data_3IKH
# 
_entry.id   3IKH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.338 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3IKH         
RCSB  RCSB054524   
WWPDB D_1000054524 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      3I3Y           'Crystal structure of Ribokinase in Complex with D-Ribose from Klebsiella pneumoniae'                      
unspecified 
PDB      3H49           'Crystal structure of a putative Ribokinase (Apo Form) from E.coli at 1.8A resolution'                     
unspecified 
PDB      3HIC           'THE CRYSTAL STRUCTURE OF PHOSPHOFRUCTOKINASE(Lin2199)FROM Listeria innocua'                               
unspecified 
PDB      3IE7           'The crystal structure of phosphofructokinase (lin2199) from Listeria innocua in complex with ATP at 1.6A' 
unspecified 
TargetDB NYSGXRC-11206l .                                                                                                          
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3IKH 
_pdbx_database_status.recvd_initial_deposition_date   2009-08-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Satyanarayana, L.'                                              1 ?                   
'Burley, S.K.'                                                   2 0000-0002-2487-9713 
'Swaminathan, S.'                                                3 ?                   
'New York SGX Research Center for Structural Genomics (NYSGXRC)' 4 ?                   
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of Ribokinase in Complex with ATP and glycerol in the active site from Klebsiella pneumoniae' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Satyanarayana, L.' 1 ?                   
primary 'Burley, S.K.'      2 0000-0002-2487-9713 
primary 'Swaminathan, S.'   3 ?                   
# 
_cell.entry_id           3IKH 
_cell.length_a           54.332 
_cell.length_b           106.352 
_cell.length_c           122.056 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.51 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3IKH 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Carbohydrate kinase'       32053.193 4   2.7.1.15 ? ? ? 
2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181   4   ?        ? ? ? 
3 non-polymer syn GLYCEROL                    92.094    2   ?        ? ? ? 
4 water       nat water                       18.015    380 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)SLRVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAWIRQQIK
NEPL(MSE)LLPDGHFNQHSDTSIILNSADGDNAIITTTAAADTFSLDE(MSE)IPH(MSE)ADAVAGDILLQQGNFSLD
KTRALFQYARSRG(MSE)TTVFNPSPVNPDFCHLWPLIDIAVVNESEAELLQPYGVKTLVITQGAAGAWLVQEGQRQFCP
AVPAEALDTTGAGDTFLAV(MSE)LASALLRGVAPDALALAHASRAAAITVSRRGTLSAFPGSRELAALLTTDGAEGHHH
HHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSLRVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAWIRQQIKNEPL
MLLPDGHFNQHSDTSIILNSADGDNAIITTTAAADTFSLDEMIPHMADAVAGDILLQQGNFSLDKTRALFQYARSRGMTT
VFNPSPVNPDFCHLWPLIDIAVVNESEAELLQPYGVKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVM
LASALLRGVAPDALALAHASRAAAITVSRRGTLSAFPGSRELAALLTTDGAEGHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         NYSGXRC-11206l 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   SER n 
1 3   LEU n 
1 4   ARG n 
1 5   VAL n 
1 6   TYR n 
1 7   VAL n 
1 8   THR n 
1 9   GLY n 
1 10  ASN n 
1 11  ILE n 
1 12  THR n 
1 13  VAL n 
1 14  ASP n 
1 15  GLU n 
1 16  THR n 
1 17  TRP n 
1 18  SER n 
1 19  ILE n 
1 20  PRO n 
1 21  ASP n 
1 22  ILE n 
1 23  PRO n 
1 24  LYS n 
1 25  LYS n 
1 26  GLY n 
1 27  ALA n 
1 28  SER n 
1 29  ILE n 
1 30  HIS n 
1 31  GLY n 
1 32  VAL n 
1 33  LYS n 
1 34  VAL n 
1 35  SER n 
1 36  GLN n 
1 37  ASP n 
1 38  ILE n 
1 39  GLY n 
1 40  GLY n 
1 41  LYS n 
1 42  GLY n 
1 43  ALA n 
1 44  ASN n 
1 45  GLN n 
1 46  ALA n 
1 47  ILE n 
1 48  ILE n 
1 49  LEU n 
1 50  SER n 
1 51  ARG n 
1 52  CYS n 
1 53  GLY n 
1 54  ILE n 
1 55  GLU n 
1 56  THR n 
1 57  ARG n 
1 58  LEU n 
1 59  ILE n 
1 60  ALA n 
1 61  ALA n 
1 62  THR n 
1 63  GLY n 
1 64  ASN n 
1 65  ASP n 
1 66  SER n 
1 67  ASN n 
1 68  GLY n 
1 69  ALA n 
1 70  TRP n 
1 71  ILE n 
1 72  ARG n 
1 73  GLN n 
1 74  GLN n 
1 75  ILE n 
1 76  LYS n 
1 77  ASN n 
1 78  GLU n 
1 79  PRO n 
1 80  LEU n 
1 81  MSE n 
1 82  LEU n 
1 83  LEU n 
1 84  PRO n 
1 85  ASP n 
1 86  GLY n 
1 87  HIS n 
1 88  PHE n 
1 89  ASN n 
1 90  GLN n 
1 91  HIS n 
1 92  SER n 
1 93  ASP n 
1 94  THR n 
1 95  SER n 
1 96  ILE n 
1 97  ILE n 
1 98  LEU n 
1 99  ASN n 
1 100 SER n 
1 101 ALA n 
1 102 ASP n 
1 103 GLY n 
1 104 ASP n 
1 105 ASN n 
1 106 ALA n 
1 107 ILE n 
1 108 ILE n 
1 109 THR n 
1 110 THR n 
1 111 THR n 
1 112 ALA n 
1 113 ALA n 
1 114 ALA n 
1 115 ASP n 
1 116 THR n 
1 117 PHE n 
1 118 SER n 
1 119 LEU n 
1 120 ASP n 
1 121 GLU n 
1 122 MSE n 
1 123 ILE n 
1 124 PRO n 
1 125 HIS n 
1 126 MSE n 
1 127 ALA n 
1 128 ASP n 
1 129 ALA n 
1 130 VAL n 
1 131 ALA n 
1 132 GLY n 
1 133 ASP n 
1 134 ILE n 
1 135 LEU n 
1 136 LEU n 
1 137 GLN n 
1 138 GLN n 
1 139 GLY n 
1 140 ASN n 
1 141 PHE n 
1 142 SER n 
1 143 LEU n 
1 144 ASP n 
1 145 LYS n 
1 146 THR n 
1 147 ARG n 
1 148 ALA n 
1 149 LEU n 
1 150 PHE n 
1 151 GLN n 
1 152 TYR n 
1 153 ALA n 
1 154 ARG n 
1 155 SER n 
1 156 ARG n 
1 157 GLY n 
1 158 MSE n 
1 159 THR n 
1 160 THR n 
1 161 VAL n 
1 162 PHE n 
1 163 ASN n 
1 164 PRO n 
1 165 SER n 
1 166 PRO n 
1 167 VAL n 
1 168 ASN n 
1 169 PRO n 
1 170 ASP n 
1 171 PHE n 
1 172 CYS n 
1 173 HIS n 
1 174 LEU n 
1 175 TRP n 
1 176 PRO n 
1 177 LEU n 
1 178 ILE n 
1 179 ASP n 
1 180 ILE n 
1 181 ALA n 
1 182 VAL n 
1 183 VAL n 
1 184 ASN n 
1 185 GLU n 
1 186 SER n 
1 187 GLU n 
1 188 ALA n 
1 189 GLU n 
1 190 LEU n 
1 191 LEU n 
1 192 GLN n 
1 193 PRO n 
1 194 TYR n 
1 195 GLY n 
1 196 VAL n 
1 197 LYS n 
1 198 THR n 
1 199 LEU n 
1 200 VAL n 
1 201 ILE n 
1 202 THR n 
1 203 GLN n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 GLY n 
1 208 ALA n 
1 209 TRP n 
1 210 LEU n 
1 211 VAL n 
1 212 GLN n 
1 213 GLU n 
1 214 GLY n 
1 215 GLN n 
1 216 ARG n 
1 217 GLN n 
1 218 PHE n 
1 219 CYS n 
1 220 PRO n 
1 221 ALA n 
1 222 VAL n 
1 223 PRO n 
1 224 ALA n 
1 225 GLU n 
1 226 ALA n 
1 227 LEU n 
1 228 ASP n 
1 229 THR n 
1 230 THR n 
1 231 GLY n 
1 232 ALA n 
1 233 GLY n 
1 234 ASP n 
1 235 THR n 
1 236 PHE n 
1 237 LEU n 
1 238 ALA n 
1 239 VAL n 
1 240 MSE n 
1 241 LEU n 
1 242 ALA n 
1 243 SER n 
1 244 ALA n 
1 245 LEU n 
1 246 LEU n 
1 247 ARG n 
1 248 GLY n 
1 249 VAL n 
1 250 ALA n 
1 251 PRO n 
1 252 ASP n 
1 253 ALA n 
1 254 LEU n 
1 255 ALA n 
1 256 LEU n 
1 257 ALA n 
1 258 HIS n 
1 259 ALA n 
1 260 SER n 
1 261 ARG n 
1 262 ALA n 
1 263 ALA n 
1 264 ALA n 
1 265 ILE n 
1 266 THR n 
1 267 VAL n 
1 268 SER n 
1 269 ARG n 
1 270 ARG n 
1 271 GLY n 
1 272 THR n 
1 273 LEU n 
1 274 SER n 
1 275 ALA n 
1 276 PHE n 
1 277 PRO n 
1 278 GLY n 
1 279 SER n 
1 280 ARG n 
1 281 GLU n 
1 282 LEU n 
1 283 ALA n 
1 284 ALA n 
1 285 LEU n 
1 286 LEU n 
1 287 THR n 
1 288 THR n 
1 289 ASP n 
1 290 GLY n 
1 291 ALA n 
1 292 GLU n 
1 293 GLY n 
1 294 HIS n 
1 295 HIS n 
1 296 HIS n 
1 297 HIS n 
1 298 HIS n 
1 299 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KPN78578_16990, KPN78578_16990/5340552, KPN_01729' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC700721/MGH78578)' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'Top10 (Invitrogen)' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Klebsiella pneumoniae subsp. pneumoniae MGH 78578' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     272620 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) Codon + RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pSGX3 (BC)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A6T989_KLEP7 
_struct_ref.pdbx_db_accession          A6T989 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAWIRQQIKNEPLMLL
PDGHFNQHSDTSIILNSADGDNAIITTTAAADTFSLDEMIPHMADAVAGDILLQQGNFSLDKTRALFQYARSRGMTTVFN
PSPVNPDFCHLWPLIDIAVVNESEAELLQPYGVKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVMLAS
ALLRGVAPDALALAHASRAAAITVSRRGTLSAFPGSRELAALLTTDGA
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3IKH A 4 ? 291 ? A6T989 2 ? 289 ? 2 289 
2 1 3IKH B 4 ? 291 ? A6T989 2 ? 289 ? 2 289 
3 1 3IKH C 4 ? 291 ? A6T989 2 ? 289 ? 2 289 
4 1 3IKH D 4 ? 291 ? A6T989 2 ? 289 ? 2 289 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3IKH MSE A 1   ? UNP A6T989 ? ? 'expression tag' -3  1  
1 3IKH SER A 2   ? UNP A6T989 ? ? 'expression tag' -2  2  
1 3IKH LEU A 3   ? UNP A6T989 ? ? 'expression tag' -1  3  
1 3IKH GLU A 292 ? UNP A6T989 ? ? 'expression tag' 290 4  
1 3IKH GLY A 293 ? UNP A6T989 ? ? 'expression tag' 291 5  
1 3IKH HIS A 294 ? UNP A6T989 ? ? 'expression tag' 292 6  
1 3IKH HIS A 295 ? UNP A6T989 ? ? 'expression tag' 293 7  
1 3IKH HIS A 296 ? UNP A6T989 ? ? 'expression tag' 294 8  
1 3IKH HIS A 297 ? UNP A6T989 ? ? 'expression tag' 295 9  
1 3IKH HIS A 298 ? UNP A6T989 ? ? 'expression tag' 296 10 
1 3IKH HIS A 299 ? UNP A6T989 ? ? 'expression tag' 297 11 
2 3IKH MSE B 1   ? UNP A6T989 ? ? 'expression tag' -3  12 
2 3IKH SER B 2   ? UNP A6T989 ? ? 'expression tag' -2  13 
2 3IKH LEU B 3   ? UNP A6T989 ? ? 'expression tag' -1  14 
2 3IKH GLU B 292 ? UNP A6T989 ? ? 'expression tag' 290 15 
2 3IKH GLY B 293 ? UNP A6T989 ? ? 'expression tag' 291 16 
2 3IKH HIS B 294 ? UNP A6T989 ? ? 'expression tag' 292 17 
2 3IKH HIS B 295 ? UNP A6T989 ? ? 'expression tag' 293 18 
2 3IKH HIS B 296 ? UNP A6T989 ? ? 'expression tag' 294 19 
2 3IKH HIS B 297 ? UNP A6T989 ? ? 'expression tag' 295 20 
2 3IKH HIS B 298 ? UNP A6T989 ? ? 'expression tag' 296 21 
2 3IKH HIS B 299 ? UNP A6T989 ? ? 'expression tag' 297 22 
3 3IKH MSE C 1   ? UNP A6T989 ? ? 'expression tag' -3  23 
3 3IKH SER C 2   ? UNP A6T989 ? ? 'expression tag' -2  24 
3 3IKH LEU C 3   ? UNP A6T989 ? ? 'expression tag' -1  25 
3 3IKH GLU C 292 ? UNP A6T989 ? ? 'expression tag' 290 26 
3 3IKH GLY C 293 ? UNP A6T989 ? ? 'expression tag' 291 27 
3 3IKH HIS C 294 ? UNP A6T989 ? ? 'expression tag' 292 28 
3 3IKH HIS C 295 ? UNP A6T989 ? ? 'expression tag' 293 29 
3 3IKH HIS C 296 ? UNP A6T989 ? ? 'expression tag' 294 30 
3 3IKH HIS C 297 ? UNP A6T989 ? ? 'expression tag' 295 31 
3 3IKH HIS C 298 ? UNP A6T989 ? ? 'expression tag' 296 32 
3 3IKH HIS C 299 ? UNP A6T989 ? ? 'expression tag' 297 33 
4 3IKH MSE D 1   ? UNP A6T989 ? ? 'expression tag' -3  34 
4 3IKH SER D 2   ? UNP A6T989 ? ? 'expression tag' -2  35 
4 3IKH LEU D 3   ? UNP A6T989 ? ? 'expression tag' -1  36 
4 3IKH GLU D 292 ? UNP A6T989 ? ? 'expression tag' 290 37 
4 3IKH GLY D 293 ? UNP A6T989 ? ? 'expression tag' 291 38 
4 3IKH HIS D 294 ? UNP A6T989 ? ? 'expression tag' 292 39 
4 3IKH HIS D 295 ? UNP A6T989 ? ? 'expression tag' 293 40 
4 3IKH HIS D 296 ? UNP A6T989 ? ? 'expression tag' 294 41 
4 3IKH HIS D 297 ? UNP A6T989 ? ? 'expression tag' 295 42 
4 3IKH HIS D 298 ? UNP A6T989 ? ? 'expression tag' 296 43 
4 3IKH HIS D 299 ? UNP A6T989 ? ? 'expression tag' 297 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                               'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ?                               'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ?                               'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                    'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                   ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ?                               'C6 H15 N2 O2 1'    147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE            ?                               'C5 H11 N O2 Se'    196.106 
PHE 'L-peptide linking' y PHENYLALANINE               ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3IKH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.71 
_exptl_crystal.density_percent_sol   54.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;0.2M LITHIUM SULFATE MONO HYDRATE, 
0.1M HEPES PH 7.5,  
20%PEG 3,350, VAPOR DIFFUSION, SITTING DROP, temperature 292K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-07-16 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
# 
_reflns.entry_id                     3IKH 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.88 
_reflns.number_obs                   110843 
_reflns.number_all                   110843 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.085 
_reflns.pdbx_netI_over_sigmaI        13.0 
_reflns.B_iso_Wilson_estimate        21.3 
_reflns.pdbx_redundancy              7.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.88 
_reflns_shell.d_res_low              1.95 
_reflns_shell.percent_possible_all   98.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.49 
_reflns_shell.meanI_over_sigI_obs    8.3 
_reflns_shell.pdbx_redundancy        6.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      11075 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3IKH 
_refine.ls_number_reflns_obs                     106135 
_refine.ls_number_reflns_all                     106135 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.54 
_refine.ls_d_res_high                            1.88 
_refine.ls_percent_reflns_obs                    95.3 
_refine.ls_R_factor_obs                          0.220 
_refine.ls_R_factor_all                          0.235 
_refine.ls_R_factor_R_work                       0.220 
_refine.ls_R_factor_R_free                       0.240 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  4275 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               32.7 
_refine.aniso_B[1][1]                            -4.90 
_refine.aniso_B[2][2]                            7.10 
_refine.aniso_B[3][3]                            -2.20 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.39 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3I3Y 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3IKH 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8484 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         136 
_refine_hist.number_atoms_solvent             380 
_refine_hist.number_atoms_total               9000 
_refine_hist.d_res_high                       1.88 
_refine_hist.d_res_low                        37.54 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg          1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d             0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_deg 0.83  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_deg 23.9  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.88 
_refine_ls_shell.d_res_low                        1.99 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.289 
_refine_ls_shell.percent_reflns_obs               78.1 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.R_factor_R_free_error            0.013 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             562 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                14019 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3IKH 
_struct.title                     
'Crystal structure of Ribokinase in Complex with ATP and glycerol in the active site from Klebsiella pneumoniae' 
_struct.pdbx_descriptor           'Carbohydrate kinase (E.C.2.7.1.15)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3IKH 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;TRANSFERASE, KINASE, SAD, RIBOSE, D-RIBOSE METABOLIC PROCESS, ATP, RIBOKINASE, PFKB FAMILY, 11206L1, PSI-II, NYSGXRC, STRUCTURAL GENOMICS, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 40  ? CYS A 52  ? GLY A 38  CYS A 50  1 ? 13 
HELX_P HELX_P2  2  ASP A 65  ? ILE A 75  ? ASP A 63  ILE A 73  1 ? 11 
HELX_P HELX_P3  3  LYS A 76  ? GLU A 78  ? LYS A 74  GLU A 76  5 ? 3  
HELX_P HELX_P4  4  THR A 111 ? PHE A 117 ? THR A 109 PHE A 115 1 ? 7  
HELX_P HELX_P5  5  SER A 118 ? ILE A 123 ? SER A 116 ILE A 121 1 ? 6  
HELX_P HELX_P6  6  PRO A 124 ? ALA A 127 ? PRO A 122 ALA A 125 5 ? 4  
HELX_P HELX_P7  7  SER A 142 ? ARG A 156 ? SER A 140 ARG A 154 1 ? 15 
HELX_P HELX_P8  8  ASN A 168 ? ILE A 178 ? ASN A 166 ILE A 176 5 ? 11 
HELX_P HELX_P9  9  GLU A 185 ? GLN A 192 ? GLU A 183 GLN A 190 1 ? 8  
HELX_P HELX_P10 10 GLY A 204 ? ALA A 206 ? GLY A 202 ALA A 204 5 ? 3  
HELX_P HELX_P11 11 GLY A 231 ? ARG A 247 ? GLY A 229 ARG A 245 1 ? 17 
HELX_P HELX_P12 12 ASP A 252 ? ARG A 269 ? ASP A 250 ARG A 267 1 ? 18 
HELX_P HELX_P13 13 GLY A 278 ? THR A 287 ? GLY A 276 THR A 285 1 ? 10 
HELX_P HELX_P14 14 GLY B 40  ? CYS B 52  ? GLY B 38  CYS B 50  1 ? 13 
HELX_P HELX_P15 15 ASP B 65  ? ILE B 75  ? ASP B 63  ILE B 73  1 ? 11 
HELX_P HELX_P16 16 LYS B 76  ? GLU B 78  ? LYS B 74  GLU B 76  5 ? 3  
HELX_P HELX_P17 17 THR B 111 ? THR B 116 ? THR B 109 THR B 114 1 ? 6  
HELX_P HELX_P18 18 SER B 118 ? ILE B 123 ? SER B 116 ILE B 121 1 ? 6  
HELX_P HELX_P19 19 PRO B 124 ? ALA B 127 ? PRO B 122 ALA B 125 5 ? 4  
HELX_P HELX_P20 20 SER B 142 ? ARG B 156 ? SER B 140 ARG B 154 1 ? 15 
HELX_P HELX_P21 21 ASN B 168 ? ILE B 178 ? ASN B 166 ILE B 176 5 ? 11 
HELX_P HELX_P22 22 GLU B 185 ? GLN B 192 ? GLU B 183 GLN B 190 1 ? 8  
HELX_P HELX_P23 23 GLY B 231 ? ARG B 247 ? GLY B 229 ARG B 245 1 ? 17 
HELX_P HELX_P24 24 ASP B 252 ? SER B 268 ? ASP B 250 SER B 266 1 ? 17 
HELX_P HELX_P25 25 THR B 272 ? PHE B 276 ? THR B 270 PHE B 274 5 ? 5  
HELX_P HELX_P26 26 GLY B 278 ? THR B 287 ? GLY B 276 THR B 285 1 ? 10 
HELX_P HELX_P27 27 GLY C 40  ? CYS C 52  ? GLY C 38  CYS C 50  1 ? 13 
HELX_P HELX_P28 28 ASP C 65  ? ASN C 77  ? ASP C 63  ASN C 75  1 ? 13 
HELX_P HELX_P29 29 THR C 111 ? PHE C 117 ? THR C 109 PHE C 115 1 ? 7  
HELX_P HELX_P30 30 SER C 118 ? ILE C 123 ? SER C 116 ILE C 121 1 ? 6  
HELX_P HELX_P31 31 PRO C 124 ? ALA C 127 ? PRO C 122 ALA C 125 5 ? 4  
HELX_P HELX_P32 32 SER C 142 ? ARG C 156 ? SER C 140 ARG C 154 1 ? 15 
HELX_P HELX_P33 33 ASN C 168 ? ILE C 178 ? ASN C 166 ILE C 176 5 ? 11 
HELX_P HELX_P34 34 GLU C 185 ? GLN C 192 ? GLU C 183 GLN C 190 1 ? 8  
HELX_P HELX_P35 35 GLY C 204 ? ALA C 206 ? GLY C 202 ALA C 204 5 ? 3  
HELX_P HELX_P36 36 GLY C 231 ? GLY C 248 ? GLY C 229 GLY C 246 1 ? 18 
HELX_P HELX_P37 37 ASP C 252 ? ARG C 269 ? ASP C 250 ARG C 267 1 ? 18 
HELX_P HELX_P38 38 THR C 272 ? PHE C 276 ? THR C 270 PHE C 274 5 ? 5  
HELX_P HELX_P39 39 GLY C 278 ? THR C 287 ? GLY C 276 THR C 285 1 ? 10 
HELX_P HELX_P40 40 GLY D 40  ? CYS D 52  ? GLY D 38  CYS D 50  1 ? 13 
HELX_P HELX_P41 41 ASP D 65  ? ASN D 77  ? ASP D 63  ASN D 75  1 ? 13 
HELX_P HELX_P42 42 THR D 111 ? SER D 118 ? THR D 109 SER D 116 1 ? 8  
HELX_P HELX_P43 43 SER D 118 ? ILE D 123 ? SER D 116 ILE D 121 1 ? 6  
HELX_P HELX_P44 44 PRO D 124 ? ALA D 127 ? PRO D 122 ALA D 125 5 ? 4  
HELX_P HELX_P45 45 SER D 142 ? ARG D 154 ? SER D 140 ARG D 152 1 ? 13 
HELX_P HELX_P46 46 ASN D 168 ? ILE D 178 ? ASN D 166 ILE D 176 5 ? 11 
HELX_P HELX_P47 47 GLU D 185 ? GLN D 192 ? GLU D 183 GLN D 190 1 ? 8  
HELX_P HELX_P48 48 GLY D 204 ? ALA D 206 ? GLY D 202 ALA D 204 5 ? 3  
HELX_P HELX_P49 49 GLY D 231 ? ARG D 247 ? GLY D 229 ARG D 245 1 ? 17 
HELX_P HELX_P50 50 ASP D 252 ? SER D 268 ? ASP D 250 SER D 266 1 ? 17 
HELX_P HELX_P51 51 THR D 272 ? PHE D 276 ? THR D 270 PHE D 274 5 ? 5  
HELX_P HELX_P52 52 GLY D 278 ? THR D 287 ? GLY D 276 THR D 285 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A LEU 80  C ? ? ? 1_555 A MSE 81  N ? ? A LEU 78  A MSE 79  1_555 ? ? ? ? ? ? ? 1.322 ? ? 
covale2  covale both ? A MSE 81  C ? ? ? 1_555 A LEU 82  N ? ? A MSE 79  A LEU 80  1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale3  covale both ? A GLU 121 C ? ? ? 1_555 A MSE 122 N ? ? A GLU 119 A MSE 120 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale4  covale both ? A MSE 122 C ? ? ? 1_555 A ILE 123 N ? ? A MSE 120 A ILE 121 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale5  covale both ? A HIS 125 C ? ? ? 1_555 A MSE 126 N ? ? A HIS 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale6  covale both ? A MSE 126 C ? ? ? 1_555 A ALA 127 N ? ? A MSE 124 A ALA 125 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale7  covale both ? A GLY 157 C ? ? ? 1_555 A MSE 158 N ? ? A GLY 155 A MSE 156 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale8  covale both ? A MSE 158 C ? ? ? 1_555 A THR 159 N ? ? A MSE 156 A THR 157 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale9  covale both ? A VAL 239 C ? ? ? 1_555 A MSE 240 N ? ? A VAL 237 A MSE 238 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale10 covale both ? A MSE 240 C ? ? ? 1_555 A LEU 241 N ? ? A MSE 238 A LEU 239 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale11 covale both ? B LEU 80  C ? ? ? 1_555 B MSE 81  N ? ? B LEU 78  B MSE 79  1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale12 covale both ? B MSE 81  C ? ? ? 1_555 B LEU 82  N ? ? B MSE 79  B LEU 80  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale13 covale both ? B GLU 121 C ? ? ? 1_555 B MSE 122 N ? ? B GLU 119 B MSE 120 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale14 covale both ? B MSE 122 C ? ? ? 1_555 B ILE 123 N ? ? B MSE 120 B ILE 121 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale15 covale both ? B HIS 125 C ? ? ? 1_555 B MSE 126 N ? ? B HIS 123 B MSE 124 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale16 covale both ? B MSE 126 C ? ? ? 1_555 B ALA 127 N ? ? B MSE 124 B ALA 125 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale17 covale both ? B GLY 157 C ? ? ? 1_555 B MSE 158 N ? ? B GLY 155 B MSE 156 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale18 covale both ? B MSE 158 C ? ? ? 1_555 B THR 159 N ? ? B MSE 156 B THR 157 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale19 covale both ? B VAL 239 C ? ? ? 1_555 B MSE 240 N ? ? B VAL 237 B MSE 238 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale20 covale both ? B MSE 240 C ? ? ? 1_555 B LEU 241 N ? ? B MSE 238 B LEU 239 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale21 covale both ? C LEU 80  C ? ? ? 1_555 C MSE 81  N ? ? C LEU 78  C MSE 79  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale22 covale both ? C MSE 81  C ? ? ? 1_555 C LEU 82  N ? ? C MSE 79  C LEU 80  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale23 covale both ? C GLU 121 C ? ? ? 1_555 C MSE 122 N ? ? C GLU 119 C MSE 120 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale24 covale both ? C MSE 122 C ? ? ? 1_555 C ILE 123 N ? ? C MSE 120 C ILE 121 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale25 covale both ? C HIS 125 C ? ? ? 1_555 C MSE 126 N ? ? C HIS 123 C MSE 124 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale26 covale both ? C MSE 126 C ? ? ? 1_555 C ALA 127 N ? ? C MSE 124 C ALA 125 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale27 covale both ? C GLY 157 C ? ? ? 1_555 C MSE 158 N ? ? C GLY 155 C MSE 156 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale28 covale both ? C MSE 158 C ? ? ? 1_555 C THR 159 N ? ? C MSE 156 C THR 157 1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale29 covale both ? C VAL 239 C ? ? ? 1_555 C MSE 240 N ? ? C VAL 237 C MSE 238 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale30 covale both ? C MSE 240 C ? ? ? 1_555 C LEU 241 N ? ? C MSE 238 C LEU 239 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale31 covale both ? D LEU 80  C ? ? ? 1_555 D MSE 81  N ? ? D LEU 78  D MSE 79  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale32 covale both ? D MSE 81  C ? ? ? 1_555 D LEU 82  N ? ? D MSE 79  D LEU 80  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale33 covale both ? D GLU 121 C ? ? ? 1_555 D MSE 122 N ? ? D GLU 119 D MSE 120 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale34 covale both ? D MSE 122 C ? ? ? 1_555 D ILE 123 N ? ? D MSE 120 D ILE 121 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale35 covale both ? D HIS 125 C ? ? ? 1_555 D MSE 126 N ? ? D HIS 123 D MSE 124 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale36 covale both ? D MSE 126 C ? ? ? 1_555 D ALA 127 N ? ? D MSE 124 D ALA 125 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale37 covale both ? D GLY 157 C ? ? ? 1_555 D MSE 158 N ? ? D GLY 155 D MSE 156 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale38 covale both ? D MSE 158 C ? ? ? 1_555 D THR 159 N ? ? D MSE 156 D THR 157 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale39 covale both ? D VAL 239 C ? ? ? 1_555 D MSE 240 N ? ? D VAL 237 D MSE 238 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale40 covale both ? D MSE 240 C ? ? ? 1_555 D LEU 241 N ? ? D MSE 238 D LEU 239 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 83  A . ? LEU 81  A PRO 84  A ? PRO 82  A 1 -0.09 
2 SER 165 A . ? SER 163 A PRO 166 A ? PRO 164 A 1 0.13  
3 LEU 83  B . ? LEU 81  B PRO 84  B ? PRO 82  B 1 0.17  
4 SER 165 B . ? SER 163 B PRO 166 B ? PRO 164 B 1 0.15  
5 LEU 83  C . ? LEU 81  C PRO 84  C ? PRO 82  C 1 -0.15 
6 SER 165 C . ? SER 163 C PRO 166 C ? PRO 164 C 1 -0.19 
7 GLU 78  D . ? GLU 76  D PRO 79  D ? PRO 77  D 1 0.05  
8 LEU 83  D . ? LEU 81  D PRO 84  D ? PRO 82  D 1 0.09  
9 SER 165 D . ? SER 163 D PRO 166 D ? PRO 164 D 1 -0.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 5 ? 
C ? 5 ? 
D ? 9 ? 
E ? 9 ? 
F ? 9 ? 
G ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? anti-parallel 
D 8 9 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
E 7 8 ? parallel      
E 8 9 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? parallel      
F 7 8 ? anti-parallel 
F 8 9 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
G 7 8 ? anti-parallel 
G 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MSE A 81  ? LEU A 83  ? MSE A 79  LEU A 81  
A 2 THR A 56  ? ILE A 59  ? THR A 54  ILE A 57  
A 3 VAL A 5   ? THR A 8   ? VAL A 3   THR A 6   
A 4 ILE A 134 ? GLN A 137 ? ILE A 132 GLN A 135 
A 5 THR A 159 ? PHE A 162 ? THR A 157 PHE A 160 
A 6 ILE A 180 ? ASN A 184 ? ILE A 178 ASN A 182 
A 7 THR A 198 ? THR A 202 ? THR A 196 THR A 200 
A 8 ALA A 208 ? VAL A 211 ? ALA A 206 VAL A 209 
A 9 ARG A 216 ? CYS A 219 ? ARG A 214 CYS A 217 
B 1 VAL A 32  ? GLY A 39  ? VAL A 30  GLY A 37  
B 2 THR A 12  ? SER A 18  ? THR A 10  SER A 16  
B 3 ASP A 93  ? LEU A 98  ? ASP A 91  LEU A 96  
B 4 ALA A 106 ? THR A 110 ? ALA A 104 THR A 108 
B 5 SER C 28  ? HIS C 30  ? SER C 26  HIS C 28  
C 1 SER A 28  ? HIS A 30  ? SER A 26  HIS A 28  
C 2 ALA C 106 ? THR C 109 ? ALA C 104 THR C 107 
C 3 THR C 94  ? SER C 100 ? THR C 92  SER C 98  
C 4 THR C 12  ? ILE C 19  ? THR C 10  ILE C 17  
C 5 VAL C 32  ? GLY C 39  ? VAL C 30  GLY C 37  
D 1 MSE B 81  ? LEU B 83  ? MSE B 79  LEU B 81  
D 2 THR B 56  ? ILE B 59  ? THR B 54  ILE B 57  
D 3 VAL B 5   ? THR B 8   ? VAL B 3   THR B 6   
D 4 ILE B 134 ? GLN B 137 ? ILE B 132 GLN B 135 
D 5 THR B 159 ? PHE B 162 ? THR B 157 PHE B 160 
D 6 ILE B 180 ? ASN B 184 ? ILE B 178 ASN B 182 
D 7 THR B 198 ? THR B 202 ? THR B 196 THR B 200 
D 8 GLY B 207 ? GLN B 212 ? GLY B 205 GLN B 210 
D 9 GLN B 215 ? PRO B 220 ? GLN B 213 PRO B 218 
E 1 SER D 28  ? HIS D 30  ? SER D 26  HIS D 28  
E 2 ALA B 106 ? THR B 109 ? ALA B 104 THR B 107 
E 3 ASP B 93  ? LEU B 98  ? ASP B 91  LEU B 96  
E 4 THR B 12  ? SER B 18  ? THR B 10  SER B 16  
E 5 SER B 28  ? GLY B 39  ? SER B 26  GLY B 37  
E 6 ALA D 106 ? THR D 110 ? ALA D 104 THR D 108 
E 7 THR D 94  ? ASN D 99  ? THR D 92  ASN D 97  
E 8 THR D 12  ? SER D 18  ? THR D 10  SER D 16  
E 9 VAL D 32  ? GLY D 39  ? VAL D 30  GLY D 37  
F 1 MSE C 81  ? LEU C 83  ? MSE C 79  LEU C 81  
F 2 THR C 56  ? ILE C 59  ? THR C 54  ILE C 57  
F 3 VAL C 5   ? THR C 8   ? VAL C 3   THR C 6   
F 4 ILE C 134 ? GLN C 137 ? ILE C 132 GLN C 135 
F 5 THR C 159 ? PHE C 162 ? THR C 157 PHE C 160 
F 6 ILE C 180 ? ASN C 184 ? ILE C 178 ASN C 182 
F 7 THR C 198 ? THR C 202 ? THR C 196 THR C 200 
F 8 ALA C 208 ? GLN C 212 ? ALA C 206 GLN C 210 
F 9 GLN C 215 ? CYS C 219 ? GLN C 213 CYS C 217 
G 1 MSE D 81  ? LEU D 83  ? MSE D 79  LEU D 81  
G 2 THR D 56  ? ILE D 59  ? THR D 54  ILE D 57  
G 3 VAL D 5   ? THR D 8   ? VAL D 3   THR D 6   
G 4 ILE D 134 ? GLN D 137 ? ILE D 132 GLN D 135 
G 5 THR D 159 ? PHE D 162 ? THR D 157 PHE D 160 
G 6 ILE D 180 ? ASN D 184 ? ILE D 178 ASN D 182 
G 7 THR D 198 ? THR D 202 ? THR D 196 THR D 200 
G 8 ALA D 208 ? VAL D 211 ? ALA D 206 VAL D 209 
G 9 ARG D 216 ? CYS D 219 ? ARG D 214 CYS D 217 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 83  ? O LEU A 81  N LEU A 58  ? N LEU A 56  
A 2 3 O ILE A 59  ? O ILE A 57  N VAL A 7   ? N VAL A 5   
A 3 4 N TYR A 6   ? N TYR A 4   O ILE A 134 ? O ILE A 132 
A 4 5 N LEU A 135 ? N LEU A 133 O THR A 159 ? O THR A 157 
A 5 6 N PHE A 162 ? N PHE A 160 O ILE A 180 ? O ILE A 178 
A 6 7 N VAL A 183 ? N VAL A 181 O THR A 202 ? O THR A 200 
A 7 8 N LEU A 199 ? N LEU A 197 O VAL A 211 ? O VAL A 209 
A 8 9 N LEU A 210 ? N LEU A 208 O GLN A 217 ? O GLN A 215 
B 1 2 O ASP A 37  ? O ASP A 35  N ASP A 14  ? N ASP A 12  
B 2 3 N GLU A 15  ? N GLU A 13  O ILE A 96  ? O ILE A 94  
B 3 4 N ILE A 97  ? N ILE A 95  O ALA A 106 ? O ALA A 104 
B 4 5 N ILE A 107 ? N ILE A 105 O ILE C 29  ? O ILE C 27  
C 1 2 N ILE A 29  ? N ILE A 27  O ILE C 107 ? O ILE C 105 
C 2 3 O ALA C 106 ? O ALA C 104 N LEU C 98  ? N LEU C 96  
C 3 4 O ASN C 99  ? O ASN C 97  N TRP C 17  ? N TRP C 15  
C 4 5 N ASP C 14  ? N ASP C 12  O ASP C 37  ? O ASP C 35  
D 1 2 O MSE B 81  ? O MSE B 79  N LEU B 58  ? N LEU B 56  
D 2 3 O ILE B 59  ? O ILE B 57  N VAL B 7   ? N VAL B 5   
D 3 4 N TYR B 6   ? N TYR B 4   O ILE B 134 ? O ILE B 132 
D 4 5 N LEU B 135 ? N LEU B 133 O THR B 159 ? O THR B 157 
D 5 6 N PHE B 162 ? N PHE B 160 O ILE B 180 ? O ILE B 178 
D 6 7 N ALA B 181 ? N ALA B 179 O THR B 198 ? O THR B 196 
D 7 8 N LEU B 199 ? N LEU B 197 O VAL B 211 ? O VAL B 209 
D 8 9 N ALA B 208 ? N ALA B 206 O CYS B 219 ? O CYS B 217 
E 1 2 O ILE D 29  ? O ILE D 27  N ILE B 107 ? N ILE B 105 
E 2 3 O ALA B 106 ? O ALA B 104 N ILE B 97  ? N ILE B 95  
E 3 4 O ILE B 96  ? O ILE B 94  N GLU B 15  ? N GLU B 13  
E 4 5 N ASP B 14  ? N ASP B 12  O ASP B 37  ? O ASP B 35  
E 5 6 N ILE B 29  ? N ILE B 27  O ILE D 107 ? O ILE D 105 
E 6 7 O ILE D 108 ? O ILE D 106 N ILE D 96  ? N ILE D 94  
E 7 8 O ILE D 97  ? O ILE D 95  N GLU D 15  ? N GLU D 13  
E 8 9 N ASP D 14  ? N ASP D 12  O ASP D 37  ? O ASP D 35  
F 1 2 O LEU C 83  ? O LEU C 81  N LEU C 58  ? N LEU C 56  
F 2 3 O ILE C 59  ? O ILE C 57  N VAL C 7   ? N VAL C 5   
F 3 4 N TYR C 6   ? N TYR C 4   O ILE C 134 ? O ILE C 132 
F 4 5 N LEU C 135 ? N LEU C 133 O THR C 159 ? O THR C 157 
F 5 6 N PHE C 162 ? N PHE C 160 O ILE C 180 ? O ILE C 178 
F 6 7 N VAL C 183 ? N VAL C 181 O VAL C 200 ? O VAL C 198 
F 7 8 N LEU C 199 ? N LEU C 197 O VAL C 211 ? O VAL C 209 
F 8 9 N ALA C 208 ? N ALA C 206 O CYS C 219 ? O CYS C 217 
G 1 2 O LEU D 83  ? O LEU D 81  N LEU D 58  ? N LEU D 56  
G 2 3 O ILE D 59  ? O ILE D 57  N VAL D 7   ? N VAL D 5   
G 3 4 N TYR D 6   ? N TYR D 4   O ILE D 134 ? O ILE D 132 
G 4 5 N LEU D 135 ? N LEU D 133 O THR D 159 ? O THR D 157 
G 5 6 N PHE D 162 ? N PHE D 160 O ILE D 180 ? O ILE D 178 
G 6 7 N VAL D 183 ? N VAL D 181 O THR D 202 ? O THR D 200 
G 7 8 N LEU D 199 ? N LEU D 197 O VAL D 211 ? O VAL D 209 
G 8 9 N ALA D 208 ? N ALA D 206 O CYS D 219 ? O CYS D 217 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ATP 900 ? 14 'BINDING SITE FOR RESIDUE ATP A 900' 
AC2 Software B ATP 900 ? 23 'BINDING SITE FOR RESIDUE ATP B 900' 
AC3 Software C ATP 900 ? 23 'BINDING SITE FOR RESIDUE ATP C 900' 
AC4 Software C GOL 501 ? 8  'BINDING SITE FOR RESIDUE GOL C 501' 
AC5 Software D ATP 900 ? 20 'BINDING SITE FOR RESIDUE ATP D 900' 
AC6 Software D GOL 501 ? 7  'BINDING SITE FOR RESIDUE GOL D 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 ASN A 184 ? ASN A 182 . ? 1_555 ? 
2  AC1 14 THR A 202 ? THR A 200 . ? 1_555 ? 
3  AC1 14 GLY A 204 ? GLY A 202 . ? 1_555 ? 
4  AC1 14 GLY A 207 ? GLY A 205 . ? 1_555 ? 
5  AC1 14 VAL A 222 ? VAL A 220 . ? 1_555 ? 
6  AC1 14 GLY A 233 ? GLY A 231 . ? 1_555 ? 
7  AC1 14 PHE A 236 ? PHE A 234 . ? 1_555 ? 
8  AC1 14 ALA A 263 ? ALA A 261 . ? 1_555 ? 
9  AC1 14 HOH K .   ? HOH A 306 . ? 1_555 ? 
10 AC1 14 HOH K .   ? HOH A 328 . ? 1_555 ? 
11 AC1 14 HOH K .   ? HOH A 331 . ? 1_555 ? 
12 AC1 14 HOH K .   ? HOH A 346 . ? 1_555 ? 
13 AC1 14 HOH K .   ? HOH A 360 . ? 1_555 ? 
14 AC1 14 HOH K .   ? HOH A 390 . ? 1_555 ? 
15 AC2 23 LYS B 41  ? LYS B 39  . ? 1_555 ? 
16 AC2 23 ASN B 184 ? ASN B 182 . ? 1_555 ? 
17 AC2 23 THR B 202 ? THR B 200 . ? 1_555 ? 
18 AC2 23 GLN B 203 ? GLN B 201 . ? 1_555 ? 
19 AC2 23 GLY B 204 ? GLY B 202 . ? 1_555 ? 
20 AC2 23 ALA B 205 ? ALA B 203 . ? 1_555 ? 
21 AC2 23 GLY B 207 ? GLY B 205 . ? 1_555 ? 
22 AC2 23 VAL B 222 ? VAL B 220 . ? 1_555 ? 
23 AC2 23 ALA B 232 ? ALA B 230 . ? 1_555 ? 
24 AC2 23 GLY B 233 ? GLY B 231 . ? 1_555 ? 
25 AC2 23 PHE B 236 ? PHE B 234 . ? 1_555 ? 
26 AC2 23 ALA B 263 ? ALA B 261 . ? 1_555 ? 
27 AC2 23 HOH L .   ? HOH B 302 . ? 1_555 ? 
28 AC2 23 HOH L .   ? HOH B 308 . ? 1_555 ? 
29 AC2 23 HOH L .   ? HOH B 311 . ? 1_555 ? 
30 AC2 23 HOH L .   ? HOH B 317 . ? 1_555 ? 
31 AC2 23 HOH L .   ? HOH B 319 . ? 1_555 ? 
32 AC2 23 HOH L .   ? HOH B 324 . ? 1_555 ? 
33 AC2 23 HOH L .   ? HOH B 344 . ? 1_555 ? 
34 AC2 23 HOH L .   ? HOH B 358 . ? 1_555 ? 
35 AC2 23 HOH L .   ? HOH B 370 . ? 1_555 ? 
36 AC2 23 HOH L .   ? HOH B 375 . ? 1_555 ? 
37 AC2 23 HOH L .   ? HOH B 395 . ? 1_555 ? 
38 AC3 23 ASN C 184 ? ASN C 182 . ? 1_555 ? 
39 AC3 23 THR C 202 ? THR C 200 . ? 1_555 ? 
40 AC3 23 GLN C 203 ? GLN C 201 . ? 1_555 ? 
41 AC3 23 GLY C 204 ? GLY C 202 . ? 1_555 ? 
42 AC3 23 ALA C 205 ? ALA C 203 . ? 1_555 ? 
43 AC3 23 GLY C 207 ? GLY C 205 . ? 1_555 ? 
44 AC3 23 VAL C 222 ? VAL C 220 . ? 1_555 ? 
45 AC3 23 GLY C 231 ? GLY C 229 . ? 1_555 ? 
46 AC3 23 ALA C 232 ? ALA C 230 . ? 1_555 ? 
47 AC3 23 GLY C 233 ? GLY C 231 . ? 1_555 ? 
48 AC3 23 PHE C 236 ? PHE C 234 . ? 1_555 ? 
49 AC3 23 ALA C 263 ? ALA C 261 . ? 1_555 ? 
50 AC3 23 HOH M .   ? HOH C 300 . ? 1_555 ? 
51 AC3 23 HOH M .   ? HOH C 303 . ? 1_555 ? 
52 AC3 23 HOH M .   ? HOH C 304 . ? 1_555 ? 
53 AC3 23 HOH M .   ? HOH C 330 . ? 1_555 ? 
54 AC3 23 HOH M .   ? HOH C 336 . ? 1_555 ? 
55 AC3 23 HOH M .   ? HOH C 360 . ? 1_555 ? 
56 AC3 23 HOH M .   ? HOH C 377 . ? 1_555 ? 
57 AC3 23 HOH M .   ? HOH C 387 . ? 1_555 ? 
58 AC3 23 HOH M .   ? HOH C 388 . ? 1_555 ? 
59 AC3 23 HOH M .   ? HOH C 391 . ? 1_555 ? 
60 AC3 23 HOH M .   ? HOH C 393 . ? 1_555 ? 
61 AC4 8  THR C 12  ? THR C 10  . ? 1_555 ? 
62 AC4 8  ASP C 14  ? ASP C 12  . ? 1_555 ? 
63 AC4 8  GLY C 40  ? GLY C 38  . ? 1_555 ? 
64 AC4 8  ASN C 44  ? ASN C 42  . ? 1_555 ? 
65 AC4 8  SER C 95  ? SER C 93  . ? 1_555 ? 
66 AC4 8  ASP C 234 ? ASP C 232 . ? 1_555 ? 
67 AC4 8  HOH M .   ? HOH C 330 . ? 1_555 ? 
68 AC4 8  HOH M .   ? HOH C 367 . ? 1_555 ? 
69 AC5 20 LYS D 41  ? LYS D 39  . ? 1_555 ? 
70 AC5 20 ASN D 184 ? ASN D 182 . ? 1_555 ? 
71 AC5 20 THR D 202 ? THR D 200 . ? 1_555 ? 
72 AC5 20 GLN D 203 ? GLN D 201 . ? 1_555 ? 
73 AC5 20 GLY D 204 ? GLY D 202 . ? 1_555 ? 
74 AC5 20 ALA D 205 ? ALA D 203 . ? 1_555 ? 
75 AC5 20 GLY D 207 ? GLY D 205 . ? 1_555 ? 
76 AC5 20 VAL D 222 ? VAL D 220 . ? 1_555 ? 
77 AC5 20 ALA D 232 ? ALA D 230 . ? 1_555 ? 
78 AC5 20 GLY D 233 ? GLY D 231 . ? 1_555 ? 
79 AC5 20 PHE D 236 ? PHE D 234 . ? 1_555 ? 
80 AC5 20 ALA D 263 ? ALA D 261 . ? 1_555 ? 
81 AC5 20 HOH N .   ? HOH D 300 . ? 1_555 ? 
82 AC5 20 HOH N .   ? HOH D 316 . ? 1_555 ? 
83 AC5 20 HOH N .   ? HOH D 328 . ? 1_555 ? 
84 AC5 20 HOH N .   ? HOH D 334 . ? 1_555 ? 
85 AC5 20 HOH N .   ? HOH D 353 . ? 1_555 ? 
86 AC5 20 HOH N .   ? HOH D 356 . ? 1_555 ? 
87 AC5 20 HOH N .   ? HOH D 358 . ? 1_555 ? 
88 AC5 20 HOH N .   ? HOH D 361 . ? 1_555 ? 
89 AC6 7  THR D 12  ? THR D 10  . ? 1_555 ? 
90 AC6 7  ASP D 14  ? ASP D 12  . ? 1_555 ? 
91 AC6 7  GLY D 40  ? GLY D 38  . ? 1_555 ? 
92 AC6 7  ASN D 44  ? ASN D 42  . ? 1_555 ? 
93 AC6 7  SER D 95  ? SER D 93  . ? 1_555 ? 
94 AC6 7  ASP D 234 ? ASP D 232 . ? 1_555 ? 
95 AC6 7  HOH N .   ? HOH D 356 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3IKH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3IKH 
_atom_sites.fract_transf_matrix[1][1]   0.018405 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003083 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009403 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008307 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 2   ? -2.956  17.487 120.263 1.00 37.92 ? -2  SER A N     1 
ATOM   2    C  CA    . SER A 1 2   ? -4.069  18.460 120.327 1.00 36.66 ? -2  SER A CA    1 
ATOM   3    C  C     . SER A 1 2   ? -3.889  19.638 121.281 1.00 33.57 ? -2  SER A C     1 
ATOM   4    O  O     . SER A 1 2   ? -4.710  20.561 121.293 1.00 33.61 ? -2  SER A O     1 
ATOM   5    C  CB    . SER A 1 2   ? -5.373  17.753 120.624 1.00 38.38 ? -2  SER A CB    1 
ATOM   6    O  OG    . SER A 1 2   ? -6.431  18.633 120.299 1.00 41.75 ? -2  SER A OG    1 
ATOM   7    N  N     . LEU A 1 3   ? -2.842  19.617 122.100 1.00 30.79 ? -1  LEU A N     1 
ATOM   8    C  CA    . LEU A 1 3   ? -2.543  20.753 122.968 1.00 26.62 ? -1  LEU A CA    1 
ATOM   9    C  C     . LEU A 1 3   ? -1.931  21.728 121.954 1.00 26.58 ? -1  LEU A C     1 
ATOM   10   O  O     . LEU A 1 3   ? -1.285  21.290 120.998 1.00 26.98 ? -1  LEU A O     1 
ATOM   11   C  CB    . LEU A 1 3   ? -1.484  20.353 123.995 1.00 25.94 ? -1  LEU A CB    1 
ATOM   12   C  CG    . LEU A 1 3   ? -1.809  20.506 125.482 1.00 27.98 ? -1  LEU A CG    1 
ATOM   13   C  CD1   . LEU A 1 3   ? -3.232  20.080 125.780 1.00 23.84 ? -1  LEU A CD1   1 
ATOM   14   C  CD2   . LEU A 1 3   ? -0.781  19.704 126.291 1.00 25.08 ? -1  LEU A CD2   1 
ATOM   15   N  N     . ARG A 1 4   ? -2.129  23.027 122.136 1.00 24.23 ? 2   ARG A N     1 
ATOM   16   C  CA    . ARG A 1 4   ? -1.582  24.001 121.194 1.00 23.10 ? 2   ARG A CA    1 
ATOM   17   C  C     . ARG A 1 4   ? -0.593  24.938 121.878 1.00 22.69 ? 2   ARG A C     1 
ATOM   18   O  O     . ARG A 1 4   ? -0.614  25.092 123.100 1.00 22.49 ? 2   ARG A O     1 
ATOM   19   C  CB    . ARG A 1 4   ? -2.719  24.801 120.553 1.00 24.20 ? 2   ARG A CB    1 
ATOM   20   C  CG    . ARG A 1 4   ? -3.627  23.947 119.661 1.00 26.74 ? 2   ARG A CG    1 
ATOM   21   C  CD    . ARG A 1 4   ? -4.903  24.696 119.296 1.00 29.88 ? 2   ARG A CD    1 
ATOM   22   N  NE    . ARG A 1 4   ? -5.647  25.045 120.502 1.00 31.98 ? 2   ARG A NE    1 
ATOM   23   C  CZ    . ARG A 1 4   ? -6.644  25.922 120.546 1.00 32.88 ? 2   ARG A CZ    1 
ATOM   24   N  NH1   . ARG A 1 4   ? -7.034  26.552 119.442 1.00 31.94 ? 2   ARG A NH1   1 
ATOM   25   N  NH2   . ARG A 1 4   ? -7.234  26.181 121.703 1.00 31.73 ? 2   ARG A NH2   1 
ATOM   26   N  N     . VAL A 1 5   ? 0.272   25.567 121.090 1.00 22.13 ? 3   VAL A N     1 
ATOM   27   C  CA    . VAL A 1 5   ? 1.261   26.466 121.646 1.00 19.90 ? 3   VAL A CA    1 
ATOM   28   C  C     . VAL A 1 5   ? 1.112   27.886 121.138 1.00 21.88 ? 3   VAL A C     1 
ATOM   29   O  O     . VAL A 1 5   ? 0.981   28.117 119.932 1.00 21.60 ? 3   VAL A O     1 
ATOM   30   C  CB    . VAL A 1 5   ? 2.684   25.966 121.335 1.00 21.10 ? 3   VAL A CB    1 
ATOM   31   C  CG1   . VAL A 1 5   ? 3.709   26.962 121.842 1.00 22.68 ? 3   VAL A CG1   1 
ATOM   32   C  CG2   . VAL A 1 5   ? 2.904   24.611 122.003 1.00 20.63 ? 3   VAL A CG2   1 
ATOM   33   N  N     . TYR A 1 6   ? 1.108   28.832 122.074 1.00 21.20 ? 4   TYR A N     1 
ATOM   34   C  CA    . TYR A 1 6   ? 1.012   30.248 121.750 1.00 22.82 ? 4   TYR A CA    1 
ATOM   35   C  C     . TYR A 1 6   ? 2.348   30.887 122.107 1.00 23.76 ? 4   TYR A C     1 
ATOM   36   O  O     . TYR A 1 6   ? 2.768   30.867 123.267 1.00 24.44 ? 4   TYR A O     1 
ATOM   37   C  CB    . TYR A 1 6   ? -0.103  30.922 122.558 1.00 20.56 ? 4   TYR A CB    1 
ATOM   38   C  CG    . TYR A 1 6   ? -1.483  30.445 122.197 1.00 21.23 ? 4   TYR A CG    1 
ATOM   39   C  CD1   . TYR A 1 6   ? -1.942  29.195 122.614 1.00 22.45 ? 4   TYR A CD1   1 
ATOM   40   C  CD2   . TYR A 1 6   ? -2.334  31.241 121.428 1.00 24.50 ? 4   TYR A CD2   1 
ATOM   41   C  CE1   . TYR A 1 6   ? -3.209  28.749 122.279 1.00 25.03 ? 4   TYR A CE1   1 
ATOM   42   C  CE2   . TYR A 1 6   ? -3.610  30.803 121.084 1.00 23.96 ? 4   TYR A CE2   1 
ATOM   43   C  CZ    . TYR A 1 6   ? -4.039  29.558 121.513 1.00 24.60 ? 4   TYR A CZ    1 
ATOM   44   O  OH    . TYR A 1 6   ? -5.289  29.111 121.180 1.00 26.35 ? 4   TYR A OH    1 
ATOM   45   N  N     . VAL A 1 7   ? 3.018   31.453 121.112 1.00 21.63 ? 5   VAL A N     1 
ATOM   46   C  CA    . VAL A 1 7   ? 4.307   32.084 121.351 1.00 22.55 ? 5   VAL A CA    1 
ATOM   47   C  C     . VAL A 1 7   ? 4.198   33.597 121.213 1.00 24.57 ? 5   VAL A C     1 
ATOM   48   O  O     . VAL A 1 7   ? 3.930   34.107 120.126 1.00 26.38 ? 5   VAL A O     1 
ATOM   49   C  CB    . VAL A 1 7   ? 5.369   31.572 120.351 1.00 22.33 ? 5   VAL A CB    1 
ATOM   50   C  CG1   . VAL A 1 7   ? 6.741   32.127 120.711 1.00 22.98 ? 5   VAL A CG1   1 
ATOM   51   C  CG2   . VAL A 1 7   ? 5.385   30.048 120.344 1.00 22.63 ? 5   VAL A CG2   1 
ATOM   52   N  N     . THR A 1 8   ? 4.378   34.311 122.320 1.00 24.78 ? 6   THR A N     1 
ATOM   53   C  CA    . THR A 1 8   ? 4.329   35.769 122.296 1.00 24.98 ? 6   THR A CA    1 
ATOM   54   C  C     . THR A 1 8   ? 5.762   36.255 122.391 1.00 25.41 ? 6   THR A C     1 
ATOM   55   O  O     . THR A 1 8   ? 6.378   36.196 123.455 1.00 27.02 ? 6   THR A O     1 
ATOM   56   C  CB    . THR A 1 8   ? 3.516   36.350 123.484 1.00 25.94 ? 6   THR A CB    1 
ATOM   57   O  OG1   . THR A 1 8   ? 4.044   35.857 124.721 1.00 28.45 ? 6   THR A OG1   1 
ATOM   58   C  CG2   . THR A 1 8   ? 2.053   35.961 123.364 1.00 27.09 ? 6   THR A CG2   1 
ATOM   59   N  N     . GLY A 1 9   ? 6.295   36.723 121.267 1.00 24.59 ? 7   GLY A N     1 
ATOM   60   C  CA    . GLY A 1 9   ? 7.664   37.190 121.242 1.00 23.34 ? 7   GLY A CA    1 
ATOM   61   C  C     . GLY A 1 9   ? 7.929   38.086 120.049 1.00 24.70 ? 7   GLY A C     1 
ATOM   62   O  O     . GLY A 1 9   ? 7.055   38.836 119.618 1.00 23.16 ? 7   GLY A O     1 
ATOM   63   N  N     . ASN A 1 10  ? 9.127   37.995 119.488 1.00 24.31 ? 8   ASN A N     1 
ATOM   64   C  CA    . ASN A 1 10  ? 9.467   38.851 118.358 1.00 25.29 ? 8   ASN A CA    1 
ATOM   65   C  C     . ASN A 1 10  ? 9.722   38.108 117.054 1.00 25.16 ? 8   ASN A C     1 
ATOM   66   O  O     . ASN A 1 10  ? 9.735   36.879 117.003 1.00 24.25 ? 8   ASN A O     1 
ATOM   67   C  CB    . ASN A 1 10  ? 10.711  39.661 118.700 1.00 26.31 ? 8   ASN A CB    1 
ATOM   68   C  CG    . ASN A 1 10  ? 11.939  38.786 118.885 1.00 29.09 ? 8   ASN A CG    1 
ATOM   69   O  OD1   . ASN A 1 10  ? 13.070  39.266 118.832 1.00 29.81 ? 8   ASN A OD1   1 
ATOM   70   N  ND2   . ASN A 1 10  ? 11.720  37.495 119.113 1.00 28.22 ? 8   ASN A ND2   1 
ATOM   71   N  N     . ILE A 1 11  ? 9.899   38.879 115.988 1.00 24.51 ? 9   ILE A N     1 
ATOM   72   C  CA    . ILE A 1 11  ? 10.225  38.322 114.684 1.00 24.55 ? 9   ILE A CA    1 
ATOM   73   C  C     . ILE A 1 11  ? 11.038  39.414 114.004 1.00 26.36 ? 9   ILE A C     1 
ATOM   74   O  O     . ILE A 1 11  ? 10.689  40.594 114.083 1.00 25.86 ? 9   ILE A O     1 
ATOM   75   C  CB    . ILE A 1 11  ? 8.967   37.938 113.861 1.00 23.31 ? 9   ILE A CB    1 
ATOM   76   C  CG1   . ILE A 1 11  ? 9.408   37.236 112.572 1.00 22.41 ? 9   ILE A CG1   1 
ATOM   77   C  CG2   . ILE A 1 11  ? 8.124   39.160 113.556 1.00 24.89 ? 9   ILE A CG2   1 
ATOM   78   C  CD1   . ILE A 1 11  ? 8.321   36.410 111.914 1.00 24.74 ? 9   ILE A CD1   1 
ATOM   79   N  N     . THR A 1 12  ? 12.138  39.027 113.368 1.00 26.21 ? 10  THR A N     1 
ATOM   80   C  CA    . THR A 1 12  ? 13.026  39.996 112.737 1.00 27.84 ? 10  THR A CA    1 
ATOM   81   C  C     . THR A 1 12  ? 13.516  39.587 111.356 1.00 27.36 ? 10  THR A C     1 
ATOM   82   O  O     . THR A 1 12  ? 13.141  38.547 110.819 1.00 25.10 ? 10  THR A O     1 
ATOM   83   C  CB    . THR A 1 12  ? 14.312  40.164 113.553 1.00 30.18 ? 10  THR A CB    1 
ATOM   84   O  OG1   . THR A 1 12  ? 15.182  39.064 113.252 1.00 32.63 ? 10  THR A OG1   1 
ATOM   85   C  CG2   . THR A 1 12  ? 14.030  40.151 115.051 1.00 30.26 ? 10  THR A CG2   1 
ATOM   86   N  N     . VAL A 1 13  ? 14.356  40.448 110.790 1.00 26.42 ? 11  VAL A N     1 
ATOM   87   C  CA    . VAL A 1 13  ? 15.029  40.174 109.528 1.00 25.44 ? 11  VAL A CA    1 
ATOM   88   C  C     . VAL A 1 13  ? 16.491  40.308 109.943 1.00 27.40 ? 11  VAL A C     1 
ATOM   89   O  O     . VAL A 1 13  ? 16.909  41.363 110.422 1.00 26.87 ? 11  VAL A O     1 
ATOM   90   C  CB    . VAL A 1 13  ? 14.751  41.219 108.413 1.00 25.54 ? 11  VAL A CB    1 
ATOM   91   C  CG1   . VAL A 1 13  ? 15.724  40.986 107.243 1.00 26.79 ? 11  VAL A CG1   1 
ATOM   92   C  CG2   . VAL A 1 13  ? 13.327  41.094 107.901 1.00 27.09 ? 11  VAL A CG2   1 
ATOM   93   N  N     . ASP A 1 14  ? 17.257  39.234 109.817 1.00 27.48 ? 12  ASP A N     1 
ATOM   94   C  CA    . ASP A 1 14  ? 18.666  39.300 110.159 1.00 28.61 ? 12  ASP A CA    1 
ATOM   95   C  C     . ASP A 1 14  ? 19.403  39.484 108.835 1.00 29.46 ? 12  ASP A C     1 
ATOM   96   O  O     . ASP A 1 14  ? 19.358  38.616 107.963 1.00 28.95 ? 12  ASP A O     1 
ATOM   97   C  CB    . ASP A 1 14  ? 19.137  38.016 110.858 1.00 29.74 ? 12  ASP A CB    1 
ATOM   98   C  CG    . ASP A 1 14  ? 18.448  37.782 112.207 1.00 32.28 ? 12  ASP A CG    1 
ATOM   99   O  OD1   . ASP A 1 14  ? 17.906  38.743 112.794 1.00 32.03 ? 12  ASP A OD1   1 
ATOM   100  O  OD2   . ASP A 1 14  ? 18.467  36.628 112.686 1.00 32.84 ? 12  ASP A OD2   1 
ATOM   101  N  N     . GLU A 1 15  ? 20.061  40.626 108.685 1.00 29.60 ? 13  GLU A N     1 
ATOM   102  C  CA    . GLU A 1 15  ? 20.798  40.937 107.461 1.00 31.89 ? 13  GLU A CA    1 
ATOM   103  C  C     . GLU A 1 15  ? 22.289  40.714 107.624 1.00 32.45 ? 13  GLU A C     1 
ATOM   104  O  O     . GLU A 1 15  ? 22.917  41.303 108.505 1.00 34.31 ? 13  GLU A O     1 
ATOM   105  C  CB    . GLU A 1 15  ? 20.567  42.390 107.067 1.00 30.39 ? 13  GLU A CB    1 
ATOM   106  C  CG    . GLU A 1 15  ? 19.168  42.700 106.612 1.00 33.31 ? 13  GLU A CG    1 
ATOM   107  C  CD    . GLU A 1 15  ? 18.975  44.185 106.382 1.00 34.47 ? 13  GLU A CD    1 
ATOM   108  O  OE1   . GLU A 1 15  ? 19.907  44.821 105.847 1.00 34.00 ? 13  GLU A OE1   1 
ATOM   109  O  OE2   . GLU A 1 15  ? 17.897  44.709 106.731 1.00 35.47 ? 13  GLU A OE2   1 
ATOM   110  N  N     . THR A 1 16  ? 22.857  39.871 106.770 1.00 33.24 ? 14  THR A N     1 
ATOM   111  C  CA    . THR A 1 16  ? 24.283  39.596 106.835 1.00 34.47 ? 14  THR A CA    1 
ATOM   112  C  C     . THR A 1 16  ? 25.009  40.484 105.834 1.00 33.58 ? 14  THR A C     1 
ATOM   113  O  O     . THR A 1 16  ? 24.808  40.353 104.628 1.00 32.73 ? 14  THR A O     1 
ATOM   114  C  CB    . THR A 1 16  ? 24.580  38.121 106.508 1.00 36.24 ? 14  THR A CB    1 
ATOM   115  O  OG1   . THR A 1 16  ? 23.888  37.276 107.439 1.00 38.07 ? 14  THR A OG1   1 
ATOM   116  C  CG2   . THR A 1 16  ? 26.077  37.850 106.600 1.00 37.18 ? 14  THR A CG2   1 
ATOM   117  N  N     . TRP A 1 17  ? 25.836  41.396 106.339 1.00 34.27 ? 15  TRP A N     1 
ATOM   118  C  CA    . TRP A 1 17  ? 26.597  42.308 105.486 1.00 34.28 ? 15  TRP A CA    1 
ATOM   119  C  C     . TRP A 1 17  ? 28.084  41.995 105.503 1.00 36.01 ? 15  TRP A C     1 
ATOM   120  O  O     . TRP A 1 17  ? 28.688  41.830 106.563 1.00 36.89 ? 15  TRP A O     1 
ATOM   121  C  CB    . TRP A 1 17  ? 26.420  43.757 105.931 1.00 33.63 ? 15  TRP A CB    1 
ATOM   122  C  CG    . TRP A 1 17  ? 25.087  44.344 105.626 1.00 33.63 ? 15  TRP A CG    1 
ATOM   123  C  CD1   . TRP A 1 17  ? 23.884  43.955 106.135 1.00 35.04 ? 15  TRP A CD1   1 
ATOM   124  C  CD2   . TRP A 1 17  ? 24.820  45.453 104.760 1.00 34.13 ? 15  TRP A CD2   1 
ATOM   125  N  NE1   . TRP A 1 17  ? 22.879  44.756 105.642 1.00 34.75 ? 15  TRP A NE1   1 
ATOM   126  C  CE2   . TRP A 1 17  ? 23.426  45.684 104.796 1.00 32.91 ? 15  TRP A CE2   1 
ATOM   127  C  CE3   . TRP A 1 17  ? 25.624  46.276 103.958 1.00 32.92 ? 15  TRP A CE3   1 
ATOM   128  C  CZ2   . TRP A 1 17  ? 22.816  46.706 104.062 1.00 32.96 ? 15  TRP A CZ2   1 
ATOM   129  C  CZ3   . TRP A 1 17  ? 25.014  47.297 103.227 1.00 33.24 ? 15  TRP A CZ3   1 
ATOM   130  C  CH2   . TRP A 1 17  ? 23.622  47.500 103.285 1.00 33.78 ? 15  TRP A CH2   1 
ATOM   131  N  N     . SER A 1 18  ? 28.673  41.930 104.317 1.00 35.70 ? 16  SER A N     1 
ATOM   132  C  CA    . SER A 1 18  ? 30.092  41.658 104.188 1.00 36.85 ? 16  SER A CA    1 
ATOM   133  C  C     . SER A 1 18  ? 30.841  42.954 103.912 1.00 36.62 ? 16  SER A C     1 
ATOM   134  O  O     . SER A 1 18  ? 30.534  43.664 102.957 1.00 37.14 ? 16  SER A O     1 
ATOM   135  C  CB    . SER A 1 18  ? 30.333  40.676 103.042 1.00 38.00 ? 16  SER A CB    1 
ATOM   136  O  OG    . SER A 1 18  ? 31.716  40.560 102.773 1.00 41.25 ? 16  SER A OG    1 
ATOM   137  N  N     . ILE A 1 19  ? 31.816  43.266 104.757 1.00 36.34 ? 17  ILE A N     1 
ATOM   138  C  CA    . ILE A 1 19  ? 32.617  44.468 104.580 1.00 37.23 ? 17  ILE A CA    1 
ATOM   139  C  C     . ILE A 1 19  ? 34.080  44.140 104.886 1.00 39.85 ? 17  ILE A C     1 
ATOM   140  O  O     . ILE A 1 19  ? 34.376  43.176 105.596 1.00 39.44 ? 17  ILE A O     1 
ATOM   141  C  CB    . ILE A 1 19  ? 32.140  45.619 105.506 1.00 36.81 ? 17  ILE A CB    1 
ATOM   142  C  CG1   . ILE A 1 19  ? 32.192  45.182 106.973 1.00 37.09 ? 17  ILE A CG1   1 
ATOM   143  C  CG2   . ILE A 1 19  ? 30.719  46.029 105.136 1.00 35.29 ? 17  ILE A CG2   1 
ATOM   144  C  CD1   . ILE A 1 19  ? 31.826  46.287 107.953 1.00 35.47 ? 17  ILE A CD1   1 
ATOM   145  N  N     . PRO A 1 20  ? 35.016  44.926 104.333 1.00 40.96 ? 18  PRO A N     1 
ATOM   146  C  CA    . PRO A 1 20  ? 36.444  44.688 104.572 1.00 42.07 ? 18  PRO A CA    1 
ATOM   147  C  C     . PRO A 1 20  ? 36.759  44.770 106.058 1.00 42.37 ? 18  PRO A C     1 
ATOM   148  O  O     . PRO A 1 20  ? 37.502  43.951 106.597 1.00 41.51 ? 18  PRO A O     1 
ATOM   149  C  CB    . PRO A 1 20  ? 37.115  45.804 103.779 1.00 42.04 ? 18  PRO A CB    1 
ATOM   150  C  CG    . PRO A 1 20  ? 36.149  46.030 102.645 1.00 42.80 ? 18  PRO A CG    1 
ATOM   151  C  CD    . PRO A 1 20  ? 34.822  46.019 103.365 1.00 41.43 ? 18  PRO A CD    1 
ATOM   152  N  N     . ASP A 1 21  ? 36.178  45.769 106.712 1.00 42.84 ? 19  ASP A N     1 
ATOM   153  C  CA    . ASP A 1 21  ? 36.374  45.976 108.136 1.00 44.05 ? 19  ASP A CA    1 
ATOM   154  C  C     . ASP A 1 21  ? 35.353  46.990 108.635 1.00 44.17 ? 19  ASP A C     1 
ATOM   155  O  O     . ASP A 1 21  ? 34.803  47.760 107.852 1.00 43.32 ? 19  ASP A O     1 
ATOM   156  C  CB    . ASP A 1 21  ? 37.795  46.480 108.399 1.00 46.37 ? 19  ASP A CB    1 
ATOM   157  C  CG    . ASP A 1 21  ? 38.091  46.642 109.875 1.00 49.03 ? 19  ASP A CG    1 
ATOM   158  O  OD1   . ASP A 1 21  ? 37.755  45.724 110.651 1.00 50.07 ? 19  ASP A OD1   1 
ATOM   159  O  OD2   . ASP A 1 21  ? 38.666  47.681 110.261 1.00 51.72 ? 19  ASP A OD2   1 
ATOM   160  N  N     . ILE A 1 22  ? 35.088  46.979 109.938 1.00 43.76 ? 20  ILE A N     1 
ATOM   161  C  CA    . ILE A 1 22  ? 34.123  47.914 110.518 1.00 44.50 ? 20  ILE A CA    1 
ATOM   162  C  C     . ILE A 1 22  ? 34.640  49.340 110.357 1.00 44.19 ? 20  ILE A C     1 
ATOM   163  O  O     . ILE A 1 22  ? 35.727  49.672 110.831 1.00 44.60 ? 20  ILE A O     1 
ATOM   164  C  CB    . ILE A 1 22  ? 33.886  47.619 112.010 1.00 44.84 ? 20  ILE A CB    1 
ATOM   165  C  CG1   . ILE A 1 22  ? 33.291  46.218 112.174 1.00 45.03 ? 20  ILE A CG1   1 
ATOM   166  C  CG2   . ILE A 1 22  ? 32.958  48.671 112.605 1.00 44.90 ? 20  ILE A CG2   1 
ATOM   167  C  CD1   . ILE A 1 22  ? 33.135  45.778 113.614 1.00 46.71 ? 20  ILE A CD1   1 
ATOM   168  N  N     . PRO A 1 23  ? 33.855  50.202 109.690 1.00 44.83 ? 21  PRO A N     1 
ATOM   169  C  CA    . PRO A 1 23  ? 34.230  51.598 109.458 1.00 45.33 ? 21  PRO A CA    1 
ATOM   170  C  C     . PRO A 1 23  ? 34.275  52.429 110.732 1.00 45.90 ? 21  PRO A C     1 
ATOM   171  O  O     . PRO A 1 23  ? 33.436  52.270 111.628 1.00 45.35 ? 21  PRO A O     1 
ATOM   172  C  CB    . PRO A 1 23  ? 33.151  52.080 108.500 1.00 44.81 ? 21  PRO A CB    1 
ATOM   173  C  CG    . PRO A 1 23  ? 31.954  51.333 108.967 1.00 45.37 ? 21  PRO A CG    1 
ATOM   174  C  CD    . PRO A 1 23  ? 32.500  49.929 109.172 1.00 44.97 ? 21  PRO A CD    1 
ATOM   175  N  N     . LYS A 1 24  ? 35.251  53.320 110.797 1.00 46.14 ? 22  LYS A N     1 
ATOM   176  C  CA    . LYS A 1 24  ? 35.379  54.195 111.949 1.00 47.07 ? 22  LYS A CA    1 
ATOM   177  C  C     . LYS A 1 24  ? 34.419  55.353 111.788 1.00 46.53 ? 22  LYS A C     1 
ATOM   178  O  O     . LYS A 1 24  ? 33.911  55.586 110.690 1.00 45.19 ? 22  LYS A O     1 
ATOM   179  C  CB    . LYS A 1 24  ? 36.810  54.720 112.045 1.00 48.47 ? 22  LYS A CB    1 
ATOM   180  C  CG    . LYS A 1 24  ? 37.819  53.629 112.260 1.00 50.56 ? 22  LYS A CG    1 
ATOM   181  C  CD    . LYS A 1 24  ? 39.239  54.181 112.224 1.00 51.80 ? 22  LYS A CD    1 
ATOM   182  C  CE    . LYS A 1 24  ? 40.180  53.175 112.860 1.00 52.46 ? 22  LYS A CE    1 
ATOM   183  N  NZ    . LYS A 1 24  ? 41.596  53.426 112.448 1.00 53.20 ? 22  LYS A NZ    1 
ATOM   184  N  N     . LYS A 1 25  ? 34.198  56.098 112.866 1.00 46.09 ? 23  LYS A N     1 
ATOM   185  C  CA    . LYS A 1 25  ? 33.309  57.253 112.788 1.00 46.14 ? 23  LYS A CA    1 
ATOM   186  C  C     . LYS A 1 25  ? 33.845  58.226 111.735 1.00 45.60 ? 23  LYS A C     1 
ATOM   187  O  O     . LYS A 1 25  ? 35.060  58.508 111.711 1.00 45.80 ? 23  LYS A O     1 
ATOM   188  C  CB    . LYS A 1 25  ? 33.260  57.964 114.123 1.00 47.25 ? 23  LYS A CB    1 
ATOM   189  C  CG    . LYS A 1 25  ? 32.696  57.163 115.267 1.00 48.68 ? 23  LYS A CG    1 
ATOM   190  C  CD    . LYS A 1 25  ? 32.696  58.077 116.466 1.00 51.66 ? 23  LYS A CD    1 
ATOM   191  C  CE    . LYS A 1 25  ? 32.018  57.403 117.604 1.00 52.02 ? 23  LYS A CE    1 
ATOM   192  N  NZ    . LYS A 1 25  ? 31.646  58.400 118.626 1.00 52.71 ? 23  LYS A NZ    1 
ATOM   193  N  N     . GLY A 1 26  ? 32.947  58.732 110.885 1.00 43.68 ? 24  GLY A N     1 
ATOM   194  C  CA    . GLY A 1 26  ? 33.352  59.652 109.841 1.00 41.99 ? 24  GLY A CA    1 
ATOM   195  C  C     . GLY A 1 26  ? 33.754  58.956 108.553 1.00 40.86 ? 24  GLY A C     1 
ATOM   196  O  O     . GLY A 1 26  ? 33.910  59.604 107.518 1.00 40.74 ? 24  GLY A O     1 
ATOM   197  N  N     . ALA A 1 27  ? 33.893  57.636 108.605 1.00 39.08 ? 25  ALA A N     1 
ATOM   198  C  CA    . ALA A 1 27  ? 34.298  56.874 107.425 1.00 37.84 ? 25  ALA A CA    1 
ATOM   199  C  C     . ALA A 1 27  ? 33.077  56.456 106.605 1.00 36.28 ? 25  ALA A C     1 
ATOM   200  O  O     . ALA A 1 27  ? 31.949  56.398 107.112 1.00 36.08 ? 25  ALA A O     1 
ATOM   201  C  CB    . ALA A 1 27  ? 35.086  55.630 107.839 1.00 37.06 ? 25  ALA A CB    1 
ATOM   202  N  N     . SER A 1 28  ? 33.316  56.164 105.333 1.00 34.57 ? 26  SER A N     1 
ATOM   203  C  CA    . SER A 1 28  ? 32.272  55.718 104.426 1.00 33.03 ? 26  SER A CA    1 
ATOM   204  C  C     . SER A 1 28  ? 32.917  54.660 103.552 1.00 32.18 ? 26  SER A C     1 
ATOM   205  O  O     . SER A 1 28  ? 33.910  54.921 102.878 1.00 31.66 ? 26  SER A O     1 
ATOM   206  C  CB    . SER A 1 28  ? 31.766  56.881 103.576 1.00 34.02 ? 26  SER A CB    1 
ATOM   207  O  OG    . SER A 1 28  ? 32.815  57.500 102.857 1.00 35.53 ? 26  SER A OG    1 
ATOM   208  N  N     . ILE A 1 29  ? 32.351  53.461 103.569 1.00 30.79 ? 27  ILE A N     1 
ATOM   209  C  CA    . ILE A 1 29  ? 32.903  52.364 102.794 1.00 29.83 ? 27  ILE A CA    1 
ATOM   210  C  C     . ILE A 1 29  ? 31.852  51.649 101.962 1.00 28.41 ? 27  ILE A C     1 
ATOM   211  O  O     . ILE A 1 29  ? 30.663  51.945 102.042 1.00 25.78 ? 27  ILE A O     1 
ATOM   212  C  CB    . ILE A 1 29  ? 33.542  51.317 103.715 1.00 30.50 ? 27  ILE A CB    1 
ATOM   213  C  CG1   . ILE A 1 29  ? 32.462  50.712 104.618 1.00 29.67 ? 27  ILE A CG1   1 
ATOM   214  C  CG2   . ILE A 1 29  ? 34.650  51.961 104.548 1.00 30.89 ? 27  ILE A CG2   1 
ATOM   215  C  CD1   . ILE A 1 29  ? 32.871  49.418 105.285 1.00 32.36 ? 27  ILE A CD1   1 
ATOM   216  N  N     . HIS A 1 30  ? 32.314  50.698 101.161 1.00 28.47 ? 28  HIS A N     1 
ATOM   217  C  CA    . HIS A 1 30  ? 31.425  49.904 100.340 1.00 28.19 ? 28  HIS A CA    1 
ATOM   218  C  C     . HIS A 1 30  ? 31.263  48.559 101.018 1.00 30.46 ? 28  HIS A C     1 
ATOM   219  O  O     . HIS A 1 30  ? 32.194  48.047 101.646 1.00 30.65 ? 28  HIS A O     1 
ATOM   220  C  CB    . HIS A 1 30  ? 32.001  49.715 98.939  1.00 29.28 ? 28  HIS A CB    1 
ATOM   221  C  CG    . HIS A 1 30  ? 31.918  50.945 98.091  1.00 28.54 ? 28  HIS A CG    1 
ATOM   222  N  ND1   . HIS A 1 30  ? 30.757  51.675 97.959  1.00 28.01 ? 28  HIS A ND1   1 
ATOM   223  C  CD2   . HIS A 1 30  ? 32.847  51.572 97.332  1.00 30.17 ? 28  HIS A CD2   1 
ATOM   224  C  CE1   . HIS A 1 30  ? 30.973  52.701 97.154  1.00 28.83 ? 28  HIS A CE1   1 
ATOM   225  N  NE2   . HIS A 1 30  ? 32.233  52.661 96.760  1.00 31.59 ? 28  HIS A NE2   1 
ATOM   226  N  N     . GLY A 1 31  ? 30.069  47.999 100.910 1.00 29.86 ? 29  GLY A N     1 
ATOM   227  C  CA    . GLY A 1 31  ? 29.823  46.712 101.519 1.00 32.27 ? 29  GLY A CA    1 
ATOM   228  C  C     . GLY A 1 31  ? 28.889  45.894 100.666 1.00 32.24 ? 29  GLY A C     1 
ATOM   229  O  O     . GLY A 1 31  ? 28.342  46.381 99.674  1.00 34.31 ? 29  GLY A O     1 
ATOM   230  N  N     . VAL A 1 32  ? 28.704  44.644 101.057 1.00 31.22 ? 30  VAL A N     1 
ATOM   231  C  CA    . VAL A 1 32  ? 27.828  43.753 100.331 1.00 30.78 ? 30  VAL A CA    1 
ATOM   232  C  C     . VAL A 1 32  ? 26.753  43.199 101.243 1.00 31.57 ? 30  VAL A C     1 
ATOM   233  O  O     . VAL A 1 32  ? 27.049  42.626 102.292 1.00 30.36 ? 30  VAL A O     1 
ATOM   234  C  CB    . VAL A 1 32  ? 28.609  42.570 99.732  1.00 29.28 ? 30  VAL A CB    1 
ATOM   235  C  CG1   . VAL A 1 32  ? 27.643  41.591 99.077  1.00 30.67 ? 30  VAL A CG1   1 
ATOM   236  C  CG2   . VAL A 1 32  ? 29.622  43.082 98.718  1.00 29.99 ? 30  VAL A CG2   1 
ATOM   237  N  N     . LYS A 1 33  ? 25.502  43.401 100.849 1.00 31.81 ? 31  LYS A N     1 
ATOM   238  C  CA    . LYS A 1 33  ? 24.373  42.877 101.597 1.00 32.99 ? 31  LYS A CA    1 
ATOM   239  C  C     . LYS A 1 33  ? 24.239  41.497 100.968 1.00 34.66 ? 31  LYS A C     1 
ATOM   240  O  O     . LYS A 1 33  ? 23.581  41.327 99.939  1.00 32.73 ? 31  LYS A O     1 
ATOM   241  C  CB    . LYS A 1 33  ? 23.126  43.717 101.333 1.00 35.08 ? 31  LYS A CB    1 
ATOM   242  C  CG    . LYS A 1 33  ? 21.910  43.310 102.149 1.00 38.43 ? 31  LYS A CG    1 
ATOM   243  C  CD    . LYS A 1 33  ? 20.758  44.274 101.909 1.00 40.51 ? 31  LYS A CD    1 
ATOM   244  C  CE    . LYS A 1 33  ? 19.552  43.904 102.743 1.00 40.70 ? 31  LYS A CE    1 
ATOM   245  N  NZ    . LYS A 1 33  ? 18.422  44.841 102.485 1.00 42.84 ? 31  LYS A NZ    1 
ATOM   246  N  N     . VAL A 1 34  ? 24.901  40.517 101.574 1.00 35.81 ? 32  VAL A N     1 
ATOM   247  C  CA    . VAL A 1 34  ? 24.904  39.165 101.043 1.00 37.23 ? 32  VAL A CA    1 
ATOM   248  C  C     . VAL A 1 34  ? 23.634  38.348 101.252 1.00 38.51 ? 32  VAL A C     1 
ATOM   249  O  O     . VAL A 1 34  ? 23.209  37.636 100.340 1.00 38.80 ? 32  VAL A O     1 
ATOM   250  C  CB    . VAL A 1 34  ? 26.144  38.372 101.565 1.00 38.59 ? 32  VAL A CB    1 
ATOM   251  C  CG1   . VAL A 1 34  ? 26.466  38.770 102.986 1.00 39.97 ? 32  VAL A CG1   1 
ATOM   252  C  CG2   . VAL A 1 34  ? 25.888  36.877 101.487 1.00 38.72 ? 32  VAL A CG2   1 
ATOM   253  N  N     . SER A 1 35  ? 23.003  38.462 102.420 1.00 37.57 ? 33  SER A N     1 
ATOM   254  C  CA    . SER A 1 35  ? 21.800  37.676 102.668 1.00 36.80 ? 33  SER A CA    1 
ATOM   255  C  C     . SER A 1 35  ? 20.894  38.221 103.763 1.00 35.03 ? 33  SER A C     1 
ATOM   256  O  O     . SER A 1 35  ? 21.314  39.022 104.593 1.00 33.61 ? 33  SER A O     1 
ATOM   257  C  CB    . SER A 1 35  ? 22.194  36.248 103.044 1.00 37.56 ? 33  SER A CB    1 
ATOM   258  O  OG    . SER A 1 35  ? 22.885  36.244 104.285 1.00 40.06 ? 33  SER A OG    1 
ATOM   259  N  N     . GLN A 1 36  ? 19.645  37.759 103.748 1.00 35.57 ? 34  GLN A N     1 
ATOM   260  C  CA    . GLN A 1 36  ? 18.642  38.137 104.740 1.00 35.45 ? 34  GLN A CA    1 
ATOM   261  C  C     . GLN A 1 36  ? 17.916  36.866 105.144 1.00 35.96 ? 34  GLN A C     1 
ATOM   262  O  O     . GLN A 1 36  ? 17.628  36.021 104.294 1.00 34.30 ? 34  GLN A O     1 
ATOM   263  C  CB    . GLN A 1 36  ? 17.601  39.092 104.166 1.00 35.08 ? 34  GLN A CB    1 
ATOM   264  C  CG    . GLN A 1 36  ? 18.094  40.447 103.729 1.00 39.55 ? 34  GLN A CG    1 
ATOM   265  C  CD    . GLN A 1 36  ? 16.932  41.351 103.377 1.00 37.69 ? 34  GLN A CD    1 
ATOM   266  O  OE1   . GLN A 1 36  ? 15.997  40.926 102.703 1.00 38.70 ? 34  GLN A OE1   1 
ATOM   267  N  NE2   . GLN A 1 36  ? 16.979  42.600 103.833 1.00 40.26 ? 34  GLN A NE2   1 
ATOM   268  N  N     . ASP A 1 37  ? 17.609  36.741 106.431 1.00 36.06 ? 35  ASP A N     1 
ATOM   269  C  CA    . ASP A 1 37  ? 16.900  35.571 106.943 1.00 37.63 ? 35  ASP A CA    1 
ATOM   270  C  C     . ASP A 1 37  ? 15.902  36.034 108.003 1.00 35.13 ? 35  ASP A C     1 
ATOM   271  O  O     . ASP A 1 37  ? 16.152  37.010 108.701 1.00 33.72 ? 35  ASP A O     1 
ATOM   272  C  CB    . ASP A 1 37  ? 17.872  34.581 107.618 1.00 42.37 ? 35  ASP A CB    1 
ATOM   273  C  CG    . ASP A 1 37  ? 19.272  34.596 107.011 1.00 47.96 ? 35  ASP A CG    1 
ATOM   274  O  OD1   . ASP A 1 37  ? 19.431  34.213 105.831 1.00 50.89 ? 35  ASP A OD1   1 
