ? 83.803  62.135  50.178  1.00 15.63 ? 125  TYR A CD2 1 
ATOM   1000  C  CE1 . TYR A 1 128 ? 84.561  61.133  47.719  1.00 11.55 ? 125  TYR A CE1 1 
ATOM   1001  C  CE2 . TYR A 1 128 ? 82.954  62.279  49.082  1.00 15.11 ? 125  TYR A CE2 1 
ATOM   1002  C  CZ  . TYR A 1 128 ? 83.344  61.779  47.858  1.00 15.93 ? 125  TYR A CZ  1 
ATOM   1003  O  OH  . TYR A 1 128 ? 82.525  61.897  46.764  1.00 16.62 ? 125  TYR A OH  1 
HETATM 1004  N  N   . MSE A 1 129 ? 87.156  58.509  50.759  1.00 12.68 ? 126  MSE A N   1 
HETATM 1005  C  CA  . MSE A 1 129 ? 87.430  57.378  49.870  1.00 14.35 ? 126  MSE A CA  1 
HETATM 1006  C  C   . MSE A 1 129 ? 87.069  56.022  50.451  1.00 12.71 ? 126  MSE A C   1 
HETATM 1007  O  O   . MSE A 1 129 ? 86.507  55.194  49.746  1.00 13.66 ? 126  MSE A O   1 
HETATM 1008  C  CB  . MSE A 1 129 ? 88.886  57.387  49.386  1.00 14.05 ? 126  MSE A CB  1 
HETATM 1009  C  CG  . MSE A 1 129 ? 89.252  58.660  48.681  1.00 20.28 ? 126  MSE A CG  1 
HETATM 1010  SE SE  . MSE A 1 129 ? 91.063  58.588  47.905  1.00 26.85 ? 126  MSE A SE  1 
HETATM 1011  C  CE  . MSE A 1 129 ? 91.438  60.512  48.010  1.00 24.65 ? 126  MSE A CE  1 
ATOM   1012  N  N   . LYS A 1 130 ? 87.427  55.774  51.708  1.00 13.24 ? 127  LYS A N   1 
ATOM   1013  C  CA  . LYS A 1 130 ? 87.102  54.508  52.375  1.00 13.97 ? 127  LYS A CA  1 
ATOM   1014  C  C   . LYS A 1 130 ? 85.578  54.366  52.486  1.00 13.63 ? 127  LYS A C   1 
ATOM   1015  O  O   . LYS A 1 130 ? 85.030  53.283  52.278  1.00 13.35 ? 127  LYS A O   1 
ATOM   1016  C  CB  . LYS A 1 130 ? 87.741  54.473  53.772  1.00 14.64 ? 127  LYS A CB  1 
ATOM   1017  C  CG  . LYS A 1 130 ? 87.543  53.176  54.562  1.00 20.50 ? 127  LYS A CG  1 
ATOM   1018  C  CD  . LYS A 1 130 ? 88.433  52.027  54.068  1.00 26.34 ? 127  LYS A CD  1 
ATOM   1019  C  CE  . LYS A 1 130 ? 89.954  52.227  54.359  1.00 28.34 ? 127  LYS A CE  1 
ATOM   1020  N  NZ  . LYS A 1 130 ? 90.423  52.148  55.815  1.00 27.94 ? 127  LYS A NZ  1 
ATOM   1021  N  N   . ASP A 1 131 ? 84.907  55.462  52.840  1.00 12.23 ? 128  ASP A N   1 
ATOM   1022  C  CA  . ASP A 1 131 ? 83.463  55.467  52.930  1.00 12.95 ? 128  ASP A CA  1 
ATOM   1023  C  C   . ASP A 1 131 ? 82.808  55.218  51.562  1.00 12.74 ? 128  ASP A C   1 
ATOM   1024  O  O   . ASP A 1 131 ? 81.785  54.524  51.470  1.00 11.03 ? 128  ASP A O   1 
ATOM   1025  C  CB  . ASP A 1 131 ? 82.949  56.771  53.553  1.00 13.58 ? 128  ASP A CB  1 
ATOM   1026  C  CG  . ASP A 1 131 ? 83.167  56.841  55.065  1.00 11.58 ? 128  ASP A CG  1 
ATOM   1027  O  OD1 . ASP A 1 131 ? 83.606  55.847  55.702  1.00 11.03 ? 128  ASP A OD1 1 
ATOM   1028  O  OD2 . ASP A 1 131 ? 82.899  57.912  55.622  1.00 9.73  ? 128  ASP A OD2 1 
ATOM   1029  N  N   . LEU A 1 132 ? 83.384  55.767  50.495  1.00 13.35 ? 129  LEU A N   1 
ATOM   1030  C  CA  . LEU A 1 132 ? 82.815  55.563  49.139  1.00 13.38 ? 129  LEU A CA  1 
ATOM   1031  C  C   . LEU A 1 132 ? 82.865  54.089  48.722  1.00 12.14 ? 129  LEU A C   1 
ATOM   1032  O  O   . LEU A 1 132 ? 81.950  53.592  48.038  1.00 13.94 ? 129  LEU A O   1 
ATOM   1033  C  CB  . LEU A 1 132 ? 83.538  56.433  48.115  1.00 14.49 ? 129  LEU A CB  1 
ATOM   1034  C  CG  . LEU A 1 132 ? 83.112  56.292  46.657  1.00 17.63 ? 129  LEU A CG  1 
ATOM   1035  C  CD1 . LEU A 1 132 ? 81.707  56.776  46.494  1.00 19.71 ? 129  LEU A CD1 1 
ATOM   1036  C  CD2 . LEU A 1 132 ? 84.057  57.099  45.785  1.00 24.17 ? 129  LEU A CD2 1 
HETATM 1037  N  N   . MSE A 1 133 ? 83.899  53.377  49.173  1.00 13.26 ? 130  MSE A N   1 
HETATM 1038  C  CA  . MSE A 1 133 ? 84.059  51.943  48.868  1.00 12.41 ? 130  MSE A CA  1 
HETATM 1039  C  C   . MSE A 1 133 ? 82.890  51.146  49.429  1.00 13.33 ? 130  MSE A C   1 
HETATM 1040  O  O   . MSE A 1 133 ? 82.487  50.150  48.832  1.00 12.77 ? 130  MSE A O   1 
HETATM 1041  C  CB  . MSE A 1 133 ? 85.378  51.401  49.421  1.00 12.52 ? 130  MSE A CB  1 
HETATM 1042  C  CG  . MSE A 1 133 ? 86.616  52.006  48.782  1.00 14.56 ? 130  MSE A CG  1 
HETATM 1043  SE SE  . MSE A 1 133 ? 88.264  51.413  49.694  1.00 18.16 ? 130  MSE A SE  1 
HETATM 1044  C  CE  . MSE A 1 133 ? 89.508  52.634  48.801  1.00 19.68 ? 130  MSE A CE  1 
ATOM   1045  N  N   . ASP A 1 134 ? 82.330  51.594  50.563  1.00 13.38 ? 131  ASP A N   1 
ATOM   1046  C  CA  . ASP A 1 134 ? 81.162  50.934  51.167  1.00 13.80 ? 131  ASP A CA  1 
ATOM   1047  C  C   . ASP A 1 134 ? 79.934  51.004  50.226  1.00 15.48 ? 131  ASP A C   1 
ATOM   1048  O  O   . ASP A 1 134 ? 79.138  50.046  50.151  1.00 14.20 ? 131  ASP A O   1 
ATOM   1049  C  CB  . ASP A 1 134 ? 80.805  51.544  52.535  1.00 13.82 ? 131  ASP A CB  1 
ATOM   1050  C  CG  . ASP A 1 134 ? 81.885  51.319  53.607  1.00 17.88 ? 131  ASP A CG  1 
ATOM   1051  O  OD1 . ASP A 1 134 ? 82.574  50.261  53.564  1.00 20.67 ? 131  ASP A OD1 1 
ATOM   1052  O  OD2 . ASP A 1 134 ? 81.991  52.176  54.537  1.00 15.36 ? 131  ASP A OD2 1 
ATOM   1053  N  N   . VAL A 1 135 ? 79.791  52.127  49.518  1.00 15.80 ? 132  VAL A N   1 
ATOM   1054  C  CA  . VAL A 1 135 ? 78.685  52.344  48.576  1.00 16.89 ? 132  VAL A CA  1 
ATOM   1055  C  C   . VAL A 1 135 ? 78.840  51.514  47.289  1.00 16.91 ? 132  VAL A C   1 
ATOM   1056  O  O   . VAL A 1 135 ? 77.855  51.096  46.688  1.00 16.59 ? 132  VAL A O   1 
ATOM   1057  C  CB  . VAL A 1 135 ? 78.581  53.828  48.160  1.00 16.16 ? 132  VAL A CB  1 
ATOM   1058  C  CG1 . VAL A 1 135 ? 77.375  54.040  47.276  1.00 18.39 ? 132  VAL A CG1 1 
ATOM   1059  C  CG2 . VAL A 1 135 ? 78.489  54.705  49.351  1.00 18.28 ? 132  VAL A CG2 1 
ATOM   1060  N  N   . LEU A 1 136 ? 80.080  51.287  46.865  1.00 16.45 ? 133  LEU A N   1 
ATOM   1061  C  CA  . LEU A 1 136 ? 80.354  50.475  45.683  1.00 16.89 ? 133  LEU A CA  1 
ATOM   1062  C  C   . LEU A 1 136 ? 80.139  48.974  45.913  1.00 17.34 ? 133  LEU A C   1 
ATOM   1063  O  O   . LEU A 1 136 ? 79.963  48.219  44.953  1.00 17.06 ? 133  LEU A O   1 
ATOM   1064  C  CB  . LEU A 1 136 ? 81.813  50.649  45.229  1.00 16.55 ? 133  LEU A CB  1 
ATOM   1065  C  CG  . LEU A 1 136 ? 82.299  52.017  44.804  1.00 17.39 ? 133  LEU A CG  1 
ATOM   1066  C  CD1 . LEU A 1 136 ? 83.810  51.941  44.497  1.00 17.93 ? 133  LEU A CD1 1 
ATOM   1067  C  CD2 . LEU A 1 136 ? 81.528  52.512  43.596  1.00 21.07 ? 133  LEU A CD2 1 
ATOM   1068  N  N   A GLU A 1 137 ? 80.121  48.562  47.178  0.50 18.23 ? 134  GLU A N   1 
ATOM   1069  N  N   B GLU A 1 137 ? 80.143  48.546  47.176  0.50 17.59 ? 134  GLU A N   1 
ATOM   1070  C  CA  A GLU A 1 137 ? 79.959  47.151  47.541  0.50 18.84 ? 134  GLU A CA  1 
ATOM   1071  C  CA  B GLU A 1 137 ? 80.031  47.117  47.510  0.50 17.60 ? 134  GLU A CA  1 
ATOM   1072  C  C   A GLU A 1 137 ? 78.732  46.456  46.947  0.50 18.29 ? 134  GLU A C   1 
ATOM   1073  C  C   B GLU A 1 137 ? 78.762  46.445  46.970  0.50 17.63 ? 134  GLU A C   1 
ATOM   1074  O  O   A GLU A 1 137 ? 77.595  46.919  47.116  0.50 17.02 ? 134  GLU A O   1 
ATOM   1075  O  O   B GLU A 1 137 ? 77.638  46.917  47.188  0.50 16.39 ? 134  GLU A O   1 
ATOM   1076  C  CB  A GLU A 1 137 ? 79.899  47.012  49.062  0.50 19.71 ? 134  GLU A CB  1 
ATOM   1077  C  CB  B GLU A 1 137 ? 80.128  46.915  49.029  0.50 17.95 ? 134  GLU A CB  1 
ATOM   1078  C  CG  A GLU A 1 137 ? 79.571  45.611  49.517  0.50 21.33 ? 134  GLU A CG  1 
ATOM   1079  C  CG  B GLU A 1 137 ? 80.415  45.475  49.458  0.50 16.43 ? 134  GLU A CG  1 
ATOM   1080  C  CD  A GLU A 1 137 ? 80.549  44.595  48.988  0.50 25.34 ? 134  GLU A CD  1 
ATOM   1081  C  CD  B GLU A 1 137 ? 79.287  44.500  49.158  0.50 17.51 ? 134  GLU A CD  1 
ATOM   1082  O  OE1 A GLU A 1 137 ? 81.598  45.009  48.446  0.50 28.68 ? 134  GLU A OE1 1 
ATOM   1083  O  OE1 B GLU A 1 137 ? 78.132  44.754  49.557  0.50 15.64 ? 134  GLU A OE1 1 
ATOM   1084  O  OE2 A GLU A 1 137 ? 80.277  43.381  49.116  0.50 27.74 ? 134  GLU A OE2 1 
ATOM   1085  O  OE2 B GLU A 1 137 ? 79.575  43.443  48.563  0.50 18.79 ? 134  GLU A OE2 1 
ATOM   1086  N  N   . GLY A 1 138 ? 78.969  45.332  46.269  1.00 17.52 ? 135  GLY A N   1 
ATOM   1087  C  CA  . GLY A 1 138 ? 77.883  44.535  45.677  1.00 17.52 ? 135  GLY A CA  1 
ATOM   1088  C  C   . GLY A 1 138 ? 77.230  45.125  44.443  1.00 18.03 ? 135  GLY A C   1 
ATOM   1089  O  O   . GLY A 1 138 ? 76.180  44.647  43.999  1.00 18.14 ? 135  GLY A O   1 
ATOM   1090  N  N   . LYS A 1 139 ? 77.855  46.149  43.880  1.00 16.51 ? 136  LYS A N   1 
ATOM   1091  C  CA  . LYS A 1 139 ? 77.329  46.831  42.717  1.00 16.35 ? 136  LYS A CA  1 
ATOM   1092  C  C   . LYS A 1 139 ? 78.313  46.815  41.548  1.00 15.50 ? 136  LYS A C   1 
ATOM   1093  O  O   . LYS A 1 139 ? 79.534  46.905  41.745  1.00 15.86 ? 136  LYS A O   1 
ATOM   1094  C  CB  . LYS A 1 139 ? 77.107  48.318  43.042  1.00 16.50 ? 136  LYS A CB  1 
ATOM   1095  C  CG  . LYS A 1 139 ? 76.110  48.711  44.159  1.00 21.37 ? 136  LYS A CG  1 
ATOM   1096  C  CD  . LYS A 1 139 ? 74.650  48.505  43.771  1.00 24.24 ? 136  LYS A CD  1 
ATOM   1097  C  CE  . LYS A 1 139 ? 73.695  49.246  44.747  1.00 27.30 ? 136  LYS A CE  1 
ATOM   1098  N  NZ  . LYS A 1 139 ? 73.821  48.814  46.174  1.00 26.73 ? 136  LYS A NZ  1 
ATOM   1099  N  N   . ASP A 1 140 ? 77.780  46.735  40.330  1.00 14.13 ? 137  ASP A N   1 
ATOM   1100  C  CA  . ASP A 1 140 ? 78.597  46.829  39.131  1.00 13.78 ? 137  ASP A CA  1 
ATOM   1101  C  C   . ASP A 1 140 ? 78.924  48.289  38.917  1.00 13.66 ? 137  ASP A C   1 
ATOM   1102  O  O   . ASP A 1 140 ? 78.052  49.131  39.084  1.00 11.76 ? 137  ASP A O   1 
ATOM   1103  C  CB  . ASP A 1 140 ? 77.851  46.352  37.883  1.00 13.93 ? 137  ASP A CB  1 
ATOM   1104  C  CG  . ASP A 1 140 ? 77.858  44.846  37.722  1.00 16.30 ? 137  ASP A CG  1 
ATOM   1105  O  OD1 . ASP A 1 140 ? 78.923  44.205  37.880  1.00 19.27 ? 137  ASP A OD1 1 
ATOM   1106  O  OD2 . ASP A 1 140 ? 76.813  44.317  37.331  1.00 23.02 ? 137  ASP A OD2 1 
ATOM   1107  N  N   . PHE A 1 141 ? 80.171  48.595  38.553  1.00 13.66 ? 138  PHE A N   1 
ATOM   1108  C  CA  . PHE A 1 141 ? 80.526  49.987  38.281  1.00 13.82 ? 138  PHE A CA  1 
ATOM   1109  C  C   . PHE A 1 141 ? 81.544  50.152  37.138  1.00 13.46 ? 138  PHE A C   1 
ATOM   1110  O  O   . PHE A 1 141 ? 82.151  49.186  36.661  1.00 11.42 ? 138  PHE A O   1 
ATOM   1111  C  CB  . PHE A 1 141 ? 80.976  50.724  39.554  1.00 14.15 ? 138  PHE A CB  1 
ATOM   1112  C  CG  . PHE A 1 141 ? 82.365  50.344  40.072  1.00 15.86 ? 138  PHE A CG  1 
ATOM   1113  C  CD1 . PHE A 1 141 ? 82.561  49.213  40.852  1.00 16.71 ? 138  PHE A CD1 1 
ATOM   1114  C  CD2 . PHE A 1 141 ? 83.441  51.191  39.860  1.00 16.55 ? 138  PHE A CD2 1 
ATOM   1115  C  CE1 . PHE A 1 141 ? 83.837  48.898  41.358  1.00 17.26 ? 138  PHE A CE1 1 
ATOM   1116  C  CE2 . PHE A 1 141 ? 84.704  50.886  40.343  1.00 18.82 ? 138  PHE A CE2 1 
ATOM   1117  C  CZ  . PHE A 1 141 ? 84.905  49.723  41.099  1.00 16.96 ? 138  PHE A CZ  1 
ATOM   1118  N  N   . SER A 1 142 ? 81.644  51.388  36.659  1.00 12.66 ? 139  SER A N   1 
ATOM   1119  C  CA  . SER A 1 142 ? 82.593  51.748  35.634  1.00 12.23 ? 139  SER A CA  1 
ATOM   1120  C  C   . SER A 1 142 ? 83.259  53.022  36.136  1.00 12.68 ? 139  SER A C   1 
ATOM   1121  O  O   . SER A 1 142 ? 82.742  53.682  37.059  1.00 11.66 ? 139  SER A O   1 
ATOM   1122  C  CB  . SER A 1 142 ? 81.921  52.038  34.303  1.00 11.63 ? 139  SER A CB  1 
ATOM   1123  O  OG  . SER A 1 142 ? 81.213  50.931  33.807  1.00 13.60 ? 139  SER A OG  1 
ATOM   1124  N  N   . ILE A 1 143 ? 84.394  53.356  35.530  1.00 11.56 ? 140  ILE A N   1 
ATOM   1125  C  CA  . ILE A 1 143 ? 85.139  54.556  35.876  1.00 12.49 ? 140  ILE A CA  1 
ATOM   1126  C  C   . ILE A 1 143 ? 85.359  55.457  34.686  1.00 12.10 ? 140  ILE A C   1 
ATOM   1127  O  O   . ILE A 1 143 ? 85.740  54.994  33.606  1.00 11.64 ? 140  ILE A O   1 
ATOM   1128  C  CB  . ILE A 1 143 ? 86.554  54.213  36.443  1.00 13.67 ? 140  ILE A CB  1 
ATOM   1129  C  CG1 . ILE A 1 143 ? 86.429  53.468  37.775  1.00 14.22 ? 140  ILE A CG1 1 
ATOM   1130  C  CG2 . ILE A 1 143 ? 87.366  55.479  36.612  1.00 12.17 ? 140  ILE A CG2 1 
ATOM   1131  C  CD1 . ILE A 1 143 ? 87.745  52.971  38.357  1.00 12.19 ? 140  ILE A CD1 1 
ATOM   1132  N  N   . ASN A 1 144 ? 85.066  56.742  34.851  1.00 12.52 ? 141  ASN A N   1 
ATOM   1133  C  CA  . ASN A 1 144 ? 85.393  57.718  33.817  1.00 12.35 ? 141  ASN A CA  1 
ATOM   1134  C  C   . ASN A 1 144 ? 86.444  58.587  34.465  1.00 12.92 ? 141  ASN A C   1 
ATOM   1135  O  O   . ASN A 1 144 ? 86.124  59.350  35.370  1.00 14.26 ? 141  ASN A O   1 
ATOM   1136  C  CB  . ASN A 1 144 ? 84.195  58.541  33.383  1.00 13.27 ? 141  ASN A CB  1 
ATOM   1137  C  CG  . ASN A 1 144 ? 84.547  59.627  32.355  1.00 15.05 ? 141  ASN A CG  1 
ATOM   1138  O  OD1 . ASN A 1 144 ? 83.817  60.609  32.241  1.00 14.13 ? 141  ASN A OD1 1 
ATOM   1139  N  ND2 . ASN A 1 144 ? 85.682  59.465  31.611  1.00 11.03 ? 141  ASN A ND2 1 
ATOM   1140  N  N   . VAL A 1 145 ? 87.707  58.402  34.072  1.00 12.42 ? 142  VAL A N   1 
ATOM   1141  C  CA  . VAL A 1 145 ? 88.814  59.196  34.621  1.00 12.47 ? 142  VAL A CA  1 
ATOM   1142  C  C   . VAL A 1 145 ? 89.082  60.362  33.677  1.00 12.92 ? 142  VAL A C   1 
ATOM   1143  O  O   . VAL A 1 145 ? 89.230  60.186  32.460  1.00 11.87 ? 142  VAL A O   1 
ATOM   1144  C  CB  . VAL A 1 145 ? 90.072  58.333  34.915  1.00 13.64 ? 142  VAL A CB  1 
ATOM   1145  C  CG1 . VAL A 1 145 ? 90.582  57.601  33.632  1.00 14.16 ? 142  VAL A CG1 1 
ATOM   1146  C  CG2 . VAL A 1 145 ? 91.173  59.189  35.579  1.00 11.61 ? 142  VAL A CG2 1 
ATOM   1147  N  N   . ILE A 1 146 ? 89.086  61.563  34.247  1.00 14.20 ? 143  ILE A N   1 
ATOM   1148  C  CA  . ILE A 1 146 ? 89.208  62.788  33.490  1.00 13.90 ? 143  ILE A CA  1 
ATOM   1149  C  C   . ILE A 1 146 ? 90.360  63.627  34.028  1.00 15.55 ? 143  ILE A C   1 
ATOM   1150  O  O   . ILE A 1 146 ? 90.303  64.132  35.151  1.00 17.88 ? 143  ILE A O   1 
ATOM   1151  C  CB  . ILE A 1 146 ? 87.909  63.610  33.611  1.00 15.05 ? 143  ILE A CB  1 
ATOM   1152  C  CG1 . ILE A 1 146 ? 86.666  62.710  33.422  1.00 14.99 ? 143  ILE A CG1 1 
ATOM   1153  C  CG2 . ILE A 1 146 ? 87.913  64.770  32.611  1.00 12.70 ? 143  ILE A CG2 1 
ATOM   1154  C  CD1 . ILE A 1 146 ? 85.349  63.449  33.653  1.00 13.02 ? 143  ILE A CD1 1 
ATOM   1155  N  N   . SER A 1 147 ? 91.394  63.797  33.214  1.00 16.08 ? 144  SER A N   1 
ATOM   1156  C  CA  . SER A 1 147 ? 92.580  64.556  33.600  1.00 16.22 ? 144  SER A CA  1 
ATOM   1157  C  C   . SER A 1 147 ? 93.430  64.778  32.376  1.00 16.76 ? 144  SER A C   1 
ATOM   1158  O  O   . SER A 1 147 ? 93.797  63.833  31.699  1.00 16.95 ? 144  SER A O   1 
ATOM   1159  C  CB  . SER A 1 147 ? 93.421  63.791  34.634  1.00 17.27 ? 144  SER A CB  1 
ATOM   1160  O  OG  . SER A 1 147 ? 94.622  64.514  34.968  1.00 16.95 ? 144  SER A OG  1 
ATOM   1161  N  N   . LYS A 1 148 ? 93.796  66.016  32.109  1.00 18.46 ? 145  LYS A N   1 
ATOM   1162  C  CA  . LYS A 1 148 ? 94.600  66.281  30.928  1.00 20.34 ? 145  LYS A CA  1 
ATOM   1163  C  C   . LYS A 1 148 ? 95.997  65.669  30.982  1.00 20.03 ? 145  LYS A C   1 
ATOM   1164  O  O   . LYS A 1 148 ? 96.444  65.068  30.022  1.00 18.72 ? 145  LYS A O   1 
ATOM   1165  C  CB  . LYS A 1 148 ? 94.702  67.769  30.681  1.00 21.84 ? 145  LYS A CB  1 
ATOM   1166  C  CG  . LYS A 1 148 ? 95.232  68.069  29.276  1.00 27.55 ? 145  LYS A CG  1 
ATOM   1167  C  CD  . LYS A 1 148 ? 94.771  69.453  28.811  1.00 32.47 ? 145  LYS A CD  1 
ATOM   1168  C  CE  . LYS A 1 148 ? 95.074  69.692  27.315  1.00 33.43 ? 145  LYS A CE  1 
ATOM   1169  N  NZ  . LYS A 1 148 ? 96.547  69.746  27.030  1.00 27.85 ? 145  LYS A NZ  1 
ATOM   1170  N  N   . SER A 1 149 ? 96.657  65.795  32.125  1.00 20.27 ? 146  SER A N   1 
ATOM   1171  C  CA  . SER A 1 149 ? 98.025  65.317  32.287  1.00 21.28 ? 146  SER A CA  1 
ATOM   1172  C  C   . SER A 1 149 ? 98.114  63.906  32.843  1.00 20.84 ? 146  SER A C   1 
ATOM   1173  O  O   . SER A 1 149 ? 99.070  63.181  32.554  1.00 20.91 ? 146  SER A O   1 
ATOM   1174  C  CB  . SER A 1 149 ? 98.764  66.252  33.250  1.00 21.94 ? 146  SER A CB  1 
ATOM   1175  O  OG  . SER A 1 149 ? 98.125  66.248  34.537  1.00 22.00 ? 146  SER A OG  1 
ATOM   1176  N  N   . GLY A 1 150 ? 97.134  63.522  33.654  1.00 19.03 ? 147  GLY A N   1 
ATOM   1177  C  CA  . GLY A 1 150 ? 97.165  62.218  34.283  1.00 20.07 ? 147  GLY A CA  1 
ATOM   1178  C  C   . GLY A 1 150 ? 98.114  62.258  35.484  1.00 19.87 ? 147  GLY A C   1 
ATOM   1179  O  O   . GLY A 1 150 ? 98.446  61.218  36.081  1.00 19.77 ? 147  GLY A O   1 
ATOM   1180  N  N   . THR A 1 151 ? 98.539  63.466  35.841  1.00 18.74 ? 148  THR A N   1 
ATOM   1181  C  CA  . THR A 1 151 ? 99.448  63.658  36.960  1.00 19.01 ? 148  THR A CA  1 
ATOM   1182  C  C   . THR A 1 151 ? 98.939  64.636  38.042  1.00 18.09 ? 148  THR A C   1 
ATOM   1183  O  O   . THR A 1 151 ? 99.572  64.760  39.069  1.00 20.35 ? 148  THR A O   1 
ATOM   1184  C  CB  . THR A 1 151 ? 100.826 64.091  36.470  1.00 19.07 ? 148  THR A CB  1 
ATOM   1185  O  OG1 . THR A 1 151 ? 100.719 65.328  35.746  1.00 20.13 ? 148  THR A OG1 1 
ATOM   1186  C  CG2 . THR A 1 151 ? 101.423 62.992  35.580  1.00 18.10 ? 148  THR A CG2 1 
ATOM   1187  N  N   . THR A 1 152 ? 97.830  65.333  37.819  1.00 18.01 ? 149  THR A N   1 
ATOM   1188  C  CA  . THR A 1 152 ? 97.261  66.192  38.880  1.00 17.73 ? 149  THR A CA  1 
ATOM   1189  C  C   . THR A 1 152 ? 97.141  65.234  40.071  1.00 15.80 ? 149  THR A C   1 
ATOM   1190  O  O   . THR A 1 152 ? 96.557  64.150  39.961  1.00 16.24 ? 149  THR A O   1 
ATOM   1191  C  CB  . THR A 1 152 ? 95.914  66.765  38.493  1.00 17.66 ? 149  THR A CB  1 
ATOM   1192  O  OG1 . THR A 1 152 ? 96.013  67.370  37.200  1.00 22.47 ? 149  THR A OG1 1 
ATOM   1193  C  CG2 . THR A 1 152 ? 95.435  67.832  39.539  1.00 16.49 ? 149  THR A CG2 1 
ATOM   1194  N  N   . THR A 1 153 ? 97.710  65.628  41.195  1.00 15.26 ? 150  THR A N   1 
ATOM   1195  C  CA  . THR A 1 153 ? 97.803  64.756  42.373  1.00 13.99 ? 150  THR A CA  1 
ATOM   1196  C  C   . THR A 1 153 ? 96.523  64.034  42.834  1.00 13.32 ? 150  THR A C   1 
ATOM   1197  O  O   . THR A 1 153 ? 96.501  62.792  42.937  1.00 12.41 ? 150  THR A O   1 
ATOM   1198  C  CB  . THR A 1 153 ? 98.440  65.546  43.569  1.00 14.88 ? 150  THR A CB  1 
ATOM   1199  O  OG1 . THR A 1 153 ? 99.645  66.191  43.126  1.00 12.69 ? 150  THR A OG1 1 
ATOM   1200  C  CG2 . THR A 1 153 ? 98.769  64.635  44.763  1.00 13.28 ? 150  THR A CG2 1 
ATOM   1201  N  N   . GLU A 1 154 ? 95.457  64.782  43.083  1.00 12.66 ? 151  GLU A N   1 
ATOM   1202  C  CA  . GLU A 1 154 ? 94.256  64.181  43.650  1.00 12.94 ? 151  GLU A CA  1 
ATOM   1203  C  C   . GLU A 1 154 ? 93.585  63.115  42.776  1.00 13.39 ? 151  GLU A C   1 
ATOM   1204  O  O   . GLU A 1 154 ? 93.290  62.021  43.261  1.00 12.65 ? 151  GLU A O   1 
ATOM   1205  C  CB  . GLU A 1 154 ? 93.246  65.257  44.101  1.00 14.20 ? 151  GLU A CB  1 
ATOM   1206  C  CG  . GLU A 1 154 ? 93.791  66.353  45.047  1.00 13.95 ? 151  GLU A CG  1 
ATOM   1207  C  CD  . GLU A 1 154 ? 94.381  67.579  44.312  1.00 17.00 ? 151  GLU A CD  1 
ATOM   1208  O  OE1 . GLU A 1 154 ? 95.022  67.431  43.237  1.00 15.22 ? 151  GLU A OE1 1 
ATOM   1209  O  OE2 . GLU A 1 154 ? 94.165  68.709  44.818  1.00 16.40 ? 151  GLU A OE2 1 
ATOM   1210  N  N   . PRO A 1 155 ? 93.327  63.425  41.493  1.00 13.12 ? 152  PRO A N   1 
ATOM   1211  C  CA  . PRO A 1 155 ? 92.712  62.387  40.683  1.00 13.71 ? 152  PRO A CA  1 
ATOM   1212  C  C   . PRO A 1 155 ? 93.691  61.252  40.316  1.00 13.54 ? 152  PRO A C   1 
ATOM   1213  O  O   . PRO A 1 155 ? 93.265  60.120  40.184  1.00 13.60 ? 152  PRO A O   1 
ATOM   1214  C  CB  . PRO A 1 155 ? 92.186  63.138  39.459  1.00 14.76 ? 152  PRO A CB  1 
ATOM   1215  C  CG  . PRO A 1 155 ? 92.912  64.421  39.425  1.00 14.71 ? 152  PRO A CG  1 
ATOM   1216  C  CD  . PRO A 1 155 ? 93.278  64.742  40.845  1.00 13.59 ? 152  PRO A CD  1 
ATOM   1217  N  N   . ALA A 1 156 ? 94.985  61.531  40.190  1.00 13.47 ? 153  ALA A N   1 
ATOM   1218  C  CA  . ALA A 1 156 ? 95.949  60.470  39.895  1.00 13.33 ? 153  ALA A CA  1 
ATOM   1219  C  C   . ALA A 1 156 ? 95.987  59.465  41.063  1.00 13.44 ? 153  ALA A C   1 
ATOM   1220  O  O   . ALA A 1 156 ? 96.039  58.260  40.852  1.00 14.69 ? 153  ALA A O   1 
ATOM   1221  C  CB  . ALA A 1 156 ? 97.364  61.041  39.633  1.00 12.23 ? 153  ALA A CB  1 
ATOM   1222  N  N   . LEU A 1 157 ? 95.948  59.976  42.290  1.00 13.92 ? 154  LEU A N   1 
ATOM   1223  C  CA  . LEU A 1 157 ? 95.989  59.139  43.480  1.00 14.52 ? 154  LEU A CA  1 
ATOM   1224  C  C   . LEU A 1 157 ? 94.703  58.333  43.647  1.00 13.86 ? 154  LEU A C   1 
ATOM   1225  O  O   . LEU A 1 157 ? 94.742  57.140  43.962  1.00 13.10 ? 154  LEU A O   1 
ATOM   1226  C  CB  . LEU A 1 157 ? 96.247  60.021  44.699  1.00 15.35 ? 154  LEU A CB  1 
ATOM   1227  C  CG  . LEU A 1 157 ? 96.335  59.382  46.079  1.00 19.59 ? 154  LEU A CG  1 
ATOM   1228  C  CD1 . LEU A 1 157 ? 97.327  58.216  46.107  1.00 19.67 ? 154  LEU A CD1 1 
ATOM   1229  C  CD2 . LEU A 1 157 ? 96.723  60.486  47.086  1.00 20.54 ? 154  LEU A CD2 1 
ATOM   1230  N  N   . ALA A 1 158 ? 93.562  58.989  43.430  1.00 12.84 ? 155  ALA A N   1 
ATOM   1231  C  CA  . ALA A 1 158 ? 92.277  58.316  43.529  1.00 12.89 ? 155  ALA A CA  1 
ATOM   1232  C  C   . ALA A 1 158 ? 92.159  57.252  42.421  1.00 13.08 ? 155  ALA A C   1 
ATOM   1233  O  O   . ALA A 1 158 ? 91.647  56.167  42.650  1.00 13.08 ? 155  ALA A O   1 
ATOM   1234  C  CB  . ALA A 1 158 ? 91.139  59.312  43.426  1.00 12.00 ? 155  ALA A CB  1 
ATOM   1235  N  N   . PHE A 1 159 ? 92.643  57.559  41.228  1.00 13.26 ? 156  PHE A N   1 
ATOM   1236  C  CA  . PHE A 1 159 ? 92.553  56.595  40.122  1.00 14.44 ? 156  PHE A CA  1 
ATOM   1237  C  C   . PHE A 1 159 ? 93.392  55.348  40.403  1.00 14.14 ? 156  PHE A C   1 
ATOM   1238  O  O   . PHE A 1 159 ? 92.977  54.213  40.120  1.00 14.77 ? 156  PHE A O   1 
ATOM   1239  C  CB  . PHE A 1 159 ? 92.955  57.252  38.800  1.00 15.36 ? 156  PHE A CB  1 
ATOM   1240  C  CG  . PHE A 1 159 ? 92.857  56.338  37.608  1.00 15.45 ? 156  PHE A CG  1 
ATOM   1241  C  CD1 . PHE A 1 159 ? 91.655  55.730  37.290  1.00 15.31 ? 156  PHE A CD1 1 
ATOM   1242  C  CD2 . PHE A 1 159 ? 93.942  56.145  36.764  1.00 18.94 ? 156  PHE A CD2 1 
ATOM   1243  C  CE1 . PHE A 1 159 ? 91.546  54.882  36.185  1.00 15.53 ? 156  PHE A CE1 1 
ATOM   1244  C  CE2 . PHE A 1 159 ? 93.833  55.319  35.654  1.00 18.89 ? 156  PHE A CE2 1 
ATOM   1245  C  CZ  . PHE A 1 159 ? 92.637  54.681  35.368  1.00 17.35 ? 156  PHE A CZ  1 
ATOM   1246  N  N   . ARG A 1 160 ? 94.576  55.550  40.967  1.00 14.63 ? 157  ARG A N   1 
ATOM   1247  C  CA  . ARG A 1 160 ? 95.436  54.432  41.325  1.00 15.66 ? 157  ARG A CA  1 
ATOM   1248  C  C   . ARG A 1 160 ? 94.658  53.491  42.271  1.00 14.80 ? 157  ARG A C   1 
ATOM   1249  O  O   . ARG A 1 160 ? 94.598  52.250  42.087  1.00 14.48 ? 157  ARG A O   1 
ATOM   1250  C  CB  . ARG A 1 160 ? 96.708  55.014  41.962  1.00 16.61 ? 157  ARG A CB  1 
ATOM   1251  C  CG  . ARG A 1 160 ? 97.734  54.062  42.500  1.00 22.68 ? 157  ARG A CG  1 
ATOM   1252  C  CD  . ARG A 1 160 ? 98.967  54.874  43.019  1.00 24.65 ? 157  ARG A CD  1 
ATOM   1253  N  NE  . ARG A 1 160 ? 99.940  55.250  41.980  1.00 25.72 ? 157  ARG A NE  1 
ATOM   1254  C  CZ  . ARG A 1 160 ? 101.169 54.730  41.881  1.00 21.34 ? 157  ARG A CZ  1 
ATOM   1255  N  NH1 . ARG A 1 160 ? 101.603 53.862  42.788  1.00 21.79 ? 157  ARG A NH1 1 
ATOM   1256  N  NH2 . ARG A 1 160 ? 101.992 55.110  40.908  1.00 21.60 ? 157  ARG A NH2 1 
ATOM   1257  N  N   . ILE A 1 161 ? 94.022  54.087  43.264  1.00 13.46 ? 158  ILE A N   1 
ATOM   1258  C  CA  . ILE A 1 161 ? 93.283  53.330  44.254  1.00 13.93 ? 158  ILE A CA  1 
ATOM   1259  C  C   . ILE A 1 161 ? 92.059  52.615  43.679  1.00 13.75 ? 158  ILE A C   1 
ATOM   1260  O  O   . ILE A 1 161 ? 91.935  51.390  43.827  1.00 13.72 ? 158  ILE A O   1 
ATOM   1261  C  CB  . ILE A 1 161 ? 92.890  54.230  45.454  1.00 13.56 ? 158  ILE A CB  1 
ATOM   1262  C  CG1 . ILE A 1 161 ? 94.173  54.706  46.149  1.00 17.41 ? 158  ILE A CG1 1 
ATOM   1263  C  CG2 . ILE A 1 161 ? 91.966  53.462  46.445  1.00 12.39 ? 158  ILE A CG2 1 
ATOM   1264  C  CD1 . ILE A 1 161 ? 93.953  55.689  47.268  1.00 15.95 ? 158  ILE A CD1 1 
ATOM   1265  N  N   . PHE A 1 162 ? 91.199  53.347  42.973  1.00 13.12 ? 159  PHE A N   1 
ATOM   1266  C  CA  . PHE A 1 162 ? 89.974  52.751  42.464  1.00 13.12 ? 159  PHE A CA  1 
ATOM   1267  C  C   . PHE A 1 162 ? 90.117  51.869  41.212  1.00 13.96 ? 159  PHE A C   1 
ATOM   1268  O  O   . PHE A 1 162 ? 89.321  50.973  41.006  1.00 14.10 ? 159  PHE A O   1 
ATOM   1269  C  CB  . PHE A 1 162 ? 88.877  53.800  42.358  1.00 13.26 ? 159  PHE A CB  1 
ATOM   1270  C  CG  . PHE A 1 162 ? 88.374  54.247  43.701  1.00 14.53 ? 159  PHE A CG  1 
ATOM   1271  C  CD1 . PHE A 1 162 ? 87.301  53.589  44.311  1.00 16.95 ? 159  PHE A CD1 1 
ATOM   1272  C  CD2 . PHE A 1 162 ? 89.018  55.256  44.399  1.00 11.90 ? 159  PHE A CD2 1 
ATOM   1273  C  CE1 . PHE A 1 162 ? 86.840  53.986  45.580  1.00 18.73 ? 159  PHE A CE1 1 
ATOM   1274  C  CE2 . PHE A 1 162 ? 88.591  55.635  45.673  1.00 14.19 ? 159  PHE A CE2 1 
ATOM   1275  C  CZ  . PHE A 1 162 ? 87.485  55.007  46.257  1.00 15.47 ? 159  PHE A CZ  1 
ATOM   1276  N  N   . ARG A 1 163 ? 91.146  52.110  40.406  1.00 14.48 ? 160  ARG A N   1 
ATOM   1277  C  CA  . ARG A 1 163 ? 91.414  51.250  39.266  1.00 14.95 ? 160  ARG A CA  1 
ATOM   1278  C  C   . ARG A 1 163 ? 91.797  49.866  39.796  1.00 15.01 ? 160  ARG A C   1 
ATOM   1279  O  O   . ARG A 1 163 ? 91.408  48.830  39.245  1.00 12.63 ? 160  ARG A O   1 
ATOM   1280  C  CB  . ARG A 1 163 ? 92.556  51.811  38.409  1.00 15.49 ? 160  ARG A CB  1 
ATOM   1281  C  CG  . ARG A 1 163 ? 93.028  50.834  37.355  1.00 20.97 ? 160  ARG A CG  1 
ATOM   1282  C  CD  . ARG A 1 163 ? 93.950  51.490  36.375  1.00 23.56 ? 160  ARG A CD  1 
ATOM   1283  N  NE  . ARG A 1 163 ? 95.274  51.785  36.906  1.00 24.16 ? 160  ARG A NE  1 
ATOM   1284  C  CZ  . ARG A 1 163 ? 96.356  51.027  36.712  1.00 28.29 ? 160  ARG A CZ  1 
ATOM   1285  N  NH1 . ARG A 1 163 ? 96.286  49.899  36.016  1.00 27.60 ? 160  ARG A NH1 1 
ATOM   1286  N  NH2 . ARG A 1 163 ? 97.523  51.403  37.217  1.00 28.13 ? 160  ARG A NH2 1 
ATOM   1287  N  N   . LYS A 1 164 ? 92.557  49.849  40.884  1.00 16.07 ? 161  LYS A N   1 
ATOM   1288  C  CA  . LYS A 1 164 ? 92.972  48.588  41.474  1.00 17.18 ? 161  LYS A CA  1 
ATOM   1289  C  C   . LYS A 1 164 ? 91.738  47.842  42.029  1.00 16.31 ? 161  LYS A C   1 
ATOM   1290  O  O   . LYS A 1 164 ? 91.666  46.626  41.948  1.00 15.67 ? 161  LYS A O   1 
ATOM   1291  C  CB  . LYS A 1 164 ? 94.052  48.814  42.535  1.00 17.99 ? 161  LYS A CB  1 
ATOM   1292  C  CG  . LYS A 1 164 ? 94.757  47.522  42.976  1.00 23.50 ? 161  LYS A CG  1 
ATOM   1293  C  CD  . LYS A 1 164 ? 95.942  47.835  43.898  1.00 29.59 ? 161  LYS A CD  1 
ATOM   1294  C  CE  . LYS A 1 164 ? 96.777  46.590  44.205  1.00 33.12 ? 161  LYS A CE  1 
ATOM   1295  N  NZ  . LYS A 1 164 ? 95.991  45.535  44.895  1.00 37.19 ? 161  LYS A NZ  1 
ATOM   1296  N  N   . LEU A 1 165 ? 90.760  48.570  42.562  1.00 16.70 ? 162  LEU A N   1 
ATOM   1297  C  CA  . LEU A 1 165 ? 89.543  47.941  43.064  1.00 17.13 ? 162  LEU A CA  1 
ATOM   1298  C  C   . LEU A 1 165 ? 88.763  47.332  41.920  1.00 16.42 ? 162  LEU A C   1 
ATOM   1299  O  O   . LEU A 1 165 ? 88.290  46.193  42.008  1.00 17.67 ? 162  LEU A O   1 
ATOM   1300  C  CB  . LEU A 1 165 ? 88.650  48.933  43.834  1.00 18.39 ? 162  LEU A CB  1 
ATOM   1301  C  CG  . LEU A 1 165 ? 89.197  49.432  45.180  1.00 23.61 ? 162  LEU A CG  1 
ATOM   1302  C  CD1 . LEU A 1 165 ? 88.149  50.201  45.977  1.00 24.13 ? 162  LEU A CD1 1 
ATOM   1303  C  CD2 . LEU A 1 165 ? 89.664  48.250  45.988  1.00 25.14 ? 162  LEU A CD2 1 
ATOM   1304  N  N   . LEU A 1 166 ? 88.620  48.098  40.848  1.00 15.92 ? 163  LEU A N   1 
ATOM   1305  C  CA  . LEU A 1 166 ? 87.928  47.630  39.655  1.00 16.08 ? 163  LEU A CA  1 
ATOM   1306  C  C   . LEU A 1 166 ? 88.604  46.377  39.082  1.00 15.94 ? 163  LEU A C   1 
ATOM   1307  O  O   . LEU A 1 166 ? 87.922  45.392  38.762  1.00 14.54 ? 163  LEU A O   1 
ATOM   1308  C  CB  . LEU A 1 166 ? 87.911  48.729  38.592  1.00 15.52 ? 163  LEU A CB  1 
ATOM   1309  C  CG  . LEU A 1 166 ? 87.063  48.458  37.338  1.00 17.66 ? 163  LEU A CG  1 
ATOM   1310  C  CD1 . LEU A 1 166 ? 85.588  48.399  37.700  1.00 16.54 ? 163  LEU A CD1 1 
ATOM   1311  C  CD2 . LEU A 1 166 ? 87.291  49.545  36.302  1.00 18.93 ? 163  LEU A CD2 1 
ATOM   1312  N  N   . GLU A 1 167 ? 89.936  46.403  38.966  1.00 15.88 ? 164  GLU A N   1 
ATOM   1313  C  CA  . GLU A 1 167 ? 90.685  45.252  38.408  1.00 15.25 ? 164  GLU A CA  1 
ATOM   1314  C  C   . GLU A 1 167 ? 90.552  44.001  39.281  1.00 15.97 ? 164  GLU A C   1 
ATOM   1315  O  O   . GLU A 1 167 ? 90.450  42.869  38.779  1.00 15.56 ? 164  GLU A O   1 
ATOM   1316  C  CB  . GLU A 1 167 ? 92.153  45.628  38.175  1.00 16.77 ? 164  GLU A CB  1 
ATOM   1317  C  CG  . GLU A 1 167 ? 92.351  46.755  37.107  1.00 17.05 ? 164  GLU A CG  1 
ATOM   1318  C  CD  . GLU A 1 167 ? 93.818  47.182  36.921  1.00 23.82 ? 164  GLU A CD  1 
ATOM   1319  O  OE1 . GLU A 1 167 ? 94.652  46.833  37.785  1.00 27.59 ? 164  GLU A OE1 1 
ATOM   1320  O  OE2 . GLU A 1 167 ? 94.137  47.881  35.921  1.00 20.86 ? 164  GLU A OE2 1 
ATOM   1321  N  N   . GLU A 1 168 ? 90.549  44.197  40.591  1.00 16.39 ? 165  GLU A N   1 
ATOM   1322  C  CA  . GLU A 1 168 ? 90.380  43.092  41.514  1.00 18.41 ? 165  GLU A CA  1 
ATOM   1323  C  C   . GLU A 1 168 ? 88.961  42.512  41.391  1.00 17.59 ? 165  GLU A C   1 
ATOM   1324  O  O   . GLU A 1 168 ? 88.757  41.290  41.372  1.00 16.62 ? 165  GLU A O   1 
ATOM   1325  C  CB  . GLU A 1 168 ? 90.685  43.566  42.937  1.00 18.82 ? 165  GLU A CB  1 
ATOM   1326  C  CG  . GLU A 1 168 ? 92.176  43.901  43.119  1.00 26.40 ? 165  GLU A CG  1 
ATOM   1327  C  CD  . GLU A 1 168 ? 92.517  44.516  44.483  1.00 34.27 ? 165  GLU A CD  1 
ATOM   1328  O  OE1 . GLU A 1 168 ? 91.592  44.901  45.232  1.00 34.76 ? 165  GLU A OE1 1 
ATOM   1329  O  OE2 . GLU A 1 168 ? 93.725  44.623  44.795  1.00 41.92 ? 165  GLU A OE2 1 
ATOM   1330  N  N   . LYS A 1 169 ? 87.987  43.399  41.238  1.00 17.33 ? 166  LYS A N   1 
ATOM   1331  C  CA  . LYS A 1 169 ? 86.595  42.994  41.132  1.00 17.54 ? 166  LYS A CA  1 
ATOM   1332  C  C   . LYS A 1 169 ? 86.265  42.207  39.850  1.00 18.58 ? 166  LYS A C   1 
ATOM   1333  O  O   . LYS A 1 169 ? 85.590  41.155  39.902  1.00 18.11 ? 166  LYS A O   1 
ATOM   1334  C  CB  . LYS A 1 169 ? 85.713  44.248  41.211  1.00 18.73 ? 166  LYS A CB  1 
ATOM   1335  C  CG  . LYS A 1 169 ? 84.236  43.987  41.076  1.00 19.83 ? 166  LYS A CG  1 
ATOM   1336  C  CD  . LYS A 1 169 ? 83.476  45.291  41.135  1.00 22.55 ? 166  LYS A CD  1 
ATOM   1337  C  CE  . LYS A 1 169 ? 82.003  45.080  40.876  1.00 21.88 ? 166  LYS A CE  1 
ATOM   1338  N  NZ  . LYS A 1 169 ? 81.325  44.331  41.968  1.00 25.74 ? 166  LYS A NZ  1 
ATOM   1339  N  N   . TYR A 1 170 ? 86.788  42.670  38.714  1.00 17.06 ? 167  TYR A N   1 
ATOM   1340  C  CA  . TYR A 1 170 ? 86.452  42.075  37.423  1.00 17.65 ? 167  TYR A CA  1 
ATOM   1341  C  C   . TYR A 1 170 ? 87.568  41.367  36.648  1.00 17.63 ? 167  TYR A C   1 
ATOM   1342  O  O   . TYR A 1 170 ? 87.285  40.677  35.681  1.00 18.45 ? 167  TYR A O   1 
ATOM   1343  C  CB  . TYR A 1 170 ? 85.936  43.191  36.485  1.00 17.44 ? 167  TYR A CB  1 
ATOM   1344  C  CG  . TYR A 1 170 ? 84.635  43.888  36.867  1.00 17.33 ? 167  TYR A CG  1 
ATOM   1345  C  CD1 . TYR A 1 170 ? 83.399  43.270  36.640  1.00 15.83 ? 167  TYR A CD1 1 
ATOM   1346  C  CD2 . TYR A 1 170 ? 84.633  45.192  37.358  1.00 13.64 ? 167  TYR A CD2 1 
ATOM   1347  C  CE1 . TYR A 1 170 ? 82.211  43.906  36.953  1.00 15.27 ? 167  TYR A CE1 1 
ATOM   1348  C  CE2 . TYR A 1 170 ? 83.448  45.831  37.672  1.00 13.94 ? 167  TYR A CE2 1 
ATOM   1349  C  CZ  . TYR A 1 170 ? 82.236  45.189  37.459  1.00 14.24 ? 167  TYR A CZ  1 
ATOM   1350  O  OH  . TYR A 1 170 ? 81.041  45.830  37.761  1.00 15.05 ? 167  TYR A OH  1 
ATOM   1351  N  N   . GLY A 1 171 ? 88.821  41.551  37.047  1.00 17.58 ? 168  GLY A N   1 
ATOM   1352  C  CA  . GLY A 1 171 ? 89.955  40.997  36.304  1.00 17.87 ? 168  GLY A CA  1 
ATOM   1353  C  C   . GLY A 1 171 ? 90.344  42.111  35.335  1.00 18.40 ? 168  GLY A C   1 
ATOM   1354  O  O   . GLY A 1 171 ? 89.504  42.940  35.003  1.00 15.67 ? 168  GLY A O   1 
ATOM   1355  N  N   . LYS A 1 172 ? 91.598  42.152  34.888  1.00 19.06 ? 169  LYS A N   1 
ATOM   1356  C  CA  . LYS A 1 172 ? 92.051  43.220  33.968  1.00 20.72 ? 169  LYS A CA  1 
ATOM   1357  C  C   . LYS A 1 172 ? 91.342  43.295  32.606  1.00 20.18 ? 169  LYS A C   1 
ATOM   1358  O  O   . LYS A 1 172 ? 91.090  44.384  32.089  1.00 19.16 ? 169  LYS A O   1 
ATOM   1359  C  CB  . LYS A 1 172 ? 93.562  43.128  33.722  1.00 22.02 ? 169  LYS A CB  1 
ATOM   1360  C  CG  . LYS A 1 172 ? 94.438  43.487  34.932  1.00 26.92 ? 169  LYS A CG  1 
ATOM   1361  C  CD  . LYS A 1 172 ? 95.929  43.371  34.564  1.00 33.33 ? 169  LYS A CD  1 
ATOM   1362  C  CE  . LYS A 1 172 ? 96.851  43.754  35.709  1.00 35.63 ? 169  LYS A CE  1 
ATOM   1363  N  NZ  . LYS A 1 172 ? 96.674  42.880  36.899  1.00 40.22 ? 169  LYS A NZ  1 
ATOM   1364  N  N   . GLU A 1 173 ? 91.048  42.148  32.013  1.00 19.31 ? 170  GLU A N   1 
ATOM   1365  C  CA  . GLU A 1 173 ? 90.394  42.115  30.710  1.00 19.61 ? 170  GLU A CA  1 
ATOM   1366  C  C   . GLU A 1 173 ? 89.039  42.810  30.772  1.00 19.53 ? 170  GLU A C   1 
ATOM   1367  O  O   . GLU A 1 173 ? 88.718  43.635  29.926  1.00 18.58 ? 170  GLU A O   1 
ATOM   1368  C  CB  . GLU A 1 173 ? 90.223  40.659  30.248  1.00 20.85 ? 170  GLU A CB  1 
ATOM   1369  C  CG  . GLU A 1 173 ? 89.492  40.469  28.908  1.00 25.57 ? 170  GLU A CG  1 
ATOM   1370  C  CD  . GLU A 1 173 ? 89.274  38.987  28.562  1.00 33.26 ? 170  GLU A CD  1 
ATOM   1371  O  OE1 . GLU A 1 173 ? 89.822  38.116  29.277  1.00 36.38 ? 170  GLU A OE1 1 
ATOM   1372  O  OE2 . GLU A 1 173 ? 88.552  38.694  27.579  1.00 39.54 ? 170  GLU A OE2 1 
ATOM   1373  N  N   . GLU A 1 174 ? 88.243  42.485  31.781  1.00 18.98 ? 171  GLU A N   1 
ATOM   1374  C  CA  . GLU A 1 174 ? 86.917  43.102  31.900  1.00 18.61 ? 171  GLU A CA  1 
ATOM   1375  C  C   . GLU A 1 174 ? 87.043  44.535  32.407  1.00 17.68 ? 171  GLU A C   1 
ATOM   1376  O  O   . GLU A 1 174 ? 86.279  45.407  31.995  1.00 17.85 ? 171  GLU A O   1 
ATOM   1377  C  CB  . GLU A 1 174 ? 85.997  42.243  32.775  1.00 18.45 ? 171  GLU A CB  1 
ATOM   1378  C  CG  . GLU A 1 174 ? 84.646  42.856  33.061  1.00 23.38 ? 171  GLU A CG  1 
ATOM   1379  C  CD  . GLU A 1 174 ? 83.811  43.124  31.812  1.00 28.27 ? 171  GLU A CD  1 
ATOM   1380  O  OE1 . GLU A 1 174 ? 83.941  42.373  30.806  1.00 28.95 ? 171  GLU A OE1 1 
ATOM   1381  O  OE2 . GLU A 1 174 ? 82.985  44.063  31.869  1.00 31.87 ? 171  GLU A OE2 1 
ATOM   1382  N  N   . ALA A 1 175 ? 88.026  44.798  33.270  1.00 17.45 ? 172  ALA A N   1 
ATOM   1383  C  CA  . ALA A 1 175 ? 88.244  46.160  33.801  1.00 16.79 ? 172  ALA A CA  1 
ATOM   1384  C  C   . ALA A 1 175 ? 88.501  47.166  32.677  1.00 17.21 ? 172  ALA A C   1 
ATOM   1385  O  O   . ALA A 1 175 ? 88.001  48.293  32.703  1.00 17.19 ? 172  ALA A O   1 
ATOM   1386  C  CB  . ALA A 1 175 ? 89.411  46.171  34.786  1.00 15.95 ? 172  ALA A CB  1 
ATOM   1387  N  N   A ARG A 1 176 ? 89.280  46.721  31.702  0.50 17.46 ? 173  ARG A N   1 
ATOM   1388  N  N   B ARG A 1 176 ? 89.291  46.759  31.691  0.50 16.86 ? 173  ARG A N   1 
ATOM   1389  C  CA  A ARG A 1 176 ? 89.638  47.499  30.527  0.50 18.36 ? 173  ARG A CA  1 
ATOM   1390  C  CA  B ARG A 1 176 ? 89.629  47.626  30.560  0.50 17.29 ? 173  ARG A CA  1 
ATOM   1391  C  C   A ARG A 1 176 ? 88.426  48.051  29.794  0.50 17.75 ? 173  ARG A C   1 
ATOM   1392  C  C   B ARG A 1 176 ? 88.402  48.087  29.789  0.50 17.17 ? 173  ARG A C   1 
ATOM   1393  O  O   A ARG A 1 176 ? 88.462  49.162  29.269  0.50 17.79 ? 173  ARG A O   1 
ATOM   1394  O  O   B ARG A 1 176 ? 88.407  49.175  29.218  0.50 17.36 ? 173  ARG A O   1 
ATOM   1395  C  CB  A ARG A 1 176 ? 90.431  46.592  29.586  0.50 18.54 ? 173  ARG A CB  1 
ATOM   1396  C  CB  B ARG A 1 176 ? 90.622  46.921  29.633  0.50 16.86 ? 173  ARG A CB  1 
ATOM   1397  C  CG  A ARG A 1 176 ? 90.587  47.087  28.178  0.50 20.75 ? 173  ARG A CG  1 
ATOM   1398  C  CG  B ARG A 1 176 ? 91.997  46.769  30.259  0.50 16.29 ? 173  ARG A CG  1 
ATOM   1399  C  CD  A ARG A 1 176 ? 91.332  46.055  27.352  0.50 23.08 ? 173  ARG A CD  1 
ATOM   1400  C  CD  B ARG A 1 176 ? 92.808  45.671  29.598  0.50 16.64 ? 173  ARG A CD  1 
ATOM   1401  N  NE  A ARG A 1 176 ? 90.708  44.737  27.473  0.50 26.26 ? 173  ARG A NE  1 
ATOM   1402  N  NE  B ARG A 1 176 ? 94.061  45.456  30.304  0.50 13.63 ? 173  ARG A NE  1 
ATOM   1403  C  CZ  A ARG A 1 176 ? 89.705  44.315  26.717  0.50 26.03 ? 173  ARG A CZ  1 
ATOM   1404  C  CZ  B ARG A 1 176 ? 94.745  44.321  30.267  0.50 15.54 ? 173  ARG A CZ  1 
ATOM   1405  N  NH1 A ARG A 1 176 ? 89.201  45.107  25.779  0.50 29.05 ? 173  ARG A NH1 1 
ATOM   1406  N  NH1 B ARG A 1 176 ? 94.268  43.283  29.594  0.50 14.97 ? 173  ARG A NH1 1 
ATOM   1407  N  NH2 A ARG A 1 176 ? 89.203  43.107  26.905  0.50 26.81 ? 173  ARG A NH2 1 
ATOM   1408  N  NH2 B ARG A 1 176 ? 95.872  44.207  30.950  0.50 15.28 ? 173  ARG A NH2 1 
ATOM   1409  N  N   . LYS A 1 177 ? 87.359  47.258  29.775  1.00 17.28 ? 174  LYS A N   1 
ATOM   1410  C  CA  . LYS A 1 177 ? 86.118  47.600  29.102  1.00 16.52 ? 174  LYS A CA  1 
ATOM   1411  C  C   . LYS A 1 177 ? 85.183  48.472  29.955  1.00 15.27 ? 174  LYS A C   1 
ATOM   1412  O  O   . LYS A 1 177 ? 84.124  48.873  29.492  1.00 14.74 ? 174  LYS A O   1 
ATOM   1413  C  CB  . LYS A 1 177 ? 85.403  46.301  28.663  1.00 17.45 ? 174  LYS A CB  1 
ATOM   1414  C  CG  . LYS A 1 177 ? 86.182  45.579  27.572  1.00 21.61 ? 174  LYS A CG  1 
ATOM   1415  C  CD  . LYS A 1 177 ? 85.508  44.341  27.011  1.00 28.05 ? 174  LYS A CD  1 
ATOM   1416  C  CE  . LYS A 1 177 ? 85.514  43.180  27.963  1.00 31.39 ? 174  LYS A CE  1 
ATOM   1417  N  NZ  . LYS A 1 177 ? 85.089  41.906  27.250  1.00 33.16 ? 174  LYS A NZ  1 
ATOM   1418  N  N   . ARG A 1 178 ? 85.586  48.767  31.192  1.00 13.71 ? 175  ARG A N   1 
ATOM   1419  C  CA  . ARG A 1 178 ? 84.778  49.581  32.100  1.00 12.41 ? 175  ARG A CA  1 
ATOM   1420  C  C   . ARG A 1 178 ? 85.490  50.860  32.531  1.00 12.04 ? 175  ARG A C   1 
ATOM   1421  O  O   . ARG A 1 178 ? 85.057  51.525  33.463  1.00 12.38 ? 175  ARG A O   1 
ATOM   1422  C  CB  . ARG A 1 178 ? 84.363  48.754  33.325  1.00 12.56 ? 175  ARG A CB  1 
ATOM   1423  C  CG  . ARG A 1 178 ? 83.455  47.541  32.980  1.00 12.37 ? 175  ARG A CG  1 
ATOM   1424  C  CD  . ARG A 1 178 ? 83.127  46.711  34.220  1.00 11.25 ? 175  ARG A CD  1 
ATOM   1425  N  NE  . ARG A 1 178 ? 81.977  45.839  34.011  1.00 15.52 ? 175  ARG A NE  1 
ATOM   1426  C  CZ  . ARG A 1 178 ? 80.715  46.194  34.239  1.00 17.18 ? 175  ARG A CZ  1 
ATOM   1427  N  NH1 . ARG A 1 178 ? 80.417  47.415  34.681  1.00 15.42 ? 175  ARG A NH1 1 
ATOM   1428  N  NH2 . ARG A 1 178 ? 79.733  45.328  33.995  1.00 14.42 ? 175  ARG A NH2 1 
ATOM   1429  N  N   . ILE A 1 179 ? 86.606  51.177  31.878  1.00 11.64 ? 176  ILE A N   1 
ATOM   1430  C  CA  . ILE A 1 179 ? 87.336  52.400  32.182  1.00 11.70 ? 176  ILE A CA  1 
ATOM   1431  C  C   . ILE A 1 179 ? 87.303  53.238  30.932  1.00 11.34 ? 176  ILE A C   1 
ATOM   1432  O  O   . ILE A 1 179 ? 87.579  52.754  29.816  1.00 14.03 ? 176  ILE A O   1 
ATOM   1433  C  CB  . ILE A 1 179 ? 88.788  52.149  32.634  1.00 12.00 ? 176  ILE A CB  1 
ATOM   1434  C  CG1 . ILE A 1 179 ? 88.808  51.404  33.985  1.00 12.97 ? 176  ILE A CG1 1 
ATOM   1435  C  CG2 . ILE A 1 179 ? 89.521  53.490  32.777  1.00 9.39  ? 176  ILE A CG2 1 
ATOM   1436  C  CD1 . ILE A 1 179 ? 90.236  50.884  34.426  1.00 9.27  ? 176  ILE A CD1 1 
ATOM   1437  N  N   . TYR A 1 180 ? 86.965  54.502  31.126  1.00 12.04 ? 177  TYR A N   1 
ATOM   1438  C  CA  . TYR A 1 180 ? 86.834  55.469  30.063  1.00 11.64 ? 177  TYR A CA  1 
ATOM   1439  C  C   . TYR A 1 180 ? 87.711  56.671  30.429  1.00 12.04 ? 177  TYR A C   1 
ATOM   1440  O  O   . TYR A 1 180 ? 87.463  57.350  31.442  1.00 12.06 ? 177  TYR A O   1 
ATOM   1441  C  CB  . TYR A 1 180 ? 85.346  55.845  29.907  1.00 11.24 ? 177  TYR A CB  1 
ATOM   1442  C  CG  . TYR A 1 180 ? 84.441  54.654  29.646  1.00 11.80 ? 177  TYR A CG  1 
ATOM   1443  C  CD1 . TYR A 1 180 ? 84.012  53.857  30.689  1.00 14.63 ? 177  TYR A CD1 1 
ATOM   1444  C  CD2 . TYR A 1 180 ? 84.020  54.327  28.363  1.00 15.15 ? 177  TYR A CD2 1 
ATOM   1445  C  CE1 . TYR A 1 180 ? 83.204  52.758  30.474  1.00 15.65 ? 177  TYR A CE1 1 
ATOM   1446  C  CE2 . TYR A 1 180 ? 83.197  53.237  28.138  1.00 14.68 ? 177  TYR A CE2 1 
ATOM   1447  C  CZ  . TYR A 1 180 ? 82.798  52.448  29.206  1.00 14.02 ? 177  TYR A CZ  1 
ATOM   1448  O  OH  . TYR A 1 180 ? 81.992  51.342  29.032  1.00 13.28 ? 177  TYR A OH  1 
ATOM   1449  N  N   . ALA A 1 181 ? 88.757  56.904  29.623  1.00 11.97 ? 178  ALA A N   1 
ATOM   1450  C  CA  . ALA A 1 181 ? 89.725  57.969  29.869  1.00 11.53 ? 178  ALA A CA  1 
ATOM   1451  C  C   . ALA A 1 181 ? 89.538  59.170  28.978  1.00 12.52 ? 178  ALA A C   1 
ATOM   1452  O  O   . ALA A 1 181 ? 89.533  59.055  27.759  1.00 13.73 ? 178  ALA A O   1 
ATOM   1453  C  CB  . ALA A 1 181 ? 91.167  57.442  29.714  1.00 10.61 ? 178  ALA A CB  1 
ATOM   1454  N  N   . THR A 1 182 ? 89.400  60.327  29.600  1.00 12.00 ? 179  THR A N   1 
ATOM   1455  C  CA  . THR A 1 182 ? 89.232  61.592  28.890  1.00 12.46 ? 179  THR A CA  1 
ATOM   1456  C  C   . THR A 1 182 ? 90.478  62.400  29.258  1.00 12.87 ? 179  THR A C   1 
ATOM   1457  O  O   . THR A 1 182 ? 90.655  62.768  30.404  1.00 12.61 ? 179  THR A O   1 
ATOM   1458  C  CB  . THR A 1 182 ? 87.980  62.286  29.358  1.00 13.30 ? 179  THR A CB  1 
ATOM   1459  O  OG1 . THR A 1 182 ? 86.849  61.456  29.052  1.00 9.97  ? 179  THR A OG1 1 
ATOM   1460  C  CG2 . THR A 1 182 ? 87.850  63.673  28.694  1.00 11.60 ? 179  THR A CG2 1 
ATOM   1461  N  N   . THR A 1 183 ? 91.333  62.660  28.281  1.00 13.07 ? 180  THR A N   1 
ATOM   1462  C  CA  . THR A 1 183 ? 92.610  63.295  28.563  1.00 14.12 ? 180  THR A CA  1 
ATOM   1463  C  C   . THR A 1 183 ? 93.183  63.962  27.313  1.00 14.70 ? 180  THR A C   1 
ATOM   1464  O  O   . THR A 1 183 ? 92.493  64.099  26.276  1.00 13.24 ? 180  THR A O   1 
ATOM   1465  C  CB  . THR A 1 183 ? 93.595  62.184  29.112  1.00 13.73 ? 180  THR A CB  1 
ATOM   1466  O  OG1 . THR A 1 183 ? 94.791  62.760  29.662  1.00 15.16 ? 180  THR A OG1 1 
ATOM   1467  C  CG2 . THR A 1 183 ? 93.926  61.179  28.037  1.00 13.53 ? 180  THR A CG2 1 
ATOM   1468  N  N   . ASP A 1 184 ? 94.451  64.375  27.419  1.00 14.65 ? 181  ASP A N   1 
ATOM   1469  C  CA  . ASP A 1 184 ? 95.162  65.020  26.330  1.00 14.55 ? 181  ASP A CA  1 
ATOM   1470  C  C   . ASP A 1 184 ? 95.185  64.084  25.108  1.00 14.72 ? 181  ASP A C   1 
ATOM   1471  O  O   . ASP A 1 184 ? 95.198  62.845  25.239  1.00 13.06 ? 181  ASP A O   1 
ATOM   1472  C  CB  . ASP A 1 184 ? 96.578  65.350  26.823  1.00 15.12 ? 181  ASP A CB  1 
ATOM   1473  C  CG  . ASP A 1 184 ? 97.386  66.159  25.840  1.00 16.97 ? 181  ASP A CG  1 
ATOM   1474  O  OD1 . ASP A 1 184 ? 97.405  67.393  25.994  1.00 24.15 ? 181  ASP A OD1 1 
ATOM   1475  O  OD2 . ASP A 1 184 ? 97.984  65.596  24.912  1.00 17.39 ? 181  ASP A OD2 1 
ATOM   1476  N  N   . LYS A 1 185 ? 95.197  64.662  23.914  1.00 14.58 ? 182  LYS A N   1 
ATOM   1477  C  CA  . LYS A 1 185 ? 95.212  63.831  22.715  1.00 15.26 ? 182  LYS A CA  1 
ATOM   1478  C  C   . LYS A 1 185 ? 96.589  63.258  22.399  1.00 14.64 ? 182  LYS A C   1 
ATOM   1479  O  O   . LYS A 1 185 ? 96.687  62.379  21.580  1.00 12.43 ? 182  LYS A O   1 
ATOM   1480  C  CB  . LYS A 1 185 ? 94.748  64.634  21.489  1.00 17.26 ? 182  LYS A CB  1 
ATOM   1481  C  CG  . LYS A 1 185 ? 95.692  65.729  21.023  1.00 18.80 ? 182  LYS A CG  1 
ATOM   1482  C  CD  . LYS A 1 185 ? 95.161  66.362  19.733  1.00 25.20 ? 182  LYS A CD  1 
ATOM   1483  C  CE  . LYS A 1 185 ? 96.072  67.455  19.160  1.00 27.78 ? 182  LYS A CE  1 
ATOM   1484  N  NZ  . LYS A 1 185 ? 96.179  68.679  20.025  1.00 28.96 ? 182  LYS A NZ  1 
ATOM   1485  N  N   . ALA A 1 186 ? 97.650  63.752  23.042  1.00 15.08 ? 183  ALA A N   1 
ATOM   1486  C  CA  . ALA A 1 186 ? 99.004  63.310  22.676  1.00 16.29 ? 183  ALA A CA  1 
ATOM   1487  C  C   . ALA A 1 186 ? 99.933  62.871  23.784  1.00 16.47 ? 183  ALA A C   1 
ATOM   1488  O  O   . ALA A 1 186 ? 100.826 62.070  23.538  1.00 17.11 ? 183  ALA A O   1 
ATOM   1489  C  CB  . ALA A 1 186 ? 99.713  64.444  21.869  1.00 15.56 ? 183  ALA A CB  1 
ATOM   1490  N  N   . ARG A 1 187 ? 99.781  63.397  24.989  1.00 16.01 ? 184  ARG A N   1 
ATOM   1491  C  CA  . ARG A 1 187 ? 100.740 63.027  26.015  1.00 16.63 ? 184  ARG A CA  1 
ATOM   1492  C  C   . ARG A 1 187 ? 100.167 62.972  27.428  1.00 15.48 ? 184  ARG A C   1 
ATOM   1493  O  O   . ARG A 1 187 ? 98.983  63.201  27.634  1.00 15.03 ? 184  ARG A O   1 
ATOM   1494  C  CB  . ARG A 1 187 ? 101.933 64.000  25.933  1.00 16.44 ? 184  ARG A CB  1 
ATOM   1495  C  CG  . ARG A 1 187 ? 101.549 65.443  26.193  1.00 17.01 ? 184  ARG A CG  1 
ATOM   1496  C  CD  . ARG A 1 187 ? 102.731 66.380  25.992  1.00 18.02 ? 184  ARG A CD  1 
ATOM   1497  N  NE  . ARG A 1 187 ? 103.173 66.384  24.606  1.00 15.67 ? 184  ARG A NE  1 
ATOM   1498  C  CZ  . ARG A 1 187 ? 102.662 67.153  23.641  1.00 14.61 ? 184  ARG A CZ  1 
ATOM   1499  N  NH1 . ARG A 1 187 ? 101.670 67.996  23.891  1.00 14.16 ? 184  ARG A NH1 1 
ATOM   1500  N  NH2 . ARG A 1 187 ? 103.155 67.076  22.413  1.00 13.09 ? 184  ARG A NH2 1 
ATOM   1501  N  N   . GLY A 1 188 ? 101.031 62.641  28.386  1.00 14.51 ? 185  GLY A N   1 
ATOM   1502  C  CA  . GLY A 1 188 ? 100.648 62.524  29.789  1.00 14.81 ? 185  GLY A CA  1 
ATOM   1503  C  C   . GLY A 1 188 ? 100.513 61.069  30.190  1.00 15.87 ? 185  GLY A C   1 
ATOM   1504  O  O   . GLY A 1 188 ? 100.386 60.169  29.326  1.00 16.49 ? 185  GLY A O   1 
ATOM   1505  N  N   . ALA A 1 189 ? 100.506 60.836  31.501  1.00 16.00 ? 186  ALA A N   1 
ATOM   1506  C  CA  . ALA A 1 189 ? 100.428 59.482  32.056  1.00 16.18 ? 186  ALA A CA  1 
ATOM   1507  C  C   . ALA A 1 189 ? 99.131  58.754  31.718  1.00 15.71 ? 186  ALA A C   1 
ATOM   1508  O  O   . ALA A 1 189 ? 99.140  57.547  31.501  1.00 16.40 ? 186  ALA A O   1 
ATOM   1509  C  CB  . ALA A 1 189 ? 100.624 59.522  33.595  1.00 16.36 ? 186  ALA A CB  1 
ATOM   1510  N  N   . LEU A 1 190 ? 98.022  59.481  31.672  1.00 15.20 ? 187  LEU A N   1 
ATOM   1511  C  CA  . LEU A 1 190 ? 96.730  58.859  31.403  1.00 15.73 ? 187  LEU A CA  1 
ATOM   1512  C  C   . LEU A 1 190 ? 96.612  58.413  29.946  1.00 15.12 ? 187  LEU A C   1 
ATOM   1513  O  O   . LEU A 1 190 ? 96.071  57.337  29.656  1.00 15.34 ? 187  LEU A O   1 
ATOM   1514  C  CB  . LEU A 1 190 ? 95.583  59.801  31.797  1.00 15.82 ? 187  LEU A CB  1 
ATOM   1515  C  CG  . LEU A 1 190 ? 94.158  59.234  31.713  1.00 16.92 ? 187  LEU A CG  1 
ATOM   1516  C  CD1 . LEU A 1 190 ? 94.058  57.887  32.448  1.00 16.18 ? 187  LEU A CD1 1 
ATOM   1517  C  CD2 . LEU A 1 190 ? 93.148  60.237  32.279  1.00 16.05 ? 187  LEU A CD2 1 
ATOM   1518  N  N   . LYS A 1 191 ? 97.111  59.233  29.029  1.00 15.26 ? 188  LYS A N   1 
ATOM   1519  C  CA  . LYS A 1 191 ? 97.076  58.884  27.609  1.00 15.66 ? 188  LYS A CA  1 
ATOM   1520  C  C   . LYS A 1 191 ? 97.906  57.608  27.389  1.00 14.95 ? 188  LYS A C   1 
ATOM   1521  O  O   . LYS A 1 191 ? 97.463  56.680  26.703  1.00 12.33 ? 188  LYS A O   1 
ATOM   1522  C  CB  . LYS A 1 191 ? 97.599  60.046  26.776  1.00 16.37 ? 188  LYS A CB  1 
ATOM   1523  C  CG  . LYS A 1 191 ? 97.737  59.790  25.271  1.00 19.40 ? 188  LYS A CG  1 
ATOM   1524  C  CD  . LYS A 1 191 ? 96.432  59.417  24.576  1.00 23.20 ? 188  LYS A CD  1 
ATOM   1525  C  CE  . LYS A 1 191 ? 96.706  59.203  23.071  1.00 28.51 ? 188  LYS A CE  1 
ATOM   1526  N  NZ  . LYS A 1 191 ? 95.522  58.745  22.313  1.00 34.70 ? 188  LYS A NZ  1 
ATOM   1527  N  N   . THR A 1 192 ? 99.077  57.544  28.025  1.00 14.36 ? 189  THR A N   1 
ATOM   1528  C  CA  . THR A 1 192 ? 99.936  56.376  27.911  1.00 14.93 ? 189  THR A CA  1 
ATOM   1529  C  C   . THR A 1 192 ? 99.240  55.133  28.428  1.00 14.63 ? 189  THR A C   1 
ATOM   1530  O  O   . THR A 1 192 ? 99.228  54.102  27.756  1.00 15.44 ? 189  THR A O   1 
ATOM   1531  C  CB  . THR A 1 192 ? 101.225 56.567  28.695  1.00 16.20 ? 189  THR A CB  1 
ATOM   1532  O  OG1 . THR A 1 192 ? 101.924 57.704  28.175  1.00 16.66 ? 189  THR A OG1 1 
ATOM   1533  C  CG2 . THR A 1 192 ? 102.112 55.303  28.600  1.00 15.24 ? 189  THR A CG2 1 
ATOM   1534  N  N   . LEU A 1 193 ? 98.691  55.211  29.639  1.00 15.07 ? 190  LEU A N   1 
ATOM   1535  C  CA  . LEU A 1 193 ? 97.976  54.078  30.215  1.00 15.88 ? 190  LEU A CA  1 
ATOM   1536  C  C   . LEU A 1 193 ? 96.823  53.664  29.285  1.00 15.81 ? 190  LEU A C   1 
ATOM   1537  O  O   . LEU A 1 193 ? 96.654  52.492  28.988  1.00 16.31 ? 190  LEU A O   1 
ATOM   1538  C  CB  . LEU A 1 193 ? 97.419  54.425  31.615  1.00 15.82 ? 190  LEU A CB  1 
ATOM   1539  C  CG  . LEU A 1 193 ? 96.635  53.279  32.301  1.00 17.73 ? 190  LEU A CG  1 
ATOM   1540  C  CD1 . LEU A 1 193 ? 97.575  52.067  32.583  1.00 17.26 ? 190  LEU A CD1 1 
ATOM   1541  C  CD2 . LEU A 1 193 ? 95.915  53.742  33.597  1.00 14.97 ? 190  LEU A CD2 1 
ATOM   1542  N  N   . ALA A 1 194 ? 96.031  54.635  28.825  1.00 16.35 ? 191  ALA A N   1 
ATOM   1543  C  CA  . ALA A 1 194 ? 94.885  54.327  27.952  1.00 16.29 ? 191  ALA A CA  1 
ATOM   1544  C  C   . ALA A 1 194 ? 95.313  53.589  26.691  1.00 17.20 ? 191  ALA A C   1 
ATOM   1545  O  O   . ALA A 1 194 ? 94.619  52.678  26.231  1.00 17.30 ? 191  ALA A O   1 
ATOM   1546  C  CB  . ALA A 1 194 ? 94.125  55.598  27.588  1.00 15.74 ? 191  ALA A CB  1 
ATOM   1547  N  N   . ASP A 1 195 ? 96.443  53.998  26.121  1.00 18.48 ? 192  ASP A N   1 
ATOM   1548  C  CA  . ASP A 1 195 ? 96.961  53.357  24.908  1.00 19.74 ? 192  ASP A CA  1 
ATOM   1549  C  C   . ASP A 1 195 ? 97.450  51.946  25.214  1.00 20.09 ? 192  ASP A C   1 
ATOM   1550  O  O   . ASP A 1 195 ? 97.175  51.025  24.458  1.00 20.14 ? 192  ASP A O   1 
ATOM   1551  C  CB  . ASP A 1 195 ? 98.082  54.188  24.288  1.00 20.51 ? 192  ASP A CB  1 
ATOM   1552  C  CG  . ASP A 1 195 ? 97.594  55.537  23.759  1.00 22.32 ? 192  ASP A CG  1 
ATOM   1553  O  OD1 . ASP A 1 195 ? 96.373  55.733  23.640  1.00 25.54 ? 192  ASP A OD1 1 
ATOM   1554  O  OD2 . ASP A 1 195 ? 98.435  56.397  23.442  1.00 24.52 ? 192  ASP A OD2 1 
ATOM   1555  N  N   . ASN A 1 196 ? 98.168  51.782  26.323  1.00 19.28 ? 193  ASN A N   1 
ATOM   1556  C  CA  . ASN A 1 196 ? 98.649  50.468  26.734  1.00 20.60 ? 193  ASN A CA  1 
ATOM   1557  C  C   . ASN A 1 196 ? 97.503  49.493  27.027  1.00 20.05 ? 193  ASN A C   1 
ATOM   1558  O  O   . ASN A 1 196 ? 97.548  48.336  26.644  1.00 20.12 ? 193  ASN A O   1 
ATOM   1559  C  CB  . ASN A 1 196 ? 99.459  50.562  28.026  1.00 20.82 ? 193  ASN A CB  1 
ATOM   1560  C  CG  . ASN A 1 196 ? 100.755 51.326  27.878  1.00 24.46 ? 193  ASN A CG  1 
ATOM   1561  O  OD1 . ASN A 1 196 ? 101.227 51.599  26.775  1.00 29.39 ? 193  ASN A OD1 1 
ATOM   1562  N  ND2 . ASN A 1 196 ? 101.364 51.646  29.015  1.00 28.03 ? 193  ASN A ND2 1 
ATOM   1563  N  N   . GLU A 1 197 ? 96.484  49.970  27.723  1.00 19.15 ? 194  GLU A N   1 
ATOM   1564  C  CA  . GLU A 1 197 ? 95.370  49.106  28.133  1.00 20.72 ? 194  GLU A CA  1 
ATOM   1565  C  C   . GLU A 1 197 ? 94.237  48.996  27.130  1.00 20.62 ? 194  GLU A C   1 
ATOM   1566  O  O   . GLU A 1 197 ? 93.445  48.059  27.201  1.00 22.53 ? 194  GLU A O   1 
ATOM   1567  C  CB  . GLU A 1 197 ? 94.803  49.606  29.452  1.00 20.05 ? 194  GLU A CB  1 
ATOM   1568  C  CG  . GLU A 1 197 ? 95.815  49.669  30.572  1.00 23.82 ? 194  GLU A CG  1 
ATOM   1569  C  CD  . GLU A 1 197 ? 96.222  48.300  31.061  1.00 27.99 ? 194  GLU A CD  1 
ATOM   1570  O  OE1 . GLU A 1 197 ? 95.348  47.414  31.126  1.00 30.47 ? 194  GLU A OE1 1 
ATOM   1571  O  OE2 . GLU A 1 197 ? 97.404  48.127  31.424  1.00 31.87 ? 194  GLU A OE2 1 
ATOM   1572  N  N   . GLY A 1 198 ? 94.151  49.939  26.202  1.00 19.89 ? 195  GLY A N   1 
ATOM   1573  C  CA  . GLY A 1 198 ? 93.080  49.926  25.213  1.00 18.44 ? 195  GLY A CA  1 
ATOM   1574  C  C   . GLY A 1 198 ? 91.749  50.456  25.756  1.00 17.45 ? 195  GLY A C   1 
ATOM   1575  O  O   . GLY A 1 198 ? 90.685  50.021  25.327  1.00 16.48 ? 195  GLY A O   1 
ATOM   1576  N  N   . TYR A 1 199 ? 91.783  51.393  26.698  1.00 16.08 ? 196  TYR A N   1 
ATOM   1577  C  CA  . TYR A 1 199 ? 90.530  51.941  27.189  1.00 15.70 ? 196  TYR A CA  1 
ATOM   1578  C  C   . TYR A 1 199 ? 89.904  52.840  26.115  1.00 15.28 ? 196  TYR A C   1 
ATOM   1579  O  O   . TYR A 1 199 ? 90.624  53.399  25.287  1.00 15.16 ? 196  TYR A O   1 
ATOM   1580  C  CB  . TYR A 1 199 ? 90.722  52.848  28.402  1.00 15.65 ? 196  TYR A CB  1 
ATOM   1581  C  CG  . TYR A 1 199 ? 91.533  52.337  29.582  1.00 16.68 ? 196  TYR A CG  1 
ATOM   1582  C  CD1 . TYR A 1 199 ? 91.358  51.059  30.083  1.00 17.17 ? 196  TYR A CD1 1 
ATOM   1583  C  CD2 . TYR A 1 199 ? 92.368  53.205  30.283  1.00 18.68 ? 196  TYR A CD2 1 
ATOM   1584  C  CE1 . TYR A 1 199 ? 92.074  50.618  31.196  1.00 19.30 ? 196  TYR A CE1 1 
ATOM   1585  C  CE2 . TYR A 1 199 ? 93.084  52.780  31.412  1.00 19.04 ? 196  TYR A CE2 1 
ATOM   1586  C  CZ  . TYR A 1 199 ? 92.928  51.489  31.863  1.00 20.80 ? 196  TYR A CZ  1 
ATOM   1587  O  OH  . TYR A 1 199 ? 93.624  51.066  32.979  1.00 20.60 ? 196  TYR A OH  1 
ATOM   1588  N  N   . GLU A 1 200 ? 88.575  52.983  26.140  1.00 13.93 ? 197  GLU A N   1 
ATOM   1589  C  CA  . GLU A 1 200 ? 87.892  53.935  25.272  1.00 14.64 ? 197  GLU A CA  1 
ATOM   1590  C  C   . GLU A 1 200 ? 88.469  55.292  25.706  1.00 14.02 ? 197  GLU A C   1 
ATOM   1591  O  O   . GLU A 1 200 ? 88.545  55.565  26.900  1.00 13.70 ? 197  GLU A O   1 
ATOM   1592  C  CB  . GLU A 1 200 ? 86.378  53.908  25.501  1.00 14.47 ? 197  GLU A CB  1 
ATOM   1593  C  CG  . GLU A 1 200 ? 85.629  52.756  24.889  1.00 17.30 ? 197  GLU A CG  1 
ATOM   1594  C  CD  . GLU A 1 200 ? 85.380  52.913  23.374  1.00 21.89 ? 197  GLU A CD  1 
ATOM   1595  O  OE1 . GLU A 1 200 ? 85.704  53.973  22.799  1.00 21.11 ? 197  GLU A OE1 1 
ATOM   1596  O  OE2 . GLU A 1 200 ? 84.812  51.974  22.772  1.00 24.13 ? 197  GLU A OE2 1 
ATOM   1597  N  N   . THR A 1 201 ? 88.877  56.131  24.759  1.00 14.63 ? 198  THR A N   1 
ATOM   1598  C  CA  . THR A 1 201 ? 89.527  57.399  25.085  1.00 14.54 ? 198  THR A CA  1 
ATOM   1599  C  C   . THR A 1 201 ? 88.859  58.588  24.393  1.00 15.38 ? 198  THR A C   1 
ATOM   1600  O  O   . THR A 1 201 ? 88.424  58.488  23.250  1.00 14.83 ? 198  THR A O   1 
ATOM   1601  C  CB  . THR A 1 201 ? 91.020  57.346  24.663  1.00 16.43 ? 198  THR A CB  1 
ATOM   1602  O  OG1 . THR A 1 201 ? 91.652  56.205  25.270  1.00 19.08 ? 198  THR A OG1 1 
ATOM   1603  C  CG2 . THR A 1 201 ? 91.782  58.618  25.063  1.00 15.69 ? 198  THR A CG2 1 
ATOM   1604  N  N   . PHE A 1 202 ? 88.771  59.704  25.111  1.00 13.45 ? 199  PHE A N   1 
ATOM   1605  C  CA  . PHE A 1 202 ? 88.183  60.933  24.596  1.00 12.87 ? 199  PHE A CA  1 
ATOM   1606  C  C   . PHE A 1 202 ? 89.214  62.043  24.790  1.00 13.17 ? 199  PHE A C   1 
ATOM   1607  O  O   . PHE A 1 202 ? 90.086  61.931  25.637  1.00 13.10 ? 199  PHE A O   1 
ATOM   1608  C  CB  . PHE A 1 202 ? 86.864  61.243  25.303  1.00 10.96 ? 199  PHE A CB  1 
ATOM   1609  C  CG  . PHE A 1 202 ? 85.832  60.168  25.110  1.00 12.75 ? 199  PHE A CG  1 
ATOM   1610  C  CD1 . PHE A 1 202 ? 85.078  60.121  23.945  1.00 14.76 ? 199  PHE A CD1 1 
ATOM   1611  C  CD2 . PHE A 1 202 ? 85.695  59.147  26.028  1.00 11.85 ? 199  PHE A CD2 1 
ATOM   1612  C  CE1 . PHE A 1 202 ? 84.148  59.117  23.754  1.00 14.54 ? 199  PHE A CE1 1 
ATOM   1613  C  CE2 . PHE A 1 202 ? 84.797  58.120  25.818  1.00 16.63 ? 199  PHE A CE2 1 
ATOM   1614  C  CZ  . PHE A 1 202 ? 84.030  58.107  24.684  1.00 16.92 ? 199  PHE A CZ  1 
ATOM   1615  N  N   . VAL A 1 203 ? 89.082  63.108  24.014  1.00 12.48 ? 200  VAL A N   1 
ATOM   1616  C  CA  . VAL A 1 203 ? 90.019  64.196  24.030  1.00 13.52 ? 200  VAL A CA  1 
ATOM   1617  C  C   . VAL A 1 203 ? 89.556  65.483  24.697  1.00 15.31 ? 200  VAL A C   1 
ATOM   1618  O  O   . VAL A 1 203 ? 88.430  65.938  24.492  1.00 15.28 ? 200  VAL A O   1 
ATOM   1619  C  CB  . VAL A 1 203 ? 90.422  64.547  22.559  1.00 13.34 ? 200  VAL A CB  1 
ATOM   1620  C  CG1 . VAL A 1 203 ? 91.222  65.866  22.478  1.00 13.56 ? 200  VAL A CG1 1 
ATOM   1621  C  CG2 . VAL A 1 203 ? 91.200  63.390  21.925  1.00 14.32 ? 200  VAL A CG2 1 
ATOM   1622  N  N   . ILE A 1 204 ? 90.430  66.024  25.543  1.00 15.51 ? 201  ILE A N   1 
ATOM   1623  C  CA  . ILE A 1 204 ? 90.233  67.340  26.116  1.00 16.45 ? 201  ILE A CA  1 
ATOM   1624  C  C   . ILE A 1 204 ? 91.079  68.220  25.171  1.00 15.99 ? 201  ILE A C   1 
ATOM   1625  O  O   . ILE A 1 204 ? 92.295  68.128  25.167  1.00 16.50 ? 201  ILE A O   1 
ATOM   1626  C  CB  . ILE A 1 204 ? 90.765  67.484  27.545  1.00 15.95 ? 201  ILE A CB  1 
ATOM   1627  C  CG1 . ILE A 1 204 ? 90.166  66.413  28.465  1.00 14.90 ? 201  ILE A CG1 1 
ATOM   1628  C  CG2 . ILE A 1 204 ? 90.440  68.909  28.069  1.00 18.43 ? 201  ILE A CG2 1 
ATOM   1629  C  CD1 . ILE A 1 204 ? 90.620  66.506  29.927  1.00 14.88 ? 201  ILE A CD1 1 
ATOM   1630  N  N   . PRO A 1 205 ? 90.438  69.073  24.366  1.00 16.88 ? 202  PRO A N   1 
ATOM   1631  C  CA  . PRO A 1 205 ? 91.215  69.861  23.413  1.00 16.12 ? 202  PRO A CA  1 
ATOM   1632  C  C   . PRO A 1 205 ? 92.231  70.797  24.064  1.00 15.50 ? 202  PRO A C   1 
ATOM   1633  O  O   . PRO A 1 205 ? 91.972  71.336  25.134  1.00 14.76 ? 202  PRO A O   1 
ATOM   1634  C  CB  . PRO A 1 205 ? 90.147  70.665  22.654  1.00 17.72 ? 202  PRO A CB  1 
ATOM   1635  C  CG  . PRO A 1 205 ? 88.842  70.094  23.036  1.00 16.46 ? 202  PRO A CG  1 
ATOM   1636  C  CD  . PRO A 1 205 ? 89.016  69.459  24.376  1.00 16.89 ? 202  PRO A CD  1 
ATOM   1637  N  N   . ASP A 1 206 ? 93.394  70.961  23.425  1.00 13.61 ? 203  ASP A N   1 
ATOM   1638  C  CA  . ASP A 1 206 ? 94.445  71.817  23.947  1.00 14.06 ? 203  ASP A CA  1 
ATOM   1639  C  C   . ASP A 1 206 ? 93.984  73.260  24.094  1.00 13.55 ? 203  ASP A C   1 
ATOM   1640  O  O   . ASP A 1 206 ? 94.500  73.987  24.942  1.00 13.04 ? 203  ASP A O   1 
ATOM   1641  C  CB  . ASP A 1 206 ? 95.664  71.830  23.004  1.00 14.21 ? 203  ASP A CB  1 
ATOM   1642  C  CG  . ASP A 1 206 ? 96.498  70.545  23.051  1.00 18.41 ? 203  ASP A CG  1 
ATOM   1643  O  OD1 . ASP A 1 206 ? 96.362  69.724  23.998  1.00 16.79 ? 203  ASP A OD1 1 
ATOM   1644  O  OD2 . ASP A 1 206 ? 97.349  70.403  22.134  1.00 25.37 ? 203  ASP A OD2 1 
ATOM   1645  N  N   . ASP A 1 207 ? 93.025  73.679  23.266  1.00 13.20 ? 204  ASP A N   1 
ATOM   1646  C  CA  . ASP A 1 207 ? 92.572  75.072  23.297  1.00 13.74 ? 204  ASP A CA  1 
ATOM   1647  C  C   . ASP A 1 207 ? 91.355  75.333  24.167  1.00 13.53 ? 204  ASP A C   1 
ATOM   1648  O  O   . ASP A 1 207 ? 90.757  76.413  24.077  1.00 13.49 ? 204  ASP A O   1 
ATOM   1649  C  CB  . ASP A 1 207 ? 92.380  75.649  21.875  1.00 13.82 ? 204  ASP A CB  1 
ATOM   1650  C  CG  . ASP A 1 207 ? 91.290  74.941  21.076  1.00 15.15 ? 204  ASP A CG  1 
ATOM   1651  O  OD1 . ASP A 1 207 ? 90.604  74.053  21.627  1.00 19.72 ? 204  ASP A OD1 1 
ATOM   1652  O  OD2 . ASP A 1 207 ? 91.102  75.312  19.889  1.00 18.33 ? 204  ASP A OD2 1 
ATOM   1653  N  N   . VAL A 1 208 ? 90.964  74.349  24.976  1.00 13.10 ? 205  VAL A N   1 
ATOM   1654  C  CA  . VAL A 1 208 ? 89.863  74.555  25.905  1.00 12.43 ? 205  VAL A CA  1 
ATOM   1655  C  C   . VAL A 1 208 ? 90.362  74.321  27.334  1.00 13.59 ? 205  VAL A C   1 
ATOM   1656  O  O   . VAL A 1 208 ? 90.693  73.181  27.724  1.00 14.05 ? 205  VAL A O   1 
ATOM   1657  C  CB  . VAL A 1 208 ? 88.639  73.652  25.639  1.00 12.37 ? 205  VAL A CB  1 
ATOM   1658  C  CG1 . VAL A 1 208 ? 87.604  73.912  26.693  1.00 10.96 ? 205  VAL A CG1 1 
ATOM   1659  C  CG2 . VAL A 1 208 ? 88.041  73.912  24.206  1.00 7.60  ? 205  VAL A CG2 1 
ATOM   1660  N  N   . GLY A 1 209 ? 90.450  75.403  28.103  1.00 12.59 ? 206  GLY A N   1 
ATOM   1661  C  CA  . GLY A 1 209 ? 90.862  75.317  29.496  1.00 13.81 ? 206  GLY A CA  1 
ATOM   1662  C  C   . GLY A 1 209 ? 89.824  74.624  30.352  1.00 13.91 ? 206  GLY A C   1 
ATOM   1663  O  O   . GLY A 1 209 ? 88.632  74.572  30.002  1.00 12.48 ? 206  GLY A O   1 
ATOM   1664  N  N   . GLY A 1 210 ? 90.280  74.081  31.482  1.00 14.53 ? 207  GLY A N   1 
ATOM   1665  C  CA  . GLY A 1 210 ? 89.414  73.317  32.399  1.00 13.99 ? 207  GLY A CA  1 
ATOM   1666  C  C   . GLY A 1 210 ? 88.068  73.958  32.732  1.00 13.39 ? 207  GLY A C   1 
ATOM   1667  O  O   . GLY A 1 210 ? 87.030  73.341  32.562  1.00 13.12 ? 207  GLY A O   1 
ATOM   1668  N  N   . ARG A 1 211 ? 88.090  75.203  33.202  1.00 13.50 ? 208  ARG A N   1 
ATOM   1669  C  CA  . ARG A 1 211 ? 86.856  75.897  33.589  1.00 12.50 ? 208  ARG A CA  1 
ATOM   1670  C  C   . ARG A 1 211 ? 85.890  76.128  32.418  1.00 13.03 ? 208  ARG A C   1 
ATOM   1671  O  O   . ARG A 1 211 ? 84.683  76.361  32.641  1.00 13.23 ? 208  ARG A O   1 
ATOM   1672  C  CB  . ARG A 1 211 ? 87.169  77.198  34.350  1.00 13.56 ? 208  ARG A CB  1 
ATOM   1673  C  CG  . ARG A 1 211 ? 88.020  78.242  33.608  1.00 12.96 ? 208  ARG A CG  1 
ATOM   1674  C  CD  . ARG A 1 211 ? 88.403  79.329  34.579  1.00 11.36 ? 208  ARG A CD  1 
ATOM   1675  N  NE  . ARG A 1 211 ? 89.285  80.333  34.018  1.00 11.85 ? 208  ARG A NE  1 
ATOM   1676  C  CZ  . ARG A 1 211 ? 90.615  80.239  33.971  1.00 11.56 ? 208  ARG A CZ  1 
ATOM   1677  N  NH1 . ARG A 1 211 ? 91.246  79.182  34.460  1.00 13.95 ? 208  ARG A NH1 1 
ATOM   1678  N  NH2 . ARG A 1 211 ? 91.318  81.219  33.437  1.00 11.81 ? 208  ARG A NH2 1 
ATOM   1679  N  N   . PHE A 1 212 ? 86.396  76.052  31.181  1.00 12.27 ? 209  PHE A N   1 
ATOM   1680  C  CA  . PHE A 1 212 ? 85.547  76.200  29.994  1.00 12.70 ? 209  PHE A CA  1 
ATOM   1681  C  C   . PHE A 1 212 ? 85.296  74.840  29.310  1.00 12.42 ? 209  PHE A C   1 
ATOM   1682  O  O   . PHE A 1 212 ? 84.789  74.806  28.176  1.00 14.25 ? 209  PHE A O   1 
ATOM   1683  C  CB  . PHE A 1 212 ? 86.196  77.144  28.955  1.00 13.21 ? 209  PHE A CB  1 
ATOM   1684  C  CG  . PHE A 1 212 ? 86.281  78.568  29.385  1.00 12.56 ? 209  PHE A CG  1 
ATOM   1685  C  CD1 . PHE A 1 212 ? 87.382  79.030  30.077  1.00 14.36 ? 209  PHE A CD1 1 
ATOM   1686  C  CD2 . PHE A 1 212 ? 85.267  79.455  29.088  1.00 10.38 ? 209  PHE A CD2 1 
ATOM   1687  C  CE1 . PHE A 1 212 ? 87.458  80.339  30.468  1.00 13.24 ? 209  PHE A CE1 1 
ATOM   1688  C  CE2 . PHE A 1 212 ? 85.346  80.766  29.472  1.00 13.62 ? 209  PHE A CE2 1 
ATOM   1689  C  CZ  . PHE A 1 212 ? 86.439  81.211  30.173  1.00 13.93 ? 209  PHE A CZ  1 
ATOM   1690  N  N   . SER A 1 213 ? 85.591  73.725  29.989  1.00 12.19 ? 210  SER A N   1 
ATOM   1691  C  CA  . SER A 1 213 ? 85.503  72.400  29.342  1.00 12.18 ? 210  SER A CA  1 
ATOM   1692  C  C   . SER A 1 213 ? 84.238  71.563  29.508  1.00 13.79 ? 210  SER A C   1 
ATOM   1693  O  O   . SER A 1 213 ? 84.201  70.429  29.011  1.00 14.50 ? 210  SER A O   1 
ATOM   1694  C  CB  . SER A 1 213 ? 86.696  71.529  29.799  1.00 11.46 ? 210  SER A CB  1 
ATOM   1695  O  OG  . SER A 1 213 ? 86.597  71.147  31.169  1.00 12.33 ? 210  SER A OG  1 
ATOM   1696  N  N   . VAL A 1 214 ? 83.205  72.075  30.171  1.00 14.04 ? 211  VAL A N   1 
ATOM   1697  C  CA  . VAL A 1 214 ? 82.013  71.261  30.402  1.00 13.47 ? 211  VAL A CA  1 
ATOM   1698  C  C   . VAL A 1 214 ? 81.362  70.717  29.124  1.00 14.55 ? 211  VAL A C   1 
ATOM   1699  O  O   . VAL A 1 214 ? 80.853  69.595  29.127  1.00 15.40 ? 211  VAL A O   1 
ATOM   1700  C  CB  . VAL A 1 214 ? 80.961  71.977  31.290  1.00 14.83 ? 211  VAL A CB  1 
ATOM   1701  C  CG1 . VAL A 1 214 ? 80.398  73.228  30.586  1.00 14.15 ? 211  VAL A CG1 1 
ATOM   1702  C  CG2 . VAL A 1 214 ? 79.819  70.985  31.680  1.00 13.20 ? 211  VAL A CG2 1 
ATOM   1703  N  N   . LEU A 1 215 ? 81.403  71.467  28.027  1.00 14.90 ? 212  LEU A N   1 
ATOM   1704  C  CA  . LEU A 1 215 ? 80.771  71.001  26.782  1.00 14.50 ? 212  LEU A CA  1 
ATOM   1705  C  C   . LEU A 1 215 ? 81.687  70.134  25.909  1.00 14.08 ? 212  LEU A C   1 
ATOM   1706  O  O   . LEU A 1 215 ? 81.370  69.871  24.773  1.00 14.69 ? 212  LEU A O   1 
ATOM   1707  C  CB  . LEU A 1 215 ? 80.185  72.170  26.007  1.00 14.62 ? 212  LEU A CB  1 
ATOM   1708  C  CG  . LEU A 1 215 ? 79.149  72.909  26.855  1.00 16.13 ? 212  LEU A CG  1 
ATOM   1709  C  CD1 . LEU A 1 215 ? 78.622  74.164  26.134  1.00 17.67 ? 212  LEU A CD1 1 
ATOM   1710  C  CD2 . LEU A 1 215 ? 78.016  71.938  27.236  1.00 16.13 ? 212  LEU A CD2 1 
ATOM   1711  N  N   . THR A 1 216 ? 82.848  69.738  26.438  1.00 14.71 ? 213  THR A N   1 
ATOM   1712  C  CA  . THR A 1 216 ? 83.718  68.806  25.742  1.00 12.88 ? 213  THR A CA  1 
ATOM   1713  C  C   . THR A 1 216 ? 83.332  67.466  26.348  1.00 13.16 ? 213  THR A C   1 
ATOM   1714  O  O   . THR A 1 216 ? 82.439  67.406  27.207  1.00 12.63 ? 213  THR A O   1 
ATOM   1715  C  CB  . THR A 1 216 ? 85.222  69.067  25.998  1.00 15.48 ? 213  THR A CB  1 
ATOM   1716  O  OG1 . THR A 1 216 ? 85.566  68.687  27.338  1.00 12.40 ? 213  THR A OG1 1 
ATOM   1717  C  CG2 . THR A 1 216 ? 85.594  70.563  25.747  1.00 11.99 ? 213  THR A CG2 1 
ATOM   1718  N  N   . PRO A 1 217 ? 84.001  66.375  25.939  1.00 13.16 ? 214  PRO A N   1 
ATOM   1719  C  CA  . PRO A 1 217 ? 83.666  65.072  26.555  1.00 12.78 ? 214  PRO A CA  1 
ATOM   1720  C  C   . PRO A 1 217 ? 83.760  65.062  28.102  1.00 13.96 ? 214  PRO A C   1 
ATOM   1721  O  O   . PRO A 1 217 ? 83.086  64.264  28.764  1.00 13.46 ? 214  PRO A O   1 
ATOM   1722  C  CB  . PRO A 1 217 ? 84.671  64.132  25.916  1.00 11.88 ? 214  PRO A CB  1 
ATOM   1723  C  CG  . PRO A 1 217 ? 84.925  64.766  24.532  1.00 13.19 ? 214  PRO A CG  1 
ATOM   1724  C  CD  . PRO A 1 217 ? 84.942  66.230  24.808  1.00 12.25 ? 214  PRO A CD  1 
ATOM   1725  N  N   . VAL A 1 218 ? 84.575  65.956  28.654  1.00 13.33 ? 215  VAL A N   1 
ATOM   1726  C  CA  . VAL A 1 218 ? 84.722  66.108  30.101  1.00 13.22 ? 215  VAL A CA  1 
ATOM   1727  C  C   . VAL A 1 218 ? 83.365  66.094  30.800  1.00 14.40 ? 215  VAL A C   1 
ATOM   1728  O  O   . VAL A 1 218 ? 83.138  65.338  31.727  1.00 14.29 ? 215  VAL A O   1 
ATOM   1729  C  CB  . VAL A 1 218 ? 85.422  67.456  30.439  1.00 13.41 ? 215  VAL A CB  1 
ATOM   1730  C  CG1 . VAL A 1 218 ? 85.331  67.727  31.923  1.00 11.54 ? 215  VAL A CG1 1 
ATOM   1731  C  CG2 . VAL A 1 218 ? 86.889  67.440  29.946  1.00 10.99 ? 215  VAL A CG2 1 
ATOM   1732  N  N   . GLY A 1 219 ? 82.462  66.964  30.370  1.00 13.90 ? 216  GLY A N   1 
ATOM   1733  C  CA  . GLY A 1 219 ? 81.136  66.981  30.942  1.00 13.63 ? 216  GLY A CA  1 
ATOM   1734  C  C   . GLY A 1 219 ? 80.142  66.043  30.258  1.00 14.17 ? 216  GLY A C   1 
ATOM   1735  O  O   . GLY A 1 219 ? 79.358  65.376  30.923  1.00 13.31 ? 216  GLY A O   1 
ATOM   1736  N  N   . LEU A 1 220 ? 80.200  65.974  28.929  1.00 13.45 ? 217  LEU A N   1 
ATOM   1737  C  CA  . LEU A 1 220 ? 79.227  65.211  28.157  1.00 13.12 ? 217  LEU A CA  1 
ATOM   1738  C  C   . LEU A 1 220 ? 79.065  63.722  28.496  1.00 12.29 ? 217  LEU A C   1 
ATOM   1739  O  O   . LEU A 1 220 ? 77.941  63.238  28.546  1.00 10.37 ? 217  LEU A O   1 
ATOM   1740  C  CB  . LEU A 1 220 ? 79.460  65.388  26.657  1.00 11.52 ? 217  LEU A CB  1 
ATOM   1741  C  CG  . LEU A 1 220 ? 79.340  66.833  26.143  1.00 16.13 ? 217  LEU A CG  1 
ATOM   1742  C  CD1 . LEU A 1 220 ? 79.580  66.855  24.651  1.00 14.93 ? 217  LEU A CD1 1 
ATOM   1743  C  CD2 . LEU A 1 220 ? 77.986  67.502  26.488  1.00 19.06 ? 217  LEU A CD2 1 
ATOM   1744  N  N   . LEU A 1 221 ? 80.148  63.007  28.752  1.00 11.79 ? 218  LEU A N   1 
ATOM   1745  C  CA  . LEU A 1 221 ? 80.004  61.572  29.043  1.00 11.87 ? 218  LEU A CA  1 
ATOM   1746  C  C   . LEU A 1 221 ? 79.215  61.312  30.323  1.00 12.31 ? 218  LEU A C   1 
ATOM   1747  O  O   . LEU A 1 221 ? 78.182  60.643  30.277  1.00 12.76 ? 218  LEU A O   1 
ATOM   1748  C  CB  . LEU A 1 221 ? 81.367  60.868  29.032  1.00 10.97 ? 218  LEU A CB  1 
ATOM   1749  C  CG  . LEU A 1 221 ? 81.345  59.386  29.362  1.00 11.59 ? 218  LEU A CG  1 
ATOM   1750  C  CD1 . LEU A 1 221 ? 80.326  58.643  28.500  1.00 13.37 ? 218  LEU A CD1 1 
ATOM   1751  C  CD2 . LEU A 1 221 ? 82.768  58.830  29.223  1.00 12.10 ? 218  LEU A CD2 1 
ATOM   1752  N  N   . PRO A 1 222 ? 79.662  61.861  31.468  1.00 13.59 ? 219  PRO A N   1 
ATOM   1753  C  CA  . PRO A 1 222 ? 78.895  61.658  32.705  1.00 13.27 ? 219  PRO A CA  1 
ATOM   1754  C  C   . PRO A 1 222 ? 77.457  62.190  32.648  1.00 13.09 ? 219  PRO A C   1 
ATOM   1755  O  O   . PRO A 1 222 ? 76.545  61.556  33.169  1.00 12.93 ? 219  PRO A O   1 
ATOM   1756  C  CB  . PRO A 1 222 ? 79.709  62.401  33.758  1.00 14.83 ? 219  PRO A CB  1 
ATOM   1757  C  CG  . PRO A 1 222 ? 80.988  62.659  33.174  1.00 15.62 ? 219  PRO A CG  1 
ATOM   1758  C  CD  . PRO A 1 222 ? 80.885  62.639  31.706  1.00 13.68 ? 219  PRO A CD  1 
ATOM   1759  N  N   . ILE A 1 223 ? 77.263  63.361  32.044  1.00 13.50 ? 220  ILE A N   1 
ATOM   1760  C  CA  . ILE A 1 223 ? 75.943  63.934  31.878  1.00 12.95 ? 220  ILE A CA  1 
ATOM   1761  C  C   . ILE A 1 223 ? 75.021  62.956  31.114  1.00 13.76 ? 220  ILE A C   1 
ATOM   1762  O  O   . ILE A 1 223 ? 73.878  62.717  31.526  1.00 11.54 ? 220  ILE A O   1 
ATOM   1763  C  CB  . ILE A 1 223 ? 76.046  65.291  31.147  1.00 13.72 ? 220  ILE A CB  1 
ATOM   1764  C  CG1 . ILE A 1 223 ? 76.704  66.316  32.070  1.00 12.92 ? 220  ILE A CG1 1 
ATOM   1765  C  CG2 . ILE A 1 223 ? 74.675  65.802  30.676  1.00 14.20 ? 220  ILE A CG2 1 
ATOM   1766  C  CD1 . ILE A 1 223 ? 77.026  67.671  31.393  1.00 10.82 ? 220  ILE A CD1 1 
ATOM   1767  N  N   . ALA A 1 224 ? 75.531  62.382  30.020  1.00 12.20 ? 221  ALA A N   1 
ATOM   1768  C  CA  . ALA A 1 224 ? 74.753  61.426  29.205  1.00 12.19 ? 221  ALA A CA  1 
ATOM   1769  C  C   . ALA A 1 224 ? 74.471  60.139  29.990  1.00 11.72 ? 221  ALA A C   1 
ATOM   1770  O  O   . ALA A 1 224 ? 73.413  59.533  29.843  1.00 11.63 ? 221  ALA A O   1 
ATOM   1771  C  CB  . ALA A 1 224 ? 75.481  61.097  27.916  1.00 11.84 ? 221  ALA A CB  1 
ATOM   1772  N  N   . VAL A 1 225 ? 75.414  59.706  30.809  1.00 12.22 ? 222  VAL A N   1 
ATOM   1773  C  CA  . VAL A 1 225 ? 75.193  58.500  31.591  1.00 13.51 ? 222  VAL A CA  1 
ATOM   1774  C  C   . VAL A 1 225 ? 74.034  58.714  32.586  1.00 13.24 ? 222  VAL A C   1 
ATOM   1775  O  O   . VAL A 1 225 ? 73.275  57.787  32.854  1.00 11.13 ? 222  VAL A O   1 
ATOM   1776  C  CB  . VAL A 1 225 ? 76.451  58.025  32.342  1.00 14.64 ? 222  VAL A CB  1 
ATOM   1777  C  CG1 . VAL A 1 225 ? 76.065  56.941  33.389  1.00 12.90 ? 222  VAL A CG1 1 
ATOM   1778  C  CG2 . VAL A 1 225 ? 77.510  57.501  31.373  1.00 13.03 ? 222  VAL A CG2 1 
ATOM   1779  N  N   . SER A 1 226 ? 73.887  59.938  33.098  1.00 12.61 ? 223  SER A N   1 
ATOM   1780  C  CA  . SER A 1 226 ? 72.815  60.232  34.054  1.00 13.51 ? 223  SER A CA  1 
ATOM   1781  C  C   . SER A 1 226 ? 71.443  60.322  33.379  1.00 13.54 ? 223  SER A C   1 
ATOM   1782  O  O   . SER A 1 226 ? 70.442  60.637  34.031  1.00 13.96 ? 223  SER A O   1 
ATOM   1783  C  CB  . SER A 1 226 ? 73.087  61.504  34.841  1.00 14.23 ? 223  SER A CB  1 
ATOM   1784  O  OG  . SER A 1 226 ? 72.833  62.649  34.068  1.00 13.16 ? 223  SER A OG  1 
ATOM   1785  N  N   . GLY A 1 227 ? 71.410  60.063  32.076  1.00 12.89 ? 224  GLY A N   1 
ATOM   1786  C  CA  . GLY A 1 227 ? 70.157  60.042  31.308  1.00 13.46 ? 224  GLY A CA  1 
ATOM   1787  C  C   . GLY A 1 227 ? 69.778  61.319  30.585  1.00 13.90 ? 224  GLY A C   1 
ATOM   1788  O  O   . GLY A 1 227 ? 68.715  61.396  29.988  1.00 13.67 ? 224  GLY A O   1 
ATOM   1789  N  N   . LEU A 1 228 ? 70.643  62.313  30.625  1.00 14.10 ? 225  LEU A N   1 
ATOM   1790  C  CA  . LEU A 1 228 ? 70.350  63.609  29.994  1.00 14.49 ? 225  LEU A CA  1 
ATOM   1791  C  C   . LEU A 1 228 ? 70.685  63.582  28.483  1.00 14.78 ? 225  LEU A C   1 
ATOM   1792  O  O   . LEU A 1 228 ? 71.560  62.820  28.036  1.00 15.06 ? 225  LEU A O   1 
ATOM   1793  C  CB  . LEU A 1 228 ? 71.118  64.711  30.717  1.00 13.47 ? 225  LEU A CB  1 
ATOM   1794  C  CG  . LEU A 1 228 ? 70.786  64.821  32.206  1.00 14.73 ? 225  LEU A CG  1 
ATOM   1795  C  CD1 . LEU A 1 228 ? 71.781  65.757  32.922  1.00 12.73 ? 225  LEU A CD1 1 
ATOM   1796  C  CD2 . LEU A 1 228 ? 69.293  65.230  32.443  1.00 10.69 ? 225  LEU A CD2 1 
ATOM   1797  N  N   . ASN A 1 229 ? 69.970  64.411  27.720  1.00 13.96 ? 226  ASN A N   1 
ATOM   1798  C  CA  . ASN A 1 229 ? 70.086  64.479  26.263  1.00 13.40 ? 226  ASN A CA  1 
ATOM   1799  C  C   . ASN A 1 229 ? 71.159  65.494  25.897  1.00 13.78 ? 226  ASN A C   1 
ATOM   1800  O  O   . ASN A 1 229 ? 70.929  66.718  25.952  1.00 11.62 ? 226  ASN A O   1 
ATOM   1801  C  CB  . ASN A 1 229 ? 68.695  64.850  25.672  1.00 14.79 ? 226  ASN A CB  1 
ATOM   1802  C  CG  . ASN A 1 229 ? 68.666  64.908  24.134  1.00 15.68 ? 226  ASN A CG  1 
ATOM   1803  O  OD1 . ASN A 1 229 ? 69.654  65.224  23.482  1.00 16.20 ? 226  ASN A OD1 1 
ATOM   1804  N  ND2 . ASN A 1 229 ? 67.495  64.635  23.564  1.00 20.36 ? 226  ASN A ND2 1 
ATOM   1805  N  N   . ILE A 1 230 ? 72.348  64.993  25.555  1.00 13.83 ? 227  ILE A N   1 
ATOM   1806  C  CA  . ILE A 1 230 ? 73.454  65.895  25.217  1.00 13.95 ? 227  ILE A CA  1 
ATOM   1807  C  C   . ILE A 1 230 ? 73.294  66.645  23.870  1.00 14.94 ? 227  ILE A C   1 
ATOM   1808  O  O   . ILE A 1 230 ? 73.919  67.681  23.680  1.00 15.65 ? 227  ILE A O   1 
ATOM   1809  C  CB  . ILE A 1 230 ? 74.846  65.255  25.402  1.00 14.19 ? 227  ILE A CB  1 
ATOM   1810  C  CG1 . ILE A 1 230 ? 75.012  63.986  24.563  1.00 13.64 ? 227  ILE A CG1 1 
ATOM   1811  C  CG2 . ILE A 1 230 ? 75.077  64.914  26.883  1.00 14.73 ? 227  ILE A CG2 1 
ATOM   1812  C  CD1 . ILE A 1 230 ? 76.433  63.413  24.641  1.00 13.75 ? 227  ILE A CD1 1 
ATOM   1813  N  N   A GLU A 1 231 ? 72.466  66.112  22.971  0.50 15.83 ? 228  GLU A N   1 
ATOM   1814  N  N   B GLU A 1 231 ? 72.479  66.132  22.951  0.50 15.67 ? 228  GLU A N   1 
ATOM   1815  C  CA  A GLU A 1 231 ? 72.184  66.758  21.685  0.50 16.13 ? 228  GLU A CA  1 
ATOM   1816  C  CA  B GLU A 1 231 ? 72.256  66.839  21.686  0.50 15.80 ? 228  GLU A CA  1 
ATOM   1817  C  C   A GLU A 1 231 ? 71.478  68.093  21.952  0.50 16.13 ? 228  GLU A C   1 
ATOM   1818  C  C   B GLU A 1 231 ? 71.496  68.135  21.973  0.50 15.95 ? 228  GLU A C   1 
ATOM   1819  O  O   A GLU A 1 231 ? 71.826  69.132  21.386  0.50 15.18 ? 228  GLU A O   1 
ATOM   1820  O  O   B GLU A 1 231 ? 71.821  69.195  21.433  0.50 14.81 ? 228  GLU A O   1 
ATOM   1821  C  CB  A GLU A 1 231 ? 71.283  65.862  20.807  0.50 17.15 ? 228  GLU A CB  1 
ATOM   1822  C  CB  B GLU A 1 231 ? 71.479  65.985  20.674  0.50 16.85 ? 228  GLU A CB  1 
ATOM   1823  C  CG  A GLU A 1 231 ? 71.892  64.495  20.443  0.50 18.04 ? 228  GLU A CG  1 
ATOM   1824  C  CG  B GLU A 1 231 ? 71.219  66.719  19.366  0.50 16.75 ? 228  GLU A CG  1 
ATOM   1825  C  CD  A GLU A 1 231 ? 70.958  63.600  19.614  0.50 22.15 ? 228  GLU A CD  1 
ATOM   1826  C  CD  B GLU A 1 231 ? 70.625  65.842  18.268  0.50 21.00 ? 228  GLU A CD  1 
ATOM   1827  O  OE1 A GLU A 1 231 ? 69.717  63.790  19.660  0.50 22.53 ? 228  GLU A OE1 1 
ATOM   1828  O  OE1 B GLU A 1 231 ? 70.421  64.629  18.483  0.50 22.64 ? 228  GLU A OE1 1 
ATOM   1829  O  OE2 A GLU A 1 231 ? 71.472  62.688  18.933  0.50 19.26 ? 228  GLU A OE2 1 
ATOM   1830  O  OE2 B GLU A 1 231 ? 70.374  66.377  17.168  0.50 23.98 ? 228  GLU A OE2 1 
ATOM   1831  N  N   . GLU A 1 232 ? 70.495  68.053  22.846  1.00 15.80 ? 229  GLU A N   1 
ATOM   1832  C  CA  . GLU A 1 232 ? 69.729  69.240  23.200  1.00 15.36 ? 229  GLU A CA  1 
ATOM   1833  C  C   . GLU A 1 232 ? 70.604  70.242  23.921  1.00 13.57 ? 229  GLU A C   1 
ATOM   1834  O  O   . GLU A 1 232 ? 70.485  71.439  23.700  1.00 11.44 ? 229  GLU A O   1 
ATOM   1835  C  CB  . GLU A 1 232 ? 68.483  68.884  24.011  1.00 15.95 ? 229  GLU A CB  1 
ATOM   1836  C  CG  . GLU A 1 232 ? 67.440  68.185  23.186  1.00 18.09 ? 229  GLU A CG  1 
ATOM   1837  C  CD  . GLU A 1 232 ? 66.924  69.040  22.014  1.00 27.65 ? 229  GLU A CD  1 
ATOM   1838  O  OE1 . GLU A 1 232 ? 66.865  70.289  22.127  1.00 30.50 ? 229  GLU A OE1 1 
ATOM   1839  O  OE2 . GLU A 1 232 ? 66.546  68.445  20.975  1.00 37.37 ? 229  GLU A OE2 1 
HETATM 1840  N  N   . MSE A 1 233 ? 71.513  69.744  24.736  1.00 13.18 ? 230  MSE A N   1 
HETATM 1841  C  CA  . MSE A 1 233 ? 72.434  70.602  25.444  1.00 14.00 ? 230  MSE A CA  1 
HETATM 1842  C  C   . MSE A 1 233 ? 73.301  71.354  24.435  1.00 14.09 ? 230  MSE A C   1 
HETATM 1843  O  O   . MSE A 1 233 ? 73.467  72.566  24.548  1.00 14.54 ? 230  MSE A O   1 
HETATM 1844  C  CB  . MSE A 1 233 ? 73.280  69.775  26.409  1.00 14.24 ? 230  MSE A CB  1 
HETATM 1845  C  CG  . MSE A 1 233 ? 74.224  70.589  27.235  1.00 14.30 ? 230  MSE A CG  1 
HETATM 1846  SE SE  . MSE A 1 233 ? 75.039  69.540  28.668  1.00 17.36 ? 230  MSE A SE  1 
HETATM 1847  C  CE  . MSE A 1 233 ? 73.429  69.230  29.761  1.00 12.54 ? 230  MSE A CE  1 
HETATM 1848  N  N   . MSE A 1 234 ? 73.845  70.647  23.436  1.00 15.55 ? 231  MSE A N   1 
HETATM 1849  C  CA  . MSE A 1 234 ? 74.679  71.307  22.414  1.00 15.31 ? 231  MSE A CA  1 
HETATM 1850  C  C   . MSE A 1 234 ? 73.888  72.345  21.588  1.00 14.60 ? 231  MSE A C   1 
HETATM 1851  O  O   . MSE A 1 234 ? 74.424  73.408  21.224  1.00 13.32 ? 231  MSE A O   1 
HETATM 1852  C  CB  . MSE A 1 234 ? 75.359  70.293  21.493  1.00 16.13 ? 231  MSE A CB  1 
HETATM 1853  C  CG  . MSE A 1 234 ? 76.393  69.409  22.165  1.00 19.48 ? 231  MSE A CG  1 
HETATM 1854  SE SE  . MSE A 1 234 ? 77.745  70.516  23.139  1.00 27.85 ? 231  MSE A SE  1 
HETATM 1855  C  CE  . MSE A 1 234 ? 78.094  71.735  21.776  1.00 15.69 ? 231  MSE A CE  1 
ATOM   1856  N  N   . LYS A 1 235 ? 72.629  72.046  21.298  1.00 14.35 ? 232  LYS A N   1 
ATOM   1857  C  CA  . LYS A 1 235 ? 71.796  72.995  20.565  1.00 14.34 ? 232  LYS A CA  1 
ATOM   1858  C  C   . LYS A 1 235 ? 71.570  74.265  21.378  1.00 13.90 ? 232  LYS A C   1 
ATOM   1859  O  O   . LYS A 1 235 ? 71.539  75.381  20.815  1.00 12.04 ? 232  LYS A O   1 
ATOM   1860  C  CB  . LYS A 1 235 ? 70.448  72.387  20.199  1.00 15.93 ? 232  LYS A CB  1 
ATOM   1861  C  CG  . LYS A 1 235 ? 70.503  71.316  19.127  1.00 19.27 ? 232  LYS A CG  1 
ATOM   1862  C  CD  . LYS A 1 235 ? 69.111  70.734  18.850  1.00 24.70 ? 232  LYS A CD  1 
ATOM   1863  C  CE  . LYS A 1 235 ? 69.166  69.622  17.789  1.00 27.16 ? 232  LYS A CE  1 
ATOM   1864  N  NZ  . LYS A 1 235 ? 67.849  68.931  17.632  1.00 31.64 ? 232  LYS A NZ  1 
ATOM   1865  N  N   . GLY A 1 236 ? 71.391  74.103  22.693  1.00 12.27 ? 233  GLY A N   1 
ATOM   1866  C  CA  . GLY A 1 236 ? 71.171  75.246  23.578  1.00 11.51 ? 233  GLY A CA  1 
ATOM   1867  C  C   . GLY A 1 236 ? 72.409  76.114  23.561  1.00 10.98 ? 233  GLY A C   1 
ATOM   1868  O  O   . GLY A 1 236 ? 72.325  77.329  23.385  1.00 10.57 ? 233  GLY A O   1 
ATOM   1869  N  N   . ALA A 1 237 ? 73.568  75.481  23.704  1.00 9.60  ? 234  ALA A N   1 
ATOM   1870  C  CA  . ALA A 1 237 ? 74.832  76.209  23.666  1.00 10.13 ? 234  ALA A CA  1 
ATOM   1871  C  C   . ALA A 1 237 ? 75.060  76.896  22.301  1.00 10.62 ? 234  ALA A C   1 
ATOM   1872  O  O   . ALA A 1 237 ? 75.548  78.027  22.260  1.00 11.68 ? 234  ALA A O   1 
ATOM   1873  C  CB  . ALA A 1 237 ? 75.991  75.289  24.016  1.00 9.75  ? 234  ALA A CB  1 
ATOM   1874  N  N   . ALA A 1 238 ? 74.665  76.249  21.201  1.00 11.66 ? 235  ALA A N   1 
ATOM   1875  C  CA  . ALA A 1 238 ? 74.814  76.830  19.846  1.00 11.68 ? 235  ALA A CA  1 
ATOM   1876  C  C   . ALA A 1 238 ? 73.933  78.074  19.659  1.00 12.34 ? 235  ALA A C   1 
ATOM   1877  O  O   . ALA A 1 238 ? 74.337  79.041  19.011  1.00 11.33 ? 235  ALA A O   1 
ATOM   1878  C  CB  . ALA A 1 238 ? 74.502  75.791  18.761  1.00 11.75 ? 235  ALA A CB  1 
ATOM   1879  N  N   . ALA A 1 239 ? 72.718  78.028  20.201  1.00 12.61 ? 236  ALA A N   1 
ATOM   1880  C  CA  . ALA A 1 239 ? 71.819  79.173  20.162  1.00 12.47 ? 236  ALA A CA  1 
ATOM   1881  C  C   . ALA A 1 239 ? 72.463  80.334  20.943  1.00 11.13 ? 236  ALA A C   1 
ATOM   1882  O  O   . ALA A 1 239 ? 72.381  81.492  20.535  1.00 11.35 ? 236  ALA A O   1 
ATOM   1883  C  CB  . ALA A 1 239 ? 70.469  78.799  20.757  1.00 11.64 ? 236  ALA A CB  1 
ATOM   1884  N  N   . GLY A 1 240 ? 73.056  80.019  22.090  1.00 12.05 ? 237  GLY A N   1 
ATOM   1885  C  CA  . GLY A 1 240 ? 73.768  81.015  22.909  1.00 12.13 ? 237  GLY A CA  1 
ATOM   1886  C  C   . GLY A 1 240 ? 74.906  81.621  22.096  1.00 12.00 ? 237  GLY A C   1 
ATOM   1887  O  O   . GLY A 1 240 ? 75.070  82.858  22.023  1.00 10.10 ? 237  GLY A O   1 
ATOM   1888  N  N   . ARG A 1 241 ? 75.689  80.752  21.468  1.00 13.32 ? 238  ARG A N   1 
ATOM   1889  C  CA  . ARG A 1 241 ? 76.804  81.212  20.622  1.00 14.32 ? 238  ARG A CA  1 
ATOM   1890  C  C   . ARG A 1 241 ? 76.306  82.236  19.592  1.00 14.63 ? 238  ARG A C   1 
ATOM   1891  O  O   . ARG A 1 241 ? 76.952  83.261  19.357  1.00 15.08 ? 238  ARG A O   1 
ATOM   1892  C  CB  . ARG A 1 241 ? 77.482  80.024  19.928  1.00 15.09 ? 238  ARG A CB  1 
ATOM   1893  C  CG  . ARG A 1 241 ? 78.510  80.447  18.931  1.00 16.45 ? 238  ARG A CG  1 
ATOM   1894  C  CD  . ARG A 1 241 ? 79.108  79.309  18.155  1.00 19.67 ? 238  ARG A CD  1 
ATOM   1895  N  NE  . ARG A 1 241 ? 80.037  79.861  17.168  1.00 20.94 ? 238  ARG A NE  1 
ATOM   1896  C  CZ  . ARG A 1 241 ? 79.661  80.377  16.003  1.00 22.59 ? 238  ARG A CZ  1 
ATOM   1897  N  NH1 . ARG A 1 241 ? 78.374  80.377  15.651  1.00 20.68 ? 238  ARG A NH1 1 
ATOM   1898  N  NH2 . ARG A 1 241 ? 80.577  80.876  15.179  1.00 23.48 ? 238  ARG A NH2 1 
ATOM   1899  N  N   A ASP A 1 242 ? 75.149  81.953  19.002  0.60 15.53 ? 239  ASP A N   1 
ATOM   1900  N  N   B ASP A 1 242 ? 75.156  81.964  18.975  0.40 15.02 ? 239  ASP A N   1 
ATOM   1901  C  CA  A ASP A 1 242 ? 74.550  82.823  18.002  0.60 16.04 ? 239  ASP A CA  1 
ATOM   1902  C  CA  B ASP A 1 242 ? 74.580  82.894  17.999  0.40 15.15 ? 239  ASP A CA  1 
ATOM   1903  C  C   A ASP A 1 242 ? 74.083  84.149  18.616  0.60 15.77 ? 239  ASP A C   1 
ATOM   1904  C  C   B ASP A 1 242 ? 74.114  84.184  18.646  0.40 15.38 ? 239  ASP A C   1 
ATOM   1905  O  O   A ASP A 1 242 ? 74.465  85.220  18.157  0.60 15.10 ? 239  ASP A O   1 
ATOM   1906  O  O   B ASP A 1 242 ? 74.510  85.271  18.233  0.40 14.87 ? 239  ASP A O   1 
ATOM   1907  C  CB  A ASP A 1 242 ? 73.363  82.096  17.349  0.60 16.74 ? 239  ASP A CB  1 
ATOM   1908  C  CB  B ASP A 1 242 ? 73.384  82.276  17.268  0.40 15.26 ? 239  ASP A CB  1 
ATOM   1909  C  CG  A ASP A 1 242 ? 72.748  82.872  16.206  0.60 20.59 ? 239  ASP A CG  1 
ATOM   1910  C  CG  B ASP A 1 242 ? 73.790  81.284  16.213  0.40 16.67 ? 239  ASP A CG  1 
ATOM   1911  O  OD1 A ASP A 1 242 ? 73.437  83.725  15.604  0.60 25.17 ? 239  ASP A OD1 1 
ATOM   1912  O  OD1 B ASP A 1 242 ? 74.995  81.222  15.877  0.40 17.43 ? 239  ASP A OD1 1 
ATOM   1913  O  OD2 A ASP A 1 242 ? 71.567  82.608  15.890  0.60 28.50 ? 239  ASP A OD2 1 
ATOM   1914  O  OD2 B ASP A 1 242 ? 72.892  80.581  15.706  0.40 17.91 ? 239  ASP A OD2 1 
ATOM   1915  N  N   . ASP A 1 243 ? 73.267  84.065  19.662  1.00 15.68 ? 240  ASP A N   1 
ATOM   1916  C  CA  . ASP A 1 243 ? 72.729  85.258  20.326  1.00 17.68 ? 240  ASP A CA  1 
ATOM   1917  C  C   . ASP A 1 243 ? 73.793  86.157  20.936  1.00 17.29 ? 240  ASP A C   1 
ATOM   1918  O  O   . ASP A 1 243 ? 73.651  87.371  20.927  1.00 18.12 ? 240  ASP A O   1 
ATOM   1919  C  CB  . ASP A 1 243 ? 71.758  84.881  21.443  1.00 17.68 ? 240  ASP A CB  1 
ATOM   1920  C  CG  . ASP A 1 243 ? 70.527  84.182  20.936  1.00 20.78 ? 240  ASP A CG  1 
ATOM   1921  O  OD1 . ASP A 1 243 ? 70.318  84.170  19.702  1.00 19.29 ? 240  ASP A OD1 1 
ATOM   1922  O  OD2 . ASP A 1 243 ? 69.764  83.658  21.789  1.00 19.38 ? 240  ASP A OD2 1 
ATOM   1923  N  N   . PHE A 1 244 ? 74.862  85.575  21.462  1.00 16.78 ? 241  PHE A N   1 
ATOM   1924  C  CA  . PHE A 1 244 ? 75.863  86.403  22.103  1.00 16.43 ? 241  PHE A CA  1 
ATOM   1925  C  C   . PHE A 1 244 ? 77.043  86.640  21.193  1.00 16.23 ? 241  PHE A C   1 
ATOM   1926  O  O   . PHE A 1 244 ? 78.092  87.059  21.630  1.00 18.39 ? 241  PHE A O   1 
ATOM   1927  C  CB  . PHE A 1 244 ? 76.251  85.832  23.468  1.00 16.18 ? 241  PHE A CB  1 
ATOM   1928  C  CG  . PHE A 1 244 ? 75.072  85.538  24.341  1.00 15.05 ? 241  PHE A CG  1 
ATOM   1929  C  CD1 . PHE A 1 244 ? 74.168  86.543  24.659  1.00 15.57 ? 241  PHE A CD1 1 
ATOM   1930  C  CD2 . PHE A 1 244 ? 74.875  84.273  24.876  1.00 13.75 ? 241  PHE A CD2 1 
ATOM   1931  C  CE1 . PHE A 1 244 ? 73.064  86.286  25.437  1.00 15.88 ? 241  PHE A CE1 1 
ATOM   1932  C  CE2 . PHE A 1 244 ? 73.764  84.008  25.664  1.00 15.50 ? 241  PHE A CE2 1 
ATOM   1933  C  CZ  . PHE A 1 244 ? 72.857  85.021  25.952  1.00 15.42 ? 241  PHE A CZ  1 
ATOM   1934  N  N   . GLY A 1 245 ? 76.823  86.416  19.907  1.00 16.30 ? 242  GLY A N   1 
ATOM   1935  C  CA  . GLY A 1 245 ? 77.824  86.633  18.887  1.00 16.74 ? 242  GLY A CA  1 
ATOM   1936  C  C   . GLY A 1 245 ? 77.769  88.045  18.308  1.00 15.38 ? 242  GLY A C   1 
ATOM   1937  O  O   . GLY A 1 245 ? 78.549  88.373  17.428  1.00 14.15 ? 242  GLY A O   1 
ATOM   1938  N  N   . THR A 1 246 ? 76.872  88.896  18.803  1.00 14.04 ? 243  THR A N   1 
ATOM   1939  C  CA  . THR A 1 246 ? 76.796  90.279  18.285  1.00 14.56 ? 243  THR A CA  1 
ATOM   1940  C  C   . THR A 1 246 ? 77.793  91.195  19.000  1.00 15.06 ? 243  THR A C   1 
ATOM   1941  O  O   . THR A 1 246 ? 77.984  91.094  20.206  1.00 15.31 ? 243  THR A O   1 
ATOM   1942  C  CB  . THR A 1 246 ? 75.373  90.893  18.392  1.00 14.54 ? 243  THR A CB  1 
ATOM   1943  O  OG1 . THR A 1 246 ? 75.419  92.267  17.987  1.00 13.91 ? 243  THR A OG1 1 
ATOM   1944  C  CG2 . THR A 1 246 ? 74.841  90.812  19.816  1.00 15.71 ? 243  THR A CG2 1 
ATOM   1945  N  N   . SER A 1 247 ? 78.411  92.106  18.252  1.00 15.06 ? 244  SER A N   1 
ATOM   1946  C  CA  . SER A 1 247 ? 79.370  93.043  18.835  1.00 16.13 ? 244  SER A CA  1 
ATOM   1947  C  C   . SER A 1 247 ? 78.679  94.239  19.487  1.00 17.07 ? 244  SER A C   1 
ATOM   1948  O  O   . SER A 1 247 ? 79.342  95.078  20.119  1.00 17.42 ? 244  SER A O   1 
ATOM   1949  C  CB  . SER A 1 247 ? 80.288  93.600  17.755  1.00 16.63 ? 244  SER A CB  1 
ATOM   1950  O  OG  . SER A 1 247 ? 79.551  94.415  16.856  1.00 14.08 ? 244  SER A OG  1 
ATOM   1951  N  N   . GLU A 1 248 ? 77.364  94.342  19.317  1.00 16.85 ? 245  GLU A N   1 
ATOM   1952  C  CA  . GLU A 1 248 ? 76.630  95.487  19.850  1.00 17.74 ? 245  GLU A CA  1 
ATOM   1953  C  C   . GLU A 1 248 ? 76.178  95.270  21.309  1.00 15.81 ? 245  GLU A C   1 
ATOM   1954  O  O   . GLU A 1 248 ? 75.317  94.440  21.594  1.00 15.36 ? 245  GLU A O   1 
ATOM   1955  C  CB  . GLU A 1 248 ? 75.432  95.793  18.952  1.00 18.26 ? 245  GLU A CB  1 
ATOM   1956  C  CG  . GLU A 1 248 ? 74.718  97.111  19.261  1.00 22.36 ? 245  GLU A CG  1 
ATOM   1957  C  CD  . GLU A 1 248 ? 75.606  98.333  19.072  1.00 28.16 ? 245  GLU A CD  1 
ATOM   1958  O  OE1 . GLU A 1 248 ? 75.518  99.241  19.918  1.00 34.20 ? 245  GLU A OE1 1 
ATOM   1959  O  OE2 . GLU A 1 248 ? 76.421  98.375  18.120  1.00 29.17 ? 245  GLU A OE2 1 
ATOM   1960  N  N   . LEU A 1 249 ? 76.761  96.042  22.220  1.00 15.29 ? 246  LEU A N   1 
ATOM   1961  C  CA  . LEU A 1 249 ? 76.446  95.949  23.658  1.00 14.84 ? 246  LEU A CA  1 
ATOM   1962  C  C   . LEU A 1 249 ? 74.949  95.943  24.008  1.00 15.69 ? 246  LEU A C   1 
ATOM   1963  O  O   . LEU A 1 249 ? 74.493  95.093  24.756  1.00 14.82 ? 246  LEU A O   1 
ATOM   1964  C  CB  . LEU A 1 249 ? 77.165  97.086  24.402  1.00 14.95 ? 246  LEU A CB  1 
ATOM   1965  C  CG  . LEU A 1 249 ? 77.058  97.206  25.922  1.00 14.19 ? 246  LEU A CG  1 
ATOM   1966  C  CD1 . LEU A 1 249 ? 77.332  95.875  26.632  1.00 13.79 ? 246  LEU A CD1 1 
ATOM   1967  C  CD2 . LEU A 1 249 ? 77.983  98.323  26.436  1.00 13.70 ? 246  LEU A CD2 1 
ATOM   1968  N  N   . GLU A 1 250 ? 74.174  96.860  23.437  1.00 17.22 ? 247  GLU A N   1 
ATOM   1969  C  CA  . GLU A 1 250 ? 72.741  96.929  23.748  1.00 18.72 ? 247  GLU A CA  1 
ATOM   1970  C  C   . GLU A 1 250 ? 71.941  95.702  23.276  1.00 17.49 ? 247  GLU A C   1 
ATOM   1971  O  O   . GLU A 1 250 ? 70.796  95.510  23.674  1.00 16.84 ? 247  GLU A O   1 
ATOM   1972  C  CB  . GLU A 1 250 ? 72.138  98.214  23.156  1.00 20.54 ? 247  GLU A CB  1 
ATOM   1973  C  CG  . GLU A 1 250 ? 72.115  98.251  21.643  1.00 24.38 ? 247  GLU A CG  1 
ATOM   1974  C  CD  . GLU A 1 250 ? 71.646  99.596  21.083  1.00 33.45 ? 247  GLU A CD  1 
ATOM   1975  O  OE1 . GLU A 1 250 ? 71.295  100.498 21.880  1.00 38.65 ? 247  GLU A OE1 1 
ATOM   1976  O  OE2 . GLU A 1 250 ? 71.625  99.742  19.836  1.00 41.38 ? 247  GLU A OE2 1 
ATOM   1977  N  N   . GLU A 1 251 ? 72.542  94.885  22.420  1.00 17.37 ? 248  GLU A N   1 
ATOM   1978  C  CA  . GLU A 1 251 ? 71.899  93.672  21.904  1.00 17.78 ? 248  GLU A CA  1 
ATOM   1979  C  C   . GLU A 1 251 ? 72.505  92.402  22.491  1.00 17.01 ? 248  GLU A C   1 
ATOM   1980  O  O   . GLU A 1 251 ? 72.070  91.311  22.164  1.00 16.26 ? 248  GLU A O   1 
ATOM   1981  C  CB  . GLU A 1 251 ? 72.082  93.603  20.392  1.00 19.21 ? 248  GLU A CB  1 
ATOM   1982  C  CG  . GLU A 1 251 ? 71.476  94.774  19.648  1.00 23.70 ? 248  GLU A CG  1 
ATOM   1983  C  CD  . GLU A 1 251 ? 71.756  94.716  18.152  1.00 31.99 ? 248  GLU A CD  1 
ATOM   1984  O  OE1 . GLU A 1 251 ? 72.515  93.818  17.687  1.00 38.74 ? 248  GLU A OE1 1 
ATOM   1985  O  OE2 . GLU A 1 251 ? 71.227  95.584  17.440  1.00 38.45 ? 248  GLU A OE2 1 
ATOM   1986  N  N   . ASN A 1 252 ? 73.509  92.540  23.356  1.00 15.24 ? 249  ASN A N   1 
ATOM   1987  C  CA  . ASN A 1 252 ? 74.179  91.376  23.920  1.00 14.93 ? 249  ASN A CA  1 
ATOM   1988  C  C   . ASN A 1 252 ? 74.099  91.321  25.456  1.00 13.96 ? 249  ASN A C   1 
ATOM   1989  O  O   . ASN A 1 252 ? 74.896  91.944  26.143  1.00 13.23 ? 249  ASN A O   1 
ATOM   1990  C  CB  . ASN A 1 252 ? 75.644  91.381  23.456  1.00 14.72 ? 249  ASN A CB  1 
ATOM   1991  C  CG  . ASN A 1 252 ? 76.325  90.070  23.688  1.00 14.71 ? 249  ASN A CG  1 
ATOM   1992  O  OD1 . ASN A 1 252 ? 76.119  89.426  24.730  1.00 15.69 ? 249  ASN A OD1 1 
ATOM   1993  N  ND2 . ASN A 1 252 ? 77.144  89.631  22.693  1.00 9.47  ? 249  ASN A ND2 1 
ATOM   1994  N  N   . PRO A 1 253 ? 73.140  90.548  25.989  1.00 13.96 ? 250  PRO A N   1 
ATOM   1995  C  CA  . PRO A 1 253 ? 72.943  90.398  27.420  1.00 13.35 ? 250  PRO A CA  1 
ATOM   1996  C  C   . PRO A 1 253 ? 74.179  89.931  28.178  1.00 12.73 ? 250  PRO A C   1 
ATOM   1997  O  O   . PRO A 1 253 ? 74.392  90.341  29.320  1.00 12.57 ? 250  PRO A O   1 
ATOM   1998  C  CB  . PRO A 1 253 ? 71.818  89.362  27.503  1.00 13.93 ? 250  PRO A CB  1 
ATOM   1999  C  CG  . PRO A 1 253 ? 71.014  89.612  26.230  1.00 15.39 ? 250  PRO A CG  1 
ATOM   2000  C  CD  . PRO A 1 253 ? 72.062  89.904  25.208  1.00 15.83 ? 250  PRO A CD  1 
ATOM   2001  N  N   . ALA A 1 254 ? 74.983  89.078  27.559  1.00 12.82 ? 251  ALA A N   1 
ATOM   2002  C  CA  . ALA A 1 254 ? 76.197  88.589  28.207  1.00 12.36 ? 251  ALA A CA  1 
ATOM   2003  C  C   . ALA A 1 254 ? 77.189  89.741  28.419  1.00 13.20 ? 251  ALA A C   1 
ATOM   2004  O  O   . ALA A 1 254 ? 77.848  89.826  29.463  1.00 13.11 ? 251  ALA A O   1 
ATOM   2005  C  CB  . ALA A 1 254 ? 76.821  87.485  27.375  1.00 12.51 ? 251  ALA A CB  1 
ATOM   2006  N  N   . TYR A 1 255 ? 77.328  90.594  27.411  1.00 14.06 ? 252  TYR A N   1 
ATOM   2007  C  CA  . TYR A 1 255 ? 78.241  91.736  27.522  1.00 14.39 ? 252  TYR A CA  1 
ATOM   2008  C  C   . TYR A 1 255 ? 77.703  92.786  28.491  1.00 13.72 ? 252  TYR A C   1 
ATOM   2009  O  O   . TYR A 1 255 ? 78.484  93.475  29.167  1.00 14.03 ? 252  TYR A O   1 
ATOM   2010  C  CB  . TYR A 1 255 ? 78.582  92.358  26.150  1.00 15.33 ? 252  TYR A CB  1 
ATOM   2011  C  CG  . TYR A 1 255 ? 79.269  91.411  25.174  1.00 12.90 ? 252  TYR A CG  1 
ATOM   2012  C  CD1 . TYR A 1 255 ? 79.979  90.306  25.630  1.00 15.66 ? 252  TYR A CD1 1 
ATOM   2013  C  CD2 . TYR A 1 255 ? 79.336  91.709  23.813  1.00 11.79 ? 252  TYR A CD2 1 
ATOM   2014  C  CE1 . TYR A 1 255 ? 80.643  89.458  24.755  1.00 16.26 ? 252  TYR A CE1 1 
ATOM   2015  C  CE2 . TYR A 1 255 ? 80.016  90.871  22.921  1.00 13.71 ? 252  TYR A CE2 1 
ATOM   2016  C  CZ  . TYR A 1 255 ? 80.659  89.749  23.400  1.00 14.88 ? 252  TYR A CZ  1 
ATOM   2017  O  OH  . TYR A 1 255 ? 81.319  88.906  22.533  1.00 15.06 ? 252  TYR A OH  1 
ATOM   2018  N  N   . GLN A 1 256 ? 76.377  92.890  28.577  1.00 12.98 ? 253  GLN A N   1 
ATOM   2019  C  CA  . GLN A 1 256 ? 75.743  93.810  29.516  1.00 12.64 ? 253  GLN A CA  1 
ATOM   2020  C  C   . GLN A 1 256 ? 76.065  93.394  30.939  1.00 12.71 ? 253  GLN A C   1 
ATOM   2021  O  O   . GLN A 1 256 ? 76.343  94.240  31.770  1.00 12.03 ? 253  GLN A O   1 
ATOM   2022  C  CB  . GLN A 1 256 ? 74.241  93.852  29.311  1.00 12.94 ? 253  GLN A CB  1 
ATOM   2023  C  CG  . GLN A 1 256 ? 73.839  94.497  27.979  1.00 14.95 ? 253  GLN A CG  1 
ATOM   2024  C  CD  . GLN A 1 256 ? 72.396  94.224  27.632  1.00 20.15 ? 253  GLN A CD  1 
ATOM   2025  O  OE1 . GLN A 1 256 ? 71.605  93.868  28.498  1.00 16.61 ? 253  GLN A OE1 1 
ATOM   2026  N  NE2 . GLN A 1 256 ? 72.049  94.366  26.350  1.00 18.27 ? 253  GLN A NE2 1 
ATOM   2027  N  N   . TYR A 1 257 ? 76.022  92.091  31.213  1.00 12.76 ? 254  TYR A N   1 
ATOM   2028  C  CA  . TYR A 1 257 ? 76.339  91.559  32.547  1.00 12.92 ? 254  TYR A CA  1 
ATOM   2029  C  C   . TYR A 1 257 ? 77.786  91.865  32.895  1.00 11.84 ? 254  TYR A C   1 
ATOM   2030  O  O   . TYR A 1 257 ? 78.069  92.298  34.012  1.00 12.56 ? 254  TYR A O   1 
ATOM   2031  C  CB  . TYR A 1 257 ? 76.028  90.047  32.605  1.00 13.06 ? 254  TYR A CB  1 
ATOM   2032  C  CG  . TYR A 1 257 ? 76.481  89.316  33.849  1.00 14.97 ? 254  TYR A CG  1 
ATOM   2033  C  CD1 . TYR A 1 257 ? 76.170  89.787  35.123  1.00 14.27 ? 254  TYR A CD1 1 
ATOM   2034  C  CD2 . TYR A 1 257 ? 77.132  88.089  33.747  1.00 17.05 ? 254  TYR A CD2 1 
ATOM   2035  C  CE1 . TYR A 1 257 ? 76.566  89.072  36.288  1.00 14.10 ? 254  TYR A CE1 1 
ATOM   2036  C  CE2 . TYR A 1 257 ? 77.527  87.385  34.872  1.00 17.16 ? 254  TYR A CE2 1 
ATOM   2037  C  CZ  . TYR A 1 257 ? 77.232  87.876  36.147  1.00 15.24 ? 254  TYR A CZ  1 
ATOM   2038  O  OH  . TYR A 1 257 ? 77.622  87.142  37.245  1.00 14.78 ? 254  TYR A OH  1 
ATOM   2039  N  N   . ALA A 1 258 ? 78.691  91.651  31.937  1.00 11.88 ? 255  ALA A N   1 
ATOM   2040  C  CA  . ALA A 1 258 ? 80.121  91.940  32.110  1.00 11.68 ? 255  ALA A CA  1 
ATOM   2041  C  C   . ALA A 1 258 ? 80.360  93.423  32.417  1.00 12.65 ? 255  ALA A C   1 
ATOM   2042  O  O   . ALA A 1 258 ? 81.110  93.766  33.324  1.00 13.00 ? 255  ALA A O   1 
ATOM   2043  C  CB  . ALA A 1 258 ? 80.908  91.531  30.858  1.00 10.83 ? 255  ALA A CB  1 
ATOM   2044  N  N   . VAL A 1 259 ? 79.737  94.304  31.644  1.00 12.61 ? 256  VAL A N   1 
ATOM   2045  C  CA  . VAL A 1 259 ? 79.868  95.737  31.855  1.00 11.48 ? 256  VAL A CA  1 
ATOM   2046  C  C   . VAL A 1 259 ? 79.319  96.165  33.211  1.00 12.73 ? 256  VAL A C   1 
ATOM   2047  O  O   . VAL A 1 259 ? 79.963  96.921  33.945  1.00 11.37 ? 256  VAL A O   1 
ATOM   2048  C  CB  . VAL A 1 259 ? 79.181  96.527  30.723  1.00 11.13 ? 256  VAL A CB  1 
ATOM   2049  C  CG1 . VAL A 1 259 ? 79.010  98.004  31.085  1.00 10.74 ? 256  VAL A CG1 1 
ATOM   2050  C  CG2 . VAL A 1 259 ? 79.985  96.369  29.423  1.00 10.21 ? 256  VAL A CG2 1 
ATOM   2051  N  N   . VAL A 1 260 ? 78.143  95.662  33.562  1.00 11.82 ? 257  VAL A N   1 
ATOM   2052  C  CA  . VAL A 1 260 ? 77.542  96.026  34.828  1.00 12.60 ? 257  VAL A CA  1 
ATOM   2053  C  C   . VAL A 1 260 ? 78.377  95.564  36.026  1.00 13.99 ? 257  VAL A C   1 
ATOM   2054  O  O   . VAL A 1 260 ? 78.596  96.330  36.971  1.00 14.07 ? 257  VAL A O   1 
ATOM   2055  C  CB  . VAL A 1 260 ? 76.087  95.479  34.938  1.00 12.80 ? 257  VAL A CB  1 
ATOM   2056  C  CG1 . VAL A 1 260 ? 75.603  95.589  36.352  1.00 12.81 ? 257  VAL A CG1 1 
ATOM   2057  C  CG2 . VAL A 1 260 ? 75.163  96.252  33.972  1.00 13.61 ? 257  VAL A CG2 1 
ATOM   2058  N  N   . ARG A 1 261 ? 78.858  94.326  35.999  1.00 14.19 ? 258  ARG A N   1 
ATOM   2059  C  CA  . ARG A 1 261 ? 79.647  93.851  37.126  1.00 15.35 ? 258  ARG A CA  1 
ATOM   2060  C  C   . ARG A 1 261 ? 80.954  94.638  37.232  1.00 15.10 ? 258  ARG A C   1 
ATOM   2061  O  O   . ARG A 1 261 ? 81.369  94.981  38.332  1.00 14.49 ? 258  ARG A O   1 
ATOM   2062  C  CB  . ARG A 1 261 ? 79.810  92.324  37.134  1.00 16.63 ? 258  ARG A CB  1 
ATOM   2063  C  CG  . ARG A 1 261 ? 80.564  91.720  36.024  1.00 17.31 ? 258  ARG A CG  1 
ATOM   2064  C  CD  . ARG A 1 261 ? 80.363  90.177  35.987  1.00 16.57 ? 258  ARG A CD  1 
ATOM   2065  N  NE  . ARG A 1 261 ? 80.754  89.487  37.213  1.00 18.15 ? 258  ARG A NE  1 
ATOM   2066  C  CZ  . ARG A 1 261 ? 82.011  89.228  37.564  1.00 18.49 ? 258  ARG A CZ  1 
ATOM   2067  N  NH1 . ARG A 1 261 ? 83.016  89.671  36.812  1.00 17.29 ? 258  ARG A NH1 1 
ATOM   2068  N  NH2 . ARG A 1 261 ? 82.265  88.567  38.693  1.00 15.74 ? 258  ARG A NH2 1 
ATOM   2069  N  N   . ASN A 1 262 ? 81.562  95.010  36.114  1.00 15.15 ? 259  ASN A N   1 
ATOM   2070  C  CA  . ASN A 1 262 ? 82.767  95.840  36.198  1.00 15.93 ? 259  ASN A CA  1 
ATOM   2071  C  C   . ASN A 1 262 ? 82.473  97.241  36.752  1.00 15.10 ? 259  ASN A C   1 
ATOM   2072  O  O   . ASN A 1 262 ? 83.298  97.818  37.486  1.00 14.76 ? 259  ASN A O   1 
ATOM   2073  C  CB  . ASN A 1 262 ? 83.522  95.944  34.862  1.00 17.22 ? 259  ASN A CB  1 
ATOM   2074  C  CG  . ASN A 1 262 ? 84.482  94.787  34.645  1.00 21.67 ? 259  ASN A CG  1 
ATOM   2075  O  OD1 . ASN A 1 262 ? 85.652  94.867  35.058  1.00 23.74 ? 259  ASN A OD1 1 
ATOM   2076  N  ND2 . ASN A 1 262 ? 83.990  93.684  34.078  1.00 21.27 ? 259  ASN A ND2 1 
ATOM   2077  N  N   . ALA A 1 263 ? 81.308  97.788  36.403  1.00 13.61 ? 260  ALA A N   1 
ATOM   2078  C  CA  . ALA A 1 263 ? 80.918  99.111  36.887  1.00 14.43 ? 260  ALA A CA  1 
ATOM   2079  C  C   . ALA A 1 263 ? 80.688  99.081  38.417  1.00 13.43 ? 260  ALA A C   1 
ATOM   2080  O  O   . ALA A 1 263 ? 81.107  99.991  39.126  1.00 13.08 ? 260  ALA A O   1 
ATOM   2081  C  CB  . ALA A 1 263 ? 79.680  99.640  36.134  1.00 12.24 ? 260  ALA A CB  1 
ATOM   2082  N  N   . LEU A 1 264 ? 80.046  98.023  38.905  1.00 13.04 ? 261  LEU A N   1 
ATOM   2083  C  CA  . LEU A 1 264 ? 79.798  97.848  40.338  1.00 11.71 ? 261  LEU A CA  1 
ATOM   2084  C  C   . LEU A 1 264 ? 81.123  97.660  41.094  1.00 11.74 ? 261  LEU A C   1 
ATOM   2085  O  O   . LEU A 1 264 ? 81.306  98.196  42.189  1.00 12.39 ? 261  LEU A O   1 
ATOM   2086  C  CB  . LEU A 1 264 ? 78.816  96.677  40.585  1.00 11.79 ? 261  LEU A CB  1 
ATOM   2087  C  CG  . LEU A 1 264 ? 77.385  96.872  40.049  1.00 11.18 ? 261  LEU A CG  1 
ATOM   2088  C  CD1 . LEU A 1 264 ? 76.438  95.692  40.371  1.00 8.69  ? 261  LEU A CD1 1 
ATOM   2089  C  CD2 . LEU A 1 264 ? 76.787  98.169  40.607  1.00 12.22 ? 261  LEU A CD2 1 
ATOM   2090  N  N   . TYR A 1 265 ? 82.046  96.908  40.505  1.00 10.51 ? 262  TYR A N   1 
ATOM   2091  C  CA  . TYR A 1 265 ? 83.357  96.717  41.092  1.00 12.12 ? 262  TYR A CA  1 
ATOM   2092  C  C   . TYR A 1 265 ? 84.022  98.092  41.290  1.00 12.49 ? 262  TYR A C   1 
ATOM   2093  O  O   . TYR A 1 265 ? 84.569  98.381  42.354  1.00 11.35 ? 262  TYR A O   1 
ATOM   2094  C  CB  . TYR A 1 265 ? 84.203  95.820  40.204  1.00 11.65 ? 262  TYR A CB  1 
ATOM   2095  C  CG  . TYR A 1 265 ? 85.608  95.536  40.713  1.00 12.02 ? 262  TYR A CG  1 
ATOM   2096  C  CD1 . TYR A 1 265 ? 85.818  94.656  41.754  1.00 14.90 ? 262  TYR A CD1 1 
ATOM   2097  C  CD2 . TYR A 1 265 ? 86.714  96.076  40.092  1.00 12.34 ? 262  TYR A CD2 1 
ATOM   2098  C  CE1 . TYR A 1 265 ? 87.080  94.355  42.206  1.00 15.57 ? 262  TYR A CE1 1 
ATOM   2099  C  CE2 . TYR A 1 265 ? 88.006  95.782  40.544  1.00 15.16 ? 262  TYR A CE2 1 
ATOM   2100  C  CZ  . TYR A 1 265 ? 88.167  94.910  41.606  1.00 14.51 ? 262  TYR A CZ  1 
ATOM   2101  O  OH  . TYR A 1 265 ? 89.412  94.577  42.066  1.00 13.90 ? 262  TYR A OH  1 
ATOM   2102  N  N   . ASN A 1 266 ? 83.914  98.948  40.291  1.00 12.80 ? 263  ASN A N   1 
ATOM   2103  C  CA  . ASN A 1 266 ? 84.483  100.295 40.365  1.00 12.98 ? 263  ASN A CA  1 
ATOM   2104  C  C   . ASN A 1 266 ? 83.825  101.195 41.406  1.00 12.23 ? 263  ASN A C   1 
ATOM   2105  O  O   . ASN A 1 266 ? 84.434  102.177 41.859  1.00 12.19 ? 263  ASN A O   1 
ATOM   2106  C  CB  . ASN A 1 266 ? 84.513  100.950 38.982  1.00 13.86 ? 263  ASN A CB  1 
ATOM   2107  C  CG  . ASN A 1 266 ? 85.617  100.381 38.100  1.00 16.78 ? 263  ASN A CG  1 
ATOM   2108  O  OD1 . ASN A 1 266 ? 86.699  100.035 38.590  1.00 19.57 ? 263  ASN A OD1 1 
ATOM   2109  N  ND2 . ASN A 1 266 ? 85.361  100.297 36.796  1.00 19.46 ? 263  ASN A ND2 1 
ATOM   2110  N  N   . LYS A 1 267 ? 82.609  100.856 41.816  1.00 11.51 ? 264  LYS A N   1 
ATOM   2111  C  CA  . LYS A 1 267 ? 81.922  101.611 42.885  1.00 12.73 ? 264  LYS A CA  1 
ATOM   2112  C  C   . LYS A 1 267 ? 82.260  101.030 44.275  1.00 13.35 ? 264  LYS A C   1 
ATOM   2113  O  O   . LYS A 1 267 ? 81.745  101.495 45.284  1.00 14.97 ? 264  LYS A O   1 
ATOM   2114  C  CB  . LYS A 1 267 ? 80.405  101.542 42.713  1.00 12.17 ? 264  LYS A CB  1 
ATOM   2115  C  CG  . LYS A 1 267 ? 79.848  102.113 41.435  1.00 13.03 ? 264  LYS A CG  1 
ATOM   2116  C  CD  . LYS A 1 267 ? 78.389  101.690 41.288  1.00 11.56 ? 264  LYS A CD  1 
ATOM   2117  C  CE  . LYS A 1 267 ? 77.741  102.178 39.968  1.00 17.10 ? 264  LYS A CE  1 
ATOM   2118  N  NZ  . LYS A 1 267 ? 77.387  103.637 39.936  1.00 14.84 ? 264  LYS A NZ  1 
ATOM   2119  N  N   . GLY A 1 268 ? 83.102  100.012 44.332  1.00 13.38 ? 265  GLY A N   1 
ATOM   2120  C  CA  . GLY A 1 268 ? 83.456  99.390  45.613  1.00 14.73 ? 265  GLY A CA  1 
ATOM   2121  C  C   . GLY A 1 268 ? 82.675  98.120  45.942  1.00 16.54 ? 265  GLY A C   1 
ATOM   2122  O  O   . GLY A 1 268 ? 82.757  97.617  47.082  1.00 14.87 ? 265  GLY A O   1 
ATOM   2123  N  N   . LYS A 1 269 ? 81.883  97.599  44.989  1.00 15.17 ? 266  LYS A N   1 
ATOM   2124  C  CA  . LYS A 1 269 ? 81.132  96.354  45.258  1.00 16.38 ? 266  LYS A CA  1 
ATOM   2125  C  C   . LYS A 1 269 ? 82.067  95.266  44.826  1.00 17.19 ? 266  LYS A C   1 
ATOM   2126  O  O   . LYS A 1 269 ? 82.075  94.867  43.652  1.00 19.12 ? 266  LYS A O   1 
ATOM   2127  C  CB  . LYS A 1 269 ? 79.802  96.287  44.507  1.00 16.31 ? 266  LYS A CB  1 
ATOM   2128  C  CG  . LYS A 1 269 ? 78.891  97.493  44.741  1.00 17.57 ? 266  LYS A CG  1 
ATOM   2129  C  CD  . LYS A 1 269 ? 78.626  97.801  46.230  1.00 16.78 ? 266  LYS A CD  1 
ATOM   2130  C  CE  . LYS A 1 269 ? 77.562  98.885  46.399  1.00 14.85 ? 266  LYS A CE  1 
ATOM   2131  N  NZ  . LYS A 1 269 ? 77.430  99.367  47.820  1.00 16.45 ? 266  LYS A NZ  1 
ATOM   2132  N  N   . THR A 1 270 ? 82.879  94.808  45.781  1.00 16.45 ? 267  THR A N   1 
ATOM   2133  C  CA  . THR A 1 270 ? 83.935  93.827  45.523  1.00 16.29 ? 267  THR A CA  1 
ATOM   2134  C  C   . THR A 1 270 ? 83.612  92.346  45.749  1.00 15.74 ? 267  THR A C   1 
ATOM   2135  O  O   . THR A 1 270 ? 84.485  91.483  45.539  1.00 15.90 ? 267  THR A O   1 
ATOM   2136  C  CB  . THR A 1 270 ? 85.182  94.211  46.323  1.00 16.65 ? 267  THR A CB  1 
ATOM   2137  O  OG1 . THR A 1 270 ? 84.810  94.453  47.692  1.00 16.86 ? 267  THR A OG1 1 
ATOM   2138  C  CG2 . THR A 1 270 ? 85.802  95.499  45.743  1.00 19.35 ? 267  THR A CG2 1 
ATOM   2139  N  N   . ILE A 1 271 ? 82.393  92.068  46.211  1.00 13.43 ? 268  ILE A N   1 
ATOM   2140  C  CA  . ILE A 1 271 ? 81.906  90.717  46.431  1.00 12.52 ? 268  ILE A CA  1 
ATOM   2141  C  C   . ILE A 1 271 ? 80.613  90.510  45.625  1.00 12.34 ? 268  ILE A C   1 
ATOM   2142  O  O   . ILE A 1 271 ? 79.648  91.274  45.771  1.00 10.74 ? 268  ILE A O   1 
ATOM   2143  C  CB  . ILE A 1 271 ? 81.538  90.467  47.910  1.00 13.24 ? 268  ILE A CB  1 
ATOM   2144  C  CG1 . ILE A 1 271 ? 82.768  90.599  48.816  1.00 12.47 ? 268  ILE A CG1 1 
ATOM   2145  C  CG2 . ILE A 1 271 ? 80.938  89.057  48.092  1.00 12.68 ? 268  ILE A CG2 1 
ATOM   2146  C  CD1 . ILE A 1 271 ? 82.411  90.605  50.325  1.00 11.65 ? 268  ILE A CD1 1 
ATOM   2147  N  N   . GLU A 1 272 ? 80.590  89.500  44.771  1.00 11.18 ? 269  GLU A N   1 
ATOM   2148  C  CA  . GLU A 1 272 ? 79.370  89.178  44.043  1.00 12.46 ? 269  GLU A CA  1 
ATOM   2149  C  C   . GLU A 1 272 ? 78.807  87.878  44.588  1.00 13.25 ? 269  GLU A C   1 
ATOM   2150  O  O   . GLU A 1 272 ? 79.499  86.844  44.591  1.00 13.25 ? 269  GLU A O   1 
ATOM   2151  C  CB  . GLU A 1 272 ? 79.627  88.981  42.554  1.00 13.48 ? 269  GLU A CB  1 
ATOM   2152  C  CG  . GLU A 1 272 ? 78.317  88.706  41.748  1.00 14.07 ? 269  GLU A CG  1 
ATOM   2153  C  CD  . GLU A 1 272 ? 78.539  88.560  40.250  1.00 18.68 ? 269  GLU A CD  1 
ATOM   2154  O  OE1 . GLU A 1 272 ? 79.701  88.650  39.805  1.00 16.54 ? 269  GLU A OE1 1 
ATOM   2155  O  OE2 . GLU A 1 272 ? 77.541  88.355  39.513  1.00 18.12 ? 269  GLU A OE2 1 
HETATM 2156  N  N   . MSE A 1 273 ? 77.564  87.904  45.035  1.00 12.49 ? 270  MSE A N   1 
HETATM 2157  C  CA  . MSE A 1 273 ? 76.934  86.687  45.502  1.00 13.10 ? 270  MSE A CA  1 
HETATM 2158  C  C   . MSE A 1 273 ? 75.941  86.151  44.475  1.00 13.36 ? 270  MSE A C   1 
HETATM 2159  O  O   . MSE A 1 273 ? 74.939  86.821  44.150  1.00 14.10 ? 270  MSE A O   1 
HETATM 2160  C  CB  . MSE A 1 273 ? 76.204  86.934  46.814  1.00 13.89 ? 270  MSE A CB  1 
HETATM 2161  C  CG  . MSE A 1 273 ? 77.084  87.390  47.953  1.00 17.60 ? 270  MSE A CG  1 
HETATM 2162  SE SE  . MSE A 1 273 ? 75.955  87.760  49.548  1.00 24.72 ? 270  MSE A SE  1 
HETATM 2163  C  CE  . MSE A 1 273 ? 75.121  86.024  49.691  1.00 14.79 ? 270  MSE A CE  1 
ATOM   2164  N  N   . LEU A 1 274 ? 76.226  84.962  43.936  1.00 13.78 ? 271  LEU A N   1 
ATOM   2165  C  CA  . LEU A 1 274 ? 75.327  84.312  42.982  1.00 13.56 ? 271  LEU A CA  1 
ATOM   2166  C  C   . LEU A 1 274 ? 74.258  83.627  43.832  1.00 12.75 ? 271  LEU A C   1 
ATOM   2167  O  O   . LEU A 1 274 ? 74.557  82.725  44.626  1.00 13.17 ? 271  LEU A O   1 
ATOM   2168  C  CB  . LEU A 1 274 ? 76.056  83.261  42.117  1.00 13.37 ? 271  LEU A CB  1 
ATOM   2169  C  CG  . LEU A 1 274 ? 75.240  82.627  40.968  1.00 14.82 ? 271  LEU A CG  1 
ATOM   2170  C  CD1 . LEU A 1 274 ? 75.029  83.630  39.833  1.00 13.38 ? 271  LEU A CD1 1 
ATOM   2171  C  CD2 . LEU A 1 274 ? 75.909  81.365  40.390  1.00 14.21 ? 271  LEU A CD2 1 
ATOM   2172  N  N   . ILE A 1 275 ? 73.013  84.037  43.637  1.00 12.89 ? 272  ILE A N   1 
ATOM   2173  C  CA  . ILE A 1 275 ? 71.870  83.532  44.416  1.00 13.35 ? 272  ILE A CA  1 
ATOM   2174  C  C   . ILE A 1 275 ? 70.950  82.617  43.605  1.00 13.10 ? 272  ILE A C   1 
ATOM   2175  O  O   . ILE A 1 275 ? 70.764  82.828  42.410  1.00 12.18 ? 272  ILE A O   1 
ATOM   2176  C  CB  . ILE A 1 275 ? 70.987  84.732  44.868  1.00 14.96 ? 272  ILE A CB  1 
ATOM   2177  C  CG1 . ILE A 1 275 ? 71.794  85.748  45.686  1.00 15.30 ? 272  ILE A CG1 1 
ATOM   2178  C  CG2 . ILE A 1 275 ? 69.701  84.266  45.603  1.00 15.47 ? 272  ILE A CG2 1 
ATOM   2179  C  CD1 . ILE A 1 275 ? 72.484  85.202  46.900  1.00 12.88 ? 272  ILE A CD1 1 
ATOM   2180  N  N   . ASN A 1 276 ? 70.426  81.575  44.234  1.00 13.76 ? 273  ASN A N   1 
ATOM   2181  C  CA  . ASN A 1 276 ? 69.403  80.735  43.599  1.00 13.42 ? 273  ASN A CA  1 
ATOM   2182  C  C   . ASN A 1 276 ? 68.255  80.561  44.607  1.00 12.66 ? 273  ASN A C   1 
ATOM   2183  O  O   . ASN A 1 276 ? 68.414  80.879  45.806  1.00 11.80 ? 273  ASN A O   1 
ATOM   2184  C  CB  . ASN A 1 276 ? 69.966  79.379  43.181  1.00 14.62 ? 273  ASN A CB  1 
ATOM   2185  C  CG  . ASN A 1 276 ? 70.316  78.511  44.355  1.00 15.20 ? 273  ASN A CG  1 
ATOM   2186  O  OD1 . ASN A 1 276 ? 69.453  78.145  45.155  1.00 20.12 ? 273  ASN A OD1 1 
ATOM   2187  N  ND2 . ASN A 1 276 ? 71.588  78.169  44.468  1.00 16.18 ? 273  ASN A ND2 1 
ATOM   2188  N  N   . TYR A 1 277 ? 67.102  80.103  44.124  1.00 11.76 ? 274  TYR A N   1 
ATOM   2189  C  CA  . TYR A 1 277 ? 65.949  79.795  44.971  1.00 11.18 ? 274  TYR A CA  1 
ATOM   2190  C  C   . TYR A 1 277 ? 65.577  78.330  44.797  1.00 14.16 ? 274  TYR A C   1 
ATOM   2191  O  O   . TYR A 1 277 ? 64.494  77.884  45.198  1.00 13.84 ? 274  TYR A O   1 
ATOM   2192  C  CB  . TYR A 1 277 ? 64.769  80.722  44.688  1.00 11.38 ? 274  TYR A CB  1 
ATOM   2193  C  CG  . TYR A 1 277 ? 64.893  82.042  45.408  1.00 11.78 ? 274  TYR A CG  1 
ATOM   2194  C  CD1 . TYR A 1 277 ? 65.672  83.068  44.892  1.00 12.28 ? 274  TYR A CD1 1 
ATOM   2195  C  CD2 . TYR A 1 277 ? 64.263  82.245  46.642  1.00 13.67 ? 274  TYR A CD2 1 
ATOM   2196  C  CE1 . TYR A 1 277 ? 65.778  84.295  45.571  1.00 13.94 ? 274  TYR A CE1 1 
ATOM   2197  C  CE2 . TYR A 1 277 ? 64.381  83.453  47.325  1.00 13.15 ? 274  TYR A CE2 1 
ATOM   2198  C  CZ  . TYR A 1 277 ? 65.132  84.466  46.784  1.00 11.85 ? 274  TYR A CZ  1 
ATOM   2199  O  OH  . TYR A 1 277 ? 65.268  85.653  47.480  1.00 14.14 ? 274  TYR A OH  1 
ATOM   2200  N  N   . GLU A 1 278 ? 66.508  77.575  44.221  1.00 14.65 ? 275  GLU A N   1 
ATOM   2201  C  CA  . GLU A 1 278 ? 66.337  76.151  43.966  1.00 15.10 ? 275  GLU A CA  1 
ATOM   2202  C  C   . GLU A 1 278 ? 67.614  75.426  44.340  1.00 16.05 ? 275  GLU A C   1 
ATOM   2203  O  O   . GLU A 1 278 ? 68.630  75.607  43.660  1.00 17.28 ? 275  GLU A O   1 
ATOM   2204  C  CB  . GLU A 1 278 ? 66.044  75.910  42.485  1.00 14.57 ? 275  GLU A CB  1 
ATOM   2205  C  CG  . GLU A 1 278 ? 64.643  76.317  42.063  1.00 17.35 ? 275  GLU A CG  1 
ATOM   2206  C  CD  . GLU A 1 278 ? 63.554  75.430  42.675  1.00 20.08 ? 275  GLU A CD  1 
ATOM   2207  O  OE1 . GLU A 1 278 ? 63.868  74.416  43.357  1.00 21.13 ? 275  GLU A OE1 1 
ATOM   2208  O  OE2 . GLU A 1 278 ? 62.370  75.750  42.465  1.00 21.28 ? 275  GLU A OE2 1 
ATOM   2209  N  N   . PRO A 1 279 ? 67.565  74.570  45.383  1.00 16.61 ? 276  PRO A N   1 
ATOM   2210  C  CA  . PRO A 1 279 ? 68.763  73.865  45.855  1.00 17.15 ? 276  PRO A CA  1 
ATOM   2211  C  C   . PRO A 1 279 ? 69.512  73.057  44.791  1.00 17.27 ? 276  PRO A C   1 
ATOM   2212  O  O   . PRO A 1 279 ? 70.711  72.808  44.950  1.00 17.77 ? 276  PRO A O   1 
ATOM   2213  C  CB  . PRO A 1 279 ? 68.214  72.934  46.951  1.00 18.22 ? 276  PRO A CB  1 
ATOM   2214  C  CG  . PRO A 1 279 ? 66.784  72.823  46.683  1.00 17.94 ? 276  PRO A CG  1 
ATOM   2215  C  CD  . PRO A 1 279 ? 66.369  74.141  46.129  1.00 16.58 ? 276  PRO A CD  1 
ATOM   2216  N  N   . ALA A 1 280 ? 68.836  72.671  43.715  1.00 15.89 ? 277  ALA A N   1 