ATOM   275  O  OD2   . ASP A 1 37  ? 20.222  34.986 107.728 1.00 50.52 ? 35  ASP A OD2   1 
ATOM   276  N  N     . ILE A 1 38  ? 14.772  35.344 108.120 1.00 33.42 ? 36  ILE A N     1 
ATOM   277  C  CA    . ILE A 1 38  ? 13.809  35.689 109.162 1.00 31.90 ? 36  ILE A CA    1 
ATOM   278  C  C     . ILE A 1 38  ? 14.462  35.236 110.464 1.00 30.19 ? 36  ILE A C     1 
ATOM   279  O  O     . ILE A 1 38  ? 14.960  34.113 110.543 1.00 30.74 ? 36  ILE A O     1 
ATOM   280  C  CB    . ILE A 1 38  ? 12.476  34.936 108.997 1.00 31.67 ? 36  ILE A CB    1 
ATOM   281  C  CG1   . ILE A 1 38  ? 11.627  35.611 107.923 1.00 33.40 ? 36  ILE A CG1   1 
ATOM   282  C  CG2   . ILE A 1 38  ? 11.734  34.891 110.336 1.00 32.02 ? 36  ILE A CG2   1 
ATOM   283  C  CD1   . ILE A 1 38  ? 10.253  34.987 107.745 1.00 34.58 ? 36  ILE A CD1   1 
ATOM   284  N  N     . GLY A 1 39  ? 14.473  36.104 111.473 1.00 27.09 ? 37  GLY A N     1 
ATOM   285  C  CA    . GLY A 1 39  ? 15.095  35.750 112.741 1.00 24.62 ? 37  GLY A CA    1 
ATOM   286  C  C     . GLY A 1 39  ? 14.224  36.079 113.943 1.00 23.75 ? 37  GLY A C     1 
ATOM   287  O  O     . GLY A 1 39  ? 13.023  36.291 113.796 1.00 23.18 ? 37  GLY A O     1 
ATOM   288  N  N     . GLY A 1 40  ? 14.832  36.130 115.125 1.00 22.09 ? 38  GLY A N     1 
ATOM   289  C  CA    . GLY A 1 40  ? 14.085  36.420 116.342 1.00 22.66 ? 38  GLY A CA    1 
ATOM   290  C  C     . GLY A 1 40  ? 13.827  35.126 117.099 1.00 23.73 ? 38  GLY A C     1 
ATOM   291  O  O     . GLY A 1 40  ? 13.363  34.153 116.505 1.00 22.93 ? 38  GLY A O     1 
ATOM   292  N  N     . LYS A 1 41  ? 14.131  35.099 118.396 1.00 23.01 ? 39  LYS A N     1 
ATOM   293  C  CA    . LYS A 1 41  ? 13.933  33.883 119.190 1.00 23.23 ? 39  LYS A CA    1 
ATOM   294  C  C     . LYS A 1 41  ? 12.481  33.424 119.178 1.00 22.45 ? 39  LYS A C     1 
ATOM   295  O  O     . LYS A 1 41  ? 12.205  32.230 119.111 1.00 22.48 ? 39  LYS A O     1 
ATOM   296  C  CB    . LYS A 1 41  ? 14.415  34.094 120.627 1.00 22.47 ? 39  LYS A CB    1 
ATOM   297  C  CG    . LYS A 1 41  ? 15.908  34.334 120.725 1.00 26.24 ? 39  LYS A CG    1 
ATOM   298  C  CD    . LYS A 1 41  ? 16.393  34.389 122.171 1.00 30.82 ? 39  LYS A CD    1 
ATOM   299  C  CE    . LYS A 1 41  ? 16.553  32.993 122.750 1.00 32.12 ? 39  LYS A CE    1 
ATOM   300  N  NZ    . LYS A 1 41  ? 17.550  32.204 121.967 1.00 34.36 ? 39  LYS A NZ    1 
ATOM   301  N  N     . GLY A 1 42  ? 11.553  34.371 119.236 1.00 22.00 ? 40  GLY A N     1 
ATOM   302  C  CA    . GLY A 1 42  ? 10.151  34.008 119.206 1.00 22.60 ? 40  GLY A CA    1 
ATOM   303  C  C     . GLY A 1 42  ? 9.788   33.283 117.923 1.00 21.74 ? 40  GLY A C     1 
ATOM   304  O  O     . GLY A 1 42  ? 9.217   32.194 117.953 1.00 19.47 ? 40  GLY A O     1 
ATOM   305  N  N     . ALA A 1 43  ? 10.125  33.884 116.784 1.00 21.79 ? 41  ALA A N     1 
ATOM   306  C  CA    . ALA A 1 43  ? 9.809   33.278 115.491 1.00 21.37 ? 41  ALA A CA    1 
ATOM   307  C  C     . ALA A 1 43  ? 10.528  31.942 115.277 1.00 20.31 ? 41  ALA A C     1 
ATOM   308  O  O     . ALA A 1 43  ? 9.912   30.978 114.820 1.00 22.38 ? 41  ALA A O     1 
ATOM   309  C  CB    . ALA A 1 43  ? 10.155  34.253 114.343 1.00 19.20 ? 41  ALA A CB    1 
ATOM   310  N  N     . ASN A 1 44  ? 11.821  31.884 115.596 1.00 18.86 ? 42  ASN A N     1 
ATOM   311  C  CA    . ASN A 1 44  ? 12.577  30.642 115.414 1.00 20.51 ? 42  ASN A CA    1 
ATOM   312  C  C     . ASN A 1 44  ? 11.929  29.504 116.201 1.00 19.98 ? 42  ASN A C     1 
ATOM   313  O  O     . ASN A 1 44  ? 11.700  28.424 115.670 1.00 18.25 ? 42  ASN A O     1 
ATOM   314  C  CB    . ASN A 1 44  ? 14.038  30.793 115.877 1.00 20.75 ? 42  ASN A CB    1 
ATOM   315  C  CG    . ASN A 1 44  ? 14.842  31.756 115.008 1.00 24.27 ? 42  ASN A CG    1 
ATOM   316  O  OD1   . ASN A 1 44  ? 14.433  32.097 113.900 1.00 23.22 ? 42  ASN A OD1   1 
ATOM   317  N  ND2   . ASN A 1 44  ? 16.003  32.180 115.507 1.00 22.87 ? 42  ASN A ND2   1 
ATOM   318  N  N     . GLN A 1 45  ? 11.637  29.752 117.473 1.00 19.01 ? 43  GLN A N     1 
ATOM   319  C  CA    . GLN A 1 45  ? 11.025  28.713 118.295 1.00 19.18 ? 43  GLN A CA    1 
ATOM   320  C  C     . GLN A 1 45  ? 9.633   28.316 117.793 1.00 19.56 ? 43  GLN A C     1 
ATOM   321  O  O     . GLN A 1 45  ? 9.319   27.125 117.710 1.00 19.80 ? 43  GLN A O     1 
ATOM   322  C  CB    . GLN A 1 45  ? 10.986  29.168 119.761 1.00 19.06 ? 43  GLN A CB    1 
ATOM   323  C  CG    . GLN A 1 45  ? 12.393  29.320 120.343 1.00 20.41 ? 43  GLN A CG    1 
ATOM   324  C  CD    . GLN A 1 45  ? 12.413  29.813 121.784 1.00 20.98 ? 43  GLN A CD    1 
ATOM   325  O  OE1   . GLN A 1 45  ? 11.385  29.853 122.458 1.00 22.38 ? 43  GLN A OE1   1 
ATOM   326  N  NE2   . GLN A 1 45  ? 13.595  30.186 122.260 1.00 21.29 ? 43  GLN A NE2   1 
ATOM   327  N  N     . ALA A 1 46  ? 8.807   29.297 117.438 1.00 19.06 ? 44  ALA A N     1 
ATOM   328  C  CA    . ALA A 1 46  ? 7.462   29.003 116.950 1.00 18.03 ? 44  ALA A CA    1 
ATOM   329  C  C     . ALA A 1 46  ? 7.496   28.223 115.640 1.00 18.10 ? 44  ALA A C     1 
ATOM   330  O  O     . ALA A 1 46  ? 6.730   27.288 115.447 1.00 18.01 ? 44  ALA A O     1 
ATOM   331  C  CB    . ALA A 1 46  ? 6.671   30.296 116.761 1.00 18.05 ? 44  ALA A CB    1 
ATOM   332  N  N     . ILE A 1 47  ? 8.375   28.623 114.732 1.00 19.17 ? 45  ILE A N     1 
ATOM   333  C  CA    . ILE A 1 47  ? 8.489   27.960 113.436 1.00 19.65 ? 45  ILE A CA    1 
ATOM   334  C  C     . ILE A 1 47  ? 8.940   26.503 113.564 1.00 18.48 ? 45  ILE A C     1 
ATOM   335  O  O     . ILE A 1 47  ? 8.375   25.615 112.931 1.00 19.91 ? 45  ILE A O     1 
ATOM   336  C  CB    . ILE A 1 47  ? 9.469   28.727 112.520 1.00 19.70 ? 45  ILE A CB    1 
ATOM   337  C  CG1   . ILE A 1 47  ? 8.849   30.069 112.127 1.00 21.91 ? 45  ILE A CG1   1 
ATOM   338  C  CG2   . ILE A 1 47  ? 9.795   27.904 111.274 1.00 22.45 ? 45  ILE A CG2   1 
ATOM   339  C  CD1   . ILE A 1 47  ? 9.786   30.970 111.338 1.00 20.63 ? 45  ILE A CD1   1 
ATOM   340  N  N     . ILE A 1 48  ? 9.955   26.256 114.381 1.00 17.50 ? 46  ILE A N     1 
ATOM   341  C  CA    . ILE A 1 48  ? 10.441  24.893 114.549 1.00 18.22 ? 46  ILE A CA    1 
ATOM   342  C  C     . ILE A 1 48  ? 9.367   24.027 115.219 1.00 18.69 ? 46  ILE A C     1 
ATOM   343  O  O     . ILE A 1 48  ? 9.186   22.864 114.854 1.00 18.26 ? 46  ILE A O     1 
ATOM   344  C  CB    . ILE A 1 48  ? 11.772  24.898 115.327 1.00 18.57 ? 46  ILE A CB    1 
ATOM   345  C  CG1   . ILE A 1 48  ? 12.842  25.578 114.453 1.00 18.08 ? 46  ILE A CG1   1 
ATOM   346  C  CG2   . ILE A 1 48  ? 12.192  23.475 115.688 1.00 16.62 ? 46  ILE A CG2   1 
ATOM   347  C  CD1   . ILE A 1 48  ? 14.167  25.839 115.135 1.00 19.41 ? 46  ILE A CD1   1 
ATOM   348  N  N     . LEU A 1 49  ? 8.630   24.602 116.167 1.00 17.83 ? 47  LEU A N     1 
ATOM   349  C  CA    . LEU A 1 49  ? 7.551   23.873 116.832 1.00 19.92 ? 47  LEU A CA    1 
ATOM   350  C  C     . LEU A 1 49  ? 6.492   23.474 115.804 1.00 19.82 ? 47  LEU A C     1 
ATOM   351  O  O     . LEU A 1 49  ? 5.985   22.350 115.825 1.00 20.74 ? 47  LEU A O     1 
ATOM   352  C  CB    . LEU A 1 49  ? 6.892   24.741 117.910 1.00 19.87 ? 47  LEU A CB    1 
ATOM   353  C  CG    . LEU A 1 49  ? 7.516   24.750 119.305 1.00 21.41 ? 47  LEU A CG    1 
ATOM   354  C  CD1   . LEU A 1 49  ? 7.047   25.983 120.076 1.00 22.24 ? 47  LEU A CD1   1 
ATOM   355  C  CD2   . LEU A 1 49  ? 7.114   23.464 120.034 1.00 21.75 ? 47  LEU A CD2   1 
ATOM   356  N  N     . SER A 1 50  ? 6.166   24.393 114.896 1.00 18.79 ? 48  SER A N     1 
ATOM   357  C  CA    . SER A 1 50  ? 5.160   24.113 113.873 1.00 19.67 ? 48  SER A CA    1 
ATOM   358  C  C     . SER A 1 50  ? 5.671   23.043 112.909 1.00 19.82 ? 48  SER A C     1 
ATOM   359  O  O     . SER A 1 50  ? 4.892   22.243 112.401 1.00 18.72 ? 48  SER A O     1 
ATOM   360  C  CB    . SER A 1 50  ? 4.800   25.392 113.096 1.00 20.67 ? 48  SER A CB    1 
ATOM   361  O  OG    . SER A 1 50  ? 5.867   25.823 112.262 1.00 24.52 ? 48  SER A OG    1 
ATOM   362  N  N     . ARG A 1 51  ? 6.976   23.029 112.657 1.00 19.58 ? 49  ARG A N     1 
ATOM   363  C  CA    . ARG A 1 51  ? 7.548   22.024 111.763 1.00 20.89 ? 49  ARG A CA    1 
ATOM   364  C  C     . ARG A 1 51  ? 7.486   20.620 112.374 1.00 21.79 ? 49  ARG A C     1 
ATOM   365  O  O     . ARG A 1 51  ? 7.498   19.618 111.647 1.00 20.40 ? 49  ARG A O     1 
ATOM   366  C  CB    . ARG A 1 51  ? 8.996   22.363 111.422 1.00 20.85 ? 49  ARG A CB    1 
ATOM   367  C  CG    . ARG A 1 51  ? 9.158   23.487 110.410 1.00 20.67 ? 49  ARG A CG    1 
ATOM   368  C  CD    . ARG A 1 51  ? 10.639  23.663 110.073 1.00 23.42 ? 49  ARG A CD    1 
ATOM   369  N  NE    . ARG A 1 51  ? 10.870  24.758 109.134 1.00 19.93 ? 49  ARG A NE    1 
ATOM   370  C  CZ    . ARG A 1 51  ? 12.018  24.958 108.498 1.00 22.29 ? 49  ARG A CZ    1 
ATOM   371  N  NH1   . ARG A 1 51  ? 13.043  24.136 108.702 1.00 18.27 ? 49  ARG A NH1   1 
ATOM   372  N  NH2   . ARG A 1 51  ? 12.137  25.973 107.644 1.00 20.12 ? 49  ARG A NH2   1 
ATOM   373  N  N     . CYS A 1 52  ? 7.427   20.555 113.702 1.00 21.02 ? 50  CYS A N     1 
ATOM   374  C  CA    . CYS A 1 52  ? 7.342   19.282 114.421 1.00 23.82 ? 50  CYS A CA    1 
ATOM   375  C  C     . CYS A 1 52  ? 5.899   18.785 114.435 1.00 24.94 ? 50  CYS A C     1 
ATOM   376  O  O     . CYS A 1 52  ? 5.606   17.705 114.954 1.00 27.74 ? 50  CYS A O     1 
ATOM   377  C  CB    . CYS A 1 52  ? 7.816   19.438 115.873 1.00 22.56 ? 50  CYS A CB    1 
ATOM   378  S  SG    . CYS A 1 52  ? 9.568   19.763 116.118 1.00 24.62 ? 50  CYS A SG    1 
ATOM   379  N  N     . GLY A 1 53  ? 4.993   19.585 113.884 1.00 25.43 ? 51  GLY A N     1 
ATOM   380  C  CA    . GLY A 1 53  ? 3.598   19.194 113.848 1.00 24.08 ? 51  GLY A CA    1 
ATOM   381  C  C     . GLY A 1 53  ? 2.767   19.700 115.014 1.00 24.86 ? 51  GLY A C     1 
ATOM   382  O  O     . GLY A 1 53  ? 1.647   19.234 115.225 1.00 24.32 ? 51  GLY A O     1 
ATOM   383  N  N     . ILE A 1 54  ? 3.305   20.641 115.783 1.00 22.21 ? 52  ILE A N     1 
ATOM   384  C  CA    . ILE A 1 54  ? 2.560   21.202 116.909 1.00 21.52 ? 52  ILE A CA    1 
ATOM   385  C  C     . ILE A 1 54  ? 1.811   22.418 116.365 1.00 22.01 ? 52  ILE A C     1 
ATOM   386  O  O     . ILE A 1 54  ? 2.416   23.279 115.721 1.00 21.01 ? 52  ILE A O     1 
ATOM   387  C  CB    . ILE A 1 54  ? 3.504   21.676 118.042 1.00 21.68 ? 52  ILE A CB    1 
ATOM   388  C  CG1   . ILE A 1 54  ? 4.385   20.518 118.525 1.00 21.87 ? 52  ILE A CG1   1 
ATOM   389  C  CG2   . ILE A 1 54  ? 2.680   22.241 119.200 1.00 22.40 ? 52  ILE A CG2   1 
ATOM   390  C  CD1   . ILE A 1 54  ? 3.621   19.375 119.163 1.00 22.16 ? 52  ILE A CD1   1 
ATOM   391  N  N     . GLU A 1 55  ? 0.501   22.482 116.591 1.00 22.75 ? 53  GLU A N     1 
ATOM   392  C  CA    . GLU A 1 55  ? -0.269  23.627 116.106 1.00 24.15 ? 53  GLU A CA    1 
ATOM   393  C  C     . GLU A 1 55  ? 0.224   24.814 116.914 1.00 24.06 ? 53  GLU A C     1 
ATOM   394  O  O     . GLU A 1 55  ? -0.007  24.901 118.125 1.00 24.59 ? 53  GLU A O     1 
ATOM   395  C  CB    . GLU A 1 55  ? -1.771  23.423 116.317 1.00 26.54 ? 53  GLU A CB    1 
ATOM   396  C  CG    . GLU A 1 55  ? -2.611  24.483 115.616 1.00 30.43 ? 53  GLU A CG    1 
ATOM   397  C  CD    . GLU A 1 55  ? -4.111  24.295 115.816 1.00 33.99 ? 53  GLU A CD    1 
ATOM   398  O  OE1   . GLU A 1 55  ? -4.550  23.153 116.087 1.00 33.84 ? 53  GLU A OE1   1 
ATOM   399  O  OE2   . GLU A 1 55  ? -4.852  25.293 115.685 1.00 33.22 ? 53  GLU A OE2   1 
ATOM   400  N  N     . THR A 1 56  ? 0.902   25.728 116.230 1.00 24.90 ? 54  THR A N     1 
ATOM   401  C  CA    . THR A 1 56  ? 1.510   26.877 116.883 1.00 26.10 ? 54  THR A CA    1 
ATOM   402  C  C     . THR A 1 56  ? 1.064   28.224 116.335 1.00 26.94 ? 54  THR A C     1 
ATOM   403  O  O     . THR A 1 56  ? 0.913   28.400 115.124 1.00 24.96 ? 54  THR A O     1 
ATOM   404  C  CB    . THR A 1 56  ? 3.043   26.794 116.739 1.00 26.66 ? 54  THR A CB    1 
ATOM   405  O  OG1   . THR A 1 56  ? 3.487   25.497 117.156 1.00 27.90 ? 54  THR A OG1   1 
ATOM   406  C  CG2   . THR A 1 56  ? 3.731   27.861 117.575 1.00 26.24 ? 54  THR A CG2   1 
ATOM   407  N  N     . ARG A 1 57  ? 0.875   29.172 117.245 1.00 25.46 ? 55  ARG A N     1 
ATOM   408  C  CA    . ARG A 1 57  ? 0.488   30.512 116.874 1.00 25.89 ? 55  ARG A CA    1 
ATOM   409  C  C     . ARG A 1 57  ? 1.598   31.458 117.328 1.00 24.95 ? 55  ARG A C     1 
ATOM   410  O  O     . ARG A 1 57  ? 1.966   31.481 118.506 1.00 24.05 ? 55  ARG A O     1 
ATOM   411  C  CB    . ARG A 1 57  ? -0.835  30.877 117.542 1.00 29.96 ? 55  ARG A CB    1 
ATOM   412  C  CG    . ARG A 1 57  ? -1.481  32.117 116.970 1.00 35.33 ? 55  ARG A CG    1 
ATOM   413  C  CD    . ARG A 1 57  ? -2.882  32.305 117.522 1.00 39.04 ? 55  ARG A CD    1 
ATOM   414  N  NE    . ARG A 1 57  ? -3.783  31.226 117.121 1.00 40.95 ? 55  ARG A NE    1 
ATOM   415  C  CZ    . ARG A 1 57  ? -5.065  31.169 117.463 1.00 42.54 ? 55  ARG A CZ    1 
ATOM   416  N  NH1   . ARG A 1 57  ? -5.598  32.131 118.213 1.00 38.51 ? 55  ARG A NH1   1 
ATOM   417  N  NH2   . ARG A 1 57  ? -5.814  30.149 117.059 1.00 44.56 ? 55  ARG A NH2   1 
ATOM   418  N  N     . LEU A 1 58  ? 2.156   32.213 116.388 1.00 21.26 ? 56  LEU A N     1 
ATOM   419  C  CA    . LEU A 1 58  ? 3.208   33.164 116.717 1.00 21.74 ? 56  LEU A CA    1 
ATOM   420  C  C     . LEU A 1 58  ? 2.560   34.534 116.784 1.00 22.43 ? 56  LEU A C     1 
ATOM   421  O  O     . LEU A 1 58  ? 1.990   35.018 115.798 1.00 21.16 ? 56  LEU A O     1 
ATOM   422  C  CB    . LEU A 1 58  ? 4.319   33.173 115.656 1.00 22.30 ? 56  LEU A CB    1 
ATOM   423  C  CG    . LEU A 1 58  ? 5.376   34.281 115.782 1.00 20.99 ? 56  LEU A CG    1 
ATOM   424  C  CD1   . LEU A 1 58  ? 6.160   34.131 117.076 1.00 20.73 ? 56  LEU A CD1   1 
ATOM   425  C  CD2   . LEU A 1 58  ? 6.323   34.227 114.574 1.00 23.06 ? 56  LEU A CD2   1 
ATOM   426  N  N     . ILE A 1 59  ? 2.634   35.138 117.963 1.00 22.36 ? 57  ILE A N     1 
ATOM   427  C  CA    . ILE A 1 59  ? 2.070   36.451 118.199 1.00 23.35 ? 57  ILE A CA    1 
ATOM   428  C  C     . ILE A 1 59  ? 3.250   37.393 118.283 1.00 24.01 ? 57  ILE A C     1 
ATOM   429  O  O     . ILE A 1 59  ? 3.924   37.474 119.309 1.00 23.07 ? 57  ILE A O     1 
ATOM   430  C  CB    . ILE A 1 59  ? 1.276   36.469 119.517 1.00 23.46 ? 57  ILE A CB    1 
ATOM   431  C  CG1   . ILE A 1 59  ? 0.122   35.470 119.424 1.00 25.11 ? 57  ILE A CG1   1 
ATOM   432  C  CG2   . ILE A 1 59  ? 0.752   37.865 119.795 1.00 25.50 ? 57  ILE A CG2   1 
ATOM   433  C  CD1   . ILE A 1 59  ? -0.625  35.258 120.720 1.00 25.62 ? 57  ILE A CD1   1 
ATOM   434  N  N     . ALA A 1 60  ? 3.507   38.097 117.185 1.00 24.28 ? 58  ALA A N     1 
ATOM   435  C  CA    . ALA A 1 60  ? 4.631   39.015 117.121 1.00 23.37 ? 58  ALA A CA    1 
ATOM   436  C  C     . ALA A 1 60  ? 4.300   40.157 116.166 1.00 24.35 ? 58  ALA A C     1 
ATOM   437  O  O     . ALA A 1 60  ? 3.490   39.996 115.254 1.00 26.56 ? 58  ALA A O     1 
ATOM   438  C  CB    . ALA A 1 60  ? 5.872   38.271 116.653 1.00 22.34 ? 58  ALA A CB    1 
ATOM   439  N  N     . ALA A 1 61  ? 4.932   41.306 116.376 1.00 24.02 ? 59  ALA A N     1 
ATOM   440  C  CA    . ALA A 1 61  ? 4.663   42.476 115.551 1.00 25.42 ? 59  ALA A CA    1 
ATOM   441  C  C     . ALA A 1 61  ? 5.662   42.729 114.430 1.00 27.07 ? 59  ALA A C     1 
ATOM   442  O  O     . ALA A 1 61  ? 6.861   42.501 114.582 1.00 27.62 ? 59  ALA A O     1 
ATOM   443  C  CB    . ALA A 1 61  ? 4.574   43.718 116.440 1.00 24.77 ? 59  ALA A CB    1 
ATOM   444  N  N     . THR A 1 62  ? 5.140   43.202 113.303 1.00 29.38 ? 60  THR A N     1 
ATOM   445  C  CA    . THR A 1 62  ? 5.946   43.561 112.140 1.00 30.42 ? 60  THR A CA    1 
ATOM   446  C  C     . THR A 1 62  ? 5.579   45.012 111.816 1.00 31.00 ? 60  THR A C     1 
ATOM   447  O  O     . THR A 1 62  ? 4.512   45.489 112.209 1.00 30.26 ? 60  THR A O     1 
ATOM   448  C  CB    . THR A 1 62  ? 5.633   42.672 110.920 1.00 31.39 ? 60  THR A CB    1 
ATOM   449  O  OG1   . THR A 1 62  ? 4.295   42.918 110.475 1.00 30.40 ? 60  THR A OG1   1 
ATOM   450  C  CG2   . THR A 1 62  ? 5.791   41.194 111.283 1.00 33.00 ? 60  THR A CG2   1 
ATOM   451  N  N     . GLY A 1 63  ? 6.458   45.713 111.106 1.00 32.18 ? 61  GLY A N     1 
ATOM   452  C  CA    . GLY A 1 63  ? 6.203   47.109 110.781 1.00 31.83 ? 61  GLY A CA    1 
ATOM   453  C  C     . GLY A 1 63  ? 5.811   47.356 109.341 1.00 33.32 ? 61  GLY A C     1 
ATOM   454  O  O     . GLY A 1 63  ? 5.654   46.417 108.557 1.00 33.64 ? 61  GLY A O     1 
ATOM   455  N  N     . ASN A 1 64  ? 5.668   48.627 108.982 1.00 34.55 ? 62  ASN A N     1 
ATOM   456  C  CA    . ASN A 1 64  ? 5.269   48.984 107.628 1.00 37.01 ? 62  ASN A CA    1 
ATOM   457  C  C     . ASN A 1 64  ? 6.427   49.376 106.718 1.00 36.81 ? 62  ASN A C     1 
ATOM   458  O  O     . ASN A 1 64  ? 6.331   50.356 105.980 1.00 37.48 ? 62  ASN A O     1 
ATOM   459  C  CB    . ASN A 1 64  ? 4.236   50.117 107.667 1.00 39.67 ? 62  ASN A CB    1 
ATOM   460  C  CG    . ASN A 1 64  ? 4.774   51.380 108.311 1.00 42.15 ? 62  ASN A CG    1 
ATOM   461  O  OD1   . ASN A 1 64  ? 5.811   51.361 108.970 1.00 45.71 ? 62  ASN A OD1   1 
ATOM   462  N  ND2   . ASN A 1 64  ? 4.060   52.487 108.131 1.00 45.16 ? 62  ASN A ND2   1 
ATOM   463  N  N     . ASP A 1 65  ? 7.515   48.610 106.763 1.00 33.88 ? 63  ASP A N     1 
ATOM   464  C  CA    . ASP A 1 65  ? 8.668   48.881 105.914 1.00 32.55 ? 63  ASP A CA    1 
ATOM   465  C  C     . ASP A 1 65  ? 8.941   47.671 105.025 1.00 31.92 ? 63  ASP A C     1 
ATOM   466  O  O     . ASP A 1 65  ? 8.188   46.696 105.044 1.00 30.04 ? 63  ASP A O     1 
ATOM   467  C  CB    . ASP A 1 65  ? 9.903   49.199 106.757 1.00 32.29 ? 63  ASP A CB    1 
ATOM   468  C  CG    . ASP A 1 65  ? 10.090  48.222 107.885 1.00 34.55 ? 63  ASP A CG    1 
ATOM   469  O  OD1   . ASP A 1 65  ? 9.480   47.134 107.820 1.00 31.12 ? 63  ASP A OD1   1 
ATOM   470  O  OD2   . ASP A 1 65  ? 10.846  48.544 108.824 1.00 34.10 ? 63  ASP A OD2   1 
ATOM   471  N  N     . SER A 1 66  ? 10.013  47.738 104.244 1.00 31.01 ? 64  SER A N     1 
ATOM   472  C  CA    . SER A 1 66  ? 10.352  46.648 103.343 1.00 33.53 ? 64  SER A CA    1 
ATOM   473  C  C     . SER A 1 66  ? 10.621  45.335 104.085 1.00 31.96 ? 64  SER A C     1 
ATOM   474  O  O     . SER A 1 66  ? 10.196  44.273 103.637 1.00 32.04 ? 64  SER A O     1 
ATOM   475  C  CB    . SER A 1 66  ? 11.556  47.034 102.476 1.00 35.17 ? 64  SER A CB    1 
ATOM   476  O  OG    . SER A 1 66  ? 12.653  47.454 103.271 1.00 39.77 ? 64  SER A OG    1 
ATOM   477  N  N     . ASN A 1 67  ? 11.324  45.397 105.212 1.00 30.83 ? 65  ASN A N     1 
ATOM   478  C  CA    . ASN A 1 67  ? 11.597  44.178 105.972 1.00 30.19 ? 65  ASN A CA    1 
ATOM   479  C  C     . ASN A 1 67  ? 10.294  43.570 106.489 1.00 29.55 ? 65  ASN A C     1 
ATOM   480  O  O     . ASN A 1 67  ? 10.172  42.350 106.625 1.00 29.70 ? 65  ASN A O     1 
ATOM   481  C  CB    . ASN A 1 67  ? 12.542  44.469 107.142 1.00 30.05 ? 65  ASN A CB    1 
ATOM   482  C  CG    . ASN A 1 67  ? 13.982  44.632 106.698 1.00 30.48 ? 65  ASN A CG    1 
ATOM   483  O  OD1   . ASN A 1 67  ? 14.304  44.459 105.522 1.00 32.96 ? 65  ASN A OD1   1 
ATOM   484  N  ND2   . ASN A 1 67  ? 14.858  44.960 107.639 1.00 30.44 ? 65  ASN A ND2   1 
ATOM   485  N  N     . GLY A 1 68  ? 9.317   44.427 106.767 1.00 29.29 ? 66  GLY A N     1 
ATOM   486  C  CA    . GLY A 1 68  ? 8.035   43.953 107.251 1.00 28.65 ? 66  GLY A CA    1 
ATOM   487  C  C     . GLY A 1 68  ? 7.289   43.133 106.225 1.00 30.39 ? 66  GLY A C     1 
ATOM   488  O  O     . GLY A 1 68  ? 6.787   42.052 106.527 1.00 27.77 ? 66  GLY A O     1 
ATOM   489  N  N     . ALA A 1 69  ? 7.202   43.655 105.007 1.00 29.23 ? 67  ALA A N     1 
ATOM   490  C  CA    . ALA A 1 69  ? 6.513   42.948 103.939 1.00 30.17 ? 67  ALA A CA    1 
ATOM   491  C  C     . ALA A 1 69  ? 7.229   41.628 103.672 1.00 29.17 ? 67  ALA A C     1 
ATOM   492  O  O     . ALA A 1 69  ? 6.590   40.605 103.453 1.00 31.23 ? 67  ALA A O     1 
ATOM   493  C  CB    . ALA A 1 69  ? 6.488   43.805 102.672 1.00 30.35 ? 67  ALA A CB    1 
ATOM   494  N  N     . TRP A 1 70  ? 8.558   41.659 103.700 1.00 29.63 ? 68  TRP A N     1 
ATOM   495  C  CA    . TRP A 1 70  ? 9.362   40.465 103.457 1.00 29.04 ? 68  TRP A CA    1 
ATOM   496  C  C     . TRP A 1 70  ? 9.063   39.395 104.508 1.00 28.69 ? 68  TRP A C     1 
ATOM   497  O  O     . TRP A 1 70  ? 8.901   38.215 104.180 1.00 26.98 ? 68  TRP A O     1 
ATOM   498  C  CB    . TRP A 1 70  ? 10.851  40.810 103.496 1.00 32.66 ? 68  TRP A CB    1 
ATOM   499  C  CG    . TRP A 1 70  ? 11.738  39.744 102.921 1.00 37.05 ? 68  TRP A CG    1 
ATOM   500  C  CD1   . TRP A 1 70  ? 11.951  39.480 101.596 1.00 39.00 ? 68  TRP A CD1   1 
ATOM   501  C  CD2   . TRP A 1 70  ? 12.520  38.790 103.649 1.00 37.68 ? 68  TRP A CD2   1 
ATOM   502  N  NE1   . TRP A 1 70  ? 12.819  38.423 101.456 1.00 38.98 ? 68  TRP A NE1   1 
ATOM   503  C  CE2   . TRP A 1 70  ? 13.183  37.981 102.700 1.00 39.37 ? 68  TRP A CE2   1 
ATOM   504  C  CE3   . TRP A 1 70  ? 12.723  38.539 105.012 1.00 38.23 ? 68  TRP A CE3   1 
ATOM   505  C  CZ2   . TRP A 1 70  ? 14.037  36.939 103.071 1.00 39.75 ? 68  TRP A CZ2   1 
ATOM   506  C  CZ3   . TRP A 1 70  ? 13.574  37.501 105.380 1.00 39.37 ? 68  TRP A CZ3   1 
ATOM   507  C  CH2   . TRP A 1 70  ? 14.219  36.715 104.412 1.00 40.24 ? 68  TRP A CH2   1 
ATOM   508  N  N     . ILE A 1 71  ? 9.004   39.807 105.771 1.00 26.82 ? 69  ILE A N     1 
ATOM   509  C  CA    . ILE A 1 71  ? 8.709   38.873 106.853 1.00 26.15 ? 69  ILE A CA    1 
ATOM   510  C  C     . ILE A 1 71  ? 7.349   38.225 106.602 1.00 26.02 ? 69  ILE A C     1 
ATOM   511  O  O     . ILE A 1 71  ? 7.225   36.998 106.573 1.00 25.27 ? 69  ILE A O     1 
ATOM   512  C  CB    . ILE A 1 71  ? 8.654   39.584 108.230 1.00 23.28 ? 69  ILE A CB    1 
ATOM   513  C  CG1   . ILE A 1 71  ? 10.049  40.069 108.630 1.00 22.00 ? 69  ILE A CG1   1 
ATOM   514  C  CG2   . ILE A 1 71  ? 8.087   38.633 109.288 1.00 23.10 ? 69  ILE A CG2   1 
ATOM   515  C  CD1   . ILE A 1 71  ? 10.088  40.778 109.972 1.00 21.58 ? 69  ILE A CD1   1 
ATOM   516  N  N     . ARG A 1 72  ? 6.331   39.061 106.418 1.00 26.75 ? 70  ARG A N     1 
ATOM   517  C  CA    . ARG A 1 72  ? 4.979   38.570 106.198 1.00 30.12 ? 70  ARG A CA    1 
ATOM   518  C  C     . ARG A 1 72  ? 4.880   37.655 104.984 1.00 31.61 ? 70  ARG A C     1 
ATOM   519  O  O     . ARG A 1 72  ? 4.043   36.757 104.937 1.00 33.22 ? 70  ARG A O     1 
ATOM   520  C  CB    . ARG A 1 72  ? 4.004   39.746 106.085 1.00 30.75 ? 70  ARG A CB    1 
ATOM   521  C  CG    . ARG A 1 72  ? 3.872   40.541 107.393 1.00 32.21 ? 70  ARG A CG    1 
ATOM   522  C  CD    . ARG A 1 72  ? 2.729   41.547 107.346 1.00 33.01 ? 70  ARG A CD    1 
ATOM   523  N  NE    . ARG A 1 72  ? 3.001   42.665 106.449 1.00 33.57 ? 70  ARG A NE    1 
ATOM   524  C  CZ    . ARG A 1 72  ? 3.759   43.712 106.762 1.00 34.10 ? 70  ARG A CZ    1 
ATOM   525  N  NH1   . ARG A 1 72  ? 4.329   43.798 107.959 1.00 33.08 ? 70  ARG A NH1   1 
ATOM   526  N  NH2   . ARG A 1 72  ? 3.944   44.681 105.877 1.00 34.91 ? 70  ARG A NH2   1 
ATOM   527  N  N     . GLN A 1 73  ? 5.748   37.870 104.006 1.00 33.63 ? 71  GLN A N     1 
ATOM   528  C  CA    . GLN A 1 73  ? 5.738   37.037 102.813 1.00 34.70 ? 71  GLN A CA    1 
ATOM   529  C  C     . GLN A 1 73  ? 6.439   35.699 103.074 1.00 32.76 ? 71  GLN A C     1 
ATOM   530  O  O     . GLN A 1 73  ? 5.883   34.633 102.807 1.00 32.03 ? 71  GLN A O     1 
ATOM   531  C  CB    . GLN A 1 73  ? 6.420   37.787 101.666 1.00 38.44 ? 71  GLN A CB    1 
ATOM   532  C  CG    . GLN A 1 73  ? 6.643   36.981 100.404 1.00 41.53 ? 71  GLN A CG    1 
ATOM   533  C  CD    . GLN A 1 73  ? 8.104   36.614 100.215 1.00 46.65 ? 71  GLN A CD    1 
ATOM   534  O  OE1   . GLN A 1 73  ? 8.583   35.606 100.748 1.00 48.44 ? 71  GLN A OE1   1 
ATOM   535  N  NE2   . GLN A 1 73  ? 8.828   37.444 99.465  1.00 46.17 ? 71  GLN A NE2   1 
ATOM   536  N  N     . GLN A 1 74  ? 7.648   35.768 103.618 1.00 30.80 ? 72  GLN A N     1 
ATOM   537  C  CA    . GLN A 1 74  ? 8.443   34.577 103.906 1.00 30.85 ? 72  GLN A CA    1 
ATOM   538  C  C     . GLN A 1 74  ? 7.837   33.647 104.960 1.00 29.75 ? 72  GLN A C     1 
ATOM   539  O  O     . GLN A 1 74  ? 8.029   32.434 104.904 1.00 27.33 ? 72  GLN A O     1 
ATOM   540  C  CB    . GLN A 1 74  ? 9.848   34.995 104.348 1.00 33.73 ? 72  GLN A CB    1 
ATOM   541  C  CG    . GLN A 1 74  ? 10.610  35.787 103.290 1.00 39.44 ? 72  GLN A CG    1 
ATOM   542  C  CD    . GLN A 1 74  ? 11.006  34.936 102.095 1.00 44.16 ? 72  GLN A CD    1 
ATOM   543  O  OE1   . GLN A 1 74  ? 11.069  35.422 100.967 1.00 47.73 ? 72  GLN A OE1   1 
ATOM   544  N  NE2   . GLN A 1 74  ? 11.290  33.661 102.340 1.00 46.51 ? 72  GLN A NE2   1 
ATOM   545  N  N     . ILE A 1 75  ? 7.106   34.207 105.918 1.00 27.78 ? 73  ILE A N     1 
ATOM   546  C  CA    . ILE A 1 75  ? 6.511   33.388 106.969 1.00 27.68 ? 73  ILE A CA    1 
ATOM   547  C  C     . ILE A 1 75  ? 5.413   32.471 106.420 1.00 28.21 ? 73  ILE A C     1 
ATOM   548  O  O     . ILE A 1 75  ? 5.101   31.439 107.017 1.00 26.45 ? 73  ILE A O     1 
ATOM   549  C  CB    . ILE A 1 75  ? 5.922   34.269 108.098 1.00 27.64 ? 73  ILE A CB    1 
ATOM   550  C  CG1   . ILE A 1 75  ? 5.651   33.416 109.339 1.00 27.83 ? 73  ILE A CG1   1 
ATOM   551  C  CG2   . ILE A 1 75  ? 4.631   34.930 107.629 1.00 29.02 ? 73  ILE A CG2   1 
ATOM   552  C  CD1   . ILE A 1 75  ? 6.908   32.924 110.012 1.00 29.86 ? 73  ILE A CD1   1 
ATOM   553  N  N     . LYS A 1 76  ? 4.832   32.848 105.283 1.00 28.97 ? 74  LYS A N     1 
ATOM   554  C  CA    . LYS A 1 76  ? 3.776   32.053 104.660 1.00 30.23 ? 74  LYS A CA    1 
ATOM   555  C  C     . LYS A 1 76  ? 4.273   30.677 104.225 1.00 29.54 ? 74  LYS A C     1 
ATOM   556  O  O     . LYS A 1 76  ? 3.472   29.773 103.983 1.00 30.08 ? 74  LYS A O     1 
ATOM   557  C  CB    . LYS A 1 76  ? 3.200   32.782 103.443 1.00 33.60 ? 74  LYS A CB    1 
ATOM   558  C  CG    . LYS A 1 76  ? 2.393   34.037 103.776 1.00 38.92 ? 74  LYS A CG    1 
ATOM   559  C  CD    . LYS A 1 76  ? 1.871   34.706 102.507 1.00 41.58 ? 74  LYS A CD    1 
ATOM   560  C  CE    . LYS A 1 76  ? 0.974   33.758 101.710 1.00 45.62 ? 74  LYS A CE    1 
ATOM   561  N  NZ    . LYS A 1 76  ? 0.515   34.327 100.407 1.00 47.09 ? 74  LYS A NZ    1 
ATOM   562  N  N     . ASN A 1 77  ? 5.589   30.521 104.113 1.00 28.49 ? 75  ASN A N     1 
ATOM   563  C  CA    . ASN A 1 77  ? 6.152   29.234 103.722 1.00 27.47 ? 75  ASN A CA    1 
ATOM   564  C  C     . ASN A 1 77  ? 6.187   28.247 104.889 1.00 27.39 ? 75  ASN A C     1 
ATOM   565  O  O     . ASN A 1 77  ? 6.443   27.063 104.688 1.00 27.59 ? 75  ASN A O     1 
ATOM   566  C  CB    . ASN A 1 77  ? 7.570   29.391 103.173 1.00 26.68 ? 75  ASN A CB    1 
ATOM   567  C  CG    . ASN A 1 77  ? 7.609   30.145 101.860 1.00 28.28 ? 75  ASN A CG    1 
ATOM   568  O  OD1   . ASN A 1 77  ? 6.722   29.995 101.014 1.00 27.48 ? 75  ASN A OD1   1 
ATOM   569  N  ND2   . ASN A 1 77  ? 8.647   30.946 101.673 1.00 26.54 ? 75  ASN A ND2   1 
ATOM   570  N  N     . GLU A 1 78  ? 5.935   28.731 106.103 1.00 26.25 ? 76  GLU A N     1 
ATOM   571  C  CA    . GLU A 1 78  ? 5.959   27.862 107.282 1.00 25.43 ? 76  GLU A CA    1 
ATOM   572  C  C     . GLU A 1 78  ? 4.541   27.528 107.755 1.00 27.11 ? 76  GLU A C     1 
ATOM   573  O  O     . GLU A 1 78  ? 3.625   28.350 107.651 1.00 27.25 ? 76  GLU A O     1 
ATOM   574  C  CB    . GLU A 1 78  ? 6.760   28.519 108.413 1.00 25.22 ? 76  GLU A CB    1 
ATOM   575  C  CG    . GLU A 1 78  ? 8.231   28.804 108.088 1.00 25.90 ? 76  GLU A CG    1 
ATOM   576  C  CD    . GLU A 1 78  ? 9.040   27.551 107.764 1.00 28.32 ? 76  GLU A CD    1 
ATOM   577  O  OE1   . GLU A 1 78  ? 8.724   26.461 108.289 1.00 24.66 ? 76  GLU A OE1   1 
ATOM   578  O  OE2   . GLU A 1 78  ? 10.016  27.655 106.992 1.00 29.52 ? 76  GLU A OE2   1 
ATOM   579  N  N     . PRO A 1 79  ? 4.345   26.309 108.289 1.00 27.62 ? 77  PRO A N     1 
ATOM   580  C  CA    . PRO A 1 79  ? 3.054   25.811 108.783 1.00 29.50 ? 77  PRO A CA    1 
ATOM   581  C  C     . PRO A 1 79  ? 2.622   26.448 110.096 1.00 31.28 ? 77  PRO A C     1 
ATOM   582  O  O     . PRO A 1 79  ? 2.043   25.799 110.963 1.00 31.87 ? 77  PRO A O     1 
ATOM   583  C  CB    . PRO A 1 79  ? 3.306   24.315 108.922 1.00 28.22 ? 77  PRO A CB    1 
ATOM   584  C  CG    . PRO A 1 79  ? 4.730   24.283 109.386 1.00 27.20 ? 77  PRO A CG    1 
ATOM   585  C  CD    . PRO A 1 79  ? 5.403   25.300 108.486 1.00 28.30 ? 77  PRO A CD    1 
ATOM   586  N  N     . LEU A 1 80  ? 2.891   27.736 110.212 1.00 34.87 ? 78  LEU A N     1 
ATOM   587  C  CA    . LEU A 1 80  ? 2.598   28.505 111.409 1.00 37.42 ? 78  LEU A CA    1 
ATOM   588  C  C     . LEU A 1 80  ? 1.648   29.644 111.073 1.00 38.22 ? 78  LEU A C     1 
ATOM   589  O  O     . LEU A 1 80  ? 1.553   30.068 109.927 1.00 37.58 ? 78  LEU A O     1 
ATOM   590  C  CB    . LEU A 1 80  ? 3.920   29.064 111.937 1.00 39.45 ? 78  LEU A CB    1 
ATOM   591  C  CG    . LEU A 1 80  ? 3.985   29.998 113.139 1.00 41.60 ? 78  LEU A CG    1 
ATOM   592  C  CD1   . LEU A 1 80  ? 3.534   29.267 114.380 1.00 43.24 ? 78  LEU A CD1   1 
ATOM   593  C  CD2   . LEU A 1 80  ? 5.413   30.485 113.315 1.00 40.70 ? 78  LEU A CD2   1 
HETATM 594  N  N     . MSE A 1 81  ? 0.952   30.140 112.082 1.00 38.78 ? 79  MSE A N     1 
HETATM 595  C  CA    . MSE A 1 81  ? 0.034   31.246 111.895 1.00 39.51 ? 79  MSE A CA    1 
HETATM 596  C  C     . MSE A 1 81  ? 0.698   32.447 112.575 1.00 37.38 ? 79  MSE A C     1 
HETATM 597  O  O     . MSE A 1 81  ? 1.117   32.349 113.727 1.00 32.94 ? 79  MSE A O     1 
HETATM 598  C  CB    . MSE A 1 81  ? -1.302  30.912 112.565 1.00 46.44 ? 79  MSE A CB    1 
HETATM 599  C  CG    . MSE A 1 81  ? -2.484  31.754 112.121 1.00 54.13 ? 79  MSE A CG    1 
HETATM 600  SE SE    . MSE A 1 81  ? -4.135  31.188 112.993 1.00 67.82 ? 79  MSE A SE    1 
HETATM 601  C  CE    . MSE A 1 81  ? -4.328  29.454 112.170 1.00 61.48 ? 79  MSE A CE    1 
ATOM   602  N  N     . LEU A 1 82  ? 0.826   33.561 111.857 1.00 33.92 ? 80  LEU A N     1 
ATOM   603  C  CA    . LEU A 1 82  ? 1.434   34.760 112.426 1.00 34.19 ? 80  LEU A CA    1 
ATOM   604  C  C     . LEU A 1 82  ? 0.361   35.791 112.730 1.00 34.35 ? 80  LEU A C     1 
ATOM   605  O  O     . LEU A 1 82  ? -0.331  36.261 111.829 1.00 33.20 ? 80  LEU A O     1 
ATOM   606  C  CB    . LEU A 1 82  ? 2.457   35.378 111.466 1.00 32.59 ? 80  LEU A CB    1 
ATOM   607  C  CG    . LEU A 1 82  ? 2.957   36.764 111.905 1.00 30.63 ? 80  LEU A CG    1 
ATOM   608  C  CD1   . LEU A 1 82  ? 3.698   36.658 113.236 1.00 29.57 ? 80  LEU A CD1   1 
ATOM   609  C  CD2   . LEU A 1 82  ? 3.859   37.352 110.840 1.00 29.94 ? 80  LEU A CD2   1 
ATOM   610  N  N     . LEU A 1 83  ? 0.232   36.150 114.001 1.00 34.12 ? 81  LEU A N     1 
ATOM   611  C  CA    . LEU A 1 83  ? -0.766  37.131 114.406 1.00 35.24 ? 81  LEU A CA    1 
ATOM   612  C  C     . LEU A 1 83  ? -0.135  38.325 115.105 1.00 35.21 ? 81  LEU A C     1 
ATOM   613  O  O     . LEU A 1 83  ? 0.867   38.189 115.806 1.00 35.22 ? 81  LEU A O     1 
ATOM   614  C  CB    . LEU A 1 83  ? -1.801  36.478 115.324 1.00 36.33 ? 81  LEU A CB    1 
ATOM   615  C  CG    . LEU A 1 83  ? -2.663  35.398 114.666 1.00 38.09 ? 81  LEU A CG    1 
ATOM   616  C  CD1   . LEU A 1 83  ? -3.581  34.780 115.705 1.00 39.58 ? 81  LEU A CD1   1 
ATOM   617  C  CD2   . LEU A 1 83  ? -3.478  36.006 113.533 1.00 37.61 ? 81  LEU A CD2   1 
ATOM   618  N  N     . PRO A 1 84  ? -0.715  39.519 114.913 1.00 36.81 ? 82  PRO A N     1 
ATOM   619  C  CA    . PRO A 1 84  ? -1.902  39.746 114.082 1.00 38.67 ? 82  PRO A CA    1 
ATOM   620  C  C     . PRO A 1 84  ? -1.522  39.958 112.620 1.00 40.78 ? 82  PRO A C     1 
ATOM   621  O  O     . PRO A 1 84  ? -0.346  40.137 112.302 1.00 39.98 ? 82  PRO A O     1 
ATOM   622  C  CB    . PRO A 1 84  ? -2.497  41.006 114.691 1.00 38.50 ? 82  PRO A CB    1 
ATOM   623  C  CG    . PRO A 1 84  ? -1.262  41.803 114.988 1.00 37.29 ? 82  PRO A CG    1 
ATOM   624  C  CD    . PRO A 1 84  ? -0.322  40.761 115.604 1.00 36.86 ? 82  PRO A CD    1 
ATOM   625  N  N     . ASP A 1 85  ? -2.514  39.928 111.734 1.00 44.56 ? 83  ASP A N     1 
ATOM   626  C  CA    . ASP A 1 85  ? -2.256  40.165 110.316 1.00 48.48 ? 83  ASP A CA    1 
ATOM   627  C  C     . ASP A 1 85  ? -2.060  41.667 110.161 1.00 49.04 ? 83  ASP A C     1 
ATOM   628  O  O     . ASP A 1 85  ? -2.287  42.426 111.099 1.00 49.43 ? 83  ASP A O     1 
ATOM   629  C  CB    . ASP A 1 85  ? -3.439  39.722 109.451 1.00 51.62 ? 83  ASP A CB    1 
ATOM   630  C  CG    . ASP A 1 85  ? -3.695  38.233 109.528 1.00 54.71 ? 83  ASP A CG    1 
ATOM   631  O  OD1   . ASP A 1 85  ? -2.722  37.449 109.467 1.00 56.98 ? 83  ASP A OD1   1 
ATOM   632  O  OD2   . ASP A 1 85  ? -4.876  37.845 109.637 1.00 56.73 ? 83  ASP A OD2   1 
ATOM   633  N  N     . GLY A 1 86  ? -1.647  42.104 108.982 1.00 51.26 ? 84  GLY A N     1 
ATOM   634  C  CA    . GLY A 1 86  ? -1.437  43.525 108.791 1.00 51.96 ? 84  GLY A CA    1 
ATOM   635  C  C     . GLY A 1 86  ? -0.132  43.902 109.450 1.00 52.41 ? 84  GLY A C     1 
ATOM   636  O  O     . GLY A 1 86  ? 0.816   43.122 109.445 1.00 54.18 ? 84  GLY A O     1 
ATOM   637  N  N     . HIS A 1 87  ? -0.067  45.080 110.046 1.00 51.68 ? 85  HIS A N     1 
ATOM   638  C  CA    . HIS A 1 87  ? 1.173   45.477 110.666 1.00 50.81 ? 85  HIS A CA    1 
ATOM   639  C  C     . HIS A 1 87  ? 1.050   46.770 111.423 1.00 49.37 ? 85  HIS A C     1 
ATOM   640  O  O     . HIS A 1 87  ? -0.008  47.388 111.484 1.00 49.13 ? 85  HIS A O     1 
ATOM   641  C  CB    . HIS A 1 87  ? 2.259   45.622 109.601 1.00 51.95 ? 85  HIS A CB    1 
ATOM   642  C  CG    . HIS A 1 87  ? 1.847   46.461 108.433 1.00 53.19 ? 85  HIS A CG    1 
ATOM   643  N  ND1   . HIS A 1 87  ? 0.926   46.036 107.500 1.00 54.44 ? 85  HIS A ND1   1 
ATOM   644  C  CD2   . HIS A 1 87  ? 2.212   47.709 108.058 1.00 53.99 ? 85  HIS A CD2   1 
ATOM   645  C  CE1   . HIS A 1 87  ? 0.742   46.986 106.600 1.00 54.48 ? 85  HIS A CE1   1 
ATOM   646  N  NE2   . HIS A 1 87  ? 1.511   48.012 106.916 1.00 54.17 ? 85  HIS A NE2   1 
ATOM   647  N  N     . PHE A 1 88  ? 2.165   47.158 112.010 1.00 48.44 ? 86  PHE A N     1 
ATOM   648  C  CA    . PHE A 1 88  ? 2.260   48.388 112.754 1.00 48.40 ? 86  PHE A CA    1 
ATOM   649  C  C     . PHE A 1 88  ? 3.253   49.204 111.959 1.00 48.68 ? 86  PHE A C     1 
ATOM   650  O  O     . PHE A 1 88  ? 3.171   49.238 110.734 1.00 48.64 ? 86  PHE A O     1 
ATOM   651  C  CB    . PHE A 1 88  ? 2.765   48.102 114.159 1.00 47.74 ? 86  PHE A CB    1 
ATOM   652  C  CG    . PHE A 1 88  ? 1.874   47.175 114.919 1.00 47.46 ? 86  PHE A CG    1 
ATOM   653  C  CD1   . PHE A 1 88  ? 0.753   47.658 115.576 1.00 47.90 ? 86  PHE A CD1   1 
ATOM   654  C  CD2   . PHE A 1 88  ? 2.107   45.808 114.907 1.00 47.25 ? 86  PHE A CD2   1 
ATOM   655  C  CE1   . PHE A 1 88  ? -0.126  46.794 116.211 1.00 47.71 ? 86  PHE A CE1   1 
ATOM   656  C  CE2   . PHE A 1 88  ? 1.235   44.932 115.538 1.00 47.41 ? 86  PHE A CE2   1 
ATOM   657  C  CZ    . PHE A 1 88  ? 0.115   45.426 116.189 1.00 47.36 ? 86  PHE A CZ    1 
ATOM   658  N  N     . ASN A 1 89  ? 4.212   49.841 112.627 1.00 49.89 ? 87  ASN A N     1 
ATOM   659  C  CA    . ASN A 1 89  ? 5.188   50.709 111.934 1.00 49.10 ? 87  ASN A CA    1 
ATOM   660  C  C     . ASN A 1 89  ? 6.547   50.586 112.566 1.00 48.97 ? 87  ASN A C     1 
ATOM   661  O  O     . ASN A 1 89  ? 6.612   50.363 113.804 1.00 48.30 ? 87  ASN A O     1 
ATOM   662  C  CB    . ASN A 1 89  ? 4.696   52.142 112.085 1.00 49.41 ? 87  ASN A CB    1 
ATOM   663  C  CG    . ASN A 1 89  ? 3.192   52.248 111.993 1.00 50.32 ? 87  ASN A CG    1 
ATOM   664  O  OD1   . ASN A 1 89  ? 2.467   51.273 112.182 1.00 50.36 ? 87  ASN A OD1   1 
ATOM   665  N  ND2   . ASN A 1 89  ? 2.702   53.459 111.721 1.00 49.26 ? 87  ASN A ND2   1 
ATOM   666  N  N     . GLN A 1 90  ? 7.626   50.721 111.770 1.00 48.30 ? 88  GLN A N     1 
ATOM   667  C  CA    . GLN A 1 90  ? 8.977   50.655 112.320 1.00 48.18 ? 88  GLN A CA    1 
ATOM   668  C  C     . GLN A 1 90  ? 9.906   49.496 112.103 1.00 47.75 ? 88  GLN A C     1 
ATOM   669  O  O     . GLN A 1 90  ? 10.837  49.627 111.305 1.00 48.84 ? 88  GLN A O     1 
ATOM   670  C  CB    . GLN A 1 90  ? 8.840   51.007 113.743 1.00 51.59 ? 88  GLN A CB    1 
ATOM   671  C  CG    . GLN A 1 90  ? 8.280   52.377 113.864 1.00 53.66 ? 88  GLN A CG    1 
ATOM   672  C  CD    . GLN A 1 90  ? 9.358   53.215 114.374 1.00 54.98 ? 88  GLN A CD    1 
ATOM   673  O  OE1   . GLN A 1 90  ? 10.148  52.733 115.202 1.00 54.93 ? 88  GLN A OE1   1 
ATOM   674  N  NE2   . GLN A 1 90  ? 9.476   54.452 113.869 1.00 54.82 ? 88  GLN A NE2   1 
ATOM   675  N  N     . HIS A 1 91  ? 9.771   48.394 112.845 1.00 45.53 ? 89  HIS A N     1 
ATOM   676  C  CA    . HIS A 1 91  ? 10.521  47.165 112.466 1.00 44.67 ? 89  HIS A CA    1 
ATOM   677  C  C     . HIS A 1 91  ? 11.832  46.447 112.904 1.00 42.16 ? 89  HIS A C     1 
ATOM   678  O  O     . HIS A 1 91  ? 12.890  46.728 112.318 1.00 40.37 ? 89  HIS A O     1 
ATOM   679  C  CB    . HIS A 1 91  ? 10.635  47.218 110.989 1.00 46.12 ? 89  HIS A CB    1 
ATOM   680  C  CG    . HIS A 1 91  ? 10.044  46.021 110.312 1.00 48.56 ? 89  HIS A CG    1 
ATOM   681  N  ND1   . HIS A 1 91  ? 10.677  44.801 110.329 1.00 49.10 ? 89  HIS A ND1   1 
ATOM   682  C  CD2   . HIS A 1 91  ? 8.799   45.789 109.849 1.00 47.96 ? 89  HIS A CD2   1 
ATOM   683  C  CE1   . HIS A 1 91  ? 9.838   43.868 109.936 1.00 51.46 ? 89  HIS A CE1   1 
ATOM   684  N  NE2   . HIS A 1 91  ? 8.687   44.440 109.644 1.00 50.71 ? 89  HIS A NE2   1 
ATOM   685  N  N     . SER A 1 92  ? 11.731  45.468 113.812 1.00 39.62 ? 90  SER A N     1 
ATOM   686  C  CA    . SER A 1 92  ? 12.851  44.679 114.329 1.00 35.85 ? 90  SER A CA    1 
ATOM   687  C  C     . SER A 1 92  ? 13.689  43.861 113.319 1.00 34.71 ? 90  SER A C     1 
ATOM   688  O  O     . SER A 1 92  ? 13.161  43.115 112.462 1.00 32.43 ? 90  SER A O     1 
ATOM   689  C  CB    . SER A 1 92  ? 12.276  43.753 115.384 1.00 34.96 ? 90  SER A CB    1 
ATOM   690  O  OG    . SER A 1 92  ? 11.668  44.549 116.358 1.00 33.68 ? 90  SER A OG    1 
ATOM   691  N  N     . ASP A 1 93  ? 15.001  43.979 113.484 1.00 34.32 ? 91  ASP A N     1 
ATOM   692  C  CA    . ASP A 1 93  ? 16.003  43.319 112.660 1.00 35.97 ? 91  ASP A CA    1 
ATOM   693  C  C     . ASP A 1 93  ? 17.384  43.601 113.146 1.00 34.58 ? 91  ASP A C     1 
ATOM   694  O  O     . ASP A 1 93  ? 17.593  44.538 113.914 1.00 32.58 ? 91  ASP A O     1 
ATOM   695  C  CB    . ASP A 1 93  ? 15.846  43.744 111.186 1.00 41.01 ? 91  ASP A CB    1 
ATOM   696  C  CG    . ASP A 1 93  ? 15.922  45.277 110.964 1.00 40.85 ? 91  ASP A CG    1 
ATOM   697  O  OD1   . ASP A 1 93  ? 16.928  45.918 111.300 1.00 45.50 ? 91  ASP A OD1   1 
ATOM   698  O  OD2   . ASP A 1 93  ? 14.934  45.819 110.467 1.00 42.65 ? 91  ASP A OD2   1 
ATOM   699  N  N     . THR A 1 94  ? 18.305  42.752 112.710 1.00 34.70 ? 92  THR A N     1 
ATOM   700  C  CA    . THR A 1 94  ? 19.683  42.881 113.100 1.00 36.76 ? 92  THR A CA    1 
ATOM   701  C  C     . THR A 1 94  ? 20.614  42.910 111.884 1.00 36.24 ? 92  THR A C     1 
ATOM   702  O  O     . THR A 1 94  ? 20.430  42.166 110.908 1.00 36.05 ? 92  THR A O     1 
ATOM   703  C  CB    . THR A 1 94  ? 20.080  41.728 114.046 1.00 38.68 ? 92  THR A CB    1 
ATOM   704  O  OG1   . THR A 1 94  ? 21.405  41.956 114.551 1.00 43.42 ? 92  THR A OG1   1 
ATOM   705  C  CG2   . THR A 1 94  ? 20.051  40.403 113.291 1.00 42.02 ? 92  THR A CG2   1 
ATOM   706  N  N     . SER A 1 95  ? 21.584  43.817 111.934 1.00 35.31 ? 93  SER A N     1 
ATOM   707  C  CA    . SER A 1 95  ? 22.575  43.944 110.880 1.00 34.83 ? 93  SER A CA    1 
ATOM   708  C  C     . SER A 1 95  ? 23.790  43.190 111.403 1.00 34.35 ? 93  SER A C     1 
ATOM   709  O  O     . SER A 1 95  ? 24.386  43.564 112.418 1.00 32.15 ? 93  SER A O     1 
ATOM   710  C  CB    . SER A 1 95  ? 22.916  45.415 110.649 1.00 36.71 ? 93  SER A CB    1 
ATOM   711  O  OG    . SER A 1 95  ? 21.786  46.109 110.150 1.00 42.46 ? 93  SER A OG    1 
ATOM   712  N  N     . ILE A 1 96  ? 24.125  42.106 110.716 1.00 34.23 ? 94  ILE A N     1 
ATOM   713  C  CA    . ILE A 1 96  ? 25.255  41.267 111.075 1.00 34.49 ? 94  ILE A CA    1 
ATOM   714  C  C     . ILE A 1 96  ? 26.447  41.665 110.204 1.00 36.20 ? 94  ILE A C     1 
ATOM   715  O  O     . ILE A 1 96  ? 26.542  41.289 109.033 1.00 34.72 ? 94  ILE A O     1 
ATOM   716  C  CB    . ILE A 1 96  ? 24.889  39.785 110.870 1.00 34.64 ? 94  ILE A CB    1 
ATOM   717  C  CG1   . ILE A 1 96  ? 23.694  39.446 111.767 1.00 32.56 ? 94  ILE A CG1   1 
ATOM   718  C  CG2   . ILE A 1 96  ? 26.075  38.891 111.198 1.00 36.42 ? 94  ILE A CG2   1 
ATOM   719  C  CD1   . ILE A 1 96  ? 23.048  38.110 111.479 1.00 34.27 ? 94  ILE A CD1   1 
ATOM   720  N  N     . ILE A 1 97  ? 27.338  42.453 110.797 1.00 37.15 ? 95  ILE A N     1 
ATOM   721  C  CA    . ILE A 1 97  ? 28.528  42.954 110.124 1.00 38.99 ? 95  ILE A CA    1 
ATOM   722  C  C     . ILE A 1 97  ? 29.645  41.908 110.069 1.00 40.68 ? 95  ILE A C     1 
ATOM   723  O  O     . ILE A 1 97  ? 30.336  41.669 111.063 1.00 39.45 ? 95  ILE A O     1 
ATOM   724  C  CB    . ILE A 1 97  ? 29.049  44.219 110.846 1.00 39.44 ? 95  ILE A CB    1 
ATOM   725  C  CG1   . ILE A 1 97  ? 28.031  45.359 110.720 1.00 40.03 ? 95  ILE A CG1   1 
ATOM   726  C  CG2   . ILE A 1 97  ? 30.392  44.621 110.289 1.00 41.95 ? 95  ILE A CG2   1 
ATOM   727  C  CD1   . ILE A 1 97  ? 27.731  45.779 109.290 1.00 38.93 ? 95  ILE A CD1   1 
ATOM   728  N  N     . LEU A 1 98  ? 29.812  41.289 108.904 1.00 41.65 ? 96  LEU A N     1 
ATOM   729  C  CA    . LEU A 1 98  ? 30.844  40.273 108.709 1.00 44.62 ? 96  LEU A CA    1 
ATOM   730  C  C     . LEU A 1 98  ? 32.079  40.892 108.070 1.00 45.71 ? 96  LEU A C     1 
ATOM   731  O  O     . LEU A 1 98  ? 32.079  41.239 106.890 1.00 44.76 ? 96  LEU A O     1 
ATOM   732  C  CB    . LEU A 1 98  ? 30.318  39.136 107.829 1.00 44.84 ? 96  LEU A CB    1 
ATOM   733  C  CG    . LEU A 1 98  ? 31.358  38.132 107.320 1.00 46.92 ? 96  LEU A CG    1 
ATOM   734  C  CD1   . LEU A 1 98  ? 32.105  37.510 108.485 1.00 48.02 ? 96  LEU A CD1   1 
ATOM   735  C  CD2   . LEU A 1 98  ? 30.668  37.056 106.498 1.00 48.31 ? 96  LEU A CD2   1 
ATOM   736  N  N     . ASN A 1 99  ? 33.134  41.017 108.863 1.00 47.53 ? 97  ASN A N     1 
ATOM   737  C  CA    . ASN A 1 99  ? 34.381  41.612 108.407 1.00 50.50 ? 97  ASN A CA    1 
ATOM   738  C  C     . ASN A 1 99  ? 35.301  40.623 107.696 1.00 52.65 ? 97  ASN A C     1 
ATOM   739  O  O     . ASN A 1 99  ? 35.044  39.419 107.670 1.00 51.97 ? 97  ASN A O     1 
ATOM   740  C  CB    . ASN A 1 99  ? 35.109  42.217 109.601 1.00 51.04 ? 97  ASN A CB    1 
ATOM   741  C  CG    . ASN A 1 99  ? 34.266  43.227 110.345 1.00 52.69 ? 97  ASN A CG    1 
ATOM   742  O  OD1   . ASN A 1 99  ? 34.211  44.396 109.970 1.00 54.42 ? 97  ASN A OD1   1 
ATOM   743  N  ND2   . ASN A 1 99  ? 33.588  42.777 111.403 1.00 53.59 ? 97  ASN A ND2   1 
ATOM   744  N  N     . SER A 1 100 ? 36.379  41.150 107.124 1.00 55.28 ? 98  SER A N     1 
ATOM   745  C  CA    . SER A 1 100 ? 37.356  40.343 106.402 1.00 58.54 ? 98  SER A CA    1 
ATOM   746  C  C     . SER A 1 100 ? 38.370  39.729 107.361 1.00 59.95 ? 98  SER A C     1 
ATOM   747  O  O     . SER A 1 100 ? 38.031  38.854 108.159 1.00 60.45 ? 98  SER A O     1 
ATOM   748  C  CB    . SER A 1 100 ? 38.083  41.210 105.371 1.00 59.63 ? 98  SER A CB    1 
ATOM   749  O  OG    . SER A 1 100 ? 39.114  40.485 104.726 1.00 62.25 ? 98  SER A OG    1 
ATOM   750  N  N     . ALA A 1 101 ? 39.616  40.190 107.270 1.00 61.87 ? 99  ALA A N     1 
ATOM   751  C  CA    . ALA A 1 101 ? 40.685  39.703 108.135 1.00 62.77 ? 99  ALA A CA    1 
ATOM   752  C  C     . ALA A 1 101 ? 40.195  39.766 109.576 1.00 63.26 ? 99  ALA A C     1 
ATOM   753  O  O     . ALA A 1 101 ? 40.584  38.952 110.415 1.00 63.87 ? 99  ALA A O     1 
ATOM   754  C  CB    . ALA A 1 101 ? 41.934  40.566 107.965 1.00 62.42 ? 99  ALA A CB    1 
ATOM   755  N  N     . ASP A 1 102 ? 39.335  40.743 109.848 1.00 63.41 ? 100 ASP A N     1 
ATOM   756  C  CA    . ASP A 1 102 ? 38.771  40.924 111.177 1.00 62.77 ? 100 ASP A CA    1 
ATOM   757  C  C     . ASP A 1 102 ? 38.170  39.619 111.660 1.00 61.91 ? 100 ASP A C     1 
ATOM   758  O  O     . ASP A 1 102 ? 37.600  38.854 110.882 1.00 62.06 ? 100 ASP A O     1 
ATOM   759  C  CB    . ASP A 1 102 ? 37.687  41.997 111.152 1.00 63.90 ? 100 ASP A CB    1 
ATOM   760  C  CG    . ASP A 1 102 ? 38.089  43.250 111.894 1.00 64.40 ? 100 ASP A CG    1 
ATOM   761  O  OD1   . ASP A 1 102 ? 39.216  43.738 111.666 1.00 64.94 ? 100 ASP A OD1   1 
ATOM   762  O  OD2   . ASP A 1 102 ? 37.272  43.751 112.697 1.00 64.62 ? 100 ASP A OD2   1 
ATOM   763  N  N     . GLY A 1 103 ? 38.300  39.373 112.955 1.00 60.76 ? 101 GLY A N     1 
ATOM   764  C  CA    . GLY A 1 103 ? 37.767  38.155 113.518 1.00 59.14 ? 101 GLY A CA    1 
ATOM   765  C  C     . GLY A 1 103 ? 36.254  38.080 113.510 1.00 57.86 ? 101 GLY A C     1 
ATOM   766  O  O     . GLY A 1 103 ? 35.620  37.968 112.460 1.00 56.95 ? 101 GLY A O     1 
ATOM   767  N  N     . ASP A 1 104 ? 35.682  38.158 114.704 1.00 56.23 ? 102 ASP A N     1 
ATOM   768  C  CA    . ASP A 1 104 ? 34.244  38.055 114.902 1.00 55.20 ? 102 ASP A CA    1 
ATOM   769  C  C     . ASP A 1 104 ? 33.404  39.143 114.251 1.00 53.22 ? 102 ASP A C     1 
ATOM   770  O  O     . ASP A 1 104 ? 33.905  40.202 113.880 1.00 52.17 ? 102 ASP A O     1 
ATOM   771  C  CB    . ASP A 1 104 ? 33.957  38.009 116.399 1.00 56.97 ? 102 ASP A CB    1 
ATOM   772  C  CG    . ASP A 1 104 ? 34.949  37.140 117.146 1.00 59.12 ? 102 ASP A CG    1 
ATOM   773  O  OD1   . ASP A 1 104 ? 35.100  35.957 116.768 1.00 58.92 ? 102 ASP A OD1   1 
ATOM   774  O  OD2   . ASP A 1 104 ? 35.582  37.641 118.102 1.00 60.35 ? 102 ASP A OD2   1 
ATOM   775  N  N     . ASN A 1 105 ? 32.112  38.859 114.114 1.00 51.54 ? 103 ASN A N     1 
ATOM   776  C  CA    . ASN A 1 105 ? 31.179  39.804 113.523 1.00 49.36 ? 103 ASN A CA    1 
ATOM   777  C  C     . ASN A 1 105 ? 30.720  40.786 114.582 1.00 47.72 ? 103 ASN A C     1 
ATOM   778  O  O     . ASN A 1 105 ? 30.833  40.525 115.779 1.00 47.88 ? 103 ASN A O     1 
ATOM   779  C  CB    . ASN A 1 105 ? 29.933  39.096 112.984 1.00 49.90 ? 103 ASN A CB    1 
ATOM   780  C  CG    . ASN A 1 105 ? 30.250  38.032 111.966 1.00 50.64 ? 103 ASN A CG    1 
ATOM   781  O  OD1   . ASN A 1 105 ? 31.181  38.169 111.176 1.00 53.11 ? 103 ASN A OD1   1 
ATOM   782  N  ND2   . ASN A 1 105 ? 29.457  36.968 111.959 1.00 49.67 ? 103 ASN A ND2   1 
ATOM   783  N  N     . ALA A 1 106 ? 30.199  41.916 114.123 1.00 45.00 ? 104 ALA A N     1 
ATOM   784  C  CA    . ALA A 1 106 ? 29.661  42.938 115.005 1.00 42.10 ? 104 ALA A CA    1 
ATOM   785  C  C     . ALA A 1 106 ? 28.169  42.910 114.698 1.00 41.31 ? 104 ALA A C     1 
ATOM   786  O  O     . ALA A 1 106 ? 27.773  42.798 113.536 1.00 40.41 ? 104 ALA A O     1 
ATOM   787  C  CB    . ALA A 1 106 ? 30.252  44.296 114.671 1.00 42.48 ? 104 ALA A CB    1 
ATOM   788  N  N     . ILE A 1 107 ? 27.341  42.994 115.731 1.00 39.76 ? 105 ILE A N     1 
ATOM   789  C  CA    . ILE A 1 107 ? 25.897  42.950 115.541 1.00 37.39 ? 105 ILE A CA    1 
ATOM   790  C  C     . ILE A 1 107 ? 25.182  44.180 116.098 1.00 37.11 ? 105 ILE A C     1 
ATOM   791  O  O     . ILE A 1 107 ? 25.475  44.634 117.205 1.00 35.64 ? 105 ILE A O     1 
ATOM   792  C  CB    . ILE A 1 107 ? 25.304  41.678 116.204 1.00 38.14 ? 105 ILE A CB    1 
ATOM   793  C  CG1   . ILE A 1 107 ? 25.851  40.427 115.513 1.00 39.52 ? 105 ILE A CG1   1 
ATOM   794  C  CG2   . ILE A 1 107 ? 23.789  41.694 116.125 1.00 37.91 ? 105 ILE A CG2   1 
ATOM   795  C  CD1   . ILE A 1 107 ? 25.315  39.121 116.078 1.00 38.15 ? 105 ILE A CD1   1 
ATOM   796  N  N     . ILE A 1 108 ? 24.256  44.721 115.309 1.00 35.14 ? 106 ILE A N     1 
ATOM   797  C  CA    . ILE A 1 108 ? 23.458  45.874 115.717 1.00 34.30 ? 106 ILE A CA    1 
ATOM   798  C  C     . ILE A 1 108 ? 22.024  45.393 115.597 1.00 34.10 ? 106 ILE A C     1 
ATOM   799  O  O     . ILE A 1 108 ? 21.619  44.897 114.542 1.00 35.20 ? 106 ILE A O     1 
ATOM   800  C  CB    . ILE A 1 108 ? 23.641  47.101 114.781 1.00 34.34 ? 106 ILE A CB    1 
ATOM   801  C  CG1   . ILE A 1 108 ? 25.105  47.554 114.758 1.00 35.38 ? 106 ILE A CG1   1 
ATOM   802  C  CG2   . ILE A 1 108 ? 22.784  48.251 115.271 1.00 33.67 ? 106 ILE A CG2   1 
ATOM   803  C  CD1   . ILE A 1 108 ? 26.007  46.667 113.942 1.00 37.57 ? 106 ILE A CD1   1 
ATOM   804  N  N     . THR A 1 109 ? 21.255  45.533 116.670 1.00 32.57 ? 107 THR A N     1 
ATOM   805  C  CA    . THR A 1 109 ? 19.878  45.062 116.665 1.00 32.11 ? 107 THR A CA    1 
ATOM   806  C  C     . THR A 1 109 ? 18.864  46.110 117.096 1.00 30.67 ? 107 THR A C     1 
ATOM   807  O  O     . THR A 1 109 ? 19.116  46.881 118.015 1.00 32.48 ? 107 THR A O     1 
ATOM   808  C  CB    . THR A 1 109 ? 19.743  43.835 117.584 1.00 33.07 ? 107 THR A CB    1 
ATOM   809  O  OG1   . THR A 1 109 ? 20.709  42.847 117.194 1.00 34.38 ? 107 THR A OG1   1 
ATOM   810  C  CG2   . THR A 1 109 ? 18.344  43.240 117.483 1.00 33.85 ? 107 THR A CG2   1 
ATOM   811  N  N     . THR A 1 110 ? 17.718  46.135 116.420 1.00 29.53 ? 108 THR A N     1 
ATOM   812  C  CA    . THR A 1 110 ? 16.647  47.071 116.746 1.00 29.63 ? 108 THR A CA    1 
ATOM   813  C  C     . THR A 1 110 ? 15.503  46.263 117.349 1.00 31.00 ? 108 THR A C     1 
ATOM   814  O  O     . THR A 1 110 ? 15.337  45.088 117.029 1.00 29.95 ? 108 THR A O     1 
ATOM   815  C  CB    . THR A 1 110 ? 16.123  47.803 115.499 1.00 30.08 ? 108 THR A CB    1 
ATOM   816  O  OG1   . THR A 1 110 ? 15.502  46.861 114.616 1.00 31.44 ? 108 THR A OG1   1 
ATOM   817  C  CG2   . THR A 1 110 ? 17.255  48.492 114.780 1.00 28.47 ? 108 THR A CG2   1 
ATOM   818  N  N     . THR A 1 111 ? 14.704  46.899 118.200 1.00 31.04 ? 109 THR A N     1 
ATOM   819  C  CA    . THR A 1 111 ? 13.606  46.211 118.874 1.00 33.73 ? 109 THR A CA    1 
ATOM   820  C  C     . THR A 1 111 ? 12.322  47.031 118.981 1.00 33.51 ? 109 THR A C     1 
ATOM   821  O  O     . THR A 1 111 ? 11.440  46.693 119.770 1.00 33.62 ? 109 THR A O     1 
ATOM   822  C  CB    . THR A 1 111 ? 14.017  45.839 120.304 1.00 34.70 ? 109 THR A CB    1 
ATOM   823  O  OG1   . THR A 1 111 ? 14.345  47.038 121.022 1.00 37.23 ? 109 THR A OG1   1 
ATOM   824  C  CG2   . THR A 1 111 ? 15.229  44.924 120.294 1.00 35.87 ? 109 THR A CG2   1 
ATOM   825  N  N     . ALA A 1 112 ? 12.216  48.094 118.191 1.00 33.09 ? 110 ALA A N     1 
ATOM   826  C  CA    . ALA A 1 112 ? 11.050  48.970 118.230 1.00 32.46 ? 110 ALA A CA    1 
ATOM   827  C  C     . ALA A 1 112 ? 9.689   48.287 118.122 1.00 32.01 ? 110 ALA A C     1 
ATOM   828  O  O     . ALA A 1 112 ? 8.759   48.650 118.842 1.00 33.46 ? 110 ALA A O     1 
ATOM   829  C  CB    . ALA A 1 112 ? 11.172  50.041 117.154 1.00 33.71 ? 110 ALA A CB    1 
ATOM   830  N  N     . ALA A 1 113 ? 9.554   47.315 117.225 1.00 29.87 ? 111 ALA A N     1 
ATOM   831  C  CA    . ALA A 1 113 ? 8.275   46.626 117.064 1.00 30.23 ? 111 ALA A CA    1 
ATOM   832  C  C     . ALA A 1 113 ? 7.874   45.853 118.323 1.00 30.33 ? 111 ALA A C     1 
ATOM   833  O  O     . ALA A 1 113 ? 6.722   45.909 118.756 1.00 30.27 ? 111 ALA A O     1 
ATOM   834  C  CB    . ALA A 1 113 ? 8.330   45.680 115.861 1.00 30.43 ? 111 ALA A CB    1 
ATOM   835  N  N     . ALA A 1 114 ? 8.827   45.135 118.911 1.00 30.37 ? 112 ALA A N     1 
ATOM   836  C  CA    . ALA A 1 114 ? 8.549   44.360 120.118 1.00 32.19 ? 112 ALA A CA    1 
ATOM   837  C  C     . ALA A 1 114 ? 8.285   45.266 121.322 1.00 33.54 ? 112 ALA A C     1 
ATOM   838  O  O     . ALA A 1 114 ? 7.348   45.037 122.083 1.00 33.52 ? 112 ALA A O     1 
ATOM   839  C  CB    . ALA A 1 114 ? 9.711   43.424 120.418 1.00 30.71 ? 112 ALA A CB    1 
ATOM   840  N  N     . ASP A 1 115 ? 9.112   46.295 121.486 1.00 35.84 ? 113 ASP A N     1 
ATOM   841  C  CA    . ASP A 1 115 ? 8.966   47.220 122.610 1.00 37.98 ? 113 ASP A CA    1 
ATOM   842  C  C     . ASP A 1 115 ? 7.610   47.928 122.631 1.00 38.04 ? 113 ASP A C     1 
ATOM   843  O  O     . ASP A 1 115 ? 7.122   48.308 123.694 1.00 38.77 ? 113 ASP A O     1 
ATOM   844  C  CB    . ASP A 1 115 ? 10.056  48.299 122.581 1.00 38.16 ? 113 ASP A CB    1 
ATOM   845  C  CG    . ASP A 1 115 ? 11.460  47.730 122.529 1.00 40.26 ? 113 ASP A CG    1 
ATOM   846  O  OD1   . ASP A 1 115 ? 11.726  46.699 123.183 1.00 38.47 ? 113 ASP A OD1   1 
ATOM   847  O  OD2   . ASP A 1 115 ? 12.310  48.339 121.842 1.00 39.00 ? 113 ASP A OD2   1 
ATOM   848  N  N     . THR A 1 116 ? 7.012   48.099 121.457 1.00 38.22 ? 114 THR A N     1 
ATOM   849  C  CA    . THR A 1 116 ? 5.738   48.804 121.322 1.00 39.88 ? 114 THR A CA    1 
ATOM   850  C  C     . THR A 1 116 ? 4.496   47.914 121.257 1.00 38.40 ? 114 THR A C     1 
ATOM   851  O  O     . THR A 1 116 ? 3.379   48.393 121.451 1.00 39.25 ? 114 THR A O     1 
ATOM   852  C  CB    . THR A 1 116 ? 5.758   49.691 120.064 1.00 41.63 ? 114 THR A CB    1 
ATOM   853  O  OG1   . THR A 1 116 ? 6.956   50.475 120.059 1.00 46.96 ? 114 THR A OG1   1 
ATOM   854  C  CG2   . THR A 1 116 ? 4.561   50.623 120.044 1.00 44.81 ? 114 THR A CG2   1 
ATOM   855  N  N     . PHE A 1 117 ? 4.700   46.632 120.970 1.00 36.09 ? 115 PHE A N     1 
ATOM   856  C  CA    . PHE A 1 117 ? 3.624   45.644 120.871 1.00 34.94 ? 115 PHE A CA    1 
ATOM   857  C  C     . PHE A 1 117 ? 2.952   45.590 122.249 1.00 35.33 ? 115 PHE A C     1 
ATOM   858  O  O     . PHE A 1 117 ? 3.576   45.179 123.227 1.00 34.43 ? 115 PHE A O     1 
ATOM   859  C  CB    . PHE A 1 117 ? 4.258   44.290 120.504 1.00 33.38 ? 115 PHE A CB    1 
ATOM   860  C  CG    . PHE A 1 117 ? 3.309   43.288 119.898 1.00 32.75 ? 115 PHE A CG    1 
ATOM   861  C  CD1   . PHE A 1 117 ? 2.208   43.691 119.147 1.00 32.43 ? 115 PHE A CD1   1 
ATOM   862  C  CD2   . PHE A 1 117 ? 3.576   41.924 120.010 1.00 30.50 ? 115 PHE A CD2   1 
ATOM   863  C  CE1   . PHE A 1 117 ? 1.390   42.753 118.515 1.00 32.54 ? 115 PHE A CE1   1 
ATOM   864  C  CE2   . PHE A 1 117 ? 2.770   40.981 119.384 1.00 29.60 ? 115 PHE A CE2   1 
ATOM   865  C  CZ    . PHE A 1 117 ? 1.673   41.392 118.633 1.00 30.65 ? 115 PHE A CZ    1 
ATOM   866  N  N     . SER A 1 118 ? 1.688   46.006 122.329 1.00 36.25 ? 116 SER A N     1 
ATOM   867  C  CA    . SER A 1 118 ? 0.978   46.031 123.613 1.00 37.98 ? 116 SER A CA    1 
ATOM   868  C  C     . SER A 1 118 ? 0.148   44.797 123.958 1.00 38.47 ? 116 SER A C     1 
ATOM   869  O  O     . SER A 1 118 ? -0.200  43.990 123.093 1.00 37.79 ? 116 SER A O     1 
ATOM   870  C  CB    . SER A 1 118 ? 0.060   47.254 123.685 1.00 38.63 ? 116 SER A CB    1 
ATOM   871  O  OG    . SER A 1 118 ? -1.101  47.051 122.894 1.00 40.57 ? 116 SER A OG    1 
ATOM   872  N  N     . LEU A 1 119 ? -0.184  44.682 125.240 1.00 38.96 ? 117 LEU A N     1 
ATOM   873  C  CA    . LEU A 1 119 ? -0.986  43.575 125.746 1.00 40.87 ? 117 LEU A CA    1 
ATOM   874  C  C     . LEU A 1 119 ? -2.345  43.476 125.056 1.00 41.32 ? 117 LEU A C     1 
ATOM   875  O  O     . LEU A 1 119 ? -2.841  42.379 124.815 1.00 40.55 ? 117 LEU A O     1 
ATOM   876  C  CB    . LEU A 1 119 ? -1.184  43.725 127.258 1.00 41.53 ? 117 LEU A CB    1 
ATOM   877  C  CG    . LEU A 1 119 ? 0.091   43.634 128.097 1.00 40.80 ? 117 LEU A CG    1 
ATOM   878  C  CD1   . LEU A 1 119 ? -0.193  44.018 129.539 1.00 42.94 ? 117 LEU A CD1   1 
ATOM   879  C  CD2   . LEU A 1 119 ? 0.640   42.219 128.013 1.00 42.76 ? 117 LEU A CD2   1 
ATOM   880  N  N     . ASP A 1 120 ? -2.945  44.620 124.734 1.00 43.28 ? 118 ASP A N     1 
ATOM   881  C  CA    . ASP A 1 120 ? -4.249  44.625 124.074 1.00 44.39 ? 118 ASP A CA    1 
ATOM   882  C  C     . ASP A 1 120 ? -4.145  44.155 122.634 1.00 43.81 ? 118 ASP A C     1 
ATOM   883  O  O     . ASP A 1 120 ? -5.149  43.828 122.004 1.00 44.32 ? 118 ASP A O     1 
ATOM   884  C  CB    . ASP A 1 120 ? -4.860  46.024 124.114 1.00 47.52 ? 118 ASP A CB    1 
ATOM   885  C  CG    . ASP A 1 120 ? -4.966  46.563 125.519 1.00 50.34 ? 118 ASP A CG    1 
ATOM   886  O  OD1   . ASP A 1 120 ? -5.450  45.819 126.400 1.00 52.54 ? 118 ASP A OD1   1 
ATOM   887  O  OD2   . ASP A 1 120 ? -4.566  47.726 125.745 1.00 52.58 ? 118 ASP A OD2   1 
ATOM   888  N  N     . GLU A 1 121 ? -2.924  44.135 122.113 1.00 44.07 ? 119 GLU A N     1 
ATOM   889  C  CA    . GLU A 1 121 ? -2.681  43.684 120.749 1.00 44.71 ? 119 GLU A CA    1 
ATOM   890  C  C     . GLU A 1 121 ? -2.495  42.173 120.768 1.00 43.20 ? 119 GLU A C     1 
ATOM   891  O  O     . GLU A 1 121 ? -2.884  41.475 119.831 1.00 42.44 ? 119 GLU A O     1 
ATOM   892  C  CB    . GLU A 1 121 ? -1.397  44.305 120.192 1.00 47.10 ? 119 GLU A CB    1 
ATOM   893  C  CG    . GLU A 1 121 ? -1.370  45.817 120.103 1.00 51.97 ? 119 GLU A CG    1 
ATOM   894  C  CD    . GLU A 1 121 ? -2.332  46.358 119.070 1.00 54.22 ? 119 GLU A CD    1 
ATOM   895  O  OE1   . GLU A 1 121 ? -2.656  45.625 118.109 1.00 55.95 ? 119 GLU A OE1   1 
ATOM   896  O  OE2   . GLU A 1 121 ? -2.753  47.526 119.210 1.00 56.74 ? 119 GLU A OE2   1 
HETATM 897  N  N     . MSE A 1 122 ? -1.895  41.682 121.848 1.00 41.46 ? 120 MSE A N     1 
HETATM 898  C  CA    . MSE A 1 122 ? -1.602  40.261 121.994 1.00 40.84 ? 120 MSE A CA    1 
HETATM 899  C  C     . MSE A 1 122 ? -2.712  39.391 122.566 1.00 39.89 ? 120 MSE A C     1 
HETATM 900  O  O     . MSE A 1 122 ? -3.178  38.464 121.909 1.00 39.84 ? 120 MSE A O     1 
HETATM 901  C  CB    . MSE A 1 122 ? -0.336  40.087 122.835 1.00 40.77 ? 120 MSE A CB    1 
HETATM 902  C  CG    . MSE A 1 122 ? 0.896   40.720 122.209 1.00 43.14 ? 120 MSE A CG    1 
HETATM 903  SE SE    . MSE A 1 122 ? 2.538   40.365 123.162 1.00 48.63 ? 120 MSE A SE    1 
HETATM 904  C  CE    . MSE A 1 122 ? 2.733   42.050 124.080 1.00 44.57 ? 120 MSE A CE    1 
ATOM   905  N  N     . ILE A 1 123 ? -3.123  39.685 123.795 1.00 40.02 ? 121 ILE A N     1 
ATOM   906  C  CA    . ILE A 1 123 ? -4.165  38.913 124.467 1.00 40.68 ? 121 ILE A CA    1 
ATOM   907  C  C     . ILE A 1 123 ? -5.322  38.449 123.578 1.00 39.32 ? 121 ILE A C     1 
ATOM   908  O  O     . ILE A 1 123 ? -5.726  37.287 123.634 1.00 38.33 ? 121 ILE A O     1 
ATOM   909  C  CB    . ILE A 1 123 ? -4.746  39.697 125.673 1.00 41.56 ? 121 ILE A CB    1 
ATOM   910  C  CG1   . ILE A 1 123 ? -3.795  39.599 126.869 1.00 43.62 ? 121 ILE A CG1   1 
ATOM   911  C  CG2   . ILE A 1 123 ? -6.112  39.139 126.059 1.00 42.52 ? 121 ILE A CG2   1 
ATOM   912  C  CD1   . ILE A 1 123 ? -2.417  40.160 126.626 1.00 44.72 ? 121 ILE A CD1   1 
ATOM   913  N  N     . PRO A 1 124 ? -5.876  39.348 122.750 1.00 38.89 ? 122 PRO A N     1 
ATOM   914  C  CA    . PRO A 1 124 ? -6.988  38.946 121.885 1.00 38.99 ? 122 PRO A CA    1 
ATOM   915  C  C     . PRO A 1 124 ? -6.706  37.705 121.040 1.00 37.95 ? 122 PRO A C     1 
ATOM   916  O  O     . PRO A 1 124 ? -7.627  36.972 120.676 1.00 36.73 ? 122 PRO A O     1 
ATOM   917  C  CB    . PRO A 1 124 ? -7.218  40.186 121.025 1.00 38.56 ? 122 PRO A CB    1 
ATOM   918  C  CG    . PRO A 1 124 ? -6.854  41.296 121.958 1.00 39.58 ? 122 PRO A CG    1 
ATOM   919  C  CD    . PRO A 1 124 ? -5.578  40.780 122.580 1.00 38.82 ? 122 PRO A CD    1 
ATOM   920  N  N     . HIS A 1 125 ? -5.436  37.469 120.731 1.00 36.97 ? 123 HIS A N     1 
ATOM   921  C  CA    . HIS A 1 125 ? -5.071  36.321 119.909 1.00 36.73 ? 123 HIS A CA    1 
ATOM   922  C  C     . HIS A 1 125 ? -4.923  35.014 120.666 1.00 36.78 ? 123 HIS A C     1 
ATOM   923  O  O     . HIS A 1 125 ? -4.535  33.996 120.090 1.00 35.85 ? 123 HIS A O     1 
ATOM   924  C  CB    . HIS A 1 125 ? -3.796  36.622 119.133 1.00 37.97 ? 123 HIS A CB    1 
ATOM   925  C  CG    . HIS A 1 125 ? -3.941  37.773 118.191 1.00 38.50 ? 123 HIS A CG    1 
ATOM   926  N  ND1   . HIS A 1 125 ? -3.490  39.040 118.489 1.00 39.36 ? 123 HIS A ND1   1 
ATOM   927  C  CD2   . HIS A 1 125 ? -4.543  37.862 116.983 1.00 40.00 ? 123 HIS A CD2   1 
ATOM   928  C  CE1   . HIS A 1 125 ? -3.807  39.860 117.504 1.00 39.37 ? 123 HIS A CE1   1 
ATOM   929  N  NE2   . HIS A 1 125 ? -4.448  39.171 116.578 1.00 40.42 ? 123 HIS A NE2   1 
HETATM 930  N  N     . MSE A 1 126 ? -5.226  35.050 121.958 1.00 36.60 ? 124 MSE A N     1 
HETATM 931  C  CA    . MSE A 1 126 ? -5.173  33.857 122.791 1.00 37.96 ? 124 MSE A CA    1 
HETATM 932  C  C     . MSE A 1 126 ? -6.587  33.591 123.293 1.00 36.26 ? 124 MSE A C     1 
HETATM 933  O  O     . MSE A 1 126 ? -6.808  32.745 124.158 1.00 35.94 ? 124 MSE A O     1 
HETATM 934  C  CB    . MSE A 1 126 ? -4.236  34.062 123.974 1.00 40.57 ? 124 MSE A CB    1 
HETATM 935  C  CG    . MSE A 1 126 ? -2.802  34.321 123.581 1.00 45.39 ? 124 MSE A CG    1 
HETATM 936  SE SE    . MSE A 1 126 ? -1.660  34.273 125.126 1.00 54.85 ? 124 MSE A SE    1 
HETATM 937  C  CE    . MSE A 1 126 ? -1.897  36.090 125.728 1.00 47.33 ? 124 MSE A CE    1 
ATOM   938  N  N     . ALA A 1 127 ? -7.541  34.327 122.735 1.00 34.99 ? 125 ALA A N     1 
ATOM   939  C  CA    . ALA A 1 127 ? -8.942  34.184 123.107 1.00 34.23 ? 125 ALA A CA    1 
ATOM   940  C  C     . ALA A 1 127 ? -9.405  32.734 123.029 1.00 32.71 ? 125 ALA A C     1 
ATOM   941  O  O     . ALA A 1 127 ? -10.128 32.268 123.905 1.00 33.75 ? 125 ALA A O     1 