ATOM   2217  C  CA  . ALA A 1 280 ? 69.490  71.900  42.647  1.00 17.24 ? 277  ALA A CA  1 
ATOM   2218  C  C   . ALA A 1 280 ? 70.553  72.705  41.894  1.00 16.54 ? 277  ALA A C   1 
ATOM   2219  O  O   . ALA A 1 280 ? 71.389  72.124  41.180  1.00 16.97 ? 277  ALA A O   1 
ATOM   2220  C  CB  . ALA A 1 280 ? 68.455  71.379  41.665  1.00 16.58 ? 277  ALA A CB  1 
ATOM   2221  N  N   . LEU A 1 281 ? 70.506  74.026  42.037  1.00 15.65 ? 278  LEU A N   1 
ATOM   2222  C  CA  . LEU A 1 281 ? 71.455  74.915  41.371  1.00 16.45 ? 278  LEU A CA  1 
ATOM   2223  C  C   . LEU A 1 281 ? 72.723  75.131  42.177  1.00 16.53 ? 278  LEU A C   1 
ATOM   2224  O  O   . LEU A 1 281 ? 73.589  75.901  41.766  1.00 16.34 ? 278  LEU A O   1 
ATOM   2225  C  CB  . LEU A 1 281 ? 70.812  76.275  41.063  1.00 16.02 ? 278  LEU A CB  1 
ATOM   2226  C  CG  . LEU A 1 281 ? 69.652  76.263  40.056  1.00 18.82 ? 278  LEU A CG  1 
ATOM   2227  C  CD1 . LEU A 1 281 ? 68.976  77.661  39.927  1.00 18.69 ? 278  LEU A CD1 1 
ATOM   2228  C  CD2 . LEU A 1 281 ? 70.154  75.828  38.727  1.00 24.10 ? 278  LEU A CD2 1 
ATOM   2229  N  N   . GLN A 1 282 ? 72.842  74.434  43.304  1.00 16.61 ? 279  GLN A N   1 
ATOM   2230  C  CA  . GLN A 1 282 ? 74.011  74.565  44.178  1.00 18.15 ? 279  GLN A CA  1 
ATOM   2231  C  C   . GLN A 1 282 ? 75.330  74.319  43.467  1.00 17.09 ? 279  GLN A C   1 
ATOM   2232  O  O   . GLN A 1 282 ? 76.254  75.137  43.571  1.00 15.52 ? 279  GLN A O   1 
ATOM   2233  C  CB  . GLN A 1 282 ? 73.900  73.627  45.382  1.00 18.73 ? 279  GLN A CB  1 
ATOM   2234  C  CG  . GLN A 1 282 ? 75.144  73.589  46.233  1.00 26.66 ? 279  GLN A CG  1 
ATOM   2235  C  CD  . GLN A 1 282 ? 74.990  72.667  47.437  1.00 34.68 ? 279  GLN A CD  1 
ATOM   2236  O  OE1 . GLN A 1 282 ? 73.902  72.559  48.018  1.00 39.25 ? 279  GLN A OE1 1 
ATOM   2237  N  NE2 . GLN A 1 282 ? 76.081  72.003  47.821  1.00 39.21 ? 279  GLN A NE2 1 
ATOM   2238  N  N   . TYR A 1 283 ? 75.455  73.189  42.775  1.00 15.92 ? 280  TYR A N   1 
ATOM   2239  C  CA  . TYR A 1 283 ? 76.723  72.926  42.075  1.00 16.93 ? 280  TYR A CA  1 
ATOM   2240  C  C   . TYR A 1 283 ? 76.964  73.850  40.895  1.00 15.36 ? 280  TYR A C   1 
ATOM   2241  O  O   . TYR A 1 283 ? 78.131  74.121  40.559  1.00 13.65 ? 280  TYR A O   1 
ATOM   2242  C  CB  . TYR A 1 283 ? 76.978  71.431  41.776  1.00 16.73 ? 280  TYR A CB  1 
ATOM   2243  C  CG  . TYR A 1 283 ? 77.712  70.824  42.946  1.00 21.01 ? 280  TYR A CG  1 
ATOM   2244  C  CD1 . TYR A 1 283 ? 79.104  70.896  43.014  1.00 25.70 ? 280  TYR A CD1 1 
ATOM   2245  C  CD2 . TYR A 1 283 ? 77.027  70.300  44.027  1.00 28.54 ? 280  TYR A CD2 1 
ATOM   2246  C  CE1 . TYR A 1 283 ? 79.786  70.414  44.089  1.00 29.01 ? 280  TYR A CE1 1 
ATOM   2247  C  CE2 . TYR A 1 283 ? 77.704  69.800  45.123  1.00 30.90 ? 280  TYR A CE2 1 
ATOM   2248  C  CZ  . TYR A 1 283 ? 79.086  69.863  45.147  1.00 31.68 ? 280  TYR A CZ  1 
ATOM   2249  O  OH  . TYR A 1 283 ? 79.771  69.381  46.231  1.00 34.98 ? 280  TYR A OH  1 
ATOM   2250  N  N   . PHE A 1 284 ? 75.891  74.324  40.261  1.00 14.46 ? 281  PHE A N   1 
ATOM   2251  C  CA  . PHE A 1 284 ? 76.052  75.290  39.182  1.00 14.79 ? 281  PHE A CA  1 
ATOM   2252  C  C   . PHE A 1 284 ? 76.772  76.529  39.731  1.00 14.22 ? 281  PHE A C   1 
ATOM   2253  O  O   . PHE A 1 284 ? 77.638  77.126  39.061  1.00 14.05 ? 281  PHE A O   1 
ATOM   2254  C  CB  . PHE A 1 284 ? 74.714  75.716  38.546  1.00 16.36 ? 281  PHE A CB  1 
ATOM   2255  C  CG  . PHE A 1 284 ? 74.896  76.624  37.380  1.00 17.02 ? 281  PHE A CG  1 
ATOM   2256  C  CD1 . PHE A 1 284 ? 75.183  76.100  36.132  1.00 21.93 ? 281  PHE A CD1 1 
ATOM   2257  C  CD2 . PHE A 1 284 ? 74.866  77.999  37.531  1.00 19.22 ? 281  PHE A CD2 1 
ATOM   2258  C  CE1 . PHE A 1 284 ? 75.402  76.924  35.051  1.00 18.84 ? 281  PHE A CE1 1 
ATOM   2259  C  CE2 . PHE A 1 284 ? 75.086  78.836  36.443  1.00 17.79 ? 281  PHE A CE2 1 
ATOM   2260  C  CZ  . PHE A 1 284 ? 75.351  78.299  35.209  1.00 21.84 ? 281  PHE A CZ  1 
ATOM   2261  N  N   . ALA A 1 285 ? 76.413  76.940  40.942  1.00 13.61 ? 282  ALA A N   1 
ATOM   2262  C  CA  . ALA A 1 285 ? 77.071  78.109  41.542  1.00 13.41 ? 282  ALA A CA  1 
ATOM   2263  C  C   . ALA A 1 285 ? 78.570  77.817  41.766  1.00 13.25 ? 282  ALA A C   1 
ATOM   2264  O  O   . ALA A 1 285 ? 79.405  78.702  41.612  1.00 14.00 ? 282  ALA A O   1 
ATOM   2265  C  CB  . ALA A 1 285 ? 76.385  78.510  42.861  1.00 12.90 ? 282  ALA A CB  1 
ATOM   2266  N  N   . GLU A 1 286 ? 78.918  76.579  42.127  1.00 14.11 ? 283  GLU A N   1 
ATOM   2267  C  CA  . GLU A 1 286 ? 80.341  76.214  42.325  1.00 13.92 ? 283  GLU A CA  1 
ATOM   2268  C  C   . GLU A 1 286 ? 81.089  76.310  40.987  1.00 13.04 ? 283  GLU A C   1 
ATOM   2269  O  O   . GLU A 1 286 ? 82.252  76.759  40.926  1.00 13.33 ? 283  GLU A O   1 
ATOM   2270  C  CB  . GLU A 1 286 ? 80.486  74.811  42.939  1.00 15.23 ? 283  GLU A CB  1 
ATOM   2271  C  CG  . GLU A 1 286 ? 79.924  74.693  44.337  1.00 15.78 ? 283  GLU A CG  1 
ATOM   2272  C  CD  . GLU A 1 286 ? 80.661  75.564  45.324  1.00 20.50 ? 283  GLU A CD  1 
ATOM   2273  O  OE1 . GLU A 1 286 ? 81.907  75.558  45.324  1.00 22.67 ? 283  GLU A OE1 1 
ATOM   2274  O  OE2 . GLU A 1 286 ? 79.995  76.264  46.110  1.00 25.28 ? 283  GLU A OE2 1 
ATOM   2275  N  N   . TRP A 1 287 ? 80.430  75.877  39.916  1.00 12.86 ? 284  TRP A N   1 
ATOM   2276  C  CA  . TRP A 1 287 ? 80.986  75.977  38.554  1.00 12.03 ? 284  TRP A CA  1 
ATOM   2277  C  C   . TRP A 1 287 ? 81.230  77.462  38.204  1.00 12.46 ? 284  TRP A C   1 
ATOM   2278  O  O   . TRP A 1 287 ? 82.299  77.844  37.677  1.00 12.69 ? 284  TRP A O   1 
ATOM   2279  C  CB  . TRP A 1 287 ? 80.015  75.324  37.552  1.00 11.53 ? 284  TRP A CB  1 
ATOM   2280  C  CG  . TRP A 1 287 ? 80.411  75.477  36.147  1.00 13.90 ? 284  TRP A CG  1 
ATOM   2281  C  CD1 . TRP A 1 287 ? 81.277  74.688  35.436  1.00 11.46 ? 284  TRP A CD1 1 
ATOM   2282  C  CD2 . TRP A 1 287 ? 79.965  76.515  35.244  1.00 8.39  ? 284  TRP A CD2 1 
ATOM   2283  N  NE1 . TRP A 1 287 ? 81.400  75.177  34.151  1.00 12.34 ? 284  TRP A NE1 1 
ATOM   2284  C  CE2 . TRP A 1 287 ? 80.618  76.302  34.013  1.00 10.60 ? 284  TRP A CE2 1 
ATOM   2285  C  CE3 . TRP A 1 287 ? 79.092  77.614  35.378  1.00 11.25 ? 284  TRP A CE3 1 
ATOM   2286  C  CZ2 . TRP A 1 287 ? 80.428  77.145  32.904  1.00 11.58 ? 284  TRP A CZ2 1 
ATOM   2287  C  CZ3 . TRP A 1 287 ? 78.907  78.462  34.280  1.00 14.38 ? 284  TRP A CZ3 1 
ATOM   2288  C  CH2 . TRP A 1 287 ? 79.562  78.210  33.053  1.00 13.61 ? 284  TRP A CH2 1 
ATOM   2289  N  N   . TRP A 1 288 ? 80.238  78.289  38.500  1.00 12.20 ? 285  TRP A N   1 
ATOM   2290  C  CA  . TRP A 1 288 ? 80.304  79.729  38.255  1.00 12.84 ? 285  TRP A CA  1 
ATOM   2291  C  C   . TRP A 1 288 ? 81.443  80.368  39.056  1.00 14.19 ? 285  TRP A C   1 
ATOM   2292  O  O   . TRP A 1 288 ? 82.126  81.289  38.554  1.00 12.96 ? 285  TRP A O   1 
ATOM   2293  C  CB  . TRP A 1 288 ? 78.945  80.370  38.589  1.00 12.71 ? 285  TRP A CB  1 
ATOM   2294  C  CG  . TRP A 1 288 ? 78.896  81.873  38.579  1.00 13.02 ? 285  TRP A CG  1 
ATOM   2295  C  CD1 . TRP A 1 288 ? 78.520  82.680  37.536  1.00 15.97 ? 285  TRP A CD1 1 
ATOM   2296  C  CD2 . TRP A 1 288 ? 79.177  82.750  39.682  1.00 13.41 ? 285  TRP A CD2 1 
ATOM   2297  N  NE1 . TRP A 1 288 ? 78.583  84.009  37.915  1.00 15.12 ? 285  TRP A NE1 1 
ATOM   2298  C  CE2 . TRP A 1 288 ? 78.993  84.075  39.225  1.00 14.52 ? 285  TRP A CE2 1 
ATOM   2299  C  CE3 . TRP A 1 288 ? 79.586  82.545  41.007  1.00 16.02 ? 285  TRP A CE3 1 
ATOM   2300  C  CZ2 . TRP A 1 288 ? 79.195  85.191  40.050  1.00 16.46 ? 285  TRP A CZ2 1 
ATOM   2301  C  CZ3 . TRP A 1 288 ? 79.786  83.649  41.824  1.00 16.16 ? 285  TRP A CZ3 1 
ATOM   2302  C  CH2 . TRP A 1 288 ? 79.587  84.962  41.340  1.00 13.19 ? 285  TRP A CH2 1 
ATOM   2303  N  N   . LYS A 1 289 ? 81.658  79.894  40.291  1.00 13.71 ? 286  LYS A N   1 
ATOM   2304  C  CA  . LYS A 1 289 ? 82.757  80.426  41.116  1.00 14.86 ? 286  LYS A CA  1 
ATOM   2305  C  C   . LYS A 1 289 ? 84.101  80.137  40.512  1.00 13.94 ? 286  LYS A C   1 
ATOM   2306  O  O   . LYS A 1 289 ? 84.966  81.000  40.511  1.00 14.84 ? 286  LYS A O   1 
ATOM   2307  C  CB  . LYS A 1 289 ? 82.701  79.962  42.582  1.00 14.65 ? 286  LYS A CB  1 
ATOM   2308  C  CG  . LYS A 1 289 ? 81.601  80.641  43.369  1.00 18.83 ? 286  LYS A CG  1 
ATOM   2309  C  CD  . LYS A 1 289 ? 81.639  80.372  44.895  1.00 26.13 ? 286  LYS A CD  1 
ATOM   2310  C  CE  . LYS A 1 289 ? 81.133  79.028  45.275  1.00 29.57 ? 286  LYS A CE  1 
ATOM   2311  N  NZ  . LYS A 1 289 ? 81.094  78.821  46.764  1.00 27.04 ? 286  LYS A NZ  1 
ATOM   2312  N  N   . GLN A 1 290 ? 84.308  78.933  40.005  1.00 14.11 ? 287  GLN A N   1 
ATOM   2313  C  CA  . GLN A 1 290 ? 85.573  78.642  39.362  1.00 14.67 ? 287  GLN A CA  1 
ATOM   2314  C  C   . GLN A 1 290 ? 85.765  79.516  38.121  1.00 15.36 ? 287  GLN A C   1 
ATOM   2315  O  O   . GLN A 1 290 ? 86.851  80.098  37.891  1.00 14.26 ? 287  GLN A O   1 
ATOM   2316  C  CB  . GLN A 1 290 ? 85.673  77.174  38.937  1.00 15.34 ? 287  GLN A CB  1 
ATOM   2317  C  CG  . GLN A 1 290 ? 86.969  76.937  38.181  1.00 15.41 ? 287  GLN A CG  1 
ATOM   2318  C  CD  . GLN A 1 290 ? 87.258  75.495  37.855  1.00 19.56 ? 287  GLN A CD  1 
ATOM   2319  O  OE1 . GLN A 1 290 ? 86.486  74.594  38.197  1.00 20.05 ? 287  GLN A OE1 1 
ATOM   2320  N  NE2 . GLN A 1 290 ? 88.403  75.265  37.173  1.00 15.95 ? 287  GLN A NE2 1 
ATOM   2321  N  N   . LEU A 1 291 ? 84.706  79.603  37.313  1.00 14.18 ? 288  LEU A N   1 
ATOM   2322  C  CA  . LEU A 1 291 ? 84.714  80.372  36.087  1.00 14.19 ? 288  LEU A CA  1 
ATOM   2323  C  C   . LEU A 1 291 ? 85.202  81.804  36.296  1.00 14.01 ? 288  LEU A C   1 
ATOM   2324  O  O   . LEU A 1 291 ? 86.212  82.227  35.709  1.00 13.56 ? 288  LEU A O   1 
ATOM   2325  C  CB  . LEU A 1 291 ? 83.311  80.377  35.452  1.00 13.45 ? 288  LEU A CB  1 
ATOM   2326  C  CG  . LEU A 1 291 ? 83.226  80.966  34.030  1.00 16.21 ? 288  LEU A CG  1 
ATOM   2327  C  CD1 . LEU A 1 291 ? 84.218  80.274  33.070  1.00 14.00 ? 288  LEU A CD1 1 
ATOM   2328  C  CD2 . LEU A 1 291 ? 81.781  80.912  33.451  1.00 12.05 ? 288  LEU A CD2 1 
ATOM   2329  N  N   . PHE A 1 292 ? 84.493  82.550  37.124  1.00 14.96 ? 289  PHE A N   1 
ATOM   2330  C  CA  . PHE A 1 292 ? 84.880  83.928  37.389  1.00 15.37 ? 289  PHE A CA  1 
ATOM   2331  C  C   . PHE A 1 292 ? 86.070  84.056  38.329  1.00 15.56 ? 289  PHE A C   1 
ATOM   2332  O  O   . PHE A 1 292 ? 86.921  84.929  38.134  1.00 15.90 ? 289  PHE A O   1 
ATOM   2333  C  CB  . PHE A 1 292 ? 83.677  84.746  37.874  1.00 14.87 ? 289  PHE A CB  1 
ATOM   2334  C  CG  . PHE A 1 292 ? 82.697  85.025  36.782  1.00 13.66 ? 289  PHE A CG  1 
ATOM   2335  C  CD1 . PHE A 1 292 ? 82.813  86.181  36.014  1.00 13.90 ? 289  PHE A CD1 1 
ATOM   2336  C  CD2 . PHE A 1 292 ? 81.716  84.103  36.453  1.00 13.65 ? 289  PHE A CD2 1 
ATOM   2337  C  CE1 . PHE A 1 292 ? 81.943  86.444  34.987  1.00 13.62 ? 289  PHE A CE1 1 
ATOM   2338  C  CE2 . PHE A 1 292 ? 80.829  84.358  35.388  1.00 16.36 ? 289  PHE A CE2 1 
ATOM   2339  C  CZ  . PHE A 1 292 ? 80.942  85.518  34.667  1.00 14.94 ? 289  PHE A CZ  1 
ATOM   2340  N  N   . GLY A 1 293 ? 86.133  83.201  39.340  1.00 15.93 ? 290  GLY A N   1 
ATOM   2341  C  CA  . GLY A 1 293 ? 87.247  83.236  40.304  1.00 15.22 ? 290  GLY A CA  1 
ATOM   2342  C  C   . GLY A 1 293 ? 88.606  83.013  39.666  1.00 15.11 ? 290  GLY A C   1 
ATOM   2343  O  O   . GLY A 1 293 ? 89.560  83.765  39.919  1.00 14.12 ? 290  GLY A O   1 
ATOM   2344  N  N   . GLU A 1 294 ? 88.715  81.952  38.871  1.00 15.89 ? 291  GLU A N   1 
ATOM   2345  C  CA  . GLU A 1 294 ? 89.975  81.628  38.201  1.00 16.38 ? 291  GLU A CA  1 
ATOM   2346  C  C   . GLU A 1 294 ? 90.268  82.550  37.051  1.00 16.31 ? 291  GLU A C   1 
ATOM   2347  O  O   . GLU A 1 294 ? 91.428  82.783  36.745  1.00 15.01 ? 291  GLU A O   1 
ATOM   2348  C  CB  . GLU A 1 294 ? 90.032  80.193  37.660  1.00 17.08 ? 291  GLU A CB  1 
ATOM   2349  C  CG  . GLU A 1 294 ? 90.331  79.146  38.660  1.00 20.45 ? 291  GLU A CG  1 
ATOM   2350  C  CD  . GLU A 1 294 ? 90.874  77.868  38.000  1.00 24.20 ? 291  GLU A CD  1 
ATOM   2351  O  OE1 . GLU A 1 294 ? 90.432  77.538  36.880  1.00 21.60 ? 291  GLU A OE1 1 
ATOM   2352  O  OE2 . GLU A 1 294 ? 91.749  77.206  38.602  1.00 23.13 ? 291  GLU A OE2 1 
ATOM   2353  N  N   . SER A 1 295 ? 89.228  83.044  36.376  1.00 14.31 ? 292  SER A N   1 
ATOM   2354  C  CA  . SER A 1 295 ? 89.469  83.930  35.250  1.00 14.05 ? 292  SER A CA  1 
ATOM   2355  C  C   . SER A 1 295 ? 89.923  85.338  35.659  1.00 14.65 ? 292  SER A C   1 
ATOM   2356  O  O   . SER A 1 295 ? 90.782  85.922  34.997  1.00 13.19 ? 292  SER A O   1 
ATOM   2357  C  CB  . SER A 1 295 ? 88.222  84.065  34.344  1.00 13.92 ? 292  SER A CB  1 
ATOM   2358  O  OG  . SER A 1 295 ? 87.842  82.810  33.772  1.00 14.01 ? 292  SER A OG  1 
ATOM   2359  N  N   . GLU A 1 296 ? 89.355  85.883  36.731  1.00 12.86 ? 293  GLU A N   1 
ATOM   2360  C  CA  . GLU A 1 296 ? 89.660  87.271  37.091  1.00 14.13 ? 293  GLU A CA  1 
ATOM   2361  C  C   . GLU A 1 296 ? 90.510  87.526  38.335  1.00 14.18 ? 293  GLU A C   1 
ATOM   2362  O  O   . GLU A 1 296 ? 90.963  88.656  38.552  1.00 14.88 ? 293  GLU A O   1 
ATOM   2363  C  CB  . GLU A 1 296 ? 88.346  88.014  37.270  1.00 13.86 ? 293  GLU A CB  1 
ATOM   2364  C  CG  . GLU A 1 296 ? 87.523  88.002  36.035  1.00 15.57 ? 293  GLU A CG  1 
ATOM   2365  C  CD  . GLU A 1 296 ? 86.293  88.846  36.129  1.00 19.30 ? 293  GLU A CD  1 
ATOM   2366  O  OE1 . GLU A 1 296 ? 85.626  88.849  37.197  1.00 22.68 ? 293  GLU A OE1 1 
ATOM   2367  O  OE2 . GLU A 1 296 ? 85.957  89.473  35.098  1.00 21.15 ? 293  GLU A OE2 1 
ATOM   2368  N  N   . GLY A 1 297 ? 90.729  86.500  39.139  1.00 13.91 ? 294  GLY A N   1 
ATOM   2369  C  CA  . GLY A 1 297 ? 91.477  86.661  40.388  1.00 14.52 ? 294  GLY A CA  1 
ATOM   2370  C  C   . GLY A 1 297 ? 92.951  86.687  40.132  1.00 14.67 ? 294  GLY A C   1 
ATOM   2371  O  O   . GLY A 1 297 ? 93.650  85.741  40.448  1.00 16.26 ? 294  GLY A O   1 
ATOM   2372  N  N   . LYS A 1 298 ? 93.430  87.754  39.510  1.00 13.60 ? 295  LYS A N   1 
ATOM   2373  C  CA  . LYS A 1 298 ? 94.847  87.851  39.224  1.00 14.35 ? 295  LYS A CA  1 
ATOM   2374  C  C   . LYS A 1 298 ? 95.343  89.284  39.249  1.00 13.28 ? 295  LYS A C   1 
ATOM   2375  O  O   . LYS A 1 298 ? 94.550  90.233  39.216  1.00 11.93 ? 295  LYS A O   1 
ATOM   2376  C  CB  . LYS A 1 298 ? 95.165  87.163  37.906  1.00 15.93 ? 295  LYS A CB  1 
ATOM   2377  C  CG  . LYS A 1 298 ? 94.276  87.591  36.770  1.00 17.43 ? 295  LYS A CG  1 
ATOM   2378  C  CD  . LYS A 1 298 ? 94.291  86.570  35.634  1.00 20.97 ? 295  LYS A CD  1 
ATOM   2379  C  CE  . LYS A 1 298 ? 93.728  85.207  36.046  1.00 24.43 ? 295  LYS A CE  1 
ATOM   2380  N  NZ  . LYS A 1 298 ? 93.440  84.336  34.846  1.00 15.44 ? 295  LYS A NZ  1 
ATOM   2381  N  N   . ASP A 1 299 ? 96.658  89.411  39.337  1.00 11.76 ? 296  ASP A N   1 
ATOM   2382  C  CA  . ASP A 1 299 ? 97.318  90.717  39.405  1.00 13.58 ? 296  ASP A CA  1 
ATOM   2383  C  C   . ASP A 1 299 ? 96.774  91.562  40.567  1.00 11.97 ? 296  ASP A C   1 
ATOM   2384  O  O   . ASP A 1 299 ? 96.782  92.806  40.494  1.00 11.81 ? 296  ASP A O   1 
ATOM   2385  C  CB  . ASP A 1 299 ? 97.174  91.429  38.051  1.00 12.98 ? 296  ASP A CB  1 
ATOM   2386  C  CG  . ASP A 1 299 ? 97.837  90.654  36.906  1.00 16.56 ? 296  ASP A CG  1 
ATOM   2387  O  OD1 . ASP A 1 299 ? 98.896  90.030  37.151  1.00 14.86 ? 296  ASP A OD1 1 
ATOM   2388  O  OD2 . ASP A 1 299 ? 97.315  90.698  35.754  1.00 16.96 ? 296  ASP A OD2 1 
ATOM   2389  N  N   . GLN A 1 300 ? 96.377  90.879  41.660  1.00 11.57 ? 297  GLN A N   1 
ATOM   2390  C  CA  . GLN A 1 300 ? 95.808  91.503  42.891  1.00 12.58 ? 297  GLN A CA  1 
ATOM   2391  C  C   . GLN A 1 300 ? 94.446  92.186  42.674  1.00 12.55 ? 297  GLN A C   1 
ATOM   2392  O  O   . GLN A 1 300 ? 94.076  93.115  43.396  1.00 11.67 ? 297  GLN A O   1 
ATOM   2393  C  CB  . GLN A 1 300 ? 96.794  92.483  43.569  1.00 13.72 ? 297  GLN A CB  1 
ATOM   2394  C  CG  . GLN A 1 300 ? 97.962  91.780  44.298  1.00 19.35 ? 297  GLN A CG  1 
ATOM   2395  C  CD  . GLN A 1 300 ? 98.826  91.026  43.370  1.00 26.47 ? 297  GLN A CD  1 
ATOM   2396  O  OE1 . GLN A 1 300 ? 99.333  91.587  42.393  1.00 32.31 ? 297  GLN A OE1 1 
ATOM   2397  N  NE2 . GLN A 1 300 ? 99.047  89.743  43.666  1.00 27.23 ? 297  GLN A NE2 1 
ATOM   2398  N  N   . LYS A 1 301 ? 93.687  91.685  41.705  1.00 12.32 ? 298  LYS A N   1 
ATOM   2399  C  CA  . LYS A 1 301 ? 92.406  92.265  41.358  1.00 13.13 ? 298  LYS A CA  1 
ATOM   2400  C  C   . LYS A 1 301 ? 91.274  91.234  41.320  1.00 12.73 ? 298  LYS A C   1 
ATOM   2401  O  O   . LYS A 1 301 ? 91.495  90.040  41.461  1.00 9.70  ? 298  LYS A O   1 
ATOM   2402  C  CB  . LYS A 1 301 ? 92.507  92.832  39.934  1.00 13.84 ? 298  LYS A CB  1 
ATOM   2403  C  CG  . LYS A 1 301 ? 93.641  93.809  39.692  1.00 15.68 ? 298  LYS A CG  1 
ATOM   2404  C  CD  . LYS A 1 301 ? 93.832  94.097  38.225  1.00 13.74 ? 298  LYS A CD  1 
ATOM   2405  C  CE  . LYS A 1 301 ? 95.047  94.964  37.981  1.00 15.06 ? 298  LYS A CE  1 
ATOM   2406  N  NZ  . LYS A 1 301 ? 95.328  95.143  36.523  1.00 16.90 ? 298  LYS A NZ  1 
ATOM   2407  N  N   . GLY A 1 302 ? 90.055  91.724  41.150  1.00 14.83 ? 299  GLY A N   1 
ATOM   2408  C  CA  . GLY A 1 302 ? 88.924  90.836  40.940  1.00 15.65 ? 299  GLY A CA  1 
ATOM   2409  C  C   . GLY A 1 302 ? 87.809  90.778  41.951  1.00 15.34 ? 299  GLY A C   1 
ATOM   2410  O  O   . GLY A 1 302 ? 88.039  90.809  43.150  1.00 14.69 ? 299  GLY A O   1 
ATOM   2411  N  N   . ILE A 1 303 ? 86.585  90.710  41.432  1.00 14.64 ? 300  ILE A N   1 
ATOM   2412  C  CA  . ILE A 1 303 ? 85.417  90.529  42.254  1.00 14.47 ? 300  ILE A CA  1 
ATOM   2413  C  C   . ILE A 1 303 ? 85.554  89.167  42.895  1.00 13.73 ? 300  ILE A C   1 
ATOM   2414  O  O   . ILE A 1 303 ? 85.907  88.184  42.220  1.00 13.79 ? 300  ILE A O   1 
ATOM   2415  C  CB  . ILE A 1 303 ? 84.123  90.519  41.396  1.00 15.52 ? 300  ILE A CB  1 
ATOM   2416  C  CG1 . ILE A 1 303 ? 83.855  91.911  40.820  1.00 15.50 ? 300  ILE A CG1 1 
ATOM   2417  C  CG2 . ILE A 1 303 ? 82.912  90.060  42.224  1.00 13.71 ? 300  ILE A CG2 1 
ATOM   2418  C  CD1 . ILE A 1 303 ? 82.746  91.935  39.722  1.00 12.34 ? 300  ILE A CD1 1 
ATOM   2419  N  N   . PHE A 1 304 ? 85.291  89.099  44.194  1.00 14.26 ? 301  PHE A N   1 
ATOM   2420  C  CA  . PHE A 1 304 ? 85.334  87.846  44.926  1.00 14.11 ? 301  PHE A CA  1 
ATOM   2421  C  C   . PHE A 1 304 ? 83.995  87.152  44.643  1.00 14.54 ? 301  PHE A C   1 
ATOM   2422  O  O   . PHE A 1 304 ? 82.947  87.733  44.895  1.00 13.49 ? 301  PHE A O   1 
ATOM   2423  C  CB  . PHE A 1 304 ? 85.514  88.113  46.437  1.00 14.29 ? 301  PHE A CB  1 
ATOM   2424  C  CG  . PHE A 1 304 ? 85.532  86.866  47.288  1.00 13.16 ? 301  PHE A CG  1 
ATOM   2425  C  CD1 . PHE A 1 304 ? 86.696  86.140  47.456  1.00 15.71 ? 301  PHE A CD1 1 
ATOM   2426  C  CD2 . PHE A 1 304 ? 84.399  86.456  47.969  1.00 16.94 ? 301  PHE A CD2 1 
ATOM   2427  C  CE1 . PHE A 1 304 ? 86.719  84.998  48.266  1.00 19.42 ? 301  PHE A CE1 1 
ATOM   2428  C  CE2 . PHE A 1 304 ? 84.411  85.300  48.772  1.00 19.19 ? 301  PHE A CE2 1 
ATOM   2429  C  CZ  . PHE A 1 304 ? 85.571  84.574  48.906  1.00 19.10 ? 301  PHE A CZ  1 
ATOM   2430  N  N   . PRO A 1 305 ? 84.029  85.916  44.110  1.00 14.79 ? 302  PRO A N   1 
ATOM   2431  C  CA  . PRO A 1 305 ? 82.802  85.210  43.791  1.00 15.46 ? 302  PRO A CA  1 
ATOM   2432  C  C   . PRO A 1 305 ? 82.295  84.379  44.972  1.00 15.39 ? 302  PRO A C   1 
ATOM   2433  O  O   . PRO A 1 305 ? 82.995  83.501  45.503  1.00 15.12 ? 302  PRO A O   1 
ATOM   2434  C  CB  . PRO A 1 305 ? 83.198  84.350  42.593  1.00 16.30 ? 302  PRO A CB  1 
ATOM   2435  C  CG  . PRO A 1 305 ? 84.666  84.119  42.732  1.00 19.49 ? 302  PRO A CG  1 
ATOM   2436  C  CD  . PRO A 1 305 ? 85.221  85.157  43.691  1.00 15.08 ? 302  PRO A CD  1 
ATOM   2437  N  N   . SER A 1 306 ? 81.101  84.709  45.417  1.00 13.52 ? 303  SER A N   1 
ATOM   2438  C  CA  . SER A 1 306 ? 80.487  84.019  46.537  1.00 15.65 ? 303  SER A CA  1 
ATOM   2439  C  C   . SER A 1 306 ? 79.135  83.497  46.044  1.00 15.10 ? 303  SER A C   1 
ATOM   2440  O  O   . SER A 1 306 ? 78.732  83.808  44.918  1.00 14.50 ? 303  SER A O   1 
ATOM   2441  C  CB  . SER A 1 306 ? 80.306  85.001  47.703  1.00 16.40 ? 303  SER A CB  1 
ATOM   2442  O  OG  . SER A 1 306 ? 79.773  84.373  48.851  1.00 21.02 ? 303  SER A OG  1 
ATOM   2443  N  N   . SER A 1 307 ? 78.445  82.711  46.865  1.00 15.36 ? 304  SER A N   1 
ATOM   2444  C  CA  . SER A 1 307 ? 77.128  82.187  46.472  1.00 16.13 ? 304  SER A CA  1 
ATOM   2445  C  C   . SER A 1 307 ? 76.253  81.925  47.681  1.00 16.36 ? 304  SER A C   1 
ATOM   2446  O  O   . SER A 1 307 ? 76.757  81.814  48.800  1.00 15.14 ? 304  SER A O   1 
ATOM   2447  C  CB  . SER A 1 307 ? 77.287  80.902  45.688  1.00 15.89 ? 304  SER A CB  1 
ATOM   2448  O  OG  . SER A 1 307 ? 77.854  79.895  46.481  1.00 17.65 ? 304  SER A OG  1 
ATOM   2449  N  N   . ALA A 1 308 ? 74.943  81.847  47.457  1.00 14.69 ? 305  ALA A N   1 
ATOM   2450  C  CA  . ALA A 1 308 ? 74.001  81.561  48.525  1.00 14.82 ? 305  ALA A CA  1 
ATOM   2451  C  C   . ALA A 1 308 ? 72.783  80.859  47.956  1.00 14.39 ? 305  ALA A C   1 
ATOM   2452  O  O   . ALA A 1 308 ? 72.417  81.066  46.798  1.00 15.39 ? 305  ALA A O   1 
ATOM   2453  C  CB  . ALA A 1 308 ? 73.595  82.852  49.257  1.00 14.69 ? 305  ALA A CB  1 
ATOM   2454  N  N   . ASN A 1 309 ? 72.179  80.007  48.765  1.00 13.71 ? 306  ASN A N   1 
ATOM   2455  C  CA  . ASN A 1 309 ? 70.996  79.274  48.378  1.00 13.88 ? 306  ASN A CA  1 
ATOM   2456  C  C   . ASN A 1 309 ? 69.823  79.816  49.196  1.00 13.49 ? 306  ASN A C   1 
ATOM   2457  O  O   . ASN A 1 309 ? 69.789  79.651  50.403  1.00 13.74 ? 306  ASN A O   1 
ATOM   2458  C  CB  . ASN A 1 309 ? 71.216  77.799  48.677  1.00 15.22 ? 306  ASN A CB  1 
ATOM   2459  C  CG  . ASN A 1 309 ? 72.563  77.281  48.134  1.00 19.01 ? 306  ASN A CG  1 
ATOM   2460  O  OD1 . ASN A 1 309 ? 72.849  77.377  46.936  1.00 24.25 ? 306  ASN A OD1 1 
ATOM   2461  N  ND2 . ASN A 1 309 ? 73.386  76.716  49.025  1.00 20.31 ? 306  ASN A ND2 1 
ATOM   2462  N  N   . PHE A 1 310 ? 68.918  80.540  48.556  1.00 12.84 ? 307  PHE A N   1 
ATOM   2463  C  CA  . PHE A 1 310 ? 67.764  81.099  49.233  1.00 13.84 ? 307  PHE A CA  1 
ATOM   2464  C  C   . PHE A 1 310 ? 66.529  80.212  49.015  1.00 14.30 ? 307  PHE A C   1 
ATOM   2465  O  O   . PHE A 1 310 ? 66.518  79.398  48.090  1.00 15.65 ? 307  PHE A O   1 
ATOM   2466  C  CB  . PHE A 1 310 ? 67.460  82.515  48.756  1.00 14.17 ? 307  PHE A CB  1 
ATOM   2467  C  CG  . PHE A 1 310 ? 68.507  83.525  49.109  1.00 12.85 ? 307  PHE A CG  1 
ATOM   2468  C  CD1 . PHE A 1 310 ? 69.470  83.265  50.084  1.00 15.52 ? 307  PHE A CD1 1 
ATOM   2469  C  CD2 . PHE A 1 310 ? 68.402  84.807  48.618  1.00 11.28 ? 307  PHE A CD2 1 
ATOM   2470  C  CE1 . PHE A 1 310 ? 70.392  84.237  50.445  1.00 13.26 ? 307  PHE A CE1 1 
ATOM   2471  C  CE2 . PHE A 1 310 ? 69.315  85.790  48.985  1.00 14.95 ? 307  PHE A CE2 1 
ATOM   2472  C  CZ  . PHE A 1 310 ? 70.314  85.496  49.893  1.00 13.42 ? 307  PHE A CZ  1 
ATOM   2473  N  N   . SER A 1 311 ? 65.515  80.308  49.877  1.00 14.48 ? 308  SER A N   1 
ATOM   2474  C  CA  . SER A 1 311 ? 65.470  81.197  51.053  1.00 14.09 ? 308  SER A CA  1 
ATOM   2475  C  C   . SER A 1 311 ? 66.305  80.692  52.226  1.00 13.03 ? 308  SER A C   1 
ATOM   2476  O  O   . SER A 1 311 ? 66.502  81.409  53.194  1.00 11.56 ? 308  SER A O   1 
ATOM   2477  C  CB  . SER A 1 311 ? 64.015  81.356  51.534  1.00 13.85 ? 308  SER A CB  1 
ATOM   2478  O  OG  . SER A 1 311 ? 63.467  80.128  52.013  1.00 13.22 ? 308  SER A OG  1 
ATOM   2479  N  N   . THR A 1 312 ? 66.774  79.454  52.132  1.00 12.47 ? 309  THR A N   1 
ATOM   2480  C  CA  . THR A 1 312 ? 67.580  78.824  53.181  1.00 12.83 ? 309  THR A CA  1 
ATOM   2481  C  C   . THR A 1 312 ? 68.602  79.757  53.858  1.00 12.16 ? 309  THR A C   1 
ATOM   2482  O  O   . THR A 1 312 ? 68.577  79.937  55.076  1.00 12.44 ? 309  THR A O   1 
ATOM   2483  C  CB  . THR A 1 312 ? 68.363  77.656  52.603  1.00 13.63 ? 309  THR A CB  1 
ATOM   2484  O  OG1 . THR A 1 312 ? 67.524  76.881  51.739  1.00 13.68 ? 309  THR A OG1 1 
ATOM   2485  C  CG2 . THR A 1 312 ? 68.953  76.774  53.721  1.00 14.25 ? 309  THR A CG2 1 
ATOM   2486  N  N   . ASP A 1 313 ? 69.483  80.352  53.056  1.00 12.23 ? 310  ASP A N   1 
ATOM   2487  C  CA  . ASP A 1 313 ? 70.554  81.232  53.557  1.00 11.82 ? 310  ASP A CA  1 
ATOM   2488  C  C   . ASP A 1 313 ? 70.079  82.620  54.018  1.00 13.04 ? 310  ASP A C   1 
ATOM   2489  O  O   . ASP A 1 313 ? 70.867  83.411  54.530  1.00 13.36 ? 310  ASP A O   1 
ATOM   2490  C  CB  . ASP A 1 313 ? 71.708  81.295  52.548  1.00 11.96 ? 310  ASP A CB  1 
ATOM   2491  C  CG  . ASP A 1 313 ? 72.349  79.917  52.309  1.00 15.18 ? 310  ASP A CG  1 
ATOM   2492  O  OD1 . ASP A 1 313 ? 72.019  78.985  53.078  1.00 17.21 ? 310  ASP A OD1 1 
ATOM   2493  O  OD2 . ASP A 1 313 ? 73.172  79.754  51.363  1.00 14.37 ? 310  ASP A OD2 1 
ATOM   2494  N  N   . LEU A 1 314 ? 68.801  82.936  53.861  1.00 12.47 ? 311  LEU A N   1 
ATOM   2495  C  CA  . LEU A 1 314 ? 68.306  84.199  54.430  1.00 12.40 ? 311  LEU A CA  1 
ATOM   2496  C  C   . LEU A 1 314 ? 68.272  84.056  55.956  1.00 13.87 ? 311  LEU A C   1 
ATOM   2497  O  O   . LEU A 1 314 ? 68.131  85.044  56.672  1.00 13.60 ? 311  LEU A O   1 
ATOM   2498  C  CB  . LEU A 1 314 ? 66.913  84.568  53.931  1.00 12.93 ? 311  LEU A CB  1 
ATOM   2499  C  CG  . LEU A 1 314 ? 66.835  84.977  52.455  1.00 12.32 ? 311  LEU A CG  1 
ATOM   2500  C  CD1 . LEU A 1 314 ? 65.389  84.995  51.940  1.00 13.16 ? 311  LEU A CD1 1 
ATOM   2501  C  CD2 . LEU A 1 314 ? 67.517  86.342  52.244  1.00 13.51 ? 311  LEU A CD2 1 
ATOM   2502  N  N   . HIS A 1 315 ? 68.367  82.816  56.435  1.00 13.68 ? 312  HIS A N   1 
ATOM   2503  C  CA  . HIS A 1 315 ? 68.382  82.500  57.866  1.00 14.04 ? 312  HIS A CA  1 
ATOM   2504  C  C   . HIS A 1 315 ? 69.797  82.291  58.413  1.00 14.71 ? 312  HIS A C   1 
ATOM   2505  O  O   . HIS A 1 315 ? 69.958  81.895  59.576  1.00 16.37 ? 312  HIS A O   1 
ATOM   2506  C  CB  . HIS A 1 315 ? 67.538  81.251  58.157  1.00 13.29 ? 312  HIS A CB  1 
ATOM   2507  C  CG  . HIS A 1 315 ? 66.116  81.388  57.728  1.00 14.08 ? 312  HIS A CG  1 
ATOM   2508  N  ND1 . HIS A 1 315 ? 65.114  81.768  58.590  1.00 10.92 ? 312  HIS A ND1 1 
ATOM   2509  C  CD2 . HIS A 1 315 ? 65.535  81.260  56.508  1.00 14.43 ? 312  HIS A CD2 1 
ATOM   2510  C  CE1 . HIS A 1 315 ? 63.963  81.810  57.938  1.00 14.06 ? 312  HIS A CE1 1 
ATOM   2511  N  NE2 . HIS A 1 315 ? 64.193  81.520  56.667  1.00 15.41 ? 312  HIS A NE2 1 
ATOM   2512  N  N   . SER A 1 316 ? 70.812  82.479  57.571  1.00 15.06 ? 313  SER A N   1 
ATOM   2513  C  CA  . SER A 1 316 ? 72.208  82.390  58.011  1.00 15.09 ? 313  SER A CA  1 
ATOM   2514  C  C   . SER A 1 316 ? 72.935  83.685  57.613  1.00 14.37 ? 313  SER A C   1 
ATOM   2515  O  O   . SER A 1 316 ? 73.546  84.328  58.454  1.00 15.12 ? 313  SER A O   1 
ATOM   2516  C  CB  . SER A 1 316 ? 72.936  81.145  57.469  1.00 15.97 ? 313  SER A CB  1 
ATOM   2517  O  OG  . SER A 1 316 ? 72.982  81.099  56.052  1.00 17.60 ? 313  SER A OG  1 
ATOM   2518  N  N   . LEU A 1 317 ? 72.861  84.057  56.338  1.00 13.84 ? 314  LEU A N   1 
ATOM   2519  C  CA  . LEU A 1 317 ? 73.497  85.281  55.819  1.00 14.49 ? 314  LEU A CA  1 
ATOM   2520  C  C   . LEU A 1 317 ? 72.531  86.439  55.550  1.00 14.18 ? 314  LEU A C   1 
ATOM   2521  O  O   . LEU A 1 317 ? 72.963  87.535  55.178  1.00 13.87 ? 314  LEU A O   1 
ATOM   2522  C  CB  . LEU A 1 317 ? 74.227  84.989  54.507  1.00 15.99 ? 314  LEU A CB  1 
ATOM   2523  C  CG  . LEU A 1 317 ? 75.438  84.052  54.542  1.00 18.39 ? 314  LEU A CG  1 
ATOM   2524  C  CD1 . LEU A 1 317 ? 75.942  83.873  53.114  1.00 26.90 ? 314  LEU A CD1 1 
ATOM   2525  C  CD2 . LEU A 1 317 ? 76.517  84.607  55.436  1.00 26.17 ? 314  LEU A CD2 1 
ATOM   2526  N  N   . GLY A 1 318 ? 71.231  86.206  55.707  1.00 13.49 ? 315  GLY A N   1 
ATOM   2527  C  CA  . GLY A 1 318 ? 70.236  87.262  55.474  1.00 13.66 ? 315  GLY A CA  1 
ATOM   2528  C  C   . GLY A 1 318 ? 70.498  88.528  56.275  1.00 12.32 ? 315  GLY A C   1 
ATOM   2529  O  O   . GLY A 1 318 ? 70.403  89.638  55.747  1.00 13.87 ? 315  GLY A O   1 
ATOM   2530  N  N   . GLN A 1 319 ? 70.779  88.378  57.562  1.00 12.09 ? 316  GLN A N   1 
ATOM   2531  C  CA  . GLN A 1 319 ? 71.071  89.518  58.398  1.00 10.57 ? 316  GLN A CA  1 
ATOM   2532  C  C   . GLN A 1 319 ? 72.208  90.324  57.775  1.00 11.58 ? 316  GLN A C   1 
ATOM   2533  O  O   . GLN A 1 319 ? 72.121  91.546  57.622  1.00 11.37 ? 316  GLN A O   1 
ATOM   2534  C  CB  . GLN A 1 319 ? 71.472  89.063  59.806  1.00 10.93 ? 316  GLN A CB  1 
ATOM   2535  C  CG  . GLN A 1 319 ? 72.032  90.168  60.703  1.00 8.98  ? 316  GLN A CG  1 
ATOM   2536  C  CD  . GLN A 1 319 ? 71.038  91.259  61.028  1.00 15.46 ? 316  GLN A CD  1 
ATOM   2537  O  OE1 . GLN A 1 319 ? 69.901  90.980  61.387  1.00 14.71 ? 316  GLN A OE1 1 
ATOM   2538  N  NE2 . GLN A 1 319 ? 71.477  92.524  60.936  1.00 7.21  ? 316  GLN A NE2 1 
ATOM   2539  N  N   . TYR A 1 320 ? 73.272  89.624  57.408  1.00 11.63 ? 317  TYR A N   1 
ATOM   2540  C  CA  . TYR A 1 320 ? 74.442  90.276  56.833  1.00 12.97 ? 317  TYR A CA  1 
ATOM   2541  C  C   . TYR A 1 320 ? 74.133  90.988  55.487  1.00 12.27 ? 317  TYR A C   1 
ATOM   2542  O  O   . TYR A 1 320 ? 74.577  92.123  55.246  1.00 10.48 ? 317  TYR A O   1 
ATOM   2543  C  CB  . TYR A 1 320 ? 75.603  89.279  56.644  1.00 12.18 ? 317  TYR A CB  1 
ATOM   2544  C  CG  . TYR A 1 320 ? 76.904  90.001  56.350  1.00 11.19 ? 317  TYR A CG  1 
ATOM   2545  C  CD1 . TYR A 1 320 ? 77.845  90.196  57.349  1.00 11.24 ? 317  TYR A CD1 1 
ATOM   2546  C  CD2 . TYR A 1 320 ? 77.146  90.559  55.114  1.00 14.35 ? 317  TYR A CD2 1 
ATOM   2547  C  CE1 . TYR A 1 320 ? 79.000  90.905  57.111  1.00 10.28 ? 317  TYR A CE1 1 
ATOM   2548  C  CE2 . TYR A 1 320 ? 78.316  91.263  54.857  1.00 14.25 ? 317  TYR A CE2 1 
ATOM   2549  C  CZ  . TYR A 1 320 ? 79.227  91.435  55.866  1.00 14.20 ? 317  TYR A CZ  1 
ATOM   2550  O  OH  . TYR A 1 320 ? 80.364  92.148  55.646  1.00 15.63 ? 317  TYR A OH  1 
ATOM   2551  N  N   . VAL A 1 321 ? 73.408  90.327  54.599  1.00 10.52 ? 318  VAL A N   1 
ATOM   2552  C  CA  . VAL A 1 321 ? 73.118  90.945  53.316  1.00 10.23 ? 318  VAL A CA  1 
ATOM   2553  C  C   . VAL A 1 321 ? 72.316  92.214  53.530  1.00 9.96  ? 318  VAL A C   1 
ATOM   2554  O  O   . VAL A 1 321 ? 72.580  93.243  52.888  1.00 11.63 ? 318  VAL A O   1 
ATOM   2555  C  CB  . VAL A 1 321 ? 72.408  89.958  52.343  1.00 12.60 ? 318  VAL A CB  1 
ATOM   2556  C  CG1 . VAL A 1 321 ? 71.951  90.694  51.045  1.00 10.10 ? 318  VAL A CG1 1 
ATOM   2557  C  CG2 . VAL A 1 321 ? 73.357  88.765  52.024  1.00 12.85 ? 318  VAL A CG2 1 
ATOM   2558  N  N   . GLN A 1 322 ? 71.400  92.183  54.492  1.00 9.80  ? 319  GLN A N   1 
ATOM   2559  C  CA  . GLN A 1 322 ? 70.569  93.345  54.768  1.00 10.73 ? 319  GLN A CA  1 
ATOM   2560  C  C   . GLN A 1 322 ? 71.307  94.506  55.457  1.00 11.92 ? 319  GLN A C   1 
ATOM   2561  O  O   . GLN A 1 322 ? 71.122  95.656  55.047  1.00 11.82 ? 319  GLN A O   1 
ATOM   2562  C  CB  . GLN A 1 322 ? 69.349  92.964  55.628  1.00 11.06 ? 319  GLN A CB  1 
ATOM   2563  C  CG  . GLN A 1 322 ? 68.232  94.062  55.712  1.00 11.34 ? 319  GLN A CG  1 
ATOM   2564  C  CD  . GLN A 1 322 ? 67.542  94.270  54.385  1.00 11.61 ? 319  GLN A CD  1 
ATOM   2565  O  OE1 . GLN A 1 322 ? 67.141  93.307  53.726  1.00 12.91 ? 319  GLN A OE1 1 
ATOM   2566  N  NE2 . GLN A 1 322 ? 67.371  95.523  53.990  1.00 10.88 ? 319  GLN A NE2 1 
ATOM   2567  N  N   . GLU A 1 323 ? 72.171  94.203  56.444  1.00 12.61 ? 320  GLU A N   1 
ATOM   2568  C  CA  . GLU A 1 323 ? 72.783  95.247  57.279  1.00 13.27 ? 320  GLU A CA  1 
ATOM   2569  C  C   . GLU A 1 323 ? 74.284  95.207  57.609  1.00 12.56 ? 320  GLU A C   1 
ATOM   2570  O  O   . GLU A 1 323 ? 74.729  95.961  58.494  1.00 10.76 ? 320  GLU A O   1 
ATOM   2571  C  CB  . GLU A 1 323 ? 72.025  95.261  58.634  1.00 15.29 ? 320  GLU A CB  1 
ATOM   2572  C  CG  . GLU A 1 323 ? 70.526  95.543  58.508  1.00 17.10 ? 320  GLU A CG  1 
ATOM   2573  C  CD  . GLU A 1 323 ? 69.774  95.561  59.838  1.00 19.75 ? 320  GLU A CD  1 
ATOM   2574  O  OE1 . GLU A 1 323 ? 70.247  94.969  60.841  1.00 17.13 ? 320  GLU A OE1 1 
ATOM   2575  O  OE2 . GLU A 1 323 ? 68.678  96.165  59.867  1.00 24.35 ? 320  GLU A OE2 1 
ATOM   2576  N  N   . GLY A 1 324 ? 75.049  94.351  56.935  1.00 11.78 ? 321  GLY A N   1 
ATOM   2577  C  CA  . GLY A 1 324 ? 76.502  94.260  57.147  1.00 11.51 ? 321  GLY A CA  1 
ATOM   2578  C  C   . GLY A 1 324 ? 77.226  95.273  56.257  1.00 11.60 ? 321  GLY A C   1 
ATOM   2579  O  O   . GLY A 1 324 ? 76.628  96.266  55.834  1.00 10.35 ? 321  GLY A O   1 
ATOM   2580  N  N   A ARG A 1 325 ? 78.497  95.024  55.956  0.60 11.65 ? 322  ARG A N   1 
ATOM   2581  N  N   B ARG A 1 325 ? 78.512  95.051  55.975  0.40 11.80 ? 322  ARG A N   1 
ATOM   2582  C  CA  A ARG A 1 325 ? 79.248  95.931  55.094  0.60 11.87 ? 322  ARG A CA  1 
ATOM   2583  C  CA  B ARG A 1 325 ? 79.230  95.995  55.122  0.40 12.15 ? 322  ARG A CA  1 
ATOM   2584  C  C   A ARG A 1 325 ? 78.619  96.007  53.711  0.60 12.03 ? 322  ARG A C   1 
ATOM   2585  C  C   B ARG A 1 325 ? 78.566  96.033  53.758  0.40 12.15 ? 322  ARG A C   1 
ATOM   2586  O  O   A ARG A 1 325 ? 78.183  94.990  53.155  0.60 12.28 ? 322  ARG A O   1 
ATOM   2587  O  O   B ARG A 1 325 ? 78.073  95.014  53.259  0.40 12.41 ? 322  ARG A O   1 
ATOM   2588  C  CB  A ARG A 1 325 ? 80.718  95.505  55.012  0.60 11.31 ? 322  ARG A CB  1 
ATOM   2589  C  CB  B ARG A 1 325 ? 80.707  95.646  54.922  0.40 11.98 ? 322  ARG A CB  1 
ATOM   2590  C  CG  A ARG A 1 325 ? 81.482  95.856  56.264  0.60 13.64 ? 322  ARG A CG  1 
ATOM   2591  C  CG  B ARG A 1 325 ? 81.573  95.591  56.155  0.40 14.38 ? 322  ARG A CG  1 
ATOM   2592  C  CD  A ARG A 1 325 ? 81.817  97.358  56.308  0.60 13.08 ? 322  ARG A CD  1 
ATOM   2593  C  CD  B ARG A 1 325 ? 83.018  95.602  55.685  0.40 15.96 ? 322  ARG A CD  1 
ATOM   2594  N  NE  A ARG A 1 325 ? 82.830  97.653  55.294  0.60 14.90 ? 322  ARG A NE  1 
ATOM   2595  N  NE  B ARG A 1 325 ? 83.050  94.881  54.435  0.40 20.96 ? 322  ARG A NE  1 
ATOM   2596  C  CZ  A ARG A 1 325 ? 84.147  97.596  55.501  0.60 6.79  ? 322  ARG A CZ  1 
ATOM   2597  C  CZ  B ARG A 1 325 ? 83.165  93.565  54.331  0.40 19.72 ? 322  ARG A CZ  1 
ATOM   2598  N  NH1 A ARG A 1 325 ? 84.630  97.318  56.701  0.60 4.28  ? 322  ARG A NH1 1 
ATOM   2599  N  NH1 B ARG A 1 325 ? 83.362  92.829  55.415  0.40 17.01 ? 322  ARG A NH1 1 
ATOM   2600  N  NH2 A ARG A 1 325 ? 84.977  97.851  54.509  0.60 8.26  ? 322  ARG A NH2 1 
ATOM   2601  N  NH2 B ARG A 1 325 ? 83.134  93.007  53.134  0.40 16.32 ? 322  ARG A NH2 1 
ATOM   2602  N  N   . ARG A 1 326 ? 78.567  97.215  53.162  1.00 11.53 ? 323  ARG A N   1 
ATOM   2603  C  CA  . ARG A 1 326 ? 77.971  97.444  51.838  1.00 12.84 ? 323  ARG A CA  1 
ATOM   2604  C  C   . ARG A 1 326 ? 79.031  97.328  50.695  1.00 14.29 ? 323  ARG A C   1 
ATOM   2605  O  O   . ARG A 1 326 ? 79.310  98.288  49.972  1.00 13.57 ? 323  ARG A O   1 
ATOM   2606  C  CB  . ARG A 1 326 ? 77.321  98.827  51.818  1.00 12.59 ? 323  ARG A CB  1 
ATOM   2607  C  CG  . ARG A 1 326 ? 76.264  99.130  52.941  1.00 12.96 ? 323  ARG A CG  1 
ATOM   2608  C  CD  . ARG A 1 326 ? 75.052  98.199  52.919  1.00 12.13 ? 323  ARG A CD  1 
ATOM   2609  N  NE  . ARG A 1 326 ? 75.411  96.828  53.272  1.00 12.15 ? 323  ARG A NE  1 
ATOM   2610  C  CZ  . ARG A 1 326 ? 74.594  95.781  53.194  1.00 13.55 ? 323  ARG A CZ  1 
ATOM   2611  N  NH1 . ARG A 1 326 ? 73.338  95.917  52.782  1.00 14.87 ? 323  ARG A NH1 1 
ATOM   2612  N  NH2 . ARG A 1 326 ? 75.048  94.582  53.519  1.00 11.68 ? 323  ARG A NH2 1 
ATOM   2613  N  N   . ASP A 1 327 ? 79.618  96.141  50.565  1.00 15.94 ? 324  ASP A N   1 
ATOM   2614  C  CA  . ASP A 1 327 ? 80.618  95.852  49.559  1.00 15.86 ? 324  ASP A CA  1 
ATOM   2615  C  C   . ASP A 1 327 ? 80.095  94.714  48.661  1.00 16.39 ? 324  ASP A C   1 
ATOM   2616  O  O   . ASP A 1 327 ? 80.857  94.130  47.898  1.00 15.29 ? 324  ASP A O   1 
ATOM   2617  C  CB  . ASP A 1 327 ? 81.896  95.366  50.249  1.00 17.59 ? 324  ASP A CB  1 
ATOM   2618  C  CG  . ASP A 1 327 ? 82.518  96.412  51.179  1.00 21.46 ? 324  ASP A CG  1 
ATOM   2619  O  OD1 . ASP A 1 327 ? 82.275  97.626  51.000  1.00 22.47 ? 324  ASP A OD1 1 
ATOM   2620  O  OD2 . ASP A 1 327 ? 83.293  96.008  52.077  1.00 28.89 ? 324  ASP A OD2 1 
ATOM   2621  N  N   . LEU A 1 328 ? 78.789  94.436  48.735  1.00 15.12 ? 325  LEU A N   1 
ATOM   2622  C  CA  . LEU A 1 328 ? 78.184  93.307  48.026  1.00 15.51 ? 325  LEU A CA  1 
ATOM   2623  C  C   . LEU A 1 328 ? 77.214  93.686  46.955  1.00 13.51 ? 325  LEU A C   1 
ATOM   2624  O  O   . LEU A 1 328 ? 76.590  94.750  47.024  1.00 14.82 ? 325  LEU A O   1 
ATOM   2625  C  CB  . LEU A 1 328 ? 77.258  92.539  49.008  1.00 17.63 ? 325  LEU A CB  1 
ATOM   2626  C  CG  . LEU A 1 328 ? 77.683  92.202  50.419  1.00 22.73 ? 325  LEU A CG  1 
ATOM   2627  C  CD1 . LEU A 1 328 ? 76.473  91.761  51.259  1.00 25.35 ? 325  LEU A CD1 1 
ATOM   2628  C  CD2 . LEU A 1 328 ? 78.761  91.149  50.387  1.00 26.64 ? 325  LEU A CD2 1 
ATOM   2629  N  N   . PHE A 1 329 ? 77.092  92.814  45.964  1.00 12.08 ? 326  PHE A N   1 
ATOM   2630  C  CA  . PHE A 1 329 ? 76.001  92.906  44.987  1.00 11.95 ? 326  PHE A CA  1 
ATOM   2631  C  C   . PHE A 1 329 ? 75.529  91.463  44.744  1.00 11.73 ? 326  PHE A C   1 
ATOM   2632  O  O   . PHE A 1 329 ? 76.267  90.510  44.978  1.00 12.29 ? 326  PHE A O   1 
ATOM   2633  C  CB  . PHE A 1 329 ? 76.316  93.712  43.731  1.00 11.57 ? 326  PHE A CB  1 
ATOM   2634  C  CG  . PHE A 1 329 ? 77.215  93.034  42.725  1.00 11.80 ? 326  PHE A CG  1 
ATOM   2635  C  CD1 . PHE A 1 329 ? 76.680  92.376  41.635  1.00 14.89 ? 326  PHE A CD1 1 
ATOM   2636  C  CD2 . PHE A 1 329 ? 78.592  93.160  42.802  1.00 12.03 ? 326  PHE A CD2 1 
ATOM   2637  C  CE1 . PHE A 1 329 ? 77.513  91.801  40.672  1.00 12.57 ? 326  PHE A CE1 1 
ATOM   2638  C  CE2 . PHE A 1 329 ? 79.403  92.605  41.850  1.00 12.43 ? 326  PHE A CE2 1 
ATOM   2639  C  CZ  . PHE A 1 329 ? 78.861  91.936  40.779  1.00 14.49 ? 326  PHE A CZ  1 
ATOM   2640  N  N   . GLU A 1 330 ? 74.274  91.306  44.369  1.00 12.18 ? 327  GLU A N   1 
ATOM   2641  C  CA  . GLU A 1 330 ? 73.702  89.997  44.135  1.00 14.04 ? 327  GLU A CA  1 
ATOM   2642  C  C   . GLU A 1 330 ? 73.247  89.805  42.701  1.00 13.79 ? 327  GLU A C   1 
ATOM   2643  O  O   . GLU A 1 330 ? 72.693  90.731  42.071  1.00 13.17 ? 327  GLU A O   1 
ATOM   2644  C  CB  . GLU A 1 330 ? 72.493  89.765  45.063  1.00 13.73 ? 327  GLU A CB  1 
ATOM   2645  C  CG  . GLU A 1 330 ? 72.833  89.574  46.555  1.00 16.52 ? 327  GLU A CG  1 
ATOM   2646  C  CD  . GLU A 1 330 ? 71.601  89.499  47.458  1.00 21.01 ? 327  GLU A CD  1 
ATOM   2647  O  OE1 . GLU A 1 330 ? 70.848  90.499  47.554  1.00 17.90 ? 327  GLU A OE1 1 
ATOM   2648  O  OE2 . GLU A 1 330 ? 71.427  88.456  48.141  1.00 26.03 ? 327  GLU A OE2 1 
ATOM   2649  N  N   . THR A 1 331 ? 73.463  88.586  42.207  1.00 12.63 ? 328  THR A N   1 
ATOM   2650  C  CA  . THR A 1 331 ? 73.023  88.182  40.875  1.00 13.26 ? 328  THR A CA  1 
ATOM   2651  C  C   . THR A 1 331 ? 72.158  86.973  41.130  1.00 12.77 ? 328  THR A C   1 
ATOM   2652  O  O   . THR A 1 331 ? 72.646  85.914  41.573  1.00 13.18 ? 328  THR A O   1 
ATOM   2653  C  CB  . THR A 1 331 ? 74.180  87.853  39.934  1.00 12.48 ? 328  THR A CB  1 
ATOM   2654  O  OG1 . THR A 1 331 ? 74.987  89.031  39.757  1.00 13.92 ? 328  THR A OG1 1 
ATOM   2655  C  CG2 . THR A 1 331 ? 73.643  87.374  38.564  1.00 13.55 ? 328  THR A CG2 1 
ATOM   2656  N  N   . VAL A 1 332 ? 70.869  87.132  40.878  1.00 13.69 ? 329  VAL A N   1 
ATOM   2657  C  CA  . VAL A 1 332 ? 69.902  86.085  41.170  1.00 13.30 ? 329  VAL A CA  1 
ATOM   2658  C  C   . VAL A 1 332 ? 69.499  85.233  39.965  1.00 14.40 ? 329  VAL A C   1 
ATOM   2659  O  O   . VAL A 1 332 ? 69.060  85.755  38.941  1.00 14.32 ? 329  VAL A O   1 
ATOM   2660  C  CB  . VAL A 1 332 ? 68.616  86.685  41.811  1.00 14.38 ? 329  VAL A CB  1 
ATOM   2661  C  CG1 . VAL A 1 332 ? 67.618  85.565  42.179  1.00 14.53 ? 329  VAL A CG1 1 
ATOM   2662  C  CG2 . VAL A 1 332 ? 68.948  87.521  43.035  1.00 14.86 ? 329  VAL A CG2 1 
ATOM   2663  N  N   . LEU A 1 333 ? 69.711  83.914  40.069  1.00 14.64 ? 330  LEU A N   1 
ATOM   2664  C  CA  . LEU A 1 333 ? 69.275  82.997  39.031  1.00 14.94 ? 330  LEU A CA  1 
ATOM   2665  C  C   . LEU A 1 333 ? 67.817  82.721  39.361  1.00 14.67 ? 330  LEU A C   1 
ATOM   2666  O  O   . LEU A 1 333 ? 67.528  82.150  40.413  1.00 16.47 ? 330  LEU A O   1 
ATOM   2667  C  CB  . LEU A 1 333 ? 70.064  81.687  39.066  1.00 14.68 ? 330  LEU A CB  1 
ATOM   2668  C  CG  . LEU A 1 333 ? 71.587  81.794  38.887  1.00 18.74 ? 330  LEU A CG  1 
ATOM   2669  C  CD1 . LEU A 1 333 ? 72.228  80.430  39.020  1.00 16.15 ? 330  LEU A CD1 1 
ATOM   2670  C  CD2 . LEU A 1 333 ? 71.933  82.443  37.517  1.00 16.51 ? 330  LEU A CD2 1 
ATOM   2671  N  N   . LYS A 1 334 ? 66.903  83.151  38.496  1.00 14.65 ? 331  LYS A N   1 
ATOM   2672  C  CA  . LYS A 1 334 ? 65.469  82.973  38.734  1.00 14.38 ? 331  LYS A CA  1 
ATOM   2673  C  C   . LYS A 1 334 ? 64.893  82.031  37.680  1.00 15.18 ? 331  LYS A C   1 
ATOM   2674  O  O   . LYS A 1 334 ? 64.939  82.332  36.471  1.00 15.09 ? 331  LYS A O   1 
ATOM   2675  C  CB  . LYS A 1 334 ? 64.770  84.346  38.709  1.00 15.30 ? 331  LYS A CB  1 
ATOM   2676  C  CG  . LYS A 1 334 ? 63.235  84.311  38.910  1.00 14.97 ? 331  LYS A CG  1 
ATOM   2677  C  CD  . LYS A 1 334 ? 62.860  83.700  40.245  1.00 18.42 ? 331  LYS A CD  1 
ATOM   2678  C  CE  . LYS A 1 334 ? 61.344  83.647  40.465  1.00 20.11 ? 331  LYS A CE  1 
ATOM   2679  N  NZ  . LYS A 1 334 ? 60.676  82.888  39.403  1.00 22.67 ? 331  LYS A NZ  1 
ATOM   2680  N  N   . VAL A 1 335 ? 64.377  80.887  38.129  1.00 14.26 ? 332  VAL A N   1 
ATOM   2681  C  CA  . VAL A 1 335 ? 63.812  79.899  37.226  1.00 14.72 ? 332  VAL A CA  1 
ATOM   2682  C  C   . VAL A 1 335 ? 62.347  80.220  37.006  1.00 15.66 ? 332  VAL A C   1 
ATOM   2683  O  O   . VAL A 1 335 ? 61.598  80.405  37.960  1.00 15.33 ? 332  VAL A O   1 
ATOM   2684  C  CB  . VAL A 1 335 ? 63.936  78.478  37.767  1.00 15.52 ? 332  VAL A CB  1 
ATOM   2685  C  CG1 . VAL A 1 335 ? 63.444  77.461  36.704  1.00 13.67 ? 332  VAL A CG1 1 
ATOM   2686  C  CG2 . VAL A 1 335 ? 65.372  78.188  38.181  1.00 11.72 ? 332  VAL A CG2 1 
ATOM   2687  N  N   . GLY A 1 336 ? 61.950  80.285  35.745  1.00 16.77 ? 333  GLY A N   1 
ATOM   2688  C  CA  . GLY A 1 336 ? 60.587  80.639  35.381  1.00 18.48 ? 333  GLY A CA  1 
ATOM   2689  C  C   . GLY A 1 336 ? 59.539  79.604  35.719  1.00 20.00 ? 333  GLY A C   1 
ATOM   2690  O  O   . GLY A 1 336 ? 58.497  79.953  36.225  1.00 19.97 ? 333  GLY A O   1 
ATOM   2691  N  N   . LYS A 1 337 ? 59.824  78.335  35.442  1.00 21.79 ? 334  LYS A N   1 
ATOM   2692  C  CA  . LYS A 1 337 ? 58.886  77.246  35.692  1.00 23.20 ? 334  LYS A CA  1 
ATOM   2693  C  C   . LYS A 1 337 ? 59.457  76.164  36.629  1.00 23.92 ? 334  LYS A C   1 
ATOM   2694  O  O   . LYS A 1 337 ? 60.537  75.599  36.371  1.00 24.72 ? 334  LYS A O   1 
ATOM   2695  C  CB  . LYS A 1 337 ? 58.506  76.600  34.347  1.00 24.12 ? 334  LYS A CB  1 
ATOM   2696  C  CG  . LYS A 1 337 ? 57.512  75.419  34.448  1.00 27.12 ? 334  LYS A CG  1 
ATOM   2697  C  CD  . LYS A 1 337 ? 56.122  75.869  34.903  1.00 33.09 ? 334  LYS A CD  1 
ATOM   2698  C  CE  . LYS A 1 337 ? 55.133  74.683  35.131  1.00 34.15 ? 334  LYS A CE  1 
ATOM   2699  N  NZ  . LYS A 1 337 ? 55.494  73.857  36.333  1.00 29.22 ? 334  LYS A NZ  1 
ATOM   2700  N  N   . SER A 1 338 ? 58.727  75.851  37.696  1.00 22.30 ? 335  SER A N   1 
ATOM   2701  C  CA  . SER A 1 338 ? 59.171  74.809  38.629  1.00 22.73 ? 335  SER A CA  1 
ATOM   2702  C  C   . SER A 1 338 ? 58.935  73.457  37.991  1.00 20.93 ? 335  SER A C   1 
ATOM   2703  O  O   . SER A 1 338 ? 57.919  73.256  37.346  1.00 20.90 ? 335  SER A O   1 
ATOM   2704  C  CB  . SER A 1 338 ? 58.414  74.885  39.955  1.00 22.42 ? 335  SER A CB  1 
ATOM   2705  O  OG  . SER A 1 338 ? 58.685  73.744  40.753  1.00 26.31 ? 335  SER A OG  1 
ATOM   2706  N  N   . THR A 1 339 ? 59.861  72.527  38.185  1.00 19.69 ? 336  THR A N   1 
ATOM   2707  C  CA  . THR A 1 339 ? 59.722  71.191  37.578  1.00 20.33 ? 336  THR A CA  1 
ATOM   2708  C  C   . THR A 1 339 ? 58.482  70.484  38.093  1.00 19.25 ? 336  THR A C   1 
ATOM   2709  O  O   . THR A 1 339 ? 57.762  69.841  37.329  1.00 19.48 ? 336  THR A O   1 
ATOM   2710  C  CB  . THR A 1 339 ? 60.968  70.320  37.827  1.00 19.94 ? 336  THR A CB  1 
ATOM   2711  O  OG1 . THR A 1 339 ? 62.114  70.978  37.268  1.00 20.51 ? 336  THR A OG1 1 
ATOM   2712  C  CG2 . THR A 1 339 ? 60.786  68.935  37.190  1.00 22.16 ? 336  THR A CG2 1 
ATOM   2713  N  N   . HIS A 1 340 ? 58.232  70.602  39.397  1.00 19.90 ? 337  HIS A N   1 
ATOM   2714  C  CA  . HIS A 1 340 ? 57.047  70.004  40.007  1.00 18.77 ? 337  HIS A CA  1 
ATOM   2715  C  C   . HIS A 1 340 ? 56.247  71.084  40.722  1.00 19.63 ? 337  HIS A C   1 
ATOM   2716  O  O   . HIS A 1 340 ? 56.824  72.081  41.181  1.00 19.67 ? 337  HIS A O   1 
ATOM   2717  C  CB  . HIS A 1 340 ? 57.440  68.912  40.996  1.00 19.22 ? 337  HIS A CB  1 
ATOM   2718  C  CG  . HIS A 1 340 ? 58.221  67.792  40.380  1.00 19.19 ? 337  HIS A CG  1 
ATOM   2719  N  ND1 . HIS A 1 340 ? 57.671  66.921  39.467  1.00 23.34 ? 337  HIS A ND1 1 
ATOM   2720  C  CD2 . HIS A 1 340 ? 59.491  67.372  40.581  1.00 17.48 ? 337  HIS A CD2 1 
ATOM   2721  C  CE1 . HIS A 1 340 ? 58.577  66.026  39.112  1.00 24.21 ? 337  HIS A CE1 1 
ATOM   2722  N  NE2 . HIS A 1 340 ? 59.691  66.279  39.775  1.00 20.86 ? 337  HIS A NE2 1 
ATOM   2723  N  N   . GLU A 1 341 ? 54.925  70.906  40.779  1.00 17.21 ? 338  GLU A N   1 
ATOM   2724  C  CA  . GLU A 1 341 ? 54.049  71.852  41.456  1.00 17.67 ? 338  GLU A CA  1 
ATOM   2725  C  C   . GLU A 1 341 ? 53.352  71.173  42.641  1.00 16.07 ? 338  GLU A C   1 
ATOM   2726  O  O   . GLU A 1 341 ? 53.041  69.981  42.601  1.00 14.70 ? 338  GLU A O   1 
ATOM   2727  C  CB  . GLU A 1 341 ? 52.976  72.413  40.498  1.00 18.54 ? 338  GLU A CB  1 
ATOM   2728  C  CG  . GLU A 1 341 ? 53.509  73.219  39.281  1.00 22.07 ? 338  GLU A CG  1 
ATOM   2729  C  CD  . GLU A 1 341 ? 54.165  74.578  39.625  1.00 25.44 ? 338  GLU A CD  1 
ATOM   2730  O  OE1 . GLU A 1 341 ? 54.087  75.045  40.789  1.00 20.97 ? 338  GLU A OE1 1 
ATOM   2731  O  OE2 . GLU A 1 341 ? 54.742  75.190  38.692  1.00 28.08 ? 338  GLU A OE2 1 
ATOM   2732  N  N   . LEU A 1 342 ? 53.135  71.936  43.708  1.00 15.28 ? 339  LEU A N   1 
ATOM   2733  C  CA  . LEU A 1 342 ? 52.401  71.461  44.884  1.00 14.12 ? 339  LEU A CA  1 
ATOM   2734  C  C   . LEU A 1 342 ? 51.448  72.579  45.291  1.00 13.79 ? 339  LEU A C   1 
ATOM   2735  O  O   . LEU A 1 342 ? 51.856  73.729  45.426  1.00 11.56 ? 339  LEU A O   1 
ATOM   2736  C  CB  . LEU A 1 342 ? 53.323  71.135  46.063  1.00 14.72 ? 339  LEU A CB  1 
ATOM   2737  C  CG  . LEU A 1 342 ? 54.298  69.970  45.936  1.00 15.63 ? 339  LEU A CG  1 
ATOM   2738  C  CD1 . LEU A 1 342 ? 55.218  69.924  47.174  1.00 17.86 ? 339  LEU A CD1 1 
ATOM   2739  C  CD2 . LEU A 1 342 ? 53.545  68.662  45.754  1.00 18.07 ? 339  LEU A CD2 1 
ATOM   2740  N  N   . THR A 1 343 ? 50.188  72.240  45.488  1.00 12.42 ? 340  THR A N   1 
ATOM   2741  C  CA  . THR A 1 343 ? 49.190  73.228  45.872  1.00 14.69 ? 340  THR A CA  1 
ATOM   2742  C  C   . THR A 1 343 ? 48.969  73.146  47.366  1.00 14.44 ? 340  THR A C   1 
ATOM   2743  O  O   . THR A 1 343 ? 48.895  72.064  47.919  1.00 13.88 ? 340  THR A O   1 
ATOM   2744  C  CB  . THR A 1 343 ? 47.876  72.997  45.104  1.00 15.84 ? 340  THR A CB  1 
ATOM   2745  O  OG1 . THR A 1 343 ? 48.138  73.118  43.700  1.00 17.69 ? 340  THR A OG1 1 
ATOM   2746  C  CG2 . THR A 1 343 ? 46.796  74.018  45.511  1.00 16.76 ? 340  THR A CG2 1 
ATOM   2747  N  N   . ILE A 1 344 ? 48.895  74.300  48.021  1.00 14.44 ? 341  ILE A N   1 
ATOM   2748  C  CA  . ILE A 1 344 ? 48.697  74.363  49.461  1.00 13.91 ? 341  ILE A CA  1 
ATOM   2749  C  C   . ILE A 1 344 ? 47.227  74.076  49.801  1.00 15.18 ? 341  ILE A C   1 
ATOM   2750  O  O   . ILE A 1 344 ? 46.308  74.619  49.175  1.00 14.22 ? 341  ILE A O   1 
ATOM   2751  C  CB  . ILE A 1 344 ? 49.134  75.736  50.018  1.00 14.57 ? 341  ILE A CB  1 
ATOM   2752  C  CG1 . ILE A 1 344 ? 50.609  76.005  49.674  1.00 15.00 ? 341  ILE A CG1 1 
ATOM   2753  C  CG2 . ILE A 1 344 ? 48.901  75.795  51.526  1.00 15.46 ? 341  ILE A CG2 1 
ATOM   2754  C  CD1 . ILE A 1 344 ? 51.059  77.402  49.971  1.00 13.00 ? 341  ILE A CD1 1 
ATOM   2755  N  N   . GLU A 1 345 ? 47.003  73.195  50.766  1.00 14.97 ? 342  GLU A N   1 
ATOM   2756  C  CA  . GLU A 1 345 ? 45.643  72.837  51.153  1.00 16.90 ? 342  GLU A CA  1 
ATOM   2757  C  C   . GLU A 1 345 ? 45.296  73.468  52.485  1.00 16.85 ? 342  GLU A C   1 
ATOM   2758  O  O   . GLU A 1 345 ? 46.183  73.718  53.301  1.00 17.28 ? 342  GLU A O   1 
ATOM   2759  C  CB  . GLU A 1 345 ? 45.496  71.312  51.246  1.00 17.58 ? 342  GLU A CB  1 
ATOM   2760  C  CG  . GLU A 1 345 ? 45.878  70.578  49.990  1.00 20.00 ? 342  GLU A CG  1 
ATOM   2761  C  CD  . GLU A 1 345 ? 45.563  69.097  50.071  1.00 26.68 ? 342  GLU A CD  1 
ATOM   2762  O  OE1 . GLU A 1 345 ? 44.444  68.731  50.522  1.00 32.01 ? 342  GLU A OE1 1 
ATOM   2763  O  OE2 . GLU A 1 345 ? 46.426  68.305  49.658  1.00 30.56 ? 342  GLU A OE2 1 
ATOM   2764  N  N   . SER A 1 346 ? 44.018  73.747  52.708  1.00 17.47 ? 343  SER A N   1 
ATOM   2765  C  CA  . SER A 1 346 ? 43.610  74.367  53.961  1.00 19.08 ? 343  SER A CA  1 
ATOM   2766  C  C   . SER A 1 346 ? 43.522  73.338  55.092  1.00 19.46 ? 343  SER A C   1 
ATOM   2767  O  O   . SER A 1 346 ? 43.473  72.130  54.851  1.00 19.08 ? 343  SER A O   1 
ATOM   2768  C  CB  . SER A 1 346 ? 42.264  75.085  53.820  1.00 19.40 ? 343  SER A CB  1 
ATOM   2769  O  OG  . SER A 1 346 ? 41.248  74.168  53.496  1.00 20.88 ? 343  SER A OG  1 
ATOM   2770  N  N   . GLU A 1 347 ? 43.560  73.849  56.317  1.00 20.80 ? 344  GLU A N   1 
ATOM   2771  C  CA  . GLU A 1 347 ? 43.443  73.061  57.548  1.00 21.92 ? 344  GLU A CA  1 
ATOM   2772  C  C   . GLU A 1 347 ? 42.293  73.685  58.342  1.00 21.08 ? 344  GLU A C   1 
ATOM   2773  O  O   . GLU A 1 347 ? 42.222  74.904  58.446  1.00 20.26 ? 344  GLU A O   1 
ATOM   2774  C  CB  . GLU A 1 347 ? 44.715  73.187  58.381  1.00 22.12 ? 344  GLU A CB  1 
ATOM   2775  C  CG  . GLU A 1 347 ? 45.982  72.661  57.743  1.00 27.67 ? 344  GLU A CG  1 
ATOM   2776  C  CD  . GLU A 1 347 ? 46.077  71.157  57.741  1.00 33.17 ? 344  GLU A CD  1 
ATOM   2777  O  OE1 . GLU A 1 347 ? 47.128  70.634  57.304  1.00 37.93 ? 344  GLU A OE1 1 
ATOM   2778  O  OE2 . GLU A 1 347 ? 45.124  70.493  58.195  1.00 39.94 ? 344  GLU A OE2 1 
ATOM   2779  N  N   A GLU A 1 348 ? 41.438  72.836  58.909  0.70 21.01 ? 345  GLU A N   1 
ATOM   2780  N  N   B GLU A 1 348 ? 41.393  72.872  58.891  0.30 21.31 ? 345  GLU A N   1 
ATOM   2781  C  CA  A GLU A 1 348 ? 40.291  73.267  59.709  0.70 21.94 ? 345  GLU A CA  1 
ATOM   2782  C  CA  B GLU A 1 348 ? 40.256  73.409  59.660  0.30 21.84 ? 345  GLU A CA  1 
ATOM   2783  C  C   A GLU A 1 348 ? 40.636  74.285  60.792  0.70 21.89 ? 345  GLU A C   1 
ATOM   2784  C  C   B GLU A 1 348 ? 40.635  74.331  60.816  0.30 22.12 ? 345  GLU A C   1 
ATOM   2785  O  O   A GLU A 1 348 ? 40.083  75.378  60.841  0.70 21.28 ? 345  GLU A O   1 
ATOM   2786  O  O   B GLU A 1 348 ? 40.105  75.435  60.926  0.30 21.85 ? 345  GLU A O   1 
ATOM   2787  C  CB  A GLU A 1 348 ? 39.676  72.053  60.427  0.70 22.21 ? 345  GLU A CB  1 
ATOM   2788  C  CB  B GLU A 1 348 ? 39.352  72.282  60.175  0.30 21.91 ? 345  GLU A CB  1 
ATOM   2789  C  CG  A GLU A 1 348 ? 38.830  71.109  59.599  0.70 23.57 ? 345  GLU A CG  1 
ATOM   2790  C  CG  B GLU A 1 348 ? 38.296  71.844  59.186  0.30 22.37 ? 345  GLU A CG  1 
ATOM   2791  C  CD  A GLU A 1 348 ? 38.501  69.817  60.363  0.70 25.90 ? 345  GLU A CD  1 
ATOM   2792  C  CD  B GLU A 1 348 ? 37.217  72.902  58.995  0.30 22.67 ? 345  GLU A CD  1 
ATOM   2793  O  OE1 A GLU A 1 348 ? 39.447  69.042  60.634  0.70 24.31 ? 345  GLU A OE1 1 
ATOM   2794  O  OE1 B GLU A 1 348 ? 36.568  72.910  57.930  0.30 23.94 ? 345  GLU A OE1 1 
ATOM   2795  O  OE2 A GLU A 1 348 ? 37.308  69.563  60.664  0.70 26.46 ? 345  GLU A OE2 1 
ATOM   2796  O  OE2 B GLU A 1 348 ? 37.029  73.732  59.909  0.30 22.57 ? 345  GLU A OE2 1 
ATOM   2797  N  N   . ASN A 1 349 ? 41.535  73.882  61.684  1.00 22.78 ? 346  ASN A N   1 
ATOM   2798  C  CA  . ASN A 1 349 ? 41.943  74.700  62.827  1.00 23.88 ? 346  ASN A CA  1 
ATOM   2799  C  C   . ASN A 1 349 ? 42.813  75.920  62.471  1.00 24.28 ? 346  ASN A C   1 
ATOM   2800  O  O   . ASN A 1 349 ? 42.811  76.914  63.199  1.00 25.47 ? 346  ASN A O   1 
ATOM   2801  C  CB  . ASN A 1 349 ? 42.620  73.806  63.902  1.00 24.19 ? 346  ASN A CB  1 
ATOM   2802  C  CG  . ASN A 1 349 ? 41.670  72.708  64.464  1.00 24.69 ? 346  ASN A CG  1 
ATOM   2803  O  OD1 . ASN A 1 349 ? 40.449  72.891  64.530  1.00 20.60 ? 346  ASN A OD1 1 
ATOM   2804  N  ND2 . ASN A 1 349 ? 42.248  71.581  64.896  1.00 21.46 ? 346  ASN A ND2 1 
ATOM   2805  N  N   . ASP A 1 350 ? 43.514  75.863  61.341  1.00 23.84 ? 347  ASP A N   1 
ATOM   2806  C  CA  . ASP A 1 350 ? 44.396  76.957  60.891  1.00 23.53 ? 347  ASP A CA  1 
ATOM   2807  C  C   . ASP A 1 350 ? 45.272  77.538  62.012  1.00 22.14 ? 347  ASP A C   1 
ATOM   2808  O  O   . ASP A 1 350 ? 45.550  78.745  62.037  1.00 19.05 ? 347  ASP A O   1 
ATOM   2809  C  CB  . ASP A 1 350 ? 43.605  78.112  60.246  1.00 24.55 ? 347  ASP A CB  1 
ATOM   2810  C  CG  . ASP A 1 350 ? 44.510  79.079  59.464  1.00 24.92 ? 347  ASP A CG  1 
ATOM   2811  O  OD1 . ASP A 1 350 ? 45.505  78.615  58.870  1.00 23.94 ? 347  ASP A OD1 1 
ATOM   2812  O  OD2 . ASP A 1 350 ? 44.221  80.294  59.411  1.00 31.64 ? 347  ASP A OD2 1 
ATOM   2813  N  N   . LEU A 1 351 ? 45.731  76.680  62.917  1.00 21.52 ? 348  LEU A N   1 
ATOM   2814  C  CA  . LEU A 1 351 ? 46.587  77.138  64.019  1.00 22.31 ? 348  LEU A CA  1 
ATOM   2815  C  C   . LEU A 1 351 ? 47.924  77.733  63.541  1.00 22.04 ? 348  LEU A C   1 
ATOM   2816  O  O   . LEU A 1 351 ? 48.477  78.599  64.204  1.00 24.20 ? 348  LEU A O   1 
ATOM   2817  C  CB  . LEU A 1 351 ? 46.803  75.999  65.024  1.00 21.41 ? 348  LEU A CB  1 
ATOM   2818  C  CG  . LEU A 1 351 ? 45.484  75.624  65.699  1.00 23.40 ? 348  LEU A CG  1 
ATOM   2819  C  CD1 . LEU A 1 351 ? 45.569  74.353  66.549  1.00 22.56 ? 348  LEU A CD1 1 
ATOM   2820  C  CD2 . LEU A 1 351 ? 44.987  76.823  66.530  1.00 23.12 ? 348  LEU A CD2 1 
ATOM   2821  N  N   . ASP A 1 352 ? 48.421  77.305  62.380  1.00 22.59 ? 349  ASP A N   1 
ATOM   2822  C  CA  . ASP A 1 352 ? 49.699  77.839  61.840  1.00 23.45 ? 349  ASP A CA  1 
ATOM   2823  C  C   . ASP A 1 352 ? 49.495  79.130  61.018  1.00 22.97 ? 349  ASP A C   1 
ATOM   2824  O  O   . ASP A 1 352 ? 50.450  79.761  60.577  1.00 22.79 ? 349  ASP A O   1 
ATOM   2825  C  CB  . ASP A 1 352 ? 50.430  76.774  61.015  1.00 23.60 ? 349  ASP A CB  1 
ATOM   2826  C  CG  . ASP A 1 352 ? 49.587  76.246  59.851  1.00 25.97 ? 349  ASP A CG  1 
ATOM   2827  O  OD1 . ASP A 1 352 ? 48.646  76.956  59.429  1.00 29.12 ? 349  ASP A OD1 1 
ATOM   2828  O  OD2 . ASP A 1 352 ? 49.870  75.125  59.360  1.00 25.88 ? 349  ASP A OD2 1 
ATOM   2829  N  N   . GLY A 1 353 ? 48.240  79.516  60.804  1.00 21.95 ? 350  GLY A N   1 
ATOM   2830  C  CA  . GLY A 1 353 ? 47.936  80.753  60.062  1.00 20.50 ? 350  GLY A CA  1 
ATOM   2831  C  C   . GLY A 1 353 ? 48.302  80.744  58.586  1.00 19.03 ? 350  GLY A C   1 
ATOM   2832  O  O   . GLY A 1 353 ? 48.592  81.784  58.015  1.00 19.27 ? 350  GLY A O   1 
ATOM   2833  N  N   . LEU A 1 354 ? 48.289  79.575  57.962  1.00 17.37 ? 351  LEU A N   1 
ATOM   2834  C  CA  . LEU A 1 354 ? 48.633  79.486  56.551  1.00 16.86 ? 351  LEU A CA  1 
ATOM   2835  C  C   . LEU A 1 354 ? 47.420  79.365  55.625  1.00 15.88 ? 351  LEU A C   1 
ATOM   2836  O  O   . LEU A 1 354 ? 47.586  79.363  54.402  1.00 14.45 ? 351  LEU A O   1 
ATOM   2837  C  CB  . LEU A 1 354 ? 49.606  78.321  56.309  1.00 16.69 ? 351  LEU A CB  1 
ATOM   2838  C  CG  . LEU A 1 354 ? 51.008  78.481  56.909  1.00 16.23 ? 351  LEU A CG  1 
ATOM   2839  C  CD1 . LEU A 1 354 ? 51.864  77.258  56.605  1.00 16.98 ? 351  LEU A CD1 1 
ATOM   2840  C  CD2 . LEU A 1 354 ? 51.683  79.727  56.359  1.00 18.86 ? 351  LEU A CD2 1 
ATOM   2841  N  N   . ASN A 1 355 ? 46.212  79.246  56.182  1.00 15.23 ? 352  ASN A N   1 
ATOM   2842  C  CA  . ASN A 1 355 ? 45.006  79.124  55.338  1.00 14.74 ? 352  ASN A CA  1 
ATOM   2843  C  C   . ASN A 1 355 ? 44.804  80.236  54.321  1.00 13.87 ? 352  ASN A C   1 
ATOM   2844  O  O   . ASN A 1 355 ? 44.134  80.010  53.308  1.00 14.26 ? 352  ASN A O   1 
ATOM   2845  C  CB  . ASN A 1 355 ? 43.719  78.971  56.157  1.00 14.58 ? 352  ASN A CB  1 
ATOM   2846  C  CG  . ASN A 1 355 ? 43.477  77.548  56.624  1.00 16.25 ? 352  ASN A CG  1 
ATOM   2847  O  OD1 . ASN A 1 355 ? 44.238  76.635  56.295  1.00 15.47 ? 352  ASN A OD1 1 
ATOM   2848  N  ND2 . ASN A 1 355 ? 42.380  77.345  57.369  1.00 13.41 ? 352  ASN A ND2 1 
ATOM   2849  N  N   . TYR A 1 356 ? 45.379  81.417  54.556  1.00 13.78 ? 353  TYR A N   1 
ATOM   2850  C  CA  . TYR A 1 356 ? 45.204  82.528  53.609  1.00 14.08 ? 353  TYR A CA  1 
ATOM   2851  C  C   . TYR A 1 356 ? 45.874  82.231  52.260  1.00 14.18 ? 353  TYR A C   1 
ATOM   2852  O  O   . TYR A 1 356 ? 45.614  82.915  51.275  1.00 14.85 ? 353  TYR A O   1 
ATOM   2853  C  CB  . TYR A 1 356 ? 45.707  83.849  54.188  1.00 13.93 ? 353  TYR A CB  1 
ATOM   2854  C  CG  . TYR A 1 356 ? 47.201  84.063  54.184  1.00 14.12 ? 353  TYR A CG  1 
ATOM   2855  C  CD1 . TYR A 1 356 ? 48.009  83.485  55.140  1.00 14.68 ? 353  TYR A CD1 1 
ATOM   2856  C  CD2 . TYR A 1 356 ? 47.797  84.903  53.246  1.00 15.12 ? 353  TYR A CD2 1 
ATOM   2857  C  CE1 . TYR A 1 356 ? 49.362  83.703  55.149  1.00 15.91 ? 353  TYR A CE1 1 
ATOM   2858  C  CE2 . TYR A 1 356 ? 49.147  85.124  53.244  1.00 16.27 ? 353  TYR A CE2 1 
ATOM   2859  C  CZ  . TYR A 1 356 ? 49.935  84.535  54.205  1.00 15.23 ? 353  TYR A CZ  1 
ATOM   2860  O  OH  . TYR A 1 356 ? 51.308  84.750  54.221  1.00 17.18 ? 353  TYR A OH  1 
ATOM   2861  N  N   . LEU A 1 357 ? 46.724  81.201  52.232  1.00 14.60 ? 354  LEU A N   1 
ATOM   2862  C  CA  . LEU A 1 357 ? 47.431  80.771  51.024  1.00 14.41 ? 354  LEU A CA  1 
ATOM   2863  C  C   . LEU A 1 357 ? 46.858  79.503  50.368  1.00 15.18 ? 354  LEU A C   1 
ATOM   2864  O  O   . LEU A 1 357 ? 47.395  79.033  49.358  1.00 15.11 ? 354  LEU A O   1 
ATOM   2865  C  CB  . LEU A 1 357 ? 48.892  80.489  51.376  1.00 15.55 ? 354  LEU A CB  1 
ATOM   2866  C  CG  . LEU A 1 357 ? 49.729  81.690  51.837  1.00 14.68 ? 354  LEU A CG  1 
ATOM   2867  C  CD1 . LEU A 1 357 ? 51.015  81.197  52.459  1.00 12.65 ? 354  LEU A CD1 1 
ATOM   2868  C  CD2 . LEU A 1 357 ? 49.971  82.652  50.649  1.00 12.01 ? 354  LEU A CD2 1 
ATOM   2869  N  N   . ALA A 1 358 ? 45.781  78.952  50.926  1.00 14.88 ? 355  ALA A N   1 
ATOM   2870  C  CA  . ALA A 1 358 ? 45.169  77.732  50.381  1.00 13.78 ? 355  ALA A CA  1 
ATOM   2871  C  C   . ALA A 1 358 ? 44.787  77.930  48.929  1.00 13.66 ? 355  ALA A C   1 
ATOM   2872  O  O   . ALA A 1 358 ? 44.177  78.919  48.571  1.00 12.22 ? 355  ALA A O   1 
ATOM   2873  C  CB  . ALA A 1 358 ? 43.938  77.331  51.209  1.00 14.06 ? 355  ALA A CB  1 
ATOM   2874  N  N   . GLY A 1 359 ? 45.163  76.988  48.076  1.00 13.84 ? 356  GLY A N   1 
ATOM   2875  C  CA  . GLY A 1 359 ? 44.846  77.108  46.661  1.00 13.99 ? 356  GLY A CA  1 
ATOM   2876  C  C   . GLY A 1 359 ? 46.021  77.637  45.866  1.00 14.96 ? 356  GLY A C   1 
ATOM   2877  O  O   . GLY A 1 359 ? 46.089  77.434  44.661  1.00 15.25 ? 356  GLY A O   1 
ATOM   2878  N  N   . GLU A 1 360 ? 46.936  78.349  46.523  1.00 13.82 ? 357  GLU A N   1 
ATOM   2879  C  CA  . GLU A 1 360 ? 48.142  78.808  45.843  1.00 13.94 ? 357  GLU A CA  1 
ATOM   2880  C  C   . GLU A 1 360 ? 49.154  77.673  45.890  1.00 12.86 ? 357  GLU A C   1 
ATOM   2881  O  O   . GLU A 1 360 ? 49.013  76.730  46.680  1.00 12.50 ? 357  GLU A O   1 
ATOM   2882  C  CB  . GLU A 1 360 ? 48.713  80.050  46.510  1.00 15.06 ? 357  GLU A CB  1 
ATOM   2883  C  CG  . GLU A 1 360 ? 47.768  81.228  46.486  1.00 18.65 ? 357  GLU A CG  1 
ATOM   2884  C  CD  . GLU A 1 360 ? 47.354  81.624  45.068  1.00 23.78 ? 357  GLU A CD  1 
ATOM   2885  O  OE1 . GLU A 1 360 ? 48.171  81.483  44.118  1.00 22.69 ? 357  GLU A OE1 1 
ATOM   2886  O  OE2 . GLU A 1 360 ? 46.201  82.083  44.909  1.00 30.40 ? 357  GLU A OE2 1 
ATOM   2887  N  N   . THR A 1 361 ? 50.174  77.753  45.049  1.00 12.23 ? 358  THR A N   1 
ATOM   2888  C  CA  . THR A 1 361 ? 51.181  76.709  44.988  1.00 12.09 ? 358  THR A CA  1 
ATOM   2889  C  C   . THR A 1 361 ? 52.387  77.056  45.863  1.00 11.98 ? 358  THR A C   1 
ATOM   2890  O  O   . THR A 1 361 ? 52.596  78.207  46.238  1.00 11.76 ? 358  THR A O   1 
ATOM   2891  C  CB  . THR A 1 361 ? 51.703  76.519  43.539  1.00 12.39 ? 358  THR A CB  1 
ATOM   2892  O  OG1 . THR A 1 361 ? 52.332  77.734  43.092  1.00 11.06 ? 358  THR A OG1 1 
ATOM   2893  C  CG2 . THR A 1 361 ? 50.558  76.113  42.557  1.00 11.41 ? 358  THR A CG2 1 
ATOM   2894  N  N   . VAL A 1 362 ? 53.188  76.055  46.181  1.00 11.58 ? 359  VAL A N   1 
ATOM   2895  C  CA  . VAL A 1 362 ? 54.414  76.305  46.918  1.00 11.50 ? 359  VAL A CA  1 
ATOM   2896  C  C   . VAL A 1 362 ? 55.352  77.229  46.081  1.00 12.53 ? 359  VAL A C   1 
ATOM   2897  O  O   . VAL A 1 362 ? 55.977  78.174  46.618  1.00 10.07 ? 359  VAL A O   1 
ATOM   2898  C  CB  . VAL A 1 362 ? 55.075  74.990  47.281  1.00 12.79 ? 359  VAL A CB  1 
ATOM   2899  C  CG1 . VAL A 1 362 ? 56.565  75.182  47.749  1.00 9.99  ? 359  VAL A CG1 1 
ATOM   2900  C  CG2 . VAL A 1 362 ? 54.208  74.270  48.335  1.00 13.09 ? 359  VAL A CG2 1 
ATOM   2901  N  N   . ASP A 1 363 ? 55.388  77.028  44.764  1.00 11.46 ? 360  ASP A N   1 
ATOM   2902  C  CA  . ASP A 1 363 ? 56.248  77.859  43.953  1.00 13.22 ? 360  ASP A CA  1 
ATOM   2903  C  C   . ASP A 1 363 ? 55.782  79.329  43.930  1.00 12.21 ? 360  ASP A C   1 
ATOM   2904  O  O   . ASP A 1 363 ? 56.599  80.238  43.741  1.00 12.97 ? 360  ASP A O   1 
ATOM   2905  C  CB  . ASP A 1 363 ? 56.417  77.321  42.547  1.00 15.47 ? 360  ASP A CB  1 
ATOM   2906  C  CG  . ASP A 1 363 ? 57.521  78.047  41.789  1.00 17.45 ? 360  ASP A CG  1 
ATOM   2907  O  OD1 . ASP A 1 363 ? 58.688  78.058  42.267  1.00 21.99 ? 360  ASP A OD1 1 
ATOM   2908  O  OD2 . ASP A 1 363 ? 57.209  78.593  40.718  1.00 23.95 ? 360  ASP A OD2 1 
ATOM   2909  N  N   . PHE A 1 364 ? 54.484  79.565  44.129  1.00 12.71 ? 361  PHE A N   1 
ATOM   2910  C  CA  . PHE A 1 364 ? 53.959  80.936  44.238  1.00 11.81 ? 361  PHE A CA  1 
ATOM   2911  C  C   . PHE A 1 364 ? 54.624  81.603  45.435  1.00 12.33 ? 361  PHE A C   1 
ATOM   2912  O  O   . PHE A 1 364 ? 55.065  82.750  45.350  1.00 11.43 ? 361  PHE A O   1 
ATOM   2913  C  CB  . PHE A 1 364 ? 52.430  80.933  44.404  1.00 13.41 ? 361  PHE A CB  1 
ATOM   2914  C  CG  . PHE A 1 364 ? 51.839  82.252  44.894  1.00 10.66 ? 361  PHE A CG  1 
ATOM   2915  C  CD1 . PHE A 1 364 ? 51.522  83.268  44.007  1.00 16.83 ? 361  PHE A CD1 1 
ATOM   2916  C  CD2 . PHE A 1 364 ? 51.534  82.433  46.233  1.00 14.77 ? 361  PHE A CD2 1 
ATOM   2917  C  CE1 . PHE A 1 364 ? 50.953  84.462  44.452  1.00 15.37 ? 361  PHE A CE1 1 
ATOM   2918  C  CE2 . PHE A 1 364 ? 50.962  83.629  46.688  1.00 15.78 ? 361  PHE A CE2 1 
ATOM   2919  C  CZ  . PHE A 1 364 ? 50.680  84.644  45.781  1.00 15.44 ? 361  PHE A CZ  1 
ATOM   2920  N  N   . VAL A 1 365 ? 54.723  80.865  46.541  1.00 12.36 ? 362  VAL A N   1 
ATOM   2921  C  CA  . VAL A 1 365 ? 55.333  81.387  47.764  1.00 12.64 ? 362  VAL A CA  1 
ATOM   2922  C  C   . VAL A 1 365 ? 56.824  81.656  47.550  1.00 12.86 ? 362  VAL A C   1 
ATOM   2923  O  O   . VAL A 1 365 ? 57.361  82.695  47.962  1.00 12.06 ? 362  VAL A O   1 
ATOM   2924  C  CB  . VAL A 1 365 ? 55.102  80.425  48.974  1.00 13.07 ? 362  VAL A CB  1 
ATOM   2925  C  CG1 . VAL A 1 365 ? 55.774  80.978  50.241  1.00 13.92 ? 362  VAL A CG1 1 
ATOM   2926  C  CG2 . VAL A 1 365 ? 53.596  80.182  49.197  1.00 14.02 ? 362  VAL A CG2 1 
ATOM   2927  N  N   . ASN A 1 366 ? 57.488  80.739  46.863  1.00 13.18 ? 363  ASN A N   1 
ATOM   2928  C  CA  . ASN A 1 366 ? 58.904  80.883  46.583  1.00 11.83 ? 363  ASN A CA  1 
ATOM   2929  C  C   . ASN A 1 366 ? 59.153  82.161  45.741  1.00 12.86 ? 363  ASN A C   1 
ATOM   2930  O  O   . ASN A 1 366 ? 60.133  82.876  45.939  1.00 11.00 ? 363  ASN A O   1 
ATOM   2931  C  CB  . ASN A 1 366 ? 59.414  79.645  45.865  1.00 11.55 ? 363  ASN A CB  1 
ATOM   2932  C  CG  . ASN A 1 366 ? 60.916  79.470  45.999  1.00 16.68 ? 363  ASN A CG  1 
ATOM   2933  O  OD1 . ASN A 1 366 ? 61.521  79.897  47.000  1.00 13.22 ? 363  ASN A OD1 1 
ATOM   2934  N  ND2 . ASN A 1 366 ? 61.523  78.798  45.025  1.00 9.90  ? 363  ASN A ND2 1 
ATOM   2935  N  N   . THR A 1 367 ? 58.249  82.432  44.809  1.00 12.92 ? 364  THR A N   1 
ATOM   2936  C  CA  . THR A 1 367 ? 58.323  83.601  43.955  1.00 12.78 ? 364  THR A CA  1 
ATOM   2937  C  C   . THR A 1 367 ? 58.128  84.903  44.719  1.00 12.07 ? 364  THR A C   1 
ATOM   2938  O  O   . THR A 1 367 ? 58.870  85.864  44.495  1.00 12.33 ? 364  THR A O   1 
ATOM   2939  C  CB  . THR A 1 367 ? 57.320  83.476  42.786  1.00 15.13 ? 364  THR A CB  1 
ATOM   2940  O  OG1 . THR A 1 367 ? 57.687  82.332  42.028  1.00 11.77 ? 364  THR A OG1 1 
ATOM   2941  C  CG2 . THR A 1 367 ? 57.355  84.719  41.860  1.00 13.63 ? 364  THR A CG2 1 
ATOM   2942  N  N   . LYS A 1 368 ? 57.179  84.941  45.651  1.00 12.25 ? 365  LYS A N   1 
ATOM   2943  C  CA  . LYS A 1 368 ? 56.953  86.150  46.437  1.00 11.36 ? 365  LYS A CA  1 
ATOM   2944  C  C   . LYS A 1 368 ? 58.127  86.399  47.398  1.00 11.79 ? 365  LYS A C   1 
ATOM   2945  O  O   . LYS A 1 368 ? 58.446  87.532  47.732  1.00 10.82 ? 365  LYS A O   1 
ATOM   2946  C  CB  . LYS A 1 368 ? 55.600  86.090  47.173  1.00 11.15 ? 365  LYS A CB  1 
ATOM   2947  C  CG  . LYS A 1 368 ? 54.404  85.887  46.219  1.00 12.34 ? 365  LYS A CG  1 
ATOM   2948  C  CD  . LYS A 1 368 ? 54.431  86.924  45.117  1.00 16.15 ? 365  LYS A CD  1 
ATOM   2949  C  CE  . LYS A 1 368 ? 53.901  86.380  43.828  1.00 21.13 ? 365  LYS A CE  1 
ATOM   2950  N  NZ  . LYS A 1 368 ? 54.256  87.230  42.667  1.00 17.14 ? 365  LYS A NZ  1 
ATOM   2951  N  N   . ALA A 1 369 ? 58.773  85.327  47.829  1.00 11.59 ? 366  ALA A N   1 
ATOM   2952  C  CA  . ALA A 1 369 ? 59.925  85.436  48.684  1.00 11.27 ? 366  ALA A CA  1 
ATOM   2953  C  C   . ALA A 1 369 ? 61.041  86.108  47.897  1.00 11.89 ? 366  ALA A C   1 
ATOM   2954  O  O   . ALA A 1 369 ? 61.714  86.993  48.396  1.00 12.96 ? 366  ALA A O   1 
ATOM   2955  C  CB  . ALA A 1 369 ? 60.381  84.029  49.155  1.00 12.28 ? 366  ALA A CB  1 
ATOM   2956  N  N   . TYR A 1 370 ? 61.241  85.650  46.661  1.00 12.39 ? 367  TYR A N   1 
ATOM   2957  C  CA  . TYR A 1 370 ? 62.267  86.192  45.785  1.00 12.20 ? 367  TYR A CA  1 
ATOM   2958  C  C   . TYR A 1 370 ? 62.048  87.687  45.552  1.00 12.14 ? 367  TYR A C   1 
ATOM   2959  O  O   . TYR A 1 370 ? 62.961  88.502  45.744  1.00 11.24 ? 367  TYR A O   1 
ATOM   2960  C  CB  . TYR A 1 370 ? 62.307  85.388  44.469  1.00 12.13 ? 367  TYR A CB  1 
ATOM   2961  C  CG  . TYR A 1 370 ? 62.700  86.176  43.244  1.00 10.29 ? 367  TYR A CG  1 
ATOM   2962  C  CD1 . TYR A 1 370 ? 61.748  86.510  42.278  1.00 14.71 ? 367  TYR A CD1 1 
ATOM   2963  C  CD2 . TYR A 1 370 ? 63.991  86.613  43.059  1.00 13.65 ? 367  TYR A CD2 1 
ATOM   2964  C  CE1 . TYR A 1 370 ? 62.101  87.235  41.160  1.00 16.70 ? 367  TYR A CE1 1 
ATOM   2965  C  CE2 . TYR A 1 370 ? 64.349  87.338  41.955  1.00 13.82 ? 367  TYR A CE2 1 
ATOM   2966  C  CZ  . TYR A 1 370 ? 63.405  87.644  41.005  1.00 19.10 ? 367  TYR A CZ  1 
ATOM   2967  O  OH  . TYR A 1 370 ? 63.785  88.375  39.905  1.00 19.37 ? 367  TYR A OH  1 
ATOM   2968  N  N   . GLU A 1 371 ? 60.822  88.041  45.190  1.00 12.33 ? 368  GLU A N   1 
ATOM   2969  C  CA  . GLU A 1 371 ? 60.472  89.428  44.917  1.00 11.78 ? 368  GLU A CA  1 
ATOM   2970  C  C   . GLU A 1 371 ? 60.608  90.312  46.140  1.00 11.80 ? 368  GLU A C   1 
ATOM   2971  O  O   . GLU A 1 371 ? 61.179  91.393  46.062  1.00 12.76 ? 368  GLU A O   1 
ATOM   2972  C  CB  . GLU A 1 371 ? 59.050  89.499  44.350  1.00 12.40 ? 368  GLU A CB  1 
ATOM   2973  C  CG  . GLU A 1 371 ? 58.915  88.854  42.970  1.00 14.48 ? 368  GLU A CG  1 
ATOM   2974  C  CD  . GLU A 1 371 ? 57.450  88.720  42.513  1.00 18.89 ? 368  GLU A CD  1 
ATOM   2975  O  OE1 . GLU A 1 371 ? 56.537  88.691  43.372  1.00 18.78 ? 368  GLU A OE1 1 
ATOM   2976  O  OE2 . GLU A 1 371 ? 57.216  88.593  41.298  1.00 20.39 ? 368  GLU A OE2 1 
ATOM   2977  N  N   . GLY A 1 372 ? 60.106  89.841  47.275  1.00 12.27 ? 369  GLY A N   1 
ATOM   2978  C  CA  . GLY A 1 372 ? 60.158  90.610  48.514  1.00 12.66 ? 369  GLY A CA  1 
ATOM   2979  C  C   . GLY A 1 372 ? 61.587  90.809  48.987  1.00 12.75 ? 369  GLY A C   1 
ATOM   2980  O  O   . GLY A 1 372 ? 61.939  91.872  49.488  1.00 11.37 ? 369  GLY A O   1 
ATOM   2981  N  N   . THR A 1 373 ? 62.403  89.776  48.814  1.00 11.79 ? 370  THR A N   1 
ATOM   2982  C  CA  . THR A 1 373 ? 63.804  89.816  49.217  1.00 11.98 ? 370  THR A CA  1 
ATOM   2983  C  C   . THR A 1 373 ? 64.620  90.737  48.312  1.00 12.78 ? 370  THR A C   1 
ATOM   2984  O  O   . THR A 1 373 ? 65.450  91.509  48.792  1.00 12.61 ? 370  THR A O   1 
ATOM   2985  C  CB  . THR A 1 373 ? 64.363  88.395  49.247  1.00 11.94 ? 370  THR A CB  1 
ATOM   2986  O  OG1 . THR A 1 373 ? 63.601  87.644  50.204  1.00 10.80 ? 370  THR A OG1 1 
ATOM   2987  C  CG2 . THR A 1 373 ? 65.830  88.376  49.644  1.00 13.45 ? 370  THR A CG2 1 
ATOM   2988  N  N   . LEU A 1 374 ? 64.347  90.713  47.005  1.00 12.95 ? 371  LEU A N   1 
ATOM   2989  C  CA  . LEU A 1 374 ? 65.080  91.555  46.081  1.00 13.62 ? 371  LEU A CA  1 
ATOM   2990  C  C   . LEU A 1 374 ? 64.866  93.035  46.384  1.00 14.12 ? 371  LEU A C   1 
ATOM   2991  O  O   . LEU A 1 374 ? 65.823  93.839  46.383  1.00 14.11 ? 371  LEU A O   1 
ATOM   2992  C  CB  . LEU A 1 374 ? 64.693  91.215  44.656  1.00 15.77 ? 371  LEU A CB  1 
ATOM   2993  C  CG  . LEU A 1 374 ? 65.355  91.972  43.506  1.00 18.96 ? 371  LEU A CG  1 
ATOM   2994  C  CD1 . LEU A 1 374 ? 65.461  91.064  42.284  1.00 20.77 ? 371  LEU A CD1 1 
ATOM   2995  C  CD2 . LEU A 1 374 ? 64.611  93.290  43.197  1.00 18.41 ? 371  LEU A CD2 1 
ATOM   2996  N  N   . LEU A 1 375 ? 63.636  93.390  46.719  1.00 13.10 ? 372  LEU A N   1 
ATOM   2997  C  CA  . LEU A 1 375 ? 63.331  94.777  47.027  1.00 14.00 ? 372  LEU A CA  1 
ATOM   2998  C  C   . LEU A 1 375 ? 63.903  95.156  48.393  1.00 13.57 ? 372  LEU A C   1 
ATOM   2999  O  O   . LEU A 1 375 ? 64.414  96.258  48.547  1.00 11.35 ? 372  LEU A O   1 
ATOM   3000  C  CB  . LEU A 1 375 ? 61.830  95.038  46.947  1.00 14.29 ? 372  LEU A CB  1 
ATOM   3001  C  CG  . LEU A 1 375 ? 61.262  94.805  45.529  1.00 15.65 ? 372  LEU A CG  1 
ATOM   3002  C  CD1 . LEU A 1 375 ? 59.721  94.814  45.535  1.00 13.97 ? 372  LEU A CD1 1 
ATOM   3003  C  CD2 . LEU A 1 375 ? 61.838  95.810  44.521  1.00 13.40 ? 372  LEU A CD2 1 
ATOM   3004  N  N   . ALA A 1 376 ? 63.796  94.256  49.378  1.00 12.24 ? 373  ALA A N   1 
ATOM   3005  C  CA  . ALA A 1 376 ? 64.362  94.511  50.712  1.00 11.78 ? 373  ALA A CA  1 
ATOM   3006  C  C   . ALA A 1 376 ? 65.866  94.741  50.613  1.00 11.91 ? 373  ALA A C   1 
ATOM   3007  O  O   . ALA A 1 376 ? 66.393  95.716  51.155  1.00 11.69 ? 373  ALA A O   1 
ATOM   3008  C  CB  . ALA A 1 376 ? 64.084  93.337  51.656  1.00 10.87 ? 373  ALA A CB  1 
ATOM   3009  N  N   . HIS A 1 377 ? 66.561  93.841  49.922  1.00 11.97 ? 374  HIS A N   1 
ATOM   3010  C  CA  . HIS A 1 377 ? 68.018  93.973  49.764  1.00 11.88 ? 374  HIS A CA  1 
ATOM   3011  C  C   . HIS A 1 377 ? 68.417  95.245  49.010  1.00 12.73 ? 374  HIS A C   1 
ATOM   3012  O  O   . HIS A 1 377 ? 69.384  95.939  49.383  1.00 11.46 ? 374  HIS A O   1 
ATOM   3013  C  CB  . HIS A 1 377 ? 68.650  92.745  49.119  1.00 11.72 ? 374  HIS A CB  1 
ATOM   3014  C  CG  . HIS A 1 377 ? 68.614  91.523  49.980  1.00 8.25  ? 374  HIS A CG  1 
ATOM   3015  N  ND1 . HIS A 1 377 ? 68.856  90.265  49.489  1.00 12.32 ? 374  HIS A ND1 1 
ATOM   3016  C  CD2 . HIS A 1 377 ? 68.288  91.360  51.285  1.00 9.89  ? 374  HIS A CD2 1 
ATOM   3017  C  CE1 . HIS A 1 377 ? 68.765  89.382  50.470  1.00 11.82 ? 374  HIS A CE1 1 
ATOM   3018  N  NE2 . HIS A 1 377 ? 68.406  90.020  51.569  1.00 11.37 ? 374  HIS A NE2 1 
ATOM   3019  N  N   . SER A 1 378 ? 67.672  95.563  47.963  1.00 14.22 ? 375  SER A N   1 
ATOM   3020  C  CA  . SER A 1 378 ? 67.910  96.790  47.215  1.00 14.58 ? 375  SER A CA  1 
ATOM   3021  C  C   . SER A 1 378 ? 67.814  97.990  48.145  1.00 15.50 ? 375  SER A C   1 
ATOM   3022  O  O   . SER A 1 378 ? 68.679  98.873  48.119  1.00 15.05 ? 375  SER A O   1 
ATOM   3023  C  CB  . SER A 1 378 ? 66.883  96.941  46.090  1.00 14.48 ? 375  SER A CB  1 
ATOM   3024  O  OG  . SER A 1 378 ? 66.993  95.873  45.170  1.00 16.38 ? 375  SER A OG  1 
ATOM   3025  N  N   . ASP A 1 379 ? 66.751  98.033  48.950  1.00 15.72 ? 376  ASP A N   1 
ATOM   3026  C  CA  . ASP A 1 379 ? 66.545  99.145  49.890  1.00 15.70 ? 376  ASP A CA  1 
ATOM   3027  C  C   . ASP A 1 379 ? 67.623  99.230  50.969  1.00 15.52 ? 376  ASP A C   1 
ATOM   3028  O  O   . ASP A 1 379 ? 67.839  100.289 51.525  1.00 13.62 ? 376  ASP A O   1 
ATOM   3029  C  CB  . ASP A 1 379 ? 65.152  99.076  50.515  1.00 16.13 ? 376  ASP A CB  1 
ATOM   3030  C  CG  . ASP A 1 379 ? 64.039  99.387  49.508  1.00 19.12 ? 376  ASP A CG  1 
ATOM   3031  O  OD1 . ASP A 1 379 ? 64.324  99.915  48.422  1.00 18.29 ? 376  ASP A OD1 1 
ATOM   3032  O  OD2 . ASP A 1 379 ? 62.867  99.117  49.802  1.00 20.74 ? 376  ASP A OD2 1 
ATOM   3033  N  N   . GLY A 1 380 ? 68.277  98.104  51.266  1.00 14.60 ? 377  GLY A N   1 
ATOM   3034  C  CA  . GLY A 1 380 ? 69.360  98.045  52.242  1.00 14.07 ? 377  GLY A CA  1 
ATOM   3035  C  C   . GLY A 1 380 ? 70.737  98.347  51.635  1.00 14.80 ? 377  GLY A C   1 
ATOM   3036  O  O   . GLY A 1 380 ? 71.752  98.259  52.324  1.00 14.88 ? 377  GLY A O   1 
ATOM   3037  N  N   . GLY A 1 381 ? 70.769  98.692  50.350  1.00 13.56 ? 378  GLY A N   1 
ATOM   3038  C  CA  . GLY A 1 381 ? 72.007  99.072  49.675  1.00 14.34 ? 378  GLY A CA  1 
ATOM   3039  C  C   . GLY A 1 381 ? 72.702  98.016  48.838  1.00 13.67 ? 378  GLY A C   1 
ATOM   3040  O  O   . GLY A 1 381 ? 73.869  98.189  48.472  1.00 14.74 ? 378  GLY A O   1 
ATOM   3041  N  N   . VAL A 1 382 ? 72.000  96.937  48.496  1.00 13.71 ? 379  VAL A N   1 
ATOM   3042  C  CA  . VAL A 1 382 ? 72.606  95.859  47.693  1.00 13.35 ? 379  VAL A CA  1 
ATOM   3043  C  C   . VAL A 1 382 ? 72.047  95.836  46.273  1.00 13.03 ? 379  VAL A C   1 
ATOM   3044  O  O   . VAL A 1 382 ? 70.869  95.501  46.088  1.00 13.25 ? 379  VAL A O   1 
ATOM   3045  C  CB  . VAL A 1 382 ? 72.352  94.467  48.355  1.00 13.08 ? 379  VAL A CB  1 
ATOM   3046  C  CG1 . VAL A 1 382 ? 73.014  93.333  47.568  1.00 13.97 ? 379  VAL A CG1 1 
ATOM   3047  C  CG2 . VAL A 1 382 ? 72.835  94.472  49.801  1.00 13.46 ? 379  VAL A CG2 1 
ATOM   3048  N  N   . PRO A 1 383 ? 72.884  96.168  45.255  1.00 13.08 ? 380  PRO A N   1 
ATOM   3049  C  CA  . PRO A 1 383 ? 72.395  96.104  43.896  1.00 12.48 ? 380  PRO A CA  1 
ATOM   3050  C  C   . PRO A 1 383 ? 72.042  94.670  43.535  1.00 13.56 ? 380  PRO A C   1 
ATOM   3051  O  O   . PRO A 1 383 ? 72.822  93.744  43.826  1.00 10.81 ? 380  PRO A O   1 
ATOM   3052  C  CB  . PRO A 1 383 ? 73.594  96.565  43.058  1.00 13.58 ? 380  PRO A CB  1 
ATOM   3053  C  CG  . PRO A 1 383 ? 74.385  97.406  43.951  1.00 13.47 ? 380  PRO A CG  1 
ATOM   3054  C  CD  . PRO A 1 383 ? 74.233  96.764  45.313  1.00 14.22 ? 380  PRO A CD  1 
ATOM   3055  N  N   . ASN A 1 384 ? 70.860  94.488  42.949  1.00 12.11 ? 381  ASN A N   1 
ATOM   3056  C  CA  . ASN A 1 384 ? 70.402  93.173  42.509  1.00 14.14 ? 381  ASN A CA  1 
ATOM   3057  C  C   . ASN A 1 384 ? 70.225  93.081  40.986  1.00 13.31 ? 381  ASN A C   1 
ATOM   3058  O  O   . ASN A 1 384 ? 69.499  93.870  40.385  1.00 13.95 ? 381  ASN A O   1 
ATOM   3059  C  CB  . ASN A 1 384 ? 69.078  92.755  43.178  1.00 14.40 ? 381  ASN A CB  1 
ATOM   3060  C  CG  . ASN A 1 384 ? 69.275  92.137  44.560  1.00 17.23 ? 381  ASN A CG  1 
ATOM   3061  O  OD1 . ASN A 1 384 ? 68.943  90.968  44.760  1.00 20.12 ? 381  ASN A OD1 1 
ATOM   3062  N  ND2 . ASN A 1 384 ? 69.836  92.901  45.505  1.00 16.96 ? 381  ASN A ND2 1 
ATOM   3063  N  N   . LEU A 1 385 ? 70.879  92.086  40.409  1.00 13.11 ? 382  LEU A N   1 
ATOM   3064  C  CA  . LEU A 1 385 ? 70.824  91.776  39.003  1.00 13.02 ? 382  LEU A CA  1 
ATOM   3065  C  C   . LEU A 1 385 ? 70.065  90.441  38.871  1.00 14.05 ? 382  LEU A C   1 
ATOM   3066  O  O   . LEU A 1 385 ? 70.132  89.599  39.766  1.00 14.12 ? 382  LEU A O   1 
ATOM   3067  C  CB  . LEU A 1 385 ? 72.238  91.602  38.469  1.00 12.23 ? 382  LEU A CB  1 
ATOM   3068  C  CG  . LEU A 1 385 ? 73.228  92.708  38.814  1.00 13.84 ? 382  LEU A CG  1 
ATOM   3069  C  CD1 . LEU A 1 385 ? 74.588  92.362  38.201  1.00 12.18 ? 382  LEU A CD1 1 
ATOM   3070  C  CD2 . LEU A 1 385 ? 72.729  94.094  38.359  1.00 12.08 ? 382  LEU A CD2 1 
ATOM   3071  N  N   . ILE A 1 386 ? 69.348  90.252  37.772  1.00 14.13 ? 383  ILE A N   1 
ATOM   3072  C  CA  . ILE A 1 386 ? 68.578  89.020  37.564  1.00 14.49 ? 383  ILE A CA  1 
ATOM   3073  C  C   . ILE A 1 386 ? 68.976  88.327  36.257  1.00 15.31 ? 383  ILE A C   1 
ATOM   3074  O  O   . ILE A 1 386 ? 69.122  88.971  35.217  1.00 16.20 ? 383  ILE A O   1 
ATOM   3075  C  CB  . ILE A 1 386 ? 67.089  89.322  37.475  1.00 14.97 ? 383  ILE A CB  1 
ATOM   3076  C  CG1 . ILE A 1 386 ? 66.644  90.154  38.686  1.00 14.82 ? 383  ILE A CG1 1 
ATOM   3077  C  CG2 . ILE A 1 386 ? 66.263  88.014  37.366  1.00 16.49 ? 383  ILE A CG2 1 
ATOM   3078  C  CD1 . ILE A 1 386 ? 65.257  90.695  38.546  1.00 18.41 ? 383  ILE A CD1 1 
ATOM   3079  N  N   . VAL A 1 387 ? 69.169  87.015  36.341  1.00 15.19 ? 384  VAL A N   1 
ATOM   3080  C  CA  . VAL A 1 387 ? 69.453  86.170  35.194  1.00 15.40 ? 384  VAL A CA  1 
ATOM   3081  C  C   . VAL A 1 387 ? 68.257  85.230  35.127  1.00 16.34 ? 384  VAL A C   1 
ATOM   3082  O  O   . VAL A 1 387 ? 68.137  84.289  35.914  1.00 16.41 ? 384  VAL A O   1 
ATOM   3083  C  CB  . VAL A 1 387 ? 70.782  85.374  35.321  1.00 15.60 ? 384  VAL A CB  1 
ATOM   3084  C  CG1 . VAL A 1 387 ? 70.877  84.278  34.255  1.00 14.39 ? 384  VAL A CG1 1 
ATOM   3085  C  CG2 . VAL A 1 387 ? 71.992  86.322  35.249  1.00 14.18 ? 384  VAL A CG2 1 
ATOM   3086  N  N   . ASN A 1 388 ? 67.356  85.517  34.195  1.00 17.18 ? 385  ASN A N   1 
ATOM   3087  C  CA  . ASN A 1 388 ? 66.141  84.730  34.017  1.00 17.58 ? 385  ASN A CA  1 
ATOM   3088  C  C   . ASN A 1 388 ? 66.341  83.441  33.209  1.00 18.20 ? 385  ASN A C   1 
ATOM   3089  O  O   . ASN A 1 388 ? 66.727  83.474  32.029  1.00 18.38 ? 385  ASN A O   1 
ATOM   3090  C  CB  . ASN A 1 388 ? 65.077  85.612  33.369  1.00 18.28 ? 385  ASN A CB  1 
ATOM   3091  C  CG  . ASN A 1 388 ? 64.493  86.620  34.334  1.00 19.11 ? 385  ASN A CG  1 
ATOM   3092  O  OD1 . ASN A 1 388 ? 63.876  86.247  35.334  1.00 19.64 ? 385  ASN A OD1 1 
ATOM   3093  N  ND2 . ASN A 1 388 ? 64.620  87.902  34.007  1.00 19.21 ? 385  ASN A ND2 1 
ATOM   3094  N  N   . ILE A 1 389 ? 66.059  82.318  33.864  1.00 17.55 ? 386  ILE A N   1 
ATOM   3095  C  CA  . ILE A 1 389 ? 66.177  80.973  33.308  1.00 17.29 ? 386  ILE A CA  1 
ATOM   3096  C  C   . ILE A 1 389 ? 64.744  80.437  33.124  1.00 17.83 ? 386  ILE A C   1 
ATOM   3097  O  O   . ILE A 1 389 ? 64.024  80.234  34.108  1.00 18.74 ? 386  ILE A O   1 
ATOM   3098  C  CB  . ILE A 1 389 ? 66.946  80.051  34.309  1.00 17.25 ? 386  ILE A CB  1 
ATOM   3099  C  CG1 . ILE A 1 389 ? 68.342  80.621  34.607  1.00 20.13 ? 386  ILE A CG1 1 
ATOM   3100  C  CG2 . ILE A 1 389 ? 67.047  78.635  33.800  1.00 17.14 ? 386  ILE A CG2 1 
ATOM   3101  C  CD1 . ILE A 1 389 ? 69.054  79.908  35.718  1.00 20.26 ? 386  ILE A CD1 1 
ATOM   3102  N  N   . PRO A 1 390 ? 64.323  80.187  31.877  1.00 17.47 ? 387  PRO A N   1 
ATOM   3103  C  CA  . PRO A 1 390 ? 62.927  79.745  31.662  1.00 18.34 ? 387  PRO A CA  1 
ATOM   3104  C  C   . PRO A 1 390 ? 62.538  78.440  32.366  1.00 17.49 ? 387  PRO A C   1 
ATOM   3105  O  O   . PRO A 1 390 ? 61.500  78.381  33.024  1.00 17.31 ? 387  PRO A O   1 
ATOM   3106  C  CB  . PRO A 1 390 ? 62.826  79.605  30.142  1.00 19.60 ? 387  PRO A CB  1 
ATOM   3107  C  CG  . PRO A 1 390 ? 63.914  80.468  29.598  1.00 19.98 ? 387  PRO A CG  1 
ATOM   3108  C  CD  . PRO A 1 390 ? 65.025  80.469  30.618  1.00 18.39 ? 387  PRO A CD  1 
ATOM   3109  N  N   . GLU A 1 391 ? 63.361  77.416  32.232  1.00 18.39 ? 388  GLU A N   1 
ATOM   3110  C  CA  . GLU A 1 391 ? 63.110  76.137  32.881  1.00 19.76 ? 388  GLU A CA  1 
ATOM   3111  C  C   . GLU A 1 391 ? 64.395  75.343  32.985  1.00 18.86 ? 388  GLU A C   1 
ATOM   3112  O  O   . GLU A 1 391 ? 65.404  75.681  32.354  1.00 16.60 ? 388  GLU A O   1 
ATOM   3113  C  CB  . GLU A 1 391 ? 62.045  75.319  32.137  1.00 21.96 ? 388  GLU A CB  1 
ATOM   3114  C  CG  . GLU A 1 391 ? 62.359  75.009  30.697  1.00 27.93 ? 388  GLU A CG  1 
ATOM   3115  C  CD  . GLU A 1 391 ? 61.292  74.113  30.042  1.00 37.61 ? 388  GLU A CD  1 
ATOM   3116  O  OE1 . GLU A 1 391 ? 60.439  73.547  30.776  1.00 41.35 ? 388  GLU A OE1 1 
ATOM   3117  O  OE2 . GLU A 1 391 ? 61.319  73.966  28.792  1.00 42.52 ? 388  GLU A OE2 1 
ATOM   3118  N  N   . LEU A 1 392 ? 64.359  74.286  33.792  1.00 17.63 ? 389  LEU A N   1 
ATOM   3119  C  CA  . LEU A 1 392 ? 65.535  73.445  33.995  1.00 18.49 ? 389  LEU A CA  1 
ATOM   3120  C  C   . LEU A 1 392 ? 65.544  72.236  33.063  1.00 16.93 ? 389  LEU A C   1 
ATOM   3121  O  O   . LEU A 1 392 ? 64.916  71.238  33.344  1.00 17.36 ? 389  LEU A O   1 
ATOM   3122  C  CB  . LEU A 1 392 ? 65.619  72.999  35.457  1.00 18.70 ? 389  LEU A CB  1 
ATOM   3123  C  CG  . LEU A 1 392 ? 65.805  74.151  36.441  1.00 20.28 ? 389  LEU A CG  1 
ATOM   3124  C  CD1 . LEU A 1 392 ? 65.968  73.624  37.866  1.00 22.87 ? 389  LEU A CD1 1 
ATOM   3125  C  CD2 . LEU A 1 392 ? 66.997  74.997  36.032  1.00 20.94 ? 389  LEU A CD2 1 
ATOM   3126  N  N   . ASN A 1 393 ? 66.213  72.374  31.922  1.00 15.68 ? 390  ASN A N   1 
ATOM   3127  C  CA  . ASN A 1 393 ? 66.343  71.297  30.950  1.00 14.03 ? 390  ASN A CA  1 
ATOM   3128  C  C   . ASN A 1 393 ? 67.722  71.406  30.279  1.00 13.03 ? 390  ASN A C   1 
ATOM   3129  O  O   . ASN A 1 393 ? 68.447  72.388  30.485  1.00 12.90 ? 390  ASN A O   1 
ATOM   3130  C  CB  . ASN A 1 393 ? 65.178  71.268  29.935  1.00 14.90 ? 390  ASN A CB  1 
ATOM   3131  C  CG  . ASN A 1 393 ? 65.045  72.545  29.135  1.00 15.59 ? 390  ASN A CG  1 
ATOM   3132  O  OD1 . ASN A 1 393 ? 65.981  73.333  29.015  1.00 13.53 ? 390  ASN A OD1 1 
ATOM   3133  N  ND2 . ASN A 1 393 ? 63.853  72.762  28.588  1.00 14.45 ? 390  ASN A ND2 1 
ATOM   3134  N  N   . GLU A 1 394 ? 68.081  70.395  29.507  1.00 12.16 ? 391  GLU A N   1 
ATOM   3135  C  CA  . GLU A 1 394 ? 69.388  70.342  28.850  1.00 11.82 ? 391  GLU A CA  1 
ATOM   3136  C  C   . GLU A 1 394 ? 69.695  71.546  27.954  1.00 12.23 ? 391  GLU A C   1 
ATOM   3137  O  O   . GLU A 1 394 ? 70.777  72.131  28.015  1.00 12.10 ? 391  GLU A O   1 
ATOM   3138  C  CB  . GLU A 1 394 ? 69.539  69.049  28.058  1.00 11.89 ? 391  GLU A CB  1 
ATOM   3139  C  CG  . GLU A 1 394 ? 69.464  67.748  28.880  1.00 11.73 ? 391  GLU A CG  1 
ATOM   3140  C  CD  . GLU A 1 394 ? 68.049  67.164  29.029  1.00 15.83 ? 391  GLU A CD  1 
ATOM   3141  O  OE1 . GLU A 1 394 ? 67.075  67.917  29.195  1.00 14.43 ? 391  GLU A OE1 1 
ATOM   3142  O  OE2 . GLU A 1 394 ? 67.924  65.921  28.964  1.00 12.30 ? 391  GLU A OE2 1 
ATOM   3143  N  N   . TYR A 1 395 ? 68.741  71.917  27.120  1.00 12.76 ? 392  TYR A N   1 
ATOM   3144  C  CA  . TYR A 1 395 ? 68.909  73.041  26.218  1.00 12.11 ? 392  TYR A CA  1 
ATOM   3145  C  C   . TYR A 1 395 ? 69.251  74.330  26.979  1.00 12.36 ? 392  TYR A C   1 
ATOM   3146  O  O   . TYR A 1 395 ? 70.183  75.057  26.629  1.00 11.37 ? 392  TYR A O   1 
ATOM   3147  C  CB  . TYR A 1 395 ? 67.603  73.225  25.460  1.00 12.81 ? 392  TYR A CB  1 
ATOM   3148  C  CG  . TYR A 1 395 ? 67.612  74.330  24.456  1.00 11.59 ? 392  TYR A CG  1 
ATOM   3149  C  CD1 . TYR A 1 395 ? 67.318  75.629  24.837  1.00 16.07 ? 392  TYR A CD1 1 
ATOM   3150  C  CD2 . TYR A 1 395 ? 67.867  74.082  23.124  1.00 14.46 ? 392  TYR A CD2 1 
ATOM   3151  C  CE1 . TYR A 1 395 ? 67.299  76.654  23.931  1.00 13.84 ? 392  TYR A CE1 1 
ATOM   3152  C  CE2 . TYR A 1 395 ? 67.853  75.121  22.185  1.00 17.35 ? 392  TYR A CE2 1 
ATOM   3153  C  CZ  . TYR A 1 395 ? 67.563  76.409  22.610  1.00 15.15 ? 392  TYR A CZ  1 
ATOM   3154  O  OH  . TYR A 1 395 ? 67.540  77.454  21.727  1.00 19.51 ? 392  TYR A OH  1 
ATOM   3155  N  N   . THR A 1 396 ? 68.484  74.602  28.029  1.00 13.84 ? 393  THR A N   1 
ATOM   3156  C  CA  . THR A 1 396 ? 68.675  75.785  28.837  1.00 14.39 ? 393  THR A CA  1 
ATOM   3157  C  C   . THR A 1 396 ? 70.032  75.757  29.559  1.00 13.69 ? 393  THR A C   1 
ATOM   3158  O  O   . THR A 1 396 ? 70.712  76.775  29.640  1.00 12.85 ? 393  THR A O   1 
ATOM   3159  C  CB  . THR A 1 396 ? 67.511  75.948  29.826  1.00 15.51 ? 393  THR A CB  1 
ATOM   3160  O  OG1 . THR A 1 396 ? 66.279  76.039  29.085  1.00 14.79 ? 393  THR A OG1 1 
ATOM   3161  C  CG2 . THR A 1 396 ? 67.685  77.201  30.644  1.00 16.11 ? 393  THR A CG2 1 
ATOM   3162  N  N   . PHE A 1 397 ? 70.427  74.591  30.061  1.00 12.42 ? 394  PHE A N   1 
ATOM   3163  C  CA  . PHE A 1 397 ? 71.732  74.449  30.704  1.00 11.62 ? 394  PHE A CA  1 
ATOM   3164  C  C   . PHE A 1 397 ? 72.837  74.822  29.709  1.00 12.05 ? 394  PHE A C   1 
ATOM   3165  O  O   . PHE A 1 397 ? 73.750  75.588  30.024  1.00 12.29 ? 394  PHE A O   1 
ATOM   3166  C  CB  . PHE A 1 397 ? 71.944  73.022  31.207  1.00 12.66 ? 394  PHE A CB  1 
ATOM   3167  C  CG  . PHE A 1 397 ? 73.308  72.801  31.819  1.00 10.28 ? 394  PHE A CG  1 
ATOM   3168  C  CD1 . PHE A 1 397 ? 74.356  72.313  31.057  1.00 13.87 ? 394  PHE A CD1 1 
ATOM   3169  C  CD2 . PHE A 1 397 ? 73.549  73.135  33.132  1.00 14.67 ? 394  PHE A CD2 1 
ATOM   3170  C  CE1 . PHE A 1 397 ? 75.625  72.148  31.617  1.00 14.68 ? 394  PHE A CE1 1 
ATOM   3171  C  CE2 . PHE A 1 397 ? 74.800  72.977  33.683  1.00 13.13 ? 394  PHE A CE2 1 
ATOM   3172  C  CZ  . PHE A 1 397 ? 75.833  72.483  32.922  1.00 14.01 ? 394  PHE A CZ  1 
ATOM   3173  N  N   . GLY A 1 398 ? 72.745  74.298  28.491  1.00 12.20 ? 395  GLY A N   1 
ATOM   3174  C  CA  . GLY A 1 398 ? 73.735  74.608  27.461  1.00 12.41 ? 395  GLY A CA  1 
ATOM   3175  C  C   . GLY A 1 398 ? 73.783  76.099  27.160  1.00 11.52 ? 395  GLY A C   1 
ATOM   3176  O  O   . GLY A 1 398 ? 74.840  76.694  27.075  1.00 12.19 ? 395  GLY A O   1 
ATOM   3177  N  N   . TYR A 1 399 ? 72.620  76.714  27.040  1.00 12.04 ? 396  TYR A N   1 
ATOM   3178  C  CA  . TYR A 1 399 ? 72.522  78.144  26.745  1.00 11.56 ? 396  TYR A CA  1 
ATOM   3179  C  C   . TYR A 1 399 ? 73.079  78.995  27.890  1.00 11.91 ? 396  TYR A C   1 
ATOM   3180  O  O   . TYR A 1 399 ? 73.827  79.985  27.661  1.00 13.85 ? 396  TYR A O   1 
ATOM   3181  C  CB  . TYR A 1 399 ? 71.062  78.506  26.502  1.00 12.14 ? 396  TYR A CB  1 
ATOM   3182  C  CG  . TYR A 1 399 ? 70.838  79.839  25.841  1.00 10.50 ? 396  TYR A CG  1 
ATOM   3183  C  CD1 . TYR A 1 399 ? 70.887  81.015  26.566  1.00 15.73 ? 396  TYR A CD1 1 
ATOM   3184  C  CD2 . TYR A 1 399 ? 70.510  79.916  24.493  1.00 13.38 ? 396  TYR A CD2 1 
ATOM   3185  C  CE1 . TYR A 1 399 ? 70.651  82.242  25.950  1.00 16.09 ? 396  TYR A CE1 1 
ATOM   3186  C  CE2 . TYR A 1 399 ? 70.272  81.135  23.874  1.00 14.48 ? 396  TYR A CE2 1 
ATOM   3187  C  CZ  . TYR A 1 399 ? 70.359  82.295  24.606  1.00 15.74 ? 396  TYR A CZ  1 
ATOM   3188  O  OH  . TYR A 1 399 ? 70.120  83.512  23.993  1.00 15.57 ? 396  TYR A OH  1 
ATOM   3189  N  N   . LEU A 1 400 ? 72.752  78.599  29.117  1.00 11.52 ? 397  LEU A N   1 
ATOM   3190  C  CA  . LEU A 1 400 ? 73.189  79.300  30.333  1.00 11.66 ? 397  LEU A CA  1 
ATOM   3191  C  C   . LEU A 1 400 ? 74.712  79.244  30.522  1.00 12.97 ? 397  LEU A C   1 
ATOM   3192  O  O   . LEU A 1 400 ? 75.349  80.238  30.898  1.00 12.21 ? 397  LEU A O   1 
ATOM   3193  C  CB  . LEU A 1 400 ? 72.518  78.690  31.549  1.00 11.55 ? 397  LEU A CB  1 
ATOM   3194  C  CG  . LEU A 1 400 ? 72.719  79.398  32.883  1.00 12.57 ? 397  LEU A CG  1 
ATOM   3195  C  CD1 . LEU A 1 400 ? 72.163  80.843  32.834  1.00 11.07 ? 397  LEU A CD1 1 
ATOM   3196  C  CD2 . LEU A 1 400 ? 72.061  78.598  34.032  1.00 10.79 ? 397  LEU A CD2 1 
ATOM   3197  N  N   . VAL A 1 401 ? 75.279  78.071  30.315  1.00 11.96 ? 398  VAL A N   1 
ATOM   3198  C  CA  . VAL A 1 401 ? 76.722  77.913  30.394  1.00 13.45 ? 398  VAL A CA  1 
ATOM   3199  C  C   . VAL A 1 401 ? 77.417  78.870  29.404  1.00 12.85 ? 398  VAL A C   1 
ATOM   3200  O  O   . VAL A 1 401 ? 78.373  79.554  29.756  1.00 13.45 ? 398  VAL A O   1 
ATOM   3201  C  CB  . VAL A 1 401 ? 77.145  76.457  30.119  1.00 13.75 ? 398  VAL A CB  1 
ATOM   3202  C  CG1 . VAL A 1 401 ? 78.621  76.374  29.660  1.00 16.15 ? 398  VAL A CG1 1 
ATOM   3203  C  CG2 . VAL A 1 401 ? 76.856  75.569  31.347  1.00 17.05 ? 398  VAL A CG2 1 
ATOM   3204  N  N   . TYR A 1 402 ? 76.903  78.949  28.189  1.00 12.84 ? 399  TYR A N   1 
ATOM   3205  C  CA  . TYR A 1 402 ? 77.507  79.787  27.174  1.00 11.98 ? 399  TYR A CA  1 
ATOM   3206  C  C   . TYR A 1 402 ? 77.367  81.270  27.534  1.00 13.10 ? 399  TYR A C   1 
ATOM   3207  O  O   . TYR A 1 402 ? 78.316  82.056  27.358  1.00 14.38 ? 399  TYR A O   1 
ATOM   3208  C  CB  . TYR A 1 402 ? 76.953  79.489  25.779  1.00 11.79 ? 399  TYR A CB  1 
ATOM   3209  C  CG  . TYR A 1 402 ? 77.893  80.005  24.704  1.00 10.31 ? 399  TYR A CG  1 
ATOM   3210  C  CD1 . TYR A 1 402 ? 77.785  81.298  24.218  1.00 10.76 ? 399  TYR A CD1 1 
ATOM   3211  C  CD2 . TYR A 1 402 ? 78.960  79.230  24.270  1.00 11.56 ? 399  TYR A CD2 1 
ATOM   3212  C  CE1 . TYR A 1 402 ? 78.674  81.787  23.273  1.00 11.17 ? 399  TYR A CE1 1 
ATOM   3213  C  CE2 . TYR A 1 402 ? 79.855  79.715  23.314  1.00 13.01 ? 399  TYR A CE2 1 
ATOM   3214  C  CZ  . TYR A 1 402 ? 79.693  80.995  22.826  1.00 10.20 ? 399  TYR A CZ  1 
ATOM   3215  O  OH  . TYR A 1 402 ? 80.552  81.491  21.888  1.00 12.21 ? 399  TYR A OH  1 
ATOM   3216  N  N   . PHE A 1 403 ? 76.203  81.643  28.058  1.00 12.86 ? 400  PHE A N   1 
ATOM   3217  C  CA  . PHE A 1 403 ? 75.964  82.997  28.521  1.00 11.95 ? 400  PHE A CA  1 
ATOM   3218  C  C   . PHE A 1 403 ? 77.079  83.396  29.496  1.00 12.27 ? 400  PHE A C   1 
ATOM   3219  O  O   . PHE A 1 403 ? 77.701  84.430  29.335  1.00 11.72 ? 400  PHE A O   1 
ATOM   3220  C  CB  . PHE A 1 403 ? 74.584  83.103  29.189  1.00 11.48 ? 400  PHE A CB  1 
ATOM   3221  C  CG  . PHE A 1 403 ? 74.386  84.357  29.991  1.00 11.07 ? 400  PHE A CG  1 
ATOM   3222  C  CD1 . PHE A 1 403 ? 74.004  85.539  29.381  1.00 13.01 ? 400  PHE A CD1 1 
ATOM   3223  C  CD2 . PHE A 1 403 ? 74.542  84.343  31.371  1.00 11.68 ? 400  PHE A CD2 1 
ATOM   3224  C  CE1 . PHE A 1 403 ? 73.832  86.703  30.117  1.00 13.35 ? 400  PHE A CE1 1 
ATOM   3225  C  CE2 . PHE A 1 403 ? 74.366  85.504  32.124  1.00 10.39 ? 400  PHE A CE2 1 
ATOM   3226  C  CZ  . PHE A 1 403 ? 74.005  86.683  31.494  1.00 13.95 ? 400  PHE A CZ  1 
ATOM   3227  N  N   . PHE A 1 404 ? 77.317  82.579  30.514  1.00 12.77 ? 401  PHE A N   1 
ATOM   3228  C  CA  . PHE A 1 404 ? 78.350  82.900  31.498  1.00 12.68 ? 401  PHE A CA  1 
ATOM   3229  C  C   . PHE A 1 404 ? 79.788  82.835  30.977  1.00 13.19 ? 401  PHE A C   1 
ATOM   3230  O  O   . PHE A 1 404 ? 80.617  83.637  31.397  1.00 13.16 ? 401  PHE A O   1 
ATOM   3231  C  CB  . PHE A 1 404 ? 78.197  82.056  32.772  1.00 13.93 ? 401  PHE A CB  1 
ATOM   3232  C  CG  . PHE A 1 404 ? 77.077  82.517  33.669  1.00 14.27 ? 401  PHE A CG  1 
ATOM   3233  C  CD1 . PHE A 1 404 ? 77.154  83.750  34.316  1.00 13.92 ? 401  PHE A CD1 1 
ATOM   3234  C  CD2 . PHE A 1 404 ? 75.991  81.709  33.922  1.00 13.60 ? 401  PHE A CD2 1 
ATOM   3235  C  CE1 . PHE A 1 404 ? 76.147  84.170  35.162  1.00 15.77 ? 401  PHE A CE1 1 
ATOM   3236  C  CE2 . PHE A 1 404 ? 74.969  82.139  34.766  1.00 13.75 ? 401  PHE A CE2 1 
ATOM   3237  C  CZ  . PHE A 1 404 ? 75.046  83.361  35.382  1.00 14.43 ? 401  PHE A CZ  1 
ATOM   3238  N  N   . GLU A 1 405 ? 80.083  81.893  30.089  1.00 11.97 ? 402  GLU A N   1 
ATOM   3239  C  CA  . GLU A 1 405 ? 81.433  81.786  29.530  1.00 13.69 ? 402  GLU A CA  1 
ATOM   3240  C  C   . GLU A 1 405 ? 81.773  83.031  28.717  1.00 13.65 ? 402  GLU A C   1 
ATOM   3241  O  O   . GLU A 1 405 ? 82.862  83.604  28.854  1.00 11.90 ? 402  GLU A O   1 
ATOM   3242  C  CB  . GLU A 1 405 ? 81.585  80.528  28.659  1.00 12.44 ? 402  GLU A CB  1 
ATOM   3243  C  CG  . GLU A 1 405 ? 81.528  79.185  29.440  1.00 15.22 ? 402  GLU A CG  1 
ATOM   3244  C  CD  . GLU A 1 405 ? 81.656  77.946  28.557  1.00 13.00 ? 402  GLU A CD  1 
ATOM   3245  O  OE1 . GLU A 1 405 ? 81.456  78.082  27.323  1.00 14.88 ? 402  GLU A OE1 1 
ATOM   3246  O  OE2 . GLU A 1 405 ? 81.936  76.819  29.099  1.00 11.41 ? 402  GLU A OE2 1 
ATOM   3247  N  N   . LYS A 1 406 ? 80.831  83.461  27.897  1.00 13.04 ? 403  LYS A N   1 
ATOM   3248  C  CA  . LYS A 1 406 ? 81.032  84.631  27.035  1.00 13.86 ? 403  LYS A CA  1 
ATOM   3249  C  C   . LYS A 1 406 ? 81.075  85.892  27.893  1.00 13.60 ? 403  LYS A C   1 
ATOM   3250  O  O   . LYS A 1 406 ? 81.879  86.803  27.636  1.00 14.30 ? 403  LYS A O   1 
ATOM   3251  C  CB  . LYS A 1 406 ? 79.918  84.674  25.970  1.00 13.30 ? 403  LYS A CB  1 
ATOM   3252  C  CG  . LYS A 1 406 ? 80.221  85.402  24.625  1.00 16.11 ? 403  LYS A CG  1 
ATOM   3253  C  CD  . LYS A 1 406 ? 81.548  84.972  24.032  1.00 18.36 ? 403  LYS A CD  1 
ATOM   3254  C  CE  . LYS A 1 406 ? 81.679  85.164  22.513  1.00 19.79 ? 403  LYS A CE  1 
ATOM   3255  N  NZ  . LYS A 1 406 ? 80.955  86.320  21.878  1.00 16.37 ? 403  LYS A NZ  1 
ATOM   3256  N  N   . ALA A 1 407 ? 80.243  85.952  28.937  1.00 13.02 ? 404  ALA A N   1 
ATOM   3257  C  CA  . ALA A 1 407 ? 80.246  87.110  29.838  1.00 13.71 ? 404  ALA A CA  1 
ATOM   3258  C  C   . ALA A 1 407 ? 81.575  87.180  30.580  1.00 14.82 ? 404  ALA A C   1 
ATOM   3259  O  O   . ALA A 1 407 ? 82.128  88.264  30.786  1.00 13.98 ? 404  ALA A O   1 
ATOM   3260  C  CB  . ALA A 1 407 ? 79.117  87.018  30.852  1.00 13.92 ? 404  ALA A CB  1 
ATOM   3261  N  N   . CYS A 1 408 ? 82.086  86.013  30.962  1.00 15.08 ? 405  CYS A N   1 
ATOM   3262  C  CA  . CYS A 1 408 ? 83.340  85.940  31.706  1.00 14.43 ? 405  CYS A CA  1 
ATOM   3263  C  C   . CYS A 1 408 ? 84.527  86.448  30.883  1.00 13.67 ? 405  CYS A C   1 
ATOM   3264  O  O   . CYS A 1 408 ? 85.376  87.163  31.393  1.00 14.15 ? 405  CYS A O   1 
ATOM   3265  C  CB  . CYS A 1 408 ? 83.600  84.509  32.150  1.00 13.50 ? 405  CYS A CB  1 
ATOM   3266  S  SG  . CYS A 1 408 ? 85.085  84.370  33.167  1.00 18.83 ? 405  CYS A SG  1 
ATOM   3267  N  N   . ALA A 1 409 ? 84.586  86.044  29.617  1.00 13.93 ? 406  ALA A N   1 
ATOM   3268  C  CA  . ALA A 1 409 ? 85.631  86.480  28.688  1.00 13.43 ? 406  ALA A CA  1 
ATOM   3269  C  C   . ALA A 1 409 ? 85.636  88.016  28.593  1.00 13.67 ? 406  ALA A C   1 
ATOM   3270  O  O   . ALA A 1 409 ? 86.684  88.664  28.724  1.00 13.23 ? 406  ALA A O   1 
ATOM   3271  C  CB  . ALA A 1 409 ? 85.394  85.863  27.306  1.00 13.19 ? 406  ALA A CB  1 
HETATM 3272  N  N   . MSE A 1 410 ? 84.462  88.597  28.387  1.00 12.77 ? 407  MSE A N   1 
HETATM 3273  C  CA  . MSE A 1 410 ? 84.340  90.061  28.289  1.00 12.53 ? 407  MSE A CA  1 
HETATM 3274  C  C   . MSE A 1 410 ? 84.719  90.748  29.598  1.00 12.83 ? 407  MSE A C   1 
HETATM 3275  O  O   . MSE A 1 410 ? 85.464  91.727  29.612  1.00 12.74 ? 407  MSE A O   1 
HETATM 3276  C  CB  . MSE A 1 410 ? 82.912  90.446  27.903  1.00 11.75 ? 407  MSE A CB  1 
HETATM 3277  C  CG  . MSE A 1 410 ? 82.672  91.956  27.759  1.00 12.99 ? 407  MSE A CG  1 
HETATM 3278  SE SE  . MSE A 1 410 ? 83.760  92.847  26.401  1.00 15.27 ? 407  MSE A SE  1 
HETATM 3279  C  CE  . MSE A 1 410 ? 83.174  91.854  24.808  1.00 13.48 ? 407  MSE A CE  1 
ATOM   3280  N  N   . SER A 1 411 ? 84.216  90.211  30.706  1.00 13.31 ? 408  SER A N   1 
ATOM   3281  C  CA  . SER A 1 411 ? 84.458  90.793  32.001  1.00 14.01 ? 408  SER A CA  1 
ATOM   3282  C  C   . SER A 1 411 ? 85.955  90.847  32.315  1.00 14.27 ? 408  SER A C   1 
ATOM   3283  O  O   . SER A 1 411 ? 86.462  91.873  32.773  1.00 13.29 ? 408  SER A O   1 
ATOM   3284  C  CB  . SER A 1 411 ? 83.693  89.999  33.076  1.00 13.18 ? 408  SER A CB  1 
ATOM   3285  O  OG  . SER A 1 411 ? 83.880  90.577  34.349  1.00 14.48 ? 408  SER A OG  1 
ATOM   3286  N  N   . GLY A 1 412 ? 86.651  89.740  32.066  1.00 12.99 ? 409  GLY A N   1 
ATOM   3287  C  CA  . GLY A 1 412 ? 88.084  89.669  32.309  1.00 13.47 ? 409  GLY A CA  1 
ATOM   3288  C  C   . GLY A 1 412 ? 88.859  90.669  31.460  1.00 14.77 ? 409  GLY A C   1 
ATOM   3289  O  O   . GLY A 1 412 ? 89.749  91.367  31.955  1.00 14.74 ? 409  GLY A O   1 
ATOM   3290  N  N   . TYR A 1 413 ? 88.526  90.742  30.174  1.00 14.40 ? 410  TYR A N   1 
ATOM   3291  C  CA  . TYR A 1 413 ? 89.187  91.690  29.294  1.00 15.02 ? 410  TYR A CA  1 
ATOM   3292  C  C   . TYR A 1 413 ? 88.921  93.125  29.702  1.00 14.39 ? 410  TYR A C   1 
ATOM   3293  O  O   . TYR A 1 413 ? 89.815  93.944  29.607  1.00 15.10 ? 410  TYR A O   1 
ATOM   3294  C  CB  . TYR A 1 413 ? 88.814  91.492  27.814  1.00 15.52 ? 410  TYR A CB  1 
ATOM   3295  C  CG  . TYR A 1 413 ? 89.524  90.345  27.148  1.00 16.60 ? 410  TYR A CG  1 
ATOM   3296  C  CD1 . TYR A 1 413 ? 90.913  90.262  27.191  1.00 16.61 ? 410  TYR A CD1 1 
ATOM   3297  C  CD2 . TYR A 1 413 ? 88.831  89.418  26.365  1.00 18.44 ? 410  TYR A CD2 1 
ATOM   3298  C  CE1 . TYR A 1 413 ? 91.594  89.228  26.567  1.00 18.63 ? 410  TYR A CE1 1 
ATOM   3299  C  CE2 . TYR A 1 413 ? 89.505  88.390  25.718  1.00 19.31 ? 410  TYR A CE2 1 
ATOM   3300  C  CZ  . TYR A 1 413 ? 90.891  88.307  25.820  1.00 18.64 ? 410  TYR A CZ  1 
ATOM   3301  O  OH  . TYR A 1 413 ? 91.587  87.313  25.192  1.00 15.20 ? 410  TYR A OH  1 
ATOM   3302  N  N   . LEU A 1 414 ? 87.706  93.432  30.154  1.00 14.46 ? 411  LEU A N   1 
ATOM   3303  C  CA  . LEU A 1 414 ? 87.376  94.793  30.591  1.00 14.77 ? 411  LEU A CA  1 
ATOM   3304  C  C   . LEU A 1 414 ? 88.116  95.148  31.884  1.00 14.92 ? 411  LEU A C   1 
ATOM   3305  O  O   . LEU A 1 414 ? 88.488  96.295  32.087  1.00 14.42 ? 411  LEU A O   1 
ATOM   3306  C  CB  . LEU A 1 414 ? 85.853  94.981  30.762  1.00 14.19 ? 411  LEU A CB  1 
ATOM   3307  C  CG  . LEU A 1 414 ? 85.019  94.935  29.463  1.00 16.24 ? 411  LEU A CG  1 
ATOM   3308  C  CD1 . LEU A 1 414 ? 83.524  94.974  29.770  1.00 18.10 ? 411  LEU A CD1 1 
ATOM   3309  C  CD2 . LEU A 1 414 ? 85.400  96.054  28.487  1.00 16.55 ? 411  LEU A CD2 1 
ATOM   3310  N  N   . LEU A 1 415 ? 88.343  94.151  32.737  1.00 14.37 ? 412  LEU A N   1 
ATOM   3311  C  CA  . LEU A 1 415 ? 89.053  94.345  34.003  1.00 15.25 ? 412  LEU A CA  1 
ATOM   3312  C  C   . LEU A 1 415 ? 90.523  94.618  33.727  1.00 15.84 ? 412  LEU A C   1 
ATOM   3313  O  O   . LEU A 1 415 ? 91.197  95.274  34.522  1.00 17.60 ? 412  LEU A O   1 
ATOM   3314  C  CB  . LEU A 1 415 ? 88.928  93.106  34.894  1.00 13.63 ? 412  LEU A CB  1 
ATOM   3315  C  CG  . LEU A 1 415 ? 89.626  93.112  36.260  1.00 15.48 ? 412  LEU A CG  1 
ATOM   3316  C  CD1 . LEU A 1 415 ? 89.074  94.203  37.172  1.00 13.85 ? 412  LEU A CD1 1 
ATOM   3317  C  CD2 . LEU A 1 415 ? 89.488  91.754  36.925  1.00 11.13 ? 412  LEU A CD2 1 
ATOM   3318  N  N   . GLY A 1 416 ? 91.010  94.125  32.595  1.00 15.30 ? 413  GLY A N   1 
ATOM   3319  C  CA  . GLY A 1 416 ? 92.405  94.318  32.208  1.00 15.81 ? 413  GLY A CA  1 
ATOM   3320  C  C   . GLY A 1 416 ? 93.314  93.137  32.547  1.00 14.86 ? 413  GLY A C   1 
ATOM   3321  O  O   . GLY A 1 416 ? 94.510  93.316  32.729  1.00 14.81 ? 413  GLY A O   1 
ATOM   3322  N  N   . VAL A 1 417 ? 92.760  91.931  32.639  1.00 15.05 ? 414  VAL A N   1 
ATOM   3323  C  CA  . VAL A 1 417 ? 93.571  90.750  32.955  1.00 13.43 ? 414  VAL A CA  1 
ATOM   3324  C  C   . VAL A 1 417 ? 93.495  89.734  31.808  1.00 14.79 ? 414  VAL A C   1 
ATOM   3325  O  O   . VAL A 1 417 ? 92.749  89.926  30.850  1.00 13.53 ? 414  VAL A O   1 
ATOM   3326  C  CB  . VAL A 1 417 ? 93.061  89.991  34.224  1.00 14.04 ? 414  VAL A CB  1 
ATOM   3327  C  CG1 . VAL A 1 417 ? 93.074  90.877  35.486  1.00 13.29 ? 414  VAL A CG1 1 
ATOM   3328  C  CG2 . VAL A 1 417 ? 91.660  89.360  33.980  1.00 12.66 ? 414  VAL A CG2 1 
ATOM   3329  N  N   . ASN A 1 418 ? 94.300  88.677  31.918  1.00 14.44 ? 415  ASN A N   1 
ATOM   3330  C  CA  . ASN A 1 418 ? 94.275  87.551  31.001  1.00 13.87 ? 415  ASN A CA  1 
ATOM   3331  C  C   . ASN A 1 418 ? 93.228  86.621  31.594  1.00 14.39 ? 415  ASN A C   1 
ATOM   3332  O  O   . ASN A 1 418 ? 93.446  86.032  32.636  1.00 14.73 ? 415  ASN A O   1 
ATOM   3333  C  CB  . ASN A 1 418 ? 95.627  86.848  30.947  1.00 13.68 ? 415  ASN A CB  1 
ATOM   3334  C  CG  . ASN A 1 418 ? 95.609  85.594  30.069  1.00 14.23 ? 415  ASN A CG  1 
ATOM   3335  O  OD1 . ASN A 1 418 ? 94.546  85.109  29.658  1.00 12.75 ? 415  ASN A OD1 1 
ATOM   3336  N  ND2 . ASN A 1 418 ? 96.777  85.053  29.808  1.00 9.88  ? 415  ASN A ND2 1 
ATOM   3337  N  N   . PRO A 1 419 ? 92.075  86.497  30.942  1.00 13.59 ? 416  PRO A N   1 
ATOM   3338  C  CA  . PRO A 1 419 ? 91.025  85.684  31.523  1.00 13.67 ? 416  PRO A CA  1 
ATOM   3339  C  C   . PRO A 1 419 ? 91.217  84.191  31.420  1.00 14.26 ? 416  PRO A C   1 
ATOM   3340  O  O   . PRO A 1 419 ? 90.465  83.467  32.054  1.00 14.01 ? 416  PRO A O   1 
ATOM   3341  C  CB  . PRO A 1 419 ? 89.786  86.034  30.664  1.00 14.09 ? 416  PRO A CB  1 
ATOM   3342  C  CG  . PRO A 1 419 ? 90.170  87.264  29.876  1.00 13.34 ? 416  PRO A CG  1 
ATOM   3343  C  CD  . PRO A 1 419 ? 91.641  87.196  29.726  1.00 13.66 ? 416  PRO A CD  1 
ATOM   3344  N  N   . PHE A 1 420 ? 92.225  83.738  30.679  1.00 12.43 ? 417  PHE A N   1 
ATOM   3345  C  CA  . PHE A 1 420 ? 92.336  82.320  30.390  1.00 13.39 ? 417  PHE A CA  1 
ATOM   3346  C  C   . PHE A 1 420 ? 93.514  81.538  30.966  1.00 13.57 ? 417  PHE A C   1 
ATOM   3347  O  O   . PHE A 1 420 ? 93.656  80.345  30.678  1.00 13.92 ? 417  PHE A O   1 
ATOM   3348  C  CB  . PHE A 1 420 ? 92.279  82.170  28.864  1.00 13.86 ? 417  PHE A CB  1 
ATOM   3349  C  CG  . PHE A 1 420 ? 91.090  82.861  28.259  1.00 12.55 ? 417  PHE A CG  1 
ATOM   3350  C  CD1 . PHE A 1 420 ? 89.816  82.341  28.424  1.00 16.18 ? 417  PHE A CD1 1 
ATOM   3351  C  CD2 . PHE A 1 420 ? 91.231  84.050  27.574  1.00 15.95 ? 417  PHE A CD2 1 
ATOM   3352  C  CE1 . PHE A 1 420 ? 88.712  82.992  27.909  1.00 13.23 ? 417  PHE A CE1 1 
ATOM   3353  C  CE2 . PHE A 1 420 ? 90.130  84.694  27.056  1.00 14.57 ? 417  PHE A CE2 1 
ATOM   3354  C  CZ  . PHE A 1 420 ? 88.869  84.154  27.225  1.00 13.59 ? 417  PHE A CZ  1 
ATOM   3355  N  N   . ASP A 1 421 ? 94.331  82.191  31.782  1.00 13.13 ? 418  ASP A N   1 
ATOM   3356  C  CA  . ASP A 1 421 ? 95.445  81.520  32.450  1.00 14.24 ? 418  ASP A CA  1 
ATOM   3357  C  C   . ASP A 1 421 ? 95.140  81.305  33.953  1.00 13.82 ? 418  ASP A C   1 
ATOM   3358  O  O   . ASP A 1 421 ? 94.092  81.712  34.436  1.00 11.53 ? 418  ASP A O   1 
ATOM   3359  C  CB  . ASP A 1 421 ? 96.743  82.302  32.275  1.00 13.89 ? 418  ASP A CB  1 
ATOM   3360  C  CG  . ASP A 1 421 ? 96.715  83.678  32.932  1.00 14.76 ? 418  ASP A CG  1 
ATOM   3361  O  OD1 . ASP A 1 421 ? 95.644  84.172  33.393  1.00 13.58 ? 418  ASP A OD1 1 
ATOM   3362  O  OD2 . ASP A 1 421 ? 97.808  84.282  32.970  1.00 17.96 ? 418  ASP A OD2 1 
ATOM   3363  N  N   . GLN A 1 422 ? 96.049  80.625  34.663  1.00 12.94 ? 419  GLN A N   1 
ATOM   3364  C  CA  . GLN A 1 422 ? 95.906  80.385  36.109  1.00 12.03 ? 419  GLN A CA  1 
ATOM   3365  C  C   . GLN A 1 422 ? 97.280  80.209  36.791  1.00 12.80 ? 419  GLN A C   1 
ATOM   3366  O  O   . GLN A 1 422 ? 97.543  79.190  37.415  1.00 12.28 ? 419  GLN A O   1 
ATOM   3367  C  CB  . GLN A 1 422 ? 94.951  79.202  36.393  1.00 11.80 ? 419  GLN A CB  1 
ATOM   3368  C  CG  . GLN A 1 422 ? 95.273  77.882  35.671  1.00 12.63 ? 419  GLN A CG  1 
ATOM   3369  C  CD  . GLN A 1 422 ? 94.958  77.910  34.184  1.00 15.25 ? 419  GLN A CD  1 
ATOM   3370  O  OE1 . GLN A 1 422 ? 93.903  78.407  33.747  1.00 15.04 ? 419  GLN A OE1 1 
ATOM   3371  N  NE2 . GLN A 1 422 ? 95.876  77.373  33.394  1.00 14.87 ? 419  GLN A NE2 1 
ATOM   3372  N  N   . PRO A 1 423 ? 98.163  81.223  36.656  1.00 13.56 ? 420  PRO A N   1 
ATOM   3373  C  CA  . PRO A 1 423 ? 99.516  81.149  37.210  1.00 14.72 ? 420  PRO A CA  1 
ATOM   3374  C  C   . PRO A 1 423 ? 99.594  81.030  38.737  1.00 13.96 ? 420  PRO A C   1 
ATOM   3375  O  O   . PRO A 1 423 ? 100.599 80.550  39.256  1.00 14.87 ? 420  PRO A O   1 
ATOM   3376  C  CB  . PRO A 1 423 ? 100.160 82.467  36.746  1.00 14.99 ? 420  PRO A CB  1 
ATOM   3377  C  CG  . PRO A 1 423 ? 99.041  83.388  36.522  1.00 16.00 ? 420  PRO A CG  1 
ATOM   3378  C  CD  . PRO A 1 423 ? 97.904  82.533  36.028  1.00 13.67 ? 420  PRO A CD  1 
ATOM   3379  N  N   . GLY A 1 424 ? 98.542  81.444  39.438  1.00 13.44 ? 421  GLY A N   1 
ATOM   3380  C  CA  . GLY A 1 424 ? 98.525  81.392  40.890  1.00 13.77 ? 421  GLY A CA  1 
ATOM   3381  C  C   . GLY A 1 424 ? 98.461  80.007  41.533  1.00 14.44 ? 421  GLY A C   1 
ATOM   3382  O  O   . GLY A 1 424 ? 98.852  79.854  42.697  1.00 15.37 ? 421  GLY A O   1 
ATOM   3383  N  N   . VAL A 1 425 ? 97.972  78.993  40.815  1.00 14.40 ? 422  VAL A N   1 
ATOM   3384  C  CA  . VAL A 1 425 ? 97.882  77.640  41.414  1.00 13.62 ? 422  VAL A CA  1 
ATOM   3385  C  C   . VAL A 1 425 ? 99.235  76.916  41.547  1.00 14.61 ? 422  VAL A C   1 
ATOM   3386  O  O   . VAL A 1 425 ? 99.348  75.912  42.273  1.00 14.63 ? 422  VAL A O   1 
ATOM   3387  C  CB  . VAL A 1 425 ? 96.906  76.726  40.643  1.00 14.10 ? 422  VAL A CB  1 
ATOM   3388  C  CG1 . VAL A 1 425 ? 95.521  77.354  40.605  1.00 13.67 ? 422  VAL A CG1 1 
ATOM   3389  C  CG2 . VAL A 1 425 ? 97.412  76.448  39.223  1.00 13.86 ? 422  VAL A CG2 1 
ATOM   3390  N  N   . GLU A 1 426 ? 100.259 77.396  40.846  1.00 14.03 ? 423  GLU A N   1 
ATOM   3391  C  CA  . GLU A 1 426 ? 101.569 76.752  40.917  1.00 15.38 ? 423  GLU A CA  1 
ATOM   3392  C  C   . GLU A 1 426 ? 102.223 76.817  42.305  1.00 14.12 ? 423  GLU A C   1 
ATOM   3393  O  O   . GLU A 1 426 ? 102.931 75.893  42.699  1.00 12.63 ? 423  GLU A O   1 
ATOM   3394  C  CB  . GLU A 1 426 ? 102.532 77.370  39.894  1.00 16.15 ? 423  GLU A CB  1 
ATOM   3395  C  CG  . GLU A 1 426 ? 102.061 77.216  38.467  1.00 23.17 ? 423  GLU A CG  1 
ATOM   3396  C  CD  . GLU A 1 426 ? 101.769 75.758  38.114  1.00 30.11 ? 423  GLU A CD  1 
ATOM   3397  O  OE1 . GLU A 1 426 ? 102.563 74.863  38.520  1.00 35.02 ? 423  GLU A OE1 1 
ATOM   3398  O  OE2 . GLU A 1 426 ? 100.750 75.516  37.420  1.00 31.65 ? 423  GLU A OE2 1 
ATOM   3399  N  N   . ALA A 1 427 ? 101.975 77.901  43.038  1.00 13.24 ? 424  ALA A N   1 
ATOM   3400  C  CA  . ALA A 1 427 ? 102.617 78.102  44.341  1.00 13.91 ? 424  ALA A CA  1 
ATOM   3401  C  C   . ALA A 1 427 ? 102.335 76.999  45.358  1.00 14.23 ? 424  ALA A C   1 
ATOM   3402  O  O   . ALA A 1 427 ? 103.277 76.378  45.863  1.00 14.70 ? 424  ALA A O   1 
ATOM   3403  C  CB  . ALA A 1 427 ? 102.283 79.507  44.910  1.00 11.62 ? 424  ALA A CB  1 
ATOM   3404  N  N   . TYR A 1 428 ? 101.069 76.706  45.641  1.00 14.04 ? 425  TYR A N   1 
ATOM   3405  C  CA  . TYR A 1 428 ? 100.793 75.655  46.609  1.00 13.97 ? 425  TYR A CA  1 
ATOM   3406  C  C   . TYR A 1 428 ? 101.265 74.312  46.057  1.00 15.12 ? 425  TYR A C   1 
ATOM   3407  O  O   . TYR A 1 428 ? 101.753 73.470  46.802  1.00 14.59 ? 425  TYR A O   1 
ATOM   3408  C  CB  . TYR A 1 428 ? 99.311  75.560  46.982  1.00 14.64 ? 425  TYR A CB  1 
ATOM   3409  C  CG  . TYR A 1 428 ? 98.443  74.738  46.027  1.00 13.25 ? 425  TYR A CG  1 
ATOM   3410  C  CD1 . TYR A 1 428 ? 98.350  73.354  46.177  1.00 10.97 ? 425  TYR A CD1 1 
ATOM   3411  C  CD2 . TYR A 1 428 ? 97.691  75.334  45.025  1.00 11.54 ? 425  TYR A CD2 1 
ATOM   3412  C  CE1 . TYR A 1 428 ? 97.574  72.586  45.346  1.00 12.25 ? 425  TYR A CE1 1 
ATOM   3413  C  CE2 . TYR A 1 428 ? 96.885  74.553  44.182  1.00 10.63 ? 425  TYR A CE2 1 
ATOM   3414  C  CZ  . TYR A 1 428 ? 96.847  73.170  44.351  1.00 13.38 ? 425  TYR A CZ  1 
ATOM   3415  O  OH  . TYR A 1 428 ? 96.071  72.362  43.517  1.00 14.95 ? 425  TYR A OH  1 
ATOM   3416  N  N   . LYS A 1 429 ? 101.142 74.103  44.750  1.00 15.35 ? 426  LYS A N   1 
ATOM   3417  C  CA  . LYS A 1 429 ? 101.552 72.811  44.192  1.00 15.86 ? 426  LYS A CA  1 
ATOM   3418  C  C   . LYS A 1 429 ? 103.039 72.523  44.396  1.00 15.62 ? 426  LYS A C   1 
ATOM   3419  O  O   . LYS A 1 429 ? 103.430 71.421  44.809  1.00 15.30 ? 426  LYS A O   1 
ATOM   3420  C  CB  . LYS A 1 429 ? 101.197 72.711  42.705  1.00 15.76 ? 426  LYS A CB  1 
ATOM   3421  C  CG  . LYS A 1 429 ? 99.691  72.669  42.400  1.00 15.71 ? 426  LYS A CG  1 
ATOM   3422  C  CD  . LYS A 1 429 ? 99.468  72.559  40.890  1.00 21.25 ? 426  LYS A CD  1 
ATOM   3423  C  CE  . LYS A 1 429 ? 97.987  72.633  40.524  1.00 25.19 ? 426  LYS A CE  1 
ATOM   3424  N  NZ  . LYS A 1 429 ? 97.800  72.460  39.038  1.00 28.92 ? 426  LYS A NZ  1 
ATOM   3425  N  N   . LYS A 1 430 ? 103.864 73.495  44.056  1.00 15.57 ? 427  LYS A N   1 
ATOM   3426  C  CA  . LYS A 1 430 ? 105.308 73.353  44.220  1.00 17.16 ? 427  LYS A CA  1 
ATOM   3427  C  C   . LYS A 1 430 ? 105.670 73.083  45.683  1.00 15.74 ? 427  LYS A C   1 
ATOM   3428  O  O   . LYS A 1 430 ? 106.553 72.257  45.991  1.00 15.56 ? 427  LYS A O   1 
ATOM   3429  C  CB  . LYS A 1 430 ? 106.005 74.606  43.677  1.00 17.82 ? 427  LYS A CB  1 
ATOM   3430  C  CG  . LYS A 1 430 ? 107.491 74.722  44.012  1.00 26.16 ? 427  LYS A CG  1 
ATOM   3431  C  CD  . LYS A 1 430 ? 108.198 75.854  43.210  1.00 31.26 ? 427  LYS A CD  1 
ATOM   3432  C  CE  . LYS A 1 430 ? 107.574 77.240  43.420  1.00 34.68 ? 427  LYS A CE  1 
ATOM   3433  N  NZ  . LYS A 1 430 ? 108.180 78.298  42.515  1.00 37.09 ? 427  LYS A NZ  1 
ATOM   3434  N  N   . ASN A 1 431 ? 104.992 73.772  46.590  1.00 14.31 ? 428  ASN A N   1 
ATOM   3435  C  CA  . ASN A 1 431 ? 105.251 73.590  48.004  1.00 15.14 ? 428  ASN A CA  1 
ATOM   3436  C  C   . ASN A 1 431 ? 104.841 72.195  48.430  1.00 16.84 ? 428  ASN A C   1 
ATOM   3437  O  O   . ASN A 1 431 ? 105.572 71.515  49.160  1.00 15.75 ? 428  ASN A O   1 
ATOM   3438  C  CB  . ASN A 1 431 ? 104.531 74.655  48.840  1.00 15.84 ? 428  ASN A CB  1 
ATOM   3439  C  CG  . ASN A 1 431 ? 105.203 76.021  48.766  1.00 15.99 ? 428  ASN A CG  1 
ATOM   3440  O  OD1 . ASN A 1 431 ? 106.297 76.177  48.185  1.00 13.04 ? 428  ASN A OD1 1 
ATOM   3441  N  ND2 . ASN A 1 431 ? 104.581 77.013  49.402  1.00 12.44 ? 428  ASN A ND2 1 
HETATM 3442  N  N   . MSE A 1 432 ? 103.666 71.766  47.975  1.00 15.80 ? 429  MSE A N   1 
HETATM 3443  C  CA  . MSE A 1 432 ? 103.187 70.436  48.288  1.00 16.82 ? 429  MSE A CA  1 
HETATM 3444  C  C   . MSE A 1 432 ? 104.195 69.386  47.782  1.00 16.24 ? 429  MSE A C   1 
HETATM 3445  O  O   . MSE A 1 432 ? 104.622 68.510  48.547  1.00 15.97 ? 429  MSE A O   1 
HETATM 3446  C  CB  . MSE A 1 432 ? 101.814 70.216  47.659  1.00 16.11 ? 429  MSE A CB  1 
HETATM 3447  C  CG  . MSE A 1 432 ? 101.210 68.857  47.966  1.00 19.01 ? 429  MSE A CG  1 
HETATM 3448  SE SE  . MSE A 1 432 ? 99.484  68.615  47.110  1.00 20.17 ? 429  MSE A SE  1 
HETATM 3449  C  CE  . MSE A 1 432 ? 99.992  68.739  45.199  1.00 18.30 ? 429  MSE A CE  1 
ATOM   3450  N  N   . PHE A 1 433 ? 104.582 69.475  46.507  1.00 16.76 ? 430  PHE A N   1 
ATOM   3451  C  CA  . PHE A 1 433 ? 105.526 68.509  45.934  1.00 16.16 ? 430  PHE A CA  1 
ATOM   3452  C  C   . PHE A 1 433 ? 106.801 68.411  46.759  1.00 16.65 ? 430  PHE A C   1 
ATOM   3453  O  O   . PHE A 1 433 ? 107.316 67.316  46.991  1.00 17.53 ? 430  PHE A O   1 
ATOM   3454  C  CB  . PHE A 1 433 ? 105.920 68.852  44.487  1.00 17.19 ? 430  PHE A CB  1 
ATOM   3455  C  CG  . PHE A 1 433 ? 104.771 68.846  43.507  1.00 17.59 ? 430  PHE A CG  1 
ATOM   3456  C  CD1 . PHE A 1 433 ? 103.764 67.903  43.592  1.00 21.13 ? 430  PHE A CD1 1 
ATOM   3457  C  CD2 . PHE A 1 433 ? 104.787 69.698  42.413  1.00 20.53 ? 430  PHE A CD2 1 
ATOM   3458  C  CE1 . PHE A 1 433 ? 102.732 67.873  42.662  1.00 21.16 ? 430  PHE A CE1 1 
ATOM   3459  C  CE2 . PHE A 1 433 ? 103.767 69.667  41.476  1.00 22.58 ? 430  PHE A CE2 1 
ATOM   3460  C  CZ  . PHE A 1 433 ? 102.736 68.750  41.607  1.00 22.16 ? 430  PHE A CZ  1 
ATOM   3461  N  N   . ALA A 1 434 ? 107.312 69.562  47.182  1.00 16.01 ? 431  ALA A N   1 
ATOM   3462  C  CA  . ALA A 1 434 ? 108.517 69.623  47.996  1.00 16.91 ? 431  ALA A CA  1 
ATOM   3463  C  C   . ALA A 1 434 ? 108.321 68.849  49.299  1.00 17.11 ? 431  ALA A C   1 
ATOM   3464  O  O   . ALA A 1 434 ? 109.092 67.940  49.617  1.00 15.00 ? 431  ALA A O   1 
ATOM   3465  C  CB  . ALA A 1 434 ? 108.888 71.088  48.281  1.00 15.67 ? 431  ALA A CB  1 
ATOM   3466  N  N   . LEU A 1 435 ? 107.255 69.183  50.028  1.00 15.96 ? 432  LEU A N   1 
ATOM   3467  C  CA  . LEU A 1 435 ? 106.986 68.540  51.310  1.00 15.62 ? 432  LEU A CA  1 
ATOM   3468  C  C   . LEU A 1 435 ? 106.670 67.044  51.180  1.00 15.80 ? 432  LEU A C   1 
ATOM   3469  O  O   . LEU A 1 435 ? 106.924 66.280  52.103  1.00 14.06 ? 432  LEU A O   1 
ATOM   3470  C  CB  . LEU A 1 435 ? 105.876 69.282  52.072  1.00 15.06 ? 432  LEU A CB  1 
ATOM   3471  C  CG  . LEU A 1 435 ? 106.246 70.720  52.482  1.00 13.90 ? 432  LEU A CG  1 
ATOM   3472  C  CD1 . LEU A 1 435 ? 105.032 71.450  53.047  1.00 12.16 ? 432  LEU A CD1 1 
ATOM   3473  C  CD2 . LEU A 1 435 ? 107.392 70.731  53.479  1.00 12.94 ? 432  LEU A CD2 1 
ATOM   3474  N  N   . LEU A 1 436 ? 106.142 66.634  50.029  1.00 14.99 ? 433  LEU A N   1 
ATOM   3475  C  CA  . LEU A 1 436 ? 105.839 65.237  49.796  1.00 15.59 ? 433  LEU A CA  1 
ATOM   3476  C  C   . LEU A 1 436 ? 107.105 64.434  49.559  1.00 14.74 ? 433  LEU A C   1 
ATOM   3477  O  O   . LEU A 1 436 ? 107.097 63.214  49.697  1.00 13.71 ? 433  LEU A O   1 
ATOM   3478  C  CB  . LEU A 1 436 ? 104.921 65.067  48.583  1.00 15.05 ? 433  LEU A CB  1 
ATOM   3479  C  CG  . LEU A 1 436 ? 103.476 65.484  48.746  1.00 14.00 ? 433  LEU A CG  1 
ATOM   3480  C  CD1 . LEU A 1 436 ? 102.793 65.396  47.385  1.00 13.47 ? 433  LEU A CD1 1 
ATOM   3481  C  CD2 . LEU A 1 436 ? 102.763 64.606  49.797  1.00 14.57 ? 433  LEU A CD2 1 
ATOM   3482  N  N   . GLY A 1 437 ? 108.183 65.125  49.214  1.00 14.50 ? 434  GLY A N   1 
ATOM   3483  C  CA  . GLY A 1 437 ? 109.445 64.486  48.924  1.00 15.29 ? 434  GLY A CA  1 
ATOM   3484  C  C   . GLY A 1 437 ? 109.548 64.093  47.462  1.00 15.79 ? 434  GLY A C   1 
ATOM   3485  O  O   . GLY A 1 437 ? 110.294 63.174  47.107  1.00 14.76 ? 434  GLY A O   1 
ATOM   3486  N  N   . LYS A 1 438 ? 108.821 64.793  46.598  1.00 16.11 ? 435  LYS A N   1 
ATOM   3487  C  CA  . LYS A 1 438 ? 108.859 64.490  45.165  1.00 16.39 ? 435  LYS A CA  1 
ATOM   3488  C  C   . LYS A 1 438 ? 110.249 64.813  44.645  1.00 17.04 ? 435  LYS A C   1 
ATOM   3489  O  O   . LYS A 1 438 ? 110.769 65.886  44.917  1.00 15.98 ? 435  LYS A O   1 
ATOM   3490  C  CB  . LYS A 1 438 ? 107.834 65.324  44.400  1.00 16.14 ? 435  LYS A CB  1 
ATOM   3491  C  CG  . LYS A 1 438 ? 107.588 64.883  42.962  1.00 17.10 ? 435  LYS A CG  1 
ATOM   3492  C  CD  . LYS A 1 438 ? 106.528 65.764  42.288  1.00 16.77 ? 435  LYS A CD  1 
ATOM   3493  C  CE  . LYS A 1 438 ? 106.010 65.167  40.988  1.00 19.41 ? 435  LYS A CE  1 
ATOM   3494  N  NZ  . LYS A 1 438 ? 105.193 63.926  41.207  1.00 21.25 ? 435  LYS A NZ  1 
ATOM   3495  N  N   . PRO A 1 439 ? 110.855 63.881  43.901  1.00 18.44 ? 436  PRO A N   1 
ATOM   3496  C  CA  . PRO A 1 439 ? 112.196 64.108  43.367  1.00 20.08 ? 436  PRO A CA  1 
ATOM   3497  C  C   . PRO A 1 439 ? 112.300 65.397  42.577  1.00 21.56 ? 436  PRO A C   1 
ATOM   3498  O  O   . PRO A 1 439 ? 111.403 65.728  41.803  1.00 22.28 ? 436  PRO A O   1 
ATOM   3499  C  CB  . PRO A 1 439 ? 112.422 62.904  42.452  1.00 19.78 ? 436  PRO A CB  1 
ATOM   3500  C  CG  . PRO A 1 439 ? 111.558 61.837  43.020  1.00 19.72 ? 436  PRO A CG  1 
ATOM   3501  C  CD  . PRO A 1 439 ? 110.346 62.541  43.556  1.00 19.08 ? 436  PRO A CD  1 
ATOM   3502  N  N   . GLY A 1 440 ? 113.394 66.121  42.785  1.00 23.46 ? 437  GLY A N   1 
ATOM   3503  C  CA  . GLY A 1 440 ? 113.629 67.379  42.092  1.00 24.00 ? 437  GLY A CA  1 
ATOM   3504  C  C   . GLY A 1 440 ? 113.241 68.606  42.889  1.00 24.91 ? 437  GLY A C   1 
ATOM   3505  O  O   . GLY A 1 440 ? 113.550 69.726  42.485  1.00 25.63 ? 437  GLY A O   1 
ATOM   3506  N  N   . PHE A 1 441 ? 112.579 68.404  44.028  1.00 24.85 ? 438  PHE A N   1 
ATOM   3507  C  CA  . PHE A 1 441 ? 112.131 69.509  44.853  1.00 23.90 ? 438  PHE A CA  1 
ATOM   3508  C  C   . PHE A 1 441 ? 112.782 69.513  46.233  1.00 24.19 ? 438  PHE A C   1 
ATOM   3509  O  O   . PHE A 1 441 ? 112.288 70.164  47.162  1.00 24.46 ? 438  PHE A O   1 
ATOM   3510  C  CB  . PHE A 1 441 ? 110.605 69.428  45.011  1.00 24.33 ? 438  PHE A CB  1 
ATOM   3511  C  CG  . PHE A 1 441 ? 109.841 69.692  43.737  1.00 23.52 ? 438  PHE A CG  1 
ATOM   3512  C  CD1 . PHE A 1 441 ? 109.527 68.661  42.871  1.00 21.25 ? 438  PHE A CD1 1 
ATOM   3513  C  CD2 . PHE A 1 441 ? 109.423 70.974  43.424  1.00 23.78 ? 438  PHE A CD2 1 
ATOM   3514  C  CE1 . PHE A 1 441 ? 108.821 68.902  41.694  1.00 21.13 ? 438  PHE A CE1 1 
ATOM   3515  C  CE2 . PHE A 1 441 ? 108.716 71.229  42.244  1.00 25.88 ? 438  PHE A CE2 1 
ATOM   3516  C  CZ  . PHE A 1 441 ? 108.420 70.186  41.377  1.00 24.69 ? 438  PHE A CZ  1 
ATOM   3517  N  N   . GLU A 1 442 ? 113.905 68.820  46.364  1.00 24.54 ? 439  GLU A N   1 
ATOM   3518  C  CA  . GLU A 1 442 ? 114.580 68.691  47.659  1.00 24.26 ? 439  GLU A CA  1 
ATOM   3519  C  C   . GLU A 1 442 ? 114.993 69.980  48.383  1.00 23.66 ? 439  GLU A C   1 
ATOM   3520  O  O   . GLU A 1 442 ? 114.829 70.080  49.595  1.00 22.46 ? 439  GLU A O   1 
ATOM   3521  C  CB  . GLU A 1 442 ? 115.801 67.768  47.546  1.00 25.17 ? 439  GLU A CB  1 
ATOM   3522  C  CG  . GLU A 1 442 ? 115.499 66.314  47.145  1.00 26.08 ? 439  GLU A CG  1 
ATOM   3523  C  CD  . GLU A 1 442 ? 115.268 66.110  45.649  1.00 28.08 ? 439  GLU A CD  1 
ATOM   3524  O  OE1 . GLU A 1 442 ? 115.436 67.076  44.871  1.00 26.99 ? 439  GLU A OE1 1 
ATOM   3525  O  OE2 . GLU A 1 442 ? 114.956 64.961  45.252  1.00 28.34 ? 439  GLU A OE2 1 
ATOM   3526  N  N   . GLU A 1 443 ? 115.550 70.953  47.672  1.00 23.39 ? 440  GLU A N   1 
ATOM   3527  C  CA  . GLU A 1 443 ? 115.982 72.189  48.329  1.00 23.27 ? 440  GLU A CA  1 
ATOM   3528  C  C   . GLU A 1 443 ? 114.820 72.935  48.967  1.00 22.46 ? 440  GLU A C   1 
ATOM   3529  O  O   . GLU A 1 443 ? 114.926 73.413  50.108  1.00 20.26 ? 440  GLU A O   1 
ATOM   3530  C  CB  . GLU A 1 443 ? 116.661 73.127  47.350  1.00 24.21 ? 440  GLU A CB  1 
ATOM   3531  C  CG  . GLU A 1 443 ? 117.113 74.425  47.998  1.00 27.88 ? 440  GLU A CG  1 
ATOM   3532  C  CD  . GLU A 1 443 ? 117.736 75.373  47.005  1.00 33.84 ? 440  GLU A CD  1 
ATOM   3533  O  OE1 . GLU A 1 443 ? 117.245 75.433  45.857  1.00 40.56 ? 440  GLU A OE1 1 
ATOM   3534  O  OE2 . GLU A 1 443 ? 118.705 76.071  47.369  1.00 38.56 ? 440  GLU A OE2 1 
ATOM   3535  N  N   . LEU A 1 444 ? 113.725 73.069  48.212  1.00 20.45 ? 441  LEU A N   1 
ATOM   3536  C  CA  . LEU A 1 444 ? 112.558 73.752  48.710  1.00 20.08 ? 441  LEU A CA  1 
ATOM   3537  C  C   . LEU A 1 444 ? 111.999 72.998  49.924  1.00 19.67 ? 441  LEU A C   1 
ATOM   3538  O  O   . LEU A 1 444 ? 111.466 73.611  50.839  1.00 20.73 ? 441  LEU A O   1 
ATOM   3539  C  CB  . LEU A 1 444 ? 111.500 73.868  47.607  1.00 19.85 ? 441  LEU A CB  1 
ATOM   3540  C  CG  . LEU A 1 444 ? 110.180 74.557  47.989  1.00 18.86 ? 441  LEU A CG  1 
ATOM   3541  C  CD1 . LEU A 1 444 ? 110.416 76.006  48.399  1.00 17.09 ? 441  LEU A CD1 1 
ATOM   3542  C  CD2 . LEU A 1 444 ? 109.155 74.490  46.839  1.00 17.19 ? 441  LEU A CD2 1 
ATOM   3543  N  N   . LYS A 1 445 ? 112.142 71.673  49.945  1.00 19.42 ? 442  LYS A N   1 
ATOM   3544  C  CA  . LYS A 1 445 ? 111.626 70.872  51.064  1.00 19.50 ? 442  LYS A CA  1 
ATOM   3545  C  C   . LYS A 1 445 ? 112.290 71.266  52.382  1.00 19.60 ? 442  LYS A C   1 
ATOM   3546  O  O   . LYS A 1 445 ? 111.607 71.471  53.389  1.00 17.82 ? 442  LYS A O   1 
ATOM   3547  C  CB  . LYS A 1 445 ? 111.826 69.375  50.811  1.00 19.62 ? 442  LYS A CB  1 
ATOM   3548  C  CG  . LYS A 1 445 ? 111.319 68.446  51.924  1.00 19.34 ? 442  LYS A CG  1 
ATOM   3549  C  CD  . LYS A 1 445 ? 111.585 66.984  51.548  1.00 22.15 ? 442  LYS A CD  1 
ATOM   3550  C  CE  . LYS A 1 445 ? 110.987 65.989  52.534  1.00 22.82 ? 442  LYS A CE  1 
ATOM   3551  N  NZ  . LYS A 1 445 ? 111.542 66.101  53.900  1.00 25.25 ? 442  LYS A NZ  1 
ATOM   3552  N  N   . ALA A 1 446 ? 113.613 71.382  52.372  1.00 19.10 ? 443  ALA A N   1 
ATOM   3553  C  CA  . ALA A 1 446 ? 114.351 71.738  53.594  1.00 19.58 ? 443  ALA A CA  1 
ATOM   3554  C  C   . ALA A 1 446 ? 113.978 73.144  54.076  1.00 19.76 ? 443  ALA A C   1 
ATOM   3555  O  O   . ALA A 1 446 ? 113.818 73.383  55.276  1.00 18.95 ? 443  ALA A O   1 
ATOM   3556  C  CB  . ALA A 1 446 ? 115.855 71.624  53.366  1.00 19.00 ? 443  ALA A CB  1 
ATOM   3557  N  N   . GLU A 1 447 ? 113.830 74.062  53.127  1.00 20.41 ? 444  GLU A N   1 
ATOM   3558  C  CA  . GLU A 1 447 ? 113.451 75.444  53.420  1.00 21.01 ? 444  GLU A CA  1 
ATOM   3559  C  C   . GLU A 1 447 ? 112.062 75.534  54.081  1.00 19.30 ? 444  GLU A C   1 
ATOM   3560  O  O   . GLU A 1 447 ? 111.880 76.222  55.085  1.00 19.13 ? 444  GLU A O   1 
ATOM   3561  C  CB  . GLU A 1 447 ? 113.473 76.240  52.109  1.00 22.93 ? 444  GLU A CB  1 
ATOM   3562  C  CG  . GLU A 1 447 ? 112.903 77.641  52.174  1.00 28.87 ? 444  GLU A CG  1 
ATOM   3563  C  CD  . GLU A 1 447 ? 112.899 78.338  50.802  1.00 37.42 ? 444  GLU A CD  1 
ATOM   3564  O  OE1 . GLU A 1 447 ? 113.643 77.906  49.885  1.00 40.98 ? 444  GLU A OE1 1 
ATOM   3565  O  OE2 . GLU A 1 447 ? 112.146 79.324  50.644  1.00 41.98 ? 444  GLU A OE2 1 
ATOM   3566  N  N   . LEU A 1 448 ? 111.081 74.849  53.510  1.00 18.55 ? 445  LEU A N   1 
ATOM   3567  C  CA  . LEU A 1 448 ? 109.706 74.877  54.048  1.00 17.80 ? 445  LEU A CA  1 
ATOM   3568  C  C   . LEU A 1 448 ? 109.593 74.120  55.387  1.00 17.53 ? 445  LEU A C   1 
ATOM   3569  O  O   . LEU A 1 448 ? 108.848 74.528  56.284  1.00 15.51 ? 445  LEU A O   1 
ATOM   3570  C  CB  . LEU A 1 448 ? 108.708 74.310  53.028  1.00 17.50 ? 445  LEU A CB  1 
ATOM   3571  C  CG  . LEU A 1 448 ? 108.553 75.029  51.687  1.00 17.65 ? 445  LEU A CG  1 
ATOM   3572  C  CD1 . LEU A 1 448 ? 107.599 74.240  50.787  1.00 17.28 ? 445  LEU A CD1 1 
ATOM   3573  C  CD2 . LEU A 1 448 ? 108.082 76.501  51.855  1.00 17.22 ? 445  LEU A CD2 1 
ATOM   3574  N  N   . GLU A 1 449 ? 110.304 73.003  55.519  1.00 17.04 ? 446  GLU A N   1 
ATOM   3575  C  CA  . GLU A 1 449 ? 110.272 72.275  56.774  1.00 17.63 ? 446  GLU A CA  1 
ATOM   3576  C  C   . GLU A 1 449 ? 110.852 73.135  57.894  1.00 17.61 ? 446  GLU A C   1 
ATOM   3577  O  O   . GLU A 1 449 ? 110.377 73.089  59.018  1.00 17.17 ? 446  GLU A O   1 
ATOM   3578  C  CB  . GLU A 1 449 ? 111.004 70.936  56.653  1.00 18.28 ? 446  GLU A CB  1 
ATOM   3579  C  CG  . GLU A 1 449 ? 110.203 69.950  55.827  1.00 20.17 ? 446  GLU A CG  1 
ATOM   3580  C  CD  . GLU A 1 449 ? 110.869 68.618  55.673  1.00 24.37 ? 446  GLU A CD  1 
ATOM   3581  O  OE1 . GLU A 1 449 ? 112.091 68.530  55.926  1.00 27.78 ? 446  GLU A OE1 1 
ATOM   3582  O  OE2 . GLU A 1 449 ? 110.168 67.654  55.283  1.00 25.52 ? 446  GLU A OE2 1 
ATOM   3583  N  N   . GLU A 1 450 ? 111.867 73.938  57.578  1.00 16.64 ? 447  GLU A N   1 
ATOM   3584  C  CA  . GLU A 1 450 ? 112.459 74.803  58.578  1.00 17.54 ? 447  GLU A CA  1 
ATOM   3585  C  C   . GLU A 1 450 ? 111.420 75.841  58.996  1.00 16.35 ? 447  GLU A C   1 
ATOM   3586  O  O   . GLU A 1 450 ? 111.296 76.156  60.156  1.00 15.15 ? 447  GLU A O   1 
ATOM   3587  C  CB  . GLU A 1 450 ? 113.733 75.460  58.050  1.00 17.71 ? 447  GLU A CB  1 
ATOM   3588  C  CG  . GLU A 1 450 ? 114.478 76.251  59.079  1.00 22.02 ? 447  GLU A CG  1 
ATOM   3589  C  CD  . GLU A 1 450 ? 114.900 75.400  60.285  1.00 26.95 ? 447  GLU A CD  1 
ATOM   3590  O  OE1 . GLU A 1 450 ? 115.084 74.167  60.136  1.00 28.37 ? 447  GLU A OE1 1 
ATOM   3591  O  OE2 . GLU A 1 450 ? 115.058 75.977  61.383  1.00 32.39 ? 447  GLU A OE2 1 
ATOM   3592  N  N   . ARG A 1 451 ? 110.642 76.334  58.045  1.00 17.85 ? 448  ARG A N   1 
ATOM   3593  C  CA  . ARG A 1 451 ? 109.586 77.302  58.352  1.00 18.99 ? 448  ARG A CA  1 
ATOM   3594  C  C   . ARG A 1 451 ? 108.487 76.699  59.220  1.00 20.03 ? 448  ARG A C   1 
ATOM   3595  O  O   . ARG A 1 451 ? 107.923 77.376  60.074  1.00 19.70 ? 448  ARG A O   1 
ATOM   3596  C  CB  . ARG A 1 451 ? 108.979 77.876  57.064  1.00 18.97 ? 448  ARG A CB  1 
ATOM   3597  C  CG  . ARG A 1 451 ? 109.968 78.760  56.267  1.00 20.42 ? 448  ARG A CG  1 
ATOM   3598  C  CD  . ARG A 1 451 ? 109.339 79.306  54.997  1.00 23.03 ? 448  ARG A CD  1 
ATOM   3599  N  NE  . ARG A 1 451 ? 108.207 80.179  55.285  1.00 21.64 ? 448  ARG A NE  1 
ATOM   3600  C  CZ  . ARG A 1 451 ? 107.423 80.723  54.357  1.00 24.15 ? 448  ARG A CZ  1 
ATOM   3601  N  NH1 . ARG A 1 451 ? 107.646 80.493  53.073  1.00 20.72 ? 448  ARG A NH1 1 
ATOM   3602  N  NH2 . ARG A 1 451 ? 106.410 81.495  54.722  1.00 21.29 ? 448  ARG A NH2 1 
ATOM   3603  N  N   . LEU A 1 452 ? 108.196 75.422  59.003  1.00 21.08 ? 449  LEU A N   1 
ATOM   3604  C  CA  . LEU A 1 452 ? 107.148 74.729  59.756  1.00 22.68 ? 449  LEU A CA  1 
ATOM   3605  C  C   . LEU A 1 452 ? 107.660 74.253  61.096  1.00 24.13 ? 449  LEU A C   1 
ATOM   3606  O  O   . LEU A 1 452 ? 106.895 74.135  62.049  1.00 24.20 ? 449  LEU A O   1 
ATOM   3607  C  CB  . LEU A 1 452 ? 106.653 73.521  58.964  1.00 22.68 ? 449  LEU A CB  1 
ATOM   3608  C  CG  . LEU A 1 452 ? 105.954 73.827  57.643  1.00 21.27 ? 449  LEU A CG  1 
ATOM   3609  C  CD1 . LEU A 1 452 ? 105.810 72.558  56.813  1.00 21.81 ? 449  LEU A CD1 1 
ATOM   3610  C  CD2 . LEU A 1 452 ? 104.599 74.487  57.906  1.00 20.54 ? 449  LEU A CD2 1 
ATOM   3611  N  N   . LYS A 1 453 ? 108.964 73.971  61.143  1.00 25.81 ? 450  LYS A N   1 
ATOM   3612  C  CA  . LYS A 1 453 ? 109.630 73.480  62.342  1.00 27.24 ? 450  LYS A CA  1 
ATOM   3613  C  C   . LYS A 1 453 ? 109.568 74.569  63.387  1.00 27.51 ? 450  LYS A C   1 
ATOM   3614  O  O   . LYS A 1 453 ? 108.521 74.787  63.990  1.00 27.25 ? 450  LYS A O   1 
ATOM   3615  C  CB  . LYS A 1 453 ? 111.077 73.128  61.995  1.00 27.18 ? 450  LYS A CB  1 
ATOM   3616  C  CG  . LYS A 1 453 ? 111.875 72.446  63.058  1.00 30.17 ? 450  LYS A CG  1 
ATOM   3617  C  CD  . LYS A 1 453 ? 113.254 72.067  62.514  1.00 33.87 ? 450  LYS A CD  1 
ATOM   3618  C  CE  . LYS A 1 453 ? 113.147 71.113  61.311  1.00 38.02 ? 450  LYS A CE  1 
ATOM   3619  N  NZ  . LYS A 1 453 ? 114.474 70.781  60.714  1.00 41.85 ? 450  LYS A NZ  1 
ATOM   3620  O  OXT . LYS A 1 453 ? 110.551 75.275  63.621  1.00 29.01 ? 450  LYS A OXT 1 
ATOM   3621  N  N   . THR B 1 6   ? 93.678  65.341  72.157  1.00 43.40 ? 3    THR B N   1 
ATOM   3622  C  CA  . THR B 1 6   ? 93.860  66.054  73.459  1.00 43.35 ? 3    THR B CA  1 
ATOM   3623  C  C   . THR B 1 6   ? 92.768  67.114  73.694  1.00 41.67 ? 3    THR B C   1 
ATOM   3624  O  O   . THR B 1 6   ? 91.974  66.991  74.629  1.00 42.81 ? 3    THR B O   1 
ATOM   3625  C  CB  . THR B 1 6   ? 95.273  66.673  73.548  1.00 44.45 ? 3    THR B CB  1 
ATOM   3626  O  OG1 . THR B 1 6   ? 95.395  67.442  74.759  1.00 47.38 ? 3    THR B OG1 1 
ATOM   3627  C  CG2 . THR B 1 6   ? 95.559  67.561  72.324  1.00 46.12 ? 3    THR B CG2 1 
ATOM   3628  N  N   . HIS B 1 7   ? 92.742  68.149  72.852  1.00 38.96 ? 4    HIS B N   1 
ATOM   3629  C  CA  . HIS B 1 7   ? 91.737  69.224  72.914  1.00 35.93 ? 4    HIS B CA  1 
ATOM   3630  C  C   . HIS B 1 7   ? 91.978  70.198  71.771  1.00 32.30 ? 4    HIS B C   1 
ATOM   3631  O  O   . HIS B 1 7   ? 93.079  70.252  71.214  1.00 32.62 ? 4    HIS B O   1 
ATOM   3632  C  CB  . HIS B 1 7   ? 91.764  69.972  74.253  1.00 36.54 ? 4    HIS B CB  1 
ATOM   3633  C  CG  . HIS B 1 7   ? 93.091  70.582  74.577  1.00 38.70 ? 4    HIS B CG  1 
ATOM   3634  N  ND1 . HIS B 1 7   ? 94.092  69.885  75.224  1.00 42.06 ? 4    HIS B ND1 1 
ATOM   3635  C  CD2 . HIS B 1 7   ? 93.591  71.817  74.333  1.00 40.56 ? 4    HIS B CD2 1 
ATOM   3636  C  CE1 . HIS B 1 7   ? 95.147  70.669  75.370  1.00 42.82 ? 4    HIS B CE1 1 
ATOM   3637  N  NE2 . HIS B 1 7   ? 94.869  71.847  74.841  1.00 42.31 ? 4    HIS B NE2 1 
ATOM   3638  N  N   . VAL B 1 8   ? 90.949  70.970  71.432  1.00 29.04 ? 5    VAL B N   1 
ATOM   3639  C  CA  . VAL B 1 8   ? 91.031  71.965  70.358  1.00 26.72 ? 5    VAL B CA  1 
ATOM   3640  C  C   . VAL B 1 8   ? 91.923  73.149  70.771  1.00 25.24 ? 5    VAL B C   1 
ATOM   3641  O  O   . VAL B 1 8   ? 91.810  73.665  71.892  1.00 25.52 ? 5    VAL B O   1 
ATOM   3642  C  CB  . VAL B 1 8   ? 89.623  72.522  69.988  1.00 26.55 ? 5    VAL B CB  1 
ATOM   3643  C  CG1 . VAL B 1 8   ? 89.725  73.642  68.935  1.00 25.68 ? 5    VAL B CG1 1 
ATOM   3644  C  CG2 . VAL B 1 8   ? 88.699  71.398  69.515  1.00 26.81 ? 5    VAL B CG2 1 
ATOM   3645  N  N   . THR B 1 9   ? 92.810  73.566  69.872  1.00 22.28 ? 6    THR B N   1 
ATOM   3646  C  CA  . THR B 1 9   ? 93.700  74.695  70.113  1.00 19.94 ? 6    THR B CA  1 
ATOM   3647  C  C   . THR B 1 9   ? 93.622  75.695  68.958  1.00 18.61 ? 6    THR B C   1 
ATOM   3648  O  O   . THR B 1 9   ? 93.186  75.353  67.861  1.00 16.80 ? 6    THR B O   1 
ATOM   3649  C  CB  . THR B 1 9   ? 95.169  74.235  70.302  1.00 19.86 ? 6    THR B CB  1 
ATOM   3650  O  OG1 . THR B 1 9   ? 95.576  73.445  69.178  1.00 18.87 ? 6    THR B OG1 1 
ATOM   3651  C  CG2 . THR B 1 9   ? 95.310  73.385  71.559  1.00 20.98 ? 6    THR B CG2 1 
ATOM   3652  N  N   . PHE B 1 10  ? 94.043  76.935  69.229  1.00 17.31 ? 7    PHE B N   1 
ATOM   3653  C  CA  . PHE B 1 10  ? 94.037  78.018  68.243  1.00 15.39 ? 7    PHE B CA  1 
ATOM   3654  C  C   . PHE B 1 10  ? 95.465  78.498  68.062  1.00 15.29 ? 7    PHE B C   1 
ATOM   3655  O  O   . PHE B 1 10  ? 96.158  78.780  69.034  1.00 13.07 ? 7    PHE B O   1 
ATOM   3656  C  CB  . PHE B 1 10  ? 93.140  79.173  68.695  1.00 15.83 ? 7    PHE B CB  1 
ATOM   3657  C  CG  . PHE B 1 10  ? 93.187  80.368  67.788  1.00 13.23 ? 7    PHE B CG  1 
ATOM   3658  C  CD1 . PHE B 1 10  ? 92.710  80.289  66.500  1.00 12.86 ? 7    PHE B CD1 1 
ATOM   3659  C  CD2 . PHE B 1 10  ? 93.657  81.588  68.242  1.00 12.93 ? 7    PHE B CD2 1 
ATOM   3660  C  CE1 . PHE B 1 10  ? 92.767  81.385  65.656  1.00 14.36 ? 7    PHE B CE1 1 
ATOM   3661  C  CE2 . PHE B 1 10  ? 93.708  82.673  67.414  1.00 13.05 ? 7    PHE B CE2 1 
ATOM   3662  C  CZ  . PHE B 1 10  ? 93.256  82.574  66.106  1.00 12.89 ? 7    PHE B CZ  1 
ATOM   3663  N  N   . ASP B 1 11  ? 95.911  78.543  66.812  1.00 13.74 ? 8    ASP B N   1 
ATOM   3664  C  CA  . ASP B 1 11  ? 97.274  78.935  66.499  1.00 14.45 ? 8    ASP B CA  1 
ATOM   3665  C  C   . ASP B 1 11  ? 97.268  80.079  65.489  1.00 14.55 ? 8    ASP B C   1 
ATOM   3666  O  O   . ASP B 1 11  ? 96.773  79.933  64.374  1.00 14.96 ? 8    ASP B O   1 
ATOM   3667  C  CB  . ASP B 1 11  ? 98.027  77.698  65.965  1.00 15.31 ? 8    ASP B CB  1 
ATOM   3668  C  CG  . ASP B 1 11  ? 99.476  77.980  65.563  1.00 18.84 ? 8    ASP B CG  1 
ATOM   3669  O  OD1 . ASP B 1 11  ? 100.017 79.060  65.881  1.00 17.45 ? 8    ASP B OD1 1 
ATOM   3670  O  OD2 . ASP B 1 11  ? 100.076 77.094  64.903  1.00 19.74 ? 8    ASP B OD2 1 
ATOM   3671  N  N   . TYR B 1 12  ? 97.791  81.227  65.897  1.00 13.62 ? 9    TYR B N   1 
ATOM   3672  C  CA  . TYR B 1 12  ? 97.918  82.363  64.996  1.00 14.79 ? 9    TYR B CA  1 
ATOM   3673  C  C   . TYR B 1 12  ? 99.395  82.633  64.693  1.00 14.43 ? 9    TYR B C   1 
ATOM   3674  O  O   . TYR B 1 12  ? 99.733  83.631  64.047  1.00 12.62 ? 9    TYR B O   1 
ATOM   3675  C  CB  . TYR B 1 12  ? 97.236  83.608  65.576  1.00 13.76 ? 9    TYR B CB  1 
ATOM   3676  C  CG  . TYR B 1 12  ? 97.760  84.075  66.917  1.00 17.26 ? 9    TYR B CG  1 
ATOM   3677  C  CD1 . TYR B 1 12  ? 98.870  84.905  66.997  1.00 21.12 ? 9    TYR B CD1 1 
ATOM   3678  C  CD2 . TYR B 1 12  ? 97.130  83.712  68.095  1.00 16.02 ? 9    TYR B CD2 1 
ATOM   3679  C  CE1 . TYR B 1 12  ? 99.357  85.333  68.218  1.00 26.16 ? 9    TYR B CE1 1 
ATOM   3680  C  CE2 . TYR B 1 12  ? 97.586  84.154  69.320  1.00 21.72 ? 9    TYR B CE2 1 
ATOM   3681  C  CZ  . TYR B 1 12  ? 98.710  84.965  69.376  1.00 26.62 ? 9    TYR B CZ  1 
ATOM   3682  O  OH  . TYR B 1 12  ? 99.179  85.403  70.589  1.00 32.13 ? 9    TYR B OH  1 
ATOM   3683  N  N   . SER B 1 13  ? 100.270 81.709  65.096  1.00 14.52 ? 10   SER B N   1 
ATOM   3684  C  CA  . SER B 1 13  ? 101.713 81.906  64.913  1.00 15.04 ? 10   SER B CA  1 
ATOM   3685  C  C   . SER B 1 13  ? 102.160 81.976  63.448  1.00 16.46 ? 10   SER B C   1 
ATOM   3686  O  O   . SER B 1 13  ? 103.136 82.667  63.142  1.00 17.93 ? 10   SER B O   1 
ATOM   3687  C  CB  . SER B 1 13  ? 102.532 80.859  65.673  1.00 15.58 ? 10   SER B CB  1 
ATOM   3688  O  OG  . SER B 1 13  ? 102.330 79.581  65.125  1.00 13.93 ? 10   SER B OG  1 
ATOM   3689  N  N   . LYS B 1 14  ? 101.420 81.337  62.539  1.00 16.13 ? 11   LYS B N   1 
ATOM   3690  C  CA  . LYS B 1 14  ? 101.779 81.390  61.132  1.00 17.21 ? 11   LYS B CA  1 
ATOM   3691  C  C   . LYS B 1 14  ? 101.370 82.730  60.508  1.00 16.27 ? 11   LYS B C   1 
ATOM   3692  O  O   . LYS B 1 14  ? 101.702 82.996  59.353  1.00 18.02 ? 11   LYS B O   1 
ATOM   3693  C  CB  . LYS B 1 14  ? 101.147 80.239  60.333  1.00 16.94 ? 11   LYS B CB  1 
ATOM   3694  C  CG  . LYS B 1 14  ? 101.532 78.828  60.793  1.00 22.80 ? 11   LYS B CG  1 
ATOM   3695  C  CD  . LYS B 1 14  ? 103.016 78.570  60.770  1.00 30.39 ? 11   LYS B CD  1 
ATOM   3696  C  CE  . LYS B 1 14  ? 103.322 77.062  60.998  1.00 35.61 ? 11   LYS B CE  1 
ATOM   3697  N  NZ  . LYS B 1 14  ? 102.649 76.485  62.205  1.00 39.70 ? 11   LYS B NZ  1 
ATOM   3698  N  N   . ALA B 1 15  ? 100.653 83.566  61.255  1.00 14.40 ? 12   ALA B N   1 
ATOM   3699  C  CA  . ALA B 1 15  ? 100.212 84.875  60.737  1.00 13.12 ? 12   ALA B CA  1 
ATOM   3700  C  C   . ALA B 1 15  ? 100.970 86.056  61.371  1.00 13.20 ? 12   ALA B C   1 
ATOM   3701  O  O   . ALA B 1 15  ? 100.622 87.215  61.157  1.00 13.12 ? 12   ALA B O   1 
ATOM   3702  C  CB  . ALA B 1 15  ? 98.744  85.038  60.944  1.00 13.02 ? 12   ALA B CB  1 
ATOM   3703  N  N   . LEU B 1 16  ? 102.014 85.760  62.135  1.00 14.27 ? 13   LEU B N   1 
ATOM   3704  C  CA  . LEU B 1 16  ? 102.799 86.789  62.796  1.00 15.59 ? 13   LEU B CA  1 
ATOM   3705  C  C   . LEU B 1 16  ? 103.538 87.751  61.853  1.00 16.55 ? 13   LEU B C   1 
ATOM   3706  O  O   . LEU B 1 16  ? 104.033 88.794  62.306  1.00 16.92 ? 13   LEU B O   1 
ATOM   3707  C  CB  . LEU B 1 16  ? 103.769 86.168  63.817  1.00 16.29 ? 13   LEU B CB  1 
ATOM   3708  C  CG  . LEU B 1 16  ? 103.036 85.629  65.066  1.00 17.87 ? 13   LEU B CG  1 
ATOM   3709  C  CD1 . LEU B 1 16  ? 103.996 84.899  65.997  1.00 20.47 ? 13   LEU B CD1 1 
ATOM   3710  C  CD2 . LEU B 1 16  ? 102.304 86.773  65.810  1.00 17.46 ? 13   LEU B CD2 1 
ATOM   3711  N  N   . SER B 1 17  ? 103.628 87.424  60.563  1.00 16.50 ? 14   SER B N   1 
ATOM   3712  C  CA  . SER B 1 17  ? 104.254 88.338  59.628  1.00 17.95 ? 14   SER B CA  1 
ATOM   3713  C  C   . SER B 1 17  ? 103.230 89.424  59.233  1.00 17.38 ? 14   SER B C   1 
ATOM   3714  O  O   . SER B 1 17  ? 103.588 90.444  58.635  1.00 18.99 ? 14   SER B O   1 
ATOM   3715  C  CB  . SER B 1 17  ? 104.793 87.611  58.396  1.00 19.07 ? 14   SER B CB  1 
ATOM   3716  O  OG  . SER B 1 17  ? 103.720 87.093  57.647  1.00 24.71 ? 14   SER B OG  1 
ATOM   3717  N  N   . PHE B 1 18  ? 101.970 89.226  59.606  1.00 15.52 ? 15   PHE B N   1 
ATOM   3718  C  CA  . PHE B 1 18  ? 100.924 90.197  59.328  1.00 16.24 ? 15   PHE B CA  1 
ATOM   3719  C  C   . PHE B 1 18  ? 100.438 90.926  60.584  1.00 17.83 ? 15   PHE B C   1 
ATOM   3720  O  O   . PHE B 1 18  ? 99.912  92.019  60.497  1.00 17.45 ? 15   PHE B O   1 
ATOM   3721  C  CB  . PHE B 1 18  ? 99.697  89.500  58.758  1.00 15.38 ? 15   PHE B CB  1 
ATOM   3722  C  CG  . PHE B 1 18  ? 99.937  88.807  57.471  1.00 14.40 ? 15   PHE B CG  1 
ATOM   3723  C  CD1 . PHE B 1 18  ? 100.181 87.442  57.441  1.00 15.64 ? 15   PHE B CD1 1 
ATOM   3724  C  CD2 . PHE B 1 18  ? 99.884  89.503  56.284  1.00 14.51 ? 15   PHE B CD2 1 
ATOM   3725  C  CE1 . PHE B 1 18  ? 100.371 86.787  56.248  1.00 17.01 ? 15   PHE B CE1 1 
ATOM   3726  C  CE2 . PHE B 1 18  ? 100.099 88.860  55.087  1.00 18.70 ? 15   PHE B CE2 1 
ATOM   3727  C  CZ  . PHE B 1 18  ? 100.341 87.494  55.067  1.00 15.89 ? 15   PHE B CZ  1 
ATOM   3728  N  N   . ILE B 1 19  ? 100.533 90.269  61.733  1.00 18.98 ? 16   ILE B N   1 
ATOM   3729  C  CA  . ILE B 1 19  ? 100.064 90.845  62.979  1.00 21.01 ? 16   ILE B CA  1 
ATOM   3730  C  C   . ILE B 1 19  ? 101.144 90.770  64.063  1.00 20.03 ? 16   ILE B C   1 
ATOM   3731  O  O   . ILE B 1 19  ? 101.786 89.741  64.250  1.00 22.12 ? 16   ILE B O   1 
ATOM   3732  C  CB  . ILE B 1 19  ? 98.751  90.161  63.440  1.00 22.41 ? 16   ILE B CB  1 
ATOM   3733  C  CG1 . ILE B 1 19  ? 98.928  88.679  63.665  1.00 25.83 ? 16   ILE B CG1 1 
ATOM   3734  C  CG2 . ILE B 1 19  ? 97.677  90.267  62.384  1.00 25.35 ? 16   ILE B CG2 1 
ATOM   3735  C  CD1 . ILE B 1 19  ? 97.588  87.973  63.685  1.00 27.48 ? 16   ILE B CD1 1 
ATOM   3736  N  N   . GLY B 1 20  ? 101.384 91.884  64.726  1.00 19.13 ? 17   GLY B N   1 
ATOM   3737  C  CA  . GLY B 1 20  ? 102.371 91.927  65.800  1.00 18.91 ? 17   GLY B CA  1 
ATOM   3738  C  C   . GLY B 1 20  ? 101.741 91.407  67.070  1.00 17.94 ? 17   GLY B C   1 
ATOM   3739  O  O   . GLY B 1 20  ? 100.523 91.549  67.259  1.00 16.45 ? 17   GLY B O   1 
ATOM   3740  N  N   . GLU B 1 21  ? 102.543 90.761  67.930  1.00 18.21 ? 18   GLU B N   1 
ATOM   3741  C  CA  . GLU B 1 21  ? 102.023 90.255  69.203  1.00 16.93 ? 18   GLU B CA  1 
ATOM   3742  C  C   . GLU B 1 21  ? 101.355 91.387  69.999  1.00 15.05 ? 18   GLU B C   1 
ATOM   3743  O  O   . GLU B 1 21  ? 100.346 91.152  70.656  1.00 14.09 ? 18   GLU B O   1 
ATOM   3744  C  CB  . GLU B 1 21  ? 103.118 89.574  70.051  1.00 18.70 ? 18   GLU B CB  1 
ATOM   3745  C  CG  . GLU B 1 21  ? 103.473 88.104  69.651  1.00 21.97 ? 18   GLU B CG  1 
ATOM   3746  C  CD  . GLU B 1 21  ? 102.393 87.062  70.012  1.00 26.89 ? 18   GLU B CD  1 
ATOM   3747  O  OE1 . GLU B 1 21  ? 101.327 87.413  70.571  1.00 30.93 ? 18   GLU B OE1 1 
ATOM   3748  O  OE2 . GLU B 1 21  ? 102.626 85.862  69.758  1.00 35.09 ? 18   GLU B OE2 1 
ATOM   3749  N  N   . HIS B 1 22  ? 101.882 92.611  69.912  1.00 14.57 ? 19   HIS B N   1 
ATOM   3750  C  CA  . HIS B 1 22  ? 101.300 93.746  70.658  1.00 14.63 ? 19   HIS B CA  1 
ATOM   3751  C  C   . HIS B 1 22  ? 99.861  94.038  70.251  1.00 14.30 ? 19   HIS B C   1 
ATOM   3752  O  O   . HIS B 1 22  ? 99.078  94.534  71.049  1.00 13.08 ? 19   HIS B O   1 
ATOM   3753  C  CB  . HIS B 1 22  ? 102.151 95.015  70.519  1.00 15.45 ? 19   HIS B CB  1 
ATOM   3754  C  CG  . HIS B 1 22  ? 102.220 95.548  69.126  1.00 16.51 ? 19   HIS B CG  1 
ATOM   3755  N  ND1 . HIS B 1 22  ? 103.095 95.052  68.188  1.00 16.93 ? 19   HIS B ND1 1 
ATOM   3756  C  CD2 . HIS B 1 22  ? 101.520 96.532  68.512  1.00 16.73 ? 19   HIS B CD2 1 
ATOM   3757  C  CE1 . HIS B 1 22  ? 102.923 95.702  67.048  1.00 19.25 ? 19   HIS B CE1 1 
ATOM   3758  N  NE2 . HIS B 1 22  ? 101.971 96.603  67.219  1.00 16.36 ? 19   HIS B NE2 1 
ATOM   3759  N  N   . GLU B 1 23  ? 99.502  93.716  69.013  1.00 14.01 ? 20   GLU B N   1 
ATOM   3760  C  CA  . GLU B 1 23  ? 98.142  93.968  68.566  1.00 15.42 ? 20   GLU B CA  1 
ATOM   3761  C  C   . GLU B 1 23  ? 97.142  93.151  69.389  1.00 15.97 ? 20   GLU B C   1 
ATOM   3762  O  O   . GLU B 1 23  ? 96.028  93.580  69.624  1.00 16.77 ? 20   GLU B O   1 
ATOM   3763  C  CB  . GLU B 1 23  ? 97.982  93.683  67.078  1.00 13.92 ? 20   GLU B CB  1 
ATOM   3764  C  CG  . GLU B 1 23  ? 98.955  94.450  66.186  1.00 15.19 ? 20   GLU B CG  1 
ATOM   3765  C  CD  . GLU B 1 23  ? 98.677  94.246  64.712  1.00 15.83 ? 20   GLU B CD  1 
ATOM   3766  O  OE1 . GLU B 1 23  ? 97.484  94.246  64.316  1.00 19.86 ? 20   GLU B OE1 1 
ATOM   3767  O  OE2 . GLU B 1 23  ? 99.646  94.103  63.943  1.00 17.83 ? 20   GLU B OE2 1 
ATOM   3768  N  N   . ILE B 1 24  ? 97.558  91.980  69.842  1.00 17.06 ? 21   ILE B N   1 
ATOM   3769  C  CA  . ILE B 1 24  ? 96.688  91.117  70.636  1.00 17.00 ? 21   ILE B CA  1 
ATOM   3770  C  C   . ILE B 1 24  ? 96.677  91.587  72.081  1.00 17.06 ? 21   ILE B C   1 
ATOM   3771  O  O   . ILE B 1 24  ? 95.627  91.820  72.654  1.00 18.49 ? 21   ILE B O   1 
ATOM   3772  C  CB  . ILE B 1 24  ? 97.166  89.637  70.571  1.00 17.95 ? 21   ILE B CB  1 
ATOM   3773  C  CG1 . ILE B 1 24  ? 97.249  89.181  69.113  1.00 19.92 ? 21   ILE B CG1 1 
ATOM   3774  C  CG2 . ILE B 1 24  ? 96.223  88.724  71.349  1.00 17.44 ? 21   ILE B CG2 1 
ATOM   3775  C  CD1 . ILE B 1 24  ? 97.842  87.796  68.934  1.00 25.37 ? 21   ILE B CD1 1 
ATOM   3776  N  N   . THR B 1 25  ? 97.854  91.775  72.657  1.00 16.78 ? 22   THR B N   1 
ATOM   3777  C  CA  . THR B 1 25  ? 97.941  92.171  74.043  1.00 16.94 ? 22   THR B CA  1 
ATOM   3778  C  C   . THR B 1 25  ? 97.357  93.553  74.308  1.00 15.82 ? 22   THR B C   1 
ATOM   3779  O  O   . THR B 1 25  ? 96.874  93.805  75.411  1.00 14.32 ? 22   THR B O   1 
ATOM   3780  C  CB  . THR B 1 25  ? 99.368  92.082  74.564  1.00 17.95 ? 22   THR B CB  1 
ATOM   3781  O  OG1 . THR B 1 25  ? 100.208 92.920  73.784  1.00 21.22 ? 22   THR B OG1 1 
ATOM   3782  C  CG2 . THR B 1 25  ? 99.878  90.655  74.454  1.00 18.73 ? 22   THR B CG2 1 
ATOM   3783  N  N   . TYR B 1 26  ? 97.361  94.446  73.321  1.00 14.65 ? 23   TYR B N   1 
ATOM   3784  C  CA  . TYR B 1 26  ? 96.758  95.768  73.562  1.00 15.83 ? 23   TYR B CA  1 
ATOM   3785  C  C   . TYR B 1 26  ? 95.251  95.704  73.836  1.00 16.11 ? 23   TYR B C   1 
ATOM   3786  O  O   . TYR B 1 26  ? 94.687  96.636  74.388  1.00 15.69 ? 23   TYR B O   1 
ATOM   3787  C  CB  . TYR B 1 26  ? 97.003  96.760  72.437  1.00 15.33 ? 23   TYR B CB  1 
ATOM   3788  C  CG  . TYR B 1 26  ? 98.428  97.239  72.302  1.00 13.71 ? 23   TYR B CG  1 
ATOM   3789  C  CD1 . TYR B 1 26  ? 99.348  97.097  73.340  1.00 14.59 ? 23   TYR B CD1 1 
ATOM   3790  C  CD2 . TYR B 1 26  ? 98.801  98.011  71.213  1.00 13.10 ? 23   TYR B CD2 1 
ATOM   3791  C  CE1 . TYR B 1 26  ? 100.650 97.594  73.212  1.00 15.90 ? 23   TYR B CE1 1 
ATOM   3792  C  CE2 . TYR B 1 26  ? 100.060 98.541  71.103  1.00 14.86 ? 23   TYR B CE2 1 
ATOM   3793  C  CZ  . TYR B 1 26  ? 100.986 98.326  72.096  1.00 16.37 ? 23   TYR B CZ  1 
ATOM   3794  O  OH  . TYR B 1 26  ? 102.244 98.859  71.952  1.00 15.28 ? 23   TYR B OH  1 
ATOM   3795  N  N   . LEU B 1 27  ? 94.597  94.609  73.475  1.00 16.93 ? 24   LEU B N   1 
ATOM   3796  C  CA  . LEU B 1 27  ? 93.155  94.503  73.736  1.00 18.40 ? 24   LEU B CA  1 
ATOM   3797  C  C   . LEU B 1 27  ? 92.780  93.812  75.047  1.00 17.60 ? 24   LEU B C   1 
ATOM   3798  O  O   . LEU B 1 27  ? 91.583  93.603  75.300  1.00 17.22 ? 24   LEU B O   1 
ATOM   3799  C  CB  . LEU B 1 27  ? 92.420  93.838  72.565  1.00 18.73 ? 24   LEU B CB  1 
ATOM   3800  C  CG  . LEU B 1 27  ? 92.064  94.768  71.406  1.00 21.82 ? 24   LEU B CG  1 
ATOM   3801  C  CD1 . LEU B 1 27  ? 93.290  95.384  70.793  1.00 22.04 ? 24   LEU B CD1 1 
ATOM   3802  C  CD2 . LEU B 1 27  ? 91.268  94.036  70.354  1.00 29.64 ? 24   LEU B CD2 1 
ATOM   3803  N  N   . ARG B 1 28  ? 93.766  93.488  75.888  1.00 16.80 ? 25   ARG B N   1 
ATOM   3804  C  CA  . ARG B 1 28  ? 93.487  92.793  77.147  1.00 17.90 ? 25   ARG B CA  1 
ATOM   3805  C  C   . ARG B 1 28  ? 92.417  93.484  78.007  1.00 17.93 ? 25   ARG B C   1 
ATOM   3806  O  O   . ARG B 1 28  ? 91.540  92.811  78.552  1.00 17.69 ? 25   ARG B O   1 
ATOM   3807  C  CB  . ARG B 1 28  ? 94.763  92.608  77.983  1.00 18.81 ? 25   ARG B CB  1 
ATOM   3808  C  CG  . ARG B 1 28  ? 95.728  91.573  77.442  1.00 22.02 ? 25   ARG B CG  1 
ATOM   3809  C  CD  . ARG B 1 28  ? 97.049  91.546  78.254  1.00 22.62 ? 25   ARG B CD  1 
ATOM   3810  N  NE  . ARG B 1 28  ? 96.816  91.291  79.670  1.00 26.20 ? 25   ARG B NE  1 
ATOM   3811  C  CZ  . ARG B 1 28  ? 96.643  90.081  80.199  1.00 30.53 ? 25   ARG B CZ  1 
ATOM   3812  N  NH1 . ARG B 1 28  ? 96.661  88.996  79.427  1.00 30.95 ? 25   ARG B NH1 1 
ATOM   3813  N  NH2 . ARG B 1 28  ? 96.434  89.954  81.505  1.00 33.65 ? 25   ARG B NH2 1 
ATOM   3814  N  N   . ASP B 1 29  ? 92.502  94.813  78.131  1.00 18.42 ? 26   ASP B N   1 
ATOM   3815  C  CA  . ASP B 1 29  ? 91.532  95.577  78.936  1.00 19.09 ? 26   ASP B CA  1 
ATOM   3816  C  C   . ASP B 1 29  ? 90.123  95.492  78.381  1.00 18.00 ? 26   ASP B C   1 
ATOM   3817  O  O   . ASP B 1 29  ? 89.154  95.377  79.149  1.00 17.09 ? 26   ASP B O   1 
ATOM   3818  C  CB  . ASP B 1 29  ? 91.915  97.061  79.043  1.00 20.11 ? 26   ASP B CB  1 
ATOM   3819  C  CG  . ASP B 1 29  ? 93.035  97.328  80.057  1.00 26.53 ? 26   ASP B CG  1 
ATOM   3820  O  OD1 . ASP B 1 29  ? 93.415  96.388  80.802  1.00 32.98 ? 26   ASP B OD1 1 
ATOM   3821  O  OD2 . ASP B 1 29  ? 93.490  98.513  80.142  1.00 32.02 ? 26   ASP B OD2 1 
ATOM   3822  N  N   . ALA B 1 30  ? 89.999  95.581  77.058  1.00 16.56 ? 27   ALA B N   1 
ATOM   3823  C  CA  . ALA B 1 30  ? 88.692  95.517  76.413  1.00 16.08 ? 27   ALA B CA  1 
ATOM   3824  C  C   . ALA B 1 30  ? 88.084  94.131  76.574  1.00 14.50 ? 27   ALA B C   1 
ATOM   3825  O  O   . ALA B 1 30  ? 86.875  93.995  76.777  1.00 14.80 ? 27   ALA B O   1 
ATOM   3826  C  CB  . ALA B 1 30  ? 88.800  95.882  74.926  1.00 15.97 ? 27   ALA B CB  1 
ATOM   3827  N  N   . VAL B 1 31  ? 88.932  93.108  76.476  1.00 12.97 ? 28   VAL B N   1 
ATOM   3828  C  CA  . VAL B 1 31  ? 88.513  91.716  76.621  1.00 11.84 ? 28   VAL B CA  1 
ATOM   3829  C  C   . VAL B 1 31  ? 87.996  91.472  78.025  1.00 12.31 ? 28   VAL B C   1 
ATOM   3830  O  O   . VAL B 1 31  ? 86.952  90.858  78.218  1.00 12.88 ? 28   VAL B O   1 
ATOM   3831  C  CB  . VAL B 1 31  ? 89.674  90.753  76.318  1.00 12.19 ? 28   VAL B CB  1 
ATOM   3832  C  CG1 . VAL B 1 31  ? 89.368  89.342  76.808  1.00 12.83 ? 28   VAL B CG1 1 
ATOM   3833  C  CG2 . VAL B 1 31  ? 90.020  90.765  74.816  1.00 13.28 ? 28   VAL B CG2 1 
ATOM   3834  N  N   . LYS B 1 32  ? 88.733  91.948  79.019  1.00 12.71 ? 29   LYS B N   1 
ATOM   3835  C  CA  . LYS B 1 32  ? 88.331  91.767  80.408  1.00 14.39 ? 29   LYS B CA  1 
ATOM   3836  C  C   . LYS B 1 32  ? 86.941  92.369  80.693  1.00 13.51 ? 29   LYS B C   1 
ATOM   3837  O  O   . LYS B 1 32  ? 86.082  91.694  81.241  1.00 12.70 ? 29   LYS B O   1 
ATOM   3838  C  CB  . LYS B 1 32  ? 89.408  92.372  81.309  1.00 15.76 ? 29   LYS B CB  1 
ATOM   3839  C  CG  . LYS B 1 32  ? 89.266  92.105  82.770  1.00 23.03 ? 29   LYS B CG  1 
ATOM   3840  C  CD  . LYS B 1 32  ? 90.645  92.214  83.456  1.00 28.38 ? 29   LYS B CD  1 
ATOM   3841  C  CE  . LYS B 1 32  ? 91.583  91.096  82.962  1.00 29.51 ? 29   LYS B CE  1 
ATOM   3842  N  NZ  . LYS B 1 32  ? 92.934  91.123  83.591  1.00 36.20 ? 29   LYS B NZ  1 
ATOM   3843  N  N   . VAL B 1 33  ? 86.704  93.624  80.312  1.00 13.89 ? 30   VAL B N   1 
ATOM   3844  C  CA  . VAL B 1 33  ? 85.399  94.222  80.585  1.00 15.28 ? 30   VAL B CA  1 
ATOM   3845  C  C   . VAL B 1 33  ? 84.279  93.496  79.823  1.00 13.75 ? 30   VAL B C   1 
ATOM   3846  O  O   . VAL B 1 33  ? 83.183  93.348  80.350  1.00 13.43 ? 30   VAL B O   1 
ATOM   3847  C  CB  . VAL B 1 33  ? 85.339  95.774  80.312  1.00 16.53 ? 30   VAL B CB  1 
ATOM   3848  C  CG1 . VAL B 1 33  ? 86.304  96.513  81.215  1.00 18.56 ? 30   VAL B CG1 1 
ATOM   3849  C  CG2 . VAL B 1 33  ? 85.597  96.090  78.863  1.00 19.01 ? 30   VAL B CG2 1 
ATOM   3850  N  N   . THR B 1 34  ? 84.561  93.023  78.608  1.00 12.88 ? 31   THR B N   1 
ATOM   3851  C  CA  . THR B 1 34  ? 83.573  92.283  77.821  1.00 14.21 ? 31   THR B CA  1 
ATOM   3852  C  C   . THR B 1 34  ? 83.310  90.919  78.462  1.00 13.70 ? 31   THR B C   1 
ATOM   3853  O  O   . THR B 1 34  ? 82.174  90.456  78.495  1.00 12.83 ? 31   THR B O   1 
ATOM   3854  C  CB  . THR B 1 34  ? 84.007  92.111  76.371  1.00 15.47 ? 31   THR B CB  1 
ATOM   3855  O  OG1 . THR B 1 34  ? 84.235  93.410  75.798  1.00 17.67 ? 31   THR B OG1 1 
ATOM   3856  C  CG2 . THR B 1 34  ? 82.950  91.407  75.593  1.00 13.82 ? 31   THR B CG2 1 
ATOM   3857  N  N   . HIS B 1 35  ? 84.358  90.291  78.984  1.00 12.03 ? 32   HIS B N   1 
ATOM   3858  C  CA  . HIS B 1 35  ? 84.211  89.033  79.685  1.00 12.82 ? 32   HIS B CA  1 
ATOM   3859  C  C   . HIS B 1 35  ? 83.233  89.195  80.862  1.00 12.34 ? 32   HIS B C   1 
ATOM   3860  O  O   . HIS B 1 35  ? 82.312  88.406  81.004  1.00 13.24 ? 32   HIS B O   1 
ATOM   3861  C  CB  . HIS B 1 35  ? 85.567  88.524  80.185  1.00 12.89 ? 32   HIS B CB  1 
ATOM   3862  C  CG  . HIS B 1 35  ? 85.461  87.323  81.058  1.00 11.66 ? 32   HIS B CG  1 
ATOM   3863  N  ND1 . HIS B 1 35  ? 85.372  86.045  80.556  1.00 14.00 ? 32   HIS B ND1 1 
ATOM   3864  C  CD2 . HIS B 1 35  ? 85.407  87.204  82.405  1.00 12.16 ? 32   HIS B CD2 1 
ATOM   3865  C  CE1 . HIS B 1 35  ? 85.294  85.186  81.555  1.00 17.20 ? 32   HIS B CE1 1 
ATOM   3866  N  NE2 . HIS B 1 35  ? 85.290  85.863  82.687  1.00 13.74 ? 32   HIS B NE2 1 
ATOM   3867  N  N   . HIS B 1 36  ? 83.418  90.230  81.674  1.00 14.68 ? 33   HIS B N   1 
ATOM   3868  C  CA  . HIS B 1 36  ? 82.512  90.488  82.806  1.00 16.47 ? 33   HIS B CA  1 
ATOM   3869  C  C   . HIS B 1 36  ? 81.076  90.688  82.310  1.00 15.92 ? 33   HIS B C   1 
ATOM   3870  O  O   . HIS B 1 36  ? 80.129  90.237  82.951  1.00 15.80 ? 33   HIS B O   1 
ATOM   3871  C  CB  . HIS B 1 36  ? 82.900  91.717  83.621  1.00 17.10 ? 33   HIS B CB  1 
ATOM   3872  C  CG  . HIS B 1 36  ? 84.292  91.687  84.163  1.00 22.57 ? 33   HIS B CG  1 
ATOM   3873  N  ND1 . HIS B 1 36  ? 85.117  92.794  84.143  1.00 25.26 ? 33   HIS B ND1 1 
ATOM   3874  C  CD2 . HIS B 1 36  ? 85.030  90.675  84.674  1.00 21.25 ? 33   HIS B CD2 1 
ATOM   3875  C  CE1 . HIS B 1 36  ? 86.287  92.474  84.661  1.00 23.44 ? 33   HIS B CE1 1 
ATOM   3876  N  NE2 . HIS B 1 36  ? 86.263  91.196  84.988  1.00 20.80 ? 33   HIS B NE2 1 
ATOM   3877  N  N   . ALA B 1 37  ? 80.921  91.397  81.192  1.00 15.21 ? 34   ALA B N   1 
ATOM   3878  C  CA  . ALA B 1 37  ? 79.584  91.634  80.606  1.00 14.85 ? 34   ALA B CA  1 
ATOM   3879  C  C   . ALA B 1 37  ? 78.877  90.327  80.189  1.00 14.21 ? 34   ALA B C   1 
ATOM   3880  O  O   . ALA B 1 37  ? 77.667  90.154  80.388  1.00 12.52 ? 34   ALA B O   1 
ATOM   3881  C  CB  . ALA B 1 37  ? 79.680  92.577  79.421  1.00 15.13 ? 34   ALA B CB  1 
ATOM   3882  N  N   . ILE B 1 38  ? 79.625  89.432  79.577  1.00 13.55 ? 35   ILE B N   1 
ATOM   3883  C  CA  . ILE B 1 38  ? 79.081  88.151  79.168  1.00 15.37 ? 35   ILE B CA  1 
ATOM   3884  C  C   . ILE B 1 38  ? 78.657  87.343  80.393  1.00 16.25 ? 35   ILE B C   1 
ATOM   3885  O  O   . ILE B 1 38  ? 77.506  86.902  80.508  1.00 17.34 ? 35   ILE B O   1 
ATOM   3886  C  CB  . ILE B 1 38  ? 80.129  87.352  78.370  1.00 14.87 ? 35   ILE B CB  1 
ATOM   3887  C  CG1 . ILE B 1 38  ? 80.406  88.040  77.027  1.00 13.13 ? 35   ILE B CG1 1 
ATOM   3888  C  CG2 . ILE B 1 38  ? 79.665  85.922  78.162  1.00 18.18 ? 35   ILE B CG2 1 
ATOM   3889  C  CD1 . ILE B 1 38  ? 81.632  87.515  76.292  1.00 8.26  ? 35   ILE B CD1 1 
ATOM   3890  N  N   . HIS B 1 39  ? 79.570  87.184  81.338  1.00 16.70 ? 36   HIS B N   1 
ATOM   3891  C  CA  . HIS B 1 39  ? 79.274  86.349  82.506  1.00 17.10 ? 36   HIS B CA  1 
ATOM   3892  C  C   . HIS B 1 39  ? 78.311  86.933  83.520  1.00 16.68 ? 36   HIS B C   1 
ATOM   3893  O  O   . HIS B 1 39  ? 77.583  86.186  84.150  1.00 16.93 ? 36   HIS B O   1 
ATOM   3894  C  CB  . HIS B 1 39  ? 80.558  85.819  83.129  1.00 17.52 ? 36   HIS B CB  1 
ATOM   3895  C  CG  . HIS B 1 39  ? 81.212  84.775  82.282  1.00 17.71 ? 36   HIS B CG  1 
ATOM   3896  N  ND1 . HIS B 1 39  ? 80.849  83.445  82.341  1.00 20.61 ? 36   HIS B ND1 1 
ATOM   3897  C  CD2 . HIS B 1 39  ? 82.143  84.871  81.303  1.00 15.44 ? 36   HIS B CD2 1 
ATOM   3898  C  CE1 . HIS B 1 39  ? 81.567  82.761  81.463  1.00 23.55 ? 36   HIS B CE1 1 
ATOM   3899  N  NE2 . HIS B 1 39  ? 82.354  83.605  80.816  1.00 18.54 ? 36   HIS B NE2 1 
ATOM   3900  N  N   . GLU B 1 40  ? 78.281  88.259  83.655  1.00 15.25 ? 37   GLU B N   1 
ATOM   3901  C  CA  . GLU B 1 40  ? 77.332  88.905  84.558  1.00 15.15 ? 37   GLU B CA  1 
ATOM   3902  C  C   . GLU B 1 40  ? 76.054  89.297  83.809  1.00 14.17 ? 37   GLU B C   1 
ATOM   3903  O  O   . GLU B 1 40  ? 75.083  89.750  84.415  1.00 14.38 ? 37   GLU B O   1 
ATOM   3904  C  CB  . GLU B 1 40  ? 77.983  90.095  85.240  1.00 14.80 ? 37   GLU B CB  1 
ATOM   3905  C  CG  . GLU B 1 40  ? 79.177  89.632  86.086  1.00 20.53 ? 37   GLU B CG  1 
ATOM   3906  C  CD  . GLU B 1 40  ? 80.037  90.758  86.637  1.00 25.40 ? 37   GLU B CD  1 
ATOM   3907  O  OE1 . GLU B 1 40  ? 79.605  91.941  86.613  1.00 29.96 ? 37   GLU B OE1 1 
ATOM   3908  O  OE2 . GLU B 1 40  ? 81.169  90.441  87.089  1.00 29.46 ? 37   GLU B OE2 1 
ATOM   3909  N  N   . LYS B 1 41  ? 76.053  89.102  82.495  1.00 13.67 ? 38   LYS B N   1 
ATOM   3910  C  CA  . LYS B 1 41  ? 74.885  89.386  81.648  1.00 13.77 ? 38   LYS B CA  1 
ATOM   3911  C  C   . LYS B 1 41  ? 74.428  90.839  81.750  1.00 14.09 ? 38   LYS B C   1 
ATOM   3912  O  O   . LYS B 1 41  ? 73.256  91.126  82.015  1.00 13.50 ? 38   LYS B O   1 
ATOM   3913  C  CB  . LYS B 1 41  ? 73.744  88.461  82.036  1.00 12.97 ? 38   LYS B CB  1 
ATOM   3914  C  CG  . LYS B 1 41  ? 74.146  86.995  82.112  1.00 17.43 ? 38   LYS B CG  1 
ATOM   3915  C  CD  . LYS B 1 41  ? 72.929  86.133  82.468  1.00 23.19 ? 38   LYS B CD  1 
ATOM   3916  C  CE  . LYS B 1 41  ? 73.316  84.676  82.781  1.00 24.34 ? 38   LYS B CE  1 
ATOM   3917  N  NZ  . LYS B 1 41  ? 73.895  83.955  81.643  1.00 25.88 ? 38   LYS B NZ  1 
ATOM   3918  N  N   . THR B 1 42  ? 75.346  91.761  81.514  1.00 14.10 ? 39   THR B N   1 
ATOM   3919  C  CA  . THR B 1 42  ? 75.031  93.170  81.633  1.00 15.50 ? 39   THR B CA  1 
ATOM   3920  C  C   . THR B 1 42  ? 75.062  93.954  80.319  1.00 15.94 ? 39   THR B C   1 
ATOM   3921  O  O   . THR B 1 42  ? 74.672  95.114  80.290  1.00 16.56 ? 39   THR B O   1 
ATOM   3922  C  CB  . THR B 1 42  ? 76.034  93.838  82.579  1.00 16.35 ? 39   THR B CB  1 
ATOM   3923  O  OG1 . THR B 1 42  ? 77.356  93.757  82.014  1.00 14.16 ? 39   THR B OG1 1 
ATOM   3924  C  CG2 . THR B 1 42  ? 76.004  93.154  83.960  1.00 18.25 ? 39   THR B CG2 1 
ATOM   3925  N  N   . GLY B 1 43  ? 75.454  93.322  79.229  1.00 15.94 ? 40   GLY B N   1 
ATOM   3926  C  CA  . GLY B 1 43  ? 75.590  94.048  77.961  1.00 15.81 ? 40   GLY B CA  1 
ATOM   3927  C  C   . GLY B 1 43  ? 74.449  93.904  76.983  1.00 14.39 ? 40   GLY B C   1 
ATOM   3928  O  O   . GLY B 1 43  ? 73.396  93.397  77.319  1.00 12.64 ? 40   GLY B O   1 
ATOM   3929  N  N   . ALA B 1 44  ? 74.672  94.375  75.759  1.00 14.16 ? 41   ALA B N   1 
ATOM   3930  C  CA  . ALA B 1 44  ? 73.653  94.281  74.712  1.00 13.63 ? 41   ALA B CA  1 
ATOM   3931  C  C   . ALA B 1 44  ? 73.306  92.807  74.490  1.00 13.25 ? 41   ALA B C   1 
ATOM   3932  O  O   . ALA B 1 44  ? 74.188  91.950  74.479  1.00 11.03 ? 41   ALA B O   1 
ATOM   3933  C  CB  . ALA B 1 44  ? 74.154  94.942  73.409  1.00 13.74 ? 41   ALA B CB  1 
ATOM   3934  N  N   . GLY B 1 45  ? 72.011  92.540  74.338  1.00 14.80 ? 42   GLY B N   1 
ATOM   3935  C  CA  . GLY B 1 45  ? 71.471  91.208  74.102  1.00 14.83 ? 42   GLY B CA  1 
ATOM   3936  C  C   . GLY B 1 45  ? 71.600  90.247  75.276  1.00 14.88 ? 42   GLY B C   1 
ATOM   3937  O  O   . GLY B 1 45  ? 71.613  89.029  75.072  1.00 15.30 ? 42   GLY B O   1 
ATOM   3938  N  N   . ASN B 1 46  ? 71.634  90.787  76.499  1.00 14.27 ? 43   ASN B N   1 
ATOM   3939  C  CA  . ASN B 1 46  ? 71.817  89.974  77.704  1.00 16.01 ? 43   ASN B CA  1 
ATOM   3940  C  C   . ASN B 1 46  ? 70.641  89.035  78.029  1.00 15.70 ? 43   ASN B C   1 
ATOM   3941  O  O   . ASN B 1 46  ? 70.756  88.194  78.918  1.00 17.14 ? 43   ASN B O   1 
ATOM   3942  C  CB  . ASN B 1 46  ? 72.245  90.823  78.925  1.00 15.34 ? 43   ASN B CB  1 
ATOM   3943  C  CG  . ASN B 1 46  ? 71.220  91.905  79.309  1.00 20.00 ? 43   ASN B CG  1 
ATOM   3944  O  OD1 . ASN B 1 46  ? 70.123  91.964  78.776  1.00 25.43 ? 43   ASN B OD1 1 
ATOM   3945  N  ND2 . ASN B 1 46  ? 71.605  92.775  80.221  1.00 22.93 ? 43   ASN B ND2 1 
ATOM   3946  N  N   . ASP B 1 47  ? 69.532  89.157  77.304  1.00 16.53 ? 44   ASP B N   1 
ATOM   3947  C  CA  . ASP B 1 47  ? 68.406  88.230  77.478  1.00 17.42 ? 44   ASP B CA  1 
ATOM   3948  C  C   . ASP B 1 47  ? 68.666  86.921  76.688  1.00 15.50 ? 44   ASP B C   1 
ATOM   3949  O  O   . ASP B 1 47  ? 67.847  86.018  76.708  1.00 16.05 ? 44   ASP B O   1 
ATOM   3950  C  CB  . ASP B 1 47  ? 67.094  88.842  76.969  1.00 19.06 ? 44   ASP B CB  1 
ATOM   3951  C  CG  . ASP B 1 47  ? 66.544  89.927  77.880  1.00 25.13 ? 44   ASP B CG  1 
ATOM   3952  O  OD1 . ASP B 1 47  ? 66.679  89.805  79.115  1.00 35.03 ? 44   ASP B OD1 1 
ATOM   3953  O  OD2 . ASP B 1 47  ? 65.918  90.875  77.357  1.00 32.09 ? 44   ASP B OD2 1 
ATOM   3954  N  N   . PHE B 1 48  ? 69.786  86.838  75.975  1.00 13.84 ? 45   PHE B N   1 
ATOM   3955  C  CA  . PHE B 1 48  ? 70.080  85.667  75.151  1.00 13.92 ? 45   PHE B CA  1 
ATOM   3956  C  C   . PHE B 1 48  ? 71.431  85.039  75.413  1.00 13.98 ? 45   PHE B C   1 
ATOM   3957  O  O   . PHE B 1 48  ? 72.142  84.639  74.477  1.00 10.78 ? 45   PHE B O   1 
ATOM   3958  C  CB  . PHE B 1 48  ? 69.935  86.034  73.675  1.00 14.19 ? 45   PHE B CB  1 
ATOM   3959  C  CG  . PHE B 1 48  ? 68.571  86.502  73.336  1.00 16.76 ? 45   PHE B CG  1 
ATOM   3960  C  CD1 . PHE B 1 48  ? 67.553  85.584  73.126  1.00 19.47 ? 45   PHE B CD1 1 
ATOM   3961  C  CD2 . PHE B 1 48  ? 68.279  87.855  73.288  1.00 15.96 ? 45   PHE B CD2 1 
ATOM   3962  C  CE1 . PHE B 1 48  ? 66.255  86.013  72.862  1.00 18.21 ? 45   PHE B CE1 1 
ATOM   3963  C  CE2 . PHE B 1 48  ? 66.995  88.286  73.010  1.00 17.53 ? 45   PHE B CE2 1 
ATOM   3964  C  CZ  . PHE B 1 48  ? 65.984  87.363  72.798  1.00 16.97 ? 45   PHE B CZ  1 
ATOM   3965  N  N   . LEU B 1 49  ? 71.731  84.870  76.695  1.00 12.21 ? 46   LEU B N   1 
ATOM   3966  C  CA  . LEU B 1 49  ? 72.999  84.296  77.112  1.00 13.33 ? 46   LEU B CA  1 
ATOM   3967  C  C   . LEU B 1 49  ? 72.833  82.932  77.756  1.00 12.69 ? 46   LEU B C   1 
ATOM   3968  O  O   . LEU B 1 49  ? 73.741  82.458  78.433  1.00 13.57 ? 46   LEU B O   1 
ATOM   3969  C  CB  . LEU B 1 49  ? 73.719  85.265  78.070  1.00 12.57 ? 46   LEU B CB  1 
ATOM   3970  C  CG  . LEU B 1 49  ? 74.249  86.521  77.368  1.00 13.45 ? 46   LEU B CG  1 
ATOM   3971  C  CD1 . LEU B 1 49  ? 74.731  87.583  78.378  1.00 17.16 ? 46   LEU B CD1 1 
ATOM   3972  C  CD2 . LEU B 1 49  ? 75.386  86.151  76.420  1.00 14.33 ? 46   LEU B CD2 1 
ATOM   3973  N  N   . GLY B 1 50  ? 71.703  82.272  77.499  1.00 13.41 ? 47   GLY B N   1 
ATOM   3974  C  CA  . GLY B 1 50  ? 71.435  80.952  78.079  1.00 13.18 ? 47   GLY B CA  1 
ATOM   3975  C  C   . GLY B 1 50  ? 72.350  79.847  77.591  1.00 13.12 ? 47   GLY B C   1 
ATOM   3976  O  O   . GLY B 1 50  ? 72.396  78.770  78.179  1.00 12.80 ? 47   GLY B O   1 
ATOM   3977  N  N   . TRP B 1 51  ? 73.071  80.103  76.503  1.00 12.15 ? 48   TRP B N   1 
ATOM   3978  C  CA  . TRP B 1 51  ? 73.993  79.113  75.945  1.00 12.56 ? 48   TRP B CA  1 
ATOM   3979  C  C   . TRP B 1 51  ? 75.323  79.039  76.730  1.00 13.24 ? 48   TRP B C   1 
ATOM   3980  O  O   . TRP B 1 51  ? 76.038  78.038  76.648  1.00 12.65 ? 48   TRP B O   1 
ATOM   3981  C  CB  . TRP B 1 51  ? 74.289  79.420  74.460  1.00 11.05 ? 48   TRP B CB  1 
ATOM   3982  C  CG  . TRP B 1 51  ? 74.786  80.792  74.249  1.00 10.26 ? 48   TRP B CG  1 
ATOM   3983  C  CD1 . TRP B 1 51  ? 74.031  81.894  74.007  1.00 11.25 ? 48   TRP B CD1 1 
ATOM   3984  C  CD2 . TRP B 1 51  ? 76.146  81.244  74.316  1.00 12.68 ? 48   TRP B CD2 1 
ATOM   3985  N  NE1 . TRP B 1 51  ? 74.827  82.997  73.900  1.00 12.41 ? 48   TRP B NE1 1 
ATOM   3986  C  CE2 . TRP B 1 51  ? 76.132  82.628  74.094  1.00 9.75  ? 48   TRP B CE2 1 
ATOM   3987  C  CE3 . TRP B 1 51  ? 77.373  80.604  74.505  1.00 11.59 ? 48   TRP B CE3 1 
ATOM   3988  C  CZ2 . TRP B 1 51  ? 77.283  83.386  74.066  1.00 11.42 ? 48   TRP B CZ2 1 
ATOM   3989  C  CZ3 . TRP B 1 51  ? 78.526  81.367  74.489  1.00 12.64 ? 48   TRP B CZ3 1 
ATOM   3990  C  CH2 . TRP B 1 51  ? 78.471  82.742  74.275  1.00 12.76 ? 48   TRP B CH2 1 
ATOM   3991  N  N   . VAL B 1 52  ? 75.644  80.083  77.498  1.00 14.00 ? 49   VAL B N   1 
ATOM   3992  C  CA  . VAL B 1 52  ? 76.924  80.127  78.226  1.00 13.74 ? 49   VAL B CA  1 
ATOM   3993  C  C   . VAL B 1 52  ? 77.129  78.978  79.222  1.00 13.82 ? 49   VAL B C   1 
ATOM   3994  O  O   . VAL B 1 52  ? 78.201  78.361  79.237  1.00 12.32 ? 49   VAL B O   1 
ATOM   3995  C  CB  . VAL B 1 52  ? 77.124  81.477  78.933  1.00 15.19 ? 49   VAL B CB  1 
ATOM   3996  C  CG1 . VAL B 1 52  ? 78.426  81.478  79.762  1.00 13.75 ? 49   VAL B CG1 1 
ATOM   3997  C  CG2 . VAL B 1 52  ? 77.113  82.624  77.892  1.00 11.14 ? 49   VAL B CG2 1 
ATOM   3998  N  N   . ASP B 1 53  ? 76.125  78.702  80.055  1.00 14.47 ? 50   ASP B N   1 
ATOM   3999  C  CA  . ASP B 1 53  ? 76.220  77.616  81.037  1.00 14.77 ? 50   ASP B CA  1 
ATOM   4000  C  C   . ASP B 1 53  ? 75.365  76.424  80.674  1.00 13.08 ? 50   ASP B C   1 
ATOM   4001  O  O   . ASP B 1 53  ? 75.271  75.456  81.446  1.00 11.41 ? 50   ASP B O   1 
ATOM   4002  C  CB  . ASP B 1 53  ? 75.855  78.111  82.429  1.00 15.08 ? 50   ASP B CB  1 
ATOM   4003  C  CG  . ASP B 1 53  ? 76.844  79.154  82.962  1.00 20.43 ? 50   ASP B CG  1 
ATOM   4004  O  OD1 . ASP B 1 53  ? 78.011  79.212  82.493  1.00 19.54 ? 50   ASP B OD1 1 
ATOM   4005  O  OD2 . ASP B 1 53  ? 76.459  79.891  83.885  1.00 23.70 ? 50   ASP B OD2 1 
ATOM   4006  N  N   . LEU B 1 54  ? 74.769  76.473  79.485  1.00 13.03 ? 51   LEU B N   1 
ATOM   4007  C  CA  . LEU B 1 54  ? 73.908  75.386  79.023  1.00 13.19 ? 51   LEU B CA  1 
ATOM   4008  C  C   . LEU B 1 54  ? 74.558  73.997  79.153  1.00 13.99 ? 51   LEU B C   1 
ATOM   4009  O  O   . LEU B 1 54  ? 73.885  73.044  79.568  1.00 16.55 ? 51   LEU B O   1 
ATOM   4010  C  CB  . LEU B 1 54  ? 73.477  75.631  77.573  1.00 13.77 ? 51   LEU B CB  1 
ATOM   4011  C  CG  . LEU B 1 54  ? 72.627  74.555  76.870  1.00 14.57 ? 51   LEU B CG  1 
ATOM   4012  C  CD1 . LEU B 1 54  ? 71.325  74.324  77.605  1.00 16.70 ? 51   LEU B CD1 1 
ATOM   4013  C  CD2 . LEU B 1 54  ? 72.375  74.954  75.430  1.00 15.49 ? 51   LEU B CD2 1 
ATOM   4014  N  N   . PRO B 1 55  ? 75.862  73.867  78.817  1.00 13.42 ? 52   PRO B N   1 
ATOM   4015  C  CA  . PRO B 1 55  ? 76.498  72.535  78.887  1.00 14.27 ? 52   PRO B CA  1 
ATOM   4016  C  C   . PRO B 1 55  ? 76.516  71.900  80.266  1.00 16.37 ? 52   PRO B C   1 
ATOM   4017  O  O   . PRO B 1 55  ? 76.677  70.675  80.376  1.00 17.32 ? 52   PRO B O   1 
ATOM   4018  C  CB  . PRO B 1 55  ? 77.927  72.789  78.418  1.00 13.33 ? 52   PRO B CB  1 
ATOM   4019  C  CG  . PRO B 1 55  ? 77.848  74.047  77.611  1.00 15.70 ? 52   PRO B CG  1 
ATOM   4020  C  CD  . PRO B 1 55  ? 76.813  74.887  78.343  1.00 14.14 ? 52   PRO B CD  1 
ATOM   4021  N  N   . LEU B 1 56  ? 76.336  72.705  81.306  1.00 16.36 ? 53   LEU B N   1 
ATOM   4022  C  CA  . LEU B 1 56  ? 76.321  72.183  82.657  1.00 18.03 ? 53   LEU B CA  1 
ATOM   4023  C  C   . LEU B 1 56  ? 74.918  72.107  83.235  1.00 18.94 ? 53   LEU B C   1 
ATOM   4024  O  O   . LEU B 1 56  ? 74.554  71.122  83.889  1.00 21.11 ? 53   LEU B O   1 
ATOM   4025  C  CB  . LEU B 1 56  ? 77.201  73.057  83.558  1.00 18.04 ? 53   LEU B CB  1 
ATOM   4026  C  CG  . LEU B 1 56  ? 78.674  72.980  83.146  1.00 18.93 ? 53   LEU B CG  1 
ATOM   4027  C  CD1 . LEU B 1 56  ? 79.528  74.010  83.837  1.00 21.20 ? 53   LEU B CD1 1 
ATOM   4028  C  CD2 . LEU B 1 56  ? 79.159  71.563  83.436  1.00 22.53 ? 53   LEU B CD2 1 
ATOM   4029  N  N   . GLN B 1 57  ? 74.119  73.114  82.933  1.00 19.20 ? 54   GLN B N   1 
ATOM   4030  C  CA  . GLN B 1 57  ? 72.798  73.226  83.507  1.00 19.99 ? 54   GLN B CA  1 
ATOM   4031  C  C   . GLN B 1 57  ? 71.587  72.817  82.654  1.00 19.56 ? 54   GLN B C   1 
ATOM   4032  O  O   . GLN B 1 57  ? 70.459  73.111  83.019  1.00 19.84 ? 54   GLN B O   1 
ATOM   4033  C  CB  . GLN B 1 57  ? 72.637  74.657  84.033  1.00 20.07 ? 54   GLN B CB  1 
ATOM   4034  C  CG  . GLN B 1 57  ? 73.513  74.920  85.263  1.00 24.43 ? 54   GLN B CG  1 
ATOM   4035  C  CD  . GLN B 1 57  ? 73.413  76.351  85.775  1.00 28.29 ? 54   GLN B CD  1 
ATOM   4036  O  OE1 . GLN B 1 57  ? 73.425  77.305  84.991  1.00 34.89 ? 54   GLN B OE1 1 
ATOM   4037  N  NE2 . GLN B 1 57  ? 73.352  76.509  87.101  1.00 24.77 ? 54   GLN B NE2 1 
ATOM   4038  N  N   . TYR B 1 58  ? 71.808  72.107  81.559  1.00 19.66 ? 55   TYR B N   1 
ATOM   4039  C  CA  . TYR B 1 58  ? 70.697  71.657  80.716  1.00 19.55 ? 55   TYR B CA  1 
ATOM   4040  C  C   . TYR B 1 58  ? 69.704  70.806  81.534  1.00 18.87 ? 55   TYR B C   1 
ATOM   4041  O  O   . TYR B 1 58  ? 70.075  70.195  82.537  1.00 18.24 ? 55   TYR B O   1 
ATOM   4042  C  CB  . TYR B 1 58  ? 71.220  70.852  79.522  1.00 19.03 ? 55   TYR B CB  1 
ATOM   4043  C  CG  . TYR B 1 58  ? 71.978  69.601  79.911  1.00 20.97 ? 55   TYR B CG  1 
ATOM   4044  C  CD1 . TYR B 1 58  ? 73.349  69.637  80.155  1.00 21.47 ? 55   TYR B CD1 1 
ATOM   4045  C  CD2 . TYR B 1 58  ? 71.328  68.379  80.022  1.00 21.91 ? 55   TYR B CD2 1 
ATOM   4046  C  CE1 . TYR B 1 58  ? 74.041  68.499  80.512  1.00 23.07 ? 55   TYR B CE1 1 
ATOM   4047  C  CE2 . TYR B 1 58  ? 72.019  67.230  80.379  1.00 25.09 ? 55   TYR B CE2 1 
ATOM   4048  C  CZ  . TYR B 1 58  ? 73.370  67.297  80.621  1.00 24.19 ? 55   TYR B CZ  1 
ATOM   4049  O  OH  . TYR B 1 58  ? 74.051  66.162  80.968  1.00 27.40 ? 55   TYR B OH  1 
ATOM   4050  N  N   . ASP B 1 59  ? 68.439  70.813  81.113  1.00 18.95 ? 56   ASP B N   1 
ATOM   4051  C  CA  . ASP B 1 59  ? 67.377  70.035  81.765  1.00 19.11 ? 56   ASP B CA  1 
ATOM   4052  C  C   . ASP B 1 59  ? 67.736  68.553  81.675  1.00 18.53 ? 56   ASP B C   1 
ATOM   4053  O  O   . ASP B 1 59  ? 67.713  67.970  80.595  1.00 19.13 ? 56   ASP B O   1 
ATOM   4054  C  CB  . ASP B 1 59  ? 66.050  70.334  81.066  1.00 19.48 ? 56   ASP B CB  1 
ATOM   4055  C  CG  . ASP B 1 59  ? 64.861  69.664  81.728  1.00 20.45 ? 56   ASP B CG  1 
ATOM   4056  O  OD1 . ASP B 1 59  ? 64.978  68.533  82.229  1.00 18.53 ? 56   ASP B OD1 1 
ATOM   4057  O  OD2 . ASP B 1 59  ? 63.773  70.271  81.692  1.00 28.57 ? 56   ASP B OD2 1 
ATOM   4058  N  N   . LYS B 1 60  ? 68.061  67.945  82.811  1.00 18.02 ? 57   LYS B N   1 
ATOM   4059  C  CA  . LYS B 1 60  ? 68.505  66.535  82.839  1.00 17.60 ? 57   LYS B CA  1 
ATOM   4060  C  C   . LYS B 1 60  ? 67.393  65.527  82.530  1.00 17.60 ? 57   LYS B C   1 
ATOM   4061  O  O   . LYS B 1 60  ? 67.633  64.501  81.878  1.00 16.74 ? 57   LYS B O   1 
ATOM   4062  C  CB  . LYS B 1 60  ? 69.108  66.204  84.202  1.00 17.72 ? 57   LYS B CB  1 
ATOM   4063  C  CG  . LYS B 1 60  ? 70.226  67.143  84.690  1.00 22.06 ? 57   LYS B CG  1 
ATOM   4064  C  CD  . LYS B 1 60  ? 71.510  67.015  83.887  1.00 26.14 ? 57   LYS B CD  1 
ATOM   4065  C  CE  . LYS B 1 60  ? 72.617  67.999  84.357  1.00 28.08 ? 57   LYS B CE  1 
ATOM   4066  N  NZ  . LYS B 1 60  ? 72.329  69.457  84.071  1.00 26.11 ? 57   LYS B NZ  1 
ATOM   4067  N  N   . GLU B 1 61  ? 66.195  65.784  83.053  1.00 17.18 ? 58   GLU B N   1 
ATOM   4068  C  CA  . GLU B 1 61  ? 65.060  64.906  82.813  1.00 17.85 ? 58   GLU B CA  1 
ATOM   4069  C  C   . GLU B 1 61  ? 64.680  64.963  81.329  1.00 16.63 ? 58   GLU B C   1 
ATOM   4070  O  O   . GLU B 1 61  ? 64.375  63.946  80.714  1.00 15.15 ? 58   GLU B O   1 
ATOM   4071  C  CB  . GLU B 1 61  ? 63.866  65.253  83.729  1.00 19.15 ? 58   GLU B CB  1 
ATOM   4072  C  CG  . GLU B 1 61  ? 64.132  64.985  85.236  1.00 24.05 ? 58   GLU B CG  1 
ATOM   4073  C  CD  . GLU B 1 61  ? 65.206  65.903  85.844  1.00 33.91 ? 58   GLU B CD  1 
ATOM   4074  O  OE1 . GLU B 1 61  ? 65.363  67.063  85.374  1.00 40.27 ? 58   GLU B OE1 1 
ATOM   4075  O  OE2 . GLU B 1 61  ? 65.885  65.474  86.809  1.00 39.12 ? 58   GLU B OE2 1 
ATOM   4076  N  N   . GLU B 1 62  ? 64.722  66.149  80.739  1.00 15.21 ? 59   GLU B N   1 
ATOM   4077  C  CA  . GLU B 1 62  ? 64.405  66.270  79.331  1.00 14.70 ? 59   GLU B CA  1 
ATOM   4078  C  C   . GLU B 1 62  ? 65.483  65.573  78.491  1.00 14.73 ? 59   GLU B C   1 
ATOM   4079  O  O   . GLU B 1 62  ? 65.202  64.972  77.445  1.00 13.61 ? 59   GLU B O   1 
ATOM   4080  C  CB  . GLU B 1 62  ? 64.328  67.735  78.940  1.00 15.41 ? 59   GLU B CB  1 
ATOM   4081  C  CG  . GLU B 1 62  ? 63.929  67.952  77.502  1.00 17.57 ? 59   GLU B CG  1 
ATOM   4082  C  CD  . GLU B 1 62  ? 64.036  69.401  77.085  1.00 21.54 ? 59   GLU B CD  1 
ATOM   4083  O  OE1 . GLU B 1 62  ? 65.147  69.979  77.262  1.00 19.23 ? 59   GLU B OE1 1 
ATOM   4084  O  OE2 . GLU B 1 62  ? 63.029  69.934  76.539  1.00 18.86 ? 59   GLU B OE2 1 
ATOM   4085  N  N   . PHE B 1 63  ? 66.721  65.656  78.955  1.00 14.20 ? 60   PHE B N   1 
ATOM   4086  C  CA  . PHE B 1 63  ? 67.844  65.058  78.240  1.00 14.09 ? 60   PHE B CA  1 
ATOM   4087  C  C   . PHE B 1 63  ? 67.644  63.528  78.170  1.00 13.63 ? 60   PHE B C   1 
ATOM   4088  O  O   . PHE B 1 63  ? 67.871  62.887  77.135  1.00 13.33 ? 60   PHE B O   1 
ATOM   4089  C  CB  . PHE B 1 63  ? 69.138  65.473  78.941  1.00 14.52 ? 60   PHE B CB  1 
ATOM   4090  C  CG  . PHE B 1 63  ? 70.393  65.002  78.259  1.00 15.02 ? 60   PHE B CG  1 
ATOM   4091  C  CD1 . PHE B 1 63  ? 70.927  63.761  78.556  1.00 17.64 ? 60   PHE B CD1 1 
ATOM   4092  C  CD2 . PHE B 1 63  ? 71.055  65.823  77.356  1.00 17.33 ? 60   PHE B CD2 1 
ATOM   4093  C  CE1 . PHE B 1 63  ? 72.105  63.338  77.941  1.00 20.27 ? 60   PHE B CE1 1 
ATOM   4094  C  CE2 . PHE B 1 63  ? 72.222  65.412  76.738  1.00 19.03 ? 60   PHE B CE2 1 
ATOM   4095  C  CZ  . PHE B 1 63  ? 72.745  64.161  77.035  1.00 17.60 ? 60   PHE B CZ  1 
ATOM   4096  N  N   . ALA B 1 64  ? 67.200  62.965  79.281  1.00 13.78 ? 61   ALA B N   1 
ATOM   4097  C  CA  . ALA B 1 64  ? 66.892  61.542  79.390  1.00 13.62 ? 61   ALA B CA  1 
ATOM   4098  C  C   . ALA B 1 64  ? 65.747  61.178  78.436  1.00 13.76 ? 61   ALA B C   1 
ATOM   4099  O  O   . ALA B 1 64  ? 65.772  60.136  77.782  1.00 14.16 ? 61   ALA B O   1 
ATOM   4100  C  CB  . ALA B 1 64  ? 66.494  61.193  80.842  1.00 12.42 ? 61   ALA B CB  1 
ATOM   4101  N  N   . ARG B 1 65  ? 64.745  62.044  78.358  1.00 14.04 ? 62   ARG B N   1 
ATOM   4102  C  CA  . ARG B 1 65  ? 63.611  61.810  77.481  1.00 14.40 ? 62   ARG B CA  1 
ATOM   4103  C  C   . ARG B 1 65  ? 64.043  61.861  76.005  1.00 14.35 ? 62   ARG B C   1 
ATOM   4104  O  O   . ARG B 1 65  ? 63.554  61.085  75.191  1.00 16.20 ? 62   ARG B O   1 
ATOM   4105  C  CB  . ARG B 1 65  ? 62.472  62.789  77.818  1.00 15.84 ? 62   ARG B CB  1 
ATOM   4106  C  CG  . ARG B 1 65  ? 61.182  62.521  77.076  1.00 18.66 ? 62   ARG B CG  1 
ATOM   4107  C  CD  . ARG B 1 65  ? 59.990  63.183  77.796  1.00 20.01 ? 62   ARG B CD  1 
ATOM   4108  N  NE  . ARG B 1 65  ? 60.166  64.625  77.918  1.00 22.08 ? 62   ARG B NE  1 
ATOM   4109  C  CZ  . ARG B 1 65  ? 59.819  65.511  76.987  1.00 24.74 ? 62   ARG B CZ  1 
ATOM   4110  N  NH1 . ARG B 1 65  ? 59.268  65.114  75.841  1.00 21.53 ? 62   ARG B NH1 1 
ATOM   4111  N  NH2 . ARG B 1 65  ? 60.026  66.801  77.205  1.00 24.21 ? 62   ARG B NH2 1 
ATOM   4112  N  N   . ILE B 1 66  ? 65.003  62.717  75.672  1.00 13.28 ? 63   ILE B N   1 
ATOM   4113  C  CA  . ILE B 1 66  ? 65.518  62.796  74.298  1.00 13.29 ? 63   ILE B CA  1 
ATOM   4114  C  C   . ILE B 1 66  ? 66.114  61.439  73.902  1.00 13.34 ? 63   ILE B C   1 
ATOM   4115  O  O   . ILE B 1 66  ? 65.826  60.897  72.827  1.00 12.01 ? 63   ILE B O   1 
ATOM   4116  C  CB  . ILE B 1 66  ? 66.564  63.904  74.167  1.00 13.63 ? 63   ILE B CB  1 
ATOM   4117  C  CG1 . ILE B 1 66  ? 65.878  65.259  74.350  1.00 15.59 ? 63   ILE B CG1 1 
ATOM   4118  C  CG2 . ILE B 1 66  ? 67.293  63.832  72.818  1.00 11.80 ? 63   ILE B CG2 1 
ATOM   4119  C  CD1 . ILE B 1 66  ? 66.824  66.411  74.393  1.00 17.07 ? 63   ILE B CD1 1 
ATOM   4120  N  N   . GLN B 1 67  ? 66.931  60.886  74.784  1.00 14.74 ? 64   GLN B N   1 
ATOM   4121  C  CA  . GLN B 1 67  ? 67.556  59.585  74.544  1.00 15.61 ? 64   GLN B CA  1 
ATOM   4122  C  C   . GLN B 1 67  ? 66.493  58.478  74.369  1.00 16.38 ? 64   GLN B C   1 
ATOM   4123  O  O   . GLN B 1 67  ? 66.641  57.588  73.530  1.00 15.95 ? 64   GLN B O   1 
ATOM   4124  C  CB  . GLN B 1 67  ? 68.514  59.242  75.694  1.00 15.87 ? 64   GLN B CB  1 
ATOM   4125  C  CG  . GLN B 1 67  ? 69.641  60.249  75.868  1.00 18.50 ? 64   GLN B CG  1 
ATOM   4126  C  CD  . GLN B 1 67  ? 70.615  59.905  76.992  1.00 23.57 ? 64   GLN B CD  1 
ATOM   4127  O  OE1 . GLN B 1 67  ? 70.223  59.772  78.152  1.00 25.12 ? 64   GLN B OE1 1 
ATOM   4128  N  NE2 . GLN B 1 67  ? 71.903  59.799  76.650  1.00 21.73 ? 64   GLN B NE2 1 
ATOM   4129  N  N   . LYS B 1 68  ? 65.426  58.542  75.171  1.00 17.38 ? 65   LYS B N   1 
ATOM   4130  C  CA  . LYS B 1 68  ? 64.344  57.559  75.091  1.00 17.30 ? 65   LYS B CA  1 
ATOM   4131  C  C   . LYS B 1 68  ? 63.596  57.689  73.762  1.00 16.38 ? 65   LYS B C   1 
ATOM   4132  O  O   . LYS B 1 68  ? 63.281  56.687  73.127  1.00 15.06 ? 65   LYS B O   1 
ATOM   4133  C  CB  . LYS B 1 68  ? 63.395  57.719  76.280  1.00 18.16 ? 65   LYS B CB  1 
ATOM   4134  C  CG  . LYS B 1 68  ? 62.229  56.741  76.319  1.00 22.01 ? 65   LYS B CG  1 
ATOM   4135  C  CD  . LYS B 1 68  ? 61.465  56.885  77.626  1.00 28.48 ? 65   LYS B CD  1 
ATOM   4136  C  CE  . LYS B 1 68  ? 60.264  55.942  77.720  1.00 32.79 ? 65   LYS B CE  1 
ATOM   4137  N  NZ  . LYS B 1 68  ? 59.219  56.254  76.703  1.00 37.05 ? 65   LYS B NZ  1 
ATOM   4138  N  N   . CYS B 1 69  ? 63.292  58.917  73.356  1.00 15.38 ? 66   CYS B N   1 
ATOM   4139  C  CA  . CYS B 1 69  ? 62.631  59.154  72.064  1.00 15.99 ? 66   CYS B CA  1 
ATOM   4140  C  C   . CYS B 1 69  ? 63.523  58.737  70.897  1.00 14.89 ? 66   CYS B C   1 
ATOM   4141  O  O   . CYS B 1 69  ? 63.043  58.225  69.884  1.00 15.05 ? 66   CYS B O   1 
ATOM   4142  C  CB  . CYS B 1 69  ? 62.244  60.616  71.902  1.00 16.14 ? 66   CYS B CB  1 
ATOM   4143  S  SG  . CYS B 1 69  ? 60.819  61.100  72.938  1.00 20.02 ? 66   CYS B SG  1 
ATOM   4144  N  N   . ALA B 1 70  ? 64.822  58.952  71.039  1.00 14.23 ? 67   ALA B N   1 
ATOM   4145  C  CA  . ALA B 1 70  ? 65.757  58.575  69.997  1.00 13.88 ? 67   ALA B CA  1 
ATOM   4146  C  C   . ALA B 1 70  ? 65.734  57.064  69.807  1.00 13.88 ? 67   ALA B C   1 
ATOM   4147  O  O   . ALA B 1 70  ? 65.749  56.579  68.669  1.00 14.45 ? 67   ALA B O   1 
ATOM   4148  C  CB  . ALA B 1 70  ? 67.172  59.058  70.314  1.00 12.02 ? 67   ALA B CB  1 
ATOM   4149  N  N   . GLU B 1 71  ? 65.729  56.310  70.900  1.00 14.56 ? 68   GLU B N   1 
ATOM   4150  C  CA  . GLU B 1 71  ? 65.673  54.845  70.774  1.00 15.90 ? 68   GLU B CA  1 
ATOM   4151  C  C   . GLU B 1 71  ? 64.347  54.381  70.165  1.00 15.34 ? 68   GLU B C   1 
ATOM   4152  O  O   . GLU B 1 71  ? 64.319  53.412  69.402  1.00 14.81 ? 68   GLU B O   1 
ATOM   4153  C  CB  . GLU B 1 71  ? 65.932  54.154  72.109  1.00 17.18 ? 68   GLU B CB  1 
ATOM   4154  C  CG  . GLU B 1 71  ? 67.319  54.445  72.642  1.00 22.06 ? 68   GLU B CG  1 
ATOM   4155  C  CD  . GLU B 1 71  ? 68.419  53.993  71.691  1.00 23.77 ? 68   GLU B CD  1 
ATOM   4156  O  OE1 . GLU B 1 71  ? 68.290  52.897  71.096  1.00 24.18 ? 68   GLU B OE1 1 
ATOM   4157  O  OE2 . GLU B 1 71  ? 69.420  54.733  71.556  1.00 28.65 ? 68   GLU B OE2 1 
ATOM   4158  N  N   . LYS B 1 72  ? 63.255  55.062  70.501  1.00 15.04 ? 69   LYS B N   1 
ATOM   4159  C  CA  . LYS B 1 72  ? 61.947  54.725  69.940  1.00 15.65 ? 69   LYS B CA  1 
ATOM   4160  C  C   . LYS B 1 72  ? 61.966  54.858  68.416  1.00 14.98 ? 69   LYS B C   1 
ATOM   4161  O  O   . LYS B 1 72  ? 61.570  53.938  67.668  1.00 13.69 ? 69   LYS B O   1 
ATOM   4162  C  CB  . LYS B 1 72  ? 60.868  55.658  70.506  1.00 16.60 ? 69   LYS B CB  1 
ATOM   4163  C  CG  . LYS B 1 72  ? 59.495  55.447  69.888  1.00 19.54 ? 69   LYS B CG  1 
ATOM   4164  C  CD  . LYS B 1 72  ? 58.437  56.341  70.507  1.00 21.87 ? 69   LYS B CD  1 
ATOM   4165  C  CE  . LYS B 1 72  ? 57.057  56.028  69.937  1.00 24.38 ? 69   LYS B CE  1 
ATOM   4166  N  NZ  . LYS B 1 72  ? 57.003  56.136  68.434  1.00 26.60 ? 69   LYS B NZ  1 
ATOM   4167  N  N   . ILE B 1 73  ? 62.465  56.005  67.968  1.00 14.07 ? 70   ILE B N   1 
ATOM   4168  C  CA  . ILE B 1 73  ? 62.540  56.330  66.553  1.00 13.41 ? 70   ILE B CA  1 
ATOM   4169  C  C   . ILE B 1 73  ? 63.448  55.350  65.807  1.00 13.99 ? 70   ILE B C   1 
ATOM   4170  O  O   . ILE B 1 73  ? 63.111  54.888  64.712  1.00 13.49 ? 70   ILE B O   1 
ATOM   4171  C  CB  . ILE B 1 73  ? 63.010  57.785  66.362  1.00 13.71 ? 70   ILE B CB  1 
ATOM   4172  C  CG1 . ILE B 1 73  ? 61.970  58.759  66.932  1.00 12.97 ? 70   ILE B CG1 1 
ATOM   4173  C  CG2 . ILE B 1 73  ? 63.231  58.076  64.887  1.00 12.39 ? 70   ILE B CG2 1 
ATOM   4174  C  CD1 . ILE B 1 73  ? 62.467  60.214  67.064  1.00 12.41 ? 70   ILE B CD1 1 
ATOM   4175  N  N   . LYS B 1 74  ? 64.597  55.026  66.393  1.00 14.13 ? 71   LYS B N   1 
ATOM   4176  C  CA  . LYS B 1 74  ? 65.506  54.051  65.780  1.00 14.38 ? 71   LYS B CA  1 
ATOM   4177  C  C   . LYS B 1 74  ? 64.851  52.683  65.584  1.00 14.94 ? 71   LYS B C   1 
ATOM   4178  O  O   . LYS B 1 74  ? 65.159  51.965  64.623  1.00 15.32 ? 71   LYS B O   1 
ATOM   4179  C  CB  . LYS B 1 74  ? 66.759  53.846  66.638  1.00 14.98 ? 71   LYS B CB  1 
ATOM   4180  C  CG  . LYS B 1 74  ? 67.720  55.023  66.743  1.00 17.75 ? 71   LYS B CG  1 
ATOM   4181  C  CD  . LYS B 1 74  ? 68.835  54.641  67.748  1.00 20.75 ? 71   LYS B CD  1 
ATOM   4182  C  CE  . LYS B 1 74  ? 69.790  55.756  68.062  1.00 22.85 ? 71   LYS B CE  1 
ATOM   4183  N  NZ  . LYS B 1 74  ? 70.816  55.318  69.107  1.00 24.55 ? 71   LYS B NZ  1 
ATOM   4184  N  N   A ASN B 1 75  ? 63.958  52.309  66.489  0.70 15.25 ? 72   ASN B N   1 
ATOM   4185  N  N   B ASN B 1 75  ? 63.944  52.332  66.489  0.30 14.06 ? 72   ASN B N   1 
ATOM   4186  C  CA  A ASN B 1 75  ? 63.283  51.022  66.373  0.70 16.61 ? 72   ASN B CA  1 
ATOM   4187  C  CA  B ASN B 1 75  ? 63.260  51.042  66.442  0.30 13.83 ? 72   ASN B CA  1 
ATOM   4188  C  C   A ASN B 1 75  ? 62.045  50.986  65.479  0.70 15.85 ? 72   ASN B C   1 
ATOM   4189  C  C   B ASN B 1 75  ? 62.010  50.982  65.554  0.30 14.48 ? 72   ASN B C   1 
ATOM   4190  O  O   A ASN B 1 75  ? 61.669  49.913  65.010  0.70 15.89 ? 72   ASN B O   1 
ATOM   4191  O  O   B ASN B 1 75  ? 61.588  49.890  65.172  0.30 14.45 ? 72   ASN B O   1 
ATOM   4192  C  CB  A ASN B 1 75  ? 62.882  50.480  67.745  0.70 17.02 ? 72   ASN B CB  1 
ATOM   4193  C  CB  B ASN B 1 75  ? 62.843  50.631  67.858  0.30 13.03 ? 72   ASN B CB  1 
ATOM   4194  C  CG  A ASN B 1 75  ? 64.046  49.895  68.500  0.70 23.19 ? 72   ASN B CG  1 
ATOM   4195  C  CG  B ASN B 1 75  ? 62.180  49.265  67.896  0.30 11.03 ? 72   ASN B CG  1 
ATOM   4196  O  OD1 A ASN B 1 75  ? 63.919  48.824  69.096  0.70 35.08 ? 72   ASN B OD1 1 
ATOM   4197  O  OD1 B ASN B 1 75  ? 62.674  48.312  67.304  0.30 6.51  ? 72   ASN B OD1 1 
ATOM   4198  N  ND2 A ASN B 1 75  ? 65.203  50.547  68.435  0.70 24.20 ? 72   ASN B ND2 1 
ATOM   4199  N  ND2 B ASN B 1 75  ? 61.073  49.162  68.619  0.30 10.25 ? 72   ASN B ND2 1 
ATOM   4200  N  N   . ASP B 1 76  ? 61.405  52.130  65.244  1.00 15.71 ? 73   ASP B N   1 
ATOM   4201  C  CA  . ASP B 1 76  ? 60.161  52.138  64.438  1.00 15.47 ? 73   ASP B CA  1 
ATOM   4202  C  C   . ASP B 1 76  ? 60.200  52.920  63.136  1.00 15.67 ? 73   ASP B C   1 
ATOM   4203  O  O   . ASP B 1 76  ? 59.190  52.973  62.419  1.00 14.89 ? 73   ASP B O   1 
ATOM   4204  C  CB  . ASP B 1 76  ? 58.960  52.612  65.306  1.00 16.52 ? 73   ASP B CB  1 
ATOM   4205  C  CG  . ASP B 1 76  ? 59.015  54.105  65.660  1.00 17.41 ? 73   ASP B CG  1 
ATOM   4206  O  OD1 . ASP B 1 76  ? 59.835  54.853  65.061  1.00 19.22 ? 73   ASP B OD1 1 
ATOM   4207  O  OD2 . ASP B 1 76  ? 58.209  54.537  66.532  1.00 21.05 ? 73   ASP B OD2 1 
ATOM   4208  N  N   . SER B 1 77  ? 61.357  53.493  62.806  1.00 15.12 ? 74   SER B N   1 
ATOM   4209  C  CA  . SER B 1 77  ? 61.469  54.299  61.607  1.00 14.45 ? 74   SER B CA  1 
ATOM   4210  C  C   . SER B 1 77  ? 62.689  54.006  60.734  1.00 13.36 ? 74   SER B C   1 
ATOM   4211  O  O   . SER B 1 77  ? 63.795  53.855  61.222  1.00 14.29 ? 74   SER B O   1 
ATOM   4212  C  CB  . SER B 1 77  ? 61.499  55.794  61.978  1.00 14.18 ? 74   SER B CB  1 
ATOM   4213  O  OG  . SER B 1 77  ? 60.379  56.168  62.775  1.00 16.39 ? 74   SER B OG  1 
ATOM   4214  N  N   . ASP B 1 78  ? 62.450  53.940  59.430  1.00 11.87 ? 75   ASP B N   1 
ATOM   4215  C  CA  . ASP B 1 78  ? 63.510  53.817  58.443  1.00 12.27 ? 75   ASP B CA  1 
ATOM   4216  C  C   . ASP B 1 78  ? 64.140  55.208  58.225  1.00 12.37 ? 75   ASP B C   1 
ATOM   4217  O  O   . ASP B 1 78  ? 65.322  55.346  57.862  1.00 13.01 ? 75   ASP B O   1 
ATOM   4218  C  CB  . ASP B 1 78  ? 62.912  53.386  57.120  1.00 11.02 ? 75   ASP B CB  1 
ATOM   4219  C  CG  . ASP B 1 78  ? 62.330  51.964  57.154  1.00 15.77 ? 75   ASP B CG  1 
ATOM   4220  O  OD1 . ASP B 1 78  ? 63.075  51.013  57.456  1.00 19.76 ? 75   ASP B OD1 1 
ATOM   4221  O  OD2 . ASP B 1 78  ? 61.148  51.795  56.797  1.00 17.41 ? 75   ASP B OD2 1 
ATOM   4222  N  N   . ILE B 1 79  ? 63.317  56.234  58.419  1.00 11.51 ? 76   ILE B N   1 
ATOM   4223  C  CA  . ILE B 1 79  ? 63.693  57.617  58.170  1.00 13.06 ? 76   ILE B CA  1 
ATOM   4224  C  C   . ILE B 1 79  ? 63.184  58.601  59.220  1.00 12.85 ? 76   ILE B C   1 
ATOM   4225  O  O   . ILE B 1 79  ? 62.037  58.498  59.670  1.00 12.57 ? 76   ILE B O   1 
ATOM   4226  C  CB  . ILE B 1 79  ? 63.026  58.091  56.835  1.00 12.74 ? 76   ILE B CB  1 
ATOM   4227  C  CG1 . ILE B 1 79  ? 63.534  57.284  55.646  1.00 14.73 ? 76   ILE B CG1 1 
ATOM   4228  C  CG2 . ILE B 1 79  ? 63.248  59.606  56.605  1.00 15.78 ? 76   ILE B CG2 1 
ATOM   4229  C  CD1 . ILE B 1 79  ? 62.811  57.596  54.320  1.00 15.72 ? 76   ILE B CD1 1 
ATOM   4230  N  N   . LEU B 1 80  ? 64.041  59.546  59.606  1.00 12.47 ? 77   LEU B N   1 
ATOM   4231  C  CA  . LEU B 1 80  ? 63.648  60.632  60.469  1.00 11.90 ? 77   LEU B CA  1 
ATOM   4232  C  C   . LEU B 1 80  ? 63.672  61.845  59.564  1.00 13.64 ? 77   LEU B C   1 
ATOM   4233  O  O   . LEU B 1 80  ? 64.692  62.136  58.911  1.00 12.88 ? 77   LEU B O   1 
ATOM   4234  C  CB  . LEU B 1 80  ? 64.597  60.864  61.659  1.00 12.35 ? 77   LEU B CB  1 
ATOM   4235  C  CG  . LEU B 1 80  ? 64.247  62.163  62.422  1.00 12.97 ? 77   LEU B CG  1 
ATOM   4236  C  CD1 . LEU B 1 80  ? 62.825  62.127  63.071  1.00 12.46 ? 77   LEU B CD1 1 
ATOM   4237  C  CD2 . LEU B 1 80  ? 65.308  62.487  63.503  1.00 13.65 ? 77   LEU B CD2 1 
ATOM   4238  N  N   . LEU B 1 81  ? 62.540  62.540  59.495  1.00 13.22 ? 78   LEU B N   1 
ATOM   4239  C  CA  . LEU B 1 81  ? 62.431  63.730  58.703  1.00 13.62 ? 78   LEU B CA  1 
ATOM   4240  C  C   . LEU B 1 81  ? 62.479  64.929  59.637  1.00 14.10 ? 78   LEU B C   1 
ATOM   4241  O  O   . LEU B 1 81  ? 61.602  65.091  60.504  1.00 14.07 ? 78   LEU B O   1 
ATOM   4242  C  CB  . LEU B 1 81  ? 61.120  63.704  57.933  1.00 15.27 ? 78   LEU B CB  1 
ATOM   4243  C  CG  . LEU B 1 81  ? 60.826  64.828  56.947  1.00 18.93 ? 78   LEU B CG  1 
ATOM   4244  C  CD1 . LEU B 1 81  ? 61.989  65.012  55.955  1.00 18.96 ? 78   LEU B CD1 1 
ATOM   4245  C  CD2 . LEU B 1 81  ? 59.510  64.495  56.230  1.00 21.50 ? 78   LEU B CD2 1 
ATOM   4246  N  N   . VAL B 1 82  ? 63.520  65.741  59.495  1.00 12.70 ? 79   VAL B N   1 
ATOM   4247  C  CA  . VAL B 1 82  ? 63.695  66.934  60.317  1.00 12.52 ? 79   VAL B CA  1 
ATOM   4248  C  C   . VAL B 1 82  ? 63.148  68.148  59.567  1.00 13.11 ? 79   VAL B C   1 
ATOM   4249  O  O   . VAL B 1 82  ? 63.588  68.421  58.467  1.00 13.14 ? 79   VAL B O   1 
ATOM   4250  C  CB  . VAL B 1 82  ? 65.180  67.187  60.635  1.00 12.96 ? 79   VAL B CB  1 
ATOM   4251  C  CG1 . VAL B 1 82  ? 65.358  68.539  61.401  1.00 9.71  ? 79   VAL B CG1 1 
ATOM   4252  C  CG2 . VAL B 1 82  ? 65.746  66.036  61.430  1.00 12.32 ? 79   VAL B CG2 1 
ATOM   4253  N  N   . VAL B 1 83  ? 62.183  68.843  60.164  1.00 12.98 ? 80   VAL B N   1 
ATOM   4254  C  CA  . VAL B 1 83  ? 61.546  70.004  59.568  1.00 12.61 ? 80   VAL B CA  1 
ATOM   4255  C  C   . VAL B 1 83  ? 62.030  71.233  60.343  1.00 13.40 ? 80   VAL B C   1 
ATOM   4256  O  O   . VAL B 1 83  ? 61.714  71.411  61.533  1.00 12.88 ? 80   VAL B O   1 
ATOM   4257  C  CB  . VAL B 1 83  ? 60.000  69.904  59.614  1.00 13.48 ? 80   VAL B CB  1 
ATOM   4258  C  CG1 . VAL B 1 83  ? 59.362  71.078  58.882  1.00 11.11 ? 80   VAL B CG1 1 
ATOM   4259  C  CG2 . VAL B 1 83  ? 59.519  68.590  58.988  1.00 10.22 ? 80   VAL B CG2 1 
ATOM   4260  N  N   . GLY B 1 84  ? 62.821  72.061  59.669  1.00 13.15 ? 81   GLY B N   1 
ATOM   4261  C  CA  . GLY B 1 84  ? 63.397  73.250  60.280  1.00 13.23 ? 81   GLY B CA  1 
ATOM   4262  C  C   . GLY B 1 84  ? 64.274  74.034  59.315  1.00 13.95 ? 81   GLY B C   1 
ATOM   4263  O  O   . GLY B 1 84  ? 64.617  73.561  58.213  1.00 13.09 ? 81   GLY B O   1 
ATOM   4264  N  N   . ILE B 1 85  ? 64.677  75.222  59.753  1.00 14.55 ? 82   ILE B N   1 
ATOM   4265  C  CA  . ILE B 1 85  ? 65.510  76.092  58.937  1.00 13.32 ? 82   ILE B CA  1 
ATOM   4266  C  C   . ILE B 1 85  ? 66.419  76.895  59.859  1.00 13.49 ? 82   ILE B C   1 
ATOM   4267  O  O   . ILE B 1 85  ? 66.173  76.963  61.061  1.00 13.90 ? 82   ILE B O   1 
ATOM   4268  C  CB  . ILE B 1 85  ? 64.593  77.020  58.076  1.00 13.06 ? 82   ILE B CB  1 
ATOM   4269  C  CG1 . ILE B 1 85  ? 65.364  77.645  56.919  1.00 12.65 ? 82   ILE B CG1 1 
ATOM   4270  C  CG2 . ILE B 1 85  ? 63.894  78.067  58.951  1.00 12.93 ? 82   ILE B CG2 1 
ATOM   4271  C  CD1 . ILE B 1 85  ? 64.463  78.322  55.864  1.00 9.11  ? 82   ILE B CD1 1 
ATOM   4272  N  N   . GLY B 1 86  ? 67.496  77.453  59.307  1.00 13.81 ? 83   GLY B N   1 
ATOM   4273  C  CA  . GLY B 1 86  ? 68.439  78.248  60.074  1.00 13.89 ? 83   GLY B CA  1 
ATOM   4274  C  C   . GLY B 1 86  ? 68.926  77.556  61.333  1.00 15.24 ? 83   GLY B C   1 
ATOM   4275  O  O   . GLY B 1 86  ? 69.428  76.436  61.285  1.00 13.66 ? 83   GLY B O   1 
ATOM   4276  N  N   . GLY B 1 87  ? 68.772  78.235  62.467  1.00 14.99 ? 84   GLY B N   1 
ATOM   4277  C  CA  . GLY B 1 87  ? 69.231  77.712  63.742  1.00 15.13 ? 84   GLY B CA  1 
ATOM   4278  C  C   . GLY B 1 87  ? 68.660  76.357  64.107  1.00 16.80 ? 84   GLY B C   1 
ATOM   4279  O  O   . GLY B 1 87  ? 69.279  75.590  64.865  1.00 15.68 ? 84   GLY B O   1 
ATOM   4280  N  N   . SER B 1 88  ? 67.480  76.054  63.568  1.00 16.18 ? 85   SER B N   1 
ATOM   4281  C  CA  . SER B 1 88  ? 66.818  74.792  63.851  1.00 17.03 ? 85   SER B CA  1 
ATOM   4282  C  C   . SER B 1 88  ? 67.148  73.708  62.826  1.00 16.68 ? 85   SER B C   1 
ATOM   4283  O  O   . SER B 1 88  ? 66.512  72.659  62.836  1.00 18.80 ? 85   SER B O   1 
ATOM   4284  C  CB  . SER B 1 88  ? 65.309  75.009  63.866  1.00 17.48 ? 85   SER B CB  1 
ATOM   4285  O  OG  . SER B 1 88  ? 64.947  75.912  64.879  1.00 18.08 ? 85   SER B OG  1 
ATOM   4286  N  N   . TYR B 1 89  ? 68.154  73.970  61.984  1.00 15.21 ? 86   TYR B N   1 
ATOM   4287  C  CA  . TYR B 1 89  ? 68.598  73.081  60.911  1.00 14.80 ? 86   TYR B CA  1 
ATOM   4288  C  C   . TYR B 1 89  ? 70.118  72.817  60.829  1.00 15.07 ? 86   TYR B C   1 
ATOM   4289  O  O   . TYR B 1 89  ? 70.562  71.676  60.912  1.00 13.11 ? 86   TYR B O   1 
ATOM   4290  C  CB  . TYR B 1 89  ? 68.084  73.685  59.584  1.00 15.34 ? 86   TYR B CB  1 
ATOM   4291  C  CG  . TYR B 1 89  ? 68.675  73.183  58.288  1.00 16.73 ? 86   TYR B CG  1 
ATOM   4292  C  CD1 . TYR B 1 89  ? 68.596  71.846  57.927  1.00 17.21 ? 86   TYR B CD1 1 
ATOM   4293  C  CD2 . TYR B 1 89  ? 69.229  74.079  57.363  1.00 16.11 ? 86   TYR B CD2 1 
ATOM   4294  C  CE1 . TYR B 1 89  ? 69.106  71.402  56.728  1.00 16.82 ? 86   TYR B CE1 1 
ATOM   4295  C  CE2 . TYR B 1 89  ? 69.749  73.640  56.165  1.00 14.73 ? 86   TYR B CE2 1 
ATOM   4296  C  CZ  . TYR B 1 89  ? 69.685  72.295  55.850  1.00 18.48 ? 86   TYR B CZ  1 
ATOM   4297  O  OH  . TYR B 1 89  ? 70.164  71.826  54.644  1.00 18.45 ? 86   TYR B OH  1 
ATOM   4298  N  N   . LEU B 1 90  ? 70.910  73.882  60.746  1.00 15.45 ? 87   LEU B N   1 
ATOM   4299  C  CA  . LEU B 1 90  ? 72.359  73.762  60.488  1.00 14.69 ? 87   LEU B CA  1 
ATOM   4300  C  C   . LEU B 1 90  ? 73.201  73.070  61.534  1.00 14.29 ? 87   LEU B C   1 
ATOM   4301  O  O   . LEU B 1 90  ? 74.129  72.344  61.187  1.00 13.24 ? 87   LEU B O   1 
ATOM   4302  C  CB  . LEU B 1 90  ? 72.952  75.139  60.185  1.00 14.59 ? 87   LEU B CB  1 
ATOM   4303  C  CG  . LEU B 1 90  ? 72.402  75.872  58.967  1.00 15.83 ? 87   LEU B CG  1 
ATOM   4304  C  CD1 . LEU B 1 90  ? 72.928  77.299  58.958  1.00 14.70 ? 87   LEU B CD1 1 
ATOM   4305  C  CD2 . LEU B 1 90  ? 72.734  75.123  57.660  1.00 18.11 ? 87   LEU B CD2 1 
ATOM   4306  N  N   . GLY B 1 91  ? 72.881  73.276  62.807  1.00 13.02 ? 88   GLY B N   1 
ATOM   4307  C  CA  . GLY B 1 91  ? 73.636  72.638  63.876  1.00 14.78 ? 88   GLY B CA  1 
ATOM   4308  C  C   . GLY B 1 91  ? 73.521  71.124  63.837  1.00 14.25 ? 88   GLY B C   1 
ATOM   4309  O  O   . GLY B 1 91  ? 74.525  70.398  63.933  1.00 14.46 ? 88   GLY B O   1 
ATOM   4310  N  N   . ALA B 1 92  ? 72.294  70.631  63.721  1.00 15.26 ? 89   ALA B N   1 
ATOM   4311  C  CA  . ALA B 1 92  ? 72.080  69.183  63.645  1.00 14.80 ? 89   ALA B CA  1 
ATOM   4312  C  C   . ALA B 1 92  ? 72.707  68.618  62.389  1.00 14.63 ? 89   ALA B C   1 
ATOM   4313  O  O   . ALA B 1 92  ? 73.360  67.564  62.428  1.00 15.72 ? 89   ALA B O   1 
ATOM   4314  C  CB  . ALA B 1 92  ? 70.614  68.850  63.679  1.00 15.02 ? 89   ALA B CB  1 
ATOM   4315  N  N   . ARG B 1 93  ? 72.516  69.299  61.268  1.00 14.31 ? 90   ARG B N   1 
ATOM   4316  C  CA  . ARG B 1 93  ? 73.070  68.788  60.040  1.00 14.94 ? 90   ARG B CA  1 
ATOM   4317  C  C   . ARG B 1 93  ? 74.601  68.775  60.088  1.00 13.68 ? 90   ARG B C   1 
ATOM   4318  O  O   . ARG B 1 93  ? 75.232  67.809  59.664  1.00 13.17 ? 90   ARG B O   1 
ATOM   4319  C  CB  . ARG B 1 93  ? 72.536  69.527  58.822  1.00 14.81 ? 90   ARG B CB  1 
ATOM   4320  C  CG  . ARG B 1 93  ? 72.944  68.828  57.565  1.00 19.05 ? 90   ARG B CG  1 
ATOM   4321  C  CD  . ARG B 1 93  ? 72.154  69.254  56.357  1.00 22.12 ? 90   ARG B CD  1 
ATOM   4322  N  NE  . ARG B 1 93  ? 72.498  68.398  55.228  1.00 26.20 ? 90   ARG B NE  1 
ATOM   4323  C  CZ  . ARG B 1 93  ? 71.866  68.392  54.057  1.00 29.05 ? 90   ARG B CZ  1 
ATOM   4324  N  NH1 . ARG B 1 93  ? 70.854  69.218  53.843  1.00 25.26 ? 90   ARG B NH1 1 
ATOM   4325  N  NH2 . ARG B 1 93  ? 72.256  67.555  53.098  1.00 30.13 ? 90   ARG B NH2 1 
ATOM   4326  N  N   . ALA B 1 94  ? 75.191  69.843  60.624  1.00 14.25 ? 91   ALA B N   1 
ATOM   4327  C  CA  . ALA B 1 94  ? 76.653  69.917  60.787  1.00 14.23 ? 91   ALA B CA  1 
ATOM   4328  C  C   . ALA B 1 94  ? 77.173  68.716  61.587  1.00 13.75 ? 91   ALA B C   1 
ATOM   4329  O  O   . ALA B 1 94  ? 78.152  68.067  61.204  1.00 13.00 ? 91   ALA B O   1 
ATOM   4330  C  CB  . ALA B 1 94  ? 77.033  71.222  61.498  1.00 15.04 ? 91   ALA B CB  1 
ATOM   4331  N  N   . ALA B 1 95  ? 76.522  68.416  62.712  1.00 13.30 ? 92   ALA B N   1 
ATOM   4332  C  CA  . ALA B 1 95  ? 76.951  67.304  63.555  1.00 13.80 ? 92   ALA B CA  1 
ATOM   4333  C  C   . ALA B 1 95  ? 76.776  65.948  62.898  1.00 14.59 ? 92   ALA B C   1 
ATOM   4334  O  O   . ALA B 1 95  ? 77.671  65.103  62.953  1.00 15.15 ? 92   ALA B O   1 
ATOM   4335  C  CB  . ALA B 1 95  ? 76.186  67.312  64.899  1.00 13.40 ? 92   ALA B CB  1 
ATOM   4336  N  N   . ILE B 1 96  ? 75.602  65.734  62.318  1.00 15.39 ? 93   ILE B N   1 
ATOM   4337  C  CA  . ILE B 1 96  ? 75.278  64.459  61.693  1.00 16.72 ? 93   ILE B CA  1 
ATOM   4338  C  C   . ILE B 1 96  ? 76.246  64.129  60.568  1.00 16.44 ? 93   ILE B C   1 
ATOM   4339  O  O   . ILE B 1 96  ? 76.762  63.011  60.495  1.00 14.45 ? 93   ILE B O   1 
ATOM   4340  C  CB  . ILE B 1 96  ? 73.797  64.419  61.216  1.00 16.46 ? 93   ILE B CB  1 
ATOM   4341  C  CG1 . ILE B 1 96  ? 72.856  64.431  62.439  1.00 17.26 ? 93   ILE B CG1 1 
ATOM   4342  C  CG2 . ILE B 1 96  ? 73.537  63.168  60.408  1.00 17.88 ? 93   ILE B CG2 1 
ATOM   4343  C  CD1 . ILE B 1 96  ? 71.366  64.525  62.118  1.00 17.54 ? 93   ILE B CD1 1 
ATOM   4344  N  N   . GLU B 1 97  ? 76.550  65.120  59.732  1.00 17.27 ? 94   GLU B N   1 
ATOM   4345  C  CA  . GLU B 1 97  ? 77.473  64.900  58.612  1.00 16.88 ? 94   GLU B CA  1 
ATOM   4346  C  C   . GLU B 1 97  ? 78.945  64.820  59.027  1.00 17.13 ? 94   GLU B C   1 
ATOM   4347  O  O   . GLU B 1 97  ? 79.721  64.095  58.404  1.00 17.30 ? 94   GLU B O   1 
ATOM   4348  C  CB  . GLU B 1 97  ? 77.281  65.973  57.524  1.00 17.71 ? 94   GLU B CB  1 
ATOM   4349  C  CG  . GLU B 1 97  ? 75.903  65.864  56.876  1.00 23.30 ? 94   GLU B CG  1 
ATOM   4350  C  CD  . GLU B 1 97  ? 75.793  66.522  55.507  1.00 29.54 ? 94   GLU B CD  1 
ATOM   4351  O  OE1 . GLU B 1 97  ? 76.796  67.092  55.006  1.00 31.66 ? 94   GLU B OE1 1 
ATOM   4352  O  OE2 . GLU B 1 97  ? 74.686  66.431  54.917  1.00 28.45 ? 94   GLU B OE2 1 
HETATM 4353  N  N   . MSE B 1 98  ? 79.332  65.593  60.039  1.00 15.96 ? 95   MSE B N   1 
HETATM 4354  C  CA  . MSE B 1 98  ? 80.709  65.597  60.506  1.00 16.46 ? 95   MSE B CA  1 
HETATM 4355  C  C   . MSE B 1 98  ? 81.122  64.323  61.210  1.00 15.46 ? 95   MSE B C   1 
HETATM 4356  O  O   . MSE B 1 98  ? 82.284  63.931  61.140  1.00 15.66 ? 95   MSE B O   1 
HETATM 4357  C  CB  . MSE B 1 98  ? 80.945  66.718  61.521  1.00 14.98 ? 95   MSE B CB  1 
HETATM 4358  C  CG  . MSE B 1 98  ? 82.306  66.572  62.184  1.00 21.23 ? 95   MSE B CG  1 
HETATM 4359  SE SE  . MSE B 1 98  ? 82.717  67.836  63.602  1.00 30.74 ? 95   MSE B SE  1 
HETATM 4360  C  CE  . MSE B 1 98  ? 82.465  69.364  62.496  1.00 14.15 ? 95   MSE B CE  1 
ATOM   4361  N  N   . LEU B 1 99  ? 80.174  63.710  61.916  1.00 14.40 ? 96   LEU B N   1 
ATOM   4362  C  CA  . LEU B 1 99  ? 80.456  62.558  62.752  1.00 14.25 ? 96   LEU B CA  1 
ATOM   4363  C  C   . LEU B 1 99  ? 79.929  61.226  62.256  1.00 14.50 ? 96   LEU B C   1 
ATOM   4364  O  O   . LEU B 1 99  ? 80.229  60.214  62.861  1.00 14.09 ? 96   LEU B O   1 
ATOM   4365  C  CB  . LEU B 1 99  ? 79.901  62.813  64.155  1.00 12.28 ? 96   LEU B CB  1 
ATOM   4366  C  CG  . LEU B 1 99  ? 80.379  64.114  64.813  1.00 17.19 ? 96   LEU B CG  1 
ATOM   4367  C  CD1 . LEU B 1 99  ? 79.627  64.342  66.154  1.00 14.44 ? 96   LEU B CD1 1 
ATOM   4368  C  CD2 . LEU B 1 99  ? 81.901  64.140  65.005  1.00 17.66 ? 96   LEU B CD2 1 
ATOM   4369  N  N   . ASN B 1 100 ? 79.141  61.226  61.184  1.00 13.76 ? 97   ASN B N   1 
ATOM   4370  C  CA  . ASN B 1 100 ? 78.635  59.979  60.591  1.00 14.16 ? 97   ASN B CA  1 
ATOM   4371  C  C   . ASN B 1 100 ? 79.303  59.656  59.247  1.00 13.37 ? 97   ASN B C   1 
ATOM   4372  O  O   . ASN B 1 100 ? 80.045  60.467  58.698  1.00 13.36 ? 97   ASN B O   1 
ATOM   4373  C  CB  . ASN B 1 100 ? 77.112  60.033  60.428  1.00 13.56 ? 97   ASN B CB  1 
ATOM   4374  C  CG  . ASN B 1 100 ? 76.382  59.751  61.716  1.00 15.44 ? 97   ASN B CG  1 
ATOM   4375  O  OD1 . ASN B 1 100 ? 76.391  58.618  62.209  1.00 19.86 ? 97   ASN B OD1 1 
ATOM   4376  N  ND2 . ASN B 1 100 ? 75.702  60.754  62.245  1.00 11.44 ? 97   ASN B ND2 1 
ATOM   4377  N  N   . HIS B 1 101 ? 79.044  58.451  58.755  1.00 13.50 ? 98   HIS B N   1 
ATOM   4378  C  CA  . HIS B 1 101 ? 79.572  57.969  57.487  1.00 13.76 ? 98   HIS B CA  1 
ATOM   4379  C  C   . HIS B 1 101 ? 79.342  59.027  56.387  1.00 13.74 ? 98   HIS B C   1 
ATOM   4380  O  O   . HIS B 1 101 ? 78.278  59.629  56.321  1.00 11.93 ? 98   HIS B O   1 
ATOM   4381  C  CB  . HIS B 1 101 ? 78.847  56.670  57.130  1.00 14.14 ? 98   HIS B CB  1 
ATOM   4382  C  CG  . HIS B 1 101 ? 79.480  55.904  56.016  1.00 14.73 ? 98   HIS B CG  1 
ATOM   4383  N  ND1 . HIS B 1 101 ? 79.251  56.192  54.688  1.00 12.32 ? 98   HIS B ND1 1 
ATOM   4384  C  CD2 . HIS B 1 101 ? 80.316  54.834  56.032  1.00 14.95 ? 98   HIS B CD2 1 
ATOM   4385  C  CE1 . HIS B 1 101 ? 79.927  55.337  53.935  1.00 15.23 ? 98   HIS B CE1 1 
ATOM   4386  N  NE2 . HIS B 1 101 ? 80.574  54.498  54.727  1.00 11.01 ? 98   HIS B NE2 1 
ATOM   4387  N  N   . SER B 1 102 ? 80.347  59.246  55.539  1.00 14.10 ? 99   SER B N   1 
ATOM   4388  C  CA  . SER B 1 102 ? 80.272  60.231  54.455  1.00 14.44 ? 99   SER B CA  1 
ATOM   4389  C  C   . SER B 1 102 ? 79.112  60.017  53.471  1.00 14.60 ? 99   SER B C   1 
ATOM   4390  O  O   . SER B 1 102 ? 78.738  60.930  52.748  1.00 12.88 ? 99   SER B O   1 
ATOM   4391  C  CB  . SER B 1 102 ? 81.579  60.204  53.662  1.00 15.26 ? 99   SER B CB  1 
ATOM   4392  O  OG  . SER B 1 102 ? 82.690  60.370  54.519  1.00 16.24 ? 99   SER B OG  1 
ATOM   4393  N  N   . PHE B 1 103 ? 78.601  58.791  53.406  1.00 13.62 ? 100  PHE B N   1 
ATOM   4394  C  CA  . PHE B 1 103 ? 77.515  58.435  52.521  1.00 14.95 ? 100  PHE B CA  1 
ATOM   4395  C  C   . PHE B 1 103 ? 76.367  57.813  53.326  1.00 15.16 ? 100  PHE B C   1 
ATOM   4396  O  O   . PHE B 1 103 ? 75.628  56.963  52.838  1.00 14.27 ? 100  PHE B O   1 
ATOM   4397  C  CB  . PHE B 1 103 ? 78.028  57.480  51.433  1.00 14.60 ? 100  PHE B CB  1 
ATOM   4398  C  CG  . PHE B 1 103 ? 78.978  58.140  50.450  1.00 17.15 ? 100  PHE B CG  1 
ATOM   4399  C  CD1 . PHE B 1 103 ? 80.348  58.148  50.675  1.00 13.10 ? 100  PHE B CD1 1 
ATOM   4400  C  CD2 . PHE B 1 103 ? 78.483  58.777  49.303  1.00 16.02 ? 100  PHE B CD2 1 
ATOM   4401  C  CE1 . PHE B 1 103 ? 81.200  58.764  49.784  1.00 14.34 ? 100  PHE B CE1 1 
ATOM   4402  C  CE2 . PHE B 1 103 ? 79.338  59.383  48.395  1.00 14.46 ? 100  PHE B CE2 1 
ATOM   4403  C  CZ  . PHE B 1 103 ? 80.685  59.387  48.630  1.00 14.17 ? 100  PHE B CZ  1 
ATOM   4404  N  N   . TYR B 1 104 ? 76.235  58.298  54.557  1.00 16.15 ? 101  TYR B N   1 
ATOM   4405  C  CA  . TYR B 1 104 ? 75.232  57.853  55.540  1.00 15.90 ? 101  TYR B CA  1 
ATOM   4406  C  C   . TYR B 1 104 ? 73.885  57.412  54.955  1.00 17.68 ? 101  TYR B C   1 
ATOM   4407  O  O   . TYR B 1 104 ? 73.484  56.239  55.114  1.00 16.74 ? 101  TYR B O   1 
ATOM   4408  C  CB  . TYR B 1 104 ? 75.041  58.971  56.587  1.00 15.25 ? 101  TYR B CB  1 
ATOM   4409  C  CG  . TYR B 1 104 ? 74.133  58.617  57.736  1.00 15.50 ? 101  TYR B CG  1 
ATOM   4410  C  CD1 . TYR B 1 104 ? 74.587  57.843  58.798  1.00 13.88 ? 101  TYR B CD1 1 
ATOM   4411  C  CD2 . TYR B 1 104 ? 72.829  59.087  57.780  1.00 13.64 ? 101  TYR B CD2 1 
ATOM   4412  C  CE1 . TYR B 1 104 ? 73.746  57.516  59.856  1.00 15.34 ? 101  TYR B CE1 1 
ATOM   4413  C  CE2 . TYR B 1 104 ? 71.991  58.785  58.836  1.00 10.90 ? 101  TYR B CE2 1 
ATOM   4414  C  CZ  . TYR B 1 104 ? 72.442  58.008  59.869  1.00 15.08 ? 101  TYR B CZ  1 
ATOM   4415  O  OH  . TYR B 1 104 ? 71.575  57.698  60.896  1.00 10.18 ? 101  TYR B OH  1 
ATOM   4416  N  N   . ASN B 1 105 ? 73.191  58.334  54.286  1.00 17.88 ? 102  ASN B N   1 
ATOM   4417  C  CA  . ASN B 1 105 ? 71.863  58.042  53.706  1.00 18.87 ? 102  ASN B CA  1 
ATOM   4418  C  C   . ASN B 1 105 ? 71.832  57.127  52.490  1.00 19.22 ? 102  ASN B C   1 
ATOM   4419  O  O   . ASN B 1 105 ? 70.770  56.621  52.126  1.00 18.70 ? 102  ASN B O   1 
ATOM   4420  C  CB  . ASN B 1 105 ? 71.143  59.350  53.360  1.00 19.47 ? 102  ASN B CB  1 
ATOM   4421  C  CG  . ASN B 1 105 ? 70.681  60.104  54.579  1.00 21.48 ? 102  ASN B CG  1 
ATOM   4422  O  OD1 . ASN B 1 105 ? 70.271  59.511  55.578  1.00 16.62 ? 102  ASN B OD1 1 
ATOM   4423  N  ND2 . ASN B 1 105 ? 70.702  61.432  54.489  1.00 26.91 ? 102  ASN B ND2 1 
ATOM   4424  N  N   A THR B 1 106 ? 73.000  56.939  51.876  0.50 18.79 ? 103  THR B N   1 
ATOM   4425  N  N   B THR B 1 106 ? 72.972  56.915  51.841  0.50 19.06 ? 103  THR B N   1 
ATOM   4426  C  CA  A THR B 1 106 ? 73.166  56.104  50.695  0.50 18.62 ? 103  THR B CA  1 
ATOM   4427  C  CA  B THR B 1 106 ? 73.000  56.032  50.679  0.50 19.09 ? 103  THR B CA  1 
ATOM   4428  C  C   A THR B 1 106 ? 73.477  54.656  51.071  0.50 18.89 ? 103  THR B C   1 
ATOM   4429  C  C   B THR B 1 106 ? 73.461  54.621  51.067  0.50 19.15 ? 103  THR B C   1 
ATOM   4430  O  O   A THR B 1 106 ? 73.326  53.750  50.260  0.50 18.65 ? 103  THR B O   1 
ATOM   4431  O  O   B THR B 1 106 ? 73.414  53.707  50.253  0.50 18.87 ? 103  THR B O   1 
ATOM   4432  C  CB  A THR B 1 106 ? 74.358  56.608  49.844  0.50 18.43 ? 103  THR B CB  1 
ATOM   4433  C  CB  B THR B 1 106 ? 73.840  56.608  49.524  0.50 19.25 ? 103  THR B CB  1 
ATOM   4434  O  OG1 A THR B 1 106 ? 74.202  58.003  49.556  0.50 16.62 ? 103  THR B OG1 1 
ATOM   4435  O  OG1 B THR B 1 106 ? 75.180  56.831  49.963  0.50 18.49 ? 103  THR B OG1 1 
ATOM   4436  C  CG2 A THR B 1 106 ? 74.473  55.820  48.555  0.50 17.78 ? 103  THR B CG2 1 
ATOM   4437  C  CG2 B THR B 1 106 ? 73.237  57.921  49.041  0.50 19.58 ? 103  THR B CG2 1 
ATOM   4438  N  N   . LEU B 1 107 ? 73.923  54.448  52.305  1.00 18.75 ? 104  LEU B N   1 
ATOM   4439  C  CA  . LEU B 1 107 ? 74.274  53.119  52.790  1.00 18.97 ? 104  LEU B CA  1 
ATOM   4440  C  C   . LEU B 1 107 ? 73.007  52.277  52.847  1.00 19.38 ? 104  LEU B C   1 
ATOM   4441  O  O   . LEU B 1 107 ? 71.905  52.824  52.831  1.00 17.88 ? 104  LEU B O   1 
ATOM   4442  C  CB  . LEU B 1 107 ? 74.839  53.196  54.214  1.00 19.66 ? 104  LEU B CB  1 
ATOM   4443  C  CG  . LEU B 1 107 ? 76.212  53.816  54.453  1.00 17.36 ? 104  LEU B CG  1 
ATOM   4444  C  CD1 . LEU B 1 107 ? 76.485  53.885  55.921  1.00 19.82 ? 104  LEU B CD1 1 
ATOM   4445  C  CD2 . LEU B 1 107 ? 77.284  52.986  53.755  1.00 20.06 ? 104  LEU B CD2 1 
ATOM   4446  N  N   . SER B 1 108 ? 73.152  50.952  52.913  1.00 19.13 ? 105  SER B N   1 
ATOM   4447  C  CA  . SER B 1 108 ? 71.993  50.106  53.061  1.00 19.65 ? 105  SER B CA  1 
ATOM   4448  C  C   . SER B 1 108 ? 71.560  50.155  54.533  1.00 20.12 ? 105  SER B C   1 
ATOM   4449  O  O   . SER B 1 108 ? 72.336  50.573  55.407  1.00 16.97 ? 105  SER B O   1 
ATOM   4450  C  CB  . SER B 1 108 ? 72.286  48.655  52.651  1.00 19.19 ? 105  SER B CB  1 
ATOM   4451  O  OG  . SER B 1 108 ? 73.181  48.014  53.551  1.00 18.45 ? 105  SER B OG  1 
ATOM   4452  N  N   . LYS B 1 109 ? 70.344  49.684  54.808  1.00 21.25 ? 106  LYS B N   1 
ATOM   4453  C  CA  . LYS B 1 109 ? 69.812  49.664  56.176  1.00 23.67 ? 106  LYS B CA  1 
ATOM   4454  C  C   . LYS B 1 109 ? 70.772  48.937  57.097  1.00 23.87 ? 106  LYS B C   1 
ATOM   4455  O  O   . LYS B 1 109 ? 71.108  49.437  58.175  1.00 24.66 ? 106  LYS B O   1 
ATOM   4456  C  CB  . LYS B 1 109 ? 68.447  48.953  56.232  1.00 25.09 ? 106  LYS B CB  1 
ATOM   4457  C  CG  . LYS B 1 109 ? 67.350  49.612  55.400  1.00 30.34 ? 106  LYS B CG  1 
ATOM   4458  C  CD  . LYS B 1 109 ? 66.055  48.787  55.416  1.00 35.89 ? 106  LYS B CD  1 
ATOM   4459  C  CE  . LYS B 1 109 ? 64.986  49.402  54.499  1.00 38.82 ? 106  LYS B CE  1 
ATOM   4460  N  NZ  . LYS B 1 109 ? 63.698  48.622  54.496  1.00 40.78 ? 106  LYS B NZ  1 
ATOM   4461  N  N   . GLU B 1 110 ? 71.216  47.762  56.644  1.00 23.64 ? 107  GLU B N   1 
ATOM   4462  C  CA  . GLU B 1 110 ? 72.138  46.904  57.385  1.00 24.18 ? 107  GLU B CA  1 
ATOM   4463  C  C   . GLU B 1 110 ? 73.463  47.585  57.666  1.00 22.26 ? 107  GLU B C   1 
ATOM   4464  O  O   . GLU B 1 110 ? 73.994  47.478  58.765  1.00 22.20 ? 107  GLU B O   1 
ATOM   4465  C  CB  . GLU B 1 110 ? 72.402  45.604  56.624  1.00 24.20 ? 107  GLU B CB  1 
ATOM   4466  C  CG  . GLU B 1 110 ? 71.161  44.723  56.427  1.00 30.17 ? 107  GLU B CG  1 
ATOM   4467  C  CD  . GLU B 1 110 ? 70.059  45.366  55.560  1.00 35.33 ? 107  GLU B CD  1 
ATOM   4468  O  OE1 . GLU B 1 110 ? 70.386  46.114  54.602  1.00 33.68 ? 107  GLU B OE1 1 
ATOM   4469  O  OE2 . GLU B 1 110 ? 68.861  45.086  55.830  1.00 36.72 ? 107  GLU B OE2 1 
ATOM   4470  N  N   . GLN B 1 111 ? 74.006  48.275  56.675  1.00 21.42 ? 108  GLN B N   1 
ATOM   4471  C  CA  . GLN B 1 111 ? 75.277  48.988  56.868  1.00 21.04 ? 108  GLN B CA  1 
ATOM   4472  C  C   . GLN B 1 111 ? 75.152  50.167  57.834  1.00 20.35 ? 108  GLN B C   1 
ATOM   4473  O  O   . GLN B 1 111 ? 76.004  50.375  58.694  1.00 20.04 ? 108  GLN B O   1 
ATOM   4474  C  CB  . GLN B 1 111 ? 75.805  49.517  55.527  1.00 20.94 ? 108  GLN B CB  1 
ATOM   4475  C  CG  . GLN B 1 111 ? 76.482  48.488  54.632  1.00 22.53 ? 108  GLN B CG  1 
ATOM   4476  C  CD  . GLN B 1 111 ? 76.805  49.052  53.260  1.00 23.18 ? 108  GLN B CD  1 
ATOM   4477  O  OE1 . GLN B 1 111 ? 76.023  49.830  52.714  1.00 21.48 ? 108  GLN B OE1 1 
ATOM   4478  N  NE2 . GLN B 1 111 ? 77.942  48.631  52.677  1.00 16.46 ? 108  GLN B NE2 1 
ATOM   4479  N  N   . ARG B 1 112 ? 74.082  50.937  57.682  1.00 19.93 ? 109  ARG B N   1 
ATOM   4480  C  CA  . ARG B 1 112 ? 73.874  52.145  58.482  1.00 19.60 ? 109  ARG B CA  1 
ATOM   4481  C  C   . ARG B 1 112 ? 73.493  51.885  59.943  1.00 20.91 ? 109  ARG B C   1 
ATOM   4482  O  O   . ARG B 1 112 ? 73.998  52.564  60.843  1.00 22.52 ? 109  ARG B O   1 
ATOM   4483  C  CB  . ARG B 1 112 ? 72.833  53.048  57.798  1.00 18.05 ? 109  ARG B CB  1 
ATOM   4484  C  CG  . ARG B 1 112 ? 72.600  54.399  58.515  1.00 16.50 ? 109  ARG B CG  1 
ATOM   4485  C  CD  . ARG B 1 112 ? 71.622  55.311  57.747  1.00 12.94 ? 109  ARG B CD  1 
ATOM   4486  N  NE  . ARG B 1 112 ? 70.436  54.576  57.324  1.00 16.15 ? 109  ARG B NE  1 
ATOM   4487  C  CZ  . ARG B 1 112 ? 70.236  54.092  56.103  1.00 14.58 ? 109  ARG B CZ  1 
ATOM   4488  N  NH1 . ARG B 1 112 ? 71.094  54.333  55.131  1.00 16.96 ? 109  ARG B NH1 1 
ATOM   4489  N  NH2 . ARG B 1 112 ? 69.142  53.401  55.847  1.00 17.39 ? 109  ARG B NH2 1 
ATOM   4490  N  N   . LYS B 1 113 ? 72.582  50.935  60.164  1.00 20.07 ? 110  LYS B N   1 
ATOM   4491  C  CA  . LYS B 1 113 ? 72.132  50.552  61.501  1.00 20.56 ? 110  LYS B CA  1 
ATOM   4492  C  C   . LYS B 1 113 ? 71.049  51.499  62.061  1.00 19.15 ? 110  LYS B C   1 
ATOM   4493  O  O   . LYS B 1 113 ? 70.081  51.063  62.643  1.00 21.21 ? 110  LYS B O   1 
ATOM   4494  C  CB  . LYS B 1 113 ? 73.328  50.464  62.465  1.00 21.98 ? 110  LYS B CB  1 
ATOM   4495  C  CG  . LYS B 1 113 ? 74.497  49.595  61.956  1.00 28.69 ? 110  LYS B CG  1 
ATOM   4496  C  CD  . LYS B 1 113 ? 75.651  49.534  62.969  1.00 33.99 ? 110  LYS B CD  1 
ATOM   4497  C  CE  . LYS B 1 113 ? 76.857  48.775  62.422  1.00 37.00 ? 110  LYS B CE  1 
ATOM   4498  N  NZ  . LYS B 1 113 ? 76.524  47.377  62.018  1.00 40.27 ? 110  LYS B NZ  1 
ATOM   4499  N  N   . THR B 1 114 ? 71.213  52.795  61.854  1.00 16.33 ? 111  THR B N   1 
ATOM   4500  C  CA  . THR B 1 114 ? 70.279  53.774  62.333  1.00 14.92 ? 111  THR B CA  1 
ATOM   4501  C  C   . THR B 1 114 ? 69.407  54.328  61.169  1.00 14.95 ? 111  THR B C   1 
ATOM   4502  O  O   . THR B 1 114 ? 69.629  54.012  59.995  1.00 13.59 ? 111  THR B O   1 
ATOM   4503  C  CB  . THR B 1 114 ? 71.068  54.907  63.009  1.00 14.79 ? 111  THR B CB  1 
ATOM   4504  O  OG1 . THR B 1 114 ? 72.095  55.356  62.110  1.00 13.97 ? 111  THR B OG1 1 
ATOM   4505  C  CG2 . THR B 1 114 ? 71.742  54.404  64.259  1.00 13.34 ? 111  THR B CG2 1 
ATOM   4506  N  N   . PRO B 1 115 ? 68.418  55.169  61.493  1.00 14.28 ? 112  PRO B N   1 
ATOM   4507  C  CA  . PRO B 1 115 ? 67.621  55.671  60.390  1.00 14.65 ? 112  PRO B CA  1 
ATOM   4508  C  C   . PRO B 1 115 ? 68.311  56.707  59.500  1.00 14.52 ? 112  PRO B C   1 
ATOM   4509  O  O   . PRO B 1 115 ? 69.295  57.327  59.889  1.00 13.41 ? 112  PRO B O   1 
ATOM   4510  C  CB  . PRO B 1 115 ? 66.422  56.357  61.085  1.00 15.49 ? 112  PRO B CB  1 
ATOM   4511  C  CG  . PRO B 1 115 ? 66.444  55.914  62.517  1.00 14.71 ? 112  PRO B CG  1 
ATOM   4512  C  CD  . PRO B 1 115 ? 67.839  55.473  62.822  1.00 14.63 ? 112  PRO B CD  1 
ATOM   4513  N  N   . GLN B 1 116 ? 67.774  56.881  58.298  1.00 14.45 ? 113  GLN B N   1 
ATOM   4514  C  CA  . GLN B 1 116 ? 68.235  57.933  57.422  1.00 13.56 ? 113  GLN B CA  1 
ATOM   4515  C  C   . GLN B 1 116 ? 67.719  59.203  58.067  1.00 13.58 ? 113  GLN B C   1 
ATOM   4516  O  O   . GLN B 1 116 ? 66.695  59.176  58.735  1.00 13.15 ? 113  GLN B O   1 
ATOM   4517  C  CB  . GLN B 1 116 ? 67.622  57.815  56.029  1.00 14.05 ? 113  GLN B CB  1 
ATOM   4518  C  CG  . GLN B 1 116 ? 68.099  56.642  55.202  1.00 16.67 ? 113  GLN B CG  1 
ATOM   4519  C  CD  . GLN B 1 116 ? 67.330  56.487  53.881  1.00 18.70 ? 113  GLN B CD  1 
ATOM   4520  O  OE1 . GLN B 1 116 ? 66.118  56.317  53.877  1.00 20.54 ? 113  GLN B OE1 1 
ATOM   4521  N  NE2 . GLN B 1 116 ? 68.056  56.469  52.763  1.00 21.38 ? 113  GLN B NE2 1 
ATOM   4522  N  N   . VAL B 1 117 ? 68.424  60.311  57.876  1.00 13.62 ? 114  VAL B N   1 
ATOM   4523  C  CA  . VAL B 1 117 ? 68.005  61.591  58.402  1.00 14.59 ? 114  VAL B CA  1 
ATOM   4524  C  C   . VAL B 1 117 ? 67.940  62.519  57.211  1.00 15.62 ? 114  VAL B C   1 
ATOM   4525  O  O   . VAL B 1 117 ? 68.939  62.770  56.565  1.00 15.84 ? 114  VAL B O   1 
ATOM   4526  C  CB  . VAL B 1 117 ? 68.965  62.181  59.435  1.00 15.87 ? 114  VAL B CB  1 
ATOM   4527  C  CG1 . VAL B 1 117 ? 68.434  63.533  59.930  1.00 14.70 ? 114  VAL B CG1 1 
ATOM   4528  C  CG2 . VAL B 1 117 ? 69.138  61.240  60.607  1.00 14.25 ? 114  VAL B CG2 1 
ATOM   4529  N  N   . LEU B 1 118 ? 66.735  62.964  56.892  1.00 14.92 ? 115  LEU B N   1 
ATOM   4530  C  CA  . LEU B 1 118 ? 66.496  63.839  55.766  1.00 15.24 ? 115  LEU B CA  1 
ATOM   4531  C  C   . LEU B 1 118 ? 65.935  65.146  56.290  1.00 15.28 ? 115  LEU B C   1 
ATOM   4532  O  O   . LEU B 1 118 ? 65.268  65.164  57.334  1.00 13.81 ? 115  LEU B O   1 
ATOM   4533  C  CB  . LEU B 1 118 ? 65.512  63.180  54.815  1.00 15.84 ? 115  LEU B CB  1 
ATOM   4534  C  CG  . LEU B 1 118 ? 65.995  61.825  54.262  1.00 18.04 ? 115  LEU B CG  1 
ATOM   4535  C  CD1 . LEU B 1 118 ? 64.928  61.204  53.368  1.00 19.52 ? 115  LEU B CD1 1 
ATOM   4536  C  CD2 . LEU B 1 118 ? 67.285  62.040  53.509  1.00 18.64 ? 115  LEU B CD2 1 
ATOM   4537  N  N   . PHE B 1 119 ? 66.205  66.224  55.561  1.00 14.07 ? 116  PHE B N   1 
ATOM   4538  C  CA  . PHE B 1 119 ? 65.776  67.553  55.940  1.00 14.51 ? 116  PHE B CA  1 
ATOM   4539  C  C   . PHE B 1 119 ? 64.835  68.198  54.945  1.00 15.56 ? 116  PHE B C   1 
ATOM   4540  O  O   . PHE B 1 119 ? 65.047  68.123  53.717  1.00 16.45 ? 116  PHE B O   1 
ATOM   4541  C  CB  . PHE B 1 119 ? 66.994  68.447  56.073  1.00 15.70 ? 116  PHE B CB  1 
ATOM   4542  C  CG  . PHE B 1 119 ? 67.941  67.997  57.113  1.00 14.32 ? 116  PHE B CG  1 
ATOM   4543  C  CD1 . PHE B 1 119 ? 68.987  67.160  56.798  1.00 18.16 ? 116  PHE B CD1 1 
ATOM   4544  C  CD2 . PHE B 1 119 ? 67.787  68.406  58.417  1.00 16.69 ? 116  PHE B CD2 1 
ATOM   4545  C  CE1 . PHE B 1 119 ? 69.861  66.730  57.779  1.00 17.16 ? 116  PHE B CE1 1 
ATOM   4546  C  CE2 . PHE B 1 119 ? 68.666  67.997  59.386  1.00 16.27 ? 116  PHE B CE2 1 
ATOM   4547  C  CZ  . PHE B 1 119 ? 69.691  67.154  59.067  1.00 17.88 ? 116  PHE B CZ  1 
ATOM   4548  N  N   . VAL B 1 120 ? 63.808  68.851  55.477  1.00 13.90 ? 117  VAL B N   1 
ATOM   4549  C  CA  . VAL B 1 120 ? 62.846  69.543  54.661  1.00 14.77 ? 117  VAL B CA  1 
ATOM   4550  C  C   . VAL B 1 120 ? 62.400  70.773  55.476  1.00 14.95 ? 117  VAL B C   1 
ATOM   4551  O  O   . VAL B 1 120 ? 62.624  70.838  56.691  1.00 13.35 ? 117  VAL B O   1 
ATOM   4552  C  CB  . VAL B 1 120 ? 61.642  68.664  54.292  1.00 16.66 ? 117  VAL B CB  1 
ATOM   4553  C  CG1 . VAL B 1 120 ? 60.707  68.487  55.516  1.00 13.37 ? 117  VAL B CG1 1 
ATOM   4554  C  CG2 . VAL B 1 120 ? 60.875  69.281  53.075  1.00 15.73 ? 117  VAL B CG2 1 
ATOM   4555  N  N   . GLY B 1 121 ? 61.805  71.742  54.790  1.00 14.15 ? 118  GLY B N   1 
ATOM   4556  C  CA  . GLY B 1 121 ? 61.345  72.967  55.409  1.00 14.67 ? 118  GLY B CA  1 
ATOM   4557  C  C   . GLY B 1 121 ? 62.447  74.013  55.504  1.00 15.33 ? 118  GLY B C   1 
ATOM   4558  O  O   . GLY B 1 121 ? 62.249  75.072  56.127  1.00 15.37 ? 118  GLY B O   1 
ATOM   4559  N  N   . GLN B 1 122 ? 63.603  73.724  54.898  1.00 14.39 ? 119  GLN B N   1 
ATOM   4560  C  CA  . GLN B 1 122 ? 64.716  74.654  54.908  1.00 14.92 ? 119  GLN B CA  1 
ATOM   4561  C  C   . GLN B 1 122 ? 64.750  75.488  53.606  1.00 15.40 ? 119  GLN B C   1 
ATOM   4562  O  O   . GLN B 1 122 ? 65.637  76.331  53.429  1.00 15.93 ? 119  GLN B O   1 
ATOM   4563  C  CB  . GLN B 1 122 ? 66.080  73.956  55.154  1.00 15.95 ? 119  GLN B CB  1 
ATOM   4564  C  CG  . GLN B 1 122 ? 66.770  73.234  53.962  1.00 15.01 ? 119  GLN B CG  1 
ATOM   4565  C  CD  . GLN B 1 122 ? 66.127  71.916  53.542  1.00 18.06 ? 119  GLN B CD  1 
ATOM   4566  O  OE1 . GLN B 1 122 ? 64.918  71.727  53.640  1.00 18.96 ? 119  GLN B OE1 1 
ATOM   4567  N  NE2 . GLN B 1 122 ? 66.958  70.994  53.056  1.00 17.14 ? 119  GLN B NE2 1 
ATOM   4568  N  N   . ASN B 1 123 ? 63.764  75.256  52.734  1.00 14.54 ? 120  ASN B N   1 
ATOM   4569  C  CA  . ASN B 1 123 ? 63.615  75.970  51.468  1.00 14.16 ? 120  ASN B CA  1 
ATOM   4570  C  C   . ASN B 1 123 ? 62.119  76.019  51.114  1.00 13.55 ? 120  ASN B C   1 
ATOM   4571  O  O   . ASN B 1 123 ? 61.264  75.535  51.883  1.00 13.99 ? 120  ASN B O   1 
ATOM   4572  C  CB  . ASN B 1 123 ? 64.445  75.296  50.361  1.00 13.39 ? 120  ASN B CB  1 
ATOM   4573  C  CG  . ASN B 1 123 ? 63.996  73.851  50.087  1.00 14.55 ? 120  ASN B CG  1 
ATOM   4574  O  OD1 . ASN B 1 123 ? 62.819  73.596  49.852  1.00 14.49 ? 120  ASN B OD1 1 
ATOM   4575  N  ND2 . ASN B 1 123 ? 64.947  72.911  50.096  1.00 15.74 ? 120  ASN B ND2 1 
ATOM   4576  N  N   . ILE B 1 124 ? 61.795  76.628  49.980  1.00 13.31 ? 121  ILE B N   1 
ATOM   4577  C  CA  . ILE B 1 124 ? 60.406  76.725  49.524  1.00 14.06 ? 121  ILE B CA  1 
ATOM   4578  C  C   . ILE B 1 124 ? 60.348  76.162  48.093  1.00 13.03 ? 121  ILE B C   1 
ATOM   4579  O  O   . ILE B 1 124 ? 59.717  76.721  47.200  1.00 12.25 ? 121  ILE B O   1 
ATOM   4580  C  CB  . ILE B 1 124 ? 59.884  78.183  49.524  1.00 13.39 ? 121  ILE B CB  1 
ATOM   4581  C  CG1 . ILE B 1 124 ? 60.373  78.949  50.758  1.00 17.70 ? 121  ILE B CG1 1 
ATOM   4582  C  CG2 . ILE B 1 124 ? 58.330  78.200  49.423  1.00 13.24 ? 121  ILE B CG2 1 
ATOM   4583  C  CD1 . ILE B 1 124 ? 59.940  80.409  50.774  1.00 10.38 ? 121  ILE B CD1 1 
ATOM   4584  N  N   . SER B 1 125 ? 61.017  75.031  47.897  1.00 13.12 ? 122  SER B N   1 
ATOM   4585  C  CA  . SER B 1 125 ? 61.079  74.392  46.610  1.00 12.73 ? 122  SER B CA  1 
ATOM   4586  C  C   . SER B 1 125 ? 60.144  73.200  46.533  1.00 13.21 ? 122  SER B C   1 
ATOM   4587  O  O   . SER B 1 125 ? 60.359  72.180  47.210  1.00 11.83 ? 122  SER B O   1 
ATOM   4588  C  CB  . SER B 1 125 ? 62.504  73.900  46.329  1.00 14.18 ? 122  SER B CB  1 
ATOM   4589  O  OG  . SER B 1 125 ? 62.510  73.088  45.158  1.00 14.09 ? 122  SER B OG  1 
ATOM   4590  N  N   . SER B 1 126 ? 59.124  73.319  45.689  1.00 12.88 ? 123  SER B N   1 
ATOM   4591  C  CA  . SER B 1 126 ? 58.196  72.222  45.483  1.00 13.69 ? 123  SER B CA  1 
ATOM   4592  C  C   . SER B 1 126 ? 58.899  71.061  44.772  1.00 13.62 ? 123  SER B C   1 
ATOM   4593  O  O   . SER B 1 126 ? 58.546  69.894  44.989  1.00 13.94 ? 123  SER B O   1 
ATOM   4594  C  CB  . SER B 1 126 ? 56.925  72.680  44.754  1.00 14.10 ? 123  SER B CB  1 
ATOM   4595  O  OG  . SER B 1 126 ? 57.202  73.458  43.622  1.00 16.87 ? 123  SER B OG  1 
ATOM   4596  N  N   . THR B 1 127 ? 59.906  71.361  43.946  1.00 13.22 ? 124  THR B N   1 
ATOM   4597  C  CA  . THR B 1 127 ? 60.641  70.285  43.278  1.00 13.56 ? 124  THR B CA  1 
ATOM   4598  C  C   . THR B 1 127 ? 61.363  69.419  44.323  1.00 12.87 ? 124  THR B C   1 
ATOM   4599  O  O   . THR B 1 127 ? 61.283  68.185  44.295  1.00 12.56 ? 124  THR B O   1 
ATOM   4600  C  CB  . THR B 1 127 ? 61.598  70.838  42.211  1.00 13.92 ? 124  THR B CB  1 
ATOM   4601  O  OG1 . THR B 1 127 ? 60.802  71.405  41.155  1.00 13.45 ? 124  THR B OG1 1 
ATOM   4602  C  CG2 . THR B 1 127 ? 62.498  69.704  41.638  1.00 13.15 ? 124  THR B CG2 1 
ATOM   4603  N  N   . TYR B 1 128 ? 62.042  70.067  45.258  1.00 12.51 ? 125  TYR B N   1 
ATOM   4604  C  CA  . TYR B 1 128 ? 62.724  69.354  46.332  1.00 12.90 ? 125  TYR B CA  1 
ATOM   4605  C  C   . TYR B 1 128 ? 61.741  68.517  47.167  1.00 12.67 ? 125  TYR B C   1 
ATOM   4606  O  O   . TYR B 1 128 ? 61.965  67.333  47.424  1.00 10.92 ? 125  TYR B O   1 
ATOM   4607  C  CB  . TYR B 1 128 ? 63.409  70.372  47.242  1.00 13.51 ? 125  TYR B CB  1 
ATOM   4608  C  CG  . TYR B 1 128 ? 64.177  69.779  48.395  1.00 13.49 ? 125  TYR B CG  1 
ATOM   4609  C  CD1 . TYR B 1 128 ? 63.578  69.589  49.628  1.00 11.38 ? 125  TYR B CD1 1 
ATOM   4610  C  CD2 . TYR B 1 128 ? 65.513  69.423  48.248  1.00 13.82 ? 125  TYR B CD2 1 
ATOM   4611  C  CE1 . TYR B 1 128 ? 64.274  69.063  50.690  1.00 15.08 ? 125  TYR B CE1 1 
ATOM   4612  C  CE2 . TYR B 1 128 ? 66.226  68.883  49.291  1.00 17.12 ? 125  TYR B CE2 1 
ATOM   4613  C  CZ  . TYR B 1 128 ? 65.613  68.705  50.518  1.00 18.25 ? 125  TYR B CZ  1 
ATOM   4614  O  OH  . TYR B 1 128 ? 66.330  68.164  51.560  1.00 16.55 ? 125  TYR B OH  1 
HETATM 4615  N  N   . MSE B 1 129 ? 60.644  69.136  47.588  1.00 12.26 ? 126  MSE B N   1 
HETATM 4616  C  CA  . MSE B 1 129 ? 59.667  68.444  48.420  1.00 14.08 ? 126  MSE B CA  1 
HETATM 4617  C  C   . MSE B 1 129 ? 58.969  67.293  47.705  1.00 14.26 ? 126  MSE B C   1 
HETATM 4618  O  O   . MSE B 1 129 ? 58.796  66.233  48.296  1.00 13.39 ? 126  MSE B O   1 
HETATM 4619  C  CB  . MSE B 1 129 ? 58.627  69.420  48.979  1.00 14.37 ? 126  MSE B CB  1 
HETATM 4620  C  CG  . MSE B 1 129 ? 59.224  70.542  49.809  1.00 18.68 ? 126  MSE B CG  1 
HETATM 4621  SE SE  . MSE B 1 129 ? 57.799  71.659  50.594  1.00 24.87 ? 126  MSE B SE  1 
HETATM 4622  C  CE  . MSE B 1 129 ? 58.797  73.291  50.780  1.00 22.00 ? 126  MSE B CE  1 
ATOM   4623  N  N   . LYS B 1 130 ? 58.557  67.498  46.449  1.00 14.23 ? 127  LYS B N   1 
ATOM   4624  C  CA  . LYS B 1 130 ? 57.898  66.439  45.683  1.00 14.05 ? 127  LYS B CA  1 
ATOM   4625  C  C   . LYS B 1 130 ? 58.869  65.263  45.511  1.00 13.69 ? 127  LYS B C   1 
ATOM   4626  O  O   . LYS B 1 130 ? 58.493  64.097  45.672  1.00 11.78 ? 127  LYS B O   1 
ATOM   4627  C  CB  . LYS B 1 130 ? 57.460  66.966  44.321  1.00 15.58 ? 127  LYS B CB  1 
ATOM   4628  C  CG  . LYS B 1 130 ? 56.793  65.941  43.406  1.00 19.98 ? 127  LYS B CG  1 
ATOM   4629  C  CD  . LYS B 1 130 ? 55.435  65.499  43.928  1.00 26.60 ? 127  LYS B CD  1 
ATOM   4630  C  CE  . LYS B 1 130 ? 54.699  64.646  42.897  1.00 31.56 ? 127  LYS B CE  1 
ATOM   4631  N  NZ  . LYS B 1 130 ? 53.297  64.344  43.332  1.00 36.25 ? 127  LYS B NZ  1 
ATOM   4632  N  N   . ASP B 1 131 ? 60.127  65.578  45.213  1.00 12.31 ? 128  ASP B N   1 
ATOM   4633  C  CA  . ASP B 1 131 ? 61.159  64.545  45.054  1.00 12.36 ? 128  ASP B CA  1 
ATOM   4634  C  C   . ASP B 1 131 ? 61.430  63.758  46.357  1.00 12.08 ? 128  ASP B C   1 
ATOM   4635  O  O   . ASP B 1 131 ? 61.662  62.540  46.332  1.00 12.39 ? 128  ASP B O   1 
ATOM   4636  C  CB  . ASP B 1 131 ? 62.458  65.173  44.517  1.00 12.10 ? 128  ASP B CB  1 
ATOM   4637  C  CG  . ASP B 1 131 ? 62.376  65.541  43.031  1.00 14.28 ? 128  ASP B CG  1 
ATOM   4638  O  OD1 . ASP B 1 131 ? 61.393  65.137  42.368  1.00 9.23  ? 128  ASP B OD1 1 
ATOM   4639  O  OD2 . ASP B 1 131 ? 63.314  66.225  42.528  1.00 11.75 ? 128  ASP B OD2 1 
ATOM   4640  N  N   . LEU B 1 132 ? 61.396  64.451  47.491  1.00 12.60 ? 129  LEU B N   1 
ATOM   4641  C  CA  . LEU B 1 132 ? 61.627  63.830  48.786  1.00 13.68 ? 129  LEU B CA  1 
ATOM   4642  C  C   . LEU B 1 132 ? 60.537  62.818  49.098  1.00 14.52 ? 129  LEU B C   1 
ATOM   4643  O  O   . LEU B 1 132 ? 60.805  61.791  49.706  1.00 13.32 ? 129  LEU B O   1 
ATOM   4644  C  CB  . LEU B 1 132 ? 61.722  64.890  49.888  1.00 14.54 ? 129  LEU B CB  1 
ATOM   4645  C  CG  . LEU B 1 132 ? 61.812  64.447  51.361  1.00 17.34 ? 129  LEU B CG  1 
ATOM   4646  C  CD1 . LEU B 1 132 ? 62.883  63.376  51.598  1.00 22.80 ? 129  LEU B CD1 1 
ATOM   4647  C  CD2 . LEU B 1 132 ? 62.074  65.648  52.243  1.00 21.65 ? 129  LEU B CD2 1 
HETATM 4648  N  N   . MSE B 1 133 ? 59.319  63.086  48.643  1.00 13.45 ? 130  MSE B N   1 
HETATM 4649  C  CA  . MSE B 1 133 ? 58.222  62.163  48.887  1.00 14.32 ? 130  MSE B CA  1 
HETATM 4650  C  C   . MSE B 1 133 ? 58.522  60.810  48.241  1.00 15.03 ? 130  MSE B C   1 
HETATM 4651  O  O   . MSE B 1 133 ? 58.064  59.790  48.735  1.00 13.75 ? 130  MSE B O   1 