ATOM   942  C  CB    . ALA A 1 127 ? -9.811  35.054 122.207 1.00 35.41 ? 125 ALA A CB    1 
ATOM   943  N  N     . ASP A 1 128 ? -8.987  32.017 121.990 1.00 30.39 ? 126 ASP A N     1 
ATOM   944  C  CA    . ASP A 1 128 ? -9.393  30.626 121.833 1.00 29.76 ? 126 ASP A CA    1 
ATOM   945  C  C     . ASP A 1 128 ? -8.506  29.618 122.569 1.00 28.01 ? 126 ASP A C     1 
ATOM   946  O  O     . ASP A 1 128 ? -8.650  28.413 122.375 1.00 27.16 ? 126 ASP A O     1 
ATOM   947  C  CB    . ASP A 1 128 ? -9.451  30.248 120.351 1.00 33.59 ? 126 ASP A CB    1 
ATOM   948  C  CG    . ASP A 1 128 ? -8.089  30.289 119.679 1.00 34.99 ? 126 ASP A CG    1 
ATOM   949  O  OD1   . ASP A 1 128 ? -7.961  29.713 118.578 1.00 38.63 ? 126 ASP A OD1   1 
ATOM   950  O  OD2   . ASP A 1 128 ? -7.153  30.901 120.241 1.00 36.04 ? 126 ASP A OD2   1 
ATOM   951  N  N     . ALA A 1 129 ? -7.590  30.099 123.403 1.00 27.04 ? 127 ALA A N     1 
ATOM   952  C  CA    . ALA A 1 129 ? -6.723  29.194 124.151 1.00 25.75 ? 127 ALA A CA    1 
ATOM   953  C  C     . ALA A 1 129 ? -7.580  28.493 125.202 1.00 26.88 ? 127 ALA A C     1 
ATOM   954  O  O     . ALA A 1 129 ? -8.615  29.025 125.612 1.00 26.31 ? 127 ALA A O     1 
ATOM   955  C  CB    . ALA A 1 129 ? -5.593  29.974 124.825 1.00 25.58 ? 127 ALA A CB    1 
ATOM   956  N  N     . VAL A 1 130 ? -7.166  27.296 125.609 1.00 26.06 ? 128 VAL A N     1 
ATOM   957  C  CA    . VAL A 1 130 ? -7.880  26.521 126.629 1.00 24.73 ? 128 VAL A CA    1 
ATOM   958  C  C     . VAL A 1 130 ? -6.866  25.960 127.633 1.00 25.02 ? 128 VAL A C     1 
ATOM   959  O  O     . VAL A 1 130 ? -5.672  25.915 127.349 1.00 23.20 ? 128 VAL A O     1 
ATOM   960  C  CB    . VAL A 1 130 ? -8.659  25.323 126.013 1.00 23.10 ? 128 VAL A CB    1 
ATOM   961  C  CG1   . VAL A 1 130 ? -9.733  25.820 125.056 1.00 25.74 ? 128 VAL A CG1   1 
ATOM   962  C  CG2   . VAL A 1 130 ? -7.703  24.388 125.295 1.00 25.19 ? 128 VAL A CG2   1 
ATOM   963  N  N     . ALA A 1 131 ? -7.347  25.532 128.798 1.00 24.00 ? 129 ALA A N     1 
ATOM   964  C  CA    . ALA A 1 131 ? -6.473  24.959 129.825 1.00 23.49 ? 129 ALA A CA    1 
ATOM   965  C  C     . ALA A 1 131 ? -5.653  23.817 129.228 1.00 22.72 ? 129 ALA A C     1 
ATOM   966  O  O     . ALA A 1 131 ? -6.194  22.949 128.539 1.00 20.85 ? 129 ALA A O     1 
ATOM   967  C  CB    . ALA A 1 131 ? -7.313  24.445 130.998 1.00 23.54 ? 129 ALA A CB    1 
ATOM   968  N  N     . GLY A 1 132 ? -4.351  23.802 129.513 1.00 19.25 ? 130 GLY A N     1 
ATOM   969  C  CA    . GLY A 1 132 ? -3.501  22.769 128.957 1.00 20.65 ? 130 GLY A CA    1 
ATOM   970  C  C     . GLY A 1 132 ? -2.643  23.334 127.837 1.00 20.82 ? 130 GLY A C     1 
ATOM   971  O  O     . GLY A 1 132 ? -1.534  22.856 127.587 1.00 21.70 ? 130 GLY A O     1 
ATOM   972  N  N     . ASP A 1 133 ? -3.153  24.348 127.142 1.00 20.90 ? 131 ASP A N     1 
ATOM   973  C  CA    . ASP A 1 133 ? -2.385  24.965 126.067 1.00 21.79 ? 131 ASP A CA    1 
ATOM   974  C  C     . ASP A 1 133 ? -1.182  25.672 126.670 1.00 21.86 ? 131 ASP A C     1 
ATOM   975  O  O     . ASP A 1 133 ? -1.195  26.057 127.847 1.00 21.43 ? 131 ASP A O     1 
ATOM   976  C  CB    . ASP A 1 133 ? -3.234  25.963 125.279 1.00 21.44 ? 131 ASP A CB    1 
ATOM   977  C  CG    . ASP A 1 133 ? -4.258  25.280 124.387 1.00 23.37 ? 131 ASP A CG    1 
ATOM   978  O  OD1   . ASP A 1 133 ? -4.075  24.084 124.062 1.00 22.95 ? 131 ASP A OD1   1 
ATOM   979  O  OD2   . ASP A 1 133 ? -5.236  25.951 123.998 1.00 24.91 ? 131 ASP A OD2   1 
ATOM   980  N  N     . ILE A 1 134 ? -0.149  25.859 125.859 1.00 21.67 ? 132 ILE A N     1 
ATOM   981  C  CA    . ILE A 1 134 ? 1.078   26.483 126.333 1.00 22.54 ? 132 ILE A CA    1 
ATOM   982  C  C     . ILE A 1 134 ? 1.305   27.924 125.897 1.00 21.97 ? 132 ILE A C     1 
ATOM   983  O  O     . ILE A 1 134 ? 1.011   28.294 124.763 1.00 22.24 ? 132 ILE A O     1 
ATOM   984  C  CB    . ILE A 1 134 ? 2.326   25.689 125.852 1.00 24.58 ? 132 ILE A CB    1 
ATOM   985  C  CG1   . ILE A 1 134 ? 2.276   24.251 126.366 1.00 26.12 ? 132 ILE A CG1   1 
ATOM   986  C  CG2   . ILE A 1 134 ? 3.607   26.377 126.325 1.00 23.73 ? 132 ILE A CG2   1 
ATOM   987  C  CD1   . ILE A 1 134 ? 3.439   23.412 125.876 1.00 26.85 ? 132 ILE A CD1   1 
ATOM   988  N  N     . LEU A 1 135 ? 1.827   28.728 126.817 1.00 20.78 ? 133 LEU A N     1 
ATOM   989  C  CA    . LEU A 1 135 ? 2.214   30.095 126.507 1.00 21.85 ? 133 LEU A CA    1 
ATOM   990  C  C     . LEU A 1 135 ? 3.728   30.032 126.622 1.00 23.15 ? 133 LEU A C     1 
ATOM   991  O  O     . LEU A 1 135 ? 4.259   29.756 127.697 1.00 23.96 ? 133 LEU A O     1 
ATOM   992  C  CB    . LEU A 1 135 ? 1.688   31.118 127.515 1.00 22.40 ? 133 LEU A CB    1 
ATOM   993  C  CG    . LEU A 1 135 ? 2.447   32.446 127.317 1.00 25.14 ? 133 LEU A CG    1 
ATOM   994  C  CD1   . LEU A 1 135 ? 2.138   33.017 125.933 1.00 23.89 ? 133 LEU A CD1   1 
ATOM   995  C  CD2   . LEU A 1 135 ? 2.080   33.441 128.399 1.00 27.51 ? 133 LEU A CD2   1 
ATOM   996  N  N     . LEU A 1 136 ? 4.415   30.254 125.506 1.00 22.90 ? 134 LEU A N     1 
ATOM   997  C  CA    . LEU A 1 136 ? 5.869   30.228 125.470 1.00 23.32 ? 134 LEU A CA    1 
ATOM   998  C  C     . LEU A 1 136 ? 6.350   31.659 125.268 1.00 24.30 ? 134 LEU A C     1 
ATOM   999  O  O     . LEU A 1 136 ? 5.896   32.364 124.365 1.00 21.72 ? 134 LEU A O     1 
ATOM   1000 C  CB    . LEU A 1 136 ? 6.355   29.332 124.323 1.00 23.46 ? 134 LEU A CB    1 
ATOM   1001 C  CG    . LEU A 1 136 ? 7.834   29.452 123.930 1.00 25.29 ? 134 LEU A CG    1 
ATOM   1002 C  CD1   . LEU A 1 136 ? 8.727   29.125 125.117 1.00 23.79 ? 134 LEU A CD1   1 
ATOM   1003 C  CD2   . LEU A 1 136 ? 8.122   28.518 122.765 1.00 23.63 ? 134 LEU A CD2   1 
ATOM   1004 N  N     . GLN A 1 137 ? 7.282   32.078 126.108 1.00 23.89 ? 135 GLN A N     1 
ATOM   1005 C  CA    . GLN A 1 137 ? 7.793   33.429 126.040 1.00 25.89 ? 135 GLN A CA    1 
ATOM   1006 C  C     . GLN A 1 137 ? 9.316   33.442 126.196 1.00 26.19 ? 135 GLN A C     1 
ATOM   1007 O  O     . GLN A 1 137 ? 9.895   32.572 126.860 1.00 23.93 ? 135 GLN A O     1 
ATOM   1008 C  CB    . GLN A 1 137 ? 7.089   34.223 127.144 1.00 28.67 ? 135 GLN A CB    1 
ATOM   1009 C  CG    . GLN A 1 137 ? 7.380   35.687 127.246 1.00 34.34 ? 135 GLN A CG    1 
ATOM   1010 C  CD    . GLN A 1 137 ? 6.220   36.432 127.892 1.00 32.57 ? 135 GLN A CD    1 
ATOM   1011 O  OE1   . GLN A 1 137 ? 5.611   35.958 128.858 1.00 34.41 ? 135 GLN A OE1   1 
ATOM   1012 N  NE2   . GLN A 1 137 ? 5.912   37.602 127.362 1.00 34.57 ? 135 GLN A NE2   1 
ATOM   1013 N  N     . GLN A 1 138 ? 9.975   34.397 125.543 1.00 24.72 ? 136 GLN A N     1 
ATOM   1014 C  CA    . GLN A 1 138 ? 11.425  34.507 125.666 1.00 25.51 ? 136 GLN A CA    1 
ATOM   1015 C  C     . GLN A 1 138 ? 11.690  35.776 126.473 1.00 26.89 ? 136 GLN A C     1 
ATOM   1016 O  O     . GLN A 1 138 ? 10.856  36.179 127.279 1.00 26.36 ? 136 GLN A O     1 
ATOM   1017 C  CB    . GLN A 1 138 ? 12.098  34.605 124.294 1.00 25.38 ? 136 GLN A CB    1 
ATOM   1018 C  CG    . GLN A 1 138 ? 11.843  33.422 123.355 1.00 26.80 ? 136 GLN A CG    1 
ATOM   1019 C  CD    . GLN A 1 138 ? 10.448  33.429 122.764 1.00 25.27 ? 136 GLN A CD    1 
ATOM   1020 O  OE1   . GLN A 1 138 ? 9.910   34.482 122.427 1.00 26.15 ? 136 GLN A OE1   1 
ATOM   1021 N  NE2   . GLN A 1 138 ? 9.862   32.248 122.615 1.00 25.68 ? 136 GLN A NE2   1 
ATOM   1022 N  N     . GLY A 1 139 ? 12.835  36.415 126.262 1.00 28.31 ? 137 GLY A N     1 
ATOM   1023 C  CA    . GLY A 1 139 ? 13.115  37.625 127.014 1.00 30.88 ? 137 GLY A CA    1 
ATOM   1024 C  C     . GLY A 1 139 ? 13.077  38.897 126.186 1.00 33.28 ? 137 GLY A C     1 
ATOM   1025 O  O     . GLY A 1 139 ? 13.840  39.819 126.462 1.00 34.05 ? 137 GLY A O     1 
ATOM   1026 N  N     . ASN A 1 140 ? 12.188  38.968 125.196 1.00 34.71 ? 138 ASN A N     1 
ATOM   1027 C  CA    . ASN A 1 140 ? 12.105  40.148 124.330 1.00 37.85 ? 138 ASN A CA    1 
ATOM   1028 C  C     . ASN A 1 140 ? 11.142  41.238 124.800 1.00 38.24 ? 138 ASN A C     1 
ATOM   1029 O  O     . ASN A 1 140 ? 11.013  42.273 124.141 1.00 39.51 ? 138 ASN A O     1 
ATOM   1030 C  CB    . ASN A 1 140 ? 11.731  39.743 122.896 1.00 39.49 ? 138 ASN A CB    1 
ATOM   1031 C  CG    . ASN A 1 140 ? 12.081  38.302 122.582 1.00 43.34 ? 138 ASN A CG    1 
ATOM   1032 O  OD1   . ASN A 1 140 ? 11.261  37.393 122.782 1.00 44.65 ? 138 ASN A OD1   1 
ATOM   1033 N  ND2   . ASN A 1 140 ? 13.304  38.076 122.100 1.00 40.70 ? 138 ASN A ND2   1 
ATOM   1034 N  N     . PHE A 1 141 ? 10.467  41.013 125.924 1.00 37.23 ? 139 PHE A N     1 
ATOM   1035 C  CA    . PHE A 1 141 ? 9.529   41.997 126.457 1.00 37.05 ? 139 PHE A CA    1 
ATOM   1036 C  C     . PHE A 1 141 ? 9.956   42.490 127.837 1.00 38.05 ? 139 PHE A C     1 
ATOM   1037 O  O     . PHE A 1 141 ? 10.727  41.829 128.539 1.00 38.52 ? 139 PHE A O     1 
ATOM   1038 C  CB    . PHE A 1 141 ? 8.114   41.413 126.570 1.00 36.96 ? 139 PHE A CB    1 
ATOM   1039 C  CG    . PHE A 1 141 ? 7.498   41.028 125.256 1.00 37.57 ? 139 PHE A CG    1 
ATOM   1040 C  CD1   . PHE A 1 141 ? 7.559   41.887 124.160 1.00 37.17 ? 139 PHE A CD1   1 
ATOM   1041 C  CD2   . PHE A 1 141 ? 6.819   39.817 125.123 1.00 35.85 ? 139 PHE A CD2   1 
ATOM   1042 C  CE1   . PHE A 1 141 ? 6.950   41.546 122.953 1.00 36.75 ? 139 PHE A CE1   1 
ATOM   1043 C  CE2   . PHE A 1 141 ? 6.206   39.468 123.919 1.00 35.14 ? 139 PHE A CE2   1 
ATOM   1044 C  CZ    . PHE A 1 141 ? 6.272   40.333 122.833 1.00 34.26 ? 139 PHE A CZ    1 
ATOM   1045 N  N     . SER A 1 142 ? 9.443   43.655 128.218 1.00 37.95 ? 140 SER A N     1 
ATOM   1046 C  CA    . SER A 1 142 ? 9.746   44.249 129.517 1.00 38.78 ? 140 SER A CA    1 
ATOM   1047 C  C     . SER A 1 142 ? 9.201   43.349 130.616 1.00 38.71 ? 140 SER A C     1 
ATOM   1048 O  O     . SER A 1 142 ? 8.280   42.564 130.383 1.00 37.50 ? 140 SER A O     1 
ATOM   1049 C  CB    . SER A 1 142 ? 9.080   45.617 129.643 1.00 38.76 ? 140 SER A CB    1 
ATOM   1050 O  OG    . SER A 1 142 ? 7.669   45.473 129.688 1.00 40.11 ? 140 SER A OG    1 
ATOM   1051 N  N     . LEU A 1 143 ? 9.759   43.481 131.815 1.00 38.30 ? 141 LEU A N     1 
ATOM   1052 C  CA    . LEU A 1 143 ? 9.315   42.685 132.950 1.00 38.99 ? 141 LEU A CA    1 
ATOM   1053 C  C     . LEU A 1 143 ? 7.803   42.756 133.157 1.00 38.76 ? 141 LEU A C     1 
ATOM   1054 O  O     . LEU A 1 143 ? 7.153   41.731 133.346 1.00 38.99 ? 141 LEU A O     1 
ATOM   1055 C  CB    . LEU A 1 143 ? 10.022  43.138 134.230 1.00 39.84 ? 141 LEU A CB    1 
ATOM   1056 C  CG    . LEU A 1 143 ? 9.442   42.561 135.529 1.00 40.48 ? 141 LEU A CG    1 
ATOM   1057 C  CD1   . LEU A 1 143 ? 9.535   41.047 135.503 1.00 41.61 ? 141 LEU A CD1   1 
ATOM   1058 C  CD2   . LEU A 1 143 ? 10.188  43.119 136.727 1.00 41.02 ? 141 LEU A CD2   1 
ATOM   1059 N  N     . ASP A 1 144 ? 7.243   43.962 133.120 1.00 39.58 ? 142 ASP A N     1 
ATOM   1060 C  CA    . ASP A 1 144 ? 5.807   44.129 133.324 1.00 39.49 ? 142 ASP A CA    1 
ATOM   1061 C  C     . ASP A 1 144 ? 4.967   43.402 132.278 1.00 38.68 ? 142 ASP A C     1 
ATOM   1062 O  O     . ASP A 1 144 ? 4.001   42.715 132.621 1.00 36.92 ? 142 ASP A O     1 
ATOM   1063 C  CB    . ASP A 1 144 ? 5.433   45.615 133.347 1.00 43.19 ? 142 ASP A CB    1 
ATOM   1064 C  CG    . ASP A 1 144 ? 6.033   46.350 134.538 1.00 46.96 ? 142 ASP A CG    1 
ATOM   1065 O  OD1   . ASP A 1 144 ? 5.986   45.806 135.664 1.00 47.94 ? 142 ASP A OD1   1 
ATOM   1066 O  OD2   . ASP A 1 144 ? 6.542   47.477 134.351 1.00 50.15 ? 142 ASP A OD2   1 
ATOM   1067 N  N     . LYS A 1 145 ? 5.324   43.553 131.006 1.00 37.26 ? 143 LYS A N     1 
ATOM   1068 C  CA    . LYS A 1 145 ? 4.579   42.885 129.946 1.00 36.89 ? 143 LYS A CA    1 
ATOM   1069 C  C     . LYS A 1 145 ? 4.726   41.369 130.073 1.00 34.46 ? 143 LYS A C     1 
ATOM   1070 O  O     . LYS A 1 145 ? 3.741   40.635 129.993 1.00 34.67 ? 143 LYS A O     1 
ATOM   1071 C  CB    . LYS A 1 145 ? 5.072   43.347 128.570 1.00 39.16 ? 143 LYS A CB    1 
ATOM   1072 C  CG    . LYS A 1 145 ? 4.711   44.791 128.226 1.00 44.10 ? 143 LYS A CG    1 
ATOM   1073 C  CD    . LYS A 1 145 ? 3.207   44.978 128.047 1.00 46.96 ? 143 LYS A CD    1 
ATOM   1074 C  CE    . LYS A 1 145 ? 2.861   46.408 127.616 1.00 47.42 ? 143 LYS A CE    1 
ATOM   1075 N  NZ    . LYS A 1 145 ? 1.408   46.583 127.289 1.00 46.20 ? 143 LYS A NZ    1 
ATOM   1076 N  N     . THR A 1 146 ? 5.956   40.911 130.282 1.00 31.37 ? 144 THR A N     1 
ATOM   1077 C  CA    . THR A 1 146 ? 6.230   39.487 130.425 1.00 29.41 ? 144 THR A CA    1 
ATOM   1078 C  C     . THR A 1 146 ? 5.451   38.898 131.601 1.00 28.57 ? 144 THR A C     1 
ATOM   1079 O  O     . THR A 1 146 ? 4.796   37.864 131.466 1.00 26.09 ? 144 THR A O     1 
ATOM   1080 C  CB    . THR A 1 146 ? 7.730   39.226 130.648 1.00 29.38 ? 144 THR A CB    1 
ATOM   1081 O  OG1   . THR A 1 146 ? 8.481   39.750 129.546 1.00 28.13 ? 144 THR A OG1   1 
ATOM   1082 C  CG2   . THR A 1 146 ? 7.996   37.736 130.772 1.00 26.97 ? 144 THR A CG2   1 
ATOM   1083 N  N     . ARG A 1 147 ? 5.517   39.556 132.754 1.00 28.59 ? 145 ARG A N     1 
ATOM   1084 C  CA    . ARG A 1 147 ? 4.801   39.062 133.923 1.00 29.30 ? 145 ARG A CA    1 
ATOM   1085 C  C     . ARG A 1 147 ? 3.299   39.027 133.672 1.00 28.70 ? 145 ARG A C     1 
ATOM   1086 O  O     . ARG A 1 147 ? 2.625   38.061 134.037 1.00 27.00 ? 145 ARG A O     1 
ATOM   1087 C  CB    . ARG A 1 147 ? 5.091   39.930 135.150 1.00 31.61 ? 145 ARG A CB    1 
ATOM   1088 C  CG    . ARG A 1 147 ? 4.245   39.558 136.369 1.00 36.13 ? 145 ARG A CG    1 
ATOM   1089 C  CD    . ARG A 1 147 ? 4.807   40.165 137.641 1.00 39.44 ? 145 ARG A CD    1 
ATOM   1090 N  NE    . ARG A 1 147 ? 4.962   41.609 137.525 1.00 41.76 ? 145 ARG A NE    1 
ATOM   1091 C  CZ    . ARG A 1 147 ? 5.920   42.305 138.129 1.00 44.27 ? 145 ARG A CZ    1 
ATOM   1092 N  NH1   . ARG A 1 147 ? 6.812   41.689 138.895 1.00 44.29 ? 145 ARG A NH1   1 
ATOM   1093 N  NH2   . ARG A 1 147 ? 5.995   43.615 137.958 1.00 44.88 ? 145 ARG A NH2   1 
ATOM   1094 N  N     . ALA A 1 148 ? 2.785   40.083 133.045 1.00 27.32 ? 146 ALA A N     1 
ATOM   1095 C  CA    . ALA A 1 148 ? 1.361   40.192 132.744 1.00 27.56 ? 146 ALA A CA    1 
ATOM   1096 C  C     . ALA A 1 148 ? 0.885   39.083 131.813 1.00 28.05 ? 146 ALA A C     1 
ATOM   1097 O  O     . ALA A 1 148 ? -0.235  38.588 131.954 1.00 28.17 ? 146 ALA A O     1 
ATOM   1098 C  CB    . ALA A 1 148 ? 1.059   41.555 132.118 1.00 27.71 ? 146 ALA A CB    1 
ATOM   1099 N  N     . LEU A 1 149 ? 1.722   38.703 130.851 1.00 26.99 ? 147 LEU A N     1 
ATOM   1100 C  CA    . LEU A 1 149 ? 1.338   37.645 129.923 1.00 26.02 ? 147 LEU A CA    1 
ATOM   1101 C  C     . LEU A 1 149 ? 1.267   36.305 130.645 1.00 24.67 ? 147 LEU A C     1 
ATOM   1102 O  O     . LEU A 1 149 ? 0.351   35.520 130.406 1.00 25.46 ? 147 LEU A O     1 
ATOM   1103 C  CB    . LEU A 1 149 ? 2.315   37.583 128.742 1.00 26.81 ? 147 LEU A CB    1 
ATOM   1104 C  CG    . LEU A 1 149 ? 2.100   38.709 127.720 1.00 29.39 ? 147 LEU A CG    1 
ATOM   1105 C  CD1   . LEU A 1 149 ? 3.279   38.806 126.769 1.00 29.47 ? 147 LEU A CD1   1 
ATOM   1106 C  CD2   . LEU A 1 149 ? 0.804   38.454 126.952 1.00 29.53 ? 147 LEU A CD2   1 
ATOM   1107 N  N     . PHE A 1 150 ? 2.219   36.041 131.536 1.00 24.12 ? 148 PHE A N     1 
ATOM   1108 C  CA    . PHE A 1 150 ? 2.201   34.784 132.276 1.00 23.98 ? 148 PHE A CA    1 
ATOM   1109 C  C     . PHE A 1 150 ? 1.020   34.723 133.242 1.00 25.40 ? 148 PHE A C     1 
ATOM   1110 O  O     . PHE A 1 150 ? 0.459   33.652 133.471 1.00 22.96 ? 148 PHE A O     1 
ATOM   1111 C  CB    . PHE A 1 150 ? 3.512   34.574 133.037 1.00 25.55 ? 148 PHE A CB    1 
ATOM   1112 C  CG    . PHE A 1 150 ? 4.646   34.096 132.168 1.00 26.81 ? 148 PHE A CG    1 
ATOM   1113 C  CD1   . PHE A 1 150 ? 4.445   33.067 131.243 1.00 26.64 ? 148 PHE A CD1   1 
ATOM   1114 C  CD2   . PHE A 1 150 ? 5.917   34.646 132.290 1.00 25.28 ? 148 PHE A CD2   1 
ATOM   1115 C  CE1   . PHE A 1 150 ? 5.497   32.596 130.454 1.00 26.90 ? 148 PHE A CE1   1 
ATOM   1116 C  CE2   . PHE A 1 150 ? 6.978   34.177 131.504 1.00 25.47 ? 148 PHE A CE2   1 
ATOM   1117 C  CZ    . PHE A 1 150 ? 6.768   33.156 130.590 1.00 23.11 ? 148 PHE A CZ    1 
ATOM   1118 N  N     . GLN A 1 151 ? 0.638   35.868 133.810 1.00 25.91 ? 149 GLN A N     1 
ATOM   1119 C  CA    . GLN A 1 151 ? -0.500  35.898 134.731 1.00 26.87 ? 149 GLN A CA    1 
ATOM   1120 C  C     . GLN A 1 151 ? -1.775  35.641 133.941 1.00 26.89 ? 149 GLN A C     1 
ATOM   1121 O  O     . GLN A 1 151 ? -2.711  35.018 134.433 1.00 24.86 ? 149 GLN A O     1 
ATOM   1122 C  CB    . GLN A 1 151 ? -0.575  37.249 135.451 1.00 28.49 ? 149 GLN A CB    1 
ATOM   1123 C  CG    . GLN A 1 151 ? 0.620   37.498 136.353 1.00 30.60 ? 149 GLN A CG    1 
ATOM   1124 C  CD    . GLN A 1 151 ? 0.609   38.879 136.968 1.00 33.11 ? 149 GLN A CD    1 
ATOM   1125 O  OE1   . GLN A 1 151 ? 0.401   39.878 136.276 1.00 35.53 ? 149 GLN A OE1   1 
ATOM   1126 N  NE2   . GLN A 1 151 ? 0.847   38.947 138.272 1.00 34.24 ? 149 GLN A NE2   1 
ATOM   1127 N  N     . TYR A 1 152 ? -1.808  36.117 132.702 1.00 28.28 ? 150 TYR A N     1 
ATOM   1128 C  CA    . TYR A 1 152 ? -2.974  35.881 131.861 1.00 29.01 ? 150 TYR A CA    1 
ATOM   1129 C  C     . TYR A 1 152 ? -3.075  34.382 131.601 1.00 27.75 ? 150 TYR A C     1 
ATOM   1130 O  O     . TYR A 1 152 ? -4.146  33.788 131.731 1.00 27.41 ? 150 TYR A O     1 
ATOM   1131 C  CB    . TYR A 1 152 ? -2.842  36.593 130.520 1.00 30.28 ? 150 TYR A CB    1 
ATOM   1132 C  CG    . TYR A 1 152 ? -4.004  36.303 129.606 1.00 33.41 ? 150 TYR A CG    1 
ATOM   1133 C  CD1   . TYR A 1 152 ? -5.201  37.004 129.729 1.00 35.11 ? 150 TYR A CD1   1 
ATOM   1134 C  CD2   . TYR A 1 152 ? -3.934  35.282 128.661 1.00 33.84 ? 150 TYR A CD2   1 
ATOM   1135 C  CE1   . TYR A 1 152 ? -6.297  36.696 128.938 1.00 36.41 ? 150 TYR A CE1   1 
ATOM   1136 C  CE2   . TYR A 1 152 ? -5.031  34.964 127.864 1.00 35.67 ? 150 TYR A CE2   1 
ATOM   1137 C  CZ    . TYR A 1 152 ? -6.206  35.676 128.010 1.00 35.22 ? 150 TYR A CZ    1 
ATOM   1138 O  OH    . TYR A 1 152 ? -7.296  35.370 127.234 1.00 39.60 ? 150 TYR A OH    1 
ATOM   1139 N  N     . ALA A 1 153 ? -1.951  33.780 131.216 1.00 26.35 ? 151 ALA A N     1 
ATOM   1140 C  CA    . ALA A 1 153 ? -1.902  32.351 130.935 1.00 25.10 ? 151 ALA A CA    1 
ATOM   1141 C  C     . ALA A 1 153 ? -2.376  31.563 132.147 1.00 25.62 ? 151 ALA A C     1 
ATOM   1142 O  O     . ALA A 1 153 ? -3.196  30.653 132.025 1.00 23.74 ? 151 ALA A O     1 
ATOM   1143 C  CB    . ALA A 1 153 ? -0.479  31.931 130.567 1.00 22.80 ? 151 ALA A CB    1 
ATOM   1144 N  N     . ARG A 1 154 ? -1.849  31.917 133.313 1.00 28.35 ? 152 ARG A N     1 
ATOM   1145 C  CA    . ARG A 1 154 ? -2.216  31.244 134.553 1.00 31.06 ? 152 ARG A CA    1 
ATOM   1146 C  C     . ARG A 1 154 ? -3.715  31.326 134.835 1.00 32.66 ? 152 ARG A C     1 
ATOM   1147 O  O     . ARG A 1 154 ? -4.313  30.365 135.319 1.00 32.12 ? 152 ARG A O     1 
ATOM   1148 C  CB    . ARG A 1 154 ? -1.431  31.839 135.728 1.00 31.36 ? 152 ARG A CB    1 
ATOM   1149 C  CG    . ARG A 1 154 ? -0.055  31.209 135.937 1.00 32.28 ? 152 ARG A CG    1 
ATOM   1150 C  CD    . ARG A 1 154 ? -0.200  29.752 136.385 1.00 34.95 ? 152 ARG A CD    1 
ATOM   1151 N  NE    . ARG A 1 154 ? 1.069   29.025 136.419 1.00 35.90 ? 152 ARG A NE    1 
ATOM   1152 C  CZ    . ARG A 1 154 ? 2.058   29.283 137.267 1.00 35.99 ? 152 ARG A CZ    1 
ATOM   1153 N  NH1   . ARG A 1 154 ? 1.932   30.258 138.160 1.00 39.10 ? 152 ARG A NH1   1 
ATOM   1154 N  NH2   . ARG A 1 154 ? 3.169   28.563 137.227 1.00 34.71 ? 152 ARG A NH2   1 
ATOM   1155 N  N     . SER A 1 155 ? -4.323  32.465 134.518 1.00 33.37 ? 153 SER A N     1 
ATOM   1156 C  CA    . SER A 1 155 ? -5.747  32.641 134.775 1.00 35.65 ? 153 SER A CA    1 
ATOM   1157 C  C     . SER A 1 155 ? -6.611  31.843 133.803 1.00 35.79 ? 153 SER A C     1 
ATOM   1158 O  O     . SER A 1 155 ? -7.817  31.712 133.998 1.00 35.95 ? 153 SER A O     1 
ATOM   1159 C  CB    . SER A 1 155 ? -6.120  34.123 134.716 1.00 35.91 ? 153 SER A CB    1 
ATOM   1160 O  OG    . SER A 1 155 ? -5.992  34.635 133.401 1.00 39.21 ? 153 SER A OG    1 
ATOM   1161 N  N     . ARG A 1 156 ? -5.989  31.307 132.758 1.00 34.41 ? 154 ARG A N     1 
ATOM   1162 C  CA    . ARG A 1 156 ? -6.710  30.514 131.774 1.00 33.06 ? 154 ARG A CA    1 
ATOM   1163 C  C     . ARG A 1 156 ? -6.365  29.034 131.906 1.00 31.68 ? 154 ARG A C     1 
ATOM   1164 O  O     . ARG A 1 156 ? -6.876  28.202 131.161 1.00 31.86 ? 154 ARG A O     1 
ATOM   1165 C  CB    . ARG A 1 156 ? -6.376  31.000 130.367 1.00 35.49 ? 154 ARG A CB    1 
ATOM   1166 C  CG    . ARG A 1 156 ? -6.786  32.444 130.106 1.00 39.94 ? 154 ARG A CG    1 
ATOM   1167 C  CD    . ARG A 1 156 ? -8.300  32.596 130.049 1.00 43.99 ? 154 ARG A CD    1 
ATOM   1168 N  NE    . ARG A 1 156 ? -8.712  33.979 129.807 1.00 48.67 ? 154 ARG A NE    1 
ATOM   1169 C  CZ    . ARG A 1 156 ? -8.962  34.871 130.763 1.00 51.68 ? 154 ARG A CZ    1 
ATOM   1170 N  NH1   . ARG A 1 156 ? -8.848  34.535 132.043 1.00 53.51 ? 154 ARG A NH1   1 
ATOM   1171 N  NH2   . ARG A 1 156 ? -9.328  36.107 130.441 1.00 52.83 ? 154 ARG A NH2   1 
ATOM   1172 N  N     . GLY A 1 157 ? -5.496  28.709 132.856 1.00 28.49 ? 155 GLY A N     1 
ATOM   1173 C  CA    . GLY A 1 157 ? -5.115  27.323 133.050 1.00 26.25 ? 155 GLY A CA    1 
ATOM   1174 C  C     . GLY A 1 157 ? -4.072  26.851 132.055 1.00 25.94 ? 155 GLY A C     1 
ATOM   1175 O  O     . GLY A 1 157 ? -3.902  25.647 131.839 1.00 25.14 ? 155 GLY A O     1 
HETATM 1176 N  N     . MSE A 1 158 ? -3.368  27.799 131.445 1.00 23.87 ? 156 MSE A N     1 
HETATM 1177 C  CA    . MSE A 1 158 ? -2.335  27.467 130.472 1.00 23.90 ? 156 MSE A CA    1 
HETATM 1178 C  C     . MSE A 1 158 ? -1.016  27.123 131.153 1.00 23.55 ? 156 MSE A C     1 
HETATM 1179 O  O     . MSE A 1 158 ? -0.723  27.605 132.245 1.00 22.51 ? 156 MSE A O     1 
HETATM 1180 C  CB    . MSE A 1 158 ? -2.116  28.646 129.517 1.00 25.27 ? 156 MSE A CB    1 
HETATM 1181 C  CG    . MSE A 1 158 ? -3.314  28.952 128.614 1.00 26.23 ? 156 MSE A CG    1 
HETATM 1182 SE SE    . MSE A 1 158 ? -3.121  30.609 127.602 1.00 35.84 ? 156 MSE A SE    1 
HETATM 1183 C  CE    . MSE A 1 158 ? -1.902  29.981 126.223 1.00 28.52 ? 156 MSE A CE    1 
ATOM   1184 N  N     . THR A 1 159 ? -0.231  26.274 130.506 1.00 22.10 ? 157 THR A N     1 
ATOM   1185 C  CA    . THR A 1 159 ? 1.074   25.907 131.019 1.00 22.18 ? 157 THR A CA    1 
ATOM   1186 C  C     . THR A 1 159 ? 2.029   27.002 130.554 1.00 24.01 ? 157 THR A C     1 
ATOM   1187 O  O     . THR A 1 159 ? 1.961   27.452 129.409 1.00 22.92 ? 157 THR A O     1 
ATOM   1188 C  CB    . THR A 1 159 ? 1.512   24.546 130.465 1.00 23.13 ? 157 THR A CB    1 
ATOM   1189 O  OG1   . THR A 1 159 ? 0.647   23.533 130.998 1.00 22.48 ? 157 THR A OG1   1 
ATOM   1190 C  CG2   . THR A 1 159 ? 2.962   24.234 130.854 1.00 24.86 ? 157 THR A CG2   1 
ATOM   1191 N  N     . THR A 1 160 ? 2.912   27.437 131.445 1.00 23.22 ? 158 THR A N     1 
ATOM   1192 C  CA    . THR A 1 160 ? 3.853   28.501 131.111 1.00 23.50 ? 158 THR A CA    1 
ATOM   1193 C  C     . THR A 1 160 ? 5.273   28.017 130.884 1.00 22.84 ? 158 THR A C     1 
ATOM   1194 O  O     . THR A 1 160 ? 5.824   27.278 131.707 1.00 21.02 ? 158 THR A O     1 
ATOM   1195 C  CB    . THR A 1 160 ? 3.874   29.572 132.217 1.00 25.09 ? 158 THR A CB    1 
ATOM   1196 O  OG1   . THR A 1 160 ? 4.032   28.941 133.497 1.00 25.29 ? 158 THR A OG1   1 
ATOM   1197 C  CG2   . THR A 1 160 ? 2.576   30.369 132.203 1.00 25.49 ? 158 THR A CG2   1 
ATOM   1198 N  N     . VAL A 1 161 ? 5.861   28.431 129.762 1.00 20.86 ? 159 VAL A N     1 
ATOM   1199 C  CA    . VAL A 1 161 ? 7.231   28.056 129.434 1.00 20.83 ? 159 VAL A CA    1 
ATOM   1200 C  C     . VAL A 1 161 ? 8.012   29.346 129.249 1.00 22.25 ? 159 VAL A C     1 
ATOM   1201 O  O     . VAL A 1 161 ? 7.577   30.250 128.530 1.00 21.61 ? 159 VAL A O     1 
ATOM   1202 C  CB    . VAL A 1 161 ? 7.304   27.208 128.152 1.00 21.78 ? 159 VAL A CB    1 
ATOM   1203 C  CG1   . VAL A 1 161 ? 8.750   26.795 127.897 1.00 20.86 ? 159 VAL A CG1   1 
ATOM   1204 C  CG2   . VAL A 1 161 ? 6.422   25.971 128.297 1.00 21.78 ? 159 VAL A CG2   1 
ATOM   1205 N  N     . PHE A 1 162 ? 9.176   29.413 129.885 1.00 22.25 ? 160 PHE A N     1 
ATOM   1206 C  CA    . PHE A 1 162 ? 9.989   30.618 129.867 1.00 23.06 ? 160 PHE A CA    1 
ATOM   1207 C  C     . PHE A 1 162 ? 11.471  30.388 129.559 1.00 24.03 ? 160 PHE A C     1 
ATOM   1208 O  O     . PHE A 1 162 ? 12.131  29.532 130.159 1.00 23.68 ? 160 PHE A O     1 
ATOM   1209 C  CB    . PHE A 1 162 ? 9.816   31.298 131.230 1.00 24.53 ? 160 PHE A CB    1 
ATOM   1210 C  CG    . PHE A 1 162 ? 10.391  32.682 131.320 1.00 27.52 ? 160 PHE A CG    1 
ATOM   1211 C  CD1   . PHE A 1 162 ? 10.265  33.581 130.268 1.00 28.12 ? 160 PHE A CD1   1 
ATOM   1212 C  CD2   . PHE A 1 162 ? 10.985  33.113 132.501 1.00 27.21 ? 160 PHE A CD2   1 
ATOM   1213 C  CE1   . PHE A 1 162 ? 10.716  34.894 130.395 1.00 30.38 ? 160 PHE A CE1   1 
ATOM   1214 C  CE2   . PHE A 1 162 ? 11.437  34.422 132.640 1.00 30.36 ? 160 PHE A CE2   1 
ATOM   1215 C  CZ    . PHE A 1 162 ? 11.301  35.316 131.585 1.00 30.37 ? 160 PHE A CZ    1 
ATOM   1216 N  N     . ASN A 1 163 ? 11.974  31.154 128.594 1.00 24.06 ? 161 ASN A N     1 
ATOM   1217 C  CA    . ASN A 1 163 ? 13.373  31.104 128.181 1.00 26.22 ? 161 ASN A CA    1 
ATOM   1218 C  C     . ASN A 1 163 ? 13.810  32.567 128.267 1.00 27.43 ? 161 ASN A C     1 
ATOM   1219 O  O     . ASN A 1 163 ? 13.738  33.302 127.282 1.00 25.86 ? 161 ASN A O     1 
ATOM   1220 C  CB    . ASN A 1 163 ? 13.476  30.570 126.743 1.00 24.54 ? 161 ASN A CB    1 
ATOM   1221 C  CG    . ASN A 1 163 ? 14.900  30.609 126.192 1.00 26.38 ? 161 ASN A CG    1 
ATOM   1222 O  OD1   . ASN A 1 163 ? 15.872  30.336 126.905 1.00 25.42 ? 161 ASN A OD1   1 
ATOM   1223 N  ND2   . ASN A 1 163 ? 15.022  30.924 124.904 1.00 23.80 ? 161 ASN A ND2   1 
ATOM   1224 N  N     . PRO A 1 164 ? 14.252  33.004 129.463 1.00 28.54 ? 162 PRO A N     1 
ATOM   1225 C  CA    . PRO A 1 164 ? 14.700  34.370 129.752 1.00 29.86 ? 162 PRO A CA    1 
ATOM   1226 C  C     . PRO A 1 164 ? 15.974  34.791 129.028 1.00 32.82 ? 162 PRO A C     1 
ATOM   1227 O  O     . PRO A 1 164 ? 17.037  34.927 129.635 1.00 32.62 ? 162 PRO A O     1 
ATOM   1228 C  CB    . PRO A 1 164 ? 14.852  34.359 131.270 1.00 28.68 ? 162 PRO A CB    1 
ATOM   1229 C  CG    . PRO A 1 164 ? 15.368  32.987 131.527 1.00 28.96 ? 162 PRO A CG    1 
ATOM   1230 C  CD    . PRO A 1 164 ? 14.484  32.126 130.628 1.00 29.61 ? 162 PRO A CD    1 
ATOM   1231 N  N     . SER A 1 165 ? 15.842  35.007 127.724 1.00 33.82 ? 163 SER A N     1 
ATOM   1232 C  CA    . SER A 1 165 ? 16.958  35.406 126.873 1.00 36.87 ? 163 SER A CA    1 
ATOM   1233 C  C     . SER A 1 165 ? 16.383  36.272 125.756 1.00 37.13 ? 163 SER A C     1 
ATOM   1234 O  O     . SER A 1 165 ? 15.490  35.832 125.033 1.00 36.37 ? 163 SER A O     1 
ATOM   1235 C  CB    . SER A 1 165 ? 17.628  34.153 126.285 1.00 37.58 ? 163 SER A CB    1 
ATOM   1236 O  OG    . SER A 1 165 ? 18.703  34.477 125.420 1.00 40.46 ? 163 SER A OG    1 
ATOM   1237 N  N     . PRO A 1 166 ? 16.870  37.517 125.604 1.00 38.59 ? 164 PRO A N     1 
ATOM   1238 C  CA    . PRO A 1 166 ? 17.914  38.215 126.368 1.00 40.44 ? 164 PRO A CA    1 
ATOM   1239 C  C     . PRO A 1 166 ? 17.588  38.242 127.852 1.00 40.13 ? 164 PRO A C     1 
ATOM   1240 O  O     . PRO A 1 166 ? 16.425  38.340 128.230 1.00 39.71 ? 164 PRO A O     1 
ATOM   1241 C  CB    . PRO A 1 166 ? 17.907  39.619 125.764 1.00 40.24 ? 164 PRO A CB    1 
ATOM   1242 C  CG    . PRO A 1 166 ? 17.473  39.377 124.360 1.00 41.05 ? 164 PRO A CG    1 
ATOM   1243 C  CD    . PRO A 1 166 ? 16.347  38.390 124.540 1.00 39.64 ? 164 PRO A CD    1 
ATOM   1244 N  N     . VAL A 1 167 ? 18.615  38.172 128.689 1.00 41.17 ? 165 VAL A N     1 
ATOM   1245 C  CA    . VAL A 1 167 ? 18.407  38.169 130.129 1.00 41.88 ? 165 VAL A CA    1 
ATOM   1246 C  C     . VAL A 1 167 ? 18.076  39.548 130.703 1.00 42.19 ? 165 VAL A C     1 
ATOM   1247 O  O     . VAL A 1 167 ? 18.534  40.576 130.205 1.00 42.11 ? 165 VAL A O     1 
ATOM   1248 C  CB    . VAL A 1 167 ? 19.646  37.591 130.863 1.00 42.55 ? 165 VAL A CB    1 
ATOM   1249 C  CG1   . VAL A 1 167 ? 20.858  38.487 130.638 1.00 43.78 ? 165 VAL A CG1   1 
ATOM   1250 C  CG2   . VAL A 1 167 ? 19.354  37.450 132.346 1.00 43.13 ? 165 VAL A CG2   1 
ATOM   1251 N  N     . ASN A 1 168 ? 17.242  39.546 131.740 1.00 42.27 ? 166 ASN A N     1 
ATOM   1252 C  CA    . ASN A 1 168 ? 16.837  40.756 132.450 1.00 42.56 ? 166 ASN A CA    1 
ATOM   1253 C  C     . ASN A 1 168 ? 16.909  40.365 133.918 1.00 42.56 ? 166 ASN A C     1 
ATOM   1254 O  O     . ASN A 1 168 ? 16.211  39.449 134.357 1.00 40.41 ? 166 ASN A O     1 
ATOM   1255 C  CB    . ASN A 1 168 ? 15.402  41.161 132.107 1.00 42.82 ? 166 ASN A CB    1 
ATOM   1256 C  CG    . ASN A 1 168 ? 14.955  42.416 132.851 1.00 44.47 ? 166 ASN A CG    1 
ATOM   1257 O  OD1   . ASN A 1 168 ? 15.284  42.609 134.023 1.00 45.35 ? 166 ASN A OD1   1 
ATOM   1258 N  ND2   . ASN A 1 168 ? 14.190  43.267 132.175 1.00 44.20 ? 166 ASN A ND2   1 
ATOM   1259 N  N     . PRO A 1 169 ? 17.763  41.046 134.696 1.00 43.31 ? 167 PRO A N     1 
ATOM   1260 C  CA    . PRO A 1 169 ? 17.921  40.753 136.125 1.00 43.34 ? 167 PRO A CA    1 
ATOM   1261 C  C     . PRO A 1 169 ? 16.596  40.582 136.870 1.00 42.19 ? 167 PRO A C     1 
ATOM   1262 O  O     . PRO A 1 169 ? 16.448  39.676 137.691 1.00 41.80 ? 167 PRO A O     1 
ATOM   1263 C  CB    . PRO A 1 169 ? 18.718  41.954 136.636 1.00 44.13 ? 167 PRO A CB    1 
ATOM   1264 C  CG    . PRO A 1 169 ? 19.534  42.348 135.442 1.00 44.37 ? 167 PRO A CG    1 
ATOM   1265 C  CD    . PRO A 1 169 ? 18.537  42.241 134.315 1.00 43.49 ? 167 PRO A CD    1 
ATOM   1266 N  N     . ASP A 1 170 ? 15.633  41.447 136.569 1.00 40.50 ? 168 ASP A N     1 
ATOM   1267 C  CA    . ASP A 1 170 ? 14.335  41.403 137.231 1.00 41.23 ? 168 ASP A CA    1 
ATOM   1268 C  C     . ASP A 1 170 ? 13.477  40.185 136.902 1.00 40.33 ? 168 ASP A C     1 
ATOM   1269 O  O     . ASP A 1 170 ? 12.415  39.998 137.496 1.00 39.56 ? 168 ASP A O     1 
ATOM   1270 C  CB    . ASP A 1 170 ? 13.551  42.680 136.928 1.00 44.34 ? 168 ASP A CB    1 
ATOM   1271 C  CG    . ASP A 1 170 ? 14.204  43.912 137.518 1.00 46.32 ? 168 ASP A CG    1 
ATOM   1272 O  OD1   . ASP A 1 170 ? 14.435  43.925 138.745 1.00 49.12 ? 168 ASP A OD1   1 
ATOM   1273 O  OD2   . ASP A 1 170 ? 14.487  44.862 136.760 1.00 47.69 ? 168 ASP A OD2   1 
ATOM   1274 N  N     . PHE A 1 171 ? 13.932  39.365 135.958 1.00 37.70 ? 169 PHE A N     1 
ATOM   1275 C  CA    . PHE A 1 171 ? 13.200  38.159 135.585 1.00 36.48 ? 169 PHE A CA    1 
ATOM   1276 C  C     . PHE A 1 171 ? 13.263  37.151 136.731 1.00 36.97 ? 169 PHE A C     1 
ATOM   1277 O  O     . PHE A 1 171 ? 12.441  36.240 136.814 1.00 35.47 ? 169 PHE A O     1 
ATOM   1278 C  CB    . PHE A 1 171 ? 13.804  37.528 134.320 1.00 34.06 ? 169 PHE A CB    1 
ATOM   1279 C  CG    . PHE A 1 171 ? 13.416  38.222 133.032 1.00 33.61 ? 169 PHE A CG    1 
ATOM   1280 C  CD1   . PHE A 1 171 ? 14.082  37.924 131.844 1.00 33.01 ? 169 PHE A CD1   1 
ATOM   1281 C  CD2   . PHE A 1 171 ? 12.370  39.142 132.995 1.00 33.87 ? 169 PHE A CD2   1 
ATOM   1282 C  CE1   . PHE A 1 171 ? 13.713  38.526 130.639 1.00 32.99 ? 169 PHE A CE1   1 
ATOM   1283 C  CE2   . PHE A 1 171 ? 11.992  39.751 131.796 1.00 33.49 ? 169 PHE A CE2   1 
ATOM   1284 C  CZ    . PHE A 1 171 ? 12.668  39.439 130.614 1.00 33.86 ? 169 PHE A CZ    1 
ATOM   1285 N  N     . CYS A 1 172 ? 14.237  37.323 137.621 1.00 38.12 ? 170 CYS A N     1 
ATOM   1286 C  CA    . CYS A 1 172 ? 14.403  36.407 138.747 1.00 41.10 ? 170 CYS A CA    1 
ATOM   1287 C  C     . CYS A 1 172 ? 13.225  36.433 139.721 1.00 41.15 ? 170 CYS A C     1 
ATOM   1288 O  O     . CYS A 1 172 ? 13.197  35.676 140.687 1.00 43.06 ? 170 CYS A O     1 
ATOM   1289 C  CB    . CYS A 1 172 ? 15.699  36.723 139.501 1.00 41.25 ? 170 CYS A CB    1 
ATOM   1290 S  SG    . CYS A 1 172 ? 15.692  38.309 140.359 1.00 47.82 ? 170 CYS A SG    1 
ATOM   1291 N  N     . HIS A 1 173 ? 12.249  37.295 139.456 1.00 42.31 ? 171 HIS A N     1 
ATOM   1292 C  CA    . HIS A 1 173 ? 11.070  37.416 140.315 1.00 43.48 ? 171 HIS A CA    1 
ATOM   1293 C  C     . HIS A 1 173 ? 9.874   36.608 139.800 1.00 42.29 ? 171 HIS A C     1 
ATOM   1294 O  O     . HIS A 1 173 ? 8.938   36.327 140.550 1.00 42.63 ? 171 HIS A O     1 
ATOM   1295 C  CB    . HIS A 1 173 ? 10.643  38.884 140.408 1.00 46.58 ? 171 HIS A CB    1 
ATOM   1296 C  CG    . HIS A 1 173 ? 11.698  39.797 140.955 1.00 50.44 ? 171 HIS A CG    1 
ATOM   1297 N  ND1   . HIS A 1 173 ? 11.738  41.143 140.659 1.00 52.17 ? 171 HIS A ND1   1 
ATOM   1298 C  CD2   . HIS A 1 173 ? 12.734  39.565 141.796 1.00 51.66 ? 171 HIS A CD2   1 
ATOM   1299 C  CE1   . HIS A 1 173 ? 12.754  41.701 141.293 1.00 53.04 ? 171 HIS A CE1   1 
ATOM   1300 N  NE2   . HIS A 1 173 ? 13.374  40.765 141.990 1.00 53.52 ? 171 HIS A NE2   1 
ATOM   1301 N  N     . LEU A 1 174 ? 9.915   36.227 138.527 1.00 39.45 ? 172 LEU A N     1 
ATOM   1302 C  CA    . LEU A 1 174 ? 8.808   35.511 137.896 1.00 35.91 ? 172 LEU A CA    1 
ATOM   1303 C  C     . LEU A 1 174 ? 8.723   34.000 138.066 1.00 34.47 ? 172 LEU A C     1 
ATOM   1304 O  O     . LEU A 1 174 ? 7.717   33.393 137.697 1.00 33.81 ? 172 LEU A O     1 
ATOM   1305 C  CB    . LEU A 1 174 ? 8.806   35.826 136.400 1.00 36.22 ? 172 LEU A CB    1 
ATOM   1306 C  CG    . LEU A 1 174 ? 8.763   37.311 136.051 1.00 35.60 ? 172 LEU A CG    1 
ATOM   1307 C  CD1   . LEU A 1 174 ? 8.874   37.501 134.542 1.00 35.91 ? 172 LEU A CD1   1 
ATOM   1308 C  CD2   . LEU A 1 174 ? 7.471   37.908 136.580 1.00 36.58 ? 172 LEU A CD2   1 
ATOM   1309 N  N     . TRP A 1 175 ? 9.755   33.385 138.627 1.00 32.24 ? 173 TRP A N     1 
ATOM   1310 C  CA    . TRP A 1 175 ? 9.759   31.937 138.764 1.00 31.25 ? 173 TRP A CA    1 
ATOM   1311 C  C     . TRP A 1 175 ? 8.470   31.276 139.249 1.00 31.33 ? 173 TRP A C     1 
ATOM   1312 O  O     . TRP A 1 175 ? 8.106   30.207 138.756 1.00 29.90 ? 173 TRP A O     1 
ATOM   1313 C  CB    . TRP A 1 175 ? 10.961  31.505 139.604 1.00 31.95 ? 173 TRP A CB    1 
ATOM   1314 C  CG    . TRP A 1 175 ? 12.247  31.813 138.880 1.00 33.60 ? 173 TRP A CG    1 
ATOM   1315 C  CD1   . TRP A 1 175 ? 13.314  32.516 139.362 1.00 34.04 ? 173 TRP A CD1   1 
ATOM   1316 C  CD2   . TRP A 1 175 ? 12.557  31.500 137.513 1.00 32.97 ? 173 TRP A CD2   1 
ATOM   1317 N  NE1   . TRP A 1 175 ? 14.264  32.668 138.379 1.00 34.42 ? 173 TRP A NE1   1 
ATOM   1318 C  CE2   . TRP A 1 175 ? 13.826  32.054 137.235 1.00 33.86 ? 173 TRP A CE2   1 
ATOM   1319 C  CE3   . TRP A 1 175 ? 11.884  30.806 136.496 1.00 31.92 ? 173 TRP A CE3   1 
ATOM   1320 C  CZ2   . TRP A 1 175 ? 14.437  31.939 135.978 1.00 33.48 ? 173 TRP A CZ2   1 
ATOM   1321 C  CZ3   . TRP A 1 175 ? 12.489  30.692 135.248 1.00 31.84 ? 173 TRP A CZ3   1 
ATOM   1322 C  CH2   . TRP A 1 175 ? 13.755  31.257 135.000 1.00 32.59 ? 173 TRP A CH2   1 
ATOM   1323 N  N     . PRO A 1 176 ? 7.752   31.900 140.198 1.00 31.33 ? 174 PRO A N     1 
ATOM   1324 C  CA    . PRO A 1 176 ? 6.508   31.287 140.677 1.00 31.67 ? 174 PRO A CA    1 
ATOM   1325 C  C     . PRO A 1 176 ? 5.446   31.142 139.580 1.00 31.43 ? 174 PRO A C     1 
ATOM   1326 O  O     . PRO A 1 176 ? 4.547   30.307 139.673 1.00 30.02 ? 174 PRO A O     1 
ATOM   1327 C  CB    . PRO A 1 176 ? 6.057   32.244 141.783 1.00 32.42 ? 174 PRO A CB    1 
ATOM   1328 C  CG    . PRO A 1 176 ? 7.358   32.769 142.318 1.00 33.64 ? 174 PRO A CG    1 
ATOM   1329 C  CD    . PRO A 1 176 ? 8.115   33.057 141.034 1.00 31.87 ? 174 PRO A CD    1 
ATOM   1330 N  N     . LEU A 1 177 ? 5.559   31.961 138.540 1.00 30.16 ? 175 LEU A N     1 
ATOM   1331 C  CA    . LEU A 1 177 ? 4.600   31.940 137.443 1.00 29.56 ? 175 LEU A CA    1 
ATOM   1332 C  C     . LEU A 1 177 ? 4.990   30.992 136.323 1.00 28.67 ? 175 LEU A C     1 
ATOM   1333 O  O     . LEU A 1 177 ? 4.266   30.877 135.334 1.00 29.19 ? 175 LEU A O     1 
ATOM   1334 C  CB    . LEU A 1 177 ? 4.457   33.344 136.853 1.00 30.39 ? 175 LEU A CB    1 
ATOM   1335 C  CG    . LEU A 1 177 ? 3.854   34.424 137.747 1.00 32.31 ? 175 LEU A CG    1 
ATOM   1336 C  CD1   . LEU A 1 177 ? 4.052   35.794 137.112 1.00 31.92 ? 175 LEU A CD1   1 
ATOM   1337 C  CD2   . LEU A 1 177 ? 2.388   34.127 137.961 1.00 31.83 ? 175 LEU A CD2   1 
ATOM   1338 N  N     . ILE A 1 178 ? 6.116   30.305 136.486 1.00 27.67 ? 176 ILE A N     1 
ATOM   1339 C  CA    . ILE A 1 178 ? 6.629   29.423 135.443 1.00 27.30 ? 176 ILE A CA    1 
ATOM   1340 C  C     . ILE A 1 178 ? 6.602   27.925 135.722 1.00 26.96 ? 176 ILE A C     1 
ATOM   1341 O  O     . ILE A 1 178 ? 7.021   27.468 136.783 1.00 26.21 ? 176 ILE A O     1 
ATOM   1342 C  CB    . ILE A 1 178 ? 8.063   29.861 135.087 1.00 29.02 ? 176 ILE A CB    1 
ATOM   1343 C  CG1   . ILE A 1 178 ? 8.021   31.324 134.634 1.00 30.88 ? 176 ILE A CG1   1 
ATOM   1344 C  CG2   . ILE A 1 178 ? 8.646   28.985 133.974 1.00 24.96 ? 176 ILE A CG2   1 
ATOM   1345 C  CD1   . ILE A 1 178 ? 9.161   32.154 135.147 1.00 36.86 ? 176 ILE A CD1   1 
ATOM   1346 N  N     . ASP A 1 179 ? 6.109   27.166 134.747 1.00 24.46 ? 177 ASP A N     1 
ATOM   1347 C  CA    . ASP A 1 179 ? 6.032   25.715 134.866 1.00 25.25 ? 177 ASP A CA    1 
ATOM   1348 C  C     . ASP A 1 179 ? 7.285   25.046 134.306 1.00 25.59 ? 177 ASP A C     1 
ATOM   1349 O  O     . ASP A 1 179 ? 7.772   24.055 134.863 1.00 25.61 ? 177 ASP A O     1 
ATOM   1350 C  CB    . ASP A 1 179 ? 4.794   25.184 134.131 1.00 25.48 ? 177 ASP A CB    1 
ATOM   1351 C  CG    . ASP A 1 179 ? 3.495   25.663 134.760 1.00 28.15 ? 177 ASP A CG    1 
ATOM   1352 O  OD1   . ASP A 1 179 ? 3.382   25.595 136.000 1.00 28.23 ? 177 ASP A OD1   1 
ATOM   1353 O  OD2   . ASP A 1 179 ? 2.583   26.098 134.023 1.00 29.52 ? 177 ASP A OD2   1 
ATOM   1354 N  N     . ILE A 1 180 ? 7.796   25.582 133.197 1.00 23.81 ? 178 ILE A N     1 
ATOM   1355 C  CA    . ILE A 1 180 ? 8.991   25.037 132.564 1.00 24.33 ? 178 ILE A CA    1 
ATOM   1356 C  C     . ILE A 1 180 ? 9.975   26.159 132.252 1.00 24.97 ? 178 ILE A C     1 
ATOM   1357 O  O     . ILE A 1 180 ? 9.621   27.128 131.585 1.00 24.55 ? 178 ILE A O     1 
ATOM   1358 C  CB    . ILE A 1 180 ? 8.643   24.304 131.244 1.00 23.99 ? 178 ILE A CB    1 
ATOM   1359 C  CG1   . ILE A 1 180 ? 7.697   23.135 131.531 1.00 24.58 ? 178 ILE A CG1   1 
ATOM   1360 C  CG2   . ILE A 1 180 ? 9.919   23.804 130.571 1.00 24.53 ? 178 ILE A CG2   1 
ATOM   1361 C  CD1   . ILE A 1 180 ? 7.023   22.576 130.288 1.00 26.19 ? 178 ILE A CD1   1 
ATOM   1362 N  N     . ALA A 1 181 ? 11.200  26.024 132.755 1.00 24.85 ? 179 ALA A N     1 
ATOM   1363 C  CA    . ALA A 1 181 ? 12.247  27.014 132.522 1.00 26.19 ? 179 ALA A CA    1 
ATOM   1364 C  C     . ALA A 1 181 ? 13.386  26.406 131.710 1.00 25.69 ? 179 ALA A C     1 
ATOM   1365 O  O     . ALA A 1 181 ? 13.844  25.295 131.981 1.00 25.48 ? 179 ALA A O     1 
ATOM   1366 C  CB    . ALA A 1 181 ? 12.785  27.533 133.848 1.00 27.07 ? 179 ALA A CB    1 
ATOM   1367 N  N     . VAL A 1 182 ? 13.830  27.146 130.704 1.00 26.22 ? 180 VAL A N     1 
ATOM   1368 C  CA    . VAL A 1 182 ? 14.923  26.716 129.850 1.00 25.24 ? 180 VAL A CA    1 
ATOM   1369 C  C     . VAL A 1 182 ? 15.940  27.846 129.891 1.00 25.98 ? 180 VAL A C     1 
ATOM   1370 O  O     . VAL A 1 182 ? 15.663  28.946 129.420 1.00 26.75 ? 180 VAL A O     1 
ATOM   1371 C  CB    . VAL A 1 182 ? 14.443  26.502 128.397 1.00 26.16 ? 180 VAL A CB    1 
ATOM   1372 C  CG1   . VAL A 1 182 ? 15.609  26.078 127.515 1.00 26.32 ? 180 VAL A CG1   1 
ATOM   1373 C  CG2   . VAL A 1 182 ? 13.355  25.435 128.369 1.00 26.50 ? 180 VAL A CG2   1 
ATOM   1374 N  N     . VAL A 1 183 ? 17.107  27.571 130.465 1.00 26.18 ? 181 VAL A N     1 
ATOM   1375 C  CA    . VAL A 1 183 ? 18.159  28.575 130.592 1.00 28.06 ? 181 VAL A CA    1 
ATOM   1376 C  C     . VAL A 1 183 ? 19.533  28.022 130.227 1.00 29.39 ? 181 VAL A C     1 
ATOM   1377 O  O     . VAL A 1 183 ? 19.764  26.819 130.325 1.00 29.83 ? 181 VAL A O     1 
ATOM   1378 C  CB    . VAL A 1 183 ? 18.247  29.091 132.051 1.00 28.33 ? 181 VAL A CB    1 
ATOM   1379 C  CG1   . VAL A 1 183 ? 16.942  29.750 132.458 1.00 27.91 ? 181 VAL A CG1   1 
ATOM   1380 C  CG2   . VAL A 1 183 ? 18.558  27.931 132.992 1.00 27.19 ? 181 VAL A CG2   1 
ATOM   1381 N  N     . ASN A 1 184 ? 20.444  28.891 129.796 1.00 30.97 ? 182 ASN A N     1 
ATOM   1382 C  CA    . ASN A 1 184 ? 21.792  28.425 129.499 1.00 33.47 ? 182 ASN A CA    1 
ATOM   1383 C  C     . ASN A 1 184 ? 22.581  28.637 130.790 1.00 34.21 ? 182 ASN A C     1 
ATOM   1384 O  O     . ASN A 1 184 ? 22.027  29.124 131.775 1.00 33.13 ? 182 ASN A O     1 
ATOM   1385 C  CB    . ASN A 1 184 ? 22.425  29.188 128.318 1.00 33.08 ? 182 ASN A CB    1 
ATOM   1386 C  CG    . ASN A 1 184 ? 22.557  30.677 128.571 1.00 33.68 ? 182 ASN A CG    1 
ATOM   1387 O  OD1   . ASN A 1 184 ? 22.701  31.117 129.710 1.00 32.17 ? 182 ASN A OD1   1 
ATOM   1388 N  ND2   . ASN A 1 184 ? 22.535  31.461 127.496 1.00 32.72 ? 182 ASN A ND2   1 
ATOM   1389 N  N     . GLU A 1 185 ? 23.859  28.280 130.795 1.00 36.98 ? 183 GLU A N     1 
ATOM   1390 C  CA    . GLU A 1 185 ? 24.677  28.415 132.002 1.00 39.46 ? 183 GLU A CA    1 
ATOM   1391 C  C     . GLU A 1 185 ? 24.638  29.779 132.682 1.00 38.24 ? 183 GLU A C     1 
ATOM   1392 O  O     . GLU A 1 185 ? 24.341  29.883 133.872 1.00 39.12 ? 183 GLU A O     1 
ATOM   1393 C  CB    . GLU A 1 185 ? 26.137  28.069 131.699 1.00 42.86 ? 183 GLU A CB    1 
ATOM   1394 C  CG    . GLU A 1 185 ? 26.345  26.703 131.077 1.00 48.22 ? 183 GLU A CG    1 
ATOM   1395 C  CD    . GLU A 1 185 ? 27.794  26.460 130.695 1.00 49.82 ? 183 GLU A CD    1 
ATOM   1396 O  OE1   . GLU A 1 185 ? 28.529  27.451 130.508 1.00 51.75 ? 183 GLU A OE1   1 
ATOM   1397 O  OE2   . GLU A 1 185 ? 28.198  25.287 130.571 1.00 51.87 ? 183 GLU A OE2   1 
ATOM   1398 N  N     . SER A 1 186 ? 24.943  30.828 131.935 1.00 37.03 ? 184 SER A N     1 
ATOM   1399 C  CA    . SER A 1 186 ? 24.967  32.155 132.525 1.00 36.84 ? 184 SER A CA    1 
ATOM   1400 C  C     . SER A 1 186 ? 23.617  32.506 133.134 1.00 35.70 ? 184 SER A C     1 
ATOM   1401 O  O     . SER A 1 186 ? 23.538  32.954 134.275 1.00 35.39 ? 184 SER A O     1 
ATOM   1402 C  CB    . SER A 1 186 ? 25.350  33.193 131.476 1.00 36.41 ? 184 SER A CB    1 
ATOM   1403 O  OG    . SER A 1 186 ? 24.274  33.430 130.600 1.00 43.22 ? 184 SER A OG    1 
ATOM   1404 N  N     . GLU A 1 187 ? 22.564  32.302 132.352 1.00 34.00 ? 185 GLU A N     1 
ATOM   1405 C  CA    . GLU A 1 187 ? 21.206  32.562 132.798 1.00 32.61 ? 185 GLU A CA    1 
ATOM   1406 C  C     . GLU A 1 187 ? 20.820  31.796 134.074 1.00 31.14 ? 185 GLU A C     1 
ATOM   1407 O  O     . GLU A 1 187 ? 20.152  32.369 134.951 1.00 30.49 ? 185 GLU A O     1 
ATOM   1408 C  CB    . GLU A 1 187 ? 20.221  32.242 131.666 1.00 32.41 ? 185 GLU A CB    1 
ATOM   1409 C  CG    . GLU A 1 187 ? 20.301  33.204 130.484 1.00 31.35 ? 185 GLU A CG    1 
ATOM   1410 C  CD    . GLU A 1 187 ? 19.830  32.579 129.190 1.00 33.61 ? 185 GLU A CD    1 
ATOM   1411 O  OE1   . GLU A 1 187 ? 19.232  31.484 129.240 1.00 30.47 ? 185 GLU A OE1   1 
ATOM   1412 O  OE2   . GLU A 1 187 ? 20.059  33.188 128.123 1.00 33.14 ? 185 GLU A OE2   1 
ATOM   1413 N  N     . ALA A 1 188 ? 21.248  30.535 134.178 1.00 31.71 ? 186 ALA A N     1 
ATOM   1414 C  CA    . ALA A 1 188 ? 20.969  29.682 135.345 1.00 30.57 ? 186 ALA A CA    1 
ATOM   1415 C  C     . ALA A 1 188 ? 21.606  30.258 136.601 1.00 33.09 ? 186 ALA A C     1 
ATOM   1416 O  O     . ALA A 1 188 ? 20.983  30.295 137.664 1.00 33.12 ? 186 ALA A O     1 
ATOM   1417 C  CB    . ALA A 1 188 ? 21.478  28.223 135.074 1.00 30.53 ? 186 ALA A CB    1 
ATOM   1418 N  N     . GLU A 1 189 ? 22.827  30.759 136.469 1.00 33.57 ? 187 GLU A N     1 
ATOM   1419 C  CA    . GLU A 1 189 ? 23.502  31.343 137.631 1.00 34.15 ? 187 GLU A CA    1 
ATOM   1420 C  C     . GLU A 1 189 ? 23.043  32.761 138.015 1.00 35.01 ? 187 GLU A C     1 
ATOM   1421 O  O     . GLU A 1 189 ? 23.000  33.092 139.179 1.00 35.30 ? 187 GLU A O     1 
ATOM   1422 C  CB    . GLU A 1 189 ? 25.009  31.376 137.421 1.00 35.94 ? 187 GLU A CB    1 
ATOM   1423 C  CG    . GLU A 1 189 ? 25.720  32.026 138.568 1.00 36.34 ? 187 GLU A CG    1 
ATOM   1424 C  CD    . GLU A 1 189 ? 27.247  31.820 138.512 1.00 39.84 ? 187 GLU A CD    1 
ATOM   1425 O  OE1   . GLU A 1 189 ? 27.701  31.028 137.672 1.00 39.31 ? 187 GLU A OE1   1 
ATOM   1426 O  OE2   . GLU A 1 189 ? 27.940  32.478 139.296 1.00 40.75 ? 187 GLU A OE2   1 
ATOM   1427 N  N     . LEU A 1 190 ? 22.727  33.567 137.001 1.00 35.91 ? 188 LEU A N     1 
ATOM   1428 C  CA    . LEU A 1 190 ? 22.255  34.939 137.149 1.00 37.91 ? 188 LEU A CA    1 
ATOM   1429 C  C     . LEU A 1 190 ? 20.833  35.112 137.649 1.00 38.80 ? 188 LEU A C     1 
ATOM   1430 O  O     . LEU A 1 190 ? 20.606  35.958 138.482 1.00 39.43 ? 188 LEU A O     1 
ATOM   1431 C  CB    . LEU A 1 190 ? 22.447  35.758 135.876 1.00 38.72 ? 188 LEU A CB    1 
ATOM   1432 C  CG    . LEU A 1 190 ? 21.704  37.077 135.679 1.00 40.93 ? 188 LEU A CG    1 
ATOM   1433 C  CD1   . LEU A 1 190 ? 21.711  37.969 136.962 1.00 43.49 ? 188 LEU A CD1   1 
ATOM   1434 C  CD2   . LEU A 1 190 ? 22.272  37.808 134.432 1.00 42.59 ? 188 LEU A CD2   1 
ATOM   1435 N  N     . LEU A 1 191 ? 19.866  34.416 137.066 1.00 38.37 ? 189 LEU A N     1 
ATOM   1436 C  CA    . LEU A 1 191 ? 18.470  34.391 137.534 1.00 39.01 ? 189 LEU A CA    1 
ATOM   1437 C  C     . LEU A 1 191 ? 18.145  33.388 138.627 1.00 39.48 ? 189 LEU A C     1 
ATOM   1438 O  O     . LEU A 1 191 ? 17.083  33.494 139.235 1.00 39.03 ? 189 LEU A O     1 
ATOM   1439 C  CB    . LEU A 1 191 ? 17.522  34.178 136.342 1.00 38.42 ? 189 LEU A CB    1 
ATOM   1440 C  CG    . LEU A 1 191 ? 17.271  35.269 135.343 1.00 39.21 ? 189 LEU A CG    1 
ATOM   1441 C  CD1   . LEU A 1 191 ? 18.128  36.531 135.530 1.00 39.50 ? 189 LEU A CD1   1 
ATOM   1442 C  CD2   . LEU A 1 191 ? 17.189  34.693 133.943 1.00 39.14 ? 189 LEU A CD2   1 
ATOM   1443 N  N     . GLN A 1 192 ? 19.040  32.428 138.863 1.00 40.01 ? 190 GLN A N     1 
ATOM   1444 C  CA    . GLN A 1 192 ? 18.827  31.409 139.929 1.00 40.59 ? 190 GLN A CA    1 
ATOM   1445 C  C     . GLN A 1 192 ? 17.402  30.851 139.986 1.00 41.00 ? 190 GLN A C     1 
ATOM   1446 O  O     . GLN A 1 192 ? 16.680  31.008 140.988 1.00 40.21 ? 190 GLN A O     1 
ATOM   1447 C  CB    . GLN A 1 192 ? 19.189  31.976 141.326 1.00 40.72 ? 190 GLN A CB    1 
ATOM   1448 C  CG    . GLN A 1 192 ? 19.937  30.986 142.231 1.00 44.40 ? 190 GLN A CG    1 
ATOM   1449 C  CD    . GLN A 1 192 ? 21.259  30.540 141.625 1.00 40.00 ? 190 GLN A CD    1 
ATOM   1450 O  OE1   . GLN A 1 192 ? 22.141  31.354 141.353 1.00 43.40 ? 190 GLN A OE1   1 
ATOM   1451 N  NE2   . GLN A 1 192 ? 21.399  29.246 141.412 1.00 40.74 ? 190 GLN A NE2   1 
ATOM   1452 N  N     . PRO A 1 193 ? 16.984  30.187 138.906 1.00 41.26 ? 191 PRO A N     1 
ATOM   1453 C  CA    . PRO A 1 193 ? 15.638  29.625 138.885 1.00 41.68 ? 191 PRO A CA    1 
ATOM   1454 C  C     . PRO A 1 193 ? 15.466  28.659 140.045 1.00 42.39 ? 191 PRO A C     1 
ATOM   1455 O  O     . PRO A 1 193 ? 16.343  27.842 140.311 1.00 42.58 ? 191 PRO A O     1 
ATOM   1456 C  CB    . PRO A 1 193 ? 15.569  28.948 137.518 1.00 41.61 ? 191 PRO A CB    1 
ATOM   1457 C  CG    . PRO A 1 193 ? 17.007  28.649 137.191 1.00 40.60 ? 191 PRO A CG    1 
ATOM   1458 C  CD    . PRO A 1 193 ? 17.690  29.911 137.645 1.00 40.32 ? 191 PRO A CD    1 
ATOM   1459 N  N     . TYR A 1 194 ? 14.336  28.763 140.738 1.00 43.31 ? 192 TYR A N     1 
ATOM   1460 C  CA    . TYR A 1 194 ? 14.046  27.915 141.891 1.00 42.51 ? 192 TYR A CA    1 
ATOM   1461 C  C     . TYR A 1 194 ? 12.574  27.521 141.930 1.00 40.76 ? 192 TYR A C     1 
ATOM   1462 O  O     . TYR A 1 194 ? 11.710  28.265 141.471 1.00 39.14 ? 192 TYR A O     1 
ATOM   1463 C  CB    . TYR A 1 194 ? 14.389  28.670 143.181 1.00 44.77 ? 192 TYR A CB    1 
ATOM   1464 C  CG    . TYR A 1 194 ? 13.487  29.868 143.432 1.00 47.86 ? 192 TYR A CG    1 
ATOM   1465 C  CD1   . TYR A 1 194 ? 12.200  29.705 143.951 1.00 48.25 ? 192 TYR A CD1   1 
ATOM   1466 C  CD2   . TYR A 1 194 ? 13.899  31.158 143.095 1.00 48.93 ? 192 TYR A CD2   1 
ATOM   1467 C  CE1   . TYR A 1 194 ? 11.347  30.795 144.122 1.00 49.50 ? 192 TYR A CE1   1 
ATOM   1468 C  CE2   . TYR A 1 194 ? 13.052  32.255 143.262 1.00 49.22 ? 192 TYR A CE2   1 
ATOM   1469 C  CZ    . TYR A 1 194 ? 11.781  32.065 143.774 1.00 49.04 ? 192 TYR A CZ    1 
ATOM   1470 O  OH    . TYR A 1 194 ? 10.945  33.147 143.932 1.00 51.22 ? 192 TYR A OH    1 
ATOM   1471 N  N     . GLY A 1 195 ? 12.294  26.350 142.487 1.00 39.60 ? 193 GLY A N     1 
ATOM   1472 C  CA    . GLY A 1 195 ? 10.917  25.907 142.601 1.00 38.50 ? 193 GLY A CA    1 
ATOM   1473 C  C     . GLY A 1 195 ? 10.201  25.632 141.293 1.00 37.19 ? 193 GLY A C     1 
ATOM   1474 O  O     . GLY A 1 195 ? 9.025   25.268 141.296 1.00 37.23 ? 193 GLY A O     1 
ATOM   1475 N  N     . VAL A 1 196 ? 10.892  25.810 140.172 1.00 35.18 ? 194 VAL A N     1 
ATOM   1476 C  CA    . VAL A 1 196 ? 10.277  25.545 138.878 1.00 33.66 ? 194 VAL A CA    1 
ATOM   1477 C  C     . VAL A 1 196 ? 10.175  24.029 138.775 1.00 33.70 ? 194 VAL A C     1 
ATOM   1478 O  O     . VAL A 1 196 ? 11.160  23.327 138.973 1.00 32.99 ? 194 VAL A O     1 
ATOM   1479 C  CB    . VAL A 1 196 ? 11.138  26.093 137.725 1.00 31.00 ? 194 VAL A CB    1 
ATOM   1480 C  CG1   . VAL A 1 196 ? 10.383  25.977 136.406 1.00 29.91 ? 194 VAL A CG1   1 
ATOM   1481 C  CG2   . VAL A 1 196 ? 11.497  27.537 138.002 1.00 31.44 ? 194 VAL A CG2   1 
ATOM   1482 N  N     . LYS A 1 197 ? 8.988   23.520 138.465 1.00 33.36 ? 195 LYS A N     1 
ATOM   1483 C  CA    . LYS A 1 197 ? 8.801   22.079 138.398 1.00 35.75 ? 195 LYS A CA    1 
ATOM   1484 C  C     . LYS A 1 197 ? 9.649   21.393 137.321 1.00 35.82 ? 195 LYS A C     1 
ATOM   1485 O  O     . LYS A 1 197 ? 10.023  20.229 137.468 1.00 36.26 ? 195 LYS A O     1 
ATOM   1486 C  CB    . LYS A 1 197 ? 7.294   21.759 138.293 1.00 37.51 ? 195 LYS A CB    1 
ATOM   1487 C  CG    . LYS A 1 197 ? 6.512   22.377 139.497 1.00 41.78 ? 195 LYS A CG    1 
ATOM   1488 C  CD    . LYS A 1 197 ? 5.073   21.853 139.780 1.00 42.34 ? 195 LYS A CD    1 
ATOM   1489 C  CE    . LYS A 1 197 ? 4.455   22.634 140.986 1.00 43.41 ? 195 LYS A CE    1 
ATOM   1490 N  NZ    . LYS A 1 197 ? 3.215   22.093 141.670 1.00 40.84 ? 195 LYS A NZ    1 
ATOM   1491 N  N     . THR A 1 198 ? 9.975   22.111 136.251 1.00 33.71 ? 196 THR A N     1 
ATOM   1492 C  CA    . THR A 1 198 ? 10.836  21.559 135.204 1.00 32.86 ? 196 THR A CA    1 
ATOM   1493 C  C     . THR A 1 198 ? 11.909  22.590 134.861 1.00 31.58 ? 196 THR A C     1 
ATOM   1494 O  O     . THR A 1 198 ? 11.603  23.672 134.367 1.00 30.52 ? 196 THR A O     1 
ATOM   1495 C  CB    . THR A 1 198 ? 10.060  21.210 133.914 1.00 32.96 ? 196 THR A CB    1 
ATOM   1496 O  OG1   . THR A 1 198 ? 9.211   20.084 134.151 1.00 34.48 ? 196 THR A OG1   1 
ATOM   1497 C  CG2   . THR A 1 198 ? 11.027  20.857 132.792 1.00 34.39 ? 196 THR A CG2   1 
ATOM   1498 N  N     . LEU A 1 199 ? 13.166  22.260 135.149 1.00 31.05 ? 197 LEU A N     1 
ATOM   1499 C  CA    . LEU A 1 199 ? 14.276  23.166 134.858 1.00 29.06 ? 197 LEU A CA    1 
ATOM   1500 C  C     . LEU A 1 199 ? 15.277  22.498 133.932 1.00 27.22 ? 197 LEU A C     1 
ATOM   1501 O  O     . LEU A 1 199 ? 15.780  21.410 134.217 1.00 29.87 ? 197 LEU A O     1 
ATOM   1502 C  CB    . LEU A 1 199 ? 14.989  23.592 136.146 1.00 28.90 ? 197 LEU A CB    1 
ATOM   1503 C  CG    . LEU A 1 199 ? 16.250  24.449 135.966 1.00 29.95 ? 197 LEU A CG    1 
ATOM   1504 C  CD1   . LEU A 1 199 ? 15.890  25.754 135.264 1.00 27.99 ? 197 LEU A CD1   1 
ATOM   1505 C  CD2   . LEU A 1 199 ? 16.895  24.733 137.328 1.00 28.85 ? 197 LEU A CD2   1 
ATOM   1506 N  N     . VAL A 1 200 ? 15.560  23.153 132.817 1.00 26.55 ? 198 VAL A N     1 
ATOM   1507 C  CA    . VAL A 1 200 ? 16.513  22.636 131.852 1.00 25.51 ? 198 VAL A CA    1 
ATOM   1508 C  C     . VAL A 1 200 ? 17.634  23.652 131.738 1.00 26.04 ? 198 VAL A C     1 
ATOM   1509 O  O     . VAL A 1 200 ? 17.385  24.829 131.504 1.00 24.17 ? 198 VAL A O     1 
ATOM   1510 C  CB    . VAL A 1 200 ? 15.864  22.431 130.458 1.00 24.81 ? 198 VAL A CB    1 
ATOM   1511 C  CG1   . VAL A 1 200 ? 16.938  22.122 129.431 1.00 24.64 ? 198 VAL A CG1   1 
ATOM   1512 C  CG2   . VAL A 1 200 ? 14.850  21.285 130.518 1.00 26.30 ? 198 VAL A CG2   1 
ATOM   1513 N  N     . ILE A 1 201 ? 18.867  23.191 131.934 1.00 26.12 ? 199 ILE A N     1 
ATOM   1514 C  CA    . ILE A 1 201 ? 20.035  24.062 131.849 1.00 26.77 ? 199 ILE A CA    1 
ATOM   1515 C  C     . ILE A 1 201 ? 20.878  23.617 130.664 1.00 25.71 ? 199 ILE A C     1 
ATOM   1516 O  O     . ILE A 1 201 ? 21.437  22.522 130.673 1.00 25.84 ? 199 ILE A O     1 
ATOM   1517 C  CB    . ILE A 1 201 ? 20.898  23.975 133.125 1.00 27.00 ? 199 ILE A CB    1 
ATOM   1518 C  CG1   . ILE A 1 201 ? 20.055  24.347 134.349 1.00 27.49 ? 199 ILE A CG1   1 
ATOM   1519 C  CG2   . ILE A 1 201 ? 22.095  24.911 133.001 1.00 26.44 ? 199 ILE A CG2   1 
ATOM   1520 C  CD1   . ILE A 1 201 ? 20.788  24.212 135.660 1.00 28.22 ? 199 ILE A CD1   1 
ATOM   1521 N  N     . THR A 1 202 ? 20.964  24.467 129.647 1.00 25.73 ? 200 THR A N     1 
ATOM   1522 C  CA    . THR A 1 202 ? 21.727  24.141 128.449 1.00 25.96 ? 200 THR A CA    1 
ATOM   1523 C  C     . THR A 1 202 ? 23.169  24.636 128.570 1.00 26.71 ? 200 THR A C     1 
ATOM   1524 O  O     . THR A 1 202 ? 23.429  25.695 129.146 1.00 25.50 ? 200 THR A O     1 
ATOM   1525 C  CB    . THR A 1 202 ? 21.082  24.772 127.199 1.00 25.64 ? 200 THR A CB    1 
ATOM   1526 O  OG1   . THR A 1 202 ? 21.109  26.194 127.319 1.00 27.29 ? 200 THR A OG1   1 
ATOM   1527 C  CG2   . THR A 1 202 ? 19.626  24.319 127.059 1.00 25.93 ? 200 THR A CG2   1 
ATOM   1528 N  N     . GLN A 1 203 ? 24.099  23.860 128.025 1.00 26.24 ? 201 GLN A N     1 
ATOM   1529 C  CA    . GLN A 1 203 ? 25.509  24.209 128.076 1.00 29.45 ? 201 GLN A CA    1 
ATOM   1530 C  C     . GLN A 1 203 ? 26.192  23.992 126.718 1.00 29.62 ? 201 GLN A C     1 
ATOM   1531 O  O     . GLN A 1 203 ? 27.318  23.505 126.639 1.00 29.11 ? 201 GLN A O     1 
ATOM   1532 C  CB    . GLN A 1 203 ? 26.206  23.397 129.184 1.00 29.29 ? 201 GLN A CB    1 
ATOM   1533 C  CG    . GLN A 1 203 ? 25.608  23.636 130.576 1.00 31.19 ? 201 GLN A CG    1 
ATOM   1534 C  CD    . GLN A 1 203 ? 26.422  23.022 131.715 1.00 32.23 ? 201 GLN A CD    1 
ATOM   1535 O  OE1   . GLN A 1 203 ? 26.230  21.866 132.086 1.00 32.26 ? 201 GLN A OE1   1 
ATOM   1536 N  NE2   . GLN A 1 203 ? 27.337  23.805 132.269 1.00 36.52 ? 201 GLN A NE2   1 
ATOM   1537 N  N     . GLY A 1 204 ? 25.488  24.363 125.652 1.00 32.55 ? 202 GLY A N     1 
ATOM   1538 C  CA    . GLY A 1 204 ? 26.023  24.233 124.305 1.00 31.70 ? 202 GLY A CA    1 
ATOM   1539 C  C     . GLY A 1 204 ? 26.538  22.854 123.932 1.00 31.83 ? 202 GLY A C     1 
ATOM   1540 O  O     . GLY A 1 204 ? 25.892  21.842 124.195 1.00 30.85 ? 202 GLY A O     1 
ATOM   1541 N  N     . ALA A 1 205 ? 27.711  22.822 123.309 1.00 32.22 ? 203 ALA A N     1 
ATOM   1542 C  CA    . ALA A 1 205 ? 28.327  21.571 122.891 1.00 32.09 ? 203 ALA A CA    1 
ATOM   1543 C  C     . ALA A 1 205 ? 28.613  20.677 124.096 1.00 31.92 ? 203 ALA A C     1 
ATOM   1544 O  O     . ALA A 1 205 ? 28.969  19.510 123.938 1.00 32.90 ? 203 ALA A O     1 
ATOM   1545 C  CB    . ALA A 1 205 ? 29.623  21.857 122.121 1.00 33.36 ? 203 ALA A CB    1 
ATOM   1546 N  N     . ALA A 1 206 ? 28.440  21.227 125.298 1.00 30.96 ? 204 ALA A N     1 
ATOM   1547 C  CA    . ALA A 1 206 ? 28.679  20.483 126.532 1.00 31.18 ? 204 ALA A CA    1 
ATOM   1548 C  C     . ALA A 1 206 ? 27.433  19.772 127.064 1.00 30.89 ? 204 ALA A C     1 
ATOM   1549 O  O     . ALA A 1 206 ? 27.444  19.245 128.180 1.00 32.84 ? 204 ALA A O     1 
ATOM   1550 C  CB    . ALA A 1 206 ? 29.240  21.414 127.599 1.00 31.64 ? 204 ALA A CB    1 
ATOM   1551 N  N     . GLY A 1 207 ? 26.358  19.768 126.279 1.00 28.49 ? 205 GLY A N     1 
ATOM   1552 C  CA    . GLY A 1 207 ? 25.143  19.085 126.699 1.00 25.64 ? 205 GLY A CA    1 
ATOM   1553 C  C     . GLY A 1 207 ? 24.129  19.928 127.450 1.00 24.21 ? 205 GLY A C     1 
ATOM   1554 O  O     . GLY A 1 207 ? 24.149  21.153 127.392 1.00 22.31 ? 205 GLY A O     1 
ATOM   1555 N  N     . ALA A 1 208 ? 23.236  19.261 128.170 1.00 23.42 ? 206 ALA A N     1 
ATOM   1556 C  CA    . ALA A 1 208 ? 22.204  19.958 128.921 1.00 22.41 ? 206 ALA A CA    1 
ATOM   1557 C  C     . ALA A 1 208 ? 21.730  19.124 130.102 1.00 23.04 ? 206 ALA A C     1 
ATOM   1558 O  O     . ALA A 1 208 ? 21.824  17.900 130.089 1.00 24.24 ? 206 ALA A O     1 
ATOM   1559 C  CB    . ALA A 1 208 ? 21.029  20.278 128.008 1.00 23.20 ? 206 ALA A CB    1 
ATOM   1560 N  N     . TRP A 1 209 ? 21.205  19.808 131.108 1.00 24.43 ? 207 TRP A N     1 
ATOM   1561 C  CA    . TRP A 1 209 ? 20.697  19.169 132.311 1.00 26.76 ? 207 TRP A CA    1 
ATOM   1562 C  C     . TRP A 1 209 ? 19.182  19.293 132.443 1.00 27.80 ? 207 TRP A C     1 
ATOM   1563 O  O     . TRP A 1 209 ? 18.614  20.350 132.179 1.00 29.17 ? 207 TRP A O     1 
ATOM   1564 C  CB    . TRP A 1 209 ? 21.327  19.809 133.547 1.00 27.73 ? 207 TRP A CB    1 
ATOM   1565 C  CG    . TRP A 1 209 ? 22.739  19.425 133.812 1.00 27.25 ? 207 TRP A CG    1 
ATOM   1566 C  CD1   . TRP A 1 209 ? 23.868  20.102 133.439 1.00 29.22 ? 207 TRP A CD1   1 
ATOM   1567 C  CD2   . TRP A 1 209 ? 23.179  18.268 134.526 1.00 28.97 ? 207 TRP A CD2   1 
ATOM   1568 N  NE1   . TRP A 1 209 ? 24.989  19.430 133.883 1.00 29.80 ? 207 TRP A NE1   1 
ATOM   1569 C  CE2   . TRP A 1 209 ? 24.592  18.301 134.551 1.00 28.20 ? 207 TRP A CE2   1 
ATOM   1570 C  CE3   . TRP A 1 209 ? 22.513  17.203 135.148 1.00 28.28 ? 207 TRP A CE3   1 
ATOM   1571 C  CZ2   . TRP A 1 209 ? 25.354  17.306 135.178 1.00 30.55 ? 207 TRP A CZ2   1 
ATOM   1572 C  CZ3   . TRP A 1 209 ? 23.271  16.214 135.771 1.00 30.37 ? 207 TRP A CZ3   1 
ATOM   1573 C  CH2   . TRP A 1 209 ? 24.676  16.274 135.779 1.00 28.13 ? 207 TRP A CH2   1 
ATOM   1574 N  N     . LEU A 1 210 ? 18.536  18.202 132.839 1.00 28.18 ? 208 LEU A N     1 
ATOM   1575 C  CA    . LEU A 1 210 ? 17.099  18.210 133.080 1.00 30.14 ? 208 LEU A CA    1 
ATOM   1576 C  C     . LEU A 1 210 ? 17.027  18.120 134.597 1.00 33.36 ? 208 LEU A C     1 
ATOM   1577 O  O     . LEU A 1 210 ? 17.599  17.208 135.190 1.00 31.10 ? 208 LEU A O     1 
ATOM   1578 C  CB    . LEU A 1 210 ? 16.419  16.997 132.455 1.00 29.84 ? 208 LEU A CB    1 
ATOM   1579 C  CG    . LEU A 1 210 ? 14.967  16.819 132.903 1.00 30.73 ? 208 LEU A CG    1 
ATOM   1580 C  CD1   . LEU A 1 210 ? 14.179  18.087 132.635 1.00 29.34 ? 208 LEU A CD1   1 
ATOM   1581 C  CD2   . LEU A 1 210 ? 14.352  15.655 132.163 1.00 32.83 ? 208 LEU A CD2   1 
ATOM   1582 N  N     . VAL A 1 211 ? 16.321  19.053 135.220 1.00 35.96 ? 209 VAL A N     1 
ATOM   1583 C  CA    . VAL A 1 211 ? 16.265  19.090 136.670 1.00 41.31 ? 209 VAL A CA    1 
ATOM   1584 C  C     . VAL A 1 211 ? 14.937  19.416 137.359 1.00 45.19 ? 209 VAL A C     1 
ATOM   1585 O  O     . VAL A 1 211 ? 14.144  20.212 136.859 1.00 43.32 ? 209 VAL A O     1 
ATOM   1586 C  CB    . VAL A 1 211 ? 17.265  20.147 137.211 1.00 40.60 ? 209 VAL A CB    1 
ATOM   1587 C  CG1   . VAL A 1 211 ? 17.177  20.237 138.706 1.00 42.21 ? 209 VAL A CG1   1 
ATOM   1588 C  CG2   . VAL A 1 211 ? 18.672  19.817 136.794 1.00 40.96 ? 209 VAL A CG2   1 
ATOM   1589 N  N     . GLN A 1 212 ? 14.732  18.771 138.514 1.00 49.80 ? 210 GLN A N     1 
ATOM   1590 C  CA    . GLN A 1 212 ? 13.621  19.032 139.451 1.00 54.73 ? 210 GLN A CA    1 
ATOM   1591 C  C     . GLN A 1 212 ? 12.742  18.061 140.243 1.00 55.37 ? 210 GLN A C     1 
ATOM   1592 O  O     . GLN A 1 212 ? 12.306  18.457 141.322 1.00 55.75 ? 210 GLN A O     1 
ATOM   1593 C  CB    . GLN A 1 212 ? 12.708  20.136 138.920 1.00 56.77 ? 210 GLN A CB    1 
ATOM   1594 C  CG    . GLN A 1 212 ? 12.722  21.332 139.874 1.00 60.79 ? 210 GLN A CG    1 
ATOM   1595 C  CD    . GLN A 1 212 ? 13.867  22.299 139.602 1.00 62.20 ? 210 GLN A CD    1 
ATOM   1596 O  OE1   . GLN A 1 212 ? 13.862  22.987 138.587 1.00 63.60 ? 210 GLN A OE1   1 
ATOM   1597 N  NE2   . GLN A 1 212 ? 14.853  22.352 140.503 1.00 63.50 ? 210 GLN A NE2   1 
ATOM   1598 N  N     . GLU A 1 213 ? 12.418  16.853 139.791 1.00 55.86 ? 211 GLU A N     1 
ATOM   1599 C  CA    . GLU A 1 213 ? 11.644  16.023 140.723 1.00 56.91 ? 211 GLU A CA    1 
ATOM   1600 C  C     . GLU A 1 213 ? 12.746  15.593 141.697 1.00 55.63 ? 211 GLU A C     1 
ATOM   1601 O  O     . GLU A 1 213 ? 12.807  14.455 142.158 1.00 56.00 ? 211 GLU A O     1 
ATOM   1602 C  CB    . GLU A 1 213 ? 11.009  14.800 140.045 1.00 58.74 ? 211 GLU A CB    1 
ATOM   1603 C  CG    . GLU A 1 213 ? 9.470   14.794 140.053 1.00 62.77 ? 211 GLU A CG    1 
ATOM   1604 C  CD    . GLU A 1 213 ? 8.854   14.947 141.449 1.00 65.48 ? 211 GLU A CD    1 
ATOM   1605 O  OE1   . GLU A 1 213 ? 9.001   16.032 142.059 1.00 66.96 ? 211 GLU A OE1   1 
ATOM   1606 O  OE2   . GLU A 1 213 ? 8.218   13.983 141.937 1.00 66.35 ? 211 GLU A OE2   1 
ATOM   1607 N  N     . GLY A 1 214 ? 13.625  16.551 141.986 1.00 54.66 ? 212 GLY A N     1 
ATOM   1608 C  CA    . GLY A 1 214 ? 14.772  16.318 142.835 1.00 52.89 ? 212 GLY A CA    1 