HETATM 4652  C  CB  . MSE B 1 133 ? 56.906  62.709  48.364  1.00 12.75 ? 130  MSE B CB  1 
HETATM 4653  C  CG  . MSE B 1 133 ? 56.478  63.992  49.033  1.00 16.42 ? 130  MSE B CG  1 
HETATM 4654  SE SE  . MSE B 1 133 ? 54.859  64.682  48.177  1.00 21.21 ? 130  MSE B SE  1 
HETATM 4655  C  CE  . MSE B 1 133 ? 54.810  66.368  49.139  1.00 19.21 ? 130  MSE B CE  1 
ATOM   4656  N  N   . ASP B 1 134 ? 59.280  60.803  47.137  1.00 14.94 ? 131  ASP B N   1 
ATOM   4657  C  CA  . ASP B 1 134 ? 59.658  59.537  46.490  1.00 14.93 ? 131  ASP B CA  1 
ATOM   4658  C  C   . ASP B 1 134 ? 60.579  58.692  47.364  1.00 15.12 ? 131  ASP B C   1 
ATOM   4659  O  O   . ASP B 1 134 ? 60.526  57.469  47.323  1.00 14.59 ? 131  ASP B O   1 
ATOM   4660  C  CB  . ASP B 1 134 ? 60.366  59.775  45.159  1.00 15.27 ? 131  ASP B CB  1 
ATOM   4661  C  CG  . ASP B 1 134 ? 59.458  60.379  44.104  1.00 16.67 ? 131  ASP B CG  1 
ATOM   4662  O  OD1 . ASP B 1 134 ? 58.236  60.083  44.100  1.00 15.45 ? 131  ASP B OD1 1 
ATOM   4663  O  OD2 . ASP B 1 134 ? 59.996  61.117  43.254  1.00 14.45 ? 131  ASP B OD2 1 
ATOM   4664  N  N   . VAL B 1 135 ? 61.448  59.349  48.120  1.00 14.88 ? 132  VAL B N   1 
ATOM   4665  C  CA  . VAL B 1 135 ? 62.356  58.658  49.021  1.00 16.10 ? 132  VAL B CA  1 
ATOM   4666  C  C   . VAL B 1 135 ? 61.576  58.069  50.211  1.00 16.94 ? 132  VAL B C   1 
ATOM   4667  O  O   . VAL B 1 135 ? 61.936  57.015  50.755  1.00 14.61 ? 132  VAL B O   1 
ATOM   4668  C  CB  . VAL B 1 135 ? 63.423  59.618  49.576  1.00 16.18 ? 132  VAL B CB  1 
ATOM   4669  C  CG1 . VAL B 1 135 ? 64.397  58.865  50.482  1.00 17.22 ? 132  VAL B CG1 1 
ATOM   4670  C  CG2 . VAL B 1 135 ? 64.178  60.306  48.450  1.00 18.90 ? 132  VAL B CG2 1 
ATOM   4671  N  N   . LEU B 1 136 ? 60.508  58.756  50.614  1.00 16.49 ? 133  LEU B N   1 
ATOM   4672  C  CA  . LEU B 1 136 ? 59.690  58.311  51.750  1.00 18.00 ? 133  LEU B CA  1 
ATOM   4673  C  C   . LEU B 1 136 ? 58.807  57.104  51.396  1.00 19.18 ? 133  LEU B C   1 
ATOM   4674  O  O   . LEU B 1 136 ? 58.490  56.268  52.258  1.00 17.25 ? 133  LEU B O   1 
ATOM   4675  C  CB  . LEU B 1 136 ? 58.806  59.464  52.270  1.00 18.24 ? 133  LEU B CB  1 
ATOM   4676  C  CG  . LEU B 1 136 ? 59.484  60.708  52.850  1.00 17.69 ? 133  LEU B CG  1 
ATOM   4677  C  CD1 . LEU B 1 136 ? 58.463  61.790  53.180  1.00 19.82 ? 133  LEU B CD1 1 
ATOM   4678  C  CD2 . LEU B 1 136 ? 60.294  60.351  54.087  1.00 19.62 ? 133  LEU B CD2 1 
ATOM   4679  N  N   . GLU B 1 137 ? 58.444  57.011  50.120  1.00 20.58 ? 134  GLU B N   1 
ATOM   4680  C  CA  . GLU B 1 137 ? 57.569  55.962  49.620  1.00 22.49 ? 134  GLU B CA  1 
ATOM   4681  C  C   . GLU B 1 137 ? 57.958  54.549  50.062  1.00 21.50 ? 134  GLU B C   1 
ATOM   4682  O  O   . GLU B 1 137 ? 59.070  54.109  49.827  1.00 20.70 ? 134  GLU B O   1 
ATOM   4683  C  CB  . GLU B 1 137 ? 57.534  56.022  48.084  1.00 24.17 ? 134  GLU B CB  1 
ATOM   4684  C  CG  . GLU B 1 137 ? 56.575  55.040  47.430  1.00 28.50 ? 134  GLU B CG  1 
ATOM   4685  C  CD  . GLU B 1 137 ? 55.122  55.363  47.702  1.00 35.39 ? 134  GLU B CD  1 
ATOM   4686  O  OE1 . GLU B 1 137 ? 54.832  56.495  48.154  1.00 41.70 ? 134  GLU B OE1 1 
ATOM   4687  O  OE2 . GLU B 1 137 ? 54.257  54.494  47.437  1.00 42.45 ? 134  GLU B OE2 1 
ATOM   4688  N  N   . GLY B 1 138 ? 57.024  53.846  50.699  1.00 21.46 ? 135  GLY B N   1 
ATOM   4689  C  CA  . GLY B 1 138 ? 57.258  52.463  51.142  1.00 20.53 ? 135  GLY B CA  1 
ATOM   4690  C  C   . GLY B 1 138 ? 58.128  52.326  52.391  1.00 21.09 ? 135  GLY B C   1 
ATOM   4691  O  O   . GLY B 1 138 ? 58.548  51.223  52.751  1.00 22.09 ? 135  GLY B O   1 
ATOM   4692  N  N   . LYS B 1 139 ? 58.388  53.437  53.071  1.00 18.40 ? 136  LYS B N   1 
ATOM   4693  C  CA  . LYS B 1 139 ? 59.229  53.413  54.265  1.00 17.92 ? 136  LYS B CA  1 
ATOM   4694  C  C   . LYS B 1 139 ? 58.477  53.934  55.473  1.00 15.98 ? 136  LYS B C   1 
ATOM   4695  O  O   . LYS B 1 139 ? 57.574  54.745  55.349  1.00 16.77 ? 136  LYS B O   1 
ATOM   4696  C  CB  . LYS B 1 139 ? 60.450  54.338  54.092  1.00 17.36 ? 136  LYS B CB  1 
ATOM   4697  C  CG  . LYS B 1 139 ? 61.480  53.998  52.988  1.00 22.57 ? 136  LYS B CG  1 
ATOM   4698  C  CD  . LYS B 1 139 ? 62.236  52.707  53.261  1.00 28.10 ? 136  LYS B CD  1 
ATOM   4699  C  CE  . LYS B 1 139 ? 63.540  52.607  52.412  1.00 32.07 ? 136  LYS B CE  1 
ATOM   4700  N  NZ  . LYS B 1 139 ? 63.345  52.596  50.946  1.00 29.44 ? 136  LYS B NZ  1 
ATOM   4701  N  N   . ASP B 1 140 ? 58.891  53.491  56.648  1.00 15.14 ? 137  ASP B N   1 
ATOM   4702  C  CA  . ASP B 1 140 ? 58.328  54.000  57.883  1.00 14.36 ? 137  ASP B CA  1 
ATOM   4703  C  C   . ASP B 1 140 ? 59.125  55.244  58.266  1.00 13.50 ? 137  ASP B C   1 
ATOM   4704  O  O   . ASP B 1 140 ? 60.352  55.262  58.147  1.00 13.22 ? 137  ASP B O   1 
ATOM   4705  C  CB  . ASP B 1 140 ? 58.394  52.956  58.980  1.00 13.17 ? 137  ASP B CB  1 
ATOM   4706  C  CG  . ASP B 1 140 ? 57.294  51.924  58.862  1.00 15.64 ? 137  ASP B CG  1 
ATOM   4707  O  OD1 . ASP B 1 140 ? 56.116  52.323  58.977  1.00 14.22 ? 137  ASP B OD1 1 
ATOM   4708  O  OD2 . ASP B 1 140 ? 57.598  50.725  58.728  1.00 19.17 ? 137  ASP B OD2 1 
ATOM   4709  N  N   . PHE B 1 141 ? 58.434  56.293  58.689  1.00 11.89 ? 138  PHE B N   1 
ATOM   4710  C  CA  . PHE B 1 141 ? 59.121  57.506  59.077  1.00 12.05 ? 138  PHE B CA  1 
ATOM   4711  C  C   . PHE B 1 141 ? 58.475  58.212  60.243  1.00 12.53 ? 138  PHE B C   1 
ATOM   4712  O  O   . PHE B 1 141 ? 57.334  57.887  60.649  1.00 11.73 ? 138  PHE B O   1 
ATOM   4713  C  CB  . PHE B 1 141 ? 59.349  58.464  57.877  1.00 11.70 ? 138  PHE B CB  1 
ATOM   4714  C  CG  . PHE B 1 141 ? 58.100  59.130  57.324  1.00 14.79 ? 138  PHE B CG  1 
ATOM   4715  C  CD1 . PHE B 1 141 ? 57.247  58.450  56.480  1.00 15.83 ? 138  PHE B CD1 1 
ATOM   4716  C  CD2 . PHE B 1 141 ? 57.845  60.477  57.577  1.00 16.65 ? 138  PHE B CD2 1 
ATOM   4717  C  CE1 . PHE B 1 141 ? 56.129  59.065  55.941  1.00 16.97 ? 138  PHE B CE1 1 
ATOM   4718  C  CE2 . PHE B 1 141 ? 56.730  61.110  57.038  1.00 16.57 ? 138  PHE B CE2 1 
ATOM   4719  C  CZ  . PHE B 1 141 ? 55.861  60.389  56.219  1.00 17.40 ? 138  PHE B CZ  1 
ATOM   4720  N  N   . SER B 1 142 ? 59.264  59.125  60.815  1.00 12.53 ? 139  SER B N   1 
ATOM   4721  C  CA  . SER B 1 142 ? 58.867  59.975  61.907  1.00 13.12 ? 139  SER B CA  1 
ATOM   4722  C  C   . SER B 1 142 ? 59.268  61.408  61.537  1.00 13.05 ? 139  SER B C   1 
ATOM   4723  O  O   . SER B 1 142 ? 60.085  61.622  60.657  1.00 13.95 ? 139  SER B O   1 
ATOM   4724  C  CB  . SER B 1 142 ? 59.544  59.547  63.216  1.00 12.29 ? 139  SER B CB  1 
ATOM   4725  O  OG  . SER B 1 142 ? 59.125  58.235  63.593  1.00 14.60 ? 139  SER B OG  1 
ATOM   4726  N  N   . ILE B 1 143 ? 58.672  62.387  62.205  1.00 12.21 ? 140  ILE B N   1 
ATOM   4727  C  CA  . ILE B 1 143 ? 58.974  63.791  61.933  1.00 9.98  ? 140  ILE B CA  1 
ATOM   4728  C  C   . ILE B 1 143 ? 59.355  64.489  63.219  1.00 10.26 ? 140  ILE B C   1 
ATOM   4729  O  O   . ILE B 1 143 ? 58.721  64.277  64.257  1.00 10.68 ? 140  ILE B O   1 
ATOM   4730  C  CB  . ILE B 1 143 ? 57.742  64.544  61.360  1.00 10.33 ? 140  ILE B CB  1 
ATOM   4731  C  CG1 . ILE B 1 143 ? 57.263  63.929  60.044  1.00 10.86 ? 140  ILE B CG1 1 
ATOM   4732  C  CG2 . ILE B 1 143 ? 58.032  66.075  61.200  1.00 10.72 ? 140  ILE B CG2 1 
ATOM   4733  C  CD1 . ILE B 1 143 ? 55.957  64.626  59.461  1.00 9.76  ? 140  ILE B CD1 1 
ATOM   4734  N  N   . ASN B 1 144 ? 60.430  65.274  63.159  1.00 11.15 ? 141  ASN B N   1 
ATOM   4735  C  CA  . ASN B 1 144 ? 60.839  66.131  64.257  1.00 11.44 ? 141  ASN B CA  1 
ATOM   4736  C  C   . ASN B 1 144 ? 60.722  67.535  63.684  1.00 11.87 ? 141  ASN B C   1 
ATOM   4737  O  O   . ASN B 1 144 ? 61.554  67.940  62.842  1.00 13.67 ? 141  ASN B O   1 
ATOM   4738  C  CB  . ASN B 1 144 ? 62.280  65.853  64.697  1.00 11.58 ? 141  ASN B CB  1 
ATOM   4739  C  CG  . ASN B 1 144 ? 62.760  66.752  65.860  1.00 12.15 ? 141  ASN B CG  1 
ATOM   4740  O  OD1 . ASN B 1 144 ? 63.962  66.802  66.136  1.00 11.22 ? 141  ASN B OD1 1 
ATOM   4741  N  ND2 . ASN B 1 144 ? 61.829  67.420  66.569  1.00 10.64 ? 141  ASN B ND2 1 
ATOM   4742  N  N   . VAL B 1 145 ? 59.651  68.239  64.054  1.00 12.32 ? 142  VAL B N   1 
ATOM   4743  C  CA  . VAL B 1 145 ? 59.434  69.619  63.604  1.00 10.77 ? 142  VAL B CA  1 
ATOM   4744  C  C   . VAL B 1 145 ? 60.062  70.556  64.641  1.00 11.29 ? 142  VAL B C   1 
ATOM   4745  O  O   . VAL B 1 145 ? 59.775  70.454  65.827  1.00 10.95 ? 142  VAL B O   1 
ATOM   4746  C  CB  . VAL B 1 145 ? 57.938  69.946  63.346  1.00 12.75 ? 142  VAL B CB  1 
ATOM   4747  C  CG1 . VAL B 1 145 ? 57.087  69.756  64.620  1.00 8.03  ? 142  VAL B CG1 1 
ATOM   4748  C  CG2 . VAL B 1 145 ? 57.799  71.387  62.793  1.00 8.75  ? 142  VAL B CG2 1 
ATOM   4749  N  N   . ILE B 1 146 ? 60.915  71.473  64.171  1.00 12.44 ? 143  ILE B N   1 
ATOM   4750  C  CA  . ILE B 1 146 ? 61.690  72.363  65.040  1.00 12.83 ? 143  ILE B CA  1 
ATOM   4751  C  C   . ILE B 1 146 ? 61.579  73.842  64.655  1.00 13.31 ? 143  ILE B C   1 
ATOM   4752  O  O   . ILE B 1 146 ? 61.888  74.220  63.527  1.00 13.78 ? 143  ILE B O   1 
ATOM   4753  C  CB  . ILE B 1 146 ? 63.188  71.990  64.959  1.00 12.84 ? 143  ILE B CB  1 
ATOM   4754  C  CG1 . ILE B 1 146 ? 63.396  70.471  65.056  1.00 11.87 ? 143  ILE B CG1 1 
ATOM   4755  C  CG2 . ILE B 1 146 ? 63.992  72.744  66.024  1.00 11.29 ? 143  ILE B CG2 1 
ATOM   4756  C  CD1 . ILE B 1 146 ? 64.851  70.031  64.758  1.00 9.84  ? 143  ILE B CD1 1 
ATOM   4757  N  N   . SER B 1 147 ? 61.168  74.679  65.602  1.00 14.55 ? 144  SER B N   1 
ATOM   4758  C  CA  . SER B 1 147 ? 61.024  76.125  65.347  1.00 16.81 ? 144  SER B CA  1 
ATOM   4759  C  C   . SER B 1 147 ? 60.968  76.909  66.664  1.00 17.91 ? 144  SER B C   1 
ATOM   4760  O  O   . SER B 1 147 ? 60.103  76.656  67.493  1.00 18.51 ? 144  SER B O   1 
ATOM   4761  C  CB  . SER B 1 147 ? 59.754  76.413  64.522  1.00 15.42 ? 144  SER B CB  1 
ATOM   4762  O  OG  . SER B 1 147 ? 59.567  77.824  64.381  1.00 17.80 ? 144  SER B OG  1 
ATOM   4763  N  N   . LYS B 1 148 ? 61.903  77.842  66.858  1.00 20.74 ? 145  LYS B N   1 
ATOM   4764  C  CA  . LYS B 1 148 ? 61.931  78.646  68.102  1.00 22.47 ? 145  LYS B CA  1 
ATOM   4765  C  C   . LYS B 1 148 ? 60.761  79.601  68.164  1.00 22.57 ? 145  LYS B C   1 
ATOM   4766  O  O   . LYS B 1 148 ? 60.065  79.675  69.180  1.00 24.21 ? 145  LYS B O   1 
ATOM   4767  C  CB  . LYS B 1 148 ? 63.247  79.419  68.241  1.00 23.29 ? 145  LYS B CB  1 
ATOM   4768  C  CG  . LYS B 1 148 ? 63.307  80.319  69.475  1.00 24.65 ? 145  LYS B CG  1 
ATOM   4769  C  CD  . LYS B 1 148 ? 64.635  81.016  69.578  1.00 23.98 ? 145  LYS B CD  1 
ATOM   4770  C  CE  . LYS B 1 148 ? 64.722  81.868  70.829  1.00 26.77 ? 145  LYS B CE  1 
ATOM   4771  N  NZ  . LYS B 1 148 ? 64.653  81.078  72.088  1.00 20.88 ? 145  LYS B NZ  1 
ATOM   4772  N  N   A SER B 1 149 ? 60.547  80.339  67.077  0.50 23.22 ? 146  SER B N   1 
ATOM   4773  N  N   B SER B 1 149 ? 60.540  80.325  67.070  0.50 22.21 ? 146  SER B N   1 
ATOM   4774  C  CA  A SER B 1 149 ? 59.443  81.290  66.992  0.50 23.51 ? 146  SER B CA  1 
ATOM   4775  C  CA  B SER B 1 149 ? 59.440  81.276  66.978  0.50 21.52 ? 146  SER B CA  1 
ATOM   4776  C  C   A SER B 1 149 ? 58.100  80.565  66.839  0.50 22.42 ? 146  SER B C   1 
ATOM   4777  C  C   B SER B 1 149 ? 58.101  80.556  66.850  0.50 21.40 ? 146  SER B C   1 
ATOM   4778  O  O   A SER B 1 149 ? 57.066  81.072  67.269  0.50 21.82 ? 146  SER B O   1 
ATOM   4779  O  O   B SER B 1 149 ? 57.073  81.055  67.305  0.50 20.79 ? 146  SER B O   1 
ATOM   4780  C  CB  A SER B 1 149 ? 59.641  82.244  65.801  0.50 23.94 ? 146  SER B CB  1 
ATOM   4781  C  CB  B SER B 1 149 ? 59.626  82.175  65.751  0.50 21.55 ? 146  SER B CB  1 
ATOM   4782  O  OG  A SER B 1 149 ? 60.811  83.044  65.944  0.50 26.26 ? 146  SER B OG  1 
ATOM   4783  O  OG  B SER B 1 149 ? 59.619  81.415  64.553  0.50 16.55 ? 146  SER B OG  1 
ATOM   4784  N  N   . GLY B 1 150 ? 58.125  79.384  66.220  1.00 21.31 ? 147  GLY B N   1 
ATOM   4785  C  CA  . GLY B 1 150 ? 56.905  78.606  65.971  1.00 21.21 ? 147  GLY B CA  1 
ATOM   4786  C  C   . GLY B 1 150 ? 56.044  79.187  64.840  1.00 22.17 ? 147  GLY B C   1 
ATOM   4787  O  O   . GLY B 1 150 ? 54.937  78.720  64.604  1.00 23.02 ? 147  GLY B O   1 
ATOM   4788  N  N   . THR B 1 151 ? 56.548  80.197  64.115  1.00 22.33 ? 148  THR B N   1 
ATOM   4789  C  CA  . THR B 1 151 ? 55.753  80.823  63.032  1.00 22.26 ? 148  THR B CA  1 
ATOM   4790  C  C   . THR B 1 151 ? 56.510  81.047  61.702  1.00 21.47 ? 148  THR B C   1 
ATOM   4791  O  O   . THR B 1 151 ? 56.004  81.712  60.791  1.00 22.00 ? 148  THR B O   1 
ATOM   4792  C  CB  . THR B 1 151 ? 55.285  82.210  63.479  1.00 21.46 ? 148  THR B CB  1 
ATOM   4793  O  OG1 . THR B 1 151 ? 56.439  83.016  63.734  1.00 24.06 ? 148  THR B OG1 1 
ATOM   4794  C  CG2 . THR B 1 151 ? 54.448  82.123  64.751  1.00 24.35 ? 148  THR B CG2 1 
ATOM   4795  N  N   . THR B 1 152 ? 57.705  80.488  61.584  1.00 19.23 ? 149  THR B N   1 
ATOM   4796  C  CA  . THR B 1 152 ? 58.526  80.678  60.389  1.00 16.50 ? 149  THR B CA  1 
ATOM   4797  C  C   . THR B 1 152 ? 57.874  79.987  59.183  1.00 15.39 ? 149  THR B C   1 
ATOM   4798  O  O   . THR B 1 152 ? 57.531  78.810  59.229  1.00 11.20 ? 149  THR B O   1 
ATOM   4799  C  CB  . THR B 1 152 ? 59.930  80.171  60.685  1.00 18.28 ? 149  THR B CB  1 
ATOM   4800  O  OG1 . THR B 1 152 ? 60.329  80.701  61.965  1.00 18.72 ? 149  THR B OG1 1 
ATOM   4801  C  CG2 . THR B 1 152 ? 60.937  80.588  59.586  1.00 14.41 ? 149  THR B CG2 1 
ATOM   4802  N  N   . THR B 1 153 ? 57.702  80.755  58.105  1.00 14.21 ? 150  THR B N   1 
ATOM   4803  C  CA  . THR B 1 153 ? 57.021  80.306  56.905  1.00 14.39 ? 150  THR B CA  1 
ATOM   4804  C  C   . THR B 1 153 ? 57.476  78.967  56.284  1.00 14.34 ? 150  THR B C   1 
ATOM   4805  O  O   . THR B 1 153 ? 56.639  78.093  56.024  1.00 13.72 ? 150  THR B O   1 
ATOM   4806  C  CB  . THR B 1 153 ? 57.088  81.392  55.786  1.00 15.38 ? 150  THR B CB  1 
ATOM   4807  O  OG1 . THR B 1 153 ? 56.533  82.634  56.263  1.00 15.63 ? 150  THR B OG1 1 
ATOM   4808  C  CG2 . THR B 1 153 ? 56.317  80.925  54.536  1.00 15.93 ? 150  THR B CG2 1 
ATOM   4809  N  N   . GLU B 1 154 ? 58.772  78.806  56.044  1.00 12.94 ? 151  GLU B N   1 
ATOM   4810  C  CA  . GLU B 1 154 ? 59.243  77.594  55.360  1.00 14.02 ? 151  GLU B CA  1 
ATOM   4811  C  C   . GLU B 1 154 ? 58.965  76.275  56.097  1.00 12.38 ? 151  GLU B C   1 
ATOM   4812  O  O   . GLU B 1 154 ? 58.423  75.347  55.511  1.00 13.02 ? 151  GLU B O   1 
ATOM   4813  C  CB  . GLU B 1 154 ? 60.706  77.701  54.952  1.00 14.06 ? 151  GLU B CB  1 
ATOM   4814  C  CG  . GLU B 1 154 ? 61.056  78.905  54.101  1.00 13.36 ? 151  GLU B CG  1 
ATOM   4815  C  CD  . GLU B 1 154 ? 61.518  80.141  54.889  1.00 16.39 ? 151  GLU B CD  1 
ATOM   4816  O  OE1 . GLU B 1 154 ? 60.974  80.456  55.985  1.00 15.84 ? 151  GLU B OE1 1 
ATOM   4817  O  OE2 . GLU B 1 154 ? 62.443  80.806  54.382  1.00 14.50 ? 151  GLU B OE2 1 
ATOM   4818  N  N   . PRO B 1 155 ? 59.351  76.180  57.373  1.00 12.44 ? 152  PRO B N   1 
ATOM   4819  C  CA  . PRO B 1 155 ? 59.052  74.960  58.101  1.00 12.66 ? 152  PRO B CA  1 
ATOM   4820  C  C   . PRO B 1 155 ? 57.557  74.787  58.396  1.00 11.68 ? 152  PRO B C   1 
ATOM   4821  O  O   . PRO B 1 155 ? 57.080  73.653  58.462  1.00 12.30 ? 152  PRO B O   1 
ATOM   4822  C  CB  . PRO B 1 155 ? 59.880  75.090  59.379  1.00 13.24 ? 152  PRO B CB  1 
ATOM   4823  C  CG  . PRO B 1 155 ? 60.221  76.521  59.475  1.00 14.77 ? 152  PRO B CG  1 
ATOM   4824  C  CD  . PRO B 1 155 ? 60.240  77.080  58.121  1.00 12.46 ? 152  PRO B CD  1 
ATOM   4825  N  N   . ALA B 1 156 ? 56.824  75.888  58.564  1.00 12.07 ? 153  ALA B N   1 
ATOM   4826  C  CA  . ALA B 1 156 ? 55.388  75.806  58.817  1.00 11.08 ? 153  ALA B CA  1 
ATOM   4827  C  C   . ALA B 1 156 ? 54.689  75.188  57.587  1.00 12.30 ? 153  ALA B C   1 
ATOM   4828  O  O   . ALA B 1 156 ? 53.831  74.319  57.713  1.00 12.32 ? 153  ALA B O   1 
ATOM   4829  C  CB  . ALA B 1 156 ? 54.791  77.195  59.163  1.00 11.07 ? 153  ALA B CB  1 
ATOM   4830  N  N   . LEU B 1 157 ? 55.074  75.644  56.400  1.00 12.62 ? 154  LEU B N   1 
ATOM   4831  C  CA  . LEU B 1 157 ? 54.511  75.144  55.140  1.00 11.96 ? 154  LEU B CA  1 
ATOM   4832  C  C   . LEU B 1 157 ? 54.873  73.671  54.899  1.00 11.49 ? 154  LEU B C   1 
ATOM   4833  O  O   . LEU B 1 157 ? 54.023  72.867  54.538  1.00 11.03 ? 154  LEU B O   1 
ATOM   4834  C  CB  . LEU B 1 157 ? 55.038  75.998  53.994  1.00 13.44 ? 154  LEU B CB  1 
ATOM   4835  C  CG  . LEU B 1 157 ? 54.667  75.609  52.575  1.00 18.49 ? 154  LEU B CG  1 
ATOM   4836  C  CD1 . LEU B 1 157 ? 53.156  75.329  52.412  1.00 21.19 ? 154  LEU B CD1 1 
ATOM   4837  C  CD2 . LEU B 1 157 ? 55.145  76.730  51.624  1.00 22.25 ? 154  LEU B CD2 1 
ATOM   4838  N  N   . ALA B 1 158 ? 56.138  73.325  55.110  1.00 10.63 ? 155  ALA B N   1 
ATOM   4839  C  CA  . ALA B 1 158 ? 56.589  71.968  54.932  1.00 10.78 ? 155  ALA B CA  1 
ATOM   4840  C  C   . ALA B 1 158 ? 55.954  71.039  55.960  1.00 11.20 ? 155  ALA B C   1 
ATOM   4841  O  O   . ALA B 1 158 ? 55.644  69.896  55.642  1.00 11.19 ? 155  ALA B O   1 
ATOM   4842  C  CB  . ALA B 1 158 ? 58.117  71.887  55.006  1.00 9.79  ? 155  ALA B CB  1 
ATOM   4843  N  N   . PHE B 1 159 ? 55.749  71.527  57.184  1.00 12.42 ? 156  PHE B N   1 
ATOM   4844  C  CA  . PHE B 1 159 ? 55.138  70.695  58.224  1.00 12.74 ? 156  PHE B CA  1 
ATOM   4845  C  C   . PHE B 1 159 ? 53.691  70.372  57.857  1.00 12.74 ? 156  PHE B C   1 
ATOM   4846  O  O   . PHE B 1 159 ? 53.271  69.232  57.958  1.00 12.24 ? 156  PHE B O   1 
ATOM   4847  C  CB  . PHE B 1 159 ? 55.276  71.314  59.637  1.00 12.17 ? 156  PHE B CB  1 
ATOM   4848  C  CG  . PHE B 1 159 ? 54.711  70.446  60.730  1.00 12.19 ? 156  PHE B CG  1 
ATOM   4849  C  CD1 . PHE B 1 159 ? 55.196  69.152  60.929  1.00 13.55 ? 156  PHE B CD1 1 
ATOM   4850  C  CD2 . PHE B 1 159 ? 53.730  70.922  61.580  1.00 13.41 ? 156  PHE B CD2 1 
ATOM   4851  C  CE1 . PHE B 1 159 ? 54.666  68.338  61.926  1.00 14.46 ? 156  PHE B CE1 1 
ATOM   4852  C  CE2 . PHE B 1 159 ? 53.216  70.123  62.587  1.00 17.65 ? 156  PHE B CE2 1 
ATOM   4853  C  CZ  . PHE B 1 159 ? 53.685  68.819  62.753  1.00 16.33 ? 156  PHE B CZ  1 
ATOM   4854  N  N   . ARG B 1 160 ? 52.948  71.374  57.403  1.00 12.81 ? 157  ARG B N   1 
ATOM   4855  C  CA  . ARG B 1 160 ? 51.554  71.182  56.976  1.00 14.45 ? 157  ARG B CA  1 
ATOM   4856  C  C   . ARG B 1 160 ? 51.483  70.086  55.903  1.00 14.24 ? 157  ARG B C   1 
ATOM   4857  O  O   . ARG B 1 160 ? 50.673  69.160  56.002  1.00 13.01 ? 157  ARG B O   1 
ATOM   4858  C  CB  . ARG B 1 160 ? 50.993  72.536  56.483  1.00 15.04 ? 157  ARG B CB  1 
ATOM   4859  C  CG  . ARG B 1 160 ? 49.644  72.542  55.839  1.00 20.56 ? 157  ARG B CG  1 
ATOM   4860  C  CD  . ARG B 1 160 ? 49.268  73.995  55.482  1.00 20.18 ? 157  ARG B CD  1 
ATOM   4861  N  NE  . ARG B 1 160 ? 48.780  74.803  56.618  1.00 18.86 ? 157  ARG B NE  1 
ATOM   4862  C  CZ  . ARG B 1 160 ? 47.568  75.368  56.671  1.00 21.31 ? 157  ARG B CZ  1 
ATOM   4863  N  NH1 . ARG B 1 160 ? 46.747  75.296  55.627  1.00 16.90 ? 157  ARG B NH1 1 
ATOM   4864  N  NH2 . ARG B 1 160 ? 47.199  76.095  57.729  1.00 22.00 ? 157  ARG B NH2 1 
ATOM   4865  N  N   . ILE B 1 161 ? 52.386  70.145  54.925  1.00 12.85 ? 158  ILE B N   1 
ATOM   4866  C  CA  . ILE B 1 161 ? 52.448  69.162  53.830  1.00 13.10 ? 158  ILE B CA  1 
ATOM   4867  C  C   . ILE B 1 161 ? 52.850  67.743  54.265  1.00 13.11 ? 158  ILE B C   1 
ATOM   4868  O  O   . ILE B 1 161 ? 52.184  66.755  53.896  1.00 11.46 ? 158  ILE B O   1 
ATOM   4869  C  CB  . ILE B 1 161 ? 53.433  69.672  52.725  1.00 12.78 ? 158  ILE B CB  1 
ATOM   4870  C  CG1 . ILE B 1 161 ? 52.835  70.888  51.999  1.00 16.58 ? 158  ILE B CG1 1 
ATOM   4871  C  CG2 . ILE B 1 161 ? 53.768  68.591  51.715  1.00 13.86 ? 158  ILE B CG2 1 
ATOM   4872  C  CD1 . ILE B 1 161 ? 53.808  71.559  51.038  1.00 14.38 ? 158  ILE B CD1 1 
ATOM   4873  N  N   . PHE B 1 162 ? 53.934  67.629  55.041  1.00 11.51 ? 159  PHE B N   1 
ATOM   4874  C  CA  . PHE B 1 162 ? 54.413  66.318  55.478  1.00 11.55 ? 159  PHE B CA  1 
ATOM   4875  C  C   . PHE B 1 162 ? 53.629  65.686  56.625  1.00 13.55 ? 159  PHE B C   1 
ATOM   4876  O  O   . PHE B 1 162 ? 53.512  64.455  56.691  1.00 13.21 ? 159  PHE B O   1 
ATOM   4877  C  CB  . PHE B 1 162 ? 55.925  66.345  55.677  1.00 11.73 ? 159  PHE B CB  1 
ATOM   4878  C  CG  . PHE B 1 162 ? 56.646  66.405  54.378  1.00 10.87 ? 159  PHE B CG  1 
ATOM   4879  C  CD1 . PHE B 1 162 ? 56.997  65.245  53.720  1.00 11.55 ? 159  PHE B CD1 1 
ATOM   4880  C  CD2 . PHE B 1 162 ? 56.871  67.613  53.751  1.00 13.54 ? 159  PHE B CD2 1 
ATOM   4881  C  CE1 . PHE B 1 162 ? 57.618  65.296  52.486  1.00 12.30 ? 159  PHE B CE1 1 
ATOM   4882  C  CE2 . PHE B 1 162 ? 57.485  67.666  52.521  1.00 12.32 ? 159  PHE B CE2 1 
ATOM   4883  C  CZ  . PHE B 1 162 ? 57.842  66.506  51.881  1.00 11.58 ? 159  PHE B CZ  1 
ATOM   4884  N  N   . ARG B 1 163 ? 53.045  66.528  57.476  1.00 13.48 ? 160  ARG B N   1 
ATOM   4885  C  CA  . ARG B 1 163 ? 52.150  66.057  58.519  1.00 15.35 ? 160  ARG B CA  1 
ATOM   4886  C  C   . ARG B 1 163 ? 50.961  65.321  57.847  1.00 15.43 ? 160  ARG B C   1 
ATOM   4887  O  O   . ARG B 1 163 ? 50.560  64.224  58.255  1.00 13.72 ? 160  ARG B O   1 
ATOM   4888  C  CB  . ARG B 1 163 ? 51.638  67.247  59.313  1.00 15.37 ? 160  ARG B CB  1 
ATOM   4889  C  CG  . ARG B 1 163 ? 50.737  66.903  60.448  1.00 23.30 ? 160  ARG B CG  1 
ATOM   4890  C  CD  . ARG B 1 163 ? 50.502  68.137  61.322  1.00 31.03 ? 160  ARG B CD  1 
ATOM   4891  N  NE  . ARG B 1 163 ? 49.516  69.070  60.799  1.00 33.47 ? 160  ARG B NE  1 
ATOM   4892  C  CZ  . ARG B 1 163 ? 48.249  69.104  61.199  1.00 40.67 ? 160  ARG B CZ  1 
ATOM   4893  N  NH1 . ARG B 1 163 ? 47.814  68.262  62.132  1.00 40.94 ? 160  ARG B NH1 1 
ATOM   4894  N  NH2 . ARG B 1 163 ? 47.415  69.994  60.684  1.00 44.73 ? 160  ARG B NH2 1 
ATOM   4895  N  N   . LYS B 1 164 ? 50.398  65.933  56.810  1.00 15.50 ? 161  LYS B N   1 
ATOM   4896  C  CA  . LYS B 1 164 ? 49.261  65.330  56.087  1.00 16.81 ? 161  LYS B CA  1 
ATOM   4897  C  C   . LYS B 1 164 ? 49.683  63.961  55.506  1.00 15.31 ? 161  LYS B C   1 
ATOM   4898  O  O   . LYS B 1 164 ? 48.941  62.959  55.603  1.00 12.85 ? 161  LYS B O   1 
ATOM   4899  C  CB  . LYS B 1 164 ? 48.802  66.296  54.986  1.00 17.89 ? 161  LYS B CB  1 
ATOM   4900  C  CG  . LYS B 1 164 ? 47.335  66.234  54.575  1.00 25.67 ? 161  LYS B CG  1 
ATOM   4901  C  CD  . LYS B 1 164 ? 46.885  64.925  53.991  1.00 33.53 ? 161  LYS B CD  1 
ATOM   4902  C  CE  . LYS B 1 164 ? 45.448  65.066  53.468  1.00 37.14 ? 161  LYS B CE  1 
ATOM   4903  N  NZ  . LYS B 1 164 ? 44.900  63.811  52.886  1.00 39.22 ? 161  LYS B NZ  1 
ATOM   4904  N  N   A LEU B 1 165 ? 50.860  63.911  54.881  0.70 14.83 ? 162  LEU B N   1 
ATOM   4905  N  N   B LEU B 1 165 ? 50.877  63.929  54.921  0.30 14.11 ? 162  LEU B N   1 
ATOM   4906  C  CA  A LEU B 1 165 ? 51.360  62.642  54.345  0.70 15.08 ? 162  LEU B CA  1 
ATOM   4907  C  CA  B LEU B 1 165 ? 51.428  62.711  54.342  0.30 13.52 ? 162  LEU B CA  1 
ATOM   4908  C  C   A LEU B 1 165 ? 51.474  61.580  55.424  0.70 14.51 ? 162  LEU B C   1 
ATOM   4909  C  C   B LEU B 1 165 ? 51.534  61.601  55.390  0.30 13.72 ? 162  LEU B C   1 
ATOM   4910  O  O   A LEU B 1 165 ? 51.102  60.422  55.211  0.70 13.70 ? 162  LEU B O   1 
ATOM   4911  O  O   B LEU B 1 165 ? 51.201  60.446  55.120  0.30 13.34 ? 162  LEU B O   1 
ATOM   4912  C  CB  A LEU B 1 165 ? 52.730  62.796  53.672  0.70 15.60 ? 162  LEU B CB  1 
ATOM   4913  C  CB  B LEU B 1 165 ? 52.813  63.001  53.757  0.30 13.15 ? 162  LEU B CB  1 
ATOM   4914  C  CG  A LEU B 1 165 ? 52.767  63.321  52.240  0.70 18.27 ? 162  LEU B CG  1 
ATOM   4915  C  CG  B LEU B 1 165 ? 53.549  61.849  53.072  0.30 11.27 ? 162  LEU B CG  1 
ATOM   4916  C  CD1 A LEU B 1 165 ? 54.204  63.497  51.786  0.70 20.96 ? 162  LEU B CD1 1 
ATOM   4917  C  CD1 B LEU B 1 165 ? 52.752  61.337  51.895  0.30 10.14 ? 162  LEU B CD1 1 
ATOM   4918  C  CD2 A LEU B 1 165 ? 52.038  62.352  51.329  0.70 20.05 ? 162  LEU B CD2 1 
ATOM   4919  C  CD2 B LEU B 1 165 ? 54.933  62.306  52.620  0.30 9.34  ? 162  LEU B CD2 1 
ATOM   4920  N  N   . LEU B 1 166 ? 52.017  61.958  56.578  1.00 13.86 ? 163  LEU B N   1 
ATOM   4921  C  CA  . LEU B 1 166 ? 52.176  61.009  57.678  1.00 14.33 ? 163  LEU B CA  1 
ATOM   4922  C  C   . LEU B 1 166 ? 50.783  60.511  58.120  1.00 14.90 ? 163  LEU B C   1 
ATOM   4923  O  O   . LEU B 1 166 ? 50.562  59.307  58.334  1.00 12.44 ? 163  LEU B O   1 
ATOM   4924  C  CB  . LEU B 1 166 ? 52.905  61.685  58.846  1.00 15.31 ? 163  LEU B CB  1 
ATOM   4925  C  CG  . LEU B 1 166 ? 53.329  60.799  60.022  1.00 15.83 ? 163  LEU B CG  1 
ATOM   4926  C  CD1 . LEU B 1 166 ? 54.457  59.863  59.582  1.00 17.10 ? 163  LEU B CD1 1 
ATOM   4927  C  CD2 . LEU B 1 166 ? 53.798  61.664  61.174  1.00 18.04 ? 163  LEU B CD2 1 
ATOM   4928  N  N   . GLU B 1 167 ? 49.831  61.436  58.232  1.00 15.54 ? 164  GLU B N   1 
ATOM   4929  C  CA  . GLU B 1 167 ? 48.479  61.066  58.637  1.00 16.63 ? 164  GLU B CA  1 
ATOM   4930  C  C   . GLU B 1 167 ? 47.825  60.131  57.617  1.00 17.89 ? 164  GLU B C   1 
ATOM   4931  O  O   . GLU B 1 167 ? 47.181  59.146  58.005  1.00 15.11 ? 164  GLU B O   1 
ATOM   4932  C  CB  . GLU B 1 167 ? 47.619  62.310  58.867  1.00 17.57 ? 164  GLU B CB  1 
ATOM   4933  C  CG  . GLU B 1 167 ? 48.087  63.126  60.056  1.00 20.92 ? 164  GLU B CG  1 
ATOM   4934  C  CD  . GLU B 1 167 ? 47.244  64.367  60.302  1.00 25.51 ? 164  GLU B CD  1 
ATOM   4935  O  OE1 . GLU B 1 167 ? 46.153  64.488  59.700  1.00 31.80 ? 164  GLU B OE1 1 
ATOM   4936  O  OE2 . GLU B 1 167 ? 47.660  65.206  61.128  1.00 24.77 ? 164  GLU B OE2 1 
ATOM   4937  N  N   A GLU B 1 168 ? 47.970  60.447  56.334  0.70 18.35 ? 165  GLU B N   1 
ATOM   4938  N  N   B GLU B 1 168 ? 48.016  60.426  56.326  0.30 17.85 ? 165  GLU B N   1 
ATOM   4939  C  CA  A GLU B 1 168 ? 47.416  59.614  55.272  0.70 20.02 ? 165  GLU B CA  1 
ATOM   4940  C  CA  B GLU B 1 168 ? 47.443  59.612  55.248  0.30 18.76 ? 165  GLU B CA  1 
ATOM   4941  C  C   A GLU B 1 168 ? 47.935  58.176  55.361  0.70 19.82 ? 165  GLU B C   1 
ATOM   4942  C  C   B GLU B 1 168 ? 47.939  58.175  55.351  0.30 18.96 ? 165  GLU B C   1 
ATOM   4943  O  O   A GLU B 1 168 ? 47.186  57.235  55.140  0.70 19.97 ? 165  GLU B O   1 
ATOM   4944  O  O   B GLU B 1 168 ? 47.184  57.233  55.126  0.30 19.04 ? 165  GLU B O   1 
ATOM   4945  C  CB  A GLU B 1 168 ? 47.750  60.208  53.898  0.70 20.93 ? 165  GLU B CB  1 
ATOM   4946  C  CB  B GLU B 1 168 ? 47.802  60.162  53.846  0.30 19.03 ? 165  GLU B CB  1 
ATOM   4947  C  CG  A GLU B 1 168 ? 46.962  61.477  53.568  0.70 25.59 ? 165  GLU B CG  1 
ATOM   4948  C  CG  B GLU B 1 168 ? 49.257  59.906  53.382  0.30 20.45 ? 165  GLU B CG  1 
ATOM   4949  C  CD  A GLU B 1 168 ? 47.440  62.184  52.295  0.70 30.81 ? 165  GLU B CD  1 
ATOM   4950  C  CD  B GLU B 1 168 ? 49.526  60.314  51.914  0.30 22.78 ? 165  GLU B CD  1 
ATOM   4951  O  OE1 A GLU B 1 168 ? 48.649  62.101  51.952  0.70 33.52 ? 165  GLU B OE1 1 
ATOM   4952  O  OE1 B GLU B 1 168 ? 48.768  61.131  51.347  0.30 22.02 ? 165  GLU B OE1 1 
ATOM   4953  O  OE2 A GLU B 1 168 ? 46.607  62.865  51.657  0.70 33.80 ? 165  GLU B OE2 1 
ATOM   4954  O  OE2 B GLU B 1 168 ? 50.514  59.816  51.327  0.30 24.28 ? 165  GLU B OE2 1 
ATOM   4955  N  N   . LYS B 1 169 ? 49.213  58.018  55.700  1.00 18.84 ? 166  LYS B N   1 
ATOM   4956  C  CA  . LYS B 1 169 ? 49.826  56.700  55.813  1.00 19.27 ? 166  LYS B CA  1 
ATOM   4957  C  C   . LYS B 1 169 ? 49.448  55.918  57.072  1.00 18.13 ? 166  LYS B C   1 
ATOM   4958  O  O   . LYS B 1 169 ? 49.104  54.738  57.007  1.00 16.82 ? 166  LYS B O   1 
ATOM   4959  C  CB  . LYS B 1 169 ? 51.349  56.847  55.823  1.00 20.41 ? 166  LYS B CB  1 
ATOM   4960  C  CG  . LYS B 1 169 ? 52.103  55.505  55.749  1.00 22.14 ? 166  LYS B CG  1 
ATOM   4961  C  CD  . LYS B 1 169 ? 53.608  55.710  55.850  1.00 25.15 ? 166  LYS B CD  1 
ATOM   4962  C  CE  . LYS B 1 169 ? 54.376  54.458  55.443  1.00 27.92 ? 166  LYS B CE  1 
ATOM   4963  N  NZ  . LYS B 1 169 ? 53.939  53.235  56.175  1.00 32.70 ? 166  LYS B NZ  1 
ATOM   4964  N  N   . TYR B 1 170 ? 49.525  56.578  58.219  1.00 16.12 ? 167  TYR B N   1 
ATOM   4965  C  CA  . TYR B 1 170 ? 49.289  55.908  59.496  1.00 15.84 ? 167  TYR B CA  1 
ATOM   4966  C  C   . TYR B 1 170 ? 47.960  56.094  60.231  1.00 15.76 ? 167  TYR B C   1 
ATOM   4967  O  O   . TYR B 1 170 ? 47.667  55.338  61.164  1.00 16.11 ? 167  TYR B O   1 
ATOM   4968  C  CB  . TYR B 1 170 ? 50.362  56.378  60.469  1.00 15.33 ? 167  TYR B CB  1 
ATOM   4969  C  CG  . TYR B 1 170 ? 51.765  55.961  60.112  1.00 13.76 ? 167  TYR B CG  1 
ATOM   4970  C  CD1 . TYR B 1 170 ? 52.169  54.639  60.273  1.00 12.92 ? 167  TYR B CD1 1 
ATOM   4971  C  CD2 . TYR B 1 170 ? 52.687  56.880  59.648  1.00 12.07 ? 167  TYR B CD2 1 
ATOM   4972  C  CE1 . TYR B 1 170 ? 53.457  54.241  59.967  1.00 12.90 ? 167  TYR B CE1 1 
ATOM   4973  C  CE2 . TYR B 1 170 ? 53.975  56.498  59.353  1.00 15.22 ? 167  TYR B CE2 1 
ATOM   4974  C  CZ  . TYR B 1 170 ? 54.355  55.164  59.514  1.00 11.69 ? 167  TYR B CZ  1 
ATOM   4975  O  OH  . TYR B 1 170 ? 55.644  54.767  59.239  1.00 9.08  ? 167  TYR B OH  1 
ATOM   4976  N  N   . GLY B 1 171 ? 47.165  57.083  59.847  1.00 14.75 ? 168  GLY B N   1 
ATOM   4977  C  CA  . GLY B 1 171 ? 45.944  57.392  60.606  1.00 14.32 ? 168  GLY B CA  1 
ATOM   4978  C  C   . GLY B 1 171 ? 46.382  58.368  61.692  1.00 14.45 ? 168  GLY B C   1 
ATOM   4979  O  O   . GLY B 1 171 ? 47.588  58.496  61.976  1.00 13.46 ? 168  GLY B O   1 
ATOM   4980  N  N   . LYS B 1 172 ? 45.433  59.054  62.316  1.00 14.20 ? 169  LYS B N   1 
ATOM   4981  C  CA  . LYS B 1 172 ? 45.761  60.065  63.335  1.00 14.84 ? 169  LYS B CA  1 
ATOM   4982  C  C   . LYS B 1 172 ? 46.551  59.650  64.576  1.00 13.64 ? 169  LYS B C   1 
ATOM   4983  O  O   . LYS B 1 172 ? 47.541  60.306  64.947  1.00 10.46 ? 169  LYS B O   1 
ATOM   4984  C  CB  . LYS B 1 172 ? 44.481  60.736  63.801  1.00 17.13 ? 169  LYS B CB  1 
ATOM   4985  C  CG  . LYS B 1 172 ? 44.061  61.895  62.945  1.00 22.72 ? 169  LYS B CG  1 
ATOM   4986  C  CD  . LYS B 1 172 ? 44.972  63.067  63.222  1.00 24.09 ? 169  LYS B CD  1 
ATOM   4987  C  CE  . LYS B 1 172 ? 44.417  64.317  62.640  1.00 26.84 ? 169  LYS B CE  1 
ATOM   4988  N  NZ  . LYS B 1 172 ? 45.275  65.468  62.931  1.00 24.13 ? 169  LYS B NZ  1 
ATOM   4989  N  N   . GLU B 1 173 ? 46.115  58.585  65.236  1.00 12.11 ? 170  GLU B N   1 
ATOM   4990  C  CA  . GLU B 1 173 ? 46.781  58.160  66.468  1.00 13.58 ? 170  GLU B CA  1 
ATOM   4991  C  C   . GLU B 1 173 ? 48.232  57.703  66.262  1.00 14.32 ? 170  GLU B C   1 
ATOM   4992  O  O   . GLU B 1 173 ? 49.141  58.097  67.025  1.00 13.09 ? 170  GLU B O   1 
ATOM   4993  C  CB  . GLU B 1 173 ? 45.945  57.086  67.194  1.00 13.84 ? 170  GLU B CB  1 
ATOM   4994  C  CG  . GLU B 1 173 ? 46.615  56.498  68.427  1.00 14.00 ? 170  GLU B CG  1 
ATOM   4995  C  CD  . GLU B 1 173 ? 47.037  57.543  69.463  1.00 17.25 ? 170  GLU B CD  1 
ATOM   4996  O  OE1 . GLU B 1 173 ? 46.625  58.723  69.361  1.00 16.88 ? 170  GLU B OE1 1 
ATOM   4997  O  OE2 . GLU B 1 173 ? 47.783  57.173  70.394  1.00 15.58 ? 170  GLU B OE2 1 
ATOM   4998  N  N   . GLU B 1 174 ? 48.468  56.876  65.249  1.00 13.98 ? 171  GLU B N   1 
ATOM   4999  C  CA  . GLU B 1 174 ? 49.835  56.428  64.995  1.00 15.18 ? 171  GLU B CA  1 
ATOM   5000  C  C   . GLU B 1 174 ? 50.715  57.585  64.469  1.00 14.44 ? 171  GLU B C   1 
ATOM   5001  O  O   . GLU B 1 174 ? 51.907  57.648  64.780  1.00 14.77 ? 171  GLU B O   1 
ATOM   5002  C  CB  . GLU B 1 174 ? 49.860  55.196  64.097  1.00 16.22 ? 171  GLU B CB  1 
ATOM   5003  C  CG  . GLU B 1 174 ? 49.188  53.983  64.736  1.00 21.25 ? 171  GLU B CG  1 
ATOM   5004  C  CD  . GLU B 1 174 ? 49.849  53.500  66.048  1.00 32.46 ? 171  GLU B CD  1 
ATOM   5005  O  OE1 . GLU B 1 174 ? 49.143  52.833  66.853  1.00 37.23 ? 171  GLU B OE1 1 
ATOM   5006  O  OE2 . GLU B 1 174 ? 51.047  53.802  66.296  1.00 37.33 ? 171  GLU B OE2 1 
ATOM   5007  N  N   . ALA B 1 175 ? 50.129  58.524  63.723  1.00 13.90 ? 172  ALA B N   1 
ATOM   5008  C  CA  . ALA B 1 175 ? 50.895  59.681  63.261  1.00 12.50 ? 172  ALA B CA  1 
ATOM   5009  C  C   . ALA B 1 175 ? 51.281  60.539  64.469  1.00 12.89 ? 172  ALA B C   1 
ATOM   5010  O  O   . ALA B 1 175 ? 52.404  61.056  64.537  1.00 12.08 ? 172  ALA B O   1 
ATOM   5011  C  CB  . ALA B 1 175 ? 50.120  60.501  62.254  1.00 12.45 ? 172  ALA B CB  1 
ATOM   5012  N  N   . ARG B 1 176 ? 50.358  60.663  65.425  1.00 11.64 ? 173  ARG B N   1 
ATOM   5013  C  CA  . ARG B 1 176 ? 50.580  61.456  66.625  1.00 11.22 ? 173  ARG B CA  1 
ATOM   5014  C  C   . ARG B 1 176 ? 51.826  60.977  67.372  1.00 12.21 ? 173  ARG B C   1 
ATOM   5015  O  O   . ARG B 1 176 ? 52.597  61.781  67.883  1.00 10.21 ? 173  ARG B O   1 
ATOM   5016  C  CB  . ARG B 1 176 ? 49.373  61.385  67.570  1.00 10.34 ? 173  ARG B CB  1 
ATOM   5017  C  CG  . ARG B 1 176 ? 49.542  62.256  68.812  1.00 11.18 ? 173  ARG B CG  1 
ATOM   5018  C  CD  . ARG B 1 176 ? 48.410  62.105  69.831  1.00 12.70 ? 173  ARG B CD  1 
ATOM   5019  N  NE  . ARG B 1 176 ? 48.345  60.770  70.404  1.00 14.22 ? 173  ARG B NE  1 
ATOM   5020  C  CZ  . ARG B 1 176 ? 49.073  60.362  71.441  1.00 15.51 ? 173  ARG B CZ  1 
ATOM   5021  N  NH1 . ARG B 1 176 ? 49.941  61.169  72.014  1.00 18.51 ? 173  ARG B NH1 1 
ATOM   5022  N  NH2 . ARG B 1 176 ? 48.949  59.134  71.895  1.00 16.32 ? 173  ARG B NH2 1 
ATOM   5023  N  N   . LYS B 1 177 ? 52.019  59.663  67.430  1.00 12.16 ? 174  LYS B N   1 
ATOM   5024  C  CA  . LYS B 1 177 ? 53.166  59.100  68.129  1.00 13.70 ? 174  LYS B CA  1 
ATOM   5025  C  C   . LYS B 1 177 ? 54.454  59.077  67.295  1.00 13.06 ? 174  LYS B C   1 
ATOM   5026  O  O   . LYS B 1 177 ? 55.484  58.589  67.766  1.00 12.72 ? 174  LYS B O   1 
ATOM   5027  C  CB  . LYS B 1 177 ? 52.836  57.690  68.632  1.00 14.86 ? 174  LYS B CB  1 
ATOM   5028  C  CG  . LYS B 1 177 ? 51.664  57.643  69.625  1.00 18.66 ? 174  LYS B CG  1 
ATOM   5029  C  CD  . LYS B 1 177 ? 51.936  58.444  70.914  1.00 27.59 ? 174  LYS B CD  1 
ATOM   5030  C  CE  . LYS B 1 177 ? 53.113  57.891  71.723  1.00 31.75 ? 174  LYS B CE  1 
ATOM   5031  N  NZ  . LYS B 1 177 ? 52.883  56.440  72.069  1.00 37.08 ? 174  LYS B NZ  1 
ATOM   5032  N  N   . ARG B 1 178 ? 54.400  59.617  66.077  1.00 12.55 ? 175  ARG B N   1 
ATOM   5033  C  CA  . ARG B 1 178 ? 55.576  59.687  65.180  1.00 12.19 ? 175  ARG B CA  1 
ATOM   5034  C  C   . ARG B 1 178 ? 55.992  61.143  64.905  1.00 11.79 ? 175  ARG B C   1 
ATOM   5035  O  O   . ARG B 1 178 ? 56.847  61.409  64.057  1.00 14.82 ? 175  ARG B O   1 
ATOM   5036  C  CB  . ARG B 1 178 ? 55.302  58.947  63.868  1.00 11.36 ? 175  ARG B CB  1 
ATOM   5037  C  CG  . ARG B 1 178 ? 55.301  57.443  64.036  1.00 10.60 ? 175  ARG B CG  1 
ATOM   5038  C  CD  . ARG B 1 178 ? 54.889  56.718  62.798  1.00 10.64 ? 175  ARG B CD  1 
ATOM   5039  N  NE  . ARG B 1 178 ? 55.114  55.282  62.952  1.00 10.54 ? 175  ARG B NE  1 
ATOM   5040  C  CZ  . ARG B 1 178 ? 56.276  54.678  62.719  1.00 10.71 ? 175  ARG B CZ  1 
ATOM   5041  N  NH1 . ARG B 1 178 ? 57.321  55.383  62.330  1.00 10.50 ? 175  ARG B NH1 1 
ATOM   5042  N  NH2 . ARG B 1 178 ? 56.400  53.362  62.889  1.00 10.43 ? 175  ARG B NH2 1 
ATOM   5043  N  N   . ILE B 1 179 ? 55.373  62.072  65.622  1.00 11.22 ? 176  ILE B N   1 
ATOM   5044  C  CA  . ILE B 1 179 ? 55.703  63.489  65.506  1.00 11.61 ? 176  ILE B CA  1 
ATOM   5045  C  C   . ILE B 1 179 ? 56.225  64.006  66.842  1.00 11.87 ? 176  ILE B C   1 
ATOM   5046  O  O   . ILE B 1 179 ? 55.608  63.772  67.889  1.00 13.65 ? 176  ILE B O   1 
ATOM   5047  C  CB  . ILE B 1 179 ? 54.505  64.312  65.032  1.00 11.68 ? 176  ILE B CB  1 
ATOM   5048  C  CG1 . ILE B 1 179 ? 54.100  63.846  63.634  1.00 13.45 ? 176  ILE B CG1 1 
ATOM   5049  C  CG2 . ILE B 1 179 ? 54.845  65.795  65.035  1.00 12.34 ? 176  ILE B CG2 1 
ATOM   5050  C  CD1 . ILE B 1 179 ? 52.856  64.531  63.050  1.00 15.04 ? 176  ILE B CD1 1 
ATOM   5051  N  N   . TYR B 1 180 ? 57.381  64.682  66.783  1.00 11.32 ? 177  TYR B N   1 
ATOM   5052  C  CA  . TYR B 1 180 ? 58.072  65.258  67.930  1.00 9.97  ? 177  TYR B CA  1 
ATOM   5053  C  C   . TYR B 1 180 ? 58.290  66.731  67.621  1.00 10.67 ? 177  TYR B C   1 
ATOM   5054  O  O   . TYR B 1 180 ? 58.947  67.083  66.625  1.00 10.25 ? 177  TYR B O   1 
ATOM   5055  C  CB  . TYR B 1 180 ? 59.424  64.544  68.134  1.00 11.00 ? 177  TYR B CB  1 
ATOM   5056  C  CG  . TYR B 1 180 ? 59.251  63.032  68.236  1.00 9.24  ? 177  TYR B CG  1 
ATOM   5057  C  CD1 . TYR B 1 180 ? 59.136  62.248  67.101  1.00 13.00 ? 177  TYR B CD1 1 
ATOM   5058  C  CD2 . TYR B 1 180 ? 59.178  62.410  69.457  1.00 11.01 ? 177  TYR B CD2 1 
ATOM   5059  C  CE1 . TYR B 1 180 ? 58.960  60.852  67.192  1.00 14.46 ? 177  TYR B CE1 1 
ATOM   5060  C  CE2 . TYR B 1 180 ? 58.987  61.036  69.563  1.00 11.83 ? 177  TYR B CE2 1 
ATOM   5061  C  CZ  . TYR B 1 180 ? 58.878  60.266  68.436  1.00 12.77 ? 177  TYR B CZ  1 
ATOM   5062  O  OH  . TYR B 1 180 ? 58.694  58.896  68.564  1.00 12.65 ? 177  TYR B OH  1 
ATOM   5063  N  N   . ALA B 1 181 ? 57.743  67.598  68.466  1.00 11.31 ? 178  ALA B N   1 
ATOM   5064  C  CA  . ALA B 1 181 ? 57.840  69.032  68.245  1.00 11.22 ? 178  ALA B CA  1 
ATOM   5065  C  C   . ALA B 1 181 ? 58.748  69.729  69.270  1.00 11.44 ? 178  ALA B C   1 
ATOM   5066  O  O   . ALA B 1 181 ? 58.529  69.663  70.477  1.00 12.53 ? 178  ALA B O   1 
ATOM   5067  C  CB  . ALA B 1 181 ? 56.444  69.663  68.251  1.00 10.62 ? 178  ALA B CB  1 
ATOM   5068  N  N   . THR B 1 182 ? 59.742  70.428  68.754  1.00 10.88 ? 179  THR B N   1 
ATOM   5069  C  CA  . THR B 1 182 ? 60.709  71.160  69.555  1.00 10.23 ? 179  THR B CA  1 
ATOM   5070  C  C   . THR B 1 182 ? 60.490  72.641  69.256  1.00 11.99 ? 179  THR B C   1 
ATOM   5071  O  O   . THR B 1 182 ? 60.753  73.118  68.149  1.00 12.65 ? 179  THR B O   1 
ATOM   5072  C  CB  . THR B 1 182 ? 62.118  70.720  69.180  1.00 12.16 ? 179  THR B CB  1 
ATOM   5073  O  OG1 . THR B 1 182 ? 62.223  69.283  69.357  1.00 9.75  ? 179  THR B OG1 1 
ATOM   5074  C  CG2 . THR B 1 182 ? 63.187  71.468  70.018  1.00 8.57  ? 179  THR B CG2 1 
ATOM   5075  N  N   . THR B 1 183 ? 60.023  73.365  70.255  1.00 13.09 ? 180  THR B N   1 
ATOM   5076  C  CA  . THR B 1 183 ? 59.677  74.754  70.094  1.00 14.44 ? 180  THR B CA  1 
ATOM   5077  C  C   . THR B 1 183 ? 59.663  75.441  71.444  1.00 14.72 ? 180  THR B C   1 
ATOM   5078  O  O   . THR B 1 183 ? 60.057  74.849  72.470  1.00 12.55 ? 180  THR B O   1 
ATOM   5079  C  CB  . THR B 1 183 ? 58.255  74.858  69.425  1.00 16.02 ? 180  THR B CB  1 
ATOM   5080  O  OG1 . THR B 1 183 ? 57.910  76.225  69.176  1.00 19.92 ? 180  THR B OG1 1 
ATOM   5081  C  CG2 . THR B 1 183 ? 57.201  74.230  70.302  1.00 15.08 ? 180  THR B CG2 1 
ATOM   5082  N  N   . ASP B 1 184 ? 59.196  76.695  71.464  1.00 15.35 ? 181  ASP B N   1 
ATOM   5083  C  CA  . ASP B 1 184 ? 59.122  77.457  72.696  1.00 15.63 ? 181  ASP B CA  1 
ATOM   5084  C  C   . ASP B 1 184 ? 58.215  76.742  73.719  1.00 16.47 ? 181  ASP B C   1 
ATOM   5085  O  O   . ASP B 1 184 ? 57.327  75.992  73.347  1.00 16.68 ? 181  ASP B O   1 
ATOM   5086  C  CB  . ASP B 1 184 ? 58.547  78.838  72.407  1.00 17.03 ? 181  ASP B CB  1 
ATOM   5087  C  CG  . ASP B 1 184 ? 58.744  79.790  73.546  1.00 17.72 ? 181  ASP B CG  1 
ATOM   5088  O  OD1 . ASP B 1 184 ? 59.844  80.409  73.599  1.00 20.14 ? 181  ASP B OD1 1 
ATOM   5089  O  OD2 . ASP B 1 184 ? 57.791  79.938  74.361  1.00 18.18 ? 181  ASP B OD2 1 
ATOM   5090  N  N   . LYS B 1 185 ? 58.441  76.976  75.010  1.00 16.80 ? 182  LYS B N   1 
ATOM   5091  C  CA  . LYS B 1 185 ? 57.625  76.368  76.055  1.00 20.28 ? 182  LYS B CA  1 
ATOM   5092  C  C   . LYS B 1 185 ? 56.157  76.829  76.031  1.00 21.76 ? 182  LYS B C   1 
ATOM   5093  O  O   . LYS B 1 185 ? 55.264  76.071  76.390  1.00 23.47 ? 182  LYS B O   1 
ATOM   5094  C  CB  . LYS B 1 185 ? 58.196  76.719  77.438  1.00 20.63 ? 182  LYS B CB  1 
ATOM   5095  C  CG  . LYS B 1 185 ? 57.415  76.124  78.622  1.00 26.25 ? 182  LYS B CG  1 
ATOM   5096  C  CD  . LYS B 1 185 ? 57.549  74.619  78.690  1.00 29.69 ? 182  LYS B CD  1 
ATOM   5097  C  CE  . LYS B 1 185 ? 56.734  74.009  79.819  1.00 32.16 ? 182  LYS B CE  1 
ATOM   5098  N  NZ  . LYS B 1 185 ? 55.271  74.059  79.543  1.00 35.83 ? 182  LYS B NZ  1 
ATOM   5099  N  N   . ALA B 1 186 ? 55.906  78.065  75.621  1.00 22.53 ? 183  ALA B N   1 
ATOM   5100  C  CA  . ALA B 1 186 ? 54.545  78.581  75.648  1.00 24.08 ? 183  ALA B CA  1 
ATOM   5101  C  C   . ALA B 1 186 ? 54.066  79.372  74.428  1.00 24.15 ? 183  ALA B C   1 
ATOM   5102  O  O   . ALA B 1 186 ? 52.889  79.382  74.128  1.00 26.53 ? 183  ALA B O   1 
ATOM   5103  C  CB  . ALA B 1 186 ? 54.375  79.440  76.899  1.00 23.64 ? 183  ALA B CB  1 
ATOM   5104  N  N   . ARG B 1 187 ? 54.947  80.025  73.703  1.00 25.01 ? 184  ARG B N   1 
ATOM   5105  C  CA  . ARG B 1 187 ? 54.457  80.848  72.600  1.00 24.73 ? 184  ARG B CA  1 
ATOM   5106  C  C   . ARG B 1 187 ? 54.750  80.317  71.203  1.00 23.39 ? 184  ARG B C   1 
ATOM   5107  O  O   . ARG B 1 187 ? 55.577  79.410  71.019  1.00 20.03 ? 184  ARG B O   1 
ATOM   5108  C  CB  . ARG B 1 187 ? 54.939  82.285  72.799  1.00 26.79 ? 184  ARG B CB  1 
ATOM   5109  C  CG  . ARG B 1 187 ? 56.395  82.365  73.128  1.00 30.58 ? 184  ARG B CG  1 
ATOM   5110  C  CD  . ARG B 1 187 ? 56.752  83.588  73.950  1.00 34.98 ? 184  ARG B CD  1 
ATOM   5111  N  NE  . ARG B 1 187 ? 58.081  83.391  74.536  1.00 39.33 ? 184  ARG B NE  1 
ATOM   5112  C  CZ  . ARG B 1 187 ? 59.226  83.727  73.951  1.00 45.54 ? 184  ARG B CZ  1 
ATOM   5113  N  NH1 . ARG B 1 187 ? 59.224  84.322  72.757  1.00 48.64 ? 184  ARG B NH1 1 
ATOM   5114  N  NH2 . ARG B 1 187 ? 60.381  83.481  74.565  1.00 45.80 ? 184  ARG B NH2 1 
ATOM   5115  N  N   . GLY B 1 188 ? 54.012  80.882  70.242  1.00 20.95 ? 185  GLY B N   1 
ATOM   5116  C  CA  . GLY B 1 188 ? 54.116  80.535  68.827  1.00 20.81 ? 185  GLY B CA  1 
ATOM   5117  C  C   . GLY B 1 188 ? 53.019  79.576  68.394  1.00 18.36 ? 185  GLY B C   1 
ATOM   5118  O  O   . GLY B 1 188 ? 52.470  78.844  69.209  1.00 17.13 ? 185  GLY B O   1 
ATOM   5119  N  N   . ALA B 1 189 ? 52.708  79.578  67.097  1.00 17.34 ? 186  ALA B N   1 
ATOM   5120  C  CA  . ALA B 1 189 ? 51.671  78.701  66.556  1.00 16.99 ? 186  ALA B CA  1 
ATOM   5121  C  C   . ALA B 1 189 ? 52.012  77.226  66.672  1.00 15.84 ? 186  ALA B C   1 
ATOM   5122  O  O   . ALA B 1 189 ? 51.132  76.409  66.912  1.00 14.64 ? 186  ALA B O   1 
ATOM   5123  C  CB  . ALA B 1 189 ? 51.379  79.051  65.100  1.00 17.13 ? 186  ALA B CB  1 
ATOM   5124  N  N   . LEU B 1 190 ? 53.283  76.865  66.512  1.00 16.15 ? 187  LEU B N   1 
ATOM   5125  C  CA  . LEU B 1 190 ? 53.649  75.448  66.568  1.00 15.91 ? 187  LEU B CA  1 
ATOM   5126  C  C   . LEU B 1 190 ? 53.325  74.825  67.925  1.00 15.79 ? 187  LEU B C   1 
ATOM   5127  O  O   . LEU B 1 190 ? 52.830  73.691  68.012  1.00 15.40 ? 187  LEU B O   1 
ATOM   5128  C  CB  . LEU B 1 190 ? 55.141  75.241  66.238  1.00 16.30 ? 187  LEU B CB  1 
ATOM   5129  C  CG  . LEU B 1 190 ? 55.600  73.779  66.277  1.00 16.66 ? 187  LEU B CG  1 
ATOM   5130  C  CD1 . LEU B 1 190 ? 54.821  72.925  65.257  1.00 14.36 ? 187  LEU B CD1 1 
ATOM   5131  C  CD2 . LEU B 1 190 ? 57.092  73.700  66.019  1.00 14.79 ? 187  LEU B CD2 1 
ATOM   5132  N  N   . LYS B 1 191 ? 53.615  75.541  68.997  1.00 16.97 ? 188  LYS B N   1 
ATOM   5133  C  CA  . LYS B 1 191 ? 53.325  75.017  70.323  1.00 15.65 ? 188  LYS B CA  1 
ATOM   5134  C  C   . LYS B 1 191 ? 51.815  74.810  70.499  1.00 16.83 ? 188  LYS B C   1 
ATOM   5135  O  O   . LYS B 1 191 ? 51.384  73.816  71.081  1.00 13.41 ? 188  LYS B O   1 
ATOM   5136  C  CB  . LYS B 1 191 ? 53.855  75.953  71.379  1.00 17.35 ? 188  LYS B CB  1 
ATOM   5137  C  CG  . LYS B 1 191 ? 53.649  75.464  72.826  1.00 19.12 ? 188  LYS B CG  1 
ATOM   5138  C  CD  . LYS B 1 191 ? 54.290  74.091  73.030  1.00 20.35 ? 188  LYS B CD  1 
ATOM   5139  C  CE  . LYS B 1 191 ? 54.325  73.705  74.486  1.00 20.19 ? 188  LYS B CE  1 
ATOM   5140  N  NZ  . LYS B 1 191 ? 52.993  73.794  75.115  1.00 18.34 ? 188  LYS B NZ  1 
ATOM   5141  N  N   . THR B 1 192 ? 51.011  75.751  70.000  1.00 17.02 ? 189  THR B N   1 
ATOM   5142  C  CA  . THR B 1 192 ? 49.556  75.618  70.105  1.00 18.54 ? 189  THR B CA  1 
ATOM   5143  C  C   . THR B 1 192 ? 49.070  74.373  69.328  1.00 17.48 ? 189  THR B C   1 
ATOM   5144  O  O   . THR B 1 192 ? 48.264  73.591  69.811  1.00 16.69 ? 189  THR B O   1 
ATOM   5145  C  CB  . THR B 1 192 ? 48.836  76.870  69.565  1.00 18.95 ? 189  THR B CB  1 
ATOM   5146  O  OG1 . THR B 1 192 ? 49.276  78.028  70.287  1.00 21.96 ? 189  THR B OG1 1 
ATOM   5147  C  CG2 . THR B 1 192 ? 47.305  76.723  69.711  1.00 21.02 ? 189  THR B CG2 1 
ATOM   5148  N  N   A LEU B 1 193 ? 49.581  74.210  68.120  0.70 18.24 ? 190  LEU B N   1 
ATOM   5149  N  N   B LEU B 1 193 ? 49.586  74.209  68.119  0.30 17.59 ? 190  LEU B N   1 
ATOM   5150  C  CA  A LEU B 1 193 ? 49.226  73.070  67.279  0.70 18.86 ? 190  LEU B CA  1 
ATOM   5151  C  CA  B LEU B 1 193 ? 49.212  73.077  67.282  0.30 17.67 ? 190  LEU B CA  1 
ATOM   5152  C  C   A LEU B 1 193 ? 49.664  71.769  67.951  0.70 18.51 ? 190  LEU B C   1 
ATOM   5153  C  C   B LEU B 1 193 ? 49.681  71.758  67.908  0.30 17.99 ? 190  LEU B C   1 
ATOM   5154  O  O   A LEU B 1 193 ? 48.888  70.818  68.050  0.70 18.17 ? 190  LEU B O   1 
ATOM   5155  O  O   B LEU B 1 193 ? 48.944  70.772  67.903  0.30 18.06 ? 190  LEU B O   1 
ATOM   5156  C  CB  A LEU B 1 193 ? 49.891  73.237  65.903  0.70 19.25 ? 190  LEU B CB  1 
ATOM   5157  C  CB  B LEU B 1 193 ? 49.765  73.273  65.865  0.30 17.31 ? 190  LEU B CB  1 
ATOM   5158  C  CG  A LEU B 1 193 ? 49.760  72.170  64.814  0.70 20.81 ? 190  LEU B CG  1 
ATOM   5159  C  CG  B LEU B 1 193 ? 49.492  72.174  64.841  0.30 16.57 ? 190  LEU B CG  1 
ATOM   5160  C  CD1 A LEU B 1 193 ? 48.303  71.896  64.445  0.70 22.74 ? 190  LEU B CD1 1 
ATOM   5161  C  CD1 B LEU B 1 193 ? 49.784  72.664  63.418  0.30 17.22 ? 190  LEU B CD1 1 
ATOM   5162  C  CD2 A LEU B 1 193 ? 50.554  72.632  63.576  0.70 24.78 ? 190  LEU B CD2 1 
ATOM   5163  C  CD2 B LEU B 1 193 ? 50.293  70.931  65.181  0.30 12.68 ? 190  LEU B CD2 1 
ATOM   5164  N  N   . ALA B 1 194 ? 50.891  71.744  68.466  1.00 18.62 ? 191  ALA B N   1 
ATOM   5165  C  CA  . ALA B 1 194 ? 51.420  70.531  69.118  1.00 18.86 ? 191  ALA B CA  1 
ATOM   5166  C  C   . ALA B 1 194 ? 50.564  70.149  70.326  1.00 20.06 ? 191  ALA B C   1 
ATOM   5167  O  O   . ALA B 1 194 ? 50.319  68.959  70.589  1.00 19.61 ? 191  ALA B O   1 
ATOM   5168  C  CB  . ALA B 1 194 ? 52.880  70.717  69.525  1.00 20.56 ? 191  ALA B CB  1 
ATOM   5169  N  N   . ASP B 1 195 ? 50.108  71.153  71.069  1.00 20.15 ? 192  ASP B N   1 
ATOM   5170  C  CA  . ASP B 1 195 ? 49.242  70.905  72.201  1.00 20.34 ? 192  ASP B CA  1 
ATOM   5171  C  C   . ASP B 1 195 ? 47.907  70.350  71.704  1.00 19.42 ? 192  ASP B C   1 
ATOM   5172  O  O   . ASP B 1 195 ? 47.393  69.391  72.264  1.00 17.72 ? 192  ASP B O   1 
ATOM   5173  C  CB  . ASP B 1 195 ? 48.980  72.183  73.002  1.00 21.68 ? 192  ASP B CB  1 
ATOM   5174  C  CG  . ASP B 1 195 ? 50.215  72.697  73.721  1.00 24.91 ? 192  ASP B CG  1 
ATOM   5175  O  OD1 . ASP B 1 195 ? 51.219  71.953  73.815  1.00 29.01 ? 192  ASP B OD1 1 
ATOM   5176  O  OD2 . ASP B 1 195 ? 50.163  73.852  74.200  1.00 27.08 ? 192  ASP B OD2 1 
ATOM   5177  N  N   . ASN B 1 196 ? 47.349  70.946  70.651  1.00 18.98 ? 193  ASN B N   1 
ATOM   5178  C  CA  . ASN B 1 196 ? 46.050  70.472  70.132  1.00 19.34 ? 193  ASN B CA  1 
ATOM   5179  C  C   . ASN B 1 196 ? 46.129  69.042  69.599  1.00 18.34 ? 193  ASN B C   1 
ATOM   5180  O  O   . ASN B 1 196 ? 45.229  68.244  69.809  1.00 17.55 ? 193  ASN B O   1 
ATOM   5181  C  CB  . ASN B 1 196 ? 45.538  71.390  69.023  1.00 20.51 ? 193  ASN B CB  1 
ATOM   5182  C  CG  . ASN B 1 196 ? 44.118  71.012  68.547  1.00 23.31 ? 193  ASN B CG  1 
ATOM   5183  O  OD1 . ASN B 1 196 ? 43.925  70.617  67.396  1.00 28.83 ? 193  ASN B OD1 1 
ATOM   5184  N  ND2 . ASN B 1 196 ? 43.148  71.072  69.452  1.00 23.89 ? 193  ASN B ND2 1 
ATOM   5185  N  N   . GLU B 1 197 ? 47.217  68.717  68.908  1.00 17.75 ? 194  GLU B N   1 
ATOM   5186  C  CA  . GLU B 1 197 ? 47.389  67.380  68.340  1.00 17.49 ? 194  GLU B CA  1 
ATOM   5187  C  C   . GLU B 1 197 ? 47.926  66.351  69.347  1.00 17.27 ? 194  GLU B C   1 
ATOM   5188  O  O   . GLU B 1 197 ? 47.869  65.141  69.093  1.00 18.44 ? 194  GLU B O   1 
ATOM   5189  C  CB  . GLU B 1 197 ? 48.297  67.447  67.110  1.00 18.37 ? 194  GLU B CB  1 
ATOM   5190  C  CG  . GLU B 1 197 ? 47.743  68.311  65.934  1.00 21.27 ? 194  GLU B CG  1 
ATOM   5191  C  CD  . GLU B 1 197 ? 46.563  67.671  65.170  1.00 25.61 ? 194  GLU B CD  1 
ATOM   5192  O  OE1 . GLU B 1 197 ? 46.197  66.503  65.442  1.00 22.72 ? 194  GLU B OE1 1 
ATOM   5193  O  OE2 . GLU B 1 197 ? 46.004  68.351  64.278  1.00 25.21 ? 194  GLU B OE2 1 
ATOM   5194  N  N   . GLY B 1 198 ? 48.432  66.812  70.488  1.00 15.33 ? 195  GLY B N   1 
ATOM   5195  C  CA  . GLY B 1 198 ? 48.971  65.897  71.493  1.00 15.12 ? 195  GLY B CA  1 
ATOM   5196  C  C   . GLY B 1 198 ? 50.341  65.284  71.182  1.00 14.70 ? 195  GLY B C   1 
ATOM   5197  O  O   . GLY B 1 198 ? 50.636  64.175  71.614  1.00 13.54 ? 195  GLY B O   1 
ATOM   5198  N  N   . TYR B 1 199 ? 51.189  65.989  70.436  1.00 13.72 ? 196  TYR B N   1 
ATOM   5199  C  CA  . TYR B 1 199 ? 52.517  65.459  70.143  1.00 14.02 ? 196  TYR B CA  1 
ATOM   5200  C  C   . TYR B 1 199 ? 53.503  65.566  71.324  1.00 13.78 ? 196  TYR B C   1 
ATOM   5201  O  O   . TYR B 1 199 ? 53.390  66.446  72.188  1.00 13.36 ? 196  TYR B O   1 
ATOM   5202  C  CB  . TYR B 1 199 ? 53.189  66.210  68.965  1.00 13.40 ? 196  TYR B CB  1 
ATOM   5203  C  CG  . TYR B 1 199 ? 52.369  66.397  67.696  1.00 15.33 ? 196  TYR B CG  1 
ATOM   5204  C  CD1 . TYR B 1 199 ? 51.625  65.349  67.139  1.00 12.85 ? 196  TYR B CD1 1 
ATOM   5205  C  CD2 . TYR B 1 199 ? 52.421  67.604  67.004  1.00 12.26 ? 196  TYR B CD2 1 
ATOM   5206  C  CE1 . TYR B 1 199 ? 50.904  65.538  65.965  1.00 15.19 ? 196  TYR B CE1 1 
ATOM   5207  C  CE2 . TYR B 1 199 ? 51.729  67.794  65.834  1.00 15.86 ? 196  TYR B CE2 1 
ATOM   5208  C  CZ  . TYR B 1 199 ? 50.977  66.773  65.309  1.00 15.69 ? 196  TYR B CZ  1 
ATOM   5209  O  OH  . TYR B 1 199 ? 50.303  66.992  64.128  1.00 15.22 ? 196  TYR B OH  1 
ATOM   5210  N  N   . GLU B 1 200 ? 54.491  64.681  71.334  1.00 13.58 ? 197  GLU B N   1 
ATOM   5211  C  CA  . GLU B 1 200 ? 55.570  64.746  72.321  1.00 15.95 ? 197  GLU B CA  1 
ATOM   5212  C  C   . GLU B 1 200 ? 56.269  66.085  72.003  1.00 14.37 ? 197  GLU B C   1 
ATOM   5213  O  O   . GLU B 1 200 ? 56.493  66.388  70.822  1.00 14.52 ? 197  GLU B O   1 
ATOM   5214  C  CB  . GLU B 1 200 ? 56.577  63.635  72.052  1.00 16.01 ? 197  GLU B CB  1 
ATOM   5215  C  CG  . GLU B 1 200 ? 57.790  63.601  72.974  1.00 21.02 ? 197  GLU B CG  1 
ATOM   5216  C  CD  . GLU B 1 200 ? 57.666  62.601  74.087  1.00 24.24 ? 197  GLU B CD  1 
ATOM   5217  O  OE1 . GLU B 1 200 ? 58.349  62.757  75.125  1.00 26.81 ? 197  GLU B OE1 1 
ATOM   5218  O  OE2 . GLU B 1 200 ? 56.914  61.623  73.900  1.00 27.47 ? 197  GLU B OE2 1 
ATOM   5219  N  N   . THR B 1 201 ? 56.640  66.854  73.017  1.00 13.56 ? 198  THR B N   1 
ATOM   5220  C  CA  . THR B 1 201 ? 57.295  68.149  72.788  1.00 13.73 ? 198  THR B CA  1 
ATOM   5221  C  C   . THR B 1 201 ? 58.586  68.319  73.595  1.00 13.01 ? 198  THR B C   1 
ATOM   5222  O  O   . THR B 1 201 ? 58.789  67.674  74.627  1.00 15.38 ? 198  THR B O   1 
ATOM   5223  C  CB  . THR B 1 201 ? 56.389  69.324  73.157  1.00 14.21 ? 198  THR B CB  1 
ATOM   5224  O  OG1 . THR B 1 201 ? 56.147  69.300  74.566  1.00 17.38 ? 198  THR B OG1 1 
ATOM   5225  C  CG2 . THR B 1 201 ? 55.059  69.274  72.401  1.00 11.47 ? 198  THR B CG2 1 
ATOM   5226  N  N   . PHE B 1 202 ? 59.452  69.185  73.091  1.00 12.35 ? 199  PHE B N   1 
ATOM   5227  C  CA  . PHE B 1 202 ? 60.722  69.515  73.723  1.00 12.25 ? 199  PHE B CA  1 
ATOM   5228  C  C   . PHE B 1 202 ? 60.801  71.023  73.701  1.00 12.17 ? 199  PHE B C   1 
ATOM   5229  O  O   . PHE B 1 202 ? 60.147  71.669  72.894  1.00 12.25 ? 199  PHE B O   1 
ATOM   5230  C  CB  . PHE B 1 202 ? 61.915  68.878  73.017  1.00 10.89 ? 199  PHE B CB  1 
ATOM   5231  C  CG  . PHE B 1 202 ? 61.921  67.368  73.100  1.00 12.11 ? 199  PHE B CG  1 
ATOM   5232  C  CD1 . PHE B 1 202 ? 62.424  66.727  74.219  1.00 15.72 ? 199  PHE B CD1 1 
ATOM   5233  C  CD2 . PHE B 1 202 ? 61.375  66.603  72.095  1.00 10.36 ? 199  PHE B CD2 1 
ATOM   5234  C  CE1 . PHE B 1 202 ? 62.398  65.336  74.318  1.00 16.35 ? 199  PHE B CE1 1 
ATOM   5235  C  CE2 . PHE B 1 202 ? 61.335  65.217  72.196  1.00 13.58 ? 199  PHE B CE2 1 
ATOM   5236  C  CZ  . PHE B 1 202 ? 61.856  64.589  73.300  1.00 14.96 ? 199  PHE B CZ  1 
ATOM   5237  N  N   . VAL B 1 203 ? 61.597  71.569  74.597  1.00 11.56 ? 200  VAL B N   1 
ATOM   5238  C  CA  . VAL B 1 203 ? 61.705  73.014  74.762  1.00 12.18 ? 200  VAL B CA  1 
ATOM   5239  C  C   . VAL B 1 203 ? 62.985  73.638  74.266  1.00 12.53 ? 200  VAL B C   1 
ATOM   5240  O  O   . VAL B 1 203 ? 64.069  73.078  74.455  1.00 11.23 ? 200  VAL B O   1 
ATOM   5241  C  CB  . VAL B 1 203 ? 61.612  73.366  76.285  1.00 12.71 ? 200  VAL B CB  1 
ATOM   5242  C  CG1 . VAL B 1 203 ? 61.917  74.906  76.569  1.00 14.31 ? 200  VAL B CG1 1 
ATOM   5243  C  CG2 . VAL B 1 203 ? 60.256  72.936  76.862  1.00 10.77 ? 200  VAL B CG2 1 
ATOM   5244  N  N   . ILE B 1 204 ? 62.838  74.788  73.594  1.00 12.56 ? 201  ILE B N   1 
ATOM   5245  C  CA  . ILE B 1 204 ? 63.957  75.623  73.204  1.00 13.53 ? 201  ILE B CA  1 
ATOM   5246  C  C   . ILE B 1 204 ? 63.895  76.729  74.256  1.00 13.58 ? 201  ILE B C   1 
ATOM   5247  O  O   . ILE B 1 204 ? 62.897  77.451  74.322  1.00 11.73 ? 201  ILE B O   1 
ATOM   5248  C  CB  . ILE B 1 204 ? 63.797  76.244  71.763  1.00 14.98 ? 201  ILE B CB  1 
ATOM   5249  C  CG1 . ILE B 1 204 ? 63.674  75.138  70.706  1.00 14.02 ? 201  ILE B CG1 1 
ATOM   5250  C  CG2 . ILE B 1 204 ? 64.972  77.164  71.451  1.00 14.48 ? 201  ILE B CG2 1 
ATOM   5251  C  CD1 . ILE B 1 204 ? 63.435  75.672  69.246  1.00 11.92 ? 201  ILE B CD1 1 
ATOM   5252  N  N   . PRO B 1 205 ? 64.923  76.836  75.126  1.00 14.71 ? 202  PRO B N   1 
ATOM   5253  C  CA  . PRO B 1 205 ? 64.881  77.864  76.167  1.00 15.83 ? 202  PRO B CA  1 
ATOM   5254  C  C   . PRO B 1 205 ? 64.702  79.267  75.586  1.00 14.95 ? 202  PRO B C   1 
ATOM   5255  O  O   . PRO B 1 205 ? 65.196  79.557  74.491  1.00 14.75 ? 202  PRO B O   1 
ATOM   5256  C  CB  . PRO B 1 205 ? 66.249  77.732  76.884  1.00 14.68 ? 202  PRO B CB  1 
ATOM   5257  C  CG  . PRO B 1 205 ? 66.797  76.397  76.446  1.00 17.06 ? 202  PRO B CG  1 
ATOM   5258  C  CD  . PRO B 1 205 ? 66.196  76.088  75.121  1.00 15.21 ? 202  PRO B CD  1 
ATOM   5259  N  N   . ASP B 1 206 ? 63.976  80.102  76.315  1.00 15.00 ? 203  ASP B N   1 
ATOM   5260  C  CA  . ASP B 1 206 ? 63.699  81.488  75.901  1.00 16.54 ? 203  ASP B CA  1 
ATOM   5261  C  C   . ASP B 1 206 ? 64.968  82.284  75.704  1.00 15.76 ? 203  ASP B C   1 
ATOM   5262  O  O   . ASP B 1 206 ? 65.029  83.156  74.840  1.00 15.50 ? 203  ASP B O   1 
ATOM   5263  C  CB  . ASP B 1 206 ? 62.914  82.229  76.990  1.00 17.52 ? 203  ASP B CB  1 
ATOM   5264  C  CG  . ASP B 1 206 ? 61.519  81.665  77.222  1.00 20.91 ? 203  ASP B CG  1 
ATOM   5265  O  OD1 . ASP B 1 206 ? 60.995  80.929  76.355  1.00 27.79 ? 203  ASP B OD1 1 
ATOM   5266  O  OD2 . ASP B 1 206 ? 60.940  81.998  78.271  1.00 24.81 ? 203  ASP B OD2 1 
ATOM   5267  N  N   . ASP B 1 207 ? 65.971  82.002  76.535  1.00 14.84 ? 204  ASP B N   1 
ATOM   5268  C  CA  . ASP B 1 207 ? 67.224  82.750  76.493  1.00 14.13 ? 204  ASP B CA  1 
ATOM   5269  C  C   . ASP B 1 207 ? 68.301  82.150  75.597  1.00 13.72 ? 204  ASP B C   1 
ATOM   5270  O  O   . ASP B 1 207 ? 69.469  82.524  75.706  1.00 14.17 ? 204  ASP B O   1 
ATOM   5271  C  CB  . ASP B 1 207 ? 67.760  82.986  77.920  1.00 14.19 ? 204  ASP B CB  1 
ATOM   5272  C  CG  . ASP B 1 207 ? 68.010  81.691  78.676  1.00 17.64 ? 204  ASP B CG  1 
ATOM   5273  O  OD1 . ASP B 1 207 ? 67.938  80.598  78.068  1.00 21.04 ? 204  ASP B OD1 1 
ATOM   5274  O  OD2 . ASP B 1 207 ? 68.283  81.759  79.884  1.00 17.77 ? 204  ASP B OD2 1 
ATOM   5275  N  N   . VAL B 1 208 ? 67.932  81.213  74.731  1.00 12.88 ? 205  VAL B N   1 
ATOM   5276  C  CA  . VAL B 1 208 ? 68.898  80.671  73.794  1.00 13.57 ? 205  VAL B CA  1 
ATOM   5277  C  C   . VAL B 1 208 ? 68.418  80.982  72.375  1.00 14.26 ? 205  VAL B C   1 
ATOM   5278  O  O   . VAL B 1 208 ? 67.389  80.483  71.935  1.00 15.89 ? 205  VAL B O   1 
ATOM   5279  C  CB  . VAL B 1 208 ? 69.138  79.152  73.961  1.00 13.65 ? 205  VAL B CB  1 
ATOM   5280  C  CG1 . VAL B 1 208 ? 70.054  78.655  72.866  1.00 13.39 ? 205  VAL B CG1 1 
ATOM   5281  C  CG2 . VAL B 1 208 ? 69.725  78.821  75.347  1.00 10.31 ? 205  VAL B CG2 1 
ATOM   5282  N  N   . GLY B 1 209 ? 69.156  81.846  71.683  1.00 15.23 ? 206  GLY B N   1 
ATOM   5283  C  CA  . GLY B 1 209 ? 68.834  82.218  70.303  1.00 15.18 ? 206  GLY B CA  1 
ATOM   5284  C  C   . GLY B 1 209 ? 69.110  81.064  69.353  1.00 15.32 ? 206  GLY B C   1 
ATOM   5285  O  O   . GLY B 1 209 ? 69.934  80.193  69.650  1.00 15.47 ? 206  GLY B O   1 
ATOM   5286  N  N   . GLY B 1 210 ? 68.443  81.065  68.192  1.00 14.33 ? 207  GLY B N   1 
ATOM   5287  C  CA  . GLY B 1 210 ? 68.604  79.975  67.197  1.00 14.02 ? 207  GLY B CA  1 
ATOM   5288  C  C   . GLY B 1 210 ? 70.029  79.564  66.830  1.00 13.74 ? 207  GLY B C   1 
ATOM   5289  O  O   . GLY B 1 210 ? 70.375  78.367  66.850  1.00 12.68 ? 207  GLY B O   1 
ATOM   5290  N  N   . ARG B 1 211 ? 70.872  80.544  66.513  1.00 12.61 ? 208  ARG B N   1 
ATOM   5291  C  CA  . ARG B 1 211 ? 72.238  80.252  66.115  1.00 12.25 ? 208  ARG B CA  1 
ATOM   5292  C  C   . ARG B 1 211 ? 73.111  79.677  67.228  1.00 13.07 ? 208  ARG B C   1 
ATOM   5293  O  O   . ARG B 1 211 ? 74.154  79.113  66.943  1.00 14.05 ? 208  ARG B O   1 
ATOM   5294  C  CB  . ARG B 1 211 ? 72.925  81.456  65.460  1.00 12.66 ? 208  ARG B CB  1 
ATOM   5295  C  CG  . ARG B 1 211 ? 73.006  82.703  66.283  1.00 11.64 ? 208  ARG B CG  1 
ATOM   5296  C  CD  . ARG B 1 211 ? 73.631  83.814  65.441  1.00 12.25 ? 208  ARG B CD  1 
ATOM   5297  N  NE  . ARG B 1 211 ? 73.579  85.108  66.102  1.00 13.62 ? 208  ARG B NE  1 
ATOM   5298  C  CZ  . ARG B 1 211 ? 72.525  85.924  66.089  1.00 16.49 ? 208  ARG B CZ  1 
ATOM   5299  N  NH1 . ARG B 1 211 ? 71.407  85.587  65.458  1.00 19.03 ? 208  ARG B NH1 1 
ATOM   5300  N  NH2 . ARG B 1 211 ? 72.585  87.093  66.729  1.00 15.18 ? 208  ARG B NH2 1 
ATOM   5301  N  N   . PHE B 1 212 ? 72.647  79.787  68.473  1.00 12.81 ? 209  PHE B N   1 
ATOM   5302  C  CA  . PHE B 1 212 ? 73.325  79.241  69.625  1.00 12.95 ? 209  PHE B CA  1 
ATOM   5303  C  C   . PHE B 1 212 ? 72.547  78.027  70.203  1.00 12.88 ? 209  PHE B C   1 
ATOM   5304  O  O   . PHE B 1 212 ? 72.824  77.595  71.321  1.00 13.65 ? 209  PHE B O   1 
ATOM   5305  C  CB  . PHE B 1 212 ? 73.442  80.334  70.713  1.00 13.54 ? 209  PHE B CB  1 
ATOM   5306  C  CG  . PHE B 1 212 ? 74.400  81.478  70.360  1.00 11.29 ? 209  PHE B CG  1 
ATOM   5307  C  CD1 . PHE B 1 212 ? 73.943  82.630  69.761  1.00 10.62 ? 209  PHE B CD1 1 
ATOM   5308  C  CD2 . PHE B 1 212 ? 75.744  81.400  70.699  1.00 9.68  ? 209  PHE B CD2 1 
ATOM   5309  C  CE1 . PHE B 1 212 ? 74.811  83.673  69.449  1.00 10.49 ? 209  PHE B CE1 1 
ATOM   5310  C  CE2 . PHE B 1 212 ? 76.617  82.438  70.420  1.00 10.17 ? 209  PHE B CE2 1 
ATOM   5311  C  CZ  . PHE B 1 212 ? 76.166  83.570  69.774  1.00 10.15 ? 209  PHE B CZ  1 
ATOM   5312  N  N   . SER B 1 213 ? 71.616  77.445  69.445  1.00 12.54 ? 210  SER B N   1 
ATOM   5313  C  CA  . SER B 1 213 ? 70.763  76.375  69.999  1.00 12.56 ? 210  SER B CA  1 
ATOM   5314  C  C   . SER B 1 213 ? 71.111  74.910  69.709  1.00 13.32 ? 210  SER B C   1 
ATOM   5315  O  O   . SER B 1 213 ? 70.366  74.013  70.125  1.00 13.77 ? 210  SER B O   1 
ATOM   5316  C  CB  . SER B 1 213 ? 69.305  76.616  69.558  1.00 13.56 ? 210  SER B CB  1 
ATOM   5317  O  OG  . SER B 1 213 ? 69.129  76.373  68.162  1.00 10.88 ? 210  SER B OG  1 
ATOM   5318  N  N   . VAL B 1 214 ? 72.229  74.642  69.043  1.00 14.39 ? 211  VAL B N   1 
ATOM   5319  C  CA  . VAL B 1 214 ? 72.560  73.253  68.668  1.00 14.31 ? 211  VAL B CA  1 
ATOM   5320  C  C   . VAL B 1 214 ? 72.594  72.296  69.870  1.00 13.86 ? 211  VAL B C   1 
ATOM   5321  O  O   . VAL B 1 214 ? 72.209  71.128  69.742  1.00 12.69 ? 211  VAL B O   1 
ATOM   5322  C  CB  . VAL B 1 214 ? 73.874  73.159  67.786  1.00 14.41 ? 211  VAL B CB  1 
ATOM   5323  C  CG1 . VAL B 1 214 ? 75.128  73.548  68.590  1.00 14.07 ? 211  VAL B CG1 1 
ATOM   5324  C  CG2 . VAL B 1 214 ? 74.045  71.753  67.226  1.00 13.67 ? 211  VAL B CG2 1 
ATOM   5325  N  N   . LEU B 1 215 ? 72.995  72.799  71.041  1.00 14.62 ? 212  LEU B N   1 
ATOM   5326  C  CA  . LEU B 1 215 ? 73.100  71.992  72.248  1.00 13.77 ? 212  LEU B CA  1 
ATOM   5327  C  C   . LEU B 1 215 ? 71.822  71.872  73.096  1.00 13.18 ? 212  LEU B C   1 
ATOM   5328  O  O   . LEU B 1 215 ? 71.842  71.262  74.179  1.00 14.22 ? 212  LEU B O   1 
ATOM   5329  C  CB  . LEU B 1 215 ? 74.312  72.439  73.091  1.00 14.16 ? 212  LEU B CB  1 
ATOM   5330  C  CG  . LEU B 1 215 ? 75.644  72.253  72.350  1.00 16.09 ? 212  LEU B CG  1 
ATOM   5331  C  CD1 . LEU B 1 215 ? 76.822  72.718  73.165  1.00 16.52 ? 212  LEU B CD1 1 
ATOM   5332  C  CD2 . LEU B 1 215 ? 75.838  70.789  71.925  1.00 14.39 ? 212  LEU B CD2 1 
ATOM   5333  N  N   . THR B 1 216 ? 70.730  72.470  72.616  1.00 11.18 ? 213  THR B N   1 
ATOM   5334  C  CA  . THR B 1 216 ? 69.415  72.312  73.223  1.00 11.78 ? 213  THR B CA  1 
ATOM   5335  C  C   . THR B 1 216 ? 68.832  71.116  72.439  1.00 12.08 ? 213  THR B C   1 
ATOM   5336  O  O   . THR B 1 216 ? 69.538  70.557  71.565  1.00 12.49 ? 213  THR B O   1 
ATOM   5337  C  CB  . THR B 1 216 ? 68.521  73.562  73.037  1.00 12.12 ? 213  THR B CB  1 
ATOM   5338  O  OG1 . THR B 1 216 ? 68.123  73.678  71.666  1.00 10.36 ? 213  THR B OG1 1 
ATOM   5339  C  CG2 . THR B 1 216 ? 69.265  74.835  73.489  1.00 9.52  ? 213  THR B CG2 1 
ATOM   5340  N  N   . PRO B 1 217 ? 67.564  70.720  72.715  1.00 12.47 ? 214  PRO B N   1 
ATOM   5341  C  CA  . PRO B 1 217 ? 66.964  69.598  71.994  1.00 12.01 ? 214  PRO B CA  1 
ATOM   5342  C  C   . PRO B 1 217 ? 66.955  69.786  70.475  1.00 12.22 ? 214  PRO B C   1 
ATOM   5343  O  O   . PRO B 1 217 ? 66.887  68.808  69.736  1.00 11.15 ? 214  PRO B O   1 
ATOM   5344  C  CB  . PRO B 1 217 ? 65.542  69.541  72.570  1.00 13.06 ? 214  PRO B CB  1 
ATOM   5345  C  CG  . PRO B 1 217 ? 65.705  70.066  73.967  1.00 12.60 ? 214  PRO B CG  1 
ATOM   5346  C  CD  . PRO B 1 217 ? 66.657  71.206  73.776  1.00 12.47 ? 214  PRO B CD  1 
ATOM   5347  N  N   . VAL B 1 218 ? 67.054  71.039  70.024  1.00 12.75 ? 215  VAL B N   1 
ATOM   5348  C  CA  . VAL B 1 218 ? 67.107  71.357  68.598  1.00 11.36 ? 215  VAL B CA  1 
ATOM   5349  C  C   . VAL B 1 218 ? 68.126  70.457  67.873  1.00 12.55 ? 215  VAL B C   1 
ATOM   5350  O  O   . VAL B 1 218 ? 67.844  69.876  66.837  1.00 13.20 ? 215  VAL B O   1 
ATOM   5351  C  CB  . VAL B 1 218 ? 67.518  72.824  68.381  1.00 11.52 ? 215  VAL B CB  1 
ATOM   5352  C  CG1 . VAL B 1 218 ? 67.971  73.049  66.944  1.00 8.72  ? 215  VAL B CG1 1 
ATOM   5353  C  CG2 . VAL B 1 218 ? 66.362  73.777  68.797  1.00 11.55 ? 215  VAL B CG2 1 
ATOM   5354  N  N   . GLY B 1 219 ? 69.327  70.373  68.409  1.00 13.16 ? 216  GLY B N   1 
ATOM   5355  C  CA  . GLY B 1 219 ? 70.335  69.532  67.800  1.00 12.86 ? 216  GLY B CA  1 
ATOM   5356  C  C   . GLY B 1 219 ? 70.377  68.154  68.405  1.00 13.20 ? 216  GLY B C   1 
ATOM   5357  O  O   . GLY B 1 219 ? 70.569  67.172  67.679  1.00 14.16 ? 216  GLY B O   1 
ATOM   5358  N  N   . LEU B 1 220 ? 70.172  68.063  69.724  1.00 12.41 ? 217  LEU B N   1 
ATOM   5359  C  CA  . LEU B 1 220 ? 70.296  66.765  70.427  1.00 12.66 ? 217  LEU B CA  1 
ATOM   5360  C  C   . LEU B 1 220 ? 69.385  65.631  69.957  1.00 13.17 ? 217  LEU B C   1 
ATOM   5361  O  O   . LEU B 1 220 ? 69.850  64.488  69.873  1.00 13.65 ? 217  LEU B O   1 
ATOM   5362  C  CB  . LEU B 1 220 ? 70.163  66.923  71.954  1.00 12.70 ? 217  LEU B CB  1 
ATOM   5363  C  CG  . LEU B 1 220 ? 71.132  67.876  72.670  1.00 13.87 ? 217  LEU B CG  1 
ATOM   5364  C  CD1 . LEU B 1 220 ? 70.912  67.824  74.193  1.00 12.78 ? 217  LEU B CD1 1 
ATOM   5365  C  CD2 . LEU B 1 220 ? 72.578  67.554  72.314  1.00 16.46 ? 217  LEU B CD2 1 
ATOM   5366  N  N   . LEU B 1 221 ? 68.109  65.890  69.664  1.00 12.37 ? 218  LEU B N   1 
ATOM   5367  C  CA  . LEU B 1 221 ? 67.251  64.773  69.236  1.00 12.89 ? 218  LEU B CA  1 
ATOM   5368  C  C   . LEU B 1 221 ? 67.695  64.136  67.894  1.00 11.64 ? 218  LEU B C   1 
ATOM   5369  O  O   . LEU B 1 221 ? 67.899  62.940  67.825  1.00 13.75 ? 218  LEU B O   1 
ATOM   5370  C  CB  . LEU B 1 221 ? 65.747  65.151  69.240  1.00 11.75 ? 218  LEU B CB  1 
ATOM   5371  C  CG  . LEU B 1 221 ? 64.796  64.039  68.813  1.00 12.52 ? 218  LEU B CG  1 
ATOM   5372  C  CD1 . LEU B 1 221 ? 65.002  62.768  69.640  1.00 14.18 ? 218  LEU B CD1 1 
ATOM   5373  C  CD2 . LEU B 1 221 ? 63.308  64.513  68.875  1.00 9.58  ? 218  LEU B CD2 1 
ATOM   5374  N  N   . PRO B 1 222 ? 67.845  64.929  66.829  1.00 13.41 ? 219  PRO B N   1 
ATOM   5375  C  CA  . PRO B 1 222 ? 68.283  64.320  65.560  1.00 13.45 ? 219  PRO B CA  1 
ATOM   5376  C  C   . PRO B 1 222 ? 69.697  63.740  65.620  1.00 14.02 ? 219  PRO B C   1 
ATOM   5377  O  O   . PRO B 1 222 ? 69.985  62.723  64.974  1.00 13.56 ? 219  PRO B O   1 
ATOM   5378  C  CB  . PRO B 1 222 ? 68.234  65.478  64.563  1.00 15.07 ? 219  PRO B CB  1 
ATOM   5379  C  CG  . PRO B 1 222 ? 67.464  66.556  65.212  1.00 15.74 ? 219  PRO B CG  1 
ATOM   5380  C  CD  . PRO B 1 222 ? 67.444  66.336  66.677  1.00 13.17 ? 219  PRO B CD  1 
ATOM   5381  N  N   . ILE B 1 223 ? 70.575  64.386  66.387  1.00 13.46 ? 220  ILE B N   1 
ATOM   5382  C  CA  . ILE B 1 223 ? 71.936  63.906  66.545  1.00 12.98 ? 220  ILE B CA  1 
ATOM   5383  C  C   . ILE B 1 223 ? 71.915  62.500  67.163  1.00 13.59 ? 220  ILE B C   1 
ATOM   5384  O  O   . ILE B 1 223 ? 72.604  61.600  66.694  1.00 12.94 ? 220  ILE B O   1 
ATOM   5385  C  CB  . ILE B 1 223 ? 72.757  64.881  67.414  1.00 12.96 ? 220  ILE B CB  1 
ATOM   5386  C  CG1 . ILE B 1 223 ? 73.071  66.158  66.616  1.00 14.35 ? 220  ILE B CG1 1 
ATOM   5387  C  CG2 . ILE B 1 223 ? 74.065  64.248  67.865  1.00 13.44 ? 220  ILE B CG2 1 
ATOM   5388  C  CD1 . ILE B 1 223 ? 73.733  67.283  67.459  1.00 14.50 ? 220  ILE B CD1 1 
ATOM   5389  N  N   . ALA B 1 224 ? 71.105  62.333  68.209  1.00 11.91 ? 221  ALA B N   1 
ATOM   5390  C  CA  . ALA B 1 224 ? 70.960  61.052  68.906  1.00 12.37 ? 221  ALA B CA  1 
ATOM   5391  C  C   . ALA B 1 224 ? 70.309  59.984  68.017  1.00 11.35 ? 221  ALA B C   1 
ATOM   5392  O  O   . ALA B 1 224 ? 70.662  58.813  68.091  1.00 12.45 ? 221  ALA B O   1 
ATOM   5393  C  CB  . ALA B 1 224 ? 70.150  61.229  70.205  1.00 12.00 ? 221  ALA B CB  1 
ATOM   5394  N  N   . VAL B 1 225 ? 69.338  60.379  67.213  1.00 10.30 ? 222  VAL B N   1 
ATOM   5395  C  CA  . VAL B 1 225 ? 68.692  59.446  66.282  1.00 10.74 ? 222  VAL B CA  1 
ATOM   5396  C  C   . VAL B 1 225 ? 69.708  58.875  65.277  1.00 11.14 ? 222  VAL B C   1 
ATOM   5397  O  O   . VAL B 1 225 ? 69.643  57.699  64.945  1.00 9.98  ? 222  VAL B O   1 
ATOM   5398  C  CB  . VAL B 1 225 ? 67.492  60.097  65.555  1.00 10.87 ? 222  VAL B CB  1 
ATOM   5399  C  CG1 . VAL B 1 225 ? 67.002  59.216  64.387  1.00 13.15 ? 222  VAL B CG1 1 
ATOM   5400  C  CG2 . VAL B 1 225 ? 66.354  60.359  66.571  1.00 8.48  ? 222  VAL B CG2 1 
ATOM   5401  N  N   . SER B 1 226 ? 70.678  59.690  64.851  1.00 12.21 ? 223  SER B N   1 
ATOM   5402  C  CA  . SER B 1 226 ? 71.697  59.230  63.913  1.00 13.15 ? 223  SER B CA  1 
ATOM   5403  C  C   . SER B 1 226 ? 72.721  58.280  64.572  1.00 13.20 ? 223  SER B C   1 
ATOM   5404  O  O   . SER B 1 226 ? 73.678  57.832  63.924  1.00 15.93 ? 223  SER B O   1 
ATOM   5405  C  CB  . SER B 1 226 ? 72.417  60.405  63.269  1.00 14.08 ? 223  SER B CB  1 
ATOM   5406  O  OG  . SER B 1 226 ? 73.292  61.057  64.174  1.00 14.03 ? 223  SER B OG  1 
ATOM   5407  N  N   . GLY B 1 227 ? 72.554  58.026  65.863  1.00 12.79 ? 224  GLY B N   1 
ATOM   5408  C  CA  . GLY B 1 227 ? 73.415  57.092  66.590  1.00 13.04 ? 224  GLY B CA  1 
ATOM   5409  C  C   . GLY B 1 227 ? 74.578  57.686  67.346  1.00 13.04 ? 224  GLY B C   1 
ATOM   5410  O  O   . GLY B 1 227 ? 75.409  56.956  67.856  1.00 13.20 ? 224  GLY B O   1 
ATOM   5411  N  N   . LEU B 1 228 ? 74.624  59.006  67.454  1.00 11.77 ? 225  LEU B N   1 
ATOM   5412  C  CA  . LEU B 1 228 ? 75.719  59.657  68.150  1.00 13.53 ? 225  LEU B CA  1 
ATOM   5413  C  C   . LEU B 1 228 ? 75.433  59.754  69.662  1.00 14.69 ? 225  LEU B C   1 
ATOM   5414  O  O   . LEU B 1 228 ? 74.273  59.802  70.088  1.00 16.23 ? 225  LEU B O   1 
ATOM   5415  C  CB  . LEU B 1 228 ? 75.973  61.037  67.540  1.00 12.63 ? 225  LEU B CB  1 
ATOM   5416  C  CG  . LEU B 1 228 ? 76.310  61.064  66.031  1.00 14.60 ? 225  LEU B CG  1 
ATOM   5417  C  CD1 . LEU B 1 228 ? 76.334  62.518  65.465  1.00 13.93 ? 225  LEU B CD1 1 
ATOM   5418  C  CD2 . LEU B 1 228 ? 77.634  60.354  65.738  1.00 13.66 ? 225  LEU B CD2 1 
ATOM   5419  N  N   . ASN B 1 229 ? 76.505  59.808  70.443  1.00 14.54 ? 226  ASN B N   1 
ATOM   5420  C  CA  . ASN B 1 229 ? 76.456  59.866  71.893  1.00 13.70 ? 226  ASN B CA  1 
ATOM   5421  C  C   . ASN B 1 229 ? 76.338  61.309  72.367  1.00 13.29 ? 226  ASN B C   1 
ATOM   5422  O  O   . ASN B 1 229 ? 77.325  62.037  72.395  1.00 12.61 ? 226  ASN B O   1 
ATOM   5423  C  CB  . ASN B 1 229 ? 77.732  59.208  72.447  1.00 14.50 ? 226  ASN B CB  1 
ATOM   5424  C  CG  . ASN B 1 229 ? 77.707  59.031  73.953  1.00 17.20 ? 226  ASN B CG  1 
ATOM   5425  O  OD1 . ASN B 1 229 ? 77.135  59.842  74.683  1.00 20.05 ? 226  ASN B OD1 1 
ATOM   5426  N  ND2 . ASN B 1 229 ? 78.371  57.975  74.434  1.00 18.59 ? 226  ASN B ND2 1 
ATOM   5427  N  N   . ILE B 1 230 ? 75.131  61.726  72.745  1.00 11.62 ? 227  ILE B N   1 
ATOM   5428  C  CA  . ILE B 1 230 ? 74.937  63.117  73.178  1.00 12.59 ? 227  ILE B CA  1 
ATOM   5429  C  C   . ILE B 1 230 ? 75.521  63.411  74.570  1.00 12.39 ? 227  ILE B C   1 
ATOM   5430  O  O   . ILE B 1 230 ? 75.797  64.569  74.888  1.00 13.43 ? 227  ILE B O   1 
ATOM   5431  C  CB  . ILE B 1 230 ? 73.472  63.592  73.020  1.00 13.11 ? 227  ILE B CB  1 
ATOM   5432  C  CG1 . ILE B 1 230 ? 72.498  62.694  73.792  1.00 14.25 ? 227  ILE B CG1 1 
ATOM   5433  C  CG2 . ILE B 1 230 ? 73.121  63.608  71.533  1.00 10.73 ? 227  ILE B CG2 1 
ATOM   5434  C  CD1 . ILE B 1 230 ? 71.049  63.236  73.850  1.00 15.24 ? 227  ILE B CD1 1 
ATOM   5435  N  N   . GLU B 1 231 ? 75.745  62.376  75.379  1.00 14.00 ? 228  GLU B N   1 
ATOM   5436  C  CA  . GLU B 1 231 ? 76.367  62.574  76.705  1.00 15.09 ? 228  GLU B CA  1 
ATOM   5437  C  C   . GLU B 1 231 ? 77.800  63.083  76.523  1.00 15.08 ? 228  GLU B C   1 
ATOM   5438  O  O   . GLU B 1 231 ? 78.227  64.019  77.198  1.00 13.81 ? 228  GLU B O   1 
ATOM   5439  C  CB  . GLU B 1 231 ? 76.372  61.290  77.536  1.00 15.56 ? 228  GLU B CB  1 
ATOM   5440  C  CG  . GLU B 1 231 ? 74.986  60.785  77.874  1.00 23.84 ? 228  GLU B CG  1 
ATOM   5441  C  CD  . GLU B 1 231 ? 74.994  59.474  78.662  1.00 30.01 ? 228  GLU B CD  1 
ATOM   5442  O  OE1 . GLU B 1 231 ? 76.086  59.024  79.087  1.00 37.76 ? 228  GLU B OE1 1 
ATOM   5443  O  OE2 . GLU B 1 231 ? 73.899  58.900  78.856  1.00 33.63 ? 228  GLU B OE2 1 
ATOM   5444  N  N   . GLU B 1 232 ? 78.535  62.474  75.588  1.00 14.77 ? 229  GLU B N   1 
ATOM   5445  C  CA  . GLU B 1 232 ? 79.925  62.877  75.310  1.00 13.62 ? 229  GLU B CA  1 
ATOM   5446  C  C   . GLU B 1 232 ? 79.979  64.268  74.727  1.00 13.29 ? 229  GLU B C   1 
ATOM   5447  O  O   . GLU B 1 232 ? 80.897  65.045  75.013  1.00 11.11 ? 229  GLU B O   1 
ATOM   5448  C  CB  . GLU B 1 232 ? 80.595  61.886  74.353  1.00 13.22 ? 229  GLU B CB  1 
ATOM   5449  C  CG  . GLU B 1 232 ? 80.920  60.592  75.010  1.00 18.01 ? 229  GLU B CG  1 
ATOM   5450  C  CD  . GLU B 1 232 ? 81.977  60.754  76.112  1.00 22.88 ? 229  GLU B CD  1 
ATOM   5451  O  OE1 . GLU B 1 232 ? 82.953  61.517  75.914  1.00 28.02 ? 229  GLU B OE1 1 
ATOM   5452  O  OE2 . GLU B 1 232 ? 81.844  60.093  77.159  1.00 30.47 ? 229  GLU B OE2 1 
HETATM 5453  N  N   . MSE B 1 233 ? 78.978  64.595  73.919  1.00 12.99 ? 230  MSE B N   1 
HETATM 5454  C  CA  . MSE B 1 233 ? 78.912  65.907  73.322  1.00 12.76 ? 230  MSE B CA  1 
HETATM 5455  C  C   . MSE B 1 233 ? 78.780  67.003  74.361  1.00 13.15 ? 230  MSE B C   1 
HETATM 5456  O  O   . MSE B 1 233 ? 79.436  68.037  74.245  1.00 12.05 ? 230  MSE B O   1 
HETATM 5457  C  CB  . MSE B 1 233 ? 77.768  65.983  72.317  1.00 12.52 ? 230  MSE B CB  1 
HETATM 5458  C  CG  . MSE B 1 233 ? 77.729  67.248  71.529  1.00 12.27 ? 230  MSE B CG  1 
HETATM 5459  SE SE  . MSE B 1 233 ? 76.363  67.134  70.079  1.00 17.19 ? 230  MSE B SE  1 
HETATM 5460  C  CE  . MSE B 1 233 ? 77.264  65.709  69.007  1.00 12.77 ? 230  MSE B CE  1 
HETATM 5461  N  N   . MSE B 1 234 ? 77.926  66.796  75.366  1.00 14.09 ? 231  MSE B N   1 
HETATM 5462  C  CA  . MSE B 1 234 ? 77.758  67.792  76.428  1.00 13.52 ? 231  MSE B CA  1 
HETATM 5463  C  C   . MSE B 1 234 ? 79.041  67.886  77.281  1.00 13.63 ? 231  MSE B C   1 
HETATM 5464  O  O   . MSE B 1 234 ? 79.423  68.972  77.725  1.00 14.90 ? 231  MSE B O   1 
HETATM 5465  C  CB  . MSE B 1 234 ? 76.541  67.467  77.302  1.00 12.64 ? 231  MSE B CB  1 
HETATM 5466  C  CG  . MSE B 1 234 ? 75.225  67.474  76.564  1.00 19.29 ? 231  MSE B CG  1 
HETATM 5467  SE SE  . MSE B 1 234 ? 74.970  69.193  75.688  1.00 28.74 ? 231  MSE B SE  1 
HETATM 5468  C  CE  . MSE B 1 234 ? 75.007  70.257  77.231  1.00 23.58 ? 231  MSE B CE  1 
ATOM   5469  N  N   . LYS B 1 235 ? 79.707  66.755  77.516  1.00 14.04 ? 232  LYS B N   1 
ATOM   5470  C  CA  . LYS B 1 235 ? 80.960  66.760  78.280  1.00 13.83 ? 232  LYS B CA  1 
ATOM   5471  C  C   . LYS B 1 235 ? 82.031  67.584  77.567  1.00 12.65 ? 232  LYS B C   1 
ATOM   5472  O  O   . LYS B 1 235 ? 82.796  68.319  78.211  1.00 12.59 ? 232  LYS B O   1 
ATOM   5473  C  CB  . LYS B 1 235 ? 81.474  65.349  78.534  1.00 15.30 ? 232  LYS B CB  1 
ATOM   5474  C  CG  . LYS B 1 235 ? 80.539  64.531  79.389  1.00 21.39 ? 232  LYS B CG  1 
ATOM   5475  C  CD  . LYS B 1 235 ? 81.100  63.168  79.759  1.00 29.85 ? 232  LYS B CD  1 
ATOM   5476  C  CE  . LYS B 1 235 ? 80.040  62.369  80.552  1.00 34.75 ? 232  LYS B CE  1 
ATOM   5477  N  NZ  . LYS B 1 235 ? 80.533  61.058  81.085  1.00 37.25 ? 232  LYS B NZ  1 
ATOM   5478  N  N   . GLY B 1 236 ? 82.090  67.474  76.242  1.00 12.03 ? 233  GLY B N   1 
ATOM   5479  C  CA  . GLY B 1 236 ? 83.051  68.252  75.467  1.00 11.46 ? 233  GLY B CA  1 
ATOM   5480  C  C   . GLY B 1 236 ? 82.736  69.734  75.567  1.00 10.90 ? 233  GLY B C   1 
ATOM   5481  O  O   . GLY B 1 236 ? 83.626  70.575  75.753  1.00 11.31 ? 233  GLY B O   1 
ATOM   5482  N  N   . ALA B 1 237 ? 81.458  70.054  75.454  1.00 10.66 ? 234  ALA B N   1 
ATOM   5483  C  CA  . ALA B 1 237 ? 80.999  71.437  75.540  1.00 12.48 ? 234  ALA B CA  1 
ATOM   5484  C  C   . ALA B 1 237 ? 81.317  72.036  76.920  1.00 12.53 ? 234  ALA B C   1 
ATOM   5485  O  O   . ALA B 1 237 ? 81.706  73.193  77.019  1.00 13.68 ? 234  ALA B O   1 
ATOM   5486  C  CB  . ALA B 1 237 ? 79.476  71.514  75.228  1.00 11.11 ? 234  ALA B CB  1 
ATOM   5487  N  N   . ALA B 1 238 ? 81.133  71.235  77.965  1.00 13.40 ? 235  ALA B N   1 
ATOM   5488  C  CA  . ALA B 1 238 ? 81.411  71.641  79.343  1.00 13.87 ? 235  ALA B CA  1 
ATOM   5489  C  C   . ALA B 1 238 ? 82.907  71.889  79.541  1.00 13.60 ? 235  ALA B C   1 
ATOM   5490  O  O   . ALA B 1 238 ? 83.287  72.784  80.277  1.00 11.80 ? 235  ALA B O   1 
ATOM   5491  C  CB  . ALA B 1 238 ? 80.906  70.577  80.339  1.00 14.23 ? 235  ALA B CB  1 
ATOM   5492  N  N   . ALA B 1 239 ? 83.755  71.093  78.882  1.00 13.60 ? 236  ALA B N   1 
ATOM   5493  C  CA  . ALA B 1 239 ? 85.186  71.300  78.982  1.00 13.39 ? 236  ALA B CA  1 
ATOM   5494  C  C   . ALA B 1 239 ? 85.513  72.641  78.297  1.00 12.79 ? 236  ALA B C   1 
ATOM   5495  O  O   . ALA B 1 239 ? 86.390  73.372  78.739  1.00 10.52 ? 236  ALA B O   1 
ATOM   5496  C  CB  . ALA B 1 239 ? 85.976  70.132  78.357  1.00 13.21 ? 236  ALA B CB  1 
ATOM   5497  N  N   . GLY B 1 240 ? 84.800  72.956  77.221  1.00 13.54 ? 237  GLY B N   1 
ATOM   5498  C  CA  . GLY B 1 240 ? 84.998  74.220  76.521  1.00 14.40 ? 237  GLY B CA  1 
ATOM   5499  C  C   . GLY B 1 240 ? 84.564  75.355  77.437  1.00 15.24 ? 237  GLY B C   1 
ATOM   5500  O  O   . GLY B 1 240 ? 85.216  76.409  77.502  1.00 16.04 ? 237  GLY B O   1 
ATOM   5501  N  N   A ARG B 1 241 ? 83.452  75.149  78.131  0.50 15.67 ? 238  ARG B N   1 
ATOM   5502  N  N   B ARG B 1 241 ? 83.443  75.150  78.123  0.50 15.50 ? 238  ARG B N   1 
ATOM   5503  C  CA  A ARG B 1 241 ? 82.927  76.145  79.060  0.50 17.09 ? 238  ARG B CA  1 
ATOM   5504  C  CA  B ARG B 1 241 ? 82.936  76.127  79.083  0.50 16.83 ? 238  ARG B CA  1 
ATOM   5505  C  C   A ARG B 1 241 ? 83.996  76.477  80.118  0.50 17.39 ? 238  ARG B C   1 
ATOM   5506  C  C   B ARG B 1 241 ? 84.030  76.479  80.085  0.50 17.21 ? 238  ARG B C   1 
ATOM   5507  O  O   A ARG B 1 241 ? 84.202  77.641  80.463  0.50 17.60 ? 238  ARG B O   1 
ATOM   5508  O  O   B ARG B 1 241 ? 84.288  77.652  80.362  0.50 17.31 ? 238  ARG B O   1 
ATOM   5509  C  CB  A ARG B 1 241 ? 81.626  75.628  79.688  0.50 17.22 ? 238  ARG B CB  1 
ATOM   5510  C  CB  B ARG B 1 241 ? 81.716  75.561  79.821  0.50 16.74 ? 238  ARG B CB  1 
ATOM   5511  C  CG  A ARG B 1 241 ? 80.865  76.630  80.562  0.50 19.41 ? 238  ARG B CG  1 
ATOM   5512  C  CG  B ARG B 1 241 ? 81.306  76.341  81.083  0.50 18.64 ? 238  ARG B CG  1 
ATOM   5513  C  CD  A ARG B 1 241 ? 81.483  76.803  81.937  0.50 21.38 ? 238  ARG B CD  1 
ATOM   5514  C  CD  B ARG B 1 241 ? 81.128  77.820  80.807  0.50 19.56 ? 238  ARG B CD  1 
ATOM   5515  N  NE  A ARG B 1 241 ? 80.780  77.816  82.721  0.50 25.58 ? 238  ARG B NE  1 
ATOM   5516  N  NE  B ARG B 1 241 ? 80.675  78.565  81.984  0.50 20.26 ? 238  ARG B NE  1 
ATOM   5517  C  CZ  A ARG B 1 241 ? 81.202  79.071  82.861  0.50 28.21 ? 238  ARG B CZ  1 
ATOM   5518  C  CZ  B ARG B 1 241 ? 81.484  79.121  82.889  0.50 22.56 ? 238  ARG B CZ  1 
ATOM   5519  N  NH1 A ARG B 1 241 ? 80.503  79.937  83.582  0.50 27.33 ? 238  ARG B NH1 1 
ATOM   5520  N  NH1 B ARG B 1 241 ? 80.970  79.783  83.914  0.50 21.59 ? 238  ARG B NH1 1 
ATOM   5521  N  NH2 A ARG B 1 241 ? 82.336  79.457  82.282  0.50 29.95 ? 238  ARG B NH2 1 
ATOM   5522  N  NH2 B ARG B 1 241 ? 82.806  79.021  82.772  0.50 21.43 ? 238  ARG B NH2 1 
ATOM   5523  N  N   . ASP B 1 242 ? 84.687  75.451  80.605  1.00 17.06 ? 239  ASP B N   1 
ATOM   5524  C  CA  . ASP B 1 242 ? 85.753  75.641  81.574  1.00 17.49 ? 239  ASP B CA  1 
ATOM   5525  C  C   . ASP B 1 242 ? 86.955  76.355  80.915  1.00 17.26 ? 239  ASP B C   1 
ATOM   5526  O  O   . ASP B 1 242 ? 87.348  77.435  81.340  1.00 15.23 ? 239  ASP B O   1 
ATOM   5527  C  CB  . ASP B 1 242 ? 86.199  74.290  82.133  1.00 17.51 ? 239  ASP B CB  1 
ATOM   5528  C  CG  . ASP B 1 242 ? 87.217  74.424  83.273  1.00 22.08 ? 239  ASP B CG  1 
ATOM   5529  O  OD1 . ASP B 1 242 ? 87.433  75.552  83.771  1.00 22.12 ? 239  ASP B OD1 1 
ATOM   5530  O  OD2 . ASP B 1 242 ? 87.781  73.389  83.693  1.00 26.60 ? 239  ASP B OD2 1 
ATOM   5531  N  N   . ASP B 1 243 ? 87.476  75.782  79.832  1.00 16.19 ? 240  ASP B N   1 
ATOM   5532  C  CA  . ASP B 1 243 ? 88.672  76.330  79.167  1.00 16.15 ? 240  ASP B CA  1 
ATOM   5533  C  C   . ASP B 1 243 ? 88.546  77.755  78.615  1.00 16.15 ? 240  ASP B C   1 
ATOM   5534  O  O   . ASP B 1 243 ? 89.549  78.492  78.546  1.00 13.78 ? 240  ASP B O   1 
ATOM   5535  C  CB  . ASP B 1 243 ? 89.139  75.394  78.055  1.00 15.22 ? 240  ASP B CB  1 
ATOM   5536  C  CG  . ASP B 1 243 ? 89.649  74.051  78.592  1.00 19.59 ? 240  ASP B CG  1 
ATOM   5537  O  OD1 . ASP B 1 243 ? 89.902  73.945  79.819  1.00 22.48 ? 240  ASP B OD1 1 
ATOM   5538  O  OD2 . ASP B 1 243 ? 89.817  73.106  77.777  1.00 25.15 ? 240  ASP B OD2 1 
ATOM   5539  N  N   . PHE B 1 244 ? 87.335  78.136  78.214  1.00 15.89 ? 241  PHE B N   1 
ATOM   5540  C  CA  . PHE B 1 244 ? 87.122  79.460  77.667  1.00 15.49 ? 241  PHE B CA  1 
ATOM   5541  C  C   . PHE B 1 244 ? 86.355  80.370  78.653  1.00 16.37 ? 241  PHE B C   1 
ATOM   5542  O  O   . PHE B 1 244 ? 85.768  81.385  78.252  1.00 17.65 ? 241  PHE B O   1 
ATOM   5543  C  CB  . PHE B 1 244 ? 86.422  79.350  76.301  1.00 14.99 ? 241  PHE B CB  1 
ATOM   5544  C  CG  . PHE B 1 244 ? 87.051  78.314  75.385  1.00 16.52 ? 241  PHE B CG  1 
ATOM   5545  C  CD1 . PHE B 1 244 ? 88.404  78.384  75.066  1.00 14.36 ? 241  PHE B CD1 1 
ATOM   5546  C  CD2 . PHE B 1 244 ? 86.289  77.277  74.844  1.00 15.74 ? 241  PHE B CD2 1 
ATOM   5547  C  CE1 . PHE B 1 244 ? 89.000  77.419  74.250  1.00 17.70 ? 241  PHE B CE1 1 
ATOM   5548  C  CE2 . PHE B 1 244 ? 86.867  76.308  74.013  1.00 13.61 ? 241  PHE B CE2 1 
ATOM   5549  C  CZ  . PHE B 1 244 ? 88.226  76.378  73.716  1.00 17.85 ? 241  PHE B CZ  1 
ATOM   5550  N  N   . GLY B 1 245 ? 86.405  80.030  79.942  1.00 15.12 ? 242  GLY B N   1 
ATOM   5551  C  CA  . GLY B 1 245 ? 85.715  80.804  80.984  1.00 16.31 ? 242  GLY B CA  1 
ATOM   5552  C  C   . GLY B 1 245 ? 86.606  81.752  81.766  1.00 16.23 ? 242  GLY B C   1 
ATOM   5553  O  O   . GLY B 1 245 ? 86.171  82.359  82.728  1.00 16.42 ? 242  GLY B O   1 
ATOM   5554  N  N   . THR B 1 246 ? 87.863  81.868  81.342  1.00 15.72 ? 243  THR B N   1 
ATOM   5555  C  CA  . THR B 1 246 ? 88.836  82.740  81.971  1.00 16.53 ? 243  THR B CA  1 
ATOM   5556  C  C   . THR B 1 246 ? 88.870  84.098  81.284  1.00 15.58 ? 243  THR B C   1 
ATOM   5557  O  O   . THR B 1 246 ? 88.686  84.193  80.063  1.00 14.46 ? 243  THR B O   1 
ATOM   5558  C  CB  . THR B 1 246 ? 90.248  82.093  81.892  1.00 17.99 ? 243  THR B CB  1 
ATOM   5559  O  OG1 . THR B 1 246 ? 91.220  83.048  82.276  1.00 18.92 ? 243  THR B OG1 1 
ATOM   5560  C  CG2 . THR B 1 246 ? 90.545  81.637  80.469  1.00 18.05 ? 243  THR B CG2 1 
ATOM   5561  N  N   . SER B 1 247 ? 89.121  85.152  82.049  1.00 15.73 ? 244  SER B N   1 
ATOM   5562  C  CA  . SER B 1 247 ? 89.153  86.503  81.488  1.00 16.88 ? 244  SER B CA  1 
ATOM   5563  C  C   . SER B 1 247 ? 90.521  86.881  80.943  1.00 17.50 ? 244  SER B C   1 
ATOM   5564  O  O   . SER B 1 247 ? 90.668  87.948  80.348  1.00 18.41 ? 244  SER B O   1 
ATOM   5565  C  CB  . SER B 1 247 ? 88.766  87.546  82.557  1.00 18.11 ? 244  SER B CB  1 
ATOM   5566  O  OG  . SER B 1 247 ? 89.753  87.631  83.590  1.00 18.01 ? 244  SER B OG  1 
ATOM   5567  N  N   . GLU B 1 248 ? 91.522  86.028  81.162  1.00 17.33 ? 245  GLU B N   1 
ATOM   5568  C  CA  . GLU B 1 248 ? 92.881  86.321  80.710  1.00 17.74 ? 245  GLU B CA  1 
ATOM   5569  C  C   . GLU B 1 248 ? 93.072  85.882  79.261  1.00 16.24 ? 245  GLU B C   1 
ATOM   5570  O  O   . GLU B 1 248 ? 92.983  84.694  78.914  1.00 14.95 ? 245  GLU B O   1 
ATOM   5571  C  CB  . GLU B 1 248 ? 93.907  85.686  81.640  1.00 18.36 ? 245  GLU B CB  1 
ATOM   5572  C  CG  . GLU B 1 248 ? 93.720  86.106  83.094  1.00 23.26 ? 245  GLU B CG  1 
ATOM   5573  C  CD  . GLU B 1 248 ? 93.849  87.617  83.285  1.00 31.64 ? 245  GLU B CD  1 
ATOM   5574  O  OE1 . GLU B 1 248 ? 94.847  88.184  82.779  1.00 31.06 ? 245  GLU B OE1 1 
ATOM   5575  O  OE2 . GLU B 1 248 ? 92.963  88.227  83.956  1.00 36.30 ? 245  GLU B OE2 1 
ATOM   5576  N  N   . LEU B 1 249 ? 93.343  86.870  78.427  1.00 14.67 ? 246  LEU B N   1 
ATOM   5577  C  CA  . LEU B 1 249 ? 93.495  86.675  76.997  1.00 14.37 ? 246  LEU B CA  1 
ATOM   5578  C  C   . LEU B 1 249 ? 94.473  85.549  76.620  1.00 13.68 ? 246  LEU B C   1 
ATOM   5579  O  O   . LEU B 1 249 ? 94.128  84.680  75.799  1.00 11.66 ? 246  LEU B O   1 
ATOM   5580  C  CB  . LEU B 1 249 ? 93.868  88.014  76.347  1.00 14.42 ? 246  LEU B CB  1 
ATOM   5581  C  CG  . LEU B 1 249 ? 93.910  88.193  74.836  1.00 12.85 ? 246  LEU B CG  1 
ATOM   5582  C  CD1 . LEU B 1 249 ? 92.659  87.622  74.115  1.00 6.74  ? 246  LEU B CD1 1 
ATOM   5583  C  CD2 . LEU B 1 249 ? 94.082  89.687  74.548  1.00 13.47 ? 246  LEU B CD2 1 
ATOM   5584  N  N   . GLU B 1 250 ? 95.655  85.509  77.241  1.00 12.85 ? 247  GLU B N   1 
ATOM   5585  C  CA  . GLU B 1 250 ? 96.630  84.465  76.888  1.00 13.78 ? 247  GLU B CA  1 
ATOM   5586  C  C   . GLU B 1 250 ? 96.210  83.063  77.365  1.00 13.41 ? 247  GLU B C   1 
ATOM   5587  O  O   . GLU B 1 250 ? 96.821  82.065  76.999  1.00 14.74 ? 247  GLU B O   1 
ATOM   5588  C  CB  . GLU B 1 250 ? 98.063  84.824  77.348  1.00 15.33 ? 247  GLU B CB  1 
ATOM   5589  C  CG  . GLU B 1 250 ? 98.390  84.706  78.838  1.00 18.97 ? 247  GLU B CG  1 
ATOM   5590  C  CD  . GLU B 1 250 ? 97.720  85.740  79.741  1.00 25.02 ? 247  GLU B CD  1 
ATOM   5591  O  OE1 . GLU B 1 250 ? 96.970  86.598  79.231  1.00 24.56 ? 247  GLU B OE1 1 
ATOM   5592  O  OE2 . GLU B 1 250 ? 97.975  85.696  80.976  1.00 25.94 ? 247  GLU B OE2 1 
ATOM   5593  N  N   . GLU B 1 251 ? 95.172  82.983  78.186  1.00 11.53 ? 248  GLU B N   1 
ATOM   5594  C  CA  . GLU B 1 251 ? 94.678  81.690  78.648  1.00 12.35 ? 248  GLU B CA  1 
ATOM   5595  C  C   . GLU B 1 251 ? 93.403  81.302  77.955  1.00 11.32 ? 248  GLU B C   1 
ATOM   5596  O  O   . GLU B 1 251 ? 92.861  80.233  78.225  1.00 9.08  ? 248  GLU B O   1 
ATOM   5597  C  CB  . GLU B 1 251 ? 94.362  81.729  80.136  1.00 13.52 ? 248  GLU B CB  1 
ATOM   5598  C  CG  . GLU B 1 251 ? 95.555  81.680  81.007  1.00 21.45 ? 248  GLU B CG  1 
ATOM   5599  C  CD  . GLU B 1 251 ? 96.488  82.815  80.803  1.00 32.33 ? 248  GLU B CD  1 
ATOM   5600  O  OE1 . GLU B 1 251 ? 96.031  83.875  80.315  1.00 41.97 ? 248  GLU B OE1 1 
ATOM   5601  O  OE2 . GLU B 1 251 ? 97.685  82.660  81.168  1.00 45.04 ? 248  GLU B OE2 1 
ATOM   5602  N  N   . ASN B 1 252 ? 92.916  82.165  77.063  1.00 9.64  ? 249  ASN B N   1 
ATOM   5603  C  CA  . ASN B 1 252 ? 91.632  81.907  76.422  1.00 9.79  ? 249  ASN B CA  1 
ATOM   5604  C  C   . ASN B 1 252 ? 91.700  81.896  74.900  1.00 9.62  ? 249  ASN B C   1 
ATOM   5605  O  O   . ASN B 1 252 ? 91.622  82.957  74.276  1.00 10.35 ? 249  ASN B O   1 
ATOM   5606  C  CB  . ASN B 1 252 ? 90.590  82.928  76.937  1.00 8.73  ? 249  ASN B CB  1 
ATOM   5607  C  CG  . ASN B 1 252 ? 89.180  82.534  76.575  1.00 11.38 ? 249  ASN B CG  1 
ATOM   5608  O  OD1 . ASN B 1 252 ? 88.950  81.999  75.497  1.00 10.10 ? 249  ASN B OD1 1 
ATOM   5609  N  ND2 . ASN B 1 252 ? 88.223  82.778  77.486  1.00 9.09  ? 249  ASN B ND2 1 
ATOM   5610  N  N   . PRO B 1 253 ? 91.828  80.688  74.301  1.00 9.52  ? 250  PRO B N   1 
ATOM   5611  C  CA  . PRO B 1 253 ? 91.925  80.544  72.835  1.00 11.37 ? 250  PRO B CA  1 
ATOM   5612  C  C   . PRO B 1 253 ? 90.779  81.185  72.081  1.00 11.28 ? 250  PRO B C   1 
ATOM   5613  O  O   . PRO B 1 253 ? 91.001  81.772  71.000  1.00 11.59 ? 250  PRO B O   1 
ATOM   5614  C  CB  . PRO B 1 253 ? 91.933  79.025  72.626  1.00 11.27 ? 250  PRO B CB  1 
ATOM   5615  C  CG  . PRO B 1 253 ? 92.662  78.494  73.864  1.00 12.46 ? 250  PRO B CG  1 
ATOM   5616  C  CD  . PRO B 1 253 ? 92.236  79.453  74.999  1.00 11.00 ? 250  PRO B CD  1 
ATOM   5617  N  N   . ALA B 1 254 ? 89.568  81.063  72.634  1.00 10.04 ? 251  ALA B N   1 
ATOM   5618  C  CA  . ALA B 1 254 ? 88.381  81.642  72.008  1.00 10.66 ? 251  ALA B CA  1 
ATOM   5619  C  C   . ALA B 1 254 ? 88.513  83.154  71.894  1.00 10.47 ? 251  ALA B C   1 
ATOM   5620  O  O   . ALA B 1 254 ? 88.222  83.733  70.849  1.00 11.90 ? 251  ALA B O   1 
ATOM   5621  C  CB  . ALA B 1 254 ? 87.107  81.272  72.805  1.00 9.14  ? 251  ALA B CB  1 
ATOM   5622  N  N   . TYR B 1 255 ? 88.970  83.799  72.957  1.00 10.72 ? 252  TYR B N   1 
ATOM   5623  C  CA  . TYR B 1 255 ? 89.125  85.250  72.928  1.00 10.03 ? 252  TYR B CA  1 
ATOM   5624  C  C   . TYR B 1 255 ? 90.298  85.700  72.045  1.00 10.58 ? 252  TYR B C   1 
ATOM   5625  O  O   . TYR B 1 255 ? 90.274  86.805  71.501  1.00 8.03  ? 252  TYR B O   1 
ATOM   5626  C  CB  . TYR B 1 255 ? 89.281  85.826  74.313  1.00 9.98  ? 252  TYR B CB  1 
ATOM   5627  C  CG  . TYR B 1 255 ? 88.121  85.596  75.271  1.00 11.18 ? 252  TYR B CG  1 
ATOM   5628  C  CD1 . TYR B 1 255 ? 86.838  85.282  74.808  1.00 11.28 ? 252  TYR B CD1 1 
ATOM   5629  C  CD2 . TYR B 1 255 ? 88.268  85.880  76.623  1.00 9.34  ? 252  TYR B CD2 1 
ATOM   5630  C  CE1 . TYR B 1 255 ? 85.778  85.122  75.691  1.00 12.64 ? 252  TYR B CE1 1 
ATOM   5631  C  CE2 . TYR B 1 255 ? 87.199  85.765  77.510  1.00 12.20 ? 252  TYR B CE2 1 
ATOM   5632  C  CZ  . TYR B 1 255 ? 85.962  85.386  77.037  1.00 12.46 ? 252  TYR B CZ  1 
ATOM   5633  O  OH  . TYR B 1 255 ? 84.902  85.263  77.916  1.00 14.32 ? 252  TYR B OH  1 
ATOM   5634  N  N   . GLN B 1 256 ? 91.343  84.874  71.962  1.00 10.18 ? 253  GLN B N   1 
ATOM   5635  C  CA  . GLN B 1 256 ? 92.475  85.171  71.081  1.00 9.92  ? 253  GLN B CA  1 
ATOM   5636  C  C   . GLN B 1 256 ? 91.959  85.198  69.650  1.00 9.48  ? 253  GLN B C   1 
ATOM   5637  O  O   . GLN B 1 256 ? 92.296  86.095  68.888  1.00 11.77 ? 253  GLN B O   1 
ATOM   5638  C  CB  . GLN B 1 256 ? 93.568  84.134  71.209  1.00 9.35  ? 253  GLN B CB  1 
ATOM   5639  C  CG  . GLN B 1 256 ? 94.306  84.131  72.569  1.00 11.26 ? 253  GLN B CG  1 
ATOM   5640  C  CD  . GLN B 1 256 ? 95.101  82.839  72.778  1.00 17.96 ? 253  GLN B CD  1 
ATOM   5641  O  OE1 . GLN B 1 256 ? 95.508  82.193  71.821  1.00 21.45 ? 253  GLN B OE1 1 
ATOM   5642  N  NE2 . GLN B 1 256 ? 95.273  82.440  74.033  1.00 21.68 ? 253  GLN B NE2 1 
ATOM   5643  N  N   . TYR B 1 257 ? 91.144  84.218  69.278  1.00 9.66  ? 254  TYR B N   1 
ATOM   5644  C  CA  . TYR B 1 257 ? 90.579  84.201  67.917  1.00 10.52 ? 254  TYR B CA  1 
ATOM   5645  C  C   . TYR B 1 257 ? 89.774  85.473  67.669  1.00 10.61 ? 254  TYR B C   1 
ATOM   5646  O  O   . TYR B 1 257 ? 89.925  86.141  66.629  1.00 10.26 ? 254  TYR B O   1 
ATOM   5647  C  CB  . TYR B 1 257 ? 89.746  82.936  67.719  1.00 10.69 ? 254  TYR B CB  1 
ATOM   5648  C  CG  . TYR B 1 257 ? 88.960  82.844  66.413  1.00 9.37  ? 254  TYR B CG  1 
ATOM   5649  C  CD1 . TYR B 1 257 ? 89.583  82.993  65.186  1.00 11.65 ? 254  TYR B CD1 1 
ATOM   5650  C  CD2 . TYR B 1 257 ? 87.629  82.455  66.416  1.00 14.09 ? 254  TYR B CD2 1 
ATOM   5651  C  CE1 . TYR B 1 257 ? 88.851  82.857  63.962  1.00 10.99 ? 254  TYR B CE1 1 
ATOM   5652  C  CE2 . TYR B 1 257 ? 86.902  82.301  65.228  1.00 12.10 ? 254  TYR B CE2 1 
ATOM   5653  C  CZ  . TYR B 1 257 ? 87.524  82.493  64.008  1.00 12.64 ? 254  TYR B CZ  1 
ATOM   5654  O  OH  . TYR B 1 257 ? 86.806  82.334  62.829  1.00 15.37 ? 254  TYR B OH  1 
ATOM   5655  N  N   . ALA B 1 258 ? 88.905  85.818  68.619  1.00 10.74 ? 255  ALA B N   1 
ATOM   5656  C  CA  . ALA B 1 258 ? 88.092  87.047  68.499  1.00 10.36 ? 255  ALA B CA  1 
ATOM   5657  C  C   . ALA B 1 258 ? 88.944  88.291  68.314  1.00 9.96  ? 255  ALA B C   1 
ATOM   5658  O  O   . ALA B 1 258 ? 88.664  89.114  67.435  1.00 10.51 ? 255  ALA B O   1 
ATOM   5659  C  CB  . ALA B 1 258 ? 87.161  87.216  69.734  1.00 9.63  ? 255  ALA B CB  1 
ATOM   5660  N  N   . VAL B 1 259 ? 89.980  88.440  69.144  1.00 10.05 ? 256  VAL B N   1 
ATOM   5661  C  CA  . VAL B 1 259 ? 90.873  89.595  69.058  1.00 11.30 ? 256  VAL B CA  1 
ATOM   5662  C  C   . VAL B 1 259 ? 91.616  89.626  67.702  1.00 11.18 ? 256  VAL B C   1 
ATOM   5663  O  O   . VAL B 1 259 ? 91.699  90.685  67.057  1.00 10.47 ? 256  VAL B O   1 
ATOM   5664  C  CB  . VAL B 1 259 ? 91.889  89.637  70.244  1.00 11.39 ? 256  VAL B CB  1 
ATOM   5665  C  CG1 . VAL B 1 259 ? 92.967  90.674  69.997  1.00 13.47 ? 256  VAL B CG1 1 
ATOM   5666  C  CG2 . VAL B 1 259 ? 91.158  89.913  71.574  1.00 11.00 ? 256  VAL B CG2 1 
ATOM   5667  N  N   . VAL B 1 260 ? 92.133  88.476  67.268  1.00 10.97 ? 257  VAL B N   1 
ATOM   5668  C  CA  . VAL B 1 260 ? 92.863  88.400  65.979  1.00 11.32 ? 257  VAL B CA  1 
ATOM   5669  C  C   . VAL B 1 260 ? 91.975  88.796  64.787  1.00 11.30 ? 257  VAL B C   1 
ATOM   5670  O  O   . VAL B 1 260 ? 92.406  89.588  63.953  1.00 11.84 ? 257  VAL B O   1 
ATOM   5671  C  CB  . VAL B 1 260 ? 93.547  87.039  65.770  1.00 12.40 ? 257  VAL B CB  1 
ATOM   5672  C  CG1 . VAL B 1 260 ? 94.068  86.902  64.334  1.00 12.27 ? 257  VAL B CG1 1 
ATOM   5673  C  CG2 . VAL B 1 260 ? 94.712  86.888  66.770  1.00 12.91 ? 257  VAL B CG2 1 
ATOM   5674  N  N   . ARG B 1 261 ? 90.739  88.277  64.738  1.00 11.18 ? 258  ARG B N   1 
ATOM   5675  C  CA  . ARG B 1 261 ? 89.778  88.613  63.674  1.00 12.70 ? 258  ARG B CA  1 
ATOM   5676  C  C   . ARG B 1 261 ? 89.571  90.103  63.601  1.00 12.08 ? 258  ARG B C   1 
ATOM   5677  O  O   . ARG B 1 261 ? 89.627  90.670  62.546  1.00 12.56 ? 258  ARG B O   1 
ATOM   5678  C  CB  . ARG B 1 261 ? 88.370  88.031  63.948  1.00 13.05 ? 258  ARG B CB  1 
ATOM   5679  C  CG  . ARG B 1 261 ? 88.314  86.589  63.984  1.00 15.85 ? 258  ARG B CG  1 
ATOM   5680  C  CD  . ARG B 1 261 ? 86.905  86.087  64.247  1.00 12.60 ? 258  ARG B CD  1 
ATOM   5681  N  NE  . ARG B 1 261 ? 86.112  86.072  63.047  1.00 11.37 ? 258  ARG B NE  1 
ATOM   5682  C  CZ  . ARG B 1 261 ? 85.060  86.837  62.778  1.00 11.97 ? 258  ARG B CZ  1 
ATOM   5683  N  NH1 . ARG B 1 261 ? 84.584  87.711  63.660  1.00 13.36 ? 258  ARG B NH1 1 
ATOM   5684  N  NH2 . ARG B 1 261 ? 84.445  86.674  61.617  1.00 13.34 ? 258  ARG B NH2 1 
ATOM   5685  N  N   A ASN B 1 262 ? 89.305  90.725  64.743  0.50 12.49 ? 259  ASN B N   1 
ATOM   5686  N  N   B ASN B 1 262 ? 89.344  90.713  64.762  0.50 13.65 ? 259  ASN B N   1 
ATOM   5687  C  CA  A ASN B 1 262 ? 89.087  92.170  64.799  0.50 11.73 ? 259  ASN B CA  1 
ATOM   5688  C  CA  B ASN B 1 262 ? 89.108  92.149  64.874  0.50 13.86 ? 259  ASN B CA  1 
ATOM   5689  C  C   A ASN B 1 262 ? 90.321  92.997  64.391  0.50 12.16 ? 259  ASN B C   1 
ATOM   5690  C  C   B ASN B 1 262 ? 90.312  92.963  64.377  0.50 13.37 ? 259  ASN B C   1 
ATOM   5691  O  O   A ASN B 1 262 ? 90.178  94.035  63.736  0.50 11.05 ? 259  ASN B O   1 
ATOM   5692  O  O   B ASN B 1 262 ? 90.146  93.946  63.648  0.50 12.36 ? 259  ASN B O   1 
ATOM   5693  C  CB  A ASN B 1 262 ? 88.536  92.567  66.171  0.50 11.30 ? 259  ASN B CB  1 
ATOM   5694  C  CB  B ASN B 1 262 ? 88.799  92.514  66.331  0.50 14.80 ? 259  ASN B CB  1 
ATOM   5695  C  CG  A ASN B 1 262 ? 87.025  92.400  66.261  0.50 9.09  ? 259  ASN B CG  1 
ATOM   5696  C  CG  B ASN B 1 262 ? 88.289  93.935  66.487  0.50 16.86 ? 259  ASN B CG  1 
ATOM   5697  O  OD1 A ASN B 1 262 ? 86.284  93.284  65.857  0.50 6.63  ? 259  ASN B OD1 1 
ATOM   5698  O  OD1 B ASN B 1 262 ? 87.295  94.319  65.868  0.50 26.45 ? 259  ASN B OD1 1 
ATOM   5699  N  ND2 A ASN B 1 262 ? 86.573  91.313  66.851  0.50 7.42  ? 259  ASN B ND2 1 
ATOM   5700  N  ND2 B ASN B 1 262 ? 88.927  94.704  67.357  0.50 20.95 ? 259  ASN B ND2 1 
ATOM   5701  N  N   . ALA B 1 263 ? 91.520  92.558  64.781  1.00 11.63 ? 260  ALA B N   1 
ATOM   5702  C  CA  . ALA B 1 263 ? 92.730  93.250  64.366  1.00 11.93 ? 260  ALA B CA  1 
ATOM   5703  C  C   . ALA B 1 263 ? 92.836  93.172  62.832  1.00 11.59 ? 260  ALA B C   1 
ATOM   5704  O  O   . ALA B 1 263 ? 93.085  94.187  62.155  1.00 10.75 ? 260  ALA B O   1 
ATOM   5705  C  CB  . ALA B 1 263 ? 94.008  92.642  65.042  1.00 11.53 ? 260  ALA B CB  1 
ATOM   5706  N  N   . LEU B 1 264 ? 92.638  91.973  62.287  1.00 10.83 ? 261  LEU B N   1 
ATOM   5707  C  CA  . LEU B 1 264 ? 92.700  91.776  60.831  1.00 10.25 ? 261  LEU B CA  1 
ATOM   5708  C  C   . LEU B 1 264 ? 91.626  92.592  60.099  1.00 11.65 ? 261  LEU B C   1 
ATOM   5709  O  O   . LEU B 1 264 ? 91.890  93.166  59.033  1.00 12.32 ? 261  LEU B O   1 
ATOM   5710  C  CB  . LEU B 1 264 ? 92.629  90.276  60.474  1.00 11.50 ? 261  LEU B CB  1 
ATOM   5711  C  CG  . LEU B 1 264 ? 93.845  89.447  60.908  1.00 10.21 ? 261  LEU B CG  1 
ATOM   5712  C  CD1 . LEU B 1 264 ? 93.620  87.964  60.595  1.00 8.99  ? 261  LEU B CD1 1 
ATOM   5713  C  CD2 . LEU B 1 264 ? 95.124  89.973  60.252  1.00 7.12  ? 261  LEU B CD2 1 
ATOM   5714  N  N   . TYR B 1 265 ? 90.429  92.672  60.679  1.00 11.33 ? 262  TYR B N   1 
ATOM   5715  C  CA  . TYR B 1 265 ? 89.357  93.467  60.105  1.00 11.86 ? 262  TYR B CA  1 
ATOM   5716  C  C   . TYR B 1 265 ? 89.797  94.933  60.008  1.00 11.84 ? 262  TYR B C   1 
ATOM   5717  O  O   . TYR B 1 265 ? 89.580  95.579  58.982  1.00 11.39 ? 262  TYR B O   1 
ATOM   5718  C  CB  . TYR B 1 265 ? 88.094  93.325  60.951  1.00 12.95 ? 262  TYR B CB  1 
ATOM   5719  C  CG  . TYR B 1 265 ? 86.906  94.114  60.469  1.00 13.55 ? 262  TYR B CG  1 
ATOM   5720  C  CD1 . TYR B 1 265 ? 86.166  93.681  59.362  1.00 12.55 ? 262  TYR B CD1 1 
ATOM   5721  C  CD2 . TYR B 1 265 ? 86.472  95.259  61.157  1.00 12.78 ? 262  TYR B CD2 1 
ATOM   5722  C  CE1 . TYR B 1 265 ? 85.036  94.367  58.928  1.00 13.95 ? 262  TYR B CE1 1 
ATOM   5723  C  CE2 . TYR B 1 265 ? 85.321  95.963  60.732  1.00 10.93 ? 262  TYR B CE2 1 
ATOM   5724  C  CZ  . TYR B 1 265 ? 84.612  95.506  59.615  1.00 14.38 ? 262  TYR B CZ  1 
ATOM   5725  O  OH  . TYR B 1 265 ? 83.507  96.189  59.170  1.00 10.29 ? 262  TYR B OH  1 
ATOM   5726  N  N   . ASN B 1 266 ? 90.477  95.422  61.044  1.00 11.35 ? 263  ASN B N   1 
ATOM   5727  C  CA  . ASN B 1 266 ? 90.991  96.793  61.063  1.00 11.95 ? 263  ASN B CA  1 
ATOM   5728  C  C   . ASN B 1 266 ? 92.109  97.094  60.040  1.00 11.17 ? 263  ASN B C   1 
ATOM   5729  O  O   . ASN B 1 266 ? 92.357  98.259  59.715  1.00 11.26 ? 263  ASN B O   1 
ATOM   5730  C  CB  . ASN B 1 266 ? 91.440  97.169  62.466  1.00 11.65 ? 263  ASN B CB  1 
ATOM   5731  C  CG  . ASN B 1 266 ? 90.267  97.461  63.398  1.00 16.38 ? 263  ASN B CG  1 
ATOM   5732  O  OD1 . ASN B 1 266 ? 89.247  98.016  62.981  1.00 22.60 ? 263  ASN B OD1 1 
ATOM   5733  N  ND2 . ASN B 1 266 ? 90.436  97.149  64.664  1.00 12.27 ? 263  ASN B ND2 1 
ATOM   5734  N  N   . LYS B 1 267 ? 92.783  96.059  59.564  1.00 10.83 ? 264  LYS B N   1 
ATOM   5735  C  CA  . LYS B 1 267 ? 93.833  96.194  58.550  1.00 12.06 ? 264  LYS B CA  1 
ATOM   5736  C  C   . LYS B 1 267 ? 93.223  96.156  57.140  1.00 12.87 ? 264  LYS B C   1 
ATOM   5737  O  O   . LYS B 1 267 ? 93.929  96.340  56.140  1.00 14.74 ? 264  LYS B O   1 
ATOM   5738  C  CB  . LYS B 1 267 ? 94.835  95.022  58.652  1.00 13.39 ? 264  LYS B CB  1 
ATOM   5739  C  CG  . LYS B 1 267 ? 95.663  94.957  59.931  1.00 12.19 ? 264  LYS B CG  1 
ATOM   5740  C  CD  . LYS B 1 267 ? 96.497  93.675  59.973  1.00 11.78 ? 264  LYS B CD  1 
ATOM   5741  C  CE  . LYS B 1 267 ? 97.305  93.551  61.233  1.00 12.31 ? 264  LYS B CE  1 
ATOM   5742  N  NZ  . LYS B 1 267 ? 98.469  94.482  61.281  1.00 12.06 ? 264  LYS B NZ  1 
ATOM   5743  N  N   . GLY B 1 268 ? 91.923  95.898  57.051  1.00 13.45 ? 265  GLY B N   1 
ATOM   5744  C  CA  . GLY B 1 268 ? 91.249  95.823  55.744  1.00 14.72 ? 265  GLY B CA  1 
ATOM   5745  C  C   . GLY B 1 268 ? 90.974  94.395  55.261  1.00 14.82 ? 265  GLY B C   1 
ATOM   5746  O  O   . GLY B 1 268 ? 90.690  94.171  54.071  1.00 15.13 ? 265  GLY B O   1 
ATOM   5747  N  N   . LYS B 1 269 ? 91.116  93.414  56.137  1.00 14.62 ? 266  LYS B N   1 
ATOM   5748  C  CA  . LYS B 1 269 ? 90.807  92.032  55.743  1.00 15.47 ? 266  LYS B CA  1 
ATOM   5749  C  C   . LYS B 1 269 ? 89.343  91.883  56.109  1.00 15.78 ? 266  LYS B C   1 
ATOM   5750  O  O   . LYS B 1 269 ? 89.003  91.589  57.261  1.00 17.15 ? 266  LYS B O   1 
ATOM   5751  C  CB  . LYS B 1 269 ? 91.662  91.003  56.449  1.00 15.80 ? 266  LYS B CB  1 
ATOM   5752  C  CG  . LYS B 1 269 ? 93.156  91.177  56.261  1.00 16.34 ? 266  LYS B CG  1 
ATOM   5753  C  CD  . LYS B 1 269 ? 93.562  91.376  54.819  1.00 15.52 ? 266  LYS B CD  1 
ATOM   5754  C  CE  . LYS B 1 269 ? 95.062  91.483  54.730  1.00 16.55 ? 266  LYS B CE  1 
ATOM   5755  N  NZ  . LYS B 1 269 ? 95.508  91.931  53.418  1.00 14.35 ? 266  LYS B NZ  1 
ATOM   5756  N  N   . THR B 1 270 ? 88.482  92.088  55.118  1.00 13.07 ? 267  THR B N   1 
ATOM   5757  C  CA  . THR B 1 270 ? 87.047  92.105  55.352  1.00 14.24 ? 267  THR B CA  1 
ATOM   5758  C  C   . THR B 1 270 ? 86.293  90.820  54.979  1.00 12.56 ? 267  THR B C   1 
ATOM   5759  O  O   . THR B 1 270 ? 85.082  90.738  55.151  1.00 12.92 ? 267  THR B O   1 
ATOM   5760  C  CB  . THR B 1 270 ? 86.456  93.308  54.653  1.00 14.41 ? 267  THR B CB  1 
ATOM   5761  O  OG1 . THR B 1 270 ? 86.900  93.310  53.301  1.00 16.73 ? 267  THR B OG1 1 
ATOM   5762  C  CG2 . THR B 1 270 ? 86.936  94.598  55.346  1.00 17.20 ? 267  THR B CG2 1 
ATOM   5763  N  N   . ILE B 1 271 ? 87.022  89.825  54.495  1.00 11.43 ? 268  ILE B N   1 
ATOM   5764  C  CA  . ILE B 1 271 ? 86.442  88.521  54.185  1.00 12.09 ? 268  ILE B CA  1 
ATOM   5765  C  C   . ILE B 1 271 ? 87.223  87.438  54.931  1.00 12.54 ? 268  ILE B C   1 
ATOM   5766  O  O   . ILE B 1 271 ? 88.460  87.375  54.843  1.00 13.50 ? 268  ILE B O   1 
ATOM   5767  C  CB  . ILE B 1 271 ? 86.543  88.206  52.683  1.00 12.67 ? 268  ILE B CB  1 
ATOM   5768  C  CG1 . ILE B 1 271 ? 85.749  89.227  51.861  1.00 12.83 ? 268  ILE B CG1 1 
ATOM   5769  C  CG2 . ILE B 1 271 ? 86.075  86.735  52.395  1.00 14.22 ? 268  ILE B CG2 1 
ATOM   5770  C  CD1 . ILE B 1 271 ? 86.113  89.217  50.323  1.00 11.29 ? 268  ILE B CD1 1 
ATOM   5771  N  N   . GLU B 1 272 ? 86.525  86.598  55.676  1.00 12.44 ? 269  GLU B N   1 
ATOM   5772  C  CA  . GLU B 1 272 ? 87.174  85.476  56.329  1.00 12.53 ? 269  GLU B CA  1 
ATOM   5773  C  C   . GLU B 1 272 ? 86.677  84.216  55.670  1.00 12.85 ? 269  GLU B C   1 
ATOM   5774  O  O   . GLU B 1 272 ? 85.476  83.998  55.579  1.00 12.47 ? 269  GLU B O   1 
ATOM   5775  C  CB  . GLU B 1 272 ? 86.876  85.410  57.828  1.00 12.31 ? 269  GLU B CB  1 
ATOM   5776  C  CG  . GLU B 1 272 ? 87.493  84.168  58.519  1.00 15.56 ? 269  GLU B CG  1 
ATOM   5777  C  CD  . GLU B 1 272 ? 87.254  84.124  60.018  1.00 16.38 ? 269  GLU B CD  1 
ATOM   5778  O  OE1 . GLU B 1 272 ? 86.497  84.996  60.532  1.00 18.22 ? 269  GLU B OE1 1 
ATOM   5779  O  OE2 . GLU B 1 272 ? 87.824  83.209  60.687  1.00 17.50 ? 269  GLU B OE2 1 
HETATM 5780  N  N   . MSE B 1 273 ? 87.602  83.405  55.183  1.00 12.40 ? 270  MSE B N   1 
HETATM 5781  C  CA  . MSE B 1 273 ? 87.250  82.122  54.607  1.00 14.21 ? 270  MSE B CA  1 
HETATM 5782  C  C   . MSE B 1 273 ? 87.607  81.026  55.580  1.00 14.29 ? 270  MSE B C   1 
HETATM 5783  O  O   . MSE B 1 273 ? 88.783  80.853  55.923  1.00 13.84 ? 270  MSE B O   1 
HETATM 5784  C  CB  . MSE B 1 273 ? 88.000  81.879  53.303  1.00 13.05 ? 270  MSE B CB  1 
HETATM 5785  C  CG  . MSE B 1 273 ? 87.643  82.843  52.204  1.00 18.20 ? 270  MSE B CG  1 
HETATM 5786  SE SE  . MSE B 1 273 ? 88.803  82.604  50.622  1.00 23.57 ? 270  MSE B SE  1 
HETATM 5787  C  CE  . MSE B 1 273 ? 88.635  80.695  50.443  1.00 17.30 ? 270  MSE B CE  1 
ATOM   5788  N  N   . LEU B 1 274 ? 86.588  80.302  56.040  1.00 14.86 ? 271  LEU B N   1 
ATOM   5789  C  CA  . LEU B 1 274 ? 86.782  79.167  56.913  1.00 14.68 ? 271  LEU B CA  1 
ATOM   5790  C  C   . LEU B 1 274 ? 87.097  77.996  55.983  1.00 14.25 ? 271  LEU B C   1 
ATOM   5791  O  O   . LEU B 1 274 ? 86.271  77.616  55.147  1.00 14.47 ? 271  LEU B O   1 
ATOM   5792  C  CB  . LEU B 1 274 ? 85.521  78.857  57.708  1.00 15.51 ? 271  LEU B CB  1 
ATOM   5793  C  CG  . LEU B 1 274 ? 85.683  77.751  58.757  1.00 14.84 ? 271  LEU B CG  1 
ATOM   5794  C  CD1 . LEU B 1 274 ? 86.509  78.277  59.929  1.00 12.69 ? 271  LEU B CD1 1 
ATOM   5795  C  CD2 . LEU B 1 274 ? 84.336  77.219  59.247  1.00 14.15 ? 271  LEU B CD2 1 
ATOM   5796  N  N   . ILE B 1 275 ? 88.267  77.400  56.169  1.00 14.62 ? 272  ILE B N   1 
ATOM   5797  C  CA  . ILE B 1 275 ? 88.759  76.319  55.316  1.00 14.21 ? 272  ILE B CA  1 
ATOM   5798  C  C   . ILE B 1 275 ? 88.797  74.981  56.013  1.00 14.54 ? 272  ILE B C   1 
ATOM   5799  O  O   . ILE B 1 275 ? 89.091  74.914  57.210  1.00 14.36 ? 272  ILE B O   1 
ATOM   5800  C  CB  . ILE B 1 275 ? 90.232  76.611  54.924  1.00 14.94 ? 272  ILE B CB  1 
ATOM   5801  C  CG1 . ILE B 1 275 ? 90.366  77.993  54.262  1.00 18.64 ? 272  ILE B CG1 1 
ATOM   5802  C  CG2 . ILE B 1 275 ? 90.806  75.480  54.057  1.00 13.47 ? 272  ILE B CG2 1 
ATOM   5803  C  CD1 . ILE B 1 275 ? 89.643  78.150  52.943  1.00 15.87 ? 272  ILE B CD1 1 
ATOM   5804  N  N   . ASN B 1 276 ? 88.494  73.922  55.274  1.00 13.80 ? 273  ASN B N   1 
ATOM   5805  C  CA  . ASN B 1 276 ? 88.601  72.567  55.788  1.00 14.04 ? 273  ASN B CA  1 
ATOM   5806  C  C   . ASN B 1 276 ? 89.314  71.703  54.744  1.00 13.45 ? 273  ASN B C   1 
ATOM   5807  O  O   . ASN B 1 276 ? 89.413  72.081  53.565  1.00 15.15 ? 273  ASN B O   1 
ATOM   5808  C  CB  . ASN B 1 276 ? 87.231  72.001  56.119  1.00 15.46 ? 273  ASN B CB  1 
ATOM   5809  C  CG  . ASN B 1 276 ? 86.420  71.679  54.885  1.00 13.70 ? 273  ASN B CG  1 
ATOM   5810  O  OD1 . ASN B 1 276 ? 86.809  70.852  54.071  1.00 17.29 ? 273  ASN B OD1 1 
ATOM   5811  N  ND2 . ASN B 1 276 ? 85.275  72.300  54.767  1.00 14.59 ? 273  ASN B ND2 1 
ATOM   5812  N  N   . TYR B 1 277 ? 89.892  70.604  55.194  1.00 13.91 ? 274  TYR B N   1 
ATOM   5813  C  CA  . TYR B 1 277 ? 90.534  69.638  54.319  1.00 13.76 ? 274  TYR B CA  1 
ATOM   5814  C  C   . TYR B 1 277 ? 89.792  68.306  54.408  1.00 14.96 ? 274  TYR B C   1 
ATOM   5815  O  O   . TYR B 1 277 ? 90.318  67.272  54.017  1.00 14.32 ? 274  TYR B O   1 
ATOM   5816  C  CB  . TYR B 1 277 ? 92.027  69.479  54.631  1.00 14.69 ? 274  TYR B CB  1 
ATOM   5817  C  CG  . TYR B 1 277 ? 92.879  70.560  53.997  1.00 12.42 ? 274  TYR B CG  1 
ATOM   5818  C  CD1 . TYR B 1 277 ? 93.003  71.825  54.591  1.00 13.22 ? 274  TYR B CD1 1 
ATOM   5819  C  CD2 . TYR B 1 277 ? 93.546  70.329  52.812  1.00 11.63 ? 274  TYR B CD2 1 
ATOM   5820  C  CE1 . TYR B 1 277 ? 93.755  72.796  54.025  1.00 12.15 ? 274  TYR B CE1 1 
ATOM   5821  C  CE2 . TYR B 1 277 ? 94.310  71.325  52.227  1.00 13.69 ? 274  TYR B CE2 1 
ATOM   5822  C  CZ  . TYR B 1 277 ? 94.413  72.549  52.843  1.00 11.83 ? 274  TYR B CZ  1 
ATOM   5823  O  OH  . TYR B 1 277 ? 95.155  73.553  52.268  1.00 14.29 ? 274  TYR B OH  1 
ATOM   5824  N  N   . GLU B 1 278 ? 88.568  68.350  54.934  1.00 15.18 ? 275  GLU B N   1 
ATOM   5825  C  CA  . GLU B 1 278 ? 87.698  67.164  55.055  1.00 15.80 ? 275  GLU B CA  1 
ATOM   5826  C  C   . GLU B 1 278 ? 86.268  67.549  54.632  1.00 16.08 ? 275  GLU B C   1 
ATOM   5827  O  O   . GLU B 1 278 ? 85.638  68.381  55.278  1.00 15.67 ? 275  GLU B O   1 
ATOM   5828  C  CB  . GLU B 1 278 ? 87.697  66.651  56.490  1.00 16.30 ? 275  GLU B CB  1 
ATOM   5829  C  CG  . GLU B 1 278 ? 88.979  65.989  56.919  1.00 17.93 ? 275  GLU B CG  1 
ATOM   5830  C  CD  . GLU B 1 278 ? 89.215  64.674  56.197  1.00 19.15 ? 275  GLU B CD  1 
ATOM   5831  O  OE1 . GLU B 1 278 ? 88.318  64.220  55.442  1.00 17.85 ? 275  GLU B OE1 1 
ATOM   5832  O  OE2 . GLU B 1 278 ? 90.289  64.089  56.392  1.00 21.80 ? 275  GLU B OE2 1 
ATOM   5833  N  N   . PRO B 1 279 ? 85.738  66.923  53.568  1.00 16.52 ? 276  PRO B N   1 
ATOM   5834  C  CA  . PRO B 1 279 ? 84.411  67.332  53.105  1.00 17.20 ? 276  PRO B CA  1 
ATOM   5835  C  C   . PRO B 1 279 ? 83.287  67.166  54.128  1.00 17.06 ? 276  PRO B C   1 
ATOM   5836  O  O   . PRO B 1 279 ? 82.284  67.885  54.054  1.00 16.52 ? 276  PRO B O   1 
ATOM   5837  C  CB  . PRO B 1 279 ? 84.175  66.466  51.853  1.00 18.33 ? 276  PRO B CB  1 
ATOM   5838  C  CG  . PRO B 1 279 ? 85.217  65.421  51.883  1.00 17.57 ? 276  PRO B CG  1 
ATOM   5839  C  CD  . PRO B 1 279 ? 86.366  65.953  52.654  1.00 17.35 ? 276  PRO B CD  1 
ATOM   5840  N  N   . ALA B 1 280 ? 83.470  66.269  55.089  1.00 16.15 ? 277  ALA B N   1 
ATOM   5841  C  CA  . ALA B 1 280 ? 82.472  66.066  56.132  1.00 16.13 ? 277  ALA B CA  1 
ATOM   5842  C  C   . ALA B 1 280 ? 82.215  67.355  56.936  1.00 16.61 ? 277  ALA B C   1 
ATOM   5843  O  O   . ALA B 1 280 ? 81.161  67.497  57.565  1.00 16.25 ? 277  ALA B O   1 
ATOM   5844  C  CB  . ALA B 1 280 ? 82.894  64.935  57.055  1.00 16.11 ? 277  ALA B CB  1 
ATOM   5845  N  N   . LEU B 1 281 ? 83.168  68.292  56.893  1.00 15.36 ? 278  LEU B N   1 
ATOM   5846  C  CA  . LEU B 1 281 ? 83.058  69.539  57.610  1.00 16.06 ? 278  LEU B CA  1 
ATOM   5847  C  C   . LEU B 1 281 ? 82.308  70.659  56.891  1.00 16.32 ? 278  LEU B C   1 
ATOM   5848  O  O   . LEU B 1 281 ? 82.197  71.752  57.428  1.00 16.58 ? 278  LEU B O   1 
ATOM   5849  C  CB  . LEU B 1 281 ? 84.465  70.044  58.016  1.00 16.30 ? 278  LEU B CB  1 
ATOM   5850  C  CG  . LEU B 1 281 ? 85.206  69.154  59.023  1.00 19.03 ? 278  LEU B CG  1 
ATOM   5851  C  CD1 . LEU B 1 281 ? 86.539  69.774  59.467  1.00 16.04 ? 278  LEU B CD1 1 
ATOM   5852  C  CD2 . LEU B 1 281 ? 84.329  68.907  60.210  1.00 23.35 ? 278  LEU B CD2 1 
ATOM   5853  N  N   A GLN B 1 282 ? 81.757  70.365  55.716  0.70 17.64 ? 279  GLN B N   1 
ATOM   5854  N  N   B GLN B 1 282 ? 81.786  70.424  55.690  0.30 16.76 ? 279  GLN B N   1 
ATOM   5855  C  CA  A GLN B 1 282 ? 81.035  71.362  54.921  0.70 17.88 ? 279  GLN B CA  1 
ATOM   5856  C  CA  B GLN B 1 282 ? 81.101  71.514  54.972  0.30 16.67 ? 279  GLN B CA  1 
ATOM   5857  C  C   A GLN B 1 282 ? 79.869  72.025  55.668  0.70 17.63 ? 279  GLN B C   1 
ATOM   5858  C  C   B GLN B 1 282 ? 79.843  72.066  55.672  0.30 16.80 ? 279  GLN B C   1 
ATOM   5859  O  O   A GLN B 1 282 ? 79.767  73.252  55.723  0.70 16.68 ? 279  GLN B O   1 
ATOM   5860  O  O   B GLN B 1 282 ? 79.653  73.284  55.696  0.30 16.26 ? 279  GLN B O   1 
ATOM   5861  C  CB  A GLN B 1 282 ? 80.543  70.736  53.608  0.70 18.83 ? 279  GLN B CB  1 
ATOM   5862  C  CB  B GLN B 1 282 ? 80.875  71.169  53.493  0.30 17.15 ? 279  GLN B CB  1 
ATOM   5863  C  CG  A GLN B 1 282 ? 79.875  71.741  52.687  0.70 23.14 ? 279  GLN B CG  1 
ATOM   5864  C  CG  B GLN B 1 282 ? 80.222  69.846  53.224  0.30 17.26 ? 279  GLN B CG  1 
ATOM   5865  C  CD  A GLN B 1 282 ? 79.744  71.263  51.247  0.70 27.89 ? 279  GLN B CD  1 
ATOM   5866  C  CD  B GLN B 1 282 ? 80.404  69.409  51.775  0.30 19.26 ? 279  GLN B CD  1 
ATOM   5867  O  OE1 A GLN B 1 282 ? 79.943  70.084  50.939  0.70 34.35 ? 279  GLN B OE1 1 
ATOM   5868  O  OE1 B GLN B 1 282 ? 80.628  70.234  50.882  0.30 21.36 ? 279  GLN B OE1 1 
ATOM   5869  N  NE2 A GLN B 1 282 ? 79.419  72.189  50.356  0.70 29.60 ? 279  GLN B NE2 1 