ATOM   1609 C  C     . GLY A 1 214 ? 15.837  15.709 141.941 1.00 51.19 ? 212 GLY A C     1 
ATOM   1610 O  O     . GLY A 1 214 ? 17.035  15.913 142.134 1.00 52.05 ? 212 GLY A O     1 
ATOM   1611 N  N     . GLN A 1 215 ? 15.371  14.976 140.934 1.00 48.76 ? 213 GLN A N     1 
ATOM   1612 C  CA    . GLN A 1 215 ? 16.222  14.279 139.975 1.00 46.35 ? 213 GLN A CA    1 
ATOM   1613 C  C     . GLN A 1 215 ? 16.978  15.179 139.006 1.00 44.16 ? 213 GLN A C     1 
ATOM   1614 O  O     . GLN A 1 215 ? 16.433  16.147 138.478 1.00 42.65 ? 213 GLN A O     1 
ATOM   1615 C  CB    . GLN A 1 215 ? 15.376  13.280 139.182 1.00 47.63 ? 213 GLN A CB    1 
ATOM   1616 C  CG    . GLN A 1 215 ? 14.502  12.435 140.074 1.00 49.87 ? 213 GLN A CG    1 
ATOM   1617 C  CD    . GLN A 1 215 ? 15.285  11.853 141.233 1.00 52.20 ? 213 GLN A CD    1 
ATOM   1618 O  OE1   . GLN A 1 215 ? 15.840  10.758 141.135 1.00 52.76 ? 213 GLN A OE1   1 
ATOM   1619 N  NE2   . GLN A 1 215 ? 15.360  12.602 142.332 1.00 50.27 ? 213 GLN A NE2   1 
ATOM   1620 N  N     . ARG A 1 216 ? 18.241  14.836 138.783 1.00 41.50 ? 214 ARG A N     1 
ATOM   1621 C  CA    . ARG A 1 216 ? 19.108  15.571 137.875 1.00 39.17 ? 214 ARG A CA    1 
ATOM   1622 C  C     . ARG A 1 216 ? 19.554  14.602 136.794 1.00 38.43 ? 214 ARG A C     1 
ATOM   1623 O  O     . ARG A 1 216 ? 20.069  13.524 137.094 1.00 38.25 ? 214 ARG A O     1 
ATOM   1624 C  CB    . ARG A 1 216 ? 20.342  16.105 138.610 1.00 38.64 ? 214 ARG A CB    1 
ATOM   1625 C  CG    . ARG A 1 216 ? 20.049  17.122 139.696 1.00 37.83 ? 214 ARG A CG    1 
ATOM   1626 C  CD    . ARG A 1 216 ? 21.339  17.769 140.182 1.00 38.50 ? 214 ARG A CD    1 
ATOM   1627 N  NE    . ARG A 1 216 ? 21.099  18.750 141.237 1.00 36.37 ? 214 ARG A NE    1 
ATOM   1628 C  CZ    . ARG A 1 216 ? 20.962  18.447 142.526 1.00 37.69 ? 214 ARG A CZ    1 
ATOM   1629 N  NH1   . ARG A 1 216 ? 21.046  17.182 142.930 1.00 35.05 ? 214 ARG A NH1   1 
ATOM   1630 N  NH2   . ARG A 1 216 ? 20.733  19.410 143.414 1.00 36.07 ? 214 ARG A NH2   1 
ATOM   1631 N  N     . GLN A 1 217 ? 19.356  14.978 135.537 1.00 36.64 ? 215 GLN A N     1 
ATOM   1632 C  CA    . GLN A 1 217 ? 19.747  14.120 134.428 1.00 35.33 ? 215 GLN A CA    1 
ATOM   1633 C  C     . GLN A 1 217 ? 20.536  14.905 133.404 1.00 33.32 ? 215 GLN A C     1 
ATOM   1634 O  O     . GLN A 1 217 ? 20.177  16.029 133.064 1.00 31.30 ? 215 GLN A O     1 
ATOM   1635 C  CB    . GLN A 1 217 ? 18.518  13.513 133.763 1.00 36.40 ? 215 GLN A CB    1 
ATOM   1636 C  CG    . GLN A 1 217 ? 17.897  12.367 134.534 1.00 40.04 ? 215 GLN A CG    1 
ATOM   1637 C  CD    . GLN A 1 217 ? 16.596  11.904 133.913 1.00 40.38 ? 215 GLN A CD    1 
ATOM   1638 O  OE1   . GLN A 1 217 ? 15.594  12.615 133.952 1.00 41.68 ? 215 GLN A OE1   1 
ATOM   1639 N  NE2   . GLN A 1 217 ? 16.609  10.713 133.324 1.00 41.14 ? 215 GLN A NE2   1 
ATOM   1640 N  N     . PHE A 1 218 ? 21.608  14.299 132.910 1.00 32.00 ? 216 PHE A N     1 
ATOM   1641 C  CA    . PHE A 1 218 ? 22.451  14.948 131.924 1.00 30.89 ? 216 PHE A CA    1 
ATOM   1642 C  C     . PHE A 1 218 ? 22.267  14.326 130.552 1.00 32.37 ? 216 PHE A C     1 
ATOM   1643 O  O     . PHE A 1 218 ? 22.183  13.102 130.413 1.00 32.34 ? 216 PHE A O     1 
ATOM   1644 C  CB    . PHE A 1 218 ? 23.923  14.842 132.323 1.00 31.06 ? 216 PHE A CB    1 
ATOM   1645 C  CG    . PHE A 1 218 ? 24.846  15.541 131.374 1.00 31.67 ? 216 PHE A CG    1 
ATOM   1646 C  CD1   . PHE A 1 218 ? 24.855  16.928 131.297 1.00 30.26 ? 216 PHE A CD1   1 
ATOM   1647 C  CD2   . PHE A 1 218 ? 25.674  14.814 130.521 1.00 31.32 ? 216 PHE A CD2   1 
ATOM   1648 C  CE1   . PHE A 1 218 ? 25.672  17.589 130.381 1.00 32.59 ? 216 PHE A CE1   1 
ATOM   1649 C  CE2   . PHE A 1 218 ? 26.496  15.463 129.601 1.00 32.32 ? 216 PHE A CE2   1 
ATOM   1650 C  CZ    . PHE A 1 218 ? 26.495  16.854 129.531 1.00 30.66 ? 216 PHE A CZ    1 
ATOM   1651 N  N     . CYS A 1 219 ? 22.199  15.172 129.532 1.00 31.16 ? 217 CYS A N     1 
ATOM   1652 C  CA    . CYS A 1 219 ? 22.046  14.679 128.174 1.00 30.94 ? 217 CYS A CA    1 
ATOM   1653 C  C     . CYS A 1 219 ? 23.166  15.262 127.339 1.00 31.02 ? 217 CYS A C     1 
ATOM   1654 O  O     . CYS A 1 219 ? 23.190  16.461 127.080 1.00 29.22 ? 217 CYS A O     1 
ATOM   1655 C  CB    . CYS A 1 219 ? 20.699  15.099 127.586 1.00 32.59 ? 217 CYS A CB    1 
ATOM   1656 S  SG    . CYS A 1 219 ? 20.448  14.485 125.904 1.00 35.17 ? 217 CYS A SG    1 
ATOM   1657 N  N     . PRO A 1 220 ? 24.122  14.422 126.915 1.00 31.98 ? 218 PRO A N     1 
ATOM   1658 C  CA    . PRO A 1 220 ? 25.216  14.959 126.106 1.00 32.26 ? 218 PRO A CA    1 
ATOM   1659 C  C     . PRO A 1 220 ? 24.743  15.509 124.767 1.00 32.59 ? 218 PRO A C     1 
ATOM   1660 O  O     . PRO A 1 220 ? 23.711  15.090 124.229 1.00 32.75 ? 218 PRO A O     1 
ATOM   1661 C  CB    . PRO A 1 220 ? 26.154  13.762 125.952 1.00 32.73 ? 218 PRO A CB    1 
ATOM   1662 C  CG    . PRO A 1 220 ? 25.216  12.591 125.990 1.00 34.36 ? 218 PRO A CG    1 
ATOM   1663 C  CD    . PRO A 1 220 ? 24.277  12.970 127.115 1.00 32.79 ? 218 PRO A CD    1 
ATOM   1664 N  N     . ALA A 1 221 ? 25.498  16.466 124.243 1.00 32.09 ? 219 ALA A N     1 
ATOM   1665 C  CA    . ALA A 1 221 ? 25.187  17.064 122.958 1.00 31.52 ? 219 ALA A CA    1 
ATOM   1666 C  C     . ALA A 1 221 ? 25.567  16.036 121.902 1.00 31.39 ? 219 ALA A C     1 
ATOM   1667 O  O     . ALA A 1 221 ? 26.367  15.132 122.166 1.00 32.08 ? 219 ALA A O     1 
ATOM   1668 C  CB    . ALA A 1 221 ? 26.001  18.338 122.769 1.00 29.59 ? 219 ALA A CB    1 
ATOM   1669 N  N     . VAL A 1 222 ? 24.987  16.156 120.715 1.00 31.61 ? 220 VAL A N     1 
ATOM   1670 C  CA    . VAL A 1 222 ? 25.311  15.235 119.639 1.00 32.49 ? 220 VAL A CA    1 
ATOM   1671 C  C     . VAL A 1 222 ? 26.453  15.858 118.852 1.00 33.56 ? 220 VAL A C     1 
ATOM   1672 O  O     . VAL A 1 222 ? 26.322  16.964 118.324 1.00 33.01 ? 220 VAL A O     1 
ATOM   1673 C  CB    . VAL A 1 222 ? 24.106  15.003 118.708 1.00 32.09 ? 220 VAL A CB    1 
ATOM   1674 C  CG1   . VAL A 1 222 ? 24.508  14.103 117.548 1.00 33.75 ? 220 VAL A CG1   1 
ATOM   1675 C  CG2   . VAL A 1 222 ? 22.968  14.378 119.491 1.00 33.69 ? 220 VAL A CG2   1 
ATOM   1676 N  N     . PRO A 1 223 ? 27.595  15.158 118.771 1.00 34.41 ? 221 PRO A N     1 
ATOM   1677 C  CA    . PRO A 1 223 ? 28.763  15.658 118.046 1.00 35.75 ? 221 PRO A CA    1 
ATOM   1678 C  C     . PRO A 1 223 ? 28.383  16.268 116.707 1.00 36.04 ? 221 PRO A C     1 
ATOM   1679 O  O     . PRO A 1 223 ? 27.667  15.655 115.917 1.00 37.20 ? 221 PRO A O     1 
ATOM   1680 C  CB    . PRO A 1 223 ? 29.633  14.411 117.895 1.00 35.66 ? 221 PRO A CB    1 
ATOM   1681 C  CG    . PRO A 1 223 ? 29.342  13.671 119.158 1.00 36.73 ? 221 PRO A CG    1 
ATOM   1682 C  CD    . PRO A 1 223 ? 27.831  13.784 119.248 1.00 34.99 ? 221 PRO A CD    1 
ATOM   1683 N  N     . ALA A 1 224 ? 28.861  17.481 116.461 1.00 36.31 ? 222 ALA A N     1 
ATOM   1684 C  CA    . ALA A 1 224 ? 28.565  18.160 115.216 1.00 37.97 ? 222 ALA A CA    1 
ATOM   1685 C  C     . ALA A 1 224 ? 29.608  19.200 114.848 1.00 38.74 ? 222 ALA A C     1 
ATOM   1686 O  O     . ALA A 1 224 ? 30.390  19.668 115.678 1.00 39.10 ? 222 ALA A O     1 
ATOM   1687 C  CB    . ALA A 1 224 ? 27.187  18.817 115.287 1.00 37.47 ? 222 ALA A CB    1 
ATOM   1688 N  N     . GLU A 1 225 ? 29.579  19.552 113.574 1.00 39.59 ? 223 GLU A N     1 
ATOM   1689 C  CA    . GLU A 1 225 ? 30.455  20.531 112.956 1.00 40.95 ? 223 GLU A CA    1 
ATOM   1690 C  C     . GLU A 1 225 ? 29.829  21.908 113.164 1.00 40.16 ? 223 GLU A C     1 
ATOM   1691 O  O     . GLU A 1 225 ? 28.854  22.258 112.499 1.00 40.32 ? 223 GLU A O     1 
ATOM   1692 C  CB    . GLU A 1 225 ? 30.550  20.204 111.468 1.00 42.61 ? 223 GLU A CB    1 
ATOM   1693 C  CG    . GLU A 1 225 ? 29.213  19.701 110.899 1.00 46.58 ? 223 GLU A CG    1 
ATOM   1694 C  CD    . GLU A 1 225 ? 28.743  18.388 111.541 1.00 47.48 ? 223 GLU A CD    1 
ATOM   1695 O  OE1   . GLU A 1 225 ? 27.554  18.028 111.402 1.00 44.58 ? 223 GLU A OE1   1 
ATOM   1696 O  OE2   . GLU A 1 225 ? 29.574  17.711 112.187 1.00 51.38 ? 223 GLU A OE2   1 
ATOM   1697 N  N     . ALA A 1 226 ? 30.391  22.680 114.089 1.00 39.24 ? 224 ALA A N     1 
ATOM   1698 C  CA    . ALA A 1 226 ? 29.880  24.009 114.412 1.00 38.13 ? 224 ALA A CA    1 
ATOM   1699 C  C     . ALA A 1 226 ? 30.062  25.029 113.294 1.00 37.67 ? 224 ALA A C     1 
ATOM   1700 O  O     . ALA A 1 226 ? 30.784  26.009 113.456 1.00 39.20 ? 224 ALA A O     1 
ATOM   1701 C  CB    . ALA A 1 226 ? 30.541  24.517 115.690 1.00 37.88 ? 224 ALA A CB    1 
ATOM   1702 N  N     . LEU A 1 227 ? 29.389  24.810 112.168 1.00 36.47 ? 225 LEU A N     1 
ATOM   1703 C  CA    . LEU A 1 227 ? 29.495  25.718 111.032 1.00 34.17 ? 225 LEU A CA    1 
ATOM   1704 C  C     . LEU A 1 227 ? 28.815  27.061 111.301 1.00 32.83 ? 225 LEU A C     1 
ATOM   1705 O  O     . LEU A 1 227 ? 29.330  28.118 110.926 1.00 30.20 ? 225 LEU A O     1 
ATOM   1706 C  CB    . LEU A 1 227 ? 28.873  25.078 109.791 1.00 35.37 ? 225 LEU A CB    1 
ATOM   1707 C  CG    . LEU A 1 227 ? 29.034  25.886 108.505 1.00 37.05 ? 225 LEU A CG    1 
ATOM   1708 C  CD1   . LEU A 1 227 ? 30.515  25.963 108.138 1.00 37.37 ? 225 LEU A CD1   1 
ATOM   1709 C  CD2   . LEU A 1 227 ? 28.239  25.231 107.383 1.00 38.74 ? 225 LEU A CD2   1 
ATOM   1710 N  N     . ASP A 1 228 ? 27.650  27.008 111.941 1.00 30.53 ? 226 ASP A N     1 
ATOM   1711 C  CA    . ASP A 1 228 ? 26.872  28.205 112.267 1.00 30.63 ? 226 ASP A CA    1 
ATOM   1712 C  C     . ASP A 1 228 ? 25.868  27.833 113.349 1.00 29.89 ? 226 ASP A C     1 
ATOM   1713 O  O     . ASP A 1 228 ? 24.870  27.157 113.078 1.00 28.89 ? 226 ASP A O     1 
ATOM   1714 C  CB    . ASP A 1 228 ? 26.132  28.717 111.025 1.00 30.94 ? 226 ASP A CB    1 
ATOM   1715 C  CG    . ASP A 1 228 ? 25.288  29.947 111.308 1.00 34.08 ? 226 ASP A CG    1 
ATOM   1716 O  OD1   . ASP A 1 228 ? 25.291  30.431 112.462 1.00 34.09 ? 226 ASP A OD1   1 
ATOM   1717 O  OD2   . ASP A 1 228 ? 24.619  30.438 110.369 1.00 35.59 ? 226 ASP A OD2   1 
ATOM   1718 N  N     . THR A 1 229 ? 26.133  28.293 114.569 1.00 29.14 ? 227 THR A N     1 
ATOM   1719 C  CA    . THR A 1 229 ? 25.289  27.980 115.717 1.00 27.70 ? 227 THR A CA    1 
ATOM   1720 C  C     . THR A 1 229 ? 24.037  28.835 115.880 1.00 25.31 ? 227 THR A C     1 
ATOM   1721 O  O     . THR A 1 229 ? 23.296  28.677 116.853 1.00 26.05 ? 227 THR A O     1 
ATOM   1722 C  CB    . THR A 1 229 ? 26.111  28.045 117.026 1.00 28.81 ? 227 THR A CB    1 
ATOM   1723 O  OG1   . THR A 1 229 ? 26.581  29.380 117.232 1.00 29.24 ? 227 THR A OG1   1 
ATOM   1724 C  CG2   . THR A 1 229 ? 27.302  27.101 116.949 1.00 28.99 ? 227 THR A CG2   1 
ATOM   1725 N  N     . THR A 1 230 ? 23.790  29.737 114.937 1.00 24.31 ? 228 THR A N     1 
ATOM   1726 C  CA    . THR A 1 230 ? 22.604  30.580 115.012 1.00 24.02 ? 228 THR A CA    1 
ATOM   1727 C  C     . THR A 1 230 ? 21.333  29.736 115.176 1.00 23.73 ? 228 THR A C     1 
ATOM   1728 O  O     . THR A 1 230 ? 21.096  28.788 114.418 1.00 20.81 ? 228 THR A O     1 
ATOM   1729 C  CB    . THR A 1 230 ? 22.464  31.455 113.748 1.00 25.41 ? 228 THR A CB    1 
ATOM   1730 O  OG1   . THR A 1 230 ? 23.652  32.239 113.589 1.00 28.03 ? 228 THR A OG1   1 
ATOM   1731 C  CG2   . THR A 1 230 ? 21.263  32.392 113.869 1.00 24.69 ? 228 THR A CG2   1 
ATOM   1732 N  N     . GLY A 1 231 ? 20.534  30.076 116.187 1.00 21.72 ? 229 GLY A N     1 
ATOM   1733 C  CA    . GLY A 1 231 ? 19.294  29.367 116.439 1.00 21.25 ? 229 GLY A CA    1 
ATOM   1734 C  C     . GLY A 1 231 ? 19.412  27.971 117.028 1.00 22.19 ? 229 GLY A C     1 
ATOM   1735 O  O     . GLY A 1 231 ? 18.425  27.230 117.062 1.00 22.29 ? 229 GLY A O     1 
ATOM   1736 N  N     . ALA A 1 232 ? 20.601  27.596 117.492 1.00 22.19 ? 230 ALA A N     1 
ATOM   1737 C  CA    . ALA A 1 232 ? 20.778  26.261 118.068 1.00 23.14 ? 230 ALA A CA    1 
ATOM   1738 C  C     . ALA A 1 232 ? 19.937  26.136 119.329 1.00 21.85 ? 230 ALA A C     1 
ATOM   1739 O  O     . ALA A 1 232 ? 19.276  25.121 119.548 1.00 22.42 ? 230 ALA A O     1 
ATOM   1740 C  CB    . ALA A 1 232 ? 22.257  26.004 118.388 1.00 24.27 ? 230 ALA A CB    1 
ATOM   1741 N  N     . GLY A 1 233 ? 19.965  27.179 120.153 1.00 22.96 ? 231 GLY A N     1 
ATOM   1742 C  CA    . GLY A 1 233 ? 19.191  27.179 121.385 1.00 21.67 ? 231 GLY A CA    1 
ATOM   1743 C  C     . GLY A 1 233 ? 17.695  27.144 121.132 1.00 21.70 ? 231 GLY A C     1 
ATOM   1744 O  O     . GLY A 1 233 ? 16.954  26.454 121.838 1.00 19.75 ? 231 GLY A O     1 
ATOM   1745 N  N     . ASP A 1 234 ? 17.245  27.888 120.121 1.00 21.30 ? 232 ASP A N     1 
ATOM   1746 C  CA    . ASP A 1 234 ? 15.826  27.928 119.779 1.00 21.57 ? 232 ASP A CA    1 
ATOM   1747 C  C     . ASP A 1 234 ? 15.393  26.548 119.276 1.00 20.96 ? 232 ASP A C     1 
ATOM   1748 O  O     . ASP A 1 234 ? 14.278  26.092 119.557 1.00 21.17 ? 232 ASP A O     1 
ATOM   1749 C  CB    . ASP A 1 234 ? 15.551  28.988 118.693 1.00 22.77 ? 232 ASP A CB    1 
ATOM   1750 C  CG    . ASP A 1 234 ? 15.982  30.399 119.112 1.00 26.10 ? 232 ASP A CG    1 
ATOM   1751 O  OD1   . ASP A 1 234 ? 15.825  30.762 120.302 1.00 23.79 ? 232 ASP A OD1   1 
ATOM   1752 O  OD2   . ASP A 1 234 ? 16.462  31.155 118.241 1.00 26.31 ? 232 ASP A OD2   1 
ATOM   1753 N  N     . THR A 1 235 ? 16.276  25.890 118.526 1.00 19.97 ? 233 THR A N     1 
ATOM   1754 C  CA    . THR A 1 235 ? 15.984  24.557 117.995 1.00 19.47 ? 233 THR A CA    1 
ATOM   1755 C  C     . THR A 1 235 ? 15.844  23.556 119.138 1.00 20.50 ? 233 THR A C     1 
ATOM   1756 O  O     . THR A 1 235 ? 14.904  22.765 119.176 1.00 19.34 ? 233 THR A O     1 
ATOM   1757 C  CB    . THR A 1 235 ? 17.104  24.069 117.050 1.00 20.41 ? 233 THR A CB    1 
ATOM   1758 O  OG1   . THR A 1 235 ? 17.231  24.977 115.947 1.00 18.23 ? 233 THR A OG1   1 
ATOM   1759 C  CG2   . THR A 1 235 ? 16.781  22.675 116.512 1.00 20.07 ? 233 THR A CG2   1 
ATOM   1760 N  N     . PHE A 1 236 ? 16.789  23.602 120.067 1.00 20.32 ? 234 PHE A N     1 
ATOM   1761 C  CA    . PHE A 1 236 ? 16.773  22.703 121.216 1.00 21.55 ? 234 PHE A CA    1 
ATOM   1762 C  C     . PHE A 1 236 ? 15.483  22.860 122.023 1.00 20.72 ? 234 PHE A C     1 
ATOM   1763 O  O     . PHE A 1 236 ? 14.830  21.868 122.374 1.00 21.26 ? 234 PHE A O     1 
ATOM   1764 C  CB    . PHE A 1 236 ? 17.973  23.002 122.113 1.00 22.40 ? 234 PHE A CB    1 
ATOM   1765 C  CG    . PHE A 1 236 ? 18.142  22.035 123.237 1.00 22.83 ? 234 PHE A CG    1 
ATOM   1766 C  CD1   . PHE A 1 236 ? 18.965  20.923 123.093 1.00 23.16 ? 234 PHE A CD1   1 
ATOM   1767 C  CD2   . PHE A 1 236 ? 17.469  22.225 124.440 1.00 24.57 ? 234 PHE A CD2   1 
ATOM   1768 C  CE1   . PHE A 1 236 ? 19.120  20.009 124.134 1.00 23.03 ? 234 PHE A CE1   1 
ATOM   1769 C  CE2   . PHE A 1 236 ? 17.615  21.316 125.488 1.00 24.44 ? 234 PHE A CE2   1 
ATOM   1770 C  CZ    . PHE A 1 236 ? 18.445  20.206 125.330 1.00 23.83 ? 234 PHE A CZ    1 
ATOM   1771 N  N     . LEU A 1 237 ? 15.115  24.105 122.321 1.00 19.26 ? 235 LEU A N     1 
ATOM   1772 C  CA    . LEU A 1 237 ? 13.915  24.363 123.102 1.00 20.86 ? 235 LEU A CA    1 
ATOM   1773 C  C     . LEU A 1 237 ? 12.655  23.897 122.383 1.00 21.32 ? 235 LEU A C     1 
ATOM   1774 O  O     . LEU A 1 237 ? 11.802  23.242 122.980 1.00 20.54 ? 235 LEU A O     1 
ATOM   1775 C  CB    . LEU A 1 237 ? 13.788  25.857 123.449 1.00 21.34 ? 235 LEU A CB    1 
ATOM   1776 C  CG    . LEU A 1 237 ? 12.632  26.220 124.405 1.00 22.17 ? 235 LEU A CG    1 
ATOM   1777 C  CD1   . LEU A 1 237 ? 12.918  27.542 125.115 1.00 22.68 ? 235 LEU A CD1   1 
ATOM   1778 C  CD2   . LEU A 1 237 ? 11.304  26.299 123.641 1.00 23.09 ? 235 LEU A CD2   1 
ATOM   1779 N  N     . ALA A 1 238 ? 12.541  24.235 121.102 1.00 19.66 ? 236 ALA A N     1 
ATOM   1780 C  CA    . ALA A 1 238 ? 11.368  23.853 120.323 1.00 19.78 ? 236 ALA A CA    1 
ATOM   1781 C  C     . ALA A 1 238 ? 11.167  22.335 120.212 1.00 19.35 ? 236 ALA A C     1 
ATOM   1782 O  O     . ALA A 1 238 ? 10.050  21.833 120.399 1.00 20.09 ? 236 ALA A O     1 
ATOM   1783 C  CB    . ALA A 1 238 ? 11.454  24.469 118.921 1.00 17.74 ? 236 ALA A CB    1 
ATOM   1784 N  N     . VAL A 1 239 ? 12.235  21.607 119.895 1.00 17.95 ? 237 VAL A N     1 
ATOM   1785 C  CA    . VAL A 1 239 ? 12.120  20.162 119.742 1.00 18.81 ? 237 VAL A CA    1 
ATOM   1786 C  C     . VAL A 1 239 ? 11.903  19.465 121.083 1.00 20.24 ? 237 VAL A C     1 
ATOM   1787 O  O     . VAL A 1 239 ? 11.149  18.496 121.164 1.00 18.49 ? 237 VAL A O     1 
ATOM   1788 C  CB    . VAL A 1 239 ? 13.346  19.576 119.023 1.00 18.65 ? 237 VAL A CB    1 
ATOM   1789 C  CG1   . VAL A 1 239 ? 13.181  18.076 118.849 1.00 18.89 ? 237 VAL A CG1   1 
ATOM   1790 C  CG2   . VAL A 1 239 ? 13.501  20.237 117.654 1.00 17.52 ? 237 VAL A CG2   1 
HETATM 1791 N  N     . MSE A 1 240 ? 12.547  19.964 122.135 1.00 21.51 ? 238 MSE A N     1 
HETATM 1792 C  CA    . MSE A 1 240 ? 12.360  19.385 123.459 1.00 24.47 ? 238 MSE A CA    1 
HETATM 1793 C  C     . MSE A 1 240 ? 10.881  19.484 123.828 1.00 24.45 ? 238 MSE A C     1 
HETATM 1794 O  O     . MSE A 1 240 ? 10.273  18.519 124.302 1.00 22.93 ? 238 MSE A O     1 
HETATM 1795 C  CB    . MSE A 1 240 ? 13.176  20.138 124.505 1.00 28.41 ? 238 MSE A CB    1 
HETATM 1796 C  CG    . MSE A 1 240 ? 12.943  19.626 125.909 1.00 35.67 ? 238 MSE A CG    1 
HETATM 1797 SE SE    . MSE A 1 240 ? 13.352  20.958 127.235 1.00 49.38 ? 238 MSE A SE    1 
HETATM 1798 C  CE    . MSE A 1 240 ? 11.787  22.085 127.044 1.00 41.51 ? 238 MSE A CE    1 
ATOM   1799 N  N     . LEU A 1 241 ? 10.303  20.662 123.615 1.00 22.52 ? 239 LEU A N     1 
ATOM   1800 C  CA    . LEU A 1 241 ? 8.898   20.868 123.917 1.00 23.15 ? 239 LEU A CA    1 
ATOM   1801 C  C     . LEU A 1 241 ? 8.001   20.023 123.009 1.00 21.86 ? 239 LEU A C     1 
ATOM   1802 O  O     . LEU A 1 241 ? 7.066   19.379 123.483 1.00 23.69 ? 239 LEU A O     1 
ATOM   1803 C  CB    . LEU A 1 241 ? 8.549   22.354 123.785 1.00 23.53 ? 239 LEU A CB    1 
ATOM   1804 C  CG    . LEU A 1 241 ? 7.188   22.805 124.320 1.00 27.64 ? 239 LEU A CG    1 
ATOM   1805 C  CD1   . LEU A 1 241 ? 6.974   22.260 125.730 1.00 29.73 ? 239 LEU A CD1   1 
ATOM   1806 C  CD2   . LEU A 1 241 ? 7.126   24.330 124.320 1.00 28.68 ? 239 LEU A CD2   1 
ATOM   1807 N  N     . ALA A 1 242 ? 8.288   19.998 121.711 1.00 21.11 ? 240 ALA A N     1 
ATOM   1808 C  CA    . ALA A 1 242 ? 7.467   19.214 120.789 1.00 19.74 ? 240 ALA A CA    1 
ATOM   1809 C  C     . ALA A 1 242 ? 7.517   17.727 121.138 1.00 22.38 ? 240 ALA A C     1 
ATOM   1810 O  O     . ALA A 1 242 ? 6.495   17.043 121.117 1.00 21.20 ? 240 ALA A O     1 
ATOM   1811 C  CB    . ALA A 1 242 ? 7.932   19.420 119.356 1.00 20.72 ? 240 ALA A CB    1 
ATOM   1812 N  N     . SER A 1 243 ? 8.705   17.226 121.445 1.00 20.81 ? 241 SER A N     1 
ATOM   1813 C  CA    . SER A 1 243 ? 8.846   15.814 121.790 1.00 23.76 ? 241 SER A CA    1 
ATOM   1814 C  C     . SER A 1 243 ? 7.953   15.437 122.968 1.00 22.47 ? 241 SER A C     1 
ATOM   1815 O  O     . SER A 1 243 ? 7.234   14.436 122.917 1.00 24.41 ? 241 SER A O     1 
ATOM   1816 C  CB    . SER A 1 243 ? 10.301  15.490 122.124 1.00 22.40 ? 241 SER A CB    1 
ATOM   1817 O  OG    . SER A 1 243 ? 10.430  14.125 122.478 1.00 22.33 ? 241 SER A OG    1 
ATOM   1818 N  N     . ALA A 1 244 ? 8.008   16.243 124.025 1.00 23.04 ? 242 ALA A N     1 
ATOM   1819 C  CA    . ALA A 1 244 ? 7.204   16.022 125.227 1.00 22.10 ? 242 ALA A CA    1 
ATOM   1820 C  C     . ALA A 1 244 ? 5.717   16.086 124.893 1.00 23.84 ? 242 ALA A C     1 
ATOM   1821 O  O     . ALA A 1 244 ? 4.926   15.260 125.351 1.00 22.62 ? 242 ALA A O     1 
ATOM   1822 C  CB    . ALA A 1 244 ? 7.544   17.069 126.273 1.00 20.02 ? 242 ALA A CB    1 
ATOM   1823 N  N     . LEU A 1 245 ? 5.340   17.084 124.102 1.00 22.87 ? 243 LEU A N     1 
ATOM   1824 C  CA    . LEU A 1 245 ? 3.953   17.249 123.691 1.00 25.30 ? 243 LEU A CA    1 
ATOM   1825 C  C     . LEU A 1 245 ? 3.435   16.050 122.901 1.00 27.20 ? 243 LEU A C     1 
ATOM   1826 O  O     . LEU A 1 245 ? 2.355   15.536 123.190 1.00 26.71 ? 243 LEU A O     1 
ATOM   1827 C  CB    . LEU A 1 245 ? 3.799   18.517 122.843 1.00 24.61 ? 243 LEU A CB    1 
ATOM   1828 C  CG    . LEU A 1 245 ? 3.947   19.849 123.581 1.00 24.55 ? 243 LEU A CG    1 
ATOM   1829 C  CD1   . LEU A 1 245 ? 3.905   20.997 122.585 1.00 25.27 ? 243 LEU A CD1   1 
ATOM   1830 C  CD2   . LEU A 1 245 ? 2.832   19.993 124.606 1.00 26.44 ? 243 LEU A CD2   1 
ATOM   1831 N  N     . LEU A 1 246 ? 4.199   15.611 121.902 1.00 26.25 ? 244 LEU A N     1 
ATOM   1832 C  CA    . LEU A 1 246 ? 3.783   14.484 121.075 1.00 28.80 ? 244 LEU A CA    1 
ATOM   1833 C  C     . LEU A 1 246 ? 3.652   13.165 121.835 1.00 31.05 ? 244 LEU A C     1 
ATOM   1834 O  O     . LEU A 1 246 ? 2.891   12.288 121.433 1.00 30.63 ? 244 LEU A O     1 
ATOM   1835 C  CB    . LEU A 1 246 ? 4.754   14.303 119.910 1.00 27.90 ? 244 LEU A CB    1 
ATOM   1836 C  CG    . LEU A 1 246 ? 4.757   15.470 118.926 1.00 28.53 ? 244 LEU A CG    1 
ATOM   1837 C  CD1   . LEU A 1 246 ? 5.926   15.349 117.963 1.00 26.75 ? 244 LEU A CD1   1 
ATOM   1838 C  CD2   . LEU A 1 246 ? 3.427   15.480 118.184 1.00 27.84 ? 244 LEU A CD2   1 
ATOM   1839 N  N     . ARG A 1 247 ? 4.393   13.022 122.928 1.00 32.09 ? 245 ARG A N     1 
ATOM   1840 C  CA    . ARG A 1 247 ? 4.341   11.795 123.712 1.00 32.02 ? 245 ARG A CA    1 
ATOM   1841 C  C     . ARG A 1 247 ? 3.475   11.939 124.958 1.00 33.24 ? 245 ARG A C     1 
ATOM   1842 O  O     . ARG A 1 247 ? 3.366   11.016 125.769 1.00 34.12 ? 245 ARG A O     1 
ATOM   1843 C  CB    . ARG A 1 247 ? 5.765   11.357 124.067 1.00 30.01 ? 245 ARG A CB    1 
ATOM   1844 C  CG    . ARG A 1 247 ? 6.547   10.915 122.832 1.00 30.31 ? 245 ARG A CG    1 
ATOM   1845 C  CD    . ARG A 1 247 ? 7.985   10.503 123.129 1.00 29.81 ? 245 ARG A CD    1 
ATOM   1846 N  NE    . ARG A 1 247 ? 8.812   11.628 123.551 1.00 28.67 ? 245 ARG A NE    1 
ATOM   1847 C  CZ    . ARG A 1 247 ? 9.242   11.806 124.793 1.00 30.29 ? 245 ARG A CZ    1 
ATOM   1848 N  NH1   . ARG A 1 247 ? 8.927   10.927 125.738 1.00 27.25 ? 245 ARG A NH1   1 
ATOM   1849 N  NH2   . ARG A 1 247 ? 9.985   12.860 125.093 1.00 28.71 ? 245 ARG A NH2   1 
ATOM   1850 N  N     . GLY A 1 248 ? 2.857   13.107 125.096 1.00 33.37 ? 246 GLY A N     1 
ATOM   1851 C  CA    . GLY A 1 248 ? 1.973   13.381 126.215 1.00 35.10 ? 246 GLY A CA    1 
ATOM   1852 C  C     . GLY A 1 248 ? 2.567   13.450 127.609 1.00 36.59 ? 246 GLY A C     1 
ATOM   1853 O  O     . GLY A 1 248 ? 1.856   13.226 128.590 1.00 37.16 ? 246 GLY A O     1 
ATOM   1854 N  N     . VAL A 1 249 ? 3.852   13.771 127.722 1.00 35.95 ? 247 VAL A N     1 
ATOM   1855 C  CA    . VAL A 1 249 ? 4.479   13.847 129.037 1.00 36.17 ? 247 VAL A CA    1 
ATOM   1856 C  C     . VAL A 1 249 ? 5.189   15.160 129.307 1.00 35.95 ? 247 VAL A C     1 
ATOM   1857 O  O     . VAL A 1 249 ? 5.300   16.023 128.431 1.00 35.59 ? 247 VAL A O     1 
ATOM   1858 C  CB    . VAL A 1 249 ? 5.517   12.729 129.230 1.00 35.65 ? 247 VAL A CB    1 
ATOM   1859 C  CG1   . VAL A 1 249 ? 4.834   11.379 129.224 1.00 36.48 ? 247 VAL A CG1   1 
ATOM   1860 C  CG2   . VAL A 1 249 ? 6.567   12.807 128.126 1.00 35.66 ? 247 VAL A CG2   1 
ATOM   1861 N  N     . ALA A 1 250 ? 5.661   15.299 130.541 1.00 33.62 ? 248 ALA A N     1 
ATOM   1862 C  CA    . ALA A 1 250 ? 6.405   16.474 130.952 1.00 33.47 ? 248 ALA A CA    1 
ATOM   1863 C  C     . ALA A 1 250 ? 7.788   16.255 130.348 1.00 32.71 ? 248 ALA A C     1 
ATOM   1864 O  O     . ALA A 1 250 ? 8.208   15.114 130.157 1.00 32.05 ? 248 ALA A O     1 
ATOM   1865 C  CB    . ALA A 1 250 ? 6.489   16.536 132.469 1.00 34.03 ? 248 ALA A CB    1 
ATOM   1866 N  N     . PRO A 1 251 ? 8.506   17.336 130.014 1.00 33.38 ? 249 PRO A N     1 
ATOM   1867 C  CA    . PRO A 1 251 ? 9.837   17.134 129.431 1.00 33.41 ? 249 PRO A CA    1 
ATOM   1868 C  C     . PRO A 1 251 ? 10.658  16.086 130.183 1.00 33.82 ? 249 PRO A C     1 
ATOM   1869 O  O     . PRO A 1 251 ? 10.753  16.108 131.410 1.00 34.38 ? 249 PRO A O     1 
ATOM   1870 C  CB    . PRO A 1 251 ? 10.460  18.535 129.459 1.00 33.85 ? 249 PRO A CB    1 
ATOM   1871 C  CG    . PRO A 1 251 ? 9.510   19.379 130.300 1.00 36.38 ? 249 PRO A CG    1 
ATOM   1872 C  CD    . PRO A 1 251 ? 8.168   18.763 130.102 1.00 33.58 ? 249 PRO A CD    1 
ATOM   1873 N  N     . ASP A 1 252 ? 11.238  15.159 129.434 1.00 33.87 ? 250 ASP A N     1 
ATOM   1874 C  CA    . ASP A 1 252 ? 12.018  14.087 130.027 1.00 34.29 ? 250 ASP A CA    1 
ATOM   1875 C  C     . ASP A 1 252 ? 13.347  13.889 129.314 1.00 33.17 ? 250 ASP A C     1 
ATOM   1876 O  O     . ASP A 1 252 ? 13.698  14.650 128.408 1.00 32.41 ? 250 ASP A O     1 
ATOM   1877 C  CB    . ASP A 1 252 ? 11.205  12.789 129.985 1.00 34.56 ? 250 ASP A CB    1 
ATOM   1878 C  CG    . ASP A 1 252 ? 10.790  12.407 128.573 1.00 36.86 ? 250 ASP A CG    1 
ATOM   1879 O  OD1   . ASP A 1 252 ? 11.077  13.185 127.632 1.00 34.59 ? 250 ASP A OD1   1 
ATOM   1880 O  OD2   . ASP A 1 252 ? 10.174  11.331 128.402 1.00 36.31 ? 250 ASP A OD2   1 
ATOM   1881 N  N     . ALA A 1 253 ? 14.075  12.852 129.718 1.00 30.73 ? 251 ALA A N     1 
ATOM   1882 C  CA    . ALA A 1 253 ? 15.379  12.549 129.133 1.00 30.98 ? 251 ALA A CA    1 
ATOM   1883 C  C     . ALA A 1 253 ? 15.321  12.382 127.616 1.00 30.51 ? 251 ALA A C     1 
ATOM   1884 O  O     . ALA A 1 253 ? 16.193  12.879 126.902 1.00 29.48 ? 251 ALA A O     1 
ATOM   1885 C  CB    . ALA A 1 253 ? 15.967  11.283 129.779 1.00 30.63 ? 251 ALA A CB    1 
ATOM   1886 N  N     . LEU A 1 254 ? 14.300  11.682 127.124 1.00 30.10 ? 252 LEU A N     1 
ATOM   1887 C  CA    . LEU A 1 254 ? 14.162  11.463 125.686 1.00 30.21 ? 252 LEU A CA    1 
ATOM   1888 C  C     . LEU A 1 254 ? 13.890  12.786 124.970 1.00 28.72 ? 252 LEU A C     1 
ATOM   1889 O  O     . LEU A 1 254 ? 14.335  12.988 123.844 1.00 28.73 ? 252 LEU A O     1 
ATOM   1890 C  CB    . LEU A 1 254 ? 13.032  10.468 125.390 1.00 31.45 ? 252 LEU A CB    1 
ATOM   1891 C  CG    . LEU A 1 254 ? 12.825  10.157 123.903 1.00 33.40 ? 252 LEU A CG    1 
ATOM   1892 C  CD1   . LEU A 1 254 ? 14.094  9.560  123.325 1.00 33.65 ? 252 LEU A CD1   1 
ATOM   1893 C  CD2   . LEU A 1 254 ? 11.651  9.203  123.726 1.00 33.89 ? 252 LEU A CD2   1 
ATOM   1894 N  N     . ALA A 1 255 ? 13.157  13.683 125.620 1.00 28.01 ? 253 ALA A N     1 
ATOM   1895 C  CA    . ALA A 1 255 ? 12.870  14.981 125.018 1.00 27.18 ? 253 ALA A CA    1 
ATOM   1896 C  C     . ALA A 1 255 ? 14.192  15.709 124.776 1.00 27.92 ? 253 ALA A C     1 
ATOM   1897 O  O     . ALA A 1 255 ? 14.401  16.300 123.713 1.00 25.25 ? 253 ALA A O     1 
ATOM   1898 C  CB    . ALA A 1 255 ? 11.980  15.803 125.930 1.00 25.95 ? 253 ALA A CB    1 
ATOM   1899 N  N     . LEU A 1 256 ? 15.094  15.662 125.756 1.00 26.68 ? 254 LEU A N     1 
ATOM   1900 C  CA    . LEU A 1 256 ? 16.380  16.327 125.600 1.00 25.59 ? 254 LEU A CA    1 
ATOM   1901 C  C     . LEU A 1 256 ? 17.252  15.667 124.538 1.00 25.50 ? 254 LEU A C     1 
ATOM   1902 O  O     . LEU A 1 256 ? 18.005  16.348 123.844 1.00 25.15 ? 254 LEU A O     1 
ATOM   1903 C  CB    . LEU A 1 256 ? 17.126  16.412 126.941 1.00 27.14 ? 254 LEU A CB    1 
ATOM   1904 C  CG    . LEU A 1 256 ? 16.731  17.622 127.802 1.00 28.96 ? 254 LEU A CG    1 
ATOM   1905 C  CD1   . LEU A 1 256 ? 15.320  17.451 128.325 1.00 31.55 ? 254 LEU A CD1   1 
ATOM   1906 C  CD2   . LEU A 1 256 ? 17.708  17.788 128.959 1.00 27.84 ? 254 LEU A CD2   1 
ATOM   1907 N  N     . ALA A 1 257 ? 17.142  14.350 124.398 1.00 23.27 ? 255 ALA A N     1 
ATOM   1908 C  CA    . ALA A 1 257 ? 17.921  13.624 123.400 1.00 24.36 ? 255 ALA A CA    1 
ATOM   1909 C  C     . ALA A 1 257 ? 17.461  14.021 121.999 1.00 23.08 ? 255 ALA A C     1 
ATOM   1910 O  O     . ALA A 1 257 ? 18.274  14.241 121.101 1.00 24.05 ? 255 ALA A O     1 
ATOM   1911 C  CB    . ALA A 1 257 ? 17.760  12.117 123.598 1.00 24.65 ? 255 ALA A CB    1 
ATOM   1912 N  N     . HIS A 1 258 ? 16.149  14.093 121.806 1.00 23.11 ? 256 HIS A N     1 
ATOM   1913 C  CA    . HIS A 1 258 ? 15.614  14.493 120.510 1.00 21.62 ? 256 HIS A CA    1 
ATOM   1914 C  C     . HIS A 1 258 ? 16.080  15.914 120.192 1.00 21.59 ? 256 HIS A C     1 
ATOM   1915 O  O     . HIS A 1 258 ? 16.463  16.218 119.065 1.00 20.99 ? 256 HIS A O     1 
ATOM   1916 C  CB    . HIS A 1 258 ? 14.084  14.477 120.524 1.00 23.26 ? 256 HIS A CB    1 
ATOM   1917 C  CG    . HIS A 1 258 ? 13.484  13.107 120.549 1.00 23.69 ? 256 HIS A CG    1 
ATOM   1918 N  ND1   . HIS A 1 258 ? 14.101  12.011 119.983 1.00 26.61 ? 256 HIS A ND1   1 
ATOM   1919 C  CD2   . HIS A 1 258 ? 12.284  12.671 120.999 1.00 22.00 ? 256 HIS A CD2   1 
ATOM   1920 C  CE1   . HIS A 1 258 ? 13.305  10.961 120.081 1.00 23.99 ? 256 HIS A CE1   1 
ATOM   1921 N  NE2   . HIS A 1 258 ? 12.196  11.334 120.692 1.00 27.28 ? 256 HIS A NE2   1 
ATOM   1922 N  N     . ALA A 1 259 ? 16.021  16.782 121.198 1.00 22.25 ? 257 ALA A N     1 
ATOM   1923 C  CA    . ALA A 1 259 ? 16.413  18.181 121.055 1.00 22.96 ? 257 ALA A CA    1 
ATOM   1924 C  C     . ALA A 1 259 ? 17.882  18.335 120.681 1.00 24.06 ? 257 ALA A C     1 
ATOM   1925 O  O     . ALA A 1 259 ? 18.240  19.175 119.847 1.00 23.04 ? 257 ALA A O     1 
ATOM   1926 C  CB    . ALA A 1 259 ? 16.131  18.934 122.352 1.00 21.96 ? 257 ALA A CB    1 
ATOM   1927 N  N     . SER A 1 260 ? 18.733  17.537 121.317 1.00 22.92 ? 258 SER A N     1 
ATOM   1928 C  CA    . SER A 1 260 ? 20.162  17.586 121.046 1.00 24.00 ? 258 SER A CA    1 
ATOM   1929 C  C     . SER A 1 260 ? 20.424  17.180 119.602 1.00 24.25 ? 258 SER A C     1 
ATOM   1930 O  O     . SER A 1 260 ? 21.284  17.745 118.931 1.00 25.71 ? 258 SER A O     1 
ATOM   1931 C  CB    . SER A 1 260 ? 20.907  16.644 121.991 1.00 23.47 ? 258 SER A CB    1 
ATOM   1932 O  OG    . SER A 1 260 ? 20.622  16.960 123.341 1.00 26.64 ? 258 SER A OG    1 
ATOM   1933 N  N     . ARG A 1 261 ? 19.668  16.195 119.133 1.00 25.26 ? 259 ARG A N     1 
ATOM   1934 C  CA    . ARG A 1 261 ? 19.815  15.699 117.775 1.00 26.27 ? 259 ARG A CA    1 
ATOM   1935 C  C     . ARG A 1 261 ? 19.396  16.763 116.768 1.00 24.30 ? 259 ARG A C     1 
ATOM   1936 O  O     . ARG A 1 261 ? 20.034  16.932 115.729 1.00 24.10 ? 259 ARG A O     1 
ATOM   1937 C  CB    . ARG A 1 261 ? 18.971  14.435 117.588 1.00 30.73 ? 259 ARG A CB    1 
ATOM   1938 C  CG    . ARG A 1 261 ? 19.476  13.517 116.491 1.00 39.85 ? 259 ARG A CG    1 
ATOM   1939 C  CD    . ARG A 1 261 ? 18.651  12.242 116.413 1.00 46.40 ? 259 ARG A CD    1 
ATOM   1940 N  NE    . ARG A 1 261 ? 18.742  11.454 117.641 1.00 51.11 ? 259 ARG A NE    1 
ATOM   1941 C  CZ    . ARG A 1 261 ? 18.018  10.365 117.879 1.00 54.65 ? 259 ARG A CZ    1 
ATOM   1942 N  NH1   . ARG A 1 261 ? 17.149  9.934  116.973 1.00 56.40 ? 259 ARG A NH1   1 
ATOM   1943 N  NH2   . ARG A 1 261 ? 18.161  9.704  119.020 1.00 57.18 ? 259 ARG A NH2   1 
ATOM   1944 N  N     . ALA A 1 262 ? 18.329  17.488 117.087 1.00 21.52 ? 260 ALA A N     1 
ATOM   1945 C  CA    . ALA A 1 262 ? 17.828  18.531 116.198 1.00 22.84 ? 260 ALA A CA    1 
ATOM   1946 C  C     . ALA A 1 262 ? 18.774  19.723 116.183 1.00 23.46 ? 260 ALA A C     1 
ATOM   1947 O  O     . ALA A 1 262 ? 19.058  20.297 115.127 1.00 24.22 ? 260 ALA A O     1 
ATOM   1948 C  CB    . ALA A 1 262 ? 16.450  18.971 116.649 1.00 20.71 ? 260 ALA A CB    1 
ATOM   1949 N  N     . ALA A 1 263 ? 19.258  20.101 117.362 1.00 23.01 ? 261 ALA A N     1 
ATOM   1950 C  CA    . ALA A 1 263 ? 20.169  21.234 117.466 1.00 23.59 ? 261 ALA A CA    1 
ATOM   1951 C  C     . ALA A 1 263 ? 21.448  20.944 116.692 1.00 24.32 ? 261 ALA A C     1 
ATOM   1952 O  O     . ALA A 1 263 ? 22.045  21.850 116.111 1.00 24.06 ? 261 ALA A O     1 
ATOM   1953 C  CB    . ALA A 1 263 ? 20.484  21.519 118.927 1.00 21.72 ? 261 ALA A CB    1 
ATOM   1954 N  N     . ALA A 1 264 ? 21.859  19.677 116.677 1.00 25.42 ? 262 ALA A N     1 
ATOM   1955 C  CA    . ALA A 1 264 ? 23.066  19.280 115.961 1.00 25.16 ? 262 ALA A CA    1 
ATOM   1956 C  C     . ALA A 1 264 ? 22.931  19.586 114.472 1.00 24.55 ? 262 ALA A C     1 
ATOM   1957 O  O     . ALA A 1 264 ? 23.913  19.919 113.812 1.00 23.56 ? 262 ALA A O     1 
ATOM   1958 C  CB    . ALA A 1 264 ? 23.338  17.795 116.168 1.00 25.89 ? 262 ALA A CB    1 
ATOM   1959 N  N     . ILE A 1 265 ? 21.716  19.469 113.942 1.00 22.86 ? 263 ILE A N     1 
ATOM   1960 C  CA    . ILE A 1 265 ? 21.476  19.757 112.533 1.00 22.84 ? 263 ILE A CA    1 
ATOM   1961 C  C     . ILE A 1 265 ? 21.634  21.261 112.291 1.00 22.95 ? 263 ILE A C     1 
ATOM   1962 O  O     . ILE A 1 265 ? 22.348  21.686 111.378 1.00 22.61 ? 263 ILE A O     1 
ATOM   1963 C  CB    . ILE A 1 265 ? 20.049  19.293 112.103 1.00 24.12 ? 263 ILE A CB    1 
ATOM   1964 C  CG1   . ILE A 1 265 ? 19.953  17.767 112.201 1.00 24.03 ? 263 ILE A CG1   1 
ATOM   1965 C  CG2   . ILE A 1 265 ? 19.744  19.746 110.680 1.00 23.28 ? 263 ILE A CG2   1 
ATOM   1966 C  CD1   . ILE A 1 265 ? 18.566  17.205 111.955 1.00 25.60 ? 263 ILE A CD1   1 
ATOM   1967 N  N     . THR A 1 266 ? 20.992  22.065 113.133 1.00 21.28 ? 264 THR A N     1 
ATOM   1968 C  CA    . THR A 1 266 ? 21.060  23.519 112.994 1.00 21.74 ? 264 THR A CA    1 
ATOM   1969 C  C     . THR A 1 266 ? 22.492  24.053 113.038 1.00 21.89 ? 264 THR A C     1 
ATOM   1970 O  O     . THR A 1 266 ? 22.855  24.942 112.263 1.00 22.55 ? 264 THR A O     1 
ATOM   1971 C  CB    . THR A 1 266 ? 20.225  24.217 114.086 1.00 20.98 ? 264 THR A CB    1 
ATOM   1972 O  OG1   . THR A 1 266 ? 18.836  23.907 113.897 1.00 22.02 ? 264 THR A OG1   1 
ATOM   1973 C  CG2   . THR A 1 266 ? 20.430  25.736 114.032 1.00 20.51 ? 264 THR A CG2   1 
ATOM   1974 N  N     . VAL A 1 267 ? 23.304  23.511 113.939 1.00 22.80 ? 265 VAL A N     1 
ATOM   1975 C  CA    . VAL A 1 267 ? 24.691  23.940 114.077 1.00 24.86 ? 265 VAL A CA    1 
ATOM   1976 C  C     . VAL A 1 267 ? 25.499  23.608 112.818 1.00 24.75 ? 265 VAL A C     1 
ATOM   1977 O  O     . VAL A 1 267 ? 26.440  24.324 112.473 1.00 23.64 ? 265 VAL A O     1 
ATOM   1978 C  CB    . VAL A 1 267 ? 25.359  23.262 115.304 1.00 25.43 ? 265 VAL A CB    1 
ATOM   1979 C  CG1   . VAL A 1 267 ? 26.824  23.618 115.374 1.00 30.75 ? 265 VAL A CG1   1 
ATOM   1980 C  CG2   . VAL A 1 267 ? 24.659  23.703 116.581 1.00 28.42 ? 265 VAL A CG2   1 
ATOM   1981 N  N     . SER A 1 268 ? 25.115  22.533 112.130 1.00 25.43 ? 266 SER A N     1 
ATOM   1982 C  CA    . SER A 1 268 ? 25.822  22.098 110.924 1.00 25.24 ? 266 SER A CA    1 
ATOM   1983 C  C     . SER A 1 268 ? 25.484  22.897 109.664 1.00 25.32 ? 266 SER A C     1 
ATOM   1984 O  O     . SER A 1 268 ? 26.184  22.785 108.652 1.00 23.66 ? 266 SER A O     1 
ATOM   1985 C  CB    . SER A 1 268 ? 25.539  20.612 110.658 1.00 25.75 ? 266 SER A CB    1 
ATOM   1986 O  OG    . SER A 1 268 ? 24.238  20.420 110.115 1.00 29.22 ? 266 SER A OG    1 
ATOM   1987 N  N     . ARG A 1 269 ? 24.408  23.679 109.716 1.00 23.97 ? 267 ARG A N     1 
ATOM   1988 C  CA    . ARG A 1 269 ? 23.966  24.466 108.563 1.00 25.21 ? 267 ARG A CA    1 
ATOM   1989 C  C     . ARG A 1 269 ? 23.970  25.966 108.829 1.00 25.11 ? 267 ARG A C     1 
ATOM   1990 O  O     . ARG A 1 269 ? 23.822  26.403 109.967 1.00 24.50 ? 267 ARG A O     1 
ATOM   1991 C  CB    . ARG A 1 269 ? 22.551  24.048 108.151 1.00 24.34 ? 267 ARG A CB    1 
ATOM   1992 C  CG    . ARG A 1 269 ? 22.412  22.616 107.675 1.00 26.73 ? 267 ARG A CG    1 
ATOM   1993 C  CD    . ARG A 1 269 ? 20.930  22.243 107.617 1.00 27.35 ? 267 ARG A CD    1 
ATOM   1994 N  NE    . ARG A 1 269 ? 20.748  20.886 107.143 1.00 31.82 ? 267 ARG A NE    1 
ATOM   1995 C  CZ    . ARG A 1 269 ? 19.605  20.219 107.186 1.00 25.74 ? 267 ARG A CZ    1 
ATOM   1996 N  NH1   . ARG A 1 269 ? 18.512  20.776 107.693 1.00 27.26 ? 267 ARG A NH1   1 
ATOM   1997 N  NH2   . ARG A 1 269 ? 19.563  18.987 106.711 1.00 29.66 ? 267 ARG A NH2   1 
ATOM   1998 N  N     . ARG A 1 270 ? 24.118  26.748 107.764 1.00 25.81 ? 268 ARG A N     1 
ATOM   1999 C  CA    . ARG A 1 270 ? 24.145  28.204 107.862 1.00 26.50 ? 268 ARG A CA    1 
ATOM   2000 C  C     . ARG A 1 270 ? 22.769  28.848 107.754 1.00 25.61 ? 268 ARG A C     1 
ATOM   2001 O  O     . ARG A 1 270 ? 21.911  28.379 107.005 1.00 26.17 ? 268 ARG A O     1 
ATOM   2002 C  CB    . ARG A 1 270 ? 25.044  28.784 106.766 1.00 31.08 ? 268 ARG A CB    1 
ATOM   2003 C  CG    . ARG A 1 270 ? 26.518  28.402 106.869 1.00 37.43 ? 268 ARG A CG    1 
ATOM   2004 C  CD    . ARG A 1 270 ? 27.316  29.026 105.720 1.00 40.93 ? 268 ARG A CD    1 
ATOM   2005 N  NE    . ARG A 1 270 ? 28.755  28.777 105.810 1.00 44.26 ? 268 ARG A NE    1 
ATOM   2006 C  CZ    . ARG A 1 270 ? 29.561  29.313 106.726 1.00 47.21 ? 268 ARG A CZ    1 
ATOM   2007 N  NH1   . ARG A 1 270 ? 29.082  30.138 107.653 1.00 46.94 ? 268 ARG A NH1   1 
ATOM   2008 N  NH2   . ARG A 1 270 ? 30.859  29.035 106.707 1.00 48.90 ? 268 ARG A NH2   1 
ATOM   2009 N  N     . GLY A 1 271 ? 22.564  29.929 108.500 1.00 22.98 ? 269 GLY A N     1 
ATOM   2010 C  CA    . GLY A 1 271 ? 21.295  30.635 108.452 1.00 23.72 ? 269 GLY A CA    1 
ATOM   2011 C  C     . GLY A 1 271 ? 20.291  30.259 109.526 1.00 25.16 ? 269 GLY A C     1 
ATOM   2012 O  O     . GLY A 1 271 ? 20.642  29.715 110.579 1.00 22.67 ? 269 GLY A O     1 
ATOM   2013 N  N     . THR A 1 272 ? 19.029  30.565 109.255 1.00 23.96 ? 270 THR A N     1 
ATOM   2014 C  CA    . THR A 1 272 ? 17.951  30.258 110.175 1.00 24.54 ? 270 THR A CA    1 
ATOM   2015 C  C     . THR A 1 272 ? 16.978  29.287 109.516 1.00 23.47 ? 270 THR A C     1 
ATOM   2016 O  O     . THR A 1 272 ? 17.188  28.075 109.546 1.00 22.46 ? 270 THR A O     1 
ATOM   2017 C  CB    . THR A 1 272 ? 17.204  31.542 110.608 1.00 25.06 ? 270 THR A CB    1 
ATOM   2018 O  OG1   . THR A 1 272 ? 16.785  32.277 109.451 1.00 24.54 ? 270 THR A OG1   1 
ATOM   2019 C  CG2   . THR A 1 272 ? 18.123  32.424 111.447 1.00 27.62 ? 270 THR A CG2   1 
ATOM   2020 N  N     . LEU A 1 273 ? 15.924  29.817 108.905 1.00 23.93 ? 271 LEU A N     1 
ATOM   2021 C  CA    . LEU A 1 273 ? 14.931  28.962 108.261 1.00 23.26 ? 271 LEU A CA    1 
ATOM   2022 C  C     . LEU A 1 273 ? 15.531  27.958 107.285 1.00 22.95 ? 271 LEU A C     1 
ATOM   2023 O  O     . LEU A 1 273 ? 15.033  26.837 107.167 1.00 24.49 ? 271 LEU A O     1 
ATOM   2024 C  CB    . LEU A 1 273 ? 13.878  29.813 107.544 1.00 23.65 ? 271 LEU A CB    1 
ATOM   2025 C  CG    . LEU A 1 273 ? 12.685  30.236 108.407 1.00 26.16 ? 271 LEU A CG    1 
ATOM   2026 C  CD1   . LEU A 1 273 ? 13.175  30.952 109.653 1.00 27.12 ? 271 LEU A CD1   1 
ATOM   2027 C  CD2   . LEU A 1 273 ? 11.742  31.115 107.591 1.00 22.06 ? 271 LEU A CD2   1 
ATOM   2028 N  N     . SER A 1 274 ? 16.590  28.341 106.580 1.00 20.23 ? 272 SER A N     1 
ATOM   2029 C  CA    . SER A 1 274 ? 17.194  27.412 105.629 1.00 21.25 ? 272 SER A CA    1 
ATOM   2030 C  C     . SER A 1 274 ? 18.133  26.398 106.289 1.00 21.70 ? 272 SER A C     1 
ATOM   2031 O  O     . SER A 1 274 ? 18.583  25.445 105.647 1.00 22.36 ? 272 SER A O     1 
ATOM   2032 C  CB    . SER A 1 274 ? 17.940  28.182 104.524 1.00 23.67 ? 272 SER A CB    1 
ATOM   2033 O  OG    . SER A 1 274 ? 19.111  28.804 105.007 1.00 25.40 ? 272 SER A OG    1 
ATOM   2034 N  N     . ALA A 1 275 ? 18.421  26.592 107.573 1.00 22.49 ? 273 ALA A N     1 
ATOM   2035 C  CA    . ALA A 1 275 ? 19.315  25.691 108.291 1.00 20.65 ? 273 ALA A CA    1 
ATOM   2036 C  C     . ALA A 1 275 ? 18.603  24.746 109.255 1.00 19.81 ? 273 ALA A C     1 
ATOM   2037 O  O     . ALA A 1 275 ? 19.043  23.616 109.462 1.00 21.10 ? 273 ALA A O     1 
ATOM   2038 C  CB    . ALA A 1 275 ? 20.365  26.504 109.054 1.00 22.00 ? 273 ALA A CB    1 
ATOM   2039 N  N     . PHE A 1 276 ? 17.516  25.209 109.855 1.00 19.42 ? 274 PHE A N     1 
ATOM   2040 C  CA    . PHE A 1 276 ? 16.786  24.390 110.821 1.00 19.34 ? 274 PHE A CA    1 
ATOM   2041 C  C     . PHE A 1 276 ? 16.334  23.064 110.223 1.00 20.06 ? 274 PHE A C     1 
ATOM   2042 O  O     . PHE A 1 276 ? 16.174  22.939 109.011 1.00 20.46 ? 274 PHE A O     1 
ATOM   2043 C  CB    . PHE A 1 276 ? 15.541  25.128 111.335 1.00 20.69 ? 274 PHE A CB    1 
ATOM   2044 C  CG    . PHE A 1 276 ? 15.832  26.450 111.990 1.00 18.89 ? 274 PHE A CG    1 
ATOM   2045 C  CD1   . PHE A 1 276 ? 17.051  26.687 112.612 1.00 19.95 ? 274 PHE A CD1   1 
ATOM   2046 C  CD2   . PHE A 1 276 ? 14.873  27.462 111.987 1.00 20.17 ? 274 PHE A CD2   1 
ATOM   2047 C  CE1   . PHE A 1 276 ? 17.318  27.922 113.226 1.00 20.88 ? 274 PHE A CE1   1 
ATOM   2048 C  CE2   . PHE A 1 276 ? 15.128  28.699 112.597 1.00 18.64 ? 274 PHE A CE2   1 
ATOM   2049 C  CZ    . PHE A 1 276 ? 16.354  28.925 113.216 1.00 18.68 ? 274 PHE A CZ    1 
ATOM   2050 N  N     . PRO A 1 277 ? 16.140  22.046 111.074 1.00 20.44 ? 275 PRO A N     1 
ATOM   2051 C  CA    . PRO A 1 277 ? 15.690  20.758 110.555 1.00 20.63 ? 275 PRO A CA    1 
ATOM   2052 C  C     . PRO A 1 277 ? 14.323  20.943 109.892 1.00 20.48 ? 275 PRO A C     1 
ATOM   2053 O  O     . PRO A 1 277 ? 13.522  21.779 110.324 1.00 18.81 ? 275 PRO A O     1 
ATOM   2054 C  CB    . PRO A 1 277 ? 15.628  19.876 111.809 1.00 21.69 ? 275 PRO A CB    1 
ATOM   2055 C  CG    . PRO A 1 277 ? 15.521  20.854 112.942 1.00 23.26 ? 275 PRO A CG    1 
ATOM   2056 C  CD    . PRO A 1 277 ? 16.426  21.963 112.516 1.00 20.55 ? 275 PRO A CD    1 
ATOM   2057 N  N     . GLY A 1 278 ? 14.081  20.181 108.829 1.00 18.46 ? 276 GLY A N     1 
ATOM   2058 C  CA    . GLY A 1 278 ? 12.815  20.259 108.123 1.00 20.73 ? 276 GLY A CA    1 
ATOM   2059 C  C     . GLY A 1 278 ? 11.787  19.329 108.743 1.00 22.07 ? 276 GLY A C     1 
ATOM   2060 O  O     . GLY A 1 278 ? 12.135  18.432 109.510 1.00 23.02 ? 276 GLY A O     1 
ATOM   2061 N  N     . SER A 1 279 ? 10.518  19.535 108.415 1.00 21.78 ? 277 SER A N     1 
ATOM   2062 C  CA    . SER A 1 279 ? 9.456   18.703 108.970 1.00 22.79 ? 277 SER A CA    1 
ATOM   2063 C  C     . SER A 1 279 ? 9.727   17.201 108.902 1.00 22.59 ? 277 SER A C     1 
ATOM   2064 O  O     . SER A 1 279 ? 9.546   16.488 109.894 1.00 22.05 ? 277 SER A O     1 
ATOM   2065 C  CB    . SER A 1 279 ? 8.129   19.030 108.285 1.00 22.63 ? 277 SER A CB    1 
ATOM   2066 O  OG    . SER A 1 279 ? 7.683   20.312 108.687 1.00 24.05 ? 277 SER A OG    1 
ATOM   2067 N  N     . ARG A 1 280 ? 10.161  16.712 107.746 1.00 23.22 ? 278 ARG A N     1 
ATOM   2068 C  CA    . ARG A 1 280 ? 10.450  15.287 107.620 1.00 24.08 ? 278 ARG A CA    1 
ATOM   2069 C  C     . ARG A 1 280 ? 11.689  14.871 108.411 1.00 24.79 ? 278 ARG A C     1 
ATOM   2070 O  O     . ARG A 1 280 ? 11.753  13.756 108.941 1.00 24.18 ? 278 ARG A O     1 
ATOM   2071 C  CB    . ARG A 1 280 ? 10.598  14.903 106.150 1.00 25.65 ? 278 ARG A CB    1 
ATOM   2072 C  CG    . ARG A 1 280 ? 9.260   14.837 105.426 1.00 28.33 ? 278 ARG A CG    1 
ATOM   2073 C  CD    . ARG A 1 280 ? 9.431   14.197 104.067 1.00 31.26 ? 278 ARG A CD    1 
ATOM   2074 N  NE    . ARG A 1 280 ? 10.281  15.015 103.220 1.00 30.43 ? 278 ARG A NE    1 
ATOM   2075 C  CZ    . ARG A 1 280 ? 11.016  14.551 102.215 1.00 31.06 ? 278 ARG A CZ    1 
ATOM   2076 N  NH1   . ARG A 1 280 ? 11.012  13.259 101.920 1.00 35.24 ? 278 ARG A NH1   1 
ATOM   2077 N  NH2   . ARG A 1 280 ? 11.766  15.386 101.512 1.00 24.14 ? 278 ARG A NH2   1 
ATOM   2078 N  N     . GLU A 1 281 ? 12.680  15.753 108.495 1.00 23.62 ? 279 GLU A N     1 
ATOM   2079 C  CA    . GLU A 1 281 ? 13.873  15.426 109.271 1.00 23.61 ? 279 GLU A CA    1 
ATOM   2080 C  C     . GLU A 1 281 ? 13.461  15.332 110.747 1.00 22.96 ? 279 GLU A C     1 
ATOM   2081 O  O     . GLU A 1 281 ? 13.950  14.477 111.485 1.00 23.20 ? 279 GLU A O     1 
ATOM   2082 C  CB    . GLU A 1 281 ? 14.952  16.502 109.096 1.00 23.63 ? 279 GLU A CB    1 
ATOM   2083 C  CG    . GLU A 1 281 ? 15.517  16.597 107.683 1.00 25.13 ? 279 GLU A CG    1 
ATOM   2084 C  CD    . GLU A 1 281 ? 16.634  17.626 107.568 1.00 25.28 ? 279 GLU A CD    1 
ATOM   2085 O  OE1   . GLU A 1 281 ? 16.452  18.755 108.070 1.00 23.48 ? 279 GLU A OE1   1 
ATOM   2086 O  OE2   . GLU A 1 281 ? 17.686  17.313 106.967 1.00 26.29 ? 279 GLU A OE2   1 
ATOM   2087 N  N     . LEU A 1 282 ? 12.550  16.206 111.168 1.00 23.59 ? 280 LEU A N     1 
ATOM   2088 C  CA    . LEU A 1 282 ? 12.086  16.218 112.550 1.00 23.85 ? 280 LEU A CA    1 
ATOM   2089 C  C     . LEU A 1 282 ? 11.234  14.994 112.833 1.00 26.12 ? 280 LEU A C     1 
ATOM   2090 O  O     . LEU A 1 282 ? 11.366  14.362 113.882 1.00 26.44 ? 280 LEU A O     1 
ATOM   2091 C  CB    . LEU A 1 282 ? 11.289  17.496 112.837 1.00 21.60 ? 280 LEU A CB    1 
ATOM   2092 C  CG    . LEU A 1 282 ? 12.144  18.770 112.896 1.00 21.27 ? 280 LEU A CG    1 
ATOM   2093 C  CD1   . LEU A 1 282 ? 11.261  19.999 112.786 1.00 21.06 ? 280 LEU A CD1   1 
ATOM   2094 C  CD2   . LEU A 1 282 ? 12.945  18.792 114.195 1.00 23.83 ? 280 LEU A CD2   1 
ATOM   2095 N  N     . ALA A 1 283 ? 10.365  14.655 111.888 1.00 26.91 ? 281 ALA A N     1 
ATOM   2096 C  CA    . ALA A 1 283 ? 9.503   13.490 112.041 1.00 28.65 ? 281 ALA A CA    1 
ATOM   2097 C  C     . ALA A 1 283 ? 10.370  12.262 112.317 1.00 29.54 ? 281 ALA A C     1 
ATOM   2098 O  O     . ALA A 1 283 ? 10.118  11.501 113.260 1.00 27.98 ? 281 ALA A O     1 
ATOM   2099 C  CB    . ALA A 1 283 ? 8.681   13.282 110.775 1.00 29.59 ? 281 ALA A CB    1 
ATOM   2100 N  N     . ALA A 1 284 ? 11.399  12.089 111.495 1.00 29.08 ? 282 ALA A N     1 
ATOM   2101 C  CA    . ALA A 1 284 ? 12.325  10.968 111.620 1.00 30.38 ? 282 ALA A CA    1 
ATOM   2102 C  C     . ALA A 1 284 ? 13.024  10.882 112.982 1.00 31.72 ? 282 ALA A C     1 
ATOM   2103 O  O     . ALA A 1 284 ? 13.046  9.817  113.602 1.00 30.91 ? 282 ALA A O     1 
ATOM   2104 C  CB    . ALA A 1 284 ? 13.372  11.035 110.509 1.00 32.34 ? 282 ALA A CB    1 
ATOM   2105 N  N     . LEU A 1 285 ? 13.589  11.987 113.463 1.00 30.30 ? 283 LEU A N     1 
ATOM   2106 C  CA    . LEU A 1 285 ? 14.291  11.930 114.742 1.00 30.24 ? 283 LEU A CA    1 
ATOM   2107 C  C     . LEU A 1 285 ? 13.365  11.816 115.952 1.00 30.71 ? 283 LEU A C     1 
ATOM   2108 O  O     . LEU A 1 285 ? 13.718  11.184 116.945 1.00 31.17 ? 283 LEU A O     1 
ATOM   2109 C  CB    . LEU A 1 285 ? 15.244  13.127 114.893 1.00 30.62 ? 283 LEU A CB    1 
ATOM   2110 C  CG    . LEU A 1 285 ? 14.752  14.557 115.116 1.00 30.29 ? 283 LEU A CG    1 
ATOM   2111 C  CD1   . LEU A 1 285 ? 14.377  14.761 116.580 1.00 29.55 ? 283 LEU A CD1   1 
ATOM   2112 C  CD2   . LEU A 1 285 ? 15.868  15.524 114.738 1.00 27.61 ? 283 LEU A CD2   1 
ATOM   2113 N  N     . LEU A 1 286 ? 12.177  12.402 115.871 1.00 30.77 ? 284 LEU A N     1 
ATOM   2114 C  CA    . LEU A 1 286 ? 11.236  12.326 116.982 1.00 33.05 ? 284 LEU A CA    1 
ATOM   2115 C  C     . LEU A 1 286 ? 10.679  10.914 117.110 1.00 36.71 ? 284 LEU A C     1 
ATOM   2116 O  O     . LEU A 1 286 ? 10.046  10.567 118.109 1.00 36.79 ? 284 LEU A O     1 
ATOM   2117 C  CB    . LEU A 1 286 ? 10.091  13.314 116.772 1.00 30.59 ? 284 LEU A CB    1 
ATOM   2118 C  CG    . LEU A 1 286 ? 10.480  14.782 116.964 1.00 30.45 ? 284 LEU A CG    1 
ATOM   2119 C  CD1   . LEU A 1 286 ? 9.397   15.694 116.404 1.00 30.51 ? 284 LEU A CD1   1 
ATOM   2120 C  CD2   . LEU A 1 286 ? 10.711  15.048 118.452 1.00 27.94 ? 284 LEU A CD2   1 
ATOM   2121 N  N     . THR A 1 287 ? 10.929  10.104 116.090 1.00 39.51 ? 285 THR A N     1 
ATOM   2122 C  CA    . THR A 1 287 ? 10.447  8.733  116.056 1.00 43.60 ? 285 THR A CA    1 
ATOM   2123 C  C     . THR A 1 287 ? 11.436  7.791  116.748 1.00 45.01 ? 285 THR A C     1 
ATOM   2124 O  O     . THR A 1 287 ? 10.979  6.949  117.550 1.00 45.33 ? 285 THR A O     1 
ATOM   2125 C  CB    . THR A 1 287 ? 10.193  8.288  114.585 1.00 43.59 ? 285 THR A CB    1 
ATOM   2126 O  OG1   . THR A 1 287 ? 8.994   7.513  114.526 1.00 46.66 ? 285 THR A OG1   1 
ATOM   2127 C  CG2   . THR A 1 287 ? 11.351  7.456  114.049 1.00 45.30 ? 285 THR A CG2   1 
ATOM   2128 N  N     . LEU B 1 3   ? 12.013  8.763  98.694  1.00 37.52 ? -1  LEU B N     1 
ATOM   2129 C  CA    . LEU B 1 3   ? 12.901  9.726  97.982  1.00 36.99 ? -1  LEU B CA    1 
ATOM   2130 C  C     . LEU B 1 3   ? 12.061  10.724 97.193  1.00 35.62 ? -1  LEU B C     1 
ATOM   2131 O  O     . LEU B 1 3   ? 11.114  10.352 96.502  1.00 36.83 ? -1  LEU B O     1 
ATOM   2132 C  CB    . LEU B 1 3   ? 13.852  8.977  97.044  1.00 38.05 ? -1  LEU B CB    1 
ATOM   2133 C  CG    . LEU B 1 3   ? 14.951  9.791  96.353  1.00 38.54 ? -1  LEU B CG    1 
ATOM   2134 C  CD1   . LEU B 1 3   ? 16.112  8.872  95.999  1.00 39.38 ? -1  LEU B CD1   1 
ATOM   2135 C  CD2   . LEU B 1 3   ? 14.403  10.478 95.112  1.00 38.67 ? -1  LEU B CD2   1 
ATOM   2136 N  N     . ARG B 1 4   ? 12.424  11.996 97.299  1.00 33.54 ? 2   ARG B N     1 
ATOM   2137 C  CA    . ARG B 1 4   ? 11.699  13.061 96.624  1.00 30.04 ? 2   ARG B CA    1 
ATOM   2138 C  C     . ARG B 1 4   ? 12.611  13.822 95.671  1.00 28.20 ? 2   ARG B C     1 
ATOM   2139 O  O     . ARG B 1 4   ? 13.765  14.102 95.994  1.00 28.51 ? 2   ARG B O     1 
ATOM   2140 C  CB    . ARG B 1 4   ? 11.132  14.009 97.679  1.00 30.73 ? 2   ARG B CB    1 
ATOM   2141 C  CG    . ARG B 1 4   ? 10.384  15.195 97.139  1.00 32.83 ? 2   ARG B CG    1 
ATOM   2142 C  CD    . ARG B 1 4   ? 9.904   16.065 98.287  1.00 32.11 ? 2   ARG B CD    1 
ATOM   2143 N  NE    . ARG B 1 4   ? 9.004   15.342 99.184  1.00 29.52 ? 2   ARG B NE    1 
ATOM   2144 C  CZ    . ARG B 1 4   ? 8.447   15.879 100.264 1.00 30.72 ? 2   ARG B CZ    1 
ATOM   2145 N  NH1   . ARG B 1 4   ? 8.703   17.140 100.586 1.00 27.06 ? 2   ARG B NH1   1 
ATOM   2146 N  NH2   . ARG B 1 4   ? 7.618   15.165 101.012 1.00 30.85 ? 2   ARG B NH2   1 
ATOM   2147 N  N     . VAL B 1 5   ? 12.101  14.148 94.490  1.00 25.07 ? 3   VAL B N     1 
ATOM   2148 C  CA    . VAL B 1 5   ? 12.896  14.889 93.523  1.00 22.28 ? 3   VAL B CA    1 
ATOM   2149 C  C     . VAL B 1 5   ? 12.433  16.336 93.422  1.00 22.42 ? 3   VAL B C     1 
ATOM   2150 O  O     . VAL B 1 5   ? 11.252  16.614 93.193  1.00 22.41 ? 3   VAL B O     1 
ATOM   2151 C  CB    . VAL B 1 5   ? 12.840  14.225 92.127  1.00 22.59 ? 3   VAL B CB    1 
ATOM   2152 C  CG1   . VAL B 1 5   ? 13.583  15.079 91.101  1.00 24.63 ? 3   VAL B CG1   1 
ATOM   2153 C  CG2   . VAL B 1 5   ? 13.461  12.845 92.197  1.00 24.35 ? 3   VAL B CG2   1 
ATOM   2154 N  N     . TYR B 1 6   ? 13.371  17.252 93.634  1.00 20.48 ? 4   TYR B N     1 
ATOM   2155 C  CA    . TYR B 1 6   ? 13.106  18.680 93.533  1.00 20.92 ? 4   TYR B CA    1 
ATOM   2156 C  C     . TYR B 1 6   ? 13.716  19.135 92.215  1.00 20.43 ? 4   TYR B C     1 
ATOM   2157 O  O     . TYR B 1 6   ? 14.855  18.794 91.906  1.00 21.15 ? 4   TYR B O     1 
ATOM   2158 C  CB    . TYR B 1 6   ? 13.782  19.454 94.675  1.00 17.98 ? 4   TYR B CB    1 
ATOM   2159 C  CG    . TYR B 1 6   ? 13.107  19.306 96.012  1.00 19.04 ? 4   TYR B CG    1 
ATOM   2160 C  CD1   . TYR B 1 6   ? 12.068  20.162 96.395  1.00 20.07 ? 4   TYR B CD1   1 
ATOM   2161 C  CD2   . TYR B 1 6   ? 13.495  18.304 96.897  1.00 19.99 ? 4   TYR B CD2   1 
ATOM   2162 C  CE1   . TYR B 1 6   ? 11.434  20.021 97.635  1.00 20.79 ? 4   TYR B CE1   1 
ATOM   2163 C  CE2   . TYR B 1 6   ? 12.870  18.153 98.137  1.00 22.15 ? 4   TYR B CE2   1 
ATOM   2164 C  CZ    . TYR B 1 6   ? 11.846  19.014 98.497  1.00 21.92 ? 4   TYR B CZ    1 
ATOM   2165 O  OH    . TYR B 1 6   ? 11.248  18.865 99.728  1.00 27.59 ? 4   TYR B OH    1 
ATOM   2166 N  N     . VAL B 1 7   ? 12.960  19.909 91.446  1.00 20.09 ? 5   VAL B N     1 
ATOM   2167 C  CA    . VAL B 1 7   ? 13.456  20.412 90.173  1.00 19.72 ? 5   VAL B CA    1 
ATOM   2168 C  C     . VAL B 1 7   ? 13.304  21.923 90.142  1.00 21.41 ? 5   VAL B C     1 
ATOM   2169 O  O     . VAL B 1 7   ? 12.189  22.441 90.168  1.00 23.94 ? 5   VAL B O     1 
ATOM   2170 C  CB    . VAL B 1 7   ? 12.666  19.830 88.985  1.00 20.81 ? 5   VAL B CB    1 
ATOM   2171 C  CG1   . VAL B 1 7   ? 13.332  20.259 87.670  1.00 20.09 ? 5   VAL B CG1   1 
ATOM   2172 C  CG2   . VAL B 1 7   ? 12.591  18.305 89.099  1.00 17.17 ? 5   VAL B CG2   1 
ATOM   2173 N  N     . THR B 1 8   ? 14.427  22.623 90.110  1.00 22.35 ? 6   THR B N     1 
ATOM   2174 C  CA    . THR B 1 8   ? 14.421  24.076 90.054  1.00 26.98 ? 6   THR B CA    1 
ATOM   2175 C  C     . THR B 1 8   ? 14.691  24.425 88.601  1.00 27.18 ? 6   THR B C     1 
ATOM   2176 O  O     . THR B 1 8   ? 15.749  24.092 88.069  1.00 30.96 ? 6   THR B O     1 
ATOM   2177 C  CB    . THR B 1 8   ? 15.533  24.682 90.941  1.00 27.08 ? 6   THR B CB    1 
ATOM   2178 O  OG1   . THR B 1 8   ? 16.795  24.116 90.571  1.00 31.51 ? 6   THR B OG1   1 
ATOM   2179 C  CG2   . THR B 1 8   ? 15.270  24.388 92.407  1.00 27.78 ? 6   THR B CG2   1 
ATOM   2180 N  N     . GLY B 1 9   ? 13.728  25.072 87.951  1.00 26.74 ? 7   GLY B N     1 
ATOM   2181 C  CA    . GLY B 1 9   ? 13.905  25.429 86.556  1.00 23.45 ? 7   GLY B CA    1 
ATOM   2182 C  C     . GLY B 1 9   ? 12.840  26.388 86.075  1.00 24.51 ? 7   GLY B C     1 
ATOM   2183 O  O     . GLY B 1 9   ? 12.295  27.159 86.865  1.00 21.79 ? 7   GLY B O     1 
ATOM   2184 N  N     . ASN B 1 10  ? 12.543  26.349 84.781  1.00 23.41 ? 8   ASN B N     1 
ATOM   2185 C  CA    . ASN B 1 10  ? 11.540  27.246 84.228  1.00 23.85 ? 8   ASN B CA    1 
ATOM   2186 C  C     . ASN B 1 10  ? 10.296  26.492 83.759  1.00 24.27 ? 8   ASN B C     1 
ATOM   2187 O  O     . ASN B 1 10  ? 10.260  25.260 83.732  1.00 24.20 ? 8   ASN B O     1 
ATOM   2188 C  CB    . ASN B 1 10  ? 12.143  28.056 83.068  1.00 25.19 ? 8   ASN B CB    1 
ATOM   2189 C  CG    . ASN B 1 10  ? 12.599  27.176 81.901  1.00 27.21 ? 8   ASN B CG    1 
ATOM   2190 O  OD1   . ASN B 1 10  ? 12.631  25.952 82.006  1.00 28.71 ? 8   ASN B OD1   1 
ATOM   2191 N  ND2   . ASN B 1 10  ? 12.952  27.805 80.787  1.00 26.61 ? 8   ASN B ND2   1 
ATOM   2192 N  N     . ILE B 1 11  ? 9.252   27.247 83.448  1.00 23.79 ? 9   ILE B N     1 
ATOM   2193 C  CA    . ILE B 1 11  ? 8.024   26.672 82.944  1.00 23.42 ? 9   ILE B CA    1 
ATOM   2194 C  C     . ILE B 1 11  ? 7.521   27.731 81.980  1.00 25.20 ? 9   ILE B C     1 
ATOM   2195 O  O     . ILE B 1 11  ? 7.615   28.932 82.253  1.00 23.71 ? 9   ILE B O     1 
ATOM   2196 C  CB    . ILE B 1 11  ? 6.994   26.379 84.058  1.00 23.97 ? 9   ILE B CB    1 
ATOM   2197 C  CG1   . ILE B 1 11  ? 5.773   25.696 83.435  1.00 23.54 ? 9   ILE B CG1   1 
ATOM   2198 C  CG2   . ILE B 1 11  ? 6.612   27.664 84.807  1.00 24.85 ? 9   ILE B CG2   1 
ATOM   2199 C  CD1   . ILE B 1 11  ? 4.853   25.015 84.438  1.00 22.40 ? 9   ILE B CD1   1 
ATOM   2200 N  N     . THR B 1 12  ? 7.027   27.290 80.832  1.00 23.41 ? 10  THR B N     1 
ATOM   2201 C  CA    . THR B 1 12  ? 6.576   28.235 79.821  1.00 26.40 ? 10  THR B CA    1 
ATOM   2202 C  C     . THR B 1 12  ? 5.307   27.783 79.122  1.00 26.13 ? 10  THR B C     1 
ATOM   2203 O  O     . THR B 1 12  ? 4.734   26.738 79.428  1.00 25.85 ? 10  THR B O     1 
ATOM   2204 C  CB    . THR B 1 12  ? 7.639   28.387 78.705  1.00 27.25 ? 10  THR B CB    1 
ATOM   2205 O  OG1   . THR B 1 12  ? 7.543   27.261 77.820  1.00 28.66 ? 10  THR B OG1   1 
ATOM   2206 C  CG2   . THR B 1 12  ? 9.055   28.415 79.281  1.00 27.75 ? 10  THR B CG2   1 
ATOM   2207 N  N     . VAL B 1 13  ? 4.876   28.617 78.185  1.00 27.21 ? 11  VAL B N     1 
ATOM   2208 C  CA    . VAL B 1 13  ? 3.752   28.324 77.321  1.00 26.95 ? 11  VAL B CA    1 
ATOM   2209 C  C     . VAL B 1 13  ? 4.442   28.343 75.966  1.00 26.75 ? 11  VAL B C     1 
ATOM   2210 O  O     . VAL B 1 13  ? 5.006   29.368 75.566  1.00 25.39 ? 11  VAL B O     1 
ATOM   2211 C  CB    . VAL B 1 13  ? 2.658   29.423 77.333  1.00 27.70 ? 11  VAL B CB    1 
ATOM   2212 C  CG1   . VAL B 1 13  ? 1.758   29.263 76.108  1.00 29.31 ? 11  VAL B CG1   1 
ATOM   2213 C  CG2   . VAL B 1 13  ? 1.813   29.311 78.591  1.00 27.49 ? 11  VAL B CG2   1 
ATOM   2214 N  N     . ASP B 1 14  ? 4.463   27.201 75.289  1.00 26.31 ? 12  ASP B N     1 
ATOM   2215 C  CA    . ASP B 1 14  ? 5.074   27.135 73.966  1.00 26.75 ? 12  ASP B CA    1 
ATOM   2216 C  C     . ASP B 1 14  ? 3.925   27.327 72.987  1.00 27.74 ? 12  ASP B C     1 
ATOM   2217 O  O     . ASP B 1 14  ? 3.025   26.484 72.913  1.00 27.47 ? 12  ASP B O     1 
ATOM   2218 C  CB    . ASP B 1 14  ? 5.744   25.773 73.725  1.00 27.33 ? 12  ASP B CB    1 
ATOM   2219 C  CG    . ASP B 1 14  ? 7.053   25.604 74.500  1.00 30.71 ? 12  ASP B CG    1 
ATOM   2220 O  OD1   . ASP B 1 14  ? 7.549   26.596 75.085  1.00 27.03 ? 12  ASP B OD1   1 
ATOM   2221 O  OD2   . ASP B 1 14  ? 7.590   24.471 74.510  1.00 28.77 ? 12  ASP B OD2   1 
ATOM   2222 N  N     . GLU B 1 15  ? 3.951   28.439 72.256  1.00 28.51 ? 13  GLU B N     1 
ATOM   2223 C  CA    . GLU B 1 15  ? 2.898   28.762 71.292  1.00 29.66 ? 13  GLU B CA    1 
ATOM   2224 C  C     . GLU B 1 15  ? 3.298   28.481 69.851  1.00 28.27 ? 13  GLU B C     1 
ATOM   2225 O  O     . GLU B 1 15  ? 4.283   29.019 69.355  1.00 28.94 ? 13  GLU B O     1 
ATOM   2226 C  CB    . GLU B 1 15  ? 2.502   30.236 71.412  1.00 30.45 ? 13  GLU B CB    1 
ATOM   2227 C  CG    . GLU B 1 15  ? 1.764   30.580 72.688  1.00 35.36 ? 13  GLU B CG    1 
ATOM   2228 C  CD    . GLU B 1 15  ? 1.369   32.042 72.738  1.00 39.00 ? 13  GLU B CD    1 
ATOM   2229 O  OE1   . GLU B 1 15  ? 0.781   32.538 71.748  1.00 40.63 ? 13  GLU B OE1   1 
ATOM   2230 O  OE2   . GLU B 1 15  ? 1.642   32.692 73.767  1.00 39.97 ? 13  GLU B OE2   1 
ATOM   2231 N  N     . THR B 1 16  ? 2.516   27.639 69.186  1.00 30.15 ? 14  THR B N     1 
ATOM   2232 C  CA    . THR B 1 16  ? 2.774   27.283 67.799  1.00 31.91 ? 14  THR B CA    1 
ATOM   2233 C  C     . THR B 1 16  ? 1.894   28.094 66.858  1.00 31.02 ? 14  THR B C     1 
ATOM   2234 O  O     . THR B 1 16  ? 0.674   27.997 66.910  1.00 31.32 ? 14  THR B O     1 
ATOM   2235 C  CB    . THR B 1 16  ? 2.504   25.787 67.554  1.00 33.11 ? 14  THR B CB    1 
ATOM   2236 O  OG1   . THR B 1 16  ? 3.481   25.009 68.256  1.00 34.82 ? 14  THR B OG1   1 
ATOM   2237 C  CG2   . THR B 1 16  ? 2.573   25.464 66.065  1.00 34.76 ? 14  THR B CG2   1 
ATOM   2238 N  N     . TRP B 1 17  ? 2.530   28.895 66.012  1.00 33.68 ? 15  TRP B N     1 
ATOM   2239 C  CA    . TRP B 1 17  ? 1.825   29.717 65.035  1.00 37.45 ? 15  TRP B CA    1 
ATOM   2240 C  C     . TRP B 1 17  ? 2.150   29.241 63.628  1.00 38.56 ? 15  TRP B C     1 
ATOM   2241 O  O     . TRP B 1 17  ? 3.231   28.709 63.379  1.00 39.65 ? 15  TRP B O     1 
ATOM   2242 C  CB    . TRP B 1 17  ? 2.243   31.184 65.166  1.00 37.79 ? 15  TRP B CB    1 
ATOM   2243 C  CG    . TRP B 1 17  ? 1.772   31.833 66.420  1.00 40.73 ? 15  TRP B CG    1 
ATOM   2244 C  CD1   . TRP B 1 17  ? 2.043   31.441 67.700  1.00 41.66 ? 15  TRP B CD1   1 
ATOM   2245 C  CD2   . TRP B 1 17  ? 0.929   32.986 66.521  1.00 41.95 ? 15  TRP B CD2   1 
ATOM   2246 N  NE1   . TRP B 1 17  ? 1.418   32.280 68.595  1.00 42.92 ? 15  TRP B NE1   1 
ATOM   2247 C  CE2   . TRP B 1 17  ? 0.728   33.236 67.897  1.00 42.19 ? 15  TRP B CE2   1 
ATOM   2248 C  CE3   . TRP B 1 17  ? 0.325   33.833 65.582  1.00 41.02 ? 15  TRP B CE3   1 
ATOM   2249 C  CZ2   . TRP B 1 17  ? -0.055  34.298 68.358  1.00 42.28 ? 15  TRP B CZ2   1 
ATOM   2250 C  CZ3   . TRP B 1 17  ? -0.453  34.890 66.040  1.00 42.01 ? 15  TRP B CZ3   1 
ATOM   2251 C  CH2   . TRP B 1 17  ? -0.636  35.112 67.417  1.00 42.33 ? 15  TRP B CH2   1 
ATOM   2252 N  N     . SER B 1 18  ? 1.208   29.429 62.713  1.00 40.02 ? 16  SER B N     1 
ATOM   2253 C  CA    . SER B 1 18  ? 1.405   29.049 61.322  1.00 40.97 ? 16  SER B CA    1 
ATOM   2254 C  C     . SER B 1 18  ? 1.292   30.305 60.476  1.00 41.70 ? 16  SER B C     1 
ATOM   2255 O  O     . SER B 1 18  ? 0.315   31.043 60.589  1.00 41.11 ? 16  SER B O     1 
ATOM   2256 C  CB    . SER B 1 18  ? 0.339   28.045 60.885  1.00 42.53 ? 16  SER B CB    1 
ATOM   2257 O  OG    . SER B 1 18  ? 0.434   27.794 59.494  1.00 45.12 ? 16  SER B OG    1 
ATOM   2258 N  N     . ILE B 1 19  ? 2.295   30.558 59.645  1.00 42.70 ? 17  ILE B N     1 
ATOM   2259 C  CA    . ILE B 1 19  ? 2.287   31.730 58.781  1.00 45.80 ? 17  ILE B CA    1 
ATOM   2260 C  C     . ILE B 1 19  ? 2.945   31.407 57.443  1.00 47.79 ? 17  ILE B C     1 
ATOM   2261 O  O     . ILE B 1 19  ? 3.736   30.472 57.345  1.00 47.32 ? 17  ILE B O     1 
ATOM   2262 C  CB    . ILE B 1 19  ? 3.054   32.917 59.413  1.00 44.63 ? 17  ILE B CB    1 
ATOM   2263 C  CG1   . ILE B 1 19  ? 4.542   32.576 59.525  1.00 44.45 ? 17  ILE B CG1   1 
ATOM   2264 C  CG2   . ILE B 1 19  ? 2.474   33.241 60.788  1.00 44.51 ? 17  ILE B CG2   1 
ATOM   2265 C  CD1   . ILE B 1 19  ? 5.412   33.757 59.902  1.00 43.82 ? 17  ILE B CD1   1 
ATOM   2266 N  N     . PRO B 1 20  ? 2.616   32.176 56.393  1.00 50.17 ? 18  PRO B N     1 
ATOM   2267 C  CA    . PRO B 1 20  ? 3.195   31.955 55.065  1.00 52.28 ? 18  PRO B CA    1 
ATOM   2268 C  C     . PRO B 1 20  ? 4.711   31.993 55.181  1.00 54.72 ? 18  PRO B C     1 
ATOM   2269 O  O     . PRO B 1 20  ? 5.413   31.118 54.674  1.00 55.64 ? 18  PRO B O     1 
ATOM   2270 C  CB    . PRO B 1 20  ? 2.650   33.125 54.257  1.00 52.46 ? 18  PRO B CB    1 
ATOM   2271 C  CG    . PRO B 1 20  ? 1.307   33.346 54.871  1.00 52.06 ? 18  PRO B CG    1 
ATOM   2272 C  CD    . PRO B 1 20  ? 1.611   33.252 56.352  1.00 51.17 ? 18  PRO B CD    1 
ATOM   2273 N  N     . ASP B 1 21  ? 5.203   33.024 55.857  1.00 56.20 ? 19  ASP B N     1 
ATOM   2274 C  CA    . ASP B 1 21  ? 6.630   33.181 56.085  1.00 58.44 ? 19  ASP B CA    1 
ATOM   2275 C  C     . ASP B 1 21  ? 6.890   34.409 56.949  1.00 58.49 ? 19  ASP B C     1 
ATOM   2276 O  O     . ASP B 1 21  ? 6.062   35.317 57.021  1.00 57.72 ? 19  ASP B O     1 
ATOM   2277 C  CB    . ASP B 1 21  ? 7.392   33.263 54.752  1.00 60.46 ? 19  ASP B CB    1 
ATOM   2278 C  CG    . ASP B 1 21  ? 7.346   34.633 54.131  1.00 62.39 ? 19  ASP B CG    1 
ATOM   2279 O  OD1   . ASP B 1 21  ? 6.252   35.231 54.090  1.00 64.88 ? 19  ASP B OD1   1 
ATOM   2280 O  OD2   . ASP B 1 21  ? 8.408   35.104 53.670  1.00 63.97 ? 19  ASP B OD2   1 
ATOM   2281 N  N     . ILE B 1 22  ? 8.034   34.417 57.623  1.00 59.09 ? 20  ILE B N     1 
ATOM   2282 C  CA    . ILE B 1 22  ? 8.406   35.516 58.505  1.00 59.42 ? 20  ILE B CA    1 
ATOM   2283 C  C     . ILE B 1 22  ? 8.250   36.875 57.827  1.00 59.11 ? 20  ILE B C     1 
ATOM   2284 O  O     . ILE B 1 22  ? 8.802   37.115 56.755  1.00 59.28 ? 20  ILE B O     1 
ATOM   2285 C  CB    . ILE B 1 22  ? 9.861   35.361 58.985  1.00 59.65 ? 20  ILE B CB    1 
ATOM   2286 C  CG1   . ILE B 1 22  ? 10.055  33.980 59.615  1.00 60.24 ? 20  ILE B CG1   1 
ATOM   2287 C  CG2   . ILE B 1 22  ? 10.188  36.441 59.994  1.00 59.56 ? 20  ILE B CG2   1 
ATOM   2288 C  CD1   . ILE B 1 22  ? 11.485  33.685 60.023  1.00 61.56 ? 20  ILE B CD1   1 
ATOM   2289 N  N     . PRO B 1 23  ? 7.488   37.785 58.452  1.00 58.93 ? 21  PRO B N     1 
ATOM   2290 C  CA    . PRO B 1 23  ? 7.264   39.121 57.900  1.00 58.88 ? 21  PRO B CA    1 
ATOM   2291 C  C     . PRO B 1 23  ? 8.484   40.018 58.048  1.00 59.04 ? 21  PRO B C     1 
ATOM   2292 O  O     . PRO B 1 23  ? 9.263   39.868 58.986  1.00 59.22 ? 21  PRO B O     1 
ATOM   2293 C  CB    . PRO B 1 23  ? 6.080   39.626 58.713  1.00 58.63 ? 21  PRO B CB    1 
ATOM   2294 C  CG    . PRO B 1 23  ? 6.345   39.025 60.055  1.00 58.91 ? 21  PRO B CG    1 
ATOM   2295 C  CD    . PRO B 1 23  ? 6.733   37.605 59.705  1.00 58.67 ? 21  PRO B CD    1 
ATOM   2296 N  N     . LYS B 1 24  ? 8.648   40.945 57.111  1.00 59.16 ? 22  LYS B N     1 
ATOM   2297 C  CA    . LYS B 1 24  ? 9.765   41.881 57.153  1.00 59.40 ? 22  LYS B CA    1 
ATOM   2298 C  C     . LYS B 1 24  ? 9.376   43.041 58.054  1.00 58.23 ? 22  LYS B C     1 
ATOM   2299 O  O     . LYS B 1 24  ? 8.205   43.193 58.399  1.00 58.02 ? 22  LYS B O     1 
ATOM   2300 C  CB    . LYS B 1 24  ? 10.072  42.417 55.752  1.00 60.85 ? 22  LYS B CB    1 
ATOM   2301 C  CG    . LYS B 1 24  ? 10.597  41.379 54.779  1.00 62.34 ? 22  LYS B CG    1 
ATOM   2302 C  CD    . LYS B 1 24  ? 10.983  42.023 53.457  1.00 63.15 ? 22  LYS B CD    1 
ATOM   2303 C  CE    . LYS B 1 24  ? 11.680  41.027 52.550  1.00 63.56 ? 22  LYS B CE    1 
ATOM   2304 N  NZ    . LYS B 1 24  ? 12.896  40.462 53.203  1.00 64.19 ? 22  LYS B NZ    1 
ATOM   2305 N  N     . LYS B 1 25  ? 10.352  43.856 58.437  1.00 56.84 ? 23  LYS B N     1 
ATOM   2306 C  CA    . LYS B 1 25  ? 10.062  45.005 59.281  1.00 55.91 ? 23  LYS B CA    1 
ATOM   2307 C  C     . LYS B 1 25  ? 9.064   45.876 58.535  1.00 54.42 ? 23  LYS B C     1 
ATOM   2308 O  O     . LYS B 1 25  ? 9.140   46.008 57.315  1.00 54.13 ? 23  LYS B O     1 
ATOM   2309 C  CB    . LYS B 1 25  ? 11.335  45.806 59.563  1.00 56.64 ? 23  LYS B CB    1 
ATOM   2310 C  CG    . LYS B 1 25  ? 12.385  45.060 60.370  1.00 57.13 ? 23  LYS B CG    1 
ATOM   2311 C  CD    . LYS B 1 25  ? 13.514  45.996 60.770  1.00 58.24 ? 23  LYS B CD    1 
ATOM   2312 C  CE    . LYS B 1 25  ? 14.575  45.281 61.591  1.00 58.08 ? 23  LYS B CE    1 
ATOM   2313 N  NZ    . LYS B 1 25  ? 15.638  46.226 62.036  1.00 58.45 ? 23  LYS B NZ    1 
ATOM   2314 N  N     . GLY B 1 26  ? 8.124   46.459 59.268  1.00 53.21 ? 24  GLY B N     1 
ATOM   2315 C  CA    . GLY B 1 26  ? 7.125   47.304 58.640  1.00 51.55 ? 24  GLY B CA    1 
ATOM   2316 C  C     . GLY B 1 26  ? 5.986   46.500 58.045  1.00 50.06 ? 24  GLY B C     1 
ATOM   2317 O  O     . GLY B 1 26  ? 4.915   47.042 57.771  1.00 50.70 ? 24  GLY B O     1 
ATOM   2318 N  N     . ALA B 1 27  ? 6.212   45.205 57.846  1.00 48.52 ? 25  ALA B N     1 
ATOM   2319 C  CA    . ALA B 1 27  ? 5.190   44.339 57.278  1.00 46.14 ? 25  ALA B CA    1 
ATOM   2320 C  C     . ALA B 1 27  ? 4.186   43.902 58.336  1.00 45.84 ? 25  ALA B C     1 
ATOM   2321 O  O     . ALA B 1 27  ? 4.514   43.787 59.516  1.00 45.75 ? 25  ALA B O     1 
ATOM   2322 C  CB    . ALA B 1 27  ? 5.833   43.116 56.635  1.00 46.60 ? 25  ALA B CB    1 
ATOM   2323 N  N     . SER B 1 28  ? 2.957   43.664 57.895  1.00 43.24 ? 26  SER B N     1 
ATOM   2324 C  CA    . SER B 1 28  ? 1.878   43.228 58.770  1.00 41.87 ? 26  SER B CA    1 
ATOM   2325 C  C     . SER B 1 28  ? 1.146   42.119 58.029  1.00 40.44 ? 26  SER B C     1 
ATOM   2326 O  O     . SER B 1 28  ? 0.648   42.335 56.922  1.00 38.30 ? 26  SER B O     1 
ATOM   2327 C  CB    . SER B 1 28  ? 0.925   44.390 59.051  1.00 43.03 ? 26  SER B CB    1 
ATOM   2328 O  OG    . SER B 1 28  ? -0.124  43.986 59.911  1.00 46.37 ? 26  SER B OG    1 
ATOM   2329 N  N     . ILE B 1 29  ? 1.075   40.940 58.639  1.00 38.33 ? 27  ILE B N     1 
ATOM   2330 C  CA    . ILE B 1 29  ? 0.436   39.798 58.000  1.00 38.45 ? 27  ILE B CA    1 
ATOM   2331 C  C     . ILE B 1 29  ? -0.506  39.032 58.920  1.00 38.08 ? 27  ILE B C     1 
ATOM   2332 O  O     . ILE B 1 29  ? -0.563  39.294 60.118  1.00 37.02 ? 27  ILE B O     1 
ATOM   2333 C  CB    . ILE B 1 29  ? 1.513   38.832 57.452  1.00 38.81 ? 27  ILE B CB    1 
ATOM   2334 C  CG1   . ILE B 1 29  ? 2.439   38.365 58.577  1.00 39.81 ? 27  ILE B CG1   1 
ATOM   2335 C  CG2   . ILE B 1 29  ? 2.356   39.541 56.412  1.00 39.76 ? 27  ILE B CG2   1 
ATOM   2336 C  CD1   . ILE B 1 29  ? 1.885   37.238 59.415  1.00 43.00 ? 27  ILE B CD1   1 
ATOM   2337 N  N     . HIS B 1 30  ? -1.259  38.094 58.353  1.00 36.78 ? 28  HIS B N     1 
ATOM   2338 C  CA    . HIS B 1 30  ? -2.172  37.287 59.153  1.00 37.99 ? 28  HIS B CA    1 
ATOM   2339 C  C     . HIS B 1 30  ? -1.503  35.958 59.462  1.00 38.93 ? 28  HIS B C     1 
ATOM   2340 O  O     . HIS B 1 30  ? -0.644  35.499 58.711  1.00 39.18 ? 28  HIS B O     1 
ATOM   2341 C  CB    . HIS B 1 30  ? -3.494  37.028 58.419  1.00 39.57 ? 28  HIS B CB    1 
ATOM   2342 C  CG    . HIS B 1 30  ? -4.340  38.251 58.241  1.00 40.34 ? 28  HIS B CG    1 
ATOM   2343 N  ND1   . HIS B 1 30  ? -4.530  38.853 57.016  1.00 41.00 ? 28  HIS B ND1   1 
ATOM   2344 C  CD2   . HIS B 1 30  ? -5.049  38.983 59.133  1.00 40.71 ? 28  HIS B CD2   1 
ATOM   2345 C  CE1   . HIS B 1 30  ? -5.320  39.902 57.160  1.00 40.65 ? 28  HIS B CE1   1 
ATOM   2346 N  NE2   . HIS B 1 30  ? -5.649  40.003 58.435  1.00 40.56 ? 28  HIS B NE2   1 
ATOM   2347 N  N     . GLY B 1 31  ? -1.901  35.348 60.572  1.00 38.11 ? 29  GLY B N     1 
ATOM   2348 C  CA    . GLY B 1 31  ? -1.329  34.076 60.961  1.00 37.40 ? 29  GLY B CA    1 
ATOM   2349 C  C     . GLY B 1 31  ? -2.353  33.234 61.684  1.00 36.80 ? 29  GLY B C     1 
ATOM   2350 O  O     . GLY B 1 31  ? -3.469  33.687 61.945  1.00 35.41 ? 29  GLY B O     1 
ATOM   2351 N  N     . VAL B 1 32  ? -1.977  32.002 62.005  1.00 36.85 ? 30  VAL B N     1 
ATOM   2352 C  CA    . VAL B 1 32  ? -2.871  31.095 62.703  1.00 37.73 ? 30  VAL B CA    1 
ATOM   2353 C  C     . VAL B 1 32  ? -2.204  30.546 63.951  1.00 38.82 ? 30  VAL B C     1 
ATOM   2354 O  O     . VAL B 1 32  ? -1.151  29.919 63.874  1.00 38.49 ? 30  VAL B O     1 
ATOM   2355 C  CB    . VAL B 1 32  ? -3.283  29.898 61.813  1.00 38.66 ? 30  VAL B CB    1 
ATOM   2356 C  CG1   . VAL B 1 32  ? -4.157  28.939 62.610  1.00 37.64 ? 30  VAL B CG1   1 
ATOM   2357 C  CG2   . VAL B 1 32  ? -4.027  30.395 60.582  1.00 39.73 ? 30  VAL B CG2   1 
ATOM   2358 N  N     . LYS B 1 33  ? -2.820  30.797 65.100  1.00 40.19 ? 31  LYS B N     1 
ATOM   2359 C  CA    . LYS B 1 33  ? -2.291  30.305 66.359  1.00 41.58 ? 31  LYS B CA    1 
ATOM   2360 C  C     . LYS B 1 33  ? -2.708  28.849 66.448  1.00 41.50 ? 31  LYS B C     1 
ATOM   2361 O  O     . LYS B 1 33  ? -3.770  28.527 66.982  1.00 42.69 ? 31  LYS B O     1 
ATOM   2362 C  CB    . LYS B 1 33  ? -2.871  31.092 67.529  1.00 42.97 ? 31  LYS B CB    1 
ATOM   2363 C  CG    . LYS B 1 33  ? -2.303  30.682 68.872  1.00 44.18 ? 31  LYS B CG    1 
ATOM   2364 C  CD    . LYS B 1 33  ? -2.699  31.663 69.954  1.00 46.59 ? 31  LYS B CD    1 
ATOM   2365 C  CE    . LYS B 1 33  ? -1.951  31.376 71.241  1.00 46.66 ? 31  LYS B CE    1 
ATOM   2366 N  NZ    . LYS B 1 33  ? -2.220  32.413 72.273  1.00 48.26 ? 31  LYS B NZ    1 
ATOM   2367 N  N     . VAL B 1 34  ? -1.866  27.977 65.908  1.00 41.45 ? 32  VAL B N     1 
ATOM   2368 C  CA    . VAL B 1 34  ? -2.142  26.550 65.885  1.00 41.79 ? 32  VAL B CA    1 
ATOM   2369 C  C     . VAL B 1 34  ? -2.465  25.948 67.245  1.00 41.33 ? 32  VAL B C     1 
ATOM   2370 O  O     . VAL B 1 34  ? -3.590  25.502 67.479  1.00 42.01 ? 32  VAL B O     1 
ATOM   2371 C  CB    . VAL B 1 34  ? -0.960  25.774 65.274  1.00 42.73 ? 32  VAL B CB    1 
ATOM   2372 C  CG1   . VAL B 1 34  ? -1.308  24.298 65.163  1.00 44.37 ? 32  VAL B CG1   1 
ATOM   2373 C  CG2   . VAL B 1 34  ? -0.619  26.346 63.914  1.00 43.54 ? 32  VAL B CG2   1 
ATOM   2374 N  N     . SER B 1 35  ? -1.491  25.942 68.149  1.00 40.06 ? 33  SER B N     1 
ATOM   2375 C  CA    . SER B 1 35  ? -1.716  25.346 69.459  1.00 39.26 ? 33  SER B CA    1 
ATOM   2376 C  C     . SER B 1 35  ? -0.911  25.964 70.594  1.00 37.01 ? 33  SER B C     1 
ATOM   2377 O  O     . SER B 1 35  ? -0.076  26.841 70.385  1.00 36.46 ? 33  SER B O     1 
ATOM   2378 C  CB    . SER B 1 35  ? -1.397  23.855 69.396  1.00 40.27 ? 33  SER B CB    1 
ATOM   2379 O  OG    . SER B 1 35  ? -0.035  23.668 69.049  1.00 40.43 ? 33  SER B OG    1 
ATOM   2380 N  N     . GLN B 1 36  ? -1.172  25.471 71.798  1.00 35.94 ? 34  GLN B N     1 
ATOM   2381 C  CA    . GLN B 1 36  ? -0.499  25.947 72.999  1.00 36.95 ? 34  GLN B CA    1 
ATOM   2382 C  C     . GLN B 1 36  ? -0.198  24.767 73.911  1.00 34.52 ? 34  GLN B C     1 
ATOM   2383 O  O     . GLN B 1 36  ? -1.026  23.869 74.075  1.00 35.58 ? 34  GLN B O     1 
ATOM   2384 C  CB    . GLN B 1 36  ? -1.396  26.942 73.732  1.00 38.94 ? 34  GLN B CB    1 
ATOM   2385 C  CG    . GLN B 1 36  ? -0.707  28.225 74.105  1.00 43.95 ? 34  GLN B CG    1 
ATOM   2386 C  CD    . GLN B 1 36  ? -1.664  29.244 74.684  1.00 46.57 ? 34  GLN B CD    1 
ATOM   2387 O  OE1   . GLN B 1 36  ? -2.282  29.019 75.725  1.00 47.73 ? 34  GLN B OE1   1 
ATOM   2388 N  NE2   . GLN B 1 36  ? -1.795  30.375 74.006  1.00 48.72 ? 34  GLN B NE2   1 
ATOM   2389 N  N     . ASP B 1 37  ? 0.987   24.777 74.511  1.00 32.30 ? 35  ASP B N     1 
ATOM   2390 C  CA    . ASP B 1 37  ? 1.405   23.704 75.406  1.00 30.92 ? 35  ASP B CA    1 
ATOM   2391 C  C     . ASP B 1 37  ? 2.277   24.233 76.528  1.00 29.27 ? 35  ASP B C     1 
ATOM   2392 O  O     . ASP B 1 37  ? 2.895   25.288 76.403  1.00 28.60 ? 35  ASP B O     1 
ATOM   2393 C  CB    . ASP B 1 37  ? 2.232   22.662 74.646  1.00 33.39 ? 35  ASP B CB    1 
ATOM   2394 C  CG    . ASP B 1 37  ? 1.454   21.402 74.330  1.00 36.64 ? 35  ASP B CG    1 
ATOM   2395 O  OD1   . ASP B 1 37  ? 0.356   21.210 74.891  1.00 40.94 ? 35  ASP B OD1   1 
ATOM   2396 O  OD2   . ASP B 1 37  ? 1.960   20.594 73.524  1.00 36.84 ? 35  ASP B OD2   1 
ATOM   2397 N  N     . ILE B 1 38  ? 2.318   23.489 77.625  1.00 28.10 ? 36  ILE B N     1 
ATOM   2398 C  CA    . ILE B 1 38  ? 3.183   23.849 78.733  1.00 28.28 ? 36  ILE B CA    1 
ATOM   2399 C  C     . ILE B 1 38  ? 4.551   23.407 78.228  1.00 26.25 ? 36  ILE B C     1 
ATOM   2400 O  O     . ILE B 1 38  ? 4.671   22.338 77.622  1.00 25.77 ? 36  ILE B O     1 
ATOM   2401 C  CB    . ILE B 1 38  ? 2.834   23.057 80.014  1.00 30.32 ? 36  ILE B CB    1 
ATOM   2402 C  CG1   . ILE B 1 38  ? 1.634   23.700 80.713  1.00 31.66 ? 36  ILE B CG1   1 
ATOM   2403 C  CG2   . ILE B 1 38  ? 4.043   22.996 80.944  1.00 30.32 ? 36  ILE B CG2   1 
ATOM   2404 C  CD1   . ILE B 1 38  ? 1.239   23.018 82.006  1.00 34.07 ? 36  ILE B CD1   1 
ATOM   2405 N  N     . GLY B 1 39  ? 5.563   24.240 78.446  1.00 24.90 ? 37  GLY B N     1 
ATOM   2406 C  CA    . GLY B 1 39  ? 6.909   23.921 78.009  1.00 22.19 ? 37  GLY B CA    1 
ATOM   2407 C  C     . GLY B 1 39  ? 7.935   24.314 79.061  1.00 21.89 ? 37  GLY B C     1 
ATOM   2408 O  O     . GLY B 1 39  ? 7.578   24.589 80.210  1.00 21.02 ? 37  GLY B O     1 
ATOM   2409 N  N     . GLY B 1 40  ? 9.202   24.359 78.663  1.00 21.85 ? 38  GLY B N     1 
ATOM   2410 C  CA    . GLY B 1 40  ? 10.266  24.702 79.589  1.00 21.96 ? 38  GLY B CA    1 
ATOM   2411 C  C     . GLY B 1 40  ? 10.945  23.429 80.049  1.00 21.83 ? 38  GLY B C     1 
ATOM   2412 O  O     . GLY B 1 40  ? 10.272  22.480 80.475  1.00 22.54 ? 38  GLY B O     1 
ATOM   2413 N  N     . LYS B 1 41  ? 12.272  23.396 79.968  1.00 23.32 ? 39  LYS B N     1 
ATOM   2414 C  CA    . LYS B 1 41  ? 13.018  22.206 80.362  1.00 22.51 ? 39  LYS B CA    1 
ATOM   2415 C  C     . LYS B 1 41  ? 12.704  21.765 81.787  1.00 23.29 ? 39  LYS B C     1 
ATOM   2416 O  O     . LYS B 1 41  ? 12.551  20.571 82.054  1.00 22.05 ? 39  LYS B O     1 
ATOM   2417 C  CB    . LYS B 1 41  ? 14.524  22.441 80.191  1.00 23.38 ? 39  LYS B CB    1 
ATOM   2418 C  CG    . LYS B 1 41  ? 14.936  22.700 78.740  1.00 25.25 ? 39  LYS B CG    1 
ATOM   2419 C  CD    . LYS B 1 41  ? 16.448  22.699 78.546  1.00 27.40 ? 39  LYS B CD    1 
ATOM   2420 C  CE    . LYS B 1 41  ? 17.029  21.286 78.594  1.00 32.76 ? 39  LYS B CE    1 
ATOM   2421 N  NZ    . LYS B 1 41  ? 16.563  20.424 77.456  1.00 35.24 ? 39  LYS B NZ    1 
ATOM   2422 N  N     . GLY B 1 42  ? 12.600  22.723 82.704  1.00 20.01 ? 40  GLY B N     1 
ATOM   2423 C  CA    . GLY B 1 42  ? 12.295  22.372 84.078  1.00 20.39 ? 40  GLY B CA    1 
ATOM   2424 C  C     . GLY B 1 42  ? 10.952  21.671 84.188  1.00 19.95 ? 40  GLY B C     1 
ATOM   2425 O  O     . GLY B 1 42  ? 10.847  20.578 84.751  1.00 17.91 ? 40  GLY B O     1 
ATOM   2426 N  N     . ALA B 1 43  ? 9.918   22.304 83.644  1.00 19.24 ? 41  ALA B N     1 
ATOM   2427 C  CA    . ALA B 1 43  ? 8.580   21.742 83.682  1.00 18.24 ? 41  ALA B CA    1 
ATOM   2428 C  C     . ALA B 1 43  ? 8.523   20.417 82.937  1.00 17.08 ? 41  ALA B C     1 
ATOM   2429 O  O     . ALA B 1 43  ? 7.966   19.444 83.441  1.00 19.87 ? 41  ALA B O     1 
ATOM   2430 C  CB    . ALA B 1 43  ? 7.584   22.716 83.074  1.00 19.83 ? 41  ALA B CB    1 
ATOM   2431 N  N     . ASN B 1 44  ? 9.086   20.380 81.736  1.00 18.56 ? 42  ASN B N     1 
ATOM   2432 C  CA    . ASN B 1 44  ? 9.071   19.147 80.948  1.00 18.86 ? 42  ASN B CA    1 
ATOM   2433 C  C     . ASN B 1 44  ? 9.643   17.980 81.748  1.00 19.58 ? 42  ASN B C     1 
ATOM   2434 O  O     . ASN B 1 44  ? 9.018   16.924 81.875  1.00 20.60 ? 42  ASN B O     1 
ATOM   2435 C  CB    . ASN B 1 44  ? 9.880   19.313 79.657  1.00 17.73 ? 42  ASN B CB    1 
ATOM   2436 C  CG    . ASN B 1 44  ? 9.251   20.307 78.688  1.00 19.49 ? 42  ASN B CG    1 
ATOM   2437 O  OD1   . ASN B 1 44  ? 8.119   20.741 78.878  1.00 21.54 ? 42  ASN B OD1   1 
ATOM   2438 N  ND2   . ASN B 1 44  ? 9.985   20.657 77.640  1.00 19.66 ? 42  ASN B ND2   1 
ATOM   2439 N  N     . GLN B 1 45  ? 10.837  18.175 82.294  1.00 19.02 ? 43  GLN B N     1 
ATOM   2440 C  CA    . GLN B 1 45  ? 11.477  17.116 83.055  1.00 18.83 ? 43  GLN B CA    1 
ATOM   2441 C  C     . GLN B 1 45  ? 10.709  16.762 84.331  1.00 18.68 ? 43  GLN B C     1 
ATOM   2442 O  O     . GLN B 1 45  ? 10.506  15.589 84.632  1.00 17.61 ? 43  GLN B O     1 
ATOM   2443 C  CB    . GLN B 1 45  ? 12.928  17.510 83.358  1.00 17.84 ? 43  GLN B CB    1 
ATOM   2444 C  CG    . GLN B 1 45  ? 13.738  17.688 82.080  1.00 19.18 ? 43  GLN B CG    1 
ATOM   2445 C  CD    . GLN B 1 45  ? 15.209  18.008 82.307  1.00 18.73 ? 43  GLN B CD    1 
ATOM   2446 O  OE1   . GLN B 1 45  ? 15.726  17.907 83.418  1.00 20.43 ? 43  GLN B OE1   1 
ATOM   2447 N  NE2   . GLN B 1 45  ? 15.894  18.380 81.234  1.00 17.37 ? 43  GLN B NE2   1 
ATOM   2448 N  N     . ALA B 1 46  ? 10.261  17.768 85.072  1.00 17.91 ? 44  ALA B N     1 
ATOM   2449 C  CA    . ALA B 1 46  ? 9.522   17.514 86.302  1.00 19.20 ? 44  ALA B CA    1 
ATOM   2450 C  C     . ALA B 1 46  ? 8.180   16.807 86.058  1.00 20.16 ? 44  ALA B C     1 
ATOM   2451 O  O     . ALA B 1 46  ? 7.818   15.883 86.784  1.00 19.20 ? 44  ALA B O     1 
ATOM   2452 C  CB    . ALA B 1 46  ? 9.301   18.829 87.062  1.00 19.09 ? 44  ALA B CB    1 
ATOM   2453 N  N     . ILE B 1 47  ? 7.439   17.234 85.040  1.00 19.29 ? 45  ILE B N     1 
ATOM   2454 C  CA    . ILE B 1 47  ? 6.150   16.601 84.760  1.00 18.74 ? 45  ILE B CA    1 
ATOM   2455 C  C     . ILE B 1 47  ? 6.305   15.127 84.358  1.00 19.73 ? 45  ILE B C     1 
ATOM   2456 O  O     . ILE B 1 47  ? 5.569   14.264 84.838  1.00 19.21 ? 45  ILE B O     1 
ATOM   2457 C  CB    . ILE B 1 47  ? 5.388   17.381 83.665  1.00 18.99 ? 45  ILE B CB    1 
ATOM   2458 C  CG1   . ILE B 1 47  ? 5.004   18.760 84.210  1.00 20.13 ? 45  ILE B CG1   1 
ATOM   2459 C  CG2   . ILE B 1 47  ? 4.139   16.604 83.232  1.00 20.51 ? 45  ILE B CG2   1 
ATOM   2460 C  CD1   . ILE B 1 47  ? 4.402   19.705 83.190  1.00 23.04 ? 45  ILE B CD1   1 
ATOM   2461 N  N     . ILE B 1 48  ? 7.269   14.839 83.489  1.00 19.42 ? 46  ILE B N     1 
ATOM   2462 C  CA    . ILE B 1 48  ? 7.493   13.463 83.061  1.00 20.81 ? 46  ILE B CA    1 
ATOM   2463 C  C     . ILE B 1 48  ? 7.910   12.621 84.268  1.00 21.21 ? 46  ILE B C     1 
ATOM   2464 O  O     . ILE B 1 48  ? 7.421   11.505 84.452  1.00 21.83 ? 46  ILE B O     1 
ATOM   2465 C  CB    . ILE B 1 48  ? 8.547   13.402 81.935  1.00 21.10 ? 46  ILE B CB    1 
ATOM   2466 C  CG1   . ILE B 1 48  ? 7.997   14.125 80.696  1.00 21.93 ? 46  ILE B CG1   1 
ATOM   2467 C  CG2   . ILE B 1 48  ? 8.862   11.950 81.586  1.00 21.57 ? 46  ILE B CG2   1 
ATOM   2468 C  CD1   . ILE B 1 48  ? 8.977   14.262 79.542  1.00 22.17 ? 46  ILE B CD1   1 
ATOM   2469 N  N     . LEU B 1 49  ? 8.796   13.157 85.104  1.00 21.35 ? 47  LEU B N     1 
ATOM   2470 C  CA    . LEU B 1 49  ? 9.200   12.435 86.311  1.00 22.59 ? 47  LEU B CA    1 
ATOM   2471 C  C     . LEU B 1 49  ? 7.961   12.086 87.135  1.00 22.63 ? 47  LEU B C     1 
ATOM   2472 O  O     . LEU B 1 49  ? 7.796   10.943 87.577  1.00 24.87 ? 47  LEU B O     1 
ATOM   2473 C  CB    . LEU B 1 49  ? 10.145  13.291 87.166  1.00 19.90 ? 47  LEU B CB    1 
ATOM   2474 C  CG    . LEU B 1 49  ? 11.629  13.244 86.824  1.00 21.67 ? 47  LEU B CG    1 
ATOM   2475 C  CD1   . LEU B 1 49  ? 12.336  14.451 87.437  1.00 22.45 ? 47  LEU B CD1   1 
ATOM   2476 C  CD2   . LEU B 1 49  ? 12.230  11.942 87.353  1.00 22.21 ? 47  LEU B CD2   1 
ATOM   2477 N  N     . SER B 1 50  ? 7.082   13.069 87.334  1.00 23.06 ? 48  SER B N     1 
ATOM   2478 C  CA    . SER B 1 50  ? 5.879   12.847 88.129  1.00 25.01 ? 48  SER B CA    1 
ATOM   2479 C  C     . SER B 1 50  ? 4.942   11.812 87.497  1.00 25.47 ? 48  SER B C     1 
ATOM   2480 O  O     . SER B 1 50  ? 4.309   11.022 88.209  1.00 25.06 ? 48  SER B O     1 
ATOM   2481 C  CB    . SER B 1 50  ? 5.130   14.169 88.358  1.00 25.29 ? 48  SER B CB    1 
ATOM   2482 O  OG    . SER B 1 50  ? 4.522   14.637 87.167  1.00 28.46 ? 48  SER B OG    1 
ATOM   2483 N  N     . ARG B 1 51  ? 4.863   11.815 86.166  1.00 23.64 ? 49  ARG B N     1 
ATOM   2484 C  CA    . ARG B 1 51  ? 4.011   10.872 85.449  1.00 24.44 ? 49  ARG B CA    1 
ATOM   2485 C  C     . ARG B 1 51  ? 4.529   9.448  85.608  1.00 25.99 ? 49  ARG B C     1 
ATOM   2486 O  O     . ARG B 1 51  ? 3.773   8.485  85.463  1.00 25.02 ? 49  ARG B O     1 
ATOM   2487 C  CB    . ARG B 1 51  ? 3.946   11.230 83.966  1.00 23.62 ? 49  ARG B CB    1 
ATOM   2488 C  CG    . ARG B 1 51  ? 3.155   12.495 83.683  1.00 21.26 ? 49  ARG B CG    1 
ATOM   2489 C  CD    . ARG B 1 51  ? 2.991   12.697 82.191  1.00 23.59 ? 49  ARG B CD    1 
ATOM   2490 N  NE    . ARG B 1 51  ? 2.040   13.764 81.874  1.00 21.29 ? 49  ARG B NE    1 
ATOM   2491 C  CZ    . ARG B 1 51  ? 1.642   14.055 80.640  1.00 22.42 ? 49  ARG B CZ    1 
ATOM   2492 N  NH1   . ARG B 1 51  ? 2.111   13.363 79.612  1.00 23.21 ? 49  ARG B NH1   1 
ATOM   2493 N  NH2   . ARG B 1 51  ? 0.767   15.033 80.433  1.00 22.50 ? 49  ARG B NH2   1 
ATOM   2494 N  N     . CYS B 1 52  ? 5.820   9.323  85.900  1.00 24.01 ? 50  CYS B N     1 
ATOM   2495 C  CA    . CYS B 1 52  ? 6.432   8.017  86.102  1.00 24.16 ? 50  CYS B CA    1 
ATOM   2496 C  C     . CYS B 1 52  ? 6.163   7.506  87.511  1.00 25.49 ? 50  CYS B C     1 
ATOM   2497 O  O     . CYS B 1 52  ? 6.533   6.384  87.847  1.00 27.88 ? 50  CYS B O     1 
ATOM   2498 C  CB    . CYS B 1 52  ? 7.945   8.088  85.886  1.00 25.39 ? 50  CYS B CB    1 
ATOM   2499 S  SG    . CYS B 1 52  ? 8.463   8.253  84.169  1.00 25.30 ? 50  CYS B SG    1 
ATOM   2500 N  N     . GLY B 1 53  ? 5.546   8.341  88.340  1.00 24.91 ? 51  GLY B N     1 
ATOM   2501 C  CA    . GLY B 1 53  ? 5.250   7.943  89.707  1.00 24.99 ? 51  GLY B CA    1 
ATOM   2502 C  C     . GLY B 1 53  ? 6.281   8.393  90.729  1.00 24.42 ? 51  GLY B C     1 
ATOM   2503 O  O     . GLY B 1 53  ? 6.311   7.899  91.854  1.00 24.67 ? 51  GLY B O     1 
ATOM   2504 N  N     . ILE B 1 54  ? 7.132   9.336  90.340  1.00 22.33 ? 52  ILE B N     1 
ATOM   2505 C  CA    . ILE B 1 54  ? 8.163   9.853  91.226  1.00 22.30 ? 52  ILE B CA    1 
ATOM   2506 C  C     . ILE B 1 54  ? 7.592   11.043 91.990  1.00 23.11 ? 52  ILE B C     1 
ATOM   2507 O  O     . ILE B 1 54  ? 7.009   11.941 91.383  1.00 22.03 ? 52  ILE B O     1 
ATOM   2508 C  CB    . ILE B 1 54  ? 9.400   10.325 90.410  1.00 22.90 ? 52  ILE B CB    1 
ATOM   2509 C  CG1   . ILE B 1 54  ? 10.004  9.146  89.634  1.00 23.09 ? 52  ILE B CG1   1 
ATOM   2510 C  CG2   . ILE B 1 54  ? 10.427  10.962 91.325  1.00 22.26 ? 52  ILE B CG2   1 
ATOM   2511 C  CD1   . ILE B 1 54  ? 10.392  7.944  90.495  1.00 24.45 ? 52  ILE B CD1   1 
ATOM   2512 N  N     . GLU B 1 55  ? 7.734   11.051 93.313  1.00 24.46 ? 53  GLU B N     1 
ATOM   2513 C  CA    . GLU B 1 55  ? 7.231   12.181 94.090  1.00 26.87 ? 53  GLU B CA    1 
ATOM   2514 C  C     . GLU B 1 55  ? 8.088   13.357 93.646  1.00 25.98 ? 53  GLU B C     1 
ATOM   2515 O  O     . GLU B 1 55  ? 9.292   13.404 93.917  1.00 24.44 ? 53  GLU B O     1 
ATOM   2516 C  CB    . GLU B 1 55  ? 7.385   11.949 95.597  1.00 28.92 ? 53  GLU B CB    1 
ATOM   2517 C  CG    . GLU B 1 55  ? 6.925   13.163 96.405  1.00 36.13 ? 53  GLU B CG    1 
ATOM   2518 C  CD    . GLU B 1 55  ? 6.881   12.917 97.905  1.00 39.99 ? 53  GLU B CD    1 
ATOM   2519 O  OE1   . GLU B 1 55  ? 7.838   12.323 98.452  1.00 41.88 ? 53  GLU B OE1   1 
ATOM   2520 O  OE2   . GLU B 1 55  ? 5.887   13.333 98.539  1.00 43.11 ? 53  GLU B OE2   1 
ATOM   2521 N  N     . THR B 1 56  ? 7.463   14.307 92.960  1.00 25.81 ? 54  THR B N     1 
ATOM   2522 C  CA    . THR B 1 56  ? 8.197   15.434 92.405  1.00 24.42 ? 54  THR B CA    1 
ATOM   2523 C  C     . THR B 1 56  ? 7.637   16.803 92.745  1.00 25.06 ? 54  THR B C     1 
ATOM   2524 O  O     . THR B 1 56  ? 6.421   16.991 92.807  1.00 24.95 ? 54  THR B O     1 
ATOM   2525 C  CB    . THR B 1 56  ? 8.242   15.319 90.852  1.00 24.27 ? 54  THR B CB    1 
ATOM   2526 O  OG1   . THR B 1 56  ? 8.707   14.016 90.480  1.00 23.20 ? 54  THR B OG1   1 
ATOM   2527 C  CG2   . THR B 1 56  ? 9.177   16.369 90.251  1.00 23.97 ? 54  THR B CG2   1 
ATOM   2528 N  N     . ARG B 1 57  ? 8.540   17.756 92.951  1.00 24.25 ? 55  ARG B N     1 
ATOM   2529 C  CA    . ARG B 1 57  ? 8.161   19.132 93.234  1.00 23.58 ? 55  ARG B CA    1 
ATOM   2530 C  C     . ARG B 1 57  ? 8.918   20.044 92.276  1.00 22.34 ? 55  ARG B C     1 
ATOM   2531 O  O     . ARG B 1 57  ? 10.141  19.988 92.193  1.00 23.08 ? 55  ARG B O     1 
ATOM   2532 C  CB    . ARG B 1 57  ? 8.487   19.499 94.682  1.00 24.54 ? 55  ARG B CB    1 
ATOM   2533 C  CG    . ARG B 1 57  ? 7.715   18.658 95.674  1.00 27.66 ? 55  ARG B CG    1 
ATOM   2534 C  CD    . ARG B 1 57  ? 7.681   19.295 97.037  1.00 32.84 ? 55  ARG B CD    1 
ATOM   2535 N  NE    . ARG B 1 57  ? 6.777   18.576 97.925  1.00 35.59 ? 55  ARG B NE    1 
ATOM   2536 C  CZ    . ARG B 1 57  ? 6.458   18.985 99.147  1.00 37.74 ? 55  ARG B CZ    1 
ATOM   2537 N  NH1   . ARG B 1 57  ? 6.974   20.112 99.624  1.00 37.98 ? 55  ARG B NH1   1 
ATOM   2538 N  NH2   . ARG B 1 57  ? 5.624   18.269 99.890  1.00 38.47 ? 55  ARG B NH2   1 
ATOM   2539 N  N     . LEU B 1 58  ? 8.184   20.860 91.531  1.00 19.71 ? 56  LEU B N     1 
ATOM   2540 C  CA    . LEU B 1 58  ? 8.803   21.784 90.588  1.00 20.86 ? 56  LEU B CA    1 
ATOM   2541 C  C     . LEU B 1 58  ? 8.824   23.186 91.186  1.00 21.72 ? 56  LEU B C     1 
ATOM   2542 O  O     . LEU B 1 58  ? 7.786   23.701 91.604  1.00 21.97 ? 56  LEU B O     1 
ATOM   2543 C  CB    . LEU B 1 58  ? 8.020   21.818 89.275  1.00 21.49 ? 56  LEU B CB    1 
ATOM   2544 C  CG    . LEU B 1 58  ? 8.432   22.887 88.250  1.00 21.25 ? 56  LEU B CG    1 
ATOM   2545 C  CD1   . LEU B 1 58  ? 9.900   22.723 87.865  1.00 21.20 ? 56  LEU B CD1   1 
ATOM   2546 C  CD2   . LEU B 1 58  ? 7.537   22.765 87.012  1.00 23.76 ? 56  LEU B CD2   1 
ATOM   2547 N  N     . ILE B 1 59  ? 10.005  23.791 91.221  1.00 21.10 ? 57  ILE B N     1 
ATOM   2548 C  CA    . ILE B 1 59  ? 10.167  25.143 91.746  1.00 21.42 ? 57  ILE B CA    1 
ATOM   2549 C  C     . ILE B 1 59  ? 10.449  26.020 90.531  1.00 20.41 ? 57  ILE B C     1 
ATOM   2550 O  O     . ILE B 1 59  ? 11.566  26.050 90.018  1.00 20.72 ? 57  ILE B O     1 
ATOM   2551 C  CB    . ILE B 1 59  ? 11.352  25.209 92.747  1.00 21.72 ? 57  ILE B CB    1 
ATOM   2552 C  CG1   . ILE B 1 59  ? 11.062  24.289 93.944  1.00 20.72 ? 57  ILE B CG1   1 
ATOM   2553 C  CG2   . ILE B 1 59  ? 11.570  26.651 93.209  1.00 23.09 ? 57  ILE B CG2   1 
ATOM   2554 C  CD1   . ILE B 1 59  ? 12.252  24.139 94.909  1.00 21.36 ? 57  ILE B CD1   1 
ATOM   2555 N  N     . ALA B 1 60  ? 9.416   26.714 90.062  1.00 22.26 ? 58  ALA B N     1 
ATOM   2556 C  CA    . ALA B 1 60  ? 9.533   27.564 88.880  1.00 24.48 ? 58  ALA B CA    1 
ATOM   2557 C  C     . ALA B 1 60  ? 8.566   28.733 88.972  1.00 24.40 ? 58  ALA B C     1 
ATOM   2558 O  O     . ALA B 1 60  ? 7.499   28.621 89.572  1.00 25.81 ? 58  ALA B O     1 
ATOM   2559 C  CB    . ALA B 1 60  ? 9.238   26.749 87.619  1.00 22.77 ? 58  ALA B CB    1 
ATOM   2560 N  N     . ALA B 1 61  ? 8.937   29.841 88.347  1.00 24.98 ? 59  ALA B N     1 
ATOM   2561 C  CA    . ALA B 1 61  ? 8.121   31.043 88.393  1.00 26.82 ? 59  ALA B CA    1 
ATOM   2562 C  C     . ALA B 1 61  ? 7.168   31.239 87.217  1.00 27.07 ? 59  ALA B C     1 
ATOM   2563 O  O     . ALA B 1 61  ? 7.496   30.924 86.071  1.00 26.39 ? 59  ALA B O     1 
ATOM   2564 C  CB    . ALA B 1 61  ? 9.031   32.256 88.520  1.00 25.26 ? 59  ALA B CB    1 
ATOM   2565 N  N     . THR B 1 62  ? 5.984   31.760 87.524  1.00 27.96 ? 60  THR B N     1 
ATOM   2566 C  CA    . THR B 1 62  ? 4.967   32.069 86.526  1.00 29.91 ? 60  THR B CA    1 
ATOM   2567 C  C     . THR B 1 62  ? 4.523   33.503 86.814  1.00 32.61 ? 60  THR B C     1 
ATOM   2568 O  O     . THR B 1 62  ? 4.663   33.981 87.944  1.00 31.58 ? 60  THR B O     1 
ATOM   2569 C  CB    . THR B 1 62  ? 3.736   31.156 86.629  1.00 30.49 ? 60  THR B CB    1 
ATOM   2570 O  OG1   . THR B 1 62  ? 3.031   31.440 87.842  1.00 31.87 ? 60  THR B OG1   1 
ATOM   2571 C  CG2   . THR B 1 62  ? 4.154   29.686 86.605  1.00 31.74 ? 60  THR B CG2   1 
ATOM   2572 N  N     . GLY B 1 63  ? 3.990   34.179 85.798  1.00 33.16 ? 61  GLY B N     1 
ATOM   2573 C  CA    . GLY B 1 63  ? 3.555   35.555 85.958  1.00 34.48 ? 61  GLY B CA    1 
ATOM   2574 C  C     . GLY B 1 63  ? 2.075   35.769 86.216  1.00 35.75 ? 61  GLY B C     1 
ATOM   2575 O  O     . GLY B 1 63  ? 1.300   34.825 86.354  1.00 35.41 ? 61  GLY B O     1 
ATOM   2576 N  N     . ASN B 1 64  ? 1.684   37.037 86.275  1.00 38.68 ? 62  ASN B N     1 
ATOM   2577 C  CA    . ASN B 1 64  ? 0.300   37.409 86.533  1.00 40.24 ? 62  ASN B CA    1 
ATOM   2578 C  C     . ASN B 1 64  ? -0.403  37.789 85.236  1.00 41.23 ? 62  ASN B C     1 
ATOM   2579 O  O     . ASN B 1 64  ? -1.149  38.767 85.181  1.00 41.46 ? 62  ASN B O     1 
ATOM   2580 C  CB    . ASN B 1 64  ? 0.259   38.577 87.521  1.00 41.61 ? 62  ASN B CB    1 
ATOM   2581 C  CG    . ASN B 1 64  ? 0.912   39.833 86.973  1.00 43.14 ? 62  ASN B CG    1 
ATOM   2582 O  OD1   . ASN B 1 64  ? 1.915   39.768 86.261  1.00 42.52 ? 62  ASN B OD1   1 
ATOM   2583 N  ND2   . ASN B 1 64  ? 0.352   40.989 87.319  1.00 44.59 ? 62  ASN B ND2   1 
ATOM   2584 N  N     . ASP B 1 65  ? -0.171  37.002 84.194  1.00 40.12 ? 63  ASP B N     1 
ATOM   2585 C  CA    . ASP B 1 65  ? -0.778  37.272 82.902  1.00 40.38 ? 63  ASP B CA    1 
ATOM   2586 C  C     . ASP B 1 65  ? -1.612  36.101 82.388  1.00 40.13 ? 63  ASP B C     1 
ATOM   2587 O  O     . ASP B 1 65  ? -1.780  35.088 83.069  1.00 40.67 ? 63  ASP B O     1 
ATOM   2588 C  CB    . ASP B 1 65  ? 0.313   37.631 81.889  1.00 39.35 ? 63  ASP B CB    1 
ATOM   2589 C  CG    . ASP B 1 65  ? 1.327   36.512 81.697  1.00 39.87 ? 63  ASP B CG    1 
ATOM   2590 O  OD1   . ASP B 1 65  ? 1.436   35.651 82.594  1.00 38.05 ? 63  ASP B OD1   1 
ATOM   2591 O  OD2   . ASP B 1 65  ? 2.020   36.502 80.656  1.00 38.13 ? 63  ASP B OD2   1 
ATOM   2592 N  N     . SER B 1 66  ? -2.139  36.258 81.183  1.00 39.32 ? 64  SER B N     1 
ATOM   2593 C  CA    . SER B 1 66  ? -2.957  35.229 80.557  1.00 40.80 ? 64  SER B CA    1 
ATOM   2594 C  C     . SER B 1 66  ? -2.281  33.853 80.590  1.00 38.88 ? 64  SER B C     1 
ATOM   2595 O  O     . SER B 1 66  ? -2.867  32.871 81.046  1.00 37.48 ? 64  SER B O     1 
ATOM   2596 C  CB    . SER B 1 66  ? -3.253  35.623 79.109  1.00 40.79 ? 64  SER B CB    1 
ATOM   2597 O  OG    . SER B 1 66  ? -3.920  34.580 78.424  1.00 45.73 ? 64  SER B OG    1 
ATOM   2598 N  N     . ASN B 1 67  ? -1.045  33.785 80.113  1.00 37.35 ? 65  ASN B N     1 
ATOM   2599 C  CA    . ASN B 1 67  ? -0.324  32.516 80.088  1.00 35.88 ? 65  ASN B CA    1 
ATOM   2600 C  C     . ASN B 1 67  ? -0.053  31.968 81.483  1.00 34.98 ? 65  ASN B C     1 
ATOM   2601 O  O     . ASN B 1 67  ? 0.060   30.756 81.676  1.00 33.14 ? 65  ASN B O     1 
ATOM   2602 C  CB    . ASN B 1 67  ? 0.989   32.672 79.324  1.00 36.39 ? 65  ASN B CB    1 
ATOM   2603 C  CG    . ASN B 1 67  ? 0.773   32.938 77.848  1.00 38.29 ? 65  ASN B CG    1 
ATOM   2604 O  OD1   . ASN B 1 67  ? -0.251  32.551 77.281  1.00 39.81 ? 65  ASN B OD1   1 
ATOM   2605 N  ND2   . ASN B 1 67  ? 1.743   33.583 77.213  1.00 37.62 ? 65  ASN B ND2   1 
ATOM   2606 N  N     . GLY B 1 68  ? 0.051   32.866 82.455  1.00 33.57 ? 66  GLY B N     1 
ATOM   2607 C  CA    . GLY B 1 68  ? 0.300   32.450 83.820  1.00 32.91 ? 66  GLY B CA    1 
ATOM   2608 C  C     . GLY B 1 68  ? -0.801  31.618 84.429  1.00 32.45 ? 66  GLY B C     1 
ATOM   2609 O  O     . GLY B 1 68  ? -0.557  30.519 84.941  1.00 28.61 ? 66  GLY B O     1 
ATOM   2610 N  N     . ALA B 1 69  ? -2.015  32.152 84.388  1.00 31.68 ? 67  ALA B N     1 
ATOM   2611 C  CA    . ALA B 1 69  ? -3.163  31.454 84.940  1.00 32.58 ? 67  ALA B CA    1 
ATOM   2612 C  C     . ALA B 1 69  ? -3.364  30.155 84.176  1.00 31.76 ? 67  ALA B C     1 
ATOM   2613 O  O     . ALA B 1 69  ? -3.736  29.146 84.764  1.00 34.07 ? 67  ALA B O     1 
ATOM   2614 C  CB    . ALA B 1 69  ? -4.418  32.330 84.839  1.00 33.97 ? 67  ALA B CB    1 
ATOM   2615 N  N     . TRP B 1 70  ? -3.118  30.185 82.868  1.00 30.09 ? 68  TRP B N     1 
ATOM   2616 C  CA    . TRP B 1 70  ? -3.272  28.991 82.042  1.00 31.18 ? 68  TRP B CA    1 
ATOM   2617 C  C     . TRP B 1 70  ? -2.314  27.903 82.518  1.00 30.11 ? 68  TRP B C     1 
ATOM   2618 O  O     . TRP B 1 70  ? -2.714  26.757 82.715  1.00 31.40 ? 68  TRP B O     1 
ATOM   2619 C  CB    . TRP B 1 70  ? -2.987  29.303 80.573  1.00 32.93 ? 68  TRP B CB    1 
ATOM   2620 C  CG    . TRP B 1 70  ? -3.362  28.179 79.657  1.00 34.38 ? 68  TRP B CG    1 
ATOM   2621 C  CD1   . TRP B 1 70  ? -4.623  27.817 79.279  1.00 36.33 ? 68  TRP B CD1   1 
ATOM   2622 C  CD2   . TRP B 1 70  ? -2.474  27.235 79.047  1.00 35.24 ? 68  TRP B CD2   1 
ATOM   2623 N  NE1   . TRP B 1 70  ? -4.578  26.705 78.471  1.00 35.99 ? 68  TRP B NE1   1 
ATOM   2624 C  CE2   . TRP B 1 70  ? -3.271  26.327 78.312  1.00 35.80 ? 68  TRP B CE2   1 
ATOM   2625 C  CE3   . TRP B 1 70  ? -1.084  27.065 79.050  1.00 35.83 ? 68  TRP B CE3   1 
ATOM   2626 C  CZ2   . TRP B 1 70  ? -2.721  25.262 77.587  1.00 36.18 ? 68  TRP B CZ2   1 
ATOM   2627 C  CZ3   . TRP B 1 70  ? -0.536  26.003 78.328  1.00 35.52 ? 68  TRP B CZ3   1 
ATOM   2628 C  CH2   . TRP B 1 70  ? -1.356  25.118 77.608  1.00 35.10 ? 68  TRP B CH2   1 
ATOM   2629 N  N     . ILE B 1 71  ? -1.047  28.269 82.699  1.00 29.67 ? 69  ILE B N     1 
ATOM   2630 C  CA    . ILE B 1 71  ? -0.035  27.323 83.167  1.00 29.21 ? 69  ILE B CA    1 
ATOM   2631 C  C     . ILE B 1 71  ? -0.444  26.718 84.510  1.00 31.60 ? 69  ILE B C     1 
ATOM   2632 O  O     . ILE B 1 71  ? -0.537  25.497 84.653  1.00 29.55 ? 69  ILE B O     1 
ATOM   2633 C  CB    . ILE B 1 71  ? 1.353   28.013 83.328  1.00 27.45 ? 69  ILE B CB    1 
ATOM   2634 C  CG1   . ILE B 1 71  ? 1.935   28.339 81.952  1.00 25.10 ? 69  ILE B CG1   1 
ATOM   2635 C  CG2   . ILE B 1 71  ? 2.309   27.109 84.121  1.00 28.13 ? 69  ILE B CG2   1 
ATOM   2636 C  CD1   . ILE B 1 71  ? 3.293   29.036 81.992  1.00 24.86 ? 69  ILE B CD1   1 
ATOM   2637 N  N     . ARG B 1 72  ? -0.682  27.582 85.494  1.00 32.64 ? 70  ARG B N     1 
ATOM   2638 C  CA    . ARG B 1 72  ? -1.073  27.134 86.821  1.00 35.04 ? 70  ARG B CA    1 
ATOM   2639 C  C     . ARG B 1 72  ? -2.324  26.269 86.747  1.00 36.48 ? 70  ARG B C     1 
ATOM   2640 O  O     . ARG B 1 72  ? -2.505  25.341 87.532  1.00 36.57 ? 70  ARG B O     1 
ATOM   2641 C  CB    . ARG B 1 72  ? -1.305  28.343 87.728  1.00 35.97 ? 70  ARG B CB    1 
ATOM   2642 C  CG    . ARG B 1 72  ? -0.049  29.171 87.976  1.00 36.03 ? 70  ARG B CG    1 
ATOM   2643 C  CD    . ARG B 1 72  ? -0.286  30.228 89.050  1.00 37.71 ? 70  ARG B CD    1 
ATOM   2644 N  NE    . ARG B 1 72  ? -1.248  31.243 88.628  1.00 38.12 ? 70  ARG B NE    1 
ATOM   2645 C  CZ    . ARG B 1 72  ? -0.972  32.240 87.793  1.00 37.59 ? 70  ARG B CZ    1 
ATOM   2646 N  NH1   . ARG B 1 72  ? 0.248   32.368 87.282  1.00 36.27 ? 70  ARG B NH1   1 
ATOM   2647 N  NH2   . ARG B 1 72  ? -1.922  33.109 87.463  1.00 35.29 ? 70  ARG B NH2   1 
ATOM   2648 N  N     . GLN B 1 73  ? -3.177  26.578 85.780  1.00 38.36 ? 71  GLN B N     1 
ATOM   2649 C  CA    . GLN B 1 73  ? -4.417  25.849 85.565  1.00 39.90 ? 71  GLN B CA    1 
ATOM   2650 C  C     . GLN B 1 73  ? -4.130  24.458 84.993  1.00 39.82 ? 71  GLN B C     1 
ATOM   2651 O  O     . GLN B 1 73  ? -4.629  23.450 85.496  1.00 38.37 ? 71  GLN B O     1 
ATOM   2652 C  CB    . GLN B 1 73  ? -5.288  26.647 84.600  1.00 43.72 ? 71  GLN B CB    1 
ATOM   2653 C  CG    . GLN B 1 73  ? -6.578  25.993 84.178  1.00 47.95 ? 71  GLN B CG    1 
ATOM   2654 C  CD    . GLN B 1 73  ? -7.361  26.885 83.237  1.00 52.28 ? 71  GLN B CD    1 
ATOM   2655 O  OE1   . GLN B 1 73  ? -7.709  28.017 83.583  1.00 54.91 ? 71  GLN B OE1   1 
ATOM   2656 N  NE2   . GLN B 1 73  ? -7.637  26.386 82.035  1.00 54.27 ? 71  GLN B NE2   1 
ATOM   2657 N  N     . GLN B 1 74  ? -3.315  24.412 83.944  1.00 39.23 ? 72  GLN B N     1 
ATOM   2658 C  CA    . GLN B 1 74  ? -2.963  23.151 83.300  1.00 40.13 ? 72  GLN B CA    1 
ATOM   2659 C  C     . GLN B 1 74  ? -2.172  22.190 84.178  1.00 38.53 ? 72  GLN B C     1 
ATOM   2660 O  O     . GLN B 1 74  ? -2.407  20.983 84.149  1.00 39.44 ? 72  GLN B O     1 
ATOM   2661 C  CB    . GLN B 1 74  ? -2.170  23.414 82.019  1.00 41.35 ? 72  GLN B CB    1 
ATOM   2662 C  CG    . GLN B 1 74  ? -2.960  24.119 80.939  1.00 44.05 ? 72  GLN B CG    1 
ATOM   2663 C  CD    . GLN B 1 74  ? -4.261  23.409 80.631  1.00 46.80 ? 72  GLN B CD    1 
ATOM   2664 O  OE1   . GLN B 1 74  ? -4.270  22.221 80.298  1.00 47.74 ? 72  GLN B OE1   1 
ATOM   2665 N  NE2   . GLN B 1 74  ? -5.369  24.130 80.744  1.00 48.62 ? 72  GLN B NE2   1 
ATOM   2666 N  N     . ILE B 1 75  ? -1.241  22.715 84.964  1.00 37.65 ? 73  ILE B N     1 
ATOM   2667 C  CA    . ILE B 1 75  ? -0.423  21.851 85.804  1.00 37.16 ? 73  ILE B CA    1 
ATOM   2668 C  C     . ILE B 1 75  ? -1.208  21.141 86.900  1.00 36.24 ? 73  ILE B C     1 
ATOM   2669 O  O     . ILE B 1 75  ? -0.729  20.159 87.467  1.00 34.12 ? 73  ILE B O     1 
ATOM   2670 C  CB    . ILE B 1 75  ? 0.767   22.629 86.427  1.00 38.20 ? 73  ILE B CB    1 
ATOM   2671 C  CG1   . ILE B 1 75  ? 2.042   21.782 86.304  1.00 40.81 ? 73  ILE B CG1   1 
ATOM   2672 C  CG2   . ILE B 1 75  ? 0.493   22.943 87.889  1.00 39.73 ? 73  ILE B CG2   1 
ATOM   2673 C  CD1   . ILE B 1 75  ? 3.305   22.476 86.771  1.00 42.08 ? 73  ILE B CD1   1 
ATOM   2674 N  N     . LYS B 1 76  ? -2.412  21.629 87.196  1.00 36.49 ? 74  LYS B N     1 
ATOM   2675 C  CA    . LYS B 1 76  ? -3.243  21.004 88.221  1.00 37.19 ? 74  LYS B CA    1 
ATOM   2676 C  C     . LYS B 1 76  ? -3.632  19.595 87.787  1.00 37.12 ? 74  LYS B C     1 
ATOM   2677 O  O     . LYS B 1 76  ? -3.983  18.754 88.614  1.00 36.64 ? 74  LYS B O     1 
ATOM   2678 C  CB    . LYS B 1 76  ? -4.513  21.827 88.470  1.00 38.55 ? 74  LYS B CB    1 
ATOM   2679 C  CG    . LYS B 1 76  ? -4.264  23.186 89.100  1.00 42.57 ? 74  LYS B CG    1 
ATOM   2680 C  CD    . LYS B 1 76  ? -5.573  23.884 89.455  1.00 46.99 ? 74  LYS B CD    1 
ATOM   2681 C  CE    . LYS B 1 76  ? -6.416  24.163 88.214  1.00 49.67 ? 74  LYS B CE    1 
ATOM   2682 N  NZ    . LYS B 1 76  ? -7.732  24.785 88.554  1.00 52.14 ? 74  LYS B NZ    1 
ATOM   2683 N  N     . ASN B 1 77  ? -3.567  19.347 86.483  1.00 36.93 ? 75  ASN B N     1 
ATOM   2684 C  CA    . ASN B 1 77  ? -3.908  18.043 85.931  1.00 38.06 ? 75  ASN B CA    1 
ATOM   2685 C  C     . ASN B 1 77  ? -2.740  17.066 86.035  1.00 36.30 ? 75  ASN B C     1 
ATOM   2686 O  O     . ASN B 1 77  ? -2.878  15.889 85.704  1.00 36.52 ? 75  ASN B O     1 
ATOM   2687 C  CB    . ASN B 1 77  ? -4.325  18.175 84.463  1.00 41.01 ? 75  ASN B CB    1 
ATOM   2688 C  CG    . ASN B 1 77  ? -5.555  19.049 84.282  1.00 44.94 ? 75  ASN B CG    1 
ATOM   2689 O  OD1   . ASN B 1 77  ? -6.554  18.887 84.986  1.00 47.58 ? 75  ASN B OD1   1 
ATOM   2690 N  ND2   . ASN B 1 77  ? -5.492  19.976 83.329  1.00 45.77 ? 75  ASN B ND2   1 
ATOM   2691 N  N     . GLU B 1 78  ? -1.592  17.554 86.496  1.00 33.99 ? 76  GLU B N     1 
ATOM   2692 C  CA    . GLU B 1 78  ? -0.408  16.706 86.628  1.00 32.09 ? 76  GLU B CA    1 
ATOM   2693 C  C     . GLU B 1 78  ? -0.120  16.373 88.096  1.00 31.37 ? 76  GLU B C     1 
ATOM   2694 O  O     . GLU B 1 78  ? -0.282  17.218 88.977  1.00 30.37 ? 76  GLU B O     1 
ATOM   2695 C  CB    . GLU B 1 78  ? 0.801   17.398 85.995  1.00 30.58 ? 76  GLU B CB    1 
ATOM   2696 C  CG    . GLU B 1 78  ? 0.626   17.751 84.517  1.00 29.67 ? 76  GLU B CG    1 
ATOM   2697 C  CD    . GLU B 1 78  ? 0.335   16.536 83.645  1.00 30.08 ? 76  GLU B CD    1 
ATOM   2698 O  OE1   . GLU B 1 78  ? 0.735   15.416 84.031  1.00 28.35 ? 76  GLU B OE1   1 
ATOM   2699 O  OE2   . GLU B 1 78  ? -0.279  16.701 82.566  1.00 28.03 ? 76  GLU B OE2   1 
ATOM   2700 N  N     . PRO B 1 79  ? 0.326   15.134 88.370  1.00 31.21 ? 77  PRO B N     1 
ATOM   2701 C  CA    . PRO B 1 79  ? 0.645   14.631 89.712  1.00 32.60 ? 77  PRO B CA    1 
ATOM   2702 C  C     . PRO B 1 79  ? 1.961   15.190 90.248  1.00 34.48 ? 77  PRO B C     1 
ATOM   2703 O  O     . PRO B 1 79  ? 2.770   14.473 90.843  1.00 36.50 ? 77  PRO B O     1 
ATOM   2704 C  CB    . PRO B 1 79  ? 0.708   13.123 89.495  1.00 32.33 ? 77  PRO B CB    1 
ATOM   2705 C  CG    . PRO B 1 79  ? 1.347   13.034 88.143  1.00 31.15 ? 77  PRO B CG    1 
ATOM   2706 C  CD    . PRO B 1 79  ? 0.619   14.110 87.347  1.00 31.30 ? 77  PRO B CD    1 
ATOM   2707 N  N     . LEU B 1 80  ? 2.148   16.483 90.045  1.00 34.99 ? 78  LEU B N     1 
ATOM   2708 C  CA    . LEU B 1 80  ? 3.351   17.205 90.437  1.00 36.69 ? 78  LEU B CA    1 
ATOM   2709 C  C     . LEU B 1 80  ? 2.891   18.383 91.294  1.00 36.71 ? 78  LEU B C     1 
ATOM   2710 O  O     . LEU B 1 80  ? 1.722   18.761 91.253  1.00 34.96 ? 78  LEU B O     1 
ATOM   2711 C  CB    . LEU B 1 80  ? 4.016   17.700 89.148  1.00 37.52 ? 78  LEU B CB    1 
ATOM   2712 C  CG    . LEU B 1 80  ? 5.218   18.630 89.022  1.00 40.16 ? 78  LEU B CG    1 
ATOM   2713 C  CD1   . LEU B 1 80  ? 6.487   17.910 89.412  1.00 41.24 ? 78  LEU B CD1   1 
ATOM   2714 C  CD2   . LEU B 1 80  ? 5.324   19.086 87.575  1.00 39.00 ? 78  LEU B CD2   1 
HETATM 2715 N  N     . MSE B 1 81  ? 3.791   18.954 92.079  1.00 36.73 ? 79  MSE B N     1 
HETATM 2716 C  CA    . MSE B 1 81  ? 3.437   20.111 92.889  1.00 36.51 ? 79  MSE B CA    1 
HETATM 2717 C  C     . MSE B 1 81  ? 4.258   21.278 92.354  1.00 34.28 ? 79  MSE B C     1 
HETATM 2718 O  O     . MSE B 1 81  ? 5.479   21.183 92.260  1.00 32.40 ? 79  MSE B O     1 
HETATM 2719 C  CB    . MSE B 1 81  ? 3.775   19.867 94.363  1.00 41.68 ? 79  MSE B CB    1 
HETATM 2720 C  CG    . MSE B 1 81  ? 3.320   20.974 95.303  1.00 48.67 ? 79  MSE B CG    1 
HETATM 2721 SE SE    . MSE B 1 81  ? 3.698   20.606 97.182  1.00 61.25 ? 79  MSE B SE    1 
HETATM 2722 C  CE    . MSE B 1 81  ? 2.887   18.853 97.290  1.00 54.17 ? 79  MSE B CE    1 
ATOM   2723 N  N     . LEU B 1 82  ? 3.589   22.362 91.978  1.00 31.53 ? 80  LEU B N     1 
ATOM   2724 C  CA    . LEU B 1 82  ? 4.280   23.537 91.470  1.00 30.09 ? 80  LEU B CA    1 
ATOM   2725 C  C     . LEU B 1 82  ? 4.385   24.561 92.594  1.00 31.44 ? 80  LEU B C     1 
ATOM   2726 O  O     . LEU B 1 82  ? 3.383   24.892 93.243  1.00 29.65 ? 80  LEU B O     1 
ATOM   2727 C  CB    . LEU B 1 82  ? 3.521   24.142 90.283  1.00 29.69 ? 80  LEU B CB    1 
ATOM   2728 C  CG    . LEU B 1 82  ? 4.027   25.509 89.803  1.00 29.82 ? 80  LEU B CG    1 
ATOM   2729 C  CD1   . LEU B 1 82  ? 5.482   25.401 89.365  1.00 29.39 ? 80  LEU B CD1   1 
ATOM   2730 C  CD2   . LEU B 1 82  ? 3.154   26.015 88.663  1.00 30.24 ? 80  LEU B CD2   1 
ATOM   2731 N  N     . LEU B 1 83  ? 5.600   25.049 92.826  1.00 30.19 ? 81  LEU B N     1 
ATOM   2732 C  CA    . LEU B 1 83  ? 5.861   26.034 93.872  1.00 31.63 ? 81  LEU B CA    1 
ATOM   2733 C  C     . LEU B 1 83  ? 6.646   27.200 93.276  1.00 32.47 ? 81  LEU B C     1 
ATOM   2734 O  O     . LEU B 1 83  ? 7.486   27.001 92.401  1.00 30.61 ? 81  LEU B O     1 
ATOM   2735 C  CB    . LEU B 1 83  ? 6.670   25.385 94.998  1.00 33.02 ? 81  LEU B CB    1 
ATOM   2736 C  CG    . LEU B 1 83  ? 5.971   24.195 95.667  1.00 35.64 ? 81  LEU B CG    1 
ATOM   2737 C  CD1   . LEU B 1 83  ? 6.991   23.145 96.052  1.00 35.48 ? 81  LEU B CD1   1 
ATOM   2738 C  CD2   . LEU B 1 83  ? 5.175   24.675 96.874  1.00 35.47 ? 81  LEU B CD2   1 
ATOM   2739 N  N     . PRO B 1 84  ? 6.380   28.436 93.739  1.00 34.22 ? 82  PRO B N     1 
ATOM   2740 C  CA    . PRO B 1 84  ? 5.408   28.812 94.773  1.00 36.28 ? 82  PRO B CA    1 
ATOM   2741 C  C     . PRO B 1 84  ? 3.978   28.843 94.232  1.00 39.64 ? 82  PRO B C     1 
ATOM   2742 O  O     . PRO B 1 84  ? 3.763   28.685 93.031  1.00 37.78 ? 82  PRO B O     1 
ATOM   2743 C  CB    . PRO B 1 84  ? 5.894   30.192 95.202  1.00 36.03 ? 82  PRO B CB    1 
ATOM   2744 C  CG    . PRO B 1 84  ? 6.388   30.765 93.904  1.00 34.38 ? 82  PRO B CG    1 
ATOM   2745 C  CD    . PRO B 1 84  ? 7.155   29.611 93.296  1.00 33.16 ? 82  PRO B CD    1 
ATOM   2746 N  N     . ASP B 1 85  ? 3.008   29.044 95.122  1.00 43.58 ? 83  ASP B N     1 
ATOM   2747 C  CA    . ASP B 1 85  ? 1.596   29.101 94.739  1.00 47.74 ? 83  ASP B CA    1 
ATOM   2748 C  C     . ASP B 1 85  ? 1.244   30.365 93.978  1.00 48.68 ? 83  ASP B C     1 
ATOM   2749 O  O     . ASP B 1 85  ? 0.611   30.309 92.925  1.00 50.32 ? 83  ASP B O     1 
ATOM   2750 C  CB    . ASP B 1 85  ? 0.694   29.028 95.968  1.00 50.28 ? 83  ASP B CB    1 
ATOM   2751 C  CG    . ASP B 1 85  ? 0.571   27.632 96.515  1.00 52.56 ? 83  ASP B CG    1 
ATOM   2752 O  OD1   . ASP B 1 85  ? 0.195   26.729 95.738  1.00 55.49 ? 83  ASP B OD1   1 
ATOM   2753 O  OD2   . ASP B 1 85  ? 0.842   27.441 97.719  1.00 53.25 ? 83  ASP B OD2   1 
ATOM   2754 N  N     . GLY B 1 86  ? 1.634   31.508 94.529  1.00 49.29 ? 84  GLY B N     1 
ATOM   2755 C  CA    . GLY B 1 86  ? 1.339   32.772 93.881  1.00 51.51 ? 84  GLY B CA    1 
ATOM   2756 C  C     . GLY B 1 86  ? 2.069   32.911 92.559  1.00 52.30 ? 84  GLY B C     1 
ATOM   2757 O  O     . GLY B 1 86  ? 2.660   31.952 92.068  1.00 53.02 ? 84  GLY B O     1 
ATOM   2758 N  N     . HIS B 1 87  ? 2.032   34.104 91.982  1.00 52.50 ? 85  HIS B N     1 
ATOM   2759 C  CA    . HIS B 1 87  ? 2.699   34.365 90.715  1.00 52.36 ? 85  HIS B CA    1 
ATOM   2760 C  C     . HIS B 1 87  ? 3.507   35.666 90.800  1.00 52.30 ? 85  HIS B C     1 
ATOM   2761 O  O     . HIS B 1 87  ? 3.540   36.306 91.849  1.00 51.94 ? 85  HIS B O     1 
ATOM   2762 C  CB    . HIS B 1 87  ? 1.657   34.446 89.596  1.00 53.15 ? 85  HIS B CB    1 
ATOM   2763 C  CG    . HIS B 1 87  ? 0.387   35.132 89.997  1.00 53.18 ? 85  HIS B CG    1 
ATOM   2764 N  ND1   . HIS B 1 87  ? -0.556  34.541 90.812  1.00 53.99 ? 85  HIS B ND1   1 
ATOM   2765 C  CD2   . HIS B 1 87  ? -0.102  36.353 89.681  1.00 52.88 ? 85  HIS B CD2   1 
ATOM   2766 C  CE1   . HIS B 1 87  ? -1.574  35.369 90.974  1.00 53.16 ? 85  HIS B CE1   1 
ATOM   2767 N  NE2   . HIS B 1 87  ? -1.323  36.475 90.297  1.00 51.65 ? 85  HIS B NE2   1 
ATOM   2768 N  N     . PHE B 1 88  ? 4.161   36.043 89.702  1.00 52.14 ? 86  PHE B N     1 
ATOM   2769 C  CA    . PHE B 1 88  ? 4.966   37.266 89.642  1.00 51.93 ? 86  PHE B CA    1 
ATOM   2770 C  C     . PHE B 1 88  ? 4.707   38.001 88.311  1.00 52.60 ? 86  PHE B C     1 
ATOM   2771 O  O     . PHE B 1 88  ? 3.572   38.246 87.934  1.00 52.02 ? 86  PHE B O     1 
ATOM   2772 C  CB    . PHE B 1 88  ? 6.467   36.948 89.688  1.00 50.99 ? 86  PHE B CB    1 
ATOM   2773 C  CG    . PHE B 1 88  ? 6.873   35.939 90.723  1.00 50.83 ? 86  PHE B CG    1 
ATOM   2774 C  CD1   . PHE B 1 88  ? 6.653   34.580 90.527  1.00 49.91 ? 86  PHE B CD1   1 
ATOM   2775 C  CD2   . PHE B 1 88  ? 7.583   36.345 91.847  1.00 50.86 ? 86  PHE B CD2   1 
ATOM   2776 C  CE1   . PHE B 1 88  ? 7.148   33.641 91.433  1.00 50.47 ? 86  PHE B CE1   1 
ATOM   2777 C  CE2   . PHE B 1 88  ? 8.079   35.421 92.754  1.00 50.61 ? 86  PHE B CE2   1 
ATOM   2778 C  CZ    . PHE B 1 88  ? 7.866   34.065 92.547  1.00 50.64 ? 86  PHE B CZ    1 
ATOM   2779 N  N     . ASN B 1 89  ? 5.815   38.306 87.621  1.00 52.95 ? 87  ASN B N     1 
ATOM   2780 C  CA    . ASN B 1 89  ? 5.969   38.991 86.300  1.00 51.54 ? 87  ASN B CA    1 
ATOM   2781 C  C     . ASN B 1 89  ? 5.125   38.835 85.024  1.00 50.50 ? 87  ASN B C     1 
ATOM   2782 O  O     . ASN B 1 89  ? 3.970   38.380 84.944  1.00 49.48 ? 87  ASN B O     1 
ATOM   2783 C  CB    . ASN B 1 89  ? 7.360   38.706 85.754  1.00 51.97 ? 87  ASN B CB    1 
ATOM   2784 C  CG    . ASN B 1 89  ? 8.448   39.130 86.658  1.00 53.32 ? 87  ASN B CG    1 
ATOM   2785 O  OD1   . ASN B 1 89  ? 8.579   38.622 87.771  1.00 55.21 ? 87  ASN B OD1   1 
ATOM   2786 N  ND2   . ASN B 1 89  ? 9.279   40.053 86.182  1.00 51.32 ? 87  ASN B ND2   1 
ATOM   2787 N  N     . GLN B 1 90  ? 5.858   39.184 83.984  1.00 49.47 ? 88  GLN B N     1 
ATOM   2788 C  CA    . GLN B 1 90  ? 5.425   39.165 82.628  1.00 48.91 ? 88  GLN B CA    1 
ATOM   2789 C  C     . GLN B 1 90  ? 5.067   37.762 82.185  1.00 48.61 ? 88  GLN B C     1 
ATOM   2790 O  O     . GLN B 1 90  ? 3.972   37.559 81.667  1.00 51.48 ? 88  GLN B O     1 
ATOM   2791 C  CB    . GLN B 1 90  ? 6.544   39.709 81.777  1.00 50.69 ? 88  GLN B CB    1 
ATOM   2792 C  CG    . GLN B 1 90  ? 6.110   39.972 80.396  1.00 51.25 ? 88  GLN B CG    1 
ATOM   2793 C  CD    . GLN B 1 90  ? 5.113   41.095 80.338  1.00 52.19 ? 88  GLN B CD    1 
ATOM   2794 O  OE1   . GLN B 1 90  ? 4.002   40.928 79.833  1.00 53.03 ? 88  GLN B OE1   1 
ATOM   2795 N  NE2   . GLN B 1 90  ? 5.501   42.254 80.854  1.00 52.61 ? 88  GLN B NE2   1 
ATOM   2796 N  N     . HIS B 1 91  ? 6.001   36.818 82.344  1.00 46.13 ? 89  HIS B N     1 
ATOM   2797 C  CA    . HIS B 1 91  ? 5.753   35.415 82.019  1.00 43.74 ? 89  HIS B CA    1 
ATOM   2798 C  C     . HIS B 1 91  ? 6.487   34.713 80.871  1.00 41.46 ? 89  HIS B C     1 
ATOM   2799 O  O     . HIS B 1 91  ? 6.273   35.028 79.704  1.00 39.34 ? 89  HIS B O     1 
ATOM   2800 C  CB    . HIS B 1 91  ? 4.288   35.216 81.803  1.00 46.31 ? 89  HIS B CB    1 
ATOM   2801 C  CG    . HIS B 1 91  ? 3.821   33.899 82.278  1.00 48.06 ? 89  HIS B CG    1 
ATOM   2802 N  ND1   . HIS B 1 91  ? 3.208   33.729 83.497  1.00 49.18 ? 89  HIS B ND1   1 
ATOM   2803 C  CD2   . HIS B 1 91  ? 3.983   32.666 81.754  1.00 50.79 ? 89  HIS B CD2   1 
ATOM   2804 C  CE1   . HIS B 1 91  ? 3.018   32.441 83.708  1.00 52.43 ? 89  HIS B CE1   1 
ATOM   2805 N  NE2   . HIS B 1 91  ? 3.477   31.774 82.666  1.00 53.29 ? 89  HIS B NE2   1 
ATOM   2806 N  N     . SER B 1 92  ? 7.290   33.702 81.199  1.00 37.17 ? 90  SER B N     1 
ATOM   2807 C  CA    . SER B 1 92  ? 8.076   33.016 80.174  1.00 33.93 ? 90  SER B CA    1 
ATOM   2808 C  C     . SER B 1 92  ? 7.312   32.142 79.153  1.00 32.43 ? 90  SER B C     1 
ATOM   2809 O  O     . SER B 1 92  ? 6.449   31.333 79.493  1.00 29.01 ? 90  SER B O     1 
ATOM   2810 C  CB    . SER B 1 92  ? 9.211   32.204 80.846  1.00 33.63 ? 90  SER B CB    1 
ATOM   2811 O  OG    . SER B 1 92  ? 10.095  33.038 81.606  1.00 30.88 ? 90  SER B OG    1 
ATOM   2812 N  N     . ASP B 1 93  ? 7.618   32.343 77.879  1.00 32.75 ? 91  ASP B N     1 
ATOM   2813 C  CA    . ASP B 1 93  ? 7.011   31.535 76.834  1.00 34.10 ? 91  ASP B CA    1 
ATOM   2814 C  C     . ASP B 1 93  ? 7.775   31.635 75.531  1.00 33.44 ? 91  ASP B C     1 
ATOM   2815 O  O     . ASP B 1 93  ? 8.618   32.507 75.354  1.00 31.07 ? 91  ASP B O     1 
ATOM   2816 C  CB    . ASP B 1 93  ? 5.560   31.931 76.622  1.00 40.07 ? 91  ASP B CB    1 
ATOM   2817 C  CG    . ASP B 1 93  ? 5.397   33.400 76.507  1.00 41.19 ? 91  ASP B CG    1 
ATOM   2818 O  OD1   . ASP B 1 93  ? 5.999   33.972 75.582  1.00 46.49 ? 91  ASP B OD1   1 
ATOM   2819 O  OD2   . ASP B 1 93  ? 4.688   33.975 77.350  1.00 44.21 ? 91  ASP B OD2   1 
ATOM   2820 N  N     . THR B 1 94  ? 7.496   30.713 74.621  1.00 31.99 ? 92  THR B N     1 
ATOM   2821 C  CA    . THR B 1 94  ? 8.183   30.738 73.349  1.00 34.69 ? 92  THR B CA    1 
ATOM   2822 C  C     . THR B 1 94  ? 7.170   30.764 72.222  1.00 33.68 ? 92  THR B C     1 
ATOM   2823 O  O     . THR B 1 94  ? 6.128   30.102 72.290  1.00 33.32 ? 92  THR B O     1 
ATOM   2824 C  CB    . THR B 1 94  ? 9.103   29.507 73.177  1.00 35.76 ? 92  THR B CB    1 
ATOM   2825 O  OG1   . THR B 1 94  ? 9.819   29.616 71.942  1.00 43.46 ? 92  THR B OG1   1 
ATOM   2826 C  CG2   . THR B 1 94  ? 8.291   28.241 73.145  1.00 39.30 ? 92  THR B CG2   1 
ATOM   2827 N  N     . SER B 1 95  ? 7.474   31.548 71.196  1.00 32.98 ? 93  SER B N     1 
ATOM   2828 C  CA    . SER B 1 95  ? 6.606   31.653 70.038  1.00 32.77 ? 93  SER B CA    1 
ATOM   2829 C  C     . SER B 1 95  ? 7.266   30.849 68.928  1.00 31.20 ? 93  SER B C     1 
ATOM   2830 O  O     . SER B 1 95  ? 8.382   31.148 68.524  1.00 31.09 ? 93  SER B O     1 
ATOM   2831 C  CB    . SER B 1 95  ? 6.460   33.120 69.615  1.00 33.40 ? 93  SER B CB    1 
ATOM   2832 O  OG    . SER B 1 95  ? 5.647   33.232 68.463  1.00 39.62 ? 93  SER B OG    1 
ATOM   2833 N  N     . ILE B 1 96  ? 6.577   29.819 68.458  1.00 32.58 ? 94  ILE B N     1 
ATOM   2834 C  CA    . ILE B 1 96  ? 7.104   28.979 67.397  1.00 34.60 ? 94  ILE B CA    1 
ATOM   2835 C  C     . ILE B 1 96  ? 6.461   29.362 66.072  1.00 34.94 ? 94  ILE B C     1 
ATOM   2836 O  O     . ILE B 1 96  ? 5.275   29.092 65.840  1.00 36.80 ? 94  ILE B O     1 
ATOM   2837 C  CB    . ILE B 1 96  ? 6.811   27.488 67.702  1.00 34.20 ? 94  ILE B CB    1 
ATOM   2838 C  CG1   . ILE B 1 96  ? 7.324   27.145 69.104  1.00 36.00 ? 94  ILE B CG1   1 
ATOM   2839 C  CG2   . ILE B 1 96  ? 7.489   26.605 66.666  1.00 36.72 ? 94  ILE B CG2   1 
ATOM   2840 C  CD1   . ILE B 1 96  ? 6.780   25.844 69.659  1.00 37.97 ? 94  ILE B CD1   1 
ATOM   2841 N  N     . ILE B 1 97  ? 7.233   30.021 65.222  1.00 36.51 ? 95  ILE B N     1 
ATOM   2842 C  CA    . ILE B 1 97  ? 6.741   30.451 63.934  1.00 38.31 ? 95  ILE B CA    1 
ATOM   2843 C  C     . ILE B 1 97  ? 7.021   29.446 62.816  1.00 40.14 ? 95  ILE B C     1 
ATOM   2844 O  O     . ILE B 1 97  ? 8.181   29.340 62.350  1.00 39.55 ? 95  ILE B O     1 
ATOM   2845 C  CB    . ILE B 1 97  ? 7.372   31.811 63.541  1.00 38.59 ? 95  ILE B CB    1 
ATOM   2846 C  CG1   . ILE B 1 97  ? 6.870   32.896 64.519  1.00 39.11 ? 95  ILE B CG1   1 
ATOM   2847 C  CG2   . ILE B 1 97  ? 7.002   32.180 62.118  1.00 42.13 ? 95  ILE B CG2   1 
ATOM   2848 C  CD1   . ILE B 1 97  ? 7.584   34.199 64.354  1.00 40.36 ? 95  ILE B CD1   1 
ATOM   2849 N  N     . LEU B 1 98  ? 5.997   28.716 62.428  1.00 42.58 ? 96  LEU B N     1 
ATOM   2850 C  CA    . LEU B 1 98  ? 6.116   27.720 61.365  1.00 44.92 ? 96  LEU B CA    1 
ATOM   2851 C  C     . LEU B 1 98  ? 5.827   28.372 59.999  1.00 46.46 ? 96  LEU B C     1 
ATOM   2852 O  O     . LEU B 1 98  ? 4.688   28.803 59.749  1.00 45.94 ? 96  LEU B O     1 
ATOM   2853 C  CB    . LEU B 1 98  ? 5.135   26.571 61.634  1.00 45.62 ? 96  LEU B CB    1 
ATOM   2854 C  CG    . LEU B 1 98  ? 5.019   25.477 60.538  1.00 48.27 ? 96  LEU B CG    1 
ATOM   2855 C  CD1   . LEU B 1 98  ? 6.288   24.616 60.429  1.00 48.11 ? 96  LEU B CD1   1 
ATOM   2856 C  CD2   . LEU B 1 98  ? 3.833   24.585 60.874  1.00 49.16 ? 96  LEU B CD2   1 
ATOM   2857 N  N     . ASN B 1 99  ? 6.850   28.420 59.165  1.00 48.45 ? 97  ASN B N     1 
ATOM   2858 C  CA    . ASN B 1 99  ? 6.768   28.992 57.822  1.00 50.13 ? 97  ASN B CA    1 
ATOM   2859 C  C     . ASN B 1 99  ? 6.228   27.993 56.802  1.00 51.83 ? 97  ASN B C     1 
ATOM   2860 O  O     . ASN B 1 99  ? 6.279   26.770 57.005  1.00 51.22 ? 97  ASN B O     1 
ATOM   2861 C  CB    . ASN B 1 99  ? 8.159   29.457 57.358  1.00 50.72 ? 97  ASN B CB    1 
ATOM   2862 C  CG    . ASN B 1 99  ? 8.311   30.957 57.388  1.00 52.08 ? 97  ASN B CG    1 
ATOM   2863 O  OD1   . ASN B 1 99  ? 7.899   31.583 58.363  1.00 52.16 ? 97  ASN B OD1   1 
ATOM   2864 N  ND2   . ASN B 1 99  ? 8.905   31.545 56.338  1.00 53.33 ? 97  ASN B ND2   1 
ATOM   2865 N  N     . SER B 1 100 ? 5.713   28.513 55.693  1.00 53.38 ? 98  SER B N     1 
ATOM   2866 C  CA    . SER B 1 100 ? 5.210   27.630 54.647  1.00 54.81 ? 98  SER B CA    1 
ATOM   2867 C  C     . SER B 1 100 ? 6.502   27.038 54.118  1.00 55.04 ? 98  SER B C     1 
ATOM   2868 O  O     . SER B 1 100 ? 6.613   25.830 53.907  1.00 54.82 ? 98  SER B O     1 
ATOM   2869 C  CB    . SER B 1 100 ? 4.509   28.435 53.552  1.00 56.18 ? 98  SER B CB    1 
ATOM   2870 O  OG    . SER B 1 100 ? 5.431   29.188 52.779  1.00 58.06 ? 98  SER B OG    1 
ATOM   2871 N  N     . ALA B 1 101 ? 7.490   27.916 53.951  1.00 55.71 ? 99  ALA B N     1 
ATOM   2872 C  CA    . ALA B 1 101 ? 8.809   27.539 53.467  1.00 56.57 ? 99  ALA B CA    1 
ATOM   2873 C  C     . ALA B 1 101 ? 9.720   27.268 54.659  1.00 56.63 ? 99  ALA B C     1 
ATOM   2874 O  O     . ALA B 1 101 ? 10.124  28.194 55.360  1.00 56.84 ? 99  ALA B O     1 
ATOM   2875 C  CB    . ALA B 1 101 ? 9.386   28.659 52.610  1.00 56.83 ? 99  ALA B CB    1 
ATOM   2876 N  N     . ASP B 1 104 ? 12.411  26.013 57.863  1.00 49.25 ? 102 ASP B N     1 
ATOM   2877 C  CA    . ASP B 1 104 ? 12.209  25.477 59.206  1.00 49.32 ? 102 ASP B CA    1 
ATOM   2878 C  C     . ASP B 1 104 ? 11.602  26.508 60.148  1.00 48.27 ? 102 ASP B C     1 
ATOM   2879 O  O     . ASP B 1 104 ? 11.555  27.698 59.837  1.00 48.88 ? 102 ASP B O     1 
ATOM   2880 C  CB    . ASP B 1 104 ? 13.534  24.988 59.798  1.00 51.70 ? 102 ASP B CB    1 
ATOM   2881 C  CG    . ASP B 1 104 ? 13.997  23.681 59.195  1.00 53.28 ? 102 ASP B CG    1 
ATOM   2882 O  OD1   . ASP B 1 104 ? 13.219  22.702 59.234  1.00 54.35 ? 102 ASP B OD1   1 
ATOM   2883 O  OD2   . ASP B 1 104 ? 15.140  23.632 58.693  1.00 54.73 ? 102 ASP B OD2   1 
ATOM   2884 N  N     . ASN B 1 105 ? 11.152  26.036 61.308  1.00 46.42 ? 103 ASN B N     1 
ATOM   2885 C  CA    . ASN B 1 105 ? 10.541  26.892 62.322  1.00 44.72 ? 103 ASN B CA    1 
ATOM   2886 C  C     . ASN B 1 105 ? 11.480  27.989 62.801  1.00 43.31 ? 103 ASN B C     1 
ATOM   2887 O  O     . ASN B 1 105 ? 12.698  27.835 62.764  1.00 44.14 ? 103 ASN B O     1 
ATOM   2888 C  CB    . ASN B 1 105 ? 10.112  26.062 63.536  1.00 44.70 ? 103 ASN B CB    1 
ATOM   2889 C  CG    . ASN B 1 105 ? 9.005   25.086 63.214  1.00 46.52 ? 103 ASN B CG    1 
ATOM   2890 O  OD1   . ASN B 1 105 ? 8.426   25.125 62.130  1.00 47.92 ? 103 ASN B OD1   1 
ATOM   2891 N  ND2   . ASN B 1 105 ? 8.692   24.208 64.163  1.00 45.93 ? 103 ASN B ND2   1 
ATOM   2892 N  N     . ALA B 1 106 ? 10.896  29.097 63.248  1.00 41.81 ? 104 ALA B N     1 
ATOM   2893 C  CA    . ALA B 1 106 ? 11.653  30.228 63.779  1.00 39.80 ? 104 ALA B CA    1 
ATOM   2894 C  C     . ALA B 1 106 ? 11.118  30.425 65.194  1.00 38.74 ? 104 ALA B C     1 
ATOM   2895 O  O     . ALA B 1 106 ? 9.911   30.538 65.389  1.00 38.59 ? 104 ALA B O     1 
ATOM   2896 C  CB    . ALA B 1 106 ? 11.408  31.472 62.941  1.00 40.94 ? 104 ALA B CB    1 
ATOM   2897 N  N     . ILE B 1 107 ? 12.010  30.463 66.180  1.00 37.68 ? 105 ILE B N     1 
ATOM   2898 C  CA    . ILE B 1 107 ? 11.584  30.600 67.569  1.00 35.28 ? 105 ILE B CA    1 
ATOM   2899 C  C     . ILE B 1 107 ? 12.064  31.866 68.279  1.00 32.69 ? 105 ILE B C     1 
ATOM   2900 O  O     . ILE B 1 107 ? 13.180  32.334 68.064  1.00 33.26 ? 105 ILE B O     1 
ATOM   2901 C  CB    . ILE B 1 107 ? 12.039  29.364 68.401  1.00 36.36 ? 105 ILE B CB    1 
ATOM   2902 C  CG1   . ILE B 1 107 ? 11.332  28.099 67.908  1.00 37.91 ? 105 ILE B CG1   1 
ATOM   2903 C  CG2   . ILE B 1 107 ? 11.716  29.562 69.868  1.00 35.65 ? 105 ILE B CG2   1 
ATOM   2904 C  CD1   . ILE B 1 107 ? 11.752  27.644 66.538  1.00 38.85 ? 105 ILE B CD1   1 
ATOM   2905 N  N     . ILE B 1 108 ? 11.193  32.416 69.121  1.00 30.88 ? 106 ILE B N     1 
ATOM   2906 C  CA    . ILE B 1 108 ? 11.499  33.600 69.920  1.00 29.39 ? 106 ILE B CA    1 
ATOM   2907 C  C     . ILE B 1 108 ? 11.080  33.221 71.342  1.00 26.87 ? 106 ILE B C     1 
ATOM   2908 O  O     . ILE B 1 108 ? 9.957   32.772 71.570  1.00 27.88 ? 106 ILE B O     1 
ATOM   2909 C  CB    . ILE B 1 108 ? 10.697  34.834 69.454  1.00 30.38 ? 106 ILE B CB    1 
ATOM   2910 C  CG1   . ILE B 1 108 ? 10.987  35.116 67.977  1.00 30.11 ? 106 ILE B CG1   1 
ATOM   2911 C  CG2   . ILE B 1 108 ? 11.084  36.047 70.285  1.00 29.38 ? 106 ILE B CG2   1 
ATOM   2912 C  CD1   . ILE B 1 108 ? 10.202  36.289 67.415  1.00 34.32 ? 106 ILE B CD1   1 
ATOM   2913 N  N     . THR B 1 109 ? 11.979  33.397 72.299  1.00 27.45 ? 107 THR B N     1 
ATOM   2914 C  CA    . THR B 1 109 ? 11.684  33.003 73.674  1.00 27.20 ? 107 THR B CA    1 
ATOM   2915 C  C     . THR B 1 109 ? 11.965  34.069 74.722  1.00 25.48 ? 107 THR B C     1 
ATOM   2916 O  O     . THR B 1 109 ? 12.941  34.806 74.618  1.00 25.67 ? 107 THR B O     1 
ATOM   2917 C  CB    . THR B 1 109 ? 12.492  31.734 74.038  1.00 27.74 ? 107 THR B CB    1 
ATOM   2918 O  OG1   . THR B 1 109 ? 12.087  30.658 73.185  1.00 31.73 ? 107 THR B OG1   1 
ATOM   2919 C  CG2   . THR B 1 109 ? 12.268  31.336 75.493  1.00 26.59 ? 107 THR B CG2   1 
ATOM   2920 N  N     . THR B 1 110 ? 11.098  34.147 75.727  1.00 27.42 ? 108 THR B N     1 
ATOM   2921 C  CA    . THR B 1 110 ? 11.285  35.108 76.808  1.00 27.87 ? 108 THR B CA    1 
ATOM   2922 C  C     . THR B 1 110 ? 11.675  34.315 78.048  1.00 28.35 ? 108 THR B C     1 
ATOM   2923 O  O     . THR B 1 110 ? 11.313  33.143 78.180  1.00 28.08 ? 108 THR B O     1 
ATOM   2924 C  CB    . THR B 1 110 ? 10.011  35.939 77.086  1.00 28.03 ? 108 THR B CB    1 
ATOM   2925 O  OG1   . THR B 1 110 ? 8.948   35.080 77.512  1.00 30.31 ? 108 THR B OG1   1 
ATOM   2926 C  CG2   . THR B 1 110 ? 9.588   36.687 75.824  1.00 30.85 ? 108 THR B CG2   1 
ATOM   2927 N  N     . THR B 1 111 ? 12.399  34.962 78.954  1.00 27.37 ? 109 THR B N     1 
ATOM   2928 C  CA    . THR B 1 111 ? 12.896  34.304 80.159  1.00 27.95 ? 109 THR B CA    1 
ATOM   2929 C  C     . THR B 1 111 ? 12.782  35.155 81.421  1.00 27.82 ? 109 THR B C     1 
ATOM   2930 O  O     . THR B 1 111 ? 13.356  34.809 82.452  1.00 26.69 ? 109 THR B O     1 
ATOM   2931 C  CB    . THR B 1 111 ? 14.386  33.965 79.983  1.00 30.19 ? 109 THR B CB    1 
ATOM   2932 O  OG1   . THR B 1 111 ? 15.117  35.175 79.709  1.00 29.07 ? 109 THR B OG1   1 
ATOM   2933 C  CG2   . THR B 1 111 ? 14.580  32.996 78.823  1.00 27.94 ? 109 THR B CG2   1 
ATOM   2934 N  N     . ALA B 1 112 ? 12.054  36.263 81.339  1.00 26.59 ? 110 ALA B N     1 
ATOM   2935 C  CA    . ALA B 1 112 ? 11.909  37.170 82.475  1.00 26.93 ? 110 ALA B CA    1 
ATOM   2936 C  C     . ALA B 1 112 ? 11.505  36.506 83.791  1.00 26.24 ? 110 ALA B C     1 
ATOM   2937 O  O     . ALA B 1 112 ? 12.059  36.830 84.840  1.00 28.80 ? 110 ALA B O     1 
ATOM   2938 C  CB    . ALA B 1 112 ? 10.916  38.295 82.126  1.00 25.71 ? 110 ALA B CB    1 
ATOM   2939 N  N     . ALA B 1 113 ? 10.536  35.596 83.751  1.00 26.67 ? 111 ALA B N     1 
ATOM   2940 C  CA    . ALA B 1 113 ? 10.093  34.925 84.973  1.00 25.90 ? 111 ALA B CA    1 
ATOM   2941 C  C     . ALA B 1 113 ? 11.279  34.229 85.643  1.00 26.95 ? 111 ALA B C     1 