ATOM   5870  N  NE2 B GLN B 1 282 ? 80.316  68.107  51.539  0.30 15.71 ? 279  GLN B NE2 1 
ATOM   5871  N  N   . TYR B 1 283 ? 78.987  71.216  56.242  1.00 16.47 ? 280  TYR B N   1 
ATOM   5872  C  CA  . TYR B 1 283 ? 77.842  71.771  56.963  1.00 16.77 ? 280  TYR B CA  1 
ATOM   5873  C  C   . TYR B 1 283 ? 78.244  72.497  58.240  1.00 15.70 ? 280  TYR B C   1 
ATOM   5874  O  O   . TYR B 1 283 ? 77.542  73.414  58.675  1.00 14.11 ? 280  TYR B O   1 
ATOM   5875  C  CB  . TYR B 1 283 ? 76.679  70.792  57.141  1.00 17.74 ? 280  TYR B CB  1 
ATOM   5876  C  CG  . TYR B 1 283 ? 75.715  70.965  55.992  1.00 21.39 ? 280  TYR B CG  1 
ATOM   5877  C  CD1 . TYR B 1 283 ? 74.722  71.954  56.047  1.00 23.68 ? 280  TYR B CD1 1 
ATOM   5878  C  CD2 . TYR B 1 283 ? 75.846  70.223  54.826  1.00 25.13 ? 280  TYR B CD2 1 
ATOM   5879  C  CE1 . TYR B 1 283 ? 73.854  72.155  54.991  1.00 28.04 ? 280  TYR B CE1 1 
ATOM   5880  C  CE2 . TYR B 1 283 ? 74.981  70.415  53.763  1.00 29.20 ? 280  TYR B CE2 1 
ATOM   5881  C  CZ  . TYR B 1 283 ? 73.990  71.382  53.851  1.00 28.38 ? 280  TYR B CZ  1 
ATOM   5882  O  OH  . TYR B 1 283 ? 73.138  71.575  52.798  1.00 36.92 ? 280  TYR B OH  1 
ATOM   5883  N  N   . PHE B 1 284 ? 79.384  72.128  58.824  1.00 14.30 ? 281  PHE B N   1 
ATOM   5884  C  CA  . PHE B 1 284 ? 79.843  72.839  59.989  1.00 13.96 ? 281  PHE B CA  1 
ATOM   5885  C  C   . PHE B 1 284 ? 80.178  74.282  59.580  1.00 13.91 ? 281  PHE B C   1 
ATOM   5886  O  O   . PHE B 1 284 ? 79.964  75.224  60.342  1.00 13.81 ? 281  PHE B O   1 
ATOM   5887  C  CB  . PHE B 1 284 ? 81.075  72.179  60.605  1.00 15.34 ? 281  PHE B CB  1 
ATOM   5888  C  CG  . PHE B 1 284 ? 81.511  72.838  61.870  1.00 15.29 ? 281  PHE B CG  1 
ATOM   5889  C  CD1 . PHE B 1 284 ? 80.906  72.510  63.074  1.00 19.57 ? 281  PHE B CD1 1 
ATOM   5890  C  CD2 . PHE B 1 284 ? 82.481  73.827  61.860  1.00 15.39 ? 281  PHE B CD2 1 
ATOM   5891  C  CE1 . PHE B 1 284 ? 81.285  73.137  64.245  1.00 18.23 ? 281  PHE B CE1 1 
ATOM   5892  C  CE2 . PHE B 1 284 ? 82.858  74.451  63.030  1.00 16.53 ? 281  PHE B CE2 1 
ATOM   5893  C  CZ  . PHE B 1 284 ? 82.259  74.113  64.215  1.00 14.40 ? 281  PHE B CZ  1 
ATOM   5894  N  N   . ALA B 1 285 ? 80.748  74.442  58.389  1.00 14.29 ? 282  ALA B N   1 
ATOM   5895  C  CA  . ALA B 1 285 ? 81.065  75.764  57.867  1.00 14.40 ? 282  ALA B CA  1 
ATOM   5896  C  C   . ALA B 1 285 ? 79.794  76.587  57.676  1.00 13.58 ? 282  ALA B C   1 
ATOM   5897  O  O   . ALA B 1 285 ? 79.810  77.795  57.868  1.00 13.74 ? 282  ALA B O   1 
ATOM   5898  C  CB  . ALA B 1 285 ? 81.823  75.652  56.538  1.00 14.68 ? 282  ALA B CB  1 
ATOM   5899  N  N   . GLU B 1 286 ? 78.699  75.940  57.280  1.00 13.85 ? 283  GLU B N   1 
ATOM   5900  C  CA  . GLU B 1 286 ? 77.417  76.653  57.102  1.00 13.26 ? 283  GLU B CA  1 
ATOM   5901  C  C   . GLU B 1 286 ? 76.915  77.159  58.453  1.00 11.93 ? 283  GLU B C   1 
ATOM   5902  O  O   . GLU B 1 286 ? 76.417  78.286  58.559  1.00 12.03 ? 283  GLU B O   1 
ATOM   5903  C  CB  . GLU B 1 286 ? 76.364  75.786  56.406  1.00 13.60 ? 283  GLU B CB  1 
ATOM   5904  C  CG  . GLU B 1 286 ? 76.701  75.436  54.962  1.00 16.33 ? 283  GLU B CG  1 
ATOM   5905  C  CD  . GLU B 1 286 ? 76.865  76.672  54.102  1.00 19.36 ? 283  GLU B CD  1 
ATOM   5906  O  OE1 . GLU B 1 286 ? 76.024  77.592  54.206  1.00 16.45 ? 283  GLU B OE1 1 
ATOM   5907  O  OE2 . GLU B 1 286 ? 77.826  76.724  53.311  1.00 25.31 ? 283  GLU B OE2 1 
ATOM   5908  N  N   . TRP B 1 287 ? 77.054  76.323  59.472  1.00 11.58 ? 284  TRP B N   1 
ATOM   5909  C  CA  . TRP B 1 287 ? 76.677  76.677  60.864  1.00 11.86 ? 284  TRP B CA  1 
ATOM   5910  C  C   . TRP B 1 287 ? 77.515  77.857  61.337  1.00 12.72 ? 284  TRP B C   1 
ATOM   5911  O  O   . TRP B 1 287 ? 77.000  78.789  61.970  1.00 14.00 ? 284  TRP B O   1 
ATOM   5912  C  CB  . TRP B 1 287 ? 76.863  75.459  61.796  1.00 10.79 ? 284  TRP B CB  1 
ATOM   5913  C  CG  . TRP B 1 287 ? 76.679  75.735  63.236  1.00 9.23  ? 284  TRP B CG  1 
ATOM   5914  C  CD1 . TRP B 1 287 ? 75.500  75.705  63.952  1.00 12.10 ? 284  TRP B CD1 1 
ATOM   5915  C  CD2 . TRP B 1 287 ? 77.706  76.089  64.166  1.00 8.91  ? 284  TRP B CD2 1 
ATOM   5916  N  NE1 . TRP B 1 287 ? 75.750  76.023  65.283  1.00 13.36 ? 284  TRP B NE1 1 
ATOM   5917  C  CE2 . TRP B 1 287 ? 77.095  76.270  65.428  1.00 11.88 ? 284  TRP B CE2 1 
ATOM   5918  C  CE3 . TRP B 1 287 ? 79.092  76.275  64.054  1.00 12.75 ? 284  TRP B CE3 1 
ATOM   5919  C  CZ2 . TRP B 1 287 ? 77.824  76.629  66.560  1.00 14.24 ? 284  TRP B CZ2 1 
ATOM   5920  C  CZ3 . TRP B 1 287 ? 79.811  76.626  65.186  1.00 13.92 ? 284  TRP B CZ3 1 
ATOM   5921  C  CH2 . TRP B 1 287 ? 79.183  76.801  66.413  1.00 12.86 ? 284  TRP B CH2 1 
ATOM   5922  N  N   . TRP B 1 288 ? 78.802  77.829  60.984  1.00 12.54 ? 285  TRP B N   1 
ATOM   5923  C  CA  . TRP B 1 288 ? 79.738  78.887  61.345  1.00 12.80 ? 285  TRP B CA  1 
ATOM   5924  C  C   . TRP B 1 288 ? 79.377  80.205  60.668  1.00 13.75 ? 285  TRP B C   1 
ATOM   5925  O  O   . TRP B 1 288 ? 79.448  81.261  61.303  1.00 13.68 ? 285  TRP B O   1 
ATOM   5926  C  CB  . TRP B 1 288 ? 81.168  78.437  61.013  1.00 13.60 ? 285  TRP B CB  1 
ATOM   5927  C  CG  . TRP B 1 288 ? 82.255  79.498  61.173  1.00 14.80 ? 285  TRP B CG  1 
ATOM   5928  C  CD1 . TRP B 1 288 ? 83.024  79.734  62.268  1.00 18.19 ? 285  TRP B CD1 1 
ATOM   5929  C  CD2 . TRP B 1 288 ? 82.692  80.419  60.173  1.00 12.38 ? 285  TRP B CD2 1 
ATOM   5930  N  NE1 . TRP B 1 288 ? 83.915  80.749  62.015  1.00 17.05 ? 285  TRP B NE1 1 
ATOM   5931  C  CE2 . TRP B 1 288 ? 83.729  81.184  60.730  1.00 15.88 ? 285  TRP B CE2 1 
ATOM   5932  C  CE3 . TRP B 1 288 ? 82.317  80.656  58.846  1.00 16.88 ? 285  TRP B CE3 1 
ATOM   5933  C  CZ2 . TRP B 1 288 ? 84.394  82.177  60.010  1.00 15.66 ? 285  TRP B CZ2 1 
ATOM   5934  C  CZ3 . TRP B 1 288 ? 82.968  81.649  58.134  1.00 14.91 ? 285  TRP B CZ3 1 
ATOM   5935  C  CH2 . TRP B 1 288 ? 83.989  82.397  58.718  1.00 13.11 ? 285  TRP B CH2 1 
ATOM   5936  N  N   . LYS B 1 289 ? 78.967  80.146  59.391  1.00 14.99 ? 286  LYS B N   1 
ATOM   5937  C  CA  . LYS B 1 289 ? 78.566  81.349  58.656  1.00 15.52 ? 286  LYS B CA  1 
ATOM   5938  C  C   . LYS B 1 289 ? 77.356  82.010  59.303  1.00 14.22 ? 286  LYS B C   1 
ATOM   5939  O  O   . LYS B 1 289 ? 77.296  83.237  59.393  1.00 12.66 ? 286  LYS B O   1 
ATOM   5940  C  CB  . LYS B 1 289 ? 78.307  81.043  57.162  1.00 16.99 ? 286  LYS B CB  1 
ATOM   5941  C  CG  . LYS B 1 289 ? 79.594  80.667  56.430  1.00 19.85 ? 286  LYS B CG  1 
ATOM   5942  C  CD  . LYS B 1 289 ? 79.495  80.602  54.901  1.00 25.47 ? 286  LYS B CD  1 
ATOM   5943  C  CE  . LYS B 1 289 ? 78.912  79.350  54.364  1.00 29.37 ? 286  LYS B CE  1 
ATOM   5944  N  NZ  . LYS B 1 289 ? 79.011  79.328  52.860  1.00 26.82 ? 286  LYS B NZ  1 
ATOM   5945  N  N   . GLN B 1 290 ? 76.394  81.204  59.756  1.00 12.93 ? 287  GLN B N   1 
ATOM   5946  C  CA  . GLN B 1 290 ? 75.235  81.747  60.436  1.00 12.33 ? 287  GLN B CA  1 
ATOM   5947  C  C   . GLN B 1 290 ? 75.670  82.394  61.749  1.00 13.22 ? 287  GLN B C   1 
ATOM   5948  O  O   . GLN B 1 290 ? 75.260  83.496  62.067  1.00 11.91 ? 287  GLN B O   1 
ATOM   5949  C  CB  . GLN B 1 290 ? 74.160  80.673  60.758  1.00 14.01 ? 287  GLN B CB  1 
ATOM   5950  C  CG  . GLN B 1 290 ? 73.072  81.283  61.641  1.00 14.00 ? 287  GLN B CG  1 
ATOM   5951  C  CD  . GLN B 1 290 ? 71.827  80.451  61.828  1.00 18.40 ? 287  GLN B CD  1 
ATOM   5952  O  OE1 . GLN B 1 290 ? 71.786  79.262  61.505  1.00 18.21 ? 287  GLN B OE1 1 
ATOM   5953  N  NE2 . GLN B 1 290 ? 70.778  81.096  62.374  1.00 14.15 ? 287  GLN B NE2 1 
ATOM   5954  N  N   . LEU B 1 291 ? 76.498  81.688  62.519  1.00 13.39 ? 288  LEU B N   1 
ATOM   5955  C  CA  . LEU B 1 291 ? 76.940  82.182  63.822  1.00 12.91 ? 288  LEU B CA  1 
ATOM   5956  C  C   . LEU B 1 291 ? 77.605  83.563  63.719  1.00 12.08 ? 288  LEU B C   1 
ATOM   5957  O  O   . LEU B 1 291 ? 77.176  84.513  64.349  1.00 12.83 ? 288  LEU B O   1 
ATOM   5958  C  CB  . LEU B 1 291 ? 77.895  81.176  64.455  1.00 13.50 ? 288  LEU B CB  1 
ATOM   5959  C  CG  . LEU B 1 291 ? 78.405  81.490  65.859  1.00 15.82 ? 288  LEU B CG  1 
ATOM   5960  C  CD1 . LEU B 1 291 ? 77.222  81.622  66.807  1.00 14.90 ? 288  LEU B CD1 1 
ATOM   5961  C  CD2 . LEU B 1 291 ? 79.392  80.405  66.341  1.00 14.34 ? 288  LEU B CD2 1 
ATOM   5962  N  N   . PHE B 1 292 ? 78.613  83.678  62.875  1.00 13.54 ? 289  PHE B N   1 
ATOM   5963  C  CA  . PHE B 1 292 ? 79.337  84.939  62.727  1.00 13.60 ? 289  PHE B CA  1 
ATOM   5964  C  C   . PHE B 1 292 ? 78.649  85.980  61.872  1.00 14.76 ? 289  PHE B C   1 
ATOM   5965  O  O   . PHE B 1 292 ? 78.668  87.171  62.223  1.00 16.39 ? 289  PHE B O   1 
ATOM   5966  C  CB  . PHE B 1 292 ? 80.783  84.683  62.288  1.00 13.39 ? 289  PHE B CB  1 
ATOM   5967  C  CG  . PHE B 1 292 ? 81.648  84.152  63.398  1.00 13.40 ? 289  PHE B CG  1 
ATOM   5968  C  CD1 . PHE B 1 292 ? 82.376  85.018  64.194  1.00 12.56 ? 289  PHE B CD1 1 
ATOM   5969  C  CD2 . PHE B 1 292 ? 81.689  82.797  63.681  1.00 15.63 ? 289  PHE B CD2 1 
ATOM   5970  C  CE1 . PHE B 1 292 ? 83.155  84.540  65.240  1.00 14.02 ? 289  PHE B CE1 1 
ATOM   5971  C  CE2 . PHE B 1 292 ? 82.471  82.317  64.722  1.00 15.62 ? 289  PHE B CE2 1 
ATOM   5972  C  CZ  . PHE B 1 292 ? 83.201  83.187  65.495  1.00 16.26 ? 289  PHE B CZ  1 
ATOM   5973  N  N   . GLY B 1 293 ? 77.990  85.534  60.802  1.00 14.56 ? 290  GLY B N   1 
ATOM   5974  C  CA  . GLY B 1 293 ? 77.269  86.417  59.915  1.00 13.53 ? 290  GLY B CA  1 
ATOM   5975  C  C   . GLY B 1 293 ? 76.093  87.114  60.585  1.00 14.59 ? 290  GLY B C   1 
ATOM   5976  O  O   . GLY B 1 293 ? 75.919  88.332  60.408  1.00 12.20 ? 290  GLY B O   1 
ATOM   5977  N  N   . GLU B 1 294 ? 75.260  86.360  61.311  1.00 13.52 ? 291  GLU B N   1 
ATOM   5978  C  CA  . GLU B 1 294 ? 74.112  86.957  62.013  1.00 14.54 ? 291  GLU B CA  1 
ATOM   5979  C  C   . GLU B 1 294 ? 74.484  87.750  63.249  1.00 14.58 ? 291  GLU B C   1 
ATOM   5980  O  O   . GLU B 1 294 ? 73.830  88.744  63.562  1.00 15.83 ? 291  GLU B O   1 
ATOM   5981  C  CB  . GLU B 1 294 ? 73.061  85.922  62.481  1.00 15.29 ? 291  GLU B CB  1 
ATOM   5982  C  CG  . GLU B 1 294 ? 72.196  85.355  61.424  1.00 18.95 ? 291  GLU B CG  1 
ATOM   5983  C  CD  . GLU B 1 294 ? 70.929  84.657  61.983  1.00 23.19 ? 291  GLU B CD  1 
ATOM   5984  O  OE1 . GLU B 1 294 ? 70.950  84.131  63.110  1.00 19.70 ? 291  GLU B OE1 1 
ATOM   5985  O  OE2 . GLU B 1 294 ? 69.905  84.638  61.264  1.00 24.98 ? 291  GLU B OE2 1 
ATOM   5986  N  N   . SER B 1 295 ? 75.498  87.307  63.977  1.00 13.11 ? 292  SER B N   1 
ATOM   5987  C  CA  . SER B 1 295 ? 75.892  88.011  65.184  1.00 12.70 ? 292  SER B CA  1 
ATOM   5988  C  C   . SER B 1 295 ? 76.582  89.352  64.876  1.00 13.83 ? 292  SER B C   1 
ATOM   5989  O  O   . SER B 1 295 ? 76.331  90.331  65.562  1.00 13.73 ? 292  SER B O   1 
ATOM   5990  C  CB  . SER B 1 295 ? 76.844  87.161  66.044  1.00 12.80 ? 292  SER B CB  1 
ATOM   5991  O  OG  . SER B 1 295 ? 76.301  85.891  66.393  1.00 14.48 ? 292  SER B OG  1 
ATOM   5992  N  N   . GLU B 1 296 ? 77.400  89.409  63.820  1.00 13.71 ? 293  GLU B N   1 
ATOM   5993  C  CA  . GLU B 1 296 ? 78.178  90.627  63.502  1.00 14.47 ? 293  GLU B CA  1 
ATOM   5994  C  C   . GLU B 1 296 ? 77.759  91.467  62.310  1.00 13.86 ? 293  GLU B C   1 
ATOM   5995  O  O   . GLU B 1 296 ? 78.201  92.608  62.186  1.00 15.08 ? 293  GLU B O   1 
ATOM   5996  C  CB  . GLU B 1 296 ? 79.641  90.239  63.284  1.00 14.83 ? 293  GLU B CB  1 
ATOM   5997  C  CG  . GLU B 1 296 ? 80.235  89.524  64.465  1.00 17.98 ? 293  GLU B CG  1 
ATOM   5998  C  CD  . GLU B 1 296 ? 81.724  89.324  64.349  1.00 21.90 ? 293  GLU B CD  1 
ATOM   5999  O  OE1 . GLU B 1 296 ? 82.200  88.977  63.241  1.00 20.93 ? 293  GLU B OE1 1 
ATOM   6000  O  OE2 . GLU B 1 296 ? 82.421  89.500  65.393  1.00 26.86 ? 293  GLU B OE2 1 
ATOM   6001  N  N   . GLY B 1 297 ? 76.911  90.929  61.446  1.00 13.43 ? 294  GLY B N   1 
ATOM   6002  C  CA  . GLY B 1 297 ? 76.482  91.634  60.249  1.00 12.53 ? 294  GLY B CA  1 
ATOM   6003  C  C   . GLY B 1 297 ? 75.416  92.663  60.495  1.00 12.78 ? 294  GLY B C   1 
ATOM   6004  O  O   . GLY B 1 297 ? 74.277  92.520  60.036  1.00 13.43 ? 294  GLY B O   1 
ATOM   6005  N  N   . LYS B 1 298 ? 75.781  93.721  61.199  1.00 12.42 ? 295  LYS B N   1 
ATOM   6006  C  CA  . LYS B 1 298 ? 74.825  94.754  61.516  1.00 11.58 ? 295  LYS B CA  1 
ATOM   6007  C  C   . LYS B 1 298 ? 75.444  96.135  61.660  1.00 11.68 ? 295  LYS B C   1 
ATOM   6008  O  O   . LYS B 1 298 ? 76.688  96.286  61.706  1.00 8.96  ? 295  LYS B O   1 
ATOM   6009  C  CB  . LYS B 1 298 ? 74.071  94.353  62.756  1.00 14.56 ? 295  LYS B CB  1 
ATOM   6010  C  CG  . LYS B 1 298 ? 74.949  94.024  63.910  1.00 13.05 ? 295  LYS B CG  1 
ATOM   6011  C  CD  . LYS B 1 298 ? 74.201  93.211  64.947  1.00 18.11 ? 295  LYS B CD  1 
ATOM   6012  C  CE  . LYS B 1 298 ? 73.692  91.872  64.413  1.00 18.31 ? 295  LYS B CE  1 
ATOM   6013  N  NZ  . LYS B 1 298 ? 73.344  90.931  65.547  1.00 11.78 ? 295  LYS B NZ  1 
ATOM   6014  N  N   . ASP B 1 299 ? 74.582  97.147  61.633  1.00 10.10 ? 296  ASP B N   1 
ATOM   6015  C  CA  . ASP B 1 299 ? 75.044  98.527  61.741  1.00 11.27 ? 296  ASP B CA  1 
ATOM   6016  C  C   . ASP B 1 299 ? 76.082  98.878  60.641  1.00 10.60 ? 296  ASP B C   1 
ATOM   6017  O  O   . ASP B 1 299 ? 76.972  99.708  60.865  1.00 9.83  ? 296  ASP B O   1 
ATOM   6018  C  CB  . ASP B 1 299 ? 75.639  98.755  63.131  1.00 10.41 ? 296  ASP B CB  1 
ATOM   6019  C  CG  . ASP B 1 299 ? 74.624  98.545  64.246  1.00 13.34 ? 296  ASP B CG  1 
ATOM   6020  O  OD1 . ASP B 1 299 ? 73.441  98.897  64.070  1.00 13.85 ? 296  ASP B OD1 1 
ATOM   6021  O  OD2 . ASP B 1 299 ? 75.027  98.080  65.324  1.00 15.99 ? 296  ASP B OD2 1 
ATOM   6022  N  N   A GLN B 1 300 ? 75.922  98.253  59.468  0.60 10.96 ? 297  GLN B N   1 
ATOM   6023  N  N   B GLN B 1 300 ? 75.943  98.232  59.479  0.40 10.63 ? 297  GLN B N   1 
ATOM   6024  C  CA  A GLN B 1 300 ? 76.802  98.402  58.290  0.60 11.00 ? 297  GLN B CA  1 
ATOM   6025  C  CA  B GLN B 1 300 ? 76.805  98.442  58.311  0.40 10.46 ? 297  GLN B CA  1 
ATOM   6026  C  C   A GLN B 1 300 ? 78.259  97.952  58.524  0.60 10.54 ? 297  GLN B C   1 
ATOM   6027  C  C   B GLN B 1 300 ? 78.256  97.971  58.536  0.40 10.32 ? 297  GLN B C   1 
ATOM   6028  O  O   A GLN B 1 300 ? 79.189  98.449  57.882  0.60 11.14 ? 297  GLN B O   1 
ATOM   6029  O  O   B GLN B 1 300 ? 79.185  98.482  57.905  0.40 10.75 ? 297  GLN B O   1 
ATOM   6030  C  CB  A GLN B 1 300 ? 76.742  99.815  57.683  0.60 11.25 ? 297  GLN B CB  1 
ATOM   6031  C  CB  B GLN B 1 300 ? 76.776  99.923  57.914  0.40 10.55 ? 297  GLN B CB  1 
ATOM   6032  C  CG  A GLN B 1 300 ? 75.397  100.142 57.025  0.60 13.60 ? 297  GLN B CG  1 
ATOM   6033  C  CG  B GLN B 1 300 ? 75.356  100.495 57.816  0.40 10.97 ? 297  GLN B CG  1 
ATOM   6034  C  CD  A GLN B 1 300 ? 74.274  100.285 58.020  0.60 17.02 ? 297  GLN B CD  1 
ATOM   6035  C  CD  B GLN B 1 300 ? 74.584  99.974  56.633  0.40 10.66 ? 297  GLN B CD  1 
ATOM   6036  O  OE1 A GLN B 1 300 ? 74.366  101.072 58.967  0.60 19.62 ? 297  GLN B OE1 1 
ATOM   6037  O  OE1 B GLN B 1 300 ? 74.969  100.194 55.488  0.40 11.13 ? 297  GLN B OE1 1 
ATOM   6038  N  NE2 A GLN B 1 300 ? 73.179  99.564  57.788  0.60 19.79 ? 297  GLN B NE2 1 
ATOM   6039  N  NE2 B GLN B 1 300 ? 73.453  99.333  56.898  0.40 14.44 ? 297  GLN B NE2 1 
ATOM   6040  N  N   . LYS B 1 301 ? 78.435  96.975  59.396  1.00 10.24 ? 298  LYS B N   1 
ATOM   6041  C  CA  . LYS B 1 301 ? 79.758  96.460  59.732  1.00 10.17 ? 298  LYS B CA  1 
ATOM   6042  C  C   . LYS B 1 301 ? 79.830  94.946  59.654  1.00 11.11 ? 298  LYS B C   1 
ATOM   6043  O  O   . LYS B 1 301 ? 78.825  94.263  59.402  1.00 10.90 ? 298  LYS B O   1 
ATOM   6044  C  CB  . LYS B 1 301 ? 80.064  96.823  61.201  1.00 9.97  ? 298  LYS B CB  1 
ATOM   6045  C  CG  . LYS B 1 301 ? 79.876  98.282  61.583  1.00 13.58 ? 298  LYS B CG  1 
ATOM   6046  C  CD  . LYS B 1 301 ? 79.912  98.505  63.096  1.00 11.92 ? 298  LYS B CD  1 
ATOM   6047  C  CE  . LYS B 1 301 ? 79.550  99.949  63.424  1.00 13.86 ? 298  LYS B CE  1 
ATOM   6048  N  NZ  . LYS B 1 301 ? 79.454  100.224 64.902  1.00 11.73 ? 298  LYS B NZ  1 
ATOM   6049  N  N   . GLY B 1 302 ? 81.044  94.422  59.859  1.00 11.66 ? 299  GLY B N   1 
ATOM   6050  C  CA  . GLY B 1 302 ? 81.251  92.976  59.958  1.00 10.80 ? 299  GLY B CA  1 
ATOM   6051  C  C   . GLY B 1 302 ? 82.078  92.279  58.900  1.00 11.02 ? 299  GLY B C   1 
ATOM   6052  O  O   . GLY B 1 302 ? 82.009  92.599  57.716  1.00 10.10 ? 299  GLY B O   1 
ATOM   6053  N  N   . ILE B 1 303 ? 82.887  91.327  59.349  1.00 12.15 ? 300  ILE B N   1 
ATOM   6054  C  CA  . ILE B 1 303 ? 83.663  90.479  58.442  1.00 12.48 ? 300  ILE B CA  1 
ATOM   6055  C  C   . ILE B 1 303 ? 82.673  89.607  57.691  1.00 11.90 ? 300  ILE B C   1 
ATOM   6056  O  O   . ILE B 1 303 ? 81.761  89.071  58.291  1.00 12.61 ? 300  ILE B O   1 
ATOM   6057  C  CB  . ILE B 1 303 ? 84.594  89.558  59.221  1.00 12.75 ? 300  ILE B CB  1 
ATOM   6058  C  CG1 . ILE B 1 303 ? 85.750  90.359  59.823  1.00 15.14 ? 300  ILE B CG1 1 
ATOM   6059  C  CG2 . ILE B 1 303 ? 85.149  88.467  58.315  1.00 12.52 ? 300  ILE B CG2 1 
ATOM   6060  C  CD1 . ILE B 1 303 ? 86.613  89.533  60.843  1.00 16.43 ? 300  ILE B CD1 1 
ATOM   6061  N  N   . PHE B 1 304 ? 82.834  89.499  56.372  1.00 14.29 ? 301  PHE B N   1 
ATOM   6062  C  CA  . PHE B 1 304 ? 81.978  88.675  55.551  1.00 13.55 ? 301  PHE B CA  1 
ATOM   6063  C  C   . PHE B 1 304 ? 82.457  87.220  55.703  1.00 13.88 ? 301  PHE B C   1 
ATOM   6064  O  O   . PHE B 1 304 ? 83.623  86.905  55.440  1.00 14.16 ? 301  PHE B O   1 
ATOM   6065  C  CB  . PHE B 1 304 ? 82.019  89.148  54.089  1.00 14.46 ? 301  PHE B CB  1 
ATOM   6066  C  CG  . PHE B 1 304 ? 81.190  88.328  53.165  1.00 14.80 ? 301  PHE B CG  1 
ATOM   6067  C  CD1 . PHE B 1 304 ? 79.828  88.578  53.018  1.00 18.48 ? 301  PHE B CD1 1 
ATOM   6068  C  CD2 . PHE B 1 304 ? 81.762  87.314  52.423  1.00 15.35 ? 301  PHE B CD2 1 
ATOM   6069  C  CE1 . PHE B 1 304 ? 79.042  87.822  52.158  1.00 17.28 ? 301  PHE B CE1 1 
ATOM   6070  C  CE2 . PHE B 1 304 ? 80.978  86.554  51.547  1.00 17.79 ? 301  PHE B CE2 1 
ATOM   6071  C  CZ  . PHE B 1 304 ? 79.616  86.816  51.424  1.00 19.24 ? 301  PHE B CZ  1 
ATOM   6072  N  N   . PRO B 1 305 ? 81.564  86.332  56.161  1.00 14.28 ? 302  PRO B N   1 
ATOM   6073  C  CA  . PRO B 1 305 ? 81.939  84.938  56.366  1.00 15.11 ? 302  PRO B CA  1 
ATOM   6074  C  C   . PRO B 1 305 ? 81.802  84.118  55.127  1.00 15.77 ? 302  PRO B C   1 
ATOM   6075  O  O   . PRO B 1 305 ? 80.705  83.963  54.620  1.00 16.60 ? 302  PRO B O   1 
ATOM   6076  C  CB  . PRO B 1 305 ? 80.942  84.451  57.422  1.00 15.28 ? 302  PRO B CB  1 
ATOM   6077  C  CG  . PRO B 1 305 ? 79.780  85.321  57.307  1.00 14.38 ? 302  PRO B CG  1 
ATOM   6078  C  CD  . PRO B 1 305 ? 80.206  86.623  56.663  1.00 14.29 ? 302  PRO B CD  1 
ATOM   6079  N  N   . SER B 1 306 ? 82.918  83.596  54.637  1.00 15.96 ? 303  SER B N   1 
ATOM   6080  C  CA  . SER B 1 306 ? 82.915  82.772  53.452  1.00 15.81 ? 303  SER B CA  1 
ATOM   6081  C  C   . SER B 1 306 ? 83.539  81.437  53.842  1.00 16.55 ? 303  SER B C   1 
ATOM   6082  O  O   . SER B 1 306 ? 84.031  81.285  54.964  1.00 13.68 ? 303  SER B O   1 
ATOM   6083  C  CB  . SER B 1 306 ? 83.744  83.444  52.365  1.00 17.18 ? 303  SER B CB  1 
ATOM   6084  O  OG  . SER B 1 306 ? 83.676  82.705  51.164  1.00 19.02 ? 303  SER B OG  1 
ATOM   6085  N  N   . SER B 1 307 ? 83.516  80.466  52.938  1.00 16.75 ? 304  SER B N   1 
ATOM   6086  C  CA  . SER B 1 307 ? 84.117  79.157  53.236  1.00 17.17 ? 304  SER B CA  1 
ATOM   6087  C  C   . SER B 1 307 ? 84.591  78.450  51.979  1.00 16.41 ? 304  SER B C   1 
ATOM   6088  O  O   . SER B 1 307 ? 84.194  78.807  50.876  1.00 15.23 ? 304  SER B O   1 
ATOM   6089  C  CB  . SER B 1 307 ? 83.127  78.260  53.970  1.00 17.91 ? 304  SER B CB  1 
ATOM   6090  O  OG  . SER B 1 307 ? 82.035  77.920  53.141  1.00 20.71 ? 304  SER B OG  1 
ATOM   6091  N  N   . ALA B 1 308 ? 85.451  77.445  52.168  1.00 16.16 ? 305  ALA B N   1 
ATOM   6092  C  CA  . ALA B 1 308 ? 85.992  76.655  51.076  1.00 15.47 ? 305  ALA B CA  1 
ATOM   6093  C  C   . ALA B 1 308 ? 86.436  75.287  51.601  1.00 16.13 ? 305  ALA B C   1 
ATOM   6094  O  O   . ALA B 1 308 ? 86.883  75.141  52.756  1.00 16.30 ? 305  ALA B O   1 
ATOM   6095  C  CB  . ALA B 1 308 ? 87.134  77.362  50.430  1.00 14.77 ? 305  ALA B CB  1 
ATOM   6096  N  N   . ASN B 1 309 ? 86.321  74.303  50.730  1.00 15.71 ? 306  ASN B N   1 
ATOM   6097  C  CA  . ASN B 1 309 ? 86.666  72.919  51.017  1.00 15.64 ? 306  ASN B CA  1 
ATOM   6098  C  C   . ASN B 1 309 ? 87.936  72.592  50.211  1.00 15.86 ? 306  ASN B C   1 
ATOM   6099  O  O   . ASN B 1 309 ? 87.894  72.542  48.977  1.00 15.48 ? 306  ASN B O   1 
ATOM   6100  C  CB  . ASN B 1 309 ? 85.532  72.010  50.548  1.00 16.17 ? 306  ASN B CB  1 
ATOM   6101  C  CG  . ASN B 1 309 ? 84.154  72.456  51.068  1.00 18.61 ? 306  ASN B CG  1 
ATOM   6102  O  OD1 . ASN B 1 309 ? 83.950  72.653  52.273  1.00 20.05 ? 306  ASN B OD1 1 
ATOM   6103  N  ND2 . ASN B 1 309 ? 83.202  72.597  50.149  1.00 20.74 ? 306  ASN B ND2 1 
ATOM   6104  N  N   . PHE B 1 310 ? 89.065  72.408  50.886  1.00 14.84 ? 307  PHE B N   1 
ATOM   6105  C  CA  . PHE B 1 310 ? 90.305  72.093  50.189  1.00 13.99 ? 307  PHE B CA  1 
ATOM   6106  C  C   . PHE B 1 310 ? 90.573  70.596  50.264  1.00 14.43 ? 307  PHE B C   1 
ATOM   6107  O  O   . PHE B 1 310 ? 89.971  69.894  51.085  1.00 15.10 ? 307  PHE B O   1 
ATOM   6108  C  CB  . PHE B 1 310 ? 91.517  72.885  50.734  1.00 14.53 ? 307  PHE B CB  1 
ATOM   6109  C  CG  . PHE B 1 310 ? 91.455  74.383  50.509  1.00 14.18 ? 307  PHE B CG  1 
ATOM   6110  C  CD1 . PHE B 1 310 ? 90.606  74.953  49.567  1.00 16.08 ? 307  PHE B CD1 1 
ATOM   6111  C  CD2 . PHE B 1 310 ? 92.403  75.206  51.125  1.00 14.97 ? 307  PHE B CD2 1 
ATOM   6112  C  CE1 . PHE B 1 310 ? 90.604  76.353  49.356  1.00 14.93 ? 307  PHE B CE1 1 
ATOM   6113  C  CE2 . PHE B 1 310 ? 92.420  76.591  50.907  1.00 12.52 ? 307  PHE B CE2 1 
ATOM   6114  C  CZ  . PHE B 1 310 ? 91.516  77.164  50.033  1.00 12.93 ? 307  PHE B CZ  1 
ATOM   6115  N  N   . SER B 1 311 ? 91.403  70.064  49.370  1.00 14.45 ? 308  SER B N   1 
ATOM   6116  C  CA  . SER B 1 311 ? 92.059  70.795  48.292  1.00 14.58 ? 308  SER B CA  1 
ATOM   6117  C  C   . SER B 1 311 ? 91.144  71.018  47.091  1.00 12.56 ? 308  SER B C   1 
ATOM   6118  O  O   . SER B 1 311 ? 91.550  71.620  46.129  1.00 11.93 ? 308  SER B O   1 
ATOM   6119  C  CB  . SER B 1 311 ? 93.251  69.985  47.788  1.00 15.90 ? 308  SER B CB  1 
ATOM   6120  O  OG  . SER B 1 311 ? 92.801  68.774  47.178  1.00 15.23 ? 308  SER B OG  1 
ATOM   6121  N  N   . THR B 1 312 ? 89.908  70.532  47.165  1.00 13.30 ? 309  THR B N   1 
ATOM   6122  C  CA  . THR B 1 312 ? 88.954  70.640  46.089  1.00 12.53 ? 309  THR B CA  1 
ATOM   6123  C  C   . THR B 1 312 ? 88.900  72.055  45.497  1.00 13.50 ? 309  THR B C   1 
ATOM   6124  O  O   . THR B 1 312 ? 89.168  72.260  44.313  1.00 12.92 ? 309  THR B O   1 
ATOM   6125  C  CB  . THR B 1 312 ? 87.565  70.273  46.619  1.00 15.06 ? 309  THR B CB  1 
ATOM   6126  O  OG1 . THR B 1 312 ? 87.663  69.077  47.398  1.00 14.21 ? 309  THR B OG1 1 
ATOM   6127  C  CG2 . THR B 1 312 ? 86.539  70.114  45.459  1.00 11.77 ? 309  THR B CG2 1 
ATOM   6128  N  N   . ASP B 1 313 ? 88.619  73.031  46.357  1.00 13.73 ? 310  ASP B N   1 
ATOM   6129  C  CA  . ASP B 1 313 ? 88.475  74.424  45.952  1.00 13.43 ? 310  ASP B CA  1 
ATOM   6130  C  C   . ASP B 1 313 ? 89.803  75.138  45.616  1.00 15.01 ? 310  ASP B C   1 
ATOM   6131  O  O   . ASP B 1 313 ? 89.804  76.322  45.259  1.00 13.64 ? 310  ASP B O   1 
ATOM   6132  C  CB  . ASP B 1 313 ? 87.622  75.186  46.978  1.00 13.26 ? 310  ASP B CB  1 
ATOM   6133  C  CG  . ASP B 1 313 ? 86.220  74.565  47.150  1.00 17.33 ? 310  ASP B CG  1 
ATOM   6134  O  OD1 . ASP B 1 313 ? 85.887  73.656  46.357  1.00 20.10 ? 310  ASP B OD1 1 
ATOM   6135  O  OD2 . ASP B 1 313 ? 85.455  74.951  48.074  1.00 14.83 ? 310  ASP B OD2 1 
ATOM   6136  N  N   . LEU B 1 314 ? 90.933  74.444  45.737  1.00 15.41 ? 311  LEU B N   1 
ATOM   6137  C  CA  . LEU B 1 314 ? 92.189  75.040  45.291  1.00 16.30 ? 311  LEU B CA  1 
ATOM   6138  C  C   . LEU B 1 314 ? 92.156  75.050  43.740  1.00 16.97 ? 311  LEU B C   1 
ATOM   6139  O  O   . LEU B 1 314 ? 92.916  75.765  43.101  1.00 16.67 ? 311  LEU B O   1 
ATOM   6140  C  CB  . LEU B 1 314 ? 93.415  74.270  45.805  1.00 16.59 ? 311  LEU B CB  1 
ATOM   6141  C  CG  . LEU B 1 314 ? 93.734  74.458  47.296  1.00 15.74 ? 311  LEU B CG  1 
ATOM   6142  C  CD1 . LEU B 1 314 ? 94.958  73.627  47.705  1.00 13.67 ? 311  LEU B CD1 1 
ATOM   6143  C  CD2 . LEU B 1 314 ? 93.963  75.955  47.587  1.00 12.70 ? 311  LEU B CD2 1 
ATOM   6144  N  N   . HIS B 1 315 ? 91.269  74.242  43.156  1.00 16.17 ? 312  HIS B N   1 
ATOM   6145  C  CA  . HIS B 1 315 ? 91.109  74.166  41.686  1.00 16.85 ? 312  HIS B CA  1 
ATOM   6146  C  C   . HIS B 1 315 ? 89.937  75.002  41.177  1.00 17.54 ? 312  HIS B C   1 
ATOM   6147  O  O   . HIS B 1 315 ? 89.552  74.884  39.998  1.00 19.51 ? 312  HIS B O   1 
ATOM   6148  C  CB  . HIS B 1 315 ? 90.910  72.718  41.265  1.00 16.74 ? 312  HIS B CB  1 
ATOM   6149  C  CG  . HIS B 1 315 ? 92.029  71.826  41.677  1.00 13.82 ? 312  HIS B CG  1 
ATOM   6150  N  ND1 . HIS B 1 315 ? 93.020  71.432  40.809  1.00 13.80 ? 312  HIS B ND1 1 
ATOM   6151  C  CD2 . HIS B 1 315 ? 92.361  71.315  42.888  1.00 15.49 ? 312  HIS B CD2 1 
ATOM   6152  C  CE1 . HIS B 1 315 ? 93.893  70.673  41.455  1.00 14.14 ? 312  HIS B CE1 1 
ATOM   6153  N  NE2 . HIS B 1 315 ? 93.515  70.586  42.719  1.00 16.71 ? 312  HIS B NE2 1 
ATOM   6154  N  N   . SER B 1 316 ? 89.344  75.800  42.073  1.00 17.39 ? 313  SER B N   1 
ATOM   6155  C  CA  . SER B 1 316 ? 88.256  76.710  41.723  1.00 17.35 ? 313  SER B CA  1 
ATOM   6156  C  C   . SER B 1 316 ? 88.563  78.133  42.233  1.00 17.17 ? 313  SER B C   1 
ATOM   6157  O  O   . SER B 1 316 ? 88.552  79.091  41.449  1.00 16.44 ? 313  SER B O   1 
ATOM   6158  C  CB  . SER B 1 316 ? 86.886  76.206  42.234  1.00 17.97 ? 313  SER B CB  1 
ATOM   6159  O  OG  . SER B 1 316 ? 86.844  76.027  43.638  1.00 19.57 ? 313  SER B OG  1 
ATOM   6160  N  N   . LEU B 1 317 ? 88.837  78.260  43.533  1.00 15.70 ? 314  LEU B N   1 
ATOM   6161  C  CA  . LEU B 1 317 ? 89.168  79.544  44.150  1.00 15.97 ? 314  LEU B CA  1 
ATOM   6162  C  C   . LEU B 1 317 ? 90.660  79.716  44.465  1.00 14.73 ? 314  LEU B C   1 
ATOM   6163  O  O   . LEU B 1 317 ? 91.069  80.772  44.944  1.00 14.45 ? 314  LEU B O   1 
ATOM   6164  C  CB  . LEU B 1 317 ? 88.378  79.743  45.450  1.00 16.92 ? 314  LEU B CB  1 
ATOM   6165  C  CG  . LEU B 1 317 ? 86.887  80.054  45.286  1.00 22.39 ? 314  LEU B CG  1 
ATOM   6166  C  CD1 . LEU B 1 317 ? 86.283  80.378  46.653  1.00 25.57 ? 314  LEU B CD1 1 
ATOM   6167  C  CD2 . LEU B 1 317 ? 86.725  81.229  44.331  1.00 24.54 ? 314  LEU B CD2 1 
ATOM   6168  N  N   . GLY B 1 318 ? 91.459  78.680  44.236  1.00 13.37 ? 315  GLY B N   1 
ATOM   6169  C  CA  . GLY B 1 318 ? 92.895  78.730  44.529  1.00 14.04 ? 315  GLY B CA  1 
ATOM   6170  C  C   . GLY B 1 318 ? 93.634  79.886  43.864  1.00 14.35 ? 315  GLY B C   1 
ATOM   6171  O  O   . GLY B 1 318 ? 94.502  80.503  44.474  1.00 14.29 ? 315  GLY B O   1 
ATOM   6172  N  N   . GLN B 1 319 ? 93.335  80.121  42.595  1.00 13.49 ? 316  GLN B N   1 
ATOM   6173  C  CA  . GLN B 1 319 ? 93.936  81.216  41.839  1.00 13.09 ? 316  GLN B CA  1 
ATOM   6174  C  C   . GLN B 1 319 ? 93.631  82.542  42.550  1.00 12.73 ? 316  GLN B C   1 
ATOM   6175  O  O   . GLN B 1 319 ? 94.529  83.342  42.835  1.00 12.06 ? 316  GLN B O   1 
ATOM   6176  C  CB  . GLN B 1 319 ? 93.364  81.210  40.400  1.00 13.44 ? 316  GLN B CB  1 
ATOM   6177  C  CG  . GLN B 1 319 ? 93.662  82.460  39.566  1.00 14.70 ? 316  GLN B CG  1 
ATOM   6178  C  CD  . GLN B 1 319 ? 95.151  82.660  39.330  1.00 13.97 ? 316  GLN B CD  1 
ATOM   6179  O  OE1 . GLN B 1 319 ? 95.844  81.739  38.946  1.00 11.97 ? 316  GLN B OE1 1 
ATOM   6180  N  NE2 . GLN B 1 319 ? 95.633  83.880  39.540  1.00 10.41 ? 316  GLN B NE2 1 
ATOM   6181  N  N   . TYR B 1 320 ? 92.362  82.743  42.881  1.00 11.80 ? 317  TYR B N   1 
ATOM   6182  C  CA  . TYR B 1 320 ? 91.939  83.969  43.544  1.00 13.21 ? 317  TYR B CA  1 
ATOM   6183  C  C   . TYR B 1 320 ? 92.585  84.142  44.929  1.00 14.02 ? 317  TYR B C   1 
ATOM   6184  O  O   . TYR B 1 320 ? 93.053  85.228  45.266  1.00 14.40 ? 317  TYR B O   1 
ATOM   6185  C  CB  . TYR B 1 320 ? 90.411  84.027  43.690  1.00 12.85 ? 317  TYR B CB  1 
ATOM   6186  C  CG  . TYR B 1 320 ? 89.950  85.412  44.066  1.00 11.47 ? 317  TYR B CG  1 
ATOM   6187  C  CD1 . TYR B 1 320 ? 89.439  86.272  43.100  1.00 14.58 ? 317  TYR B CD1 1 
ATOM   6188  C  CD2 . TYR B 1 320 ? 90.092  85.892  45.363  1.00 12.01 ? 317  TYR B CD2 1 
ATOM   6189  C  CE1 . TYR B 1 320 ? 89.065  87.554  43.414  1.00 11.32 ? 317  TYR B CE1 1 
ATOM   6190  C  CE2 . TYR B 1 320 ? 89.735  87.191  45.686  1.00 11.23 ? 317  TYR B CE2 1 
ATOM   6191  C  CZ  . TYR B 1 320 ? 89.211  88.012  44.710  1.00 13.65 ? 317  TYR B CZ  1 
ATOM   6192  O  OH  . TYR B 1 320 ? 88.840  89.305  45.018  1.00 12.72 ? 317  TYR B OH  1 
ATOM   6193  N  N   . VAL B 1 321 ? 92.598  83.088  45.742  1.00 13.52 ? 318  VAL B N   1 
ATOM   6194  C  CA  . VAL B 1 321 ? 93.178  83.206  47.083  1.00 12.27 ? 318  VAL B CA  1 
ATOM   6195  C  C   . VAL B 1 321 ? 94.658  83.577  46.961  1.00 11.84 ? 318  VAL B C   1 
ATOM   6196  O  O   . VAL B 1 321 ? 95.170  84.360  47.739  1.00 11.67 ? 318  VAL B O   1 
ATOM   6197  C  CB  . VAL B 1 321 ? 93.008  81.918  47.919  1.00 11.10 ? 318  VAL B CB  1 
ATOM   6198  C  CG1 . VAL B 1 321 ? 93.794  82.024  49.201  1.00 12.91 ? 318  VAL B CG1 1 
ATOM   6199  C  CG2 . VAL B 1 321 ? 91.511  81.650  48.216  1.00 10.68 ? 318  VAL B CG2 1 
ATOM   6200  N  N   . GLN B 1 322 ? 95.331  83.045  45.953  1.00 12.00 ? 319  GLN B N   1 
ATOM   6201  C  CA  . GLN B 1 322 ? 96.739  83.351  45.776  1.00 12.46 ? 319  GLN B CA  1 
ATOM   6202  C  C   . GLN B 1 322 ? 97.023  84.732  45.173  1.00 12.46 ? 319  GLN B C   1 
ATOM   6203  O  O   . GLN B 1 322 ? 97.990  85.380  45.579  1.00 13.80 ? 319  GLN B O   1 
ATOM   6204  C  CB  . GLN B 1 322 ? 97.411  82.325  44.867  1.00 11.96 ? 319  GLN B CB  1 
ATOM   6205  C  CG  . GLN B 1 322 ? 98.951  82.441  44.868  1.00 12.59 ? 319  GLN B CG  1 
ATOM   6206  C  CD  . GLN B 1 322 ? 99.560  81.950  46.169  1.00 12.00 ? 319  GLN B CD  1 
ATOM   6207  O  OE1 . GLN B 1 322 ? 99.162  80.908  46.696  1.00 11.11 ? 319  GLN B OE1 1 
ATOM   6208  N  NE2 . GLN B 1 322 ? 100.566 82.667  46.668  1.00 10.15 ? 319  GLN B NE2 1 
ATOM   6209  N  N   . GLU B 1 323 ? 96.214  85.165  44.202  1.00 11.79 ? 320  GLU B N   1 
ATOM   6210  C  CA  . GLU B 1 323 ? 96.527  86.395  43.450  1.00 13.29 ? 320  GLU B CA  1 
ATOM   6211  C  C   . GLU B 1 323 ? 95.417  87.423  43.188  1.00 13.90 ? 320  GLU B C   1 
ATOM   6212  O  O   . GLU B 1 323 ? 95.621  88.346  42.391  1.00 14.80 ? 320  GLU B O   1 
ATOM   6213  C  CB  . GLU B 1 323 ? 97.135  86.005  42.102  1.00 13.69 ? 320  GLU B CB  1 
ATOM   6214  C  CG  . GLU B 1 323 ? 98.388  85.128  42.224  1.00 16.00 ? 320  GLU B CG  1 
ATOM   6215  C  CD  . GLU B 1 323 ? 99.056  84.806  40.891  1.00 17.61 ? 320  GLU B CD  1 
ATOM   6216  O  OE1 . GLU B 1 323 ? 98.371  84.759  39.833  1.00 16.94 ? 320  GLU B OE1 1 
ATOM   6217  O  OE2 . GLU B 1 323 ? 100.283 84.553  40.915  1.00 21.56 ? 320  GLU B OE2 1 
ATOM   6218  N  N   . GLY B 1 324 ? 94.253  87.255  43.819  1.00 13.86 ? 321  GLY B N   1 
ATOM   6219  C  CA  . GLY B 1 324 ? 93.152  88.203  43.669  1.00 12.89 ? 321  GLY B CA  1 
ATOM   6220  C  C   . GLY B 1 324 ? 93.302  89.366  44.639  1.00 13.38 ? 321  GLY B C   1 
ATOM   6221  O  O   . GLY B 1 324 ? 94.415  89.675  45.070  1.00 12.76 ? 321  GLY B O   1 
ATOM   6222  N  N   . ARG B 1 325 ? 92.202  90.041  44.964  1.00 13.62 ? 322  ARG B N   1 
ATOM   6223  C  CA  . ARG B 1 325 ? 92.256  91.164  45.904  1.00 15.85 ? 322  ARG B CA  1 
ATOM   6224  C  C   . ARG B 1 325 ? 92.739  90.656  47.267  1.00 15.42 ? 322  ARG B C   1 
ATOM   6225  O  O   . ARG B 1 325 ? 92.346  89.572  47.709  1.00 13.17 ? 322  ARG B O   1 
ATOM   6226  C  CB  . ARG B 1 325 ? 90.874  91.817  46.059  1.00 17.50 ? 322  ARG B CB  1 
ATOM   6227  C  CG  . ARG B 1 325 ? 90.427  92.604  44.849  1.00 20.48 ? 322  ARG B CG  1 
ATOM   6228  C  CD  . ARG B 1 325 ? 91.152  93.921  44.774  1.00 25.62 ? 322  ARG B CD  1 
ATOM   6229  N  NE  . ARG B 1 325 ? 90.700  94.836  45.827  1.00 28.99 ? 322  ARG B NE  1 
ATOM   6230  C  CZ  . ARG B 1 325 ? 89.738  95.750  45.680  1.00 19.61 ? 322  ARG B CZ  1 
ATOM   6231  N  NH1 . ARG B 1 325 ? 89.125  95.894  44.533  1.00 18.88 ? 322  ARG B NH1 1 
ATOM   6232  N  NH2 . ARG B 1 325 ? 89.404  96.524  46.690  1.00 21.53 ? 322  ARG B NH2 1 
ATOM   6233  N  N   . ARG B 1 326 ? 93.594  91.450  47.912  1.00 15.62 ? 323  ARG B N   1 
ATOM   6234  C  CA  . ARG B 1 326 ? 94.151  91.112  49.218  1.00 15.71 ? 323  ARG B CA  1 
ATOM   6235  C  C   . ARG B 1 326 ? 93.261  91.647  50.373  1.00 15.75 ? 323  ARG B C   1 
ATOM   6236  O  O   . ARG B 1 326 ? 93.714  92.437  51.209  1.00 15.66 ? 323  ARG B O   1 
ATOM   6237  C  CB  . ARG B 1 326 ? 95.586  91.668  49.344  1.00 15.71 ? 323  ARG B CB  1 
ATOM   6238  C  CG  . ARG B 1 326 ? 96.608  91.262  48.241  1.00 14.74 ? 323  ARG B CG  1 
ATOM   6239  C  CD  . ARG B 1 326 ? 96.845  89.736  48.146  1.00 15.03 ? 323  ARG B CD  1 
ATOM   6240  N  NE  . ARG B 1 326 ? 95.662  89.044  47.670  1.00 12.43 ? 323  ARG B NE  1 
ATOM   6241  C  CZ  . ARG B 1 326 ? 95.502  87.724  47.636  1.00 15.23 ? 323  ARG B CZ  1 
ATOM   6242  N  NH1 . ARG B 1 326 ? 96.461  86.911  48.038  1.00 17.32 ? 323  ARG B NH1 1 
ATOM   6243  N  NH2 . ARG B 1 326 ? 94.356  87.218  47.197  1.00 13.34 ? 323  ARG B NH2 1 
ATOM   6244  N  N   . ASP B 1 327 ? 91.999  91.213  50.402  1.00 15.52 ? 324  ASP B N   1 
ATOM   6245  C  CA  . ASP B 1 327 ? 91.024  91.607  51.433  1.00 15.48 ? 324  ASP B CA  1 
ATOM   6246  C  C   . ASP B 1 327 ? 90.552  90.379  52.247  1.00 15.10 ? 324  ASP B C   1 
ATOM   6247  O  O   . ASP B 1 327 ? 89.552  90.460  52.990  1.00 14.77 ? 324  ASP B O   1 
ATOM   6248  C  CB  . ASP B 1 327 ? 89.769  92.208  50.771  1.00 17.68 ? 324  ASP B CB  1 
ATOM   6249  C  CG  . ASP B 1 327 ? 90.052  93.474  49.994  1.00 23.98 ? 324  ASP B CG  1 
ATOM   6250  O  OD1 . ASP B 1 327 ? 91.021  94.200  50.334  1.00 27.73 ? 324  ASP B OD1 1 
ATOM   6251  O  OD2 . ASP B 1 327 ? 89.260  93.764  49.070  1.00 29.98 ? 324  ASP B OD2 1 
ATOM   6252  N  N   . LEU B 1 328 ? 91.272  89.271  52.095  1.00 13.45 ? 325  LEU B N   1 
ATOM   6253  C  CA  . LEU B 1 328 ? 90.959  87.975  52.715  1.00 14.60 ? 325  LEU B CA  1 
ATOM   6254  C  C   . LEU B 1 328 ? 91.903  87.502  53.800  1.00 13.48 ? 325  LEU B C   1 
ATOM   6255  O  O   . LEU B 1 328 ? 93.089  87.843  53.794  1.00 13.52 ? 325  LEU B O   1 
ATOM   6256  C  CB  . LEU B 1 328 ? 91.191  86.851  51.671  1.00 16.34 ? 325  LEU B CB  1 
ATOM   6257  C  CG  . LEU B 1 328 ? 90.732  86.972  50.233  1.00 22.04 ? 325  LEU B CG  1 
ATOM   6258  C  CD1 . LEU B 1 328 ? 91.194  85.767  49.398  1.00 21.83 ? 325  LEU B CD1 1 
ATOM   6259  C  CD2 . LEU B 1 328 ? 89.225  87.085  50.228  1.00 27.17 ? 325  LEU B CD2 1 
ATOM   6260  N  N   . PHE B 1 329 ? 91.365  86.709  54.726  1.00 12.11 ? 326  PHE B N   1 
ATOM   6261  C  CA  . PHE B 1 329 ? 92.198  85.947  55.664  1.00 12.67 ? 326  PHE B CA  1 
ATOM   6262  C  C   . PHE B 1 329 ? 91.531  84.568  55.707  1.00 12.64 ? 326  PHE B C   1 
ATOM   6263  O  O   . PHE B 1 329 ? 90.345  84.425  55.353  1.00 13.71 ? 326  PHE B O   1 
ATOM   6264  C  CB  . PHE B 1 329 ? 92.504  86.599  57.051  1.00 11.65 ? 326  PHE B CB  1 
ATOM   6265  C  CG  . PHE B 1 329 ? 91.333  86.691  58.017  1.00 9.46  ? 326  PHE B CG  1 
ATOM   6266  C  CD1 . PHE B 1 329 ? 91.172  85.741  59.004  1.00 9.84  ? 326  PHE B CD1 1 
ATOM   6267  C  CD2 . PHE B 1 329 ? 90.469  87.773  57.996  1.00 12.46 ? 326  PHE B CD2 1 
ATOM   6268  C  CE1 . PHE B 1 329 ? 90.130  85.824  59.919  1.00 14.92 ? 326  PHE B CE1 1 
ATOM   6269  C  CE2 . PHE B 1 329 ? 89.418  87.876  58.912  1.00 12.85 ? 326  PHE B CE2 1 
ATOM   6270  C  CZ  . PHE B 1 329 ? 89.245  86.887  59.868  1.00 14.33 ? 326  PHE B CZ  1 
ATOM   6271  N  N   . GLU B 1 330 ? 92.313  83.555  56.024  1.00 12.78 ? 327  GLU B N   1 
ATOM   6272  C  CA  . GLU B 1 330 ? 91.830  82.181  56.129  1.00 13.57 ? 327  GLU B CA  1 
ATOM   6273  C  C   . GLU B 1 330 ? 91.972  81.623  57.535  1.00 14.13 ? 327  GLU B C   1 
ATOM   6274  O  O   . GLU B 1 330 ? 92.983  81.852  58.221  1.00 14.38 ? 327  GLU B O   1 
ATOM   6275  C  CB  . GLU B 1 330 ? 92.620  81.281  55.175  1.00 14.16 ? 327  GLU B CB  1 
ATOM   6276  C  CG  . GLU B 1 330 ? 92.289  81.514  53.712  1.00 14.62 ? 327  GLU B CG  1 
ATOM   6277  C  CD  . GLU B 1 330 ? 93.125  80.716  52.736  1.00 17.11 ? 327  GLU B CD  1 
ATOM   6278  O  OE1 . GLU B 1 330 ? 94.374  80.840  52.737  1.00 17.84 ? 327  GLU B OE1 1 
ATOM   6279  O  OE2 . GLU B 1 330 ? 92.515  80.016  51.891  1.00 23.74 ? 327  GLU B OE2 1 
ATOM   6280  N  N   . THR B 1 331 ? 90.953  80.878  57.963  1.00 15.12 ? 328  THR B N   1 
ATOM   6281  C  CA  . THR B 1 331 ? 90.961  80.198  59.246  1.00 14.67 ? 328  THR B CA  1 
ATOM   6282  C  C   . THR B 1 331 ? 90.804  78.743  58.857  1.00 15.41 ? 328  THR B C   1 
ATOM   6283  O  O   . THR B 1 331 ? 89.770  78.346  58.307  1.00 15.82 ? 328  THR B O   1 
ATOM   6284  C  CB  . THR B 1 331 ? 89.832  80.677  60.154  1.00 14.76 ? 328  THR B CB  1 
ATOM   6285  O  OG1 . THR B 1 331 ? 90.040  82.057  60.446  1.00 17.17 ? 328  THR B OG1 1 
ATOM   6286  C  CG2 . THR B 1 331 ? 89.792  79.896  61.466  1.00 13.10 ? 328  THR B CG2 1 
ATOM   6287  N  N   . VAL B 1 332 ? 91.835  77.952  59.118  1.00 15.01 ? 329  VAL B N   1 
ATOM   6288  C  CA  . VAL B 1 332 ? 91.844  76.563  58.705  1.00 14.82 ? 329  VAL B CA  1 
ATOM   6289  C  C   . VAL B 1 332 ? 91.548  75.566  59.811  1.00 15.86 ? 329  VAL B C   1 
ATOM   6290  O  O   . VAL B 1 332 ? 92.232  75.543  60.847  1.00 15.60 ? 329  VAL B O   1 
ATOM   6291  C  CB  . VAL B 1 332 ? 93.215  76.166  58.112  1.00 15.13 ? 329  VAL B CB  1 
ATOM   6292  C  CG1 . VAL B 1 332 ? 93.147  74.739  57.531  1.00 14.29 ? 329  VAL B CG1 1 
ATOM   6293  C  CG2 . VAL B 1 332 ? 93.652  77.147  57.036  1.00 14.28 ? 329  VAL B CG2 1 
ATOM   6294  N  N   . LEU B 1 333 ? 90.505  74.763  59.588  1.00 15.24 ? 330  LEU B N   1 
ATOM   6295  C  CA  . LEU B 1 333 ? 90.146  73.687  60.495  1.00 16.35 ? 330  LEU B CA  1 
ATOM   6296  C  C   . LEU B 1 333 ? 91.034  72.488  60.124  1.00 15.83 ? 330  LEU B C   1 
ATOM   6297  O  O   . LEU B 1 333 ? 90.860  71.864  59.091  1.00 18.30 ? 330  LEU B O   1 
ATOM   6298  C  CB  . LEU B 1 333 ? 88.661  73.308  60.365  1.00 16.79 ? 330  LEU B CB  1 
ATOM   6299  C  CG  . LEU B 1 333 ? 87.652  74.406  60.667  1.00 16.58 ? 330  LEU B CG  1 
ATOM   6300  C  CD1 . LEU B 1 333 ? 86.220  73.913  60.360  1.00 18.10 ? 330  LEU B CD1 1 
ATOM   6301  C  CD2 . LEU B 1 333 ? 87.772  74.884  62.122  1.00 17.98 ? 330  LEU B CD2 1 
ATOM   6302  N  N   . LYS B 1 334 ? 92.028  72.213  60.941  1.00 15.79 ? 331  LYS B N   1 
ATOM   6303  C  CA  . LYS B 1 334 ? 92.938  71.114  60.681  1.00 15.13 ? 331  LYS B CA  1 
ATOM   6304  C  C   . LYS B 1 334 ? 92.676  69.955  61.654  1.00 15.19 ? 331  LYS B C   1 
ATOM   6305  O  O   . LYS B 1 334 ? 92.798  70.108  62.875  1.00 15.36 ? 331  LYS B O   1 
ATOM   6306  C  CB  . LYS B 1 334 ? 94.379  71.611  60.803  1.00 14.81 ? 331  LYS B CB  1 
ATOM   6307  C  CG  . LYS B 1 334 ? 95.451  70.550  60.626  1.00 16.48 ? 331  LYS B CG  1 
ATOM   6308  C  CD  . LYS B 1 334 ? 95.392  69.909  59.258  1.00 16.35 ? 331  LYS B CD  1 
ATOM   6309  C  CE  . LYS B 1 334 ? 96.510  68.902  59.060  1.00 18.59 ? 331  LYS B CE  1 
ATOM   6310  N  NZ  . LYS B 1 334 ? 96.348  67.691  59.908  1.00 20.53 ? 331  LYS B NZ  1 
ATOM   6311  N  N   . VAL B 1 335 ? 92.322  68.800  61.101  1.00 14.99 ? 332  VAL B N   1 
ATOM   6312  C  CA  . VAL B 1 335 ? 92.021  67.600  61.886  1.00 15.24 ? 332  VAL B CA  1 
ATOM   6313  C  C   . VAL B 1 335 ? 93.313  66.776  62.047  1.00 16.21 ? 332  VAL B C   1 
ATOM   6314  O  O   . VAL B 1 335 ? 93.972  66.471  61.063  1.00 15.15 ? 332  VAL B O   1 
ATOM   6315  C  CB  . VAL B 1 335 ? 90.926  66.766  61.156  1.00 16.13 ? 332  VAL B CB  1 
ATOM   6316  C  CG1 . VAL B 1 335 ? 90.632  65.440  61.881  1.00 16.06 ? 332  VAL B CG1 1 
ATOM   6317  C  CG2 . VAL B 1 335 ? 89.669  67.598  60.985  1.00 14.02 ? 332  VAL B CG2 1 
ATOM   6318  N  N   . GLY B 1 336 ? 93.676  66.441  63.287  1.00 16.59 ? 333  GLY B N   1 
ATOM   6319  C  CA  . GLY B 1 336 ? 94.911  65.699  63.555  1.00 17.95 ? 333  GLY B CA  1 
ATOM   6320  C  C   . GLY B 1 336 ? 94.900  64.224  63.202  1.00 17.91 ? 333  GLY B C   1 
ATOM   6321  O  O   . GLY B 1 336 ? 95.895  63.689  62.720  1.00 19.18 ? 333  GLY B O   1 
ATOM   6322  N  N   . LYS B 1 337 ? 93.790  63.549  63.448  1.00 18.46 ? 334  LYS B N   1 
ATOM   6323  C  CA  . LYS B 1 337 ? 93.712  62.119  63.137  1.00 18.90 ? 334  LYS B CA  1 
ATOM   6324  C  C   . LYS B 1 337 ? 92.519  61.830  62.251  1.00 18.63 ? 334  LYS B C   1 
ATOM   6325  O  O   . LYS B 1 337 ? 91.385  62.109  62.630  1.00 18.02 ? 334  LYS B O   1 
ATOM   6326  C  CB  . LYS B 1 337 ? 93.615  61.283  64.424  1.00 19.80 ? 334  LYS B CB  1 
ATOM   6327  C  CG  . LYS B 1 337 ? 93.469  59.749  64.186  1.00 22.98 ? 334  LYS B CG  1 
ATOM   6328  C  CD  . LYS B 1 337 ? 94.736  59.149  63.554  1.00 27.13 ? 334  LYS B CD  1 
ATOM   6329  C  CE  . LYS B 1 337 ? 94.574  57.665  63.172  1.00 30.52 ? 334  LYS B CE  1 
ATOM   6330  N  NZ  . LYS B 1 337 ? 93.667  57.477  61.998  1.00 26.06 ? 334  LYS B NZ  1 
ATOM   6331  N  N   . SER B 1 338 ? 92.787  61.263  61.073  1.00 17.94 ? 335  SER B N   1 
ATOM   6332  C  CA  . SER B 1 338 ? 91.744  60.893  60.128  1.00 19.19 ? 335  SER B CA  1 
ATOM   6333  C  C   . SER B 1 338 ? 90.941  59.710  60.672  1.00 19.25 ? 335  SER B C   1 
ATOM   6334  O  O   . SER B 1 338 ? 91.485  58.825  61.313  1.00 18.57 ? 335  SER B O   1 
ATOM   6335  C  CB  . SER B 1 338 ? 92.373  60.498  58.787  1.00 19.23 ? 335  SER B CB  1 
ATOM   6336  O  OG  . SER B 1 338 ? 91.395  60.144  57.830  1.00 22.98 ? 335  SER B OG  1 
ATOM   6337  N  N   . THR B 1 339 ? 89.646  59.699  60.414  1.00 18.66 ? 336  THR B N   1 
ATOM   6338  C  CA  . THR B 1 339 ? 88.810  58.601  60.865  1.00 19.14 ? 336  THR B CA  1 
ATOM   6339  C  C   . THR B 1 339 ? 89.269  57.293  60.230  1.00 18.67 ? 336  THR B C   1 
ATOM   6340  O  O   . THR B 1 339 ? 89.385  56.277  60.925  1.00 17.89 ? 336  THR B O   1 
ATOM   6341  C  CB  . THR B 1 339 ? 87.331  58.906  60.559  1.00 20.23 ? 336  THR B CB  1 
ATOM   6342  O  OG1 . THR B 1 339 ? 86.993  60.158  61.177  1.00 18.78 ? 336  THR B OG1 1 
ATOM   6343  C  CG2 . THR B 1 339 ? 86.435  57.806  61.077  1.00 20.77 ? 336  THR B CG2 1 
ATOM   6344  N  N   . HIS B 1 340 ? 89.562  57.310  58.921  1.00 18.70 ? 337  HIS B N   1 
ATOM   6345  C  CA  . HIS B 1 340 ? 90.052  56.106  58.225  1.00 18.39 ? 337  HIS B CA  1 
ATOM   6346  C  C   . HIS B 1 340 ? 91.393  56.388  57.560  1.00 17.49 ? 337  HIS B C   1 
ATOM   6347  O  O   . HIS B 1 340 ? 91.662  57.515  57.124  1.00 19.75 ? 337  HIS B O   1 
ATOM   6348  C  CB  . HIS B 1 340 ? 89.047  55.584  57.185  1.00 18.95 ? 337  HIS B CB  1 
ATOM   6349  C  CG  . HIS B 1 340 ? 87.678  55.342  57.739  1.00 19.98 ? 337  HIS B CG  1 
ATOM   6350  N  ND1 . HIS B 1 340 ? 87.411  54.350  58.651  1.00 21.03 ? 337  HIS B ND1 1 
ATOM   6351  C  CD2 . HIS B 1 340 ? 86.491  55.942  57.479  1.00 21.39 ? 337  HIS B CD2 1 
ATOM   6352  C  CE1 . HIS B 1 340 ? 86.124  54.365  58.954  1.00 21.18 ? 337  HIS B CE1 1 
ATOM   6353  N  NE2 . HIS B 1 340 ? 85.542  55.319  58.252  1.00 21.08 ? 337  HIS B NE2 1 
ATOM   6354  N  N   . GLU B 1 341 ? 92.246  55.376  57.508  1.00 16.53 ? 338  GLU B N   1 
ATOM   6355  C  CA  . GLU B 1 341 ? 93.558  55.511  56.888  1.00 15.54 ? 338  GLU B CA  1 
ATOM   6356  C  C   . GLU B 1 341 ? 93.636  54.608  55.667  1.00 14.74 ? 338  GLU B C   1 
ATOM   6357  O  O   . GLU B 1 341 ? 93.083  53.509  55.652  1.00 15.87 ? 338  GLU B O   1 
ATOM   6358  C  CB  . GLU B 1 341 ? 94.686  55.093  57.861  1.00 16.40 ? 338  GLU B CB  1 
ATOM   6359  C  CG  . GLU B 1 341 ? 94.771  55.876  59.185  1.00 18.20 ? 338  GLU B CG  1 
ATOM   6360  C  CD  . GLU B 1 341 ? 95.289  57.297  59.043  1.00 20.67 ? 338  GLU B CD  1 
ATOM   6361  O  OE1 . GLU B 1 341 ? 95.611  57.731  57.914  1.00 20.49 ? 338  GLU B OE1 1 
ATOM   6362  O  OE2 . GLU B 1 341 ? 95.393  57.980  60.090  1.00 24.10 ? 338  GLU B OE2 1 
ATOM   6363  N  N   . LEU B 1 342 ? 94.330  55.086  54.647  1.00 13.17 ? 339  LEU B N   1 
ATOM   6364  C  CA  . LEU B 1 342 ? 94.565  54.334  53.429  1.00 13.41 ? 339  LEU B CA  1 
ATOM   6365  C  C   . LEU B 1 342 ? 96.040  54.467  53.105  1.00 13.61 ? 339  LEU B C   1 
ATOM   6366  O  O   . LEU B 1 342 ? 96.595  55.575  53.111  1.00 12.14 ? 339  LEU B O   1 
ATOM   6367  C  CB  . LEU B 1 342 ? 93.716  54.854  52.258  1.00 13.96 ? 339  LEU B CB  1 
ATOM   6368  C  CG  . LEU B 1 342 ? 92.222  54.571  52.266  1.00 13.55 ? 339  LEU B CG  1 
ATOM   6369  C  CD1 . LEU B 1 342 ? 91.582  55.251  51.057  1.00 18.12 ? 339  LEU B CD1 1 
ATOM   6370  C  CD2 . LEU B 1 342 ? 91.979  53.057  52.236  1.00 14.81 ? 339  LEU B CD2 1 
ATOM   6371  N  N   . THR B 1 343 ? 96.687  53.327  52.886  1.00 14.76 ? 340  THR B N   1 
ATOM   6372  C  CA  . THR B 1 343 ? 98.095  53.312  52.559  1.00 15.68 ? 340  THR B CA  1 
ATOM   6373  C  C   . THR B 1 343 ? 98.274  53.182  51.069  1.00 15.98 ? 340  THR B C   1 
ATOM   6374  O  O   . THR B 1 343 ? 97.706  52.291  50.444  1.00 15.57 ? 340  THR B O   1 
ATOM   6375  C  CB  . THR B 1 343 ? 98.830  52.164  53.269  1.00 15.28 ? 340  THR B CB  1 
ATOM   6376  O  OG1 . THR B 1 343 ? 98.764  52.392  54.676  1.00 17.33 ? 340  THR B OG1 1 
ATOM   6377  C  CG2 . THR B 1 343 ? 100.302 52.120  52.859  1.00 16.86 ? 340  THR B CG2 1 
ATOM   6378  N  N   . ILE B 1 344 ? 99.084  54.075  50.519  1.00 15.48 ? 341  ILE B N   1 
ATOM   6379  C  CA  . ILE B 1 344 ? 99.383  54.103  49.095  1.00 15.52 ? 341  ILE B CA  1 
ATOM   6380  C  C   . ILE B 1 344 ? 100.287 52.942  48.711  1.00 16.76 ? 341  ILE B C   1 
ATOM   6381  O  O   . ILE B 1 344 ? 101.285 52.681  49.383  1.00 16.31 ? 341  ILE B O   1 
ATOM   6382  C  CB  . ILE B 1 344 ? 100.062 55.419  48.721  1.00 15.37 ? 341  ILE B CB  1 
ATOM   6383  C  CG1 . ILE B 1 344 ? 99.146  56.600  49.063  1.00 14.56 ? 341  ILE B CG1 1 
ATOM   6384  C  CG2 . ILE B 1 344 ? 100.437 55.425  47.243  1.00 15.80 ? 341  ILE B CG2 1 
ATOM   6385  C  CD1 . ILE B 1 344 ? 99.805  57.951  48.903  1.00 15.32 ? 341  ILE B CD1 1 
ATOM   6386  N  N   . GLU B 1 345 ? 99.921  52.237  47.643  1.00 17.49 ? 342  GLU B N   1 
ATOM   6387  C  CA  . GLU B 1 345 ? 100.700 51.091  47.170  1.00 20.21 ? 342  GLU B CA  1 
ATOM   6388  C  C   . GLU B 1 345 ? 101.477 51.426  45.907  1.00 21.10 ? 342  GLU B C   1 
ATOM   6389  O  O   . GLU B 1 345 ? 101.115 52.314  45.138  1.00 21.05 ? 342  GLU B O   1 
ATOM   6390  C  CB  . GLU B 1 345 ? 99.795  49.900  46.861  1.00 19.86 ? 342  GLU B CB  1 
ATOM   6391  C  CG  . GLU B 1 345 ? 98.926  49.422  47.993  1.00 23.16 ? 342  GLU B CG  1 
ATOM   6392  C  CD  . GLU B 1 345 ? 98.070  48.247  47.573  1.00 29.14 ? 342  GLU B CD  1 
ATOM   6393  O  OE1 . GLU B 1 345 ? 98.607  47.309  46.943  1.00 36.18 ? 342  GLU B OE1 1 
ATOM   6394  O  OE2 . GLU B 1 345 ? 96.866  48.245  47.882  1.00 34.84 ? 342  GLU B OE2 1 
ATOM   6395  N  N   . SER B 1 346 ? 102.549 50.699  45.679  1.00 22.55 ? 343  SER B N   1 
ATOM   6396  C  CA  . SER B 1 346 ? 103.338 50.934  44.501  1.00 24.19 ? 343  SER B CA  1 
ATOM   6397  C  C   . SER B 1 346 ? 102.743 50.121  43.352  1.00 24.85 ? 343  SER B C   1 
ATOM   6398  O  O   . SER B 1 346 ? 101.989 49.168  43.574  1.00 24.40 ? 343  SER B O   1 
ATOM   6399  C  CB  . SER B 1 346 ? 104.776 50.501  44.760  1.00 25.27 ? 343  SER B CB  1 
ATOM   6400  O  OG  . SER B 1 346 ? 104.805 49.150  45.173  1.00 27.55 ? 343  SER B OG  1 
ATOM   6401  N  N   . GLU B 1 347 ? 103.019 50.536  42.126  1.00 25.46 ? 344  GLU B N   1 
ATOM   6402  C  CA  . GLU B 1 347 ? 102.564 49.772  40.983  1.00 26.58 ? 344  GLU B CA  1 
ATOM   6403  C  C   . GLU B 1 347 ? 103.779 49.467  40.112  1.00 26.58 ? 344  GLU B C   1 
ATOM   6404  O  O   . GLU B 1 347 ? 104.768 50.201  40.137  1.00 24.75 ? 344  GLU B O   1 
ATOM   6405  C  CB  . GLU B 1 347 ? 101.392 50.436  40.245  1.00 27.78 ? 344  GLU B CB  1 
ATOM   6406  C  CG  . GLU B 1 347 ? 101.583 51.837  39.747  1.00 32.32 ? 344  GLU B CG  1 
ATOM   6407  C  CD  . GLU B 1 347 ? 100.297 52.398  39.108  1.00 36.12 ? 344  GLU B CD  1 
ATOM   6408  O  OE1 . GLU B 1 347 ? 99.198  52.292  39.721  1.00 36.90 ? 344  GLU B OE1 1 
ATOM   6409  O  OE2 . GLU B 1 347 ? 100.395 52.968  37.999  1.00 36.43 ? 344  GLU B OE2 1 
ATOM   6410  N  N   . GLU B 1 348 ? 103.736 48.361  39.381  1.00 27.16 ? 345  GLU B N   1 
ATOM   6411  C  CA  . GLU B 1 348 ? 104.896 47.988  38.565  1.00 28.60 ? 345  GLU B CA  1 
ATOM   6412  C  C   . GLU B 1 348 ? 105.216 48.971  37.441  1.00 27.21 ? 345  GLU B C   1 
ATOM   6413  O  O   . GLU B 1 348 ? 106.374 49.095  37.047  1.00 27.34 ? 345  GLU B O   1 
ATOM   6414  C  CB  . GLU B 1 348 ? 104.812 46.536  38.076  1.00 29.38 ? 345  GLU B CB  1 
ATOM   6415  C  CG  . GLU B 1 348 ? 104.906 45.561  39.258  1.00 34.64 ? 345  GLU B CG  1 
ATOM   6416  C  CD  . GLU B 1 348 ? 105.402 44.180  38.886  1.00 41.00 ? 345  GLU B CD  1 
ATOM   6417  O  OE1 . GLU B 1 348 ? 105.788 43.962  37.712  1.00 45.58 ? 345  GLU B OE1 1 
ATOM   6418  O  OE2 . GLU B 1 348 ? 105.446 43.315  39.794  1.00 45.39 ? 345  GLU B OE2 1 
ATOM   6419  N  N   . ASN B 1 349 ? 104.210 49.690  36.957  1.00 25.93 ? 346  ASN B N   1 
ATOM   6420  C  CA  . ASN B 1 349 ? 104.425 50.660  35.895  1.00 24.97 ? 346  ASN B CA  1 
ATOM   6421  C  C   . ASN B 1 349 ? 104.070 52.032  36.469  1.00 23.05 ? 346  ASN B C   1 
ATOM   6422  O  O   . ASN B 1 349 ? 102.899 52.426  36.521  1.00 23.51 ? 346  ASN B O   1 
ATOM   6423  C  CB  . ASN B 1 349 ? 103.584 50.295  34.667  1.00 25.46 ? 346  ASN B CB  1 
ATOM   6424  C  CG  . ASN B 1 349 ? 104.001 51.057  33.408  1.00 27.76 ? 346  ASN B CG  1 
ATOM   6425  O  OD1 . ASN B 1 349 ? 104.782 52.008  33.459  1.00 31.56 ? 346  ASN B OD1 1 
ATOM   6426  N  ND2 . ASN B 1 349 ? 103.473 50.629  32.267  1.00 28.44 ? 346  ASN B ND2 1 
ATOM   6427  N  N   . ASP B 1 350 ? 105.102 52.747  36.902  1.00 20.77 ? 347  ASP B N   1 
ATOM   6428  C  CA  . ASP B 1 350 ? 104.966 54.050  37.547  1.00 20.16 ? 347  ASP B CA  1 
ATOM   6429  C  C   . ASP B 1 350 ? 104.727 55.185  36.555  1.00 18.72 ? 347  ASP B C   1 
ATOM   6430  O  O   . ASP B 1 350 ? 105.461 56.168  36.543  1.00 18.75 ? 347  ASP B O   1 
ATOM   6431  C  CB  . ASP B 1 350 ? 106.252 54.315  38.354  1.00 20.70 ? 347  ASP B CB  1 
ATOM   6432  C  CG  . ASP B 1 350 ? 106.157 55.528  39.262  1.00 22.49 ? 347  ASP B CG  1 
ATOM   6433  O  OD1 . ASP B 1 350 ? 105.060 55.840  39.780  1.00 27.92 ? 347  ASP B OD1 1 
ATOM   6434  O  OD2 . ASP B 1 350 ? 107.206 56.157  39.494  1.00 27.28 ? 347  ASP B OD2 1 
ATOM   6435  N  N   . LEU B 1 351 ? 103.690 55.059  35.732  1.00 19.11 ? 348  LEU B N   1 
ATOM   6436  C  CA  . LEU B 1 351 ? 103.372 56.083  34.722  1.00 19.53 ? 348  LEU B CA  1 
ATOM   6437  C  C   . LEU B 1 351 ? 103.067 57.447  35.322  1.00 19.26 ? 348  LEU B C   1 
ATOM   6438  O  O   . LEU B 1 351 ? 103.532 58.477  34.817  1.00 19.35 ? 348  LEU B O   1 
ATOM   6439  C  CB  . LEU B 1 351 ? 102.177 55.638  33.859  1.00 19.64 ? 348  LEU B CB  1 
ATOM   6440  C  CG  . LEU B 1 351 ? 102.377 54.394  32.991  1.00 19.68 ? 348  LEU B CG  1 
ATOM   6441  C  CD1 . LEU B 1 351 ? 101.096 53.994  32.281  1.00 18.68 ? 348  LEU B CD1 1 
ATOM   6442  C  CD2 . LEU B 1 351 ? 103.526 54.594  31.958  1.00 19.20 ? 348  LEU B CD2 1 
ATOM   6443  N  N   . ASP B 1 352 ? 102.316 57.461  36.419  1.00 18.38 ? 349  ASP B N   1 
ATOM   6444  C  CA  . ASP B 1 352 ? 101.915 58.725  37.049  1.00 18.87 ? 349  ASP B CA  1 
ATOM   6445  C  C   . ASP B 1 352 ? 102.960 59.309  37.992  1.00 19.73 ? 349  ASP B C   1 
ATOM   6446  O  O   . ASP B 1 352 ? 102.740 60.373  38.594  1.00 20.06 ? 349  ASP B O   1 
ATOM   6447  C  CB  . ASP B 1 352 ? 100.583 58.544  37.781  1.00 19.63 ? 349  ASP B CB  1 
ATOM   6448  C  CG  . ASP B 1 352 ? 100.665 57.543  38.918  1.00 22.24 ? 349  ASP B CG  1 
ATOM   6449  O  OD1 . ASP B 1 352 ? 101.800 57.164  39.301  1.00 22.28 ? 349  ASP B OD1 1 
ATOM   6450  O  OD2 . ASP B 1 352 ? 99.594  57.142  39.441  1.00 22.03 ? 349  ASP B OD2 1 
ATOM   6451  N  N   . GLY B 1 353 ? 104.092 58.609  38.122  1.00 19.38 ? 350  GLY B N   1 
ATOM   6452  C  CA  . GLY B 1 353 ? 105.192 59.052  38.965  1.00 18.92 ? 350  GLY B CA  1 
ATOM   6453  C  C   . GLY B 1 353 ? 104.897 59.148  40.446  1.00 18.67 ? 350  GLY B C   1 
ATOM   6454  O  O   . GLY B 1 353 ? 105.567 59.895  41.158  1.00 19.52 ? 350  GLY B O   1 
ATOM   6455  N  N   . LEU B 1 354 ? 103.923 58.377  40.923  1.00 17.97 ? 351  LEU B N   1 
ATOM   6456  C  CA  . LEU B 1 354 ? 103.557 58.409  42.333  1.00 17.13 ? 351  LEU B CA  1 
ATOM   6457  C  C   . LEU B 1 354 ? 104.115 57.256  43.188  1.00 16.60 ? 351  LEU B C   1 
ATOM   6458  O  O   . LEU B 1 354 ? 103.813 57.175  44.387  1.00 15.01 ? 351  LEU B O   1 
ATOM   6459  C  CB  . LEU B 1 354 ? 102.034 58.516  42.490  1.00 18.59 ? 351  LEU B CB  1 
ATOM   6460  C  CG  . LEU B 1 354 ? 101.405 59.790  41.919  1.00 18.80 ? 351  LEU B CG  1 
ATOM   6461  C  CD1 . LEU B 1 354 ? 99.915  59.836  42.250  1.00 21.64 ? 351  LEU B CD1 1 
ATOM   6462  C  CD2 . LEU B 1 354 ? 102.113 61.032  42.464  1.00 20.64 ? 351  LEU B CD2 1 
ATOM   6463  N  N   . ASN B 1 355 ? 104.965 56.402  42.608  1.00 15.28 ? 352  ASN B N   1 
ATOM   6464  C  CA  . ASN B 1 355 ? 105.559 55.307  43.387  1.00 15.41 ? 352  ASN B CA  1 
ATOM   6465  C  C   . ASN B 1 355 ? 106.405 55.780  44.570  1.00 15.36 ? 352  ASN B C   1 
ATOM   6466  O  O   . ASN B 1 355 ? 106.464 55.095  45.585  1.00 14.38 ? 352  ASN B O   1 
ATOM   6467  C  CB  . ASN B 1 355 ? 106.383 54.335  42.520  1.00 15.12 ? 352  ASN B CB  1 
ATOM   6468  C  CG  . ASN B 1 355 ? 105.539 53.265  41.864  1.00 16.82 ? 352  ASN B CG  1 
ATOM   6469  O  OD1 . ASN B 1 355 ? 104.328 53.170  42.093  1.00 17.13 ? 352  ASN B OD1 1 
ATOM   6470  N  ND2 . ASN B 1 355 ? 106.189 52.404  41.083  1.00 14.82 ? 352  ASN B ND2 1 
ATOM   6471  N  N   . TYR B 1 356 ? 107.001 56.966  44.464  1.00 16.20 ? 353  TYR B N   1 
ATOM   6472  C  CA  . TYR B 1 356 ? 107.843 57.481  45.544  1.00 16.46 ? 353  TYR B CA  1 
ATOM   6473  C  C   . TYR B 1 356 ? 107.023 57.629  46.829  1.00 16.35 ? 353  TYR B C   1 
ATOM   6474  O  O   . TYR B 1 356 ? 107.589 57.685  47.910  1.00 16.27 ? 353  TYR B O   1 
ATOM   6475  C  CB  . TYR B 1 356 ? 108.519 58.807  45.161  1.00 16.96 ? 353  TYR B CB  1 
ATOM   6476  C  CG  . TYR B 1 356 ? 107.626 60.019  45.239  1.00 16.01 ? 353  TYR B CG  1 
ATOM   6477  C  CD1 . TYR B 1 356 ? 106.735 60.322  44.221  1.00 17.43 ? 353  TYR B CD1 1 
ATOM   6478  C  CD2 . TYR B 1 356 ? 107.697 60.884  46.321  1.00 16.40 ? 353  TYR B CD2 1 
ATOM   6479  C  CE1 . TYR B 1 356 ? 105.913 61.448  44.296  1.00 16.33 ? 353  TYR B CE1 1 
ATOM   6480  C  CE2 . TYR B 1 356 ? 106.870 62.011  46.408  1.00 17.83 ? 353  TYR B CE2 1 
ATOM   6481  C  CZ  . TYR B 1 356 ? 105.984 62.281  45.393  1.00 15.37 ? 353  TYR B CZ  1 
ATOM   6482  O  OH  . TYR B 1 356 ? 105.174 63.387  45.458  1.00 17.86 ? 353  TYR B OH  1 
ATOM   6483  N  N   . LEU B 1 357 ? 105.694 57.666  46.701  1.00 14.72 ? 354  LEU B N   1 
ATOM   6484  C  CA  . LEU B 1 357 ? 104.804 57.780  47.851  1.00 14.36 ? 354  LEU B CA  1 
ATOM   6485  C  C   . LEU B 1 357 ? 104.323 56.439  48.425  1.00 14.22 ? 354  LEU B C   1 
ATOM   6486  O  O   . LEU B 1 357 ? 103.581 56.424  49.411  1.00 15.99 ? 354  LEU B O   1 
ATOM   6487  C  CB  . LEU B 1 357 ? 103.571 58.605  47.486  1.00 13.46 ? 354  LEU B CB  1 
ATOM   6488  C  CG  . LEU B 1 357 ? 103.763 60.085  47.195  1.00 14.09 ? 354  LEU B CG  1 
ATOM   6489  C  CD1 . LEU B 1 357 ? 102.510 60.639  46.572  1.00 13.13 ? 354  LEU B CD1 1 
ATOM   6490  C  CD2 . LEU B 1 357 ? 104.119 60.840  48.454  1.00 14.14 ? 354  LEU B CD2 1 
ATOM   6491  N  N   . ALA B 1 358 ? 104.711 55.328  47.814  1.00 14.49 ? 355  ALA B N   1 
ATOM   6492  C  CA  . ALA B 1 358 ? 104.305 54.012  48.310  1.00 14.82 ? 355  ALA B CA  1 
ATOM   6493  C  C   . ALA B 1 358 ? 104.743 53.855  49.767  1.00 15.66 ? 355  ALA B C   1 
ATOM   6494  O  O   . ALA B 1 358 ? 105.904 54.099  50.098  1.00 14.94 ? 355  ALA B O   1 
ATOM   6495  C  CB  . ALA B 1 358 ? 104.910 52.912  47.459  1.00 15.58 ? 355  ALA B CB  1 
ATOM   6496  N  N   . GLY B 1 359 ? 103.813 53.437  50.625  1.00 15.99 ? 356  GLY B N   1 
ATOM   6497  C  CA  . GLY B 1 359 ? 104.099 53.251  52.046  1.00 15.53 ? 356  GLY B CA  1 
ATOM   6498  C  C   . GLY B 1 359 ? 103.514 54.379  52.867  1.00 15.58 ? 356  GLY B C   1 
ATOM   6499  O  O   . GLY B 1 359 ? 103.192 54.198  54.042  1.00 16.18 ? 356  GLY B O   1 
ATOM   6500  N  N   . GLU B 1 360 ? 103.377 55.549  52.252  1.00 14.94 ? 357  GLU B N   1 
ATOM   6501  C  CA  . GLU B 1 360 ? 102.799 56.695  52.925  1.00 15.88 ? 357  GLU B CA  1 
ATOM   6502  C  C   . GLU B 1 360 ? 101.283 56.565  52.870  1.00 15.86 ? 357  GLU B C   1 
ATOM   6503  O  O   . GLU B 1 360 ? 100.738 55.808  52.059  1.00 17.19 ? 357  GLU B O   1 
ATOM   6504  C  CB  . GLU B 1 360 ? 103.181 58.002  52.233  1.00 16.28 ? 357  GLU B CB  1 
ATOM   6505  C  CG  . GLU B 1 360 ? 104.666 58.275  52.044  1.00 20.95 ? 357  GLU B CG  1 
ATOM   6506  C  CD  . GLU B 1 360 ? 105.454 58.531  53.342  1.00 28.14 ? 357  GLU B CD  1 
ATOM   6507  O  OE1 . GLU B 1 360 ? 104.853 58.608  54.440  1.00 25.94 ? 357  GLU B OE1 1 
ATOM   6508  O  OE2 . GLU B 1 360 ? 106.698 58.679  53.237  1.00 31.83 ? 357  GLU B OE2 1 
ATOM   6509  N  N   . THR B 1 361 ? 100.596 57.318  53.714  1.00 15.41 ? 358  THR B N   1 
ATOM   6510  C  CA  . THR B 1 361 ? 99.148  57.287  53.714  1.00 14.22 ? 358  THR B CA  1 
ATOM   6511  C  C   . THR B 1 361 ? 98.574  58.430  52.887  1.00 13.54 ? 358  THR B C   1 
ATOM   6512  O  O   . THR B 1 361 ? 99.270  59.390  52.529  1.00 12.40 ? 358  THR B O   1 
ATOM   6513  C  CB  . THR B 1 361 ? 98.575  57.368  55.144  1.00 12.99 ? 358  THR B CB  1 
ATOM   6514  O  OG1 . THR B 1 361 ? 98.943  58.610  55.753  1.00 14.58 ? 358  THR B OG1 1 
ATOM   6515  C  CG2 . THR B 1 361 ? 99.084  56.203  56.001  1.00 14.24 ? 358  THR B CG2 1 
ATOM   6516  N  N   . VAL B 1 362 ? 97.298  58.308  52.564  1.00 13.72 ? 359  VAL B N   1 
ATOM   6517  C  CA  . VAL B 1 362 ? 96.601  59.357  51.857  1.00 13.30 ? 359  VAL B CA  1 
ATOM   6518  C  C   . VAL B 1 362 ? 96.534  60.585  52.767  1.00 13.55 ? 359  VAL B C   1 
ATOM   6519  O  O   . VAL B 1 362 ? 96.658  61.720  52.304  1.00 12.81 ? 359  VAL B O   1 
ATOM   6520  C  CB  . VAL B 1 362 ? 95.195  58.911  51.459  1.00 13.34 ? 359  VAL B CB  1 
ATOM   6521  C  CG1 . VAL B 1 362 ? 94.341  60.122  50.967  1.00 12.86 ? 359  VAL B CG1 1 
ATOM   6522  C  CG2 . VAL B 1 362 ? 95.287  57.802  50.415  1.00 12.69 ? 359  VAL B CG2 1 
ATOM   6523  N  N   . ASP B 1 363 ? 96.371  60.366  54.071  1.00 14.10 ? 360  ASP B N   1 
ATOM   6524  C  CA  . ASP B 1 363 ? 96.300  61.499  54.986  1.00 15.46 ? 360  ASP B CA  1 
ATOM   6525  C  C   . ASP B 1 363 ? 97.633  62.273  55.048  1.00 14.90 ? 360  ASP B C   1 
ATOM   6526  O  O   . ASP B 1 363 ? 97.628  63.474  55.259  1.00 13.15 ? 360  ASP B O   1 
ATOM   6527  C  CB  . ASP B 1 363 ? 95.894  61.095  56.379  1.00 16.46 ? 360  ASP B CB  1 
ATOM   6528  C  CG  . ASP B 1 363 ? 95.498  62.295  57.214  1.00 19.21 ? 360  ASP B CG  1 
ATOM   6529  O  OD1 . ASP B 1 363 ? 94.661  63.107  56.733  1.00 24.90 ? 360  ASP B OD1 1 
ATOM   6530  O  OD2 . ASP B 1 363 ? 95.990  62.407  58.344  1.00 26.39 ? 360  ASP B OD2 1 
ATOM   6531  N  N   . PHE B 1 364 ? 98.759  61.571  54.894  1.00 15.31 ? 361  PHE B N   1 
ATOM   6532  C  CA  . PHE B 1 364 ? 100.074 62.231  54.840  1.00 14.04 ? 361  PHE B CA  1 
ATOM   6533  C  C   . PHE B 1 364 ? 100.040 63.218  53.680  1.00 13.35 ? 361  PHE B C   1 
ATOM   6534  O  O   . PHE B 1 364 ? 100.414 64.403  53.830  1.00 13.36 ? 361  PHE B O   1 
ATOM   6535  C  CB  . PHE B 1 364 ? 101.189 61.182  54.671  1.00 13.89 ? 361  PHE B CB  1 
ATOM   6536  C  CG  . PHE B 1 364 ? 102.533 61.745  54.242  1.00 16.11 ? 361  PHE B CG  1 
ATOM   6537  C  CD1 . PHE B 1 364 ? 103.457 62.186  55.179  1.00 19.21 ? 361  PHE B CD1 1 
ATOM   6538  C  CD2 . PHE B 1 364 ? 102.898 61.752  52.896  1.00 18.70 ? 361  PHE B CD2 1 
ATOM   6539  C  CE1 . PHE B 1 364 ? 104.701 62.665  54.779  1.00 20.59 ? 361  PHE B CE1 1 
ATOM   6540  C  CE2 . PHE B 1 364 ? 104.140 62.228  52.489  1.00 19.00 ? 361  PHE B CE2 1 
ATOM   6541  C  CZ  . PHE B 1 364 ? 105.044 62.681  53.436  1.00 18.24 ? 361  PHE B CZ  1 
ATOM   6542  N  N   . VAL B 1 365 ? 99.527  62.758  52.542  1.00 11.38 ? 362  VAL B N   1 
ATOM   6543  C  CA  . VAL B 1 365 ? 99.409  63.618  51.364  1.00 11.79 ? 362  VAL B CA  1 
ATOM   6544  C  C   . VAL B 1 365 ? 98.493  64.821  51.636  1.00 11.20 ? 362  VAL B C   1 
ATOM   6545  O  O   . VAL B 1 365 ? 98.820  65.940  51.271  1.00 12.73 ? 362  VAL B O   1 
ATOM   6546  C  CB  . VAL B 1 365 ? 98.910  62.858  50.122  1.00 10.94 ? 362  VAL B CB  1 
ATOM   6547  C  CG1 . VAL B 1 365 ? 98.755  63.824  48.958  1.00 13.37 ? 362  VAL B CG1 1 
ATOM   6548  C  CG2 . VAL B 1 365 ? 99.865  61.705  49.769  1.00 10.30 ? 362  VAL B CG2 1 
ATOM   6549  N  N   . ASN B 1 366 ? 97.354  64.600  52.293  1.00 12.15 ? 363  ASN B N   1 
ATOM   6550  C  CA  . ASN B 1 366 ? 96.443  65.706  52.612  1.00 12.76 ? 363  ASN B CA  1 
ATOM   6551  C  C   . ASN B 1 366 ? 97.127  66.721  53.564  1.00 12.41 ? 363  ASN B C   1 
ATOM   6552  O  O   . ASN B 1 366 ? 96.930  67.940  53.453  1.00 10.97 ? 363  ASN B O   1 
ATOM   6553  C  CB  . ASN B 1 366 ? 95.179  65.138  53.253  1.00 13.62 ? 363  ASN B CB  1 
ATOM   6554  C  CG  . ASN B 1 366 ? 93.974  66.060  53.139  1.00 14.21 ? 363  ASN B CG  1 
ATOM   6555  O  OD1 . ASN B 1 366 ? 93.811  66.787  52.149  1.00 14.89 ? 363  ASN B OD1 1 
ATOM   6556  N  ND2 . ASN B 1 366 ? 93.047  65.932  54.100  1.00 12.67 ? 363  ASN B ND2 1 
ATOM   6557  N  N   . THR B 1 367 ? 97.911  66.203  54.513  1.00 12.81 ? 364  THR B N   1 
ATOM   6558  C  CA  . THR B 1 367 ? 98.641  67.041  55.475  1.00 13.66 ? 364  THR B CA  1 
ATOM   6559  C  C   . THR B 1 367 ? 99.704  67.907  54.764  1.00 13.05 ? 364  THR B C   1 
ATOM   6560  O  O   . THR B 1 367 ? 99.836  69.105  55.070  1.00 12.91 ? 364  THR B O   1 
ATOM   6561  C  CB  . THR B 1 367 ? 99.293  66.182  56.576  1.00 14.16 ? 364  THR B CB  1 
ATOM   6562  O  OG1 . THR B 1 367 ? 98.272  65.471  57.270  1.00 15.61 ? 364  THR B OG1 1 
ATOM   6563  C  CG2 . THR B 1 367 ? 100.096 67.040  57.572  1.00 13.23 ? 364  THR B CG2 1 
ATOM   6564  N  N   . LYS B 1 368 ? 100.427 67.328  53.801  1.00 14.15 ? 365  LYS B N   1 
ATOM   6565  C  CA  . LYS B 1 368 ? 101.443 68.106  53.031  1.00 14.47 ? 365  LYS B CA  1 
ATOM   6566  C  C   . LYS B 1 368 ? 100.782 69.161  52.134  1.00 14.07 ? 365  LYS B C   1 
ATOM   6567  O  O   . LYS B 1 368 ? 101.359 70.248  51.902  1.00 13.07 ? 365  LYS B O   1 
ATOM   6568  C  CB  . LYS B 1 368 ? 102.393 67.207  52.212  1.00 14.68 ? 365  LYS B CB  1 
ATOM   6569  C  CG  . LYS B 1 368 ? 103.152 66.195  53.074  1.00 18.74 ? 365  LYS B CG  1 
ATOM   6570  C  CD  . LYS B 1 368 ? 103.780 66.899  54.272  1.00 21.18 ? 365  LYS B CD  1 
ATOM   6571  C  CE  . LYS B 1 368 ? 103.966 65.983  55.428  1.00 26.14 ? 365  LYS B CE  1 
ATOM   6572  N  NZ  . LYS B 1 368 ? 104.245 66.760  56.662  1.00 28.81 ? 365  LYS B NZ  1 
ATOM   6573  N  N   . ALA B 1 369 ? 99.588  68.844  51.626  1.00 12.70 ? 366  ALA B N   1 
ATOM   6574  C  CA  . ALA B 1 369 ? 98.824  69.781  50.820  1.00 11.74 ? 366  ALA B CA  1 
ATOM   6575  C  C   . ALA B 1 369 ? 98.474  70.963  51.705  1.00 12.55 ? 366  ALA B C   1 
ATOM   6576  O  O   . ALA B 1 369 ? 98.646  72.120  51.312  1.00 13.47 ? 366  ALA B O   1 
ATOM   6577  C  CB  . ALA B 1 369 ? 97.547  69.122  50.264  1.00 11.04 ? 366  ALA B CB  1 
ATOM   6578  N  N   . TYR B 1 370 ? 98.004  70.668  52.916  1.00 12.98 ? 367  TYR B N   1 
ATOM   6579  C  CA  . TYR B 1 370 ? 97.656  71.709  53.888  1.00 13.23 ? 367  TYR B CA  1 
ATOM   6580  C  C   . TYR B 1 370 ? 98.847  72.600  54.223  1.00 12.20 ? 367  TYR B C   1 
ATOM   6581  O  O   . TYR B 1 370 ? 98.740  73.822  54.165  1.00 12.46 ? 367  TYR B O   1 
ATOM   6582  C  CB  . TYR B 1 370 ? 97.032  71.082  55.165  1.00 13.40 ? 367  TYR B CB  1 
ATOM   6583  C  CG  . TYR B 1 370 ? 97.233  71.872  56.435  1.00 12.96 ? 367  TYR B CG  1 
ATOM   6584  C  CD1 . TYR B 1 370 ? 98.213  71.506  57.344  1.00 17.46 ? 367  TYR B CD1 1 
ATOM   6585  C  CD2 . TYR B 1 370 ? 96.462  72.975  56.724  1.00 16.41 ? 367  TYR B CD2 1 
ATOM   6586  C  CE1 . TYR B 1 370 ? 98.405  72.217  58.517  1.00 20.45 ? 367  TYR B CE1 1 
ATOM   6587  C  CE2 . TYR B 1 370 ? 96.642  73.686  57.880  1.00 17.81 ? 367  TYR B CE2 1 
ATOM   6588  C  CZ  . TYR B 1 370 ? 97.607  73.309  58.775  1.00 20.89 ? 367  TYR B CZ  1 
ATOM   6589  O  OH  . TYR B 1 370 ? 97.795  74.049  59.916  1.00 20.42 ? 367  TYR B OH  1 
ATOM   6590  N  N   . GLU B 1 371 ? 99.985  71.988  54.530  1.00 12.77 ? 368  GLU B N   1 
ATOM   6591  C  CA  . GLU B 1 371 ? 101.188 72.729  54.893  1.00 13.30 ? 368  GLU B CA  1 
ATOM   6592  C  C   . GLU B 1 371 ? 101.727 73.599  53.766  1.00 12.65 ? 368  GLU B C   1 
ATOM   6593  O  O   . GLU B 1 371 ? 102.005 74.811  53.972  1.00 13.13 ? 368  GLU B O   1 
ATOM   6594  C  CB  . GLU B 1 371 ? 102.261 71.761  55.423  1.00 14.18 ? 368  GLU B CB  1 
ATOM   6595  C  CG  . GLU B 1 371 ? 101.901 71.161  56.788  1.00 15.86 ? 368  GLU B CG  1 
ATOM   6596  C  CD  . GLU B 1 371 ? 102.857 70.074  57.256  1.00 17.19 ? 368  GLU B CD  1 
ATOM   6597  O  OE1 . GLU B 1 371 ? 103.608 69.510  56.432  1.00 19.86 ? 368  GLU B OE1 1 
ATOM   6598  O  OE2 . GLU B 1 371 ? 102.829 69.760  58.460  1.00 21.03 ? 368  GLU B OE2 1 
ATOM   6599  N  N   . GLY B 1 372 ? 101.844 73.014  52.577  1.00 11.68 ? 369  GLY B N   1 
ATOM   6600  C  CA  . GLY B 1 372 ? 102.339 73.734  51.423  1.00 11.28 ? 369  GLY B CA  1 
ATOM   6601  C  C   . GLY B 1 372 ? 101.431 74.900  51.053  1.00 11.87 ? 369  GLY B C   1 
ATOM   6602  O  O   . GLY B 1 372 ? 101.901 75.995  50.718  1.00 12.25 ? 369  GLY B O   1 
ATOM   6603  N  N   . THR B 1 373 ? 100.127 74.669  51.128  1.00 12.00 ? 370  THR B N   1 
ATOM   6604  C  CA  . THR B 1 373 ? 99.158  75.696  50.795  1.00 12.26 ? 370  THR B CA  1 
ATOM   6605  C  C   . THR B 1 373 ? 99.161  76.841  51.808  1.00 12.22 ? 370  THR B C   1 
ATOM   6606  O  O   . THR B 1 373 ? 99.073  78.004  51.432  1.00 11.99 ? 370  THR B O   1 
ATOM   6607  C  CB  . THR B 1 373 ? 97.756  75.075  50.661  1.00 12.60 ? 370  THR B CB  1 
ATOM   6608  O  OG1 . THR B 1 373 ? 97.810  74.051  49.657  1.00 14.62 ? 370  THR B OG1 1 
ATOM   6609  C  CG2 . THR B 1 373 ? 96.731  76.111  50.286  1.00 10.84 ? 370  THR B CG2 1 
ATOM   6610  N  N   A LEU B 1 374 ? 99.296  76.516  53.087  0.70 13.11 ? 371  LEU B N   1 
ATOM   6611  N  N   B LEU B 1 374 ? 99.284  76.533  53.094  0.30 12.74 ? 371  LEU B N   1 
ATOM   6612  C  CA  A LEU B 1 374 ? 99.294  77.563  54.100  0.70 13.74 ? 371  LEU B CA  1 
ATOM   6613  C  CA  B LEU B 1 374 ? 99.271  77.605  54.090  0.30 13.09 ? 371  LEU B CA  1 
ATOM   6614  C  C   A LEU B 1 374 ? 100.489 78.514  53.899  0.70 13.83 ? 371  LEU B C   1 
ATOM   6615  C  C   B LEU B 1 374 ? 100.499 78.525  53.927  0.30 13.37 ? 371  LEU B C   1 
ATOM   6616  O  O   A LEU B 1 374 ? 100.327 79.739  53.961  0.70 13.49 ? 371  LEU B O   1 
ATOM   6617  O  O   B LEU B 1 374 ? 100.379 79.742  54.083  0.30 13.45 ? 371  LEU B O   1 
ATOM   6618  C  CB  A LEU B 1 374 ? 99.209  76.977  55.516  0.70 14.07 ? 371  LEU B CB  1 
ATOM   6619  C  CB  B LEU B 1 374 ? 99.102  77.060  55.515  0.30 13.25 ? 371  LEU B CB  1 
ATOM   6620  C  CG  A LEU B 1 374 ? 99.210  78.062  56.605  0.70 14.55 ? 371  LEU B CG  1 
ATOM   6621  C  CG  B LEU B 1 374 ? 100.176 76.194  56.154  0.30 12.66 ? 371  LEU B CG  1 
ATOM   6622  C  CD1 A LEU B 1 374 ? 98.471  77.638  57.841  0.70 16.29 ? 371  LEU B CD1 1 
ATOM   6623  C  CD1 B LEU B 1 374 ? 101.445 77.004  56.377  0.30 14.32 ? 371  LEU B CD1 1 
ATOM   6624  C  CD2 A LEU B 1 374 ? 100.629 78.479  56.897  0.70 12.62 ? 371  LEU B CD2 1 
ATOM   6625  C  CD2 B LEU B 1 374 ? 99.655  75.647  57.471  0.30 12.76 ? 371  LEU B CD2 1 
ATOM   6626  N  N   . LEU B 1 375 ? 101.655 77.955  53.580  1.00 13.16 ? 372  LEU B N   1 
ATOM   6627  C  CA  . LEU B 1 375 ? 102.871 78.761  53.339  1.00 13.77 ? 372  LEU B CA  1 
ATOM   6628  C  C   . LEU B 1 375 ? 102.757 79.556  52.002  1.00 12.87 ? 372  LEU B C   1 
ATOM   6629  O  O   . LEU B 1 375 ? 103.132 80.737  51.926  1.00 11.03 ? 372  LEU B O   1 
ATOM   6630  C  CB  . LEU B 1 375 ? 104.136 77.879  53.371  1.00 14.66 ? 372  LEU B CB  1 
ATOM   6631  C  CG  . LEU B 1 375 ? 104.441 77.252  54.740  1.00 14.53 ? 372  LEU B CG  1 
ATOM   6632  C  CD1 . LEU B 1 375 ? 105.604 76.286  54.686  1.00 14.62 ? 372  LEU B CD1 1 
ATOM   6633  C  CD2 . LEU B 1 375 ? 104.674 78.324  55.802  1.00 15.41 ? 372  LEU B CD2 1 
ATOM   6634  N  N   . ALA B 1 376 ? 102.195 78.939  50.969  1.00 11.37 ? 373  ALA B N   1 
ATOM   6635  C  CA  . ALA B 1 376 ? 102.008 79.652  49.700  1.00 11.62 ? 373  ALA B CA  1 
ATOM   6636  C  C   . ALA B 1 376 ? 101.032 80.808  49.894  1.00 11.35 ? 373  ALA B C   1 
ATOM   6637  O  O   . ALA B 1 376 ? 101.294 81.952  49.489  1.00 10.21 ? 373  ALA B O   1 
ATOM   6638  C  CB  . ALA B 1 376 ? 101.490 78.693  48.598  1.00 11.69 ? 373  ALA B CB  1 
ATOM   6639  N  N   . HIS B 1 377 ? 99.912  80.543  50.562  1.00 11.52 ? 374  HIS B N   1 
ATOM   6640  C  CA  . HIS B 1 377 ? 98.929  81.594  50.742  1.00 11.78 ? 374  HIS B CA  1 
ATOM   6641  C  C   . HIS B 1 377 ? 99.463  82.717  51.594  1.00 12.85 ? 374  HIS B C   1 
ATOM   6642  O  O   . HIS B 1 377 ? 99.164  83.871  51.311  1.00 10.91 ? 374  HIS B O   1 
ATOM   6643  C  CB  . HIS B 1 377 ? 97.592  81.112  51.317  1.00 12.05 ? 374  HIS B CB  1 
ATOM   6644  C  CG  . HIS B 1 377 ? 96.801  80.247  50.385  1.00 13.08 ? 374  HIS B CG  1 
ATOM   6645  N  ND1 . HIS B 1 377 ? 95.740  79.481  50.813  1.00 12.71 ? 374  HIS B ND1 1 
ATOM   6646  C  CD2 . HIS B 1 377 ? 96.941  79.991  49.062  1.00 13.92 ? 374  HIS B CD2 1 
ATOM   6647  C  CE1 . HIS B 1 377 ? 95.223  78.832  49.784  1.00 12.87 ? 374  HIS B CE1 1 
ATOM   6648  N  NE2 . HIS B 1 377 ? 95.939  79.113  48.709  1.00 12.83 ? 374  HIS B NE2 1 
ATOM   6649  N  N   . SER B 1 378 ? 100.228 82.375  52.637  1.00 13.49 ? 375  SER B N   1 
ATOM   6650  C  CA  . SER B 1 378 ? 100.858 83.370  53.496  1.00 14.36 ? 375  SER B CA  1 
ATOM   6651  C  C   . SER B 1 378 ? 101.781 84.228  52.645  1.00 14.67 ? 375  SER B C   1 
ATOM   6652  O  O   . SER B 1 378 ? 101.769 85.473  52.737  1.00 12.60 ? 375  SER B O   1 
ATOM   6653  C  CB  . SER B 1 378 ? 101.654 82.728  54.638  1.00 15.25 ? 375  SER B CB  1 
ATOM   6654  O  OG  . SER B 1 378 ? 100.803 81.942  55.462  1.00 17.27 ? 375  SER B OG  1 
ATOM   6655  N  N   . ASP B 1 379 ? 102.571 83.569  51.805  1.00 14.20 ? 376  ASP B N   1 
ATOM   6656  C  CA  . ASP B 1 379 ? 103.504 84.285  50.932  1.00 15.42 ? 376  ASP B CA  1 
ATOM   6657  C  C   . ASP B 1 379 ? 102.813 85.177  49.894  1.00 14.85 ? 376  ASP B C   1 
ATOM   6658  O  O   . ASP B 1 379 ? 103.408 86.128  49.409  1.00 15.36 ? 376  ASP B O   1 
ATOM   6659  C  CB  . ASP B 1 379 ? 104.462 83.306  50.254  1.00 16.07 ? 376  ASP B CB  1 
ATOM   6660  C  CG  . ASP B 1 379 ? 105.487 82.724  51.232  1.00 17.13 ? 376  ASP B CG  1 
ATOM   6661  O  OD1 . ASP B 1 379 ? 105.532 83.168  52.390  1.00 19.14 ? 376  ASP B OD1 1 
ATOM   6662  O  OD2 . ASP B 1 379 ? 106.237 81.823  50.840  1.00 20.08 ? 376  ASP B OD2 1 
ATOM   6663  N  N   . GLY B 1 380 ? 101.566 84.854  49.552  1.00 13.98 ? 377  GLY B N   1 
ATOM   6664  C  CA  . GLY B 1 380 ? 100.778 85.639  48.613  1.00 13.07 ? 377  GLY B CA  1 
ATOM   6665  C  C   . GLY B 1 380 ? 100.000 86.768  49.281  1.00 14.55 ? 377  GLY B C   1 
ATOM   6666  O  O   . GLY B 1 380 ? 99.243  87.470  48.630  1.00 14.70 ? 377  GLY B O   1 
ATOM   6667  N  N   . GLY B 1 381 ? 100.164 86.919  50.596  1.00 14.16 ? 378  GLY B N   1 
ATOM   6668  C  CA  . GLY B 1 381 ? 99.532  87.992  51.336  1.00 14.02 ? 378  GLY B CA  1 
ATOM   6669  C  C   . GLY B 1 381 ? 98.241  87.639  52.051  1.00 13.62 ? 378  GLY B C   1 
ATOM   6670  O  O   . GLY B 1 381 ? 97.453  88.527  52.341  1.00 12.51 ? 378  GLY B O   1 
ATOM   6671  N  N   . VAL B 1 382 ? 98.014  86.357  52.323  1.00 11.93 ? 379  VAL B N   1 
ATOM   6672  C  CA  . VAL B 1 382 ? 96.809  85.954  53.046  1.00 12.54 ? 379  VAL B CA  1 
ATOM   6673  C  C   . VAL B 1 382 ? 97.122  85.447  54.457  1.00 12.46 ? 379  VAL B C   1 
ATOM   6674  O  O   . VAL B 1 382 ? 97.697  84.364  54.609  1.00 13.32 ? 379  VAL B O   1 
ATOM   6675  C  CB  . VAL B 1 382 ? 96.059  84.802  52.324  1.00 12.93 ? 379  VAL B CB  1 
ATOM   6676  C  CG1 . VAL B 1 382 ? 94.772  84.410  53.097  1.00 10.87 ? 379  VAL B CG1 1 
ATOM   6677  C  CG2 . VAL B 1 382 ? 95.743  85.178  50.872  1.00 15.78 ? 379  VAL B CG2 1 
ATOM   6678  N  N   . PRO B 1 383 ? 96.733  86.216  55.506  1.00 12.71 ? 380  PRO B N   1 
ATOM   6679  C  CA  . PRO B 1 383 ? 96.944  85.723  56.868  1.00 12.83 ? 380  PRO B CA  1 
ATOM   6680  C  C   . PRO B 1 383 ? 96.201  84.405  57.083  1.00 12.01 ? 380  PRO B C   1 
ATOM   6681  O  O   . PRO B 1 383 ? 95.018  84.285  56.726  1.00 12.42 ? 380  PRO B O   1 
ATOM   6682  C  CB  . PRO B 1 383 ? 96.308  86.807  57.746  1.00 12.44 ? 380  PRO B CB  1 
ATOM   6683  C  CG  . PRO B 1 383 ? 96.367  88.023  56.934  1.00 13.15 ? 380  PRO B CG  1 
ATOM   6684  C  CD  . PRO B 1 383 ? 96.151  87.563  55.510  1.00 12.57 ? 380  PRO B CD  1 
ATOM   6685  N  N   . ASN B 1 384 ? 96.901  83.417  57.628  1.00 12.22 ? 381  ASN B N   1 
ATOM   6686  C  CA  . ASN B 1 384 ? 96.313  82.113  57.915  1.00 11.43 ? 381  ASN B CA  1 
ATOM   6687  C  C   . ASN B 1 384 ? 96.290  81.800  59.413  1.00 12.50 ? 381  ASN B C   1 
ATOM   6688  O  O   . ASN B 1 384 ? 97.321  81.844  60.088  1.00 13.29 ? 381  ASN B O   1 
ATOM   6689  C  CB  . ASN B 1 384 ? 97.063  80.987  57.175  1.00 13.42 ? 381  ASN B CB  1 
ATOM   6690  C  CG  . ASN B 1 384 ? 96.567  80.762  55.764  1.00 15.05 ? 381  ASN B CG  1 
ATOM   6691  O  OD1 . ASN B 1 384 ? 95.924  79.732  55.507  1.00 19.24 ? 381  ASN B OD1 1 
ATOM   6692  N  ND2 . ASN B 1 384 ? 96.799  81.722  54.852  1.00 13.21 ? 381  ASN B ND2 1 
ATOM   6693  N  N   . LEU B 1 385 ? 95.101  81.498  59.924  1.00 12.36 ? 382  LEU B N   1 
ATOM   6694  C  CA  . LEU B 1 385 ? 94.899  81.132  61.307  1.00 13.20 ? 382  LEU B CA  1 
ATOM   6695  C  C   . LEU B 1 385 ? 94.559  79.639  61.301  1.00 14.54 ? 382  LEU B C   1 
ATOM   6696  O  O   . LEU B 1 385 ? 94.011  79.120  60.314  1.00 14.55 ? 382  LEU B O   1 
ATOM   6697  C  CB  . LEU B 1 385 ? 93.744  81.927  61.934  1.00 12.37 ? 382  LEU B CB  1 
ATOM   6698  C  CG  . LEU B 1 385 ? 93.781  83.450  61.745  1.00 14.48 ? 382  LEU B CG  1 
ATOM   6699  C  CD1 . LEU B 1 385 ? 92.521  84.120  62.294  1.00 11.04 ? 382  LEU B CD1 1 
ATOM   6700  C  CD2 . LEU B 1 385 ? 95.057  84.070  62.329  1.00 13.84 ? 382  LEU B CD2 1 
ATOM   6701  N  N   . ILE B 1 386 ? 94.869  78.942  62.393  1.00 13.97 ? 383  ILE B N   1 
ATOM   6702  C  CA  . ILE B 1 386 ? 94.610  77.518  62.458  1.00 13.62 ? 383  ILE B CA  1 
ATOM   6703  C  C   . ILE B 1 386 ? 93.823  77.119  63.691  1.00 14.07 ? 383  ILE B C   1 
ATOM   6704  O  O   . ILE B 1 386 ? 94.150  77.540  64.792  1.00 15.27 ? 383  ILE B O   1 
ATOM   6705  C  CB  . ILE B 1 386 ? 95.940  76.724  62.498  1.00 13.78 ? 383  ILE B CB  1 
ATOM   6706  C  CG1 . ILE B 1 386 ? 96.825  77.048  61.286  1.00 14.46 ? 383  ILE B CG1 1 
ATOM   6707  C  CG2 . ILE B 1 386 ? 95.662  75.256  62.553  1.00 15.62 ? 383  ILE B CG2 1 
ATOM   6708  C  CD1 . ILE B 1 386 ? 98.249  76.566  61.421  1.00 16.09 ? 383  ILE B CD1 1 
ATOM   6709  N  N   . VAL B 1 387 ? 92.767  76.330  63.491  1.00 14.14 ? 384  VAL B N   1 
ATOM   6710  C  CA  . VAL B 1 387 ? 92.009  75.766  64.591  1.00 14.40 ? 384  VAL B CA  1 
ATOM   6711  C  C   . VAL B 1 387 ? 92.279  74.252  64.481  1.00 16.26 ? 384  VAL B C   1 
ATOM   6712  O  O   . VAL B 1 387 ? 91.825  73.581  63.547  1.00 15.77 ? 384  VAL B O   1 
ATOM   6713  C  CB  . VAL B 1 387 ? 90.493  76.061  64.538  1.00 15.24 ? 384  VAL B CB  1 
ATOM   6714  C  CG1 . VAL B 1 387 ? 89.758  75.278  65.660  1.00 13.84 ? 384  VAL B CG1 1 
ATOM   6715  C  CG2 . VAL B 1 387 ? 90.214  77.575  64.638  1.00 14.35 ? 384  VAL B CG2 1 
ATOM   6716  N  N   . ASN B 1 388 ? 93.073  73.749  65.415  1.00 15.97 ? 385  ASN B N   1 
ATOM   6717  C  CA  . ASN B 1 388 ? 93.464  72.351  65.476  1.00 18.10 ? 385  ASN B CA  1 
ATOM   6718  C  C   . ASN B 1 388 ? 92.431  71.493  66.189  1.00 19.59 ? 385  ASN B C   1 
ATOM   6719  O  O   . ASN B 1 388 ? 92.091  71.748  67.362  1.00 20.15 ? 385  ASN B O   1 
ATOM   6720  C  CB  . ASN B 1 388 ? 94.811  72.242  66.182  1.00 19.14 ? 385  ASN B CB  1 
ATOM   6721  C  CG  . ASN B 1 388 ? 95.946  72.751  65.333  1.00 19.43 ? 385  ASN B CG  1 
ATOM   6722  O  OD1 . ASN B 1 388 ? 96.135  72.287  64.216  1.00 19.22 ? 385  ASN B OD1 1 
ATOM   6723  N  ND2 . ASN B 1 388 ? 96.721  73.700  65.864  1.00 20.53 ? 385  ASN B ND2 1 
ATOM   6724  N  N   . ILE B 1 389 ? 91.927  70.499  65.462  1.00 19.59 ? 386  ILE B N   1 
ATOM   6725  C  CA  . ILE B 1 389 ? 90.906  69.580  65.945  1.00 20.05 ? 386  ILE B CA  1 
ATOM   6726  C  C   . ILE B 1 389 ? 91.558  68.199  66.048  1.00 20.09 ? 386  ILE B C   1 
ATOM   6727  O  O   . ILE B 1 389 ? 91.868  67.603  65.032  1.00 21.04 ? 386  ILE B O   1 
ATOM   6728  C  CB  . ILE B 1 389 ? 89.735  69.514  64.951  1.00 19.19 ? 386  ILE B CB  1 
ATOM   6729  C  CG1 . ILE B 1 389 ? 89.261  70.933  64.609  1.00 20.30 ? 386  ILE B CG1 1 
ATOM   6730  C  CG2 . ILE B 1 389 ? 88.625  68.633  65.500  1.00 20.48 ? 386  ILE B CG2 1 
ATOM   6731  C  CD1 . ILE B 1 389 ? 88.149  71.011  63.542  1.00 19.97 ? 386  ILE B CD1 1 
ATOM   6732  N  N   . PRO B 1 390 ? 91.774  67.689  67.277  1.00 20.70 ? 387  PRO B N   1 
ATOM   6733  C  CA  . PRO B 1 390 ? 92.449  66.398  67.450  1.00 21.00 ? 387  PRO B CA  1 
ATOM   6734  C  C   . PRO B 1 390 ? 91.839  65.232  66.656  1.00 19.78 ? 387  PRO B C   1 
ATOM   6735  O  O   . PRO B 1 390 ? 92.574  64.480  66.039  1.00 20.06 ? 387  PRO B O   1 
ATOM   6736  C  CB  . PRO B 1 390 ? 92.353  66.151  68.964  1.00 21.24 ? 387  PRO B CB  1 
ATOM   6737  C  CG  . PRO B 1 390 ? 92.344  67.483  69.548  1.00 23.41 ? 387  PRO B CG  1 
ATOM   6738  C  CD  . PRO B 1 390 ? 91.602  68.383  68.559  1.00 21.80 ? 387  PRO B CD  1 
ATOM   6739  N  N   . GLU B 1 391 ? 90.523  65.066  66.723  1.00 19.85 ? 388  GLU B N   1 
ATOM   6740  C  CA  . GLU B 1 391 ? 89.836  64.018  65.969  1.00 20.22 ? 388  GLU B CA  1 
ATOM   6741  C  C   . GLU B 1 391 ? 88.349  64.334  65.932  1.00 19.87 ? 388  GLU B C   1 
ATOM   6742  O  O   . GLU B 1 391 ? 87.867  65.183  66.685  1.00 20.60 ? 388  GLU B O   1 
ATOM   6743  C  CB  . GLU B 1 391 ? 90.082  62.618  66.553  1.00 21.32 ? 388  GLU B CB  1 
ATOM   6744  C  CG  . GLU B 1 391 ? 89.665  62.452  67.987  1.00 25.26 ? 388  GLU B CG  1 
ATOM   6745  C  CD  . GLU B 1 391 ? 89.925  61.040  68.503  1.00 31.94 ? 388  GLU B CD  1 
ATOM   6746  O  OE1 . GLU B 1 391 ? 89.555  60.060  67.807  1.00 35.97 ? 388  GLU B OE1 1 
ATOM   6747  O  OE2 . GLU B 1 391 ? 90.478  60.918  69.616  1.00 35.49 ? 388  GLU B OE2 1 
ATOM   6748  N  N   . LEU B 1 392 ? 87.624  63.649  65.058  1.00 17.40 ? 389  LEU B N   1 
ATOM   6749  C  CA  . LEU B 1 392 ? 86.204  63.909  64.901  1.00 17.19 ? 389  LEU B CA  1 
ATOM   6750  C  C   . LEU B 1 392 ? 85.344  62.942  65.698  1.00 15.72 ? 389  LEU B C   1 
ATOM   6751  O  O   . LEU B 1 392 ? 85.101  61.817  65.292  1.00 16.46 ? 389  LEU B O   1 
ATOM   6752  C  CB  . LEU B 1 392 ? 85.829  63.873  63.421  1.00 17.78 ? 389  LEU B CB  1 
ATOM   6753  C  CG  . LEU B 1 392 ? 86.592  64.875  62.547  1.00 16.93 ? 389  LEU B CG  1 
ATOM   6754  C  CD1 . LEU B 1 392 ? 86.273  64.634  61.080  1.00 19.92 ? 389  LEU B CD1 1 
ATOM   6755  C  CD2 . LEU B 1 392 ? 86.287  66.324  62.943  1.00 18.62 ? 389  LEU B CD2 1 
ATOM   6756  N  N   . ASN B 1 393 ? 84.913  63.396  66.861  1.00 13.80 ? 390  ASN B N   1 
ATOM   6757  C  CA  . ASN B 1 393 ? 84.037  62.625  67.720  1.00 13.29 ? 390  ASN B CA  1 
ATOM   6758  C  C   . ASN B 1 393 ? 83.079  63.579  68.420  1.00 11.63 ? 390  ASN B C   1 
ATOM   6759  O  O   . ASN B 1 393 ? 83.219  64.802  68.306  1.00 9.09  ? 390  ASN B O   1 
ATOM   6760  C  CB  . ASN B 1 393 ? 84.813  61.736  68.692  1.00 14.31 ? 390  ASN B CB  1 
ATOM   6761  C  CG  . ASN B 1 393 ? 85.736  62.510  69.586  1.00 14.08 ? 390  ASN B CG  1 
ATOM   6762  O  OD1 . ASN B 1 393 ? 85.551  63.704  69.821  1.00 14.72 ? 390  ASN B OD1 1 
ATOM   6763  N  ND2 . ASN B 1 393 ? 86.742  61.829  70.102  1.00 14.32 ? 390  ASN B ND2 1 
ATOM   6764  N  N   . GLU B 1 394 ? 82.110  63.018  69.124  1.00 11.83 ? 391  GLU B N   1 
ATOM   6765  C  CA  . GLU B 1 394 ? 81.097  63.820  69.787  1.00 11.16 ? 391  GLU B CA  1 
ATOM   6766  C  C   . GLU B 1 394 ? 81.674  64.797  70.802  1.00 11.56 ? 391  GLU B C   1 
ATOM   6767  O  O   . GLU B 1 394 ? 81.263  65.953  70.853  1.00 10.01 ? 391  GLU B O   1 
ATOM   6768  C  CB  . GLU B 1 394 ? 80.043  62.944  70.452  1.00 11.97 ? 391  GLU B CB  1 
ATOM   6769  C  CG  . GLU B 1 394 ? 79.217  62.069  69.533  1.00 11.75 ? 391  GLU B CG  1 
ATOM   6770  C  CD  . GLU B 1 394 ? 79.826  60.692  69.302  1.00 14.81 ? 391  GLU B CD  1 
ATOM   6771  O  OE1 . GLU B 1 394 ? 81.058  60.578  69.167  1.00 14.38 ? 391  GLU B OE1 1 
ATOM   6772  O  OE2 . GLU B 1 394 ? 79.039  59.722  69.244  1.00 7.91  ? 391  GLU B OE2 1 
ATOM   6773  N  N   . TYR B 1 395 ? 82.627  64.351  71.611  1.00 12.10 ? 392  TYR B N   1 
ATOM   6774  C  CA  . TYR B 1 395 ? 83.247  65.250  72.602  1.00 12.48 ? 392  TYR B CA  1 
ATOM   6775  C  C   . TYR B 1 395 ? 83.886  66.458  71.931  1.00 12.58 ? 392  TYR B C   1 
ATOM   6776  O  O   . TYR B 1 395 ? 83.696  67.610  72.355  1.00 11.95 ? 392  TYR B O   1 
ATOM   6777  C  CB  . TYR B 1 395 ? 84.296  64.468  73.399  1.00 13.07 ? 392  TYR B CB  1 
ATOM   6778  C  CG  . TYR B 1 395 ? 85.049  65.244  74.434  1.00 13.31 ? 392  TYR B CG  1 
ATOM   6779  C  CD1 . TYR B 1 395 ? 86.161  66.010  74.081  1.00 17.04 ? 392  TYR B CD1 1 
ATOM   6780  C  CD2 . TYR B 1 395 ? 84.701  65.168  75.783  1.00 16.19 ? 392  TYR B CD2 1 
ATOM   6781  C  CE1 . TYR B 1 395 ? 86.881  66.715  75.041  1.00 19.31 ? 392  TYR B CE1 1 
ATOM   6782  C  CE2 . TYR B 1 395 ? 85.414  65.862  76.750  1.00 17.37 ? 392  TYR B CE2 1 
ATOM   6783  C  CZ  . TYR B 1 395 ? 86.508  66.625  76.375  1.00 18.61 ? 392  TYR B CZ  1 
ATOM   6784  O  OH  . TYR B 1 395 ? 87.223  67.320  77.320  1.00 20.25 ? 392  TYR B OH  1 
ATOM   6785  N  N   . THR B 1 396 ? 84.638  66.210  70.863  1.00 13.66 ? 393  THR B N   1 
ATOM   6786  C  CA  . THR B 1 396 ? 85.314  67.286  70.165  1.00 13.69 ? 393  THR B CA  1 
ATOM   6787  C  C   . THR B 1 396 ? 84.324  68.237  69.489  1.00 13.75 ? 393  THR B C   1 
ATOM   6788  O  O   . THR B 1 396 ? 84.537  69.453  69.474  1.00 14.52 ? 393  THR B O   1 
ATOM   6789  C  CB  . THR B 1 396 ? 86.317  66.726  69.172  1.00 14.36 ? 393  THR B CB  1 
ATOM   6790  O  OG1 . THR B 1 396 ? 87.169  65.823  69.875  1.00 15.91 ? 393  THR B OG1 1 
ATOM   6791  C  CG2 . THR B 1 396 ? 87.155  67.832  68.537  1.00 13.52 ? 393  THR B CG2 1 
ATOM   6792  N  N   . PHE B 1 397 ? 83.240  67.699  68.937  1.00 13.50 ? 394  PHE B N   1 
ATOM   6793  C  CA  . PHE B 1 397 ? 82.226  68.559  68.318  1.00 13.40 ? 394  PHE B CA  1 
ATOM   6794  C  C   . PHE B 1 397 ? 81.678  69.566  69.354  1.00 13.87 ? 394  PHE B C   1 
ATOM   6795  O  O   . PHE B 1 397 ? 81.585  70.773  69.096  1.00 13.48 ? 394  PHE B O   1 
ATOM   6796  C  CB  . PHE B 1 397 ? 81.079  67.722  67.705  1.00 13.24 ? 394  PHE B CB  1 
ATOM   6797  C  CG  . PHE B 1 397 ? 79.959  68.555  67.130  1.00 11.77 ? 394  PHE B CG  1 
ATOM   6798  C  CD1 . PHE B 1 397 ? 78.872  68.900  67.902  1.00 13.83 ? 394  PHE B CD1 1 
ATOM   6799  C  CD2 . PHE B 1 397 ? 80.020  69.025  65.838  1.00 16.86 ? 394  PHE B CD2 1 
ATOM   6800  C  CE1 . PHE B 1 397 ? 77.853  69.687  67.384  1.00 18.36 ? 394  PHE B CE1 1 
ATOM   6801  C  CE2 . PHE B 1 397 ? 79.000  69.806  65.310  1.00 16.02 ? 394  PHE B CE2 1 
ATOM   6802  C  CZ  . PHE B 1 397 ? 77.913  70.127  66.083  1.00 16.65 ? 394  PHE B CZ  1 
ATOM   6803  N  N   . GLY B 1 398 ? 81.341  69.070  70.535  1.00 14.53 ? 395  GLY B N   1 
ATOM   6804  C  CA  . GLY B 1 398 ? 80.806  69.937  71.599  1.00 14.42 ? 395  GLY B CA  1 
ATOM   6805  C  C   . GLY B 1 398 ? 81.775  71.003  72.021  1.00 13.41 ? 395  GLY B C   1 
ATOM   6806  O  O   . GLY B 1 398 ? 81.402  72.155  72.229  1.00 11.83 ? 395  GLY B O   1 
ATOM   6807  N  N   . TYR B 1 399 ? 83.042  70.624  72.120  1.00 12.93 ? 396  TYR B N   1 
ATOM   6808  C  CA  . TYR B 1 399 ? 84.096  71.535  72.533  1.00 13.80 ? 396  TYR B CA  1 
ATOM   6809  C  C   . TYR B 1 399 ? 84.315  72.623  71.458  1.00 14.45 ? 396  TYR B C   1 
ATOM   6810  O  O   . TYR B 1 399 ? 84.420  73.825  71.769  1.00 13.91 ? 396  TYR B O   1 
ATOM   6811  C  CB  . TYR B 1 399 ? 85.369  70.723  72.775  1.00 14.37 ? 396  TYR B CB  1 
ATOM   6812  C  CG  . TYR B 1 399 ? 86.472  71.455  73.502  1.00 14.58 ? 396  TYR B CG  1 
ATOM   6813  C  CD1 . TYR B 1 399 ? 87.384  72.224  72.817  1.00 19.37 ? 396  TYR B CD1 1 
ATOM   6814  C  CD2 . TYR B 1 399 ? 86.619  71.340  74.866  1.00 19.90 ? 396  TYR B CD2 1 
ATOM   6815  C  CE1 . TYR B 1 399 ? 88.398  72.881  73.478  1.00 22.09 ? 396  TYR B CE1 1 
ATOM   6816  C  CE2 . TYR B 1 399 ? 87.623  71.997  75.535  1.00 22.79 ? 396  TYR B CE2 1 
ATOM   6817  C  CZ  . TYR B 1 399 ? 88.513  72.761  74.834  1.00 21.63 ? 396  TYR B CZ  1 
ATOM   6818  O  OH  . TYR B 1 399 ? 89.535  73.400  75.476  1.00 26.92 ? 396  TYR B OH  1 
ATOM   6819  N  N   . LEU B 1 400 ? 84.324  72.192  70.197  1.00 14.10 ? 397  LEU B N   1 
ATOM   6820  C  CA  . LEU B 1 400 ? 84.489  73.082  69.044  1.00 13.96 ? 397  LEU B CA  1 
ATOM   6821  C  C   . LEU B 1 400 ? 83.316  74.079  68.931  1.00 12.84 ? 397  LEU B C   1 
ATOM   6822  O  O   . LEU B 1 400 ? 83.504  75.265  68.655  1.00 9.92  ? 397  LEU B O   1 
ATOM   6823  C  CB  . LEU B 1 400 ? 84.601  72.237  67.773  1.00 14.86 ? 397  LEU B CB  1 
ATOM   6824  C  CG  . LEU B 1 400 ? 85.007  72.948  66.483  1.00 17.67 ? 397  LEU B CG  1 
ATOM   6825  C  CD1 . LEU B 1 400 ? 86.397  73.628  66.626  1.00 17.04 ? 397  LEU B CD1 1 
ATOM   6826  C  CD2 . LEU B 1 400 ? 85.007  71.933  65.356  1.00 16.22 ? 397  LEU B CD2 1 
ATOM   6827  N  N   . VAL B 1 401 ? 82.104  73.578  69.118  1.00 13.65 ? 398  VAL B N   1 
ATOM   6828  C  CA  . VAL B 1 401 ? 80.917  74.437  69.101  1.00 13.04 ? 398  VAL B CA  1 
ATOM   6829  C  C   . VAL B 1 401 ? 81.034  75.519  70.163  1.00 13.58 ? 398  VAL B C   1 
ATOM   6830  O  O   . VAL B 1 401 ? 80.824  76.701  69.889  1.00 14.25 ? 398  VAL B O   1 
ATOM   6831  C  CB  . VAL B 1 401 ? 79.657  73.597  69.310  1.00 13.67 ? 398  VAL B CB  1 
ATOM   6832  C  CG1 . VAL B 1 401 ? 78.445  74.450  69.798  1.00 11.30 ? 398  VAL B CG1 1 
ATOM   6833  C  CG2 . VAL B 1 401 ? 79.364  72.829  68.011  1.00 15.03 ? 398  VAL B CG2 1 
ATOM   6834  N  N   . TYR B 1 402 ? 81.441  75.139  71.361  1.00 13.88 ? 399  TYR B N   1 
ATOM   6835  C  CA  . TYR B 1 402 ? 81.544  76.133  72.446  1.00 14.82 ? 399  TYR B CA  1 
ATOM   6836  C  C   . TYR B 1 402 ? 82.649  77.187  72.158  1.00 12.79 ? 399  TYR B C   1 
ATOM   6837  O  O   . TYR B 1 402 ? 82.479  78.374  72.405  1.00 11.92 ? 399  TYR B O   1 
ATOM   6838  C  CB  . TYR B 1 402 ? 81.716  75.433  73.807  1.00 14.83 ? 399  TYR B CB  1 
ATOM   6839  C  CG  . TYR B 1 402 ? 81.349  76.357  74.933  1.00 13.76 ? 399  TYR B CG  1 
ATOM   6840  C  CD1 . TYR B 1 402 ? 82.288  77.232  75.469  1.00 13.58 ? 399  TYR B CD1 1 
ATOM   6841  C  CD2 . TYR B 1 402 ? 80.043  76.441  75.387  1.00 12.98 ? 399  TYR B CD2 1 
ATOM   6842  C  CE1 . TYR B 1 402 ? 81.955  78.115  76.472  1.00 12.79 ? 399  TYR B CE1 1 
ATOM   6843  C  CE2 . TYR B 1 402 ? 79.692  77.353  76.395  1.00 14.17 ? 399  TYR B CE2 1 
ATOM   6844  C  CZ  . TYR B 1 402 ? 80.667  78.180  76.932  1.00 14.02 ? 399  TYR B CZ  1 
ATOM   6845  O  OH  . TYR B 1 402 ? 80.360  79.080  77.924  1.00 11.08 ? 399  TYR B OH  1 
ATOM   6846  N  N   . PHE B 1 403 ? 83.762  76.730  71.602  1.00 13.24 ? 400  PHE B N   1 
ATOM   6847  C  CA  . PHE B 1 403 ? 84.876  77.584  71.244  1.00 12.43 ? 400  PHE B CA  1 
ATOM   6848  C  C   . PHE B 1 403 ? 84.384  78.691  70.311  1.00 13.51 ? 400  PHE B C   1 
ATOM   6849  O  O   . PHE B 1 403 ? 84.608  79.875  70.549  1.00 12.94 ? 400  PHE B O   1 
ATOM   6850  C  CB  . PHE B 1 403 ? 85.964  76.741  70.553  1.00 12.68 ? 400  PHE B CB  1 
ATOM   6851  C  CG  . PHE B 1 403 ? 86.995  77.561  69.827  1.00 11.95 ? 400  PHE B CG  1 
ATOM   6852  C  CD1 . PHE B 1 403 ? 88.075  78.129  70.507  1.00 9.86  ? 400  PHE B CD1 1 
ATOM   6853  C  CD2 . PHE B 1 403 ? 86.905  77.744  68.462  1.00 11.11 ? 400  PHE B CD2 1 
ATOM   6854  C  CE1 . PHE B 1 403 ? 89.021  78.867  69.834  1.00 11.72 ? 400  PHE B CE1 1 
ATOM   6855  C  CE2 . PHE B 1 403 ? 87.853  78.521  67.785  1.00 13.95 ? 400  PHE B CE2 1 
ATOM   6856  C  CZ  . PHE B 1 403 ? 88.900  79.081  68.477  1.00 13.13 ? 400  PHE B CZ  1 
ATOM   6857  N  N   . PHE B 1 404 ? 83.682  78.307  69.248  1.00 12.70 ? 401  PHE B N   1 
ATOM   6858  C  CA  . PHE B 1 404 ? 83.194  79.303  68.314  1.00 12.90 ? 401  PHE B CA  1 
ATOM   6859  C  C   . PHE B 1 404 ? 82.080  80.181  68.891  1.00 12.23 ? 401  PHE B C   1 
ATOM   6860  O  O   . PHE B 1 404 ? 82.055  81.372  68.628  1.00 12.13 ? 401  PHE B O   1 
ATOM   6861  C  CB  . PHE B 1 404 ? 82.780  78.665  67.004  1.00 12.56 ? 401  PHE B CB  1 
ATOM   6862  C  CG  . PHE B 1 404 ? 83.935  78.291  66.118  1.00 11.98 ? 401  PHE B CG  1 
ATOM   6863  C  CD1 . PHE B 1 404 ? 84.703  79.282  65.520  1.00 13.75 ? 401  PHE B CD1 1 
ATOM   6864  C  CD2 . PHE B 1 404 ? 84.196  76.979  65.811  1.00 11.59 ? 401  PHE B CD2 1 
ATOM   6865  C  CE1 . PHE B 1 404 ? 85.730  78.959  64.658  1.00 14.07 ? 401  PHE B CE1 1 
ATOM   6866  C  CE2 . PHE B 1 404 ? 85.233  76.651  64.942  1.00 15.57 ? 401  PHE B CE2 1 
ATOM   6867  C  CZ  . PHE B 1 404 ? 85.992  77.644  64.374  1.00 13.29 ? 401  PHE B CZ  1 
ATOM   6868  N  N   . GLU B 1 405 ? 81.178  79.611  69.692  1.00 12.48 ? 402  GLU B N   1 
ATOM   6869  C  CA  . GLU B 1 405 ? 80.117  80.425  70.289  1.00 12.82 ? 402  GLU B CA  1 
ATOM   6870  C  C   . GLU B 1 405 ? 80.715  81.515  71.183  1.00 12.89 ? 402  GLU B C   1 
ATOM   6871  O  O   . GLU B 1 405 ? 80.386  82.715  71.058  1.00 11.75 ? 402  GLU B O   1 
ATOM   6872  C  CB  . GLU B 1 405 ? 79.137  79.539  71.073  1.00 13.78 ? 402  GLU B CB  1 
ATOM   6873  C  CG  . GLU B 1 405 ? 78.293  78.617  70.178  1.00 12.06 ? 402  GLU B CG  1 
ATOM   6874  C  CD  . GLU B 1 405 ? 77.328  77.720  70.962  1.00 15.68 ? 402  GLU B CD  1 
ATOM   6875  O  OE1 . GLU B 1 405 ? 77.515  77.562  72.186  1.00 17.91 ? 402  GLU B OE1 1 
ATOM   6876  O  OE2 . GLU B 1 405 ? 76.397  77.140  70.341  1.00 13.44 ? 402  GLU B OE2 1 
ATOM   6877  N  N   . LYS B 1 406 ? 81.636  81.112  72.043  1.00 12.80 ? 403  LYS B N   1 
ATOM   6878  C  CA  . LYS B 1 406 ? 82.251  82.049  72.973  1.00 13.49 ? 403  LYS B CA  1 
ATOM   6879  C  C   . LYS B 1 406 ? 83.112  83.050  72.211  1.00 13.14 ? 403  LYS B C   1 
ATOM   6880  O  O   . LYS B 1 406 ? 83.124  84.228  72.562  1.00 13.76 ? 403  LYS B O   1 
ATOM   6881  C  CB  . LYS B 1 406 ? 83.062  81.280  74.017  1.00 14.96 ? 403  LYS B CB  1 
ATOM   6882  C  CG  . LYS B 1 406 ? 83.397  81.994  75.323  1.00 17.12 ? 403  LYS B CG  1 
ATOM   6883  C  CD  . LYS B 1 406 ? 82.123  82.489  76.022  1.00 18.13 ? 403  LYS B CD  1 
ATOM   6884  C  CE  . LYS B 1 406 ? 82.173  82.427  77.526  1.00 20.34 ? 403  LYS B CE  1 
ATOM   6885  N  NZ  . LYS B 1 406 ? 83.347  82.932  78.263  1.00 12.56 ? 403  LYS B NZ  1 
ATOM   6886  N  N   . ALA B 1 407 ? 83.847  82.594  71.186  1.00 13.71 ? 404  ALA B N   1 
ATOM   6887  C  CA  . ALA B 1 407 ? 84.667  83.526  70.384  1.00 13.70 ? 404  ALA B CA  1 
ATOM   6888  C  C   . ALA B 1 407 ? 83.775  84.544  69.669  1.00 13.80 ? 404  ALA B C   1 
ATOM   6889  O  O   . ALA B 1 407 ? 84.115  85.736  69.579  1.00 13.66 ? 404  ALA B O   1 
ATOM   6890  C  CB  . ALA B 1 407 ? 85.522  82.793  69.373  1.00 14.03 ? 404  ALA B CB  1 
ATOM   6891  N  N   . CYS B 1 408 ? 82.647  84.069  69.163  1.00 13.27 ? 405  CYS B N   1 
ATOM   6892  C  CA  . CYS B 1 408 ? 81.679  84.926  68.464  1.00 12.89 ? 405  CYS B CA  1 
ATOM   6893  C  C   . CYS B 1 408 ? 81.119  86.002  69.381  1.00 13.35 ? 405  CYS B C   1 
ATOM   6894  O  O   . CYS B 1 408 ? 81.018  87.174  68.980  1.00 14.08 ? 405  CYS B O   1 
ATOM   6895  C  CB  . CYS B 1 408 ? 80.557  84.084  67.886  1.00 13.56 ? 405  CYS B CB  1 
ATOM   6896  S  SG  . CYS B 1 408 ? 79.297  85.029  66.980  1.00 18.62 ? 405  CYS B SG  1 
ATOM   6897  N  N   . ALA B 1 409 ? 80.724  85.619  70.594  1.00 13.47 ? 406  ALA B N   1 
ATOM   6898  C  CA  . ALA B 1 409 ? 80.235  86.599  71.589  1.00 14.61 ? 406  ALA B CA  1 
ATOM   6899  C  C   . ALA B 1 409 ? 81.265  87.708  71.782  1.00 14.02 ? 406  ALA B C   1 
ATOM   6900  O  O   . ALA B 1 409 ? 80.950  88.891  71.700  1.00 14.46 ? 406  ALA B O   1 
ATOM   6901  C  CB  . ALA B 1 409 ? 79.981  85.928  72.921  1.00 13.03 ? 406  ALA B CB  1 
HETATM 6902  N  N   . MSE B 1 410 ? 82.512  87.310  72.033  1.00 13.94 ? 407  MSE B N   1 
HETATM 6903  C  CA  . MSE B 1 410 ? 83.592  88.275  72.259  1.00 12.93 ? 407  MSE B CA  1 
HETATM 6904  C  C   . MSE B 1 410 ? 83.841  89.156  71.034  1.00 12.52 ? 407  MSE B C   1 
HETATM 6905  O  O   . MSE B 1 410 ? 83.979  90.375  71.154  1.00 12.23 ? 407  MSE B O   1 
HETATM 6906  C  CB  . MSE B 1 410 ? 84.878  87.538  72.641  1.00 12.09 ? 407  MSE B CB  1 
HETATM 6907  C  CG  . MSE B 1 410 ? 86.122  88.445  72.817  1.00 14.05 ? 407  MSE B CG  1 
HETATM 6908  SE SE  . MSE B 1 410 ? 85.958  89.783  74.213  1.00 15.09 ? 407  MSE B SE  1 
HETATM 6909  C  CE  . MSE B 1 410 ? 85.663  88.631  75.756  1.00 16.96 ? 407  MSE B CE  1 
ATOM   6910  N  N   . SER B 1 411 ? 83.904  88.521  69.865  1.00 11.96 ? 408  SER B N   1 
ATOM   6911  C  CA  . SER B 1 411 ? 84.167  89.206  68.599  1.00 12.61 ? 408  SER B CA  1 
ATOM   6912  C  C   . SER B 1 411 ? 83.125  90.298  68.332  1.00 12.67 ? 408  SER B C   1 
ATOM   6913  O  O   . SER B 1 411 ? 83.474  91.434  68.019  1.00 11.73 ? 408  SER B O   1 
ATOM   6914  C  CB  . SER B 1 411 ? 84.200  88.174  67.464  1.00 12.35 ? 408  SER B CB  1 
ATOM   6915  O  OG  . SER B 1 411 ? 84.575  88.748  66.243  1.00 15.37 ? 408  SER B OG  1 
ATOM   6916  N  N   . GLY B 1 412 ? 81.847  89.967  68.533  1.00 12.19 ? 409  GLY B N   1 
ATOM   6917  C  CA  . GLY B 1 412 ? 80.761  90.923  68.285  1.00 13.03 ? 409  GLY B CA  1 
ATOM   6918  C  C   . GLY B 1 412 ? 80.819  92.100  69.233  1.00 13.31 ? 409  GLY B C   1 
ATOM   6919  O  O   . GLY B 1 412 ? 80.656  93.263  68.829  1.00 13.64 ? 409  GLY B O   1 
ATOM   6920  N  N   . TYR B 1 413 ? 81.056  91.808  70.507  1.00 14.58 ? 410  TYR B N   1 
ATOM   6921  C  CA  . TYR B 1 413 ? 81.176  92.876  71.488  1.00 14.71 ? 410  TYR B CA  1 
ATOM   6922  C  C   . TYR B 1 413 ? 82.362  93.764  71.150  1.00 14.66 ? 410  TYR B C   1 
ATOM   6923  O  O   . TYR B 1 413 ? 82.274  94.993  71.250  1.00 14.28 ? 410  TYR B O   1 
ATOM   6924  C  CB  . TYR B 1 413 ? 81.261  92.353  72.926  1.00 13.70 ? 410  TYR B CB  1 
ATOM   6925  C  CG  . TYR B 1 413 ? 79.911  92.004  73.559  1.00 14.60 ? 410  TYR B CG  1 
ATOM   6926  C  CD1 . TYR B 1 413 ? 78.884  92.943  73.615  1.00 16.15 ? 410  TYR B CD1 1 
ATOM   6927  C  CD2 . TYR B 1 413 ? 79.713  90.789  74.195  1.00 13.78 ? 410  TYR B CD2 1 
ATOM   6928  C  CE1 . TYR B 1 413 ? 77.670  92.638  74.218  1.00 18.09 ? 410  TYR B CE1 1 
ATOM   6929  C  CE2 . TYR B 1 413 ? 78.516  90.487  74.812  1.00 14.98 ? 410  TYR B CE2 1 
ATOM   6930  C  CZ  . TYR B 1 413 ? 77.499  91.410  74.825  1.00 15.00 ? 410  TYR B CZ  1 
ATOM   6931  O  OH  . TYR B 1 413 ? 76.320  91.094  75.459  1.00 15.41 ? 410  TYR B OH  1 
ATOM   6932  N  N   . LEU B 1 414 ? 83.468  93.156  70.727  1.00 14.46 ? 411  LEU B N   1 
ATOM   6933  C  CA  . LEU B 1 414 ? 84.648  93.941  70.362  1.00 13.39 ? 411  LEU B CA  1 
ATOM   6934  C  C   . LEU B 1 414 ? 84.398  94.806  69.125  1.00 13.81 ? 411  LEU B C   1 
ATOM   6935  O  O   . LEU B 1 414 ? 84.921  95.924  69.019  1.00 10.14 ? 411  LEU B O   1 
ATOM   6936  C  CB  . LEU B 1 414 ? 85.871  93.029  70.161  1.00 13.70 ? 411  LEU B CB  1 
ATOM   6937  C  CG  . LEU B 1 414 ? 86.430  92.404  71.444  1.00 13.19 ? 411  LEU B CG  1 
ATOM   6938  C  CD1 . LEU B 1 414 ? 87.590  91.450  71.091  1.00 14.71 ? 411  LEU B CD1 1 
ATOM   6939  C  CD2 . LEU B 1 414 ? 86.855  93.479  72.423  1.00 10.68 ? 411  LEU B CD2 1 
ATOM   6940  N  N   . LEU B 1 415 ? 83.577  94.308  68.206  1.00 12.71 ? 412  LEU B N   1 
ATOM   6941  C  CA  . LEU B 1 415 ? 83.225  95.066  67.001  1.00 13.25 ? 412  LEU B CA  1 
ATOM   6942  C  C   . LEU B 1 415 ? 82.346  96.259  67.365  1.00 14.60 ? 412  LEU B C   1 
ATOM   6943  O  O   . LEU B 1 415 ? 82.298  97.236  66.631  1.00 16.37 ? 412  LEU B O   1 
ATOM   6944  C  CB  . LEU B 1 415 ? 82.491  94.173  65.988  1.00 14.01 ? 412  LEU B CB  1 
ATOM   6945  C  CG  . LEU B 1 415 ? 82.062  94.776  64.640  1.00 14.77 ? 412  LEU B CG  1 
ATOM   6946  C  CD1 . LEU B 1 415 ? 83.276  95.318  63.915  1.00 12.41 ? 412  LEU B CD1 1 
ATOM   6947  C  CD2 . LEU B 1 415 ? 81.294  93.727  63.782  1.00 10.80 ? 412  LEU B CD2 1 
ATOM   6948  N  N   . GLY B 1 416 ? 81.674  96.184  68.510  1.00 13.41 ? 413  GLY B N   1 
ATOM   6949  C  CA  . GLY B 1 416 ? 80.796  97.250  68.962  1.00 14.73 ? 413  GLY B CA  1 
ATOM   6950  C  C   . GLY B 1 416 ? 79.322  97.040  68.582  1.00 14.64 ? 413  GLY B C   1 
ATOM   6951  O  O   . GLY B 1 416 ? 78.573  97.996  68.494  1.00 14.61 ? 413  GLY B O   1 
ATOM   6952  N  N   . VAL B 1 417 ? 78.912  95.795  68.354  1.00 13.68 ? 414  VAL B N   1 
ATOM   6953  C  CA  . VAL B 1 417 ? 77.512  95.504  68.003  1.00 12.37 ? 414  VAL B CA  1 
ATOM   6954  C  C   . VAL B 1 417 ? 76.819  94.664  69.082  1.00 13.25 ? 414  VAL B C   1 
ATOM   6955  O  O   . VAL B 1 417 ? 77.442  94.249  70.067  1.00 11.59 ? 414  VAL B O   1 
ATOM   6956  C  CB  . VAL B 1 417 ? 77.413  94.714  66.683  1.00 12.86 ? 414  VAL B CB  1 
ATOM   6957  C  CG1 . VAL B 1 417 ? 78.094  95.469  65.516  1.00 9.63  ? 414  VAL B CG1 1 
ATOM   6958  C  CG2 . VAL B 1 417 ? 78.039  93.284  66.828  1.00 10.58 ? 414  VAL B CG2 1 
ATOM   6959  N  N   . ASN B 1 418 ? 75.512  94.454  68.909  1.00 13.28 ? 415  ASN B N   1 
ATOM   6960  C  CA  . ASN B 1 418 ? 74.748  93.545  69.755  1.00 13.19 ? 415  ASN B CA  1 
ATOM   6961  C  C   . ASN B 1 418 ? 74.920  92.169  69.091  1.00 13.28 ? 415  ASN B C   1 
ATOM   6962  O  O   . ASN B 1 418 ? 74.384  91.920  68.023  1.00 13.16 ? 415  ASN B O   1 
ATOM   6963  C  CB  . ASN B 1 418 ? 73.274  93.945  69.846  1.00 13.62 ? 415  ASN B CB  1 
ATOM   6964  C  CG  . ASN B 1 418 ? 72.449  92.951  70.633  1.00 12.81 ? 415  ASN B CG  1 
ATOM   6965  O  OD1 . ASN B 1 418 ? 72.909  91.846  70.923  1.00 12.16 ? 415  ASN B OD1 1 
ATOM   6966  N  ND2 . ASN B 1 418 ? 71.202  93.329  70.966  1.00 10.59 ? 415  ASN B ND2 1 
ATOM   6967  N  N   . PRO B 1 419 ? 75.668  91.263  69.728  1.00 13.17 ? 416  PRO B N   1 
ATOM   6968  C  CA  . PRO B 1 419 ? 75.907  89.982  69.075  1.00 12.71 ? 416  PRO B CA  1 
ATOM   6969  C  C   . PRO B 1 419 ? 74.735  89.010  69.039  1.00 13.16 ? 416  PRO B C   1 
ATOM   6970  O  O   . PRO B 1 419 ? 74.792  88.047  68.288  1.00 13.78 ? 416  PRO B O   1 
ATOM   6971  C  CB  . PRO B 1 419 ? 77.012  89.346  69.938  1.00 13.04 ? 416  PRO B CB  1 
ATOM   6972  C  CG  . PRO B 1 419 ? 77.518  90.439  70.854  1.00 13.55 ? 416  PRO B CG  1 
ATOM   6973  C  CD  . PRO B 1 419 ? 76.368  91.368  71.021  1.00 13.63 ? 416  PRO B CD  1 
ATOM   6974  N  N   . PHE B 1 420 ? 73.665  89.298  69.775  1.00 13.77 ? 417  PHE B N   1 
ATOM   6975  C  CA  . PHE B 1 420 ? 72.584  88.308  69.935  1.00 13.92 ? 417  PHE B CA  1 
ATOM   6976  C  C   . PHE B 1 420 ? 71.214  88.592  69.339  1.00 14.51 ? 417  PHE B C   1 
ATOM   6977  O  O   . PHE B 1 420 ? 70.274  87.792  69.553  1.00 13.93 ? 417  PHE B O   1 
ATOM   6978  C  CB  . PHE B 1 420 ? 72.468  87.998  71.431  1.00 14.07 ? 417  PHE B CB  1 
ATOM   6979  C  CG  . PHE B 1 420 ? 73.803  87.684  72.072  1.00 15.14 ? 417  PHE B CG  1 
ATOM   6980  C  CD1 . PHE B 1 420 ? 74.435  86.467  71.826  1.00 16.48 ? 417  PHE B CD1 1 
ATOM   6981  C  CD2 . PHE B 1 420 ? 74.426  88.602  72.906  1.00 15.10 ? 417  PHE B CD2 1 
ATOM   6982  C  CE1 . PHE B 1 420 ? 75.687  86.185  72.376  1.00 16.02 ? 417  PHE B CE1 1 
ATOM   6983  C  CE2 . PHE B 1 420 ? 75.667  88.313  73.480  1.00 15.18 ? 417  PHE B CE2 1 
ATOM   6984  C  CZ  . PHE B 1 420 ? 76.296  87.103  73.202  1.00 16.32 ? 417  PHE B CZ  1 
ATOM   6985  N  N   . ASP B 1 421 ? 71.088  89.704  68.602  1.00 14.43 ? 418  ASP B N   1 
ATOM   6986  C  CA  . ASP B 1 421 ? 69.833  90.038  67.923  1.00 14.14 ? 418  ASP B CA  1 
ATOM   6987  C  C   . ASP B 1 421 ? 70.005  89.814  66.411  1.00 14.15 ? 418  ASP B C   1 
ATOM   6988  O  O   . ASP B 1 421 ? 71.065  89.383  65.958  1.00 13.24 ? 418  ASP B O   1 
ATOM   6989  C  CB  . ASP B 1 421 ? 69.384  91.472  68.237  1.00 15.36 ? 418  ASP B CB  1 
ATOM   6990  C  CG  . ASP B 1 421 ? 70.298  92.520  67.654  1.00 15.95 ? 418  ASP B CG  1 
ATOM   6991  O  OD1 . ASP B 1 421 ? 71.392  92.170  67.150  1.00 13.23 ? 418  ASP B OD1 1 
ATOM   6992  O  OD2 . ASP B 1 421 ? 69.916  93.708  67.704  1.00 18.28 ? 418  ASP B OD2 1 
ATOM   6993  N  N   . GLN B 1 422 ? 68.934  90.045  65.653  1.00 13.45 ? 419  GLN B N   1 
ATOM   6994  C  CA  . GLN B 1 422 ? 68.930  89.889  64.194  1.00 13.43 ? 419  GLN B CA  1 
ATOM   6995  C  C   . GLN B 1 422 ? 67.815  90.742  63.563  1.00 13.56 ? 419  GLN B C   1 
ATOM   6996  O  O   . GLN B 1 422 ? 66.919  90.222  62.897  1.00 14.89 ? 419  GLN B O   1 
ATOM   6997  C  CB  . GLN B 1 422 ? 68.750  88.422  63.790  1.00 13.17 ? 419  GLN B CB  1 
ATOM   6998  C  CG  . GLN B 1 422 ? 67.512  87.711  64.413  1.00 15.81 ? 419  GLN B CG  1 
ATOM   6999  C  CD  . GLN B 1 422 ? 67.733  87.305  65.860  1.00 18.21 ? 419  GLN B CD  1 
ATOM   7000  O  OE1 . GLN B 1 422 ? 68.867  87.040  66.273  1.00 17.97 ? 419  GLN B OE1 1 
ATOM   7001  N  NE2 . GLN B 1 422 ? 66.644  87.204  66.628  1.00 19.61 ? 419  GLN B NE2 1 
ATOM   7002  N  N   . PRO B 1 423 ? 67.875  92.064  63.761  1.00 13.35 ? 420  PRO B N   1 
ATOM   7003  C  CA  . PRO B 1 423 ? 66.829  92.938  63.231  1.00 12.69 ? 420  PRO B CA  1 
ATOM   7004  C  C   . PRO B 1 423 ? 66.720  92.973  61.697  1.00 12.47 ? 420  PRO B C   1 
ATOM   7005  O  O   . PRO B 1 423 ? 65.654  93.298  61.162  1.00 9.66  ? 420  PRO B O   1 
ATOM   7006  C  CB  . PRO B 1 423 ? 67.230  94.323  63.761  1.00 13.51 ? 420  PRO B CB  1 
ATOM   7007  C  CG  . PRO B 1 423 ? 68.704  94.254  63.939  1.00 14.02 ? 420  PRO B CG  1 
ATOM   7008  C  CD  . PRO B 1 423 ? 69.005  92.826  64.341  1.00 13.58 ? 420  PRO B CD  1 
ATOM   7009  N  N   . GLY B 1 424 ? 67.812  92.652  61.017  1.00 9.38  ? 421  GLY B N   1 
ATOM   7010  C  CA  . GLY B 1 424 ? 67.854  92.682  59.570  1.00 10.97 ? 421  GLY B CA  1 
ATOM   7011  C  C   . GLY B 1 424 ? 67.004  91.680  58.813  1.00 11.96 ? 421  GLY B C   1 
ATOM   7012  O  O   . GLY B 1 424 ? 66.706  91.906  57.645  1.00 14.22 ? 421  GLY B O   1 
ATOM   7013  N  N   . VAL B 1 425 ? 66.603  90.573  59.444  1.00 11.08 ? 422  VAL B N   1 
ATOM   7014  C  CA  . VAL B 1 425 ? 65.780  89.594  58.736  1.00 10.64 ? 422  VAL B CA  1 
ATOM   7015  C  C   . VAL B 1 425 ? 64.307  90.046  58.625  1.00 13.54 ? 422  VAL B C   1 
ATOM   7016  O  O   . VAL B 1 425 ? 63.541  89.488  57.850  1.00 15.25 ? 422  VAL B O   1 
ATOM   7017  C  CB  . VAL B 1 425 ? 65.860  88.167  59.384  1.00 10.34 ? 422  VAL B CB  1 
ATOM   7018  C  CG1 . VAL B 1 425 ? 67.304  87.653  59.363  1.00 11.31 ? 422  VAL B CG1 1 
ATOM   7019  C  CG2 . VAL B 1 425 ? 65.298  88.161  60.800  1.00 8.45  ? 422  VAL B CG2 1 
ATOM   7020  N  N   . GLU B 1 426 ? 63.919  91.095  59.348  1.00 15.34 ? 423  GLU B N   1 
ATOM   7021  C  CA  . GLU B 1 426 ? 62.533  91.549  59.304  1.00 15.82 ? 423  GLU B CA  1 
ATOM   7022  C  C   . GLU B 1 426 ? 62.140  92.184  57.982  1.00 15.81 ? 423  GLU B C   1 
ATOM   7023  O  O   . GLU B 1 426 ? 60.970  92.089  57.588  1.00 15.10 ? 423  GLU B O   1 
ATOM   7024  C  CB  . GLU B 1 426 ? 62.238  92.521  60.449  1.00 17.15 ? 423  GLU B CB  1 
ATOM   7025  C  CG  . GLU B 1 426 ? 62.440  91.887  61.804  1.00 22.12 ? 423  GLU B CG  1 
ATOM   7026  C  CD  . GLU B 1 426 ? 61.642  90.605  61.949  1.00 26.98 ? 423  GLU B CD  1 
ATOM   7027  O  OE1 . GLU B 1 426 ? 60.556  90.500  61.323  1.00 29.21 ? 423  GLU B OE1 1 
ATOM   7028  O  OE2 . GLU B 1 426 ? 62.097  89.701  62.694  1.00 30.04 ? 423  GLU B OE2 1 
ATOM   7029  N  N   . ALA B 1 427 ? 63.099  92.804  57.285  1.00 14.83 ? 424  ALA B N   1 
ATOM   7030  C  CA  . ALA B 1 427 ? 62.795  93.489  56.014  1.00 14.86 ? 424  ALA B CA  1 
ATOM   7031  C  C   . ALA B 1 427 ? 62.268  92.571  54.894  1.00 15.17 ? 424  ALA B C   1 
ATOM   7032  O  O   . ALA B 1 427 ? 61.245  92.902  54.263  1.00 15.41 ? 424  ALA B O   1 
ATOM   7033  C  CB  . ALA B 1 427 ? 63.995  94.327  55.515  1.00 14.16 ? 424  ALA B CB  1 
ATOM   7034  N  N   . TYR B 1 428 ? 62.939  91.450  54.618  1.00 14.74 ? 425  TYR B N   1 
ATOM   7035  C  CA  . TYR B 1 428 ? 62.448  90.575  53.547  1.00 14.28 ? 425  TYR B CA  1 
ATOM   7036  C  C   . TYR B 1 428 ? 61.135  89.926  53.978  1.00 14.17 ? 425  TYR B C   1 
ATOM   7037  O  O   . TYR B 1 428 ? 60.219  89.763  53.162  1.00 14.28 ? 425  TYR B O   1 
ATOM   7038  C  CB  . TYR B 1 428 ? 63.461  89.524  53.114  1.00 13.09 ? 425  TYR B CB  1 
ATOM   7039  C  CG  . TYR B 1 428 ? 63.501  88.272  53.935  1.00 10.72 ? 425  TYR B CG  1 
ATOM   7040  C  CD1 . TYR B 1 428 ? 62.639  87.218  53.656  1.00 10.34 ? 425  TYR B CD1 1 
ATOM   7041  C  CD2 . TYR B 1 428 ? 64.396  88.121  54.958  1.00 13.37 ? 425  TYR B CD2 1 
ATOM   7042  C  CE1 . TYR B 1 428 ? 62.646  86.064  54.402  1.00 12.01 ? 425  TYR B CE1 1 
ATOM   7043  C  CE2 . TYR B 1 428 ? 64.427  86.952  55.712  1.00 14.78 ? 425  TYR B CE2 1 
ATOM   7044  C  CZ  . TYR B 1 428 ? 63.541  85.929  55.434  1.00 11.10 ? 425  TYR B CZ  1 
ATOM   7045  O  OH  . TYR B 1 428 ? 63.559  84.761  56.179  1.00 11.57 ? 425  TYR B OH  1 
ATOM   7046  N  N   . LYS B 1 429 ? 61.033  89.576  55.254  1.00 15.49 ? 426  LYS B N   1 
ATOM   7047  C  CA  . LYS B 1 429 ? 59.812  88.951  55.778  1.00 15.95 ? 426  LYS B CA  1 
ATOM   7048  C  C   . LYS B 1 429 ? 58.593  89.854  55.605  1.00 16.45 ? 426  LYS B C   1 
ATOM   7049  O  O   . LYS B 1 429 ? 57.535  89.407  55.142  1.00 16.72 ? 426  LYS B O   1 
ATOM   7050  C  CB  . LYS B 1 429 ? 59.970  88.578  57.248  1.00 16.93 ? 426  LYS B CB  1 
ATOM   7051  C  CG  . LYS B 1 429 ? 60.978  87.465  57.522  1.00 16.12 ? 426  LYS B CG  1 
ATOM   7052  C  CD  . LYS B 1 429 ? 61.028  87.114  59.009  1.00 14.57 ? 426  LYS B CD  1 
ATOM   7053  C  CE  . LYS B 1 429 ? 62.097  86.044  59.268  1.00 18.81 ? 426  LYS B CE  1 
ATOM   7054  N  NZ  . LYS B 1 429 ? 62.134  85.586  60.674  1.00 19.51 ? 426  LYS B NZ  1 
ATOM   7055  N  N   . LYS B 1 430 ? 58.739  91.128  55.959  1.00 16.33 ? 427  LYS B N   1 
ATOM   7056  C  CA  . LYS B 1 430 ? 57.633  92.070  55.839  1.00 17.28 ? 427  LYS B CA  1 
ATOM   7057  C  C   . LYS B 1 430 ? 57.164  92.195  54.380  1.00 15.74 ? 427  LYS B C   1 
ATOM   7058  O  O   . LYS B 1 430 ? 55.957  92.217  54.104  1.00 13.67 ? 427  LYS B O   1 
ATOM   7059  C  CB  . LYS B 1 430 ? 58.029  93.430  56.422  1.00 17.48 ? 427  LYS B CB  1 
ATOM   7060  C  CG  . LYS B 1 430 ? 56.925  94.461  56.378  1.00 23.01 ? 427  LYS B CG  1 
ATOM   7061  C  CD  . LYS B 1 430 ? 57.237  95.727  57.202  1.00 28.71 ? 427  LYS B CD  1 
ATOM   7062  C  CE  . LYS B 1 430 ? 58.435  96.495  56.690  1.00 34.33 ? 427  LYS B CE  1 
ATOM   7063  N  NZ  . LYS B 1 430 ? 58.674  97.751  57.497  1.00 37.92 ? 427  LYS B NZ  1 
ATOM   7064  N  N   . ASN B 1 431 ? 58.122  92.300  53.461  1.00 14.33 ? 428  ASN B N   1 
ATOM   7065  C  CA  . ASN B 1 431 ? 57.824  92.395  52.036  1.00 14.55 ? 428  ASN B CA  1 
ATOM   7066  C  C   . ASN B 1 431 ? 57.173  91.112  51.502  1.00 15.15 ? 428  ASN B C   1 
ATOM   7067  O  O   . ASN B 1 431 ? 56.218  91.152  50.703  1.00 14.23 ? 428  ASN B O   1 
ATOM   7068  C  CB  . ASN B 1 431 ? 59.104  92.706  51.228  1.00 13.61 ? 428  ASN B CB  1 
ATOM   7069  C  CG  . ASN B 1 431 ? 59.606  94.138  51.426  1.00 14.61 ? 428  ASN B CG  1 
ATOM   7070  O  OD1 . ASN B 1 431 ? 58.973  94.947  52.098  1.00 13.08 ? 428  ASN B OD1 1 
ATOM   7071  N  ND2 . ASN B 1 431 ? 60.735  94.464  50.789  1.00 13.35 ? 428  ASN B ND2 1 
HETATM 7072  N  N   . MSE B 1 432 ? 57.675  89.969  51.944  1.00 14.76 ? 429  MSE B N   1 
HETATM 7073  C  CA  . MSE B 1 432 ? 57.118  88.715  51.492  1.00 14.54 ? 429  MSE B CA  1 
HETATM 7074  C  C   . MSE B 1 432 ? 55.656  88.583  51.912  1.00 13.75 ? 429  MSE B C   1 
HETATM 7075  O  O   . MSE B 1 432 ? 54.808  88.240  51.081  1.00 14.14 ? 429  MSE B O   1 
HETATM 7076  C  CB  . MSE B 1 432 ? 57.933  87.554  52.033  1.00 13.70 ? 429  MSE B CB  1 
HETATM 7077  C  CG  . MSE B 1 432 ? 57.483  86.200  51.600  1.00 14.56 ? 429  MSE B CG  1 
HETATM 7078  SE SE  . MSE B 1 432 ? 58.612  84.795  52.410  1.00 19.36 ? 429  MSE B SE  1 
HETATM 7079  C  CE  . MSE B 1 432 ? 58.210  85.103  54.322  1.00 17.60 ? 429  MSE B CE  1 
ATOM   7080  N  N   . PHE B 1 433 ? 55.365  88.836  53.186  1.00 14.31 ? 430  PHE B N   1 
ATOM   7081  C  CA  . PHE B 1 433 ? 53.982  88.719  53.683  1.00 13.78 ? 430  PHE B CA  1 
ATOM   7082  C  C   . PHE B 1 433 ? 53.059  89.639  52.899  1.00 13.16 ? 430  PHE B C   1 
ATOM   7083  O  O   . PHE B 1 433 ? 51.938  89.270  52.594  1.00 12.07 ? 430  PHE B O   1 
ATOM   7084  C  CB  . PHE B 1 433 ? 53.834  89.051  55.181  1.00 14.27 ? 430  PHE B CB  1 
ATOM   7085  C  CG  . PHE B 1 433 ? 54.685  88.197  56.117  1.00 15.03 ? 430  PHE B CG  1 
ATOM   7086  C  CD1 . PHE B 1 433 ? 54.804  86.833  55.937  1.00 18.73 ? 430  PHE B CD1 1 