ATOM   2942 O  O     . ALA B 1 113 ? 11.565  34.452 86.822  1.00 25.28 ? 111 ALA B O     1 
ATOM   2943 C  CB    . ALA B 1 113 ? 8.998   33.918 84.654  1.00 27.06 ? 111 ALA B CB    1 
ATOM   2944 N  N     . ALA B 1 114 ? 11.975  33.394 84.881  1.00 25.17 ? 112 ALA B N     1 
ATOM   2945 C  CA    . ALA B 1 114 ? 13.136  32.687 85.404  1.00 25.24 ? 112 ALA B CA    1 
ATOM   2946 C  C     . ALA B 1 114 ? 14.261  33.644 85.820  1.00 26.35 ? 112 ALA B C     1 
ATOM   2947 O  O     . ALA B 1 114 ? 14.870  33.470 86.876  1.00 25.58 ? 112 ALA B O     1 
ATOM   2948 C  CB    . ALA B 1 114 ? 13.649  31.696 84.357  1.00 24.51 ? 112 ALA B CB    1 
ATOM   2949 N  N     . ASP B 1 115 ? 14.534  34.657 84.999  1.00 26.00 ? 113 ASP B N     1 
ATOM   2950 C  CA    . ASP B 1 115 ? 15.611  35.603 85.304  1.00 26.41 ? 113 ASP B CA    1 
ATOM   2951 C  C     . ASP B 1 115 ? 15.453  36.341 86.629  1.00 25.60 ? 113 ASP B C     1 
ATOM   2952 O  O     . ASP B 1 115 ? 16.444  36.622 87.309  1.00 27.96 ? 113 ASP B O     1 
ATOM   2953 C  CB    . ASP B 1 115 ? 15.755  36.654 84.194  1.00 27.94 ? 113 ASP B CB    1 
ATOM   2954 C  CG    . ASP B 1 115 ? 16.086  36.051 82.845  1.00 30.69 ? 113 ASP B CG    1 
ATOM   2955 O  OD1   . ASP B 1 115 ? 16.736  34.988 82.804  1.00 30.25 ? 113 ASP B OD1   1 
ATOM   2956 O  OD2   . ASP B 1 115 ? 15.706  36.658 81.816  1.00 32.26 ? 113 ASP B OD2   1 
ATOM   2957 N  N     . THR B 1 116 ? 14.211  36.647 86.991  1.00 24.85 ? 114 THR B N     1 
ATOM   2958 C  CA    . THR B 1 116 ? 13.911  37.396 88.209  1.00 27.08 ? 114 THR B CA    1 
ATOM   2959 C  C     . THR B 1 116 ? 13.455  36.563 89.415  1.00 27.81 ? 114 THR B C     1 
ATOM   2960 O  O     . THR B 1 116 ? 13.028  37.115 90.435  1.00 28.14 ? 114 THR B O     1 
ATOM   2961 C  CB    . THR B 1 116 ? 12.847  38.466 87.919  1.00 26.44 ? 114 THR B CB    1 
ATOM   2962 O  OG1   . THR B 1 116 ? 11.639  37.833 87.483  1.00 30.56 ? 114 THR B OG1   1 
ATOM   2963 C  CG2   . THR B 1 116 ? 13.332  39.408 86.821  1.00 28.20 ? 114 THR B CG2   1 
ATOM   2964 N  N     . PHE B 1 117 ? 13.543  35.244 89.291  1.00 25.76 ? 115 PHE B N     1 
ATOM   2965 C  CA    . PHE B 1 117 ? 13.173  34.322 90.370  1.00 28.15 ? 115 PHE B CA    1 
ATOM   2966 C  C     . PHE B 1 117 ? 14.383  34.322 91.310  1.00 27.96 ? 115 PHE B C     1 
ATOM   2967 O  O     . PHE B 1 117 ? 15.404  33.723 90.996  1.00 31.13 ? 115 PHE B O     1 
ATOM   2968 C  CB    . PHE B 1 117 ? 12.956  32.922 89.774  1.00 27.70 ? 115 PHE B CB    1 
ATOM   2969 C  CG    . PHE B 1 117 ? 12.198  31.971 90.665  1.00 29.14 ? 115 PHE B CG    1 
ATOM   2970 C  CD1   . PHE B 1 117 ? 11.478  32.429 91.761  1.00 29.41 ? 115 PHE B CD1   1 
ATOM   2971 C  CD2   . PHE B 1 117 ? 12.154  30.613 90.356  1.00 29.80 ? 115 PHE B CD2   1 
ATOM   2972 C  CE1   . PHE B 1 117 ? 10.717  31.543 92.536  1.00 31.24 ? 115 PHE B CE1   1 
ATOM   2973 C  CE2   . PHE B 1 117 ? 11.400  29.725 91.118  1.00 27.53 ? 115 PHE B CE2   1 
ATOM   2974 C  CZ    . PHE B 1 117 ? 10.680  30.187 92.209  1.00 29.44 ? 115 PHE B CZ    1 
ATOM   2975 N  N     . SER B 1 118 ? 14.279  34.987 92.455  1.00 29.13 ? 116 SER B N     1 
ATOM   2976 C  CA    . SER B 1 118 ? 15.422  35.073 93.367  1.00 30.12 ? 116 SER B CA    1 
ATOM   2977 C  C     . SER B 1 118 ? 15.675  33.864 94.254  1.00 29.42 ? 116 SER B C     1 
ATOM   2978 O  O     . SER B 1 118 ? 14.759  33.117 94.600  1.00 27.42 ? 116 SER B O     1 
ATOM   2979 C  CB    . SER B 1 118 ? 15.300  36.313 94.253  1.00 31.36 ? 116 SER B CB    1 
ATOM   2980 O  OG    . SER B 1 118 ? 14.181  36.208 95.104  1.00 35.40 ? 116 SER B OG    1 
ATOM   2981 N  N     . LEU B 1 119 ? 16.940  33.695 94.625  1.00 31.39 ? 117 LEU B N     1 
ATOM   2982 C  CA    . LEU B 1 119 ? 17.353  32.597 95.484  1.00 33.97 ? 117 LEU B CA    1 
ATOM   2983 C  C     . LEU B 1 119 ? 16.548  32.558 96.774  1.00 34.82 ? 117 LEU B C     1 
ATOM   2984 O  O     . LEU B 1 119 ? 16.139  31.485 97.220  1.00 33.15 ? 117 LEU B O     1 
ATOM   2985 C  CB    . LEU B 1 119 ? 18.837  32.721 95.825  1.00 33.89 ? 117 LEU B CB    1 
ATOM   2986 C  CG    . LEU B 1 119 ? 19.837  32.306 94.751  1.00 36.61 ? 117 LEU B CG    1 
ATOM   2987 C  CD1   . LEU B 1 119 ? 21.249  32.553 95.250  1.00 34.43 ? 117 LEU B CD1   1 
ATOM   2988 C  CD2   . LEU B 1 119 ? 19.639  30.825 94.421  1.00 37.78 ? 117 LEU B CD2   1 
ATOM   2989 N  N     . ASP B 1 120 ? 16.321  33.731 97.368  1.00 35.58 ? 118 ASP B N     1 
ATOM   2990 C  CA    . ASP B 1 120 ? 15.574  33.823 98.620  1.00 36.88 ? 118 ASP B CA    1 
ATOM   2991 C  C     . ASP B 1 120 ? 14.151  33.334 98.464  1.00 35.72 ? 118 ASP B C     1 
ATOM   2992 O  O     . ASP B 1 120 ? 13.489  33.018 99.447  1.00 37.12 ? 118 ASP B O     1 
ATOM   2993 C  CB    . ASP B 1 120 ? 15.528  35.264 99.139  1.00 41.44 ? 118 ASP B CB    1 
ATOM   2994 C  CG    . ASP B 1 120 ? 16.899  35.827 99.434  1.00 45.92 ? 118 ASP B CG    1 
ATOM   2995 O  OD1   . ASP B 1 120 ? 17.829  35.032 99.690  1.00 48.12 ? 118 ASP B OD1   1 
ATOM   2996 O  OD2   . ASP B 1 120 ? 17.042  37.071 99.425  1.00 49.13 ? 118 ASP B OD2   1 
ATOM   2997 N  N     . GLU B 1 121 ? 13.673  33.284 97.230  1.00 33.84 ? 119 GLU B N     1 
ATOM   2998 C  CA    . GLU B 1 121 ? 12.314  32.838 96.978  1.00 34.09 ? 119 GLU B CA    1 
ATOM   2999 C  C     . GLU B 1 121 ? 12.293  31.376 96.558  1.00 31.49 ? 119 GLU B C     1 
ATOM   3000 O  O     . GLU B 1 121 ? 11.242  30.734 96.577  1.00 32.33 ? 119 GLU B O     1 
ATOM   3001 C  CB    . GLU B 1 121 ? 11.675  33.707 95.890  1.00 37.65 ? 119 GLU B CB    1 
ATOM   3002 C  CG    . GLU B 1 121 ? 11.709  35.193 96.214  1.00 45.68 ? 119 GLU B CG    1 
ATOM   3003 C  CD    . GLU B 1 121 ? 11.159  36.065 95.097  1.00 49.02 ? 119 GLU B CD    1 
ATOM   3004 O  OE1   . GLU B 1 121 ? 11.643  35.961 93.945  1.00 49.91 ? 119 GLU B OE1   1 
ATOM   3005 O  OE2   . GLU B 1 121 ? 10.242  36.864 95.380  1.00 52.24 ? 119 GLU B OE2   1 
HETATM 3006 N  N     . MSE B 1 122 ? 13.459  30.853 96.188  1.00 27.93 ? 120 MSE B N     1 
HETATM 3007 C  CA    . MSE B 1 122 ? 13.571  29.463 95.751  1.00 26.94 ? 120 MSE B CA    1 
HETATM 3008 C  C     . MSE B 1 122 ? 13.998  28.514 96.869  1.00 24.36 ? 120 MSE B C     1 
HETATM 3009 O  O     . MSE B 1 122 ? 13.378  27.475 97.077  1.00 24.37 ? 120 MSE B O     1 
HETATM 3010 C  CB    . MSE B 1 122 ? 14.571  29.354 94.598  1.00 28.04 ? 120 MSE B CB    1 
HETATM 3011 C  CG    . MSE B 1 122 ? 14.221  30.208 93.390  1.00 33.81 ? 120 MSE B CG    1 
HETATM 3012 SE SE    . MSE B 1 122 ? 15.495  29.964 91.943  1.00 43.44 ? 120 MSE B SE    1 
HETATM 3013 C  CE    . MSE B 1 122 ? 14.818  28.279 91.320  1.00 36.07 ? 120 MSE B CE    1 
ATOM   3014 N  N     . ILE B 1 123 ? 15.050  28.879 97.592  1.00 23.41 ? 121 ILE B N     1 
ATOM   3015 C  CA    . ILE B 1 123 ? 15.561  28.032 98.660  1.00 24.40 ? 121 ILE B CA    1 
ATOM   3016 C  C     . ILE B 1 123 ? 14.532  27.603 99.700  1.00 23.24 ? 121 ILE B C     1 
ATOM   3017 O  O     . ILE B 1 123 ? 14.583  26.477 100.181 1.00 23.63 ? 121 ILE B O     1 
ATOM   3018 C  CB    . ILE B 1 123 ? 16.804  28.684 99.334  1.00 25.78 ? 121 ILE B CB    1 
ATOM   3019 C  CG1   . ILE B 1 123 ? 18.008  28.553 98.389  1.00 27.73 ? 121 ILE B CG1   1 
ATOM   3020 C  CG2   . ILE B 1 123 ? 17.125  27.997 100.661 1.00 26.73 ? 121 ILE B CG2   1 
ATOM   3021 C  CD1   . ILE B 1 123 ? 19.279  29.251 98.871  1.00 30.38 ? 121 ILE B CD1   1 
ATOM   3022 N  N     . PRO B 1 124 ? 13.574  28.481 100.058 1.00 24.53 ? 122 PRO B N     1 
ATOM   3023 C  CA    . PRO B 1 124 ? 12.577  28.071 101.056 1.00 24.39 ? 122 PRO B CA    1 
ATOM   3024 C  C     . PRO B 1 124 ? 11.757  26.848 100.642 1.00 24.65 ? 122 PRO B C     1 
ATOM   3025 O  O     . PRO B 1 124 ? 11.270  26.097 101.494 1.00 24.28 ? 122 PRO B O     1 
ATOM   3026 C  CB    . PRO B 1 124 ? 11.705  29.314 101.204 1.00 23.23 ? 122 PRO B CB    1 
ATOM   3027 C  CG    . PRO B 1 124 ? 12.677  30.420 100.988 1.00 25.42 ? 122 PRO B CG    1 
ATOM   3028 C  CD    . PRO B 1 124 ? 13.491  29.931 99.804  1.00 24.20 ? 122 PRO B CD    1 
ATOM   3029 N  N     . HIS B 1 125 ? 11.597  26.634 99.339  1.00 24.39 ? 123 HIS B N     1 
ATOM   3030 C  CA    . HIS B 1 125 ? 10.803  25.493 98.904  1.00 24.29 ? 123 HIS B CA    1 
ATOM   3031 C  C     . HIS B 1 125 ? 11.537  24.163 99.015  1.00 22.43 ? 123 HIS B C     1 
ATOM   3032 O  O     . HIS B 1 125 ? 10.995  23.119 98.680  1.00 24.03 ? 123 HIS B O     1 
ATOM   3033 C  CB    . HIS B 1 125 ? 10.260  25.734 97.495  1.00 25.09 ? 123 HIS B CB    1 
ATOM   3034 C  CG    . HIS B 1 125 ? 9.304   26.883 97.434  1.00 27.65 ? 123 HIS B CG    1 
ATOM   3035 N  ND1   . HIS B 1 125 ? 9.583   28.055 96.762  1.00 29.30 ? 123 HIS B ND1   1 
ATOM   3036 C  CD2   . HIS B 1 125 ? 8.116   27.080 98.055  1.00 28.02 ? 123 HIS B CD2   1 
ATOM   3037 C  CE1   . HIS B 1 125 ? 8.611   28.925 96.975  1.00 27.53 ? 123 HIS B CE1   1 
ATOM   3038 N  NE2   . HIS B 1 125 ? 7.709   28.358 97.757  1.00 31.76 ? 123 HIS B NE2   1 
HETATM 3039 N  N     . MSE B 1 126 ? 12.767  24.207 99.508  1.00 23.29 ? 124 MSE B N     1 
HETATM 3040 C  CA    . MSE B 1 126 ? 13.544  22.989 99.715  1.00 25.46 ? 124 MSE B CA    1 
HETATM 3041 C  C     . MSE B 1 126 ? 13.744  22.810 101.221 1.00 24.87 ? 124 MSE B C     1 
HETATM 3042 O  O     . MSE B 1 126 ? 14.586  22.026 101.658 1.00 24.26 ? 124 MSE B O     1 
HETATM 3043 C  CB    . MSE B 1 126 ? 14.907  23.085 99.024  1.00 28.29 ? 124 MSE B CB    1 
HETATM 3044 C  CG    . MSE B 1 126 ? 14.864  22.854 97.528  1.00 36.00 ? 124 MSE B CG    1 
HETATM 3045 SE SE    . MSE B 1 126 ? 16.598  23.136 96.711  1.00 50.86 ? 124 MSE B SE    1 
HETATM 3046 C  CE    . MSE B 1 126 ? 17.327  21.416 96.909  1.00 40.46 ? 124 MSE B CE    1 
ATOM   3047 N  N     . ALA B 1 127 ? 12.962  23.542 102.010 1.00 22.68 ? 125 ALA B N     1 
ATOM   3048 C  CA    . ALA B 1 127 ? 13.079  23.468 103.466 1.00 23.63 ? 125 ALA B CA    1 
ATOM   3049 C  C     . ALA B 1 127 ? 12.720  22.101 104.035 1.00 23.61 ? 125 ALA B C     1 
ATOM   3050 O  O     . ALA B 1 127 ? 13.185  21.737 105.116 1.00 24.52 ? 125 ALA B O     1 
ATOM   3051 C  CB    . ALA B 1 127 ? 12.211  24.546 104.121 1.00 21.78 ? 125 ALA B CB    1 
ATOM   3052 N  N     . ASP B 1 128 ? 11.898  21.342 103.317 1.00 22.85 ? 126 ASP B N     1 
ATOM   3053 C  CA    . ASP B 1 128 ? 11.495  20.032 103.801 1.00 23.52 ? 126 ASP B CA    1 
ATOM   3054 C  C     . ASP B 1 128 ? 12.221  18.879 103.113 1.00 24.70 ? 126 ASP B C     1 
ATOM   3055 O  O     . ASP B 1 128 ? 11.730  17.747 103.092 1.00 25.39 ? 126 ASP B O     1 
ATOM   3056 C  CB    . ASP B 1 128 ? 9.984   19.862 103.643 1.00 23.77 ? 126 ASP B CB    1 
ATOM   3057 C  CG    . ASP B 1 128 ? 9.429   18.767 104.528 1.00 28.49 ? 126 ASP B CG    1 
ATOM   3058 O  OD1   . ASP B 1 128 ? 10.163  18.304 105.432 1.00 26.70 ? 126 ASP B OD1   1 
ATOM   3059 O  OD2   . ASP B 1 128 ? 8.257   18.379 104.331 1.00 29.28 ? 126 ASP B OD2   1 
ATOM   3060 N  N     . ALA B 1 129 ? 13.392  19.167 102.557 1.00 24.91 ? 127 ALA B N     1 
ATOM   3061 C  CA    . ALA B 1 129 ? 14.173  18.141 101.884 1.00 25.53 ? 127 ALA B CA    1 
ATOM   3062 C  C     . ALA B 1 129 ? 14.816  17.237 102.930 1.00 27.06 ? 127 ALA B C     1 
ATOM   3063 O  O     . ALA B 1 129 ? 14.964  17.614 104.092 1.00 26.44 ? 127 ALA B O     1 
ATOM   3064 C  CB    . ALA B 1 129 ? 15.246  18.781 101.024 1.00 25.29 ? 127 ALA B CB    1 
ATOM   3065 N  N     . VAL B 1 130 ? 15.188  16.039 102.512 1.00 27.55 ? 128 VAL B N     1 
ATOM   3066 C  CA    . VAL B 1 130 ? 15.828  15.086 103.405 1.00 28.29 ? 128 VAL B CA    1 
ATOM   3067 C  C     . VAL B 1 130 ? 17.027  14.508 102.675 1.00 28.28 ? 128 VAL B C     1 
ATOM   3068 O  O     . VAL B 1 130 ? 17.015  14.409 101.444 1.00 26.55 ? 128 VAL B O     1 
ATOM   3069 C  CB    . VAL B 1 130 ? 14.859  13.950 103.785 1.00 29.03 ? 128 VAL B CB    1 
ATOM   3070 C  CG1   . VAL B 1 130 ? 15.610  12.829 104.479 1.00 31.12 ? 128 VAL B CG1   1 
ATOM   3071 C  CG2   . VAL B 1 130 ? 13.768  14.491 104.693 1.00 27.65 ? 128 VAL B CG2   1 
ATOM   3072 N  N     . ALA B 1 131 ? 18.069  14.149 103.422 1.00 26.30 ? 129 ALA B N     1 
ATOM   3073 C  CA    . ALA B 1 131 ? 19.256  13.570 102.808 1.00 25.44 ? 129 ALA B CA    1 
ATOM   3074 C  C     . ALA B 1 131 ? 18.785  12.453 101.887 1.00 25.01 ? 129 ALA B C     1 
ATOM   3075 O  O     . ALA B 1 131 ? 17.904  11.674 102.248 1.00 24.04 ? 129 ALA B O     1 
ATOM   3076 C  CB    . ALA B 1 131 ? 20.191  13.018 103.878 1.00 26.62 ? 129 ALA B CB    1 
ATOM   3077 N  N     . GLY B 1 132 ? 19.357  12.385 100.690 1.00 24.42 ? 130 GLY B N     1 
ATOM   3078 C  CA    . GLY B 1 132 ? 18.951  11.350 99.756  1.00 26.03 ? 130 GLY B CA    1 
ATOM   3079 C  C     . GLY B 1 132 ? 18.031  11.887 98.677  1.00 25.86 ? 130 GLY B C     1 
ATOM   3080 O  O     . GLY B 1 132 ? 17.969  11.335 97.580  1.00 26.40 ? 130 GLY B O     1 
ATOM   3081 N  N     . ASP B 1 133 ? 17.305  12.961 98.975  1.00 25.68 ? 131 ASP B N     1 
ATOM   3082 C  CA    . ASP B 1 133 ? 16.427  13.537 97.966  1.00 24.39 ? 131 ASP B CA    1 
ATOM   3083 C  C     . ASP B 1 133 ? 17.312  14.043 96.841  1.00 23.07 ? 131 ASP B C     1 
ATOM   3084 O  O     . ASP B 1 133 ? 18.528  14.176 96.999  1.00 23.73 ? 131 ASP B O     1 
ATOM   3085 C  CB    . ASP B 1 133 ? 15.611  14.708 98.525  1.00 23.12 ? 131 ASP B CB    1 
ATOM   3086 C  CG    . ASP B 1 133 ? 14.485  14.260 99.440  1.00 25.34 ? 131 ASP B CG    1 
ATOM   3087 O  OD1   . ASP B 1 133 ? 14.167  13.049 99.476  1.00 23.61 ? 131 ASP B OD1   1 
ATOM   3088 O  OD2   . ASP B 1 133 ? 13.908  15.136 100.122 1.00 24.34 ? 131 ASP B OD2   1 
ATOM   3089 N  N     . ILE B 1 134 ? 16.699  14.346 95.709  1.00 21.24 ? 132 ILE B N     1 
ATOM   3090 C  CA    . ILE B 1 134 ? 17.451  14.827 94.563  1.00 23.81 ? 132 ILE B CA    1 
ATOM   3091 C  C     . ILE B 1 134 ? 17.114  16.250 94.127  1.00 21.26 ? 132 ILE B C     1 
ATOM   3092 O  O     . ILE B 1 134 ? 15.963  16.678 94.214  1.00 21.79 ? 132 ILE B O     1 
ATOM   3093 C  CB    . ILE B 1 134 ? 17.224  13.890 93.355  1.00 26.23 ? 132 ILE B CB    1 
ATOM   3094 C  CG1   . ILE B 1 134 ? 17.934  12.558 93.605  1.00 28.30 ? 132 ILE B CG1   1 
ATOM   3095 C  CG2   . ILE B 1 134 ? 17.706  14.547 92.061  1.00 26.07 ? 132 ILE B CG2   1 
ATOM   3096 C  CD1   . ILE B 1 134 ? 17.578  11.504 92.598  1.00 29.35 ? 132 ILE B CD1   1 
ATOM   3097 N  N     . LEU B 1 135 ? 18.136  16.987 93.694  1.00 20.23 ? 133 LEU B N     1 
ATOM   3098 C  CA    . LEU B 1 135 ? 17.927  18.324 93.143  1.00 20.19 ? 133 LEU B CA    1 
ATOM   3099 C  C     . LEU B 1 135 ? 18.349  18.175 91.688  1.00 19.34 ? 133 LEU B C     1 
ATOM   3100 O  O     . LEU B 1 135 ? 19.490  17.802 91.406  1.00 19.16 ? 133 LEU B O     1 
ATOM   3101 C  CB    . LEU B 1 135 ? 18.817  19.396 93.777  1.00 19.39 ? 133 LEU B CB    1 
ATOM   3102 C  CG    . LEU B 1 135 ? 18.716  20.707 92.971  1.00 19.81 ? 133 LEU B CG    1 
ATOM   3103 C  CD1   . LEU B 1 135 ? 17.284  21.256 93.062  1.00 19.74 ? 133 LEU B CD1   1 
ATOM   3104 C  CD2   . LEU B 1 135 ? 19.719  21.737 93.478  1.00 18.87 ? 133 LEU B CD2   1 
ATOM   3105 N  N     . LEU B 1 136 ? 17.418  18.445 90.779  1.00 20.44 ? 134 LEU B N     1 
ATOM   3106 C  CA    . LEU B 1 136 ? 17.665  18.363 89.345  1.00 19.65 ? 134 LEU B CA    1 
ATOM   3107 C  C     . LEU B 1 136 ? 17.579  19.777 88.789  1.00 19.52 ? 134 LEU B C     1 
ATOM   3108 O  O     . LEU B 1 136 ? 16.604  20.490 89.033  1.00 19.20 ? 134 LEU B O     1 
ATOM   3109 C  CB    . LEU B 1 136 ? 16.605  17.485 88.654  1.00 19.12 ? 134 LEU B CB    1 
ATOM   3110 C  CG    . LEU B 1 136 ? 16.510  17.656 87.129  1.00 19.77 ? 134 LEU B CG    1 
ATOM   3111 C  CD1   . LEU B 1 136 ? 17.803  17.178 86.472  1.00 17.90 ? 134 LEU B CD1   1 
ATOM   3112 C  CD2   . LEU B 1 136 ? 15.319  16.865 86.593  1.00 21.45 ? 134 LEU B CD2   1 
ATOM   3113 N  N     . GLN B 1 137 ? 18.604  20.172 88.046  1.00 19.62 ? 135 GLN B N     1 
ATOM   3114 C  CA    . GLN B 1 137 ? 18.659  21.494 87.445  1.00 20.33 ? 135 GLN B CA    1 
ATOM   3115 C  C     . GLN B 1 137 ? 19.042  21.426 85.980  1.00 19.17 ? 135 GLN B C     1 
ATOM   3116 O  O     . GLN B 1 137 ? 19.704  20.487 85.549  1.00 18.52 ? 135 GLN B O     1 
ATOM   3117 C  CB    . GLN B 1 137 ? 19.700  22.365 88.148  1.00 19.50 ? 135 GLN B CB    1 
ATOM   3118 C  CG    . GLN B 1 137 ? 19.273  22.948 89.466  1.00 25.04 ? 135 GLN B CG    1 
ATOM   3119 C  CD    . GLN B 1 137 ? 20.157  24.113 89.872  1.00 25.84 ? 135 GLN B CD    1 
ATOM   3120 O  OE1   . GLN B 1 137 ? 21.256  23.927 90.395  1.00 26.88 ? 135 GLN B OE1   1 
ATOM   3121 N  NE2   . GLN B 1 137 ? 19.686  25.323 89.608  1.00 27.74 ? 135 GLN B NE2   1 
ATOM   3122 N  N     . GLN B 1 138 ? 18.625  22.427 85.211  1.00 18.15 ? 136 GLN B N     1 
ATOM   3123 C  CA    . GLN B 1 138 ? 19.024  22.479 83.816  1.00 19.95 ? 136 GLN B CA    1 
ATOM   3124 C  C     . GLN B 1 138 ? 19.861  23.750 83.680  1.00 20.31 ? 136 GLN B C     1 
ATOM   3125 O  O     . GLN B 1 138 ? 20.500  24.169 84.645  1.00 21.11 ? 136 GLN B O     1 
ATOM   3126 C  CB    . GLN B 1 138 ? 17.812  22.502 82.878  1.00 18.46 ? 136 GLN B CB    1 
ATOM   3127 C  CG    . GLN B 1 138 ? 16.881  21.312 83.059  1.00 20.06 ? 136 GLN B CG    1 
ATOM   3128 C  CD    . GLN B 1 138 ? 15.981  21.476 84.266  1.00 21.00 ? 136 GLN B CD    1 
ATOM   3129 O  OE1   . GLN B 1 138 ? 15.561  22.582 84.574  1.00 20.22 ? 136 GLN B OE1   1 
ATOM   3130 N  NE2   . GLN B 1 138 ? 15.664  20.373 84.945  1.00 22.33 ? 136 GLN B NE2   1 
ATOM   3131 N  N     . GLY B 1 139 ? 19.862  24.371 82.509  1.00 21.24 ? 137 GLY B N     1 
ATOM   3132 C  CA    . GLY B 1 139 ? 20.677  25.560 82.344  1.00 23.25 ? 137 GLY B CA    1 
ATOM   3133 C  C     . GLY B 1 139 ? 19.929  26.857 82.123  1.00 25.25 ? 137 GLY B C     1 
ATOM   3134 O  O     . GLY B 1 139 ? 20.461  27.778 81.504  1.00 24.89 ? 137 GLY B O     1 
ATOM   3135 N  N     . ASN B 1 140 ? 18.712  26.956 82.638  1.00 25.13 ? 138 ASN B N     1 
ATOM   3136 C  CA    . ASN B 1 140 ? 17.934  28.167 82.435  1.00 26.88 ? 138 ASN B CA    1 
ATOM   3137 C  C     . ASN B 1 140 ? 18.103  29.233 83.518  1.00 27.27 ? 138 ASN B C     1 
ATOM   3138 O  O     . ASN B 1 140 ? 17.344  30.195 83.567  1.00 29.78 ? 138 ASN B O     1 
ATOM   3139 C  CB    . ASN B 1 140 ? 16.463  27.799 82.246  1.00 26.90 ? 138 ASN B CB    1 
ATOM   3140 C  CG    . ASN B 1 140 ? 16.262  26.833 81.092  1.00 29.73 ? 138 ASN B CG    1 
ATOM   3141 O  OD1   . ASN B 1 140 ? 15.985  25.650 81.291  1.00 30.49 ? 138 ASN B OD1   1 
ATOM   3142 N  ND2   . ASN B 1 140 ? 16.425  27.334 79.873  1.00 29.05 ? 138 ASN B ND2   1 
ATOM   3143 N  N     . PHE B 1 141 ? 19.106  29.066 84.373  1.00 25.51 ? 139 PHE B N     1 
ATOM   3144 C  CA    . PHE B 1 141 ? 19.391  30.044 85.422  1.00 27.21 ? 139 PHE B CA    1 
ATOM   3145 C  C     . PHE B 1 141 ? 20.832  30.520 85.299  1.00 26.62 ? 139 PHE B C     1 
ATOM   3146 O  O     . PHE B 1 141 ? 21.669  29.855 84.686  1.00 26.77 ? 139 PHE B O     1 
ATOM   3147 C  CB    . PHE B 1 141 ? 19.192  29.455 86.829  1.00 26.43 ? 139 PHE B CB    1 
ATOM   3148 C  CG    . PHE B 1 141 ? 17.755  29.227 87.204  1.00 27.18 ? 139 PHE B CG    1 
ATOM   3149 C  CD1   . PHE B 1 141 ? 16.798  30.216 86.995  1.00 27.33 ? 139 PHE B CD1   1 
ATOM   3150 C  CD2   . PHE B 1 141 ? 17.357  28.022 87.778  1.00 28.73 ? 139 PHE B CD2   1 
ATOM   3151 C  CE1   . PHE B 1 141 ? 15.465  30.008 87.351  1.00 25.18 ? 139 PHE B CE1   1 
ATOM   3152 C  CE2   . PHE B 1 141 ? 16.031  27.805 88.137  1.00 27.75 ? 139 PHE B CE2   1 
ATOM   3153 C  CZ    . PHE B 1 141 ? 15.081  28.804 87.921  1.00 28.21 ? 139 PHE B CZ    1 
ATOM   3154 N  N     . SER B 1 142 ? 21.115  31.672 85.894  1.00 27.34 ? 140 SER B N     1 
ATOM   3155 C  CA    . SER B 1 142 ? 22.459  32.244 85.876  1.00 28.69 ? 140 SER B CA    1 
ATOM   3156 C  C     . SER B 1 142 ? 23.433  31.316 86.589  1.00 28.75 ? 140 SER B C     1 
ATOM   3157 O  O     . SER B 1 142 ? 23.024  30.453 87.363  1.00 29.48 ? 140 SER B O     1 
ATOM   3158 C  CB    . SER B 1 142 ? 22.465  33.583 86.608  1.00 28.88 ? 140 SER B CB    1 
ATOM   3159 O  OG    . SER B 1 142 ? 22.192  33.377 87.984  1.00 26.24 ? 140 SER B OG    1 
ATOM   3160 N  N     . LEU B 1 143 ? 24.722  31.522 86.352  1.00 29.78 ? 141 LEU B N     1 
ATOM   3161 C  CA    . LEU B 1 143 ? 25.748  30.715 86.991  1.00 30.70 ? 141 LEU B CA    1 
ATOM   3162 C  C     . LEU B 1 143 ? 25.665  30.797 88.513  1.00 31.36 ? 141 LEU B C     1 
ATOM   3163 O  O     . LEU B 1 143 ? 25.676  29.772 89.200  1.00 30.00 ? 141 LEU B O     1 
ATOM   3164 C  CB    . LEU B 1 143 ? 27.140  31.173 86.556  1.00 33.13 ? 141 LEU B CB    1 
ATOM   3165 C  CG    . LEU B 1 143 ? 28.263  30.507 87.356  1.00 34.40 ? 141 LEU B CG    1 
ATOM   3166 C  CD1   . LEU B 1 143 ? 28.308  29.022 87.015  1.00 35.24 ? 141 LEU B CD1   1 
ATOM   3167 C  CD2   . LEU B 1 143 ? 29.598  31.172 87.048  1.00 36.34 ? 141 LEU B CD2   1 
ATOM   3168 N  N     . ASP B 1 144 ? 25.598  32.019 89.038  1.00 30.40 ? 142 ASP B N     1 
ATOM   3169 C  CA    . ASP B 1 144 ? 25.540  32.210 90.485  1.00 29.89 ? 142 ASP B CA    1 
ATOM   3170 C  C     . ASP B 1 144 ? 24.360  31.503 91.131  1.00 28.31 ? 142 ASP B C     1 
ATOM   3171 O  O     . ASP B 1 144 ? 24.513  30.856 92.163  1.00 25.45 ? 142 ASP B O     1 
ATOM   3172 C  CB    . ASP B 1 144 ? 25.493  33.700 90.841  1.00 32.88 ? 142 ASP B CB    1 
ATOM   3173 C  CG    . ASP B 1 144 ? 26.793  34.417 90.528  1.00 35.02 ? 142 ASP B CG    1 
ATOM   3174 O  OD1   . ASP B 1 144 ? 27.837  33.743 90.416  1.00 39.40 ? 142 ASP B OD1   1 
ATOM   3175 O  OD2   . ASP B 1 144 ? 26.772  35.661 90.410  1.00 37.12 ? 142 ASP B OD2   1 
ATOM   3176 N  N     . LYS B 1 145 ? 23.182  31.635 90.530  1.00 26.17 ? 143 LYS B N     1 
ATOM   3177 C  CA    . LYS B 1 145 ? 21.994  30.991 91.064  1.00 27.52 ? 143 LYS B CA    1 
ATOM   3178 C  C     . LYS B 1 145 ? 22.098  29.472 90.961  1.00 26.01 ? 143 LYS B C     1 
ATOM   3179 O  O     . LYS B 1 145 ? 21.793  28.761 91.921  1.00 26.02 ? 143 LYS B O     1 
ATOM   3180 C  CB    . LYS B 1 145 ? 20.750  31.505 90.334  1.00 29.84 ? 143 LYS B CB    1 
ATOM   3181 C  CG    . LYS B 1 145 ? 20.442  32.956 90.686  1.00 33.82 ? 143 LYS B CG    1 
ATOM   3182 C  CD    . LYS B 1 145 ? 19.427  33.594 89.758  1.00 35.56 ? 143 LYS B CD    1 
ATOM   3183 C  CE    . LYS B 1 145 ? 18.068  32.950 89.862  1.00 36.27 ? 143 LYS B CE    1 
ATOM   3184 N  NZ    . LYS B 1 145 ? 17.083  33.747 89.078  1.00 34.73 ? 143 LYS B NZ    1 
ATOM   3185 N  N     . THR B 1 146 ? 22.543  28.979 89.808  1.00 24.63 ? 144 THR B N     1 
ATOM   3186 C  CA    . THR B 1 146 ? 22.692  27.539 89.604  1.00 24.69 ? 144 THR B CA    1 
ATOM   3187 C  C     . THR B 1 146 ? 23.658  26.949 90.635  1.00 23.03 ? 144 THR B C     1 
ATOM   3188 O  O     . THR B 1 146 ? 23.357  25.947 91.281  1.00 23.15 ? 144 THR B O     1 
ATOM   3189 C  CB    . THR B 1 146 ? 23.208  27.235 88.177  1.00 23.49 ? 144 THR B CB    1 
ATOM   3190 O  OG1   . THR B 1 146 ? 22.311  27.806 87.215  1.00 22.85 ? 144 THR B OG1   1 
ATOM   3191 C  CG2   . THR B 1 146 ? 23.290  25.745 87.943  1.00 23.45 ? 144 THR B CG2   1 
ATOM   3192 N  N     . ARG B 1 147 ? 24.814  27.582 90.802  1.00 23.34 ? 145 ARG B N     1 
ATOM   3193 C  CA    . ARG B 1 147 ? 25.801  27.096 91.762  1.00 23.98 ? 145 ARG B CA    1 
ATOM   3194 C  C     . ARG B 1 147 ? 25.278  27.163 93.194  1.00 23.51 ? 145 ARG B C     1 
ATOM   3195 O  O     . ARG B 1 147 ? 25.470  26.232 93.972  1.00 21.80 ? 145 ARG B O     1 
ATOM   3196 C  CB    . ARG B 1 147 ? 27.103  27.901 91.658  1.00 26.37 ? 145 ARG B CB    1 
ATOM   3197 C  CG    . ARG B 1 147 ? 28.187  27.458 92.645  1.00 31.93 ? 145 ARG B CG    1 
ATOM   3198 C  CD    . ARG B 1 147 ? 29.483  28.208 92.385  1.00 36.60 ? 145 ARG B CD    1 
ATOM   3199 N  NE    . ARG B 1 147 ? 29.247  29.644 92.405  1.00 42.31 ? 145 ARG B NE    1 
ATOM   3200 C  CZ    . ARG B 1 147 ? 29.858  30.516 91.611  1.00 44.62 ? 145 ARG B CZ    1 
ATOM   3201 N  NH1   . ARG B 1 147 ? 30.754  30.100 90.724  1.00 44.56 ? 145 ARG B NH1   1 
ATOM   3202 N  NH2   . ARG B 1 147 ? 29.561  31.806 91.697  1.00 46.35 ? 145 ARG B NH2   1 
ATOM   3203 N  N     . ALA B 1 148 ? 24.620  28.268 93.536  1.00 22.18 ? 146 ALA B N     1 
ATOM   3204 C  CA    . ALA B 1 148 ? 24.081  28.443 94.880  1.00 22.52 ? 146 ALA B CA    1 
ATOM   3205 C  C     . ALA B 1 148 ? 23.051  27.360 95.200  1.00 22.43 ? 146 ALA B C     1 
ATOM   3206 O  O     . ALA B 1 148 ? 22.996  26.855 96.327  1.00 20.10 ? 146 ALA B O     1 
ATOM   3207 C  CB    . ALA B 1 148 ? 23.447  29.828 95.015  1.00 23.60 ? 146 ALA B CB    1 
ATOM   3208 N  N     . LEU B 1 149 ? 22.237  27.006 94.207  1.00 22.09 ? 147 LEU B N     1 
ATOM   3209 C  CA    . LEU B 1 149 ? 21.221  25.979 94.394  1.00 21.27 ? 147 LEU B CA    1 
ATOM   3210 C  C     . LEU B 1 149 ? 21.862  24.606 94.612  1.00 20.07 ? 147 LEU B C     1 
ATOM   3211 O  O     . LEU B 1 149 ? 21.421  23.845 95.471  1.00 20.79 ? 147 LEU B O     1 
ATOM   3212 C  CB    . LEU B 1 149 ? 20.269  25.953 93.194  1.00 21.44 ? 147 LEU B CB    1 
ATOM   3213 C  CG    . LEU B 1 149 ? 19.346  27.182 93.122  1.00 23.70 ? 147 LEU B CG    1 
ATOM   3214 C  CD1   . LEU B 1 149 ? 18.633  27.236 91.781  1.00 24.19 ? 147 LEU B CD1   1 
ATOM   3215 C  CD2   . LEU B 1 149 ? 18.340  27.138 94.269  1.00 22.83 ? 147 LEU B CD2   1 
ATOM   3216 N  N     . PHE B 1 150 ? 22.896  24.286 93.839  1.00 20.62 ? 148 PHE B N     1 
ATOM   3217 C  CA    . PHE B 1 150 ? 23.581  23.007 94.011  1.00 21.05 ? 148 PHE B CA    1 
ATOM   3218 C  C     . PHE B 1 150 ? 24.291  22.962 95.371  1.00 22.20 ? 148 PHE B C     1 
ATOM   3219 O  O     . PHE B 1 150 ? 24.318  21.924 96.035  1.00 21.16 ? 148 PHE B O     1 
ATOM   3220 C  CB    . PHE B 1 150 ? 24.590  22.783 92.879  1.00 21.67 ? 148 PHE B CB    1 
ATOM   3221 C  CG    . PHE B 1 150 ? 23.978  22.206 91.625  1.00 21.43 ? 148 PHE B CG    1 
ATOM   3222 C  CD1   . PHE B 1 150 ? 24.336  22.695 90.374  1.00 20.60 ? 148 PHE B CD1   1 
ATOM   3223 C  CD2   . PHE B 1 150 ? 23.049  21.169 91.698  1.00 19.79 ? 148 PHE B CD2   1 
ATOM   3224 C  CE1   . PHE B 1 150 ? 23.778  22.161 89.204  1.00 21.44 ? 148 PHE B CE1   1 
ATOM   3225 C  CE2   . PHE B 1 150 ? 22.485  20.628 90.537  1.00 18.88 ? 148 PHE B CE2   1 
ATOM   3226 C  CZ    . PHE B 1 150 ? 22.853  21.128 89.289  1.00 21.72 ? 148 PHE B CZ    1 
ATOM   3227 N  N     . GLN B 1 151 ? 24.873  24.089 95.778  1.00 24.30 ? 149 GLN B N     1 
ATOM   3228 C  CA    . GLN B 1 151 ? 25.553  24.155 97.071  1.00 25.38 ? 149 GLN B CA    1 
ATOM   3229 C  C     . GLN B 1 151 ? 24.565  23.914 98.206  1.00 24.57 ? 149 GLN B C     1 
ATOM   3230 O  O     . GLN B 1 151 ? 24.866  23.191 99.160  1.00 23.55 ? 149 GLN B O     1 
ATOM   3231 C  CB    . GLN B 1 151 ? 26.250  25.511 97.247  1.00 27.51 ? 149 GLN B CB    1 
ATOM   3232 C  CG    . GLN B 1 151 ? 27.455  25.682 96.330  1.00 30.61 ? 149 GLN B CG    1 
ATOM   3233 C  CD    . GLN B 1 151 ? 28.075  27.066 96.412  1.00 34.77 ? 149 GLN B CD    1 
ATOM   3234 O  OE1   . GLN B 1 151 ? 27.369  28.077 96.407  1.00 35.53 ? 149 GLN B OE1   1 
ATOM   3235 N  NE2   . GLN B 1 151 ? 29.401  27.117 96.468  1.00 35.31 ? 149 GLN B NE2   1 
ATOM   3236 N  N     . TYR B 1 152 ? 23.376  24.502 98.105  1.00 24.15 ? 150 TYR B N     1 
ATOM   3237 C  CA    . TYR B 1 152 ? 22.383  24.297 99.145  1.00 21.95 ? 150 TYR B CA    1 
ATOM   3238 C  C     . TYR B 1 152 ? 21.993  22.825 99.185  1.00 22.96 ? 150 TYR B C     1 
ATOM   3239 O  O     . TYR B 1 152 ? 21.946  22.226 100.256 1.00 22.96 ? 150 TYR B O     1 
ATOM   3240 C  CB    . TYR B 1 152 ? 21.133  25.146 98.912  1.00 21.06 ? 150 TYR B CB    1 
ATOM   3241 C  CG    . TYR B 1 152 ? 20.166  25.048 100.073 1.00 20.52 ? 150 TYR B CG    1 
ATOM   3242 C  CD1   . TYR B 1 152 ? 20.467  25.640 101.301 1.00 23.99 ? 150 TYR B CD1   1 
ATOM   3243 C  CD2   . TYR B 1 152 ? 18.986  24.317 99.968  1.00 21.19 ? 150 TYR B CD2   1 
ATOM   3244 C  CE1   . TYR B 1 152 ? 19.622  25.501 102.399 1.00 22.84 ? 150 TYR B CE1   1 
ATOM   3245 C  CE2   . TYR B 1 152 ? 18.126  24.170 101.062 1.00 23.12 ? 150 TYR B CE2   1 
ATOM   3246 C  CZ    . TYR B 1 152 ? 18.453  24.764 102.273 1.00 24.22 ? 150 TYR B CZ    1 
ATOM   3247 O  OH    . TYR B 1 152 ? 17.614  24.622 103.354 1.00 24.37 ? 150 TYR B OH    1 
ATOM   3248 N  N     . ALA B 1 153 ? 21.724  22.235 98.018  1.00 21.42 ? 151 ALA B N     1 
ATOM   3249 C  CA    . ALA B 1 153 ? 21.347  20.821 97.955  1.00 21.16 ? 151 ALA B CA    1 
ATOM   3250 C  C     . ALA B 1 153 ? 22.411  19.971 98.657  1.00 21.68 ? 151 ALA B C     1 
ATOM   3251 O  O     . ALA B 1 153 ? 22.098  19.043 99.411  1.00 21.82 ? 151 ALA B O     1 
ATOM   3252 C  CB    . ALA B 1 153 ? 21.196  20.372 96.491  1.00 21.61 ? 151 ALA B CB    1 
ATOM   3253 N  N     . ARG B 1 154 ? 23.669  20.299 98.392  1.00 21.42 ? 152 ARG B N     1 
ATOM   3254 C  CA    . ARG B 1 154 ? 24.800  19.604 98.997  1.00 24.74 ? 152 ARG B CA    1 
ATOM   3255 C  C     . ARG B 1 154 ? 24.736  19.691 100.523 1.00 24.52 ? 152 ARG B C     1 
ATOM   3256 O  O     . ARG B 1 154 ? 24.991  18.711 101.214 1.00 23.74 ? 152 ARG B O     1 
ATOM   3257 C  CB    . ARG B 1 154 ? 26.101  20.237 98.498  1.00 26.81 ? 152 ARG B CB    1 
ATOM   3258 C  CG    . ARG B 1 154 ? 27.081  19.277 97.864  1.00 31.28 ? 152 ARG B CG    1 
ATOM   3259 C  CD    . ARG B 1 154 ? 26.401  18.207 97.042  1.00 32.85 ? 152 ARG B CD    1 
ATOM   3260 N  NE    . ARG B 1 154 ? 27.360  17.491 96.202  1.00 35.68 ? 152 ARG B NE    1 
ATOM   3261 C  CZ    . ARG B 1 154 ? 27.152  16.281 95.700  1.00 36.16 ? 152 ARG B CZ    1 
ATOM   3262 N  NH1   . ARG B 1 154 ? 26.018  15.641 95.962  1.00 35.81 ? 152 ARG B NH1   1 
ATOM   3263 N  NH2   . ARG B 1 154 ? 28.067  15.722 94.915  1.00 37.70 ? 152 ARG B NH2   1 
ATOM   3264 N  N     . SER B 1 155 ? 24.381  20.863 101.044 1.00 25.41 ? 153 SER B N     1 
ATOM   3265 C  CA    . SER B 1 155 ? 24.300  21.054 102.487 1.00 25.27 ? 153 SER B CA    1 
ATOM   3266 C  C     . SER B 1 155 ? 23.141  20.266 103.096 1.00 27.30 ? 153 SER B C     1 
ATOM   3267 O  O     . SER B 1 155 ? 23.143  19.971 104.296 1.00 28.17 ? 153 SER B O     1 
ATOM   3268 C  CB    . SER B 1 155 ? 24.172  22.549 102.828 1.00 26.89 ? 153 SER B CB    1 
ATOM   3269 O  OG    . SER B 1 155 ? 22.947  23.105 102.378 1.00 27.50 ? 153 SER B OG    1 
ATOM   3270 N  N     . ARG B 1 156 ? 22.156  19.920 102.266 1.00 25.00 ? 154 ARG B N     1 
ATOM   3271 C  CA    . ARG B 1 156 ? 21.009  19.145 102.726 1.00 24.10 ? 154 ARG B CA    1 
ATOM   3272 C  C     . ARG B 1 156 ? 21.269  17.653 102.509 1.00 23.66 ? 154 ARG B C     1 
ATOM   3273 O  O     . ARG B 1 156 ? 20.409  16.819 102.802 1.00 24.40 ? 154 ARG B O     1 
ATOM   3274 C  CB    . ARG B 1 156 ? 19.732  19.545 101.966 1.00 24.72 ? 154 ARG B CB    1 
ATOM   3275 C  CG    . ARG B 1 156 ? 19.278  20.997 102.158 1.00 25.82 ? 154 ARG B CG    1 
ATOM   3276 C  CD    . ARG B 1 156 ? 18.844  21.319 103.589 1.00 26.56 ? 154 ARG B CD    1 
ATOM   3277 N  NE    . ARG B 1 156 ? 17.697  20.524 104.031 1.00 25.04 ? 154 ARG B NE    1 
ATOM   3278 C  CZ    . ARG B 1 156 ? 16.625  21.021 104.646 1.00 22.59 ? 154 ARG B CZ    1 
ATOM   3279 N  NH1   . ARG B 1 156 ? 16.535  22.321 104.898 1.00 25.14 ? 154 ARG B NH1   1 
ATOM   3280 N  NH2   . ARG B 1 156 ? 15.637  20.218 105.021 1.00 21.87 ? 154 ARG B NH2   1 
ATOM   3281 N  N     . GLY B 1 157 ? 22.450  17.327 101.989 1.00 23.47 ? 155 GLY B N     1 
ATOM   3282 C  CA    . GLY B 1 157 ? 22.806  15.938 101.730 1.00 25.33 ? 155 GLY B CA    1 
ATOM   3283 C  C     . GLY B 1 157 ? 22.028  15.334 100.570 1.00 26.05 ? 155 GLY B C     1 
ATOM   3284 O  O     . GLY B 1 157 ? 21.774  14.130 100.526 1.00 24.14 ? 155 GLY B O     1 
HETATM 3285 N  N     . MSE B 1 158 ? 21.647  16.178 99.622  1.00 25.09 ? 156 MSE B N     1 
HETATM 3286 C  CA    . MSE B 1 158 ? 20.884  15.729 98.466  1.00 24.91 ? 156 MSE B CA    1 
HETATM 3287 C  C     . MSE B 1 158 ? 21.784  15.293 97.318  1.00 24.16 ? 156 MSE B C     1 
HETATM 3288 O  O     . MSE B 1 158 ? 22.944  15.702 97.230  1.00 22.96 ? 156 MSE B O     1 
HETATM 3289 C  CB    . MSE B 1 158 ? 19.974  16.858 97.978  1.00 25.46 ? 156 MSE B CB    1 
HETATM 3290 C  CG    . MSE B 1 158 ? 18.947  17.293 98.997  1.00 28.71 ? 156 MSE B CG    1 
HETATM 3291 SE SE    . MSE B 1 158 ? 18.113  18.976 98.519  1.00 34.89 ? 156 MSE B SE    1 
HETATM 3292 C  CE    . MSE B 1 158 ? 16.890  18.298 97.157  1.00 33.13 ? 156 MSE B CE    1 
ATOM   3293 N  N     . THR B 1 159 ? 21.235  14.447 96.450  1.00 23.89 ? 157 THR B N     1 
ATOM   3294 C  CA    . THR B 1 159 ? 21.947  13.982 95.271  1.00 23.09 ? 157 THR B CA    1 
ATOM   3295 C  C     . THR B 1 159 ? 21.672  15.026 94.199  1.00 22.78 ? 157 THR B C     1 
ATOM   3296 O  O     . THR B 1 159 ? 20.540  15.474 94.030  1.00 21.26 ? 157 THR B O     1 
ATOM   3297 C  CB    . THR B 1 159 ? 21.427  12.611 94.802  1.00 24.09 ? 157 THR B CB    1 
ATOM   3298 O  OG1   . THR B 1 159 ? 21.783  11.620 95.774  1.00 25.76 ? 157 THR B OG1   1 
ATOM   3299 C  CG2   . THR B 1 159 ? 22.037  12.232 93.453  1.00 22.78 ? 157 THR B CG2   1 
ATOM   3300 N  N     . THR B 1 160 ? 22.711  15.407 93.471  1.00 23.03 ? 158 THR B N     1 
ATOM   3301 C  CA    . THR B 1 160 ? 22.574  16.431 92.450  1.00 21.36 ? 158 THR B CA    1 
ATOM   3302 C  C     . THR B 1 160 ? 22.657  15.898 91.028  1.00 20.89 ? 158 THR B C     1 
ATOM   3303 O  O     . THR B 1 160 ? 23.518  15.083 90.707  1.00 20.23 ? 158 THR B O     1 
ATOM   3304 C  CB    . THR B 1 160 ? 23.652  17.515 92.637  1.00 23.53 ? 158 THR B CB    1 
ATOM   3305 O  OG1   . THR B 1 160 ? 24.956  16.911 92.625  1.00 22.11 ? 158 THR B OG1   1 
ATOM   3306 C  CG2   . THR B 1 160 ? 23.444  18.242 93.961  1.00 22.15 ? 158 THR B CG2   1 
ATOM   3307 N  N     . VAL B 1 161 ? 21.746  16.372 90.185  1.00 21.26 ? 159 VAL B N     1 
ATOM   3308 C  CA    . VAL B 1 161 ? 21.704  15.980 88.783  1.00 20.49 ? 159 VAL B CA    1 
ATOM   3309 C  C     . VAL B 1 161 ? 21.736  17.267 87.965  1.00 21.15 ? 159 VAL B C     1 
ATOM   3310 O  O     . VAL B 1 161 ? 20.974  18.199 88.231  1.00 18.79 ? 159 VAL B O     1 
ATOM   3311 C  CB    . VAL B 1 161 ? 20.417  15.209 88.455  1.00 21.46 ? 159 VAL B CB    1 
ATOM   3312 C  CG1   . VAL B 1 161 ? 20.455  14.739 87.009  1.00 20.19 ? 159 VAL B CG1   1 
ATOM   3313 C  CG2   . VAL B 1 161 ? 20.258  14.034 89.416  1.00 20.94 ? 159 VAL B CG2   1 
ATOM   3314 N  N     . PHE B 1 162 ? 22.599  17.305 86.956  1.00 19.94 ? 160 PHE B N     1 
ATOM   3315 C  CA    . PHE B 1 162 ? 22.738  18.500 86.142  1.00 21.79 ? 160 PHE B CA    1 
ATOM   3316 C  C     . PHE B 1 162 ? 22.673  18.219 84.638  1.00 23.11 ? 160 PHE B C     1 
ATOM   3317 O  O     . PHE B 1 162 ? 23.328  17.305 84.122  1.00 24.07 ? 160 PHE B O     1 
ATOM   3318 C  CB    . PHE B 1 162 ? 24.063  19.185 86.518  1.00 19.80 ? 160 PHE B CB    1 
ATOM   3319 C  CG    . PHE B 1 162 ? 24.232  20.576 85.960  1.00 21.25 ? 160 PHE B CG    1 
ATOM   3320 C  CD1   . PHE B 1 162 ? 23.137  21.420 85.782  1.00 22.02 ? 160 PHE B CD1   1 
ATOM   3321 C  CD2   . PHE B 1 162 ? 25.508  21.068 85.686  1.00 22.44 ? 160 PHE B CD2   1 
ATOM   3322 C  CE1   . PHE B 1 162 ? 23.308  22.737 85.344  1.00 23.18 ? 160 PHE B CE1   1 
ATOM   3323 C  CE2   . PHE B 1 162 ? 25.692  22.386 85.247  1.00 23.17 ? 160 PHE B CE2   1 
ATOM   3324 C  CZ    . PHE B 1 162 ? 24.586  23.221 85.077  1.00 22.54 ? 160 PHE B CZ    1 
ATOM   3325 N  N     . ASN B 1 163 ? 21.840  19.008 83.960  1.00 21.87 ? 161 ASN B N     1 
ATOM   3326 C  CA    . ASN B 1 163 ? 21.651  18.954 82.515  1.00 20.46 ? 161 ASN B CA    1 
ATOM   3327 C  C     . ASN B 1 163 ? 21.922  20.390 82.064  1.00 21.50 ? 161 ASN B C     1 
ATOM   3328 O  O     . ASN B 1 163 ? 20.995  21.174 81.859  1.00 19.93 ? 161 ASN B O     1 
ATOM   3329 C  CB    . ASN B 1 163 ? 20.211  18.554 82.186  1.00 19.62 ? 161 ASN B CB    1 
ATOM   3330 C  CG    . ASN B 1 163 ? 19.924  18.599 80.704  1.00 19.48 ? 161 ASN B CG    1 
ATOM   3331 O  OD1   . ASN B 1 163 ? 20.763  18.219 79.884  1.00 23.24 ? 161 ASN B OD1   1 
ATOM   3332 N  ND2   . ASN B 1 163 ? 18.738  19.055 80.351  1.00 16.85 ? 161 ASN B ND2   1 
ATOM   3333 N  N     . PRO B 1 164 ? 23.210  20.744 81.902  1.00 23.97 ? 162 PRO B N     1 
ATOM   3334 C  CA    . PRO B 1 164 ? 23.677  22.073 81.494  1.00 24.22 ? 162 PRO B CA    1 
ATOM   3335 C  C     . PRO B 1 164 ? 23.250  22.521 80.107  1.00 25.49 ? 162 PRO B C     1 
ATOM   3336 O  O     . PRO B 1 164 ? 24.088  22.755 79.234  1.00 24.94 ? 162 PRO B O     1 
ATOM   3337 C  CB    . PRO B 1 164 ? 25.193  21.959 81.644  1.00 25.12 ? 162 PRO B CB    1 
ATOM   3338 C  CG    . PRO B 1 164 ? 25.443  20.548 81.241  1.00 25.69 ? 162 PRO B CG    1 
ATOM   3339 C  CD    . PRO B 1 164 ? 24.339  19.792 81.956  1.00 24.32 ? 162 PRO B CD    1 
ATOM   3340 N  N     . SER B 1 165 ? 21.938  22.659 79.931  1.00 27.39 ? 163 SER B N     1 
ATOM   3341 C  CA    . SER B 1 165 ? 21.343  23.070 78.662  1.00 28.44 ? 163 SER B CA    1 
ATOM   3342 C  C     . SER B 1 165 ? 20.173  24.003 78.970  1.00 27.42 ? 163 SER B C     1 
ATOM   3343 O  O     . SER B 1 165 ? 19.267  23.631 79.711  1.00 25.46 ? 163 SER B O     1 
ATOM   3344 C  CB    . SER B 1 165 ? 20.844  21.825 77.912  1.00 30.39 ? 163 SER B CB    1 
ATOM   3345 O  OG    . SER B 1 165 ? 20.086  22.160 76.757  1.00 34.01 ? 163 SER B OG    1 
ATOM   3346 N  N     . PRO B 1 166 ? 20.183  25.239 78.435  1.00 28.84 ? 164 PRO B N     1 
ATOM   3347 C  CA    . PRO B 1 166 ? 21.152  25.911 77.558  1.00 30.65 ? 164 PRO B CA    1 
ATOM   3348 C  C     . PRO B 1 166 ? 22.557  25.941 78.144  1.00 31.51 ? 164 PRO B C     1 
ATOM   3349 O  O     . PRO B 1 166 ? 22.745  26.134 79.344  1.00 30.09 ? 164 PRO B O     1 
ATOM   3350 C  CB    . PRO B 1 166 ? 20.574  27.320 77.414  1.00 30.79 ? 164 PRO B CB    1 
ATOM   3351 C  CG    . PRO B 1 166 ? 19.106  27.102 77.566  1.00 30.62 ? 164 PRO B CG    1 
ATOM   3352 C  CD    . PRO B 1 166 ? 19.037  26.123 78.708  1.00 28.17 ? 164 PRO B CD    1 
ATOM   3353 N  N     . VAL B 1 167 ? 23.548  25.767 77.281  1.00 32.60 ? 165 VAL B N     1 
ATOM   3354 C  CA    . VAL B 1 167 ? 24.924  25.752 77.730  1.00 33.97 ? 165 VAL B CA    1 
ATOM   3355 C  C     . VAL B 1 167 ? 25.473  27.127 78.102  1.00 34.03 ? 165 VAL B C     1 
ATOM   3356 O  O     . VAL B 1 167 ? 25.215  28.131 77.432  1.00 34.31 ? 165 VAL B O     1 
ATOM   3357 C  CB    . VAL B 1 167 ? 25.845  25.122 76.662  1.00 34.60 ? 165 VAL B CB    1 
ATOM   3358 C  CG1   . VAL B 1 167 ? 25.956  26.038 75.450  1.00 36.04 ? 165 VAL B CG1   1 
ATOM   3359 C  CG2   . VAL B 1 167 ? 27.211  24.840 77.263  1.00 36.36 ? 165 VAL B CG2   1 
ATOM   3360 N  N     . ASN B 1 168 ? 26.211  27.153 79.204  1.00 32.94 ? 166 ASN B N     1 
ATOM   3361 C  CA    . ASN B 1 168 ? 26.872  28.351 79.696  1.00 31.76 ? 166 ASN B CA    1 
ATOM   3362 C  C     . ASN B 1 168 ? 28.289  27.834 79.891  1.00 31.44 ? 166 ASN B C     1 
ATOM   3363 O  O     . ASN B 1 168 ? 28.520  26.948 80.709  1.00 30.55 ? 166 ASN B O     1 
ATOM   3364 C  CB    . ASN B 1 168 ? 26.291  28.793 81.042  1.00 31.58 ? 166 ASN B CB    1 
ATOM   3365 C  CG    . ASN B 1 168 ? 26.913  30.084 81.554  1.00 32.85 ? 166 ASN B CG    1 
ATOM   3366 O  OD1   . ASN B 1 168 ? 28.116  30.303 81.411  1.00 32.51 ? 166 ASN B OD1   1 
ATOM   3367 N  ND2   . ASN B 1 168 ? 26.097  30.936 82.170  1.00 32.58 ? 166 ASN B ND2   1 
ATOM   3368 N  N     . PRO B 1 169 ? 29.256  28.357 79.123  1.00 32.95 ? 167 PRO B N     1 
ATOM   3369 C  CA    . PRO B 1 169 ? 30.640  27.892 79.266  1.00 33.00 ? 167 PRO B CA    1 
ATOM   3370 C  C     . PRO B 1 169 ? 31.154  27.863 80.703  1.00 31.67 ? 167 PRO B C     1 
ATOM   3371 O  O     . PRO B 1 169 ? 31.985  27.027 81.044  1.00 32.93 ? 167 PRO B O     1 
ATOM   3372 C  CB    . PRO B 1 169 ? 31.426  28.854 78.367  1.00 33.17 ? 167 PRO B CB    1 
ATOM   3373 C  CG    . PRO B 1 169 ? 30.560  30.086 78.327  1.00 35.08 ? 167 PRO B CG    1 
ATOM   3374 C  CD    . PRO B 1 169 ? 29.179  29.499 78.197  1.00 33.33 ? 167 PRO B CD    1 
ATOM   3375 N  N     . ASP B 1 170 ? 30.652  28.761 81.546  1.00 32.40 ? 168 ASP B N     1 
ATOM   3376 C  CA    . ASP B 1 170 ? 31.087  28.810 82.937  1.00 33.32 ? 168 ASP B CA    1 
ATOM   3377 C  C     . ASP B 1 170 ? 30.592  27.635 83.779  1.00 32.38 ? 168 ASP B C     1 
ATOM   3378 O  O     . ASP B 1 170 ? 31.029  27.459 84.912  1.00 30.75 ? 168 ASP B O     1 
ATOM   3379 C  CB    . ASP B 1 170 ? 30.657  30.130 83.590  1.00 37.37 ? 168 ASP B CB    1 
ATOM   3380 C  CG    . ASP B 1 170 ? 31.438  31.320 83.057  1.00 41.62 ? 168 ASP B CG    1 
ATOM   3381 O  OD1   . ASP B 1 170 ? 32.683  31.235 83.010  1.00 42.78 ? 168 ASP B OD1   1 
ATOM   3382 O  OD2   . ASP B 1 170 ? 30.814  32.336 82.688  1.00 44.09 ? 168 ASP B OD2   1 
ATOM   3383 N  N     . PHE B 1 171 ? 29.683  26.832 83.229  1.00 31.34 ? 169 PHE B N     1 
ATOM   3384 C  CA    . PHE B 1 171 ? 29.166  25.671 83.953  1.00 30.96 ? 169 PHE B CA    1 
ATOM   3385 C  C     . PHE B 1 171 ? 30.266  24.630 84.172  1.00 31.74 ? 169 PHE B C     1 
ATOM   3386 O  O     . PHE B 1 171 ? 30.155  23.777 85.053  1.00 31.54 ? 169 PHE B O     1 
ATOM   3387 C  CB    . PHE B 1 171 ? 28.005  25.008 83.186  1.00 27.93 ? 169 PHE B CB    1 
ATOM   3388 C  CG    . PHE B 1 171 ? 26.696  25.752 83.273  1.00 25.43 ? 169 PHE B CG    1 
ATOM   3389 C  CD1   . PHE B 1 171 ? 26.442  26.639 84.316  1.00 24.47 ? 169 PHE B CD1   1 
ATOM   3390 C  CD2   . PHE B 1 171 ? 25.687  25.512 82.339  1.00 25.08 ? 169 PHE B CD2   1 
ATOM   3391 C  CE1   . PHE B 1 171 ? 25.208  27.273 84.433  1.00 24.02 ? 169 PHE B CE1   1 
ATOM   3392 C  CE2   . PHE B 1 171 ? 24.447  26.138 82.444  1.00 22.76 ? 169 PHE B CE2   1 
ATOM   3393 C  CZ    . PHE B 1 171 ? 24.201  27.020 83.492  1.00 26.61 ? 169 PHE B CZ    1 
ATOM   3394 N  N     . CYS B 1 172 ? 31.331  24.706 83.378  1.00 33.87 ? 170 CYS B N     1 
ATOM   3395 C  CA    . CYS B 1 172 ? 32.426  23.742 83.485  1.00 35.79 ? 170 CYS B CA    1 
ATOM   3396 C  C     . CYS B 1 172 ? 33.056  23.701 84.871  1.00 36.51 ? 170 CYS B C     1 
ATOM   3397 O  O     . CYS B 1 172 ? 33.668  22.706 85.251  1.00 37.84 ? 170 CYS B O     1 
ATOM   3398 C  CB    . CYS B 1 172 ? 33.515  24.049 82.456  1.00 37.47 ? 170 CYS B CB    1 
ATOM   3399 S  SG    . CYS B 1 172 ? 34.474  25.541 82.825  1.00 40.29 ? 170 CYS B SG    1 
ATOM   3400 N  N     . HIS B 1 173 ? 32.898  24.777 85.630  1.00 36.38 ? 171 HIS B N     1 
ATOM   3401 C  CA    . HIS B 1 173 ? 33.477  24.845 86.967  1.00 36.37 ? 171 HIS B CA    1 
ATOM   3402 C  C     . HIS B 1 173 ? 32.597  24.208 88.033  1.00 34.99 ? 171 HIS B C     1 
ATOM   3403 O  O     . HIS B 1 173 ? 33.005  24.086 89.186  1.00 34.13 ? 171 HIS B O     1 
ATOM   3404 C  CB    . HIS B 1 173 ? 33.738  26.305 87.343  1.00 39.58 ? 171 HIS B CB    1 
ATOM   3405 C  CG    . HIS B 1 173 ? 34.622  27.025 86.376  1.00 42.56 ? 171 HIS B CG    1 
ATOM   3406 N  ND1   . HIS B 1 173 ? 34.278  28.235 85.811  1.00 45.43 ? 171 HIS B ND1   1 
ATOM   3407 C  CD2   . HIS B 1 173 ? 35.831  26.698 85.860  1.00 43.33 ? 171 HIS B CD2   1 
ATOM   3408 C  CE1   . HIS B 1 173 ? 35.236  28.621 84.987  1.00 45.06 ? 171 HIS B CE1   1 
ATOM   3409 N  NE2   . HIS B 1 173 ? 36.190  27.706 84.998  1.00 45.56 ? 171 HIS B NE2   1 
ATOM   3410 N  N     . LEU B 1 174 ? 31.397  23.791 87.641  1.00 31.93 ? 172 LEU B N     1 
ATOM   3411 C  CA    . LEU B 1 174 ? 30.445  23.199 88.576  1.00 30.46 ? 172 LEU B CA    1 
ATOM   3412 C  C     . LEU B 1 174 ? 30.487  21.683 88.761  1.00 28.81 ? 172 LEU B C     1 
ATOM   3413 O  O     . LEU B 1 174 ? 29.833  21.156 89.656  1.00 27.27 ? 172 LEU B O     1 
ATOM   3414 C  CB    . LEU B 1 174 ? 29.022  23.604 88.169  1.00 32.10 ? 172 LEU B CB    1 
ATOM   3415 C  CG    . LEU B 1 174 ? 28.424  24.897 88.738  1.00 33.44 ? 172 LEU B CG    1 
ATOM   3416 C  CD1   . LEU B 1 174 ? 29.485  25.963 88.906  1.00 35.17 ? 172 LEU B CD1   1 
ATOM   3417 C  CD2   . LEU B 1 174 ? 27.307  25.361 87.820  1.00 33.01 ? 172 LEU B CD2   1 
ATOM   3418 N  N     . TRP B 1 175 ? 31.255  20.978 87.941  1.00 28.13 ? 173 TRP B N     1 
ATOM   3419 C  CA    . TRP B 1 175 ? 31.281  19.523 88.035  1.00 29.00 ? 173 TRP B CA    1 
ATOM   3420 C  C     . TRP B 1 175 ? 31.526  18.896 89.413  1.00 28.27 ? 173 TRP B C     1 
ATOM   3421 O  O     . TRP B 1 175 ? 30.948  17.860 89.730  1.00 28.60 ? 173 TRP B O     1 
ATOM   3422 C  CB    . TRP B 1 175 ? 32.247  18.960 86.984  1.00 28.80 ? 173 TRP B CB    1 
ATOM   3423 C  CG    . TRP B 1 175 ? 31.794  19.291 85.582  1.00 28.46 ? 173 TRP B CG    1 
ATOM   3424 C  CD1   . TRP B 1 175 ? 32.513  19.938 84.615  1.00 27.80 ? 173 TRP B CD1   1 
ATOM   3425 C  CD2   . TRP B 1 175 ? 30.503  19.022 85.009  1.00 29.36 ? 173 TRP B CD2   1 
ATOM   3426 N  NE1   . TRP B 1 175 ? 31.751  20.091 83.481  1.00 29.15 ? 173 TRP B NE1   1 
ATOM   3427 C  CE2   . TRP B 1 175 ? 30.515  19.537 83.694  1.00 29.05 ? 173 TRP B CE2   1 
ATOM   3428 C  CE3   . TRP B 1 175 ? 29.338  18.394 85.482  1.00 28.06 ? 173 TRP B CE3   1 
ATOM   3429 C  CZ2   . TRP B 1 175 ? 29.405  19.444 82.839  1.00 29.89 ? 173 TRP B CZ2   1 
ATOM   3430 C  CZ3   . TRP B 1 175 ? 28.233  18.302 84.635  1.00 29.62 ? 173 TRP B CZ3   1 
ATOM   3431 C  CH2   . TRP B 1 175 ? 28.277  18.826 83.326  1.00 29.48 ? 173 TRP B CH2   1 
ATOM   3432 N  N     . PRO B 1 176 ? 32.371  19.509 90.257  1.00 28.79 ? 174 PRO B N     1 
ATOM   3433 C  CA    . PRO B 1 176 ? 32.603  18.913 91.583  1.00 27.96 ? 174 PRO B CA    1 
ATOM   3434 C  C     . PRO B 1 176 ? 31.323  18.801 92.433  1.00 27.45 ? 174 PRO B C     1 
ATOM   3435 O  O     . PRO B 1 176 ? 31.214  17.955 93.329  1.00 26.56 ? 174 PRO B O     1 
ATOM   3436 C  CB    . PRO B 1 176 ? 33.626  19.862 92.203  1.00 28.78 ? 174 PRO B CB    1 
ATOM   3437 C  CG    . PRO B 1 176 ? 34.433  20.292 91.009  1.00 29.25 ? 174 PRO B CG    1 
ATOM   3438 C  CD    . PRO B 1 176 ? 33.340  20.588 89.990  1.00 29.11 ? 174 PRO B CD    1 
ATOM   3439 N  N     . LEU B 1 177 ? 30.348  19.652 92.137  1.00 25.09 ? 175 LEU B N     1 
ATOM   3440 C  CA    . LEU B 1 177 ? 29.084  19.661 92.867  1.00 24.82 ? 175 LEU B CA    1 
ATOM   3441 C  C     . LEU B 1 177 ? 28.058  18.669 92.306  1.00 24.20 ? 175 LEU B C     1 
ATOM   3442 O  O     . LEU B 1 177 ? 26.986  18.497 92.873  1.00 24.62 ? 175 LEU B O     1 
ATOM   3443 C  CB    . LEU B 1 177 ? 28.480  21.068 92.811  1.00 25.82 ? 175 LEU B CB    1 
ATOM   3444 C  CG    . LEU B 1 177 ? 29.375  22.212 93.301  1.00 29.02 ? 175 LEU B CG    1 
ATOM   3445 C  CD1   . LEU B 1 177 ? 28.779  23.545 92.874  1.00 27.75 ? 175 LEU B CD1   1 
ATOM   3446 C  CD2   . LEU B 1 177 ? 29.543  22.125 94.824  1.00 28.93 ? 175 LEU B CD2   1 
ATOM   3447 N  N     . ILE B 1 178 ? 28.406  17.998 91.212  1.00 24.62 ? 176 ILE B N     1 
ATOM   3448 C  CA    . ILE B 1 178 ? 27.475  17.099 90.533  1.00 24.57 ? 176 ILE B CA    1 
ATOM   3449 C  C     . ILE B 1 178 ? 27.688  15.590 90.677  1.00 24.22 ? 176 ILE B C     1 
ATOM   3450 O  O     . ILE B 1 178 ? 28.809  15.094 90.552  1.00 24.54 ? 176 ILE B O     1 
ATOM   3451 C  CB    . ILE B 1 178 ? 27.466  17.434 89.025  1.00 24.30 ? 176 ILE B CB    1 
ATOM   3452 C  CG1   . ILE B 1 178 ? 27.286  18.946 88.831  1.00 24.08 ? 176 ILE B CG1   1 
ATOM   3453 C  CG2   . ILE B 1 178 ? 26.399  16.616 88.302  1.00 24.31 ? 176 ILE B CG2   1 
ATOM   3454 C  CD1   . ILE B 1 178 ? 26.047  19.537 89.483  1.00 22.82 ? 176 ILE B CD1   1 
ATOM   3455 N  N     . ASP B 1 179 ? 26.596  14.863 90.915  1.00 24.08 ? 177 ASP B N     1 
ATOM   3456 C  CA    . ASP B 1 179 ? 26.650  13.405 91.033  1.00 22.77 ? 177 ASP B CA    1 
ATOM   3457 C  C     . ASP B 1 179 ? 26.340  12.749 89.690  1.00 24.58 ? 177 ASP B C     1 
ATOM   3458 O  O     . ASP B 1 179 ? 27.017  11.799 89.275  1.00 24.49 ? 177 ASP B O     1 
ATOM   3459 C  CB    . ASP B 1 179 ? 25.640  12.893 92.060  1.00 23.97 ? 177 ASP B CB    1 
ATOM   3460 C  CG    . ASP B 1 179 ? 25.955  13.351 93.462  1.00 26.26 ? 177 ASP B CG    1 
ATOM   3461 O  OD1   . ASP B 1 179 ? 27.140  13.285 93.854  1.00 29.55 ? 177 ASP B OD1   1 
ATOM   3462 O  OD2   . ASP B 1 179 ? 25.021  13.767 94.177  1.00 26.50 ? 177 ASP B OD2   1 
ATOM   3463 N  N     . ILE B 1 180 ? 25.301  13.255 89.026  1.00 22.54 ? 178 ILE B N     1 
ATOM   3464 C  CA    . ILE B 1 180 ? 24.879  12.730 87.734  1.00 21.41 ? 178 ILE B CA    1 
ATOM   3465 C  C     . ILE B 1 180 ? 24.842  13.841 86.693  1.00 21.19 ? 178 ILE B C     1 
ATOM   3466 O  O     . ILE B 1 180 ? 24.138  14.835 86.867  1.00 19.88 ? 178 ILE B O     1 
ATOM   3467 C  CB    . ILE B 1 180 ? 23.466  12.104 87.815  1.00 20.90 ? 178 ILE B CB    1 
ATOM   3468 C  CG1   . ILE B 1 180 ? 23.449  10.982 88.861  1.00 23.20 ? 178 ILE B CG1   1 
ATOM   3469 C  CG2   . ILE B 1 180 ? 23.046  11.574 86.432  1.00 19.73 ? 178 ILE B CG2   1 
ATOM   3470 C  CD1   . ILE B 1 180 ? 22.097  10.282 89.007  1.00 22.11 ? 178 ILE B CD1   1 
ATOM   3471 N  N     . ALA B 1 181 ? 25.601  13.672 85.614  1.00 20.88 ? 179 ALA B N     1 
ATOM   3472 C  CA    . ALA B 1 181 ? 25.627  14.661 84.534  1.00 22.34 ? 179 ALA B CA    1 
ATOM   3473 C  C     . ALA B 1 181 ? 24.972  14.090 83.277  1.00 20.99 ? 179 ALA B C     1 
ATOM   3474 O  O     . ALA B 1 181 ? 25.200  12.933 82.914  1.00 22.16 ? 179 ALA B O     1 
ATOM   3475 C  CB    . ALA B 1 181 ? 27.061  15.070 84.226  1.00 22.51 ? 179 ALA B CB    1 
ATOM   3476 N  N     . VAL B 1 182 ? 24.153  14.905 82.624  1.00 21.20 ? 180 VAL B N     1 
ATOM   3477 C  CA    . VAL B 1 182 ? 23.468  14.498 81.401  1.00 22.03 ? 180 VAL B CA    1 
ATOM   3478 C  C     . VAL B 1 182 ? 23.685  15.623 80.407  1.00 22.30 ? 180 VAL B C     1 
ATOM   3479 O  O     . VAL B 1 182 ? 23.227  16.741 80.619  1.00 19.67 ? 180 VAL B O     1 
ATOM   3480 C  CB    . VAL B 1 182 ? 21.954  14.318 81.616  1.00 22.66 ? 180 VAL B CB    1 
ATOM   3481 C  CG1   . VAL B 1 182 ? 21.293  13.926 80.297  1.00 22.64 ? 180 VAL B CG1   1 
ATOM   3482 C  CG2   . VAL B 1 182 ? 21.692  13.245 82.675  1.00 24.02 ? 180 VAL B CG2   1 
ATOM   3483 N  N     . VAL B 1 183 ? 24.394  15.314 79.328  1.00 21.95 ? 181 VAL B N     1 
ATOM   3484 C  CA    . VAL B 1 183 ? 24.715  16.298 78.302  1.00 23.28 ? 181 VAL B CA    1 
ATOM   3485 C  C     . VAL B 1 183 ? 24.588  15.675 76.915  1.00 24.83 ? 181 VAL B C     1 
ATOM   3486 O  O     . VAL B 1 183 ? 24.571  14.456 76.794  1.00 24.05 ? 181 VAL B O     1 
ATOM   3487 C  CB    . VAL B 1 183 ? 26.186  16.785 78.462  1.00 24.25 ? 181 VAL B CB    1 
ATOM   3488 C  CG1   . VAL B 1 183 ? 26.376  17.451 79.809  1.00 22.15 ? 181 VAL B CG1   1 
ATOM   3489 C  CG2   . VAL B 1 183 ? 27.154  15.594 78.350  1.00 22.74 ? 181 VAL B CG2   1 
ATOM   3490 N  N     . ASN B 1 184 ? 24.469  16.505 75.879  1.00 26.03 ? 182 ASN B N     1 
ATOM   3491 C  CA    . ASN B 1 184 ? 24.439  15.976 74.515  1.00 28.85 ? 182 ASN B CA    1 
ATOM   3492 C  C     . ASN B 1 184 ? 25.889  16.080 74.015  1.00 29.23 ? 182 ASN B C     1 
ATOM   3493 O  O     . ASN B 1 184 ? 26.731  16.652 74.706  1.00 28.69 ? 182 ASN B O     1 
ATOM   3494 C  CB    . ASN B 1 184 ? 23.464  16.753 73.608  1.00 28.36 ? 182 ASN B CB    1 
ATOM   3495 C  CG    . ASN B 1 184 ? 23.792  18.232 73.499  1.00 30.35 ? 182 ASN B CG    1 
ATOM   3496 O  OD1   . ASN B 1 184 ? 24.918  18.660 73.760  1.00 28.54 ? 182 ASN B OD1   1 
ATOM   3497 N  ND2   . ASN B 1 184 ? 22.802  19.019 73.091  1.00 29.69 ? 182 ASN B ND2   1 
ATOM   3498 N  N     . GLU B 1 185 ? 26.199  15.534 72.842  1.00 31.25 ? 183 GLU B N     1 
ATOM   3499 C  CA    . GLU B 1 185 ? 27.583  15.564 72.359  1.00 34.65 ? 183 GLU B CA    1 
ATOM   3500 C  C     . GLU B 1 185 ? 28.223  16.951 72.378  1.00 33.93 ? 183 GLU B C     1 
ATOM   3501 O  O     . GLU B 1 185 ? 29.378  17.101 72.782  1.00 35.24 ? 183 GLU B O     1 
ATOM   3502 C  CB    . GLU B 1 185 ? 27.692  14.965 70.947  1.00 38.48 ? 183 GLU B CB    1 
ATOM   3503 C  CG    . GLU B 1 185 ? 27.193  15.869 69.841  1.00 44.82 ? 183 GLU B CG    1 
ATOM   3504 C  CD    . GLU B 1 185 ? 25.698  15.777 69.639  1.00 49.06 ? 183 GLU B CD    1 
ATOM   3505 O  OE1   . GLU B 1 185 ? 24.973  15.529 70.625  1.00 50.19 ? 183 GLU B OE1   1 
ATOM   3506 O  OE2   . GLU B 1 185 ? 25.247  15.964 68.488  1.00 53.70 ? 183 GLU B OE2   1 
ATOM   3507 N  N     . SER B 1 186 ? 27.471  17.960 71.953  1.00 33.74 ? 184 SER B N     1 
ATOM   3508 C  CA    . SER B 1 186 ? 27.963  19.331 71.929  1.00 34.36 ? 184 SER B CA    1 
ATOM   3509 C  C     . SER B 1 186 ? 28.364  19.812 73.326  1.00 33.41 ? 184 SER B C     1 
ATOM   3510 O  O     . SER B 1 186 ? 29.458  20.347 73.523  1.00 32.96 ? 184 SER B O     1 
ATOM   3511 C  CB    . SER B 1 186 ? 26.893  20.263 71.353  1.00 34.91 ? 184 SER B CB    1 
ATOM   3512 O  OG    . SER B 1 186 ? 27.300  21.617 71.455  1.00 38.71 ? 184 SER B OG    1 
ATOM   3513 N  N     . GLU B 1 187 ? 27.475  19.617 74.295  1.00 32.37 ? 185 GLU B N     1 
ATOM   3514 C  CA    . GLU B 1 187 ? 27.740  20.034 75.665  1.00 30.27 ? 185 GLU B CA    1 
ATOM   3515 C  C     . GLU B 1 187 ? 28.881  19.219 76.265  1.00 30.70 ? 185 GLU B C     1 
ATOM   3516 O  O     . GLU B 1 187 ? 29.655  19.725 77.077  1.00 29.78 ? 185 GLU B O     1 
ATOM   3517 C  CB    . GLU B 1 187 ? 26.465  19.889 76.513  1.00 31.38 ? 185 GLU B CB    1 
ATOM   3518 C  CG    . GLU B 1 187 ? 25.363  20.860 76.093  1.00 31.84 ? 185 GLU B CG    1 
ATOM   3519 C  CD    . GLU B 1 187 ? 23.945  20.323 76.291  1.00 31.66 ? 185 GLU B CD    1 
ATOM   3520 O  OE1   . GLU B 1 187 ? 23.776  19.196 76.810  1.00 30.82 ? 185 GLU B OE1   1 
ATOM   3521 O  OE2   . GLU B 1 187 ? 22.994  21.045 75.919  1.00 29.05 ? 185 GLU B OE2   1 
ATOM   3522 N  N     . ALA B 1 188 ? 28.994  17.959 75.859  1.00 29.18 ? 186 ALA B N     1 
ATOM   3523 C  CA    . ALA B 1 188 ? 30.061  17.105 76.373  1.00 30.43 ? 186 ALA B CA    1 
ATOM   3524 C  C     . ALA B 1 188 ? 31.426  17.696 76.005  1.00 32.03 ? 186 ALA B C     1 
ATOM   3525 O  O     . ALA B 1 188 ? 32.346  17.724 76.826  1.00 31.94 ? 186 ALA B O     1 
ATOM   3526 C  CB    . ALA B 1 188 ? 29.924  15.697 75.804  1.00 29.81 ? 186 ALA B CB    1 
ATOM   3527 N  N     . GLU B 1 189 ? 31.546  18.178 74.773  1.00 33.70 ? 187 GLU B N     1 
ATOM   3528 C  CA    . GLU B 1 189 ? 32.797  18.761 74.302  1.00 36.36 ? 187 GLU B CA    1 
ATOM   3529 C  C     . GLU B 1 189 ? 33.022  20.167 74.852  1.00 36.96 ? 187 GLU B C     1 
ATOM   3530 O  O     . GLU B 1 189 ? 34.132  20.522 75.240  1.00 36.38 ? 187 GLU B O     1 
ATOM   3531 C  CB    . GLU B 1 189 ? 32.820  18.806 72.769  1.00 37.32 ? 187 GLU B CB    1 
ATOM   3532 C  CG    . GLU B 1 189 ? 34.128  19.352 72.211  1.00 40.77 ? 187 GLU B CG    1 
ATOM   3533 C  CD    . GLU B 1 189 ? 34.304  19.094 70.726  1.00 42.14 ? 187 GLU B CD    1 
ATOM   3534 O  OE1   . GLU B 1 189 ? 33.477  18.366 70.131  1.00 42.54 ? 187 GLU B OE1   1 
ATOM   3535 O  OE2   . GLU B 1 189 ? 35.283  19.619 70.157  1.00 42.90 ? 187 GLU B OE2   1 
ATOM   3536 N  N     . LEU B 1 190 ? 31.961  20.963 74.890  1.00 37.86 ? 188 LEU B N     1 
ATOM   3537 C  CA    . LEU B 1 190 ? 32.059  22.331 75.381  1.00 38.89 ? 188 LEU B CA    1 
ATOM   3538 C  C     . LEU B 1 190 ? 32.317  22.447 76.881  1.00 37.93 ? 188 LEU B C     1 
ATOM   3539 O  O     . LEU B 1 190 ? 33.083  23.305 77.316  1.00 39.51 ? 188 LEU B O     1 
ATOM   3540 C  CB    . LEU B 1 190 ? 30.782  23.099 75.035  1.00 40.71 ? 188 LEU B CB    1 
ATOM   3541 C  CG    . LEU B 1 190 ? 30.839  24.604 75.295  1.00 44.19 ? 188 LEU B CG    1 
ATOM   3542 C  CD1   . LEU B 1 190 ? 31.921  25.232 74.419  1.00 45.13 ? 188 LEU B CD1   1 
ATOM   3543 C  CD2   . LEU B 1 190 ? 29.491  25.230 74.991  1.00 47.20 ? 188 LEU B CD2   1 
ATOM   3544 N  N     . LEU B 1 191 ? 31.692  21.582 77.673  1.00 35.98 ? 189 LEU B N     1 
ATOM   3545 C  CA    . LEU B 1 191 ? 31.846  21.648 79.124  1.00 34.54 ? 189 LEU B CA    1 
ATOM   3546 C  C     . LEU B 1 191 ? 32.793  20.625 79.746  1.00 33.09 ? 189 LEU B C     1 
ATOM   3547 O  O     . LEU B 1 191 ? 33.086  20.698 80.938  1.00 32.86 ? 189 LEU B O     1 
ATOM   3548 C  CB    . LEU B 1 191 ? 30.468  21.542 79.783  1.00 33.34 ? 189 LEU B CB    1 
ATOM   3549 C  CG    . LEU B 1 191 ? 29.469  22.618 79.344  1.00 34.39 ? 189 LEU B CG    1 
ATOM   3550 C  CD1   . LEU B 1 191 ? 28.085  22.295 79.884  1.00 33.20 ? 189 LEU B CD1   1 
ATOM   3551 C  CD2   . LEU B 1 191 ? 29.941  23.984 79.828  1.00 33.78 ? 189 LEU B CD2   1 
ATOM   3552 N  N     . GLN B 1 192 ? 33.264  19.679 78.942  1.00 32.05 ? 190 GLN B N     1 
ATOM   3553 C  CA    . GLN B 1 192 ? 34.183  18.638 79.402  1.00 33.37 ? 190 GLN B CA    1 
ATOM   3554 C  C     . GLN B 1 192 ? 33.928  18.105 80.813  1.00 33.87 ? 190 GLN B C     1 
ATOM   3555 O  O     . GLN B 1 192 ? 34.763  18.266 81.706  1.00 32.04 ? 190 GLN B O     1 
ATOM   3556 C  CB    . GLN B 1 192 ? 35.631  19.135 79.326  1.00 34.32 ? 190 GLN B CB    1 
ATOM   3557 C  CG    . GLN B 1 192 ? 36.145  19.427 77.922  1.00 35.42 ? 190 GLN B CG    1 
ATOM   3558 C  CD    . GLN B 1 192 ? 36.099  18.212 76.999  1.00 37.92 ? 190 GLN B CD    1 
ATOM   3559 O  OE1   . GLN B 1 192 ? 36.356  17.081 77.419  1.00 37.35 ? 190 GLN B OE1   1 
ATOM   3560 N  NE2   . GLN B 1 192 ? 35.791  18.451 75.732  1.00 35.60 ? 190 GLN B NE2   1 
ATOM   3561 N  N     . PRO B 1 193 ? 32.770  17.464 81.038  1.00 34.39 ? 191 PRO B N     1 
ATOM   3562 C  CA    . PRO B 1 193 ? 32.477  16.924 82.369  1.00 35.20 ? 191 PRO B CA    1 
ATOM   3563 C  C     . PRO B 1 193 ? 33.533  15.907 82.795  1.00 37.36 ? 191 PRO B C     1 
ATOM   3564 O  O     . PRO B 1 193 ? 33.977  15.090 81.997  1.00 38.73 ? 191 PRO B O     1 
ATOM   3565 C  CB    . PRO B 1 193 ? 31.095  16.297 82.192  1.00 35.13 ? 191 PRO B CB    1 
ATOM   3566 C  CG    . PRO B 1 193 ? 31.054  15.954 80.739  1.00 34.33 ? 191 PRO B CG    1 
ATOM   3567 C  CD    . PRO B 1 193 ? 31.670  17.175 80.105  1.00 34.96 ? 191 PRO B CD    1 
ATOM   3568 N  N     . TYR B 1 194 ? 33.928  15.960 84.059  1.00 39.98 ? 192 TYR B N     1 
ATOM   3569 C  CA    . TYR B 1 194 ? 34.949  15.058 84.579  1.00 41.10 ? 192 TYR B CA    1 
ATOM   3570 C  C     . TYR B 1 194 ? 34.695  14.823 86.062  1.00 39.86 ? 192 TYR B C     1 
ATOM   3571 O  O     . TYR B 1 194 ? 34.128  15.677 86.740  1.00 39.20 ? 192 TYR B O     1 
ATOM   3572 C  CB    . TYR B 1 194 ? 36.327  15.700 84.413  1.00 44.51 ? 192 TYR B CB    1 
ATOM   3573 C  CG    . TYR B 1 194 ? 36.546  16.834 85.392  1.00 48.93 ? 192 TYR B CG    1 
ATOM   3574 C  CD1   . TYR B 1 194 ? 37.186  16.614 86.612  1.00 50.78 ? 192 TYR B CD1   1 
ATOM   3575 C  CD2   . TYR B 1 194 ? 36.035  18.108 85.139  1.00 50.60 ? 192 TYR B CD2   1 
ATOM   3576 C  CE1   . TYR B 1 194 ? 37.305  17.628 87.559  1.00 52.29 ? 192 TYR B CE1   1 
ATOM   3577 C  CE2   . TYR B 1 194 ? 36.148  19.131 86.080  1.00 52.49 ? 192 TYR B CE2   1 
ATOM   3578 C  CZ    . TYR B 1 194 ? 36.782  18.882 87.288  1.00 53.20 ? 192 TYR B CZ    1 
ATOM   3579 O  OH    . TYR B 1 194 ? 36.886  19.882 88.228  1.00 54.57 ? 192 TYR B OH    1 
ATOM   3580 N  N     . GLY B 1 195 ? 35.127  13.667 86.557  1.00 38.71 ? 193 GLY B N     1 
ATOM   3581 C  CA    . GLY B 1 195 ? 34.967  13.350 87.963  1.00 37.71 ? 193 GLY B CA    1 
ATOM   3582 C  C     . GLY B 1 195 ? 33.547  13.096 88.425  1.00 37.02 ? 193 GLY B C     1 
ATOM   3583 O  O     . GLY B 1 195 ? 33.309  12.897 89.617  1.00 37.07 ? 193 GLY B O     1 
ATOM   3584 N  N     . VAL B 1 196 ? 32.596  13.102 87.498  1.00 34.93 ? 194 VAL B N     1 
ATOM   3585 C  CA    . VAL B 1 196 ? 31.209  12.863 87.863  1.00 33.06 ? 194 VAL B CA    1 
ATOM   3586 C  C     . VAL B 1 196 ? 30.965  11.355 87.917  1.00 33.40 ? 194 VAL B C     1 
ATOM   3587 O  O     . VAL B 1 196 ? 31.406  10.616 87.036  1.00 34.03 ? 194 VAL B O     1 
ATOM   3588 C  CB    . VAL B 1 196 ? 30.257  13.531 86.848  1.00 33.01 ? 194 VAL B CB    1 
ATOM   3589 C  CG1   . VAL B 1 196 ? 28.826  13.444 87.339  1.00 31.93 ? 194 VAL B CG1   1 
ATOM   3590 C  CG2   . VAL B 1 196 ? 30.656  14.991 86.655  1.00 28.72 ? 194 VAL B CG2   1 
ATOM   3591 N  N     . LYS B 1 197 ? 30.275  10.899 88.956  1.00 32.11 ? 195 LYS B N     1 
ATOM   3592 C  CA    . LYS B 1 197 ? 30.003  9.476  89.119  1.00 33.11 ? 195 LYS B CA    1 
ATOM   3593 C  C     . LYS B 1 197 ? 29.266  8.860  87.936  1.00 31.18 ? 195 LYS B C     1 
ATOM   3594 O  O     . LYS B 1 197 ? 29.664  7.813  87.430  1.00 29.72 ? 195 LYS B O     1 
ATOM   3595 C  CB    . LYS B 1 197 ? 29.224  9.236  90.413  1.00 36.52 ? 195 LYS B CB    1 
ATOM   3596 C  CG    . LYS B 1 197 ? 30.095  9.344  91.658  1.00 42.19 ? 195 LYS B CG    1 
ATOM   3597 C  CD    . LYS B 1 197 ? 29.269  9.277  92.933  1.00 45.63 ? 195 LYS B CD    1 
ATOM   3598 C  CE    . LYS B 1 197 ? 28.458  10.555 93.136  1.00 45.90 ? 195 LYS B CE    1 
ATOM   3599 N  NZ    . LYS B 1 197 ? 29.335  11.749 93.307  1.00 44.44 ? 195 LYS B NZ    1 
ATOM   3600 N  N     . THR B 1 198 ? 28.190  9.507  87.500  1.00 28.28 ? 196 THR B N     1 
ATOM   3601 C  CA    . THR B 1 198 ? 27.423  9.021  86.358  1.00 26.24 ? 196 THR B CA    1 
ATOM   3602 C  C     . THR B 1 198 ? 27.371  10.108 85.296  1.00 24.58 ? 196 THR B C     1 
ATOM   3603 O  O     . THR B 1 198 ? 26.935  11.227 85.572  1.00 23.96 ? 196 THR B O     1 
ATOM   3604 C  CB    . THR B 1 198 ? 25.980  8.680  86.741  1.00 27.20 ? 196 THR B CB    1 
ATOM   3605 O  OG1   . THR B 1 198 ? 25.970  7.569  87.639  1.00 27.48 ? 196 THR B OG1   1 
ATOM   3606 C  CG2   . THR B 1 198 ? 25.167  8.335  85.501  1.00 26.99 ? 196 THR B CG2   1 
ATOM   3607 N  N     . LEU B 1 199 ? 27.816  9.773  84.089  1.00 22.86 ? 197 LEU B N     1 
ATOM   3608 C  CA    . LEU B 1 199 ? 27.810  10.714 82.976  1.00 23.16 ? 197 LEU B CA    1 