ATOM   7087  C  CD2 . PHE B 1 433 ? 55.259  88.768  57.252  1.00 20.19 ? 430  PHE B CD2 1 
ATOM   7088  C  CE1 . PHE B 1 433 ? 55.573  86.061  56.811  1.00 21.38 ? 430  PHE B CE1 1 
ATOM   7089  C  CE2 . PHE B 1 433 ? 56.009  88.009  58.139  1.00 20.55 ? 430  PHE B CE2 1 
ATOM   7090  C  CZ  . PHE B 1 433 ? 56.169  86.647  57.915  1.00 20.61 ? 430  PHE B CZ  1 
ATOM   7091  N  N   . ALA B 1 434 ? 53.522  90.855  52.611  1.00 12.83 ? 431  ALA B N   1 
ATOM   7092  C  CA  . ALA B 1 434 ? 52.730  91.792  51.834  1.00 13.56 ? 431  ALA B CA  1 
ATOM   7093  C  C   . ALA B 1 434 ? 52.429  91.194  50.467  1.00 14.28 ? 431  ALA B C   1 
ATOM   7094  O  O   . ALA B 1 434 ? 51.271  91.136  50.052  1.00 14.05 ? 431  ALA B O   1 
ATOM   7095  C  CB  . ALA B 1 434 ? 53.455  93.147  51.691  1.00 11.62 ? 431  ALA B CB  1 
ATOM   7096  N  N   . LEU B 1 435 ? 53.460  90.706  49.785  1.00 14.26 ? 432  LEU B N   1 
ATOM   7097  C  CA  . LEU B 1 435 ? 53.294  90.150  48.444  1.00 14.52 ? 432  LEU B CA  1 
ATOM   7098  C  C   . LEU B 1 435 ? 52.480  88.850  48.413  1.00 14.15 ? 432  LEU B C   1 
ATOM   7099  O  O   . LEU B 1 435 ? 51.846  88.536  47.412  1.00 12.83 ? 432  LEU B O   1 
ATOM   7100  C  CB  . LEU B 1 435 ? 54.662  89.984  47.758  1.00 15.18 ? 432  LEU B CB  1 
ATOM   7101  C  CG  . LEU B 1 435 ? 55.404  91.308  47.496  1.00 14.71 ? 432  LEU B CG  1 
ATOM   7102  C  CD1 . LEU B 1 435 ? 56.813  91.045  46.985  1.00 14.75 ? 432  LEU B CD1 1 
ATOM   7103  C  CD2 . LEU B 1 435 ? 54.615  92.191  46.522  1.00 14.51 ? 432  LEU B CD2 1 
ATOM   7104  N  N   . LEU B 1 436 ? 52.496  88.109  49.514  1.00 14.72 ? 433  LEU B N   1 
ATOM   7105  C  CA  . LEU B 1 436 ? 51.715  86.885  49.630  1.00 13.79 ? 433  LEU B CA  1 
ATOM   7106  C  C   . LEU B 1 436 ? 50.232  87.198  49.847  1.00 14.70 ? 433  LEU B C   1 
ATOM   7107  O  O   . LEU B 1 436 ? 49.386  86.316  49.768  1.00 16.07 ? 433  LEU B O   1 
ATOM   7108  C  CB  . LEU B 1 436 ? 52.225  86.049  50.796  1.00 14.46 ? 433  LEU B CB  1 
ATOM   7109  C  CG  . LEU B 1 436 ? 53.538  85.284  50.605  1.00 11.25 ? 433  LEU B CG  1 
ATOM   7110  C  CD1 . LEU B 1 436 ? 54.020  84.758  51.950  1.00 10.59 ? 433  LEU B CD1 1 
ATOM   7111  C  CD2 . LEU B 1 436 ? 53.344  84.187  49.593  1.00 7.59  ? 433  LEU B CD2 1 
ATOM   7112  N  N   . GLY B 1 437 ? 49.926  88.461  50.107  1.00 15.03 ? 434  GLY B N   1 
ATOM   7113  C  CA  . GLY B 1 437 ? 48.552  88.888  50.346  1.00 14.66 ? 434  GLY B CA  1 
ATOM   7114  C  C   . GLY B 1 437 ? 48.105  88.690  51.781  1.00 14.77 ? 434  GLY B C   1 
ATOM   7115  O  O   . GLY B 1 437 ? 46.917  88.524  52.044  1.00 13.63 ? 434  GLY B O   1 
ATOM   7116  N  N   . LYS B 1 438 ? 49.048  88.729  52.720  1.00 14.96 ? 435  LYS B N   1 
ATOM   7117  C  CA  . LYS B 1 438 ? 48.708  88.530  54.128  1.00 17.28 ? 435  LYS B CA  1 
ATOM   7118  C  C   . LYS B 1 438 ? 47.867  89.710  54.628  1.00 17.79 ? 435  LYS B C   1 
ATOM   7119  O  O   . LYS B 1 438 ? 48.178  90.863  54.342  1.00 17.86 ? 435  LYS B O   1 
ATOM   7120  C  CB  . LYS B 1 438 ? 49.967  88.378  54.977  1.00 17.48 ? 435  LYS B CB  1 
ATOM   7121  C  CG  . LYS B 1 438 ? 49.701  87.769  56.352  1.00 20.35 ? 435  LYS B CG  1 
ATOM   7122  C  CD  . LYS B 1 438 ? 50.999  87.376  57.020  1.00 24.00 ? 435  LYS B CD  1 
ATOM   7123  C  CE  . LYS B 1 438 ? 50.771  86.561  58.281  1.00 26.42 ? 435  LYS B CE  1 
ATOM   7124  N  NZ  . LYS B 1 438 ? 52.087  86.132  58.849  1.00 29.63 ? 435  LYS B NZ  1 
ATOM   7125  N  N   . PRO B 1 439 ? 46.785  89.420  55.355  1.00 18.72 ? 436  PRO B N   1 
ATOM   7126  C  CA  . PRO B 1 439 ? 45.932  90.492  55.843  1.00 19.17 ? 436  PRO B CA  1 
ATOM   7127  C  C   . PRO B 1 439 ? 46.688  91.542  56.645  1.00 19.81 ? 436  PRO B C   1 
ATOM   7128  O  O   . PRO B 1 439 ? 47.494  91.203  57.518  1.00 18.27 ? 436  PRO B O   1 
ATOM   7129  C  CB  . PRO B 1 439 ? 44.924  89.757  56.735  1.00 19.51 ? 436  PRO B CB  1 
ATOM   7130  C  CG  . PRO B 1 439 ? 44.823  88.407  56.147  1.00 20.15 ? 436  PRO B CG  1 
ATOM   7131  C  CD  . PRO B 1 439 ? 46.187  88.092  55.580  1.00 19.62 ? 436  PRO B CD  1 
ATOM   7132  N  N   . GLY B 1 440 ? 46.444  92.808  56.324  1.00 20.56 ? 437  GLY B N   1 
ATOM   7133  C  CA  . GLY B 1 440 ? 47.088  93.911  57.016  1.00 21.69 ? 437  GLY B CA  1 
ATOM   7134  C  C   . GLY B 1 440 ? 48.306  94.492  56.317  1.00 22.31 ? 437  GLY B C   1 
ATOM   7135  O  O   . GLY B 1 440 ? 48.877  95.460  56.798  1.00 23.40 ? 437  GLY B O   1 
ATOM   7136  N  N   . PHE B 1 441 ? 48.709  93.911  55.191  1.00 22.59 ? 438  PHE B N   1 
ATOM   7137  C  CA  . PHE B 1 441 ? 49.869  94.396  54.446  1.00 22.72 ? 438  PHE B CA  1 
ATOM   7138  C  C   . PHE B 1 441 ? 49.462  94.912  53.061  1.00 22.99 ? 438  PHE B C   1 
ATOM   7139  O  O   . PHE B 1 441 ? 50.312  95.029  52.171  1.00 22.53 ? 438  PHE B O   1 
ATOM   7140  C  CB  . PHE B 1 441 ? 50.892  93.263  54.264  1.00 22.57 ? 438  PHE B CB  1 
ATOM   7141  C  CG  . PHE B 1 441 ? 51.523  92.775  55.547  1.00 23.48 ? 438  PHE B CG  1 
ATOM   7142  C  CD1 . PHE B 1 441 ? 50.872  91.848  56.352  1.00 25.11 ? 438  PHE B CD1 1 
ATOM   7143  C  CD2 . PHE B 1 441 ? 52.788  93.225  55.933  1.00 24.96 ? 438  PHE B CD2 1 
ATOM   7144  C  CE1 . PHE B 1 441 ? 51.443  91.411  57.537  1.00 26.36 ? 438  PHE B CE1 1 
ATOM   7145  C  CE2 . PHE B 1 441 ? 53.376  92.783  57.117  1.00 24.09 ? 438  PHE B CE2 1 
ATOM   7146  C  CZ  . PHE B 1 441 ? 52.706  91.878  57.918  1.00 25.54 ? 438  PHE B CZ  1 
ATOM   7147  N  N   . GLU B 1 442 ? 48.184  95.261  52.903  1.00 22.47 ? 439  GLU B N   1 
ATOM   7148  C  CA  . GLU B 1 442 ? 47.632  95.697  51.609  1.00 22.94 ? 439  GLU B CA  1 
ATOM   7149  C  C   . GLU B 1 442 ? 48.290  96.924  50.960  1.00 22.58 ? 439  GLU B C   1 
ATOM   7150  O  O   . GLU B 1 442 ? 48.573  96.908  49.760  1.00 21.54 ? 439  GLU B O   1 
ATOM   7151  C  CB  . GLU B 1 442 ? 46.114  95.940  51.707  1.00 23.93 ? 439  GLU B CB  1 
ATOM   7152  C  CG  . GLU B 1 442 ? 45.248  94.698  52.011  1.00 26.14 ? 439  GLU B CG  1 
ATOM   7153  C  CD  . GLU B 1 442 ? 45.287  94.248  53.475  1.00 30.42 ? 439  GLU B CD  1 
ATOM   7154  O  OE1 . GLU B 1 442 ? 45.751  95.023  54.336  1.00 30.24 ? 439  GLU B OE1 1 
ATOM   7155  O  OE2 . GLU B 1 442 ? 44.814  93.122  53.766  1.00 34.20 ? 439  GLU B OE2 1 
ATOM   7156  N  N   . GLU B 1 443 ? 48.508  97.990  51.725  1.00 22.00 ? 440  GLU B N   1 
ATOM   7157  C  CA  . GLU B 1 443 ? 49.114  99.199  51.169  1.00 22.58 ? 440  GLU B CA  1 
ATOM   7158  C  C   . GLU B 1 443 ? 50.543  98.930  50.705  1.00 21.52 ? 440  GLU B C   1 
ATOM   7159  O  O   . GLU B 1 443 ? 50.919  99.311  49.592  1.00 21.25 ? 440  GLU B O   1 
ATOM   7160  C  CB  . GLU B 1 443 ? 49.073  100.355 52.179  1.00 23.95 ? 440  GLU B CB  1 
ATOM   7161  C  CG  . GLU B 1 443 ? 49.572  101.679 51.611  1.00 27.87 ? 440  GLU B CG  1 
ATOM   7162  C  CD  . GLU B 1 443 ? 49.401  102.860 52.574  1.00 33.50 ? 440  GLU B CD  1 
ATOM   7163  O  OE1 . GLU B 1 443 ? 49.118  102.638 53.773  1.00 36.39 ? 440  GLU B OE1 1 
ATOM   7164  O  OE2 . GLU B 1 443 ? 49.556  104.017 52.123  1.00 37.19 ? 440  GLU B OE2 1 
ATOM   7165  N  N   . LEU B 1 444 ? 51.338  98.275  51.552  1.00 20.84 ? 441  LEU B N   1 
ATOM   7166  C  CA  . LEU B 1 444 ? 52.711  97.924  51.188  1.00 19.21 ? 441  LEU B CA  1 
ATOM   7167  C  C   . LEU B 1 444 ? 52.705  97.017  49.941  1.00 18.68 ? 441  LEU B C   1 
ATOM   7168  O  O   . LEU B 1 444 ? 53.534  97.179  49.040  1.00 17.87 ? 441  LEU B O   1 
ATOM   7169  C  CB  . LEU B 1 444 ? 53.421  97.219  52.350  1.00 19.18 ? 441  LEU B CB  1 
ATOM   7170  C  CG  . LEU B 1 444 ? 54.866  96.744  52.112  1.00 19.29 ? 441  LEU B CG  1 
ATOM   7171  C  CD1 . LEU B 1 444 ? 55.781  97.927  51.750  1.00 17.99 ? 441  LEU B CD1 1 
ATOM   7172  C  CD2 . LEU B 1 444 ? 55.440  95.988  53.317  1.00 18.67 ? 441  LEU B CD2 1 
ATOM   7173  N  N   . LYS B 1 445 ? 51.777  96.060  49.902  1.00 17.62 ? 442  LYS B N   1 
ATOM   7174  C  CA  . LYS B 1 445 ? 51.669  95.122  48.766  1.00 17.46 ? 442  LYS B CA  1 
ATOM   7175  C  C   . LYS B 1 445 ? 51.587  95.878  47.431  1.00 17.60 ? 442  LYS B C   1 
ATOM   7176  O  O   . LYS B 1 445 ? 52.369  95.632  46.506  1.00 17.61 ? 442  LYS B O   1 
ATOM   7177  C  CB  . LYS B 1 445 ? 50.455  94.197  48.950  1.00 17.56 ? 442  LYS B CB  1 
ATOM   7178  C  CG  . LYS B 1 445 ? 50.255  93.113  47.845  1.00 16.70 ? 442  LYS B CG  1 
ATOM   7179  C  CD  . LYS B 1 445 ? 49.046  92.262  48.191  1.00 17.43 ? 442  LYS B CD  1 
ATOM   7180  C  CE  . LYS B 1 445 ? 48.907  91.021  47.306  1.00 17.48 ? 442  LYS B CE  1 
ATOM   7181  N  NZ  . LYS B 1 445 ? 48.584  91.317  45.883  1.00 16.48 ? 442  LYS B NZ  1 
ATOM   7182  N  N   . ALA B 1 446 ? 50.671  96.830  47.348  1.00 18.26 ? 443  ALA B N   1 
ATOM   7183  C  CA  . ALA B 1 446 ? 50.500  97.605  46.124  1.00 18.97 ? 443  ALA B CA  1 
ATOM   7184  C  C   . ALA B 1 446 ? 51.780  98.401  45.777  1.00 19.66 ? 443  ALA B C   1 
ATOM   7185  O  O   . ALA B 1 446 ? 52.152  98.491  44.598  1.00 18.62 ? 443  ALA B O   1 
ATOM   7186  C  CB  . ALA B 1 446 ? 49.292  98.546  46.254  1.00 18.84 ? 443  ALA B CB  1 
ATOM   7187  N  N   . GLU B 1 447 ? 52.449  98.957  46.797  1.00 19.96 ? 444  GLU B N   1 
ATOM   7188  C  CA  . GLU B 1 447 ? 53.687  99.741  46.581  1.00 20.57 ? 444  GLU B CA  1 
ATOM   7189  C  C   . GLU B 1 447 ? 54.783  98.878  45.971  1.00 19.33 ? 444  GLU B C   1 
ATOM   7190  O  O   . GLU B 1 447 ? 55.464  99.270  45.014  1.00 19.17 ? 444  GLU B O   1 
ATOM   7191  C  CB  . GLU B 1 447 ? 54.274  100.264 47.894  1.00 21.55 ? 444  GLU B CB  1 
ATOM   7192  C  CG  . GLU B 1 447 ? 53.401  101.111 48.777  1.00 26.79 ? 444  GLU B CG  1 
ATOM   7193  C  CD  . GLU B 1 447 ? 54.164  101.544 50.040  1.00 33.33 ? 444  GLU B CD  1 
ATOM   7194  O  OE1 . GLU B 1 447 ? 53.513  101.887 51.055  1.00 37.71 ? 444  GLU B OE1 1 
ATOM   7195  O  OE2 . GLU B 1 447 ? 55.424  101.511 50.020  1.00 37.56 ? 444  GLU B OE2 1 
ATOM   7196  N  N   . LEU B 1 448 ? 54.990  97.726  46.589  1.00 17.11 ? 445  LEU B N   1 
ATOM   7197  C  CA  . LEU B 1 448 ? 55.998  96.786  46.147  1.00 16.84 ? 445  LEU B CA  1 
ATOM   7198  C  C   . LEU B 1 448 ? 55.742  96.274  44.732  1.00 16.60 ? 445  LEU B C   1 
ATOM   7199  O  O   . LEU B 1 448 ? 56.657  96.236  43.921  1.00 15.84 ? 445  LEU B O   1 
ATOM   7200  C  CB  . LEU B 1 448 ? 56.084  95.610  47.134  1.00 16.32 ? 445  LEU B CB  1 
ATOM   7201  C  CG  . LEU B 1 448 ? 56.588  95.949  48.546  1.00 15.87 ? 445  LEU B CG  1 
ATOM   7202  C  CD1 . LEU B 1 448 ? 56.483  94.748  49.468  1.00 16.19 ? 445  LEU B CD1 1 
ATOM   7203  C  CD2 . LEU B 1 448 ? 58.044  96.458  48.498  1.00 19.33 ? 445  LEU B CD2 1 
ATOM   7204  N  N   . GLU B 1 449 ? 54.508  95.877  44.436  1.00 16.26 ? 446  GLU B N   1 
ATOM   7205  C  CA  . GLU B 1 449 ? 54.185  95.343  43.109  1.00 17.54 ? 446  GLU B CA  1 
ATOM   7206  C  C   . GLU B 1 449 ? 54.494  96.332  41.995  1.00 17.79 ? 446  GLU B C   1 
ATOM   7207  O  O   . GLU B 1 449 ? 54.906  95.946  40.905  1.00 17.67 ? 446  GLU B O   1 
ATOM   7208  C  CB  . GLU B 1 449 ? 52.728  94.879  43.065  1.00 17.98 ? 446  GLU B CB  1 
ATOM   7209  C  CG  . GLU B 1 449 ? 52.501  93.654  43.929  1.00 18.88 ? 446  GLU B CG  1 
ATOM   7210  C  CD  . GLU B 1 449 ? 51.051  93.337  44.183  1.00 24.37 ? 446  GLU B CD  1 
ATOM   7211  O  OE1 . GLU B 1 449 ? 50.185  94.227  43.983  1.00 28.99 ? 446  GLU B OE1 1 
ATOM   7212  O  OE2 . GLU B 1 449 ? 50.777  92.198  44.629  1.00 25.04 ? 446  GLU B OE2 1 
ATOM   7213  N  N   . GLU B 1 450 ? 54.334  97.608  42.308  1.00 19.17 ? 447  GLU B N   1 
ATOM   7214  C  CA  . GLU B 1 450 ? 54.592  98.699  41.389  1.00 20.77 ? 447  GLU B CA  1 
ATOM   7215  C  C   . GLU B 1 450 ? 56.091  98.716  41.043  1.00 21.08 ? 447  GLU B C   1 
ATOM   7216  O  O   . GLU B 1 450 ? 56.485  98.970  39.908  1.00 19.87 ? 447  GLU B O   1 
ATOM   7217  C  CB  . GLU B 1 450 ? 54.294  99.999  42.119  1.00 21.98 ? 447  GLU B CB  1 
ATOM   7218  C  CG  . GLU B 1 450 ? 53.904  101.151 41.268  1.00 27.03 ? 447  GLU B CG  1 
ATOM   7219  C  CD  . GLU B 1 450 ? 52.447  101.060 40.883  1.00 36.43 ? 447  GLU B CD  1 
ATOM   7220  O  OE1 . GLU B 1 450 ? 51.848  99.992  41.155  1.00 42.93 ? 447  GLU B OE1 1 
ATOM   7221  O  OE2 . GLU B 1 450 ? 51.888  102.046 40.338  1.00 42.51 ? 447  GLU B OE2 1 
ATOM   7222  N  N   . ARG B 1 451 ? 56.922  98.469  42.054  1.00 20.38 ? 448  ARG B N   1 
ATOM   7223  C  CA  . ARG B 1 451 ? 58.379  98.467  41.880  1.00 21.75 ? 448  ARG B CA  1 
ATOM   7224  C  C   . ARG B 1 451 ? 58.872  97.281  41.045  1.00 21.94 ? 448  ARG B C   1 
ATOM   7225  O  O   . ARG B 1 451 ? 59.919  97.360  40.405  1.00 21.05 ? 448  ARG B O   1 
ATOM   7226  C  CB  . ARG B 1 451 ? 59.066  98.488  43.255  1.00 21.27 ? 448  ARG B CB  1 
ATOM   7227  C  CG  . ARG B 1 451 ? 58.783  99.777  44.029  1.00 21.56 ? 448  ARG B CG  1 
ATOM   7228  C  CD  . ARG B 1 451 ? 59.380  99.747  45.408  1.00 23.01 ? 448  ARG B CD  1 
ATOM   7229  N  NE  . ARG B 1 451 ? 60.824  99.563  45.362  1.00 21.91 ? 448  ARG B NE  1 
ATOM   7230  C  CZ  . ARG B 1 451 ? 61.573  99.352  46.426  1.00 22.41 ? 448  ARG B CZ  1 
ATOM   7231  N  NH1 . ARG B 1 451 ? 61.011  99.275  47.626  1.00 24.64 ? 448  ARG B NH1 1 
ATOM   7232  N  NH2 . ARG B 1 451 ? 62.880  99.184  46.291  1.00 26.70 ? 448  ARG B NH2 1 
ATOM   7233  N  N   . LEU B 1 452 ? 58.115  96.190  41.048  1.00 22.74 ? 449  LEU B N   1 
ATOM   7234  C  CA  . LEU B 1 452 ? 58.484  95.019  40.268  1.00 24.30 ? 449  LEU B CA  1 
ATOM   7235  C  C   . LEU B 1 452 ? 58.107  95.267  38.821  1.00 26.77 ? 449  LEU B C   1 
ATOM   7236  O  O   . LEU B 1 452 ? 58.595  94.589  37.921  1.00 26.67 ? 449  LEU B O   1 
ATOM   7237  C  CB  . LEU B 1 452 ? 57.770  93.782  40.797  1.00 24.04 ? 449  LEU B CB  1 
ATOM   7238  C  CG  . LEU B 1 452 ? 58.125  93.431  42.239  1.00 23.39 ? 449  LEU B CG  1 
ATOM   7239  C  CD1 . LEU B 1 452 ? 57.153  92.383  42.827  1.00 21.12 ? 449  LEU B CD1 1 
ATOM   7240  C  CD2 . LEU B 1 452 ? 59.572  92.970  42.331  1.00 18.96 ? 449  LEU B CD2 1 
ATOM   7241  N  N   . LYS B 1 453 ? 57.253  96.276  38.629  1.00 29.99 ? 450  LYS B N   1 
ATOM   7242  C  CA  . LYS B 1 453 ? 56.713  96.711  37.332  1.00 32.40 ? 450  LYS B CA  1 
ATOM   7243  C  C   . LYS B 1 453 ? 55.334  96.115  37.043  1.00 34.16 ? 450  LYS B C   1 
ATOM   7244  O  O   . LYS B 1 453 ? 54.308  96.752  37.316  1.00 35.27 ? 450  LYS B O   1 
ATOM   7245  C  CB  . LYS B 1 453 ? 57.704  96.528  36.169  1.00 33.04 ? 450  LYS B CB  1 
ATOM   7246  C  CG  . LYS B 1 453 ? 58.660  97.727  35.984  1.00 35.00 ? 450  LYS B CG  1 
ATOM   7247  C  CD  . LYS B 1 453 ? 59.510  98.071  37.212  1.00 38.14 ? 450  LYS B CD  1 
ATOM   7248  C  CE  . LYS B 1 453 ? 60.722  97.143  37.398  1.00 40.50 ? 450  LYS B CE  1 
ATOM   7249  N  NZ  . LYS B 1 453 ? 61.772  97.332  36.338  1.00 40.10 ? 450  LYS B NZ  1 
ATOM   7250  O  OXT . LYS B 1 453 ? 55.187  94.997  36.549  1.00 36.45 ? 450  LYS B OXT 1 
ATOM   7251  N  N   . THR C 1 6   ? 82.196  130.701 75.027  1.00 42.76 ? 3    THR C N   1 
ATOM   7252  C  CA  . THR C 1 6   ? 81.548  129.552 75.718  1.00 41.53 ? 3    THR C CA  1 
ATOM   7253  C  C   . THR C 1 6   ? 82.241  128.265 75.257  1.00 40.17 ? 3    THR C C   1 
ATOM   7254  O  O   . THR C 1 6   ? 83.289  128.321 74.606  1.00 41.23 ? 3    THR C O   1 
ATOM   7255  C  CB  . THR C 1 6   ? 80.002  129.552 75.475  1.00 42.23 ? 3    THR C CB  1 
ATOM   7256  O  OG1 . THR C 1 6   ? 79.355  128.623 76.358  1.00 44.53 ? 3    THR C OG1 1 
ATOM   7257  C  CG2 . THR C 1 6   ? 79.653  129.238 74.022  1.00 42.72 ? 3    THR C CG2 1 
ATOM   7258  N  N   . HIS C 1 7   ? 81.683  127.113 75.613  1.00 37.76 ? 4    HIS C N   1 
ATOM   7259  C  CA  . HIS C 1 7   ? 82.267  125.809 75.252  1.00 35.43 ? 4    HIS C CA  1 
ATOM   7260  C  C   . HIS C 1 7   ? 82.288  125.443 73.778  1.00 32.04 ? 4    HIS C C   1 
ATOM   7261  O  O   . HIS C 1 7   ? 81.382  125.780 73.022  1.00 31.65 ? 4    HIS C O   1 
ATOM   7262  C  CB  . HIS C 1 7   ? 81.473  124.666 75.935  1.00 36.10 ? 4    HIS C CB  1 
ATOM   7263  C  CG  . HIS C 1 7   ? 81.722  124.535 77.402  1.00 37.58 ? 4    HIS C CG  1 
ATOM   7264  N  ND1 . HIS C 1 7   ? 81.175  125.392 78.332  1.00 41.94 ? 4    HIS C ND1 1 
ATOM   7265  C  CD2 . HIS C 1 7   ? 82.428  123.617 78.105  1.00 40.17 ? 4    HIS C CD2 1 
ATOM   7266  C  CE1 . HIS C 1 7   ? 81.571  125.033 79.543  1.00 42.32 ? 4    HIS C CE1 1 
ATOM   7267  N  NE2 . HIS C 1 7   ? 82.330  123.956 79.433  1.00 36.26 ? 4    HIS C NE2 1 
ATOM   7268  N  N   . VAL C 1 8   ? 83.345  124.739 73.393  1.00 28.35 ? 5    VAL C N   1 
ATOM   7269  C  CA  . VAL C 1 8   ? 83.427  124.146 72.090  1.00 26.11 ? 5    VAL C CA  1 
ATOM   7270  C  C   . VAL C 1 8   ? 82.544  122.915 72.309  1.00 24.71 ? 5    VAL C C   1 
ATOM   7271  O  O   . VAL C 1 8   ? 82.627  122.295 73.365  1.00 23.64 ? 5    VAL C O   1 
ATOM   7272  C  CB  . VAL C 1 8   ? 84.848  123.643 71.756  1.00 25.98 ? 5    VAL C CB  1 
ATOM   7273  C  CG1 . VAL C 1 8   ? 84.817  122.681 70.582  1.00 24.52 ? 5    VAL C CG1 1 
ATOM   7274  C  CG2 . VAL C 1 8   ? 85.812  124.817 71.514  1.00 23.72 ? 5    VAL C CG2 1 
ATOM   7275  N  N   . THR C 1 9   ? 81.688  122.581 71.352  1.00 22.22 ? 6    THR C N   1 
ATOM   7276  C  CA  . THR C 1 9   ? 80.825  121.413 71.500  1.00 20.11 ? 6    THR C CA  1 
ATOM   7277  C  C   . THR C 1 9   ? 80.936  120.505 70.280  1.00 18.01 ? 6    THR C C   1 
ATOM   7278  O  O   . THR C 1 9   ? 81.310  120.945 69.195  1.00 16.88 ? 6    THR C O   1 
ATOM   7279  C  CB  . THR C 1 9   ? 79.360  121.814 71.665  1.00 20.02 ? 6    THR C CB  1 
ATOM   7280  O  OG1 . THR C 1 9   ? 78.967  122.604 70.542  1.00 21.71 ? 6    THR C OG1 1 
ATOM   7281  C  CG2 . THR C 1 9   ? 79.140  122.626 72.939  1.00 21.94 ? 6    THR C CG2 1 
ATOM   7282  N  N   . PHE C 1 10  ? 80.574  119.242 70.478  1.00 15.90 ? 7    PHE C N   1 
ATOM   7283  C  CA  . PHE C 1 10  ? 80.618  118.226 69.441  1.00 15.32 ? 7    PHE C CA  1 
ATOM   7284  C  C   . PHE C 1 10  ? 79.196  117.721 69.198  1.00 15.70 ? 7    PHE C C   1 
ATOM   7285  O  O   . PHE C 1 10  ? 78.502  117.315 70.134  1.00 15.95 ? 7    PHE C O   1 
ATOM   7286  C  CB  . PHE C 1 10  ? 81.531  117.081 69.861  1.00 15.37 ? 7    PHE C CB  1 
ATOM   7287  C  CG  . PHE C 1 10  ? 81.513  115.926 68.914  1.00 13.97 ? 7    PHE C CG  1 
ATOM   7288  C  CD1 . PHE C 1 10  ? 81.979  116.077 67.624  1.00 13.48 ? 7    PHE C CD1 1 
ATOM   7289  C  CD2 . PHE C 1 10  ? 81.052  114.697 69.311  1.00 9.11  ? 7    PHE C CD2 1 
ATOM   7290  C  CE1 . PHE C 1 10  ? 81.955  115.020 66.745  1.00 16.08 ? 7    PHE C CE1 1 
ATOM   7291  C  CE2 . PHE C 1 10  ? 81.038  113.636 68.433  1.00 10.65 ? 7    PHE C CE2 1 
ATOM   7292  C  CZ  . PHE C 1 10  ? 81.472  113.803 67.148  1.00 11.60 ? 7    PHE C CZ  1 
ATOM   7293  N  N   . ASP C 1 11  ? 78.772  117.760 67.943  1.00 14.92 ? 8    ASP C N   1 
ATOM   7294  C  CA  . ASP C 1 11  ? 77.420  117.372 67.567  1.00 15.23 ? 8    ASP C CA  1 
ATOM   7295  C  C   . ASP C 1 11  ? 77.466  116.330 66.456  1.00 15.44 ? 8    ASP C C   1 
ATOM   7296  O  O   . ASP C 1 11  ? 78.006  116.594 65.366  1.00 14.98 ? 8    ASP C O   1 
ATOM   7297  C  CB  . ASP C 1 11  ? 76.680  118.618 67.097  1.00 14.52 ? 8    ASP C CB  1 
ATOM   7298  C  CG  . ASP C 1 11  ? 75.226  118.344 66.672  1.00 19.27 ? 8    ASP C CG  1 
ATOM   7299  O  OD1 . ASP C 1 11  ? 74.721  117.225 66.849  1.00 19.36 ? 8    ASP C OD1 1 
ATOM   7300  O  OD2 . ASP C 1 11  ? 74.586  119.279 66.154  1.00 18.87 ? 8    ASP C OD2 1 
ATOM   7301  N  N   . TYR C 1 12  ? 76.969  115.134 66.764  1.00 14.12 ? 9    TYR C N   1 
ATOM   7302  C  CA  . TYR C 1 12  ? 76.889  114.058 65.782  1.00 15.17 ? 9    TYR C CA  1 
ATOM   7303  C  C   . TYR C 1 12  ? 75.422  113.790 65.420  1.00 15.37 ? 9    TYR C C   1 
ATOM   7304  O  O   . TYR C 1 12  ? 75.135  112.835 64.724  1.00 13.59 ? 9    TYR C O   1 
ATOM   7305  C  CB  . TYR C 1 12  ? 77.574  112.770 66.294  1.00 15.28 ? 9    TYR C CB  1 
ATOM   7306  C  CG  . TYR C 1 12  ? 76.995  112.206 67.586  1.00 18.50 ? 9    TYR C CG  1 
ATOM   7307  C  CD1 . TYR C 1 12  ? 75.928  111.304 67.568  1.00 20.87 ? 9    TYR C CD1 1 
ATOM   7308  C  CD2 . TYR C 1 12  ? 77.522  112.571 68.822  1.00 21.58 ? 9    TYR C CD2 1 
ATOM   7309  C  CE1 . TYR C 1 12  ? 75.400  110.795 68.744  1.00 22.07 ? 9    TYR C CE1 1 
ATOM   7310  C  CE2 . TYR C 1 12  ? 77.011  112.064 70.004  1.00 22.52 ? 9    TYR C CE2 1 
ATOM   7311  C  CZ  . TYR C 1 12  ? 75.948  111.182 69.964  1.00 25.81 ? 9    TYR C CZ  1 
ATOM   7312  O  OH  . TYR C 1 12  ? 75.443  110.688 71.143  1.00 27.11 ? 9    TYR C OH  1 
ATOM   7313  N  N   . SER C 1 13  ? 74.512  114.686 65.832  1.00 15.48 ? 10   SER C N   1 
ATOM   7314  C  CA  . SER C 1 13  ? 73.087  114.495 65.600  1.00 16.43 ? 10   SER C CA  1 
ATOM   7315  C  C   . SER C 1 13  ? 72.698  114.490 64.113  1.00 17.42 ? 10   SER C C   1 
ATOM   7316  O  O   . SER C 1 13  ? 71.740  113.808 63.735  1.00 17.69 ? 10   SER C O   1 
ATOM   7317  C  CB  . SER C 1 13  ? 72.245  115.513 66.393  1.00 16.60 ? 10   SER C CB  1 
ATOM   7318  O  OG  . SER C 1 13  ? 72.437  116.832 65.929  1.00 17.08 ? 10   SER C OG  1 
ATOM   7319  N  N   . LYS C 1 14  ? 73.451  115.198 63.274  1.00 16.55 ? 11   LYS C N   1 
ATOM   7320  C  CA  . LYS C 1 14  ? 73.159  115.230 61.839  1.00 16.65 ? 11   LYS C CA  1 
ATOM   7321  C  C   . LYS C 1 14  ? 73.661  113.951 61.130  1.00 16.27 ? 11   LYS C C   1 
ATOM   7322  O  O   . LYS C 1 14  ? 73.426  113.767 59.939  1.00 15.53 ? 11   LYS C O   1 
ATOM   7323  C  CB  . LYS C 1 14  ? 73.760  116.467 61.173  1.00 16.90 ? 11   LYS C CB  1 
ATOM   7324  C  CG  . LYS C 1 14  ? 73.326  117.821 61.776  1.00 21.71 ? 11   LYS C CG  1 
ATOM   7325  C  CD  . LYS C 1 14  ? 71.829  118.014 61.820  1.00 28.03 ? 11   LYS C CD  1 
ATOM   7326  C  CE  . LYS C 1 14  ? 71.461  119.457 62.243  1.00 30.96 ? 11   LYS C CE  1 
ATOM   7327  N  NZ  . LYS C 1 14  ? 72.157  119.895 63.516  1.00 31.89 ? 11   LYS C NZ  1 
ATOM   7328  N  N   . ALA C 1 15  ? 74.353  113.082 61.862  1.00 16.05 ? 12   ALA C N   1 
ATOM   7329  C  CA  . ALA C 1 15  ? 74.842  111.813 61.293  1.00 16.03 ? 12   ALA C CA  1 
ATOM   7330  C  C   . ALA C 1 15  ? 74.040  110.619 61.815  1.00 15.83 ? 12   ALA C C   1 
ATOM   7331  O  O   . ALA C 1 15  ? 74.406  109.454 61.595  1.00 16.21 ? 12   ALA C O   1 
ATOM   7332  C  CB  . ALA C 1 15  ? 76.326  111.634 61.605  1.00 15.71 ? 12   ALA C CB  1 
ATOM   7333  N  N   . LEU C 1 16  ? 72.956  110.890 62.531  1.00 16.37 ? 13   LEU C N   1 
ATOM   7334  C  CA  . LEU C 1 16  ? 72.116  109.802 63.089  1.00 17.60 ? 13   LEU C CA  1 
ATOM   7335  C  C   . LEU C 1 16  ? 71.484  108.845 62.059  1.00 18.15 ? 13   LEU C C   1 
ATOM   7336  O  O   . LEU C 1 16  ? 71.053  107.750 62.413  1.00 18.23 ? 13   LEU C O   1 
ATOM   7337  C  CB  . LEU C 1 16  ? 71.046  110.371 64.031  1.00 17.91 ? 13   LEU C CB  1 
ATOM   7338  C  CG  . LEU C 1 16  ? 71.582  110.845 65.390  1.00 19.16 ? 13   LEU C CG  1 
ATOM   7339  C  CD1 . LEU C 1 16  ? 70.482  111.489 66.227  1.00 20.07 ? 13   LEU C CD1 1 
ATOM   7340  C  CD2 . LEU C 1 16  ? 72.254  109.678 66.153  1.00 18.62 ? 13   LEU C CD2 1 
ATOM   7341  N  N   . SER C 1 17  ? 71.438  109.226 60.792  1.00 18.24 ? 14   SER C N   1 
ATOM   7342  C  CA  . SER C 1 17  ? 70.903  108.328 59.792  1.00 19.63 ? 14   SER C CA  1 
ATOM   7343  C  C   . SER C 1 17  ? 71.979  107.288 59.432  1.00 19.80 ? 14   SER C C   1 
ATOM   7344  O  O   . SER C 1 17  ? 71.682  106.270 58.817  1.00 21.01 ? 14   SER C O   1 
ATOM   7345  C  CB  . SER C 1 17  ? 70.484  109.106 58.550  1.00 20.71 ? 14   SER C CB  1 
ATOM   7346  O  OG  . SER C 1 17  ? 71.616  109.730 57.957  1.00 23.53 ? 14   SER C OG  1 
ATOM   7347  N  N   . PHE C 1 18  ? 73.221  107.562 59.826  1.00 17.82 ? 15   PHE C N   1 
ATOM   7348  C  CA  . PHE C 1 18  ? 74.350  106.678 59.572  1.00 18.47 ? 15   PHE C CA  1 
ATOM   7349  C  C   . PHE C 1 18  ? 74.841  105.892 60.790  1.00 19.46 ? 15   PHE C C   1 
ATOM   7350  O  O   . PHE C 1 18  ? 75.439  104.810 60.633  1.00 20.36 ? 15   PHE C O   1 
ATOM   7351  C  CB  . PHE C 1 18  ? 75.553  107.493 59.108  1.00 16.88 ? 15   PHE C CB  1 
ATOM   7352  C  CG  . PHE C 1 18  ? 75.335  108.206 57.837  1.00 16.33 ? 15   PHE C CG  1 
ATOM   7353  C  CD1 . PHE C 1 18  ? 75.015  109.558 57.831  1.00 14.04 ? 15   PHE C CD1 1 
ATOM   7354  C  CD2 . PHE C 1 18  ? 75.426  107.534 56.639  1.00 16.44 ? 15   PHE C CD2 1 
ATOM   7355  C  CE1 . PHE C 1 18  ? 74.844  110.223 56.657  1.00 15.65 ? 15   PHE C CE1 1 
ATOM   7356  C  CE2 . PHE C 1 18  ? 75.232  108.194 55.447  1.00 20.23 ? 15   PHE C CE2 1 
ATOM   7357  C  CZ  . PHE C 1 18  ? 74.941  109.547 55.455  1.00 19.44 ? 15   PHE C CZ  1 
ATOM   7358  N  N   . ILE C 1 19  ? 74.668  106.469 61.978  1.00 19.28 ? 16   ILE C N   1 
ATOM   7359  C  CA  . ILE C 1 19  ? 75.124  105.845 63.225  1.00 20.06 ? 16   ILE C CA  1 
ATOM   7360  C  C   . ILE C 1 19  ? 74.037  105.957 64.306  1.00 20.74 ? 16   ILE C C   1 
ATOM   7361  O  O   . ILE C 1 19  ? 73.550  107.052 64.597  1.00 21.73 ? 16   ILE C O   1 
ATOM   7362  C  CB  . ILE C 1 19  ? 76.469  106.479 63.692  1.00 20.47 ? 16   ILE C CB  1 
ATOM   7363  C  CG1 . ILE C 1 19  ? 77.083  105.695 64.857  1.00 21.80 ? 16   ILE C CG1 1 
ATOM   7364  C  CG2 . ILE C 1 19  ? 76.314  107.931 64.064  1.00 22.17 ? 16   ILE C CG2 1 
ATOM   7365  C  CD1 . ILE C 1 19  ? 78.415  106.231 65.283  1.00 19.31 ? 16   ILE C CD1 1 
ATOM   7366  N  N   . GLY C 1 20  ? 73.627  104.820 64.867  1.00 18.97 ? 17   GLY C N   1 
ATOM   7367  C  CA  . GLY C 1 20  ? 72.598  104.814 65.913  1.00 18.50 ? 17   GLY C CA  1 
ATOM   7368  C  C   . GLY C 1 20  ? 73.176  105.177 67.275  1.00 17.91 ? 17   GLY C C   1 
ATOM   7369  O  O   . GLY C 1 20  ? 74.368  104.975 67.521  1.00 16.86 ? 17   GLY C O   1 
ATOM   7370  N  N   . GLU C 1 21  ? 72.338  105.704 68.171  1.00 15.91 ? 18   GLU C N   1 
ATOM   7371  C  CA  . GLU C 1 21  ? 72.812  106.070 69.504  1.00 16.07 ? 18   GLU C CA  1 
ATOM   7372  C  C   . GLU C 1 21  ? 73.370  104.870 70.229  1.00 14.49 ? 18   GLU C C   1 
ATOM   7373  O  O   . GLU C 1 21  ? 74.331  104.986 70.973  1.00 14.94 ? 18   GLU C O   1 
ATOM   7374  C  CB  . GLU C 1 21  ? 71.704  106.745 70.340  1.00 16.95 ? 18   GLU C CB  1 
ATOM   7375  C  CG  . GLU C 1 21  ? 71.423  108.204 69.945  1.00 21.21 ? 18   GLU C CG  1 
ATOM   7376  C  CD  . GLU C 1 21  ? 72.569  109.154 70.342  1.00 26.64 ? 18   GLU C CD  1 
ATOM   7377  O  OE1 . GLU C 1 21  ? 73.559  108.701 70.978  1.00 29.72 ? 18   GLU C OE1 1 
ATOM   7378  O  OE2 . GLU C 1 21  ? 72.471  110.362 70.033  1.00 30.87 ? 18   GLU C OE2 1 
ATOM   7379  N  N   . HIS C 1 22  ? 72.788  103.704 69.989  1.00 14.59 ? 19   HIS C N   1 
ATOM   7380  C  CA  . HIS C 1 22  ? 73.241  102.491 70.642  1.00 14.30 ? 19   HIS C CA  1 
ATOM   7381  C  C   . HIS C 1 22  ? 74.687  102.175 70.305  1.00 14.32 ? 19   HIS C C   1 
ATOM   7382  O  O   . HIS C 1 22  ? 75.371  101.576 71.116  1.00 16.07 ? 19   HIS C O   1 
ATOM   7383  C  CB  . HIS C 1 22  ? 72.344  101.299 70.285  1.00 14.73 ? 19   HIS C CB  1 
ATOM   7384  C  CG  . HIS C 1 22  ? 72.448  100.865 68.858  1.00 15.44 ? 19   HIS C CG  1 
ATOM   7385  N  ND1 . HIS C 1 22  ? 71.714  101.442 67.846  1.00 18.24 ? 19   HIS C ND1 1 
ATOM   7386  C  CD2 . HIS C 1 22  ? 73.187  99.888  68.278  1.00 17.43 ? 19   HIS C CD2 1 
ATOM   7387  C  CE1 . HIS C 1 22  ? 72.008  100.851 66.701  1.00 18.52 ? 19   HIS C CE1 1 
ATOM   7388  N  NE2 . HIS C 1 22  ? 72.893  99.899  66.938  1.00 16.60 ? 19   HIS C NE2 1 
ATOM   7389  N  N   . GLU C 1 23  ? 75.159  102.569 69.122  1.00 13.97 ? 20   GLU C N   1 
ATOM   7390  C  CA  . GLU C 1 23  ? 76.547  102.312 68.746  1.00 14.44 ? 20   GLU C CA  1 
ATOM   7391  C  C   . GLU C 1 23  ? 77.512  103.048 69.665  1.00 15.15 ? 20   GLU C C   1 
ATOM   7392  O  O   . GLU C 1 23  ? 78.658  102.639 69.824  1.00 17.16 ? 20   GLU C O   1 
ATOM   7393  C  CB  . GLU C 1 23  ? 76.830  102.699 67.291  1.00 14.48 ? 20   GLU C CB  1 
ATOM   7394  C  CG  . GLU C 1 23  ? 75.957  101.984 66.279  1.00 12.65 ? 20   GLU C CG  1 
ATOM   7395  C  CD  . GLU C 1 23  ? 76.353  102.274 64.855  1.00 16.02 ? 20   GLU C CD  1 
ATOM   7396  O  OE1 . GLU C 1 23  ? 77.578  102.247 64.556  1.00 15.71 ? 20   GLU C OE1 1 
ATOM   7397  O  OE2 . GLU C 1 23  ? 75.435  102.475 64.014  1.00 16.68 ? 20   GLU C OE2 1 
ATOM   7398  N  N   . ILE C 1 24  ? 77.067  104.163 70.237  1.00 15.52 ? 21   ILE C N   1 
ATOM   7399  C  CA  . ILE C 1 24  ? 77.914  104.908 71.157  1.00 15.98 ? 21   ILE C CA  1 
ATOM   7400  C  C   . ILE C 1 24  ? 77.783  104.276 72.541  1.00 15.61 ? 21   ILE C C   1 
ATOM   7401  O  O   . ILE C 1 24  ? 78.769  103.909 73.173  1.00 15.65 ? 21   ILE C O   1 
ATOM   7402  C  CB  . ILE C 1 24  ? 77.533  106.402 71.200  1.00 16.55 ? 21   ILE C CB  1 
ATOM   7403  C  CG1 . ILE C 1 24  ? 77.650  106.998 69.803  1.00 16.89 ? 21   ILE C CG1 1 
ATOM   7404  C  CG2 . ILE C 1 24  ? 78.415  107.137 72.185  1.00 15.51 ? 21   ILE C CG2 1 
ATOM   7405  C  CD1 . ILE C 1 24  ? 77.478  108.484 69.742  1.00 23.57 ? 21   ILE C CD1 1 
ATOM   7406  N  N   . THR C 1 25  ? 76.540  104.119 72.973  1.00 16.78 ? 22   THR C N   1 
ATOM   7407  C  CA  . THR C 1 25  ? 76.199  103.531 74.249  1.00 17.61 ? 22   THR C CA  1 
ATOM   7408  C  C   . THR C 1 25  ? 76.950  102.239 74.509  1.00 17.56 ? 22   THR C C   1 
ATOM   7409  O  O   . THR C 1 25  ? 77.455  102.021 75.625  1.00 16.82 ? 22   THR C O   1 
ATOM   7410  C  CB  . THR C 1 25  ? 74.698  103.209 74.259  1.00 18.35 ? 22   THR C CB  1 
ATOM   7411  O  OG1 . THR C 1 25  ? 73.977  104.428 74.132  1.00 20.69 ? 22   THR C OG1 1 
ATOM   7412  C  CG2 . THR C 1 25  ? 74.287  102.508 75.529  1.00 22.06 ? 22   THR C CG2 1 
ATOM   7413  N  N   . TYR C 1 26  ? 77.043  101.381 73.488  1.00 16.02 ? 23   TYR C N   1 
ATOM   7414  C  CA  . TYR C 1 26  ? 77.721  100.102 73.668  1.00 15.91 ? 23   TYR C CA  1 
ATOM   7415  C  C   . TYR C 1 26  ? 79.212  100.225 74.062  1.00 17.58 ? 23   TYR C C   1 
ATOM   7416  O  O   . TYR C 1 26  ? 79.795  99.241  74.560  1.00 16.34 ? 23   TYR C O   1 
ATOM   7417  C  CB  . TYR C 1 26  ? 77.572  99.159  72.448  1.00 15.70 ? 23   TYR C CB  1 
ATOM   7418  C  CG  . TYR C 1 26  ? 76.151  98.698  72.089  1.00 13.83 ? 23   TYR C CG  1 
ATOM   7419  C  CD1 . TYR C 1 26  ? 75.128  98.708  73.019  1.00 13.57 ? 23   TYR C CD1 1 
ATOM   7420  C  CD2 . TYR C 1 26  ? 75.901  98.071  70.879  1.00 14.79 ? 23   TYR C CD2 1 
ATOM   7421  C  CE1 . TYR C 1 26  ? 73.838  98.259  72.694  1.00 13.76 ? 23   TYR C CE1 1 
ATOM   7422  C  CE2 . TYR C 1 26  ? 74.637  97.592  70.553  1.00 16.43 ? 23   TYR C CE2 1 
ATOM   7423  C  CZ  . TYR C 1 26  ? 73.603  97.690  71.459  1.00 12.73 ? 23   TYR C CZ  1 
ATOM   7424  O  OH  . TYR C 1 26  ? 72.351  97.193  71.138  1.00 17.74 ? 23   TYR C OH  1 
ATOM   7425  N  N   . LEU C 1 27  ? 79.836  101.391 73.834  1.00 16.44 ? 24   LEU C N   1 
ATOM   7426  C  CA  . LEU C 1 27  ? 81.260  101.574 74.197  1.00 17.22 ? 24   LEU C CA  1 
ATOM   7427  C  C   . LEU C 1 27  ? 81.543  102.234 75.556  1.00 17.19 ? 24   LEU C C   1 
ATOM   7428  O  O   . LEU C 1 27  ? 82.714  102.505 75.883  1.00 16.14 ? 24   LEU C O   1 
ATOM   7429  C  CB  . LEU C 1 27  ? 82.043  102.317 73.093  1.00 18.19 ? 24   LEU C CB  1 
ATOM   7430  C  CG  . LEU C 1 27  ? 82.555  101.391 71.993  1.00 20.95 ? 24   LEU C CG  1 
ATOM   7431  C  CD1 . LEU C 1 27  ? 81.434  100.870 71.103  1.00 20.99 ? 24   LEU C CD1 1 
ATOM   7432  C  CD2 . LEU C 1 27  ? 83.599  102.080 71.168  1.00 30.28 ? 24   LEU C CD2 1 
ATOM   7433  N  N   . ARG C 1 28  ? 80.505  102.449 76.362  1.00 16.35 ? 25   ARG C N   1 
ATOM   7434  C  CA  . ARG C 1 28  ? 80.679  103.071 77.683  1.00 18.38 ? 25   ARG C CA  1 
ATOM   7435  C  C   . ARG C 1 28  ? 81.722  102.365 78.586  1.00 17.13 ? 25   ARG C C   1 
ATOM   7436  O  O   . ARG C 1 28  ? 82.609  103.013 79.137  1.00 16.45 ? 25   ARG C O   1 
ATOM   7437  C  CB  . ARG C 1 28  ? 79.351  103.132 78.429  1.00 19.39 ? 25   ARG C CB  1 
ATOM   7438  C  CG  . ARG C 1 28  ? 79.493  103.761 79.796  1.00 26.95 ? 25   ARG C CG  1 
ATOM   7439  C  CD  . ARG C 1 28  ? 78.301  103.467 80.691  1.00 34.32 ? 25   ARG C CD  1 
ATOM   7440  N  NE  . ARG C 1 28  ? 78.500  103.995 82.040  1.00 40.65 ? 25   ARG C NE  1 
ATOM   7441  C  CZ  . ARG C 1 28  ? 79.274  103.435 82.979  1.00 45.88 ? 25   ARG C CZ  1 
ATOM   7442  N  NH1 . ARG C 1 28  ? 79.984  102.337 82.726  1.00 46.48 ? 25   ARG C NH1 1 
ATOM   7443  N  NH2 . ARG C 1 28  ? 79.367  104.002 84.176  1.00 47.06 ? 25   ARG C NH2 1 
ATOM   7444  N  N   . ASP C 1 29  ? 81.601  101.054 78.753  1.00 17.79 ? 26   ASP C N   1 
ATOM   7445  C  CA  . ASP C 1 29  ? 82.539  100.285 79.610  1.00 17.18 ? 26   ASP C CA  1 
ATOM   7446  C  C   . ASP C 1 29  ? 83.968  100.319 79.077  1.00 15.66 ? 26   ASP C C   1 
ATOM   7447  O  O   . ASP C 1 29  ? 84.922  100.467 79.852  1.00 14.97 ? 26   ASP C O   1 
ATOM   7448  C  CB  . ASP C 1 29  ? 82.097  98.805  79.750  1.00 18.49 ? 26   ASP C CB  1 
ATOM   7449  C  CG  . ASP C 1 29  ? 80.813  98.640  80.536  1.00 21.66 ? 26   ASP C CG  1 
ATOM   7450  O  OD1 . ASP C 1 29  ? 80.319  99.650  81.054  1.00 24.26 ? 26   ASP C OD1 1 
ATOM   7451  O  OD2 . ASP C 1 29  ? 80.301  97.485  80.649  1.00 29.81 ? 26   ASP C OD2 1 
ATOM   7452  N  N   . ALA C 1 30  ? 84.136  100.144 77.767  1.00 14.07 ? 27   ALA C N   1 
ATOM   7453  C  CA  . ALA C 1 30  ? 85.472  100.181 77.161  1.00 13.56 ? 27   ALA C CA  1 
ATOM   7454  C  C   . ALA C 1 30  ? 86.124  101.569 77.341  1.00 13.76 ? 27   ALA C C   1 
ATOM   7455  O  O   . ALA C 1 30  ? 87.328  101.684 77.651  1.00 15.21 ? 27   ALA C O   1 
ATOM   7456  C  CB  . ALA C 1 30  ? 85.397  99.835  75.687  1.00 14.09 ? 27   ALA C CB  1 
ATOM   7457  N  N   . VAL C 1 31  ? 85.335  102.616 77.128  1.00 12.21 ? 28   VAL C N   1 
ATOM   7458  C  CA  . VAL C 1 31  ? 85.812  103.995 77.292  1.00 10.74 ? 28   VAL C CA  1 
ATOM   7459  C  C   . VAL C 1 31  ? 86.254  104.291 78.743  1.00 12.92 ? 28   VAL C C   1 
ATOM   7460  O  O   . VAL C 1 31  ? 87.292  104.946 78.960  1.00 12.31 ? 28   VAL C O   1 
ATOM   7461  C  CB  . VAL C 1 31  ? 84.743  105.012 76.791  1.00 12.38 ? 28   VAL C CB  1 
ATOM   7462  C  CG1 . VAL C 1 31  ? 85.073  106.453 77.210  1.00 9.72  ? 28   VAL C CG1 1 
ATOM   7463  C  CG2 . VAL C 1 31  ? 84.594  104.907 75.266  1.00 11.09 ? 28   VAL C CG2 1 
ATOM   7464  N  N   A LYS C 1 32  ? 85.491  103.808 79.721  0.70 12.53 ? 29   LYS C N   1 
ATOM   7465  N  N   B LYS C 1 32  ? 85.494  103.803 79.724  0.30 12.38 ? 29   LYS C N   1 
ATOM   7466  C  CA  A LYS C 1 32  ? 85.824  104.045 81.125  0.70 13.95 ? 29   LYS C CA  1 
ATOM   7467  C  CA  B LYS C 1 32  ? 85.834  104.039 81.129  0.30 12.97 ? 29   LYS C CA  1 
ATOM   7468  C  C   A LYS C 1 32  ? 87.150  103.393 81.520  0.70 13.16 ? 29   LYS C C   1 
ATOM   7469  C  C   B LYS C 1 32  ? 87.172  103.407 81.490  0.30 13.12 ? 29   LYS C C   1 
ATOM   7470  O  O   A LYS C 1 32  ? 87.969  104.021 82.162  0.70 12.03 ? 29   LYS C O   1 
ATOM   7471  O  O   B LYS C 1 32  ? 88.018  104.055 82.095  0.30 12.66 ? 29   LYS C O   1 
ATOM   7472  C  CB  A LYS C 1 32  ? 84.678  103.603 82.045  0.70 14.49 ? 29   LYS C CB  1 
ATOM   7473  C  CB  B LYS C 1 32  ? 84.765  103.490 82.077  0.30 12.82 ? 29   LYS C CB  1 
ATOM   7474  C  CG  A LYS C 1 32  ? 84.957  103.829 83.526  0.70 19.03 ? 29   LYS C CG  1 
ATOM   7475  C  CG  B LYS C 1 32  ? 85.041  103.852 83.538  0.30 13.51 ? 29   LYS C CG  1 
ATOM   7476  C  CD  A LYS C 1 32  ? 83.671  104.057 84.329  0.70 23.79 ? 29   LYS C CD  1 
ATOM   7477  C  CD  B LYS C 1 32  ? 84.039  103.242 84.501  0.30 12.73 ? 29   LYS C CD  1 
ATOM   7478  C  CE  A LYS C 1 32  ? 82.949  105.323 83.794  0.70 27.15 ? 29   LYS C CE  1 
ATOM   7479  C  CE  B LYS C 1 32  ? 84.189  103.827 85.904  0.30 13.46 ? 29   LYS C CE  1 
ATOM   7480  N  NZ  A LYS C 1 32  ? 81.932  105.924 84.689  0.70 26.02 ? 29   LYS C NZ  1 
ATOM   7481  N  NZ  B LYS C 1 32  ? 85.543  103.642 86.493  0.30 14.49 ? 29   LYS C NZ  1 
ATOM   7482  N  N   . VAL C 1 33  ? 87.359  102.141 81.124  1.00 13.87 ? 30   VAL C N   1 
ATOM   7483  C  CA  . VAL C 1 33  ? 88.620  101.449 81.430  1.00 15.40 ? 30   VAL C CA  1 
ATOM   7484  C  C   . VAL C 1 33  ? 89.792  102.101 80.697  1.00 15.04 ? 30   VAL C C   1 
ATOM   7485  O  O   . VAL C 1 33  ? 90.904  102.187 81.223  1.00 16.33 ? 30   VAL C O   1 
ATOM   7486  C  CB  . VAL C 1 33  ? 88.568  99.921  81.120  1.00 15.98 ? 30   VAL C CB  1 
ATOM   7487  C  CG1 . VAL C 1 33  ? 88.428  99.658  79.645  1.00 18.99 ? 30   VAL C CG1 1 
ATOM   7488  C  CG2 . VAL C 1 33  ? 89.841  99.249  81.623  1.00 19.75 ? 30   VAL C CG2 1 
ATOM   7489  N  N   . THR C 1 34  ? 89.551  102.599 79.494  1.00 16.38 ? 31   THR C N   1 
ATOM   7490  C  CA  . THR C 1 34  ? 90.612  103.238 78.716  1.00 15.92 ? 31   THR C CA  1 
ATOM   7491  C  C   . THR C 1 34  ? 90.950  104.588 79.320  1.00 16.35 ? 31   THR C C   1 
ATOM   7492  O  O   . THR C 1 34  ? 92.123  104.986 79.381  1.00 14.95 ? 31   THR C O   1 
ATOM   7493  C  CB  . THR C 1 34  ? 90.226  103.382 77.237  1.00 17.70 ? 31   THR C CB  1 
ATOM   7494  O  OG1 . THR C 1 34  ? 89.963  102.078 76.697  1.00 15.89 ? 31   THR C OG1 1 
ATOM   7495  C  CG2 . THR C 1 34  ? 91.349  104.050 76.450  1.00 15.51 ? 31   THR C CG2 1 
ATOM   7496  N  N   . HIS C 1 35  ? 89.922  105.289 79.786  1.00 14.79 ? 32   HIS C N   1 
ATOM   7497  C  CA  . HIS C 1 35  ? 90.117  106.570 80.434  1.00 14.72 ? 32   HIS C CA  1 
ATOM   7498  C  C   . HIS C 1 35  ? 91.051  106.382 81.641  1.00 16.00 ? 32   HIS C C   1 
ATOM   7499  O  O   . HIS C 1 35  ? 92.040  107.132 81.827  1.00 15.03 ? 32   HIS C O   1 
ATOM   7500  C  CB  . HIS C 1 35  ? 88.763  107.147 80.861  1.00 13.99 ? 32   HIS C CB  1 
ATOM   7501  C  CG  . HIS C 1 35  ? 88.866  108.292 81.818  1.00 14.34 ? 32   HIS C CG  1 
ATOM   7502  N  ND1 . HIS C 1 35  ? 88.959  109.606 81.410  1.00 12.13 ? 32   HIS C ND1 1 
ATOM   7503  C  CD2 . HIS C 1 35  ? 88.925  108.311 83.172  1.00 15.19 ? 32   HIS C CD2 1 
ATOM   7504  C  CE1 . HIS C 1 35  ? 89.051  110.386 82.471  1.00 14.81 ? 32   HIS C CE1 1 
ATOM   7505  N  NE2 . HIS C 1 35  ? 89.041  109.627 83.552  1.00 14.31 ? 32   HIS C NE2 1 
ATOM   7506  N  N   . HIS C 1 36  ? 90.765  105.373 82.449  1.00 16.97 ? 33   HIS C N   1 
ATOM   7507  C  CA  . HIS C 1 36  ? 91.618  105.124 83.607  1.00 19.37 ? 33   HIS C CA  1 
ATOM   7508  C  C   . HIS C 1 36  ? 93.047  104.772 83.217  1.00 19.32 ? 33   HIS C C   1 
ATOM   7509  O  O   . HIS C 1 36  ? 93.965  105.170 83.910  1.00 20.71 ? 33   HIS C O   1 
ATOM   7510  C  CB  . HIS C 1 36  ? 91.017  104.100 84.539  1.00 20.26 ? 33   HIS C CB  1 
ATOM   7511  C  CG  . HIS C 1 36  ? 89.772  104.584 85.204  1.00 22.10 ? 33   HIS C CG  1 
ATOM   7512  N  ND1 . HIS C 1 36  ? 89.691  105.832 85.779  1.00 23.59 ? 33   HIS C ND1 1 
ATOM   7513  C  CD2 . HIS C 1 36  ? 88.594  103.975 85.456  1.00 22.93 ? 33   HIS C CD2 1 
ATOM   7514  C  CE1 . HIS C 1 36  ? 88.495  105.990 86.311  1.00 23.45 ? 33   HIS C CE1 1 
ATOM   7515  N  NE2 . HIS C 1 36  ? 87.812  104.875 86.135  1.00 23.79 ? 33   HIS C NE2 1 
ATOM   7516  N  N   . ALA C 1 37  ? 93.250  104.086 82.090  1.00 19.65 ? 34   ALA C N   1 
ATOM   7517  C  CA  . ALA C 1 37  ? 94.627  103.770 81.645  1.00 20.48 ? 34   ALA C CA  1 
ATOM   7518  C  C   . ALA C 1 37  ? 95.366  105.052 81.197  1.00 20.30 ? 34   ALA C C   1 
ATOM   7519  O  O   . ALA C 1 37  ? 96.598  105.172 81.347  1.00 20.18 ? 34   ALA C O   1 
ATOM   7520  C  CB  . ALA C 1 37  ? 94.629  102.724 80.542  1.00 21.04 ? 34   ALA C CB  1 
ATOM   7521  N  N   . ILE C 1 38  ? 94.631  106.020 80.658  1.00 18.76 ? 35   ILE C N   1 
ATOM   7522  C  CA  . ILE C 1 38  ? 95.255  107.276 80.264  1.00 18.97 ? 35   ILE C CA  1 
ATOM   7523  C  C   . ILE C 1 38  ? 95.755  108.001 81.522  1.00 19.72 ? 35   ILE C C   1 
ATOM   7524  O  O   . ILE C 1 38  ? 96.948  108.376 81.626  1.00 18.90 ? 35   ILE C O   1 
ATOM   7525  C  CB  . ILE C 1 38  ? 94.291  108.186 79.453  1.00 18.87 ? 35   ILE C CB  1 
ATOM   7526  C  CG1 . ILE C 1 38  ? 94.027  107.551 78.072  1.00 17.97 ? 35   ILE C CG1 1 
ATOM   7527  C  CG2 . ILE C 1 38  ? 94.891  109.593 79.292  1.00 19.00 ? 35   ILE C CG2 1 
ATOM   7528  C  CD1 . ILE C 1 38  ? 92.920  108.163 77.267  1.00 19.42 ? 35   ILE C CD1 1 
ATOM   7529  N  N   . HIS C 1 39  ? 94.862  108.147 82.494  1.00 18.50 ? 36   HIS C N   1 
ATOM   7530  C  CA  . HIS C 1 39  ? 95.195  108.860 83.734  1.00 20.30 ? 36   HIS C CA  1 
ATOM   7531  C  C   . HIS C 1 39  ? 96.118  108.104 84.698  1.00 20.76 ? 36   HIS C C   1 
ATOM   7532  O  O   . HIS C 1 39  ? 96.831  108.722 85.453  1.00 23.01 ? 36   HIS C O   1 
ATOM   7533  C  CB  . HIS C 1 39  ? 93.920  109.381 84.404  1.00 19.10 ? 36   HIS C CB  1 
ATOM   7534  C  CG  . HIS C 1 39  ? 93.259  110.458 83.606  1.00 18.68 ? 36   HIS C CG  1 
ATOM   7535  N  ND1 . HIS C 1 39  ? 93.567  111.792 83.771  1.00 18.65 ? 36   HIS C ND1 1 
ATOM   7536  C  CD2 . HIS C 1 39  ? 92.400  110.397 82.560  1.00 16.02 ? 36   HIS C CD2 1 
ATOM   7537  C  CE1 . HIS C 1 39  ? 92.884  112.511 82.895  1.00 18.60 ? 36   HIS C CE1 1 
ATOM   7538  N  NE2 . HIS C 1 39  ? 92.173  111.689 82.144  1.00 17.14 ? 36   HIS C NE2 1 
ATOM   7539  N  N   . GLU C 1 40  ? 96.121  106.779 84.648  1.00 20.94 ? 37   GLU C N   1 
ATOM   7540  C  CA  . GLU C 1 40  ? 97.010  105.983 85.487  1.00 21.84 ? 37   GLU C CA  1 
ATOM   7541  C  C   . GLU C 1 40  ? 98.330  105.715 84.752  1.00 21.39 ? 37   GLU C C   1 
ATOM   7542  O  O   . GLU C 1 40  ? 99.244  105.139 85.322  1.00 21.70 ? 37   GLU C O   1 
ATOM   7543  C  CB  . GLU C 1 40  ? 96.375  104.643 85.837  1.00 22.51 ? 37   GLU C CB  1 
ATOM   7544  C  CG  . GLU C 1 40  ? 95.114  104.734 86.693  1.00 26.55 ? 37   GLU C CG  1 
ATOM   7545  C  CD  . GLU C 1 40  ? 94.466  103.374 86.910  1.00 29.87 ? 37   GLU C CD  1 
ATOM   7546  O  OE1 . GLU C 1 40  ? 95.054  102.354 86.481  1.00 30.78 ? 37   GLU C OE1 1 
ATOM   7547  O  OE2 . GLU C 1 40  ? 93.368  103.322 87.511  1.00 34.15 ? 37   GLU C OE2 1 
ATOM   7548  N  N   . LYS C 1 41  ? 98.399  106.090 83.478  1.00 20.67 ? 38   LYS C N   1 
ATOM   7549  C  CA  . LYS C 1 41  ? 99.605  105.899 82.654  1.00 20.79 ? 38   LYS C CA  1 
ATOM   7550  C  C   . LYS C 1 41  ? 100.012 104.441 82.631  1.00 21.00 ? 38   LYS C C   1 
ATOM   7551  O  O   . LYS C 1 41  ? 101.167 104.111 82.887  1.00 20.87 ? 38   LYS C O   1 
ATOM   7552  C  CB  . LYS C 1 41  ? 100.761 106.734 83.197  1.00 21.37 ? 38   LYS C CB  1 
ATOM   7553  C  CG  . LYS C 1 41  ? 100.427 108.196 83.366  1.00 23.70 ? 38   LYS C CG  1 
ATOM   7554  C  CD  . LYS C 1 41  ? 101.633 108.969 83.880  1.00 27.45 ? 38   LYS C CD  1 
ATOM   7555  C  CE  . LYS C 1 41  ? 101.258 110.383 84.267  1.00 30.15 ? 38   LYS C CE  1 
ATOM   7556  N  NZ  . LYS C 1 41  ? 100.690 111.138 83.129  1.00 31.27 ? 38   LYS C NZ  1 
ATOM   7557  N  N   . THR C 1 42  ? 99.060  103.571 82.310  1.00 20.99 ? 39   THR C N   1 
ATOM   7558  C  CA  . THR C 1 42  ? 99.297  102.142 82.321  1.00 21.65 ? 39   THR C CA  1 
ATOM   7559  C  C   . THR C 1 42  ? 99.270  101.459 80.959  1.00 20.69 ? 39   THR C C   1 
ATOM   7560  O  O   . THR C 1 42  ? 99.623  100.287 80.864  1.00 21.77 ? 39   THR C O   1 
ATOM   7561  C  CB  . THR C 1 42  ? 98.215  101.444 83.176  1.00 22.08 ? 39   THR C CB  1 
ATOM   7562  O  OG1 . THR C 1 42  ? 96.934  101.678 82.600  1.00 21.60 ? 39   THR C OG1 1 
ATOM   7563  C  CG2 . THR C 1 42  ? 98.226  101.981 84.590  1.00 25.54 ? 39   THR C CG2 1 
ATOM   7564  N  N   . GLY C 1 43  ? 98.840  102.164 79.917  1.00 19.41 ? 40   GLY C N   1 
ATOM   7565  C  CA  . GLY C 1 43  ? 98.742  101.562 78.578  1.00 18.36 ? 40   GLY C CA  1 
ATOM   7566  C  C   . GLY C 1 43  ? 99.950  101.806 77.682  1.00 17.31 ? 40   GLY C C   1 
ATOM   7567  O  O   . GLY C 1 43  ? 100.969 102.395 78.105  1.00 17.53 ? 40   GLY C O   1 
ATOM   7568  N  N   . ALA C 1 44  ? 99.827  101.371 76.434  1.00 16.24 ? 41   ALA C N   1 
ATOM   7569  C  CA  . ALA C 1 44  ? 100.876 101.551 75.444  1.00 16.49 ? 41   ALA C CA  1 
ATOM   7570  C  C   . ALA C 1 44  ? 101.266 103.023 75.362  1.00 16.03 ? 41   ALA C C   1 
ATOM   7571  O  O   . ALA C 1 44  ? 100.404 103.896 75.424  1.00 14.96 ? 41   ALA C O   1 
ATOM   7572  C  CB  . ALA C 1 44  ? 100.391 101.081 74.108  1.00 17.54 ? 41   ALA C CB  1 
ATOM   7573  N  N   . GLY C 1 45  ? 102.567 103.281 75.227  1.00 15.56 ? 42   GLY C N   1 
ATOM   7574  C  CA  . GLY C 1 45  ? 103.105 104.633 75.111  1.00 16.11 ? 42   GLY C CA  1 
ATOM   7575  C  C   . GLY C 1 45  ? 102.949 105.523 76.328  1.00 15.89 ? 42   GLY C C   1 
ATOM   7576  O  O   . GLY C 1 45  ? 102.926 106.753 76.215  1.00 13.66 ? 42   GLY C O   1 
ATOM   7577  N  N   . ASN C 1 46  ? 102.886 104.912 77.498  1.00 17.10 ? 43   ASN C N   1 
ATOM   7578  C  CA  . ASN C 1 46  ? 102.695 105.658 78.731  1.00 18.20 ? 43   ASN C CA  1 
ATOM   7579  C  C   . ASN C 1 46  ? 103.839 106.579 79.155  1.00 18.21 ? 43   ASN C C   1 
ATOM   7580  O  O   . ASN C 1 46  ? 103.678 107.320 80.097  1.00 18.83 ? 43   ASN C O   1 
ATOM   7581  C  CB  . ASN C 1 46  ? 102.314 104.722 79.874  1.00 18.89 ? 43   ASN C CB  1 
ATOM   7582  C  CG  . ASN C 1 46  ? 103.407 103.739 80.216  1.00 21.55 ? 43   ASN C CG  1 
ATOM   7583  O  OD1 . ASN C 1 46  ? 104.552 104.116 80.430  1.00 29.88 ? 43   ASN C OD1 1 
ATOM   7584  N  ND2 . ASN C 1 46  ? 103.048 102.478 80.303  1.00 23.42 ? 43   ASN C ND2 1 
ATOM   7585  N  N   . ASP C 1 47  ? 104.981 106.544 78.476  1.00 18.99 ? 44   ASP C N   1 
ATOM   7586  C  CA  . ASP C 1 47  ? 106.066 107.478 78.808  1.00 19.08 ? 44   ASP C CA  1 
ATOM   7587  C  C   . ASP C 1 47  ? 105.842 108.810 78.091  1.00 17.57 ? 44   ASP C C   1 
ATOM   7588  O  O   . ASP C 1 47  ? 106.641 109.735 78.238  1.00 17.18 ? 44   ASP C O   1 
ATOM   7589  C  CB  . ASP C 1 47  ? 107.429 106.929 78.401  1.00 20.26 ? 44   ASP C CB  1 
ATOM   7590  C  CG  . ASP C 1 47  ? 107.873 105.739 79.247  1.00 26.11 ? 44   ASP C CG  1 
ATOM   7591  O  OD1 . ASP C 1 47  ? 107.259 105.464 80.305  1.00 33.40 ? 44   ASP C OD1 1 
ATOM   7592  O  OD2 . ASP C 1 47  ? 108.861 105.088 78.858  1.00 31.45 ? 44   ASP C OD2 1 
ATOM   7593  N  N   . PHE C 1 48  ? 104.780 108.908 77.296  1.00 15.30 ? 45   PHE C N   1 
ATOM   7594  C  CA  . PHE C 1 48  ? 104.509 110.142 76.544  1.00 14.44 ? 45   PHE C CA  1 
ATOM   7595  C  C   . PHE C 1 48  ? 103.144 110.743 76.836  1.00 13.17 ? 45   PHE C C   1 
ATOM   7596  O  O   . PHE C 1 48  ? 102.444 111.175 75.925  1.00 11.82 ? 45   PHE C O   1 
ATOM   7597  C  CB  . PHE C 1 48  ? 104.681 109.856 75.052  1.00 15.09 ? 45   PHE C CB  1 
ATOM   7598  C  CG  . PHE C 1 48  ? 106.047 109.351 74.724  1.00 15.93 ? 45   PHE C CG  1 
ATOM   7599  C  CD1 . PHE C 1 48  ? 107.102 110.229 74.603  1.00 20.48 ? 45   PHE C CD1 1 
ATOM   7600  C  CD2 . PHE C 1 48  ? 106.288 108.006 74.618  1.00 20.20 ? 45   PHE C CD2 1 
ATOM   7601  C  CE1 . PHE C 1 48  ? 108.374 109.776 74.364  1.00 20.09 ? 45   PHE C CE1 1 
ATOM   7602  C  CE2 . PHE C 1 48  ? 107.568 107.539 74.378  1.00 22.49 ? 45   PHE C CE2 1 
ATOM   7603  C  CZ  . PHE C 1 48  ? 108.604 108.428 74.243  1.00 21.89 ? 45   PHE C CZ  1 
ATOM   7604  N  N   . LEU C 1 49  ? 102.786 110.795 78.113  1.00 11.94 ? 46   LEU C N   1 
ATOM   7605  C  CA  . LEU C 1 49  ? 101.484 111.311 78.522  1.00 12.90 ? 46   LEU C CA  1 
ATOM   7606  C  C   . LEU C 1 49  ? 101.573 112.624 79.259  1.00 13.68 ? 46   LEU C C   1 
ATOM   7607  O  O   . LEU C 1 49  ? 100.619 113.031 79.928  1.00 14.89 ? 46   LEU C O   1 
ATOM   7608  C  CB  . LEU C 1 49  ? 100.792 110.277 79.385  1.00 13.67 ? 46   LEU C CB  1 
ATOM   7609  C  CG  . LEU C 1 49  ? 100.268 109.065 78.636  1.00 14.46 ? 46   LEU C CG  1 
ATOM   7610  C  CD1 . LEU C 1 49  ? 99.883  107.966 79.631  1.00 14.16 ? 46   LEU C CD1 1 
ATOM   7611  C  CD2 . LEU C 1 49  ? 99.066  109.508 77.755  1.00 15.24 ? 46   LEU C CD2 1 
ATOM   7612  N  N   . GLY C 1 50  ? 102.693 113.318 79.065  1.00 14.09 ? 47   GLY C N   1 
ATOM   7613  C  CA  . GLY C 1 50  ? 102.959 114.600 79.731  1.00 14.39 ? 47   GLY C CA  1 
ATOM   7614  C  C   . GLY C 1 50  ? 102.007 115.720 79.371  1.00 14.25 ? 47   GLY C C   1 
ATOM   7615  O  O   . GLY C 1 50  ? 101.837 116.654 80.135  1.00 14.20 ? 47   GLY C O   1 
ATOM   7616  N  N   . TRP C 1 51  ? 101.366 115.611 78.211  1.00 12.99 ? 48   TRP C N   1 
ATOM   7617  C  CA  . TRP C 1 51  ? 100.432 116.622 77.759  1.00 12.45 ? 48   TRP C CA  1 
ATOM   7618  C  C   . TRP C 1 51  ? 99.082  116.588 78.504  1.00 12.78 ? 48   TRP C C   1 
ATOM   7619  O  O   . TRP C 1 51  ? 98.346  117.565 78.482  1.00 12.03 ? 48   TRP C O   1 
ATOM   7620  C  CB  . TRP C 1 51  ? 100.185 116.439 76.250  1.00 13.09 ? 48   TRP C CB  1 
ATOM   7621  C  CG  . TRP C 1 51  ? 99.699  115.037 75.908  1.00 11.40 ? 48   TRP C CG  1 
ATOM   7622  C  CD1 . TRP C 1 51  ? 100.476 113.945 75.592  1.00 11.87 ? 48   TRP C CD1 1 
ATOM   7623  C  CD2 . TRP C 1 51  ? 98.346  114.577 75.902  1.00 12.01 ? 48   TRP C CD2 1 
ATOM   7624  N  NE1 . TRP C 1 51  ? 99.688  112.847 75.390  1.00 10.03 ? 48   TRP C NE1 1 
ATOM   7625  C  CE2 . TRP C 1 51  ? 98.372  113.209 75.559  1.00 11.40 ? 48   TRP C CE2 1 
ATOM   7626  C  CE3 . TRP C 1 51  ? 97.110  115.192 76.129  1.00 12.84 ? 48   TRP C CE3 1 
ATOM   7627  C  CZ2 . TRP C 1 51  ? 97.217  112.450 75.462  1.00 11.79 ? 48   TRP C CZ2 1 
ATOM   7628  C  CZ3 . TRP C 1 51  ? 95.961  114.427 76.024  1.00 10.31 ? 48   TRP C CZ3 1 
ATOM   7629  C  CH2 . TRP C 1 51  ? 96.024  113.082 75.677  1.00 11.26 ? 48   TRP C CH2 1 
ATOM   7630  N  N   . VAL C 1 52  ? 98.754  115.469 79.151  1.00 13.13 ? 49   VAL C N   1 
ATOM   7631  C  CA  . VAL C 1 52  ? 97.451  115.332 79.840  1.00 12.80 ? 49   VAL C CA  1 
ATOM   7632  C  C   . VAL C 1 52  ? 97.225  116.376 80.942  1.00 13.05 ? 49   VAL C C   1 
ATOM   7633  O  O   . VAL C 1 52  ? 96.176  117.029 80.976  1.00 8.59  ? 49   VAL C O   1 
ATOM   7634  C  CB  . VAL C 1 52  ? 97.238  113.898 80.391  1.00 13.38 ? 49   VAL C CB  1 
ATOM   7635  C  CG1 . VAL C 1 52  ? 95.897  113.777 81.132  1.00 11.16 ? 49   VAL C CG1 1 
ATOM   7636  C  CG2 . VAL C 1 52  ? 97.268  112.871 79.222  1.00 13.13 ? 49   VAL C CG2 1 
ATOM   7637  N  N   . ASP C 1 53  ? 98.213  116.542 81.822  1.00 12.36 ? 50   ASP C N   1 
ATOM   7638  C  CA  . ASP C 1 53  ? 98.114  117.514 82.923  1.00 13.33 ? 50   ASP C CA  1 
ATOM   7639  C  C   . ASP C 1 53  ? 98.956  118.801 82.730  1.00 12.73 ? 50   ASP C C   1 
ATOM   7640  O  O   . ASP C 1 53  ? 98.997  119.667 83.608  1.00 12.70 ? 50   ASP C O   1 
ATOM   7641  C  CB  . ASP C 1 53  ? 98.425  116.812 84.246  1.00 14.92 ? 50   ASP C CB  1 
ATOM   7642  C  CG  . ASP C 1 53  ? 97.386  115.733 84.581  1.00 14.64 ? 50   ASP C CG  1 
ATOM   7643  O  OD1 . ASP C 1 53  ? 96.183  115.958 84.347  1.00 14.02 ? 50   ASP C OD1 1 
ATOM   7644  O  OD2 . ASP C 1 53  ? 97.777  114.670 85.085  1.00 22.00 ? 50   ASP C OD2 1 
ATOM   7645  N  N   . LEU C 1 54  ? 99.600  118.914 81.573  1.00 12.77 ? 51   LEU C N   1 
ATOM   7646  C  CA  . LEU C 1 54  ? 100.383 120.102 81.192  1.00 12.95 ? 51   LEU C CA  1 
ATOM   7647  C  C   . LEU C 1 54  ? 99.618  121.428 81.392  1.00 13.39 ? 51   LEU C C   1 
ATOM   7648  O  O   . LEU C 1 54  ? 100.192 122.420 81.890  1.00 14.09 ? 51   LEU C O   1 
ATOM   7649  C  CB  . LEU C 1 54  ? 100.827 119.971 79.714  1.00 13.59 ? 51   LEU C CB  1 
ATOM   7650  C  CG  . LEU C 1 54  ? 101.594 121.129 79.052  1.00 15.75 ? 51   LEU C CG  1 
ATOM   7651  C  CD1 . LEU C 1 54  ? 102.932 121.371 79.769  1.00 18.96 ? 51   LEU C CD1 1 
ATOM   7652  C  CD2 . LEU C 1 54  ? 101.827 120.895 77.563  1.00 15.70 ? 51   LEU C CD2 1 
ATOM   7653  N  N   . PRO C 1 55  ? 98.324  121.476 81.019  1.00 13.97 ? 52   PRO C N   1 
ATOM   7654  C  CA  . PRO C 1 55  ? 97.583  122.738 81.182  1.00 14.14 ? 52   PRO C CA  1 
ATOM   7655  C  C   . PRO C 1 55  ? 97.483  123.191 82.633  1.00 14.87 ? 52   PRO C C   1 
ATOM   7656  O  O   . PRO C 1 55  ? 97.339  124.381 82.914  1.00 13.82 ? 52   PRO C O   1 
ATOM   7657  C  CB  . PRO C 1 55  ? 96.202  122.393 80.643  1.00 15.04 ? 52   PRO C CB  1 
ATOM   7658  C  CG  . PRO C 1 55  ? 96.477  121.327 79.630  1.00 14.20 ? 52   PRO C CG  1 
ATOM   7659  C  CD  . PRO C 1 55  ? 97.519  120.482 80.295  1.00 13.86 ? 52   PRO C CD  1 
ATOM   7660  N  N   . LEU C 1 56  ? 97.583  122.243 83.544  1.00 15.06 ? 53   LEU C N   1 
ATOM   7661  C  CA  . LEU C 1 56  ? 97.534  122.549 84.965  1.00 16.66 ? 53   LEU C CA  1 
ATOM   7662  C  C   . LEU C 1 56  ? 98.940  122.735 85.554  1.00 16.52 ? 53   LEU C C   1 
ATOM   7663  O  O   . LEU C 1 56  ? 99.217  123.716 86.247  1.00 17.13 ? 53   LEU C O   1 
ATOM   7664  C  CB  . LEU C 1 56  ? 96.839  121.405 85.701  1.00 16.16 ? 53   LEU C CB  1 
ATOM   7665  C  CG  . LEU C 1 56  ? 96.611  121.557 87.209  1.00 19.16 ? 53   LEU C CG  1 
ATOM   7666  C  CD1 . LEU C 1 56  ? 95.627  122.687 87.505  1.00 20.51 ? 53   LEU C CD1 1 
ATOM   7667  C  CD2 . LEU C 1 56  ? 96.099  120.232 87.793  1.00 23.43 ? 53   LEU C CD2 1 
ATOM   7668  N  N   . GLN C 1 57  ? 99.824  121.802 85.232  1.00 16.60 ? 54   GLN C N   1 
ATOM   7669  C  CA  . GLN C 1 57  ? 101.166 121.747 85.818  1.00 17.75 ? 54   GLN C CA  1 
ATOM   7670  C  C   . GLN C 1 57  ? 102.352 122.344 85.053  1.00 17.53 ? 54   GLN C C   1 
ATOM   7671  O  O   . GLN C 1 57  ? 103.496 122.161 85.456  1.00 18.00 ? 54   GLN C O   1 
ATOM   7672  C  CB  . GLN C 1 57  ? 101.456 120.277 86.137  1.00 18.25 ? 54   GLN C CB  1 
ATOM   7673  C  CG  . GLN C 1 57  ? 100.437 119.687 87.112  1.00 21.92 ? 54   GLN C CG  1 
ATOM   7674  C  CD  . GLN C 1 57  ? 100.724 118.240 87.495  1.00 27.58 ? 54   GLN C CD  1 
ATOM   7675  O  OE1 . GLN C 1 57  ? 101.143 117.429 86.663  1.00 28.47 ? 54   GLN C OE1 1 
ATOM   7676  N  NE2 . GLN C 1 57  ? 100.494 117.912 88.769  1.00 30.84 ? 54   GLN C NE2 1 
ATOM   7677  N  N   . TYR C 1 58  ? 102.107 123.083 83.989  1.00 16.88 ? 55   TYR C N   1 
ATOM   7678  C  CA  . TYR C 1 58  ? 103.214 123.670 83.251  1.00 17.64 ? 55   TYR C CA  1 
ATOM   7679  C  C   . TYR C 1 58  ? 104.117 124.499 84.190  1.00 17.21 ? 55   TYR C C   1 
ATOM   7680  O  O   . TYR C 1 58  ? 103.658 125.058 85.191  1.00 17.58 ? 55   TYR C O   1 
ATOM   7681  C  CB  . TYR C 1 58  ? 102.707 124.538 82.104  1.00 17.35 ? 55   TYR C CB  1 
ATOM   7682  C  CG  . TYR C 1 58  ? 101.918 125.752 82.542  1.00 19.39 ? 55   TYR C CG  1 
ATOM   7683  C  CD1 . TYR C 1 58  ? 100.542 125.688 82.719  1.00 19.41 ? 55   TYR C CD1 1 
ATOM   7684  C  CD2 . TYR C 1 58  ? 102.553 126.974 82.760  1.00 21.99 ? 55   TYR C CD2 1 
ATOM   7685  C  CE1 . TYR C 1 58  ? 99.820  126.800 83.115  1.00 21.35 ? 55   TYR C CE1 1 
ATOM   7686  C  CE2 . TYR C 1 58  ? 101.838 128.092 83.157  1.00 23.16 ? 55   TYR C CE2 1 
ATOM   7687  C  CZ  . TYR C 1 58  ? 100.477 127.998 83.334  1.00 23.75 ? 55   TYR C CZ  1 
ATOM   7688  O  OH  . TYR C 1 58  ? 99.770  129.101 83.734  1.00 27.61 ? 55   TYR C OH  1 
ATOM   7689  N  N   . ASP C 1 59  ? 105.404 124.541 83.860  1.00 17.07 ? 56   ASP C N   1 
ATOM   7690  C  CA  . ASP C 1 59  ? 106.428 125.297 84.608  1.00 16.44 ? 56   ASP C CA  1 
ATOM   7691  C  C   . ASP C 1 59  ? 106.053 126.761 84.491  1.00 16.20 ? 56   ASP C C   1 
ATOM   7692  O  O   . ASP C 1 59  ? 106.068 127.323 83.386  1.00 15.84 ? 56   ASP C O   1 
ATOM   7693  C  CB  . ASP C 1 59  ? 107.787 125.008 83.974  1.00 17.36 ? 56   ASP C CB  1 
ATOM   7694  C  CG  . ASP C 1 59  ? 108.957 125.678 84.683  1.00 19.41 ? 56   ASP C CG  1 
ATOM   7695  O  OD1 . ASP C 1 59  ? 108.810 126.731 85.340  1.00 17.47 ? 56   ASP C OD1 1 
ATOM   7696  O  OD2 . ASP C 1 59  ? 110.061 125.136 84.521  1.00 23.61 ? 56   ASP C OD2 1 
ATOM   7697  N  N   . LYS C 1 60  ? 105.696 127.364 85.630  1.00 16.64 ? 57   LYS C N   1 
ATOM   7698  C  CA  . LYS C 1 60  ? 105.241 128.748 85.675  1.00 17.51 ? 57   LYS C CA  1 
ATOM   7699  C  C   . LYS C 1 60  ? 106.356 129.800 85.585  1.00 17.08 ? 57   LYS C C   1 
ATOM   7700  O  O   . LYS C 1 60  ? 106.130 130.870 85.049  1.00 16.41 ? 57   LYS C O   1 
ATOM   7701  C  CB  . LYS C 1 60  ? 104.279 128.967 86.855  1.00 18.82 ? 57   LYS C CB  1 
ATOM   7702  C  CG  . LYS C 1 60  ? 103.073 128.023 86.714  1.00 21.79 ? 57   LYS C CG  1 
ATOM   7703  C  CD  . LYS C 1 60  ? 101.768 128.463 87.384  1.00 30.41 ? 57   LYS C CD  1 
ATOM   7704  C  CE  . LYS C 1 60  ? 101.790 128.456 88.901  1.00 32.25 ? 57   LYS C CE  1 
ATOM   7705  N  NZ  . LYS C 1 60  ? 100.395 128.671 89.435  1.00 31.40 ? 57   LYS C NZ  1 
ATOM   7706  N  N   A GLU C 1 61  ? 107.545 129.485 86.078  0.70 16.52 ? 58   GLU C N   1 
ATOM   7707  N  N   B GLU C 1 61  ? 107.542 129.485 86.106  0.30 16.46 ? 58   GLU C N   1 
ATOM   7708  C  CA  A GLU C 1 61  ? 108.650 130.429 85.995  0.70 18.01 ? 58   GLU C CA  1 
ATOM   7709  C  CA  B GLU C 1 61  ? 108.674 130.403 86.003  0.30 16.87 ? 58   GLU C CA  1 
ATOM   7710  C  C   A GLU C 1 61  ? 109.117 130.488 84.551  0.70 16.41 ? 58   GLU C C   1 
ATOM   7711  C  C   B GLU C 1 61  ? 109.072 130.492 84.544  0.30 16.12 ? 58   GLU C C   1 
ATOM   7712  O  O   A GLU C 1 61  ? 109.440 131.560 84.042  0.70 15.59 ? 58   GLU C O   1 
ATOM   7713  O  O   B GLU C 1 61  ? 109.317 131.578 84.022  0.30 15.80 ? 58   GLU C O   1 
ATOM   7714  C  CB  A GLU C 1 61  ? 109.777 130.056 86.966  0.70 18.65 ? 58   GLU C CB  1 
ATOM   7715  C  CB  B GLU C 1 61  ? 109.884 129.936 86.821  0.30 16.94 ? 58   GLU C CB  1 
ATOM   7716  C  CG  A GLU C 1 61  ? 109.363 130.285 88.416  0.70 23.03 ? 58   GLU C CG  1 
ATOM   7717  C  CG  B GLU C 1 61  ? 109.737 130.064 88.321  0.30 18.49 ? 58   GLU C CG  1 
ATOM   7718  C  CD  A GLU C 1 61  ? 108.068 129.559 88.777  0.70 28.93 ? 58   GLU C CD  1 
ATOM   7719  C  CD  B GLU C 1 61  ? 111.010 129.682 89.056  0.30 19.41 ? 58   GLU C CD  1 
ATOM   7720  O  OE1 A GLU C 1 61  ? 107.852 128.420 88.283  0.70 30.85 ? 58   GLU C OE1 1 
ATOM   7721  O  OE1 B GLU C 1 61  ? 111.953 129.186 88.398  0.30 20.35 ? 58   GLU C OE1 1 
ATOM   7722  O  OE2 A GLU C 1 61  ? 107.271 130.123 89.563  0.70 32.08 ? 58   GLU C OE2 1 
ATOM   7723  O  OE2 B GLU C 1 61  ? 111.066 129.876 90.288  0.30 20.72 ? 58   GLU C OE2 1 
ATOM   7724  N  N   . GLU C 1 62  ? 109.130 129.335 83.888  1.00 15.81 ? 59   GLU C N   1 
ATOM   7725  C  CA  . GLU C 1 62  ? 109.496 129.280 82.483  1.00 15.31 ? 59   GLU C CA  1 
ATOM   7726  C  C   . GLU C 1 62  ? 108.468 130.067 81.679  1.00 14.41 ? 59   GLU C C   1 
ATOM   7727  O  O   . GLU C 1 62  ? 108.822 130.842 80.798  1.00 15.51 ? 59   GLU C O   1 
ATOM   7728  C  CB  . GLU C 1 62  ? 109.520 127.843 81.981  1.00 15.14 ? 59   GLU C CB  1 
ATOM   7729  C  CG  . GLU C 1 62  ? 109.971 127.724 80.562  1.00 13.22 ? 59   GLU C CG  1 
ATOM   7730  C  CD  . GLU C 1 62  ? 109.946 126.295 80.041  1.00 14.38 ? 59   GLU C CD  1 
ATOM   7731  O  OE1 . GLU C 1 62  ? 108.910 125.611 80.193  1.00 15.25 ? 59   GLU C OE1 1 
ATOM   7732  O  OE2 . GLU C 1 62  ? 110.950 125.888 79.412  1.00 16.42 ? 59   GLU C OE2 1 
ATOM   7733  N  N   . PHE C 1 63  ? 107.190 129.852 81.971  1.00 13.46 ? 60   PHE C N   1 
ATOM   7734  C  CA  . PHE C 1 63  ? 106.115 130.557 81.269  1.00 14.11 ? 60   PHE C CA  1 
ATOM   7735  C  C   . PHE C 1 63  ? 106.338 132.087 81.316  1.00 14.63 ? 60   PHE C C   1 
ATOM   7736  O  O   . PHE C 1 63  ? 106.202 132.776 80.300  1.00 14.28 ? 60   PHE C O   1 
ATOM   7737  C  CB  . PHE C 1 63  ? 104.780 130.184 81.903  1.00 15.21 ? 60   PHE C CB  1 
ATOM   7738  C  CG  . PHE C 1 63  ? 103.581 130.683 81.157  1.00 15.52 ? 60   PHE C CG  1 
ATOM   7739  C  CD1 . PHE C 1 63  ? 102.992 131.893 81.483  1.00 19.61 ? 60   PHE C CD1 1 
ATOM   7740  C  CD2 . PHE C 1 63  ? 103.010 129.913 80.165  1.00 18.89 ? 60   PHE C CD2 1 
ATOM   7741  C  CE1 . PHE C 1 63  ? 101.883 132.330 80.805  1.00 18.76 ? 60   PHE C CE1 1 
ATOM   7742  C  CE2 . PHE C 1 63  ? 101.900 130.354 79.487  1.00 19.53 ? 60   PHE C CE2 1 
ATOM   7743  C  CZ  . PHE C 1 63  ? 101.346 131.560 79.802  1.00 17.50 ? 60   PHE C CZ  1 
ATOM   7744  N  N   . ALA C 1 64  ? 106.684 132.607 82.497  1.00 14.86 ? 61   ALA C N   1 
ATOM   7745  C  CA  . ALA C 1 64  ? 106.936 134.047 82.672  1.00 14.78 ? 61   ALA C CA  1 
ATOM   7746  C  C   . ALA C 1 64  ? 108.152 134.486 81.854  1.00 14.52 ? 61   ALA C C   1 
ATOM   7747  O  O   . ALA C 1 64  ? 108.181 135.589 81.329  1.00 13.00 ? 61   ALA C O   1 
ATOM   7748  C  CB  . ALA C 1 64  ? 107.119 134.400 84.157  1.00 15.22 ? 61   ALA C CB  1 
ATOM   7749  N  N   . ARG C 1 65  ? 109.144 133.604 81.733  1.00 14.76 ? 62   ARG C N   1 
ATOM   7750  C  CA  . ARG C 1 65  ? 110.325 133.911 80.939  1.00 15.33 ? 62   ARG C CA  1 
ATOM   7751  C  C   . ARG C 1 65  ? 109.987 133.907 79.432  1.00 15.46 ? 62   ARG C C   1 
ATOM   7752  O  O   . ARG C 1 65  ? 110.608 134.628 78.655  1.00 15.23 ? 62   ARG C O   1 
ATOM   7753  C  CB  . ARG C 1 65  ? 111.467 132.967 81.292  1.00 16.28 ? 62   ARG C CB  1 
ATOM   7754  C  CG  . ARG C 1 65  ? 112.774 133.331 80.639  1.00 19.61 ? 62   ARG C CG  1 
ATOM   7755  C  CD  . ARG C 1 65  ? 113.962 132.692 81.370  1.00 21.74 ? 62   ARG C CD  1 
ATOM   7756  N  NE  . ARG C 1 65  ? 113.788 131.255 81.476  1.00 21.43 ? 62   ARG C NE  1 
ATOM   7757  C  CZ  . ARG C 1 65  ? 114.159 130.374 80.552  1.00 20.65 ? 62   ARG C CZ  1 
ATOM   7758  N  NH1 . ARG C 1 65  ? 114.753 130.759 79.422  1.00 17.40 ? 62   ARG C NH1 1 
ATOM   7759  N  NH2 . ARG C 1 65  ? 113.924 129.095 80.764  1.00 21.49 ? 62   ARG C NH2 1 
ATOM   7760  N  N   . ILE C 1 66  ? 109.019 133.083 79.012  1.00 15.17 ? 63   ILE C N   1 
ATOM   7761  C  CA  . ILE C 1 66  ? 108.576 133.097 77.614  1.00 14.44 ? 63   ILE C CA  1 
ATOM   7762  C  C   . ILE C 1 66  ? 107.993 134.497 77.332  1.00 15.57 ? 63   ILE C C   1 
ATOM   7763  O  O   . ILE C 1 66  ? 108.297 135.120 76.316  1.00 14.19 ? 63   ILE C O   1 
ATOM   7764  C  CB  . ILE C 1 66  ? 107.475 132.045 77.347  1.00 14.28 ? 63   ILE C CB  1 
ATOM   7765  C  CG1 . ILE C 1 66  ? 108.032 130.630 77.529  1.00 15.46 ? 63   ILE C CG1 1 
ATOM   7766  C  CG2 . ILE C 1 66  ? 106.884 132.222 75.935  1.00 13.58 ? 63   ILE C CG2 1 
ATOM   7767  C  CD1 . ILE C 1 66  ? 106.976 129.551 77.518  1.00 14.06 ? 63   ILE C CD1 1 
ATOM   7768  N  N   . GLN C 1 67  ? 107.162 134.987 78.251  1.00 16.11 ? 64   GLN C N   1 
ATOM   7769  C  CA  . GLN C 1 67  ? 106.543 136.308 78.106  1.00 16.81 ? 64   GLN C CA  1 
ATOM   7770  C  C   . GLN C 1 67  ? 107.580 137.434 78.018  1.00 17.12 ? 64   GLN C C   1 
ATOM   7771  O  O   . GLN C 1 67  ? 107.460 138.336 77.195  1.00 17.69 ? 64   GLN C O   1 
ATOM   7772  C  CB  . GLN C 1 67  ? 105.571 136.568 79.261  1.00 17.48 ? 64   GLN C CB  1 
ATOM   7773  C  CG  . GLN C 1 67  ? 104.312 135.670 79.237  1.00 18.25 ? 64   GLN C CG  1 
ATOM   7774  C  CD  . GLN C 1 67  ? 103.452 135.815 80.494  1.00 22.12 ? 64   GLN C CD  1 
ATOM   7775  O  OE1 . GLN C 1 67  ? 103.969 135.871 81.619  1.00 20.82 ? 64   GLN C OE1 1 
ATOM   7776  N  NE2 . GLN C 1 67  ? 102.137 135.844 80.309  1.00 18.57 ? 64   GLN C NE2 1 
ATOM   7777  N  N   . LYS C 1 68  ? 108.601 137.374 78.864  1.00 17.21 ? 65   LYS C N   1 
ATOM   7778  C  CA  . LYS C 1 68  ? 109.658 138.392 78.874  1.00 17.78 ? 65   LYS C CA  1 
ATOM   7779  C  C   . LYS C 1 68  ? 110.471 138.372 77.571  1.00 17.08 ? 65   LYS C C   1 
ATOM   7780  O  O   . LYS C 1 68  ? 110.820 139.436 77.012  1.00 14.38 ? 65   LYS C O   1 
ATOM   7781  C  CB  . LYS C 1 68  ? 110.565 138.157 80.084  1.00 17.90 ? 65   LYS C CB  1 
ATOM   7782  C  CG  . LYS C 1 68  ? 111.681 139.139 80.256  1.00 22.11 ? 65   LYS C CG  1 
ATOM   7783  C  CD  . LYS C 1 68  ? 112.377 138.895 81.588  1.00 24.32 ? 65   LYS C CD  1 
ATOM   7784  C  CE  . LYS C 1 68  ? 113.398 139.980 81.882  1.00 28.62 ? 65   LYS C CE  1 
ATOM   7785  N  NZ  . LYS C 1 68  ? 113.913 139.883 83.291  1.00 31.37 ? 65   LYS C NZ  1 
ATOM   7786  N  N   . CYS C 1 69  ? 110.792 137.167 77.103  1.00 15.61 ? 66   CYS C N   1 
ATOM   7787  C  CA  . CYS C 1 69  ? 111.534 137.022 75.858  1.00 16.73 ? 66   CYS C CA  1 
ATOM   7788  C  C   . CYS C 1 69  ? 110.724 137.500 74.672  1.00 15.39 ? 66   CYS C C   1 
ATOM   7789  O  O   . CYS C 1 69  ? 111.273 138.081 73.756  1.00 15.43 ? 66   CYS C O   1 
ATOM   7790  C  CB  . CYS C 1 69  ? 111.983 135.575 75.642  1.00 17.58 ? 66   CYS C CB  1 
ATOM   7791  S  SG  . CYS C 1 69  ? 113.301 135.113 76.786  1.00 22.83 ? 66   CYS C SG  1 
ATOM   7792  N  N   . ALA C 1 70  ? 109.423 137.227 74.685  1.00 15.95 ? 67   ALA C N   1 
ATOM   7793  C  CA  . ALA C 1 70  ? 108.547 137.658 73.609  1.00 15.69 ? 67   ALA C CA  1 
ATOM   7794  C  C   . ALA C 1 70  ? 108.552 139.177 73.534  1.00 14.96 ? 67   ALA C C   1 
ATOM   7795  O  O   . ALA C 1 70  ? 108.566 139.744 72.445  1.00 15.29 ? 67   ALA C O   1 
ATOM   7796  C  CB  . ALA C 1 70  ? 107.127 137.123 73.821  1.00 15.35 ? 67   ALA C CB  1 
ATOM   7797  N  N   . GLU C 1 71  ? 108.525 139.846 74.688  1.00 16.23 ? 68   GLU C N   1 
ATOM   7798  C  CA  . GLU C 1 71  ? 108.555 141.329 74.711  1.00 15.73 ? 68   GLU C CA  1 
ATOM   7799  C  C   . GLU C 1 71  ? 109.878 141.853 74.147  1.00 14.66 ? 68   GLU C C   1 
ATOM   7800  O  O   . GLU C 1 71  ? 109.882 142.792 73.377  1.00 13.42 ? 68   GLU C O   1 
ATOM   7801  C  CB  . GLU C 1 71  ? 108.315 141.897 76.125  1.00 16.68 ? 68   GLU C CB  1 
ATOM   7802  C  CG  . GLU C 1 71  ? 106.905 141.658 76.650  1.00 21.06 ? 68   GLU C CG  1 
ATOM   7803  C  CD  . GLU C 1 71  ? 105.834 142.267 75.748  1.00 25.09 ? 68   GLU C CD  1 
ATOM   7804  O  OE1 . GLU C 1 71  ? 105.978 143.451 75.355  1.00 29.48 ? 68   GLU C OE1 1 
ATOM   7805  O  OE2 . GLU C 1 71  ? 104.849 141.558 75.440  1.00 24.84 ? 68   GLU C OE2 1 
ATOM   7806  N  N   . LYS C 1 72  ? 110.994 141.245 74.542  1.00 15.19 ? 69   LYS C N   1 
ATOM   7807  C  CA  . LYS C 1 72  ? 112.314 141.632 74.033  1.00 15.22 ? 69   LYS C CA  1 
ATOM   7808  C  C   . LYS C 1 72  ? 112.366 141.539 72.506  1.00 15.47 ? 69   LYS C C   1 
ATOM   7809  O  O   . LYS C 1 72  ? 112.832 142.460 71.817  1.00 15.22 ? 69   LYS C O   1 
ATOM   7810  C  CB  . LYS C 1 72  ? 113.416 140.721 74.600  1.00 15.81 ? 69   LYS C CB  1 
ATOM   7811  C  CG  . LYS C 1 72  ? 114.818 141.065 74.046  1.00 17.63 ? 69   LYS C CG  1 
ATOM   7812  C  CD  . LYS C 1 72  ? 115.909 140.090 74.489  1.00 20.77 ? 69   LYS C CD  1 
ATOM   7813  C  CE  . LYS C 1 72  ? 117.302 140.495 73.908  1.00 23.60 ? 69   LYS C CE  1 
ATOM   7814  N  NZ  . LYS C 1 72  ? 117.419 140.476 72.379  1.00 23.06 ? 69   LYS C NZ  1 
ATOM   7815  N  N   . ILE C 1 73  ? 111.898 140.411 71.985  1.00 14.70 ? 70   ILE C N   1 
ATOM   7816  C  CA  . ILE C 1 73  ? 111.887 140.175 70.537  1.00 14.88 ? 70   ILE C CA  1 
ATOM   7817  C  C   . ILE C 1 73  ? 110.991 141.188 69.811  1.00 14.79 ? 70   ILE C C   1 
ATOM   7818  O  O   . ILE C 1 73  ? 111.364 141.715 68.757  1.00 14.18 ? 70   ILE C O   1 
ATOM   7819  C  CB  . ILE C 1 73  ? 111.443 138.732 70.222  1.00 13.43 ? 70   ILE C CB  1 
ATOM   7820  C  CG1 . ILE C 1 73  ? 112.447 137.723 70.783  1.00 12.91 ? 70   ILE C CG1 1 
ATOM   7821  C  CG2 . ILE C 1 73  ? 111.291 138.554 68.730  1.00 13.53 ? 70   ILE C CG2 1 
ATOM   7822  C  CD1 . ILE C 1 73  ? 111.935 136.249 70.786  1.00 10.49 ? 70   ILE C CD1 1 
ATOM   7823  N  N   . LYS C 1 74  ? 109.810 141.456 70.367  1.00 15.76 ? 71   LYS C N   1 
ATOM   7824  C  CA  . LYS C 1 74  ? 108.897 142.433 69.771  1.00 16.70 ? 71   LYS C CA  1 
ATOM   7825  C  C   . LYS C 1 74  ? 109.551 143.794 69.689  1.00 17.67 ? 71   LYS C C   1 
ATOM   7826  O  O   . LYS C 1 74  ? 109.285 144.557 68.762  1.00 16.72 ? 71   LYS C O   1 
ATOM   7827  C  CB  . LYS C 1 74  ? 107.593 142.605 70.588  1.00 17.87 ? 71   LYS C CB  1 
ATOM   7828  C  CG  . LYS C 1 74  ? 106.624 141.434 70.590  1.00 20.42 ? 71   LYS C CG  1 
ATOM   7829  C  CD  . LYS C 1 74  ? 105.424 141.775 71.477  1.00 23.63 ? 71   LYS C CD  1 
ATOM   7830  C  CE  . LYS C 1 74  ? 104.463 140.633 71.676  1.00 26.53 ? 71   LYS C CE  1 
ATOM   7831  N  NZ  . LYS C 1 74  ? 103.344 141.047 72.602  1.00 27.00 ? 71   LYS C NZ  1 
ATOM   7832  N  N   . ASN C 1 75  ? 110.396 144.109 70.666  1.00 18.27 ? 72   ASN C N   1 
ATOM   7833  C  CA  . ASN C 1 75  ? 111.032 145.413 70.718  1.00 18.86 ? 72   ASN C CA  1 
ATOM   7834  C  C   . ASN C 1 75  ? 112.360 145.530 69.967  1.00 18.37 ? 72   ASN C C   1 
ATOM   7835  O  O   . ASN C 1 75  ? 112.824 146.639 69.729  1.00 17.68 ? 72   ASN C O   1 
ATOM   7836  C  CB  . ASN C 1 75  ? 111.209 145.844 72.183  1.00 20.92 ? 72   ASN C CB  1 
ATOM   7837  C  CG  . ASN C 1 75  ? 109.870 146.095 72.883  1.00 26.16 ? 72   ASN C CG  1 
ATOM   7838  O  OD1 . ASN C 1 75  ? 108.886 146.453 72.242  1.00 33.04 ? 72   ASN C OD1 1 
ATOM   7839  N  ND2 . ASN C 1 75  ? 109.842 145.934 74.202  1.00 31.23 ? 72   ASN C ND2 1 
ATOM   7840  N  N   . ASP C 1 76  ? 112.985 144.409 69.603  1.00 16.47 ? 73   ASP C N   1 
ATOM   7841  C  CA  . ASP C 1 76  ? 114.254 144.499 68.888  1.00 14.66 ? 73   ASP C CA  1 
ATOM   7842  C  C   . ASP C 1 76  ? 114.284 143.794 67.521  1.00 13.67 ? 73   ASP C C   1 
ATOM   7843  O  O   . ASP C 1 76  ? 115.331 143.748 66.886  1.00 13.30 ? 73   ASP C O   1 
ATOM   7844  C  CB  . ASP C 1 76  ? 115.409 144.027 69.784  1.00 14.53 ? 73   ASP C CB  1 
ATOM   7845  C  CG  . ASP C 1 76  ? 115.437 142.527 70.016  1.00 14.62 ? 73   ASP C CG  1 
ATOM   7846  O  OD1 . ASP C 1 76  ? 114.773 141.764 69.297  1.00 17.72 ? 73   ASP C OD1 1 
ATOM   7847  O  OD2 . ASP C 1 76  ? 116.188 142.092 70.921  1.00 16.95 ? 73   ASP C OD2 1 
ATOM   7848  N  N   . SER C 1 77  ? 113.148 143.279 67.052  1.00 12.73 ? 74   SER C N   1 
ATOM   7849  C  CA  . SER C 1 77  ? 113.136 142.562 65.779  1.00 13.92 ? 74   SER C CA  1 
ATOM   7850  C  C   . SER C 1 77  ? 111.969 142.899 64.857  1.00 13.98 ? 74   SER C C   1 
ATOM   7851  O  O   . SER C 1 77  ? 110.838 143.069 65.299  1.00 15.62 ? 74   SER C O   1 
ATOM   7852  C  CB  . SER C 1 77  ? 113.076 141.043 66.031  1.00 13.78 ? 74   SER C CB  1 
ATOM   7853  O  OG  . SER C 1 77  ? 114.054 140.598 66.949  1.00 15.14 ? 74   SER C OG  1 
ATOM   7854  N  N   . ASP C 1 78  ? 112.253 142.977 63.563  1.00 14.02 ? 75   ASP C N   1 
ATOM   7855  C  CA  . ASP C 1 78  ? 111.211 143.178 62.563  1.00 14.17 ? 75   ASP C CA  1 
ATOM   7856  C  C   . ASP C 1 78  ? 110.653 141.801 62.207  1.00 14.51 ? 75   ASP C C   1 
ATOM   7857  O  O   . ASP C 1 78  ? 109.518 141.668 61.736  1.00 14.80 ? 75   ASP C O   1 
ATOM   7858  C  CB  . ASP C 1 78  ? 111.793 143.794 61.294  1.00 13.63 ? 75   ASP C CB  1 
ATOM   7859  C  CG  . ASP C 1 78  ? 112.343 145.168 61.517  1.00 16.61 ? 75   ASP C CG  1 
ATOM   7860  O  OD1 . ASP C 1 78  ? 111.601 146.011 62.050  1.00 17.63 ? 75   ASP C OD1 1 
ATOM   7861  O  OD2 . ASP C 1 78  ? 113.509 145.415 61.127  1.00 18.09 ? 75   ASP C OD2 1 
ATOM   7862  N  N   . ILE C 1 79  ? 111.472 140.773 62.427  1.00 15.07 ? 76   ILE C N   1 
ATOM   7863  C  CA  . ILE C 1 79  ? 111.100 139.410 62.073  1.00 14.86 ? 76   ILE C CA  1 
ATOM   7864  C  C   . ILE C 1 79  ? 111.577 138.348 63.042  1.00 14.87 ? 76   ILE C C   1 
ATOM   7865  O  O   . ILE C 1 79  ? 112.691 138.435 63.562  1.00 13.49 ? 76   ILE C O   1 
ATOM   7866  C  CB  . ILE C 1 79  ? 111.762 139.033 60.726  1.00 14.79 ? 76   ILE C CB  1 
ATOM   7867  C  CG1 . ILE C 1 79  ? 111.393 140.053 59.641  1.00 17.33 ? 76   ILE C CG1 1 
ATOM   7868  C  CG2 . ILE C 1 79  ? 111.376 137.597 60.320  1.00 18.43 ? 76   ILE C CG2 1 
ATOM   7869  C  CD1 . ILE C 1 79  ? 112.009 139.784 58.293  1.00 12.92 ? 76   ILE C CD1 1 
ATOM   7870  N  N   . LEU C 1 80  ? 110.724 137.348 63.288  1.00 14.25 ? 77   LEU C N   1 
ATOM   7871  C  CA  . LEU C 1 80  ? 111.104 136.187 64.087  1.00 14.33 ? 77   LEU C CA  1 
ATOM   7872  C  C   . LEU C 1 80  ? 111.153 135.049 63.103  1.00 14.60 ? 77   LEU C C   1 
ATOM   7873  O  O   . LEU C 1 80  ? 110.169 134.788 62.393  1.00 15.08 ? 77   LEU C O   1 
ATOM   7874  C  CB  . LEU C 1 80  ? 110.096 135.845 65.191  1.00 14.78 ? 77   LEU C CB  1 
ATOM   7875  C  CG  . LEU C 1 80  ? 110.378 134.522 65.918  1.00 16.80 ? 77   LEU C CG  1 
ATOM   7876  C  CD1 . LEU C 1 80  ? 111.746 134.578 66.709  1.00 13.84 ? 77   LEU C CD1 1 
ATOM   7877  C  CD2 . LEU C 1 80  ? 109.219 134.159 66.844  1.00 17.11 ? 77   LEU C CD2 1 
ATOM   7878  N  N   . LEU C 1 81  ? 112.301 134.396 63.023  1.00 13.92 ? 78   LEU C N   1 
ATOM   7879  C  CA  . LEU C 1 81  ? 112.477 133.244 62.150  1.00 14.16 ? 78   LEU C CA  1 
ATOM   7880  C  C   . LEU C 1 81  ? 112.404 131.997 63.026  1.00 14.07 ? 78   LEU C C   1 
ATOM   7881  O  O   . LEU C 1 81  ? 113.219 131.830 63.949  1.00 13.65 ? 78   LEU C O   1 
ATOM   7882  C  CB  . LEU C 1 81  ? 113.826 133.340 61.451  1.00 13.84 ? 78   LEU C CB  1 
ATOM   7883  C  CG  . LEU C 1 81  ? 114.191 132.278 60.422  1.00 19.77 ? 78   LEU C CG  1 
ATOM   7884  C  CD1 . LEU C 1 81  ? 113.136 132.234 59.287  1.00 19.48 ? 78   LEU C CD1 1 
ATOM   7885  C  CD2 . LEU C 1 81  ? 115.592 132.563 59.884  1.00 20.86 ? 78   LEU C CD2 1 
ATOM   7886  N  N   . VAL C 1 82  ? 111.400 131.151 62.783  1.00 12.83 ? 79   VAL C N   1 
ATOM   7887  C  CA  . VAL C 1 82  ? 111.237 129.916 63.542  1.00 12.90 ? 79   VAL C CA  1 
ATOM   7888  C  C   . VAL C 1 82  ? 111.853 128.774 62.730  1.00 13.43 ? 79   VAL C C   1 
ATOM   7889  O  O   . VAL C 1 82  ? 111.485 128.541 61.582  1.00 14.00 ? 79   VAL C O   1 
ATOM   7890  C  CB  . VAL C 1 82  ? 109.747 129.614 63.835  1.00 13.65 ? 79   VAL C CB  1 
ATOM   7891  C  CG1 . VAL C 1 82  ? 109.592 128.277 64.573  1.00 13.44 ? 79   VAL C CG1 1 
ATOM   7892  C  CG2 . VAL C 1 82  ? 109.106 130.763 64.610  1.00 11.65 ? 79   VAL C CG2 1 
ATOM   7893  N  N   . VAL C 1 83  ? 112.801 128.074 63.329  1.00 13.95 ? 80   VAL C N   1 
ATOM   7894  C  CA  . VAL C 1 83  ? 113.487 126.987 62.670  1.00 12.68 ? 80   VAL C CA  1 
ATOM   7895  C  C   . VAL C 1 83  ? 112.991 125.691 63.290  1.00 12.69 ? 80   VAL C C   1 
ATOM   7896  O  O   . VAL C 1 83  ? 113.285 125.380 64.450  1.00 13.57 ? 80   VAL C O   1 
ATOM   7897  C  CB  . VAL C 1 83  ? 115.001 127.104 62.850  1.00 13.55 ? 80   VAL C CB  1 
ATOM   7898  C  CG1 . VAL C 1 83  ? 115.728 125.993 62.076  1.00 12.62 ? 80   VAL C CG1 1 
ATOM   7899  C  CG2 . VAL C 1 83  ? 115.492 128.493 62.405  1.00 12.16 ? 80   VAL C CG2 1 
ATOM   7900  N  N   . GLY C 1 84  ? 112.216 124.937 62.532  1.00 12.46 ? 81   GLY C N   1 
ATOM   7901  C  CA  . GLY C 1 84  ? 111.671 123.699 63.047  1.00 13.47 ? 81   GLY C CA  1 
ATOM   7902  C  C   . GLY C 1 84  ? 110.832 122.985 62.030  1.00 12.53 ? 81   GLY C C   1 
ATOM   7903  O  O   . GLY C 1 84  ? 110.492 123.568 60.994  1.00 13.08 ? 81   GLY C O   1 
ATOM   7904  N  N   . ILE C 1 85  ? 110.443 121.750 62.364  1.00 13.76 ? 82   ILE C N   1 
ATOM   7905  C  CA  . ILE C 1 85  ? 109.659 120.897 61.466  1.00 12.93 ? 82   ILE C CA  1 
ATOM   7906  C  C   . ILE C 1 85  ? 108.699 120.026 62.282  1.00 14.13 ? 82   ILE C C   1 
ATOM   7907  O  O   . ILE C 1 85  ? 108.902 119.842 63.474  1.00 13.16 ? 82   ILE C O   1 
ATOM   7908  C  CB  . ILE C 1 85  ? 110.615 120.021 60.616  1.00 14.09 ? 82   ILE C CB  1 
ATOM   7909  C  CG1 . ILE C 1 85  ? 109.929 119.459 59.360  1.00 13.75 ? 82   ILE C CG1 1 
ATOM   7910  C  CG2 . ILE C 1 85  ? 111.278 118.905 61.448  1.00 11.27 ? 82   ILE C CG2 1 
ATOM   7911  C  CD1 . ILE C 1 85  ? 110.926 118.842 58.409  1.00 12.46 ? 82   ILE C CD1 1 
ATOM   7912  N  N   . GLY C 1 86  ? 107.628 119.545 61.657  1.00 14.62 ? 83   GLY C N   1 
ATOM   7913  C  CA  . GLY C 1 86  ? 106.645 118.682 62.352  1.00 15.68 ? 83   GLY C CA  1 
ATOM   7914  C  C   . GLY C 1 86  ? 106.016 119.307 63.583  1.00 16.08 ? 83   GLY C C   1 
ATOM   7915  O  O   . GLY C 1 86  ? 105.454 120.386 63.512  1.00 16.65 ? 83   GLY C O   1 
ATOM   7916  N  N   . GLY C 1 87  ? 106.123 118.630 64.721  1.00 15.94 ? 84   GLY C N   1 
ATOM   7917  C  CA  . GLY C 1 87  ? 105.542 119.134 65.958  1.00 16.99 ? 84   GLY C CA  1 
ATOM   7918  C  C   . GLY C 1 87  ? 106.140 120.467 66.400  1.00 17.36 ? 84   GLY C C   1 
ATOM   7919  O  O   . GLY C 1 87  ? 105.496 121.228 67.131  1.00 18.02 ? 84   GLY C O   1 
ATOM   7920  N  N   . SER C 1 88  ? 107.362 120.754 65.945  1.00 15.75 ? 85   SER C N   1 
ATOM   7921  C  CA  . SER C 1 88  ? 108.044 122.004 66.289  1.00 15.89 ? 85   SER C CA  1 
ATOM   7922  C  C   . SER C 1 88  ? 107.715 123.141 65.335  1.00 16.43 ? 85   SER C C   1 
ATOM   7923  O  O   . SER C 1 88  ? 108.284 124.221 65.434  1.00 17.60 ? 85   SER C O   1 
ATOM   7924  C  CB  . SER C 1 88  ? 109.550 121.770 66.318  1.00 17.27 ? 85   SER C CB  1 
ATOM   7925  O  OG  . SER C 1 88  ? 109.855 120.822 67.325  1.00 17.69 ? 85   SER C OG  1 
ATOM   7926  N  N   . TYR C 1 89  ? 106.748 122.903 64.455  1.00 16.07 ? 86   TYR C N   1 
ATOM   7927  C  CA  . TYR C 1 89  ? 106.338 123.850 63.446  1.00 15.75 ? 86   TYR C CA  1 
ATOM   7928  C  C   . TYR C 1 89  ? 104.830 124.102 63.302  1.00 15.90 ? 86   TYR C C   1 
ATOM   7929  O  O   . TYR C 1 89  ? 104.381 125.264 63.377  1.00 14.94 ? 86   TYR C O   1 
ATOM   7930  C  CB  . TYR C 1 89  ? 106.912 123.333 62.119  1.00 16.29 ? 86   TYR C CB  1 
ATOM   7931  C  CG  . TYR C 1 89  ? 106.364 123.908 60.847  1.00 16.07 ? 86   TYR C CG  1 
ATOM   7932  C  CD1 . TYR C 1 89  ? 106.477 125.265 60.562  1.00 19.86 ? 86   TYR C CD1 1 
ATOM   7933  C  CD2 . TYR C 1 89  ? 105.857 123.074 59.859  1.00 15.62 ? 86   TYR C CD2 1 
ATOM   7934  C  CE1 . TYR C 1 89  ? 106.014 125.781 59.372  1.00 18.09 ? 86   TYR C CE1 1 
ATOM   7935  C  CE2 . TYR C 1 89  ? 105.385 123.580 58.663  1.00 18.62 ? 86   TYR C CE2 1 
ATOM   7936  C  CZ  . TYR C 1 89  ? 105.470 124.938 58.425  1.00 19.91 ? 86   TYR C CZ  1 
ATOM   7937  O  OH  . TYR C 1 89  ? 105.031 125.458 57.233  1.00 18.78 ? 86   TYR C OH  1 
ATOM   7938  N  N   . LEU C 1 90  ? 104.055 123.026 63.134  1.00 14.43 ? 87   LEU C N   1 
ATOM   7939  C  CA  . LEU C 1 90  ? 102.588 123.130 62.843  1.00 14.50 ? 87   LEU C CA  1 
ATOM   7940  C  C   . LEU C 1 90  ? 101.684 123.745 63.897  1.00 13.72 ? 87   LEU C C   1 
ATOM   7941  O  O   . LEU C 1 90  ? 100.763 124.469 63.554  1.00 15.39 ? 87   LEU C O   1 
ATOM   7942  C  CB  . LEU C 1 90  ? 102.024 121.760 62.453  1.00 13.17 ? 87   LEU C CB  1 
ATOM   7943  C  CG  . LEU C 1 90  ? 102.602 121.113 61.179  1.00 15.40 ? 87   LEU C CG  1 
ATOM   7944  C  CD1 . LEU C 1 90  ? 102.007 119.683 60.956  1.00 14.25 ? 87   LEU C CD1 1 
ATOM   7945  C  CD2 . LEU C 1 90  ? 102.332 122.011 59.959  1.00 14.46 ? 87   LEU C CD2 1 
ATOM   7946  N  N   . GLY C 1 91  ? 101.920 123.441 65.171  1.00 14.33 ? 88   GLY C N   1 
ATOM   7947  C  CA  . GLY C 1 91  ? 101.110 123.995 66.254  1.00 14.22 ? 88   GLY C CA  1 
ATOM   7948  C  C   . GLY C 1 91  ? 101.215 125.504 66.335  1.00 14.97 ? 88   GLY C C   1 
ATOM   7949  O  O   . GLY C 1 91  ? 100.199 126.214 66.446  1.00 15.81 ? 88   GLY C O   1 
ATOM   7950  N  N   . ALA C 1 92  ? 102.444 126.007 66.300  1.00 14.95 ? 89   ALA C N   1 
ATOM   7951  C  CA  . ALA C 1 92  ? 102.679 127.459 66.330  1.00 14.08 ? 89   ALA C CA  1 
ATOM   7952  C  C   . ALA C 1 92  ? 102.073 128.101 65.091  1.00 14.35 ? 89   ALA C C   1 
ATOM   7953  O  O   . ALA C 1 92  ? 101.397 129.131 65.182  1.00 15.83 ? 89   ALA C O   1 
ATOM   7954  C  CB  . ALA C 1 92  ? 104.186 127.779 66.406  1.00 13.13 ? 89   ALA C CB  1 
ATOM   7955  N  N   . ARG C 1 93  ? 102.317 127.524 63.921  1.00 15.69 ? 90   ARG C N   1 
ATOM   7956  C  CA  . ARG C 1 93  ? 101.761 128.132 62.691  1.00 15.81 ? 90   ARG C CA  1 
ATOM   7957  C  C   . ARG C 1 93  ? 100.241 128.140 62.686  1.00 14.81 ? 90   ARG C C   1 
ATOM   7958  O  O   . ARG C 1 93  ? 99.624  129.113 62.258  1.00 14.89 ? 90   ARG C O   1 
ATOM   7959  C  CB  . ARG C 1 93  ? 102.311 127.477 61.429  1.00 16.25 ? 90   ARG C CB  1 
ATOM   7960  C  CG  . ARG C 1 93  ? 101.897 128.210 60.196  1.00 18.91 ? 90   ARG C CG  1 
ATOM   7961  C  CD  . ARG C 1 93  ? 102.802 127.922 59.034  1.00 24.05 ? 90   ARG C CD  1 
ATOM   7962  N  NE  . ARG C 1 93  ? 102.463 128.782 57.901  1.00 25.59 ? 90   ARG C NE  1 
ATOM   7963  C  CZ  . ARG C 1 93  ? 103.175 128.865 56.785  1.00 28.91 ? 90   ARG C CZ  1 
ATOM   7964  N  NH1 . ARG C 1 93  ? 104.289 128.149 56.643  1.00 28.14 ? 90   ARG C NH1 1 
ATOM   7965  N  NH2 . ARG C 1 93  ? 102.779 129.680 55.812  1.00 33.14 ? 90   ARG C NH2 1 
ATOM   7966  N  N   . ALA C 1 94  ? 99.642  127.057 63.171  1.00 14.21 ? 91   ALA C N   1 
ATOM   7967  C  CA  . ALA C 1 94  ? 98.192  126.954 63.243  1.00 14.09 ? 91   ALA C CA  1 
ATOM   7968  C  C   . ALA C 1 94  ? 97.610  128.080 64.121  1.00 14.74 ? 91   ALA C C   1 
ATOM   7969  O  O   . ALA C 1 94  ? 96.665  128.773 63.728  1.00 14.47 ? 91   ALA C O   1 
ATOM   7970  C  CB  . ALA C 1 94  ? 97.780  125.545 63.781  1.00 13.39 ? 91   ALA C CB  1 
ATOM   7971  N  N   . ALA C 1 95  ? 98.205  128.296 65.293  1.00 14.28 ? 92   ALA C N   1 
ATOM   7972  C  CA  . ALA C 1 95  ? 97.708  129.328 66.206  1.00 14.13 ? 92   ALA C CA  1 
ATOM   7973  C  C   . ALA C 1 95  ? 97.899  130.730 65.662  1.00 13.63 ? 92   ALA C C   1 
ATOM   7974  O  O   . ALA C 1 95  ? 96.995  131.575 65.719  1.00 12.70 ? 92   ALA C O   1 
ATOM   7975  C  CB  . ALA C 1 95  ? 98.391  129.202 67.564  1.00 14.57 ? 92   ALA C CB  1 
ATOM   7976  N  N   . ILE C 1 96  ? 99.091  130.981 65.153  1.00 14.56 ? 93   ILE C N   1 
ATOM   7977  C  CA  . ILE C 1 96  ? 99.448  132.303 64.630  1.00 14.92 ? 93   ILE C CA  1 
ATOM   7978  C  C   . ILE C 1 96  ? 98.546  132.676 63.481  1.00 15.28 ? 93   ILE C C   1 
ATOM   7979  O  O   . ILE C 1 96  ? 98.006  133.784 63.449  1.00 16.31 ? 93   ILE C O   1 
ATOM   7980  C  CB  . ILE C 1 96  ? 100.931 132.358 64.224  1.00 13.13 ? 93   ILE C CB  1 
ATOM   7981  C  CG1 . ILE C 1 96  ? 101.785 132.270 65.496  1.00 14.18 ? 93   ILE C CG1 1 
ATOM   7982  C  CG2 . ILE C 1 96  ? 101.248 133.672 63.461  1.00 14.35 ? 93   ILE C CG2 1 
ATOM   7983  C  CD1 . ILE C 1 96  ? 103.268 132.021 65.266  1.00 13.00 ? 93   ILE C CD1 1 
ATOM   7984  N  N   . GLU C 1 97  ? 98.335  131.752 62.554  1.00 15.38 ? 94   GLU C N   1 
ATOM   7985  C  CA  . GLU C 1 97  ? 97.469  132.063 61.426  1.00 16.69 ? 94   GLU C CA  1 
ATOM   7986  C  C   . GLU C 1 97  ? 95.988  132.126 61.786  1.00 15.69 ? 94   GLU C C   1 
ATOM   7987  O  O   . GLU C 1 97  ? 95.269  132.967 61.268  1.00 17.79 ? 94   GLU C O   1 
ATOM   7988  C  CB  . GLU C 1 97  ? 97.705  131.114 60.268  1.00 17.34 ? 94   GLU C CB  1 
ATOM   7989  C  CG  . GLU C 1 97  ? 99.079  131.347 59.638  1.00 20.04 ? 94   GLU C CG  1 
ATOM   7990  C  CD  . GLU C 1 97  ? 99.194  130.749 58.259  1.00 25.83 ? 94   GLU C CD  1 
ATOM   7991  O  OE1 . GLU C 1 97  ? 98.141  130.374 57.677  1.00 28.67 ? 94   GLU C OE1 1 
ATOM   7992  O  OE2 . GLU C 1 97  ? 100.331 130.684 57.740  1.00 27.09 ? 94   GLU C OE2 1 
HETATM 7993  N  N   . MSE C 1 98  ? 95.531  131.272 62.684  1.00 15.50 ? 95   MSE C N   1 
HETATM 7994  C  CA  . MSE C 1 98  ? 94.116  131.283 63.048  1.00 15.33 ? 95   MSE C CA  1 
HETATM 7995  C  C   . MSE C 1 98  ? 93.687  132.520 63.794  1.00 15.37 ? 95   MSE C C   1 
HETATM 7996  O  O   . MSE C 1 98  ? 92.573  132.995 63.611  1.00 15.63 ? 95   MSE C O   1 
HETATM 7997  C  CB  . MSE C 1 98  ? 93.770  130.096 63.946  1.00 16.17 ? 95   MSE C CB  1 
HETATM 7998  C  CG  . MSE C 1 98  ? 92.364  130.194 64.556  1.00 18.02 ? 95   MSE C CG  1 
HETATM 7999  SE SE  . MSE C 1 98  ? 91.975  128.840 65.902  1.00 29.85 ? 95   MSE C SE  1 
HETATM 8000  C  CE  . MSE C 1 98  ? 92.468  127.370 64.793  1.00 10.44 ? 95   MSE C CE  1 
ATOM   8001  N  N   . LEU C 1 99  ? 94.570  133.045 64.639  1.00 15.42 ? 96   LEU C N   1 
ATOM   8002  C  CA  . LEU C 1 99  ? 94.206  134.146 65.510  1.00 16.02 ? 96   LEU C CA  1 
ATOM   8003  C  C   . LEU C 1 99  ? 94.723  135.525 65.137  1.00 16.85 ? 96   LEU C C   1 
ATOM   8004  O  O   . LEU C 1 99  ? 94.393  136.495 65.817  1.00 17.45 ? 96   LEU C O   1 
ATOM   8005  C  CB  . LEU C 1 99  ? 94.641  133.800 66.927  1.00 15.43 ? 96   LEU C CB  1 
ATOM   8006  C  CG  . LEU C 1 99  ? 94.113  132.451 67.403  1.00 16.49 ? 96   LEU C CG  1 
ATOM   8007  C  CD1 . LEU C 1 99  ? 94.753  132.102 68.748  1.00 16.69 ? 96   LEU C CD1 1 
ATOM   8008  C  CD2 . LEU C 1 99  ? 92.583  132.423 67.468  1.00 13.40 ? 96   LEU C CD2 1 
ATOM   8009  N  N   . ASN C 1 100 ? 95.507  135.622 64.065  1.00 16.08 ? 97   ASN C N   1 
ATOM   8010  C  CA  . ASN C 1 100 ? 96.018  136.908 63.599  1.00 15.52 ? 97   ASN C CA  1 
ATOM   8011  C  C   . ASN C 1 100 ? 95.371  137.352 62.278  1.00 14.98 ? 97   ASN C C   1 
ATOM   8012  O  O   . ASN C 1 100 ? 94.644  136.604 61.635  1.00 14.61 ? 97   ASN C O   1 
ATOM   8013  C  CB  . ASN C 1 100 ? 97.549  136.864 63.454  1.00 14.98 ? 97   ASN C CB  1 
ATOM   8014  C  CG  . ASN C 1 100 ? 98.272  136.951 64.793  1.00 14.63 ? 97   ASN C CG  1 
ATOM   8015  O  OD1 . ASN C 1 100 ? 98.893  135.985 65.241  1.00 16.88 ? 97   ASN C OD1 1 
ATOM   8016  N  ND2 . ASN C 1 100 ? 98.143  138.090 65.457  1.00 10.06 ? 97   ASN C ND2 1 
ATOM   8017  N  N   . HIS C 1 101 ? 95.656  138.593 61.899  1.00 14.05 ? 98   HIS C N   1 
ATOM   8018  C  CA  . HIS C 1 101 ? 95.163  139.178 60.674  1.00 13.01 ? 98   HIS C CA  1 
ATOM   8019  C  C   . HIS C 1 101 ? 95.450  138.212 59.515  1.00 12.91 ? 98   HIS C C   1 
ATOM   8020  O  O   . HIS C 1 101 ? 96.506  137.570 59.474  1.00 12.37 ? 98   HIS C O   1 
ATOM   8021  C  CB  . HIS C 1 101 ? 95.868  140.520 60.476  1.00 13.38 ? 98   HIS C CB  1 
ATOM   8022  C  CG  . HIS C 1 101 ? 95.306  141.373 59.384  1.00 11.08 ? 98   HIS C CG  1 
ATOM   8023  N  ND1 . HIS C 1 101 ? 95.579  141.153 58.053  1.00 7.69  ? 98   HIS C ND1 1 
ATOM   8024  C  CD2 . HIS C 1 101 ? 94.579  142.516 59.434  1.00 10.31 ? 98   HIS C CD2 1 
ATOM   8025  C  CE1 . HIS C 1 101 ? 95.003  142.094 57.327  1.00 8.66  ? 98   HIS C CE1 1 
ATOM   8026  N  NE2 . HIS C 1 101 ? 94.381  142.928 58.140  1.00 6.80  ? 98   HIS C NE2 1 
ATOM   8027  N  N   . SER C 1 102 ? 94.510  138.116 58.579  1.00 12.15 ? 99   SER C N   1 
ATOM   8028  C  CA  . SER C 1 102 ? 94.615  137.192 57.435  1.00 13.23 ? 99   SER C CA  1 
ATOM   8029  C  C   . SER C 1 102 ? 95.821  137.453 56.535  1.00 13.49 ? 99   SER C C   1 
ATOM   8030  O  O   . SER C 1 102 ? 96.274  136.555 55.829  1.00 10.84 ? 99   SER C O   1 
ATOM   8031  C  CB  . SER C 1 102 ? 93.348  137.262 56.586  1.00 12.57 ? 99   SER C CB  1 
ATOM   8032  O  OG  . SER C 1 102 ? 92.183  137.036 57.359  1.00 13.58 ? 99   SER C OG  1 
ATOM   8033  N  N   . PHE C 1 103 ? 96.313  138.691 56.548  1.00 13.23 ? 100  PHE C N   1 
ATOM   8034  C  CA  . PHE C 1 103 ? 97.472  139.084 55.747  1.00 13.46 ? 100  PHE C CA  1 
ATOM   8035  C  C   . PHE C 1 103 ? 98.583  139.609 56.662  1.00 13.74 ? 100  PHE C C   1 
ATOM   8036  O  O   . PHE C 1 103 ? 99.327  140.519 56.310  1.00 14.16 ? 100  PHE C O   1 
ATOM   8037  C  CB  . PHE C 1 103 ? 97.046  140.122 54.706  1.00 12.73 ? 100  PHE C CB  1 
ATOM   8038  C  CG  . PHE C 1 103 ? 96.139  139.564 53.675  1.00 12.37 ? 100  PHE C CG  1 
ATOM   8039  C  CD1 . PHE C 1 103 ? 94.776  139.519 53.890  1.00 11.66 ? 100  PHE C CD1 1 
ATOM   8040  C  CD2 . PHE C 1 103 ? 96.653  139.006 52.518  1.00 15.16 ? 100  PHE C CD2 1 
ATOM   8041  C  CE1 . PHE C 1 103 ? 93.927  138.938 52.953  1.00 15.49 ? 100  PHE C CE1 1 
ATOM   8042  C  CE2 . PHE C 1 103 ? 95.820  138.440 51.574  1.00 16.19 ? 100  PHE C CE2 1 
ATOM   8043  C  CZ  . PHE C 1 103 ? 94.450  138.408 51.790  1.00 15.05 ? 100  PHE C CZ  1 
ATOM   8044  N  N   . TYR C 1 104 ? 98.687  138.990 57.834  1.00 14.41 ? 101  TYR C N   1 
ATOM   8045  C  CA  . TYR C 1 104 ? 99.657  139.365 58.873  1.00 14.62 ? 101  TYR C CA  1 
ATOM   8046  C  C   . TYR C 1 104 ? 101.049 139.774 58.367  1.00 16.48 ? 101  TYR C C   1 
ATOM   8047  O  O   . TYR C 1 104 ? 101.501 140.898 58.629  1.00 15.33 ? 101  TYR C O   1 
ATOM   8048  C  CB  . TYR C 1 104 ? 99.774  138.212 59.871  1.00 15.64 ? 101  TYR C CB  1 
ATOM   8049  C  CG  . TYR C 1 104 ? 100.647 138.487 61.062  1.00 13.68 ? 101  TYR C CG  1 
ATOM   8050  C  CD1 . TYR C 1 104 ? 100.160 139.183 62.160  1.00 11.97 ? 101  TYR C CD1 1 
ATOM   8051  C  CD2 . TYR C 1 104 ? 101.944 138.011 61.110  1.00 15.19 ? 101  TYR C CD2 1 
ATOM   8052  C  CE1 . TYR C 1 104 ? 100.949 139.425 63.264  1.00 13.87 ? 101  TYR C CE1 1 
ATOM   8053  C  CE2 . TYR C 1 104 ? 102.740 138.232 62.211  1.00 16.01 ? 101  TYR C CE2 1 
ATOM   8054  C  CZ  . TYR C 1 104 ? 102.248 138.942 63.284  1.00 17.63 ? 101  TYR C CZ  1 
ATOM   8055  O  OH  . TYR C 1 104 ? 103.063 139.151 64.377  1.00 16.87 ? 101  TYR C OH  1 
ATOM   8056  N  N   . ASN C 1 105 ? 101.733 138.874 57.660  1.00 17.02 ? 102  ASN C N   1 
ATOM   8057  C  CA  . ASN C 1 105 ? 103.090 139.167 57.146  1.00 17.85 ? 102  ASN C CA  1 
ATOM   8058  C  C   . ASN C 1 105 ? 103.176 140.176 56.001  1.00 18.73 ? 102  ASN C C   1 
ATOM   8059  O  O   . ASN C 1 105 ? 104.243 140.729 55.744  1.00 18.81 ? 102  ASN C O   1 
ATOM   8060  C  CB  . ASN C 1 105 ? 103.813 137.876 56.740  1.00 18.10 ? 102  ASN C CB  1 
ATOM   8061  C  CG  . ASN C 1 105 ? 104.327 137.094 57.934  1.00 19.36 ? 102  ASN C CG  1 
ATOM   8062  O  OD1 . ASN C 1 105 ? 104.654 137.668 58.981  1.00 20.85 ? 102  ASN C OD1 1 
ATOM   8063  N  ND2 . ASN C 1 105 ? 104.440 135.788 57.775  1.00 22.70 ? 102  ASN C ND2 1 
ATOM   8064  N  N   . THR C 1 106 ? 102.051 140.430 55.342  1.00 19.44 ? 103  THR C N   1 
ATOM   8065  C  CA  . THR C 1 106 ? 101.993 141.355 54.214  1.00 20.15 ? 103  THR C CA  1 
ATOM   8066  C  C   . THR C 1 106 ? 101.711 142.794 54.674  1.00 19.85 ? 103  THR C C   1 
ATOM   8067  O  O   . THR C 1 106 ? 102.035 143.743 53.965  1.00 20.46 ? 103  THR C O   1 
ATOM   8068  C  CB  . THR C 1 106 ? 100.907 140.899 53.204  1.00 19.93 ? 103  THR C CB  1 
ATOM   8069  O  OG1 . THR C 1 106 ? 101.097 139.516 52.905  1.00 23.45 ? 103  THR C OG1 1 
ATOM   8070  C  CG2 . THR C 1 106 ? 100.970 141.712 51.928  1.00 20.59 ? 103  THR C CG2 1 
ATOM   8071  N  N   . LEU C 1 107 ? 101.104 142.948 55.855  1.00 19.33 ? 104  LEU C N   1 
ATOM   8072  C  CA  . LEU C 1 107 ? 100.801 144.260 56.413  1.00 18.94 ? 104  LEU C CA  1 
ATOM   8073  C  C   . LEU C 1 107 ? 102.088 145.039 56.624  1.00 19.10 ? 104  LEU C C   1 
ATOM   8074  O  O   . LEU C 1 107 ? 103.158 144.446 56.679  1.00 18.25 ? 104  LEU C O   1 
ATOM   8075  C  CB  . LEU C 1 107 ? 100.111 144.121 57.774  1.00 19.51 ? 104  LEU C CB  1 
ATOM   8076  C  CG  . LEU C 1 107 ? 98.690  143.559 57.879  1.00 19.04 ? 104  LEU C CG  1 
ATOM   8077  C  CD1 . LEU C 1 107 ? 98.322  143.337 59.353  1.00 15.52 ? 104  LEU C CD1 1 
ATOM   8078  C  CD2 . LEU C 1 107 ? 97.696  144.481 57.183  1.00 15.25 ? 104  LEU C CD2 1 
ATOM   8079  N  N   . SER C 1 108 ? 101.992 146.362 56.757  1.00 19.19 ? 105  SER C N   1 
ATOM   8080  C  CA  . SER C 1 108 ? 103.182 147.165 57.018  1.00 20.04 ? 105  SER C CA  1 
ATOM   8081  C  C   . SER C 1 108 ? 103.520 147.015 58.509  1.00 21.48 ? 105  SER C C   1 
ATOM   8082  O  O   . SER C 1 108 ? 102.690 146.567 59.294  1.00 19.98 ? 105  SER C O   1 
ATOM   8083  C  CB  . SER C 1 108 ? 102.954 148.641 56.681  1.00 20.33 ? 105  SER C CB  1 
ATOM   8084  O  OG  . SER C 1 108 ? 102.044 149.244 57.585  1.00 18.83 ? 105  SER C OG  1 
ATOM   8085  N  N   . LYS C 1 109 ? 104.731 147.397 58.901  1.00 23.13 ? 106  LYS C N   1 
ATOM   8086  C  CA  . LYS C 1 109 ? 105.135 147.298 60.303  1.00 24.92 ? 106  LYS C CA  1 
ATOM   8087  C  C   . LYS C 1 109 ? 104.164 148.042 61.203  1.00 24.44 ? 106  LYS C C   1 
ATOM   8088  O  O   . LYS C 1 109 ? 103.776 147.543 62.262  1.00 24.66 ? 106  LYS C O   1 
ATOM   8089  C  CB  . LYS C 1 109 ? 106.532 147.897 60.515  1.00 26.37 ? 106  LYS C CB  1 
ATOM   8090  C  CG  . LYS C 1 109 ? 107.645 147.215 59.746  1.00 29.60 ? 106  LYS C CG  1 
ATOM   8091  C  CD  . LYS C 1 109 ? 108.936 148.007 59.907  1.00 33.59 ? 106  LYS C CD  1 
ATOM   8092  C  CE  . LYS C 1 109 ? 110.081 147.419 59.101  1.00 36.39 ? 106  LYS C CE  1 
ATOM   8093  N  NZ  . LYS C 1 109 ? 111.327 148.248 59.255  1.00 38.75 ? 106  LYS C NZ  1 
ATOM   8094  N  N   A GLU C 1 110 ? 103.772 149.241 60.795  0.50 24.65 ? 107  GLU C N   1 
ATOM   8095  N  N   B GLU C 1 110 ? 103.779 149.232 60.754  0.50 24.46 ? 107  GLU C N   1 
ATOM   8096  C  CA  A GLU C 1 110 ? 102.858 150.049 61.602  0.50 24.92 ? 107  GLU C CA  1 
ATOM   8097  C  CA  B GLU C 1 110 ? 102.852 150.103 61.472  0.50 24.61 ? 107  GLU C CA  1 
ATOM   8098  C  C   A GLU C 1 110 ? 101.472 149.415 61.720  0.50 24.54 ? 107  GLU C C   1 
ATOM   8099  C  C   B GLU C 1 110 ? 101.508 149.420 61.699  0.50 24.38 ? 107  GLU C C   1 
ATOM   8100  O  O   A GLU C 1 110 ? 100.846 149.485 62.780  0.50 24.38 ? 107  GLU C O   1 
ATOM   8101  O  O   B GLU C 1 110 ? 100.956 149.450 62.802  0.50 24.30 ? 107  GLU C O   1 
ATOM   8102  C  CB  A GLU C 1 110 ? 102.785 151.475 61.064  0.50 25.27 ? 107  GLU C CB  1 
ATOM   8103  C  CB  B GLU C 1 110 ? 102.638 151.385 60.663  0.50 24.78 ? 107  GLU C CB  1 
ATOM   8104  C  CG  A GLU C 1 110 ? 104.127 152.184 61.134  0.50 26.43 ? 107  GLU C CG  1 
ATOM   8105  C  CG  B GLU C 1 110 ? 101.729 152.412 61.325  0.50 25.20 ? 107  GLU C CG  1 
ATOM   8106  C  CD  A GLU C 1 110 ? 104.066 153.616 60.656  0.50 28.84 ? 107  GLU C CD  1 
ATOM   8107  C  CD  B GLU C 1 110 ? 102.305 152.941 62.616  0.50 26.40 ? 107  GLU C CD  1 
ATOM   8108  O  OE1 A GLU C 1 110 ? 102.952 154.168 60.547  0.50 30.01 ? 107  GLU C OE1 1 
ATOM   8109  O  OE1 B GLU C 1 110 ? 103.473 152.614 62.916  0.50 27.54 ? 107  GLU C OE1 1 
ATOM   8110  O  OE2 A GLU C 1 110 ? 105.142 154.197 60.407  0.50 31.49 ? 107  GLU C OE2 1 
ATOM   8111  O  OE2 B GLU C 1 110 ? 101.597 153.683 63.329  0.50 28.39 ? 107  GLU C OE2 1 
ATOM   8112  N  N   . GLN C 1 111 ? 100.990 148.798 60.644  1.00 23.85 ? 108  GLN C N   1 
ATOM   8113  C  CA  . GLN C 1 111 ? 99.710  148.113 60.704  1.00 22.68 ? 108  GLN C CA  1 
ATOM   8114  C  C   . GLN C 1 111 ? 99.801  146.871 61.599  1.00 21.87 ? 108  GLN C C   1 
ATOM   8115  O  O   . GLN C 1 111 ? 98.948  146.655 62.461  1.00 21.73 ? 108  GLN C O   1 
ATOM   8116  C  CB  . GLN C 1 111 ? 99.257  147.672 59.308  1.00 22.31 ? 108  GLN C CB  1 
ATOM   8117  C  CG  . GLN C 1 111 ? 98.843  148.784 58.370  1.00 22.02 ? 108  GLN C CG  1 
ATOM   8118  C  CD  . GLN C 1 111 ? 98.535  148.270 56.972  1.00 21.86 ? 108  GLN C CD  1 
ATOM   8119  O  OE1 . GLN C 1 111 ? 99.301  147.489 56.393  1.00 18.19 ? 108  GLN C OE1 1 
ATOM   8120  N  NE2 . GLN C 1 111 ? 97.428  148.730 56.411  1.00 19.06 ? 108  GLN C NE2 1 
ATOM   8121  N  N   . ARG C 1 112 ? 100.847 146.070 61.410  1.00 21.01 ? 109  ARG C N   1 
ATOM   8122  C  CA  . ARG C 1 112 ? 100.994 144.803 62.151  1.00 20.64 ? 109  ARG C CA  1 
ATOM   8123  C  C   . ARG C 1 112 ? 101.342 144.976 63.643  1.00 21.39 ? 109  ARG C C   1 
ATOM   8124  O  O   . ARG C 1 112 ? 100.794 144.255 64.487  1.00 21.53 ? 109  ARG C O   1 
ATOM   8125  C  CB  . ARG C 1 112 ? 102.010 143.901 61.439  1.00 20.73 ? 109  ARG C CB  1 
ATOM   8126  C  CG  . ARG C 1 112 ? 102.247 142.536 62.084  1.00 19.63 ? 109  ARG C CG  1 
ATOM   8127  C  CD  . ARG C 1 112 ? 103.282 141.711 61.320  1.00 18.59 ? 109  ARG C CD  1 
ATOM   8128  N  NE  . ARG C 1 112 ? 104.422 142.535 60.959  1.00 19.24 ? 109  ARG C NE  1 
ATOM   8129  C  CZ  . ARG C 1 112 ? 104.647 143.030 59.746  1.00 19.64 ? 109  ARG C CZ  1 
ATOM   8130  N  NH1 . ARG C 1 112 ? 103.864 142.701 58.723  1.00 19.98 ? 109  ARG C NH1 1 
ATOM   8131  N  NH2 . ARG C 1 112 ? 105.693 143.827 59.542  1.00 16.20 ? 109  ARG C NH2 1 
ATOM   8132  N  N   . LYS C 1 113 ? 102.248 145.909 63.956  1.00 19.61 ? 110  LYS C N   1 
ATOM   8133  C  CA  . LYS C 1 113 ? 102.648 146.204 65.347  1.00 20.07 ? 110  LYS C CA  1 
ATOM   8134  C  C   . LYS C 1 113 ? 103.610 145.192 65.973  1.00 18.85 ? 110  LYS C C   1 
ATOM   8135  O  O   . LYS C 1 113 ? 104.425 145.544 66.822  1.00 19.48 ? 110  LYS C O   1 
ATOM   8136  C  CB  . LYS C 1 113 ? 101.419 146.320 66.263  1.00 21.27 ? 110  LYS C CB  1 
ATOM   8137  C  CG  . LYS C 1 113 ? 100.366 147.343 65.824  1.00 25.35 ? 110  LYS C CG  1 
ATOM   8138  C  CD  . LYS C 1 113 ? 99.118  147.254 66.729  1.00 31.03 ? 110  LYS C CD  1 
ATOM   8139  C  CE  . LYS C 1 113 ? 97.987  148.224 66.317  1.00 32.67 ? 110  LYS C CE  1 
ATOM   8140  N  NZ  . LYS C 1 113 ? 97.391  147.952 64.962  1.00 33.70 ? 110  LYS C NZ  1 
ATOM   8141  N  N   . THR C 1 114 ? 103.471 143.933 65.607  1.00 16.91 ? 111  THR C N   1 
ATOM   8142  C  CA  . THR C 1 114 ? 104.331 142.884 66.117  1.00 16.59 ? 111  THR C CA  1 
ATOM   8143  C  C   . THR C 1 114 ? 105.237 142.381 64.979  1.00 15.72 ? 111  THR C C   1 
ATOM   8144  O  O   . THR C 1 114 ? 105.062 142.750 63.833  1.00 14.25 ? 111  THR C O   1 
ATOM   8145  C  CB  . THR C 1 114 ? 103.483 141.746 66.709  1.00 17.53 ? 111  THR C CB  1 
ATOM   8146  O  OG1 . THR C 1 114 ? 102.515 141.323 65.738  1.00 16.30 ? 111  THR C OG1 1 
ATOM   8147  C  CG2 . THR C 1 114 ? 102.751 142.216 67.964  1.00 14.75 ? 111  THR C CG2 1 
ATOM   8148  N  N   . PRO C 1 115 ? 106.212 141.526 65.295  1.00 16.19 ? 112  PRO C N   1 
ATOM   8149  C  CA  . PRO C 1 115 ? 107.090 141.076 64.220  1.00 15.97 ? 112  PRO C CA  1 
ATOM   8150  C  C   . PRO C 1 115 ? 106.456 140.102 63.244  1.00 16.14 ? 112  PRO C C   1 
ATOM   8151  O  O   . PRO C 1 115 ? 105.471 139.444 63.576  1.00 15.17 ? 112  PRO C O   1 
ATOM   8152  C  CB  . PRO C 1 115 ? 108.206 140.334 64.974  1.00 15.87 ? 112  PRO C CB  1 
ATOM   8153  C  CG  . PRO C 1 115 ? 108.131 140.852 66.375  1.00 16.36 ? 112  PRO C CG  1 
ATOM   8154  C  CD  . PRO C 1 115 ? 106.682 141.073 66.616  1.00 16.16 ? 112  PRO C CD  1 
ATOM   8155  N  N   . GLN C 1 116 ? 107.010 140.043 62.038  1.00 16.45 ? 113  GLN C N   1 
ATOM   8156  C  CA  . GLN C 1 116 ? 106.580 139.067 61.065  1.00 17.75 ? 113  GLN C CA  1 
ATOM   8157  C  C   . GLN C 1 116 ? 107.054 137.752 61.654  1.00 17.59 ? 113  GLN C C   1 
ATOM   8158  O  O   . GLN C 1 116 ? 108.018 137.738 62.416  1.00 17.42 ? 113  GLN C O   1 
ATOM   8159  C  CB  . GLN C 1 116 ? 107.265 139.285 59.708  1.00 17.39 ? 113  GLN C CB  1 
ATOM   8160  C  CG  . GLN C 1 116 ? 106.820 140.544 58.978  1.00 21.93 ? 113  GLN C CG  1 
ATOM   8161  C  CD  . GLN C 1 116 ? 107.602 140.814 57.696  1.00 27.62 ? 113  GLN C CD  1 
ATOM   8162  O  OE1 . GLN C 1 116 ? 108.824 140.933 57.714  1.00 30.62 ? 113  GLN C OE1 1 
ATOM   8163  N  NE2 . GLN C 1 116 ? 106.887 140.992 56.593  1.00 30.49 ? 113  GLN C NE2 1 
ATOM   8164  N  N   . VAL C 1 117 ? 106.369 136.659 61.357  1.00 17.09 ? 114  VAL C N   1 
ATOM   8165  C  CA  . VAL C 1 117 ? 106.828 135.361 61.830  1.00 16.58 ? 114  VAL C CA  1 
ATOM   8166  C  C   . VAL C 1 117 ? 106.979 134.478 60.602  1.00 16.78 ? 114  VAL C C   1 
ATOM   8167  O  O   . VAL C 1 117 ? 105.999 134.190 59.906  1.00 17.21 ? 114  VAL C O   1 
ATOM   8168  C  CB  . VAL C 1 117 ? 105.900 134.732 62.853  1.00 17.58 ? 114  VAL C CB  1 
ATOM   8169  C  CG1 . VAL C 1 117 ? 106.442 133.366 63.281  1.00 17.61 ? 114  VAL C CG1 1 
ATOM   8170  C  CG2 . VAL C 1 117 ? 105.762 135.632 64.062  1.00 15.55 ? 114  VAL C CG2 1 
ATOM   8171  N  N   . LEU C 1 118 ? 108.219 134.093 60.310  1.00 15.17 ? 115  LEU C N   1 
ATOM   8172  C  CA  . LEU C 1 118 ? 108.520 133.275 59.152  1.00 16.08 ? 115  LEU C CA  1 
ATOM   8173  C  C   . LEU C 1 118 ? 109.106 131.955 59.620  1.00 15.92 ? 115  LEU C C   1 
ATOM   8174  O  O   . LEU C 1 118 ? 109.699 131.877 60.697  1.00 16.64 ? 115  LEU C O   1 
ATOM   8175  C  CB  . LEU C 1 118 ? 109.491 134.011 58.221  1.00 16.17 ? 115  LEU C CB  1 
ATOM   8176  C  CG  . LEU C 1 118 ? 109.012 135.369 57.683  1.00 17.88 ? 115  LEU C CG  1 
ATOM   8177  C  CD1 . LEU C 1 118 ? 110.131 136.057 56.873  1.00 17.44 ? 115  LEU C CD1 1 
ATOM   8178  C  CD2 . LEU C 1 118 ? 107.742 135.241 56.846  1.00 17.56 ? 115  LEU C CD2 1 
ATOM   8179  N  N   . PHE C 1 119 ? 108.897 130.910 58.829  1.00 15.75 ? 116  PHE C N   1 
ATOM   8180  C  CA  . PHE C 1 119 ? 109.366 129.582 59.175  1.00 16.09 ? 116  PHE C CA  1 
ATOM   8181  C  C   . PHE C 1 119 ? 110.376 129.037 58.179  1.00 15.99 ? 116  PHE C C   1 
ATOM   8182  O  O   . PHE C 1 119 ? 110.238 129.233 56.973  1.00 15.38 ? 116  PHE C O   1 
ATOM   8183  C  CB  . PHE C 1 119 ? 108.171 128.639 59.223  1.00 16.20 ? 116  PHE C CB  1 
ATOM   8184  C  CG  . PHE C 1 119 ? 107.117 129.071 60.189  1.00 16.81 ? 116  PHE C CG  1 
ATOM   8185  C  CD1 . PHE C 1 119 ? 106.123 129.963 59.799  1.00 15.66 ? 116  PHE C CD1 1 
ATOM   8186  C  CD2 . PHE C 1 119 ? 107.118 128.594 61.487  1.00 15.87 ? 116  PHE C CD2 1 
ATOM   8187  C  CE1 . PHE C 1 119 ? 105.158 130.374 60.685  1.00 14.97 ? 116  PHE C CE1 1 
ATOM   8188  C  CE2 . PHE C 1 119 ? 106.146 128.989 62.381  1.00 17.70 ? 116  PHE C CE2 1 
ATOM   8189  C  CZ  . PHE C 1 119 ? 105.167 129.894 61.982  1.00 15.85 ? 116  PHE C CZ  1 
ATOM   8190  N  N   . VAL C 1 120 ? 111.383 128.333 58.693  1.00 15.09 ? 117  VAL C N   1 
ATOM   8191  C  CA  . VAL C 1 120 ? 112.360 127.708 57.839  1.00 14.44 ? 117  VAL C CA  1 
ATOM   8192  C  C   . VAL C 1 120 ? 112.775 126.423 58.564  1.00 15.04 ? 117  VAL C C   1 
ATOM   8193  O  O   . VAL C 1 120 ? 112.444 126.226 59.747  1.00 15.67 ? 117  VAL C O   1 
ATOM   8194  C  CB  . VAL C 1 120 ? 113.544 128.658 57.537  1.00 15.75 ? 117  VAL C CB  1 
ATOM   8195  C  CG1 . VAL C 1 120 ? 114.414 128.827 58.767  1.00 13.97 ? 117  VAL C CG1 1 
ATOM   8196  C  CG2 . VAL C 1 120 ? 114.350 128.157 56.319  1.00 13.60 ? 117  VAL C CG2 1 
ATOM   8197  N  N   . GLY C 1 121 ? 113.452 125.534 57.853  1.00 13.77 ? 118  GLY C N   1 
ATOM   8198  C  CA  . GLY C 1 121 ? 113.877 124.273 58.421  1.00 14.05 ? 118  GLY C CA  1 
ATOM   8199  C  C   . GLY C 1 121 ? 112.780 123.222 58.394  1.00 14.51 ? 118  GLY C C   1 
ATOM   8200  O  O   . GLY C 1 121 ? 112.964 122.127 58.948  1.00 15.15 ? 118  GLY C O   1 
ATOM   8201  N  N   . GLN C 1 122 ? 111.661 123.540 57.735  1.00 13.15 ? 119  GLN C N   1 
ATOM   8202  C  CA  . GLN C 1 122 ? 110.546 122.610 57.615  1.00 14.48 ? 119  GLN C CA  1 
ATOM   8203  C  C   . GLN C 1 122 ? 110.594 121.886 56.261  1.00 14.01 ? 119  GLN C C   1 
ATOM   8204  O  O   . GLN C 1 122 ? 109.729 121.072 55.959  1.00 15.10 ? 119  GLN C O   1 
ATOM   8205  C  CB  . GLN C 1 122 ? 109.182 123.290 57.815  1.00 14.48 ? 119  GLN C CB  1 
ATOM   8206  C  CG  . GLN C 1 122 ? 108.591 124.127 56.630  1.00 13.99 ? 119  GLN C CG  1 
ATOM   8207  C  CD  . GLN C 1 122 ? 109.244 125.459 56.419  1.00 16.34 ? 119  GLN C CD  1 
ATOM   8208  O  OE1 . GLN C 1 122 ? 110.436 125.633 56.661  1.00 18.00 ? 119  GLN C OE1 1 
ATOM   8209  N  NE2 . GLN C 1 122 ? 108.466 126.416 55.910  1.00 15.19 ? 119  GLN C NE2 1 
ATOM   8210  N  N   . ASN C 1 123 ? 111.622 122.187 55.464  1.00 13.38 ? 120  ASN C N   1 
ATOM   8211  C  CA  . ASN C 1 123 ? 111.811 121.570 54.161  1.00 13.08 ? 120  ASN C CA  1 
ATOM   8212  C  C   . ASN C 1 123 ? 113.308 121.550 53.855  1.00 13.07 ? 120  ASN C C   1 
ATOM   8213  O  O   . ASN C 1 123 ? 114.109 122.046 54.665  1.00 11.65 ? 120  ASN C O   1 
ATOM   8214  C  CB  . ASN C 1 123 ? 111.043 122.353 53.074  1.00 11.98 ? 120  ASN C CB  1 
ATOM   8215  C  CG  . ASN C 1 123 ? 111.546 123.779 52.900  1.00 14.75 ? 120  ASN C CG  1 
ATOM   8216  O  OD1 . ASN C 1 123 ? 112.749 124.018 52.805  1.00 16.72 ? 120  ASN C OD1 1 
ATOM   8217  N  ND2 . ASN C 1 123 ? 110.604 124.746 52.844  1.00 16.15 ? 120  ASN C ND2 1 
ATOM   8218  N  N   . ILE C 1 124 ? 113.687 120.966 52.722  1.00 10.89 ? 121  ILE C N   1 
ATOM   8219  C  CA  . ILE C 1 124 ? 115.104 120.951 52.310  1.00 12.22 ? 121  ILE C CA  1 
ATOM   8220  C  C   . ILE C 1 124 ? 115.187 121.643 50.936  1.00 12.91 ? 121  ILE C C   1 
ATOM   8221  O  O   . ILE C 1 124 ? 115.858 121.165 50.010  1.00 13.30 ? 121  ILE C O   1 
ATOM   8222  C  CB  . ILE C 1 124 ? 115.688 119.506 52.218  1.00 12.79 ? 121  ILE C CB  1 
ATOM   8223  C  CG1 . ILE C 1 124 ? 115.217 118.629 53.381  1.00 13.05 ? 121  ILE C CG1 1 
ATOM   8224  C  CG2 . ILE C 1 124 ? 117.208 119.556 52.154  1.00 9.07  ? 121  ILE C CG2 1 
ATOM   8225  C  CD1 . ILE C 1 124 ? 115.532 117.152 53.179  1.00 12.24 ? 121  ILE C CD1 1 
ATOM   8226  N  N   . SER C 1 125 ? 114.509 122.788 50.808  1.00 13.64 ? 122  SER C N   1 
ATOM   8227  C  CA  . SER C 1 125 ? 114.493 123.533 49.559  1.00 13.83 ? 122  SER C CA  1 
ATOM   8228  C  C   . SER C 1 125 ? 115.446 124.727 49.570  1.00 13.76 ? 122  SER C C   1 
ATOM   8229  O  O   . SER C 1 125 ? 115.230 125.707 50.284  1.00 12.39 ? 122  SER C O   1 
ATOM   8230  C  CB  . SER C 1 125 ? 113.066 124.012 49.244  1.00 14.37 ? 122  SER C CB  1 
ATOM   8231  O  OG  . SER C 1 125 ? 113.035 124.869 48.110  1.00 12.41 ? 122  SER C OG  1 
ATOM   8232  N  N   . SER C 1 126 ? 116.495 124.650 48.761  1.00 13.65 ? 123  SER C N   1 
ATOM   8233  C  CA  . SER C 1 126 ? 117.427 125.750 48.674  1.00 14.25 ? 123  SER C CA  1 
ATOM   8234  C  C   . SER C 1 126 ? 116.785 126.962 47.990  1.00 13.92 ? 123  SER C C   1 
ATOM   8235  O  O   . SER C 1 126 ? 117.191 128.090 48.245  1.00 13.89 ? 123  SER C O   1 
ATOM   8236  C  CB  . SER C 1 126 ? 118.732 125.326 48.004  1.00 14.05 ? 123  SER C CB  1 
ATOM   8237  O  OG  . SER C 1 126 ? 118.512 124.719 46.772  1.00 18.66 ? 123  SER C OG  1 
ATOM   8238  N  N   . THR C 1 127 ? 115.769 126.741 47.154  1.00 13.87 ? 124  THR C N   1 
ATOM   8239  C  CA  . THR C 1 127 ? 115.094 127.856 46.505  1.00 13.34 ? 124  THR C CA  1 
ATOM   8240  C  C   . THR C 1 127 ? 114.321 128.618 47.584  1.00 12.56 ? 124  THR C C   1 
ATOM   8241  O  O   . THR C 1 127 ? 114.422 129.841 47.693  1.00 12.34 ? 124  THR C O   1 
ATOM   8242  C  CB  . THR C 1 127 ? 114.182 127.407 45.317  1.00 13.11 ? 124  THR C CB  1 
ATOM   8243  O  OG1 . THR C 1 127 ? 114.997 126.839 44.281  1.00 13.47 ? 124  THR C OG1 1 
ATOM   8244  C  CG2 . THR C 1 127 ? 113.396 128.614 44.698  1.00 12.03 ? 124  THR C CG2 1 
ATOM   8245  N  N   . TYR C 1 128 ? 113.581 127.898 48.409  1.00 13.29 ? 125  TYR C N   1 
ATOM   8246  C  CA  . TYR C 1 128 ? 112.822 128.531 49.492  1.00 13.12 ? 125  TYR C CA  1 
ATOM   8247  C  C   . TYR C 1 128 ? 113.765 129.322 50.412  1.00 14.23 ? 125  TYR C C   1 
ATOM   8248  O  O   . TYR C 1 128 ? 113.526 130.498 50.688  1.00 13.62 ? 125  TYR C O   1 
ATOM   8249  C  CB  . TYR C 1 128 ? 112.029 127.478 50.277  1.00 13.52 ? 125  TYR C CB  1 
ATOM   8250  C  CG  . TYR C 1 128 ? 111.210 127.995 51.455  1.00 13.95 ? 125  TYR C CG  1 
ATOM   8251  C  CD1 . TYR C 1 128 ? 111.751 128.043 52.741  1.00 15.09 ? 125  TYR C CD1 1 
ATOM   8252  C  CD2 . TYR C 1 128 ? 109.890 128.404 51.289  1.00 14.02 ? 125  TYR C CD2 1 
ATOM   8253  C  CE1 . TYR C 1 128 ? 111.001 128.518 53.831  1.00 14.90 ? 125  TYR C CE1 1 
ATOM   8254  C  CE2 . TYR C 1 128 ? 109.124 128.860 52.381  1.00 14.39 ? 125  TYR C CE2 1 
ATOM   8255  C  CZ  . TYR C 1 128 ? 109.685 128.919 53.635  1.00 14.92 ? 125  TYR C CZ  1 
ATOM   8256  O  OH  . TYR C 1 128 ? 108.934 129.374 54.703  1.00 17.62 ? 125  TYR C OH  1 
HETATM 8257  N  N   . MSE C 1 129 ? 114.873 128.708 50.820  1.00 13.03 ? 126  MSE C N   1 
HETATM 8258  C  CA  . MSE C 1 129 ? 115.798 129.366 51.739  1.00 14.41 ? 126  MSE C CA  1 
HETATM 8259  C  C   . MSE C 1 129 ? 116.486 130.583 51.155  1.00 14.43 ? 126  MSE C C   1 
HETATM 8260  O  O   . MSE C 1 129 ? 116.580 131.601 51.829  1.00 13.02 ? 126  MSE C O   1 
HETATM 8261  C  CB  . MSE C 1 129 ? 116.842 128.382 52.294  1.00 15.20 ? 126  MSE C CB  1 
HETATM 8262  C  CG  . MSE C 1 129 ? 116.212 127.199 52.967  1.00 20.58 ? 126  MSE C CG  1 
HETATM 8263  SE SE  . MSE C 1 129 ? 117.517 125.998 53.799  1.00 27.21 ? 126  MSE C SE  1 
HETATM 8264  C  CE  . MSE C 1 129 ? 116.414 124.377 53.795  1.00 29.68 ? 126  MSE C CE  1 
ATOM   8265  N  N   . LYS C 1 130 ? 116.952 130.482 49.911  1.00 13.74 ? 127  LYS C N   1 
ATOM   8266  C  CA  . LYS C 1 130 ? 117.611 131.596 49.240  1.00 14.11 ? 127  LYS C CA  1 
ATOM   8267  C  C   . LYS C 1 130 ? 116.605 132.748 49.138  1.00 14.17 ? 127  LYS C C   1 
ATOM   8268  O  O   . LYS C 1 130 ? 116.915 133.917 49.444  1.00 12.65 ? 127  LYS C O   1 
ATOM   8269  C  CB  . LYS C 1 130 ? 118.075 131.153 47.847  1.00 14.95 ? 127  LYS C CB  1 
ATOM   8270  C  CG  . LYS C 1 130 ? 118.808 132.186 47.030  1.00 18.73 ? 127  LYS C CG  1 
ATOM   8271  C  CD  . LYS C 1 130 ? 120.148 132.523 47.644  1.00 22.40 ? 127  LYS C CD  1 
ATOM   8272  C  CE  . LYS C 1 130 ? 120.891 133.520 46.793  1.00 25.53 ? 127  LYS C CE  1 
ATOM   8273  N  NZ  . LYS C 1 130 ? 122.176 133.846 47.448  1.00 28.68 ? 127  LYS C NZ  1 
ATOM   8274  N  N   . ASP C 1 131 ? 115.391 132.415 48.732  1.00 12.93 ? 128  ASP C N   1 
ATOM   8275  C  CA  . ASP C 1 131 ? 114.339 133.413 48.602  1.00 13.44 ? 128  ASP C CA  1 
ATOM   8276  C  C   . ASP C 1 131 ? 114.024 134.110 49.938  1.00 14.27 ? 128  ASP C C   1 
ATOM   8277  O  O   . ASP C 1 131 ? 113.809 135.325 49.974  1.00 13.36 ? 128  ASP C O   1 
ATOM   8278  C  CB  . ASP C 1 131 ? 113.085 132.775 48.000  1.00 13.21 ? 128  ASP C CB  1 
ATOM   8279  C  CG  . ASP C 1 131 ? 113.231 132.490 46.517  1.00 13.33 ? 128  ASP C CG  1 
ATOM   8280  O  OD1 . ASP C 1 131 ? 114.253 132.908 45.937  1.00 11.25 ? 128  ASP C OD1 1 
ATOM   8281  O  OD2 . ASP C 1 131 ? 112.328 131.852 45.927  1.00 15.26 ? 128  ASP C OD2 1 
ATOM   8282  N  N   . LEU C 1 132 ? 113.992 133.345 51.028  1.00 14.53 ? 129  LEU C N   1 
ATOM   8283  C  CA  . LEU C 1 132 ? 113.721 133.909 52.356  1.00 15.43 ? 129  LEU C CA  1 
ATOM   8284  C  C   . LEU C 1 132 ? 114.776 134.948 52.732  1.00 16.20 ? 129  LEU C C   1 
ATOM   8285  O  O   . LEU C 1 132 ? 114.462 135.976 53.327  1.00 15.92 ? 129  LEU C O   1 
ATOM   8286  C  CB  . LEU C 1 132 ? 113.672 132.801 53.423  1.00 16.25 ? 129  LEU C CB  1 
ATOM   8287  C  CG  . LEU C 1 132 ? 113.538 133.189 54.908  1.00 17.94 ? 129  LEU C CG  1 
ATOM   8288  C  CD1 . LEU C 1 132 ? 112.271 133.987 55.181  1.00 18.70 ? 129  LEU C CD1 1 
ATOM   8289  C  CD2 . LEU C 1 132 ? 113.548 131.920 55.747  1.00 22.67 ? 129  LEU C CD2 1 
HETATM 8290  N  N   . MSE C 1 133 ? 116.021 134.700 52.365  1.00 15.72 ? 130  MSE C N   1 
HETATM 8291  C  CA  . MSE C 1 133 ? 117.077 135.640 52.686  1.00 15.98 ? 130  MSE C CA  1 
HETATM 8292  C  C   . MSE C 1 133 ? 116.761 137.011 52.126  1.00 16.72 ? 130  MSE C C   1 
HETATM 8293  O  O   . MSE C 1 133 ? 117.150 138.005 52.713  1.00 16.71 ? 130  MSE C O   1 
HETATM 8294  C  CB  . MSE C 1 133 ? 118.419 135.165 52.147  1.00 15.53 ? 130  MSE C CB  1 
HETATM 8295  C  CG  . MSE C 1 133 ? 118.862 133.840 52.728  1.00 15.70 ? 130  MSE C CG  1 
HETATM 8296  SE SE  . MSE C 1 133 ? 120.559 133.192 51.973  1.00 20.83 ? 130  MSE C SE  1 
HETATM 8297  C  CE  . MSE C 1 133 ? 120.546 131.417 52.823  1.00 19.40 ? 130  MSE C CE  1 
ATOM   8298  N  N   . ASP C 1 134 ? 116.076 137.067 50.985  1.00 15.93 ? 131  ASP C N   1 
ATOM   8299  C  CA  . ASP C 1 134 ? 115.720 138.350 50.383  1.00 17.61 ? 131  ASP C CA  1 
ATOM   8300  C  C   . ASP C 1 134 ? 114.774 139.121 51.284  1.00 17.85 ? 131  ASP C C   1 
ATOM   8301  O  O   . ASP C 1 134 ? 114.813 140.343 51.315  1.00 18.91 ? 131  ASP C O   1 
ATOM   8302  C  CB  . ASP C 1 134 ? 115.063 138.164 49.003  1.00 17.78 ? 131  ASP C CB  1 
ATOM   8303  C  CG  . ASP C 1 134 ? 116.010 137.570 47.973  1.00 19.54 ? 131  ASP C CG  1 
ATOM   8304  O  OD1 . ASP C 1 134 ? 117.226 137.842 48.037  1.00 21.44 ? 131  ASP C OD1 1 
ATOM   8305  O  OD2 . ASP C 1 134 ? 115.532 136.837 47.086  1.00 22.46 ? 131  ASP C OD2 1 
ATOM   8306  N  N   . VAL C 1 135 ? 113.896 138.405 51.980  1.00 18.25 ? 132  VAL C N   1 
ATOM   8307  C  CA  . VAL C 1 135 ? 112.945 139.026 52.897  1.00 18.79 ? 132  VAL C CA  1 
ATOM   8308  C  C   . VAL C 1 135 ? 113.648 139.529 54.155  1.00 19.25 ? 132  VAL C C   1 
ATOM   8309  O  O   . VAL C 1 135 ? 113.223 140.519 54.744  1.00 19.32 ? 132  VAL C O   1 
ATOM   8310  C  CB  . VAL C 1 135 ? 111.840 138.047 53.326  1.00 19.17 ? 132  VAL C CB  1 
ATOM   8311  C  CG1 . VAL C 1 135 ? 110.953 138.681 54.380  1.00 19.92 ? 132  VAL C CG1 1 
ATOM   8312  C  CG2 . VAL C 1 135 ? 111.000 137.602 52.117  1.00 21.11 ? 132  VAL C CG2 1 
ATOM   8313  N  N   . LEU C 1 136 ? 114.709 138.841 54.581  1.00 19.09 ? 133  LEU C N   1 
ATOM   8314  C  CA  . LEU C 1 136 ? 115.456 139.253 55.786  1.00 19.27 ? 133  LEU C CA  1 
ATOM   8315  C  C   . LEU C 1 136 ? 116.341 140.459 55.537  1.00 19.66 ? 133  LEU C C   1 
ATOM   8316  O  O   . LEU C 1 136 ? 116.760 141.133 56.470  1.00 17.49 ? 133  LEU C O   1 
ATOM   8317  C  CB  . LEU C 1 136 ? 116.357 138.121 56.277  1.00 19.51 ? 133  LEU C CB  1 
ATOM   8318  C  CG  . LEU C 1 136 ? 115.711 136.810 56.708  1.00 19.33 ? 133  LEU C CG  1 
ATOM   8319  C  CD1 . LEU C 1 136 ? 116.798 135.789 57.086  1.00 20.71 ? 133  LEU C CD1 1 
ATOM   8320  C  CD2 . LEU C 1 136 ? 114.765 137.039 57.872  1.00 20.14 ? 133  LEU C CD2 1 
ATOM   8321  N  N   . GLU C 1 137 ? 116.637 140.704 54.265  1.00 21.39 ? 134  GLU C N   1 
ATOM   8322  C  CA  . GLU C 1 137 ? 117.525 141.781 53.844  1.00 22.40 ? 134  GLU C CA  1 
ATOM   8323  C  C   . GLU C 1 137 ? 117.145 143.161 54.374  1.00 21.13 ? 134  GLU C C   1 
ATOM   8324  O  O   . GLU C 1 137 ? 116.047 143.649 54.123  1.00 22.65 ? 134  GLU C O   1 
ATOM   8325  C  CB  . GLU C 1 137 ? 117.574 141.826 52.308  1.00 23.07 ? 134  GLU C CB  1 
ATOM   8326  C  CG  . GLU C 1 137 ? 118.535 142.851 51.770  1.00 27.93 ? 134  GLU C CG  1 
ATOM   8327  C  CD  . GLU C 1 137 ? 119.951 142.586 52.236  1.00 33.29 ? 134  GLU C CD  1 
ATOM   8328  O  OE1 . GLU C 1 137 ? 120.289 141.397 52.453  1.00 38.60 ? 134  GLU C OE1 1 
ATOM   8329  O  OE2 . GLU C 1 137 ? 120.724 143.559 52.380  1.00 37.62 ? 134  GLU C OE2 1 
ATOM   8330  N  N   . GLY C 1 138 ? 118.062 143.781 55.104  1.00 19.35 ? 135  GLY C N   1 
ATOM   8331  C  CA  . GLY C 1 138 ? 117.846 145.110 55.656  1.00 18.47 ? 135  GLY C CA  1 
ATOM   8332  C  C   . GLY C 1 138 ? 116.871 145.149 56.814  1.00 18.87 ? 135  GLY C C   1 
ATOM   8333  O  O   . GLY C 1 138 ? 116.347 146.213 57.154  1.00 19.88 ? 135  GLY C O   1 
ATOM   8334  N  N   . LYS C 1 139 ? 116.649 144.004 57.452  1.00 17.35 ? 136  LYS C N   1 
ATOM   8335  C  CA  . LYS C 1 139 ? 115.705 143.911 58.556  1.00 18.02 ? 136  LYS C CA  1 
ATOM   8336  C  C   . LYS C 1 139 ? 116.355 143.296 59.790  1.00 17.42 ? 136  LYS C C   1 
ATOM   8337  O  O   . LYS C 1 139 ? 117.212 142.428 59.657  1.00 18.45 ? 136  LYS C O   1 
ATOM   8338  C  CB  . LYS C 1 139 ? 114.571 142.962 58.166  1.00 18.45 ? 136  LYS C CB  1 
ATOM   8339  C  CG  . LYS C 1 139 ? 113.754 143.342 56.958  1.00 21.64 ? 136  LYS C CG  1 
ATOM   8340  C  CD  . LYS C 1 139 ? 112.814 144.486 57.259  1.00 25.34 ? 136  LYS C CD  1 
ATOM   8341  C  CE  . LYS C 1 139 ? 111.837 144.690 56.104  1.00 30.15 ? 136  LYS C CE  1 
ATOM   8342  N  NZ  . LYS C 1 139 ? 110.865 145.772 56.377  1.00 34.51 ? 136  LYS C NZ  1 
ATOM   8343  N  N   . ASP C 1 140 ? 115.930 143.731 60.976  1.00 16.05 ? 137  ASP C N   1 
ATOM   8344  C  CA  . ASP C 1 140 ? 116.402 143.142 62.240  1.00 15.42 ? 137  ASP C CA  1 
ATOM   8345  C  C   . ASP C 1 140 ? 115.606 141.862 62.488  1.00 14.48 ? 137  ASP C C   1 
ATOM   8346  O  O   . ASP C 1 140 ? 114.390 141.819 62.272  1.00 14.27 ? 137  ASP C O   1 
ATOM   8347  C  CB  . ASP C 1 140 ? 116.220 144.107 63.414  1.00 13.76 ? 137  ASP C CB  1 
ATOM   8348  C  CG  . ASP C 1 140 ? 117.273 145.188 63.439  1.00 17.04 ? 137  ASP C CG  1 
ATOM   8349  O  OD1 . ASP C 1 140 ? 118.447 144.846 63.702  1.00 11.11 ? 137  ASP C OD1 1 
ATOM   8350  O  OD2 . ASP C 1 140 ? 116.921 146.373 63.248  1.00 13.74 ? 137  ASP C OD2 1 
ATOM   8351  N  N   . PHE C 1 141 ? 116.285 140.804 62.901  1.00 15.21 ? 138  PHE C N   1 
ATOM   8352  C  CA  . PHE C 1 141 ? 115.582 139.560 63.136  1.00 14.72 ? 138  PHE C CA  1 
ATOM   8353  C  C   . PHE C 1 141 ? 116.203 138.729 64.243  1.00 14.24 ? 138  PHE C C   1 
ATOM   8354  O  O   . PHE C 1 141 ? 117.322 138.998 64.699  1.00 12.59 ? 138  PHE C O   1 
ATOM   8355  C  CB  . PHE C 1 141 ? 115.426 138.756 61.829  1.00 15.31 ? 138  PHE C CB  1 
ATOM   8356  C  CG  . PHE C 1 141 ? 116.689 138.076 61.330  1.00 16.03 ? 138  PHE C CG  1 
ATOM   8357  C  CD1 . PHE C 1 141 ? 117.659 138.781 60.626  1.00 15.66 ? 138  PHE C CD1 1 
ATOM   8358  C  CD2 . PHE C 1 141 ? 116.854 136.712 61.495  1.00 17.57 ? 138  PHE C CD2 1 
ATOM   8359  C  CE1 . PHE C 1 141 ? 118.781 138.141 60.145  1.00 18.10 ? 138  PHE C CE1 1 
ATOM   8360  C  CE2 . PHE C 1 141 ? 117.973 136.067 61.012  1.00 20.59 ? 138  PHE C CE2 1 
ATOM   8361  C  CZ  . PHE C 1 141 ? 118.935 136.773 60.340  1.00 18.56 ? 138  PHE C CZ  1 
ATOM   8362  N  N   . SER C 1 142 ? 115.411 137.773 64.728  1.00 13.36 ? 139  SER C N   1 
ATOM   8363  C  CA  . SER C 1 142 ? 115.828 136.853 65.755  1.00 13.74 ? 139  SER C CA  1 
ATOM   8364  C  C   . SER C 1 142 ? 115.465 135.452 65.303  1.00 13.18 ? 139  SER C C   1 
ATOM   8365  O  O   . SER C 1 142 ? 114.655 135.286 64.388  1.00 11.52 ? 139  SER C O   1 
ATOM   8366  C  CB  . SER C 1 142 ? 115.157 137.174 67.098  1.00 15.21 ? 139  SER C CB  1 
ATOM   8367  O  OG  . SER C 1 142 ? 115.588 138.430 67.626  1.00 18.70 ? 139  SER C OG  1 
ATOM   8368  N  N   . ILE C 1 143 ? 116.096 134.453 65.918  1.00 11.90 ? 140  ILE C N   1 
ATOM   8369  C  CA  . ILE C 1 143 ? 115.835 133.054 65.582  1.00 12.34 ? 140  ILE C CA  1 
ATOM   8370  C  C   . ILE C 1 143 ? 115.377 132.228 66.787  1.00 12.46 ? 140  ILE C C   1 
ATOM   8371  O  O   . ILE C 1 143 ? 116.000 132.280 67.862  1.00 13.20 ? 140  ILE C O   1 
ATOM   8372  C  CB  . ILE C 1 143 ? 117.114 132.354 65.087  1.00 11.84 ? 140  ILE C CB  1 
ATOM   8373  C  CG1 . ILE C 1 143 ? 117.628 132.974 63.792  1.00 12.80 ? 140  ILE C CG1 1 
ATOM   8374  C  CG2 . ILE C 1 143 ? 116.863 130.842 64.861  1.00 13.14 ? 140  ILE C CG2 1 
ATOM   8375  C  CD1 . ILE C 1 143 ? 118.937 132.344 63.344  1.00 12.29 ? 140  ILE C CD1 1 
ATOM   8376  N  N   . ASN C 1 144 ? 114.270 131.513 66.638  1.00 12.40 ? 141  ASN C N   1 
ATOM   8377  C  CA  . ASN C 1 144 ? 113.842 130.574 67.667  1.00 13.43 ? 141  ASN C CA  1 
ATOM   8378  C  C   . ASN C 1 144 ? 114.023 129.200 67.020  1.00 13.49 ? 141  ASN C C   1 
ATOM   8379  O  O   . ASN C 1 144 ? 113.244 128.829 66.144  1.00 12.99 ? 141  ASN C O   1 
ATOM   8380  C  CB  . ASN C 1 144 ? 112.391 130.788 68.093  1.00 14.12 ? 141  ASN C CB  1 
ATOM   8381  C  CG  . ASN C 1 144 ? 111.898 129.754 69.140  1.00 16.31 ? 141  ASN C CG  1 
ATOM   8382  O  OD1 . ASN C 1 144 ? 110.683 129.549 69.281  1.00 17.42 ? 141  ASN C OD1 1 
ATOM   8383  N  ND2 . ASN C 1 144 ? 112.827 129.111 69.864  1.00 15.00 ? 141  ASN C ND2 1 
ATOM   8384  N  N   . VAL C 1 145 ? 115.092 128.494 67.394  1.00 12.81 ? 142  VAL C N   1 
ATOM   8385  C  CA  . VAL C 1 145 ? 115.377 127.151 66.868  1.00 12.33 ? 142  VAL C CA  1 
ATOM   8386  C  C   . VAL C 1 145 ? 114.741 126.143 67.820  1.00 13.82 ? 142  VAL C C   1 
ATOM   8387  O  O   . VAL C 1 145 ? 115.000 126.174 69.032  1.00 13.66 ? 142  VAL C O   1 
ATOM   8388  C  CB  . VAL C 1 145 ? 116.899 126.899 66.649  1.00 12.85 ? 142  VAL C CB  1 
ATOM   8389  C  CG1 . VAL C 1 145 ? 117.711 127.280 67.885  1.00 12.52 ? 142  VAL C CG1 1 
ATOM   8390  C  CG2 . VAL C 1 145 ? 117.177 125.420 66.182  1.00 12.49 ? 142  VAL C CG2 1 
ATOM   8391  N  N   . ILE C 1 146 ? 113.918 125.251 67.260  1.00 13.85 ? 143  ILE C N   1 
ATOM   8392  C  CA  . ILE C 1 146 ? 113.155 124.285 68.032  1.00 13.51 ? 143  ILE C CA  1 
ATOM   8393  C  C   . ILE C 1 146 ? 113.367 122.829 67.577  1.00 15.07 ? 143  ILE C C   1 
ATOM   8394  O  O   . ILE C 1 146 ? 112.980 122.451 66.473  1.00 16.77 ? 143  ILE C O   1 
ATOM   8395  C  CB  . ILE C 1 146 ? 111.660 124.592 67.886  1.00 13.27 ? 143  ILE C CB  1 
ATOM   8396  C  CG1 . ILE C 1 146 ? 111.394 126.081 68.050  1.00 14.51 ? 143  ILE C CG1 1 
ATOM   8397  C  CG2 . ILE C 1 146 ? 110.831 123.772 68.900  1.00 14.62 ? 143  ILE C CG2 1 
ATOM   8398  C  CD1 . ILE C 1 146 ? 109.916 126.498 67.851  1.00 12.57 ? 143  ILE C CD1 1 
ATOM   8399  N  N   . SER C 1 147 ? 113.933 122.013 68.451  1.00 14.63 ? 144  SER C N   1 
ATOM   8400  C  CA  . SER C 1 147 ? 114.205 120.601 68.159  1.00 16.37 ? 144  SER C CA  1 
ATOM   8401  C  C   . SER C 1 147 ? 114.602 119.879 69.419  1.00 16.36 ? 144  SER C C   1 
ATOM   8402  O  O   . SER C 1 147 ? 115.477 120.336 70.147  1.00 16.42 ? 144  SER C O   1 
ATOM   8403  C  CB  . SER C 1 147 ? 115.354 120.457 67.150  1.00 16.46 ? 144  SER C CB  1 
ATOM   8404  O  OG  . SER C 1 147 ? 115.725 119.101 66.963  1.00 16.40 ? 144  SER C OG  1 
ATOM   8405  N  N   . LYS C 1 148 ? 113.959 118.749 69.687  1.00 17.89 ? 145  LYS C N   1 
ATOM   8406  C  CA  . LYS C 1 148 ? 114.320 117.951 70.861  1.00 18.69 ? 145  LYS C CA  1 
ATOM   8407  C  C   . LYS C 1 148 ? 115.791 117.520 70.838  1.00 19.35 ? 145  LYS C C   1 
ATOM   8408  O  O   . LYS C 1 148 ? 116.519 117.665 71.842  1.00 20.08 ? 145  LYS C O   1 
ATOM   8409  C  CB  . LYS C 1 148 ? 113.458 116.691 70.950  1.00 19.68 ? 145  LYS C CB  1 
ATOM   8410  C  CG  . LYS C 1 148 ? 112.023 116.861 71.466  1.00 22.30 ? 145  LYS C CG  1 
ATOM   8411  C  CD  . LYS C 1 148 ? 111.283 115.507 71.358  1.00 27.07 ? 145  LYS C CD  1 
ATOM   8412  C  CE  . LYS C 1 148 ? 109.937 115.462 72.096  1.00 29.11 ? 145  LYS C CE  1 
ATOM   8413  N  NZ  . LYS C 1 148 ? 110.116 115.293 73.582  1.00 24.93 ? 145  LYS C NZ  1 
ATOM   8414  N  N   . SER C 1 149 ? 116.244 117.022 69.683  1.00 19.87 ? 146  SER C N   1 
ATOM   8415  C  CA  . SER C 1 149 ? 117.599 116.463 69.541  1.00 19.45 ? 146  SER C CA  1 
ATOM   8416  C  C   . SER C 1 149 ? 118.664 117.367 68.959  1.00 19.19 ? 146  SER C C   1 
ATOM   8417  O  O   . SER C 1 149 ? 119.856 117.250 69.294  1.00 19.73 ? 146  SER C O   1 
ATOM   8418  C  CB  . SER C 1 149 ? 117.514 115.253 68.606  1.00 21.90 ? 146  SER C CB  1 
ATOM   8419  O  OG  . SER C 1 149 ? 117.008 115.655 67.315  1.00 22.41 ? 146  SER C OG  1 
ATOM   8420  N  N   . GLY C 1 150 ? 118.261 118.236 68.051  1.00 17.77 ? 147  GLY C N   1 
ATOM   8421  C  CA  . GLY C 1 150 ? 119.211 119.080 67.369  1.00 18.52 ? 147  GLY C CA  1 
ATOM   8422  C  C   . GLY C 1 150 ? 119.844 118.343 66.192  1.00 18.86 ? 147  GLY C C   1 
ATOM   8423  O  O   . GLY C 1 150 ? 120.703 118.907 65.482  1.00 20.07 ? 147  GLY C O   1 
ATOM   8424  N  N   . THR C 1 151 ? 119.418 117.096 65.968  1.00 17.60 ? 148  THR C N   1 
ATOM   8425  C  CA  . THR C 1 151 ? 119.957 116.293 64.865  1.00 18.43 ? 148  THR C CA  1 
ATOM   8426  C  C   . THR C 1 151 ? 118.923 116.030 63.756  1.00 17.62 ? 148  THR C C   1 
ATOM   8427  O  O   . THR C 1 151 ? 119.241 115.380 62.787  1.00 19.06 ? 148  THR C O   1 
ATOM   8428  C  CB  . THR C 1 151 ? 120.579 114.936 65.339  1.00 18.25 ? 148  THR C CB  1 
ATOM   8429  O  OG1 . THR C 1 151 ? 119.604 114.182 66.063  1.00 17.91 ? 148  THR C OG1 1 
ATOM   8430  C  CG2 . THR C 1 151 ? 121.802 115.176 66.222  1.00 19.72 ? 148  THR C CG2 1 
ATOM   8431  N  N   . THR C 1 152 ? 117.691 116.516 63.897  1.00 16.86 ? 149  THR C N   1 
ATOM   8432  C  CA  . THR C 1 152 ? 116.717 116.329 62.819  1.00 15.70 ? 149  THR C CA  1 
ATOM   8433  C  C   . THR C 1 152 ? 117.293 117.093 61.635  1.00 14.08 ? 149  THR C C   1 
ATOM   8434  O  O   . THR C 1 152 ? 117.534 118.304 61.692  1.00 12.70 ? 149  THR C O   1 
ATOM   8435  C  CB  . THR C 1 152 ? 115.329 116.804 63.190  1.00 16.18 ? 149  THR C CB  1 
ATOM   8436  O  OG1 . THR C 1 152 ? 114.970 116.258 64.465  1.00 18.49 ? 149  THR C OG1 1 
ATOM   8437  C  CG2 . THR C 1 152 ? 114.305 116.340 62.129  1.00 14.00 ? 149  THR C CG2 1 
ATOM   8438  N  N   . THR C 1 153 ? 117.532 116.353 60.563  1.00 14.23 ? 150  THR C N   1 
ATOM   8439  C  CA  . THR C 1 153 ? 118.200 116.871 59.384  1.00 13.02 ? 150  THR C CA  1 
ATOM   8440  C  C   . THR C 1 153 ? 117.754 118.261 58.877  1.00 12.88 ? 150  THR C C   1 
ATOM   8441  O  O   . THR C 1 153 ? 118.586 119.159 58.740  1.00 11.70 ? 150  THR C O   1 
ATOM   8442  C  CB  . THR C 1 153 ? 118.116 115.830 58.231  1.00 12.59 ? 150  THR C CB  1 
ATOM   8443  O  OG1 . THR C 1 153 ? 118.600 114.543 58.680  1.00 11.12 ? 150  THR C OG1 1 
ATOM   8444  C  CG2 . THR C 1 153 ? 118.923 116.289 57.043  1.00 10.43 ? 150  THR C CG2 1 
ATOM   8445  N  N   . GLU C 1 154 ? 116.456 118.447 58.624  1.00 13.06 ? 151  GLU C N   1 
ATOM   8446  C  CA  . GLU C 1 154 ? 115.975 119.698 58.037  1.00 13.24 ? 151  GLU C CA  1 
ATOM   8447  C  C   . GLU C 1 154 ? 116.254 120.943 58.875  1.00 13.20 ? 151  GLU C C   1 
ATOM   8448  O  O   . GLU C 1 154 ? 116.873 121.914 58.382  1.00 11.91 ? 151  GLU C O   1 
ATOM   8449  C  CB  . GLU C 1 154 ? 114.474 119.623 57.677  1.00 14.72 ? 151  GLU C CB  1 
ATOM   8450  C  CG  . GLU C 1 154 ? 114.075 118.503 56.717  1.00 14.27 ? 151  GLU C CG  1 
ATOM   8451  C  CD  . GLU C 1 154 ? 113.745 117.161 57.366  1.00 16.69 ? 151  GLU C CD  1 
ATOM   8452  O  OE1 . GLU C 1 154 ? 114.318 116.794 58.424  1.00 14.94 ? 151  GLU C OE1 1 
ATOM   8453  O  OE2 . GLU C 1 154 ? 112.889 116.457 56.774  1.00 13.51 ? 151  GLU C OE2 1 
ATOM   8454  N  N   . PRO C 1 155 ? 115.789 120.947 60.130  1.00 13.39 ? 152  PRO C N   1 
ATOM   8455  C  CA  . PRO C 1 155 ? 116.047 122.139 60.938  1.00 13.25 ? 152  PRO C CA  1 
ATOM   8456  C  C   . PRO C 1 155 ? 117.523 122.302 61.329  1.00 12.53 ? 152  PRO C C   1 
ATOM   8457  O  O   . PRO C 1 155 ? 117.989 123.427 61.473  1.00 13.26 ? 152  PRO C O   1 
ATOM   8458  C  CB  . PRO C 1 155 ? 115.138 121.952 62.149  1.00 13.05 ? 152  PRO C CB  1 
ATOM   8459  C  CG  . PRO C 1 155 ? 114.845 120.483 62.191  1.00 14.75 ? 152  PRO C CG  1 
ATOM   8460  C  CD  . PRO C 1 155 ? 114.858 120.018 60.791  1.00 13.09 ? 152  PRO C CD  1 
ATOM   8461  N  N   . ALA C 1 156 ? 118.264 121.211 61.473  1.00 11.82 ? 153  ALA C N   1 
ATOM   8462  C  CA  . ALA C 1 156 ? 119.696 121.343 61.813  1.00 11.17 ? 153  ALA C CA  1 
ATOM   8463  C  C   . ALA C 1 156 ? 120.453 122.027 60.663  1.00 11.95 ? 153  ALA C C   1 
ATOM   8464  O  O   . ALA C 1 156 ? 121.308 122.884 60.893  1.00 12.40 ? 153  ALA C O   1 
ATOM   8465  C  CB  . ALA C 1 156 ? 120.331 119.975 62.157  1.00 9.85  ? 153  ALA C CB  1 
ATOM   8466  N  N   A LEU C 1 157 ? 120.109 121.655 59.435  0.60 12.38 ? 154  LEU C N   1 
ATOM   8467  N  N   B LEU C 1 157 ? 120.143 121.644 59.422  0.40 11.96 ? 154  LEU C N   1 
ATOM   8468  C  CA  A LEU C 1 157 ? 120.744 122.206 58.261  0.60 12.97 ? 154  LEU C CA  1 
ATOM   8469  C  CA  B LEU C 1 157 ? 120.784 122.254 58.259  0.40 12.17 ? 154  LEU C CA  1 
ATOM   8470  C  C   A LEU C 1 157 ? 120.378 123.686 58.090  0.60 13.97 ? 154  LEU C C   1 
ATOM   8471  C  C   B LEU C 1 157 ? 120.389 123.719 58.129  0.40 13.20 ? 154  LEU C C   1 
ATOM   8472  O  O   A LEU C 1 157 ? 121.253 124.526 57.833  0.60 14.58 ? 154  LEU C O   1 
ATOM   8473  O  O   B LEU C 1 157 ? 121.251 124.585 57.940  0.40 13.52 ? 154  LEU C O   1 
ATOM   8474  C  CB  A LEU C 1 157 ? 120.341 121.387 57.039  0.60 13.22 ? 154  LEU C CB  1 
ATOM   8475  C  CB  B LEU C 1 157 ? 120.449 121.506 56.963  0.40 12.02 ? 154  LEU C CB  1 
ATOM   8476  C  CG  A LEU C 1 157 ? 121.041 121.699 55.731  0.60 14.07 ? 154  LEU C CG  1 
ATOM   8477  C  CG  B LEU C 1 157 ? 121.151 120.167 56.743  0.40 11.06 ? 154  LEU C CG  1 
ATOM   8478  C  CD1 A LEU C 1 157 ? 122.547 121.530 55.888  0.60 13.28 ? 154  LEU C CD1 1 
ATOM   8479  C  CD1 B LEU C 1 157 ? 120.610 119.447 55.509  0.40 10.45 ? 154  LEU C CD1 1 
ATOM   8480  C  CD2 A LEU C 1 157 ? 120.498 120.776 54.635  0.60 14.64 ? 154  LEU C CD2 1 
ATOM   8481  C  CD2 B LEU C 1 157 ? 122.660 120.390 56.625  0.40 9.97  ? 154  LEU C CD2 1 
ATOM   8482  N  N   . ALA C 1 158 ? 119.096 124.006 58.246  1.00 12.55 ? 155  ALA C N   1 
ATOM   8483  C  CA  . ALA C 1 158 ? 118.637 125.377 58.133  1.00 13.40 ? 155  ALA C CA  1 
ATOM   8484  C  C   . ALA C 1 158 ? 119.186 126.238 59.275  1.00 13.52 ? 155  ALA C C   1 
ATOM   8485  O  O   . ALA C 1 158 ? 119.496 127.416 59.079  1.00 11.21 ? 155  ALA C O   1 
ATOM   8486  C  CB  . ALA C 1 158 ? 117.111 125.451 58.075  1.00 12.64 ? 155  ALA C CB  1 
ATOM   8487  N  N   . PHE C 1 159 ? 119.301 125.666 60.471  1.00 14.40 ? 156  PHE C N   1 
ATOM   8488  C  CA  . PHE C 1 159 ? 119.840 126.443 61.586  1.00 13.61 ? 156  PHE C CA  1 
ATOM   8489  C  C   . PHE C 1 159 ? 121.287 126.818 61.283  1.00 13.36 ? 156  PHE C C   1 
ATOM   8490  O  O   . PHE C 1 159 ? 121.683 127.964 61.496  1.00 14.16 ? 156  PHE C O   1 
ATOM   8491  C  CB  . PHE C 1 159 ? 119.702 125.743 62.939  1.00 12.54 ? 156  PHE C CB  1 
ATOM   8492  C  CG  . PHE C 1 159 ? 120.264 126.539 64.063  1.00 14.26 ? 156  PHE C CG  1 
ATOM   8493  C  CD1 . PHE C 1 159 ? 119.700 127.746 64.413  1.00 13.72 ? 156  PHE C CD1 1 
ATOM   8494  C  CD2 . PHE C 1 159 ? 121.360 126.087 64.772  1.00 15.05 ? 156  PHE C CD2 1 
ATOM   8495  C  CE1 . PHE C 1 159 ? 120.218 128.491 65.443  1.00 15.67 ? 156  PHE C CE1 1 
ATOM   8496  C  CE2 . PHE C 1 159 ? 121.873 126.821 65.795  1.00 17.98 ? 156  PHE C CE2 1 
ATOM   8497  C  CZ  . PHE C 1 159 ? 121.299 128.037 66.132  1.00 15.57 ? 156  PHE C CZ  1 
ATOM   8498  N  N   . ARG C 1 160 ? 122.067 125.881 60.765  1.00 13.70 ? 157  ARG C N   1 
ATOM   8499  C  CA  . ARG C 1 160 ? 123.450 126.203 60.374  1.00 15.53 ? 157  ARG C CA  1 
ATOM   8500  C  C   . ARG C 1 160 ? 123.534 127.401 59.421  1.00 15.01 ? 157  ARG C C   1 
ATOM   8501  O  O   . ARG C 1 160 ? 124.361 128.313 59.580  1.00 14.88 ? 157  ARG C O   1 
ATOM   8502  C  CB  . ARG C 1 160 ? 124.113 125.023 59.675  1.00 15.32 ? 157  ARG C CB  1 
ATOM   8503  C  CG  . ARG C 1 160 ? 124.506 123.884 60.575  1.00 18.97 ? 157  ARG C CG  1 
ATOM   8504  C  CD  . ARG C 1 160 ? 125.435 122.968 59.807  1.00 22.73 ? 157  ARG C CD  1 
ATOM   8505  N  NE  . ARG C 1 160 ? 126.078 121.997 60.678  1.00 21.36 ? 157  ARG C NE  1 
ATOM   8506  C  CZ  . ARG C 1 160 ? 127.259 121.446 60.418  1.00 18.57 ? 157  ARG C CZ  1 
ATOM   8507  N  NH1 . ARG C 1 160 ? 127.944 121.801 59.338  1.00 16.32 ? 157  ARG C NH1 1 
ATOM   8508  N  NH2 . ARG C 1 160 ? 127.778 120.580 61.270  1.00 15.79 ? 157  ARG C NH2 1 
ATOM   8509  N  N   . ILE C 1 161 ? 122.692 127.368 58.402  1.00 13.56 ? 158  ILE C N   1 
ATOM   8510  C  CA  . ILE C 1 161 ? 122.656 128.403 57.392  1.00 13.24 ? 158  ILE C CA  1 
ATOM   8511  C  C   . ILE C 1 161 ? 122.215 129.778 57.908  1.00 13.07 ? 158  ILE C C   1 
ATOM   8512  O  O   . ILE C 1 161 ? 122.869 130.802 57.632  1.00 12.29 ? 158  ILE C O   1 
ATOM   8513  C  CB  . ILE C 1 161 ? 121.757 127.945 56.198  1.00 13.19 ? 158  ILE C CB  1 
ATOM   8514  C  CG1 . ILE C 1 161 ? 122.436 126.759 55.484  1.00 14.38 ? 158  ILE C CG1 1 
ATOM   8515  C  CG2 . ILE C 1 161 ? 121.553 129.097 55.199  1.00 12.57 ? 158  ILE C CG2 1 
ATOM   8516  C  CD1 . ILE C 1 161 ? 121.545 126.024 54.484  1.00 11.23 ? 158  ILE C CD1 1 
ATOM   8517  N  N   . PHE C 1 162 ? 121.125 129.810 58.656  1.00 11.93 ? 159  PHE C N   1 
ATOM   8518  C  CA  . PHE C 1 162 ? 120.605 131.077 59.136  1.00 12.85 ? 159  PHE C CA  1 
ATOM   8519  C  C   . PHE C 1 162 ? 121.334 131.598 60.354  1.00 11.97 ? 159  PHE C C   1 
ATOM   8520  O  O   . PHE C 1 162 ? 121.375 132.806 60.573  1.00 13.69 ? 159  PHE C O   1 
ATOM   8521  C  CB  . PHE C 1 162 ? 119.073 131.034 59.259  1.00 13.75 ? 159  PHE C CB  1 
ATOM   8522  C  CG  . PHE C 1 162 ? 118.407 130.987 57.913  1.00 13.34 ? 159  PHE C CG  1 
ATOM   8523  C  CD1 . PHE C 1 162 ? 118.092 132.171 57.238  1.00 16.27 ? 159  PHE C CD1 1 
ATOM   8524  C  CD2 . PHE C 1 162 ? 118.208 129.793 57.273  1.00 12.89 ? 159  PHE C CD2 1 
ATOM   8525  C  CE1 . PHE C 1 162 ? 117.541 132.143 55.976  1.00 15.35 ? 159  PHE C CE1 1 
ATOM   8526  C  CE2 . PHE C 1 162 ? 117.659 129.755 56.006  1.00 16.04 ? 159  PHE C CE2 1 
ATOM   8527  C  CZ  . PHE C 1 162 ? 117.332 130.926 55.353  1.00 14.48 ? 159  PHE C CZ  1 
ATOM   8528  N  N   . ARG C 1 163 ? 121.927 130.713 61.139  1.00 12.82 ? 160  ARG C N   1 
ATOM   8529  C  CA  . ARG C 1 163 ? 122.735 131.188 62.258  1.00 15.13 ? 160  ARG C CA  1 
ATOM   8530  C  C   . ARG C 1 163 ? 123.915 131.980 61.695  1.00 16.25 ? 160  ARG C C   1 
ATOM   8531  O  O   . ARG C 1 163 ? 124.281 133.038 62.200  1.00 16.83 ? 160  ARG C O   1 
ATOM   8532  C  CB  . ARG C 1 163 ? 123.244 130.039 63.121  1.00 14.90 ? 160  ARG C CB  1 
ATOM   8533  C  CG  . ARG C 1 163 ? 124.274 130.518 64.142  1.00 20.19 ? 160  ARG C CG  1 
ATOM   8534  C  CD  . ARG C 1 163 ? 124.406 129.575 65.295  1.00 25.97 ? 160  ARG C CD  1 
ATOM   8535  N  NE  . ARG C 1 163 ? 125.067 128.323 64.979  1.00 31.00 ? 160  ARG C NE  1 
ATOM   8536  C  CZ  . ARG C 1 163 ? 126.330 128.053 65.286  1.00 36.81 ? 160  ARG C CZ  1 
ATOM   8537  N  NH1 . ARG C 1 163 ? 127.072 128.947 65.926  1.00 38.95 ? 160  ARG C NH1 1 
ATOM   8538  N  NH2 . ARG C 1 163 ? 126.849 126.873 64.966  1.00 39.85 ? 160  ARG C NH2 1 
ATOM   8539  N  N   . LYS C 1 164 ? 124.487 131.467 60.617  1.00 17.50 ? 161  LYS C N   1 
ATOM   8540  C  CA  . LYS C 1 164 ? 125.638 132.094 59.994  1.00 18.78 ? 161  LYS C CA  1 
ATOM   8541  C  C   . LYS C 1 164 ? 125.242 133.474 59.455  1.00 18.01 ? 161  LYS C C   1 
ATOM   8542  O  O   . LYS C 1 164 ? 126.007 134.417 59.552  1.00 16.80 ? 161  LYS C O   1 
ATOM   8543  C  CB  . LYS C 1 164 ? 126.178 131.174 58.897  1.00 19.61 ? 161  LYS C CB  1 
ATOM   8544  C  CG  . LYS C 1 164 ? 127.675 131.220 58.731  1.00 26.85 ? 161  LYS C CG  1 
ATOM   8545  C  CD  . LYS C 1 164 ? 128.145 130.060 57.853  1.00 33.07 ? 161  LYS C CD  1 
ATOM   8546  C  CE  . LYS C 1 164 ? 129.642 129.798 58.018  1.00 37.74 ? 161  LYS C CE  1 
ATOM   8547  N  NZ  . LYS C 1 164 ? 130.487 130.985 57.726  1.00 37.79 ? 161  LYS C NZ  1 
ATOM   8548  N  N   A LEU C 1 165 ? 124.051 133.584 58.871  0.60 17.99 ? 162  LEU C N   1 
ATOM   8549  N  N   B LEU C 1 165 ? 124.036 133.566 58.902  0.40 17.49 ? 162  LEU C N   1 
ATOM   8550  C  CA  A LEU C 1 165 ? 123.579 134.875 58.374  0.60 17.64 ? 162  LEU C CA  1 
ATOM   8551  C  CA  B LEU C 1 165 ? 123.521 134.818 58.366  0.40 16.85 ? 162  LEU C CA  1 
ATOM   8552  C  C   A LEU C 1 165 ? 123.420 135.858 59.529  0.60 17.30 ? 162  LEU C C   1 
ATOM   8553  C  C   B LEU C 1 165 ? 123.368 135.844 59.495  0.40 16.91 ? 162  LEU C C   1 
ATOM   8554  O  O   A LEU C 1 165 ? 123.814 137.011 59.428  0.60 16.51 ? 162  LEU C O   1 
ATOM   8555  O  O   B LEU C 1 165 ? 123.721 137.008 59.339  0.40 16.44 ? 162  LEU C O   1 
ATOM   8556  C  CB  A LEU C 1 165 ? 122.246 134.745 57.642  0.60 18.24 ? 162  LEU C CB  1 
ATOM   8557  C  CB  B LEU C 1 165 ? 122.166 134.576 57.697  0.40 16.88 ? 162  LEU C CB  1 
ATOM   8558  C  CG  A LEU C 1 165 ? 122.230 134.092 56.264  0.60 18.53 ? 162  LEU C CG  1 
ATOM   8559  C  CG  B LEU C 1 165 ? 121.525 135.728 56.923  0.40 15.57 ? 162  LEU C CG  1 
ATOM   8560  C  CD1 A LEU C 1 165 ? 120.809 133.872 55.825  0.60 20.61 ? 162  LEU C CD1 1 
ATOM   8561  C  CD1 B LEU C 1 165 ? 122.356 136.059 55.698  0.40 14.16 ? 162  LEU C CD1 1 
ATOM   8562  C  CD2 A LEU C 1 165 ? 122.978 134.968 55.270  0.60 23.64 ? 162  LEU C CD2 1 
ATOM   8563  C  CD2 B LEU C 1 165 ? 120.118 135.363 56.513  0.40 13.30 ? 162  LEU C CD2 1 
ATOM   8564  N  N   . LEU C 1 166 ? 122.836 135.400 60.630  1.00 16.93 ? 163  LEU C N   1 
ATOM   8565  C  CA  . LEU C 1 166 ? 122.633 136.269 61.780  1.00 17.06 ? 163  LEU C CA  1 
ATOM   8566  C  C   . LEU C 1 166 ? 123.993 136.765 62.312  1.00 17.38 ? 163  LEU C C   1 
ATOM   8567  O  O   . LEU C 1 166 ? 124.192 137.968 62.576  1.00 15.44 ? 163  LEU C O   1 
ATOM   8568  C  CB  . LEU C 1 166 ? 121.854 135.515 62.865  1.00 17.36 ? 163  LEU C CB  1 
ATOM   8569  C  CG  . LEU C 1 166 ? 121.422 136.270 64.122  1.00 19.43 ? 163  LEU C CG  1 
ATOM   8570  C  CD1 . LEU C 1 166 ? 120.382 137.320 63.784  1.00 17.81 ? 163  LEU C CD1 1 
ATOM   8571  C  CD2 . LEU C 1 166 ? 120.872 135.269 65.135  1.00 18.98 ? 163  LEU C CD2 1 
ATOM   8572  N  N   . GLU C 1 167 ? 124.927 135.831 62.448  1.00 17.22 ? 164  GLU C N   1 
ATOM   8573  C  CA  . GLU C 1 167 ? 126.252 136.151 62.921  1.00 17.85 ? 164  GLU C CA  1 
ATOM   8574  C  C   . GLU C 1 167 ? 126.944 137.137 61.972  1.00 18.31 ? 164  GLU C C   1 
ATOM   8575  O  O   . GLU C 1 167 ? 127.615 138.069 62.420  1.00 17.88 ? 164  GLU C O   1 
ATOM   8576  C  CB  . GLU C 1 167 ? 127.073 134.873 63.106  1.00 17.57 ? 164  GLU C CB  1 
ATOM   8577  C  CG  . GLU C 1 167 ? 126.585 134.002 64.239  1.00 18.61 ? 164  GLU C CG  1 
ATOM   8578  C  CD  . GLU C 1 167 ? 127.353 132.698 64.352  1.00 21.13 ? 164  GLU C CD  1 
ATOM   8579  O  OE1 . GLU C 1 167 ? 128.097 132.360 63.412  1.00 23.69 ? 164  GLU C OE1 1 
ATOM   8580  O  OE2 . GLU C 1 167 ? 127.186 131.990 65.365  1.00 22.77 ? 164  GLU C OE2 1 
ATOM   8581  N  N   . GLU C 1 168 ? 126.773 136.949 60.669  1.00 18.70 ? 165  GLU C N   1 
ATOM   8582  C  CA  . GLU C 1 168 ? 127.369 137.864 59.698  1.00 20.70 ? 165  GLU C CA  1 
ATOM   8583  C  C   . GLU C 1 168 ? 126.793 139.265 59.813  1.00 19.77 ? 165  GLU C C   1 
ATOM   8584  O  O   . GLU C 1 168 ? 127.499 140.243 59.626  1.00 18.93 ? 165  GLU C O   1 
ATOM   8585  C  CB  . GLU C 1 168 ? 127.167 137.358 58.270  1.00 21.73 ? 165  GLU C CB  1 
ATOM   8586  C  CG  . GLU C 1 168 ? 127.950 136.098 57.982  1.00 26.83 ? 165  GLU C CG  1 
ATOM   8587  C  CD  . GLU C 1 168 ? 127.658 135.501 56.618  1.00 31.56 ? 165  GLU C CD  1 
ATOM   8588  O  OE1 . GLU C 1 168 ? 126.776 136.024 55.895  1.00 34.18 ? 165  GLU C OE1 1 
ATOM   8589  O  OE2 . GLU C 1 168 ? 128.312 134.491 56.282  1.00 36.38 ? 165  GLU C OE2 1 
ATOM   8590  N  N   . LYS C 1 169 ? 125.503 139.356 60.108  1.00 19.11 ? 166  LYS C N   1 
ATOM   8591  C  CA  . LYS C 1 169 ? 124.855 140.644 60.233  1.00 19.22 ? 166  LYS C CA  1 
ATOM   8592  C  C   . LYS C 1 169 ? 125.191 141.364 61.529  1.00 18.52 ? 166  LYS C C   1 
ATOM   8593  O  O   . LYS C 1 169 ? 125.466 142.556 61.520  1.00 18.70 ? 166  LYS C O   1 
ATOM   8594  C  CB  . LYS C 1 169 ? 123.336 140.478 60.149  1.00 19.30 ? 166  LYS C CB  1 
ATOM   8595  C  CG  . LYS C 1 169 ? 122.545 141.792 60.244  1.00 23.81 ? 166  LYS C CG  1 
ATOM   8596  C  CD  . LYS C 1 169 ? 121.077 141.564 59.877  1.00 28.14 ? 166  LYS C CD  1 
ATOM   8597  C  CE  . LYS C 1 169 ? 120.273 142.856 59.801  1.00 28.59 ? 166  LYS C CE  1 
ATOM   8598  N  NZ  . LYS C 1 169 ? 120.124 143.481 61.128  1.00 34.61 ? 166  LYS C NZ  1 
ATOM   8599  N  N   . TYR C 1 170 ? 125.178 140.635 62.638  1.00 17.02 ? 167  TYR C N   1 
ATOM   8600  C  CA  . TYR C 1 170 ? 125.384 141.235 63.954  1.00 16.64 ? 167  TYR C CA  1 
ATOM   8601  C  C   . TYR C 1 170 ? 126.712 141.004 64.675  1.00 16.52 ? 167  TYR C C   1 
ATOM   8602  O  O   . TYR C 1 170 ? 127.027 141.722 65.618  1.00 16.31 ? 167  TYR C O   1 
ATOM   8603  C  CB  . TYR C 1 170 ? 124.296 140.716 64.901  1.00 16.50 ? 167  TYR C CB  1 
ATOM   8604  C  CG  . TYR C 1 170 ? 122.895 141.160 64.569  1.00 16.50 ? 167  TYR C CG  1 
ATOM   8605  C  CD1 . TYR C 1 170 ? 122.464 142.435 64.885  1.00 17.20 ? 167  TYR C CD1 1 
ATOM   8606  C  CD2 . TYR C 1 170 ? 121.987 140.293 63.996  1.00 15.83 ? 167  TYR C CD2 1 
ATOM   8607  C  CE1 . TYR C 1 170 ? 121.158 142.835 64.619  1.00 18.10 ? 167  TYR C CE1 1 
ATOM   8608  C  CE2 . TYR C 1 170 ? 120.685 140.696 63.710  1.00 12.82 ? 167  TYR C CE2 1 
ATOM   8609  C  CZ  . TYR C 1 170 ? 120.279 141.959 64.023  1.00 14.93 ? 167  TYR C CZ  1 
ATOM   8610  O  OH  . TYR C 1 170 ? 118.981 142.366 63.740  1.00 13.75 ? 167  TYR C OH  1 
ATOM   8611  N  N   . GLY C 1 171 ? 127.489 140.028 64.236  1.00 16.39 ? 168  GLY C N   1 
ATOM   8612  C  CA  . GLY C 1 171 ? 128.705 139.663 64.944  1.00 16.07 ? 168  GLY C CA  1 
ATOM   8613  C  C   . GLY C 1 171 ? 128.226 138.567 65.899  1.00 16.56 ? 168  GLY C C   1 
ATOM   8614  O  O   . GLY C 1 171 ? 127.033 138.526 66.252  1.00 13.46 ? 168  GLY C O   1 
ATOM   8615  N  N   . LYS C 1 172 ? 129.136 137.704 66.345  1.00 16.54 ? 169  LYS C N   1 
ATOM   8616  C  CA  . LYS C 1 172 ? 128.762 136.595 67.218  1.00 18.33 ? 169  LYS C CA  1 
ATOM   8617  C  C   . LYS C 1 172 ? 128.148 136.937 68.579  1.00 19.50 ? 169  LYS C C   1 
ATOM   8618  O  O   . LYS C 1 172 ? 127.190 136.268 69.014  1.00 18.05 ? 169  LYS C O   1 
ATOM   8619  C  CB  . LYS C 1 172 ? 129.945 135.644 67.422  1.00 19.46 ? 169  LYS C CB  1 
ATOM   8620  C  CG  . LYS C 1 172 ? 130.301 134.766 66.208  1.00 21.68 ? 169  LYS C CG  1 
ATOM   8621  C  CD  . LYS C 1 172 ? 131.421 133.795 66.595  1.00 27.27 ? 169  LYS C CD  1 
ATOM   8622  C  CE  . LYS C 1 172 ? 131.668 132.691 65.577  1.00 29.58 ? 169  LYS C CE  1 
ATOM   8623  N  NZ  . LYS C 1 172 ? 132.273 133.192 64.331  1.00 31.08 ? 169  LYS C NZ  1 
ATOM   8624  N  N   . GLU C 1 173 ? 128.645 137.976 69.245  1.00 20.56 ? 170  GLU C N   1 
ATOM   8625  C  CA  . GLU C 1 173 ? 128.112 138.313 70.570  1.00 22.59 ? 170  GLU C CA  1 
ATOM   8626  C  C   . GLU C 1 173 ? 126.686 138.833 70.539  1.00 22.14 ? 170  GLU C C   1 
ATOM   8627  O  O   . GLU C 1 173 ? 125.874 138.460 71.391  1.00 22.71 ? 170  GLU C O   1 
ATOM   8628  C  CB  . GLU C 1 173 ? 129.038 139.273 71.345  1.00 24.24 ? 170  GLU C CB  1 
ATOM   8629  C  CG  . GLU C 1 173 ? 128.388 139.906 72.619  1.00 29.42 ? 170  GLU C CG  1 
ATOM   8630  C  CD  . GLU C 1 173 ? 127.673 138.896 73.550  1.00 35.56 ? 170  GLU C CD  1 
ATOM   8631  O  OE1 . GLU C 1 173 ? 127.885 137.666 73.427  1.00 39.60 ? 170  GLU C OE1 1 
ATOM   8632  O  OE2 . GLU C 1 173 ? 126.879 139.348 74.412  1.00 38.61 ? 170  GLU C OE2 1 
ATOM   8633  N  N   . GLU C 1 174 ? 126.375 139.706 69.586  1.00 21.09 ? 171  GLU C N   1 
ATOM   8634  C  CA  . GLU C 1 174 ? 125.026 140.209 69.476  1.00 20.92 ? 171  GLU C CA  1 
ATOM   8635  C  C   . GLU C 1 174 ? 124.089 139.107 68.937  1.00 20.11 ? 171  GLU C C   1 
ATOM   8636  O  O   . GLU C 1 174 ? 122.913 139.049 69.294  1.00 19.69 ? 171  GLU C O   1 
ATOM   8637  C  CB  . GLU C 1 174 ? 124.986 141.452 68.586  1.00 22.08 ? 171  GLU C CB  1 
ATOM   8638  C  CG  . GLU C 1 174 ? 123.580 141.957 68.276  1.00 25.14 ? 171  GLU C CG  1 
ATOM   8639  C  CD  . GLU C 1 174 ? 122.795 142.386 69.510  1.00 29.40 ? 171  GLU C CD  1 
ATOM   8640  O  OE1 . GLU C 1 174 ? 123.390 142.990 70.433  1.00 28.29 ? 171  GLU C OE1 1 
ATOM   8641  O  OE2 . GLU C 1 174 ? 121.565 142.157 69.531  1.00 32.82 ? 171  GLU C OE2 1 
ATOM   8642  N  N   . ALA C 1 175 ? 124.607 138.231 68.079  1.00 19.22 ? 172  ALA C N   1 
ATOM   8643  C  CA  . ALA C 1 175 ? 123.773 137.157 67.517  1.00 17.99 ? 172  ALA C CA  1 
ATOM   8644  C  C   . ALA C 1 175 ? 123.303 136.256 68.638  1.00 17.48 ? 172  ALA C C   1 
ATOM   8645  O  O   . ALA C 1 175 ? 122.150 135.815 68.648  1.00 16.13 ? 172  ALA C O   1 
ATOM   8646  C  CB  . ALA C 1 175 ? 124.532 136.360 66.479  1.00 17.32 ? 172  ALA C CB  1 
ATOM   8647  N  N   . ARG C 1 176 ? 124.202 135.979 69.579  1.00 16.62 ? 173  ARG C N   1 
ATOM   8648  C  CA  . ARG C 1 176 ? 123.885 135.153 70.732  1.00 17.74 ? 173  ARG C CA  1 
ATOM   8649  C  C   . ARG C 1 176 ? 122.622 135.651 71.446  1.00 17.43 ? 173  ARG C C   1 
ATOM   8650  O  O   . ARG C 1 176 ? 121.818 134.863 71.929  1.00 16.21 ? 173  ARG C O   1 
ATOM   8651  C  CB  . ARG C 1 176 ? 125.016 135.199 71.742  1.00 18.63 ? 173  ARG C CB  1 
ATOM   8652  C  CG  . ARG C 1 176 ? 124.707 134.407 72.999  1.00 23.59 ? 173  ARG C CG  1 
ATOM   8653  C  CD  . ARG C 1 176 ? 125.679 134.716 74.126  1.00 25.03 ? 173  ARG C CD  1 
ATOM   8654  N  NE  . ARG C 1 176 ? 125.505 136.081 74.607  1.00 28.37 ? 173  ARG C NE  1 
ATOM   8655  C  CZ  . ARG C 1 176 ? 124.578 136.451 75.483  1.00 26.25 ? 173  ARG C CZ  1 
ATOM   8656  N  NH1 . ARG C 1 176 ? 123.714 135.570 75.962  1.00 26.22 ? 173  ARG C NH1 1 
ATOM   8657  N  NH2 . ARG C 1 176 ? 124.503 137.716 75.868  1.00 30.38 ? 173  ARG C NH2 1 
ATOM   8658  N  N   . LYS C 1 177 ? 122.460 136.967 71.521  1.00 15.95 ? 174  LYS C N   1 
ATOM   8659  C  CA  . LYS C 1 177 ? 121.308 137.537 72.198  1.00 16.94 ? 174  LYS C CA  1 
ATOM   8660  C  C   . LYS C 1 177 ? 120.026 137.470 71.366  1.00 14.85 ? 174  LYS C C   1 
ATOM   8661  O  O   . LYS C 1 177 ? 118.951 137.787 71.858  1.00 14.39 ? 174  LYS C O   1 
ATOM   8662  C  CB  . LYS C 1 177 ? 121.639 138.977 72.642  1.00 17.94 ? 174  LYS C CB  1 
ATOM   8663  C  CG  . LYS C 1 177 ? 122.688 138.966 73.779  1.00 20.83 ? 174  LYS C CG  1 
ATOM   8664  C  CD  . LYS C 1 177 ? 123.006 140.312 74.403  1.00 26.38 ? 174  LYS C CD  1 
ATOM   8665  C  CE  . LYS C 1 177 ? 123.890 141.157 73.545  1.00 30.58 ? 174  LYS C CE  1 
ATOM   8666  N  NZ  . LYS C 1 177 ? 124.354 142.375 74.282  1.00 31.34 ? 174  LYS C NZ  1 
ATOM   8667  N  N   . ARG C 1 178 ? 120.146 137.009 70.130  1.00 12.90 ? 175  ARG C N   1 
ATOM   8668  C  CA  . ARG C 1 178 ? 119.010 136.934 69.216  1.00 12.74 ? 175  ARG C CA  1 
ATOM   8669  C  C   . ARG C 1 178 ? 118.622 135.499 68.858  1.00 13.07 ? 175  ARG C C   1 
ATOM   8670  O  O   . ARG C 1 178 ? 117.811 135.277 67.949  1.00 12.04 ? 175  ARG C O   1 
ATOM   8671  C  CB  . ARG C 1 178 ? 119.305 137.757 67.958  1.00 11.28 ? 175  ARG C CB  1 
ATOM   8672  C  CG  . ARG C 1 178 ? 119.344 139.242 68.233  1.00 11.93 ? 175  ARG C CG  1 
ATOM   8673  C  CD  . ARG C 1 178 ? 119.719 140.073 67.034  1.00 11.83 ? 175  ARG C CD  1 
ATOM   8674  N  NE  . ARG C 1 178 ? 119.494 141.479 67.332  1.00 9.78  ? 175  ARG C NE  1 
ATOM   8675  C  CZ  . ARG C 1 178 ? 118.346 142.115 67.119  1.00 13.11 ? 175  ARG C CZ  1 
ATOM   8676  N  NH1 . ARG C 1 178 ? 117.314 141.491 66.588  1.00 14.70 ? 175  ARG C NH1 1 
ATOM   8677  N  NH2 . ARG C 1 178 ? 118.216 143.375 67.457  1.00 10.88 ? 175  ARG C NH2 1 
ATOM   8678  N  N   . ILE C 1 179 ? 119.196 134.532 69.577  1.00 12.70 ? 176  ILE C N   1 
ATOM   8679  C  CA  . ILE C 1 179 ? 118.873 133.125 69.349  1.00 12.35 ? 176  ILE C CA  1 
ATOM   8680  C  C   . ILE C 1 179 ? 118.231 132.530 70.596  1.00 12.54 ? 176  ILE C C   1 
ATOM   8681  O  O   . ILE C 1 179 ? 118.767 132.640 71.719  1.00 14.29 ? 176  ILE C O   1 
ATOM   8682  C  CB  . ILE C 1 179 ? 120.110 132.303 68.928  1.00 12.05 ? 176  ILE C CB  1 
ATOM   8683  C  CG1 . ILE C 1 179 ? 120.636 132.842 67.596  1.00 12.04 ? 176  ILE C CG1 1 
ATOM   8684  C  CG2 . ILE C 1 179 ? 119.738 130.794 68.778  1.00 10.53 ? 176  ILE C CG2 1 
ATOM   8685  C  CD1 . ILE C 1 179 ? 122.024 132.284 67.180  1.00 13.21 ? 176  ILE C CD1 1 
ATOM   8686  N  N   . TYR C 1 180 ? 117.088 131.888 70.384  1.00 12.14 ? 177  TYR C N   1 
ATOM   8687  C  CA  . TYR C 1 180 ? 116.308 131.249 71.450  1.00 13.02 ? 177  TYR C CA  1 
ATOM   8688  C  C   . TYR C 1 180 ? 116.158 129.782 71.062  1.00 12.45 ? 177  TYR C C   1 
ATOM   8689  O  O   . TYR C 1 180 ? 115.570 129.469 70.039  1.00 15.00 ? 177  TYR C O   1 
ATOM   8690  C  CB  . TYR C 1 180 ? 114.947 131.947 71.596  1.00 12.01 ? 177  TYR C CB  1 
ATOM   8691  C  CG  . TYR C 1 180 ? 115.098 133.451 71.807  1.00 13.76 ? 177  TYR C CG  1 
ATOM   8692  C  CD1 . TYR C 1 180 ? 115.376 134.308 70.742  1.00 10.83 ? 177  TYR C CD1 1 
ATOM   8693  C  CD2 . TYR C 1 180 ? 114.980 134.003 73.074  1.00 13.91 ? 177  TYR C CD2 1 
ATOM   8694  C  CE1 . TYR C 1 180 ? 115.555 135.683 70.946  1.00 10.38 ? 177  TYR C CE1 1 
ATOM   8695  C  CE2 . TYR C 1 180 ? 115.142 135.358 73.288  1.00 15.56 ? 177  TYR C CE2 1 
ATOM   8696  C  CZ  . TYR C 1 180 ? 115.428 136.197 72.225  1.00 15.41 ? 177  TYR C CZ  1 
ATOM   8697  O  OH  . TYR C 1 180 ? 115.597 137.544 72.479  1.00 18.77 ? 177  TYR C OH  1 
ATOM   8698  N  N   . ALA C 1 181 ? 116.731 128.898 71.878  1.00 12.12 ? 178  ALA C N   1 
ATOM   8699  C  CA  . ALA C 1 181 ? 116.711 127.483 71.632  1.00 12.77 ? 178  ALA C CA  1 
ATOM   8700  C  C   . ALA C 1 181 ? 115.690 126.781 72.523  1.00 12.81 ? 178  ALA C C   1 
ATOM   8701  O  O   . ALA C 1 181 ? 115.706 126.947 73.724  1.00 11.78 ? 178  ALA C O   1 
ATOM   8702  C  CB  . ALA C 1 181 ? 118.097 126.906 71.863  1.00 12.91 ? 178  ALA C CB  1 
ATOM   8703  N  N   . THR C 1 182 ? 114.806 126.002 71.911  1.00 11.47 ? 179  THR C N   1 
ATOM   8704  C  CA  . THR C 1 182 ? 113.773 125.269 72.625  1.00 10.81 ? 179  THR C CA  1 
ATOM   8705  C  C   . THR C 1 182 ? 114.117 123.805 72.341  1.00 11.11 ? 179  THR C C   1 
ATOM   8706  O  O   . THR C 1 182 ? 114.021 123.343 71.193  1.00 10.38 ? 179  THR C O   1 
ATOM   8707  C  CB  . THR C 1 182 ? 112.369 125.660 72.123  1.00 10.56 ? 179  THR C CB  1 
ATOM   8708  O  OG1 . THR C 1 182 ? 112.116 127.063 72.399  1.00 10.77 ? 179  THR C OG1 1 
ATOM   8709  C  CG2 . THR C 1 182 ? 111.269 124.811 72.799  1.00 8.41  ? 179  THR C CG2 1 
ATOM   8710  N  N   . THR C 1 183 ? 114.520 123.072 73.374  1.00 12.22 ? 180  THR C N   1 
ATOM   8711  C  CA  . THR C 1 183 ? 114.992 121.717 73.167  1.00 12.54 ? 180  THR C CA  1 
ATOM   8712  C  C   . THR C 1 183 ? 114.919 120.854 74.432  1.00 13.84 ? 180  THR C C   1 
ATOM   8713  O  O   . THR C 1 183 ? 114.327 121.247 75.451  1.00 13.31 ? 180  THR C O   1 
ATOM   8714  C  CB  . THR C 1 183 ? 116.455 121.794 72.613  1.00 13.47 ? 180  THR C CB  1 
ATOM   8715  O  OG1 . THR C 1 183 ? 116.973 120.480 72.324  1.00 17.22 ? 180  THR C OG1 1 
ATOM   8716  C  CG2 . THR C 1 183 ? 117.374 122.515 73.609  1.00 16.62 ? 180  THR C CG2 1 
ATOM   8717  N  N   . ASP C 1 184 ? 115.509 119.669 74.370  1.00 14.67 ? 181  ASP C N   1 
ATOM   8718  C  CA  . ASP C 1 184 ? 115.501 118.774 75.515  1.00 16.82 ? 181  ASP C CA  1 
ATOM   8719  C  C   . ASP C 1 184 ? 116.177 119.461 76.712  1.00 15.97 ? 181  ASP C C   1 
ATOM   8720  O  O   . ASP C 1 184 ? 117.032 120.344 76.535  1.00 13.87 ? 181  ASP C O   1 
ATOM   8721  C  CB  . ASP C 1 184 ? 116.217 117.467 75.196  1.00 17.71 ? 181  ASP C CB  1 
ATOM   8722  C  CG  . ASP C 1 184 ? 115.903 116.395 76.203  1.00 23.33 ? 181  ASP C CG  1 
ATOM   8723  O  OD1 . ASP C 1 184 ? 114.757 115.877 76.160  1.00 28.83 ? 181  ASP C OD1 1 
ATOM   8724  O  OD2 . ASP C 1 184 ? 116.787 116.090 77.040  1.00 23.76 ? 181  ASP C OD2 1 
ATOM   8725  N  N   . LYS C 1 185 ? 115.772 119.075 77.923  1.00 15.40 ? 182  LYS C N   1 
ATOM   8726  C  CA  . LYS C 1 185 ? 116.323 119.683 79.140  1.00 17.05 ? 182  LYS C CA  1 
ATOM   8727  C  C   . LYS C 1 185 ? 117.761 119.248 79.388  1.00 17.67 ? 182  LYS C C   1 
ATOM   8728  O  O   . LYS C 1 185 ? 118.483 119.911 80.122  1.00 17.01 ? 182  LYS C O   1 
ATOM   8729  C  CB  . LYS C 1 185 ? 115.486 119.335 80.379  1.00 16.92 ? 182  LYS C CB  1 
ATOM   8730  C  CG  . LYS C 1 185 ? 115.542 117.856 80.783  1.00 19.44 ? 182  LYS C CG  1 
ATOM   8731  C  CD  . LYS C 1 185 ? 114.631 117.553 81.961  1.00 24.11 ? 182  LYS C CD  1 
ATOM   8732  C  CE  . LYS C 1 185 ? 114.600 116.064 82.273  1.00 27.35 ? 182  LYS C CE  1 
ATOM   8733  N  NZ  . LYS C 1 185 ? 113.646 115.739 83.366  1.00 30.69 ? 182  LYS C NZ  1 
ATOM   8734  N  N   . ALA C 1 186 ? 118.177 118.135 78.800  1.00 19.57 ? 183  ALA C N   1 
ATOM   8735  C  CA  . ALA C 1 186 ? 119.532 117.654 79.045  1.00 22.49 ? 183  ALA C CA  1 
ATOM   8736  C  C   . ALA C 1 186 ? 120.244 117.000 77.877  1.00 23.85 ? 183  ALA C C   1 
ATOM   8737  O  O   . ALA C 1 186 ? 121.448 117.114 77.774  1.00 26.31 ? 183  ALA C O   1 
ATOM   8738  C  CB  . ALA C 1 186 ? 119.517 116.683 80.238  1.00 22.52 ? 183  ALA C CB  1 
ATOM   8739  N  N   . ARG C 1 187 ? 119.524 116.334 76.986  1.00 25.72 ? 184  ARG C N   1 
ATOM   8740  C  CA  . ARG C 1 187 ? 120.189 115.620 75.899  1.00 26.69 ? 184  ARG C CA  1 
ATOM   8741  C  C   . ARG C 1 187 ? 120.201 116.319 74.558  1.00 24.79 ? 184  ARG C C   1 
ATOM   8742  O  O   . ARG C 1 187 ? 119.421 117.242 74.307  1.00 24.26 ? 184  ARG C O   1 
ATOM   8743  C  CB  . ARG C 1 187 ? 119.465 114.302 75.652  1.00 27.49 ? 184  ARG C CB  1 
ATOM   8744  C  CG  . ARG C 1 187 ? 119.063 113.532 76.884  1.00 33.25 ? 184  ARG C CG  1 
ATOM   8745  C  CD  . ARG C 1 187 ? 118.377 112.247 76.442  1.00 40.32 ? 184  ARG C CD  1 
ATOM   8746  N  NE  . ARG C 1 187 ? 117.436 111.738 77.434  1.00 45.13 ? 184  ARG C NE  1 
ATOM   8747  C  CZ  . ARG C 1 187 ? 116.122 111.964 77.412  1.00 49.72 ? 184  ARG C CZ  1 
ATOM   8748  N  NH1 . ARG C 1 187 ? 115.566 112.684 76.436  1.00 50.83 ? 184  ARG C NH1 1 
ATOM   8749  N  NH2 . ARG C 1 187 ? 115.352 111.449 78.364  1.00 51.88 ? 184  ARG C NH2 1 
ATOM   8750  N  N   . GLY C 1 188 ? 121.067 115.821 73.680  1.00 23.64 ? 185  GLY C N   1 
ATOM   8751  C  CA  . GLY C 1 188 ? 121.145 116.300 72.292  1.00 23.36 ? 185  GLY C CA  1 
ATOM   8752  C  C   . GLY C 1 188 ? 122.156 117.365 71.924  1.00 21.79 ? 185  GLY C C   1 
ATOM   8753  O  O   . GLY C 1 188 ? 122.740 118.055 72.774  1.00 22.31 ? 185  GLY C O   1 
ATOM   8754  N  N   . ALA C 1 189 ? 122.348 117.500 70.625  1.00 19.63 ? 186  ALA C N   1 
ATOM   8755  C  CA  . ALA C 1 189 ? 123.276 118.465 70.083  1.00 18.58 ? 186  ALA C CA  1 
ATOM   8756  C  C   . ALA C 1 189 ? 122.831 119.909 70.313  1.00 17.50 ? 186  ALA C C   1 
ATOM   8757  O  O   . ALA C 1 189 ? 123.668 120.767 70.537  1.00 17.41 ? 186  ALA C O   1 
ATOM   8758  C  CB  . ALA C 1 189 ? 123.467 118.215 68.595  1.00 18.00 ? 186  ALA C CB  1 
ATOM   8759  N  N   . LEU C 1 190 ? 121.525 120.179 70.282  1.00 16.81 ? 187  LEU C N   1 
ATOM   8760  C  CA  . LEU C 1 190 ? 121.035 121.558 70.436  1.00 15.92 ? 187  LEU C CA  1 
ATOM   8761  C  C   . LEU C 1 190 ? 121.215 122.058 71.865  1.00 15.95 ? 187  LEU C C   1 
ATOM   8762  O  O   . LEU C 1 190 ? 121.731 123.156 72.086  1.00 16.28 ? 187  LEU C O   1 
ATOM   8763  C  CB  . LEU C 1 190 ? 119.581 121.694 69.954  1.00 17.18 ? 187  LEU C CB  1 
ATOM   8764  C  CG  . LEU C 1 190 ? 119.002 123.108 69.904  1.00 14.01 ? 187  LEU C CG  1 
ATOM   8765  C  CD1 . LEU C 1 190 ? 119.942 124.082 69.140  1.00 13.34 ? 187  LEU C CD1 1 
ATOM   8766  C  CD2 . LEU C 1 190 ? 117.611 123.101 69.291  1.00 12.98 ? 187  LEU C CD2 1 
ATOM   8767  N  N   . LYS C 1 191 ? 120.830 121.251 72.836  1.00 14.78 ? 188  LYS C N   1 
ATOM   8768  C  CA  . LYS C 1 191 ? 121.010 121.634 74.241  1.00 15.46 ? 188  LYS C CA  1 
ATOM   8769  C  C   . LYS C 1 191 ? 122.495 121.874 74.517  1.00 14.83 ? 188  LYS C C   1 
ATOM   8770  O  O   . LYS C 1 191 ? 122.858 122.864 75.141  1.00 15.25 ? 188  LYS C O   1 
ATOM   8771  C  CB  . LYS C 1 191 ? 120.420 120.569 75.183  1.00 14.98 ? 188  LYS C CB  1 
ATOM   8772  C  CG  . LYS C 1 191 ? 120.686 120.800 76.682  1.00 16.10 ? 188  LYS C CG  1 
ATOM   8773  C  CD  . LYS C 1 191 ? 120.162 122.131 77.200  1.00 17.50 ? 188  LYS C CD  1 
ATOM   8774  C  CE  . LYS C 1 191 ? 120.458 122.255 78.720  1.00 21.81 ? 188  LYS C CE  1 
ATOM   8775  N  NZ  . LYS C 1 191 ? 120.132 123.604 79.247  1.00 29.49 ? 188  LYS C NZ  1 
ATOM   8776  N  N   . THR C 1 192 ? 123.358 120.994 74.022  1.00 15.44 ? 189  THR C N   1 
ATOM   8777  C  CA  . THR C 1 192 ? 124.803 121.179 74.205  1.00 15.60 ? 189  THR C CA  1 
ATOM   8778  C  C   . THR C 1 192 ? 125.275 122.490 73.562  1.00 15.00 ? 189  THR C C   1 
ATOM   8779  O  O   . THR C 1 192 ? 126.027 123.236 74.167  1.00 13.81 ? 189  THR C O   1 
ATOM   8780  C  CB  . THR C 1 192 ? 125.618 120.032 73.607  1.00 16.24 ? 189  THR C CB  1 
ATOM   8781  O  OG1 . THR C 1 192 ? 125.186 118.801 74.182  1.00 16.87 ? 189  THR C OG1 1 
ATOM   8782  C  CG2 . THR C 1 192 ? 127.160 120.236 73.857  1.00 12.19 ? 189  THR C CG2 1 
ATOM   8783  N  N   . LEU C 1 193 ? 124.825 122.758 72.339  1.00 14.97 ? 190  LEU C N   1 
ATOM   8784  C  CA  . LEU C 1 193 ? 125.195 123.981 71.634  1.00 15.84 ? 190  LEU C CA  1 
ATOM   8785  C  C   . LEU C 1 193 ? 124.681 125.203 72.376  1.00 16.12 ? 190  LEU C C   1 
ATOM   8786  O  O   . LEU C 1 193 ? 125.420 126.172 72.590  1.00 17.66 ? 190  LEU C O   1 
ATOM   8787  C  CB  . LEU C 1 193 ? 124.641 123.998 70.208  1.00 16.26 ? 190  LEU C CB  1 
ATOM   8788  C  CG  . LEU C 1 193 ? 124.924 125.288 69.399  1.00 19.72 ? 190  LEU C CG  1 
ATOM   8789  C  CD1 . LEU C 1 193 ? 126.429 125.532 69.220  1.00 17.65 ? 190  LEU C CD1 1 
ATOM   8790  C  CD2 . LEU C 1 193 ? 124.259 125.205 68.059  1.00 22.87 ? 190  LEU C CD2 1 
ATOM   8791  N  N   . ALA C 1 194 ? 123.418 125.156 72.767  1.00 15.58 ? 191  ALA C N   1 
ATOM   8792  C  CA  . ALA C 1 194 ? 122.803 126.264 73.469  1.00 16.00 ? 191  ALA C CA  1 
ATOM   8793  C  C   . ALA C 1 194 ? 123.551 126.524 74.776  1.00 16.02 ? 191  ALA C C   1 
ATOM   8794  O  O   . ALA C 1 194 ? 123.805 127.680 75.119  1.00 16.55 ? 191  ALA C O   1 
ATOM   8795  C  CB  . ALA C 1 194 ? 121.309 125.980 73.715  1.00 15.18 ? 191  ALA C CB  1 
ATOM   8796  N  N   . ASP C 1 195 ? 123.882 125.463 75.512  1.00 15.41 ? 192  ASP C N   1 
ATOM   8797  C  CA  . ASP C 1 195 ? 124.679 125.608 76.746  1.00 16.16 ? 192  ASP C CA  1 
ATOM   8798  C  C   . ASP C 1 195 ? 126.051 126.275 76.439  1.00 15.59 ? 192  ASP C C   1 
ATOM   8799  O  O   . ASP C 1 195 ? 126.511 127.152 77.167  1.00 15.38 ? 192  ASP C O   1 
ATOM   8800  C  CB  . ASP C 1 195 ? 124.969 124.252 77.414  1.00 16.72 ? 192  ASP C CB  1 
ATOM   8801  C  CG  . ASP C 1 195 ? 123.776 123.670 78.200  1.00 21.91 ? 192  ASP C CG  1 
ATOM   8802  O  OD1 . ASP C 1 195 ? 122.769 124.375 78.453  1.00 22.16 ? 192  ASP C OD1 1 
ATOM   8803  O  OD2 . ASP C 1 195 ? 123.887 122.483 78.593  1.00 27.93 ? 192  ASP C OD2 1 
ATOM   8804  N  N   . ASN C 1 196 ? 126.717 125.825 75.381  1.00 15.36 ? 193  ASN C N   1 
ATOM   8805  C  CA  . ASN C 1 196 ? 128.041 126.364 75.037  1.00 15.30 ? 193  ASN C CA  1 
ATOM   8806  C  C   . ASN C 1 196 ? 128.031 127.819 74.601  1.00 15.60 ? 193  ASN C C   1 
ATOM   8807  O  O   . ASN C 1 196 ? 128.914 128.597 74.986  1.00 14.12 ? 193  ASN C O   1 
ATOM   8808  C  CB  . ASN C 1 196 ? 128.705 125.517 73.943  1.00 16.64 ? 193  ASN C CB  1 
ATOM   8809  C  CG  . ASN C 1 196 ? 129.092 124.143 74.432  1.00 18.14 ? 193  ASN C CG  1 
ATOM   8810  O  OD1 . ASN C 1 196 ? 129.007 123.856 75.622  1.00 18.98 ? 193  ASN C OD1 1 
ATOM   8811  N  ND2 . ASN C 1 196 ? 129.539 123.290 73.519  1.00 20.17 ? 193  ASN C ND2 1 
ATOM   8812  N  N   . GLU C 1 197 ? 127.023 128.192 73.822  1.00 14.85 ? 194  GLU C N   1 
ATOM   8813  C  CA  . GLU C 1 197 ? 126.931 129.552 73.303  1.00 15.56 ? 194  GLU C CA  1 
ATOM   8814  C  C   . GLU C 1 197 ? 126.212 130.542 74.218  1.00 15.65 ? 194  GLU C C   1 
ATOM   8815  O  O   . GLU C 1 197 ? 126.321 131.742 74.013  1.00 16.16 ? 194  GLU C O   1 
ATOM   8816  C  CB  . GLU C 1 197 ? 126.256 129.535 71.931  1.00 14.93 ? 194  GLU C CB  1 
ATOM   8817  C  CG  . GLU C 1 197 ? 126.976 128.660 70.925  1.00 18.90 ? 194  GLU C CG  1 
ATOM   8818  C  CD  . GLU C 1 197 ? 128.390 129.153 70.648  1.00 24.40 ? 194  GLU C CD  1 
ATOM   8819  O  OE1 . GLU C 1 197 ? 128.564 130.398 70.575  1.00 22.22 ? 194  GLU C OE1 1 
ATOM   8820  O  OE2 . GLU C 1 197 ? 129.309 128.305 70.485  1.00 20.03 ? 194  GLU C OE2 1 
ATOM   8821  N  N   . GLY C 1 198 ? 125.479 130.054 75.213  1.00 15.11 ? 195  GLY C N   1 
ATOM   8822  C  CA  . GLY C 1 198 ? 124.776 130.928 76.125  1.00 15.27 ? 195  GLY C CA  1 
ATOM   8823  C  C   . GLY C 1 198 ? 123.449 131.459 75.596  1.00 16.25 ? 195  GLY C C   1 
ATOM   8824  O  O   . GLY C 1 198 ? 123.007 132.527 75.991  1.00 17.08 ? 195  GLY C O   1 
ATOM   8825  N  N   . TYR C 1 199 ? 122.798 130.721 74.709  1.00 15.13 ? 196  TYR C N   1 
ATOM   8826  C  CA  . TYR C 1 199 ? 121.510 131.178 74.209  1.00 14.96 ? 196  TYR C CA  1 
ATOM   8827  C  C   . TYR C 1 199 ? 120.426 131.008 75.276  1.00 14.72 ? 196  TYR C C   1 
ATOM   8828  O  O   . TYR C 1 199 ? 120.549 130.138 76.126  1.00 15.07 ? 196  TYR C O   1 
ATOM   8829  C  CB  . TYR C 1 199 ? 121.053 130.359 73.010  1.00 14.24 ? 196  TYR C CB  1 
ATOM   8830  C  CG  . TYR C 1 199 ? 122.005 130.229 71.834  1.00 14.41 ? 196  TYR C CG  1 
ATOM   8831  C  CD1 . TYR C 1 199 ? 122.720 131.315 71.348  1.00 16.15 ? 196  TYR C CD1 1 
ATOM   8832  C  CD2 . TYR C 1 199 ? 122.061 129.041 71.109  1.00 16.05 ? 196  TYR C CD2 1 
ATOM   8833  C  CE1 . TYR C 1 199 ? 123.572 131.182 70.230  1.00 14.34 ? 196  TYR C CE1 1 
ATOM   8834  C  CE2 . TYR C 1 199 ? 122.894 128.911 69.980  1.00 12.93 ? 196  TYR C CE2 1 
ATOM   8835  C  CZ  . TYR C 1 199 ? 123.632 129.973 69.554  1.00 14.43 ? 196  TYR C CZ  1 
ATOM   8836  O  OH  . TYR C 1 199 ? 124.436 129.828 68.437  1.00 20.80 ? 196  TYR C OH  1 
ATOM   8837  N  N   . GLU C 1 200 ? 119.395 131.861 75.260  1.00 15.01 ? 197  GLU C N   1 
ATOM   8838  C  CA  . GLU C 1 200 ? 118.233 131.674 76.137  1.00 16.12 ? 197  GLU C CA  1 
ATOM   8839  C  C   . GLU C 1 200 ? 117.695 130.303 75.725  1.00 15.30 ? 197  GLU C C   1 
ATOM   8840  O  O   . GLU C 1 200 ? 117.589 130.042 74.537  1.00 15.39 ? 197  GLU C O   1 
ATOM   8841  C  CB  . GLU C 1 200 ? 117.135 132.696 75.850  1.00 16.54 ? 197  GLU C CB  1 
ATOM   8842  C  CG  . GLU C 1 200 ? 117.302 134.035 76.500  1.00 22.71 ? 197  GLU C CG  1 
ATOM   8843  C  CD  . GLU C 1 200 ? 116.848 134.024 77.942  1.00 24.26 ? 197  GLU C CD  1 
ATOM   8844  O  OE1 . GLU C 1 200 ? 116.273 133.010 78.394  1.00 25.38 ? 197  GLU C OE1 1 
ATOM   8845  O  OE2 . GLU C 1 200 ? 117.024 135.051 78.602  1.00 28.07 ? 197  GLU C OE2 1 
ATOM   8846  N  N   . THR C 1 201 ? 117.353 129.456 76.687  1.00 14.19 ? 198  THR C N   1 
ATOM   8847  C  CA  . THR C 1 201 ? 116.866 128.113 76.392  1.00 14.70 ? 198  THR C CA  1 
ATOM   8848  C  C   . THR C 1 201 ? 115.543 127.817 77.063  1.00 14.03 ? 198  THR C C   1 
ATOM   8849  O  O   . THR C 1 201 ? 115.267 128.319 78.154  1.00 11.88 ? 198  THR C O   1 
ATOM   8850  C  CB  . THR C 1 201 ? 117.874 127.052 76.841  1.00 15.94 ? 198  THR C CB  1 
ATOM   8851  O  OG1 . THR C 1 201 ? 119.110 127.267 76.156  1.00 19.81 ? 198  THR C OG1 1 
ATOM   8852  C  CG2 . THR C 1 201 ? 117.387 125.649 76.494  1.00 19.14 ? 198  THR C CG2 1 
ATOM   8853  N  N   . PHE C 1 202 ? 114.731 126.993 76.395  1.00 14.40 ? 199  PHE C N   1 
ATOM   8854  C  CA  . PHE C 1 202 ? 113.433 126.573 76.918  1.00 12.96 ? 199  PHE C CA  1 
ATOM   8855  C  C   . PHE C 1 202 ? 113.384 125.056 76.802  1.00 12.97 ? 199  PHE C C   1 
ATOM   8856  O  O   . PHE C 1 202 ? 114.123 124.475 76.016  1.00 13.41 ? 199  PHE C O   1 
ATOM   8857  C  CB  . PHE C 1 202 ? 112.292 127.253 76.180  1.00 11.83 ? 199  PHE C CB  1 
ATOM   8858  C  CG  . PHE C 1 202 ? 112.247 128.719 76.403  1.00 14.52 ? 199  PHE C CG  1 
ATOM   8859  C  CD1 . PHE C 1 202 ? 111.684 129.234 77.559  1.00 14.20 ? 199  PHE C CD1 1 
ATOM   8860  C  CD2 . PHE C 1 202 ? 112.816 129.587 75.497  1.00 14.42 ? 199  PHE C CD2 1 
ATOM   8861  C  CE1 . PHE C 1 202 ? 111.672 130.599 77.796  1.00 16.78 ? 199  PHE C CE1 1 
ATOM   8862  C  CE2 . PHE C 1 202 ? 112.816 130.956 75.738  1.00 14.76 ? 199  PHE C CE2 1 
ATOM   8863  C  CZ  . PHE C 1 202 ? 112.250 131.458 76.879  1.00 10.95 ? 199  PHE C CZ  1 
ATOM   8864  N  N   . VAL C 1 203 ? 112.520 124.423 77.589  1.00 12.07 ? 200  VAL C N   1 
ATOM   8865  C  CA  . VAL C 1 203 ? 112.446 122.960 77.620  1.00 12.15 ? 200  VAL C CA  1 
ATOM   8866  C  C   . VAL C 1 203 ? 111.239 122.295 76.936  1.00 12.89 ? 200  VAL C C   1 
ATOM   8867  O  O   . VAL C 1 203 ? 110.109 122.724 77.111  1.00 13.57 ? 200  VAL C O   1 
ATOM   8868  C  CB  . VAL C 1 203 ? 112.464 122.477 79.093  1.00 11.32 ? 200  VAL C CB  1 
ATOM   8869  C  CG1 . VAL C 1 203 ? 112.250 120.942 79.190  1.00 11.57 ? 200  VAL C CG1 1 
ATOM   8870  C  CG2 . VAL C 1 203 ? 113.780 122.903 79.791  1.00 13.39 ? 200  VAL C CG2 1 
ATOM   8871  N  N   . ILE C 1 204 ? 111.510 121.253 76.145  1.00 14.28 ? 201  ILE C N   1 
ATOM   8872  C  CA  . ILE C 1 204 ? 110.467 120.412 75.550  1.00 15.28 ? 201  ILE C CA  1 
ATOM   8873  C  C   . ILE C 1 204 ? 110.519 119.220 76.505  1.00 13.83 ? 201  ILE C C   1 
ATOM   8874  O  O   . ILE C 1 204 ? 111.512 118.493 76.526  1.00 13.79 ? 201  ILE C O   1 
ATOM   8875  C  CB  . ILE C 1 204 ? 110.806 119.906 74.141  1.00 15.95 ? 201  ILE C CB  1 
ATOM   8876  C  CG1 . ILE C 1 204 ? 111.137 121.049 73.181  1.00 16.57 ? 201  ILE C CG1 1 
ATOM   8877  C  CG2 . ILE C 1 204 ? 109.651 119.022 73.588  1.00 18.90 ? 201  ILE C CG2 1 
ATOM   8878  C  CD1 . ILE C 1 204 ? 111.568 120.549 71.761  1.00 13.70 ? 201  ILE C CD1 1 
ATOM   8879  N  N   . PRO C 1 205 ? 109.476 119.021 77.319  1.00 14.76 ? 202  PRO C N   1 
ATOM   8880  C  CA  . PRO C 1 205 ? 109.529 117.931 78.282  1.00 15.12 ? 202  PRO C CA  1 
ATOM   8881  C  C   . PRO C 1 205 ? 109.726 116.567 77.639  1.00 15.57 ? 202  PRO C C   1 
ATOM   8882  O  O   . PRO C 1 205 ? 109.196 116.324 76.544  1.00 15.27 ? 202  PRO C O   1 
ATOM   8883  C  CB  . PRO C 1 205 ? 108.156 118.002 78.980  1.00 15.45 ? 202  PRO C CB  1 
ATOM   8884  C  CG  . PRO C 1 205 ? 107.700 119.427 78.782  1.00 14.92 ? 202  PRO C CG  1 
ATOM   8885  C  CD  . PRO C 1 205 ? 108.218 119.794 77.416  1.00 15.61 ? 202  PRO C CD  1 
ATOM   8886  N  N   . ASP C 1 206 ? 110.462 115.701 78.342  1.00 15.19 ? 203  ASP C N   1 
ATOM   8887  C  CA  . ASP C 1 206 ? 110.762 114.326 77.917  1.00 17.26 ? 203  ASP C CA  1 
ATOM   8888  C  C   . ASP C 1 206 ? 109.536 113.498 77.590  1.00 16.37 ? 203  ASP C C   1 
ATOM   8889  O  O   . ASP C 1 206 ? 109.569 112.669 76.692  1.00 15.93 ? 203  ASP C O   1 
ATOM   8890  C  CB  . ASP C 1 206 ? 111.463 113.547 79.054  1.00 19.93 ? 203  ASP C CB  1 
ATOM   8891  C  CG  . ASP C 1 206 ? 112.889 113.960 79.264  1.00 24.27 ? 203  ASP C CG  1 
ATOM   8892  O  OD1 . ASP C 1 206 ? 113.418 114.722 78.433  1.00 36.09 ? 203  ASP C OD1 1 
ATOM   8893  O  OD2 . ASP C 1 206 ? 113.495 113.499 80.250  1.00 31.51 ? 203  ASP C OD2 1 
ATOM   8894  N  N   . ASP C 1 207 ? 108.453 113.732 78.323  1.00 15.42 ? 204  ASP C N   1 
ATOM   8895  C  CA  . ASP C 1 207 ? 107.244 112.925 78.173  1.00 15.13 ? 204  ASP C CA  1 
ATOM   8896  C  C   . ASP C 1 207 ? 106.153 113.580 77.317  1.00 14.56 ? 204  ASP C C   1 
ATOM   8897  O  O   . ASP C 1 207 ? 104.966 113.230 77.429  1.00 14.22 ? 204  ASP C O   1 
ATOM   8898  C  CB  . ASP C 1 207 ? 106.712 112.567 79.566  1.00 13.93 ? 204  ASP C CB  1 
ATOM   8899  C  CG  . ASP C 1 207 ? 106.385 113.789 80.377  1.00 18.01 ? 204  ASP C CG  1 
ATOM   8900  O  OD1 . ASP C 1 207 ? 106.584 114.906 79.841  1.00 17.68 ? 204  ASP C OD1 1 
ATOM   8901  O  OD2 . ASP C 1 207 ? 105.925 113.651 81.533  1.00 20.27 ? 204  ASP C OD2 1 
ATOM   8902  N  N   . VAL C 1 208 ? 106.552 114.539 76.488  1.00 14.31 ? 205  VAL C N   1 
ATOM   8903  C  CA  . VAL C 1 208 ? 105.630 115.188 75.558  1.00 14.57 ? 205  VAL C CA  1 
ATOM   8904  C  C   . VAL C 1 208 ? 106.159 115.051 74.143  1.00 14.91 ? 205  VAL C C   1 
ATOM   8905  O  O   . VAL C 1 208 ? 107.144 115.707 73.754  1.00 15.41 ? 205  VAL C O   1 
ATOM   8906  C  CB  . VAL C 1 208 ? 105.408 116.696 75.826  1.00 14.17 ? 205  VAL C CB  1 
ATOM   8907  C  CG1 . VAL C 1 208 ? 104.535 117.289 74.718  1.00 15.93 ? 205  VAL C CG1 1 
ATOM   8908  C  CG2 . VAL C 1 208 ? 104.789 116.929 77.175  1.00 13.14 ? 205  VAL C CG2 1 
ATOM   8909  N  N   . GLY C 1 209 ? 105.499 114.201 73.370  1.00 15.08 ? 206  GLY C N   1 
ATOM   8910  C  CA  . GLY C 1 209 ? 105.864 113.986 71.980  1.00 15.50 ? 206  GLY C CA  1 
ATOM   8911  C  C   . GLY C 1 209 ? 105.555 115.220 71.148  1.00 14.46 ? 206  GLY C C   1 
ATOM   8912  O  O   . GLY C 1 209 ? 104.688 116.047 71.507  1.00 14.02 ? 206  GLY C O   1 
ATOM   8913  N  N   . GLY C 1 210 ? 106.243 115.341 70.026  1.00 12.92 ? 207  GLY C N   1 
ATOM   8914  C  CA  . GLY C 1 210 ? 106.107 116.524 69.156  1.00 13.62 ? 207  GLY C CA  1 
ATOM   8915  C  C   . GLY C 1 210 ? 104.692 116.929 68.785  1.00 12.88 ? 207  GLY C C   1 
ATOM   8916  O  O   . GLY C 1 210 ? 104.325 118.110 68.896  1.00 13.69 ? 207  GLY C O   1 
ATOM   8917  N  N   . ARG C 1 211 ? 103.873 115.958 68.383  1.00 11.33 ? 208  ARG C N   1 
ATOM   8918  C  CA  . ARG C 1 211 ? 102.502 116.270 67.956  1.00 10.75 ? 208  ARG C CA  1 
ATOM   8919  C  C   . ARG C 1 211 ? 101.600 116.768 69.092  1.00 10.79 ? 208  ARG C C   1 
ATOM   8920  O  O   . ARG C 1 211 ? 100.548 117.354 68.834  1.00 8.88  ? 208  ARG C O   1 
ATOM   8921  C  CB  . ARG C 1 211 ? 101.866 115.086 67.208  1.00 9.98  ? 208  ARG C CB  1 
ATOM   8922  C  CG  . ARG C 1 211 ? 101.784 113.786 67.938  1.00 11.48 ? 208  ARG C CG  1 
ATOM   8923  C  CD  . ARG C 1 211 ? 101.211 112.712 67.024  1.00 11.58 ? 208  ARG C CD  1 
ATOM   8924  N  NE  . ARG C 1 211 ? 101.203 111.377 67.631  1.00 13.76 ? 208  ARG C NE  1 
ATOM   8925  C  CZ  . ARG C 1 211 ? 102.217 110.526 67.593  1.00 13.26 ? 208  ARG C CZ  1 
ATOM   8926  N  NH1 . ARG C 1 211 ? 103.368 110.854 66.993  1.00 12.27 ? 208  ARG C NH1 1 
ATOM   8927  N  NH2 . ARG C 1 211 ? 102.088 109.343 68.162  1.00 10.60 ? 208  ARG C NH2 1 
ATOM   8928  N  N   . PHE C 1 212 ? 102.034 116.556 70.336  1.00 11.68 ? 209  PHE C N   1 
ATOM   8929  C  CA  . PHE C 1 212 ? 101.290 116.999 71.513  1.00 13.61 ? 209  PHE C CA  1 
ATOM   8930  C  C   . PHE C 1 212 ? 102.017 118.165 72.197  1.00 13.35 ? 209  PHE C C   1 
ATOM   8931  O  O   . PHE C 1 212 ? 101.662 118.541 73.310  1.00 14.46 ? 209  PHE C O   1 
ATOM   8932  C  CB  . PHE C 1 212 ? 101.115 115.842 72.539  1.00 12.69 ? 209  PHE C CB  1 
ATOM   8933  C  CG  . PHE C 1 212 ? 100.215 114.704 72.077  1.00 13.04 ? 209  PHE C CG  1 
ATOM   8934  C  CD1 . PHE C 1 212 ? 100.742 113.599 71.418  1.00 15.88 ? 209  PHE C CD1 1 
ATOM   8935  C  CD2 . PHE C 1 212 ? 98.845  114.716 72.355  1.00 11.34 ? 209  PHE C CD2 1 
ATOM   8936  C  CE1 . PHE C 1 212 ? 99.911  112.534 71.008  1.00 10.82 ? 209  PHE C CE1 1 
ATOM   8937  C  CE2 . PHE C 1 212 ? 98.002  113.666 71.942  1.00 10.83 ? 209  PHE C CE2 1 
ATOM   8938  C  CZ  . PHE C 1 212 ? 98.530  112.579 71.267  1.00 11.41 ? 209  PHE C CZ  1 
ATOM   8939  N  N   . SER C 1 213 ? 103.006 118.760 71.523  1.00 13.77 ? 210  SER C N   1 
ATOM   8940  C  CA  . SER C 1 213 ? 103.830 119.805 72.140  1.00 12.52 ? 210  SER C CA  1 
ATOM   8941  C  C   . SER C 1 213 ? 103.453 121.274 71.942  1.00 13.96 ? 210  SER C C   1 
ATOM   8942  O  O   . SER C 1 213 ? 104.156 122.133 72.455  1.00 14.04 ? 210  SER C O   1 
ATOM   8943  C  CB  . SER C 1 213 ? 105.296 119.644 71.669  1.00 13.31 ? 210  SER C CB  1 
ATOM   8944  O  OG  . SER C 1 213 ? 105.458 119.966 70.278  1.00 10.94 ? 210  SER C OG  1 
ATOM   8945  N  N   . VAL C 1 214 ? 102.340 121.589 71.286  1.00 13.79 ? 211  VAL C N   1 
ATOM   8946  C  CA  . VAL C 1 214 ? 102.012 123.008 71.025  1.00 13.75 ? 211  VAL C CA  1 
ATOM   8947  C  C   . VAL C 1 214 ? 101.881 123.892 72.288  1.00 14.52 ? 211  VAL C C   1 
ATOM   8948  O  O   . VAL C 1 214 ? 102.230 125.078 72.261  1.00 13.26 ? 211  VAL C O   1 
ATOM   8949  C  CB  . VAL C 1 214 ? 100.763 123.168 70.083  1.00 14.20 ? 211  VAL C CB  1 
ATOM   8950  C  CG1 . VAL C 1 214 ? 99.493  122.671 70.759  1.00 14.18 ? 211  VAL C CG1 1 
ATOM   8951  C  CG2 . VAL C 1 214 ? 100.583 124.636 69.651  1.00 15.15 ? 211  VAL C CG2 1 
ATOM   8952  N  N   . LEU C 1 215 ? 101.394 123.318 73.385  1.00 14.76 ? 212  LEU C N   1 
ATOM   8953  C  CA  . LEU C 1 215 ? 101.237 124.059 74.621  1.00 14.02 ? 212  LEU C CA  1 
ATOM   8954  C  C   . LEU C 1 215 ? 102.505 124.100 75.487  1.00 13.98 ? 212  LEU C C   1 
ATOM   8955  O  O   . LEU C 1 215 ? 102.483 124.588 76.609  1.00 14.92 ? 212  LEU C O   1 
ATOM   8956  C  CB  . LEU C 1 215 ? 100.031 123.559 75.406  1.00 13.67 ? 212  LEU C CB  1 
ATOM   8957  C  CG  . LEU C 1 215 ? 98.709  123.703 74.642  1.00 14.37 ? 212  LEU C CG  1 
ATOM   8958  C  CD1 . LEU C 1 215 ? 97.557  123.193 75.484  1.00 15.23 ? 212  LEU C CD1 1 
ATOM   8959  C  CD2 . LEU C 1 215 ? 98.442  125.154 74.202  1.00 13.22 ? 212  LEU C CD2 1 
ATOM   8960  N  N   . THR C 1 216 ? 103.615 123.592 74.964  1.00 15.14 ? 213  THR C N   1 
ATOM   8961  C  CA  . THR C 1 216 ? 104.891 123.703 75.658  1.00 13.31 ? 213  THR C CA  1 
ATOM   8962  C  C   . THR C 1 216 ? 105.497 124.970 75.038  1.00 14.24 ? 213  THR C C   1 
ATOM   8963  O  O   . THR C 1 216 ? 104.853 125.611 74.198  1.00 12.89 ? 213  THR C O   1 
ATOM   8964  C  CB  . THR C 1 216 ? 105.814 122.488 75.414  1.00 14.95 ? 213  THR C CB  1 
ATOM   8965  O  OG1 . THR C 1 216 ? 106.243 122.477 74.050  1.00 11.22 ? 213  THR C OG1 1 
ATOM   8966  C  CG2 . THR C 1 216 ? 105.104 121.152 75.772  1.00 12.39 ? 213  THR C CG2 1 
ATOM   8967  N  N   . PRO C 1 217 ? 106.725 125.346 75.431  1.00 13.61 ? 214  PRO C N   1 
ATOM   8968  C  CA  . PRO C 1 217 ? 107.310 126.560 74.826  1.00 13.77 ? 214  PRO C CA  1 
ATOM   8969  C  C   . PRO C 1 217 ? 107.431 126.466 73.296  1.00 13.21 ? 214  PRO C C   1 
ATOM   8970  O  O   . PRO C 1 217 ? 107.566 127.493 72.609  1.00 14.08 ? 214  PRO C O   1 
ATOM   8971  C  CB  . PRO C 1 217 ? 108.691 126.642 75.488  1.00 11.76 ? 214  PRO C CB  1 
ATOM   8972  C  CG  . PRO C 1 217 ? 108.479 125.998 76.810  1.00 13.56 ? 214  PRO C CG  1 
ATOM   8973  C  CD  . PRO C 1 217 ? 107.479 124.918 76.620  1.00 13.67 ? 214  PRO C CD  1 
ATOM   8974  N  N   . VAL C 1 218 ? 107.403 125.243 72.778  1.00 12.36 ? 215  VAL C N   1 
ATOM   8975  C  CA  . VAL C 1 218 ? 107.452 125.014 71.329  1.00 12.61 ? 215  VAL C CA  1 
ATOM   8976  C  C   . VAL C 1 218 ? 106.459 125.927 70.634  1.00 13.55 ? 215  VAL C C   1 
ATOM   8977  O  O   . VAL C 1 218 ? 106.808 126.638 69.696  1.00 15.91 ? 215  VAL C O   1 
ATOM   8978  C  CB  . VAL C 1 218 ? 107.129 123.544 70.972  1.00 13.08 ? 215  VAL C CB  1 
ATOM   8979  C  CG1 . VAL C 1 218 ? 106.826 123.376 69.429  1.00 12.47 ? 215  VAL C CG1 1 
ATOM   8980  C  CG2 . VAL C 1 218 ? 108.259 122.612 71.440  1.00 13.05 ? 215  VAL C CG2 1 
ATOM   8981  N  N   . GLY C 1 219 ? 105.216 125.921 71.088  1.00 13.30 ? 216  GLY C N   1 
ATOM   8982  C  CA  . GLY C 1 219 ? 104.225 126.799 70.493  1.00 12.88 ? 216  GLY C CA  1 
ATOM   8983  C  C   . GLY C 1 219 ? 104.121 128.166 71.152  1.00 13.68 ? 216  GLY C C   1 
ATOM   8984  O  O   . GLY C 1 219 ? 104.021 129.177 70.467  1.00 13.90 ? 216  GLY C O   1 
ATOM   8985  N  N   . LEU C 1 220 ? 104.187 128.182 72.484  1.00 14.14 ? 217  LEU C N   1 
ATOM   8986  C  CA  . LEU C 1 220 ? 104.001 129.391 73.267  1.00 13.86 ? 217  LEU C CA  1 
ATOM   8987  C  C   . LEU C 1 220 ? 104.898 130.584 72.942  1.00 14.44 ? 217  LEU C C   1 
ATOM   8988  O  O   . LEU C 1 220 ? 104.407 131.706 72.919  1.00 14.27 ? 217  LEU C O   1 
ATOM   8989  C  CB  . LEU C 1 220 ? 104.064 129.080 74.767  1.00 14.40 ? 217  LEU C CB  1 
ATOM   8990  C  CG  . LEU C 1 220 ? 103.022 128.093 75.326  1.00 13.99 ? 217  LEU C CG  1 
ATOM   8991  C  CD1 . LEU C 1 220 ? 103.161 128.011 76.841  1.00 16.29 ? 217  LEU C CD1 1 
ATOM   8992  C  CD2 . LEU C 1 220 ? 101.604 128.459 74.971  1.00 10.77 ? 217  LEU C CD2 1 
ATOM   8993  N  N   . LEU C 1 221 ? 106.178 130.364 72.663  1.00 14.07 ? 218  LEU C N   1 
ATOM   8994  C  CA  . LEU C 1 221 ? 107.067 131.493 72.378  1.00 14.65 ? 218  LEU C CA  1 
ATOM   8995  C  C   . LEU C 1 221 ? 106.712 132.213 71.061  1.00 14.28 ? 218  LEU C C   1 
ATOM   8996  O  O   . LEU C 1 221 ? 106.450 133.428 71.077  1.00 14.45 ? 218  LEU C O   1 
ATOM   8997  C  CB  . LEU C 1 221 ? 108.546 131.068 72.457  1.00 14.03 ? 218  LEU C CB  1 
ATOM   8998  C  CG  . LEU C 1 221 ? 109.610 132.124 72.132  1.00 17.65 ? 218  LEU C CG  1 
ATOM   8999  C  CD1 . LEU C 1 221 ? 109.449 133.436 72.964  1.00 13.08 ? 218  LEU C CD1 1 
ATOM   9000  C  CD2 . LEU C 1 221 ? 111.006 131.510 72.325  1.00 16.23 ? 218  LEU C CD2 1 
ATOM   9001  N  N   . PRO C 1 222 ? 106.664 131.481 69.929  1.00 14.69 ? 219  PRO C N   1 
ATOM   9002  C  CA  . PRO C 1 222 ? 106.284 132.146 68.664  1.00 14.30 ? 219  PRO C CA  1 
ATOM   9003  C  C   . PRO C 1 222 ? 104.855 132.750 68.705  1.00 13.94 ? 219  PRO C C   1 
ATOM   9004  O  O   . PRO C 1 222 ? 104.609 133.830 68.158  1.00 12.80 ? 219  PRO C O   1 
ATOM   9005  C  CB  . PRO C 1 222 ? 106.402 131.033 67.618  1.00 14.56 ? 219  PRO C CB  1 
ATOM   9006  C  CG  . PRO C 1 222 ? 107.129 129.922 68.274  1.00 17.10 ? 219  PRO C CG  1 
ATOM   9007  C  CD  . PRO C 1 222 ? 107.027 130.061 69.736  1.00 14.85 ? 219  PRO C CD  1 
ATOM   9008  N  N   . ILE C 1 223 ? 103.939 132.062 69.378  1.00 13.91 ? 220  ILE C N   1 
ATOM   9009  C  CA  . ILE C 1 223 ? 102.570 132.544 69.546  1.00 11.90 ? 220  ILE C CA  1 
ATOM   9010  C  C   . ILE C 1 223 ? 102.577 133.876 70.294  1.00 12.58 ? 220  ILE C C   1 
ATOM   9011  O  O   . ILE C 1 223 ? 101.948 134.847 69.862  1.00 11.60 ? 220  ILE C O   1 
ATOM   9012  C  CB  . ILE C 1 223 ? 101.718 131.475 70.273  1.00 13.27 ? 220  ILE C CB  1 
ATOM   9013  C  CG1 . ILE C 1 223 ? 101.452 130.308 69.317  1.00 13.88 ? 220  ILE C CG1 1 
ATOM   9014  C  CG2 . ILE C 1 223 ? 100.378 132.069 70.756  1.00 10.64 ? 220  ILE C CG2 1 
ATOM   9015  C  CD1 . ILE C 1 223 ? 100.849 129.094 69.946  1.00 13.79 ? 220  ILE C CD1 1 
ATOM   9016  N  N   . ALA C 1 224 ? 103.346 133.950 71.381  1.00 13.09 ? 221  ALA C N   1 
ATOM   9017  C  CA  . ALA C 1 224 ? 103.438 135.175 72.163  1.00 12.40 ? 221  ALA C CA  1 
ATOM   9018  C  C   . ALA C 1 224 ? 104.111 136.304 71.379  1.00 12.88 ? 221  ALA C C   1 
ATOM   9019  O  O   . ALA C 1 224 ? 103.719 137.463 71.486  1.00 12.78 ? 221  ALA C O   1 
ATOM   9020  C  CB  . ALA C 1 224 ? 104.164 134.921 73.482  1.00 12.94 ? 221  ALA C CB  1 
ATOM   9021  N  N   . VAL C 1 225 ? 105.129 135.978 70.597  1.00 13.28 ? 222  VAL C N   1 
ATOM   9022  C  CA  . VAL C 1 225 ? 105.795 136.989 69.788  1.00 13.18 ? 222  VAL C CA  1 
ATOM   9023  C  C   . VAL C 1 225 ? 104.820 137.621 68.779  1.00 14.68 ? 222  VAL C C   1 
ATOM   9024  O  O   . VAL C 1 225 ? 104.890 138.823 68.529  1.00 15.02 ? 222  VAL C O   1 
ATOM   9025  C  CB  . VAL C 1 225 ? 107.068 136.433 69.084  1.00 13.78 ? 222  VAL C CB  1 
ATOM   9026  C  CG1 . VAL C 1 225 ? 107.584 137.402 67.978  1.00 11.51 ? 222  VAL C CG1 1 
ATOM   9027  C  CG2 . VAL C 1 225 ? 108.166 136.164 70.136  1.00 13.12 ? 222  VAL C CG2 1 
ATOM   9028  N  N   . SER C 1 226 ? 103.882 136.836 68.247  1.00 14.16 ? 223  SER C N   1 
ATOM   9029  C  CA  . SER C 1 226 ? 102.923 137.376 67.270  1.00 14.74 ? 223  SER C CA  1 
ATOM   9030  C  C   . SER C 1 226 ? 101.865 138.274 67.928  1.00 15.75 ? 223  SER C C   1 
ATOM   9031  O  O   . SER C 1 226 ? 100.948 138.754 67.251  1.00 16.36 ? 223  SER C O   1 
ATOM   9032  C  CB  . SER C 1 226 ? 102.223 136.255 66.491  1.00 14.18 ? 223  SER C CB  1 
ATOM   9033  O  OG  . SER C 1 226 ? 101.226 135.602 67.260  1.00 14.67 ? 223  SER C OG  1 
ATOM   9034  N  N   . GLY C 1 227 ? 101.967 138.452 69.250  1.00 16.04 ? 224  GLY C N   1 
ATOM   9035  C  CA  . GLY C 1 227 ? 101.056 139.309 70.001  1.00 15.28 ? 224  GLY C CA  1 
ATOM   9036  C  C   . GLY C 1 227 ? 99.857  138.649 70.644  1.00 15.16 ? 224  GLY C C   1 
ATOM   9037  O  O   . GLY C 1 227 ? 98.965  139.344 71.107  1.00 14.69 ? 224  GLY C O   1 
ATOM   9038  N  N   . LEU C 1 228 ? 99.840  137.315 70.702  1.00 14.27 ? 225  LEU C N   1 
ATOM   9039  C  CA  . LEU C 1 228 ? 98.715  136.580 71.287  1.00 14.41 ? 225  LEU C CA  1 
ATOM   9040  C  C   . LEU C 1 228 ? 98.917  136.375 72.804  1.00 14.41 ? 225  LEU C C   1 
ATOM   9041  O  O   . LEU C 1 228 ? 100.053 136.391 73.295  1.00 15.51 ? 225  LEU C O   1 
ATOM   9042  C  CB  . LEU C 1 228 ? 98.505  135.261 70.533  1.00 13.49 ? 225  LEU C CB  1 
ATOM   9043  C  CG  . LEU C 1 228 ? 98.156  135.468 69.056  1.00 13.30 ? 225  LEU C CG  1 
ATOM   9044  C  CD1 . LEU C 1 228 ? 98.163  134.137 68.281  1.00 12.41 ? 225  LEU C CD1 1 
ATOM   9045  C  CD2 . LEU C 1 228 ? 96.818  136.185 68.906  1.00 14.60 ? 225  LEU C CD2 1 
ATOM   9046  N  N   . ASN C 1 229 ? 97.806  136.232 73.528  1.00 14.19 ? 226  ASN C N   1 
ATOM   9047  C  CA  . ASN C 1 229 ? 97.802  136.088 74.997  1.00 13.80 ? 226  ASN C CA  1 
ATOM   9048  C  C   . ASN C 1 229 ? 97.890  134.623 75.433  1.00 13.16 ? 226  ASN C C   1 
ATOM   9049  O  O   . ASN C 1 229 ? 96.881  133.910 75.448  1.00 12.54 ? 226  ASN C O   1 
ATOM   9050  C  CB  . ASN C 1 229 ? 96.532  136.718 75.560  1.00 13.64 ? 226  ASN C CB  1 
ATOM   9051  C  CG  . ASN C 1 229 ? 96.504  136.745 77.084  1.00 16.17 ? 226  ASN C CG  1 
ATOM   9052  O  OD1 . ASN C 1 229 ? 97.044  135.870 77.760  1.00 17.51 ? 226  ASN C OD1 1 
ATOM   9053  N  ND2 . ASN C 1 229 ? 95.833  137.755 77.631  1.00 17.95 ? 226  ASN C ND2 1 
ATOM   9054  N  N   . ILE C 1 230 ? 99.088  134.180 75.795  1.00 12.50 ? 227  ILE C N   1 
ATOM   9055  C  CA  . ILE C 1 230 ? 99.274  132.782 76.175  1.00 14.08 ? 227  ILE C CA  1 
ATOM   9056  C  C   . ILE C 1 230 ? 98.642  132.403 77.525  1.00 14.59 ? 227  ILE C C   1 
ATOM   9057  O  O   . ILE C 1 230 ? 98.386  131.222 77.777  1.00 14.23 ? 227  ILE C O   1 
ATOM   9058  C  CB  . ILE C 1 230 ? 100.761 132.322 76.073  1.00 14.46 ? 227  ILE C CB  1 
ATOM   9059  C  CG1 . ILE C 1 230 ? 101.702 133.232 76.865  1.00 15.76 ? 227  ILE C CG1 1 
ATOM   9060  C  CG2 . ILE C 1 230 ? 101.205 132.327 74.610  1.00 14.71 ? 227  ILE C CG2 1 
ATOM   9061  C  CD1 . ILE C 1 230 ? 103.143 132.688 76.919  1.00 15.03 ? 227  ILE C CD1 1 
ATOM   9062  N  N   . GLU C 1 231 ? 98.385  133.377 78.396  1.00 16.46 ? 228  GLU C N   1 
ATOM   9063  C  CA  . GLU C 1 231 ? 97.744  133.032 79.661  1.00 17.82 ? 228  GLU C CA  1 
ATOM   9064  C  C   . GLU C 1 231 ? 96.311  132.574 79.367  1.00 17.74 ? 228  GLU C C   1 
ATOM   9065  O  O   . GLU C 1 231 ? 95.842  131.577 79.918  1.00 18.13 ? 228  GLU C O   1 
ATOM   9066  C  CB  . GLU C 1 231 ? 97.758  134.175 80.674  1.00 19.97 ? 228  GLU C CB  1 
ATOM   9067  C  CG  . GLU C 1 231 ? 97.182  133.700 82.009  1.00 24.93 ? 228  GLU C CG  1 
ATOM   9068  C  CD  . GLU C 1 231 ? 97.357  134.671 83.140  1.00 34.55 ? 228  GLU C CD  1 
ATOM   9069  O  OE1 . GLU C 1 231 ? 97.868  135.794 82.906  1.00 41.23 ? 228  GLU C OE1 1 
ATOM   9070  O  OE2 . GLU C 1 231 ? 96.985  134.299 84.278  1.00 41.13 ? 228  GLU C OE2 1 
ATOM   9071  N  N   . GLU C 1 232 ? 95.633  133.278 78.469  1.00 17.28 ? 229  GLU C N   1 
ATOM   9072  C  CA  . GLU C 1 232 ? 94.274  132.906 78.099  1.00 17.99 ? 229  GLU C CA  1 
ATOM   9073  C  C   . GLU C 1 232 ? 94.247  131.561 77.395  1.00 16.38 ? 229  GLU C C   1 
ATOM   9074  O  O   . GLU C 1 232 ? 93.328  130.772 77.598  1.00 15.90 ? 229  GLU C O   1 
ATOM   9075  C  CB  . GLU C 1 232 ? 93.613  133.997 77.253  1.00 18.76 ? 229  GLU C CB  1 
ATOM   9076  C  CG  . GLU C 1 232 ? 93.391  135.273 78.053  1.00 23.40 ? 229  GLU C CG  1 
ATOM   9077  C  CD  . GLU C 1 232 ? 92.458  135.053 79.240  1.00 32.61 ? 229  GLU C CD  1 
ATOM   9078  O  OE1 . GLU C 1 232 ? 91.411  134.382 79.062  1.00 37.96 ? 229  GLU C OE1 1 
ATOM   9079  O  OE2 . GLU C 1 232 ? 92.758  135.564 80.345  1.00 36.95 ? 229  GLU C OE2 1 
HETATM 9080  N  N   . MSE C 1 233 ? 95.274  131.289 76.592  1.00 15.70 ? 230  MSE C N   1 
HETATM 9081  C  CA  . MSE C 1 233 ? 95.364  130.031 75.875  1.00 14.37 ? 230  MSE C CA  1 
HETATM 9082  C  C   . MSE C 1 233 ? 95.505  128.864 76.844  1.00 14.00 ? 230  MSE C C   1 
HETATM 9083  O  O   . MSE C 1 233 ? 94.903  127.796 76.634  1.00 12.46 ? 230  MSE C O   1 
HETATM 9084  C  CB  . MSE C 1 233 ? 96.533  130.064 74.887  1.00 14.38 ? 230  MSE C CB  1 
HETATM 9085  C  CG  . MSE C 1 233 ? 96.640  128.851 74.015  1.00 15.41 ? 230  MSE C CG  1 
HETATM 9086  SE SE  . MSE C 1 233 ? 98.063  129.055 72.682  1.00 14.50 ? 230  MSE C SE  1 
HETATM 9087  C  CE  . MSE C 1 233 ? 97.221  130.383 71.517  1.00 12.48 ? 230  MSE C CE  1 
HETATM 9088  N  N   . MSE C 1 234 ? 96.307  129.043 77.887  1.00 14.12 ? 231  MSE C N   1 
HETATM 9089  C  CA  . MSE C 1 234 ? 96.469  127.986 78.885  1.00 15.37 ? 231  MSE C CA  1 
HETATM 9090  C  C   . MSE C 1 234 ? 95.189  127.798 79.705  1.00 14.68 ? 231  MSE C C   1 
HETATM 9091  O  O   . MSE C 1 234 ? 94.848  126.674 80.061  1.00 15.53 ? 231  MSE C O   1 
HETATM 9092  C  CB  . MSE C 1 234 ? 97.642  128.272 79.826  1.00 16.44 ? 231  MSE C CB  1 
HETATM 9093  C  CG  . MSE C 1 234 ? 99.006  128.146 79.196  1.00 21.06 ? 231  MSE C CG  1 
HETATM 9094  SE SE  . MSE C 1 234 ? 99.289  126.397 78.323  1.00 32.20 ? 231  MSE C SE  1 
HETATM 9095  C  CE  . MSE C 1 234 ? 98.684  125.324 79.641  1.00 5.37  ? 231  MSE C CE  1 
ATOM   9096  N  N   . LYS C 1 235 ? 94.489  128.886 80.018  1.00 14.67 ? 232  LYS C N   1 
ATOM   9097  C  CA  . LYS C 1 235 ? 93.241  128.769 80.790  1.00 14.90 ? 232  LYS C CA  1 
ATOM   9098  C  C   . LYS C 1 235 ? 92.218  127.960 80.015  1.00 13.75 ? 232  LYS C C   1 
ATOM   9099  O  O   . LYS C 1 235 ? 91.497  127.148 80.592  1.00 14.12 ? 232  LYS C O   1 
ATOM   9100  C  CB  . LYS C 1 235 ? 92.658  130.121 81.141  1.00 15.73 ? 232  LYS C CB  1 
ATOM   9101  C  CG  . LYS C 1 235 ? 93.455  130.899 82.162  1.00 22.23 ? 232  LYS C CG  1 
ATOM   9102  C  CD  . LYS C 1 235 ? 92.776  132.230 82.414  1.00 27.39 ? 232  LYS C CD  1 
ATOM   9103  C  CE  . LYS C 1 235 ? 93.512  133.072 83.403  1.00 30.07 ? 232  LYS C CE  1 
ATOM   9104  N  NZ  . LYS C 1 235 ? 92.819  134.386 83.523  1.00 33.89 ? 232  LYS C NZ  1 
ATOM   9105  N  N   . GLY C 1 236 ? 92.163  128.195 78.706  1.00 13.24 ? 233  GLY C N   1 
ATOM   9106  C  CA  . GLY C 1 236 ? 91.267  127.461 77.819  1.00 11.96 ? 233  GLY C CA  1 
ATOM   9107  C  C   . GLY C 1 236 ? 91.623  125.995 77.816  1.00 12.00 ? 233  GLY C C   1 
ATOM   9108  O  O   . GLY C 1 236 ? 90.745  125.139 77.878  1.00 10.69 ? 233  GLY C O   1 
ATOM   9109  N  N   . ALA C 1 237 ? 92.920  125.694 77.754  1.00 11.78 ? 234  ALA C N   1 
ATOM   9110  C  CA  . ALA C 1 237 ? 93.359  124.307 77.761  1.00 11.17 ? 234  ALA C CA  1 
ATOM   9111  C  C   . ALA C 1 237 ? 93.032  123.650 79.096  1.00 11.59 ? 234  ALA C C   1 
ATOM   9112  O  O   . ALA C 1 237 ? 92.660  122.456 79.143  1.00 10.47 ? 234  ALA C O   1 
ATOM   9113  C  CB  . ALA C 1 237 ? 94.860  124.195 77.443  1.00 11.75 ? 234  ALA C CB  1 
ATOM   9114  N  N   . ALA C 1 238 ? 93.132  124.424 80.175  1.00 11.24 ? 235  ALA C N   1 
ATOM   9115  C  CA  . ALA C 1 238 ? 92.836  123.913 81.516  1.00 12.51 ? 235  ALA C CA  1 
ATOM   9116  C  C   . ALA C 1 238 ? 91.340  123.585 81.643  1.00 12.85 ? 235  ALA C C   1 
ATOM   9117  O  O   . ALA C 1 238 ? 90.960  122.587 82.272  1.00 13.04 ? 235  ALA C O   1 
ATOM   9118  C  CB  . ALA C 1 238 ? 93.291  124.921 82.598  1.00 12.06 ? 235  ALA C CB  1 
ATOM   9119  N  N   . ALA C 1 239 ? 90.503  124.432 81.041  1.00 13.97 ? 236  ALA C N   1 
ATOM   9120  C  CA  . ALA C 1 239 ? 89.048  124.213 81.019  1.00 14.22 ? 236  ALA C CA  1 
ATOM   9121  C  C   . ALA C 1 239 ? 88.772  122.908 80.269  1.00 14.06 ? 236  ALA C C   1 
ATOM   9122  O  O   . ALA C 1 239 ? 87.939  122.100 80.671  1.00 14.29 ? 236  ALA C O   1 
ATOM   9123  C  CB  . ALA C 1 239 ? 88.337  125.385 80.336  1.00 13.10 ? 236  ALA C CB  1 
ATOM   9124  N  N   . GLY C 1 240 ? 89.493  122.693 79.180  1.00 13.81 ? 237  GLY C N   1 
ATOM   9125  C  CA  . GLY C 1 240 ? 89.338  121.477 78.414  1.00 13.64 ? 237  GLY C CA  1 
ATOM   9126  C  C   . GLY C 1 240 ? 89.739  120.274 79.247  1.00 13.87 ? 237  GLY C C   1 
ATOM   9127  O  O   . GLY C 1 240 ? 89.044  119.250 79.260  1.00 13.23 ? 237  GLY C O   1 
ATOM   9128  N  N   . ARG C 1 241 ? 90.856  120.395 79.962  1.00 12.70 ? 238  ARG C N   1 
ATOM   9129  C  CA  . ARG C 1 241 ? 91.339  119.305 80.812  1.00 13.53 ? 238  ARG C CA  1 
ATOM   9130  C  C   . ARG C 1 241 ? 90.249  118.855 81.813  1.00 14.34 ? 238  ARG C C   1 
ATOM   9131  O  O   . ARG C 1 241 ? 90.038  117.664 82.015  1.00 13.73 ? 238  ARG C O   1 
ATOM   9132  C  CB  . ARG C 1 241 ? 92.609  119.724 81.546  1.00 12.94 ? 238  ARG C CB  1 
ATOM   9133  C  CG  . ARG C 1 241 ? 93.154  118.665 82.442  1.00 14.75 ? 238  ARG C CG  1 
ATOM   9134  C  CD  . ARG C 1 241 ? 94.407  119.113 83.169  1.00 17.98 ? 238  ARG C CD  1 
ATOM   9135  N  NE  . ARG C 1 241 ? 94.707  118.150 84.218  1.00 20.02 ? 238  ARG C NE  1 
ATOM   9136  C  CZ  . ARG C 1 241 ? 94.157  118.187 85.422  1.00 21.09 ? 238  ARG C CZ  1 
ATOM   9137  N  NH1 . ARG C 1 241 ? 93.313  119.164 85.749  1.00 20.27 ? 238  ARG C NH1 1 
ATOM   9138  N  NH2 . ARG C 1 241 ? 94.473  117.263 86.313  1.00 23.47 ? 238  ARG C NH2 1 
ATOM   9139  N  N   . ASP C 1 242 ? 89.594  119.822 82.442  1.00 14.42 ? 239  ASP C N   1 
ATOM   9140  C  CA  . ASP C 1 242 ? 88.500  119.560 83.372  1.00 16.12 ? 239  ASP C CA  1 
ATOM   9141  C  C   . ASP C 1 242 ? 87.306  118.903 82.705  1.00 15.56 ? 239  ASP C C   1 
ATOM   9142  O  O   . ASP C 1 242 ? 86.805  117.878 83.173  1.00 15.66 ? 239  ASP C O   1 
ATOM   9143  C  CB  . ASP C 1 242 ? 87.985  120.871 83.971  1.00 17.27 ? 239  ASP C CB  1 
ATOM   9144  C  CG  . ASP C 1 242 ? 88.940  121.477 84.958  1.00 23.91 ? 239  ASP C CG  1 
ATOM   9145  O  OD1 . ASP C 1 242 ? 89.907  120.777 85.362  1.00 29.44 ? 239  ASP C OD1 1 
ATOM   9146  O  OD2 . ASP C 1 242 ? 88.711  122.655 85.346  1.00 28.92 ? 239  ASP C OD2 1 
ATOM   9147  N  N   . ASP C 1 243 ? 86.825  119.528 81.633  1.00 14.93 ? 240  ASP C N   1 
ATOM   9148  C  CA  . ASP C 1 243 ? 85.651  119.025 80.919  1.00 15.37 ? 240  ASP C CA  1 
ATOM   9149  C  C   . ASP C 1 243 ? 85.823  117.643 80.289  1.00 15.35 ? 240  ASP C C   1 
ATOM   9150  O  O   . ASP C 1 243 ? 84.852  116.882 80.214  1.00 15.82 ? 240  ASP C O   1 
ATOM   9151  C  CB  . ASP C 1 243 ? 85.185  120.033 79.868  1.00 14.54 ? 240  ASP C CB  1 
ATOM   9152  C  CG  . ASP C 1 243 ? 84.600  121.299 80.496  1.00 17.09 ? 240  ASP C CG  1 
ATOM   9153  O  OD1 . ASP C 1 243 ? 84.541  121.375 81.752  1.00 15.28 ? 240  ASP C OD1 1 
ATOM   9154  O  OD2 . ASP C 1 243 ? 84.176  122.206 79.746  1.00 21.01 ? 240  ASP C OD2 1 
ATOM   9155  N  N   . PHE C 1 244 ? 87.027  117.324 79.821  1.00 14.37 ? 241  PHE C N   1 
ATOM   9156  C  CA  . PHE C 1 244 ? 87.259  116.018 79.189  1.00 15.37 ? 241  PHE C CA  1 
ATOM   9157  C  C   . PHE C 1 244 ? 87.975  115.054 80.131  1.00 14.75 ? 241  PHE C C   1 
ATOM   9158  O  O   . PHE C 1 244 ? 88.540  114.051 79.704  1.00 17.65 ? 241  PHE C O   1 
ATOM   9159  C  CB  . PHE C 1 244 ? 87.979  116.183 77.847  1.00 14.56 ? 241  PHE C CB  1 
ATOM   9160  C  CG  . PHE C 1 244 ? 87.352  117.215 76.974  1.00 16.58 ? 241  PHE C CG  1 
ATOM   9161  C  CD1 . PHE C 1 244 ? 86.003  117.153 76.675  1.00 18.38 ? 241  PHE C CD1 1 
ATOM   9162  C  CD2 . PHE C 1 244 ? 88.100  118.262 76.452  1.00 16.30 ? 241  PHE C CD2 1 
ATOM   9163  C  CE1 . PHE C 1 244 ? 85.412  118.118 75.895  1.00 17.66 ? 241  PHE C CE1 1 
ATOM   9164  C  CE2 . PHE C 1 244 ? 87.514  119.226 75.674  1.00 15.04 ? 241  PHE C CE2 1 
ATOM   9165  C  CZ  . PHE C 1 244 ? 86.162  119.161 75.400  1.00 19.34 ? 241  PHE C CZ  1 
ATOM   9166  N  N   . GLY C 1 245 ? 87.879  115.348 81.422  1.00 14.93 ? 242  GLY C N   1 
ATOM   9167  C  CA  . GLY C 1 245 ? 88.473  114.543 82.481  1.00 15.61 ? 242  GLY C CA  1 
ATOM   9168  C  C   . GLY C 1 245 ? 87.498  113.557 83.109  1.00 15.71 ? 242  GLY C C   1 
ATOM   9169  O  O   . GLY C 1 245 ? 87.850  112.836 84.036  1.00 14.50 ? 242  GLY C O   1 
ATOM   9170  N  N   . THR C 1 246 ? 86.260  113.548 82.627  1.00 14.46 ? 243  THR C N   1 
ATOM   9171  C  CA  . THR C 1 246 ? 85.268  112.616 83.130  1.00 14.42 ? 243  THR C CA  1 
ATOM   9172  C  C   . THR C 1 246 ? 85.376  111.284 82.394  1.00 14.82 ? 243  THR C C   1 
ATOM   9173  O  O   . THR C 1 246 ? 85.590  111.230 81.174  1.00 15.25 ? 243  THR C O   1 
ATOM   9174  C  CB  . THR C 1 246 ? 83.851  113.151 82.982  1.00 14.01 ? 243  THR C CB  1 
ATOM   9175  O  OG1 . THR C 1 246 ? 82.923  112.155 83.421  1.00 12.64 ? 243  THR C OG1 1 
ATOM   9176  C  CG2 . THR C 1 246 ? 83.561  113.514 81.527  1.00 14.53 ? 243  THR C CG2 1 
ATOM   9177  N  N   . SER C 1 247 ? 85.273  110.204 83.149  1.00 14.78 ? 244  SER C N   1 
ATOM   9178  C  CA  . SER C 1 247 ? 85.338  108.868 82.573  1.00 15.05 ? 244  SER C CA  1 
ATOM   9179  C  C   . SER C 1 247 ? 84.018  108.442 81.892  1.00 14.38 ? 244  SER C C   1 
ATOM   9180  O  O   . SER C 1 247 ? 83.965  107.401 81.240  1.00 14.88 ? 244  SER C O   1 
ATOM   9181  C  CB  . SER C 1 247 ? 85.673  107.866 83.677  1.00 15.49 ? 244  SER C CB  1 
ATOM   9182  O  OG  . SER C 1 247 ? 84.618  107.771 84.623  1.00 15.42 ? 244  SER C OG  1 
ATOM   9183  N  N   . GLU C 1 248 ? 82.959  109.240 82.049  1.00 12.98 ? 245  GLU C N   1 
ATOM   9184  C  CA  . GLU C 1 248 ? 81.652  108.893 81.501  1.00 13.14 ? 245  GLU C CA  1 
ATOM   9185  C  C   . GLU C 1 248 ? 81.493  109.358 80.052  1.00 11.82 ? 245  GLU C C   1 
ATOM   9186  O  O   . GLU C 1 248 ? 81.486  110.551 79.769  1.00 10.52 ? 245  GLU C O   1 
ATOM   9187  C  CB  . GLU C 1 248 ? 80.536  109.477 82.371  1.00 14.93 ? 245  GLU C CB  1 
ATOM   9188  C  CG  . GLU C 1 248 ? 79.168  108.896 82.083  1.00 18.63 ? 245  GLU C CG  1 
ATOM   9189  C  CD  . GLU C 1 248 ? 79.079  107.430 82.464  1.00 24.60 ? 245  GLU C CD  1 
ATOM   9190  O  OE1 . GLU C 1 248 ? 79.389  107.088 83.631  1.00 28.63 ? 245  GLU C OE1 1 
ATOM   9191  O  OE2 . GLU C 1 248 ? 78.660  106.622 81.611  1.00 26.89 ? 245  GLU C OE2 1 
ATOM   9192  N  N   . LEU C 1 249 ? 81.341  108.391 79.148  1.00 11.27 ? 246  LEU C N   1 
ATOM   9193  C  CA  . LEU C 1 249 ? 81.208  108.650 77.710  1.00 10.70 ? 246  LEU C CA  1 
ATOM   9194  C  C   . LEU C 1 249 ? 80.104  109.650 77.336  1.00 11.02 ? 246  LEU C C   1 
ATOM   9195  O  O   . LEU C 1 249 ? 80.340  110.589 76.584  1.00 10.83 ? 246  LEU C O   1 
ATOM   9196  C  CB  . LEU C 1 249 ? 80.987  107.319 76.974  1.00 11.03 ? 246  LEU C CB  1 
ATOM   9197  C  CG  . LEU C 1 249 ? 80.761  107.339 75.446  1.00 8.51  ? 246  LEU C CG  1 
ATOM   9198  C  CD1 . LEU C 1 249 ? 81.892  108.066 74.693  1.00 7.87  ? 246  LEU C CD1 1 
ATOM   9199  C  CD2 . LEU C 1 249 ? 80.556  105.876 74.928  1.00 8.67  ? 246  LEU C CD2 1 
ATOM   9200  N  N   . GLU C 1 250 ? 78.908  109.458 77.873  1.00 11.68 ? 247  GLU C N   1 
ATOM   9201  C  CA  . GLU C 1 250 ? 77.790  110.343 77.559  1.00 12.70 ? 247  GLU C CA  1 
ATOM   9202  C  C   . GLU C 1 250 ? 78.010  111.806 78.003  1.00 12.79 ? 247  GLU C C   1 
ATOM   9203  O  O   . GLU C 1 250 ? 77.281  112.707 77.552  1.00 12.88 ? 247  GLU C O   1 
ATOM   9204  C  CB  . GLU C 1 250 ? 76.493  109.784 78.161  1.00 14.45 ? 247  GLU C CB  1 
ATOM   9205  C  CG  . GLU C 1 250 ? 76.513  109.711 79.665  1.00 18.41 ? 247  GLU C CG  1 
ATOM   9206  C  CD  . GLU C 1 250 ? 75.206  109.248 80.270  1.00 27.31 ? 247  GLU C CD  1 
ATOM   9207  O  OE1 . GLU C 1 250 ? 74.574  108.293 79.730  1.00 25.29 ? 247  GLU C OE1 1 
ATOM   9208  O  OE2 . GLU C 1 250 ? 74.842  109.841 81.320  1.00 31.62 ? 247  GLU C OE2 1 
ATOM   9209  N  N   . GLU C 1 251 ? 78.993  112.042 78.882  1.00 11.58 ? 248  GLU C N   1 
ATOM   9210  C  CA  . GLU C 1 251 ? 79.301  113.397 79.368  1.00 11.74 ? 248  GLU C CA  1 
ATOM   9211  C  C   . GLU C 1 251 ? 80.670  113.917 78.883  1.00 11.60 ? 248  GLU C C   1 
ATOM   9212  O  O   . GLU C 1 251 ? 81.115  115.011 79.291  1.00 9.93  ? 248  GLU C O   1 
ATOM   9213  C  CB  . GLU C 1 251 ? 79.263  113.444 80.907  1.00 11.83 ? 248  GLU C CB  1 
ATOM   9214  C  CG  . GLU C 1 251 ? 77.969  112.910 81.543  1.00 13.93 ? 248  GLU C CG  1 
ATOM   9215  C  CD  . GLU C 1 251 ? 76.706  113.649 81.094  1.00 16.34 ? 248  GLU C CD  1 
ATOM   9216  O  OE1 . GLU C 1 251 ? 76.778  114.858 80.738  1.00 13.99 ? 248  GLU C OE1 1 
ATOM   9217  O  OE2 . GLU C 1 251 ? 75.629  113.013 81.127  1.00 13.94 ? 248  GLU C OE2 1 
ATOM   9218  N  N   . ASN C 1 252 ? 81.332  113.148 78.014  1.00 10.67 ? 249  ASN C N   1 
ATOM   9219  C  CA  . ASN C 1 252 ? 82.644  113.529 77.506  1.00 11.45 ? 249  ASN C CA  1 
ATOM   9220  C  C   . ASN C 1 252 ? 82.643  113.656 75.982  1.00 11.87 ? 249  ASN C C   1 
ATOM   9221  O  O   . ASN C 1 252 ? 82.756  112.656 75.272  1.00 12.78 ? 249  ASN C O   1 
ATOM   9222  C  CB  . ASN C 1 252 ? 83.693  112.528 77.968  1.00 9.89  ? 249  ASN C CB  1 
ATOM   9223  C  CG  . ASN C 1 252 ? 85.102  113.038 77.761  1.00 10.82 ? 249  ASN C CG  1 
ATOM   9224  O  OD1 . ASN C 1 252 ? 85.417  113.608 76.718  1.00 12.23 ? 249  ASN C OD1 1 
ATOM   9225  N  ND2 . ASN C 1 252 ? 85.962  112.843 78.770  1.00 9.97  ? 249  ASN C ND2 1 
ATOM   9226  N  N   . PRO C 1 253 ? 82.518  114.895 75.477  1.00 12.33 ? 250  PRO C N   1 
ATOM   9227  C  CA  . PRO C 1 253 ? 82.472  115.125 74.039  1.00 13.06 ? 250  PRO C CA  1 
ATOM   9228  C  C   . PRO C 1 253 ? 83.692  114.634 73.276  1.00 11.69 ? 250  PRO C C   1 
ATOM   9229  O  O   . PRO C 1 253 ? 83.559  114.243 72.110  1.00 10.08 ? 250  PRO C O   1 
ATOM   9230  C  CB  . PRO C 1 253 ? 82.355  116.639 73.942  1.00 12.52 ? 250  PRO C CB  1 
ATOM   9231  C  CG  . PRO C 1 253 ? 81.574  117.006 75.129  1.00 14.98 ? 250  PRO C CG  1 
ATOM   9232  C  CD  . PRO C 1 253 ? 82.164  116.119 76.213  1.00 14.04 ? 250  PRO C CD  1 
ATOM   9233  N  N   . ALA C 1 254 ? 84.865  114.695 73.905  1.00 11.25 ? 251  ALA C N   1 
ATOM   9234  C  CA  . ALA C 1 254 ? 86.094  114.235 73.246  1.00 11.57 ? 251  ALA C CA  1 
ATOM   9235  C  C   . ALA C 1 254 ? 86.013  112.732 73.040  1.00 10.75 ? 251  ALA C C   1 
ATOM   9236  O  O   . ALA C 1 254 ? 86.385  112.214 71.984  1.00 12.45 ? 251  ALA C O   1 
ATOM   9237  C  CB  . ALA C 1 254 ? 87.338  114.611 74.060  1.00 10.65 ? 251  ALA C CB  1 
ATOM   9238  N  N   . TYR C 1 255 ? 85.485  112.021 74.020  1.00 10.53 ? 252  TYR C N   1 
ATOM   9239  C  CA  . TYR C 1 255 ? 85.384  110.571 73.864  1.00 11.36 ? 252  TYR C CA  1 
ATOM   9240  C  C   . TYR C 1 255 ? 84.276  110.179 72.873  1.00 10.95 ? 252  TYR C C   1 
ATOM   9241  O  O   . TYR C 1 255 ? 84.368  109.141 72.212  1.00 11.78 ? 252  TYR C O   1 
ATOM   9242  C  CB  . TYR C 1 255 ? 85.236  109.845 75.191  1.00 11.29 ? 252  TYR C CB  1 
ATOM   9243  C  CG  . TYR C 1 255 ? 86.355  110.086 76.195  1.00 9.23  ? 252  TYR C CG  1 
ATOM   9244  C  CD1 . TYR C 1 255 ? 87.632  110.466 75.790  1.00 11.67 ? 252  TYR C CD1 1 
ATOM   9245  C  CD2 . TYR C 1 255 ? 86.168  109.792 77.542  1.00 12.05 ? 252  TYR C CD2 1 
ATOM   9246  C  CE1 . TYR C 1 255 ? 88.647  110.664 76.724  1.00 13.51 ? 252  TYR C CE1 1 
ATOM   9247  C  CE2 . TYR C 1 255 ? 87.192  109.951 78.474  1.00 13.75 ? 252  TYR C CE2 1 
ATOM   9248  C  CZ  . TYR C 1 255 ? 88.423  110.390 78.058  1.00 15.18 ? 252  TYR C CZ  1 
ATOM   9249  O  OH  . TYR C 1 255 ? 89.438  110.554 78.990  1.00 17.82 ? 252  TYR C OH  1 
ATOM   9250  N  N   . GLN C 1 256 ? 83.214  110.983 72.790  1.00 11.11 ? 253  GLN C N   1 
ATOM   9251  C  CA  . GLN C 1 256 ? 82.136  110.705 71.832  1.00 10.16 ? 253  GLN C CA  1 
ATOM   9252  C  C   . GLN C 1 256 ? 82.698  110.818 70.403  1.00 10.29 ? 253  GLN C C   1 
ATOM   9253  O  O   . GLN C 1 256 ? 82.408  109.999 69.553  1.00 11.16 ? 253  GLN C O   1 
ATOM   9254  C  CB  . GLN C 1 256 ? 80.958  111.664 72.040  1.00 11.16 ? 253  GLN C CB  1 
ATOM   9255  C  CG  . GLN C 1 256 ? 80.213  111.470 73.396  1.00 11.55 ? 253  GLN C CG  1 
ATOM   9256  C  CD  . GLN C 1 256 ? 79.318  112.667 73.754  1.00 15.98 ? 253  GLN C CD  1 
ATOM   9257  O  OE1 . GLN C 1 256 ? 79.063  113.529 72.926  1.00 15.83 ? 253  GLN C OE1 1 
ATOM   9258  N  NE2 . GLN C 1 256 ? 78.888  112.736 75.011  1.00 18.11 ? 253  GLN C NE2 1 
ATOM   9259  N  N   . TYR C 1 257 ? 83.499  111.841 70.141  1.00 9.02  ? 254  TYR C N   1 
ATOM   9260  C  CA  . TYR C 1 257 ? 84.108  111.985 68.831  1.00 10.23 ? 254  TYR C CA  1 
ATOM   9261  C  C   . TYR C 1 257 ? 84.989  110.759 68.516  1.00 11.10 ? 254  TYR C C   1 
ATOM   9262  O  O   . TYR C 1 257 ? 84.908  110.186 67.423  1.00 12.52 ? 254  TYR C O   1 
ATOM   9263  C  CB  . TYR C 1 257 ? 84.877  113.305 68.771  1.00 10.02 ? 254  TYR C CB  1 
ATOM   9264  C  CG  . TYR C 1 257 ? 85.714  113.498 67.551  1.00 10.73 ? 254  TYR C CG  1 
ATOM   9265  C  CD1 . TYR C 1 257 ? 85.162  113.435 66.269  1.00 12.92 ? 254  TYR C CD1 1 
ATOM   9266  C  CD2 . TYR C 1 257 ? 87.037  113.851 67.670  1.00 13.11 ? 254  TYR C CD2 1 
ATOM   9267  C  CE1 . TYR C 1 257 ? 85.942  113.638 65.155  1.00 12.79 ? 254  TYR C CE1 1 
ATOM   9268  C  CE2 . TYR C 1 257 ? 87.820  114.052 66.571  1.00 13.72 ? 254  TYR C CE2 1 
ATOM   9269  C  CZ  . TYR C 1 257 ? 87.285  113.955 65.317  1.00 16.09 ? 254  TYR C CZ  1 
ATOM   9270  O  OH  . TYR C 1 257 ? 88.119  114.196 64.240  1.00 15.45 ? 254  TYR C OH  1 
ATOM   9271  N  N   . ALA C 1 258 ? 85.778  110.310 69.484  1.00 10.81 ? 255  ALA C N   1 
ATOM   9272  C  CA  . ALA C 1 258 ? 86.630  109.134 69.276  1.00 12.53 ? 255  ALA C CA  1 
ATOM   9273  C  C   . ALA C 1 258 ? 85.815  107.853 68.985  1.00 11.41 ? 255  ALA C C   1 
ATOM   9274  O  O   . ALA C 1 258 ? 86.195  107.034 68.144  1.00 12.23 ? 255  ALA C O   1 
ATOM   9275  C  CB  . ALA C 1 258 ? 87.531  108.905 70.506  1.00 11.08 ? 255  ALA C CB  1 
ATOM   9276  N  N   . VAL C 1 259 ? 84.738  107.656 69.733  1.00 11.98 ? 256  VAL C N   1 
ATOM   9277  C  CA  . VAL C 1 259 ? 83.871  106.487 69.568  1.00 10.67 ? 256  VAL C CA  1 
ATOM   9278  C  C   . VAL C 1 259 ? 83.191  106.535 68.187  1.00 10.84 ? 256  VAL C C   1 
ATOM   9279  O  O   . VAL C 1 259 ? 83.166  105.545 67.451  1.00 10.03 ? 256  VAL C O   1 
ATOM   9280  C  CB  . VAL C 1 259 ? 82.820  106.410 70.720  1.00 11.17 ? 256  VAL C CB  1 
ATOM   9281  C  CG1 . VAL C 1 259 ? 81.698  105.394 70.409  1.00 8.59  ? 256  VAL C CG1 1 
ATOM   9282  C  CG2 . VAL C 1 259 ? 83.501  106.071 72.049  1.00 12.44 ? 256  VAL C CG2 1 
ATOM   9283  N  N   . VAL C 1 260 ? 82.632  107.687 67.844  1.00 10.43 ? 257  VAL C N   1 
ATOM   9284  C  CA  . VAL C 1 260 ? 81.978  107.872 66.543  1.00 10.82 ? 257  VAL C CA  1 
ATOM   9285  C  C   . VAL C 1 260 ? 82.947  107.635 65.371  1.00 11.50 ? 257  VAL C C   1 
ATOM   9286  O  O   . VAL C 1 260 ? 82.590  106.927 64.427  1.00 12.30 ? 257  VAL C O   1 
ATOM   9287  C  CB  . VAL C 1 260 ? 81.319  109.267 66.426  1.00 10.96 ? 257  VAL C CB  1 
ATOM   9288  C  CG1 . VAL C 1 260 ? 80.865  109.540 65.001  1.00 11.73 ? 257  VAL C CG1 1 
ATOM   9289  C  CG2 . VAL C 1 260 ? 80.153  109.375 67.378  1.00 8.86  ? 257  VAL C CG2 1 
ATOM   9290  N  N   . ARG C 1 261 ? 84.171  108.180 65.444  1.00 12.70 ? 258  ARG C N   1 
ATOM   9291  C  CA  . ARG C 1 261 ? 85.184  107.978 64.380  1.00 13.88 ? 258  ARG C CA  1 
ATOM   9292  C  C   . ARG C 1 261 ? 85.423  106.501 64.171  1.00 13.59 ? 258  ARG C C   1 
ATOM   9293  O  O   . ARG C 1 261 ? 85.495  106.022 63.036  1.00 14.36 ? 258  ARG C O   1 
ATOM   9294  C  CB  . ARG C 1 261 ? 86.583  108.547 64.745  1.00 15.38 ? 258  ARG C CB  1 
ATOM   9295  C  CG  . ARG C 1 261 ? 86.645  109.958 65.020  1.00 19.84 ? 258  ARG C CG  1 
ATOM   9296  C  CD  . ARG C 1 261 ? 88.043  110.422 65.344  1.00 16.95 ? 258  ARG C CD  1 
ATOM   9297  N  NE  . ARG C 1 261 ? 88.882  110.551 64.146  1.00 13.01 ? 258  ARG C NE  1 
ATOM   9298  C  CZ  . ARG C 1 261 ? 89.913  109.776 63.836  1.00 12.73 ? 258  ARG C CZ  1 
ATOM   9299  N  NH1 . ARG C 1 261 ? 90.299  108.793 64.643  1.00 12.66 ? 258  ARG C NH1 1 
ATOM   9300  N  NH2 . ARG C 1 261 ? 90.601  110.021 62.720  1.00 14.43 ? 258  ARG C NH2 1 
ATOM   9301  N  N   . ASN C 1 262 ? 85.615  105.787 65.276  1.00 13.33 ? 259  ASN C N   1 
ATOM   9302  C  CA  . ASN C 1 262 ? 85.871  104.339 65.198  1.00 14.19 ? 259  ASN C CA  1 
ATOM   9303  C  C   . ASN C 1 262 ? 84.727  103.515 64.691  1.00 13.03 ? 259  ASN C C   1 
ATOM   9304  O  O   . ASN C 1 262 ? 84.963  102.510 64.031  1.00 11.71 ? 259  ASN C O   1 
ATOM   9305  C  CB  . ASN C 1 262 ? 86.396  103.736 66.495  1.00 15.09 ? 259  ASN C CB  1 
ATOM   9306  C  CG  . ASN C 1 262 ? 87.885  103.872 66.617  1.00 22.13 ? 259  ASN C CG  1 
ATOM   9307  O  OD1 . ASN C 1 262 ? 88.624  102.955 66.210  1.00 19.54 ? 259  ASN C OD1 1 
ATOM   9308  N  ND2 . ASN C 1 262 ? 88.351  105.047 67.049  1.00 20.54 ? 259  ASN C ND2 1 
ATOM   9309  N  N   . ALA C 1 263 ? 83.503  103.908 65.045  1.00 10.82 ? 260  ALA C N   1 
ATOM   9310  C  CA  . ALA C 1 263 ? 82.314  103.240 64.558  1.00 10.65 ? 260  ALA C CA  1 
ATOM   9311  C  C   . ALA C 1 263 ? 82.226  103.434 63.031  1.00 10.53 ? 260  ALA C C   1 
ATOM   9312  O  O   . ALA C 1 263 ? 81.963  102.485 62.291  1.00 11.14 ? 260  ALA C O   1 
ATOM   9313  C  CB  . ALA C 1 263 ? 81.037  103.794 65.259  1.00 9.65  ? 260  ALA C CB  1 
ATOM   9314  N  N   . LEU C 1 264 ? 82.441  104.658 62.564  1.00 10.23 ? 261  LEU C N   1 
ATOM   9315  C  CA  . LEU C 1 264 ? 82.403  104.948 61.125  1.00 10.16 ? 261  LEU C CA  1 
ATOM   9316  C  C   . LEU C 1 264 ? 83.493  104.171 60.364  1.00 10.34 ? 261  LEU C C   1 
ATOM   9317  O  O   . LEU C 1 264 ? 83.248  103.671 59.273  1.00 10.85 ? 261  LEU C O   1 
ATOM   9318  C  CB  . LEU C 1 264 ? 82.511  106.449 60.863  1.00 11.06 ? 261  LEU C CB  1 
ATOM   9319  C  CG  . LEU C 1 264 ? 81.308  107.252 61.369  1.00 11.00 ? 261  LEU C CG  1 
ATOM   9320  C  CD1 . LEU C 1 264 ? 81.530  108.769 61.278  1.00 9.00  ? 261  LEU C CD1 1 
ATOM   9321  C  CD2 . LEU C 1 264 ? 80.042  106.850 60.618  1.00 9.97  ? 261  LEU C CD2 1 
ATOM   9322  N  N   . TYR C 1 265 ? 84.682  104.076 60.940  1.00 10.35 ? 262  TYR C N   1 
ATOM   9323  C  CA  . TYR C 1 265 ? 85.779  103.308 60.343  1.00 11.19 ? 262  TYR C CA  1 
ATOM   9324  C  C   . TYR C 1 265 ? 85.355  101.850 60.151  1.00 11.75 ? 262  TYR C C   1 
ATOM   9325  O  O   . TYR C 1 265 ? 85.681  101.227 59.138  1.00 12.23 ? 262  TYR C O   1 
ATOM   9326  C  CB  . TYR C 1 265 ? 87.018  103.397 61.246  1.00 11.99 ? 262  TYR C CB  1 
ATOM   9327  C  CG  . TYR C 1 265 ? 88.252  102.673 60.765  1.00 11.97 ? 262  TYR C CG  1 
ATOM   9328  C  CD1 . TYR C 1 265 ? 89.049  103.216 59.772  1.00 12.86 ? 262  TYR C CD1 1 
ATOM   9329  C  CD2 . TYR C 1 265 ? 88.677  101.487 61.370  1.00 9.54  ? 262  TYR C CD2 1 
ATOM   9330  C  CE1 . TYR C 1 265 ? 90.219  102.581 59.348  1.00 13.02 ? 262  TYR C CE1 1 
ATOM   9331  C  CE2 . TYR C 1 265 ? 89.845  100.860 60.959  1.00 14.05 ? 262  TYR C CE2 1 
ATOM   9332  C  CZ  . TYR C 1 265 ? 90.615  101.422 59.948  1.00 12.04 ? 262  TYR C CZ  1 
ATOM   9333  O  OH  . TYR C 1 265 ? 91.774  100.797 59.527  1.00 11.85 ? 262  TYR C OH  1 
ATOM   9334  N  N   . ASN C 1 266 ? 84.629  101.307 61.129  1.00 11.48 ? 263  ASN C N   1 
ATOM   9335  C  CA  . ASN C 1 266 ? 84.152  99.930  61.064  1.00 11.12 ? 263  ASN C CA  1 
ATOM   9336  C  C   . ASN C 1 266 ? 83.057  99.740  60.013  1.00 10.30 ? 263  ASN C C   1 
ATOM   9337  O  O   . ASN C 1 266 ? 82.803  98.613  59.593  1.00 10.55 ? 263  ASN C O   1 
ATOM   9338  C  CB  . ASN C 1 266 ? 83.690  99.451  62.450  1.00 11.38 ? 263  ASN C CB  1 
ATOM   9339  C  CG  . ASN C 1 266 ? 84.861  99.125  63.392  1.00 16.10 ? 263  ASN C CG  1 
ATOM   9340  O  OD1 . ASN C 1 266 ? 85.913  98.636  62.960  1.00 22.26 ? 263  ASN C OD1 1 
ATOM   9341  N  ND2 . ASN C 1 266 ? 84.648  99.311  64.679  1.00 17.91 ? 263  ASN C ND2 1 
ATOM   9342  N  N   . LYS C 1 267 ? 82.409  100.840 59.600  1.00 11.29 ? 264  LYS C N   1 
ATOM   9343  C  CA  . LYS C 1 267 ? 81.404  100.819 58.533  1.00 11.04 ? 264  LYS C CA  1 
ATOM   9344  C  C   . LYS C 1 267 ? 82.078  100.998 57.170  1.00 12.56 ? 264  LYS C C   1 
ATOM   9345  O  O   . LYS C 1 267 ? 81.416  101.006 56.129  1.00 14.02 ? 264  LYS C O   1 
ATOM   9346  C  CB  . LYS C 1 267 ? 80.353  101.925 58.725  1.00 11.36 ? 264  LYS C CB  1 
ATOM   9347  C  CG  . LYS C 1 267 ? 79.499  101.799 59.971  1.00 9.12  ? 264  LYS C CG  1 
ATOM   9348  C  CD  . LYS C 1 267 ? 78.674  103.086 60.145  1.00 14.93 ? 264  LYS C CD  1 
ATOM   9349  C  CE  . LYS C 1 267 ? 77.918  103.124 61.471  1.00 14.40 ? 264  LYS C CE  1 
ATOM   9350  N  NZ  . LYS C 1 267 ? 76.685  102.309 61.499  1.00 13.44 ? 264  LYS C NZ  1 
ATOM   9351  N  N   . GLY C 1 268 ? 83.400  101.142 57.166  1.00 14.66 ? 265  GLY C N   1 
ATOM   9352  C  CA  . GLY C 1 268 ? 84.142  101.295 55.907  1.00 14.59 ? 265  GLY C CA  1 
ATOM   9353  C  C   . GLY C 1 268 ? 84.418  102.728 55.495  1.00 15.09 ? 265  GLY C C   1 
ATOM   9354  O  O   . GLY C 1 268 ? 84.769  102.987 54.332  1.00 15.05 ? 265  GLY C O   1 
ATOM   9355  N  N   . LYS C 1 269 ? 84.244  103.669 56.422  1.00 13.79 ? 266  LYS C N   1 
ATOM   9356  C  CA  . LYS C 1 269 ? 84.544  105.078 56.133  1.00 13.97 ? 266  LYS C CA  1 
ATOM   9357  C  C   . LYS C 1 269 ? 85.982  105.247 56.577  1.00 12.80 ? 266  LYS C C   1 
ATOM   9358  O  O   . LYS C 1 269 ? 86.253  105.527 57.726  1.00 15.52 ? 266  LYS C O   1 
ATOM   9359  C  CB  . LYS C 1 269 ? 83.623  106.013 56.887  1.00 13.57 ? 266  LYS C CB  1 
ATOM   9360  C  CG  . LYS C 1 269 ? 82.135  105.744 56.670  1.00 15.93 ? 266  LYS C CG  1 
ATOM   9361  C  CD  . LYS C 1 269 ? 81.775  105.746 55.177  1.00 16.91 ? 266  LYS C CD  1 
ATOM   9362  C  CE  . LYS C 1 269 ? 80.281  105.524 54.931  1.00 15.65 ? 266  LYS C CE  1 
ATOM   9363  N  NZ  . LYS C 1 269 ? 79.967  105.467 53.464  1.00 14.69 ? 266  LYS C NZ  1 
ATOM   9364  N  N   . THR C 1 270 ? 86.902  105.064 55.654  1.00 13.20 ? 267  THR C N   1 
ATOM   9365  C  CA  . THR C 1 270 ? 88.324  105.062 55.982  1.00 13.20 ? 267  THR C CA  1 
ATOM   9366  C  C   . THR C 1 270 ? 89.070  106.353 55.729  1.00 12.74 ? 267  THR C C   1 
ATOM   9367  O  O   . THR C 1 270 ? 90.294  106.433 55.950  1.00 12.77 ? 267  THR C O   1 
ATOM   9368  C  CB  . THR C 1 270 ? 88.989  103.926 55.243  1.00 12.57 ? 267  THR C CB  1 
ATOM   9369  O  OG1 . THR C 1 270 ? 88.655  104.033 53.863  1.00 14.46 ? 267  THR C OG1 1 
ATOM   9370  C  CG2 . THR C 1 270 ? 88.478  102.577 55.794  1.00 14.18 ? 267  THR C CG2 1 
ATOM   9371  N  N   . ILE C 1 271 ? 88.344  107.357 55.260  1.00 12.19 ? 268  ILE C N   1 
ATOM   9372  C  CA  . ILE C 1 271 ? 88.909  108.686 55.038  1.00 12.20 ? 268  ILE C CA  1 
ATOM   9373  C  C   . ILE C 1 271 ? 88.091  109.704 55.798  1.00 12.20 ? 268  ILE C C   1 
ATOM   9374  O  O   . ILE C 1 271 ? 86.873  109.766 55.626  1.00 14.14 ? 268  ILE C O   1 
ATOM   9375  C  CB  . ILE C 1 271 ? 88.865  109.107 53.546  1.00 11.97 ? 268  ILE C CB  1 
ATOM   9376  C  CG1 . ILE C 1 271 ? 89.682  108.154 52.688  1.00 11.10 ? 268  ILE C CG1 1 
ATOM   9377  C  CG2 . ILE C 1 271 ? 89.356  110.583 53.396  1.00 12.06 ? 268  ILE C CG2 1 
ATOM   9378  C  CD1 . ILE C 1 271 ? 89.488  108.345 51.164  1.00 13.26 ? 268  ILE C CD1 1 
ATOM   9379  N  N   . GLU C 1 272 ? 88.749  110.495 56.647  1.00 11.99 ? 269  GLU C N   1 
ATOM   9380  C  CA  . GLU C 1 272 ? 88.083  111.574 57.365  1.00 12.76 ? 269  GLU C CA  1 
ATOM   9381  C  C   . GLU C 1 272 ? 88.595  112.895 56.817  1.00 13.98 ? 269  GLU C C   1 
ATOM   9382  O  O   . GLU C 1 272 ? 89.820  113.143 56.776  1.00 13.43 ? 269  GLU C O   1 
ATOM   9383  C  CB  . GLU C 1 272 ? 88.358  111.537 58.868  1.00 13.36 ? 269  GLU C CB  1 
ATOM   9384  C  CG  . GLU C 1 272 ? 87.692  112.698 59.617  1.00 13.36 ? 269  GLU C CG  1 
ATOM   9385  C  CD  . GLU C 1 272 ? 87.865  112.619 61.140  1.00 16.16 ? 269  GLU C CD  1 
ATOM   9386  O  OE1 . GLU C 1 272 ? 88.557  111.709 61.602  1.00 16.88 ? 269  GLU C OE1 1 
ATOM   9387  O  OE2 . GLU C 1 272 ? 87.314  113.479 61.877  1.00 18.49 ? 269  GLU C OE2 1 
HETATM 9388  N  N   . MSE C 1 273 ? 87.674  113.732 56.370  1.00 14.32 ? 270  MSE C N   1 
HETATM 9389  C  CA  . MSE C 1 273 ? 88.028  115.049 55.870  1.00 15.37 ? 270  MSE C CA  1 
HETATM 9390  C  C   . MSE C 1 273 ? 87.645  116.109 56.882  1.00 14.93 ? 270  MSE C C   1 
HETATM 9391  O  O   . MSE C 1 273 ? 86.457  116.300 57.145  1.00 16.68 ? 270  MSE C O   1 
HETATM 9392  C  CB  . MSE C 1 273 ? 87.299  115.337 54.553  1.00 16.36 ? 270  MSE C CB  1 
HETATM 9393  C  CG  . MSE C 1 273 ? 87.731  114.456 53.385  1.00 18.53 ? 270  MSE C CG  1 
HETATM 9394  SE SE  . MSE C 1 273 ? 86.706  114.922 51.753  1.00 23.84 ? 270  MSE C SE  1 
HETATM 9395  C  CE  . MSE C 1 273 ? 86.936  116.851 51.807  1.00 9.21  ? 270  MSE C CE  1 
ATOM   9396  N  N   . LEU C 1 274 ? 88.643  116.762 57.486  1.00 14.37 ? 271  LEU C N   1 
ATOM   9397  C  CA  . LEU C 1 274 ? 88.400  117.843 58.431  1.00 13.33 ? 271  LEU C CA  1 
ATOM   9398  C  C   . LEU C 1 274 ? 88.098  119.061 57.564  1.00 13.29 ? 271  LEU C C   1 
ATOM   9399  O  O   . LEU C 1 274 ? 88.922  119.476 56.740  1.00 12.37 ? 271  LEU C O   1 
ATOM   9400  C  CB  . LEU C 1 274 ? 89.625  118.117 59.322  1.00 13.59 ? 271  LEU C CB  1 
ATOM   9401  C  CG  . LEU C 1 274 ? 89.401  119.202 60.383  1.00 14.47 ? 271  LEU C CG  1 
ATOM   9402  C  CD1 . LEU C 1 274 ? 88.454  118.683 61.461  1.00 14.34 ? 271  LEU C CD1 1 
ATOM   9403  C  CD2 . LEU C 1 274 ? 90.693  119.647 61.007  1.00 16.08 ? 271  LEU C CD2 1 
ATOM   9404  N  N   . ILE C 1 275 ? 86.921  119.634 57.765  1.00 12.56 ? 272  ILE C N   1 
ATOM   9405  C  CA  . ILE C 1 275 ? 86.447  120.752 56.969  1.00 11.37 ? 272  ILE C CA  1 
ATOM   9406  C  C   . ILE C 1 275 ? 86.397  122.059 57.731  1.00 12.06 ? 272  ILE C C   1 
ATOM   9407  O  O   . ILE C 1 275 ? 86.051  122.072 58.909  1.00 12.50 ? 272  ILE C O   1 
ATOM   9408  C  CB  . ILE C 1 275 ? 84.965  120.480 56.511  1.00 9.77  ? 272  ILE C CB  1 
ATOM   9409  C  CG1 . ILE C 1 275 ? 84.826  119.144 55.787  1.00 11.68 ? 272  ILE C CG1 1 
ATOM   9410  C  CG2 . ILE C 1 275 ? 84.411  121.613 55.634  1.00 11.35 ? 272  ILE C CG2 1 
ATOM   9411  C  CD1 . ILE C 1 275 ? 85.613  119.061 54.519  1.00 10.95 ? 272  ILE C CD1 1 
ATOM   9412  N  N   . ASN C 1 276 ? 86.728  123.158 57.054  1.00 12.40 ? 273  ASN C N   1 
ATOM   9413  C  CA  . ASN C 1 276 ? 86.562  124.486 57.636  1.00 13.41 ? 273  ASN C CA  1 
ATOM   9414  C  C   . ASN C 1 276 ? 85.868  125.380 56.613  1.00 13.29 ? 273  ASN C C   1 
ATOM   9415  O  O   . ASN C 1 276 ? 85.762  125.010 55.436  1.00 13.36 ? 273  ASN C O   1 
ATOM   9416  C  CB  . ASN C 1 276 ? 87.894  125.101 58.092  1.00 14.04 ? 273  ASN C CB  1 
ATOM   9417  C  CG  . ASN C 1 276 ? 88.748  125.606 56.937  1.00 15.98 ? 273  ASN C CG  1 
ATOM   9418  O  OD1 . ASN C 1 276 ? 88.315  126.438 56.146  1.00 19.07 ? 273  ASN C OD1 1 
ATOM   9419  N  ND2 . ASN C 1 276 ? 89.986  125.158 56.886  1.00 17.44 ? 273  ASN C ND2 1 
ATOM   9420  N  N   . TYR C 1 277 ? 85.339  126.514 57.082  1.00 12.81 ? 274  TYR C N   1 
ATOM   9421  C  CA  . TYR C 1 277 ? 84.719  127.521 56.222  1.00 13.28 ? 274  TYR C CA  1 
ATOM   9422  C  C   . TYR C 1 277 ? 85.420  128.860 56.449  1.00 13.71 ? 274  TYR C C   1 
ATOM   9423  O  O   . TYR C 1 277 ? 84.906  129.909 56.091  1.00 13.18 ? 274  TYR C O   1 
ATOM   9424  C  CB  . TYR C 1 277 ? 83.203  127.647 56.449  1.00 12.77 ? 274  TYR C CB  1 
ATOM   9425  C  CG  . TYR C 1 277 ? 82.406  126.588 55.742  1.00 11.49 ? 274  TYR C CG  1 
ATOM   9426  C  CD1 . TYR C 1 277 ? 82.282  125.319 56.271  1.00 13.40 ? 274  TYR C CD1 1 
ATOM   9427  C  CD2 . TYR C 1 277 ? 81.780  126.858 54.524  1.00 13.74 ? 274  TYR C CD2 1 
ATOM   9428  C  CE1 . TYR C 1 277 ? 81.559  124.341 55.607  1.00 10.18 ? 274  TYR C CE1 1 
ATOM   9429  C  CE2 . TYR C 1 277 ? 81.063  125.881 53.847  1.00 9.87  ? 274  TYR C CE2 1 
ATOM   9430  C  CZ  . TYR C 1 277 ? 80.948  124.631 54.400  1.00 10.00 ? 274  TYR C CZ  1 
ATOM   9431  O  OH  . TYR C 1 277 ? 80.240  123.650 53.751  1.00 9.20  ? 274  TYR C OH  1 
ATOM   9432  N  N   . GLU C 1 278 ? 86.605  128.804 57.045  1.00 13.90 ? 275  GLU C N   1 
ATOM   9433  C  CA  . GLU C 1 278 ? 87.404  129.994 57.307  1.00 14.11 ? 275  GLU C CA  1 
ATOM   9434  C  C   . GLU C 1 278 ? 88.843  129.651 56.941  1.00 14.77 ? 275  GLU C C   1 
ATOM   9435  O  O   . GLU C 1 278 ? 89.442  128.794 57.586  1.00 14.20 ? 275  GLU C O   1 
ATOM   9436  C  CB  . GLU C 1 278 ? 87.294  130.381 58.768  1.00 14.95 ? 275  GLU C CB  1 
ATOM   9437  C  CG  . GLU C 1 278 ? 85.970  131.006 59.145  1.00 16.13 ? 275  GLU C CG  1 
ATOM   9438  C  CD  . GLU C 1 278 ? 85.819  132.422 58.589  1.00 17.22 ? 275  GLU C CD  1 
ATOM   9439  O  OE1 . GLU C 1 278 ? 86.800  132.949 58.027  1.00 15.32 ? 275  GLU C OE1 1 
ATOM   9440  O  OE2 . GLU C 1 278 ? 84.730  133.014 58.736  1.00 19.38 ? 275  GLU C OE2 1 
ATOM   9441  N  N   . PRO C 1 279 ? 89.401  130.314 55.907  1.00 14.90 ? 276  PRO C N   1 
ATOM   9442  C  CA  . PRO C 1 279 ? 90.755  129.997 55.450  1.00 15.62 ? 276  PRO C CA  1 
ATOM   9443  C  C   . PRO C 1 279 ? 91.839  130.088 56.524  1.00 16.34 ? 276  PRO C C   1 
ATOM   9444  O  O   . PRO C 1 279 ? 92.865  129.383 56.434  1.00 16.41 ? 276  PRO C O   1 
ATOM   9445  C  CB  . PRO C 1 279 ? 91.002  131.002 54.329  1.00 16.26 ? 276  PRO C CB  1 
ATOM   9446  C  CG  . PRO C 1 279 ? 89.985  132.042 54.496  1.00 17.24 ? 276  PRO C CG  1 
ATOM   9447  C  CD  . PRO C 1 279 ? 88.796  131.381 55.100  1.00 14.08 ? 276  PRO C CD  1 
ATOM   9448  N  N   . ALA C 1 280 ? 91.615  130.911 57.542  1.00 14.76 ? 277  ALA C N   1 
ATOM   9449  C  CA  . ALA C 1 280 ? 92.582  131.027 58.623  1.00 14.57 ? 277  ALA C CA  1 
ATOM   9450  C  C   . ALA C 1 280 ? 92.785  129.694 59.362  1.00 14.47 ? 277  ALA C C   1 
ATOM   9451  O  O   . ALA C 1 280 ? 93.768  129.566 60.070  1.00 15.22 ? 277  ALA C O   1 
ATOM   9452  C  CB  . ALA C 1 280 ? 92.173  132.117 59.607  1.00 14.70 ? 277  ALA C CB  1 
ATOM   9453  N  N   . LEU C 1 281 ? 91.865  128.725 59.203  1.00 12.90 ? 278  LEU C N   1 
ATOM   9454  C  CA  . LEU C 1 281 ? 91.973  127.412 59.878  1.00 14.52 ? 278  LEU C CA  1 
ATOM   9455  C  C   . LEU C 1 281 ? 92.787  126.371 59.103  1.00 14.76 ? 278  LEU C C   1 
ATOM   9456  O  O   . LEU C 1 281 ? 92.922  125.245 59.554  1.00 15.81 ? 278  LEU C O   1 
ATOM   9457  C  CB  . LEU C 1 281 ? 90.582  126.834 60.204  1.00 14.44 ? 278  LEU C CB  1 
ATOM   9458  C  CG  . LEU C 1 281 ? 89.778  127.486 61.335  1.00 17.57 ? 278  LEU C CG  1 
ATOM   9459  C  CD1 . LEU C 1 281 ? 88.339  126.946 61.424  1.00 12.39 ? 278  LEU C CD1 1 
ATOM   9460  C  CD2 . LEU C 1 281 ? 90.496  127.260 62.629  1.00 18.84 ? 278  LEU C CD2 1 
ATOM   9461  N  N   . GLN C 1 282 ? 93.313  126.747 57.942  1.00 16.23 ? 279  GLN C N   1 
ATOM   9462  C  CA  . GLN C 1 282 ? 94.092  125.826 57.100  1.00 17.68 ? 279  GLN C CA  1 
ATOM   9463  C  C   . GLN C 1 282 ? 95.253  125.141 57.841  1.00 16.44 ? 279  GLN C C   1 
ATOM   9464  O  O   . GLN C 1 282 ? 95.396  123.908 57.797  1.00 16.20 ? 279  GLN C O   1 
ATOM   9465  C  CB  . GLN C 1 282 ? 94.616  126.555 55.874  1.00 18.92 ? 279  GLN C CB  1 
ATOM   9466  C  CG  . GLN C 1 282 ? 95.459  125.655 54.969  1.00 27.40 ? 279  GLN C CG  1 
ATOM   9467  C  CD  . GLN C 1 282 ? 96.157  126.426 53.870  1.00 35.91 ? 279  GLN C CD  1 
ATOM   9468  O  OE1 . GLN C 1 282 ? 95.768  127.554 53.532  1.00 39.39 ? 279  GLN C OE1 1 
ATOM   9469  N  NE2 . GLN C 1 282 ? 97.202  125.824 53.303  1.00 39.28 ? 279  GLN C NE2 1 
ATOM   9470  N  N   . TYR C 1 283 ? 96.097  125.910 58.518  1.00 15.64 ? 280  TYR C N   1 
ATOM   9471  C  CA  . TYR C 1 283 ? 97.185  125.265 59.260  1.00 15.48 ? 280  TYR C CA  1 
ATOM   9472  C  C   . TYR C 1 283 ? 96.720  124.475 60.467  1.00 13.73 ? 280  TYR C C   1 
ATOM   9473  O  O   . TYR C 1 283 ? 97.373  123.503 60.843  1.00 12.00 ? 280  TYR C O   1 
ATOM   9474  C  CB  . TYR C 1 283 ? 98.342  126.204 59.558  1.00 17.29 ? 280  TYR C CB  1 
ATOM   9475  C  CG  . TYR C 1 283 ? 99.329  126.128 58.443  1.00 19.70 ? 280  TYR C CG  1 
ATOM   9476  C  CD1 . TYR C 1 283 ? 100.318 125.146 58.464  1.00 24.69 ? 280  TYR C CD1 1 
ATOM   9477  C  CD2 . TYR C 1 283 ? 99.237  126.953 57.336  1.00 22.62 ? 280  TYR C CD2 1 
ATOM   9478  C  CE1 . TYR C 1 283 ? 101.216 125.013 57.441  1.00 28.26 ? 280  TYR C CE1 1 
ATOM   9479  C  CE2 . TYR C 1 283 ? 100.142 126.838 56.294  1.00 26.21 ? 280  TYR C CE2 1 
ATOM   9480  C  CZ  . TYR C 1 283 ? 101.134 125.852 56.355  1.00 29.15 ? 280  TYR C CZ  1 
ATOM   9481  O  OH  . TYR C 1 283 ? 102.056 125.702 55.345  1.00 31.93 ? 280  TYR C OH  1 
ATOM   9482  N  N   . PHE C 1 284 ? 95.578  124.839 61.045  1.00 12.11 ? 281  PHE C N   1 
ATOM   9483  C  CA  . PHE C 1 284 ? 95.044  124.052 62.155  1.00 13.40 ? 281  PHE C CA  1 
ATOM   9484  C  C   . PHE C 1 284 ? 94.729  122.638 61.636  1.00 12.75 ? 281  PHE C C   1 
ATOM   9485  O  O   . PHE C 1 284 ? 94.937  121.633 62.338  1.00 13.73 ? 281  PHE C O   1 
ATOM   9486  C  CB  . PHE C 1 284 ? 93.809  124.693 62.815  1.00 13.91 ? 281  PHE C CB  1 
ATOM   9487  C  CG  . PHE C 1 284 ? 93.308  123.909 64.000  1.00 15.52 ? 281  PHE C CG  1 
ATOM   9488  C  CD1 . PHE C 1 284 ? 93.865  124.097 65.244  1.00 17.46 ? 281  PHE C CD1 1 
ATOM   9489  C  CD2 . PHE C 1 284 ? 92.313  122.952 63.853  1.00 16.59 ? 281  PHE C CD2 1 
ATOM   9490  C  CE1 . PHE C 1 284 ? 93.440  123.342 66.344  1.00 20.12 ? 281  PHE C CE1 1 
ATOM   9491  C  CE2 . PHE C 1 284 ? 91.879  122.203 64.939  1.00 20.08 ? 281  PHE C CE2 1 
ATOM   9492  C  CZ  . PHE C 1 284 ? 92.445  122.407 66.190  1.00 20.51 ? 281  PHE C CZ  1 
ATOM   9493  N  N   . ALA C 1 285 ? 94.251  122.552 60.401  1.00 13.31 ? 282  ALA C N   1 
ATOM   9494  C  CA  . ALA C 1 285 ? 93.962  121.253 59.782  1.00 13.51 ? 282  ALA C CA  1 
ATOM   9495  C  C   . ALA C 1 285 ? 95.257  120.448 59.589  1.00 13.86 ? 282  ALA C C   1 
ATOM   9496  O  O   . ALA C 1 285 ? 95.241  119.222 59.699  1.00 14.38 ? 282  ALA C O   1 
ATOM   9497  C  CB  . ALA C 1 285 ? 93.225  121.438 58.449  1.00 14.03 ? 282  ALA C CB  1 
ATOM   9498  N  N   . GLU C 1 286 ? 96.378  121.122 59.307  1.00 14.30 ? 283  GLU C N   1 
ATOM   9499  C  CA  . GLU C 1 286 ? 97.661  120.421 59.147  1.00 13.42 ? 283  GLU C CA  1 
ATOM   9500  C  C   . GLU C 1 286 ? 98.070  119.852 60.489  1.00 12.95 ? 283  GLU C C   1 
ATOM   9501  O  O   . GLU C 1 286 ? 98.533  118.707 60.586  1.00 13.52 ? 283  GLU C O   1 
ATOM   9502  C  CB  . GLU C 1 286 ? 98.761  121.336 58.575  1.00 15.30 ? 283  GLU C CB  1 
ATOM   9503  C  CG  . GLU C 1 286 ? 98.519  121.791 57.124  1.00 17.55 ? 283  GLU C CG  1 
ATOM   9504  C  CD  . GLU C 1 286 ? 98.436  120.613 56.152  1.00 22.54 ? 283  GLU C CD  1 
ATOM   9505  O  OE1 . GLU C 1 286 ? 99.340  119.755 56.165  1.00 21.38 ? 283  GLU C OE1 1 
ATOM   9506  O  OE2 . GLU C 1 286 ? 97.466  120.551 55.371  1.00 22.65 ? 283  GLU C OE2 1 
ATOM   9507  N  N   . TRP C 1 287 ? 97.874  120.640 61.535  1.00 11.77 ? 284  TRP C N   1 
ATOM   9508  C  CA  . TRP C 1 287 ? 98.187  120.196 62.899  1.00 11.91 ? 284  TRP C CA  1 
ATOM   9509  C  C   . TRP C 1 287 ? 97.332  118.977 63.262  1.00 11.89 ? 284  TRP C C   1 
ATOM   9510  O  O   . TRP C 1 287 ? 97.826  118.005 63.837  1.00 11.31 ? 284  TRP C O   1 
ATOM   9511  C  CB  . TRP C 1 287 ? 97.970  121.335 63.893  1.00 11.69 ? 284  TRP C CB  1 
ATOM   9512  C  CG  . TRP C 1 287 ? 98.128  120.936 65.328  1.00 10.06 ? 284  TRP C CG  1 
ATOM   9513  C  CD1 . TRP C 1 287 ? 99.279  120.940 66.063  1.00 10.61 ? 284  TRP C CD1 1 
ATOM   9514  C  CD2 . TRP C 1 287 ? 97.092  120.488 66.198  1.00 10.18 ? 284  TRP C CD2 1 
ATOM   9515  N  NE1 . TRP C 1 287 ? 99.019  120.513 67.343  1.00 13.98 ? 284  TRP C NE1 1 
ATOM   9516  C  CE2 . TRP C 1 287 ? 97.683  120.227 67.453  1.00 12.67 ? 284  TRP C CE2 1 
ATOM   9517  C  CE3 . TRP C 1 287 ? 95.713  120.293 66.045  1.00 10.94 ? 284  TRP C CE3 1 
ATOM   9518  C  CZ2 . TRP C 1 287 ? 96.949  119.799 68.546  1.00 9.31  ? 284  TRP C CZ2 1 
ATOM   9519  C  CZ3 . TRP C 1 287 ? 94.977  119.836 67.144  1.00 10.64 ? 284  TRP C CZ3 1 
ATOM   9520  C  CH2 . TRP C 1 287 ? 95.599  119.594 68.372  1.00 10.63 ? 284  TRP C CH2 1 
ATOM   9521  N  N   . TRP C 1 288 ? 96.063  119.009 62.874  1.00 12.31 ? 285  TRP C N   1 
ATOM   9522  C  CA  . TRP C 1 288 ? 95.146  117.882 63.133  1.00 11.96 ? 285  TRP C CA  1 