ATOM   3609 C  C     . LEU B 1 199 ? 27.042  10.114 81.810  1.00 23.38 ? 197 LEU B C     1 
ATOM   3610 O  O     . LEU B 1 199 ? 27.352  9.011  81.355  1.00 21.68 ? 197 LEU B O     1 
ATOM   3611 C  CB    . LEU B 1 199 ? 29.234  11.030 82.509  1.00 24.19 ? 197 LEU B CB    1 
ATOM   3612 C  CG    . LEU B 1 199 ? 29.307  11.915 81.254  1.00 24.99 ? 197 LEU B CG    1 
ATOM   3613 C  CD1   . LEU B 1 199 ? 28.740  13.288 81.568  1.00 25.76 ? 197 LEU B CD1   1 
ATOM   3614 C  CD2   . LEU B 1 199 ? 30.750  12.037 80.769  1.00 27.05 ? 197 LEU B CD2   1 
ATOM   3615 N  N     . VAL B 1 200 ? 26.044  10.844 81.331  1.00 21.71 ? 198 VAL B N     1 
ATOM   3616 C  CA    . VAL B 1 200 ? 25.258  10.387 80.203  1.00 20.75 ? 198 VAL B CA    1 
ATOM   3617 C  C     . VAL B 1 200 ? 25.451  11.353 79.034  1.00 20.85 ? 198 VAL B C     1 
ATOM   3618 O  O     . VAL B 1 200 ? 25.254  12.559 79.170  1.00 17.90 ? 198 VAL B O     1 
ATOM   3619 C  CB    . VAL B 1 200 ? 23.765  10.327 80.548  1.00 21.72 ? 198 VAL B CB    1 
ATOM   3620 C  CG1   . VAL B 1 200 ? 22.980  9.837  79.337  1.00 23.00 ? 198 VAL B CG1   1 
ATOM   3621 C  CG2   . VAL B 1 200 ? 23.546  9.407  81.746  1.00 22.28 ? 198 VAL B CG2   1 
ATOM   3622 N  N     . ILE B 1 201 ? 25.854  10.820 77.890  1.00 19.73 ? 199 ILE B N     1 
ATOM   3623 C  CA    . ILE B 1 201 ? 26.052  11.648 76.713  1.00 20.78 ? 199 ILE B CA    1 
ATOM   3624 C  C     . ILE B 1 201 ? 25.051  11.216 75.654  1.00 22.09 ? 199 ILE B C     1 
ATOM   3625 O  O     . ILE B 1 201 ? 25.194  10.144 75.070  1.00 22.36 ? 199 ILE B O     1 
ATOM   3626 C  CB    . ILE B 1 201 ? 27.467  11.489 76.151  1.00 19.96 ? 199 ILE B CB    1 
ATOM   3627 C  CG1   . ILE B 1 201 ? 28.503  11.807 77.233  1.00 20.40 ? 199 ILE B CG1   1 
ATOM   3628 C  CG2   . ILE B 1 201 ? 27.664  12.432 74.967  1.00 20.81 ? 199 ILE B CG2   1 
ATOM   3629 C  CD1   . ILE B 1 201 ? 29.948  11.704 76.736  1.00 22.86 ? 199 ILE B CD1   1 
ATOM   3630 N  N     . THR B 1 202 ? 24.035  12.039 75.413  1.00 22.60 ? 200 THR B N     1 
ATOM   3631 C  CA    . THR B 1 202 ? 23.017  11.709 74.415  1.00 24.12 ? 200 THR B CA    1 
ATOM   3632 C  C     . THR B 1 202 ? 23.424  12.182 73.019  1.00 25.82 ? 200 THR B C     1 
ATOM   3633 O  O     . THR B 1 202 ? 24.087  13.211 72.862  1.00 26.54 ? 200 THR B O     1 
ATOM   3634 C  CB    . THR B 1 202 ? 21.655  12.340 74.776  1.00 26.06 ? 200 THR B CB    1 
ATOM   3635 O  OG1   . THR B 1 202 ? 21.731  13.760 74.622  1.00 27.17 ? 200 THR B OG1   1 
ATOM   3636 C  CG2   . THR B 1 202 ? 21.294  12.027 76.228  1.00 25.49 ? 200 THR B CG2   1 
ATOM   3637 N  N     . GLN B 1 203 ? 23.011  11.432 72.004  1.00 24.71 ? 201 GLN B N     1 
ATOM   3638 C  CA    . GLN B 1 203 ? 23.352  11.762 70.630  1.00 26.30 ? 201 GLN B CA    1 
ATOM   3639 C  C     . GLN B 1 203 ? 22.174  11.629 69.669  1.00 27.04 ? 201 GLN B C     1 
ATOM   3640 O  O     . GLN B 1 203 ? 22.289  11.030 68.600  1.00 29.08 ? 201 GLN B O     1 
ATOM   3641 C  CB    . GLN B 1 203 ? 24.506  10.879 70.157  1.00 25.25 ? 201 GLN B CB    1 
ATOM   3642 C  CG    . GLN B 1 203 ? 25.808  11.137 70.895  1.00 27.18 ? 201 GLN B CG    1 
ATOM   3643 C  CD    . GLN B 1 203 ? 26.992  10.477 70.222  1.00 30.92 ? 201 GLN B CD    1 
ATOM   3644 O  OE1   . GLN B 1 203 ? 27.568  9.526  70.745  1.00 30.44 ? 201 GLN B OE1   1 
ATOM   3645 N  NE2   . GLN B 1 203 ? 27.359  10.981 69.044  1.00 33.04 ? 201 GLN B NE2   1 
ATOM   3646 N  N     . GLY B 1 204 ? 21.041  12.191 70.061  1.00 26.79 ? 202 GLY B N     1 
ATOM   3647 C  CA    . GLY B 1 204 ? 19.866  12.154 69.214  1.00 27.59 ? 202 GLY B CA    1 
ATOM   3648 C  C     . GLY B 1 204 ? 19.488  10.802 68.642  1.00 25.03 ? 202 GLY B C     1 
ATOM   3649 O  O     . GLY B 1 204 ? 19.479  9.791  69.342  1.00 22.91 ? 202 GLY B O     1 
ATOM   3650 N  N     . ALA B 1 205 ? 19.170  10.806 67.351  1.00 26.55 ? 203 ALA B N     1 
ATOM   3651 C  CA    . ALA B 1 205 ? 18.742  9.617  66.634  1.00 28.19 ? 203 ALA B CA    1 
ATOM   3652 C  C     . ALA B 1 205 ? 19.760  8.488  66.680  1.00 29.70 ? 203 ALA B C     1 
ATOM   3653 O  O     . ALA B 1 205 ? 19.425  7.337  66.438  1.00 30.43 ? 203 ALA B O     1 
ATOM   3654 C  CB    . ALA B 1 205 ? 18.422  9.977  65.183  1.00 28.77 ? 203 ALA B CB    1 
ATOM   3655 N  N     . ALA B 1 206 ? 21.005  8.813  66.990  1.00 29.12 ? 204 ALA B N     1 
ATOM   3656 C  CA    . ALA B 1 206 ? 22.020  7.781  67.058  1.00 30.71 ? 204 ALA B CA    1 
ATOM   3657 C  C     . ALA B 1 206 ? 21.747  6.893  68.280  1.00 31.44 ? 204 ALA B C     1 
ATOM   3658 O  O     . ALA B 1 206 ? 21.496  5.683  68.151  1.00 32.28 ? 204 ALA B O     1 
ATOM   3659 C  CB    . ALA B 1 206 ? 23.401  8.427  67.148  1.00 31.72 ? 204 ALA B CB    1 
ATOM   3660 N  N     . GLY B 1 207 ? 21.776  7.514  69.457  1.00 27.93 ? 205 GLY B N     1 
ATOM   3661 C  CA    . GLY B 1 207 ? 21.560  6.801  70.705  1.00 24.84 ? 205 GLY B CA    1 
ATOM   3662 C  C     . GLY B 1 207 ? 22.194  7.588  71.845  1.00 23.45 ? 205 GLY B C     1 
ATOM   3663 O  O     . GLY B 1 207 ? 22.233  8.818  71.802  1.00 22.06 ? 205 GLY B O     1 
ATOM   3664 N  N     . ALA B 1 208 ? 22.692  6.893  72.863  1.00 21.43 ? 206 ALA B N     1 
ATOM   3665 C  CA    . ALA B 1 208 ? 23.312  7.566  73.999  1.00 22.38 ? 206 ALA B CA    1 
ATOM   3666 C  C     . ALA B 1 208 ? 24.339  6.693  74.710  1.00 22.46 ? 206 ALA B C     1 
ATOM   3667 O  O     . ALA B 1 208 ? 24.238  5.466  74.698  1.00 22.09 ? 206 ALA B O     1 
ATOM   3668 C  CB    . ALA B 1 208 ? 22.235  8.003  74.991  1.00 21.51 ? 206 ALA B CB    1 
ATOM   3669 N  N     . TRP B 1 209 ? 25.314  7.346  75.334  1.00 21.04 ? 207 TRP B N     1 
ATOM   3670 C  CA    . TRP B 1 209 ? 26.372  6.673  76.077  1.00 21.07 ? 207 TRP B CA    1 
ATOM   3671 C  C     . TRP B 1 209 ? 26.214  6.820  77.592  1.00 22.68 ? 207 TRP B C     1 
ATOM   3672 O  O     . TRP B 1 209 ? 25.806  7.871  78.086  1.00 22.03 ? 207 TRP B O     1 
ATOM   3673 C  CB    . TRP B 1 209 ? 27.744  7.251  75.714  1.00 20.57 ? 207 TRP B CB    1 
ATOM   3674 C  CG    . TRP B 1 209 ? 28.278  6.873  74.364  1.00 21.71 ? 207 TRP B CG    1 
ATOM   3675 C  CD1   . TRP B 1 209 ? 28.162  7.581  73.199  1.00 22.89 ? 207 TRP B CD1   1 
ATOM   3676 C  CD2   . TRP B 1 209 ? 29.031  5.697  74.046  1.00 22.33 ? 207 TRP B CD2   1 
ATOM   3677 N  NE1   . TRP B 1 209 ? 28.803  6.916  72.176  1.00 21.87 ? 207 TRP B NE1   1 
ATOM   3678 C  CE2   . TRP B 1 209 ? 29.343  5.758  72.668  1.00 22.51 ? 207 TRP B CE2   1 
ATOM   3679 C  CE3   . TRP B 1 209 ? 29.472  4.595  74.795  1.00 23.77 ? 207 TRP B CE3   1 
ATOM   3680 C  CZ2   . TRP B 1 209 ? 30.077  4.758  72.019  1.00 23.36 ? 207 TRP B CZ2   1 
ATOM   3681 C  CZ3   . TRP B 1 209 ? 30.206  3.593  74.148  1.00 24.82 ? 207 TRP B CZ3   1 
ATOM   3682 C  CH2   . TRP B 1 209 ? 30.499  3.687  72.774  1.00 24.34 ? 207 TRP B CH2   1 
ATOM   3683 N  N     . LEU B 1 210 ? 26.546  5.758  78.319  1.00 22.40 ? 208 LEU B N     1 
ATOM   3684 C  CA    . LEU B 1 210 ? 26.523  5.782  79.777  1.00 24.71 ? 208 LEU B CA    1 
ATOM   3685 C  C     . LEU B 1 210 ? 27.979  5.578  80.186  1.00 26.00 ? 208 LEU B C     1 
ATOM   3686 O  O     . LEU B 1 210 ? 28.589  4.565  79.824  1.00 26.10 ? 208 LEU B O     1 
ATOM   3687 C  CB    . LEU B 1 210 ? 25.673  4.647  80.344  1.00 24.81 ? 208 LEU B CB    1 
ATOM   3688 C  CG    . LEU B 1 210 ? 25.801  4.413  81.854  1.00 24.38 ? 208 LEU B CG    1 
ATOM   3689 C  CD1   . LEU B 1 210 ? 25.447  5.684  82.614  1.00 25.04 ? 208 LEU B CD1   1 
ATOM   3690 C  CD2   . LEU B 1 210 ? 24.893  3.266  82.271  1.00 25.68 ? 208 LEU B CD2   1 
ATOM   3691 N  N     . VAL B 1 211 ? 28.538  6.541  80.917  1.00 26.03 ? 209 VAL B N     1 
ATOM   3692 C  CA    . VAL B 1 211 ? 29.930  6.454  81.360  1.00 29.43 ? 209 VAL B CA    1 
ATOM   3693 C  C     . VAL B 1 211 ? 30.010  6.477  82.885  1.00 32.56 ? 209 VAL B C     1 
ATOM   3694 O  O     . VAL B 1 211 ? 29.681  7.478  83.521  1.00 30.10 ? 209 VAL B O     1 
ATOM   3695 C  CB    . VAL B 1 211 ? 30.776  7.634  80.822  1.00 31.16 ? 209 VAL B CB    1 
ATOM   3696 C  CG1   . VAL B 1 211 ? 32.245  7.440  81.205  1.00 31.95 ? 209 VAL B CG1   1 
ATOM   3697 C  CG2   . VAL B 1 211 ? 30.623  7.741  79.319  1.00 31.13 ? 209 VAL B CG2   1 
ATOM   3698 N  N     . GLN B 1 212 ? 30.446  5.368  83.470  1.00 36.17 ? 210 GLN B N     1 
ATOM   3699 C  CA    . GLN B 1 212 ? 30.586  5.263  84.917  1.00 40.22 ? 210 GLN B CA    1 
ATOM   3700 C  C     . GLN B 1 212 ? 31.918  4.609  85.209  1.00 43.72 ? 210 GLN B C     1 
ATOM   3701 O  O     . GLN B 1 212 ? 32.197  3.511  84.727  1.00 43.41 ? 210 GLN B O     1 
ATOM   3702 C  CB    . GLN B 1 212 ? 29.450  4.430  85.510  1.00 39.95 ? 210 GLN B CB    1 
ATOM   3703 C  CG    . GLN B 1 212 ? 28.082  5.062  85.360  1.00 42.20 ? 210 GLN B CG    1 
ATOM   3704 C  CD    . GLN B 1 212 ? 26.966  4.160  85.847  1.00 43.41 ? 210 GLN B CD    1 
ATOM   3705 O  OE1   . GLN B 1 212 ? 26.998  2.950  85.628  1.00 44.19 ? 210 GLN B OE1   1 
ATOM   3706 N  NE2   . GLN B 1 212 ? 25.963  4.747  86.499  1.00 40.73 ? 210 GLN B NE2   1 
ATOM   3707 N  N     . GLU B 1 213 ? 32.729  5.310  85.995  1.00 46.45 ? 211 GLU B N     1 
ATOM   3708 C  CA    . GLU B 1 213 ? 34.063  4.869  86.381  1.00 49.30 ? 211 GLU B CA    1 
ATOM   3709 C  C     . GLU B 1 213 ? 34.850  4.136  85.300  1.00 48.72 ? 211 GLU B C     1 
ATOM   3710 O  O     . GLU B 1 213 ? 35.286  3.007  85.494  1.00 49.61 ? 211 GLU B O     1 
ATOM   3711 C  CB    . GLU B 1 213 ? 34.000  4.021  87.663  1.00 51.90 ? 211 GLU B CB    1 
ATOM   3712 C  CG    . GLU B 1 213 ? 32.680  3.298  87.909  1.00 55.55 ? 211 GLU B CG    1 
ATOM   3713 C  CD    . GLU B 1 213 ? 32.482  2.093  87.011  1.00 57.42 ? 211 GLU B CD    1 
ATOM   3714 O  OE1   . GLU B 1 213 ? 33.382  1.800  86.195  1.00 58.24 ? 211 GLU B OE1   1 
ATOM   3715 O  OE2   . GLU B 1 213 ? 31.423  1.436  87.124  1.00 57.63 ? 211 GLU B OE2   1 
ATOM   3716 N  N     . GLY B 1 214 ? 35.033  4.790  84.158  1.00 48.71 ? 212 GLY B N     1 
ATOM   3717 C  CA    . GLY B 1 214 ? 35.793  4.184  83.079  1.00 46.97 ? 212 GLY B CA    1 
ATOM   3718 C  C     . GLY B 1 214 ? 35.035  3.263  82.142  1.00 45.08 ? 212 GLY B C     1 
ATOM   3719 O  O     . GLY B 1 214 ? 35.411  3.131  80.976  1.00 46.59 ? 212 GLY B O     1 
ATOM   3720 N  N     . GLN B 1 215 ? 33.979  2.622  82.632  1.00 42.46 ? 213 GLN B N     1 
ATOM   3721 C  CA    . GLN B 1 215 ? 33.206  1.717  81.791  1.00 39.65 ? 213 GLN B CA    1 
ATOM   3722 C  C     . GLN B 1 215 ? 32.241  2.495  80.912  1.00 36.77 ? 213 GLN B C     1 
ATOM   3723 O  O     . GLN B 1 215 ? 31.526  3.373  81.391  1.00 35.49 ? 213 GLN B O     1 
ATOM   3724 C  CB    . GLN B 1 215 ? 32.437  0.716  82.652  1.00 42.92 ? 213 GLN B CB    1 
ATOM   3725 C  CG    . GLN B 1 215 ? 33.299  0.058  83.715  1.00 47.76 ? 213 GLN B CG    1 
ATOM   3726 C  CD    . GLN B 1 215 ? 34.622  -0.454 83.164  1.00 49.96 ? 213 GLN B CD    1 
ATOM   3727 O  OE1   . GLN B 1 215 ? 34.662  -1.438 82.422  1.00 50.97 ? 213 GLN B OE1   1 
ATOM   3728 N  NE2   . GLN B 1 215 ? 35.711  0.221  83.521  1.00 51.01 ? 213 GLN B NE2   1 
ATOM   3729 N  N     . ARG B 1 216 ? 32.233  2.172  79.623  1.00 33.52 ? 214 ARG B N     1 
ATOM   3730 C  CA    . ARG B 1 216 ? 31.354  2.842  78.673  1.00 32.78 ? 214 ARG B CA    1 
ATOM   3731 C  C     . ARG B 1 216 ? 30.314  1.857  78.177  1.00 31.70 ? 214 ARG B C     1 
ATOM   3732 O  O     . ARG B 1 216 ? 30.624  0.692  77.915  1.00 31.23 ? 214 ARG B O     1 
ATOM   3733 C  CB    . ARG B 1 216 ? 32.140  3.340  77.459  1.00 33.98 ? 214 ARG B CB    1 
ATOM   3734 C  CG    . ARG B 1 216 ? 33.448  4.020  77.774  1.00 41.85 ? 214 ARG B CG    1 
ATOM   3735 C  CD    . ARG B 1 216 ? 34.329  4.061  76.532  1.00 44.47 ? 214 ARG B CD    1 
ATOM   3736 N  NE    . ARG B 1 216 ? 35.683  4.504  76.850  1.00 49.48 ? 214 ARG B NE    1 
ATOM   3737 C  CZ    . ARG B 1 216 ? 35.987  5.725  77.278  1.00 51.15 ? 214 ARG B CZ    1 
ATOM   3738 N  NH1   . ARG B 1 216 ? 35.030  6.634  77.437  1.00 49.28 ? 214 ARG B NH1   1 
ATOM   3739 N  NH2   . ARG B 1 216 ? 37.249  6.033  77.555  1.00 51.45 ? 214 ARG B NH2   1 
ATOM   3740 N  N     . GLN B 1 217 ? 29.085  2.339  78.039  1.00 30.15 ? 215 GLN B N     1 
ATOM   3741 C  CA    . GLN B 1 217 ? 27.989  1.525  77.542  1.00 30.73 ? 215 GLN B CA    1 
ATOM   3742 C  C     . GLN B 1 217 ? 27.165  2.374  76.589  1.00 29.06 ? 215 GLN B C     1 
ATOM   3743 O  O     . GLN B 1 217 ? 26.802  3.501  76.899  1.00 26.78 ? 215 GLN B O     1 
ATOM   3744 C  CB    . GLN B 1 217 ? 27.111  1.029  78.689  1.00 31.15 ? 215 GLN B CB    1 
ATOM   3745 C  CG    . GLN B 1 217 ? 27.734  -0.100 79.489  1.00 35.26 ? 215 GLN B CG    1 
ATOM   3746 C  CD    . GLN B 1 217 ? 26.825  -0.597 80.593  1.00 36.42 ? 215 GLN B CD    1 
ATOM   3747 O  OE1   . GLN B 1 217 ? 26.555  0.119  81.559  1.00 36.51 ? 215 GLN B OE1   1 
ATOM   3748 N  NE2   . GLN B 1 217 ? 26.337  -1.828 80.451  1.00 37.04 ? 215 GLN B NE2   1 
ATOM   3749 N  N     . PHE B 1 218 ? 26.875  1.823  75.422  1.00 27.53 ? 216 PHE B N     1 
ATOM   3750 C  CA    . PHE B 1 218 ? 26.109  2.546  74.434  1.00 28.78 ? 216 PHE B CA    1 
ATOM   3751 C  C     . PHE B 1 218 ? 24.704  1.977  74.292  1.00 28.50 ? 216 PHE B C     1 
ATOM   3752 O  O     . PHE B 1 218 ? 24.518  0.760  74.247  1.00 30.12 ? 216 PHE B O     1 
ATOM   3753 C  CB    . PHE B 1 218 ? 26.834  2.484  73.096  1.00 30.22 ? 216 PHE B CB    1 
ATOM   3754 C  CG    . PHE B 1 218 ? 26.061  3.082  71.969  1.00 32.83 ? 216 PHE B CG    1 
ATOM   3755 C  CD1   . PHE B 1 218 ? 25.903  4.456  71.873  1.00 32.69 ? 216 PHE B CD1   1 
ATOM   3756 C  CD2   . PHE B 1 218 ? 25.472  2.269  71.013  1.00 34.76 ? 216 PHE B CD2   1 
ATOM   3757 C  CE1   . PHE B 1 218 ? 25.168  5.011  70.838  1.00 34.43 ? 216 PHE B CE1   1 
ATOM   3758 C  CE2   . PHE B 1 218 ? 24.734  2.818  69.972  1.00 35.67 ? 216 PHE B CE2   1 
ATOM   3759 C  CZ    . PHE B 1 218 ? 24.584  4.190  69.886  1.00 33.04 ? 216 PHE B CZ    1 
ATOM   3760 N  N     . CYS B 1 219 ? 23.715  2.859  74.224  1.00 26.83 ? 217 CYS B N     1 
ATOM   3761 C  CA    . CYS B 1 219 ? 22.331  2.427  74.068  1.00 25.09 ? 217 CYS B CA    1 
ATOM   3762 C  C     . CYS B 1 219 ? 21.768  3.007  72.782  1.00 25.82 ? 217 CYS B C     1 
ATOM   3763 O  O     . CYS B 1 219 ? 21.636  4.224  72.649  1.00 24.44 ? 217 CYS B O     1 
ATOM   3764 C  CB    . CYS B 1 219 ? 21.480  2.896  75.248  1.00 26.38 ? 217 CYS B CB    1 
ATOM   3765 S  SG    . CYS B 1 219 ? 19.749  2.330  75.163  1.00 26.75 ? 217 CYS B SG    1 
ATOM   3766 N  N     . PRO B 1 220 ? 21.430  2.144  71.811  1.00 24.06 ? 218 PRO B N     1 
ATOM   3767 C  CA    . PRO B 1 220 ? 20.883  2.644  70.550  1.00 25.47 ? 218 PRO B CA    1 
ATOM   3768 C  C     . PRO B 1 220 ? 19.523  3.294  70.768  1.00 22.79 ? 218 PRO B C     1 
ATOM   3769 O  O     . PRO B 1 220 ? 18.784  2.930  71.690  1.00 22.67 ? 218 PRO B O     1 
ATOM   3770 C  CB    . PRO B 1 220 ? 20.775  1.380  69.689  1.00 27.70 ? 218 PRO B CB    1 
ATOM   3771 C  CG    . PRO B 1 220 ? 21.766  0.433  70.320  1.00 28.58 ? 218 PRO B CG    1 
ATOM   3772 C  CD    . PRO B 1 220 ? 21.538  0.678  71.779  1.00 27.35 ? 218 PRO B CD    1 
ATOM   3773 N  N     . ALA B 1 221 ? 19.202  4.265  69.928  1.00 22.95 ? 219 ALA B N     1 
ATOM   3774 C  CA    . ALA B 1 221 ? 17.915  4.932  70.018  1.00 23.78 ? 219 ALA B CA    1 
ATOM   3775 C  C     . ALA B 1 221 ? 16.892  3.962  69.429  1.00 25.11 ? 219 ALA B C     1 
ATOM   3776 O  O     . ALA B 1 221 ? 17.254  3.053  68.683  1.00 25.27 ? 219 ALA B O     1 
ATOM   3777 C  CB    . ALA B 1 221 ? 17.942  6.229  69.205  1.00 25.20 ? 219 ALA B CB    1 
ATOM   3778 N  N     . VAL B 1 222 ? 15.625  4.141  69.778  1.00 24.09 ? 220 VAL B N     1 
ATOM   3779 C  CA    . VAL B 1 222 ? 14.564  3.297  69.248  1.00 24.28 ? 220 VAL B CA    1 
ATOM   3780 C  C     . VAL B 1 222 ? 14.100  3.935  67.938  1.00 24.53 ? 220 VAL B C     1 
ATOM   3781 O  O     . VAL B 1 222 ? 13.740  5.111  67.916  1.00 24.67 ? 220 VAL B O     1 
ATOM   3782 C  CB    . VAL B 1 222 ? 13.380  3.226  70.230  1.00 24.34 ? 220 VAL B CB    1 
ATOM   3783 C  CG1   . VAL B 1 222 ? 12.178  2.555  69.562  1.00 25.02 ? 220 VAL B CG1   1 
ATOM   3784 C  CG2   . VAL B 1 222 ? 13.791  2.456  71.470  1.00 25.92 ? 220 VAL B CG2   1 
ATOM   3785 N  N     . PRO B 1 223 ? 14.111  3.173  66.826  1.00 24.40 ? 221 PRO B N     1 
ATOM   3786 C  CA    . PRO B 1 223 ? 13.678  3.744  65.543  1.00 25.43 ? 221 PRO B CA    1 
ATOM   3787 C  C     . PRO B 1 223 ? 12.327  4.439  65.676  1.00 24.90 ? 221 PRO B C     1 
ATOM   3788 O  O     . PRO B 1 223 ? 11.386  3.885  66.249  1.00 23.72 ? 221 PRO B O     1 
ATOM   3789 C  CB    . PRO B 1 223 ? 13.626  2.526  64.620  1.00 26.19 ? 221 PRO B CB    1 
ATOM   3790 C  CG    . PRO B 1 223 ? 14.689  1.628  65.192  1.00 26.26 ? 221 PRO B CG    1 
ATOM   3791 C  CD    . PRO B 1 223 ? 14.457  1.748  66.680  1.00 25.17 ? 221 PRO B CD    1 
ATOM   3792 N  N     . ALA B 1 224 ? 12.239  5.657  65.152  1.00 23.30 ? 222 ALA B N     1 
ATOM   3793 C  CA    . ALA B 1 224 ? 11.007  6.434  65.234  1.00 25.18 ? 222 ALA B CA    1 
ATOM   3794 C  C     . ALA B 1 224 ? 10.894  7.431  64.090  1.00 24.72 ? 222 ALA B C     1 
ATOM   3795 O  O     . ALA B 1 224 ? 11.902  7.824  63.499  1.00 24.93 ? 222 ALA B O     1 
ATOM   3796 C  CB    . ALA B 1 224 ? 10.959  7.186  66.569  1.00 24.15 ? 222 ALA B CB    1 
ATOM   3797 N  N     . GLU B 1 225 ? 9.661   7.821  63.776  1.00 25.42 ? 223 GLU B N     1 
ATOM   3798 C  CA    . GLU B 1 225 ? 9.394   8.818  62.742  1.00 27.65 ? 223 GLU B CA    1 
ATOM   3799 C  C     . GLU B 1 225 ? 9.448   10.158 63.477  1.00 27.90 ? 223 GLU B C     1 
ATOM   3800 O  O     . GLU B 1 225 ? 8.596   10.441 64.315  1.00 28.26 ? 223 GLU B O     1 
ATOM   3801 C  CB    . GLU B 1 225 ? 8.000   8.616  62.149  1.00 29.60 ? 223 GLU B CB    1 
ATOM   3802 C  CG    . GLU B 1 225 ? 7.612   9.634  61.084  1.00 34.72 ? 223 GLU B CG    1 
ATOM   3803 C  CD    . GLU B 1 225 ? 8.636   9.728  59.967  1.00 37.83 ? 223 GLU B CD    1 
ATOM   3804 O  OE1   . GLU B 1 225 ? 9.217   8.684  59.601  1.00 40.04 ? 223 GLU B OE1   1 
ATOM   3805 O  OE2   . GLU B 1 225 ? 8.852   10.843 59.447  1.00 40.52 ? 223 GLU B OE2   1 
ATOM   3806 N  N     . ALA B 1 226 ? 10.442  10.979 63.159  1.00 27.74 ? 224 ALA B N     1 
ATOM   3807 C  CA    . ALA B 1 226 ? 10.623  12.262 63.838  1.00 27.98 ? 224 ALA B CA    1 
ATOM   3808 C  C     . ALA B 1 226 ? 9.752   13.409 63.347  1.00 27.73 ? 224 ALA B C     1 
ATOM   3809 O  O     . ALA B 1 226 ? 10.219  14.269 62.599  1.00 29.00 ? 224 ALA B O     1 
ATOM   3810 C  CB    . ALA B 1 226 ? 12.092  12.672 63.767  1.00 27.84 ? 224 ALA B CB    1 
ATOM   3811 N  N     . LEU B 1 227 ? 8.494   13.439 63.772  1.00 26.89 ? 225 LEU B N     1 
ATOM   3812 C  CA    . LEU B 1 227 ? 7.599   14.517 63.363  1.00 26.81 ? 225 LEU B CA    1 
ATOM   3813 C  C     . LEU B 1 227 ? 7.941   15.809 64.110  1.00 25.93 ? 225 LEU B C     1 
ATOM   3814 O  O     . LEU B 1 227 ? 7.898   16.901 63.535  1.00 25.35 ? 225 LEU B O     1 
ATOM   3815 C  CB    . LEU B 1 227 ? 6.141   14.160 63.656  1.00 27.35 ? 225 LEU B CB    1 
ATOM   3816 C  CG    . LEU B 1 227 ? 5.500   12.958 62.955  1.00 29.44 ? 225 LEU B CG    1 
ATOM   3817 C  CD1   . LEU B 1 227 ? 4.011   12.955 63.270  1.00 27.49 ? 225 LEU B CD1   1 
ATOM   3818 C  CD2   . LEU B 1 227 ? 5.712   13.041 61.454  1.00 30.75 ? 225 LEU B CD2   1 
ATOM   3819 N  N     . ASP B 1 228 ? 8.279   15.675 65.390  1.00 22.75 ? 226 ASP B N     1 
ATOM   3820 C  CA    . ASP B 1 228 ? 8.593   16.826 66.230  1.00 22.16 ? 226 ASP B CA    1 
ATOM   3821 C  C     . ASP B 1 228 ? 9.501   16.378 67.371  1.00 21.68 ? 226 ASP B C     1 
ATOM   3822 O  O     . ASP B 1 228 ? 9.078   15.644 68.269  1.00 21.50 ? 226 ASP B O     1 
ATOM   3823 C  CB    . ASP B 1 228 ? 7.291   17.425 66.781  1.00 23.28 ? 226 ASP B CB    1 
ATOM   3824 C  CG    . ASP B 1 228 ? 7.511   18.716 67.542  1.00 25.71 ? 226 ASP B CG    1 
ATOM   3825 O  OD1   . ASP B 1 228 ? 8.683   19.089 67.763  1.00 25.20 ? 226 ASP B OD1   1 
ATOM   3826 O  OD2   . ASP B 1 228 ? 6.503   19.356 67.928  1.00 27.84 ? 226 ASP B OD2   1 
ATOM   3827 N  N     . THR B 1 229 ? 10.746  16.838 67.310  1.00 21.12 ? 227 THR B N     1 
ATOM   3828 C  CA    . THR B 1 229 ? 11.803  16.517 68.271  1.00 24.39 ? 227 THR B CA    1 
ATOM   3829 C  C     . THR B 1 229 ? 11.728  17.286 69.596  1.00 23.03 ? 227 THR B C     1 
ATOM   3830 O  O     . THR B 1 229 ? 12.456  16.982 70.549  1.00 22.47 ? 227 THR B O     1 
ATOM   3831 C  CB    . THR B 1 229 ? 13.182  16.745 67.574  1.00 25.55 ? 227 THR B CB    1 
ATOM   3832 O  OG1   . THR B 1 229 ? 13.462  15.623 66.724  1.00 33.37 ? 227 THR B OG1   1 
ATOM   3833 C  CG2   . THR B 1 229 ? 14.293  16.901 68.557  1.00 33.28 ? 227 THR B CG2   1 
ATOM   3834 N  N     . THR B 1 230 ? 10.826  18.256 69.674  1.00 22.15 ? 228 THR B N     1 
ATOM   3835 C  CA    . THR B 1 230 ? 10.680  19.063 70.888  1.00 22.51 ? 228 THR B CA    1 
ATOM   3836 C  C     . THR B 1 230 ? 10.555  18.262 72.183  1.00 21.89 ? 228 THR B C     1 
ATOM   3837 O  O     . THR B 1 230 ? 9.661   17.433 72.336  1.00 20.10 ? 228 THR B O     1 
ATOM   3838 C  CB    . THR B 1 230 ? 9.454   19.992 70.797  1.00 21.94 ? 228 THR B CB    1 
ATOM   3839 O  OG1   . THR B 1 230 ? 9.556   20.799 69.621  1.00 24.73 ? 228 THR B OG1   1 
ATOM   3840 C  CG2   . THR B 1 230 ? 9.381   20.903 72.018  1.00 23.12 ? 228 THR B CG2   1 
ATOM   3841 N  N     . GLY B 1 231 ? 11.462  18.521 73.117  1.00 21.31 ? 229 GLY B N     1 
ATOM   3842 C  CA    . GLY B 1 231 ? 11.413  17.838 74.395  1.00 21.80 ? 229 GLY B CA    1 
ATOM   3843 C  C     . GLY B 1 231 ? 11.910  16.409 74.454  1.00 21.21 ? 229 GLY B C     1 
ATOM   3844 O  O     . GLY B 1 231 ? 11.699  15.733 75.459  1.00 19.36 ? 229 GLY B O     1 
ATOM   3845 N  N     . ALA B 1 232 ? 12.574  15.939 73.400  1.00 22.56 ? 230 ALA B N     1 
ATOM   3846 C  CA    . ALA B 1 232 ? 13.081  14.570 73.394  1.00 23.16 ? 230 ALA B CA    1 
ATOM   3847 C  C     . ALA B 1 232 ? 14.149  14.431 74.467  1.00 21.68 ? 230 ALA B C     1 
ATOM   3848 O  O     . ALA B 1 232 ? 14.174  13.453 75.212  1.00 21.18 ? 230 ALA B O     1 
ATOM   3849 C  CB    . ALA B 1 232 ? 13.661  14.217 72.026  1.00 24.12 ? 230 ALA B CB    1 
ATOM   3850 N  N     . GLY B 1 233 ? 15.025  15.425 74.552  1.00 21.96 ? 231 GLY B N     1 
ATOM   3851 C  CA    . GLY B 1 233 ? 16.076  15.390 75.554  1.00 20.48 ? 231 GLY B CA    1 
ATOM   3852 C  C     . GLY B 1 233 ? 15.507  15.370 76.959  1.00 20.44 ? 231 GLY B C     1 
ATOM   3853 O  O     . GLY B 1 233 ? 15.985  14.626 77.835  1.00 17.47 ? 231 GLY B O     1 
ATOM   3854 N  N     . ASP B 1 234 ? 14.480  16.188 77.184  1.00 19.19 ? 232 ASP B N     1 
ATOM   3855 C  CA    . ASP B 1 234 ? 13.839  16.253 78.494  1.00 19.27 ? 232 ASP B CA    1 
ATOM   3856 C  C     . ASP B 1 234 ? 13.184  14.919 78.840  1.00 19.35 ? 232 ASP B C     1 
ATOM   3857 O  O     . ASP B 1 234 ? 13.254  14.453 79.977  1.00 18.78 ? 232 ASP B O     1 
ATOM   3858 C  CB    . ASP B 1 234 ? 12.783  17.366 78.519  1.00 19.36 ? 232 ASP B CB    1 
ATOM   3859 C  CG    . ASP B 1 234 ? 13.374  18.728 78.226  1.00 22.93 ? 232 ASP B CG    1 
ATOM   3860 O  OD1   . ASP B 1 234 ? 14.476  19.016 78.742  1.00 22.40 ? 232 ASP B OD1   1 
ATOM   3861 O  OD2   . ASP B 1 234 ? 12.734  19.508 77.492  1.00 23.14 ? 232 ASP B OD2   1 
ATOM   3862 N  N     . THR B 1 235 ? 12.533  14.314 77.854  1.00 18.53 ? 233 THR B N     1 
ATOM   3863 C  CA    . THR B 1 235 ? 11.887  13.026 78.067  1.00 19.07 ? 233 THR B CA    1 
ATOM   3864 C  C     . THR B 1 235 ? 12.917  11.974 78.441  1.00 18.61 ? 233 THR B C     1 
ATOM   3865 O  O     . THR B 1 235 ? 12.734  11.225 79.396  1.00 20.18 ? 233 THR B O     1 
ATOM   3866 C  CB    . THR B 1 235 ? 11.168  12.546 76.797  1.00 17.75 ? 233 THR B CB    1 
ATOM   3867 O  OG1   . THR B 1 235 ? 10.179  13.514 76.425  1.00 18.51 ? 233 THR B OG1   1 
ATOM   3868 C  CG2   . THR B 1 235 ? 10.485  11.193 77.048  1.00 19.12 ? 233 THR B CG2   1 
ATOM   3869 N  N     . PHE B 1 236 ? 14.000  11.921 77.676  1.00 19.19 ? 234 PHE B N     1 
ATOM   3870 C  CA    . PHE B 1 236 ? 15.059  10.943 77.919  1.00 19.09 ? 234 PHE B CA    1 
ATOM   3871 C  C     . PHE B 1 236 ? 15.607  11.035 79.350  1.00 19.44 ? 234 PHE B C     1 
ATOM   3872 O  O     . PHE B 1 236 ? 15.712  10.030 80.062  1.00 18.22 ? 234 PHE B O     1 
ATOM   3873 C  CB    . PHE B 1 236 ? 16.200  11.153 76.919  1.00 19.52 ? 234 PHE B CB    1 
ATOM   3874 C  CG    . PHE B 1 236 ? 17.236  10.066 76.948  1.00 18.29 ? 234 PHE B CG    1 
ATOM   3875 C  CD1   . PHE B 1 236 ? 17.172  9.002  76.052  1.00 18.59 ? 234 PHE B CD1   1 
ATOM   3876 C  CD2   . PHE B 1 236 ? 18.261  10.092 77.889  1.00 18.78 ? 234 PHE B CD2   1 
ATOM   3877 C  CE1   . PHE B 1 236 ? 18.115  7.980  76.091  1.00 18.62 ? 234 PHE B CE1   1 
ATOM   3878 C  CE2   . PHE B 1 236 ? 19.206  9.072  77.936  1.00 19.72 ? 234 PHE B CE2   1 
ATOM   3879 C  CZ    . PHE B 1 236 ? 19.132  8.017  77.035  1.00 18.86 ? 234 PHE B CZ    1 
ATOM   3880 N  N     . LEU B 1 237 ? 15.959  12.242 79.773  1.00 19.58 ? 235 LEU B N     1 
ATOM   3881 C  CA    . LEU B 1 237 ? 16.508  12.424 81.116  1.00 20.05 ? 235 LEU B CA    1 
ATOM   3882 C  C     . LEU B 1 237 ? 15.519  12.011 82.194  1.00 20.41 ? 235 LEU B C     1 
ATOM   3883 O  O     . LEU B 1 237 ? 15.846  11.231 83.085  1.00 18.83 ? 235 LEU B O     1 
ATOM   3884 C  CB    . LEU B 1 237 ? 16.913  13.889 81.329  1.00 20.50 ? 235 LEU B CB    1 
ATOM   3885 C  CG    . LEU B 1 237 ? 17.635  14.209 82.648  1.00 19.97 ? 235 LEU B CG    1 
ATOM   3886 C  CD1   . LEU B 1 237 ? 18.498  15.447 82.469  1.00 18.91 ? 235 LEU B CD1   1 
ATOM   3887 C  CD2   . LEU B 1 237 ? 16.618  14.419 83.758  1.00 18.91 ? 235 LEU B CD2   1 
ATOM   3888 N  N     . ALA B 1 238 ? 14.305  12.542 82.106  1.00 19.95 ? 236 ALA B N     1 
ATOM   3889 C  CA    . ALA B 1 238 ? 13.268  12.247 83.085  1.00 20.88 ? 236 ALA B CA    1 
ATOM   3890 C  C     . ALA B 1 238 ? 13.036  10.752 83.262  1.00 20.76 ? 236 ALA B C     1 
ATOM   3891 O  O     . ALA B 1 238 ? 13.036  10.241 84.389  1.00 18.13 ? 236 ALA B O     1 
ATOM   3892 C  CB    . ALA B 1 238 ? 11.955  12.929 82.680  1.00 21.38 ? 236 ALA B CB    1 
ATOM   3893 N  N     . VAL B 1 239 ? 12.836  10.051 82.149  1.00 19.62 ? 237 VAL B N     1 
ATOM   3894 C  CA    . VAL B 1 239 ? 12.571  8.620  82.215  1.00 19.34 ? 237 VAL B CA    1 
ATOM   3895 C  C     . VAL B 1 239 ? 13.784  7.799  82.647  1.00 20.57 ? 237 VAL B C     1 
ATOM   3896 O  O     . VAL B 1 239 ? 13.640  6.817  83.374  1.00 22.47 ? 237 VAL B O     1 
ATOM   3897 C  CB    . VAL B 1 239 ? 12.027  8.102  80.867  1.00 19.51 ? 237 VAL B CB    1 
ATOM   3898 C  CG1   . VAL B 1 239 ? 11.826  6.585  80.926  1.00 18.12 ? 237 VAL B CG1   1 
ATOM   3899 C  CG2   . VAL B 1 239 ? 10.688  8.802  80.555  1.00 15.61 ? 237 VAL B CG2   1 
HETATM 3900 N  N     . MSE B 1 240 ? 14.972  8.183  82.202  1.00 19.58 ? 238 MSE B N     1 
HETATM 3901 C  CA    . MSE B 1 240 ? 16.162  7.457  82.617  1.00 23.59 ? 238 MSE B CA    1 
HETATM 3902 C  C     . MSE B 1 240 ? 16.284  7.554  84.140  1.00 22.90 ? 238 MSE B C     1 
HETATM 3903 O  O     . MSE B 1 240 ? 16.492  6.554  84.824  1.00 21.26 ? 238 MSE B O     1 
HETATM 3904 C  CB    . MSE B 1 240 ? 17.411  8.054  81.976  1.00 27.90 ? 238 MSE B CB    1 
HETATM 3905 C  CG    . MSE B 1 240 ? 18.690  7.427  82.480  1.00 34.12 ? 238 MSE B CG    1 
HETATM 3906 SE SE    . MSE B 1 240 ? 20.127  8.702  82.452  1.00 49.92 ? 238 MSE B SE    1 
HETATM 3907 C  CE    . MSE B 1 240 ? 19.588  9.754  83.979  1.00 41.65 ? 238 MSE B CE    1 
ATOM   3908 N  N     . LEU B 1 241 ? 16.143  8.766  84.669  1.00 21.93 ? 239 LEU B N     1 
ATOM   3909 C  CA    . LEU B 1 241 ? 16.248  8.972  86.107  1.00 21.82 ? 239 LEU B CA    1 
ATOM   3910 C  C     . LEU B 1 241 ? 15.126  8.235  86.845  1.00 21.40 ? 239 LEU B C     1 
ATOM   3911 O  O     . LEU B 1 241 ? 15.362  7.579  87.858  1.00 21.57 ? 239 LEU B O     1 
ATOM   3912 C  CB    . LEU B 1 241 ? 16.202  10.475 86.428  1.00 23.93 ? 239 LEU B CB    1 
ATOM   3913 C  CG    . LEU B 1 241 ? 16.420  10.861 87.897  1.00 25.58 ? 239 LEU B CG    1 
ATOM   3914 C  CD1   . LEU B 1 241 ? 17.767  10.328 88.383  1.00 27.80 ? 239 LEU B CD1   1 
ATOM   3915 C  CD2   . LEU B 1 241 ? 16.371  12.377 88.042  1.00 26.10 ? 239 LEU B CD2   1 
ATOM   3916 N  N     . ALA B 1 242 ? 13.907  8.327  86.323  1.00 20.58 ? 240 ALA B N     1 
ATOM   3917 C  CA    . ALA B 1 242 ? 12.771  7.662  86.950  1.00 21.41 ? 240 ALA B CA    1 
ATOM   3918 C  C     . ALA B 1 242 ? 12.998  6.156  87.022  1.00 22.13 ? 240 ALA B C     1 
ATOM   3919 O  O     . ALA B 1 242 ? 12.771  5.532  88.067  1.00 23.38 ? 240 ALA B O     1 
ATOM   3920 C  CB    . ALA B 1 242 ? 11.483  7.959  86.173  1.00 19.79 ? 240 ALA B CB    1 
ATOM   3921 N  N     . SER B 1 243 ? 13.443  5.576  85.912  1.00 20.86 ? 241 SER B N     1 
ATOM   3922 C  CA    . SER B 1 243 ? 13.687  4.142  85.847  1.00 23.14 ? 241 SER B CA    1 
ATOM   3923 C  C     . SER B 1 243 ? 14.681  3.690  86.917  1.00 23.44 ? 241 SER B C     1 
ATOM   3924 O  O     . SER B 1 243 ? 14.431  2.729  87.638  1.00 24.46 ? 241 SER B O     1 
ATOM   3925 C  CB    . SER B 1 243 ? 14.197  3.762  84.457  1.00 21.72 ? 241 SER B CB    1 
ATOM   3926 O  OG    . SER B 1 243 ? 14.570  2.395  84.412  1.00 24.47 ? 241 SER B OG    1 
ATOM   3927 N  N     . ALA B 1 244 ? 15.807  4.386  87.011  1.00 24.90 ? 242 ALA B N     1 
ATOM   3928 C  CA    . ALA B 1 244 ? 16.831  4.058  88.004  1.00 25.99 ? 242 ALA B CA    1 
ATOM   3929 C  C     . ALA B 1 244 ? 16.282  4.262  89.420  1.00 28.18 ? 242 ALA B C     1 
ATOM   3930 O  O     . ALA B 1 244 ? 16.520  3.452  90.316  1.00 29.17 ? 242 ALA B O     1 
ATOM   3931 C  CB    . ALA B 1 244 ? 18.062  4.933  87.787  1.00 23.96 ? 242 ALA B CB    1 
ATOM   3932 N  N     . LEU B 1 245 ? 15.543  5.350  89.609  1.00 28.61 ? 243 LEU B N     1 
ATOM   3933 C  CA    . LEU B 1 245 ? 14.948  5.671  90.904  1.00 29.31 ? 243 LEU B CA    1 
ATOM   3934 C  C     . LEU B 1 245 ? 13.968  4.577  91.338  1.00 30.34 ? 243 LEU B C     1 
ATOM   3935 O  O     . LEU B 1 245 ? 14.029  4.085  92.468  1.00 29.15 ? 243 LEU B O     1 
ATOM   3936 C  CB    . LEU B 1 245 ? 14.220  7.021  90.812  1.00 31.16 ? 243 LEU B CB    1 
ATOM   3937 C  CG    . LEU B 1 245 ? 14.760  8.244  91.565  1.00 31.72 ? 243 LEU B CG    1 
ATOM   3938 C  CD1   . LEU B 1 245 ? 16.259  8.155  91.747  1.00 34.98 ? 243 LEU B CD1   1 
ATOM   3939 C  CD2   . LEU B 1 245 ? 14.370  9.510  90.809  1.00 32.55 ? 243 LEU B CD2   1 
ATOM   3940 N  N     . LEU B 1 246 ? 13.072  4.196  90.434  1.00 28.80 ? 244 LEU B N     1 
ATOM   3941 C  CA    . LEU B 1 246 ? 12.076  3.167  90.722  1.00 29.57 ? 244 LEU B CA    1 
ATOM   3942 C  C     . LEU B 1 246 ? 12.661  1.786  91.010  1.00 30.70 ? 244 LEU B C     1 
ATOM   3943 O  O     . LEU B 1 246 ? 12.004  0.946  91.620  1.00 31.50 ? 244 LEU B O     1 
ATOM   3944 C  CB    . LEU B 1 246 ? 11.086  3.061  89.562  1.00 29.01 ? 244 LEU B CB    1 
ATOM   3945 C  CG    . LEU B 1 246 ? 10.142  4.249  89.373  1.00 29.82 ? 244 LEU B CG    1 
ATOM   3946 C  CD1   . LEU B 1 246 ? 9.371   4.061  88.077  1.00 29.97 ? 244 LEU B CD1   1 
ATOM   3947 C  CD2   . LEU B 1 246 ? 9.192   4.365  90.560  1.00 28.21 ? 244 LEU B CD2   1 
ATOM   3948 N  N     . ARG B 1 247 ? 13.891  1.542  90.577  1.00 30.96 ? 245 ARG B N     1 
ATOM   3949 C  CA    . ARG B 1 247 ? 14.508  0.243  90.817  1.00 30.68 ? 245 ARG B CA    1 
ATOM   3950 C  C     . ARG B 1 247 ? 15.600  0.324  91.881  1.00 31.12 ? 245 ARG B C     1 
ATOM   3951 O  O     . ARG B 1 247 ? 16.269  -0.667 92.175  1.00 31.60 ? 245 ARG B O     1 
ATOM   3952 C  CB    . ARG B 1 247 ? 15.053  -0.325 89.504  1.00 29.08 ? 245 ARG B CB    1 
ATOM   3953 C  CG    . ARG B 1 247 ? 13.940  -0.653 88.501  1.00 28.69 ? 245 ARG B CG    1 
ATOM   3954 C  CD    . ARG B 1 247 ? 14.462  -1.125 87.151  1.00 28.81 ? 245 ARG B CD    1 
ATOM   3955 N  NE    . ARG B 1 247 ? 15.151  -0.061 86.428  1.00 27.99 ? 245 ARG B NE    1 
ATOM   3956 C  CZ    . ARG B 1 247 ? 16.466  -0.005 86.258  1.00 28.98 ? 245 ARG B CZ    1 
ATOM   3957 N  NH1   . ARG B 1 247 ? 17.242  -0.962 86.750  1.00 27.33 ? 245 ARG B NH1   1 
ATOM   3958 N  NH2   . ARG B 1 247 ? 17.006  1.019  85.613  1.00 27.50 ? 245 ARG B NH2   1 
ATOM   3959 N  N     . GLY B 1 248 ? 15.762  1.514  92.455  1.00 30.21 ? 246 GLY B N     1 
ATOM   3960 C  CA    . GLY B 1 248 ? 16.748  1.729  93.499  1.00 31.45 ? 246 GLY B CA    1 
ATOM   3961 C  C     . GLY B 1 248 ? 18.199  1.578  93.092  1.00 32.72 ? 246 GLY B C     1 
ATOM   3962 O  O     . GLY B 1 248 ? 19.018  1.129  93.891  1.00 33.89 ? 246 GLY B O     1 
ATOM   3963 N  N     . VAL B 1 249 ? 18.537  1.950  91.862  1.00 31.94 ? 247 VAL B N     1 
ATOM   3964 C  CA    . VAL B 1 249 ? 19.918  1.837  91.409  1.00 31.79 ? 247 VAL B CA    1 
ATOM   3965 C  C     . VAL B 1 249 ? 20.381  3.119  90.729  1.00 31.46 ? 247 VAL B C     1 
ATOM   3966 O  O     . VAL B 1 249 ? 19.575  4.006  90.447  1.00 30.54 ? 247 VAL B O     1 
ATOM   3967 C  CB    . VAL B 1 249 ? 20.091  0.660  90.414  1.00 32.64 ? 247 VAL B CB    1 
ATOM   3968 C  CG1   . VAL B 1 249 ? 19.611  -0.637 91.055  1.00 35.26 ? 247 VAL B CG1   1 
ATOM   3969 C  CG2   . VAL B 1 249 ? 19.324  0.933  89.133  1.00 32.34 ? 247 VAL B CG2   1 
ATOM   3970 N  N     . ALA B 1 250 ? 21.686  3.224  90.491  1.00 30.04 ? 248 ALA B N     1 
ATOM   3971 C  CA    . ALA B 1 250 ? 22.230  4.385  89.800  1.00 29.29 ? 248 ALA B CA    1 
ATOM   3972 C  C     . ALA B 1 250 ? 21.886  4.142  88.333  1.00 27.95 ? 248 ALA B C     1 
ATOM   3973 O  O     . ALA B 1 250 ? 21.609  3.008  87.945  1.00 26.91 ? 248 ALA B O     1 
ATOM   3974 C  CB    . ALA B 1 250 ? 23.740  4.452  89.985  1.00 30.01 ? 248 ALA B CB    1 
ATOM   3975 N  N     . PRO B 1 251 ? 21.888  5.195  87.501  1.00 27.21 ? 249 PRO B N     1 
ATOM   3976 C  CA    . PRO B 1 251 ? 21.563  5.008  86.083  1.00 27.04 ? 249 PRO B CA    1 
ATOM   3977 C  C     . PRO B 1 251 ? 22.330  3.830  85.486  1.00 26.43 ? 249 PRO B C     1 
ATOM   3978 O  O     . PRO B 1 251 ? 23.536  3.727  85.659  1.00 26.35 ? 249 PRO B O     1 
ATOM   3979 C  CB    . PRO B 1 251 ? 21.966  6.342  85.467  1.00 26.04 ? 249 PRO B CB    1 
ATOM   3980 C  CG    . PRO B 1 251 ? 21.627  7.306  86.558  1.00 26.99 ? 249 PRO B CG    1 
ATOM   3981 C  CD    . PRO B 1 251 ? 22.164  6.611  87.793  1.00 27.51 ? 249 PRO B CD    1 
ATOM   3982 N  N     . ASP B 1 252 ? 21.619  2.941  84.797  1.00 25.99 ? 250 ASP B N     1 
ATOM   3983 C  CA    . ASP B 1 252 ? 22.241  1.772  84.185  1.00 26.05 ? 250 ASP B CA    1 
ATOM   3984 C  C     . ASP B 1 252 ? 21.759  1.573  82.759  1.00 26.86 ? 250 ASP B C     1 
ATOM   3985 O  O     . ASP B 1 252 ? 20.972  2.367  82.245  1.00 25.61 ? 250 ASP B O     1 
ATOM   3986 C  CB    . ASP B 1 252 ? 21.952  0.507  85.014  1.00 25.49 ? 250 ASP B CB    1 
ATOM   3987 C  CG    . ASP B 1 252 ? 20.463  0.267  85.244  1.00 28.01 ? 250 ASP B CG    1 
ATOM   3988 O  OD1   . ASP B 1 252 ? 19.626  0.995  84.664  1.00 26.36 ? 250 ASP B OD1   1 
ATOM   3989 O  OD2   . ASP B 1 252 ? 20.121  -0.667 86.012  1.00 26.74 ? 250 ASP B OD2   1 
ATOM   3990 N  N     . ALA B 1 253 ? 22.230  0.505  82.121  1.00 25.98 ? 251 ALA B N     1 
ATOM   3991 C  CA    . ALA B 1 253 ? 21.842  0.206  80.748  1.00 27.36 ? 251 ALA B CA    1 
ATOM   3992 C  C     . ALA B 1 253 ? 20.326  0.137  80.562  1.00 26.70 ? 251 ALA B C     1 
ATOM   3993 O  O     . ALA B 1 253 ? 19.793  0.644  79.572  1.00 24.94 ? 251 ALA B O     1 
ATOM   3994 C  CB    . ALA B 1 253 ? 22.477  -1.108 80.303  1.00 29.18 ? 251 ALA B CB    1 
ATOM   3995 N  N     . LEU B 1 254 ? 19.632  -0.504 81.499  1.00 25.89 ? 252 LEU B N     1 
ATOM   3996 C  CA    . LEU B 1 254 ? 18.183  -0.622 81.396  1.00 25.94 ? 252 LEU B CA    1 
ATOM   3997 C  C     . LEU B 1 254 ? 17.519  0.757  81.480  1.00 24.21 ? 252 LEU B C     1 
ATOM   3998 O  O     . LEU B 1 254 ? 16.528  1.023  80.798  1.00 24.47 ? 252 LEU B O     1 
ATOM   3999 C  CB    . LEU B 1 254 ? 17.641  -1.533 82.504  1.00 27.27 ? 252 LEU B CB    1 
ATOM   4000 C  CG    . LEU B 1 254 ? 16.129  -1.763 82.496  1.00 28.60 ? 252 LEU B CG    1 
ATOM   4001 C  CD1   . LEU B 1 254 ? 15.717  -2.466 81.201  1.00 28.83 ? 252 LEU B CD1   1 
ATOM   4002 C  CD2   . LEU B 1 254 ? 15.732  -2.599 83.710  1.00 30.56 ? 252 LEU B CD2   1 
ATOM   4003 N  N     . ALA B 1 255 ? 18.072  1.635  82.310  1.00 23.00 ? 253 ALA B N     1 
ATOM   4004 C  CA    . ALA B 1 255 ? 17.524  2.979  82.461  1.00 24.15 ? 253 ALA B CA    1 
ATOM   4005 C  C     . ALA B 1 255 ? 17.570  3.720  81.119  1.00 22.44 ? 253 ALA B C     1 
ATOM   4006 O  O     . ALA B 1 255 ? 16.619  4.412  80.749  1.00 22.72 ? 253 ALA B O     1 
ATOM   4007 C  CB    . ALA B 1 255 ? 18.306  3.750  83.527  1.00 23.00 ? 253 ALA B CB    1 
ATOM   4008 N  N     . LEU B 1 256 ? 18.669  3.571  80.387  1.00 23.25 ? 254 LEU B N     1 
ATOM   4009 C  CA    . LEU B 1 256 ? 18.774  4.224  79.088  1.00 22.18 ? 254 LEU B CA    1 
ATOM   4010 C  C     . LEU B 1 256 ? 17.840  3.553  78.076  1.00 22.75 ? 254 LEU B C     1 
ATOM   4011 O  O     . LEU B 1 256 ? 17.332  4.209  77.172  1.00 21.04 ? 254 LEU B O     1 
ATOM   4012 C  CB    . LEU B 1 256 ? 20.219  4.207  78.573  1.00 23.97 ? 254 LEU B CB    1 
ATOM   4013 C  CG    . LEU B 1 256 ? 21.102  5.365  79.068  1.00 25.32 ? 254 LEU B CG    1 
ATOM   4014 C  CD1   . LEU B 1 256 ? 21.316  5.239  80.559  1.00 23.45 ? 254 LEU B CD1   1 
ATOM   4015 C  CD2   . LEU B 1 256 ? 22.433  5.367  78.326  1.00 26.83 ? 254 LEU B CD2   1 
ATOM   4016 N  N     . ALA B 1 257 ? 17.606  2.250  78.228  1.00 22.60 ? 255 ALA B N     1 
ATOM   4017 C  CA    . ALA B 1 257 ? 16.709  1.545  77.310  1.00 22.84 ? 255 ALA B CA    1 
ATOM   4018 C  C     . ALA B 1 257 ? 15.303  2.113  77.478  1.00 22.35 ? 255 ALA B C     1 
ATOM   4019 O  O     . ALA B 1 257 ? 14.650  2.455  76.501  1.00 22.56 ? 255 ALA B O     1 
ATOM   4020 C  CB    . ALA B 1 257 ? 16.702  0.041  77.601  1.00 25.10 ? 255 ALA B CB    1 
ATOM   4021 N  N     . HIS B 1 258 ? 14.836  2.195  78.722  1.00 22.16 ? 256 HIS B N     1 
ATOM   4022 C  CA    . HIS B 1 258 ? 13.510  2.752  78.993  1.00 21.84 ? 256 HIS B CA    1 
ATOM   4023 C  C     . HIS B 1 258 ? 13.439  4.178  78.449  1.00 20.17 ? 256 HIS B C     1 
ATOM   4024 O  O     . HIS B 1 258 ? 12.479  4.554  77.776  1.00 19.56 ? 256 HIS B O     1 
ATOM   4025 C  CB    . HIS B 1 258 ? 13.212  2.798  80.498  1.00 22.36 ? 256 HIS B CB    1 
ATOM   4026 C  CG    . HIS B 1 258 ? 13.087  1.451  81.144  1.00 25.49 ? 256 HIS B CG    1 
ATOM   4027 N  ND1   . HIS B 1 258 ? 12.600  0.344  80.482  1.00 29.06 ? 256 HIS B ND1   1 
ATOM   4028 C  CD2   . HIS B 1 258 ? 13.344  1.047  82.411  1.00 25.60 ? 256 HIS B CD2   1 
ATOM   4029 C  CE1   . HIS B 1 258 ? 12.566  -0.685 81.312  1.00 26.04 ? 256 HIS B CE1   1 
ATOM   4030 N  NE2   . HIS B 1 258 ? 13.010  -0.284 82.489  1.00 29.65 ? 256 HIS B NE2   1 
ATOM   4031 N  N     . ALA B 1 259 ? 14.459  4.972  78.752  1.00 18.53 ? 257 ALA B N     1 
ATOM   4032 C  CA    . ALA B 1 259 ? 14.498  6.358  78.299  1.00 18.33 ? 257 ALA B CA    1 
ATOM   4033 C  C     . ALA B 1 259 ? 14.437  6.466  76.780  1.00 19.13 ? 257 ALA B C     1 
ATOM   4034 O  O     . ALA B 1 259 ? 13.793  7.364  76.243  1.00 20.29 ? 257 ALA B O     1 
ATOM   4035 C  CB    . ALA B 1 259 ? 15.749  7.044  78.822  1.00 16.92 ? 257 ALA B CB    1 
ATOM   4036 N  N     . SER B 1 260 ? 15.095  5.547  76.082  1.00 19.38 ? 258 SER B N     1 
ATOM   4037 C  CA    . SER B 1 260 ? 15.091  5.585  74.624  1.00 21.14 ? 258 SER B CA    1 
ATOM   4038 C  C     . SER B 1 260 ? 13.692  5.299  74.077  1.00 20.68 ? 258 SER B C     1 
ATOM   4039 O  O     . SER B 1 260 ? 13.260  5.901  73.088  1.00 19.80 ? 258 SER B O     1 
ATOM   4040 C  CB    . SER B 1 260 ? 16.085  4.564  74.066  1.00 20.65 ? 258 SER B CB    1 
ATOM   4041 O  OG    . SER B 1 260 ? 17.400  4.827  74.527  1.00 23.15 ? 258 SER B OG    1 
ATOM   4042 N  N     . ARG B 1 261 ? 12.983  4.377  74.719  1.00 21.17 ? 259 ARG B N     1 
ATOM   4043 C  CA    . ARG B 1 261 ? 11.635  4.050  74.273  1.00 21.23 ? 259 ARG B CA    1 
ATOM   4044 C  C     . ARG B 1 261 ? 10.697  5.226  74.499  1.00 21.40 ? 259 ARG B C     1 
ATOM   4045 O  O     . ARG B 1 261 ? 9.848   5.515  73.659  1.00 20.90 ? 259 ARG B O     1 
ATOM   4046 C  CB    . ARG B 1 261 ? 11.098  2.815  75.009  1.00 23.62 ? 259 ARG B CB    1 
ATOM   4047 C  CG    . ARG B 1 261 ? 11.890  1.544  74.724  1.00 26.69 ? 259 ARG B CG    1 
ATOM   4048 C  CD    . ARG B 1 261 ? 11.168  0.324  75.262  1.00 32.21 ? 259 ARG B CD    1 
ATOM   4049 N  NE    . ARG B 1 261 ? 9.784   0.304  74.800  1.00 37.20 ? 259 ARG B NE    1 
ATOM   4050 C  CZ    . ARG B 1 261 ? 8.960   -0.731 74.922  1.00 41.37 ? 259 ARG B CZ    1 
ATOM   4051 N  NH1   . ARG B 1 261 ? 9.380   -1.853 75.492  1.00 44.30 ? 259 ARG B NH1   1 
ATOM   4052 N  NH2   . ARG B 1 261 ? 7.708   -0.637 74.484  1.00 41.93 ? 259 ARG B NH2   1 
ATOM   4053 N  N     . ALA B 1 262 ? 10.855  5.904  75.634  1.00 19.55 ? 260 ALA B N     1 
ATOM   4054 C  CA    . ALA B 1 262 ? 10.009  7.054  75.963  1.00 19.75 ? 260 ALA B CA    1 
ATOM   4055 C  C     . ALA B 1 262 ? 10.272  8.219  75.012  1.00 19.48 ? 260 ALA B C     1 
ATOM   4056 O  O     . ALA B 1 262 ? 9.337   8.870  74.538  1.00 20.70 ? 260 ALA B O     1 
ATOM   4057 C  CB    . ALA B 1 262 ? 10.248  7.490  77.413  1.00 19.64 ? 260 ALA B CB    1 
ATOM   4058 N  N     . ALA B 1 263 ? 11.545  8.473  74.738  1.00 18.00 ? 261 ALA B N     1 
ATOM   4059 C  CA    . ALA B 1 263 ? 11.941  9.552  73.844  1.00 18.79 ? 261 ALA B CA    1 
ATOM   4060 C  C     . ALA B 1 263 ? 11.432  9.301  72.420  1.00 19.97 ? 261 ALA B C     1 
ATOM   4061 O  O     . ALA B 1 263 ? 11.132  10.244 71.686  1.00 19.57 ? 261 ALA B O     1 
ATOM   4062 C  CB    . ALA B 1 263 ? 13.469  9.698  73.852  1.00 19.90 ? 261 ALA B CB    1 
ATOM   4063 N  N     . ALA B 1 264 ? 11.341  8.031  72.030  1.00 18.60 ? 262 ALA B N     1 
ATOM   4064 C  CA    . ALA B 1 264 ? 10.848  7.686  70.702  1.00 19.53 ? 262 ALA B CA    1 
ATOM   4065 C  C     . ALA B 1 264 ? 9.398   8.166  70.575  1.00 19.60 ? 262 ALA B C     1 
ATOM   4066 O  O     . ALA B 1 264 ? 8.992   8.691  69.531  1.00 19.52 ? 262 ALA B O     1 
ATOM   4067 C  CB    . ALA B 1 264 ? 10.937  6.166  70.473  1.00 19.24 ? 262 ALA B CB    1 
ATOM   4068 N  N     . ILE B 1 265 ? 8.623   7.984  71.642  1.00 19.91 ? 263 ILE B N     1 
ATOM   4069 C  CA    . ILE B 1 265 ? 7.235   8.427  71.660  1.00 19.40 ? 263 ILE B CA    1 
ATOM   4070 C  C     . ILE B 1 265 ? 7.188   9.943  71.448  1.00 19.25 ? 263 ILE B C     1 
ATOM   4071 O  O     . ILE B 1 265 ? 6.439   10.446 70.603  1.00 17.52 ? 263 ILE B O     1 
ATOM   4072 C  CB    . ILE B 1 265 ? 6.546   8.110  73.020  1.00 23.63 ? 263 ILE B CB    1 
ATOM   4073 C  CG1   . ILE B 1 265 ? 6.383   6.598  73.193  1.00 25.11 ? 263 ILE B CG1   1 
ATOM   4074 C  CG2   . ILE B 1 265 ? 5.180   8.812  73.095  1.00 23.94 ? 263 ILE B CG2   1 
ATOM   4075 C  CD1   . ILE B 1 265 ? 5.908   6.183  74.583  1.00 28.83 ? 263 ILE B CD1   1 
ATOM   4076 N  N     . THR B 1 266 ? 7.990   10.671 72.222  1.00 17.54 ? 264 THR B N     1 
ATOM   4077 C  CA    . THR B 1 266 ? 8.011   12.124 72.120  1.00 17.39 ? 264 THR B CA    1 
ATOM   4078 C  C     . THR B 1 266 ? 8.370   12.648 70.737  1.00 17.92 ? 264 THR B C     1 
ATOM   4079 O  O     . THR B 1 266 ? 7.728   13.577 70.234  1.00 19.62 ? 264 THR B O     1 
ATOM   4080 C  CB    . THR B 1 266 ? 8.988   12.736 73.147  1.00 17.43 ? 264 THR B CB    1 
ATOM   4081 O  OG1   . THR B 1 266 ? 8.476   12.522 74.463  1.00 16.61 ? 264 THR B OG1   1 
ATOM   4082 C  CG2   . THR B 1 266 ? 9.170   14.223 72.908  1.00 14.93 ? 264 THR B CG2   1 
ATOM   4083 N  N     . VAL B 1 267 ? 9.384   12.064 70.105  1.00 18.84 ? 265 VAL B N     1 
ATOM   4084 C  CA    . VAL B 1 267 ? 9.768   12.556 68.789  1.00 19.16 ? 265 VAL B CA    1 
ATOM   4085 C  C     . VAL B 1 267 ? 8.705   12.244 67.735  1.00 20.45 ? 265 VAL B C     1 
ATOM   4086 O  O     . VAL B 1 267 ? 8.600   12.948 66.731  1.00 21.12 ? 265 VAL B O     1 
ATOM   4087 C  CB    . VAL B 1 267 ? 11.144  11.992 68.319  1.00 22.67 ? 265 VAL B CB    1 
ATOM   4088 C  CG1   . VAL B 1 267 ? 12.211  12.268 69.376  1.00 23.42 ? 265 VAL B CG1   1 
ATOM   4089 C  CG2   . VAL B 1 267 ? 11.053  10.509 68.023  1.00 25.28 ? 265 VAL B CG2   1 
ATOM   4090 N  N     . SER B 1 268 ? 7.909   11.206 67.964  1.00 20.52 ? 266 SER B N     1 
ATOM   4091 C  CA    . SER B 1 268 ? 6.867   10.838 67.000  1.00 22.69 ? 266 SER B CA    1 
ATOM   4092 C  C     . SER B 1 268 ? 5.570   11.633 67.176  1.00 23.03 ? 266 SER B C     1 
ATOM   4093 O  O     . SER B 1 268 ? 4.625   11.458 66.407  1.00 24.08 ? 266 SER B O     1 
ATOM   4094 C  CB    . SER B 1 268 ? 6.558   9.337  67.091  1.00 21.46 ? 266 SER B CB    1 
ATOM   4095 O  OG    . SER B 1 268 ? 5.964   9.006  68.331  1.00 25.09 ? 266 SER B OG    1 
ATOM   4096 N  N     . ARG B 1 269 ? 5.521   12.497 68.187  1.00 21.28 ? 267 ARG B N     1 
ATOM   4097 C  CA    . ARG B 1 269 ? 4.326   13.292 68.434  1.00 21.96 ? 267 ARG B CA    1 
ATOM   4098 C  C     . ARG B 1 269 ? 4.638   14.777 68.371  1.00 22.75 ? 267 ARG B C     1 
ATOM   4099 O  O     . ARG B 1 269 ? 5.757   15.205 68.666  1.00 23.45 ? 267 ARG B O     1 
ATOM   4100 C  CB    . ARG B 1 269 ? 3.714   12.926 69.796  1.00 20.82 ? 267 ARG B CB    1 
ATOM   4101 C  CG    . ARG B 1 269 ? 3.197   11.491 69.857  1.00 19.13 ? 267 ARG B CG    1 
ATOM   4102 C  CD    . ARG B 1 269 ? 2.626   11.117 71.223  1.00 23.77 ? 267 ARG B CD    1 
ATOM   4103 N  NE    . ARG B 1 269 ? 2.365   9.682  71.298  1.00 22.26 ? 267 ARG B NE    1 
ATOM   4104 C  CZ    . ARG B 1 269 ? 1.985   9.029  72.395  1.00 22.76 ? 267 ARG B CZ    1 
ATOM   4105 N  NH1   . ARG B 1 269 ? 1.801   9.670  73.545  1.00 18.08 ? 267 ARG B NH1   1 
ATOM   4106 N  NH2   . ARG B 1 269 ? 1.813   7.716  72.343  1.00 21.99 ? 267 ARG B NH2   1 
ATOM   4107 N  N     . ARG B 1 270 ? 3.644   15.563 67.980  1.00 23.43 ? 268 ARG B N     1 
ATOM   4108 C  CA    . ARG B 1 270 ? 3.815   17.004 67.860  1.00 23.54 ? 268 ARG B CA    1 
ATOM   4109 C  C     . ARG B 1 270 ? 3.436   17.748 69.133  1.00 23.62 ? 268 ARG B C     1 
ATOM   4110 O  O     . ARG B 1 270 ? 2.538   17.336 69.874  1.00 24.34 ? 268 ARG B O     1 
ATOM   4111 C  CB    . ARG B 1 270 ? 2.977   17.542 66.684  1.00 24.38 ? 268 ARG B CB    1 
ATOM   4112 C  CG    . ARG B 1 270 ? 3.405   17.009 65.314  1.00 27.16 ? 268 ARG B CG    1 
ATOM   4113 C  CD    . ARG B 1 270 ? 2.569   17.615 64.185  1.00 29.52 ? 268 ARG B CD    1 
ATOM   4114 N  NE    . ARG B 1 270 ? 3.023   17.176 62.865  1.00 29.92 ? 268 ARG B NE    1 
ATOM   4115 C  CZ    . ARG B 1 270 ? 4.178   17.528 62.306  1.00 33.24 ? 268 ARG B CZ    1 
ATOM   4116 N  NH1   . ARG B 1 270 ? 5.017   18.341 62.942  1.00 34.83 ? 268 ARG B NH1   1 
ATOM   4117 N  NH2   . ARG B 1 270 ? 4.506   17.055 61.108  1.00 34.25 ? 268 ARG B NH2   1 
ATOM   4118 N  N     . GLY B 1 271 ? 4.131   18.855 69.371  1.00 23.05 ? 269 GLY B N     1 
ATOM   4119 C  CA    . GLY B 1 271 ? 3.868   19.676 70.538  1.00 22.33 ? 269 GLY B CA    1 
ATOM   4120 C  C     . GLY B 1 271 ? 4.938   19.517 71.597  1.00 21.89 ? 269 GLY B C     1 
ATOM   4121 O  O     . GLY B 1 271 ? 6.012   18.966 71.344  1.00 20.37 ? 269 GLY B O     1 
ATOM   4122 N  N     . THR B 1 272 ? 4.657   20.025 72.788  1.00 21.36 ? 270 THR B N     1 
ATOM   4123 C  CA    . THR B 1 272 ? 5.597   19.889 73.885  1.00 22.96 ? 270 THR B CA    1 
ATOM   4124 C  C     . THR B 1 272 ? 4.953   18.933 74.880  1.00 22.41 ? 270 THR B C     1 
ATOM   4125 O  O     . THR B 1 272 ? 5.005   17.727 74.672  1.00 23.11 ? 270 THR B O     1 
ATOM   4126 C  CB    . THR B 1 272 ? 5.918   21.246 74.523  1.00 21.12 ? 270 THR B CB    1 
ATOM   4127 O  OG1   . THR B 1 272 ? 6.338   22.153 73.493  1.00 22.33 ? 270 THR B OG1   1 
ATOM   4128 C  CG2   . THR B 1 272 ? 7.069   21.107 75.523  1.00 21.14 ? 270 THR B CG2   1 
ATOM   4129 N  N     . LEU B 1 273 ? 4.313   19.437 75.931  1.00 23.77 ? 271 LEU B N     1 
ATOM   4130 C  CA    . LEU B 1 273 ? 3.685   18.523 76.888  1.00 24.57 ? 271 LEU B CA    1 
ATOM   4131 C  C     . LEU B 1 273 ? 2.705   17.543 76.230  1.00 24.65 ? 271 LEU B C     1 
ATOM   4132 O  O     . LEU B 1 273 ? 2.616   16.386 76.636  1.00 22.57 ? 271 LEU B O     1 
ATOM   4133 C  CB    . LEU B 1 273 ? 2.955   19.297 77.995  1.00 26.29 ? 271 LEU B CB    1 
ATOM   4134 C  CG    . LEU B 1 273 ? 2.252   18.423 79.047  1.00 28.20 ? 271 LEU B CG    1 
ATOM   4135 C  CD1   . LEU B 1 273 ? 3.273   17.511 79.738  1.00 27.54 ? 271 LEU B CD1   1 
ATOM   4136 C  CD2   . LEU B 1 273 ? 1.548   19.306 80.071  1.00 28.45 ? 271 LEU B CD2   1 
ATOM   4137 N  N     . SER B 1 274 ? 1.968   17.992 75.217  1.00 25.27 ? 272 SER B N     1 
ATOM   4138 C  CA    . SER B 1 274 ? 1.003   17.103 74.565  1.00 26.38 ? 272 SER B CA    1 
ATOM   4139 C  C     . SER B 1 274 ? 1.675   15.962 73.791  1.00 25.19 ? 272 SER B C     1 
ATOM   4140 O  O     . SER B 1 274 ? 1.021   14.981 73.432  1.00 25.56 ? 272 SER B O     1 
ATOM   4141 C  CB    . SER B 1 274 ? 0.093   17.898 73.621  1.00 27.49 ? 272 SER B CB    1 
ATOM   4142 O  OG    . SER B 1 274 ? 0.842   18.513 72.591  1.00 29.71 ? 272 SER B OG    1 
ATOM   4143 N  N     . ALA B 1 275 ? 2.974   16.089 73.537  1.00 23.64 ? 273 ALA B N     1 
ATOM   4144 C  CA    . ALA B 1 275 ? 3.713   15.056 72.809  1.00 22.83 ? 273 ALA B CA    1 
ATOM   4145 C  C     . ALA B 1 275 ? 4.347   14.013 73.725  1.00 23.03 ? 273 ALA B C     1 
ATOM   4146 O  O     . ALA B 1 275 ? 4.756   12.944 73.273  1.00 22.46 ? 273 ALA B O     1 
ATOM   4147 C  CB    . ALA B 1 275 ? 4.791   15.697 71.952  1.00 20.98 ? 273 ALA B CB    1 
ATOM   4148 N  N     . PHE B 1 276 ? 4.421   14.313 75.015  1.00 22.71 ? 274 PHE B N     1 
ATOM   4149 C  CA    . PHE B 1 276 ? 5.052   13.394 75.953  1.00 21.94 ? 274 PHE B CA    1 
ATOM   4150 C  C     . PHE B 1 276 ? 4.192   12.194 76.323  1.00 20.62 ? 274 PHE B C     1 
ATOM   4151 O  O     . PHE B 1 276 ? 2.970   12.276 76.343  1.00 20.74 ? 274 PHE B O     1 
ATOM   4152 C  CB    . PHE B 1 276 ? 5.447   14.135 77.242  1.00 22.05 ? 274 PHE B CB    1 
ATOM   4153 C  CG    . PHE B 1 276 ? 6.298   15.360 77.014  1.00 20.84 ? 274 PHE B CG    1 
ATOM   4154 C  CD1   . PHE B 1 276 ? 7.070   15.495 75.868  1.00 21.48 ? 274 PHE B CD1   1 
ATOM   4155 C  CD2   . PHE B 1 276 ? 6.358   16.363 77.978  1.00 23.75 ? 274 PHE B CD2   1 
ATOM   4156 C  CE1   . PHE B 1 276 ? 7.893   16.611 75.683  1.00 22.32 ? 274 PHE B CE1   1 
ATOM   4157 C  CE2   . PHE B 1 276 ? 7.179   17.479 77.799  1.00 18.61 ? 274 PHE B CE2   1 
ATOM   4158 C  CZ    . PHE B 1 276 ? 7.943   17.601 76.656  1.00 21.16 ? 274 PHE B CZ    1 
ATOM   4159 N  N     . PRO B 1 277 ? 4.828   11.057 76.623  1.00 21.91 ? 275 PRO B N     1 
ATOM   4160 C  CA    . PRO B 1 277 ? 4.062   9.866  77.001  1.00 21.53 ? 275 PRO B CA    1 
ATOM   4161 C  C     . PRO B 1 277 ? 3.271   10.087 78.297  1.00 22.22 ? 275 PRO B C     1 
ATOM   4162 O  O     . PRO B 1 277 ? 3.710   10.815 79.199  1.00 18.47 ? 275 PRO B O     1 
ATOM   4163 C  CB    . PRO B 1 277 ? 5.138   8.784  77.142  1.00 22.47 ? 275 PRO B CB    1 
ATOM   4164 C  CG    . PRO B 1 277 ? 6.387   9.543  77.412  1.00 25.99 ? 275 PRO B CG    1 
ATOM   4165 C  CD    . PRO B 1 277 ? 6.269   10.758 76.540  1.00 21.45 ? 275 PRO B CD    1 
ATOM   4166 N  N     . GLY B 1 278 ? 2.103   9.455  78.379  1.00 22.12 ? 276 GLY B N     1 
ATOM   4167 C  CA    . GLY B 1 278 ? 1.259   9.585  79.555  1.00 22.12 ? 276 GLY B CA    1 
ATOM   4168 C  C     . GLY B 1 278 ? 1.647   8.605  80.642  1.00 21.65 ? 276 GLY B C     1 
ATOM   4169 O  O     . GLY B 1 278 ? 2.483   7.733  80.420  1.00 21.83 ? 276 GLY B O     1 
ATOM   4170 N  N     . SER B 1 279 ? 1.035   8.738  81.816  1.00 22.83 ? 277 SER B N     1 
ATOM   4171 C  CA    . SER B 1 279 ? 1.341   7.862  82.943  1.00 23.37 ? 277 SER B CA    1 
ATOM   4172 C  C     . SER B 1 279 ? 1.206   6.378  82.644  1.00 24.42 ? 277 SER B C     1 
ATOM   4173 O  O     . SER B 1 279 ? 2.060   5.589  83.033  1.00 23.73 ? 277 SER B O     1 
ATOM   4174 C  CB    . SER B 1 279 ? 0.460   8.208  84.145  1.00 24.94 ? 277 SER B CB    1 
ATOM   4175 O  OG    . SER B 1 279 ? 0.713   9.529  84.583  1.00 29.33 ? 277 SER B OG    1 
ATOM   4176 N  N     . ARG B 1 280 ? 0.135   5.983  81.963  1.00 25.92 ? 278 ARG B N     1 
ATOM   4177 C  CA    . ARG B 1 280 ? -0.046  4.567  81.665  1.00 26.77 ? 278 ARG B CA    1 
ATOM   4178 C  C     . ARG B 1 280 ? 0.968   4.083  80.641  1.00 26.51 ? 278 ARG B C     1 
ATOM   4179 O  O     . ARG B 1 280 ? 1.467   2.962  80.734  1.00 27.08 ? 278 ARG B O     1 
ATOM   4180 C  CB    . ARG B 1 280 ? -1.475  4.296  81.188  1.00 29.13 ? 278 ARG B CB    1 
ATOM   4181 C  CG    . ARG B 1 280 ? -2.512  4.468  82.297  1.00 31.88 ? 278 ARG B CG    1 
ATOM   4182 C  CD    . ARG B 1 280 ? -3.911  4.137  81.799  1.00 33.59 ? 278 ARG B CD    1 
ATOM   4183 N  NE    . ARG B 1 280 ? -4.189  4.808  80.536  1.00 32.87 ? 278 ARG B NE    1 
ATOM   4184 C  CZ    . ARG B 1 280 ? -5.306  4.647  79.836  1.00 34.17 ? 278 ARG B CZ    1 
ATOM   4185 N  NH1   . ARG B 1 280 ? -6.257  3.838  80.278  1.00 33.38 ? 278 ARG B NH1   1 
ATOM   4186 N  NH2   . ARG B 1 280 ? -5.461  5.282  78.685  1.00 33.74 ? 278 ARG B NH2   1 
ATOM   4187 N  N     . GLU B 1 281 ? 1.282   4.928  79.666  1.00 26.04 ? 279 GLU B N     1 
ATOM   4188 C  CA    . GLU B 1 281 ? 2.270   4.552  78.659  1.00 26.79 ? 279 GLU B CA    1 
ATOM   4189 C  C     . GLU B 1 281 ? 3.622   4.372  79.349  1.00 24.50 ? 279 GLU B C     1 
ATOM   4190 O  O     . GLU B 1 281 ? 4.378   3.449  79.041  1.00 22.99 ? 279 GLU B O     1 
ATOM   4191 C  CB    . GLU B 1 281 ? 2.375   5.642  77.585  1.00 28.15 ? 279 GLU B CB    1 
ATOM   4192 C  CG    . GLU B 1 281 ? 1.052   5.943  76.893  1.00 32.15 ? 279 GLU B CG    1 
ATOM   4193 C  CD    . GLU B 1 281 ? 1.191   6.964  75.782  1.00 34.98 ? 279 GLU B CD    1 
ATOM   4194 O  OE1   . GLU B 1 281 ? 1.696   8.074  76.049  1.00 33.54 ? 279 GLU B OE1   1 
ATOM   4195 O  OE2   . GLU B 1 281 ? 0.789   6.656  74.639  1.00 36.95 ? 279 GLU B OE2   1 
ATOM   4196 N  N     . LEU B 1 282 ? 3.918   5.268  80.286  1.00 22.90 ? 280 LEU B N     1 
ATOM   4197 C  CA    . LEU B 1 282 ? 5.171   5.222  81.031  1.00 23.58 ? 280 LEU B CA    1 
ATOM   4198 C  C     . LEU B 1 282 ? 5.258   3.953  81.864  1.00 24.28 ? 280 LEU B C     1 
ATOM   4199 O  O     . LEU B 1 282 ? 6.240   3.214  81.789  1.00 25.74 ? 280 LEU B O     1 
ATOM   4200 C  CB    . LEU B 1 282 ? 5.279   6.451  81.944  1.00 23.02 ? 280 LEU B CB    1 
ATOM   4201 C  CG    . LEU B 1 282 ? 6.240   7.583  81.557  1.00 29.72 ? 280 LEU B CG    1 
ATOM   4202 C  CD1   . LEU B 1 282 ? 6.793   7.364  80.165  1.00 26.03 ? 280 LEU B CD1   1 
ATOM   4203 C  CD2   . LEU B 1 282 ? 5.529   8.930  81.672  1.00 24.47 ? 280 LEU B CD2   1 
ATOM   4204 N  N     . ALA B 1 283 ? 4.228   3.713  82.664  1.00 25.60 ? 281 ALA B N     1 
ATOM   4205 C  CA    . ALA B 1 283 ? 4.174   2.530  83.510  1.00 28.31 ? 281 ALA B CA    1 
ATOM   4206 C  C     . ALA B 1 283 ? 4.414   1.271  82.676  1.00 29.17 ? 281 ALA B C     1 
ATOM   4207 O  O     . ALA B 1 283 ? 5.247   0.431  83.023  1.00 29.86 ? 281 ALA B O     1 
ATOM   4208 C  CB    . ALA B 1 283 ? 2.815   2.451  84.200  1.00 28.90 ? 281 ALA B CB    1 
ATOM   4209 N  N     . ALA B 1 284 ? 3.686   1.155  81.571  1.00 30.61 ? 282 ALA B N     1 
ATOM   4210 C  CA    . ALA B 1 284 ? 3.804   0.000  80.687  1.00 31.58 ? 282 ALA B CA    1 
ATOM   4211 C  C     . ALA B 1 284 ? 5.222   -0.194 80.165  1.00 33.17 ? 282 ALA B C     1 
ATOM   4212 O  O     . ALA B 1 284 ? 5.729   -1.314 80.102  1.00 33.61 ? 282 ALA B O     1 
ATOM   4213 C  CB    . ALA B 1 284 ? 2.838   0.142  79.513  1.00 32.69 ? 282 ALA B CB    1 
ATOM   4214 N  N     . LEU B 1 285 ? 5.874   0.899  79.799  1.00 33.13 ? 283 LEU B N     1 
ATOM   4215 C  CA    . LEU B 1 285 ? 7.221   0.805  79.265  1.00 35.15 ? 283 LEU B CA    1 
ATOM   4216 C  C     . LEU B 1 285 ? 8.292   0.639  80.344  1.00 35.47 ? 283 LEU B C     1 
ATOM   4217 O  O     . LEU B 1 285 ? 9.342   0.052  80.090  1.00 35.75 ? 283 LEU B O     1 
ATOM   4218 C  CB    . LEU B 1 285 ? 7.487   2.031  78.372  1.00 37.31 ? 283 LEU B CB    1 
ATOM   4219 C  CG    . LEU B 1 285 ? 8.561   3.098  78.595  1.00 39.45 ? 283 LEU B CG    1 
ATOM   4220 C  CD1   . LEU B 1 285 ? 8.296   4.221  77.592  1.00 38.90 ? 283 LEU B CD1   1 
ATOM   4221 C  CD2   . LEU B 1 285 ? 8.528   3.660  79.999  1.00 40.98 ? 283 LEU B CD2   1 
ATOM   4222 N  N     . LEU B 1 286 ? 8.014   1.123  81.550  1.00 36.15 ? 284 LEU B N     1 
ATOM   4223 C  CA    . LEU B 1 286 ? 8.971   1.034  82.647  1.00 39.57 ? 284 LEU B CA    1 
ATOM   4224 C  C     . LEU B 1 286 ? 9.041   -0.326 83.320  1.00 43.30 ? 284 LEU B C     1 
ATOM   4225 O  O     . LEU B 1 286 ? 9.925   -0.571 84.140  1.00 43.84 ? 284 LEU B O     1 
ATOM   4226 C  CB    . LEU B 1 286 ? 8.662   2.092  83.709  1.00 39.30 ? 284 LEU B CB    1 
ATOM   4227 C  CG    . LEU B 1 286 ? 9.046   3.533  83.370  1.00 37.80 ? 284 LEU B CG    1 
ATOM   4228 C  CD1   . LEU B 1 286 ? 8.599   4.464  84.490  1.00 36.60 ? 284 LEU B CD1   1 
ATOM   4229 C  CD2   . LEU B 1 286 ? 10.556  3.616  83.168  1.00 38.05 ? 284 LEU B CD2   1 
ATOM   4230 N  N     . THR B 1 287 ? 8.119   -1.219 82.992  1.00 45.61 ? 285 THR B N     1 
ATOM   4231 C  CA    . THR B 1 287 ? 8.155   -2.524 83.625  1.00 49.76 ? 285 THR B CA    1 
ATOM   4232 C  C     . THR B 1 287 ? 8.105   -3.667 82.622  1.00 51.01 ? 285 THR B C     1 
ATOM   4233 O  O     . THR B 1 287 ? 9.126   -4.382 82.511  1.00 51.67 ? 285 THR B O     1 
ATOM   4234 C  CB    . THR B 1 287 ? 7.005   -2.665 84.643  1.00 50.91 ? 285 THR B CB    1 
ATOM   4235 O  OG1   . THR B 1 287 ? 7.111   -3.929 85.310  1.00 54.41 ? 285 THR B OG1   1 
ATOM   4236 C  CG2   . THR B 1 287 ? 5.654   -2.553 83.949  1.00 50.60 ? 285 THR B CG2   1 
ATOM   4237 N  N     . LEU C 1 3   ? 25.062  75.367 79.053  1.00 35.70 ? -1  LEU C N     1 
ATOM   4238 C  CA    . LEU C 1 3   ? 26.017  74.413 79.691  1.00 36.49 ? -1  LEU C CA    1 
ATOM   4239 C  C     . LEU C 1 3   ? 25.247  73.351 80.472  1.00 35.17 ? -1  LEU C C     1 
ATOM   4240 O  O     . LEU C 1 3   ? 24.399  73.674 81.298  1.00 37.08 ? -1  LEU C O     1 
ATOM   4241 C  CB    . LEU C 1 3   ? 26.972  75.170 80.613  1.00 37.19 ? -1  LEU C CB    1 
ATOM   4242 C  CG    . LEU C 1 3   ? 28.089  74.397 81.319  1.00 38.33 ? -1  LEU C CG    1 
ATOM   4243 C  CD1   . LEU C 1 3   ? 28.336  73.062 80.637  1.00 41.10 ? -1  LEU C CD1   1 
ATOM   4244 C  CD2   . LEU C 1 3   ? 29.358  75.246 81.313  1.00 39.89 ? -1  LEU C CD2   1 
ATOM   4245 N  N     . ARG C 1 4   ? 25.559  72.087 80.202  1.00 32.73 ? 2   ARG C N     1 
ATOM   4246 C  CA    . ARG C 1 4   ? 24.889  70.961 80.839  1.00 30.30 ? 2   ARG C CA    1 
ATOM   4247 C  C     . ARG C 1 4   ? 25.813  70.135 81.743  1.00 27.67 ? 2   ARG C C     1 
ATOM   4248 O  O     . ARG C 1 4   ? 26.993  69.953 81.440  1.00 24.56 ? 2   ARG C O     1 
ATOM   4249 C  CB    . ARG C 1 4   ? 24.303  70.073 79.738  1.00 33.58 ? 2   ARG C CB    1 
ATOM   4250 C  CG    . ARG C 1 4   ? 23.484  68.898 80.205  1.00 38.69 ? 2   ARG C CG    1 
ATOM   4251 C  CD    . ARG C 1 4   ? 22.959  68.133 78.996  1.00 42.73 ? 2   ARG C CD    1 
ATOM   4252 N  NE    . ARG C 1 4   ? 22.070  68.954 78.176  1.00 45.88 ? 2   ARG C NE    1 
ATOM   4253 C  CZ    . ARG C 1 4   ? 21.677  68.633 76.947  1.00 46.71 ? 2   ARG C CZ    1 
ATOM   4254 N  NH1   . ARG C 1 4   ? 22.099  67.507 76.390  1.00 47.84 ? 2   ARG C NH1   1 
ATOM   4255 N  NH2   . ARG C 1 4   ? 20.857  69.432 76.276  1.00 46.49 ? 2   ARG C NH2   1 
ATOM   4256 N  N     . VAL C 1 5   ? 25.268  69.637 82.852  1.00 24.32 ? 3   VAL C N     1 
ATOM   4257 C  CA    . VAL C 1 5   ? 26.038  68.816 83.784  1.00 22.77 ? 3   VAL C CA    1 
ATOM   4258 C  C     . VAL C 1 5   ? 25.558  67.367 83.740  1.00 22.57 ? 3   VAL C C     1 
ATOM   4259 O  O     . VAL C 1 5   ? 24.363  67.089 83.910  1.00 24.29 ? 3   VAL C O     1 
ATOM   4260 C  CB    . VAL C 1 5   ? 25.907  69.331 85.250  1.00 23.85 ? 3   VAL C CB    1 
ATOM   4261 C  CG1   . VAL C 1 5   ? 26.590  68.366 86.217  1.00 21.95 ? 3   VAL C CG1   1 
ATOM   4262 C  CG2   . VAL C 1 5   ? 26.540  70.709 85.373  1.00 23.10 ? 3   VAL C CG2   1 
ATOM   4263 N  N     . TYR C 1 6   ? 26.492  66.457 83.484  1.00 20.10 ? 4   TYR C N     1 
ATOM   4264 C  CA    . TYR C 1 6   ? 26.203  65.033 83.440  1.00 20.39 ? 4   TYR C CA    1 
ATOM   4265 C  C     . TYR C 1 6   ? 26.803  64.451 84.708  1.00 18.78 ? 4   TYR C C     1 
ATOM   4266 O  O     . TYR C 1 6   ? 27.978  64.671 85.004  1.00 20.07 ? 4   TYR C O     1 
ATOM   4267 C  CB    . TYR C 1 6   ? 26.863  64.382 82.224  1.00 19.92 ? 4   TYR C CB    1 
ATOM   4268 C  CG    . TYR C 1 6   ? 26.259  64.812 80.909  1.00 22.12 ? 4   TYR C CG    1 
ATOM   4269 C  CD1   . TYR C 1 6   ? 25.326  64.006 80.255  1.00 23.92 ? 4   TYR C CD1   1 
ATOM   4270 C  CD2   . TYR C 1 6   ? 26.605  66.031 80.328  1.00 23.91 ? 4   TYR C CD2   1 
ATOM   4271 C  CE1   . TYR C 1 6   ? 24.750  64.402 79.054  1.00 26.12 ? 4   TYR C CE1   1 
ATOM   4272 C  CE2   . TYR C 1 6   ? 26.038  66.441 79.128  1.00 25.69 ? 4   TYR C CE2   1 
ATOM   4273 C  CZ    . TYR C 1 6   ? 25.109  65.620 78.497  1.00 28.32 ? 4   TYR C CZ    1 
ATOM   4274 O  OH    . TYR C 1 6   ? 24.525  66.024 77.320  1.00 32.87 ? 4   TYR C OH    1 
ATOM   4275 N  N     . VAL C 1 7   ? 25.993  63.720 85.460  1.00 19.25 ? 5   VAL C N     1 