ATOM   9523  C  C   . TRP C 1 288 ? 95.561  116.626 62.362  1.00 12.14 ? 285  TRP C C   1 
ATOM   9524  O  O   . TRP C 1 288 ? 95.529  115.505 62.907  1.00 10.97 ? 285  TRP C O   1 
ATOM   9525  C  CB  . TRP C 1 288 ? 93.740  118.315 62.782  1.00 13.09 ? 285  TRP C CB  1 
ATOM   9526  C  CG  . TRP C 1 288 ? 92.712  117.250 62.861  1.00 13.29 ? 285  TRP C CG  1 
ATOM   9527  C  CD1 . TRP C 1 288 ? 91.917  116.953 63.922  1.00 18.64 ? 285  TRP C CD1 1 
ATOM   9528  C  CD2 . TRP C 1 288 ? 92.291  116.422 61.798  1.00 13.27 ? 285  TRP C CD2 1 
ATOM   9529  N  NE1 . TRP C 1 288 ? 91.054  115.935 63.595  1.00 18.75 ? 285  TRP C NE1 1 
ATOM   9530  C  CE2 . TRP C 1 288 ? 91.274  115.584 62.294  1.00 15.08 ? 285  TRP C CE2 1 
ATOM   9531  C  CE3 . TRP C 1 288 ? 92.704  116.270 60.476  1.00 11.90 ? 285  TRP C CE3 1 
ATOM   9532  C  CZ2 . TRP C 1 288 ? 90.652  114.633 61.512  1.00 15.10 ? 285  TRP C CZ2 1 
ATOM   9533  C  CZ3 . TRP C 1 288 ? 92.087  115.315 59.703  1.00 15.16 ? 285  TRP C CZ3 1 
ATOM   9534  C  CH2 . TRP C 1 288 ? 91.075  114.517 60.217  1.00 14.18 ? 285  TRP C CH2 1 
ATOM   9535  N  N   . LYS C 1 289 ? 95.965  116.799 61.105  1.00 13.96 ? 286  LYS C N   1 
ATOM   9536  C  CA  . LYS C 1 289 ? 96.441  115.667 60.278  1.00 15.51 ? 286  LYS C CA  1 
ATOM   9537  C  C   . LYS C 1 289 ? 97.640  114.968 60.913  1.00 14.18 ? 286  LYS C C   1 
ATOM   9538  O  O   . LYS C 1 289 ? 97.691  113.748 60.945  1.00 14.63 ? 286  LYS C O   1 
ATOM   9539  C  CB  . LYS C 1 289 ? 96.757  116.088 58.836  1.00 15.98 ? 286  LYS C CB  1 
ATOM   9540  C  CG  . LYS C 1 289 ? 95.520  116.446 58.042  1.00 19.59 ? 286  LYS C CG  1 
ATOM   9541  C  CD  . LYS C 1 289 ? 95.762  116.622 56.529  1.00 24.90 ? 286  LYS C CD  1 
ATOM   9542  C  CE  . LYS C 1 289 ? 96.564  117.835 56.171  1.00 29.33 ? 286  LYS C CE  1 
ATOM   9543  N  NZ  . LYS C 1 289 ? 96.741  117.960 54.675  1.00 29.16 ? 286  LYS C NZ  1 
ATOM   9544  N  N   . GLN C 1 290 ? 98.600  115.728 61.422  1.00 13.54 ? 287  GLN C N   1 
ATOM   9545  C  CA  . GLN C 1 290 ? 99.741  115.115 62.092  1.00 13.35 ? 287  GLN C CA  1 
ATOM   9546  C  C   . GLN C 1 290 ? 99.264  114.408 63.352  1.00 13.65 ? 287  GLN C C   1 
ATOM   9547  O  O   . GLN C 1 290 ? 99.647  113.257 63.601  1.00 11.01 ? 287  GLN C O   1 
ATOM   9548  C  CB  . GLN C 1 290 ? 100.839 116.128 62.479  1.00 14.00 ? 287  GLN C CB  1 
ATOM   9549  C  CG  . GLN C 1 290 ? 101.943 115.461 63.328  1.00 12.90 ? 287  GLN C CG  1 
ATOM   9550  C  CD  . GLN C 1 290 ? 103.119 116.358 63.669  1.00 18.24 ? 287  GLN C CD  1 
ATOM   9551  O  OE1 . GLN C 1 290 ? 103.087 117.567 63.446  1.00 16.15 ? 287  GLN C OE1 1 
ATOM   9552  N  NE2 . GLN C 1 290 ? 104.171 115.754 64.251  1.00 12.43 ? 287  GLN C NE2 1 
ATOM   9553  N  N   . LEU C 1 291 ? 98.377  115.072 64.114  1.00 12.04 ? 288  LEU C N   1 
ATOM   9554  C  CA  . LEU C 1 291 ? 97.903  114.498 65.357  1.00 12.60 ? 288  LEU C CA  1 
ATOM   9555  C  C   . LEU C 1 291 ? 97.288  113.116 65.152  1.00 13.14 ? 288  LEU C C   1 
ATOM   9556  O  O   . LEU C 1 291 ? 97.755  112.125 65.736  1.00 12.41 ? 288  LEU C O   1 
ATOM   9557  C  CB  . LEU C 1 291 ? 96.911  115.432 66.044  1.00 11.92 ? 288  LEU C CB  1 
ATOM   9558  C  CG  . LEU C 1 291 ? 96.398  114.965 67.416  1.00 14.81 ? 288  LEU C CG  1 
ATOM   9559  C  CD1 . LEU C 1 291 ? 97.519  114.878 68.466  1.00 15.86 ? 288  LEU C CD1 1 
ATOM   9560  C  CD2 . LEU C 1 291 ? 95.318  115.875 67.931  1.00 11.48 ? 288  LEU C CD2 1 
ATOM   9561  N  N   . PHE C 1 292 ? 96.265  113.038 64.307  1.00 13.59 ? 289  PHE C N   1 
ATOM   9562  C  CA  . PHE C 1 292 ? 95.579  111.767 64.062  1.00 13.70 ? 289  PHE C CA  1 
ATOM   9563  C  C   . PHE C 1 292 ? 96.340  110.805 63.158  1.00 15.07 ? 289  PHE C C   1 
ATOM   9564  O  O   . PHE C 1 292 ? 96.347  109.597 63.421  1.00 16.07 ? 289  PHE C O   1 
ATOM   9565  C  CB  . PHE C 1 292 ? 94.139  112.006 63.572  1.00 13.74 ? 289  PHE C CB  1 
ATOM   9566  C  CG  . PHE C 1 292 ? 93.209  112.421 64.670  1.00 13.91 ? 289  PHE C CG  1 
ATOM   9567  C  CD1 . PHE C 1 292 ? 92.544  111.477 65.410  1.00 11.33 ? 289  PHE C CD1 1 
ATOM   9568  C  CD2 . PHE C 1 292 ? 93.057  113.766 65.013  1.00 17.03 ? 289  PHE C CD2 1 
ATOM   9569  C  CE1 . PHE C 1 292 ? 91.709  111.849 66.459  1.00 14.13 ? 289  PHE C CE1 1 
ATOM   9570  C  CE2 . PHE C 1 292 ? 92.224  114.146 66.059  1.00 17.21 ? 289  PHE C CE2 1 
ATOM   9571  C  CZ  . PHE C 1 292 ? 91.555  113.192 66.780  1.00 16.19 ? 289  PHE C CZ  1 
ATOM   9572  N  N   . GLY C 1 293 ? 97.001  111.339 62.129  1.00 15.09 ? 290  GLY C N   1 
ATOM   9573  C  CA  . GLY C 1 293 ? 97.780  110.534 61.183  1.00 15.22 ? 290  GLY C CA  1 
ATOM   9574  C  C   . GLY C 1 293 ? 98.939  109.772 61.810  1.00 15.08 ? 290  GLY C C   1 
ATOM   9575  O  O   . GLY C 1 293 ? 99.125  108.568 61.544  1.00 12.44 ? 290  GLY C O   1 
ATOM   9576  N  N   . GLU C 1 294 ? 99.728  110.471 62.631  1.00 15.12 ? 291  GLU C N   1 
ATOM   9577  C  CA  . GLU C 1 294 ? 100.850 109.850 63.336  1.00 14.70 ? 291  GLU C CA  1 
ATOM   9578  C  C   . GLU C 1 294 ? 100.426 108.994 64.518  1.00 14.64 ? 291  GLU C C   1 
ATOM   9579  O  O   . GLU C 1 294 ? 101.103 108.030 64.852  1.00 13.18 ? 291  GLU C O   1 
ATOM   9580  C  CB  . GLU C 1 294 ? 101.844 110.879 63.882  1.00 15.97 ? 291  GLU C CB  1 
ATOM   9581  C  CG  . GLU C 1 294 ? 102.850 111.374 62.914  1.00 17.71 ? 291  GLU C CG  1 
ATOM   9582  C  CD  . GLU C 1 294 ? 104.044 112.058 63.599  1.00 22.64 ? 291  GLU C CD  1 
ATOM   9583  O  OE1 . GLU C 1 294 ? 103.894 112.634 64.717  1.00 19.39 ? 291  GLU C OE1 1 
ATOM   9584  O  OE2 . GLU C 1 294 ? 105.139 112.023 62.992  1.00 24.17 ? 291  GLU C OE2 1 
ATOM   9585  N  N   . SER C 1 295 ? 99.342  109.364 65.194  1.00 13.33 ? 292  SER C N   1 
ATOM   9586  C  CA  . SER C 1 295 ? 98.916  108.577 66.334  1.00 13.31 ? 292  SER C CA  1 
ATOM   9587  C  C   . SER C 1 295 ? 98.294  107.236 65.927  1.00 14.74 ? 292  SER C C   1 
ATOM   9588  O  O   . SER C 1 295 ? 98.551  106.212 66.565  1.00 15.83 ? 292  SER C O   1 
ATOM   9589  C  CB  . SER C 1 295 ? 97.916  109.353 67.198  1.00 13.35 ? 292  SER C CB  1 
ATOM   9590  O  OG  . SER C 1 295 ? 98.494  110.552 67.724  1.00 13.26 ? 292  SER C OG  1 
ATOM   9591  N  N   . GLU C 1 296 ? 97.549  107.221 64.828  1.00 14.43 ? 293  GLU C N   1 
ATOM   9592  C  CA  . GLU C 1 296 ? 96.824  106.020 64.442  1.00 15.17 ? 293  GLU C CA  1 
ATOM   9593  C  C   . GLU C 1 296 ? 97.275  105.277 63.205  1.00 14.95 ? 293  GLU C C   1 
ATOM   9594  O  O   . GLU C 1 296 ? 96.807  104.177 62.975  1.00 16.04 ? 293  GLU C O   1 
ATOM   9595  C  CB  . GLU C 1 296 ? 95.355  106.393 64.253  1.00 15.38 ? 293  GLU C CB  1 
ATOM   9596  C  CG  . GLU C 1 296 ? 94.711  106.870 65.517  1.00 18.63 ? 293  GLU C CG  1 
ATOM   9597  C  CD  . GLU C 1 296 ? 93.256  107.209 65.327  1.00 20.74 ? 293  GLU C CD  1 
ATOM   9598  O  OE1 . GLU C 1 296 ? 92.889  107.678 64.221  1.00 22.40 ? 293  GLU C OE1 1 
ATOM   9599  O  OE2 . GLU C 1 296 ? 92.479  106.999 66.278  1.00 23.91 ? 293  GLU C OE2 1 
ATOM   9600  N  N   . GLY C 1 297 ? 98.169  105.862 62.411  1.00 13.50 ? 294  GLY C N   1 
ATOM   9601  C  CA  . GLY C 1 297 ? 98.614  105.225 61.174  1.00 13.02 ? 294  GLY C CA  1 
ATOM   9602  C  C   . GLY C 1 297 ? 99.708  104.204 61.387  1.00 14.27 ? 294  GLY C C   1 
ATOM   9603  O  O   . GLY C 1 297 ? 100.869 104.418 60.995  1.00 14.50 ? 294  GLY C O   1 
ATOM   9604  N  N   . LYS C 1 298 ? 99.333  103.079 61.972  1.00 13.10 ? 295  LYS C N   1 
ATOM   9605  C  CA  . LYS C 1 298 ? 100.290 102.035 62.271  1.00 13.54 ? 295  LYS C CA  1 
ATOM   9606  C  C   . LYS C 1 298 ? 99.643  100.658 62.280  1.00 12.21 ? 295  LYS C C   1 
ATOM   9607  O  O   . LYS C 1 298 ? 98.413  100.527 62.291  1.00 10.69 ? 295  LYS C O   1 
ATOM   9608  C  CB  . LYS C 1 298 ? 100.948 102.343 63.595  1.00 15.87 ? 295  LYS C CB  1 
ATOM   9609  C  CG  . LYS C 1 298 ? 99.974  102.525 64.736  1.00 16.40 ? 295  LYS C CG  1 
ATOM   9610  C  CD  . LYS C 1 298 ? 100.625 103.288 65.892  1.00 20.73 ? 295  LYS C CD  1 
ATOM   9611  C  CE  . LYS C 1 298 ? 101.187 104.633 65.436  1.00 20.91 ? 295  LYS C CE  1 
ATOM   9612  N  NZ  . LYS C 1 298 ? 101.485 105.565 66.581  1.00 15.24 ? 295  LYS C NZ  1 
ATOM   9613  N  N   . ASP C 1 299 ? 100.490 99.641  62.218  1.00 11.66 ? 296  ASP C N   1 
ATOM   9614  C  CA  . ASP C 1 299 ? 100.039 98.241  62.183  1.00 11.74 ? 296  ASP C CA  1 
ATOM   9615  C  C   . ASP C 1 299 ? 99.083  98.025  61.008  1.00 10.76 ? 296  ASP C C   1 
ATOM   9616  O  O   . ASP C 1 299 ? 98.192  97.177  61.071  1.00 10.40 ? 296  ASP C O   1 
ATOM   9617  C  CB  . ASP C 1 299 ? 99.372  97.850  63.514  1.00 10.80 ? 296  ASP C CB  1 
ATOM   9618  C  CG  . ASP C 1 299 ? 100.313 98.020  64.712  1.00 13.59 ? 296  ASP C CG  1 
ATOM   9619  O  OD1 . ASP C 1 299 ? 101.520 97.757  64.567  1.00 11.34 ? 296  ASP C OD1 1 
ATOM   9620  O  OD2 . ASP C 1 299 ? 99.846  98.397  65.807  1.00 16.03 ? 296  ASP C OD2 1 
ATOM   9621  N  N   . GLN C 1 300 ? 99.299  98.789  59.936  1.00 10.73 ? 297  GLN C N   1 
ATOM   9622  C  CA  . GLN C 1 300 ? 98.488  98.729  58.712  1.00 10.95 ? 297  GLN C CA  1 
ATOM   9623  C  C   . GLN C 1 300 ? 97.006  99.086  58.920  1.00 10.28 ? 297  GLN C C   1 
ATOM   9624  O  O   . GLN C 1 300 ? 96.137  98.584  58.206  1.00 9.82  ? 297  GLN C O   1 
ATOM   9625  C  CB  . GLN C 1 300 ? 98.635  97.356  58.033  1.00 11.59 ? 297  GLN C CB  1 
ATOM   9626  C  CG  . GLN C 1 300 ? 100.038 97.105  57.502  1.00 16.94 ? 297  GLN C CG  1 
ATOM   9627  C  CD  . GLN C 1 300 ? 101.028 96.880  58.612  1.00 22.18 ? 297  GLN C CD  1 
ATOM   9628  O  OE1 . GLN C 1 300 ? 100.805 96.038  59.487  1.00 25.88 ? 297  GLN C OE1 1 
ATOM   9629  N  NE2 . GLN C 1 300 ? 102.147 97.608  58.578  1.00 21.78 ? 297  GLN C NE2 1 
ATOM   9630  N  N   . LYS C 1 301 ? 96.748  100.027 59.831  1.00 10.09 ? 298  LYS C N   1 
ATOM   9631  C  CA  . LYS C 1 301 ? 95.401  100.440 60.172  1.00 11.79 ? 298  LYS C CA  1 
ATOM   9632  C  C   . LYS C 1 301 ? 95.314  101.944 60.195  1.00 12.75 ? 298  LYS C C   1 
ATOM   9633  O  O   . LYS C 1 301 ? 96.327  102.641 60.045  1.00 12.83 ? 298  LYS C O   1 
ATOM   9634  C  CB  . LYS C 1 301 ? 95.065  99.989  61.599  1.00 11.19 ? 298  LYS C CB  1 
ATOM   9635  C  CG  . LYS C 1 301 ? 95.173  98.502  61.854  1.00 14.68 ? 298  LYS C CG  1 
ATOM   9636  C  CD  . LYS C 1 301 ? 95.232  98.178  63.349  1.00 13.24 ? 298  LYS C CD  1 
ATOM   9637  C  CE  . LYS C 1 301 ? 95.486  96.685  63.559  1.00 11.92 ? 298  LYS C CE  1 
ATOM   9638  N  NZ  . LYS C 1 301 ? 95.630  96.226  64.974  1.00 11.18 ? 298  LYS C NZ  1 
ATOM   9639  N  N   . GLY C 1 302 ? 94.085  102.425 60.387  1.00 12.32 ? 299  GLY C N   1 
ATOM   9640  C  CA  . GLY C 1 302 ? 93.829  103.818 60.608  1.00 11.86 ? 299  GLY C CA  1 
ATOM   9641  C  C   . GLY C 1 302 ? 93.100  104.616 59.572  1.00 11.93 ? 299  GLY C C   1 
ATOM   9642  O  O   . GLY C 1 302 ? 93.305  104.449 58.378  1.00 12.44 ? 299  GLY C O   1 
ATOM   9643  N  N   . ILE C 1 303 ? 92.288  105.536 60.068  1.00 11.35 ? 300  ILE C N   1 
ATOM   9644  C  CA  . ILE C 1 303 ? 91.575  106.460 59.246  1.00 12.12 ? 300  ILE C CA  1 
ATOM   9645  C  C   . ILE C 1 303 ? 92.598  107.372 58.590  1.00 12.37 ? 300  ILE C C   1 
ATOM   9646  O  O   . ILE C 1 303 ? 93.486  107.863 59.264  1.00 12.35 ? 300  ILE C O   1 
ATOM   9647  C  CB  . ILE C 1 303 ? 90.662  107.345 60.121  1.00 13.54 ? 300  ILE C CB  1 
ATOM   9648  C  CG1 . ILE C 1 303 ? 89.497  106.507 60.678  1.00 14.71 ? 300  ILE C CG1 1 
ATOM   9649  C  CG2 . ILE C 1 303 ? 90.174  108.562 59.305  1.00 10.99 ? 300  ILE C CG2 1 
ATOM   9650  C  CD1 . ILE C 1 303 ? 88.683  107.191 61.759  1.00 12.78 ? 300  ILE C CD1 1 
ATOM   9651  N  N   . PHE C 1 304 ? 92.502  107.552 57.274  1.00 12.23 ? 301  PHE C N   1 
ATOM   9652  C  CA  . PHE C 1 304 ? 93.379  108.459 56.544  1.00 13.05 ? 301  PHE C CA  1 
ATOM   9653  C  C   . PHE C 1 304 ? 92.875  109.885 56.814  1.00 12.88 ? 301  PHE C C   1 
ATOM   9654  O  O   . PHE C 1 304 ? 91.703  110.197 56.557  1.00 12.10 ? 301  PHE C O   1 
ATOM   9655  C  CB  . PHE C 1 304 ? 93.341  108.151 55.036  1.00 12.10 ? 301  PHE C CB  1 
ATOM   9656  C  CG  . PHE C 1 304 ? 94.224  109.036 54.192  1.00 13.82 ? 301  PHE C CG  1 
ATOM   9657  C  CD1 . PHE C 1 304 ? 95.558  108.732 54.010  1.00 15.98 ? 301  PHE C CD1 1 
ATOM   9658  C  CD2 . PHE C 1 304 ? 93.707  110.146 53.536  1.00 15.58 ? 301  PHE C CD2 1 
ATOM   9659  C  CE1 . PHE C 1 304 ? 96.379  109.533 53.214  1.00 17.46 ? 301  PHE C CE1 1 
ATOM   9660  C  CE2 . PHE C 1 304 ? 94.512  110.945 52.740  1.00 18.42 ? 301  PHE C CE2 1 
ATOM   9661  C  CZ  . PHE C 1 304 ? 95.864  110.635 52.579  1.00 17.05 ? 301  PHE C CZ  1 
ATOM   9662  N  N   . PRO C 1 305 ? 93.742  110.749 57.351  1.00 14.73 ? 302  PRO C N   1 
ATOM   9663  C  CA  . PRO C 1 305 ? 93.324  112.127 57.638  1.00 14.99 ? 302  PRO C CA  1 
ATOM   9664  C  C   . PRO C 1 305 ? 93.515  113.038 56.445  1.00 16.02 ? 302  PRO C C   1 
ATOM   9665  O  O   . PRO C 1 305 ? 94.619  113.148 55.895  1.00 17.01 ? 302  PRO C O   1 
ATOM   9666  C  CB  . PRO C 1 305 ? 94.244  112.548 58.784  1.00 15.02 ? 302  PRO C CB  1 
ATOM   9667  C  CG  . PRO C 1 305 ? 95.366  111.589 58.783  1.00 16.66 ? 302  PRO C CG  1 
ATOM   9668  C  CD  . PRO C 1 305 ? 95.108  110.483 57.828  1.00 15.12 ? 302  PRO C CD  1 
ATOM   9669  N  N   . SER C 1 306 ? 92.437  113.680 56.040  1.00 15.22 ? 303  SER C N   1 
ATOM   9670  C  CA  . SER C 1 306 ? 92.462  114.581 54.920  1.00 15.39 ? 303  SER C CA  1 
ATOM   9671  C  C   . SER C 1 306 ? 91.771  115.863 55.378  1.00 14.71 ? 303  SER C C   1 
ATOM   9672  O  O   . SER C 1 306 ? 91.258  115.933 56.494  1.00 13.82 ? 303  SER C O   1 
ATOM   9673  C  CB  . SER C 1 306 ? 91.705  113.949 53.750  1.00 16.12 ? 303  SER C CB  1 
ATOM   9674  O  OG  . SER C 1 306 ? 91.847  114.724 52.587  1.00 19.52 ? 303  SER C OG  1 
ATOM   9675  N  N   . SER C 1 307 ? 91.780  116.881 54.540  1.00 15.82 ? 304  SER C N   1 
ATOM   9676  C  CA  . SER C 1 307 ? 91.131  118.127 54.888  1.00 15.77 ? 304  SER C CA  1 
ATOM   9677  C  C   . SER C 1 307 ? 90.750  118.924 53.670  1.00 15.50 ? 304  SER C C   1 
ATOM   9678  O  O   . SER C 1 307 ? 91.267  118.704 52.577  1.00 14.89 ? 304  SER C O   1 
ATOM   9679  C  CB  . SER C 1 307 ? 92.040  118.984 55.764  1.00 16.85 ? 304  SER C CB  1 
ATOM   9680  O  OG  . SER C 1 307 ? 93.190  119.361 55.044  1.00 16.92 ? 304  SER C OG  1 
ATOM   9681  N  N   . ALA C 1 308 ? 89.816  119.854 53.863  1.00 14.39 ? 305  ALA C N   1 
ATOM   9682  C  CA  . ALA C 1 308 ? 89.403  120.756 52.799  1.00 13.24 ? 305  ALA C CA  1 
ATOM   9683  C  C   . ALA C 1 308 ? 88.971  122.079 53.400  1.00 12.82 ? 305  ALA C C   1 
ATOM   9684  O  O   . ALA C 1 308 ? 88.548  122.141 54.555  1.00 10.39 ? 305  ALA C O   1 
ATOM   9685  C  CB  . ALA C 1 308 ? 88.283  120.145 51.946  1.00 14.00 ? 305  ALA C CB  1 
ATOM   9686  N  N   . ASN C 1 309 ? 89.145  123.137 52.609  1.00 12.28 ? 306  ASN C N   1 
ATOM   9687  C  CA  . ASN C 1 309 ? 88.797  124.485 52.959  1.00 12.80 ? 306  ASN C CA  1 
ATOM   9688  C  C   . ASN C 1 309 ? 87.600  124.875 52.091  1.00 11.44 ? 306  ASN C C   1 
ATOM   9689  O  O   . ASN C 1 309 ? 87.739  124.949 50.876  1.00 11.82 ? 306  ASN C O   1 
ATOM   9690  C  CB  . ASN C 1 309 ? 89.982  125.388 52.640  1.00 14.27 ? 306  ASN C CB  1 
ATOM   9691  C  CG  . ASN C 1 309 ? 91.289  124.880 53.256  1.00 20.91 ? 306  ASN C CG  1 
ATOM   9692  O  OD1 . ASN C 1 309 ? 91.349  124.543 54.446  1.00 22.90 ? 306  ASN C OD1 1 
ATOM   9693  N  ND2 . ASN C 1 309 ? 92.352  124.843 52.443  1.00 22.05 ? 306  ASN C ND2 1 
ATOM   9694  N  N   . PHE C 1 310 ? 86.423  125.048 52.705  1.00 11.82 ? 307  PHE C N   1 
ATOM   9695  C  CA  . PHE C 1 310 ? 85.209  125.407 51.989  1.00 11.59 ? 307  PHE C CA  1 
ATOM   9696  C  C   . PHE C 1 310 ? 84.923  126.881 52.193  1.00 12.22 ? 307  PHE C C   1 
ATOM   9697  O  O   . PHE C 1 310 ? 85.483  127.492 53.111  1.00 11.50 ? 307  PHE C O   1 
ATOM   9698  C  CB  . PHE C 1 310 ? 83.983  124.606 52.446  1.00 11.54 ? 307  PHE C CB  1 
ATOM   9699  C  CG  . PHE C 1 310 ? 84.040  123.138 52.144  1.00 11.59 ? 307  PHE C CG  1 
ATOM   9700  C  CD1 . PHE C 1 310 ? 84.885  122.628 51.161  1.00 12.92 ? 307  PHE C CD1 1 
ATOM   9701  C  CD2 . PHE C 1 310 ? 83.114  122.290 52.714  1.00 10.35 ? 307  PHE C CD2 1 
ATOM   9702  C  CE1 . PHE C 1 310 ? 84.902  121.273 50.864  1.00 11.67 ? 307  PHE C CE1 1 
ATOM   9703  C  CE2 . PHE C 1 310 ? 83.109  120.932 52.413  1.00 14.06 ? 307  PHE C CE2 1 
ATOM   9704  C  CZ  . PHE C 1 310 ? 84.002  120.426 51.480  1.00 14.90 ? 307  PHE C CZ  1 
ATOM   9705  N  N   . SER C 1 311 ? 84.092  127.474 51.335  1.00 12.27 ? 308  SER C N   1 
ATOM   9706  C  CA  . SER C 1 311 ? 83.444  126.804 50.198  1.00 12.30 ? 308  SER C CA  1 
ATOM   9707  C  C   . SER C 1 311 ? 84.401  126.653 49.017  1.00 12.22 ? 308  SER C C   1 
ATOM   9708  O  O   . SER C 1 311 ? 84.055  126.085 47.983  1.00 13.43 ? 308  SER C O   1 
ATOM   9709  C  CB  . SER C 1 311 ? 82.221  127.605 49.748  1.00 11.28 ? 308  SER C CB  1 
ATOM   9710  O  OG  . SER C 1 311 ? 82.618  128.894 49.306  1.00 15.99 ? 308  SER C OG  1 
ATOM   9711  N  N   . THR C 1 312 ? 85.611  127.144 49.193  1.00 13.02 ? 309  THR C N   1 
ATOM   9712  C  CA  . THR C 1 312 ? 86.643  127.105 48.165  1.00 13.03 ? 309  THR C CA  1 
ATOM   9713  C  C   . THR C 1 312 ? 86.792  125.755 47.470  1.00 12.87 ? 309  THR C C   1 
ATOM   9714  O  O   . THR C 1 312 ? 86.715  125.674 46.238  1.00 13.31 ? 309  THR C O   1 
ATOM   9715  C  CB  . THR C 1 312 ? 87.994  127.469 48.801  1.00 13.49 ? 309  THR C CB  1 
ATOM   9716  O  OG1 . THR C 1 312 ? 87.836  128.680 49.565  1.00 12.02 ? 309  THR C OG1 1 
ATOM   9717  C  CG2 . THR C 1 312 ? 89.045  127.629 47.745  1.00 11.55 ? 309  THR C CG2 1 
ATOM   9718  N  N   . ASP C 1 313 ? 86.979  124.703 48.263  1.00 13.04 ? 310  ASP C N   1 
ATOM   9719  C  CA  . ASP C 1 313 ? 87.196  123.347 47.738  1.00 13.01 ? 310  ASP C CA  1 
ATOM   9720  C  C   . ASP C 1 313 ? 85.911  122.628 47.263  1.00 13.26 ? 310  ASP C C   1 
ATOM   9721  O  O   . ASP C 1 313 ? 85.963  121.469 46.812  1.00 11.90 ? 310  ASP C O   1 
ATOM   9722  C  CB  . ASP C 1 313 ? 87.994  122.498 48.750  1.00 12.49 ? 310  ASP C CB  1 
ATOM   9723  C  CG  . ASP C 1 313 ? 89.417  123.052 49.004  1.00 17.36 ? 310  ASP C CG  1 
ATOM   9724  O  OD1 . ASP C 1 313 ? 89.874  123.952 48.257  1.00 19.34 ? 310  ASP C OD1 1 
ATOM   9725  O  OD2 . ASP C 1 313 ? 90.091  122.588 49.950  1.00 15.28 ? 310  ASP C OD2 1 
ATOM   9726  N  N   . LEU C 1 314 ? 84.756  123.283 47.359  1.00 13.08 ? 311  LEU C N   1 
ATOM   9727  C  CA  . LEU C 1 314 ? 83.542  122.676 46.804  1.00 13.86 ? 311  LEU C CA  1 
ATOM   9728  C  C   . LEU C 1 314 ? 83.643  122.790 45.280  1.00 14.44 ? 311  LEU C C   1 
ATOM   9729  O  O   . LEU C 1 314 ? 82.908  122.138 44.535  1.00 13.79 ? 311  LEU C O   1 
ATOM   9730  C  CB  . LEU C 1 314 ? 82.273  123.357 47.325  1.00 14.42 ? 311  LEU C CB  1 
ATOM   9731  C  CG  . LEU C 1 314 ? 81.940  123.123 48.799  1.00 13.89 ? 311  LEU C CG  1 
ATOM   9732  C  CD1 . LEU C 1 314 ? 80.785  124.031 49.254  1.00 12.86 ? 311  LEU C CD1 1 
ATOM   9733  C  CD2 . LEU C 1 314 ? 81.612  121.642 49.012  1.00 12.47 ? 311  LEU C CD2 1 
ATOM   9734  N  N   . HIS C 1 315 ? 84.555  123.649 44.827  1.00 14.72 ? 312  HIS C N   1 
ATOM   9735  C  CA  . HIS C 1 315 ? 84.789  123.861 43.413  1.00 15.69 ? 312  HIS C CA  1 
ATOM   9736  C  C   . HIS C 1 315 ? 85.997  123.050 42.905  1.00 16.24 ? 312  HIS C C   1 
ATOM   9737  O  O   . HIS C 1 315 ? 86.431  123.224 41.771  1.00 16.62 ? 312  HIS C O   1 
ATOM   9738  C  CB  . HIS C 1 315 ? 84.972  125.358 43.141  1.00 15.65 ? 312  HIS C CB  1 
ATOM   9739  C  CG  . HIS C 1 315 ? 83.808  126.198 43.583  1.00 13.53 ? 312  HIS C CG  1 
ATOM   9740  N  ND1 . HIS C 1 315 ? 82.840  126.645 42.711  1.00 11.83 ? 312  HIS C ND1 1 
ATOM   9741  C  CD2 . HIS C 1 315 ? 83.444  126.648 44.810  1.00 12.07 ? 312  HIS C CD2 1 
ATOM   9742  C  CE1 . HIS C 1 315 ? 81.947  127.362 43.376  1.00 13.35 ? 312  HIS C CE1 1 
ATOM   9743  N  NE2 . HIS C 1 315 ? 82.286  127.371 44.653  1.00 13.06 ? 312  HIS C NE2 1 
ATOM   9744  N  N   . SER C 1 316 ? 86.554  122.187 43.755  1.00 16.16 ? 313  SER C N   1 
ATOM   9745  C  CA  . SER C 1 316 ? 87.664  121.322 43.349  1.00 15.62 ? 313  SER C CA  1 
ATOM   9746  C  C   . SER C 1 316 ? 87.353  119.868 43.751  1.00 15.33 ? 313  SER C C   1 
ATOM   9747  O  O   . SER C 1 316 ? 87.373  118.983 42.904  1.00 14.88 ? 313  SER C O   1 
ATOM   9748  C  CB  . SER C 1 316 ? 89.021  121.807 43.887  1.00 15.52 ? 313  SER C CB  1 
ATOM   9749  O  OG  . SER C 1 316 ? 89.090  121.797 45.296  1.00 17.47 ? 313  SER C OG  1 
ATOM   9750  N  N   . LEU C 1 317 ? 87.006  119.646 45.023  1.00 15.47 ? 314  LEU C N   1 
ATOM   9751  C  CA  . LEU C 1 317 ? 86.659  118.312 45.530  1.00 14.98 ? 314  LEU C CA  1 
ATOM   9752  C  C   . LEU C 1 317 ? 85.152  118.106 45.764  1.00 14.22 ? 314  LEU C C   1 
ATOM   9753  O  O   . LEU C 1 317 ? 84.723  117.002 46.089  1.00 14.40 ? 314  LEU C O   1 
ATOM   9754  C  CB  . LEU C 1 317 ? 87.438  118.015 46.819  1.00 16.20 ? 314  LEU C CB  1 
ATOM   9755  C  CG  . LEU C 1 317 ? 88.953  117.890 46.597  1.00 17.38 ? 314  LEU C CG  1 
ATOM   9756  C  CD1 . LEU C 1 317 ? 89.636  117.538 47.897  1.00 23.09 ? 314  LEU C CD1 1 
ATOM   9757  C  CD2 . LEU C 1 317 ? 89.258  116.842 45.545  1.00 20.85 ? 314  LEU C CD2 1 
ATOM   9758  N  N   . GLY C 1 318 ? 84.362  119.160 45.597  1.00 12.67 ? 315  GLY C N   1 
ATOM   9759  C  CA  . GLY C 1 318 ? 82.898  119.100 45.764  1.00 11.60 ? 315  GLY C CA  1 
ATOM   9760  C  C   . GLY C 1 318 ? 82.202  117.994 44.975  1.00 10.68 ? 315  GLY C C   1 
ATOM   9761  O  O   . GLY C 1 318 ? 81.335  117.282 45.500  1.00 9.60  ? 315  GLY C O   1 
ATOM   9762  N  N   . GLN C 1 319 ? 82.546  117.875 43.700  1.00 9.40  ? 316  GLN C N   1 
ATOM   9763  C  CA  . GLN C 1 319 ? 81.999  116.824 42.869  1.00 9.18  ? 316  GLN C CA  1 
ATOM   9764  C  C   . GLN C 1 319 ? 82.289  115.476 43.510  1.00 9.65  ? 316  GLN C C   1 
ATOM   9765  O  O   . GLN C 1 319 ? 81.385  114.658 43.671  1.00 10.61 ? 316  GLN C O   1 
ATOM   9766  C  CB  . GLN C 1 319 ? 82.606  116.884 41.469  1.00 8.89  ? 316  GLN C CB  1 
ATOM   9767  C  CG  . GLN C 1 319 ? 82.326  115.653 40.606  1.00 9.97  ? 316  GLN C CG  1 
ATOM   9768  C  CD  . GLN C 1 319 ? 80.848  115.517 40.234  1.00 11.91 ? 316  GLN C CD  1 
ATOM   9769  O  OE1 . GLN C 1 319 ? 80.210  116.492 39.847  1.00 10.60 ? 316  GLN C OE1 1 
ATOM   9770  N  NE2 . GLN C 1 319 ? 80.317  114.303 40.324  1.00 9.48  ? 316  GLN C NE2 1 
ATOM   9771  N  N   . TYR C 1 320 ? 83.547  115.252 43.908  1.00 9.69  ? 317  TYR C N   1 
ATOM   9772  C  CA  . TYR C 1 320 ? 83.936  113.973 44.522  1.00 9.46  ? 317  TYR C CA  1 
ATOM   9773  C  C   . TYR C 1 320 ? 83.234  113.701 45.865  1.00 9.54  ? 317  TYR C C   1 
ATOM   9774  O  O   . TYR C 1 320 ? 82.770  112.595 46.109  1.00 9.38  ? 317  TYR C O   1 
ATOM   9775  C  CB  . TYR C 1 320 ? 85.461  113.882 44.712  1.00 10.74 ? 317  TYR C CB  1 
ATOM   9776  C  CG  . TYR C 1 320 ? 85.923  112.443 44.990  1.00 8.69  ? 317  TYR C CG  1 
ATOM   9777  C  CD1 . TYR C 1 320 ? 86.532  111.675 44.002  1.00 11.50 ? 317  TYR C CD1 1 
ATOM   9778  C  CD2 . TYR C 1 320 ? 85.656  111.839 46.210  1.00 10.86 ? 317  TYR C CD2 1 
ATOM   9779  C  CE1 . TYR C 1 320 ? 86.909  110.353 44.255  1.00 10.79 ? 317  TYR C CE1 1 
ATOM   9780  C  CE2 . TYR C 1 320 ? 86.023  110.541 46.470  1.00 11.31 ? 317  TYR C CE2 1 
ATOM   9781  C  CZ  . TYR C 1 320 ? 86.646  109.795 45.492  1.00 12.47 ? 317  TYR C CZ  1 
ATOM   9782  O  OH  . TYR C 1 320 ? 86.992  108.488 45.791  1.00 12.17 ? 317  TYR C OH  1 
ATOM   9783  N  N   . VAL C 1 321 ? 83.185  114.690 46.752  1.00 9.04  ? 318  VAL C N   1 
ATOM   9784  C  CA  . VAL C 1 321 ? 82.521  114.485 48.037  1.00 9.05  ? 318  VAL C CA  1 
ATOM   9785  C  C   . VAL C 1 321 ? 81.047  114.081 47.794  1.00 9.18  ? 318  VAL C C   1 
ATOM   9786  O  O   . VAL C 1 321 ? 80.507  113.180 48.457  1.00 9.84  ? 318  VAL C O   1 
ATOM   9787  C  CB  . VAL C 1 321 ? 82.667  115.734 48.979  1.00 9.90  ? 318  VAL C CB  1 
ATOM   9788  C  CG1 . VAL C 1 321 ? 81.875  115.553 50.249  1.00 9.05  ? 318  VAL C CG1 1 
ATOM   9789  C  CG2 . VAL C 1 321 ? 84.169  115.983 49.344  1.00 7.03  ? 318  VAL C CG2 1 
ATOM   9790  N  N   . GLN C 1 322 ? 80.418  114.666 46.787  1.00 9.95  ? 319  GLN C N   1 
ATOM   9791  C  CA  . GLN C 1 322 ? 79.013  114.348 46.519  1.00 10.95 ? 319  GLN C CA  1 
ATOM   9792  C  C   . GLN C 1 322 ? 78.766  113.010 45.809  1.00 11.08 ? 319  GLN C C   1 
ATOM   9793  O  O   . GLN C 1 322 ? 77.817  112.303 46.165  1.00 10.31 ? 319  GLN C O   1 
ATOM   9794  C  CB  . GLN C 1 322 ? 78.356  115.437 45.663  1.00 11.36 ? 319  GLN C CB  1 
ATOM   9795  C  CG  . GLN C 1 322 ? 76.815  115.336 45.598  1.00 11.50 ? 319  GLN C CG  1 
ATOM   9796  C  CD  . GLN C 1 322 ? 76.148  115.687 46.928  1.00 11.74 ? 319  GLN C CD  1 
ATOM   9797  O  OE1 . GLN C 1 322 ? 76.502  116.677 47.556  1.00 14.05 ? 319  GLN C OE1 1 
ATOM   9798  N  NE2 . GLN C 1 322 ? 75.152  114.896 47.335  1.00 10.27 ? 319  GLN C NE2 1 
ATOM   9799  N  N   . GLU C 1 323 ? 79.607  112.665 44.825  1.00 10.15 ? 320  GLU C N   1 
ATOM   9800  C  CA  . GLU C 1 323 ? 79.354  111.483 44.003  1.00 11.25 ? 320  GLU C CA  1 
ATOM   9801  C  C   . GLU C 1 323 ? 80.495  110.494 43.730  1.00 10.65 ? 320  GLU C C   1 
ATOM   9802  O  O   . GLU C 1 323 ? 80.347  109.635 42.866  1.00 10.90 ? 320  GLU C O   1 
ATOM   9803  C  CB  . GLU C 1 323 ? 78.780  111.965 42.664  1.00 12.58 ? 320  GLU C CB  1 
ATOM   9804  C  CG  . GLU C 1 323 ? 77.490  112.780 42.836  1.00 14.37 ? 320  GLU C CG  1 
ATOM   9805  C  CD  . GLU C 1 323 ? 76.899  113.279 41.528  1.00 17.36 ? 320  GLU C CD  1 
ATOM   9806  O  OE1 . GLU C 1 323 ? 77.623  113.335 40.496  1.00 20.08 ? 320  GLU C OE1 1 
ATOM   9807  O  OE2 . GLU C 1 323 ? 75.704  113.648 41.545  1.00 19.90 ? 320  GLU C OE2 1 
ATOM   9808  N  N   . GLY C 1 324 ? 81.625  110.633 44.420  1.00 11.10 ? 321  GLY C N   1 
ATOM   9809  C  CA  . GLY C 1 324 ? 82.745  109.702 44.250  1.00 11.82 ? 321  GLY C CA  1 
ATOM   9810  C  C   . GLY C 1 324 ? 82.549  108.479 45.139  1.00 11.69 ? 321  GLY C C   1 
ATOM   9811  O  O   . GLY C 1 324 ? 81.435  108.190 45.551  1.00 12.33 ? 321  GLY C O   1 
ATOM   9812  N  N   A ARG C 1 325 ? 83.631  107.761 45.439  0.60 12.23 ? 322  ARG C N   1 
ATOM   9813  N  N   B ARG C 1 325 ? 83.622  107.753 45.437  0.40 11.92 ? 322  ARG C N   1 
ATOM   9814  C  CA  A ARG C 1 325 ? 83.547  106.583 46.305  0.60 12.89 ? 322  ARG C CA  1 
ATOM   9815  C  CA  B ARG C 1 325 ? 83.496  106.581 46.295  0.40 12.16 ? 322  ARG C CA  1 
ATOM   9816  C  C   A ARG C 1 325 ? 82.963  106.958 47.671  0.60 12.79 ? 322  ARG C C   1 
ATOM   9817  C  C   B ARG C 1 325 ? 82.940  106.965 47.660  0.40 12.46 ? 322  ARG C C   1 
ATOM   9818  O  O   A ARG C 1 325 ? 83.209  108.047 48.178  0.60 12.51 ? 322  ARG C O   1 
ATOM   9819  O  O   B ARG C 1 325 ? 83.189  108.059 48.157  0.40 12.31 ? 322  ARG C O   1 
ATOM   9820  C  CB  A ARG C 1 325 ? 84.927  105.943 46.472  0.60 13.45 ? 322  ARG C CB  1 
ATOM   9821  C  CB  B ARG C 1 325 ? 84.829  105.871 46.452  0.40 12.28 ? 322  ARG C CB  1 
ATOM   9822  C  CG  A ARG C 1 325 ? 85.448  105.277 45.212  0.60 13.58 ? 322  ARG C CG  1 
ATOM   9823  C  CG  B ARG C 1 325 ? 85.297  105.205 45.194  0.40 10.84 ? 322  ARG C CG  1 
ATOM   9824  C  CD  A ARG C 1 325 ? 84.722  103.965 44.933  0.60 14.59 ? 322  ARG C CD  1 
ATOM   9825  C  CD  B ARG C 1 325 ? 86.644  104.592 45.416  0.40 9.70  ? 322  ARG C CD  1 
ATOM   9826  N  NE  A ARG C 1 325 ? 85.064  102.939 45.916  0.60 14.90 ? 322  ARG C NE  1 
ATOM   9827  N  NE  B ARG C 1 325 ? 86.655  103.620 46.501  0.40 5.24  ? 322  ARG C NE  1 
ATOM   9828  C  CZ  A ARG C 1 325 ? 86.080  102.084 45.794  0.60 13.03 ? 322  ARG C CZ  1 
ATOM   9829  C  CZ  B ARG C 1 325 ? 86.487  102.315 46.324  0.40 4.57  ? 322  ARG C CZ  1 
ATOM   9830  N  NH1 A ARG C 1 325 ? 86.856  102.104 44.722  0.60 14.98 ? 322  ARG C NH1 1 
ATOM   9831  N  NH1 B ARG C 1 325 ? 86.284  101.836 45.108  0.40 3.78  ? 322  ARG C NH1 1 
ATOM   9832  N  NH2 A ARG C 1 325 ? 86.316  101.194 46.740  0.60 12.14 ? 322  ARG C NH2 1 
ATOM   9833  N  NH2 B ARG C 1 325 ? 86.515  101.496 47.360  0.40 5.49  ? 322  ARG C NH2 1 
ATOM   9834  N  N   . ARG C 1 326 ? 82.185  106.053 48.258  1.00 12.90 ? 323  ARG C N   1 
ATOM   9835  C  CA  . ARG C 1 326 ? 81.558  106.302 49.553  1.00 13.53 ? 323  ARG C CA  1 
ATOM   9836  C  C   . ARG C 1 326 ? 82.372  105.739 50.722  1.00 14.35 ? 323  ARG C C   1 
ATOM   9837  O  O   . ARG C 1 326 ? 81.872  104.946 51.518  1.00 14.17 ? 323  ARG C O   1 
ATOM   9838  C  CB  . ARG C 1 326 ? 80.129  105.742 49.563  1.00 13.87 ? 323  ARG C CB  1 
ATOM   9839  C  CG  . ARG C 1 326 ? 79.202  106.233 48.412  1.00 14.27 ? 323  ARG C CG  1 
ATOM   9840  C  CD  . ARG C 1 326 ? 78.934  107.761 48.428  1.00 14.54 ? 323  ARG C CD  1 
ATOM   9841  N  NE  . ARG C 1 326 ? 80.113  108.522 48.031  1.00 14.17 ? 323  ARG C NE  1 
ATOM   9842  C  CZ  . ARG C 1 326 ? 80.226  109.845 48.115  1.00 12.76 ? 323  ARG C CZ  1 
ATOM   9843  N  NH1 . ARG C 1 326 ? 79.239  110.585 48.600  1.00 15.95 ? 323  ARG C NH1 1 
ATOM   9844  N  NH2 . ARG C 1 326 ? 81.348  110.427 47.735  1.00 11.91 ? 323  ARG C NH2 1 
ATOM   9845  N  N   . ASP C 1 327 ? 83.623  106.192 50.833  1.00 14.58 ? 324  ASP C N   1 
ATOM   9846  C  CA  . ASP C 1 327 ? 84.544  105.759 51.899  1.00 16.28 ? 324  ASP C CA  1 
ATOM   9847  C  C   . ASP C 1 327 ? 84.942  106.957 52.789  1.00 15.34 ? 324  ASP C C   1 
ATOM   9848  O  O   . ASP C 1 327 ? 85.885  106.867 53.572  1.00 14.72 ? 324  ASP C O   1 
ATOM   9849  C  CB  . ASP C 1 327 ? 85.817  105.171 51.276  1.00 17.34 ? 324  ASP C CB  1 
ATOM   9850  C  CG  . ASP C 1 327 ? 85.529  104.002 50.304  1.00 22.64 ? 324  ASP C CG  1 
ATOM   9851  O  OD1 . ASP C 1 327 ? 84.567  103.240 50.541  1.00 29.13 ? 324  ASP C OD1 1 
ATOM   9852  O  OD2 . ASP C 1 327 ? 86.288  103.845 49.317  1.00 26.51 ? 324  ASP C OD2 1 
ATOM   9853  N  N   . LEU C 1 328 ? 84.200  108.058 52.679  1.00 14.74 ? 325  LEU C N   1 
ATOM   9854  C  CA  . LEU C 1 328 ? 84.505  109.279 53.408  1.00 15.76 ? 325  LEU C CA  1 
ATOM   9855  C  C   . LEU C 1 328 ? 83.491  109.688 54.461  1.00 14.06 ? 325  LEU C C   1 
ATOM   9856  O  O   . LEU C 1 328 ? 82.308  109.353 54.354  1.00 15.18 ? 325  LEU C O   1 
ATOM   9857  C  CB  . LEU C 1 328 ? 84.429  110.463 52.432  1.00 17.27 ? 325  LEU C CB  1 
ATOM   9858  C  CG  . LEU C 1 328 ? 85.023  110.432 51.030  1.00 20.57 ? 325  LEU C CG  1 
ATOM   9859  C  CD1 . LEU C 1 328 ? 84.521  111.661 50.272  1.00 23.78 ? 325  LEU C CD1 1 
ATOM   9860  C  CD2 . LEU C 1 328 ? 86.543  110.377 51.078  1.00 24.76 ? 325  LEU C CD2 1 
ATOM   9861  N  N   . PHE C 1 329 ? 83.971  110.437 55.448  1.00 11.60 ? 326  PHE C N   1 
ATOM   9862  C  CA  . PHE C 1 329 ? 83.101  111.133 56.413  1.00 12.35 ? 326  PHE C CA  1 
ATOM   9863  C  C   . PHE C 1 329 ? 83.776  112.487 56.620  1.00 13.48 ? 326  PHE C C   1 
ATOM   9864  O  O   . PHE C 1 329 ? 84.971  112.623 56.343  1.00 13.70 ? 326  PHE C O   1 
ATOM   9865  C  CB  . PHE C 1 329 ? 82.764  110.350 57.690  1.00 11.34 ? 326  PHE C CB  1 
ATOM   9866  C  CG  . PHE C 1 329 ? 83.873  110.224 58.705  1.00 11.92 ? 326  PHE C CG  1 
ATOM   9867  C  CD1 . PHE C 1 329 ? 83.937  111.094 59.792  1.00 14.56 ? 326  PHE C CD1 1 
ATOM   9868  C  CD2 . PHE C 1 329 ? 84.763  109.181 58.652  1.00 9.89  ? 326  PHE C CD2 1 
ATOM   9869  C  CE1 . PHE C 1 329 ? 84.903  110.943 60.771  1.00 14.74 ? 326  PHE C CE1 1 
ATOM   9870  C  CE2 . PHE C 1 329 ? 85.728  109.035 59.616  1.00 11.22 ? 326  PHE C CE2 1 
ATOM   9871  C  CZ  . PHE C 1 329 ? 85.794  109.912 60.686  1.00 14.88 ? 326  PHE C CZ  1 
ATOM   9872  N  N   . GLU C 1 330 ? 82.986  113.488 56.987  1.00 12.73 ? 327  GLU C N   1 
ATOM   9873  C  CA  . GLU C 1 330 ? 83.443  114.845 57.223  1.00 13.99 ? 327  GLU C CA  1 
ATOM   9874  C  C   . GLU C 1 330 ? 83.206  115.303 58.657  1.00 13.72 ? 327  GLU C C   1 
ATOM   9875  O  O   . GLU C 1 330 ? 82.189  114.966 59.271  1.00 15.09 ? 327  GLU C O   1 
ATOM   9876  C  CB  . GLU C 1 330 ? 82.701  115.806 56.292  1.00 15.03 ? 327  GLU C CB  1 
ATOM   9877  C  CG  . GLU C 1 330 ? 83.069  115.645 54.824  1.00 15.50 ? 327  GLU C CG  1 
ATOM   9878  C  CD  . GLU C 1 330 ? 82.255  116.555 53.904  1.00 20.50 ? 327  GLU C CD  1 
ATOM   9879  O  OE1 . GLU C 1 330 ? 81.020  116.396 53.855  1.00 17.86 ? 327  GLU C OE1 1 
ATOM   9880  O  OE2 . GLU C 1 330 ? 82.870  117.374 53.180  1.00 16.80 ? 327  GLU C OE2 1 
ATOM   9881  N  N   . THR C 1 331 ? 84.149  116.092 59.169  1.00 13.25 ? 328  THR C N   1 
ATOM   9882  C  CA  . THR C 1 331 ? 84.084  116.666 60.499  1.00 12.89 ? 328  THR C CA  1 
ATOM   9883  C  C   . THR C 1 331 ? 84.281  118.151 60.230  1.00 14.20 ? 328  THR C C   1 
ATOM   9884  O  O   . THR C 1 331 ? 85.366  118.568 59.807  1.00 13.22 ? 328  THR C O   1 
ATOM   9885  C  CB  . THR C 1 331 ? 85.186  116.094 61.399  1.00 13.56 ? 328  THR C CB  1 
ATOM   9886  O  OG1 . THR C 1 331 ? 84.939  114.695 61.605  1.00 14.99 ? 328  THR C OG1 1 
ATOM   9887  C  CG2 . THR C 1 331 ? 85.234  116.794 62.757  1.00 14.40 ? 328  THR C CG2 1 
ATOM   9888  N  N   . VAL C 1 332 ? 83.223  118.928 60.445  1.00 12.66 ? 329  VAL C N   1 
ATOM   9889  C  CA  . VAL C 1 332 ? 83.227  120.339 60.143  1.00 14.29 ? 329  VAL C CA  1 
ATOM   9890  C  C   . VAL C 1 332 ? 83.464  121.250 61.334  1.00 14.57 ? 329  VAL C C   1 
ATOM   9891  O  O   . VAL C 1 332 ? 82.754  121.172 62.339  1.00 15.43 ? 329  VAL C O   1 
ATOM   9892  C  CB  . VAL C 1 332 ? 81.870  120.763 59.542  1.00 14.33 ? 329  VAL C CB  1 
ATOM   9893  C  CG1 . VAL C 1 332 ? 81.932  122.209 59.061  1.00 13.43 ? 329  VAL C CG1 1 
ATOM   9894  C  CG2 . VAL C 1 332 ? 81.478  119.839 58.388  1.00 14.77 ? 329  VAL C CG2 1 
ATOM   9895  N  N   . LEU C 1 333 ? 84.477  122.105 61.218  1.00 15.10 ? 330  LEU C N   1 
ATOM   9896  C  CA  . LEU C 1 333 ? 84.763  123.111 62.236  1.00 14.44 ? 330  LEU C CA  1 
ATOM   9897  C  C   . LEU C 1 333 ? 83.903  124.311 61.881  1.00 15.27 ? 330  LEU C C   1 
ATOM   9898  O  O   . LEU C 1 333 ? 84.161  125.018 60.891  1.00 16.48 ? 330  LEU C O   1 
ATOM   9899  C  CB  . LEU C 1 333 ? 86.226  123.536 62.231  1.00 14.57 ? 330  LEU C CB  1 
ATOM   9900  C  CG  . LEU C 1 333 ? 87.264  122.443 62.361  1.00 13.14 ? 330  LEU C CG  1 
ATOM   9901  C  CD1 . LEU C 1 333 ? 88.694  123.043 62.200  1.00 11.76 ? 330  LEU C CD1 1 
ATOM   9902  C  CD2 . LEU C 1 333 ? 87.085  121.691 63.662  1.00 15.82 ? 330  LEU C CD2 1 
ATOM   9903  N  N   . LYS C 1 334 ? 82.877  124.544 62.681  1.00 15.43 ? 331  LYS C N   1 
ATOM   9904  C  CA  . LYS C 1 334 ? 81.962  125.640 62.434  1.00 14.88 ? 331  LYS C CA  1 
ATOM   9905  C  C   . LYS C 1 334 ? 82.170  126.749 63.456  1.00 15.11 ? 331  LYS C C   1 
ATOM   9906  O  O   . LYS C 1 334 ? 81.989  126.543 64.665  1.00 15.47 ? 331  LYS C O   1 
ATOM   9907  C  CB  . LYS C 1 334 ? 80.530  125.123 62.477  1.00 13.67 ? 331  LYS C CB  1 
ATOM   9908  C  CG  . LYS C 1 334 ? 79.458  126.190 62.313  1.00 15.32 ? 331  LYS C CG  1 
ATOM   9909  C  CD  . LYS C 1 334 ? 79.532  126.879 60.966  1.00 16.79 ? 331  LYS C CD  1 
ATOM   9910  C  CE  . LYS C 1 334 ? 78.418  127.922 60.816  1.00 19.53 ? 331  LYS C CE  1 
ATOM   9911  N  NZ  . LYS C 1 334 ? 78.580  129.050 61.776  1.00 20.88 ? 331  LYS C NZ  1 
ATOM   9912  N  N   . VAL C 1 335 ? 82.546  127.926 62.966  1.00 15.09 ? 332  VAL C N   1 
ATOM   9913  C  CA  . VAL C 1 335 ? 82.785  129.081 63.847  1.00 14.88 ? 332  VAL C CA  1 
ATOM   9914  C  C   . VAL C 1 335 ? 81.479  129.852 64.048  1.00 15.27 ? 332  VAL C C   1 
ATOM   9915  O  O   . VAL C 1 335 ? 80.818  130.214 63.083  1.00 15.50 ? 332  VAL C O   1 
ATOM   9916  C  CB  . VAL C 1 335 ? 83.882  129.999 63.287  1.00 14.74 ? 332  VAL C CB  1 
ATOM   9917  C  CG1 . VAL C 1 335 ? 84.170  131.128 64.261  1.00 13.22 ? 332  VAL C CG1 1 
ATOM   9918  C  CG2 . VAL C 1 335 ? 85.172  129.196 63.007  1.00 14.06 ? 332  VAL C CG2 1 
ATOM   9919  N  N   . GLY C 1 336 ? 81.105  130.080 65.303  1.00 15.68 ? 333  GLY C N   1 
ATOM   9920  C  CA  . GLY C 1 336 ? 79.851  130.770 65.630  1.00 16.75 ? 333  GLY C CA  1 
ATOM   9921  C  C   . GLY C 1 336 ? 79.791  132.251 65.289  1.00 17.97 ? 333  GLY C C   1 
ATOM   9922  O  O   . GLY C 1 336 ? 78.815  132.722 64.704  1.00 18.96 ? 333  GLY C O   1 
ATOM   9923  N  N   . LYS C 1 337 ? 80.824  132.987 65.662  1.00 18.82 ? 334  LYS C N   1 
ATOM   9924  C  CA  . LYS C 1 337 ? 80.874  134.429 65.405  1.00 21.12 ? 334  LYS C CA  1 
ATOM   9925  C  C   . LYS C 1 337 ? 82.115  134.768 64.601  1.00 21.84 ? 334  LYS C C   1 
ATOM   9926  O  O   . LYS C 1 337 ? 83.221  134.381 64.966  1.00 21.56 ? 334  LYS C O   1 
ATOM   9927  C  CB  . LYS C 1 337 ? 80.875  135.217 66.722  1.00 21.04 ? 334  LYS C CB  1 
ATOM   9928  C  CG  . LYS C 1 337 ? 81.087  136.746 66.561  1.00 23.35 ? 334  LYS C CG  1 
ATOM   9929  C  CD  . LYS C 1 337 ? 79.961  137.392 65.754  1.00 26.57 ? 334  LYS C CD  1 
ATOM   9930  C  CE  . LYS C 1 337 ? 80.150  138.905 65.543  1.00 29.71 ? 334  LYS C CE  1 
ATOM   9931  N  NZ  . LYS C 1 337 ? 81.294  139.250 64.646  1.00 29.79 ? 334  LYS C NZ  1 
ATOM   9932  N  N   . SER C 1 338 ? 81.914  135.479 63.494  1.00 22.89 ? 335  SER C N   1 
ATOM   9933  C  CA  . SER C 1 338 ? 83.003  135.888 62.612  1.00 23.42 ? 335  SER C CA  1 
ATOM   9934  C  C   . SER C 1 338 ? 83.728  137.087 63.206  1.00 23.51 ? 335  SER C C   1 
ATOM   9935  O  O   . SER C 1 338 ? 83.108  137.960 63.817  1.00 24.10 ? 335  SER C O   1 
ATOM   9936  C  CB  . SER C 1 338 ? 82.450  136.226 61.223  1.00 23.91 ? 335  SER C CB  1 
ATOM   9937  O  OG  . SER C 1 338 ? 83.454  136.733 60.368  1.00 24.76 ? 335  SER C OG  1 
ATOM   9938  N  N   . THR C 1 339 ? 85.039  137.145 63.009  1.00 22.57 ? 336  THR C N   1 
ATOM   9939  C  CA  . THR C 1 339 ? 85.839  138.239 63.544  1.00 23.03 ? 336  THR C CA  1 
ATOM   9940  C  C   . THR C 1 339 ? 85.394  139.601 63.014  1.00 22.50 ? 336  THR C C   1 
ATOM   9941  O  O   . THR C 1 339 ? 85.320  140.572 63.767  1.00 22.69 ? 336  THR C O   1 
ATOM   9942  C  CB  . THR C 1 339 ? 87.314  138.052 63.192  1.00 23.59 ? 336  THR C CB  1 
ATOM   9943  O  OG1 . THR C 1 339 ? 87.745  136.763 63.640  1.00 24.06 ? 336  THR C OG1 1 
ATOM   9944  C  CG2 . THR C 1 339 ? 88.159  139.143 63.834  1.00 24.03 ? 336  THR C CG2 1 
ATOM   9945  N  N   . HIS C 1 340 ? 85.122  139.666 61.713  1.00 21.82 ? 337  HIS C N   1 
ATOM   9946  C  CA  . HIS C 1 340 ? 84.677  140.892 61.081  1.00 21.28 ? 337  HIS C CA  1 
ATOM   9947  C  C   . HIS C 1 340 ? 83.377  140.603 60.359  1.00 21.02 ? 337  HIS C C   1 
ATOM   9948  O  O   . HIS C 1 340 ? 83.150  139.472 59.911  1.00 21.12 ? 337  HIS C O   1 
ATOM   9949  C  CB  . HIS C 1 340 ? 85.708  141.403 60.082  1.00 20.76 ? 337  HIS C CB  1 
ATOM   9950  C  CG  . HIS C 1 340 ? 87.064  141.612 60.671  1.00 21.44 ? 337  HIS C CG  1 
ATOM   9951  N  ND1 . HIS C 1 340 ? 87.355  142.667 61.511  1.00 22.49 ? 337  HIS C ND1 1 
ATOM   9952  C  CD2 . HIS C 1 340 ? 88.220  140.925 60.514  1.00 19.25 ? 337  HIS C CD2 1 
ATOM   9953  C  CE1 . HIS C 1 340 ? 88.628  142.606 61.862  1.00 23.35 ? 337  HIS C CE1 1 
ATOM   9954  N  NE2 . HIS C 1 340 ? 89.173  141.556 61.273  1.00 21.85 ? 337  HIS C NE2 1 
ATOM   9955  N  N   . GLU C 1 341 ? 82.543  141.635 60.249  1.00 19.86 ? 338  GLU C N   1 
ATOM   9956  C  CA  . GLU C 1 341 ? 81.245  141.548 59.590  1.00 20.33 ? 338  GLU C CA  1 
ATOM   9957  C  C   . GLU C 1 341 ? 81.165  142.543 58.440  1.00 18.48 ? 338  GLU C C   1 
ATOM   9958  O  O   . GLU C 1 341 ? 81.733  143.628 58.499  1.00 18.54 ? 338  GLU C O   1 
ATOM   9959  C  CB  . GLU C 1 341 ? 80.113  141.845 60.581  1.00 21.40 ? 338  GLU C CB  1 
ATOM   9960  C  CG  . GLU C 1 341 ? 80.001  140.876 61.770  1.00 24.96 ? 338  GLU C CG  1 
ATOM   9961  C  CD  . GLU C 1 341 ? 79.422  139.504 61.418  1.00 28.45 ? 338  GLU C CD  1 
ATOM   9962  O  OE1 . GLU C 1 341 ? 79.162  139.222 60.226  1.00 28.39 ? 338  GLU C OE1 1 
ATOM   9963  O  OE2 . GLU C 1 341 ? 79.209  138.714 62.364  1.00 31.92 ? 338  GLU C OE2 1 
ATOM   9964  N  N   . LEU C 1 342 ? 80.491  142.128 57.376  1.00 17.28 ? 339  LEU C N   1 
ATOM   9965  C  CA  . LEU C 1 342 ? 80.278  142.944 56.204  1.00 16.51 ? 339  LEU C CA  1 
ATOM   9966  C  C   . LEU C 1 342 ? 78.822  142.769 55.782  1.00 16.68 ? 339  LEU C C   1 
ATOM   9967  O  O   . LEU C 1 342 ? 78.316  141.646 55.707  1.00 13.41 ? 339  LEU C O   1 
ATOM   9968  C  CB  . LEU C 1 342 ? 81.201  142.532 55.067  1.00 16.33 ? 339  LEU C CB  1 
ATOM   9969  C  CG  . LEU C 1 342 ? 82.687  142.831 55.230  1.00 17.86 ? 339  LEU C CG  1 
ATOM   9970  C  CD1 . LEU C 1 342 ? 83.461  142.156 54.104  1.00 19.49 ? 339  LEU C CD1 1 
ATOM   9971  C  CD2 . LEU C 1 342 ? 82.952  144.337 55.266  1.00 18.35 ? 339  LEU C CD2 1 
ATOM   9972  N  N   . THR C 1 343 ? 78.153  143.886 55.510  1.00 17.04 ? 340  THR C N   1 
ATOM   9973  C  CA  . THR C 1 343 ? 76.751  143.853 55.106  1.00 18.38 ? 340  THR C CA  1 
ATOM   9974  C  C   . THR C 1 343 ? 76.623  143.950 53.606  1.00 18.34 ? 340  THR C C   1 
ATOM   9975  O  O   . THR C 1 343 ? 77.237  144.813 52.989  1.00 20.23 ? 340  THR C O   1 
ATOM   9976  C  CB  . THR C 1 343 ? 75.983  145.009 55.743  1.00 18.97 ? 340  THR C CB  1 
ATOM   9977  O  OG1 . THR C 1 343 ? 75.878  144.779 57.150  1.00 21.42 ? 340  THR C OG1 1 
ATOM   9978  C  CG2 . THR C 1 343 ? 74.585  145.113 55.156  1.00 20.26 ? 340  THR C CG2 1 
ATOM   9979  N  N   . ILE C 1 344 ? 75.800  143.089 53.022  1.00 18.50 ? 341  ILE C N   1 
ATOM   9980  C  CA  . ILE C 1 344 ? 75.593  143.097 51.582  1.00 19.06 ? 341  ILE C CA  1 
ATOM   9981  C  C   . ILE C 1 344 ? 74.651  144.256 51.193  1.00 20.46 ? 341  ILE C C   1 
ATOM   9982  O  O   . ILE C 1 344 ? 73.583  144.433 51.777  1.00 19.75 ? 341  ILE C O   1 
ATOM   9983  C  CB  . ILE C 1 344 ? 74.989  141.767 51.086  1.00 19.14 ? 341  ILE C CB  1 
ATOM   9984  C  CG1 . ILE C 1 344 ? 75.830  140.582 51.563  1.00 19.97 ? 341  ILE C CG1 1 
ATOM   9985  C  CG2 . ILE C 1 344 ? 74.888  141.778 49.579  1.00 19.24 ? 341  ILE C CG2 1 
ATOM   9986  C  CD1 . ILE C 1 344 ? 75.281  139.231 51.159  1.00 19.55 ? 341  ILE C CD1 1 
ATOM   9987  N  N   . GLU C 1 345 ? 75.059  145.039 50.209  1.00 21.99 ? 342  GLU C N   1 
ATOM   9988  C  CA  . GLU C 1 345 ? 74.263  146.166 49.763  1.00 24.61 ? 342  GLU C CA  1 
ATOM   9989  C  C   . GLU C 1 345 ? 73.584  145.780 48.471  1.00 25.45 ? 342  GLU C C   1 
ATOM   9990  O  O   . GLU C 1 345 ? 74.120  144.981 47.709  1.00 25.08 ? 342  GLU C O   1 
ATOM   9991  C  CB  . GLU C 1 345 ? 75.158  147.380 49.511  1.00 24.76 ? 342  GLU C CB  1 
ATOM   9992  C  CG  . GLU C 1 345 ? 76.015  147.804 50.692  1.00 26.04 ? 342  GLU C CG  1 
ATOM   9993  C  CD  . GLU C 1 345 ? 76.823  149.054 50.398  1.00 26.95 ? 342  GLU C CD  1 
ATOM   9994  O  OE1 . GLU C 1 345 ? 76.269  150.002 49.795  1.00 31.00 ? 342  GLU C OE1 1 
ATOM   9995  O  OE2 . GLU C 1 345 ? 78.003  149.105 50.800  1.00 28.47 ? 342  GLU C OE2 1 
ATOM   9996  N  N   . SER C 1 346 ? 72.397  146.320 48.224  1.00 27.31 ? 343  SER C N   1 
ATOM   9997  C  CA  . SER C 1 346 ? 71.712  146.031 46.972  1.00 28.41 ? 343  SER C CA  1 
ATOM   9998  C  C   . SER C 1 346 ? 72.271  146.986 45.948  1.00 28.84 ? 343  SER C C   1 
ATOM   9999  O  O   . SER C 1 346 ? 72.592  148.128 46.274  1.00 30.09 ? 343  SER C O   1 
ATOM   10000 C  CB  . SER C 1 346 ? 70.202  146.209 47.095  1.00 28.64 ? 343  SER C CB  1 
ATOM   10001 O  OG  . SER C 1 346 ? 69.892  147.495 47.552  1.00 29.97 ? 343  SER C OG  1 
ATOM   10002 N  N   . GLU C 1 347 ? 72.414  146.518 44.717  1.00 29.51 ? 344  GLU C N   1 
ATOM   10003 C  CA  . GLU C 1 347 ? 72.938  147.360 43.664  1.00 29.97 ? 344  GLU C CA  1 
ATOM   10004 C  C   . GLU C 1 347 ? 71.905  147.529 42.548  1.00 29.90 ? 344  GLU C C   1 
ATOM   10005 O  O   . GLU C 1 347 ? 70.930  146.778 42.467  1.00 29.71 ? 344  GLU C O   1 
ATOM   10006 C  CB  . GLU C 1 347 ? 74.242  146.787 43.116  1.00 29.91 ? 344  GLU C CB  1 
ATOM   10007 C  CG  . GLU C 1 347 ? 74.091  145.493 42.353  1.00 32.68 ? 344  GLU C CG  1 
ATOM   10008 C  CD  . GLU C 1 347 ? 75.438  144.903 41.937  1.00 37.60 ? 344  GLU C CD  1 
ATOM   10009 O  OE1 . GLU C 1 347 ? 76.490  145.500 42.276  1.00 41.17 ? 344  GLU C OE1 1 
ATOM   10010 O  OE2 . GLU C 1 347 ? 75.448  143.835 41.285  1.00 39.42 ? 344  GLU C OE2 1 
ATOM   10011 N  N   . GLU C 1 348 ? 72.135  148.530 41.706  1.00 29.60 ? 345  GLU C N   1 
ATOM   10012 C  CA  . GLU C 1 348 ? 71.256  148.852 40.571  1.00 29.89 ? 345  GLU C CA  1 
ATOM   10013 C  C   . GLU C 1 348 ? 71.137  147.721 39.550  1.00 30.38 ? 345  GLU C C   1 
ATOM   10014 O  O   . GLU C 1 348 ? 70.036  147.384 39.122  1.00 30.07 ? 345  GLU C O   1 
ATOM   10015 C  CB  . GLU C 1 348 ? 71.739  150.125 39.882  1.00 29.25 ? 345  GLU C CB  1 
ATOM   10016 C  CG  . GLU C 1 348 ? 73.244  150.187 39.660  1.00 28.85 ? 345  GLU C CG  1 
ATOM   10017 C  CD  . GLU C 1 348 ? 73.646  151.360 38.817  1.00 29.90 ? 345  GLU C CD  1 
ATOM   10018 O  OE1 . GLU C 1 348 ? 73.117  151.475 37.696  1.00 27.00 ? 345  GLU C OE1 1 
ATOM   10019 O  OE2 . GLU C 1 348 ? 74.526  152.141 39.249  1.00 32.39 ? 345  GLU C OE2 1 
ATOM   10020 N  N   . ASN C 1 349 ? 72.271  147.164 39.137  1.00 31.18 ? 346  ASN C N   1 
ATOM   10021 C  CA  . ASN C 1 349 ? 72.275  146.049 38.196  1.00 31.64 ? 346  ASN C CA  1 
ATOM   10022 C  C   . ASN C 1 349 ? 72.284  144.748 38.964  1.00 29.95 ? 346  ASN C C   1 
ATOM   10023 O  O   . ASN C 1 349 ? 73.343  144.282 39.377  1.00 31.21 ? 346  ASN C O   1 
ATOM   10024 C  CB  . ASN C 1 349 ? 73.491  146.080 37.255  1.00 32.60 ? 346  ASN C CB  1 
ATOM   10025 C  CG  . ASN C 1 349 ? 73.322  147.039 36.098  1.00 34.11 ? 346  ASN C CG  1 
ATOM   10026 O  OD1 . ASN C 1 349 ? 72.444  147.902 36.104  1.00 40.23 ? 346  ASN C OD1 1 
ATOM   10027 N  ND2 . ASN C 1 349 ? 74.166  146.882 35.082  1.00 37.05 ? 346  ASN C ND2 1 
ATOM   10028 N  N   . ASP C 1 350 ? 71.107  144.157 39.139  1.00 27.66 ? 347  ASP C N   1 
ATOM   10029 C  CA  . ASP C 1 350 ? 70.971  142.897 39.867  1.00 26.45 ? 347  ASP C CA  1 
ATOM   10030 C  C   . ASP C 1 350 ? 71.167  141.694 38.930  1.00 25.62 ? 347  ASP C C   1 
ATOM   10031 O  O   . ASP C 1 350 ? 70.549  140.644 39.115  1.00 25.24 ? 347  ASP C O   1 
ATOM   10032 C  CB  . ASP C 1 350 ? 69.585  142.829 40.521  1.00 25.87 ? 347  ASP C CB  1 
ATOM   10033 C  CG  . ASP C 1 350 ? 69.473  141.727 41.567  1.00 25.94 ? 347  ASP C CG  1 
ATOM   10034 O  OD1 . ASP C 1 350 ? 70.513  141.239 42.055  1.00 22.88 ? 347  ASP C OD1 1 
ATOM   10035 O  OD2 . ASP C 1 350 ? 68.335  141.376 41.932  1.00 27.43 ? 347  ASP C OD2 1 
ATOM   10036 N  N   . LEU C 1 351 ? 72.040  141.843 37.940  1.00 25.13 ? 348  LEU C N   1 
ATOM   10037 C  CA  . LEU C 1 351 ? 72.306  140.771 36.976  1.00 25.23 ? 348  LEU C CA  1 
ATOM   10038 C  C   . LEU C 1 351 ? 72.798  139.502 37.652  1.00 25.01 ? 348  LEU C C   1 
ATOM   10039 O  O   . LEU C 1 351 ? 72.458  138.395 37.231  1.00 25.47 ? 348  LEU C O   1 
ATOM   10040 C  CB  . LEU C 1 351 ? 73.331  141.230 35.938  1.00 25.84 ? 348  LEU C CB  1 
ATOM   10041 C  CG  . LEU C 1 351 ? 72.906  142.418 35.070  1.00 25.56 ? 348  LEU C CG  1 
ATOM   10042 C  CD1 . LEU C 1 351 ? 74.058  142.883 34.182  1.00 26.74 ? 348  LEU C CD1 1 
ATOM   10043 C  CD2 . LEU C 1 351 ? 71.674  142.068 34.238  1.00 24.45 ? 348  LEU C CD2 1 
ATOM   10044 N  N   . ASP C 1 352 ? 73.607  139.647 38.699  1.00 24.01 ? 349  ASP C N   1 
ATOM   10045 C  CA  . ASP C 1 352 ? 74.101  138.476 39.409  1.00 22.98 ? 349  ASP C CA  1 
ATOM   10046 C  C   . ASP C 1 352 ? 72.994  137.855 40.279  1.00 22.25 ? 349  ASP C C   1 
ATOM   10047 O  O   . ASP C 1 352 ? 73.170  136.770 40.825  1.00 21.85 ? 349  ASP C O   1 
ATOM   10048 C  CB  . ASP C 1 352 ? 75.356  138.804 40.230  1.00 22.84 ? 349  ASP C CB  1 
ATOM   10049 C  CG  . ASP C 1 352 ? 75.143  139.943 41.212  1.00 23.38 ? 349  ASP C CG  1 
ATOM   10050 O  OD1 . ASP C 1 352 ? 73.979  140.313 41.481  1.00 21.33 ? 349  ASP C OD1 1 
ATOM   10051 O  OD2 . ASP C 1 352 ? 76.156  140.472 41.722  1.00 24.21 ? 349  ASP C OD2 1 
ATOM   10052 N  N   . GLY C 1 353 ? 71.860  138.550 40.394  1.00 20.85 ? 350  GLY C N   1 
ATOM   10053 C  CA  . GLY C 1 353 ? 70.710  138.067 41.157  1.00 20.07 ? 350  GLY C CA  1 
ATOM   10054 C  C   . GLY C 1 353 ? 70.915  137.976 42.657  1.00 19.75 ? 350  GLY C C   1 
ATOM   10055 O  O   . GLY C 1 353 ? 70.282  137.159 43.326  1.00 19.27 ? 350  GLY C O   1 
ATOM   10056 N  N   . LEU C 1 354 ? 71.770  138.832 43.205  1.00 18.48 ? 351  LEU C N   1 
ATOM   10057 C  CA  . LEU C 1 354 ? 72.043  138.790 44.636  1.00 18.55 ? 351  LEU C CA  1 
ATOM   10058 C  C   . LEU C 1 354 ? 71.316  139.855 45.456  1.00 17.53 ? 351  LEU C C   1 
ATOM   10059 O  O   . LEU C 1 354 ? 71.458  139.876 46.675  1.00 17.47 ? 351  LEU C O   1 
ATOM   10060 C  CB  . LEU C 1 354 ? 73.564  138.876 44.898  1.00 18.88 ? 351  LEU C CB  1 
ATOM   10061 C  CG  . LEU C 1 354 ? 74.470  137.693 44.520  1.00 22.09 ? 351  LEU C CG  1 
ATOM   10062 C  CD1 . LEU C 1 354 ? 74.228  137.221 43.102  1.00 24.82 ? 351  LEU C CD1 1 
ATOM   10063 C  CD2 . LEU C 1 354 ? 75.948  138.049 44.711  1.00 23.83 ? 351  LEU C CD2 1 
ATOM   10064 N  N   . ASN C 1 355 ? 70.526  140.729 44.826  1.00 17.19 ? 352  ASN C N   1 
ATOM   10065 C  CA  . ASN C 1 355 ? 69.852  141.780 45.607  1.00 17.00 ? 352  ASN C CA  1 
ATOM   10066 C  C   . ASN C 1 355 ? 68.932  141.264 46.708  1.00 16.95 ? 352  ASN C C   1 
ATOM   10067 O  O   . ASN C 1 355 ? 68.681  141.973 47.677  1.00 16.85 ? 352  ASN C O   1 
ATOM   10068 C  CB  . ASN C 1 355 ? 69.090  142.787 44.726  1.00 17.65 ? 352  ASN C CB  1 
ATOM   10069 C  CG  . ASN C 1 355 ? 70.002  143.841 44.076  1.00 17.31 ? 352  ASN C CG  1 
ATOM   10070 O  OD1 . ASN C 1 355 ? 71.193  143.943 44.374  1.00 15.43 ? 352  ASN C OD1 1 
ATOM   10071 N  ND2 . ASN C 1 355 ? 69.412  144.664 43.213  1.00 17.26 ? 352  ASN C ND2 1 
ATOM   10072 N  N   . TYR C 1 356 ? 68.428  140.040 46.578  1.00 17.55 ? 353  TYR C N   1 
ATOM   10073 C  CA  . TYR C 1 356 ? 67.558  139.499 47.615  1.00 17.60 ? 353  TYR C CA  1 
ATOM   10074 C  C   . TYR C 1 356 ? 68.346  139.316 48.926  1.00 18.31 ? 353  TYR C C   1 
ATOM   10075 O  O   . TYR C 1 356 ? 67.759  139.102 49.985  1.00 19.16 ? 353  TYR C O   1 
ATOM   10076 C  CB  . TYR C 1 356 ? 66.930  138.169 47.187  1.00 17.51 ? 353  TYR C CB  1 
ATOM   10077 C  CG  . TYR C 1 356 ? 67.857  136.972 47.243  1.00 15.96 ? 353  TYR C CG  1 
ATOM   10078 C  CD1 . TYR C 1 356 ? 68.659  136.632 46.168  1.00 15.22 ? 353  TYR C CD1 1 
ATOM   10079 C  CD2 . TYR C 1 356 ? 67.894  136.157 48.366  1.00 17.16 ? 353  TYR C CD2 1 
ATOM   10080 C  CE1 . TYR C 1 356 ? 69.495  135.527 46.218  1.00 11.13 ? 353  TYR C CE1 1 
ATOM   10081 C  CE2 . TYR C 1 356 ? 68.732  135.049 48.424  1.00 16.96 ? 353  TYR C CE2 1 
ATOM   10082 C  CZ  . TYR C 1 356 ? 69.523  134.742 47.342  1.00 14.58 ? 353  TYR C CZ  1 
ATOM   10083 O  OH  . TYR C 1 356 ? 70.347  133.641 47.404  1.00 16.32 ? 353  TYR C OH  1 
ATOM   10084 N  N   . LEU C 1 357 ? 69.672  139.391 48.853  1.00 18.43 ? 354  LEU C N   1 
ATOM   10085 C  CA  . LEU C 1 357 ? 70.504  139.263 50.043  1.00 18.06 ? 354  LEU C CA  1 
ATOM   10086 C  C   . LEU C 1 357 ? 70.865  140.628 50.651  1.00 17.89 ? 354  LEU C C   1 
ATOM   10087 O  O   . LEU C 1 357 ? 71.593  140.701 51.637  1.00 19.31 ? 354  LEU C O   1 
ATOM   10088 C  CB  . LEU C 1 357 ? 71.767  138.462 49.721  1.00 17.97 ? 354  LEU C CB  1 
ATOM   10089 C  CG  . LEU C 1 357 ? 71.530  136.980 49.409  1.00 17.58 ? 354  LEU C CG  1 
ATOM   10090 C  CD1 . LEU C 1 357 ? 72.779  136.320 48.876  1.00 16.30 ? 354  LEU C CD1 1 
ATOM   10091 C  CD2 . LEU C 1 357 ? 71.035  136.268 50.659  1.00 14.35 ? 354  LEU C CD2 1 
ATOM   10092 N  N   . ALA C 1 358 ? 70.351  141.705 50.073  1.00 17.89 ? 355  ALA C N   1 
ATOM   10093 C  CA  . ALA C 1 358 ? 70.631  143.053 50.578  1.00 16.82 ? 355  ALA C CA  1 
ATOM   10094 C  C   . ALA C 1 358 ? 70.219  143.170 52.043  1.00 16.90 ? 355  ALA C C   1 
ATOM   10095 O  O   . ALA C 1 358 ? 69.084  142.859 52.411  1.00 16.68 ? 355  ALA C O   1 
ATOM   10096 C  CB  . ALA C 1 358 ? 69.920  144.082 49.744  1.00 17.75 ? 355  ALA C CB  1 
ATOM   10097 N  N   . GLY C 1 359 ? 71.141  143.623 52.886  1.00 16.56 ? 356  GLY C N   1 
ATOM   10098 C  CA  . GLY C 1 359 ? 70.859  143.733 54.315  1.00 16.87 ? 356  GLY C CA  1 
ATOM   10099 C  C   . GLY C 1 359 ? 71.363  142.526 55.095  1.00 18.04 ? 356  GLY C C   1 
ATOM   10100 O  O   . GLY C 1 359 ? 71.358  142.529 56.337  1.00 17.90 ? 356  GLY C O   1 
ATOM   10101 N  N   . GLU C 1 360 ? 71.766  141.479 54.372  1.00 17.97 ? 357  GLU C N   1 
ATOM   10102 C  CA  . GLU C 1 360 ? 72.318  140.280 55.002  1.00 18.50 ? 357  GLU C CA  1 
ATOM   10103 C  C   . GLU C 1 360 ? 73.819  140.449 55.094  1.00 17.60 ? 357  GLU C C   1 
ATOM   10104 O  O   . GLU C 1 360 ? 74.405  141.238 54.356  1.00 17.11 ? 357  GLU C O   1 
ATOM   10105 C  CB  . GLU C 1 360 ? 72.000  139.013 54.192  1.00 18.07 ? 357  GLU C CB  1 
ATOM   10106 C  CG  . GLU C 1 360 ? 70.533  138.724 54.042  1.00 20.37 ? 357  GLU C CG  1 
ATOM   10107 C  CD  . GLU C 1 360 ? 69.838  138.567 55.374  1.00 23.95 ? 357  GLU C CD  1 
ATOM   10108 O  OE1 . GLU C 1 360 ? 70.461  138.069 56.329  1.00 28.98 ? 357  GLU C OE1 1 
ATOM   10109 O  OE2 . GLU C 1 360 ? 68.653  138.931 55.468  1.00 29.19 ? 357  GLU C OE2 1 
ATOM   10110 N  N   . THR C 1 361 ? 74.447  139.705 55.995  1.00 17.34 ? 358  THR C N   1 
ATOM   10111 C  CA  . THR C 1 361 ? 75.884  139.789 56.138  1.00 16.12 ? 358  THR C CA  1 
ATOM   10112 C  C   . THR C 1 361 ? 76.522  138.698 55.303  1.00 16.19 ? 358  THR C C   1 
ATOM   10113 O  O   . THR C 1 361 ? 75.856  137.730 54.906  1.00 15.89 ? 358  THR C O   1 
ATOM   10114 C  CB  . THR C 1 361 ? 76.334  139.638 57.615  1.00 16.60 ? 358  THR C CB  1 
ATOM   10115 O  OG1 . THR C 1 361 ? 75.996  138.339 58.107  1.00 17.42 ? 358  THR C OG1 1 
ATOM   10116 C  CG2 . THR C 1 361 ? 75.699  140.720 58.513  1.00 13.77 ? 358  THR C CG2 1 
ATOM   10117 N  N   . VAL C 1 362 ? 77.808  138.857 55.016  1.00 15.06 ? 359  VAL C N   1 
ATOM   10118 C  CA  . VAL C 1 362 ? 78.531  137.849 54.262  1.00 14.64 ? 359  VAL C CA  1 
ATOM   10119 C  C   . VAL C 1 362 ? 78.611  136.563 55.081  1.00 14.69 ? 359  VAL C C   1 
ATOM   10120 O  O   . VAL C 1 362 ? 78.627  135.460 54.512  1.00 13.09 ? 359  VAL C O   1 
ATOM   10121 C  CB  . VAL C 1 362 ? 79.939  138.313 53.907  1.00 14.32 ? 359  VAL C CB  1 
ATOM   10122 C  CG1 . VAL C 1 362 ? 80.766  137.162 53.360  1.00 13.84 ? 359  VAL C CG1 1 
ATOM   10123 C  CG2 . VAL C 1 362 ? 79.874  139.460 52.923  1.00 14.46 ? 359  VAL C CG2 1 
ATOM   10124 N  N   . ASP C 1 363 ? 78.646  136.693 56.413  1.00 14.31 ? 360  ASP C N   1 
ATOM   10125 C  CA  . ASP C 1 363 ? 78.717  135.509 57.259  1.00 14.26 ? 360  ASP C CA  1 
ATOM   10126 C  C   . ASP C 1 363 ? 77.409  134.701 57.197  1.00 14.32 ? 360  ASP C C   1 
ATOM   10127 O  O   . ASP C 1 363 ? 77.414  133.493 57.380  1.00 13.48 ? 360  ASP C O   1 
ATOM   10128 C  CB  . ASP C 1 363 ? 79.062  135.856 58.706  1.00 15.12 ? 360  ASP C CB  1 
ATOM   10129 C  CG  . ASP C 1 363 ? 79.484  134.622 59.501  1.00 17.55 ? 360  ASP C CG  1 
ATOM   10130 O  OD1 . ASP C 1 363 ? 80.407  133.899 59.056  1.00 21.61 ? 360  ASP C OD1 1 
ATOM   10131 O  OD2 . ASP C 1 363 ? 78.910  134.383 60.573  1.00 26.65 ? 360  ASP C OD2 1 
ATOM   10132 N  N   . PHE C 1 364 ? 76.292  135.386 56.969  1.00 15.00 ? 361  PHE C N   1 
ATOM   10133 C  CA  . PHE C 1 364 ? 74.990  134.728 56.817  1.00 14.43 ? 361  PHE C CA  1 
ATOM   10134 C  C   . PHE C 1 364 ? 75.052  133.788 55.631  1.00 13.68 ? 361  PHE C C   1 
ATOM   10135 O  O   . PHE C 1 364 ? 74.627  132.637 55.710  1.00 13.65 ? 361  PHE C O   1 
ATOM   10136 C  CB  . PHE C 1 364 ? 73.906  135.783 56.596  1.00 15.38 ? 361  PHE C CB  1 
ATOM   10137 C  CG  . PHE C 1 364 ? 72.572  135.225 56.182  1.00 16.90 ? 361  PHE C CG  1 
ATOM   10138 C  CD1 . PHE C 1 364 ? 71.679  134.752 57.124  1.00 20.31 ? 361  PHE C CD1 1 
ATOM   10139 C  CD2 . PHE C 1 364 ? 72.195  135.232 54.852  1.00 15.77 ? 361  PHE C CD2 1 
ATOM   10140 C  CE1 . PHE C 1 364 ? 70.442  134.268 56.736  1.00 21.11 ? 361  PHE C CE1 1 
ATOM   10141 C  CE2 . PHE C 1 364 ? 70.968  134.743 54.456  1.00 17.19 ? 361  PHE C CE2 1 
ATOM   10142 C  CZ  . PHE C 1 364 ? 70.091  134.263 55.396  1.00 18.99 ? 361  PHE C CZ  1 
ATOM   10143 N  N   . VAL C 1 365 ? 75.602  134.290 54.536  1.00 12.44 ? 362  VAL C N   1 
ATOM   10144 C  CA  . VAL C 1 365 ? 75.764  133.522 53.327  1.00 12.65 ? 362  VAL C CA  1 
ATOM   10145 C  C   . VAL C 1 365 ? 76.693  132.319 53.596  1.00 12.78 ? 362  VAL C C   1 
ATOM   10146 O  O   . VAL C 1 365 ? 76.392  131.184 53.224  1.00 11.66 ? 362  VAL C O   1 
ATOM   10147 C  CB  . VAL C 1 365 ? 76.366  134.406 52.211  1.00 13.21 ? 362  VAL C CB  1 
ATOM   10148 C  CG1 . VAL C 1 365 ? 76.540  133.620 50.925  1.00 11.10 ? 362  VAL C CG1 1 
ATOM   10149 C  CG2 . VAL C 1 365 ? 75.492  135.659 51.980  1.00 14.69 ? 362  VAL C CG2 1 
ATOM   10150 N  N   . ASN C 1 366 ? 77.803  132.572 54.275  1.00 12.34 ? 363  ASN C N   1 
ATOM   10151 C  CA  . ASN C 1 366 ? 78.770  131.520 54.576  1.00 13.24 ? 363  ASN C CA  1 
ATOM   10152 C  C   . ASN C 1 366 ? 78.096  130.448 55.426  1.00 12.68 ? 363  ASN C C   1 
ATOM   10153 O  O   . ASN C 1 366 ? 78.342  129.272 55.242  1.00 12.94 ? 363  ASN C O   1 
ATOM   10154 C  CB  . ASN C 1 366 ? 80.014  132.110 55.295  1.00 12.98 ? 363  ASN C CB  1 
ATOM   10155 C  CG  . ASN C 1 366 ? 81.237  131.182 55.232  1.00 14.60 ? 363  ASN C CG  1 
ATOM   10156 O  OD1 . ASN C 1 366 ? 81.426  130.457 54.251  1.00 17.33 ? 363  ASN C OD1 1 
ATOM   10157 N  ND2 . ASN C 1 366 ? 82.104  131.251 56.253  1.00 13.49 ? 363  ASN C ND2 1 
ATOM   10158 N  N   . THR C 1 367 ? 77.216  130.865 56.338  1.00 13.67 ? 364  THR C N   1 
ATOM   10159 C  CA  . THR C 1 367 ? 76.504  129.935 57.223  1.00 14.26 ? 364  THR C CA  1 
ATOM   10160 C  C   . THR C 1 367 ? 75.511  129.063 56.449  1.00 14.38 ? 364  THR C C   1 
ATOM   10161 O  O   . THR C 1 367 ? 75.399  127.877 56.702  1.00 14.06 ? 364  THR C O   1 
ATOM   10162 C  CB  . THR C 1 367 ? 75.758  130.699 58.348  1.00 15.27 ? 364  THR C CB  1 
ATOM   10163 O  OG1 . THR C 1 367 ? 76.709  131.270 59.255  1.00 17.66 ? 364  THR C OG1 1 
ATOM   10164 C  CG2 . THR C 1 367 ? 74.842  129.779 59.119  1.00 16.23 ? 364  THR C CG2 1 
ATOM   10165 N  N   . LYS C 1 368 ? 74.781  129.669 55.514  1.00 14.87 ? 365  LYS C N   1 
ATOM   10166 C  CA  . LYS C 1 368 ? 73.836  128.929 54.698  1.00 14.48 ? 365  LYS C CA  1 
ATOM   10167 C  C   . LYS C 1 368 ? 74.583  128.004 53.733  1.00 14.06 ? 365  LYS C C   1 
ATOM   10168 O  O   . LYS C 1 368 ? 74.071  126.956 53.373  1.00 12.56 ? 365  LYS C O   1 
ATOM   10169 C  CB  . LYS C 1 368 ? 72.883  129.880 53.957  1.00 14.71 ? 365  LYS C CB  1 
ATOM   10170 C  CG  . LYS C 1 368 ? 72.101  130.778 54.912  1.00 16.28 ? 365  LYS C CG  1 
ATOM   10171 C  CD  . LYS C 1 368 ? 71.507  129.945 56.044  1.00 19.93 ? 365  LYS C CD  1 
ATOM   10172 C  CE  . LYS C 1 368 ? 70.874  130.780 57.110  1.00 24.05 ? 365  LYS C CE  1 
ATOM   10173 N  NZ  . LYS C 1 368 ? 70.447  129.913 58.233  1.00 25.21 ? 365  LYS C NZ  1 
ATOM   10174 N  N   . ALA C 1 369 ? 75.794  128.389 53.323  1.00 13.71 ? 366  ALA C N   1 
ATOM   10175 C  CA  . ALA C 1 369 ? 76.606  127.528 52.454  1.00 12.91 ? 366  ALA C CA  1 
ATOM   10176 C  C   . ALA C 1 369 ? 76.920  126.255 53.244  1.00 13.79 ? 366  ALA C C   1 
ATOM   10177 O  O   . ALA C 1 369 ? 76.774  125.137 52.737  1.00 13.55 ? 366  ALA C O   1 
ATOM   10178 C  CB  . ALA C 1 369 ? 77.893  128.225 52.025  1.00 11.51 ? 366  ALA C CB  1 
ATOM   10179 N  N   . TYR C 1 370 ? 77.373  126.445 54.484  1.00 13.87 ? 367  TYR C N   1 
ATOM   10180 C  CA  . TYR C 1 370 ? 77.673  125.341 55.403  1.00 13.07 ? 367  TYR C CA  1 
ATOM   10181 C  C   . TYR C 1 370 ? 76.468  124.395 55.616  1.00 12.59 ? 367  TYR C C   1 
ATOM   10182 O  O   . TYR C 1 370 ? 76.575  123.161 55.436  1.00 11.19 ? 367  TYR C O   1 
ATOM   10183 C  CB  . TYR C 1 370 ? 78.177  125.932 56.742  1.00 12.41 ? 367  TYR C CB  1 
ATOM   10184 C  CG  . TYR C 1 370 ? 77.927  125.080 57.971  1.00 13.97 ? 367  TYR C CG  1 
ATOM   10185 C  CD1 . TYR C 1 370 ? 76.998  125.466 58.932  1.00 12.28 ? 367  TYR C CD1 1 
ATOM   10186 C  CD2 . TYR C 1 370 ? 78.569  123.866 58.144  1.00 16.12 ? 367  TYR C CD2 1 
ATOM   10187 C  CE1 . TYR C 1 370 ? 76.750  124.682 60.044  1.00 15.58 ? 367  TYR C CE1 1 
ATOM   10188 C  CE2 . TYR C 1 370 ? 78.323  123.077 59.256  1.00 17.70 ? 367  TYR C CE2 1 
ATOM   10189 C  CZ  . TYR C 1 370 ? 77.408  123.477 60.190  1.00 18.26 ? 367  TYR C CZ  1 
ATOM   10190 O  OH  . TYR C 1 370 ? 77.178  122.667 61.289  1.00 20.06 ? 367  TYR C OH  1 
ATOM   10191 N  N   . GLU C 1 371 ? 75.329  124.977 55.987  1.00 12.38 ? 368  GLU C N   1 
ATOM   10192 C  CA  . GLU C 1 371 ? 74.115  124.202 56.245  1.00 13.14 ? 368  GLU C CA  1 
ATOM   10193 C  C   . GLU C 1 371 ? 73.622  123.421 55.020  1.00 13.81 ? 368  GLU C C   1 
ATOM   10194 O  O   . GLU C 1 371 ? 73.287  122.244 55.125  1.00 12.83 ? 368  GLU C O   1 
ATOM   10195 C  CB  . GLU C 1 371 ? 72.992  125.120 56.763  1.00 13.65 ? 368  GLU C CB  1 
ATOM   10196 C  CG  . GLU C 1 371 ? 73.241  125.683 58.162  1.00 15.74 ? 368  GLU C CG  1 
ATOM   10197 C  CD  . GLU C 1 371 ? 72.194  126.697 58.602  1.00 20.75 ? 368  GLU C CD  1 
ATOM   10198 O  OE1 . GLU C 1 371 ? 71.483  127.239 57.743  1.00 22.10 ? 368  GLU C OE1 1 
ATOM   10199 O  OE2 . GLU C 1 371 ? 72.104  126.970 59.810  1.00 21.88 ? 368  GLU C OE2 1 
ATOM   10200 N  N   . GLY C 1 372 ? 73.552  124.086 53.874  1.00 12.71 ? 369  GLY C N   1 
ATOM   10201 C  CA  . GLY C 1 372 ? 73.089  123.439 52.652  1.00 13.10 ? 369  GLY C CA  1 
ATOM   10202 C  C   . GLY C 1 372 ? 74.006  122.331 52.179  1.00 11.48 ? 369  GLY C C   1 
ATOM   10203 O  O   . GLY C 1 372 ? 73.547  121.307 51.701  1.00 10.98 ? 369  GLY C O   1 
ATOM   10204 N  N   . THR C 1 373 ? 75.308  122.539 52.326  1.00 10.96 ? 370  THR C N   1 
ATOM   10205 C  CA  . THR C 1 373 ? 76.306  121.539 51.920  1.00 10.67 ? 370  THR C CA  1 
ATOM   10206 C  C   . THR C 1 373 ? 76.298  120.335 52.854  1.00 11.05 ? 370  THR C C   1 
ATOM   10207 O  O   . THR C 1 373 ? 76.399  119.181 52.412  1.00 10.71 ? 370  THR C O   1 
ATOM   10208 C  CB  . THR C 1 373 ? 77.693  122.188 51.878  1.00 12.15 ? 370  THR C CB  1 
ATOM   10209 O  OG1 . THR C 1 373 ? 77.649  123.288 50.959  1.00 8.50  ? 370  THR C OG1 1 
ATOM   10210 C  CG2 . THR C 1 373 ? 78.787  121.180 51.453  1.00 11.29 ? 370  THR C CG2 1 
ATOM   10211 N  N   . LEU C 1 374 ? 76.151  120.586 54.154  1.00 12.60 ? 371  LEU C N   1 
ATOM   10212 C  CA  . LEU C 1 374 ? 76.124  119.502 55.118  1.00 13.09 ? 371  LEU C CA  1 
ATOM   10213 C  C   . LEU C 1 374 ? 74.952  118.554 54.779  1.00 12.46 ? 371  LEU C C   1 
ATOM   10214 O  O   . LEU C 1 374 ? 75.123  117.342 54.741  1.00 11.78 ? 371  LEU C O   1 
ATOM   10215 C  CB  . LEU C 1 374 ? 76.027  120.046 56.541  1.00 14.57 ? 371  LEU C CB  1 
ATOM   10216 C  CG  . LEU C 1 374 ? 75.956  119.012 57.672  1.00 17.59 ? 371  LEU C CG  1 
ATOM   10217 C  CD1 . LEU C 1 374 ? 76.303  119.635 59.029  1.00 22.04 ? 371  LEU C CD1 1 
ATOM   10218 C  CD2 . LEU C 1 374 ? 74.600  118.368 57.715  1.00 18.91 ? 371  LEU C CD2 1 
ATOM   10219 N  N   . LEU C 1 375 ? 73.782  119.123 54.490  1.00 12.30 ? 372  LEU C N   1 
ATOM   10220 C  CA  . LEU C 1 375 ? 72.594  118.325 54.150  1.00 12.20 ? 372  LEU C CA  1 
ATOM   10221 C  C   . LEU C 1 375 ? 72.767  117.611 52.815  1.00 11.06 ? 372  LEU C C   1 
ATOM   10222 O  O   . LEU C 1 375 ? 72.428  116.451 52.698  1.00 11.87 ? 372  LEU C O   1 
ATOM   10223 C  CB  . LEU C 1 375 ? 71.328  119.190 54.132  1.00 11.50 ? 372  LEU C CB  1 
ATOM   10224 C  CG  . LEU C 1 375 ? 70.926  119.819 55.473  1.00 14.02 ? 372  LEU C CG  1 
ATOM   10225 C  CD1 . LEU C 1 375 ? 69.751  120.782 55.276  1.00 16.62 ? 372  LEU C CD1 1 
ATOM   10226 C  CD2 . LEU C 1 375 ? 70.581  118.748 56.525  1.00 13.09 ? 372  LEU C CD2 1 
ATOM   10227 N  N   . ALA C 1 376 ? 73.307  118.309 51.821  1.00 10.79 ? 373  ALA C N   1 
ATOM   10228 C  CA  . ALA C 1 376 ? 73.542  117.730 50.515  1.00 11.01 ? 373  ALA C CA  1 
ATOM   10229 C  C   . ALA C 1 376 ? 74.517  116.550 50.629  1.00 11.30 ? 373  ALA C C   1 
ATOM   10230 O  O   . ALA C 1 376 ? 74.242  115.465 50.137  1.00 9.50  ? 373  ALA C O   1 
ATOM   10231 C  CB  . ALA C 1 376 ? 74.096  118.788 49.555  1.00 9.70  ? 373  ALA C CB  1 
ATOM   10232 N  N   . HIS C 1 377 ? 75.652  116.758 51.295  1.00 11.69 ? 374  HIS C N   1 
ATOM   10233 C  CA  . HIS C 1 377 ? 76.633  115.675 51.448  1.00 12.64 ? 374  HIS C CA  1 
ATOM   10234 C  C   . HIS C 1 377 ? 76.054  114.485 52.199  1.00 13.08 ? 374  HIS C C   1 
ATOM   10235 O  O   . HIS C 1 377 ? 76.305  113.310 51.842  1.00 12.56 ? 374  HIS C O   1 
ATOM   10236 C  CB  . HIS C 1 377 ? 77.921  116.138 52.119  1.00 13.56 ? 374  HIS C CB  1 
ATOM   10237 C  CG  . HIS C 1 377 ? 78.731  117.078 51.288  1.00 12.12 ? 374  HIS C CG  1 
ATOM   10238 N  ND1 . HIS C 1 377 ? 79.732  117.864 51.817  1.00 13.92 ? 374  HIS C ND1 1 
ATOM   10239 C  CD2 . HIS C 1 377 ? 78.673  117.377 49.968  1.00 14.34 ? 374  HIS C CD2 1 
ATOM   10240 C  CE1 . HIS C 1 377 ? 80.288  118.572 50.847  1.00 15.91 ? 374  HIS C CE1 1 
ATOM   10241 N  NE2 . HIS C 1 377 ? 79.651  118.309 49.719  1.00 14.06 ? 374  HIS C NE2 1 
ATOM   10242 N  N   . SER C 1 378 ? 75.282  114.769 53.232  1.00 13.05 ? 375  SER C N   1 
ATOM   10243 C  CA  . SER C 1 378 ? 74.613  113.695 53.967  1.00 13.96 ? 375  SER C CA  1 
ATOM   10244 C  C   . SER C 1 378 ? 73.714  112.923 53.009  1.00 12.65 ? 375  SER C C   1 
ATOM   10245 O  O   . SER C 1 378 ? 73.787  111.701 52.941  1.00 12.62 ? 375  SER C O   1 
ATOM   10246 C  CB  . SER C 1 378 ? 73.797  114.239 55.137  1.00 12.76 ? 375  SER C CB  1 
ATOM   10247 O  OG  . SER C 1 378 ? 74.639  114.993 55.994  1.00 19.32 ? 375  SER C OG  1 
ATOM   10248 N  N   . ASP C 1 379 ? 72.880  113.636 52.258  1.00 12.91 ? 376  ASP C N   1 
ATOM   10249 C  CA  . ASP C 1 379 ? 71.993  112.989 51.284  1.00 13.65 ? 376  ASP C CA  1 
ATOM   10250 C  C   . ASP C 1 379 ? 72.763  112.182 50.266  1.00 13.09 ? 376  ASP C C   1 
ATOM   10251 O  O   . ASP C 1 379 ? 72.218  111.265 49.669  1.00 13.77 ? 376  ASP C O   1 
ATOM   10252 C  CB  . ASP C 1 379 ? 71.106  114.014 50.566  1.00 14.54 ? 376  ASP C CB  1 
ATOM   10253 C  CG  . ASP C 1 379 ? 70.035  114.579 51.473  1.00 16.99 ? 376  ASP C CG  1 
ATOM   10254 O  OD1 . ASP C 1 379 ? 69.861  114.040 52.579  1.00 18.22 ? 376  ASP C OD1 1 
ATOM   10255 O  OD2 . ASP C 1 379 ? 69.350  115.535 51.081  1.00 20.30 ? 376  ASP C OD2 1 
ATOM   10256 N  N   . GLY C 1 380 ? 74.030  112.520 50.070  1.00 13.48 ? 377  GLY C N   1 
ATOM   10257 C  CA  . GLY C 1 380 ? 74.881  111.800 49.140  1.00 12.44 ? 377  GLY C CA  1 
ATOM   10258 C  C   . GLY C 1 380 ? 75.640  110.639 49.757  1.00 13.09 ? 377  GLY C C   1 
ATOM   10259 O  O   . GLY C 1 380 ? 76.449  109.997 49.077  1.00 13.03 ? 377  GLY C O   1 
ATOM   10260 N  N   . GLY C 1 381 ? 75.408  110.368 51.044  1.00 13.12 ? 378  GLY C N   1 
ATOM   10261 C  CA  . GLY C 1 381 ? 76.063  109.236 51.710  1.00 13.32 ? 378  GLY C CA  1 
ATOM   10262 C  C   . GLY C 1 381 ? 77.306  109.557 52.537  1.00 12.83 ? 378  GLY C C   1 
ATOM   10263 O  O   . GLY C 1 381 ? 78.078  108.655 52.876  1.00 13.49 ? 378  GLY C O   1 
ATOM   10264 N  N   . VAL C 1 382 ? 77.494  110.823 52.887  1.00 12.46 ? 379  VAL C N   1 
ATOM   10265 C  CA  . VAL C 1 382 ? 78.644  111.227 53.682  1.00 13.25 ? 379  VAL C CA  1 
ATOM   10266 C  C   . VAL C 1 382 ? 78.256  111.660 55.091  1.00 13.65 ? 379  VAL C C   1 
ATOM   10267 O  O   . VAL C 1 382 ? 77.662  112.728 55.267  1.00 15.09 ? 379  VAL C O   1 
ATOM   10268 C  CB  . VAL C 1 382 ? 79.379  112.410 53.016  1.00 13.64 ? 379  VAL C CB  1 
ATOM   10269 C  CG1 . VAL C 1 382 ? 80.642  112.771 53.812  1.00 11.03 ? 379  VAL C CG1 1 
ATOM   10270 C  CG2 . VAL C 1 382 ? 79.716  112.066 51.576  1.00 15.62 ? 379  VAL C CG2 1 
ATOM   10271 N  N   . PRO C 1 383 ? 78.585  110.839 56.105  1.00 13.63 ? 380  PRO C N   1 
ATOM   10272 C  CA  . PRO C 1 383 ? 78.297  111.245 57.478  1.00 13.57 ? 380  PRO C CA  1 
ATOM   10273 C  C   . PRO C 1 383 ? 79.012  112.548 57.814  1.00 12.94 ? 380  PRO C C   1 
ATOM   10274 O  O   . PRO C 1 383 ? 80.209  112.695 57.531  1.00 13.21 ? 380  PRO C O   1 
ATOM   10275 C  CB  . PRO C 1 383 ? 78.873  110.096 58.324  1.00 12.60 ? 380  PRO C CB  1 
ATOM   10276 C  CG  . PRO C 1 383 ? 78.926  108.926 57.391  1.00 13.66 ? 380  PRO C CG  1 
ATOM   10277 C  CD  . PRO C 1 383 ? 79.191  109.496 56.038  1.00 12.95 ? 380  PRO C CD  1 
ATOM   10278 N  N   . ASN C 1 384 ? 78.272  113.482 58.404  1.00 12.15 ? 381  ASN C N   1 
ATOM   10279 C  CA  . ASN C 1 384 ? 78.795  114.765 58.809  1.00 12.22 ? 381  ASN C CA  1 
ATOM   10280 C  C   . ASN C 1 384 ? 78.729  114.989 60.309  1.00 12.97 ? 381  ASN C C   1 
ATOM   10281 O  O   . ASN C 1 384 ? 77.644  114.979 60.921  1.00 13.09 ? 381  ASN C O   1 
ATOM   10282 C  CB  . ASN C 1 384 ? 78.061  115.940 58.124  1.00 11.81 ? 381  ASN C CB  1 
ATOM   10283 C  CG  . ASN C 1 384 ? 78.615  116.263 56.748  1.00 13.83 ? 381  ASN C CG  1 
ATOM   10284 O  OD1 . ASN C 1 384 ? 79.198  117.339 56.555  1.00 12.13 ? 381  ASN C OD1 1 
ATOM   10285 N  ND2 . ASN C 1 384 ? 78.483  115.330 55.796  1.00 11.57 ? 381  ASN C ND2 1 
ATOM   10286 N  N   . LEU C 1 385 ? 79.906  115.226 60.873  1.00 13.03 ? 382  LEU C N   1 
ATOM   10287 C  CA  . LEU C 1 385 ? 80.090  115.502 62.281  1.00 13.09 ? 382  LEU C CA  1 
ATOM   10288 C  C   . LEU C 1 385 ? 80.435  116.987 62.411  1.00 13.40 ? 382  LEU C C   1 
ATOM   10289 O  O   . LEU C 1 385 ? 81.109  117.543 61.545  1.00 14.12 ? 382  LEU C O   1 
ATOM   10290 C  CB  . LEU C 1 385 ? 81.227  114.665 62.820  1.00 10.89 ? 382  LEU C CB  1 
ATOM   10291 C  CG  . LEU C 1 385 ? 81.108  113.172 62.574  1.00 12.47 ? 382  LEU C CG  1 
ATOM   10292 C  CD1 . LEU C 1 385 ? 82.294  112.511 63.248  1.00 13.01 ? 382  LEU C CD1 1 
ATOM   10293 C  CD2 . LEU C 1 385 ? 79.795  112.589 63.074  1.00 11.56 ? 382  LEU C CD2 1 
ATOM   10294 N  N   . ILE C 1 386 ? 80.019  117.613 63.504  1.00 14.35 ? 383  ILE C N   1 
ATOM   10295 C  CA  . ILE C 1 386 ? 80.251  119.047 63.710  1.00 13.45 ? 383  ILE C CA  1 
ATOM   10296 C  C   . ILE C 1 386 ? 80.974  119.389 65.027  1.00 14.48 ? 383  ILE C C   1 
ATOM   10297 O  O   . ILE C 1 386 ? 80.639  118.871 66.097  1.00 14.59 ? 383  ILE C O   1 
ATOM   10298 C  CB  . ILE C 1 386 ? 78.893  119.799 63.720  1.00 13.49 ? 383  ILE C CB  1 
ATOM   10299 C  CG1 . ILE C 1 386 ? 78.062  119.464 62.485  1.00 11.01 ? 383  ILE C CG1 1 
ATOM   10300 C  CG2 . ILE C 1 386 ? 79.102  121.327 63.831  1.00 13.29 ? 383  ILE C CG2 1 
ATOM   10301 C  CD1 . ILE C 1 386 ? 76.642  119.907 62.589  1.00 17.38 ? 383  ILE C CD1 1 
ATOM   10302 N  N   . VAL C 1 387 ? 81.988  120.241 64.928  1.00 14.03 ? 384  VAL C N   1 
ATOM   10303 C  CA  . VAL C 1 387 ? 82.684  120.731 66.092  1.00 14.33 ? 384  VAL C CA  1 
ATOM   10304 C  C   . VAL C 1 387 ? 82.404  122.221 66.077  1.00 14.13 ? 384  VAL C C   1 
ATOM   10305 O  O   . VAL C 1 387 ? 82.876  122.949 65.210  1.00 15.20 ? 384  VAL C O   1 
ATOM   10306 C  CB  . VAL C 1 387 ? 84.195  120.483 66.060  1.00 14.41 ? 384  VAL C CB  1 
ATOM   10307 C  CG1 . VAL C 1 387 ? 84.848  121.120 67.306  1.00 13.64 ? 384  VAL C CG1 1 
ATOM   10308 C  CG2 . VAL C 1 387 ? 84.475  119.000 65.976  1.00 13.78 ? 384  VAL C CG2 1 
ATOM   10309 N  N   . ASN C 1 388 ? 81.593  122.653 67.017  1.00 13.77 ? 385  ASN C N   1 
ATOM   10310 C  CA  . ASN C 1 388 ? 81.217  124.048 67.113  1.00 16.11 ? 385  ASN C CA  1 
ATOM   10311 C  C   . ASN C 1 388 ? 82.214  124.858 67.918  1.00 17.17 ? 385  ASN C C   1 
ATOM   10312 O  O   . ASN C 1 388 ? 82.482  124.549 69.077  1.00 17.18 ? 385  ASN C O   1 
ATOM   10313 C  CB  . ASN C 1 388 ? 79.813  124.146 67.701  1.00 15.60 ? 385  ASN C CB  1 
ATOM   10314 C  CG  . ASN C 1 388 ? 78.758  123.735 66.710  1.00 17.52 ? 385  ASN C CG  1 
ATOM   10315 O  OD1 . ASN C 1 388 ? 78.649  124.330 65.633  1.00 21.28 ? 385  ASN C OD1 1 
ATOM   10316 N  ND2 . ASN C 1 388 ? 77.955  122.732 67.064  1.00 18.77 ? 385  ASN C ND2 1 
ATOM   10317 N  N   . ILE C 1 389 ? 82.764  125.895 67.279  1.00 18.45 ? 386  ILE C N   1 
ATOM   10318 C  CA  . ILE C 1 389 ? 83.751  126.802 67.898  1.00 17.08 ? 386  ILE C CA  1 
ATOM   10319 C  C   . ILE C 1 389 ? 83.055  128.154 68.040  1.00 17.91 ? 386  ILE C C   1 
ATOM   10320 O  O   . ILE C 1 389 ? 82.843  128.838 67.040  1.00 16.83 ? 386  ILE C O   1 
ATOM   10321 C  CB  . ILE C 1 389 ? 84.991  126.936 66.990  1.00 16.85 ? 386  ILE C CB  1 
ATOM   10322 C  CG1 . ILE C 1 389 ? 85.561  125.545 66.656  1.00 17.62 ? 386  ILE C CG1 1 
ATOM   10323 C  CG2 . ILE C 1 389 ? 86.048  127.862 67.630  1.00 19.04 ? 386  ILE C CG2 1 
ATOM   10324 C  CD1 . ILE C 1 389 ? 86.679  125.553 65.671  1.00 17.31 ? 386  ILE C CD1 1 
ATOM   10325 N  N   . PRO C 1 390 ? 82.688  128.556 69.277  1.00 19.30 ? 387  PRO C N   1 
ATOM   10326 C  CA  . PRO C 1 390 ? 81.930  129.820 69.439  1.00 19.12 ? 387  PRO C CA  1 
ATOM   10327 C  C   . PRO C 1 390 ? 82.588  131.044 68.797  1.00 19.29 ? 387  PRO C C   1 
ATOM   10328 O  O   . PRO C 1 390 ? 81.915  131.811 68.091  1.00 17.91 ? 387  PRO C O   1 
ATOM   10329 C  CB  . PRO C 1 390 ? 81.802  129.964 70.956  1.00 20.53 ? 387  PRO C CB  1 
ATOM   10330 C  CG  . PRO C 1 390 ? 81.945  128.550 71.476  1.00 20.36 ? 387  PRO C CG  1 
ATOM   10331 C  CD  . PRO C 1 390 ? 82.964  127.918 70.575  1.00 19.67 ? 387  PRO C CD  1 
ATOM   10332 N  N   . GLU C 1 391 ? 83.886  131.206 69.019  1.00 19.49 ? 388  GLU C N   1 
ATOM   10333 C  CA  . GLU C 1 391 ? 84.634  132.309 68.434  1.00 21.03 ? 388  GLU C CA  1 
ATOM   10334 C  C   . GLU C 1 391 ? 86.126  132.016 68.447  1.00 20.79 ? 388  GLU C C   1 
ATOM   10335 O  O   . GLU C 1 391 ? 86.611  131.231 69.263  1.00 20.67 ? 388  GLU C O   1 
ATOM   10336 C  CB  . GLU C 1 391 ? 84.329  133.628 69.157  1.00 22.46 ? 388  GLU C CB  1 
ATOM   10337 C  CG  . GLU C 1 391 ? 84.526  133.597 70.661  1.00 26.77 ? 388  GLU C CG  1 
ATOM   10338 C  CD  . GLU C 1 391 ? 84.232  134.957 71.313  1.00 34.08 ? 388  GLU C CD  1 
ATOM   10339 O  OE1 . GLU C 1 391 ? 84.309  135.993 70.609  1.00 38.17 ? 388  GLU C OE1 1 
ATOM   10340 O  OE2 . GLU C 1 391 ? 83.936  134.987 72.527  1.00 37.19 ? 388  GLU C OE2 1 
ATOM   10341 N  N   . LEU C 1 392 ? 86.843  132.643 67.522  1.00 20.40 ? 389  LEU C N   1 
ATOM   10342 C  CA  . LEU C 1 392 ? 88.277  132.446 67.388  1.00 20.07 ? 389  LEU C CA  1 
ATOM   10343 C  C   . LEU C 1 392 ? 89.080  133.357 68.297  1.00 19.57 ? 389  LEU C C   1 
ATOM   10344 O  O   . LEU C 1 392 ? 89.238  134.548 68.032  1.00 21.43 ? 389  LEU C O   1 
ATOM   10345 C  CB  . LEU C 1 392 ? 88.708  132.646 65.932  1.00 19.70 ? 389  LEU C CB  1 
ATOM   10346 C  CG  . LEU C 1 392 ? 88.076  131.652 64.942  1.00 19.31 ? 389  LEU C CG  1 
ATOM   10347 C  CD1 . LEU C 1 392 ? 88.516  131.975 63.529  1.00 21.67 ? 389  LEU C CD1 1 
ATOM   10348 C  CD2 . LEU C 1 392 ? 88.427  130.224 65.286  1.00 16.87 ? 389  LEU C CD2 1 
ATOM   10349 N  N   . ASN C 1 393 ? 89.546  132.791 69.398  1.00 18.26 ? 390  ASN C N   1 
ATOM   10350 C  CA  . ASN C 1 393 ? 90.373  133.501 70.342  1.00 17.32 ? 390  ASN C CA  1 
ATOM   10351 C  C   . ASN C 1 393 ? 91.346  132.507 70.992  1.00 16.29 ? 390  ASN C C   1 
ATOM   10352 O  O   . ASN C 1 393 ? 91.274  131.280 70.737  1.00 14.81 ? 390  ASN C O   1 
ATOM   10353 C  CB  . ASN C 1 393 ? 89.537  134.325 71.352  1.00 18.26 ? 390  ASN C CB  1 
ATOM   10354 C  CG  . ASN C 1 393 ? 88.556  133.489 72.151  1.00 18.50 ? 390  ASN C CG  1 
ATOM   10355 O  OD1 . ASN C 1 393 ? 88.781  132.321 72.405  1.00 17.70 ? 390  ASN C OD1 1 
ATOM   10356 N  ND2 . ASN C 1 393 ? 87.469  134.119 72.593  1.00 18.79 ? 390  ASN C ND2 1 
ATOM   10357 N  N   . GLU C 1 394 ? 92.259  133.026 71.808  1.00 15.69 ? 391  GLU C N   1 
ATOM   10358 C  CA  . GLU C 1 394 ? 93.285  132.189 72.439  1.00 15.59 ? 391  GLU C CA  1 
ATOM   10359 C  C   . GLU C 1 394 ? 92.709  131.127 73.367  1.00 15.18 ? 391  GLU C C   1 
ATOM   10360 O  O   . GLU C 1 394 ? 93.127  129.971 73.348  1.00 13.25 ? 391  GLU C O   1 
ATOM   10361 C  CB  . GLU C 1 394 ? 94.300  133.038 73.215  1.00 15.32 ? 391  GLU C CB  1 
ATOM   10362 C  CG  . GLU C 1 394 ? 95.141  134.029 72.401  1.00 15.94 ? 391  GLU C CG  1 
ATOM   10363 C  CD  . GLU C 1 394 ? 94.495  135.411 72.241  1.00 17.91 ? 391  GLU C CD  1 
ATOM   10364 O  OE1 . GLU C 1 394 ? 93.270  135.517 72.096  1.00 17.32 ? 391  GLU C OE1 1 
ATOM   10365 O  OE2 . GLU C 1 394 ? 95.244  136.400 72.255  1.00 14.97 ? 391  GLU C OE2 1 
ATOM   10366 N  N   . TYR C 1 395 ? 91.750  131.531 74.189  1.00 15.01 ? 392  TYR C N   1 
ATOM   10367 C  CA  . TYR C 1 395 ? 91.111  130.614 75.119  1.00 15.45 ? 392  TYR C CA  1 
ATOM   10368 C  C   . TYR C 1 395 ? 90.534  129.440 74.365  1.00 14.89 ? 392  TYR C C   1 
ATOM   10369 O  O   . TYR C 1 395 ? 90.787  128.278 74.700  1.00 14.82 ? 392  TYR C O   1 
ATOM   10370 C  CB  . TYR C 1 395 ? 89.993  131.347 75.867  1.00 15.71 ? 392  TYR C CB  1 
ATOM   10371 C  CG  . TYR C 1 395 ? 89.260  130.514 76.874  1.00 17.19 ? 392  TYR C CG  1 
ATOM   10372 C  CD1 . TYR C 1 395 ? 88.162  129.745 76.504  1.00 19.29 ? 392  TYR C CD1 1 
ATOM   10373 C  CD2 . TYR C 1 395 ? 89.629  130.529 78.213  1.00 19.38 ? 392  TYR C CD2 1 
ATOM   10374 C  CE1 . TYR C 1 395 ? 87.467  129.002 77.442  1.00 19.25 ? 392  TYR C CE1 1 
ATOM   10375 C  CE2 . TYR C 1 395 ? 88.944  129.778 79.151  1.00 17.24 ? 392  TYR C CE2 1 
ATOM   10376 C  CZ  . TYR C 1 395 ? 87.868  129.027 78.760  1.00 17.76 ? 392  TYR C CZ  1 
ATOM   10377 O  OH  . TYR C 1 395 ? 87.195  128.291 79.699  1.00 20.58 ? 392  TYR C OH  1 
ATOM   10378 N  N   . THR C 1 396 ? 89.763  129.748 73.328  1.00 15.22 ? 393  THR C N   1 
ATOM   10379 C  CA  . THR C 1 396 ? 89.125  128.710 72.529  1.00 15.07 ? 393  THR C CA  1 
ATOM   10380 C  C   . THR C 1 396 ? 90.149  127.827 71.834  1.00 13.88 ? 393  THR C C   1 
ATOM   10381 O  O   . THR C 1 396 ? 89.967  126.604 71.767  1.00 14.63 ? 393  THR C O   1 
ATOM   10382 C  CB  . THR C 1 396 ? 88.142  129.321 71.517  1.00 14.55 ? 393  THR C CB  1 
ATOM   10383 O  OG1 . THR C 1 396 ? 87.216  130.142 72.227  1.00 16.71 ? 393  THR C OG1 1 
ATOM   10384 C  CG2 . THR C 1 396 ? 87.362  128.237 70.761  1.00 16.55 ? 393  THR C CG2 1 
ATOM   10385 N  N   . PHE C 1 397 ? 91.229  128.416 71.324  1.00 13.84 ? 394  PHE C N   1 
ATOM   10386 C  CA  . PHE C 1 397 ? 92.275  127.610 70.669  1.00 13.84 ? 394  PHE C CA  1 
ATOM   10387 C  C   . PHE C 1 397 ? 92.834  126.557 71.646  1.00 13.36 ? 394  PHE C C   1 
ATOM   10388 O  O   . PHE C 1 397 ? 93.076  125.394 71.269  1.00 13.95 ? 394  PHE C O   1 
ATOM   10389 C  CB  . PHE C 1 397 ? 93.412  128.488 70.145  1.00 14.28 ? 394  PHE C CB  1 
ATOM   10390 C  CG  . PHE C 1 397 ? 94.562  127.705 69.541  1.00 16.05 ? 394  PHE C CG  1 
ATOM   10391 C  CD1 . PHE C 1 397 ? 95.650  127.336 70.318  1.00 15.76 ? 394  PHE C CD1 1 
ATOM   10392 C  CD2 . PHE C 1 397 ? 94.552  127.343 68.198  1.00 16.59 ? 394  PHE C CD2 1 
ATOM   10393 C  CE1 . PHE C 1 397 ? 96.732  126.639 69.761  1.00 18.06 ? 394  PHE C CE1 1 
ATOM   10394 C  CE2 . PHE C 1 397 ? 95.614  126.619 67.638  1.00 17.68 ? 394  PHE C CE2 1 
ATOM   10395 C  CZ  . PHE C 1 397 ? 96.701  126.265 68.430  1.00 18.91 ? 394  PHE C CZ  1 
ATOM   10396 N  N   . GLY C 1 398 ? 93.058  126.981 72.887  1.00 13.40 ? 395  GLY C N   1 
ATOM   10397 C  CA  . GLY C 1 398 ? 93.579  126.102 73.936  1.00 12.95 ? 395  GLY C CA  1 
ATOM   10398 C  C   . GLY C 1 398 ? 92.609  124.970 74.225  1.00 12.29 ? 395  GLY C C   1 
ATOM   10399 O  O   . GLY C 1 398 ? 93.002  123.814 74.339  1.00 11.10 ? 395  GLY C O   1 
ATOM   10400 N  N   . TYR C 1 399 ? 91.335  125.325 74.341  1.00 11.66 ? 396  TYR C N   1 
ATOM   10401 C  CA  . TYR C 1 399 ? 90.271  124.370 74.606  1.00 12.58 ? 396  TYR C CA  1 
ATOM   10402 C  C   . TYR C 1 399 ? 90.170  123.364 73.456  1.00 12.51 ? 396  TYR C C   1 
ATOM   10403 O  O   . TYR C 1 399 ? 90.105  122.151 73.679  1.00 12.66 ? 396  TYR C O   1 
ATOM   10404 C  CB  . TYR C 1 399 ? 88.943  125.133 74.782  1.00 13.17 ? 396  TYR C CB  1 
ATOM   10405 C  CG  . TYR C 1 399 ? 87.839  124.329 75.392  1.00 12.26 ? 396  TYR C CG  1 
ATOM   10406 C  CD1 . TYR C 1 399 ? 87.061  123.479 74.614  1.00 14.04 ? 396  TYR C CD1 1 
ATOM   10407 C  CD2 . TYR C 1 399 ? 87.562  124.418 76.744  1.00 13.10 ? 396  TYR C CD2 1 
ATOM   10408 C  CE1 . TYR C 1 399 ? 86.016  122.743 75.166  1.00 17.11 ? 396  TYR C CE1 1 
ATOM   10409 C  CE2 . TYR C 1 399 ? 86.524  123.684 77.311  1.00 15.74 ? 396  TYR C CE2 1 
ATOM   10410 C  CZ  . TYR C 1 399 ? 85.754  122.841 76.508  1.00 18.34 ? 396  TYR C CZ  1 
ATOM   10411 O  OH  . TYR C 1 399 ? 84.731  122.089 77.040  1.00 19.98 ? 396  TYR C OH  1 
ATOM   10412 N  N   . LEU C 1 400 ? 90.207  123.878 72.232  1.00 13.51 ? 397  LEU C N   1 
ATOM   10413 C  CA  . LEU C 1 400 ? 90.093  123.069 71.007  1.00 13.76 ? 397  LEU C CA  1 
ATOM   10414 C  C   . LEU C 1 400 ? 91.256  122.086 70.843  1.00 13.51 ? 397  LEU C C   1 
ATOM   10415 O  O   . LEU C 1 400 ? 91.054  120.938 70.485  1.00 11.27 ? 397  LEU C O   1 
ATOM   10416 C  CB  . LEU C 1 400 ? 89.993  123.994 69.801  1.00 15.21 ? 397  LEU C CB  1 
ATOM   10417 C  CG  . LEU C 1 400 ? 89.676  123.416 68.437  1.00 15.93 ? 397  LEU C CG  1 
ATOM   10418 C  CD1 . LEU C 1 400 ? 88.329  122.725 68.424  1.00 17.07 ? 397  LEU C CD1 1 
ATOM   10419 C  CD2 . LEU C 1 400 ? 89.707  124.567 67.435  1.00 18.49 ? 397  LEU C CD2 1 
ATOM   10420 N  N   . VAL C 1 401 ? 92.467  122.553 71.110  1.00 13.66 ? 398  VAL C N   1 
ATOM   10421 C  CA  . VAL C 1 401 ? 93.643  121.725 71.050  1.00 14.41 ? 398  VAL C CA  1 
ATOM   10422 C  C   . VAL C 1 401 ? 93.518  120.560 72.030  1.00 14.76 ? 398  VAL C C   1 
ATOM   10423 O  O   . VAL C 1 401 ? 93.785  119.395 71.680  1.00 15.05 ? 398  VAL C O   1 
ATOM   10424 C  CB  . VAL C 1 401 ? 94.931  122.566 71.382  1.00 16.09 ? 398  VAL C CB  1 
ATOM   10425 C  CG1 . VAL C 1 401 ? 96.064  121.684 71.931  1.00 14.08 ? 398  VAL C CG1 1 
ATOM   10426 C  CG2 . VAL C 1 401 ? 95.365  123.377 70.158  1.00 15.76 ? 398  VAL C CG2 1 
ATOM   10427 N  N   . TYR C 1 402 ? 93.090  120.865 73.249  1.00 14.40 ? 399  TYR C N   1 
ATOM   10428 C  CA  . TYR C 1 402 ? 92.960  119.832 74.251  1.00 13.05 ? 399  TYR C CA  1 
ATOM   10429 C  C   . TYR C 1 402 ? 91.865  118.842 73.870  1.00 12.00 ? 399  TYR C C   1 
ATOM   10430 O  O   . TYR C 1 402 ? 92.035  117.632 74.041  1.00 10.12 ? 399  TYR C O   1 
ATOM   10431 C  CB  . TYR C 1 402 ? 92.746  120.417 75.643  1.00 12.98 ? 399  TYR C CB  1 
ATOM   10432 C  CG  . TYR C 1 402 ? 93.082  119.401 76.703  1.00 11.93 ? 399  TYR C CG  1 
ATOM   10433 C  CD1 . TYR C 1 402 ? 92.132  118.515 77.163  1.00 9.00  ? 399  TYR C CD1 1 
ATOM   10434 C  CD2 . TYR C 1 402 ? 94.382  119.288 77.197  1.00 13.89 ? 399  TYR C CD2 1 
ATOM   10435 C  CE1 . TYR C 1 402 ? 92.448  117.557 78.097  1.00 10.23 ? 399  TYR C CE1 1 
ATOM   10436 C  CE2 . TYR C 1 402 ? 94.704  118.352 78.140  1.00 10.83 ? 399  TYR C CE2 1 
ATOM   10437 C  CZ  . TYR C 1 402 ? 93.711  117.485 78.599  1.00 13.88 ? 399  TYR C CZ  1 
ATOM   10438 O  OH  . TYR C 1 402 ? 93.981  116.535 79.552  1.00 12.94 ? 399  TYR C OH  1 
ATOM   10439 N  N   . PHE C 1 403 ? 90.747  119.353 73.353  1.00 12.20 ? 400  PHE C N   1 
ATOM   10440 C  CA  . PHE C 1 403 ? 89.648  118.495 72.868  1.00 11.69 ? 400  PHE C CA  1 
ATOM   10441 C  C   . PHE C 1 403 ? 90.168  117.441 71.902  1.00 11.57 ? 400  PHE C C   1 
ATOM   10442 O  O   . PHE C 1 403 ? 89.947  116.231 72.081  1.00 11.51 ? 400  PHE C O   1 
ATOM   10443 C  CB  . PHE C 1 403 ? 88.571  119.362 72.170  1.00 11.79 ? 400  PHE C CB  1 
ATOM   10444 C  CG  . PHE C 1 403 ? 87.556  118.568 71.358  1.00 10.37 ? 400  PHE C CG  1 
ATOM   10445 C  CD1 . PHE C 1 403 ? 86.464  117.970 71.968  1.00 11.47 ? 400  PHE C CD1 1 
ATOM   10446 C  CD2 . PHE C 1 403 ? 87.668  118.486 69.978  1.00 12.97 ? 400  PHE C CD2 1 
ATOM   10447 C  CE1 . PHE C 1 403 ? 85.520  117.269 71.225  1.00 11.00 ? 400  PHE C CE1 1 
ATOM   10448 C  CE2 . PHE C 1 403 ? 86.742  117.777 69.232  1.00 14.25 ? 400  PHE C CE2 1 
ATOM   10449 C  CZ  . PHE C 1 403 ? 85.665  117.167 69.853  1.00 14.76 ? 400  PHE C CZ  1 
ATOM   10450 N  N   . PHE C 1 404 ? 90.892  117.895 70.881  1.00 12.37 ? 401  PHE C N   1 
ATOM   10451 C  CA  . PHE C 1 404 ? 91.459  116.988 69.885  1.00 11.84 ? 401  PHE C CA  1 
ATOM   10452 C  C   . PHE C 1 404 ? 92.558  116.045 70.416  1.00 11.69 ? 401  PHE C C   1 
ATOM   10453 O  O   . PHE C 1 404 ? 92.630  114.890 70.013  1.00 10.46 ? 401  PHE C O   1 
ATOM   10454 C  CB  . PHE C 1 404 ? 91.936  117.765 68.647  1.00 12.15 ? 401  PHE C CB  1 
ATOM   10455 C  CG  . PHE C 1 404 ? 90.806  118.147 67.713  1.00 13.13 ? 401  PHE C CG  1 
ATOM   10456 C  CD1 . PHE C 1 404 ? 90.040  117.158 67.104  1.00 12.68 ? 401  PHE C CD1 1 
ATOM   10457 C  CD2 . PHE C 1 404 ? 90.558  119.465 67.385  1.00 12.68 ? 401  PHE C CD2 1 
ATOM   10458 C  CE1 . PHE C 1 404 ? 88.992  117.496 66.237  1.00 13.07 ? 401  PHE C CE1 1 
ATOM   10459 C  CE2 . PHE C 1 404 ? 89.529  119.800 66.517  1.00 11.35 ? 401  PHE C CE2 1 
ATOM   10460 C  CZ  . PHE C 1 404 ? 88.755  118.819 65.947  1.00 12.61 ? 401  PHE C CZ  1 
ATOM   10461 N  N   . GLU C 1 405 ? 93.423  116.535 71.295  1.00 13.03 ? 402  GLU C N   1 
ATOM   10462 C  CA  . GLU C 1 405 ? 94.457  115.672 71.871  1.00 12.30 ? 402  GLU C CA  1 
ATOM   10463 C  C   . GLU C 1 405 ? 93.839  114.541 72.690  1.00 12.49 ? 402  GLU C C   1 
ATOM   10464 O  O   . GLU C 1 405 ? 94.199  113.374 72.540  1.00 13.22 ? 402  GLU C O   1 
ATOM   10465 C  CB  . GLU C 1 405 ? 95.409  116.484 72.747  1.00 13.46 ? 402  GLU C CB  1 
ATOM   10466 C  CG  . GLU C 1 405 ? 96.291  117.502 71.969  1.00 13.33 ? 402  GLU C CG  1 
ATOM   10467 C  CD  . GLU C 1 405 ? 97.209  118.329 72.871  1.00 13.15 ? 402  GLU C CD  1 
ATOM   10468 O  OE1 . GLU C 1 405 ? 96.977  118.367 74.083  1.00 14.87 ? 402  GLU C OE1 1 
ATOM   10469 O  OE2 . GLU C 1 405 ? 98.184  118.950 72.361  1.00 14.80 ? 402  GLU C OE2 1 
ATOM   10470 N  N   . LYS C 1 406 ? 92.897  114.874 73.554  1.00 11.86 ? 403  LYS C N   1 
ATOM   10471 C  CA  . LYS C 1 406 ? 92.284  113.859 74.403  1.00 12.40 ? 403  LYS C CA  1 
ATOM   10472 C  C   . LYS C 1 406 ? 91.454  112.905 73.539  1.00 11.23 ? 403  LYS C C   1 
ATOM   10473 O  O   . LYS C 1 406 ? 91.409  111.703 73.803  1.00 11.07 ? 403  LYS C O   1 
ATOM   10474 C  CB  . LYS C 1 406 ? 91.438  114.543 75.492  1.00 12.31 ? 403  LYS C CB  1 
ATOM   10475 C  CG  . LYS C 1 406 ? 91.121  113.750 76.786  1.00 16.66 ? 403  LYS C CG  1 
ATOM   10476 C  CD  . LYS C 1 406 ? 92.371  113.240 77.501  1.00 17.46 ? 403  LYS C CD  1 
ATOM   10477 C  CE  . LYS C 1 406 ? 92.231  113.130 79.025  1.00 21.51 ? 403  LYS C CE  1 
ATOM   10478 N  NZ  . LYS C 1 406 ? 90.942  112.695 79.648  1.00 12.93 ? 403  LYS C NZ  1 
ATOM   10479 N  N   . ALA C 1 407 ? 90.809  113.425 72.496  1.00 11.50 ? 404  ALA C N   1 
ATOM   10480 C  CA  . ALA C 1 407 ? 90.000  112.564 71.629  1.00 12.41 ? 404  ALA C CA  1 
ATOM   10481 C  C   . ALA C 1 407 ? 90.929  111.602 70.889  1.00 12.82 ? 404  ALA C C   1 
ATOM   10482 O  O   . ALA C 1 407 ? 90.622  110.424 70.724  1.00 13.31 ? 404  ALA C O   1 
ATOM   10483 C  CB  . ALA C 1 407 ? 89.200  113.383 70.658  1.00 11.49 ? 404  ALA C CB  1 
ATOM   10484 N  N   . CYS C 1 408 ? 92.075  112.119 70.461  1.00 13.75 ? 405  CYS C N   1 
ATOM   10485 C  CA  . CYS C 1 408 ? 93.059  111.308 69.737  1.00 14.53 ? 405  CYS C CA  1 
ATOM   10486 C  C   . CYS C 1 408 ? 93.550  110.131 70.583  1.00 13.87 ? 405  CYS C C   1 
ATOM   10487 O  O   . CYS C 1 408 ? 93.581  108.997 70.118  1.00 13.94 ? 405  CYS C O   1 
ATOM   10488 C  CB  . CYS C 1 408 ? 94.235  112.192 69.288  1.00 15.48 ? 405  CYS C CB  1 
ATOM   10489 S  SG  . CYS C 1 408 ? 95.444  111.284 68.361  1.00 19.37 ? 405  CYS C SG  1 
ATOM   10490 N  N   . ALA C 1 409 ? 93.872  110.398 71.840  1.00 13.69 ? 406  ALA C N   1 
ATOM   10491 C  CA  . ALA C 1 409 ? 94.340  109.363 72.745  1.00 14.11 ? 406  ALA C CA  1 
ATOM   10492 C  C   . ALA C 1 409 ? 93.320  108.231 72.841  1.00 13.24 ? 406  ALA C C   1 
ATOM   10493 O  O   . ALA C 1 409 ? 93.660  107.077 72.672  1.00 12.84 ? 406  ALA C O   1 
ATOM   10494 C  CB  . ALA C 1 409 ? 94.616  109.948 74.136  1.00 13.47 ? 406  ALA C CB  1 
HETATM 10495 N  N   . MSE C 1 410 ? 92.070  108.577 73.124  1.00 13.81 ? 407  MSE C N   1 
HETATM 10496 C  CA  . MSE C 1 410 ? 90.992  107.593 73.240  1.00 14.19 ? 407  MSE C CA  1 
HETATM 10497 C  C   . MSE C 1 410 ? 90.783  106.828 71.918  1.00 14.09 ? 407  MSE C C   1 
HETATM 10498 O  O   . MSE C 1 410 ? 90.633  105.597 71.901  1.00 13.12 ? 407  MSE C O   1 
HETATM 10499 C  CB  . MSE C 1 410 ? 89.692  108.308 73.641  1.00 14.29 ? 407  MSE C CB  1 
HETATM 10500 C  CG  . MSE C 1 410 ? 88.450  107.412 73.721  1.00 15.97 ? 407  MSE C CG  1 
HETATM 10501 SE SE  . MSE C 1 410 ? 88.652  105.974 75.001  1.00 13.64 ? 407  MSE C SE  1 
HETATM 10502 C  CE  . MSE C 1 410 ? 88.743  107.048 76.646  1.00 13.13 ? 407  MSE C CE  1 
ATOM   10503 N  N   . SER C 1 411 ? 90.805  107.564 70.815  1.00 14.76 ? 408  SER C N   1 
ATOM   10504 C  CA  . SER C 1 411 ? 90.578  106.986 69.503  1.00 13.98 ? 408  SER C CA  1 
ATOM   10505 C  C   . SER C 1 411 ? 91.640  105.947 69.154  1.00 14.14 ? 408  SER C C   1 
ATOM   10506 O  O   . SER C 1 411 ? 91.311  104.846 68.677  1.00 12.49 ? 408  SER C O   1 
ATOM   10507 C  CB  . SER C 1 411 ? 90.539  108.089 68.447  1.00 15.19 ? 408  SER C CB  1 
ATOM   10508 O  OG  . SER C 1 411 ? 90.354  107.560 67.146  1.00 14.17 ? 408  SER C OG  1 
ATOM   10509 N  N   . GLY C 1 412 ? 92.898  106.273 69.437  1.00 12.87 ? 409  GLY C N   1 
ATOM   10510 C  CA  . GLY C 1 412 ? 94.016  105.355 69.168  1.00 12.36 ? 409  GLY C CA  1 
ATOM   10511 C  C   . GLY C 1 412 ? 93.906  104.104 70.014  1.00 12.33 ? 409  GLY C C   1 
ATOM   10512 O  O   . GLY C 1 412 ? 94.127  103.003 69.530  1.00 12.65 ? 409  GLY C O   1 
ATOM   10513 N  N   . TYR C 1 413 ? 93.591  104.267 71.299  1.00 12.95 ? 410  TYR C N   1 
ATOM   10514 C  CA  . TYR C 1 413 ? 93.421  103.113 72.157  1.00 12.93 ? 410  TYR C CA  1 
ATOM   10515 C  C   . TYR C 1 413 ? 92.236  102.238 71.752  1.00 13.82 ? 410  TYR C C   1 
ATOM   10516 O  O   . TYR C 1 413 ? 92.327  101.009 71.852  1.00 13.57 ? 410  TYR C O   1 
ATOM   10517 C  CB  . TYR C 1 413 ? 93.300  103.502 73.627  1.00 13.62 ? 410  TYR C CB  1 
ATOM   10518 C  CG  . TYR C 1 413 ? 94.613  103.855 74.294  1.00 12.42 ? 410  TYR C CG  1 
ATOM   10519 C  CD1 . TYR C 1 413 ? 95.682  102.957 74.277  1.00 12.87 ? 410  TYR C CD1 1 
ATOM   10520 C  CD2 . TYR C 1 413 ? 94.754  105.028 75.038  1.00 17.69 ? 410  TYR C CD2 1 
ATOM   10521 C  CE1 . TYR C 1 413 ? 96.878  103.241 74.918  1.00 13.50 ? 410  TYR C CE1 1 
ATOM   10522 C  CE2 . TYR C 1 413 ? 95.948  105.315 75.711  1.00 13.95 ? 410  TYR C CE2 1 
ATOM   10523 C  CZ  . TYR C 1 413 ? 96.998  104.416 75.643  1.00 13.38 ? 410  TYR C CZ  1 
ATOM   10524 O  OH  . TYR C 1 413 ? 98.174  104.688 76.289  1.00 13.98 ? 410  TYR C OH  1 
ATOM   10525 N  N   . LEU C 1 414 ? 91.131  102.844 71.315  1.00 13.84 ? 411  LEU C N   1 
ATOM   10526 C  CA  . LEU C 1 414 ? 89.971  102.055 70.872  1.00 14.21 ? 411  LEU C CA  1 
ATOM   10527 C  C   . LEU C 1 414 ? 90.303  101.277 69.582  1.00 14.39 ? 411  LEU C C   1 
ATOM   10528 O  O   . LEU C 1 414 ? 89.803  100.180 69.370  1.00 12.32 ? 411  LEU C O   1 
ATOM   10529 C  CB  . LEU C 1 414 ? 88.736  102.941 70.652  1.00 13.92 ? 411  LEU C CB  1 
ATOM   10530 C  CG  . LEU C 1 414 ? 88.147  103.552 71.941  1.00 14.93 ? 411  LEU C CG  1 
ATOM   10531 C  CD1 . LEU C 1 414 ? 87.018  104.569 71.674  1.00 14.34 ? 411  LEU C CD1 1 
ATOM   10532 C  CD2 . LEU C 1 414 ? 87.667  102.415 72.887  1.00 18.61 ? 411  LEU C CD2 1 
ATOM   10533 N  N   . LEU C 1 415 ? 91.145  101.855 68.741  1.00 15.13 ? 412  LEU C N   1 
ATOM   10534 C  CA  . LEU C 1 415 ? 91.555  101.217 67.488  1.00 16.47 ? 412  LEU C CA  1 
ATOM   10535 C  C   . LEU C 1 415 ? 92.448  100.012 67.777  1.00 16.47 ? 412  LEU C C   1 
ATOM   10536 O  O   . LEU C 1 415 ? 92.510  99.073  66.979  1.00 19.97 ? 412  LEU C O   1 
ATOM   10537 C  CB  . LEU C 1 415 ? 92.305  102.214 66.604  1.00 16.35 ? 412  LEU C CB  1 
ATOM   10538 C  CG  . LEU C 1 415 ? 92.774  101.700 65.231  1.00 16.75 ? 412  LEU C CG  1 
ATOM   10539 C  CD1 . LEU C 1 415 ? 91.555  101.237 64.368  1.00 14.42 ? 412  LEU C CD1 1 
ATOM   10540 C  CD2 . LEU C 1 415 ? 93.577  102.763 64.537  1.00 15.49 ? 412  LEU C CD2 1 
ATOM   10541 N  N   . GLY C 1 416 ? 93.152  100.051 68.905  1.00 15.09 ? 413  GLY C N   1 
ATOM   10542 C  CA  . GLY C 1 416 ? 94.037  98.960  69.308  1.00 14.24 ? 413  GLY C CA  1 
ATOM   10543 C  C   . GLY C 1 416 ? 95.509  99.225  68.983  1.00 13.55 ? 413  GLY C C   1 
ATOM   10544 O  O   . GLY C 1 416 ? 96.273  98.289  68.781  1.00 11.36 ? 413  GLY C O   1 
ATOM   10545 N  N   . VAL C 1 417 ? 95.903  100.495 68.911  1.00 13.31 ? 414  VAL C N   1 
ATOM   10546 C  CA  . VAL C 1 417 ? 97.301  100.847 68.591  1.00 12.47 ? 414  VAL C CA  1 
ATOM   10547 C  C   . VAL C 1 417 ? 97.945  101.630 69.734  1.00 12.65 ? 414  VAL C C   1 
ATOM   10548 O  O   . VAL C 1 417 ? 97.287  101.963 70.724  1.00 13.73 ? 414  VAL C O   1 
ATOM   10549 C  CB  . VAL C 1 417 ? 97.400  101.688 67.290  1.00 12.95 ? 414  VAL C CB  1 
ATOM   10550 C  CG1 . VAL C 1 417 ? 96.779  100.920 66.097  1.00 11.13 ? 414  VAL C CG1 1 
ATOM   10551 C  CG2 . VAL C 1 417 ? 96.732  103.092 67.468  1.00 10.42 ? 414  VAL C CG2 1 
ATOM   10552 N  N   . ASN C 1 418 ? 99.244  101.854 69.630  1.00 12.53 ? 415  ASN C N   1 
ATOM   10553 C  CA  . ASN C 1 418 ? 99.953  102.682 70.588  1.00 13.32 ? 415  ASN C CA  1 
ATOM   10554 C  C   . ASN C 1 418 ? 99.785  104.095 70.021  1.00 12.42 ? 415  ASN C C   1 
ATOM   10555 O  O   . ASN C 1 418 ? 100.360 104.406 68.999  1.00 13.96 ? 415  ASN C O   1 
ATOM   10556 C  CB  . ASN C 1 418 ? 101.430 102.310 70.664  1.00 12.92 ? 415  ASN C CB  1 
ATOM   10557 C  CG  . ASN C 1 418 ? 102.232 103.257 71.572  1.00 14.44 ? 415  ASN C CG  1 
ATOM   10558 O  OD1 . ASN C 1 418 ? 101.716 104.280 72.021  1.00 9.99  ? 415  ASN C OD1 1 
ATOM   10559 N  ND2 . ASN C 1 418 ? 103.507 102.907 71.840  1.00 10.59 ? 415  ASN C ND2 1 
ATOM   10560 N  N   . PRO C 1 419 ? 99.014  104.959 70.686  1.00 12.99 ? 416  PRO C N   1 
ATOM   10561 C  CA  . PRO C 1 419 ? 98.826  106.270 70.054  1.00 13.25 ? 416  PRO C CA  1 
ATOM   10562 C  C   . PRO C 1 419 ? 99.993  107.236 70.154  1.00 14.32 ? 416  PRO C C   1 
ATOM   10563 O  O   . PRO C 1 419 ? 99.971  108.277 69.465  1.00 13.27 ? 416  PRO C O   1 
ATOM   10564 C  CB  . PRO C 1 419 ? 97.660  106.869 70.845  1.00 14.33 ? 416  PRO C CB  1 
ATOM   10565 C  CG  . PRO C 1 419 ? 97.165  105.788 71.784  1.00 13.69 ? 416  PRO C CG  1 
ATOM   10566 C  CD  . PRO C 1 419 ? 98.265  104.838 71.950  1.00 12.92 ? 416  PRO C CD  1 
ATOM   10567 N  N   . PHE C 1 420 ? 101.030 106.875 70.919  1.00 12.17 ? 417  PHE C N   1 
ATOM   10568 C  CA  . PHE C 1 420 ? 102.077 107.838 71.240  1.00 12.23 ? 417  PHE C CA  1 
ATOM   10569 C  C   . PHE C 1 420 ? 103.465 107.677 70.663  1.00 13.90 ? 417  PHE C C   1 
ATOM   10570 O  O   . PHE C 1 420 ? 104.336 108.506 70.946  1.00 13.92 ? 417  PHE C O   1 
ATOM   10571 C  CB  . PHE C 1 420 ? 102.114 107.958 72.770  1.00 12.89 ? 417  PHE C CB  1 
ATOM   10572 C  CG  . PHE C 1 420 ? 100.753 108.262 73.362  1.00 10.52 ? 417  PHE C CG  1 
ATOM   10573 C  CD1 . PHE C 1 420 ? 100.162 109.500 73.149  1.00 13.55 ? 417  PHE C CD1 1 
ATOM   10574 C  CD2 . PHE C 1 420 ? 100.052 107.316 74.067  1.00 13.69 ? 417  PHE C CD2 1 
ATOM   10575 C  CE1 . PHE C 1 420 ? 98.900  109.789 73.657  1.00 15.03 ? 417  PHE C CE1 1 
ATOM   10576 C  CE2 . PHE C 1 420 ? 98.782  107.599 74.603  1.00 13.39 ? 417  PHE C CE2 1 
ATOM   10577 C  CZ  . PHE C 1 420 ? 98.212  108.828 74.397  1.00 15.14 ? 417  PHE C CZ  1 
ATOM   10578 N  N   . ASP C 1 421 ? 103.680 106.628 69.859  1.00 13.09 ? 418  ASP C N   1 
ATOM   10579 C  CA  . ASP C 1 421 ? 104.975 106.404 69.190  1.00 13.42 ? 418  ASP C CA  1 
ATOM   10580 C  C   . ASP C 1 421 ? 104.878 106.719 67.696  1.00 12.87 ? 418  ASP C C   1 
ATOM   10581 O  O   . ASP C 1 421 ? 103.820 107.145 67.200  1.00 12.82 ? 418  ASP C O   1 
ATOM   10582 C  CB  . ASP C 1 421 ? 105.451 104.950 69.391  1.00 14.42 ? 418  ASP C CB  1 
ATOM   10583 C  CG  . ASP C 1 421 ? 104.505 103.917 68.762  1.00 16.72 ? 418  ASP C CG  1 
ATOM   10584 O  OD1 . ASP C 1 421 ? 103.371 104.273 68.332  1.00 15.33 ? 418  ASP C OD1 1 
ATOM   10585 O  OD2 . ASP C 1 421 ? 104.900 102.734 68.695  1.00 18.18 ? 418  ASP C OD2 1 
ATOM   10586 N  N   . GLN C 1 422 ? 105.999 106.560 66.983  1.00 12.49 ? 419  GLN C N   1 
ATOM   10587 C  CA  . GLN C 1 422 ? 106.040 106.770 65.533  1.00 12.95 ? 419  GLN C CA  1 
ATOM   10588 C  C   . GLN C 1 422 ? 107.190 105.968 64.908  1.00 12.95 ? 419  GLN C C   1 
ATOM   10589 O  O   . GLN C 1 422 ? 108.088 106.518 64.319  1.00 12.82 ? 419  GLN C O   1 
ATOM   10590 C  CB  . GLN C 1 422 ? 106.150 108.267 65.172  1.00 13.82 ? 419  GLN C CB  1 
ATOM   10591 C  CG  . GLN C 1 422 ? 107.289 109.003 65.850  1.00 15.14 ? 419  GLN C CG  1 
ATOM   10592 C  CD  . GLN C 1 422 ? 107.062 109.267 67.333  1.00 18.95 ? 419  GLN C CD  1 
ATOM   10593 O  OE1 . GLN C 1 422 ? 105.963 109.649 67.769  1.00 14.65 ? 419  GLN C OE1 1 
ATOM   10594 N  NE2 . GLN C 1 422 ? 108.127 109.124 68.112  1.00 17.42 ? 419  GLN C NE2 1 
ATOM   10595 N  N   . PRO C 1 423 ? 107.130 104.644 65.006  1.00 14.17 ? 420  PRO C N   1 
ATOM   10596 C  CA  . PRO C 1 423 ? 108.213 103.814 64.469  1.00 14.87 ? 420  PRO C CA  1 
ATOM   10597 C  C   . PRO C 1 423 ? 108.391 103.859 62.943  1.00 14.77 ? 420  PRO C C   1 
ATOM   10598 O  O   . PRO C 1 423 ? 109.500 103.606 62.450  1.00 12.69 ? 420  PRO C O   1 
ATOM   10599 C  CB  . PRO C 1 423 ? 107.826 102.401 64.908  1.00 15.27 ? 420  PRO C CB  1 
ATOM   10600 C  CG  . PRO C 1 423 ? 106.350 102.439 65.097  1.00 14.60 ? 420  PRO C CG  1 
ATOM   10601 C  CD  . PRO C 1 423 ? 106.001 103.853 65.512  1.00 14.44 ? 420  PRO C CD  1 
ATOM   10602 N  N   . GLY C 1 424 ? 107.310 104.163 62.224  1.00 13.25 ? 421  GLY C N   1 
ATOM   10603 C  CA  . GLY C 1 424 ? 107.332 104.225 60.778  1.00 13.30 ? 421  GLY C CA  1 
ATOM   10604 C  C   . GLY C 1 424 ? 108.193 105.327 60.153  1.00 13.97 ? 421  GLY C C   1 
ATOM   10605 O  O   . GLY C 1 424 ? 108.542 105.234 58.972  1.00 16.56 ? 421  GLY C O   1 
ATOM   10606 N  N   . VAL C 1 425 ? 108.559 106.363 60.904  1.00 13.28 ? 422  VAL C N   1 
ATOM   10607 C  CA  . VAL C 1 425 ? 109.389 107.411 60.320  1.00 12.70 ? 422  VAL C CA  1 
ATOM   10608 C  C   . VAL C 1 425 ? 110.861 106.997 60.242  1.00 14.75 ? 422  VAL C C   1 
ATOM   10609 O  O   . VAL C 1 425 ? 111.648 107.626 59.542  1.00 13.73 ? 422  VAL C O   1 
ATOM   10610 C  CB  . VAL C 1 425 ? 109.273 108.780 61.070  1.00 14.27 ? 422  VAL C CB  1 
ATOM   10611 C  CG1 . VAL C 1 425 ? 107.811 109.304 61.043  1.00 14.22 ? 422  VAL C CG1 1 
ATOM   10612 C  CG2 . VAL C 1 425 ? 109.789 108.680 62.496  1.00 14.26 ? 422  VAL C CG2 1 
ATOM   10613 N  N   . GLU C 1 426 ? 111.238 105.898 60.885  1.00 13.65 ? 423  GLU C N   1 
ATOM   10614 C  CA  . GLU C 1 426 ? 112.647 105.524 60.860  1.00 14.41 ? 423  GLU C CA  1 
ATOM   10615 C  C   . GLU C 1 426 ? 113.101 105.015 59.513  1.00 13.07 ? 423  GLU C C   1 
ATOM   10616 O  O   . GLU C 1 426 ? 114.244 105.231 59.125  1.00 12.22 ? 423  GLU C O   1 
ATOM   10617 C  CB  . GLU C 1 426 ? 112.977 104.495 61.954  1.00 14.35 ? 423  GLU C CB  1 
ATOM   10618 C  CG  . GLU C 1 426 ? 112.737 105.031 63.344  1.00 21.57 ? 423  GLU C CG  1 
ATOM   10619 C  CD  . GLU C 1 426 ? 113.543 106.311 63.634  1.00 28.52 ? 423  GLU C CD  1 
ATOM   10620 O  OE1 . GLU C 1 426 ? 114.712 106.410 63.196  1.00 35.27 ? 423  GLU C OE1 1 
ATOM   10621 O  OE2 . GLU C 1 426 ? 113.010 107.208 64.319  1.00 34.00 ? 423  GLU C OE2 1 
ATOM   10622 N  N   . ALA C 1 427 ? 112.207 104.367 58.783  1.00 12.37 ? 424  ALA C N   1 
ATOM   10623 C  CA  . ALA C 1 427 ? 112.557 103.791 57.485  1.00 12.29 ? 424  ALA C CA  1 
ATOM   10624 C  C   . ALA C 1 427 ? 113.153 104.799 56.494  1.00 13.19 ? 424  ALA C C   1 
ATOM   10625 O  O   . ALA C 1 427 ? 114.260 104.585 55.971  1.00 12.56 ? 424  ALA C O   1 
ATOM   10626 C  CB  . ALA C 1 427 ? 111.334 103.071 56.858  1.00 10.86 ? 424  ALA C CB  1 
ATOM   10627 N  N   . TYR C 1 428 ? 112.459 105.908 56.244  1.00 12.73 ? 425  TYR C N   1 
ATOM   10628 C  CA  . TYR C 1 428 ? 113.003 106.851 55.276  1.00 13.07 ? 425  TYR C CA  1 
ATOM   10629 C  C   . TYR C 1 428 ? 114.254 107.510 55.822  1.00 13.91 ? 425  TYR C C   1 
ATOM   10630 O  O   . TYR C 1 428 ? 115.179 107.773 55.074  1.00 14.91 ? 425  TYR C O   1 
ATOM   10631 C  CB  . TYR C 1 428 ? 111.987 107.925 54.841  1.00 12.44 ? 425  TYR C CB  1 
ATOM   10632 C  CG  . TYR C 1 428 ? 111.904 109.138 55.732  1.00 11.22 ? 425  TYR C CG  1 
ATOM   10633 C  CD1 . TYR C 1 428 ? 112.790 110.201 55.556  1.00 11.81 ? 425  TYR C CD1 1 
ATOM   10634 C  CD2 . TYR C 1 428 ? 110.946 109.238 56.729  1.00 9.25  ? 425  TYR C CD2 1 
ATOM   10635 C  CE1 . TYR C 1 428 ? 112.723 111.320 56.338  1.00 12.73 ? 425  TYR C CE1 1 
ATOM   10636 C  CE2 . TYR C 1 428 ? 110.875 110.347 57.536  1.00 12.07 ? 425  TYR C CE2 1 
ATOM   10637 C  CZ  . TYR C 1 428 ? 111.771 111.395 57.335  1.00 16.82 ? 425  TYR C CZ  1 
ATOM   10638 O  OH  . TYR C 1 428 ? 111.723 112.518 58.136  1.00 15.18 ? 425  TYR C OH  1 
ATOM   10639 N  N   . LYS C 1 429 ? 114.279 107.784 57.123  1.00 13.85 ? 426  LYS C N   1 
ATOM   10640 C  CA  . LYS C 1 429 ? 115.450 108.432 57.734  1.00 14.55 ? 426  LYS C CA  1 
ATOM   10641 C  C   . LYS C 1 429 ? 116.713 107.610 57.554  1.00 14.46 ? 426  LYS C C   1 
ATOM   10642 O  O   . LYS C 1 429 ? 117.732 108.131 57.097  1.00 15.06 ? 426  LYS C O   1 
ATOM   10643 C  CB  . LYS C 1 429 ? 115.232 108.710 59.233  1.00 13.84 ? 426  LYS C CB  1 
ATOM   10644 C  CG  . LYS C 1 429 ? 114.180 109.734 59.540  1.00 12.63 ? 426  LYS C CG  1 
ATOM   10645 C  CD  . LYS C 1 429 ? 114.021 109.939 61.039  1.00 16.45 ? 426  LYS C CD  1 
ATOM   10646 C  CE  . LYS C 1 429 ? 112.991 111.022 61.329  1.00 19.72 ? 426  LYS C CE  1 
ATOM   10647 N  NZ  . LYS C 1 429 ? 112.875 111.325 62.784  1.00 23.80 ? 426  LYS C NZ  1 
ATOM   10648 N  N   . LYS C 1 430 ? 116.672 106.332 57.874  1.00 14.21 ? 427  LYS C N   1 
ATOM   10649 C  CA  . LYS C 1 430 ? 117.901 105.561 57.728  1.00 16.54 ? 427  LYS C CA  1 
ATOM   10650 C  C   . LYS C 1 430 ? 118.330 105.387 56.270  1.00 15.91 ? 427  LYS C C   1 
ATOM   10651 O  O   . LYS C 1 430 ? 119.541 105.352 55.998  1.00 15.08 ? 427  LYS C O   1 
ATOM   10652 C  CB  . LYS C 1 430 ? 117.891 104.253 58.518  1.00 17.46 ? 427  LYS C CB  1 
ATOM   10653 C  CG  . LYS C 1 430 ? 116.877 103.228 58.179  1.00 23.88 ? 427  LYS C CG  1 
ATOM   10654 C  CD  . LYS C 1 430 ? 116.963 102.123 59.250  1.00 30.86 ? 427  LYS C CD  1 
ATOM   10655 C  CE  . LYS C 1 430 ? 115.938 101.039 59.050  1.00 35.83 ? 427  LYS C CE  1 
ATOM   10656 N  NZ  . LYS C 1 430 ? 115.881 100.103 60.220  1.00 38.60 ? 427  LYS C NZ  1 
ATOM   10657 N  N   . ASN C 1 431 ? 117.364 105.304 55.346  1.00 14.50 ? 428  ASN C N   1 
ATOM   10658 C  CA  . ASN C 1 431 ? 117.680 105.198 53.915  1.00 14.64 ? 428  ASN C CA  1 
ATOM   10659 C  C   . ASN C 1 431 ? 118.347 106.487 53.465  1.00 15.98 ? 428  ASN C C   1 
ATOM   10660 O  O   . ASN C 1 431 ? 119.307 106.459 52.691  1.00 17.15 ? 428  ASN C O   1 
ATOM   10661 C  CB  . ASN C 1 431 ? 116.421 104.956 53.046  1.00 13.95 ? 428  ASN C CB  1 
ATOM   10662 C  CG  . ASN C 1 431 ? 115.889 103.542 53.150  1.00 13.86 ? 428  ASN C CG  1 
ATOM   10663 O  OD1 . ASN C 1 431 ? 116.432 102.702 53.866  1.00 12.02 ? 428  ASN C OD1 1 
ATOM   10664 N  ND2 . ASN C 1 431 ? 114.849 103.262 52.393  1.00 10.29 ? 428  ASN C ND2 1 
HETATM 10665 N  N   . MSE C 1 432 ? 117.823 107.619 53.940  1.00 15.41 ? 429  MSE C N   1 
HETATM 10666 C  CA  . MSE C 1 432 ? 118.384 108.926 53.607  1.00 15.13 ? 429  MSE C CA  1 
HETATM 10667 C  C   . MSE C 1 432 ? 119.806 109.070 54.179  1.00 15.23 ? 429  MSE C C   1 
HETATM 10668 O  O   . MSE C 1 432 ? 120.721 109.524 53.488  1.00 14.45 ? 429  MSE C O   1 
HETATM 10669 C  CB  . MSE C 1 432 ? 117.483 110.033 54.135  1.00 14.82 ? 429  MSE C CB  1 
HETATM 10670 C  CG  . MSE C 1 432 ? 118.015 111.432 53.895  1.00 16.09 ? 429  MSE C CG  1 
HETATM 10671 SE SE  . MSE C 1 432 ? 116.875 112.819 54.665  1.00 19.90 ? 429  MSE C SE  1 
HETATM 10672 C  CE  . MSE C 1 432 ? 117.071 112.412 56.579  1.00 20.26 ? 429  MSE C CE  1 
ATOM   10673 N  N   . PHE C 1 433 ? 119.995 108.677 55.436  1.00 14.14 ? 430  PHE C N   1 
ATOM   10674 C  CA  . PHE C 1 433 ? 121.311 108.757 56.043  1.00 13.35 ? 430  PHE C CA  1 
ATOM   10675 C  C   . PHE C 1 433 ? 122.314 107.930 55.238  1.00 14.56 ? 430  PHE C C   1 
ATOM   10676 O  O   . PHE C 1 433 ? 123.430 108.377 54.955  1.00 13.64 ? 430  PHE C O   1 
ATOM   10677 C  CB  . PHE C 1 433 ? 121.317 108.268 57.501  1.00 14.05 ? 430  PHE C CB  1 
ATOM   10678 C  CG  . PHE C 1 433 ? 120.446 109.074 58.448  1.00 15.47 ? 430  PHE C CG  1 
ATOM   10679 C  CD1 . PHE C 1 433 ? 120.289 110.454 58.298  1.00 17.58 ? 430  PHE C CD1 1 
ATOM   10680 C  CD2 . PHE C 1 433 ? 119.928 108.471 59.593  1.00 16.54 ? 430  PHE C CD2 1 
ATOM   10681 C  CE1 . PHE C 1 433 ? 119.527 111.189 59.216  1.00 18.48 ? 430  PHE C CE1 1 
ATOM   10682 C  CE2 . PHE C 1 433 ? 119.174 109.192 60.516  1.00 17.10 ? 430  PHE C CE2 1 
ATOM   10683 C  CZ  . PHE C 1 433 ? 118.971 110.559 60.331  1.00 17.42 ? 430  PHE C CZ  1 
ATOM   10684 N  N   . ALA C 1 434 ? 121.913 106.712 54.884  1.00 13.91 ? 431  ALA C N   1 
ATOM   10685 C  CA  . ALA C 1 434 ? 122.751 105.811 54.114  1.00 13.97 ? 431  ALA C CA  1 
ATOM   10686 C  C   . ALA C 1 434 ? 123.192 106.461 52.806  1.00 13.51 ? 431  ALA C C   1 
ATOM   10687 O  O   . ALA C 1 434 ? 124.377 106.543 52.511  1.00 14.88 ? 431  ALA C O   1 
ATOM   10688 C  CB  . ALA C 1 434 ? 121.992 104.495 53.832  1.00 11.17 ? 431  ALA C CB  1 
ATOM   10689 N  N   . LEU C 1 435 ? 122.221 106.939 52.041  1.00 14.18 ? 432  LEU C N   1 
ATOM   10690 C  CA  . LEU C 1 435 ? 122.463 107.556 50.748  1.00 14.53 ? 432  LEU C CA  1 
ATOM   10691 C  C   . LEU C 1 435 ? 123.259 108.867 50.798  1.00 14.94 ? 432  LEU C C   1 
ATOM   10692 O  O   . LEU C 1 435 ? 123.964 109.205 49.842  1.00 11.98 ? 432  LEU C O   1 
ATOM   10693 C  CB  . LEU C 1 435 ? 121.133 107.762 50.023  1.00 14.08 ? 432  LEU C CB  1 
ATOM   10694 C  CG  . LEU C 1 435 ? 120.472 106.460 49.535  1.00 15.72 ? 432  LEU C CG  1 
ATOM   10695 C  CD1 . LEU C 1 435 ? 119.034 106.717 49.070  1.00 14.96 ? 432  LEU C CD1 1 
ATOM   10696 C  CD2 . LEU C 1 435 ? 121.287 105.785 48.422  1.00 13.63 ? 432  LEU C CD2 1 
ATOM   10697 N  N   . LEU C 1 436 ? 123.134 109.601 51.903  1.00 14.70 ? 433  LEU C N   1 
ATOM   10698 C  CA  . LEU C 1 436 ? 123.864 110.849 52.071  1.00 15.06 ? 433  LEU C CA  1 
ATOM   10699 C  C   . LEU C 1 436 ? 125.314 110.542 52.331  1.00 16.28 ? 433  LEU C C   1 
ATOM   10700 O  O   . LEU C 1 436 ? 126.165 111.422 52.221  1.00 16.86 ? 433  LEU C O   1 
ATOM   10701 C  CB  . LEU C 1 436 ? 123.327 111.632 53.261  1.00 15.95 ? 433  LEU C CB  1 
ATOM   10702 C  CG  . LEU C 1 436 ? 121.991 112.346 53.118  1.00 16.12 ? 433  LEU C CG  1 
ATOM   10703 C  CD1 . LEU C 1 436 ? 121.457 112.827 54.508  1.00 14.54 ? 433  LEU C CD1 1 
ATOM   10704 C  CD2 . LEU C 1 436 ? 122.163 113.495 52.136  1.00 11.74 ? 433  LEU C CD2 1 
ATOM   10705 N  N   . GLY C 1 437 ? 125.584 109.298 52.721  1.00 16.54 ? 434  GLY C N   1 
ATOM   10706 C  CA  . GLY C 1 437 ? 126.944 108.865 53.041  1.00 16.58 ? 434  GLY C CA  1 
ATOM   10707 C  C   . GLY C 1 437 ? 127.265 109.077 54.508  1.00 16.00 ? 434  GLY C C   1 
ATOM   10708 O  O   . GLY C 1 437 ? 128.418 109.282 54.871  1.00 14.38 ? 434  GLY C O   1 
ATOM   10709 N  N   . LYS C 1 438 ? 126.249 109.022 55.368  1.00 14.96 ? 435  LYS C N   1 
ATOM   10710 C  CA  . LYS C 1 438 ? 126.479 109.217 56.794  1.00 14.79 ? 435  LYS C CA  1 
ATOM   10711 C  C   . LYS C 1 438 ? 127.303 108.035 57.317  1.00 15.60 ? 435  LYS C C   1 
ATOM   10712 O  O   . LYS C 1 438 ? 127.021 106.889 56.983  1.00 15.50 ? 435  LYS C O   1 
ATOM   10713 C  CB  . LYS C 1 438 ? 125.150 109.324 57.540  1.00 14.57 ? 435  LYS C CB  1 
ATOM   10714 C  CG  . LYS C 1 438 ? 125.241 109.839 58.975  1.00 17.08 ? 435  LYS C CG  1 
ATOM   10715 C  CD  . LYS C 1 438 ? 123.840 109.954 59.601  1.00 19.66 ? 435  LYS C CD  1 
ATOM   10716 C  CE  . LYS C 1 438 ? 123.840 110.736 60.908  1.00 20.35 ? 435  LYS C CE  1 
ATOM   10717 N  NZ  . LYS C 1 438 ? 124.217 112.168 60.687  1.00 21.46 ? 435  LYS C NZ  1 
ATOM   10718 N  N   . PRO C 1 439 ? 128.338 108.311 58.130  1.00 15.77 ? 436  PRO C N   1 
ATOM   10719 C  CA  . PRO C 1 439 ? 129.167 107.236 58.692  1.00 16.31 ? 436  PRO C CA  1 
ATOM   10720 C  C   . PRO C 1 439 ? 128.347 106.181 59.443  1.00 15.55 ? 436  PRO C C   1 
ATOM   10721 O  O   . PRO C 1 439 ? 127.401 106.524 60.142  1.00 15.24 ? 436  PRO C O   1 
ATOM   10722 C  CB  . PRO C 1 439 ? 130.085 107.974 59.664  1.00 16.80 ? 436  PRO C CB  1 
ATOM   10723 C  CG  . PRO C 1 439 ? 130.163 109.370 59.117  1.00 18.71 ? 436  PRO C CG  1 
ATOM   10724 C  CD  . PRO C 1 439 ? 128.844 109.650 58.477  1.00 16.47 ? 436  PRO C CD  1 
ATOM   10725 N  N   . GLY C 1 440 ? 128.707 104.911 59.287  1.00 15.47 ? 437  GLY C N   1 
ATOM   10726 C  CA  . GLY C 1 440 ? 127.998 103.826 59.953  1.00 15.70 ? 437  GLY C CA  1 
ATOM   10727 C  C   . GLY C 1 440 ? 126.869 103.209 59.134  1.00 15.89 ? 437  GLY C C   1 
ATOM   10728 O  O   . GLY C 1 440 ? 126.395 102.119 59.459  1.00 16.53 ? 437  GLY C O   1 
ATOM   10729 N  N   . PHE C 1 441 ? 126.450 103.874 58.058  1.00 15.37 ? 438  PHE C N   1 
ATOM   10730 C  CA  . PHE C 1 441 ? 125.359 103.359 57.204  1.00 14.44 ? 438  PHE C CA  1 
ATOM   10731 C  C   . PHE C 1 441 ? 125.843 102.847 55.833  1.00 15.30 ? 438  PHE C C   1 
ATOM   10732 O  O   . PHE C 1 441 ? 125.054 102.801 54.867  1.00 15.42 ? 438  PHE C O   1 
ATOM   10733 C  CB  . PHE C 1 441 ? 124.331 104.473 56.980  1.00 14.21 ? 438  PHE C CB  1 
ATOM   10734 C  CG  . PHE C 1 441 ? 123.625 104.915 58.233  1.00 15.24 ? 438  PHE C CG  1 
ATOM   10735 C  CD1 . PHE C 1 441 ? 124.216 105.835 59.102  1.00 15.21 ? 438  PHE C CD1 1 
ATOM   10736 C  CD2 . PHE C 1 441 ? 122.370 104.423 58.542  1.00 16.21 ? 438  PHE C CD2 1 
ATOM   10737 C  CE1 . PHE C 1 441 ? 123.563 106.234 60.290  1.00 17.29 ? 438  PHE C CE1 1 
ATOM   10738 C  CE2 . PHE C 1 441 ? 121.704 104.824 59.715  1.00 17.77 ? 438  PHE C CE2 1 
ATOM   10739 C  CZ  . PHE C 1 441 ? 122.304 105.741 60.586  1.00 16.70 ? 438  PHE C CZ  1 
ATOM   10740 N  N