ATOM   4276 C  CA    . VAL C 1 7   ? 26.464  63.120 86.696  1.00 19.82 ? 5   VAL C CA    1 
ATOM   4277 C  C     . VAL C 1 7   ? 26.366  61.616 86.579  1.00 20.91 ? 5   VAL C C     1 
ATOM   4278 O  O     . VAL C 1 7   ? 25.278  61.074 86.419  1.00 24.76 ? 5   VAL C O     1 
ATOM   4279 C  CB    . VAL C 1 7   ? 25.614  63.570 87.911  1.00 18.87 ? 5   VAL C CB    1 
ATOM   4280 C  CG1   . VAL C 1 7   ? 26.221  63.014 89.211  1.00 20.32 ? 5   VAL C CG1   1 
ATOM   4281 C  CG2   . VAL C 1 7   ? 25.532  65.085 87.961  1.00 20.68 ? 5   VAL C CG2   1 
ATOM   4282 N  N     . THR C 1 8   ? 27.504  60.934 86.640  1.00 23.05 ? 6   THR C N     1 
ATOM   4283 C  CA    . THR C 1 8   ? 27.486  59.480 86.567  1.00 24.32 ? 6   THR C CA    1 
ATOM   4284 C  C     . THR C 1 8   ? 27.875  58.977 87.948  1.00 24.15 ? 6   THR C C     1 
ATOM   4285 O  O     . THR C 1 8   ? 29.022  59.116 88.370  1.00 23.19 ? 6   THR C O     1 
ATOM   4286 C  CB    . THR C 1 8   ? 28.470  58.949 85.491  1.00 25.19 ? 6   THR C CB    1 
ATOM   4287 O  OG1   . THR C 1 8   ? 29.811  59.329 85.821  1.00 29.10 ? 6   THR C OG1   1 
ATOM   4288 C  CG2   . THR C 1 8   ? 28.128  59.540 84.136  1.00 27.07 ? 6   THR C CG2   1 
ATOM   4289 N  N     . GLY C 1 9   ? 26.896  58.420 88.657  1.00 25.03 ? 7   GLY C N     1 
ATOM   4290 C  CA    . GLY C 1 9   ? 27.132  57.926 90.000  1.00 23.88 ? 7   GLY C CA    1 
ATOM   4291 C  C     . GLY C 1 9   ? 26.046  56.978 90.458  1.00 25.17 ? 7   GLY C C     1 
ATOM   4292 O  O     . GLY C 1 9   ? 25.495  56.228 89.658  1.00 25.74 ? 7   GLY C O     1 
ATOM   4293 N  N     . ASN C 1 10  ? 25.710  57.015 91.742  1.00 23.31 ? 8   ASN C N     1 
ATOM   4294 C  CA    . ASN C 1 10  ? 24.702  56.102 92.253  1.00 23.12 ? 8   ASN C CA    1 
ATOM   4295 C  C     . ASN C 1 10  ? 23.470  56.794 92.814  1.00 22.45 ? 8   ASN C C     1 
ATOM   4296 O  O     . ASN C 1 10  ? 23.408  58.019 92.912  1.00 23.76 ? 8   ASN C O     1 
ATOM   4297 C  CB    . ASN C 1 10  ? 25.319  55.211 93.341  1.00 24.37 ? 8   ASN C CB    1 
ATOM   4298 C  CG    . ASN C 1 10  ? 25.619  55.974 94.624  1.00 26.03 ? 8   ASN C CG    1 
ATOM   4299 O  OD1   . ASN C 1 10  ? 25.682  57.204 94.626  1.00 28.48 ? 8   ASN C OD1   1 
ATOM   4300 N  ND2   . ASN C 1 10  ? 25.821  55.245 95.718  1.00 25.79 ? 8   ASN C ND2   1 
ATOM   4301 N  N     . ILE C 1 11  ? 22.474  55.988 93.156  1.00 20.64 ? 9   ILE C N     1 
ATOM   4302 C  CA    . ILE C 1 11  ? 21.258  56.500 93.761  1.00 19.50 ? 9   ILE C CA    1 
ATOM   4303 C  C     . ILE C 1 11  ? 20.815  55.404 94.709  1.00 21.85 ? 9   ILE C C     1 
ATOM   4304 O  O     . ILE C 1 11  ? 20.802  54.221 94.353  1.00 20.65 ? 9   ILE C O     1 
ATOM   4305 C  CB    . ILE C 1 11  ? 20.184  56.836 92.709  1.00 21.27 ? 9   ILE C CB    1 
ATOM   4306 C  CG1   . ILE C 1 11  ? 18.990  57.496 93.400  1.00 19.71 ? 9   ILE C CG1   1 
ATOM   4307 C  CG2   . ILE C 1 11  ? 19.786  55.590 91.935  1.00 20.28 ? 9   ILE C CG2   1 
ATOM   4308 C  CD1   . ILE C 1 11  ? 18.115  58.290 92.458  1.00 24.15 ? 9   ILE C CD1   1 
ATOM   4309 N  N     . THR C 1 12  ? 20.471  55.792 95.930  1.00 19.09 ? 10  THR C N     1 
ATOM   4310 C  CA    . THR C 1 12  ? 20.116  54.810 96.937  1.00 23.40 ? 10  THR C CA    1 
ATOM   4311 C  C     . THR C 1 12  ? 18.909  55.152 97.785  1.00 22.99 ? 10  THR C C     1 
ATOM   4312 O  O     . THR C 1 12  ? 18.209  56.134 97.565  1.00 22.97 ? 10  THR C O     1 
ATOM   4313 C  CB    . THR C 1 12  ? 21.262  54.656 97.950  1.00 22.90 ? 10  THR C CB    1 
ATOM   4314 O  OG1   . THR C 1 12  ? 21.362  55.872 98.704  1.00 26.12 ? 10  THR C OG1   1 
ATOM   4315 C  CG2   . THR C 1 12  ? 22.605  54.414 97.247  1.00 25.20 ? 10  THR C CG2   1 
ATOM   4316 N  N     . VAL C 1 13  ? 18.696  54.280 98.765  1.00 25.32 ? 11  VAL C N     1 
ATOM   4317 C  CA    . VAL C 1 13  ? 17.688  54.447 99.791  1.00 24.55 ? 11  VAL C CA    1 
ATOM   4318 C  C     . VAL C 1 13  ? 18.607  54.417 101.015 1.00 25.43 ? 11  VAL C C     1 
ATOM   4319 O  O     . VAL C 1 13  ? 19.292  53.416 101.252 1.00 23.72 ? 11  VAL C O     1 
ATOM   4320 C  CB    . VAL C 1 13  ? 16.703  53.262 99.880  1.00 26.37 ? 11  VAL C CB    1 
ATOM   4321 C  CG1   . VAL C 1 13  ? 15.920  53.359 101.182 1.00 25.52 ? 11  VAL C CG1   1 
ATOM   4322 C  CG2   . VAL C 1 13  ? 15.737  53.289 98.706  1.00 26.78 ? 11  VAL C CG2   1 
ATOM   4323 N  N     . ASP C 1 14  ? 18.658  55.524 101.752 1.00 24.76 ? 12  ASP C N     1 
ATOM   4324 C  CA    . ASP C 1 14  ? 19.493  55.632 102.948 1.00 24.48 ? 12  ASP C CA    1 
ATOM   4325 C  C     . ASP C 1 14  ? 18.693  55.278 104.195 1.00 24.18 ? 12  ASP C C     1 
ATOM   4326 O  O     . ASP C 1 14  ? 17.598  55.790 104.388 1.00 25.00 ? 12  ASP C O     1 
ATOM   4327 C  CB    . ASP C 1 14  ? 20.004  57.068 103.152 1.00 23.41 ? 12  ASP C CB    1 
ATOM   4328 C  CG    . ASP C 1 14  ? 21.072  57.485 102.150 1.00 25.43 ? 12  ASP C CG    1 
ATOM   4329 O  OD1   . ASP C 1 14  ? 21.542  56.653 101.342 1.00 24.00 ? 12  ASP C OD1   1 
ATOM   4330 O  OD2   . ASP C 1 14  ? 21.446  58.675 102.188 1.00 24.25 ? 12  ASP C OD2   1 
ATOM   4331 N  N     . GLU C 1 15  ? 19.248  54.417 105.041 1.00 26.19 ? 13  GLU C N     1 
ATOM   4332 C  CA    . GLU C 1 15  ? 18.592  54.048 106.297 1.00 29.63 ? 13  GLU C CA    1 
ATOM   4333 C  C     . GLU C 1 15  ? 19.487  54.548 107.419 1.00 26.98 ? 13  GLU C C     1 
ATOM   4334 O  O     . GLU C 1 15  ? 20.660  54.196 107.472 1.00 28.69 ? 13  GLU C O     1 
ATOM   4335 C  CB    . GLU C 1 15  ? 18.459  52.532 106.457 1.00 31.14 ? 13  GLU C CB    1 
ATOM   4336 C  CG    . GLU C 1 15  ? 17.558  51.826 105.472 1.00 40.74 ? 13  GLU C CG    1 
ATOM   4337 C  CD    . GLU C 1 15  ? 17.089  50.482 106.012 1.00 43.38 ? 13  GLU C CD    1 
ATOM   4338 O  OE1   . GLU C 1 15  ? 17.920  49.732 106.572 1.00 45.79 ? 13  GLU C OE1   1 
ATOM   4339 O  OE2   . GLU C 1 15  ? 15.890  50.177 105.876 1.00 47.59 ? 13  GLU C OE2   1 
ATOM   4340 N  N     . THR C 1 16  ? 18.945  55.351 108.323 1.00 27.98 ? 14  THR C N     1 
ATOM   4341 C  CA    . THR C 1 16  ? 19.759  55.857 109.421 1.00 27.17 ? 14  THR C CA    1 
ATOM   4342 C  C     . THR C 1 16  ? 19.493  55.091 110.712 1.00 27.56 ? 14  THR C C     1 
ATOM   4343 O  O     . THR C 1 16  ? 18.354  54.949 111.137 1.00 26.62 ? 14  THR C O     1 
ATOM   4344 C  CB    . THR C 1 16  ? 19.505  57.364 109.656 1.00 28.14 ? 14  THR C CB    1 
ATOM   4345 O  OG1   . THR C 1 16  ? 19.846  58.092 108.466 1.00 27.39 ? 14  THR C OG1   1 
ATOM   4346 C  CG2   . THR C 1 16  ? 20.356  57.873 110.822 1.00 26.92 ? 14  THR C CG2   1 
ATOM   4347 N  N     . TRP C 1 17  ? 20.564  54.593 111.318 1.00 28.76 ? 15  TRP C N     1 
ATOM   4348 C  CA    . TRP C 1 17  ? 20.485  53.845 112.565 1.00 30.80 ? 15  TRP C CA    1 
ATOM   4349 C  C     . TRP C 1 17  ? 21.151  54.663 113.663 1.00 31.09 ? 15  TRP C C     1 
ATOM   4350 O  O     . TRP C 1 17  ? 22.283  55.127 113.506 1.00 31.61 ? 15  TRP C O     1 
ATOM   4351 C  CB    . TRP C 1 17  ? 21.229  52.514 112.440 1.00 31.81 ? 15  TRP C CB    1 
ATOM   4352 C  CG    . TRP C 1 17  ? 20.590  51.514 111.533 1.00 35.44 ? 15  TRP C CG    1 
ATOM   4353 C  CD1   . TRP C 1 17  ? 20.262  51.681 110.215 1.00 35.98 ? 15  TRP C CD1   1 
ATOM   4354 C  CD2   . TRP C 1 17  ? 20.239  50.170 111.868 1.00 34.90 ? 15  TRP C CD2   1 
ATOM   4355 N  NE1   . TRP C 1 17  ? 19.728  50.516 109.709 1.00 36.82 ? 15  TRP C NE1   1 
ATOM   4356 C  CE2   . TRP C 1 17  ? 19.702  49.574 110.704 1.00 36.73 ? 15  TRP C CE2   1 
ATOM   4357 C  CE3   . TRP C 1 17  ? 20.328  49.408 113.040 1.00 37.03 ? 15  TRP C CE3   1 
ATOM   4358 C  CZ2   . TRP C 1 17  ? 19.256  48.249 110.680 1.00 37.33 ? 15  TRP C CZ2   1 
ATOM   4359 C  CZ3   . TRP C 1 17  ? 19.887  48.090 113.016 1.00 34.82 ? 15  TRP C CZ3   1 
ATOM   4360 C  CH2   . TRP C 1 17  ? 19.356  47.526 111.843 1.00 36.37 ? 15  TRP C CH2   1 
ATOM   4361 N  N     . SER C 1 18  ? 20.450  54.841 114.772 1.00 31.47 ? 16  SER C N     1 
ATOM   4362 C  CA    . SER C 1 18  ? 20.996  55.587 115.892 1.00 32.88 ? 16  SER C CA    1 
ATOM   4363 C  C     . SER C 1 18  ? 21.659  54.585 116.844 1.00 32.88 ? 16  SER C C     1 
ATOM   4364 O  O     . SER C 1 18  ? 20.997  53.676 117.348 1.00 31.87 ? 16  SER C O     1 
ATOM   4365 C  CB    . SER C 1 18  ? 19.868  56.342 116.600 1.00 34.28 ? 16  SER C CB    1 
ATOM   4366 O  OG    . SER C 1 18  ? 20.373  57.149 117.645 1.00 39.96 ? 16  SER C OG    1 
ATOM   4367 N  N     . ILE C 1 19  ? 22.965  54.723 117.059 1.00 32.61 ? 17  ILE C N     1 
ATOM   4368 C  CA    . ILE C 1 19  ? 23.672  53.818 117.966 1.00 34.20 ? 17  ILE C CA    1 
ATOM   4369 C  C     . ILE C 1 19  ? 24.507  54.581 118.993 1.00 35.80 ? 17  ILE C C     1 
ATOM   4370 O  O     . ILE C 1 19  ? 24.891  55.728 118.770 1.00 35.88 ? 17  ILE C O     1 
ATOM   4371 C  CB    . ILE C 1 19  ? 24.615  52.837 117.209 1.00 32.87 ? 17  ILE C CB    1 
ATOM   4372 C  CG1   . ILE C 1 19  ? 25.639  53.616 116.376 1.00 32.40 ? 17  ILE C CG1   1 
ATOM   4373 C  CG2   . ILE C 1 19  ? 23.797  51.891 116.343 1.00 31.67 ? 17  ILE C CG2   1 
ATOM   4374 C  CD1   . ILE C 1 19  ? 26.670  52.734 115.695 1.00 30.96 ? 17  ILE C CD1   1 
ATOM   4375 N  N     . PRO C 1 20  ? 24.789  53.951 120.144 1.00 37.88 ? 18  PRO C N     1 
ATOM   4376 C  CA    . PRO C 1 20  ? 25.589  54.604 121.188 1.00 39.79 ? 18  PRO C CA    1 
ATOM   4377 C  C     . PRO C 1 20  ? 26.974  54.940 120.647 1.00 41.64 ? 18  PRO C C     1 
ATOM   4378 O  O     . PRO C 1 20  ? 27.499  56.028 120.869 1.00 42.13 ? 18  PRO C O     1 
ATOM   4379 C  CB    . PRO C 1 20  ? 25.649  53.547 122.286 1.00 39.38 ? 18  PRO C CB    1 
ATOM   4380 C  CG    . PRO C 1 20  ? 24.344  52.821 122.120 1.00 39.98 ? 18  PRO C CG    1 
ATOM   4381 C  CD    . PRO C 1 20  ? 24.274  52.655 120.615 1.00 38.06 ? 18  PRO C CD    1 
ATOM   4382 N  N     . ASP C 1 21  ? 27.551  53.988 119.923 1.00 43.36 ? 19  ASP C N     1 
ATOM   4383 C  CA    . ASP C 1 21  ? 28.874  54.155 119.343 1.00 45.66 ? 19  ASP C CA    1 
ATOM   4384 C  C     . ASP C 1 21  ? 29.139  52.975 118.409 1.00 46.00 ? 19  ASP C C     1 
ATOM   4385 O  O     . ASP C 1 21  ? 28.533  51.913 118.567 1.00 45.36 ? 19  ASP C O     1 
ATOM   4386 C  CB    . ASP C 1 21  ? 29.916  54.197 120.462 1.00 47.45 ? 19  ASP C CB    1 
ATOM   4387 C  CG    . ASP C 1 21  ? 31.308  54.445 119.946 1.00 50.11 ? 19  ASP C CG    1 
ATOM   4388 O  OD1   . ASP C 1 21  ? 31.486  55.431 119.210 1.00 50.64 ? 19  ASP C OD1   1 
ATOM   4389 O  OD2   . ASP C 1 21  ? 32.223  53.660 120.279 1.00 51.10 ? 19  ASP C OD2   1 
ATOM   4390 N  N     . ILE C 1 22  ? 30.026  53.153 117.433 1.00 46.60 ? 20  ILE C N     1 
ATOM   4391 C  CA    . ILE C 1 22  ? 30.324  52.064 116.505 1.00 48.49 ? 20  ILE C CA    1 
ATOM   4392 C  C     . ILE C 1 22  ? 30.736  50.814 117.279 1.00 48.33 ? 20  ILE C C     1 
ATOM   4393 O  O     . ILE C 1 22  ? 31.645  50.849 118.110 1.00 47.78 ? 20  ILE C O     1 
ATOM   4394 C  CB    . ILE C 1 22  ? 31.446  52.437 115.504 1.00 49.15 ? 20  ILE C CB    1 
ATOM   4395 C  CG1   . ILE C 1 22  ? 32.719  52.828 116.257 1.00 50.45 ? 20  ILE C CG1   1 
ATOM   4396 C  CG2   . ILE C 1 22  ? 30.974  53.566 114.594 1.00 49.87 ? 20  ILE C CG2   1 
ATOM   4397 C  CD1   . ILE C 1 22  ? 33.920  53.046 115.357 1.00 51.82 ? 20  ILE C CD1   1 
ATOM   4398 N  N     . PRO C 1 23  ? 30.064  49.688 117.011 1.00 48.53 ? 21  PRO C N     1 
ATOM   4399 C  CA    . PRO C 1 23  ? 30.351  48.421 117.684 1.00 49.29 ? 21  PRO C CA    1 
ATOM   4400 C  C     . PRO C 1 23  ? 31.735  47.856 117.406 1.00 49.89 ? 21  PRO C C     1 
ATOM   4401 O  O     . PRO C 1 23  ? 32.289  48.033 116.322 1.00 49.13 ? 21  PRO C O     1 
ATOM   4402 C  CB    . PRO C 1 23  ? 29.249  47.506 117.164 1.00 49.03 ? 21  PRO C CB    1 
ATOM   4403 C  CG    . PRO C 1 23  ? 29.065  47.997 115.769 1.00 48.19 ? 21  PRO C CG    1 
ATOM   4404 C  CD    . PRO C 1 23  ? 29.041  49.499 115.969 1.00 48.64 ? 21  PRO C CD    1 
ATOM   4405 N  N     . LYS C 1 24  ? 32.289  47.179 118.404 1.00 50.95 ? 22  LYS C N     1 
ATOM   4406 C  CA    . LYS C 1 24  ? 33.590  46.552 118.266 1.00 52.04 ? 22  LYS C CA    1 
ATOM   4407 C  C     . LYS C 1 24  ? 33.373  45.171 117.673 1.00 52.12 ? 22  LYS C C     1 
ATOM   4408 O  O     . LYS C 1 24  ? 32.277  44.614 117.739 1.00 50.62 ? 22  LYS C O     1 
ATOM   4409 C  CB    . LYS C 1 24  ? 34.279  46.411 119.627 1.00 54.37 ? 22  LYS C CB    1 
ATOM   4410 C  CG    . LYS C 1 24  ? 35.109  47.606 120.064 1.00 56.99 ? 22  LYS C CG    1 
ATOM   4411 C  CD    . LYS C 1 24  ? 36.336  47.792 119.181 1.00 58.93 ? 22  LYS C CD    1 
ATOM   4412 C  CE    . LYS C 1 24  ? 37.303  48.794 119.802 1.00 60.25 ? 22  LYS C CE    1 
ATOM   4413 N  NZ    . LYS C 1 24  ? 37.752  49.827 118.825 1.00 61.18 ? 22  LYS C NZ    1 
ATOM   4414 N  N     . LYS C 1 25  ? 34.433  44.628 117.094 1.00 52.54 ? 23  LYS C N     1 
ATOM   4415 C  CA    . LYS C 1 25  ? 34.406  43.309 116.487 1.00 53.76 ? 23  LYS C CA    1 
ATOM   4416 C  C     . LYS C 1 25  ? 33.998  42.263 117.534 1.00 53.66 ? 23  LYS C C     1 
ATOM   4417 O  O     . LYS C 1 25  ? 34.634  42.143 118.581 1.00 53.78 ? 23  LYS C O     1 
ATOM   4418 C  CB    . LYS C 1 25  ? 35.802  43.006 115.939 1.00 55.49 ? 23  LYS C CB    1 
ATOM   4419 C  CG    . LYS C 1 25  ? 35.907  41.802 115.035 1.00 58.09 ? 23  LYS C CG    1 
ATOM   4420 C  CD    . LYS C 1 25  ? 37.349  41.603 114.586 1.00 59.00 ? 23  LYS C CD    1 
ATOM   4421 C  CE    . LYS C 1 25  ? 38.273  41.313 115.764 1.00 59.83 ? 23  LYS C CE    1 
ATOM   4422 N  NZ    . LYS C 1 25  ? 37.903  40.045 116.452 1.00 59.17 ? 23  LYS C NZ    1 
ATOM   4423 N  N     . GLY C 1 26  ? 32.930  41.520 117.258 1.00 53.11 ? 24  GLY C N     1 
ATOM   4424 C  CA    . GLY C 1 26  ? 32.479  40.494 118.185 1.00 50.97 ? 24  GLY C CA    1 
ATOM   4425 C  C     . GLY C 1 26  ? 31.440  40.943 119.199 1.00 50.26 ? 24  GLY C C     1 
ATOM   4426 O  O     . GLY C 1 26  ? 31.008  40.155 120.043 1.00 49.14 ? 24  GLY C O     1 
ATOM   4427 N  N     . ALA C 1 27  ? 31.029  42.204 119.119 1.00 49.06 ? 25  ALA C N     1 
ATOM   4428 C  CA    . ALA C 1 27  ? 30.040  42.744 120.047 1.00 48.14 ? 25  ALA C CA    1 
ATOM   4429 C  C     . ALA C 1 27  ? 28.667  42.925 119.400 1.00 47.43 ? 25  ALA C C     1 
ATOM   4430 O  O     . ALA C 1 27  ? 28.564  43.192 118.201 1.00 47.08 ? 25  ALA C O     1 
ATOM   4431 C  CB    . ALA C 1 27  ? 30.530  44.078 120.601 1.00 47.99 ? 25  ALA C CB    1 
ATOM   4432 N  N     . SER C 1 28  ? 27.619  42.764 120.206 1.00 45.69 ? 26  SER C N     1 
ATOM   4433 C  CA    . SER C 1 28  ? 26.241  42.938 119.749 1.00 44.54 ? 26  SER C CA    1 
ATOM   4434 C  C     . SER C 1 28  ? 25.669  44.137 120.490 1.00 43.23 ? 26  SER C C     1 
ATOM   4435 O  O     . SER C 1 28  ? 25.544  44.113 121.717 1.00 42.17 ? 26  SER C O     1 
ATOM   4436 C  CB    . SER C 1 28  ? 25.389  41.701 120.065 1.00 45.54 ? 26  SER C CB    1 
ATOM   4437 O  OG    . SER C 1 28  ? 25.794  40.574 119.307 1.00 49.26 ? 26  SER C OG    1 
ATOM   4438 N  N     . ILE C 1 29  ? 25.330  45.190 119.755 1.00 41.60 ? 27  ILE C N     1 
ATOM   4439 C  CA    . ILE C 1 29  ? 24.778  46.376 120.384 1.00 39.37 ? 27  ILE C CA    1 
ATOM   4440 C  C     . ILE C 1 29  ? 23.365  46.679 119.909 1.00 38.53 ? 27  ILE C C     1 
ATOM   4441 O  O     . ILE C 1 29  ? 22.907  46.159 118.889 1.00 37.19 ? 27  ILE C O     1 
ATOM   4442 C  CB    . ILE C 1 29  ? 25.664  47.609 120.130 1.00 40.74 ? 27  ILE C CB    1 
ATOM   4443 C  CG1   . ILE C 1 29  ? 25.613  48.002 118.653 1.00 40.01 ? 27  ILE C CG1   1 
ATOM   4444 C  CG2   . ILE C 1 29  ? 27.096  47.300 120.542 1.00 40.90 ? 27  ILE C CG2   1 
ATOM   4445 C  CD1   . ILE C 1 29  ? 26.311  49.309 118.349 1.00 39.59 ? 27  ILE C CD1   1 
ATOM   4446 N  N     . HIS C 1 30  ? 22.687  47.530 120.669 1.00 36.87 ? 28  HIS C N     1 
ATOM   4447 C  CA    . HIS C 1 30  ? 21.325  47.937 120.378 1.00 36.44 ? 28  HIS C CA    1 
ATOM   4448 C  C     . HIS C 1 30  ? 21.337  49.160 119.475 1.00 36.57 ? 28  HIS C C     1 
ATOM   4449 O  O     . HIS C 1 30  ? 22.253  49.976 119.527 1.00 35.93 ? 28  HIS C O     1 
ATOM   4450 C  CB    . HIS C 1 30  ? 20.596  48.275 121.679 1.00 37.72 ? 28  HIS C CB    1 
ATOM   4451 C  CG    . HIS C 1 30  ? 19.169  48.683 121.488 1.00 37.12 ? 28  HIS C CG    1 
ATOM   4452 N  ND1   . HIS C 1 30  ? 18.179  47.788 121.141 1.00 37.78 ? 28  HIS C ND1   1 
ATOM   4453 C  CD2   . HIS C 1 30  ? 18.565  49.890 121.594 1.00 36.43 ? 28  HIS C CD2   1 
ATOM   4454 C  CE1   . HIS C 1 30  ? 17.027  48.427 121.045 1.00 35.89 ? 28  HIS C CE1   1 
ATOM   4455 N  NE2   . HIS C 1 30  ? 17.234  49.704 121.314 1.00 35.84 ? 28  HIS C NE2   1 
ATOM   4456 N  N     . GLY C 1 31  ? 20.308  49.277 118.649 1.00 36.48 ? 29  GLY C N     1 
ATOM   4457 C  CA    . GLY C 1 31  ? 20.205  50.408 117.750 1.00 36.42 ? 29  GLY C CA    1 
ATOM   4458 C  C     . GLY C 1 31  ? 18.749  50.758 117.538 1.00 34.84 ? 29  GLY C C     1 
ATOM   4459 O  O     . GLY C 1 31  ? 17.856  50.007 117.934 1.00 34.58 ? 29  GLY C O     1 
ATOM   4460 N  N     . VAL C 1 32  ? 18.507  51.910 116.926 1.00 33.32 ? 30  VAL C N     1 
ATOM   4461 C  CA    . VAL C 1 32  ? 17.149  52.353 116.647 1.00 32.84 ? 30  VAL C CA    1 
ATOM   4462 C  C     . VAL C 1 32  ? 17.111  52.916 115.231 1.00 33.07 ? 30  VAL C C     1 
ATOM   4463 O  O     . VAL C 1 32  ? 17.924  53.774 114.890 1.00 30.51 ? 30  VAL C O     1 
ATOM   4464 C  CB    . VAL C 1 32  ? 16.701  53.462 117.632 1.00 33.37 ? 30  VAL C CB    1 
ATOM   4465 C  CG1   . VAL C 1 32  ? 15.322  53.952 117.262 1.00 31.92 ? 30  VAL C CG1   1 
ATOM   4466 C  CG2   . VAL C 1 32  ? 16.707  52.936 119.067 1.00 34.28 ? 30  VAL C CG2   1 
ATOM   4467 N  N     . LYS C 1 33  ? 16.187  52.418 114.408 1.00 33.95 ? 31  LYS C N     1 
ATOM   4468 C  CA    . LYS C 1 33  ? 16.049  52.905 113.041 1.00 35.42 ? 31  LYS C CA    1 
ATOM   4469 C  C     . LYS C 1 33  ? 15.335  54.245 113.104 1.00 36.19 ? 31  LYS C C     1 
ATOM   4470 O  O     . LYS C 1 33  ? 14.181  54.328 113.528 1.00 35.77 ? 31  LYS C O     1 
ATOM   4471 C  CB    . LYS C 1 33  ? 15.243  51.926 112.176 1.00 37.72 ? 31  LYS C CB    1 
ATOM   4472 C  CG    . LYS C 1 33  ? 16.088  50.870 111.468 1.00 39.88 ? 31  LYS C CG    1 
ATOM   4473 C  CD    . LYS C 1 33  ? 15.266  50.095 110.438 1.00 41.11 ? 31  LYS C CD    1 
ATOM   4474 C  CE    . LYS C 1 33  ? 16.140  49.148 109.624 1.00 40.77 ? 31  LYS C CE    1 
ATOM   4475 N  NZ    . LYS C 1 33  ? 15.352  48.328 108.657 1.00 38.81 ? 31  LYS C NZ    1 
ATOM   4476 N  N     . VAL C 1 34  ? 16.027  55.296 112.682 1.00 35.82 ? 32  VAL C N     1 
ATOM   4477 C  CA    . VAL C 1 34  ? 15.457  56.632 112.727 1.00 37.90 ? 32  VAL C CA    1 
ATOM   4478 C  C     . VAL C 1 34  ? 14.740  57.049 111.453 1.00 38.34 ? 32  VAL C C     1 
ATOM   4479 O  O     . VAL C 1 34  ? 13.699  57.710 111.513 1.00 40.35 ? 32  VAL C O     1 
ATOM   4480 C  CB    . VAL C 1 34  ? 16.538  57.682 113.037 1.00 38.41 ? 32  VAL C CB    1 
ATOM   4481 C  CG1   . VAL C 1 34  ? 15.927  59.071 113.042 1.00 42.09 ? 32  VAL C CG1   1 
ATOM   4482 C  CG2   . VAL C 1 34  ? 17.178  57.381 114.378 1.00 41.12 ? 32  VAL C CG2   1 
ATOM   4483 N  N     . SER C 1 35  ? 15.279  56.670 110.300 1.00 34.97 ? 33  SER C N     1 
ATOM   4484 C  CA    . SER C 1 35  ? 14.643  57.073 109.057 1.00 33.80 ? 33  SER C CA    1 
ATOM   4485 C  C     . SER C 1 35  ? 15.169  56.369 107.816 1.00 32.48 ? 33  SER C C     1 
ATOM   4486 O  O     . SER C 1 35  ? 16.203  55.704 107.846 1.00 31.87 ? 33  SER C O     1 
ATOM   4487 C  CB    . SER C 1 35  ? 14.835  58.572 108.865 1.00 33.74 ? 33  SER C CB    1 
ATOM   4488 O  OG    . SER C 1 35  ? 16.218  58.862 108.752 1.00 33.80 ? 33  SER C OG    1 
ATOM   4489 N  N     . GLN C 1 36  ? 14.422  56.530 106.730 1.00 31.34 ? 34  GLN C N     1 
ATOM   4490 C  CA    . GLN C 1 36  ? 14.779  55.988 105.431 1.00 31.87 ? 34  GLN C CA    1 
ATOM   4491 C  C     . GLN C 1 36  ? 14.469  57.138 104.494 1.00 30.46 ? 34  GLN C C     1 
ATOM   4492 O  O     . GLN C 1 36  ? 13.463  57.830 104.666 1.00 30.08 ? 34  GLN C O     1 
ATOM   4493 C  CB    . GLN C 1 36  ? 13.921  54.781 105.067 1.00 35.69 ? 34  GLN C CB    1 
ATOM   4494 C  CG    . GLN C 1 36  ? 13.977  53.647 106.066 1.00 42.40 ? 34  GLN C CG    1 
ATOM   4495 C  CD    . GLN C 1 36  ? 13.272  52.398 105.560 1.00 46.63 ? 34  GLN C CD    1 
ATOM   4496 O  OE1   . GLN C 1 36  ? 12.254  52.480 104.867 1.00 47.96 ? 34  GLN C OE1   1 
ATOM   4497 N  NE2   . GLN C 1 36  ? 13.804  51.234 105.916 1.00 48.48 ? 34  GLN C NE2   1 
ATOM   4498 N  N     . ASP C 1 37  ? 15.330  57.358 103.511 1.00 28.00 ? 35  ASP C N     1 
ATOM   4499 C  CA    . ASP C 1 37  ? 15.118  58.458 102.588 1.00 26.62 ? 35  ASP C CA    1 
ATOM   4500 C  C     . ASP C 1 37  ? 15.902  58.174 101.310 1.00 24.42 ? 35  ASP C C     1 
ATOM   4501 O  O     . ASP C 1 37  ? 16.738  57.274 101.276 1.00 26.20 ? 35  ASP C O     1 
ATOM   4502 C  CB    . ASP C 1 37  ? 15.615  59.756 103.236 1.00 25.79 ? 35  ASP C CB    1 
ATOM   4503 C  CG    . ASP C 1 37  ? 14.959  61.000 102.658 1.00 28.68 ? 35  ASP C CG    1 
ATOM   4504 O  OD1   . ASP C 1 37  ? 14.161  60.879 101.704 1.00 25.24 ? 35  ASP C OD1   1 
ATOM   4505 O  OD2   . ASP C 1 37  ? 15.243  62.105 103.174 1.00 28.09 ? 35  ASP C OD2   1 
ATOM   4506 N  N     . ILE C 1 38  ? 15.615  58.933 100.262 1.00 23.16 ? 36  ILE C N     1 
ATOM   4507 C  CA    . ILE C 1 38  ? 16.311  58.781 98.992  1.00 22.74 ? 36  ILE C CA    1 
ATOM   4508 C  C     . ILE C 1 38  ? 17.663  59.473 99.139  1.00 22.57 ? 36  ILE C C     1 
ATOM   4509 O  O     . ILE C 1 38  ? 17.747  60.560 99.713  1.00 21.41 ? 36  ILE C O     1 
ATOM   4510 C  CB    . ILE C 1 38  ? 15.520  59.446 97.853  1.00 23.11 ? 36  ILE C CB    1 
ATOM   4511 C  CG1   . ILE C 1 38  ? 14.104  58.865 97.811  1.00 27.13 ? 36  ILE C CG1   1 
ATOM   4512 C  CG2   . ILE C 1 38  ? 16.242  59.247 96.514  1.00 23.10 ? 36  ILE C CG2   1 
ATOM   4513 C  CD1   . ILE C 1 38  ? 14.066  57.353 97.752  1.00 28.09 ? 36  ILE C CD1   1 
ATOM   4514 N  N     . GLY C 1 39  ? 18.715  58.837 98.632  1.00 20.75 ? 37  GLY C N     1 
ATOM   4515 C  CA    . GLY C 1 39  ? 20.045  59.409 98.742  1.00 21.61 ? 37  GLY C CA    1 
ATOM   4516 C  C     . GLY C 1 39  ? 20.984  58.929 97.657  1.00 23.10 ? 37  GLY C C     1 
ATOM   4517 O  O     . GLY C 1 39  ? 20.544  58.549 96.569  1.00 21.48 ? 37  GLY C O     1 
ATOM   4518 N  N     . GLY C 1 40  ? 22.279  58.938 97.970  1.00 20.61 ? 38  GLY C N     1 
ATOM   4519 C  CA    . GLY C 1 40  ? 23.290  58.516 97.020  1.00 21.55 ? 38  GLY C CA    1 
ATOM   4520 C  C     . GLY C 1 40  ? 24.139  59.710 96.630  1.00 22.04 ? 38  GLY C C     1 
ATOM   4521 O  O     . GLY C 1 40  ? 23.605  60.772 96.341  1.00 22.56 ? 38  GLY C O     1 
ATOM   4522 N  N     . LYS C 1 41  ? 25.457  59.543 96.631  1.00 23.00 ? 39  LYS C N     1 
ATOM   4523 C  CA    . LYS C 1 41  ? 26.368  60.630 96.269  1.00 23.84 ? 39  LYS C CA    1 
ATOM   4524 C  C     . LYS C 1 41  ? 26.007  61.215 94.905  1.00 22.81 ? 39  LYS C C     1 
ATOM   4525 O  O     . LYS C 1 41  ? 25.980  62.434 94.726  1.00 23.16 ? 39  LYS C O     1 
ATOM   4526 C  CB    . LYS C 1 41  ? 27.813  60.120 96.245  1.00 26.44 ? 39  LYS C CB    1 
ATOM   4527 C  CG    . LYS C 1 41  ? 28.327  59.611 97.595  1.00 29.70 ? 39  LYS C CG    1 
ATOM   4528 C  CD    . LYS C 1 41  ? 28.603  60.749 98.562  1.00 30.34 ? 39  LYS C CD    1 
ATOM   4529 C  CE    . LYS C 1 41  ? 29.696  61.667 98.017  1.00 31.99 ? 39  LYS C CE    1 
ATOM   4530 N  NZ    . LYS C 1 41  ? 30.009  62.764 98.964  1.00 32.17 ? 39  LYS C NZ    1 
ATOM   4531 N  N     . GLY C 1 42  ? 25.739  60.342 93.940  1.00 21.54 ? 40  GLY C N     1 
ATOM   4532 C  CA    . GLY C 1 42  ? 25.380  60.812 92.617  1.00 21.00 ? 40  GLY C CA    1 
ATOM   4533 C  C     . GLY C 1 42  ? 24.055  61.551 92.597  1.00 20.26 ? 40  GLY C C     1 
ATOM   4534 O  O     . GLY C 1 42  ? 23.967  62.685 92.107  1.00 19.25 ? 40  GLY C O     1 
ATOM   4535 N  N     . ALA C 1 43  ? 23.014  60.914 93.124  1.00 18.45 ? 41  ALA C N     1 
ATOM   4536 C  CA    . ALA C 1 43  ? 21.688  61.525 93.149  1.00 20.11 ? 41  ALA C CA    1 
ATOM   4537 C  C     . ALA C 1 43  ? 21.624  62.827 93.950  1.00 18.68 ? 41  ALA C C     1 
ATOM   4538 O  O     . ALA C 1 43  ? 20.983  63.782 93.521  1.00 20.53 ? 41  ALA C O     1 
ATOM   4539 C  CB    . ALA C 1 43  ? 20.662  60.533 93.698  1.00 19.06 ? 41  ALA C CB    1 
ATOM   4540 N  N     . ASN C 1 44  ? 22.280  62.864 95.108  1.00 19.40 ? 42  ASN C N     1 
ATOM   4541 C  CA    . ASN C 1 44  ? 22.251  64.062 95.950  1.00 18.25 ? 42  ASN C CA    1 
ATOM   4542 C  C     . ASN C 1 44  ? 22.800  65.265 95.215  1.00 19.33 ? 42  ASN C C     1 
ATOM   4543 O  O     . ASN C 1 44  ? 22.201  66.336 95.220  1.00 19.21 ? 42  ASN C O     1 
ATOM   4544 C  CB    . ASN C 1 44  ? 23.070  63.880 97.231  1.00 17.63 ? 42  ASN C CB    1 
ATOM   4545 C  CG    . ASN C 1 44  ? 22.496  62.827 98.162  1.00 19.18 ? 42  ASN C CG    1 
ATOM   4546 O  OD1   . ASN C 1 44  ? 21.353  62.394 98.008  1.00 19.13 ? 42  ASN C OD1   1 
ATOM   4547 N  ND2   . ASN C 1 44  ? 23.295  62.411 99.143  1.00 16.63 ? 42  ASN C ND2   1 
ATOM   4548 N  N     . GLN C 1 45  ? 23.948  65.088 94.579  1.00 18.66 ? 43  GLN C N     1 
ATOM   4549 C  CA    . GLN C 1 45  ? 24.566  66.201 93.883  1.00 18.47 ? 43  GLN C CA    1 
ATOM   4550 C  C     . GLN C 1 45  ? 23.778  66.587 92.635  1.00 18.86 ? 43  GLN C C     1 
ATOM   4551 O  O     . GLN C 1 45  ? 23.580  67.766 92.365  1.00 17.24 ? 43  GLN C O     1 
ATOM   4552 C  CB    . GLN C 1 45  ? 26.028  65.855 93.580  1.00 16.36 ? 43  GLN C CB    1 
ATOM   4553 C  CG    . GLN C 1 45  ? 26.789  65.541 94.895  1.00 16.43 ? 43  GLN C CG    1 
ATOM   4554 C  CD    . GLN C 1 45  ? 28.270  65.228 94.727  1.00 18.53 ? 43  GLN C CD    1 
ATOM   4555 O  OE1   . GLN C 1 45  ? 28.950  64.881 95.701  1.00 19.94 ? 43  GLN C OE1   1 
ATOM   4556 N  NE2   . GLN C 1 45  ? 28.778  65.349 93.508  1.00 14.24 ? 43  GLN C NE2   1 
ATOM   4557 N  N     . ALA C 1 46  ? 23.298  65.602 91.888  1.00 17.97 ? 44  ALA C N     1 
ATOM   4558 C  CA    . ALA C 1 46  ? 22.524  65.899 90.685  1.00 18.10 ? 44  ALA C CA    1 
ATOM   4559 C  C     . ALA C 1 46  ? 21.223  66.618 91.032  1.00 17.40 ? 44  ALA C C     1 
ATOM   4560 O  O     . ALA C 1 46  ? 20.850  67.592 90.387  1.00 20.12 ? 44  ALA C O     1 
ATOM   4561 C  CB    . ALA C 1 46  ? 22.209  64.611 89.942  1.00 16.72 ? 44  ALA C CB    1 
ATOM   4562 N  N     . ILE C 1 47  ? 20.525  66.122 92.045  1.00 18.77 ? 45  ILE C N     1 
ATOM   4563 C  CA    . ILE C 1 47  ? 19.254  66.722 92.439  1.00 19.49 ? 45  ILE C CA    1 
ATOM   4564 C  C     . ILE C 1 47  ? 19.414  68.180 92.860  1.00 19.45 ? 45  ILE C C     1 
ATOM   4565 O  O     . ILE C 1 47  ? 18.644  69.040 92.438  1.00 19.56 ? 45  ILE C O     1 
ATOM   4566 C  CB    . ILE C 1 47  ? 18.583  65.907 93.589  1.00 20.12 ? 45  ILE C CB    1 
ATOM   4567 C  CG1   . ILE C 1 47  ? 18.020  64.598 93.023  1.00 20.48 ? 45  ILE C CG1   1 
ATOM   4568 C  CG2   . ILE C 1 47  ? 17.458  66.714 94.225  1.00 20.83 ? 45  ILE C CG2   1 
ATOM   4569 C  CD1   . ILE C 1 47  ? 17.557  63.619 94.085  1.00 23.75 ? 45  ILE C CD1   1 
ATOM   4570 N  N     . ILE C 1 48  ? 20.426  68.460 93.676  1.00 17.43 ? 46  ILE C N     1 
ATOM   4571 C  CA    . ILE C 1 48  ? 20.639  69.826 94.139  1.00 17.57 ? 46  ILE C CA    1 
ATOM   4572 C  C     . ILE C 1 48  ? 21.025  70.740 92.984  1.00 17.95 ? 46  ILE C C     1 
ATOM   4573 O  O     . ILE C 1 48  ? 20.516  71.855 92.889  1.00 20.64 ? 46  ILE C O     1 
ATOM   4574 C  CB    . ILE C 1 48  ? 21.684  69.851 95.276  1.00 16.91 ? 46  ILE C CB    1 
ATOM   4575 C  CG1   . ILE C 1 48  ? 21.142  69.029 96.451  1.00 17.63 ? 46  ILE C CG1   1 
ATOM   4576 C  CG2   . ILE C 1 48  ? 21.956  71.272 95.733  1.00 16.73 ? 46  ILE C CG2   1 
ATOM   4577 C  CD1   . ILE C 1 48  ? 22.042  68.987 97.674  1.00 22.67 ? 46  ILE C CD1   1 
ATOM   4578 N  N     . LEU C 1 49  ? 21.902  70.274 92.093  1.00 17.68 ? 47  LEU C N     1 
ATOM   4579 C  CA    . LEU C 1 49  ? 22.278  71.075 90.925  1.00 18.55 ? 47  LEU C CA    1 
ATOM   4580 C  C     . LEU C 1 49  ? 21.020  71.440 90.138  1.00 21.47 ? 47  LEU C C     1 
ATOM   4581 O  O     . LEU C 1 49  ? 20.812  72.605 89.774  1.00 22.98 ? 47  LEU C O     1 
ATOM   4582 C  CB    . LEU C 1 49  ? 23.222  70.286 90.003  1.00 17.81 ? 47  LEU C CB    1 
ATOM   4583 C  CG    . LEU C 1 49  ? 24.683  70.203 90.433  1.00 19.79 ? 47  LEU C CG    1 
ATOM   4584 C  CD1   . LEU C 1 49  ? 25.420  69.101 89.663  1.00 20.64 ? 47  LEU C CD1   1 
ATOM   4585 C  CD2   . LEU C 1 49  ? 25.336  71.562 90.200  1.00 19.32 ? 47  LEU C CD2   1 
ATOM   4586 N  N     . SER C 1 50  ? 20.176  70.439 89.880  1.00 19.97 ? 48  SER C N     1 
ATOM   4587 C  CA    . SER C 1 50  ? 18.951  70.666 89.120  1.00 20.76 ? 48  SER C CA    1 
ATOM   4588 C  C     . SER C 1 50  ? 18.021  71.652 89.825  1.00 19.64 ? 48  SER C C     1 
ATOM   4589 O  O     . SER C 1 50  ? 17.399  72.495 89.176  1.00 19.48 ? 48  SER C O     1 
ATOM   4590 C  CB    . SER C 1 50  ? 18.220  69.342 88.849  1.00 19.63 ? 48  SER C CB    1 
ATOM   4591 O  OG    . SER C 1 50  ? 17.579  68.836 90.009  1.00 24.40 ? 48  SER C OG    1 
ATOM   4592 N  N     . ARG C 1 51  ? 17.931  71.553 91.147  1.00 19.41 ? 49  ARG C N     1 
ATOM   4593 C  CA    . ARG C 1 51  ? 17.087  72.465 91.910  1.00 20.41 ? 49  ARG C CA    1 
ATOM   4594 C  C     . ARG C 1 51  ? 17.604  73.906 91.834  1.00 23.04 ? 49  ARG C C     1 
ATOM   4595 O  O     . ARG C 1 51  ? 16.844  74.854 92.045  1.00 23.65 ? 49  ARG C O     1 
ATOM   4596 C  CB    . ARG C 1 51  ? 17.011  72.021 93.367  1.00 22.04 ? 49  ARG C CB    1 
ATOM   4597 C  CG    . ARG C 1 51  ? 16.138  70.810 93.590  1.00 21.69 ? 49  ARG C CG    1 
ATOM   4598 C  CD    . ARG C 1 51  ? 16.050  70.495 95.080  1.00 22.47 ? 49  ARG C CD    1 
ATOM   4599 N  NE    . ARG C 1 51  ? 15.101  69.424 95.357  1.00 23.17 ? 49  ARG C NE    1 
ATOM   4600 C  CZ    . ARG C 1 51  ? 14.746  69.039 96.578  1.00 23.71 ? 49  ARG C CZ    1 
ATOM   4601 N  NH1   . ARG C 1 51  ? 15.265  69.641 97.641  1.00 22.12 ? 49  ARG C NH1   1 
ATOM   4602 N  NH2   . ARG C 1 51  ? 13.863  68.060 96.734  1.00 21.58 ? 49  ARG C NH2   1 
ATOM   4603 N  N     . CYS C 1 52  ? 18.891  74.069 91.537  1.00 21.88 ? 50  CYS C N     1 
ATOM   4604 C  CA    . CYS C 1 52  ? 19.488  75.399 91.417  1.00 23.87 ? 50  CYS C CA    1 
ATOM   4605 C  C     . CYS C 1 52  ? 19.232  75.990 90.035  1.00 24.78 ? 50  CYS C C     1 
ATOM   4606 O  O     . CYS C 1 52  ? 19.579  77.146 89.775  1.00 26.24 ? 50  CYS C O     1 
ATOM   4607 C  CB    . CYS C 1 52  ? 20.998  75.345 91.651  1.00 24.14 ? 50  CYS C CB    1 
ATOM   4608 S  SG    . CYS C 1 52  ? 21.503  75.031 93.347  1.00 22.41 ? 50  CYS C SG    1 
ATOM   4609 N  N     . GLY C 1 53  ? 18.636  75.193 89.151  1.00 24.55 ? 51  GLY C N     1 
ATOM   4610 C  CA    . GLY C 1 53  ? 18.347  75.657 87.803  1.00 26.12 ? 51  GLY C CA    1 
ATOM   4611 C  C     . GLY C 1 53  ? 19.364  75.213 86.766  1.00 24.56 ? 51  GLY C C     1 
ATOM   4612 O  O     . GLY C 1 53  ? 19.357  75.693 85.626  1.00 26.02 ? 51  GLY C O     1 
ATOM   4613 N  N     . ILE C 1 54  ? 20.249  74.302 87.153  1.00 21.50 ? 52  ILE C N     1 
ATOM   4614 C  CA    . ILE C 1 54  ? 21.272  73.813 86.234  1.00 21.77 ? 52  ILE C CA    1 
ATOM   4615 C  C     . ILE C 1 54  ? 20.731  72.617 85.455  1.00 21.88 ? 52  ILE C C     1 
ATOM   4616 O  O     . ILE C 1 54  ? 20.205  71.685 86.051  1.00 22.16 ? 52  ILE C O     1 
ATOM   4617 C  CB    . ILE C 1 54  ? 22.541  73.366 87.000  1.00 21.29 ? 52  ILE C CB    1 
ATOM   4618 C  CG1   . ILE C 1 54  ? 23.112  74.536 87.810  1.00 20.46 ? 52  ILE C CG1   1 
ATOM   4619 C  CG2   . ILE C 1 54  ? 23.570  72.834 86.021  1.00 21.70 ? 52  ILE C CG2   1 
ATOM   4620 C  CD1   . ILE C 1 54  ? 23.543  75.747 86.957  1.00 24.02 ? 52  ILE C CD1   1 
ATOM   4621 N  N     . GLU C 1 55  ? 20.854  72.639 84.129  1.00 23.19 ? 53  GLU C N     1 
ATOM   4622 C  CA    . GLU C 1 55  ? 20.361  71.519 83.320  1.00 25.06 ? 53  GLU C CA    1 
ATOM   4623 C  C     . GLU C 1 55  ? 21.224  70.322 83.676  1.00 24.96 ? 53  GLU C C     1 
ATOM   4624 O  O     . GLU C 1 55  ? 22.418  70.298 83.372  1.00 23.84 ? 53  GLU C O     1 
ATOM   4625 C  CB    . GLU C 1 55  ? 20.485  71.824 81.829  1.00 29.75 ? 53  GLU C CB    1 
ATOM   4626 C  CG    . GLU C 1 55  ? 19.582  70.950 80.978  1.00 34.45 ? 53  GLU C CG    1 
ATOM   4627 C  CD    . GLU C 1 55  ? 19.749  71.206 79.497  1.00 38.40 ? 53  GLU C CD    1 
ATOM   4628 O  OE1   . GLU C 1 55  ? 19.797  72.388 79.097  1.00 41.30 ? 53  GLU C OE1   1 
ATOM   4629 O  OE2   . GLU C 1 55  ? 19.823  70.223 78.733  1.00 40.46 ? 53  GLU C OE2   1 
ATOM   4630 N  N     . THR C 1 56  ? 20.618  69.324 84.310  1.00 23.45 ? 54  THR C N     1 
ATOM   4631 C  CA    . THR C 1 56  ? 21.364  68.166 84.775  1.00 24.23 ? 54  THR C CA    1 
ATOM   4632 C  C     . THR C 1 56  ? 20.809  66.809 84.374  1.00 23.56 ? 54  THR C C     1 
ATOM   4633 O  O     . THR C 1 56  ? 19.598  66.601 84.340  1.00 24.50 ? 54  THR C O     1 
ATOM   4634 C  CB    . THR C 1 56  ? 21.442  68.177 86.321  1.00 26.30 ? 54  THR C CB    1 
ATOM   4635 O  OG1   . THR C 1 56  ? 21.858  69.470 86.772  1.00 27.27 ? 54  THR C OG1   1 
ATOM   4636 C  CG2   . THR C 1 56  ? 22.421  67.116 86.822  1.00 26.92 ? 54  THR C CG2   1 
ATOM   4637 N  N     . ARG C 1 57  ? 21.711  65.880 84.090  1.00 22.23 ? 55  ARG C N     1 
ATOM   4638 C  CA    . ARG C 1 57  ? 21.311  64.534 83.756  1.00 22.63 ? 55  ARG C CA    1 
ATOM   4639 C  C     . ARG C 1 57  ? 22.041  63.583 84.689  1.00 22.05 ? 55  ARG C C     1 
ATOM   4640 O  O     . ARG C 1 57  ? 23.263  63.603 84.771  1.00 22.75 ? 55  ARG C O     1 
ATOM   4641 C  CB    . ARG C 1 57  ? 21.617  64.242 82.284  1.00 26.71 ? 55  ARG C CB    1 
ATOM   4642 C  CG    . ARG C 1 57  ? 20.850  65.210 81.392  1.00 31.93 ? 55  ARG C CG    1 
ATOM   4643 C  CD    . ARG C 1 57  ? 20.852  64.878 79.924  1.00 35.83 ? 55  ARG C CD    1 
ATOM   4644 N  NE    . ARG C 1 57  ? 19.977  65.819 79.232  1.00 40.47 ? 55  ARG C NE    1 
ATOM   4645 C  CZ    . ARG C 1 57  ? 19.684  65.765 77.938  1.00 44.11 ? 55  ARG C CZ    1 
ATOM   4646 N  NH1   . ARG C 1 57  ? 20.200  64.808 77.179  1.00 45.12 ? 55  ARG C NH1   1 
ATOM   4647 N  NH2   . ARG C 1 57  ? 18.864  66.664 77.408  1.00 44.63 ? 55  ARG C NH2   1 
ATOM   4648 N  N     . LEU C 1 58  ? 21.281  62.785 85.431  1.00 20.06 ? 56  LEU C N     1 
ATOM   4649 C  CA    . LEU C 1 58  ? 21.871  61.815 86.341  1.00 19.34 ? 56  LEU C CA    1 
ATOM   4650 C  C     . LEU C 1 58  ? 21.845  60.458 85.655  1.00 19.30 ? 56  LEU C C     1 
ATOM   4651 O  O     . LEU C 1 58  ? 20.793  59.999 85.210  1.00 18.37 ? 56  LEU C O     1 
ATOM   4652 C  CB    . LEU C 1 58  ? 21.084  61.741 87.651  1.00 20.85 ? 56  LEU C CB    1 
ATOM   4653 C  CG    . LEU C 1 58  ? 21.415  60.558 88.575  1.00 18.68 ? 56  LEU C CG    1 
ATOM   4654 C  CD1   . LEU C 1 58  ? 22.866  60.602 89.030  1.00 21.00 ? 56  LEU C CD1   1 
ATOM   4655 C  CD2   . LEU C 1 58  ? 20.484  60.600 89.767  1.00 21.66 ? 56  LEU C CD2   1 
ATOM   4656 N  N     . ILE C 1 59  ? 23.013  59.834 85.554  1.00 20.23 ? 57  ILE C N     1 
ATOM   4657 C  CA    . ILE C 1 59  ? 23.144  58.523 84.933  1.00 19.08 ? 57  ILE C CA    1 
ATOM   4658 C  C     . ILE C 1 59  ? 23.449  57.588 86.092  1.00 19.19 ? 57  ILE C C     1 
ATOM   4659 O  O     . ILE C 1 59  ? 24.560  57.584 86.622  1.00 18.60 ? 57  ILE C O     1 
ATOM   4660 C  CB    . ILE C 1 59  ? 24.298  58.518 83.912  1.00 21.48 ? 57  ILE C CB    1 
ATOM   4661 C  CG1   . ILE C 1 59  ? 23.975  59.502 82.783  1.00 21.88 ? 57  ILE C CG1   1 
ATOM   4662 C  CG2   . ILE C 1 59  ? 24.516  57.111 83.363  1.00 19.90 ? 57  ILE C CG2   1 
ATOM   4663 C  CD1   . ILE C 1 59  ? 25.054  59.592 81.701  1.00 24.21 ? 57  ILE C CD1   1 
ATOM   4664 N  N     . ALA C 1 60  ? 22.445  56.816 86.495  1.00 17.91 ? 58  ALA C N     1 
ATOM   4665 C  CA    . ALA C 1 60  ? 22.579  55.915 87.628  1.00 20.08 ? 58  ALA C CA    1 
ATOM   4666 C  C     . ALA C 1 60  ? 21.596  54.759 87.502  1.00 21.08 ? 58  ALA C C     1 
ATOM   4667 O  O     . ALA C 1 60  ? 20.559  54.882 86.847  1.00 22.07 ? 58  ALA C O     1 
ATOM   4668 C  CB    . ALA C 1 60  ? 22.318  56.685 88.921  1.00 19.18 ? 58  ALA C CB    1 
ATOM   4669 N  N     . ALA C 1 61  ? 21.911  53.648 88.162  1.00 21.80 ? 59  ALA C N     1 
ATOM   4670 C  CA    . ALA C 1 61  ? 21.064  52.464 88.094  1.00 22.18 ? 59  ALA C CA    1 
ATOM   4671 C  C     . ALA C 1 61  ? 20.154  52.236 89.295  1.00 22.90 ? 59  ALA C C     1 
ATOM   4672 O  O     . ALA C 1 61  ? 20.568  52.425 90.443  1.00 22.13 ? 59  ALA C O     1 
ATOM   4673 C  CB    . ALA C 1 61  ? 21.946  51.227 87.876  1.00 23.48 ? 59  ALA C CB    1 
ATOM   4674 N  N     . THR C 1 62  ? 18.907  51.846 89.018  1.00 22.64 ? 60  THR C N     1 
ATOM   4675 C  CA    . THR C 1 62  ? 17.941  51.520 90.070  1.00 23.56 ? 60  THR C CA    1 
ATOM   4676 C  C     . THR C 1 62  ? 17.596  50.038 89.889  1.00 24.36 ? 60  THR C C     1 
ATOM   4677 O  O     . THR C 1 62  ? 17.768  49.486 88.794  1.00 22.73 ? 60  THR C O     1 
ATOM   4678 C  CB    . THR C 1 62  ? 16.632  52.358 89.990  1.00 24.24 ? 60  THR C CB    1 
ATOM   4679 O  OG1   . THR C 1 62  ? 15.959  52.116 88.744  1.00 24.01 ? 60  THR C OG1   1 
ATOM   4680 C  CG2   . THR C 1 62  ? 16.942  53.835 90.131  1.00 26.26 ? 60  THR C CG2   1 
ATOM   4681 N  N     . GLY C 1 63  ? 17.134  49.396 90.960  1.00 25.84 ? 61  GLY C N     1 
ATOM   4682 C  CA    . GLY C 1 63  ? 16.802  47.981 90.897  1.00 25.53 ? 61  GLY C CA    1 
ATOM   4683 C  C     . GLY C 1 63  ? 15.335  47.688 90.651  1.00 28.31 ? 61  GLY C C     1 
ATOM   4684 O  O     . GLY C 1 63  ? 14.523  48.604 90.519  1.00 27.56 ? 61  GLY C O     1 
ATOM   4685 N  N     . ASN C 1 64  ? 14.983  46.406 90.595  1.00 29.33 ? 62  ASN C N     1 
ATOM   4686 C  CA    . ASN C 1 64  ? 13.595  46.037 90.348  1.00 30.32 ? 62  ASN C CA    1 
ATOM   4687 C  C     . ASN C 1 64  ? 12.863  45.622 91.615  1.00 30.60 ? 62  ASN C C     1 
ATOM   4688 O  O     . ASN C 1 64  ? 12.059  44.687 91.608  1.00 31.54 ? 62  ASN C O     1 
ATOM   4689 C  CB    . ASN C 1 64  ? 13.523  44.923 89.294  1.00 33.28 ? 62  ASN C CB    1 
ATOM   4690 C  CG    . ASN C 1 64  ? 14.213  43.659 89.736  1.00 33.19 ? 62  ASN C CG    1 
ATOM   4691 O  OD1   . ASN C 1 64  ? 15.001  43.663 90.684  1.00 31.86 ? 62  ASN C OD1   1 
ATOM   4692 N  ND2   . ASN C 1 64  ? 13.930  42.561 89.041  1.00 35.09 ? 62  ASN C ND2   1 
ATOM   4693 N  N     . ASP C 1 65  ? 13.145  46.333 92.703  1.00 30.18 ? 63  ASP C N     1 
ATOM   4694 C  CA    . ASP C 1 65  ? 12.511  46.077 93.987  1.00 28.75 ? 63  ASP C CA    1 
ATOM   4695 C  C     . ASP C 1 65  ? 11.630  47.262 94.373  1.00 29.25 ? 63  ASP C C     1 
ATOM   4696 O  O     . ASP C 1 65  ? 11.529  48.240 93.625  1.00 28.34 ? 63  ASP C O     1 
ATOM   4697 C  CB    . ASP C 1 65  ? 13.571  45.828 95.069  1.00 28.33 ? 63  ASP C CB    1 
ATOM   4698 C  CG    . ASP C 1 65  ? 14.668  46.902 95.096  1.00 28.14 ? 63  ASP C CG    1 
ATOM   4699 O  OD1   . ASP C 1 65  ? 14.558  47.914 94.373  1.00 26.97 ? 63  ASP C OD1   1 
ATOM   4700 O  OD2   . ASP C 1 65  ? 15.643  46.725 95.852  1.00 27.65 ? 63  ASP C OD2   1 
ATOM   4701 N  N     . SER C 1 66  ? 10.988  47.175 95.535  1.00 27.11 ? 64  SER C N     1 
ATOM   4702 C  CA    . SER C 1 66  ? 10.131  48.256 95.996  1.00 26.72 ? 64  SER C CA    1 
ATOM   4703 C  C     . SER C 1 66  ? 10.931  49.552 96.183  1.00 26.43 ? 64  SER C C     1 
ATOM   4704 O  O     . SER C 1 66  ? 10.423  50.643 95.920  1.00 25.47 ? 64  SER C O     1 
ATOM   4705 C  CB    . SER C 1 66  ? 9.429   47.865 97.304  1.00 27.58 ? 64  SER C CB    1 
ATOM   4706 O  OG    . SER C 1 66  ? 10.361  47.495 98.303  1.00 29.55 ? 64  SER C OG    1 
ATOM   4707 N  N     . ASN C 1 67  ? 12.178  49.439 96.628  1.00 26.78 ? 65  ASN C N     1 
ATOM   4708 C  CA    . ASN C 1 67  ? 13.001  50.632 96.805  1.00 26.68 ? 65  ASN C CA    1 
ATOM   4709 C  C     . ASN C 1 67  ? 13.206  51.299 95.448  1.00 26.29 ? 65  ASN C C     1 
ATOM   4710 O  O     . ASN C 1 67  ? 13.130  52.524 95.334  1.00 25.62 ? 65  ASN C O     1 
ATOM   4711 C  CB    . ASN C 1 67  ? 14.358  50.286 97.426  1.00 26.77 ? 65  ASN C CB    1 
ATOM   4712 C  CG    . ASN C 1 67  ? 14.277  50.075 98.927  1.00 28.77 ? 65  ASN C CG    1 
ATOM   4713 O  OD1   . ASN C 1 67  ? 13.387  50.610 99.596  1.00 29.02 ? 65  ASN C OD1   1 
ATOM   4714 N  ND2   . ASN C 1 67  ? 15.224  49.315 99.471  1.00 26.93 ? 65  ASN C ND2   1 
ATOM   4715 N  N     . GLY C 1 68  ? 13.452  50.485 94.423  1.00 24.67 ? 66  GLY C N     1 
ATOM   4716 C  CA    . GLY C 1 68  ? 13.660  51.004 93.082  1.00 25.21 ? 66  GLY C CA    1 
ATOM   4717 C  C     . GLY C 1 68  ? 12.463  51.790 92.580  1.00 26.79 ? 66  GLY C C     1 
ATOM   4718 O  O     . GLY C 1 68  ? 12.619  52.876 92.018  1.00 25.26 ? 66  GLY C O     1 
ATOM   4719 N  N     . ALA C 1 69  ? 11.266  51.241 92.773  1.00 26.62 ? 67  ALA C N     1 
ATOM   4720 C  CA    . ALA C 1 69  ? 10.047  51.919 92.343  1.00 27.72 ? 67  ALA C CA    1 
ATOM   4721 C  C     . ALA C 1 69  ? 9.881   53.228 93.117  1.00 28.34 ? 67  ALA C C     1 
ATOM   4722 O  O     . ALA C 1 69  ? 9.449   54.239 92.566  1.00 28.52 ? 67  ALA C O     1 
ATOM   4723 C  CB    . ALA C 1 69  ? 8.839   51.022 92.576  1.00 29.01 ? 67  ALA C CB    1 
ATOM   4724 N  N     . TRP C 1 70  ? 10.225  53.202 94.398  1.00 26.87 ? 68  TRP C N     1 
ATOM   4725 C  CA    . TRP C 1 70  ? 10.112  54.389 95.231  1.00 28.87 ? 68  TRP C CA    1 
ATOM   4726 C  C     . TRP C 1 70  ? 11.088  55.465 94.733  1.00 26.79 ? 68  TRP C C     1 
ATOM   4727 O  O     . TRP C 1 70  ? 10.709  56.624 94.547  1.00 27.10 ? 68  TRP C O     1 
ATOM   4728 C  CB    . TRP C 1 70  ? 10.390  54.016 96.685  1.00 29.74 ? 68  TRP C CB    1 
ATOM   4729 C  CG    . TRP C 1 70  ? 10.397  55.169 97.629  1.00 33.72 ? 68  TRP C CG    1 
ATOM   4730 C  CD1   . TRP C 1 70  ? 9.631   56.295 97.558  1.00 36.27 ? 68  TRP C CD1   1 
ATOM   4731 C  CD2   . TRP C 1 70  ? 11.178  55.289 98.819  1.00 36.32 ? 68  TRP C CD2   1 
ATOM   4732 N  NE1   . TRP C 1 70  ? 9.886   57.112 98.633  1.00 37.38 ? 68  TRP C NE1   1 
ATOM   4733 C  CE2   . TRP C 1 70  ? 10.833  56.518 99.424  1.00 37.15 ? 68  TRP C CE2   1 
ATOM   4734 C  CE3   . TRP C 1 70  ? 12.136  54.474 99.438  1.00 37.63 ? 68  TRP C CE3   1 
ATOM   4735 C  CZ2   . TRP C 1 70  ? 11.412  56.956 100.618 1.00 38.42 ? 68  TRP C CZ2   1 
ATOM   4736 C  CZ3   . TRP C 1 70  ? 12.713  54.909 100.632 1.00 40.52 ? 68  TRP C CZ3   1 
ATOM   4737 C  CH2   . TRP C 1 70  ? 12.347  56.141 101.207 1.00 39.11 ? 68  TRP C CH2   1 
ATOM   4738 N  N     . ILE C 1 71  ? 12.334  55.069 94.499  1.00 24.66 ? 69  ILE C N     1 
ATOM   4739 C  CA    . ILE C 1 71  ? 13.353  55.991 94.003  1.00 23.66 ? 69  ILE C CA    1 
ATOM   4740 C  C     . ILE C 1 71  ? 12.889  56.665 92.715  1.00 25.49 ? 69  ILE C C     1 
ATOM   4741 O  O     . ILE C 1 71  ? 12.911  57.894 92.600  1.00 25.74 ? 69  ILE C O     1 
ATOM   4742 C  CB    . ILE C 1 71  ? 14.682  55.253 93.711  1.00 22.10 ? 69  ILE C CB    1 
ATOM   4743 C  CG1   . ILE C 1 71  ? 15.325  54.808 95.021  1.00 20.13 ? 69  ILE C CG1   1 
ATOM   4744 C  CG2   . ILE C 1 71  ? 15.624  56.152 92.896  1.00 21.75 ? 69  ILE C CG2   1 
ATOM   4745 C  CD1   . ILE C 1 71  ? 16.580  53.980 94.830  1.00 22.08 ? 69  ILE C CD1   1 
ATOM   4746 N  N     . ARG C 1 72  ? 12.467  55.860 91.745  1.00 24.69 ? 70  ARG C N     1 
ATOM   4747 C  CA    . ARG C 1 72  ? 12.022  56.397 90.470  1.00 26.48 ? 70  ARG C CA    1 
ATOM   4748 C  C     . ARG C 1 72  ? 10.819  57.328 90.608  1.00 29.25 ? 70  ARG C C     1 
ATOM   4749 O  O     . ARG C 1 72  ? 10.698  58.310 89.871  1.00 29.60 ? 70  ARG C O     1 
ATOM   4750 C  CB    . ARG C 1 72  ? 11.721  55.252 89.498  1.00 26.64 ? 70  ARG C CB    1 
ATOM   4751 C  CG    . ARG C 1 72  ? 12.956  54.414 89.153  1.00 23.39 ? 70  ARG C CG    1 
ATOM   4752 C  CD    . ARG C 1 72  ? 12.682  53.457 87.990  1.00 26.28 ? 70  ARG C CD    1 
ATOM   4753 N  NE    . ARG C 1 72  ? 11.712  52.420 88.337  1.00 25.22 ? 70  ARG C NE    1 
ATOM   4754 C  CZ    . ARG C 1 72  ? 12.013  51.309 89.002  1.00 27.21 ? 70  ARG C CZ    1 
ATOM   4755 N  NH1   . ARG C 1 72  ? 13.261  51.083 89.395  1.00 25.72 ? 70  ARG C NH1   1 
ATOM   4756 N  NH2   . ARG C 1 72  ? 11.066  50.421 89.274  1.00 27.06 ? 70  ARG C NH2   1 
ATOM   4757 N  N     . GLN C 1 73  ? 9.940   57.029 91.560  1.00 30.62 ? 71  GLN C N     1 
ATOM   4758 C  CA    . GLN C 1 73  ? 8.764   57.853 91.796  1.00 32.53 ? 71  GLN C CA    1 
ATOM   4759 C  C     . GLN C 1 73  ? 9.188   59.215 92.352  1.00 31.90 ? 71  GLN C C     1 
ATOM   4760 O  O     . GLN C 1 73  ? 8.733   60.260 91.877  1.00 31.86 ? 71  GLN C O     1 
ATOM   4761 C  CB    . GLN C 1 73  ? 7.830   57.136 92.769  1.00 36.65 ? 71  GLN C CB    1 
ATOM   4762 C  CG    . GLN C 1 73  ? 6.679   57.973 93.275  1.00 42.10 ? 71  GLN C CG    1 
ATOM   4763 C  CD    . GLN C 1 73  ? 5.607   57.121 93.919  1.00 46.73 ? 71  GLN C CD    1 
ATOM   4764 O  OE1   . GLN C 1 73  ? 4.882   56.394 93.233  1.00 49.54 ? 71  GLN C OE1   1 
ATOM   4765 N  NE2   . GLN C 1 73  ? 5.506   57.192 95.242  1.00 47.24 ? 71  GLN C NE2   1 
ATOM   4766 N  N     . GLN C 1 74  ? 10.065  59.198 93.352  1.00 29.90 ? 72  GLN C N     1 
ATOM   4767 C  CA    . GLN C 1 74  ? 10.569  60.432 93.956  1.00 31.18 ? 72  GLN C CA    1 
ATOM   4768 C  C     . GLN C 1 74  ? 11.299  61.308 92.938  1.00 29.48 ? 72  GLN C C     1 
ATOM   4769 O  O     . GLN C 1 74  ? 11.027  62.505 92.818  1.00 30.09 ? 72  GLN C O     1 
ATOM   4770 C  CB    . GLN C 1 74  ? 11.536  60.115 95.100  1.00 33.04 ? 72  GLN C CB    1 
ATOM   4771 C  CG    . GLN C 1 74  ? 10.884  59.648 96.375  1.00 38.48 ? 72  GLN C CG    1 
ATOM   4772 C  CD    . GLN C 1 74  ? 9.901   60.660 96.905  1.00 41.29 ? 72  GLN C CD    1 
ATOM   4773 O  OE1   . GLN C 1 74  ? 8.724   60.638 96.552  1.00 43.69 ? 72  GLN C OE1   1 
ATOM   4774 N  NE2   . GLN C 1 74  ? 10.383  61.572 97.743  1.00 44.36 ? 72  GLN C NE2   1 
ATOM   4775 N  N     . ILE C 1 75  ? 12.241  60.712 92.213  1.00 28.34 ? 73  ILE C N     1 
ATOM   4776 C  CA    . ILE C 1 75  ? 13.014  61.450 91.221  1.00 29.22 ? 73  ILE C CA    1 
ATOM   4777 C  C     . ILE C 1 75  ? 12.125  62.137 90.199  1.00 30.32 ? 73  ILE C C     1 
ATOM   4778 O  O     . ILE C 1 75  ? 12.467  63.199 89.683  1.00 27.76 ? 73  ILE C O     1 
ATOM   4779 C  CB    . ILE C 1 75  ? 13.999  60.525 90.461  1.00 30.70 ? 73  ILE C CB    1 
ATOM   4780 C  CG1   . ILE C 1 75  ? 15.154  60.125 91.375  1.00 33.52 ? 73  ILE C CG1   1 
ATOM   4781 C  CG2   . ILE C 1 75  ? 14.565  61.248 89.242  1.00 32.55 ? 73  ILE C CG2   1 
ATOM   4782 C  CD1   . ILE C 1 75  ? 16.042  61.294 91.767  1.00 36.21 ? 73  ILE C CD1   1 
ATOM   4783 N  N     . LYS C 1 76  ? 10.980  61.532 89.903  1.00 31.05 ? 74  LYS C N     1 
ATOM   4784 C  CA    . LYS C 1 76  ? 10.082  62.109 88.921  1.00 33.13 ? 74  LYS C CA    1 
ATOM   4785 C  C     . LYS C 1 76  ? 9.620   63.503 89.323  1.00 33.30 ? 74  LYS C C     1 
ATOM   4786 O  O     . LYS C 1 76  ? 9.294   64.321 88.463  1.00 33.62 ? 74  LYS C O     1 
ATOM   4787 C  CB    . LYS C 1 76  ? 8.871   61.202 88.705  1.00 36.43 ? 74  LYS C CB    1 
ATOM   4788 C  CG    . LYS C 1 76  ? 8.669   60.833 87.251  1.00 41.83 ? 74  LYS C CG    1 
ATOM   4789 C  CD    . LYS C 1 76  ? 7.371   60.068 87.034  1.00 46.92 ? 74  LYS C CD    1 
ATOM   4790 C  CE    . LYS C 1 76  ? 6.459   60.819 86.066  1.00 48.88 ? 74  LYS C CE    1 
ATOM   4791 N  NZ    . LYS C 1 76  ? 7.141   61.115 84.766  1.00 51.00 ? 74  LYS C NZ    1 
ATOM   4792 N  N     . ASN C 1 77  ? 9.605   63.778 90.624  1.00 32.97 ? 75  ASN C N     1 
ATOM   4793 C  CA    . ASN C 1 77  ? 9.179   65.082 91.117  1.00 34.04 ? 75  ASN C CA    1 
ATOM   4794 C  C     . ASN C 1 77  ? 10.295  66.124 91.084  1.00 33.67 ? 75  ASN C C     1 
ATOM   4795 O  O     . ASN C 1 77  ? 10.089  67.269 91.495  1.00 33.92 ? 75  ASN C O     1 
ATOM   4796 C  CB    . ASN C 1 77  ? 8.646   64.966 92.547  1.00 37.61 ? 75  ASN C CB    1 
ATOM   4797 C  CG    . ASN C 1 77  ? 7.457   64.031 92.648  1.00 42.68 ? 75  ASN C CG    1 
ATOM   4798 O  OD1   . ASN C 1 77  ? 6.555   64.067 91.807  1.00 44.37 ? 75  ASN C OD1   1 
ATOM   4799 N  ND2   . ASN C 1 77  ? 7.444   63.193 93.683  1.00 43.40 ? 75  ASN C ND2   1 
ATOM   4800 N  N     . GLU C 1 78  ? 11.472  65.731 90.604  1.00 30.03 ? 76  GLU C N     1 
ATOM   4801 C  CA    . GLU C 1 78  ? 12.603  66.651 90.531  1.00 27.67 ? 76  GLU C CA    1 
ATOM   4802 C  C     . GLU C 1 78  ? 12.865  67.088 89.089  1.00 28.64 ? 76  GLU C C     1 
ATOM   4803 O  O     . GLU C 1 78  ? 12.616  66.332 88.146  1.00 27.02 ? 76  GLU C O     1 
ATOM   4804 C  CB    . GLU C 1 78  ? 13.857  65.994 91.113  1.00 26.48 ? 76  GLU C CB    1 
ATOM   4805 C  CG    . GLU C 1 78  ? 13.742  65.577 92.581  1.00 27.37 ? 76  GLU C CG    1 
ATOM   4806 C  CD    . GLU C 1 78  ? 13.556  66.754 93.536  1.00 27.57 ? 76  GLU C CD    1 
ATOM   4807 O  OE1   . GLU C 1 78  ? 14.026  67.868 93.221  1.00 25.86 ? 76  GLU C OE1   1 
ATOM   4808 O  OE2   . GLU C 1 78  ? 12.951  66.556 94.611  1.00 26.39 ? 76  GLU C OE2   1 
ATOM   4809 N  N     . PRO C 1 79  ? 13.390  68.314 88.901  1.00 28.86 ? 77  PRO C N     1 
ATOM   4810 C  CA    . PRO C 1 79  ? 13.692  68.877 87.583  1.00 30.85 ? 77  PRO C CA    1 
ATOM   4811 C  C     . PRO C 1 79  ? 14.952  68.287 86.967  1.00 33.61 ? 77  PRO C C     1 
ATOM   4812 O  O     . PRO C 1 79  ? 15.646  68.942 86.199  1.00 34.74 ? 77  PRO C O     1 
ATOM   4813 C  CB    . PRO C 1 79  ? 13.844  70.363 87.881  1.00 31.65 ? 77  PRO C CB    1 
ATOM   4814 C  CG    . PRO C 1 79  ? 14.510  70.344 89.220  1.00 29.17 ? 77  PRO C CG    1 
ATOM   4815 C  CD    . PRO C 1 79  ? 13.721  69.278 89.968  1.00 30.14 ? 77  PRO C CD    1 
ATOM   4816 N  N     . LEU C 1 80  ? 15.233  67.042 87.317  1.00 34.66 ? 78  LEU C N     1 
ATOM   4817 C  CA    . LEU C 1 80  ? 16.410  66.338 86.835  1.00 35.14 ? 78  LEU C CA    1 
ATOM   4818 C  C     . LEU C 1 80  ? 15.983  65.215 85.886  1.00 35.02 ? 78  LEU C C     1 
ATOM   4819 O  O     . LEU C 1 80  ? 14.872  64.700 85.995  1.00 34.90 ? 78  LEU C O     1 
ATOM   4820 C  CB    . LEU C 1 80  ? 17.141  65.748 88.044  1.00 35.56 ? 78  LEU C CB    1 
ATOM   4821 C  CG    . LEU C 1 80  ? 18.317  64.795 87.853  1.00 38.87 ? 78  LEU C CG    1 
ATOM   4822 C  CD1   . LEU C 1 80  ? 19.493  65.551 87.275  1.00 40.07 ? 78  LEU C CD1   1 
ATOM   4823 C  CD2   . LEU C 1 80  ? 18.689  64.173 89.191  1.00 36.91 ? 78  LEU C CD2   1 
HETATM 4824 N  N     . MSE C 1 81  ? 16.852  64.846 84.950  1.00 34.59 ? 79  MSE C N     1 
HETATM 4825 C  CA    . MSE C 1 81  ? 16.549  63.738 84.049  1.00 33.92 ? 79  MSE C CA    1 
HETATM 4826 C  C     . MSE C 1 81  ? 17.346  62.536 84.553  1.00 30.29 ? 79  MSE C C     1 
HETATM 4827 O  O     . MSE C 1 81  ? 18.570  62.613 84.678  1.00 28.33 ? 79  MSE C O     1 
HETATM 4828 C  CB    . MSE C 1 81  ? 16.974  64.053 82.613  1.00 39.20 ? 79  MSE C CB    1 
HETATM 4829 C  CG    . MSE C 1 81  ? 16.602  62.954 81.627  1.00 46.00 ? 79  MSE C CG    1 
HETATM 4830 SE SE    . MSE C 1 81  ? 17.149  63.323 79.807  1.00 57.19 ? 79  MSE C SE    1 
HETATM 4831 C  CE    . MSE C 1 81  ? 15.896  64.743 79.416  1.00 51.82 ? 79  MSE C CE    1 
ATOM   4832 N  N     . LEU C 1 82  ? 16.656  61.443 84.869  1.00 25.99 ? 80  LEU C N     1 
ATOM   4833 C  CA    . LEU C 1 82  ? 17.326  60.230 85.341  1.00 23.60 ? 80  LEU C CA    1 
ATOM   4834 C  C     . LEU C 1 82  ? 17.422  59.262 84.174  1.00 25.36 ? 80  LEU C C     1 
ATOM   4835 O  O     . LEU C 1 82  ? 16.424  58.976 83.513  1.00 23.29 ? 80  LEU C O     1 
ATOM   4836 C  CB    . LEU C 1 82  ? 16.540  59.565 86.476  1.00 23.55 ? 80  LEU C CB    1 
ATOM   4837 C  CG    . LEU C 1 82  ? 17.045  58.175 86.899  1.00 23.99 ? 80  LEU C CG    1 
ATOM   4838 C  CD1   . LEU C 1 82  ? 18.469  58.263 87.459  1.00 22.65 ? 80  LEU C CD1   1 
ATOM   4839 C  CD2   . LEU C 1 82  ? 16.100  57.599 87.941  1.00 21.07 ? 80  LEU C CD2   1 
ATOM   4840 N  N     . LEU C 1 83  ? 18.627  58.770 83.914  1.00 24.50 ? 81  LEU C N     1 
ATOM   4841 C  CA    . LEU C 1 83  ? 18.844  57.828 82.820  1.00 25.31 ? 81  LEU C CA    1 
ATOM   4842 C  C     . LEU C 1 83  ? 19.576  56.611 83.346  1.00 26.55 ? 81  LEU C C     1 
ATOM   4843 O  O     . LEU C 1 83  ? 20.443  56.735 84.220  1.00 24.63 ? 81  LEU C O     1 
ATOM   4844 C  CB    . LEU C 1 83  ? 19.676  58.486 81.719  1.00 25.12 ? 81  LEU C CB    1 
ATOM   4845 C  CG    . LEU C 1 83  ? 19.013  59.682 81.042  1.00 27.22 ? 81  LEU C CG    1 
ATOM   4846 C  CD1   . LEU C 1 83  ? 20.000  60.359 80.093  1.00 30.22 ? 81  LEU C CD1   1 
ATOM   4847 C  CD2   . LEU C 1 83  ? 17.776  59.203 80.299  1.00 28.05 ? 81  LEU C CD2   1 
ATOM   4848 N  N     . PRO C 1 84  ? 19.230  55.415 82.840  1.00 26.91 ? 82  PRO C N     1 
ATOM   4849 C  CA    . PRO C 1 84  ? 18.201  55.159 81.819  1.00 28.68 ? 82  PRO C CA    1 
ATOM   4850 C  C     . PRO C 1 84  ? 16.784  55.113 82.400  1.00 30.36 ? 82  PRO C C     1 
ATOM   4851 O  O     . PRO C 1 84  ? 16.610  55.157 83.617  1.00 28.64 ? 82  PRO C O     1 
ATOM   4852 C  CB    . PRO C 1 84  ? 18.619  53.811 81.250  1.00 28.07 ? 82  PRO C CB    1 
ATOM   4853 C  CG    . PRO C 1 84  ? 19.148  53.102 82.471  1.00 29.61 ? 82  PRO C CG    1 
ATOM   4854 C  CD    . PRO C 1 84  ? 19.986  54.185 83.146  1.00 27.93 ? 82  PRO C CD    1 
ATOM   4855 N  N     . ASP C 1 85  ? 15.779  55.019 81.527  1.00 32.47 ? 83  ASP C N     1 
ATOM   4856 C  CA    . ASP C 1 85  ? 14.383  54.950 81.967  1.00 36.17 ? 83  ASP C CA    1 
ATOM   4857 C  C     . ASP C 1 85  ? 14.121  53.637 82.687  1.00 35.16 ? 83  ASP C C     1 
ATOM   4858 O  O     . ASP C 1 85  ? 13.480  53.604 83.731  1.00 36.99 ? 83  ASP C O     1 
ATOM   4859 C  CB    . ASP C 1 85  ? 13.421  55.015 80.780  1.00 40.61 ? 83  ASP C CB    1 
ATOM   4860 C  CG    . ASP C 1 85  ? 13.589  56.261 79.959  1.00 45.72 ? 83  ASP C CG    1 
ATOM   4861 O  OD1   . ASP C 1 85  ? 13.442  57.370 80.521  1.00 48.64 ? 83  ASP C OD1   1 
ATOM   4862 O  OD2   . ASP C 1 85  ? 13.865  56.129 78.746  1.00 49.61 ? 83  ASP C OD2   1 
ATOM   4863 N  N     . GLY C 1 86  ? 14.618  52.553 82.107  1.00 35.54 ? 84  GLY C N     1 
ATOM   4864 C  CA    . GLY C 1 86  ? 14.403  51.245 82.694  1.00 36.96 ? 84  GLY C CA    1 
ATOM   4865 C  C     . GLY C 1 86  ? 15.243  50.978 83.921  1.00 36.42 ? 84  GLY C C     1 
ATOM   4866 O  O     . GLY C 1 86  ? 16.126  51.764 84.269  1.00 36.58 ? 84  GLY C O     1 
ATOM   4867 N  N     . HIS C 1 87  ? 14.959  49.864 84.583  1.00 34.26 ? 85  HIS C N     1 
ATOM   4868 C  CA    . HIS C 1 87  ? 15.694  49.477 85.773  1.00 32.56 ? 85  HIS C CA    1 
ATOM   4869 C  C     . HIS C 1 87  ? 16.440  48.181 85.492  1.00 31.05 ? 85  HIS C C     1 
ATOM   4870 O  O     . HIS C 1 87  ? 16.268  47.572 84.436  1.00 30.84 ? 85  HIS C O     1 
ATOM   4871 C  CB    . HIS C 1 87  ? 14.738  49.286 86.944  1.00 34.26 ? 85  HIS C CB    1 
ATOM   4872 C  CG    . HIS C 1 87  ? 13.549  48.446 86.611  1.00 36.59 ? 85  HIS C CG    1 
ATOM   4873 N  ND1   . HIS C 1 87  ? 12.448  48.947 85.951  1.00 38.65 ? 85  HIS C ND1   1 
ATOM   4874 C  CD2   . HIS C 1 87  ? 13.298  47.133 86.820  1.00 37.49 ? 85  HIS C CD2   1 
ATOM   4875 C  CE1   . HIS C 1 87  ? 11.568  47.978 85.771  1.00 38.93 ? 85  HIS C CE1   1 
ATOM   4876 N  NE2   . HIS C 1 87  ? 12.060  46.867 86.289  1.00 37.15 ? 85  HIS C NE2   1 
ATOM   4877 N  N     . PHE C 1 88  ? 17.266  47.758 86.439  1.00 29.64 ? 86  PHE C N     1 
ATOM   4878 C  CA    . PHE C 1 88  ? 18.052  46.544 86.260  1.00 29.80 ? 86  PHE C CA    1 
ATOM   4879 C  C     . PHE C 1 88  ? 17.569  45.414 87.157  1.00 29.00 ? 86  PHE C C     1 
ATOM   4880 O  O     . PHE C 1 88  ? 16.926  45.646 88.179  1.00 25.99 ? 86  PHE C O     1 
ATOM   4881 C  CB    . PHE C 1 88  ? 19.533  46.825 86.542  1.00 29.59 ? 86  PHE C CB    1 
ATOM   4882 C  CG    . PHE C 1 88  ? 20.144  47.859 85.630  1.00 30.13 ? 86  PHE C CG    1 
ATOM   4883 C  CD1   . PHE C 1 88  ? 19.773  49.200 85.720  1.00 30.81 ? 86  PHE C CD1   1 
ATOM   4884 C  CD2   . PHE C 1 88  ? 21.085  47.489 84.674  1.00 31.66 ? 86  PHE C CD2   1 
ATOM   4885 C  CE1   . PHE C 1 88  ? 20.332  50.157 84.868  1.00 30.45 ? 86  PHE C CE1   1 
ATOM   4886 C  CE2   . PHE C 1 88  ? 21.649  48.433 83.819  1.00 32.01 ? 86  PHE C CE2   1 
ATOM   4887 C  CZ    . PHE C 1 88  ? 21.271  49.770 83.916  1.00 31.59 ? 86  PHE C CZ    1 
ATOM   4888 N  N     . ASN C 1 89  ? 17.887  44.188 86.761  1.00 29.28 ? 87  ASN C N     1 
ATOM   4889 C  CA    . ASN C 1 89  ? 17.497  43.015 87.525  1.00 30.51 ? 87  ASN C CA    1 
ATOM   4890 C  C     . ASN C 1 89  ? 18.470  42.888 88.685  1.00 31.60 ? 87  ASN C C     1 
ATOM   4891 O  O     . ASN C 1 89  ? 19.394  42.075 88.660  1.00 31.71 ? 87  ASN C O     1 
ATOM   4892 C  CB    . ASN C 1 89  ? 17.546  41.770 86.634  1.00 31.29 ? 87  ASN C CB    1 
ATOM   4893 C  CG    . ASN C 1 89  ? 17.142  40.510 87.371  1.00 30.52 ? 87  ASN C CG    1 
ATOM   4894 O  OD1   . ASN C 1 89  ? 16.367  40.558 88.324  1.00 30.77 ? 87  ASN C OD1   1 
ATOM   4895 N  ND2   . ASN C 1 89  ? 17.654  39.372 86.921  1.00 30.61 ? 87  ASN C ND2   1 
ATOM   4896 N  N     . GLN C 1 90  ? 18.253  43.722 89.698  1.00 32.15 ? 88  GLN C N     1 
ATOM   4897 C  CA    . GLN C 1 90  ? 19.101  43.751 90.881  1.00 32.26 ? 88  GLN C CA    1 
ATOM   4898 C  C     . GLN C 1 90  ? 18.422  44.551 91.972  1.00 29.91 ? 88  GLN C C     1 
ATOM   4899 O  O     . GLN C 1 90  ? 17.457  45.269 91.718  1.00 30.23 ? 88  GLN C O     1 
ATOM   4900 C  CB    . GLN C 1 90  ? 20.441  44.411 90.551  1.00 35.05 ? 88  GLN C CB    1 
ATOM   4901 C  CG    . GLN C 1 90  ? 21.542  43.438 90.189  1.00 40.54 ? 88  GLN C CG    1 
ATOM   4902 C  CD    . GLN C 1 90  ? 22.146  42.763 91.406  1.00 41.04 ? 88  GLN C CD    1 
ATOM   4903 O  OE1   . GLN C 1 90  ? 21.438  42.400 92.349  1.00 43.87 ? 88  GLN C OE1   1 
ATOM   4904 N  NE2   . GLN C 1 90  ? 23.460  42.581 91.386  1.00 44.22 ? 88  GLN C NE2   1 
ATOM   4905 N  N     . HIS C 1 91  ? 18.919  44.412 93.193  1.00 28.61 ? 89  HIS C N     1 
ATOM   4906 C  CA    . HIS C 1 91  ? 18.382  45.178 94.303  1.00 28.87 ? 89  HIS C CA    1 
ATOM   4907 C  C     . HIS C 1 91  ? 18.908  46.591 94.097  1.00 26.44 ? 89  HIS C C     1 
ATOM   4908 O  O     . HIS C 1 91  ? 20.034  46.772 93.621  1.00 26.81 ? 89  HIS C O     1 
ATOM   4909 C  CB    . HIS C 1 91  ? 18.906  44.637 95.638  1.00 32.59 ? 89  HIS C CB    1 
ATOM   4910 C  CG    . HIS C 1 91  ? 18.258  43.360 96.074  1.00 36.59 ? 89  HIS C CG    1 
ATOM   4911 N  ND1   . HIS C 1 91  ? 16.940  43.294 96.472  1.00 39.17 ? 89  HIS C ND1   1 
ATOM   4912 C  CD2   . HIS C 1 91  ? 18.746  42.102 96.178  1.00 39.45 ? 89  HIS C CD2   1 
ATOM   4913 C  CE1   . HIS C 1 91  ? 16.644  42.050 96.806  1.00 39.76 ? 89  HIS C CE1   1 
ATOM   4914 N  NE2   . HIS C 1 91  ? 17.723  41.306 96.636  1.00 40.57 ? 89  HIS C NE2   1 
ATOM   4915 N  N     . SER C 1 92  ? 18.102  47.589 94.434  1.00 25.28 ? 90  SER C N     1 
ATOM   4916 C  CA    . SER C 1 92  ? 18.553  48.966 94.298  1.00 23.77 ? 90  SER C CA    1 
ATOM   4917 C  C     . SER C 1 92  ? 19.607  49.144 95.374  1.00 22.95 ? 90  SER C C     1 
ATOM   4918 O  O     . SER C 1 92  ? 19.522  48.517 96.428  1.00 22.14 ? 90  SER C O     1 
ATOM   4919 C  CB    . SER C 1 92  ? 17.395  49.929 94.529  1.00 23.24 ? 90  SER C CB    1 
ATOM   4920 O  OG    . SER C 1 92  ? 16.396  49.720 93.553  1.00 27.63 ? 90  SER C OG    1 
ATOM   4921 N  N     . ASP C 1 93  ? 20.601  49.986 95.118  1.00 21.51 ? 91  ASP C N     1 
ATOM   4922 C  CA    . ASP C 1 93  ? 21.657  50.206 96.095  1.00 22.48 ? 91  ASP C CA    1 
ATOM   4923 C  C     . ASP C 1 93  ? 21.101  50.876 97.337  1.00 23.21 ? 91  ASP C C     1 
ATOM   4924 O  O     . ASP C 1 93  ? 20.165  51.662 97.253  1.00 22.74 ? 91  ASP C O     1 
ATOM   4925 C  CB    . ASP C 1 93  ? 22.784  51.055 95.491  1.00 23.23 ? 91  ASP C CB    1 
ATOM   4926 C  CG    . ASP C 1 93  ? 23.554  50.313 94.409  1.00 26.85 ? 91  ASP C CG    1 
ATOM   4927 O  OD1   . ASP C 1 93  ? 23.877  49.124 94.614  1.00 28.76 ? 91  ASP C OD1   1 
ATOM   4928 O  OD2   . ASP C 1 93  ? 23.850  50.912 93.358  1.00 29.12 ? 91  ASP C OD2   1 
ATOM   4929 N  N     . THR C 1 94  ? 21.668  50.545 98.492  1.00 23.85 ? 92  THR C N     1 
ATOM   4930 C  CA    . THR C 1 94  ? 21.222  51.133 99.750  1.00 23.66 ? 92  THR C CA    1 
ATOM   4931 C  C     . THR C 1 94  ? 22.424  51.485 100.615 1.00 22.77 ? 92  THR C C     1 
ATOM   4932 O  O     . THR C 1 94  ? 23.522  50.975 100.411 1.00 21.55 ? 92  THR C O     1 
ATOM   4933 C  CB    . THR C 1 94  ? 20.323  50.162 100.554 1.00 26.27 ? 92  THR C CB    1 
ATOM   4934 O  OG1   . THR C 1 94  ? 20.994  48.901 100.706 1.00 27.33 ? 92  THR C OG1   1 
ATOM   4935 C  CG2   . THR C 1 94  ? 18.994  49.960 99.856  1.00 26.56 ? 92  THR C CG2   1 
ATOM   4936 N  N     . SER C 1 95  ? 22.204  52.363 101.582 1.00 22.19 ? 93  SER C N     1 
ATOM   4937 C  CA    . SER C 1 95  ? 23.264  52.771 102.489 1.00 24.02 ? 93  SER C CA    1 
ATOM   4938 C  C     . SER C 1 95  ? 22.764  52.678 103.914 1.00 24.91 ? 93  SER C C     1 
ATOM   4939 O  O     . SER C 1 95  ? 21.600  52.974 104.195 1.00 23.64 ? 93  SER C O     1 
ATOM   4940 C  CB    . SER C 1 95  ? 23.706  54.217 102.221 1.00 24.47 ? 93  SER C CB    1 
ATOM   4941 O  OG    . SER C 1 95  ? 24.455  54.322 101.025 1.00 25.10 ? 93  SER C OG    1 
ATOM   4942 N  N     . ILE C 1 96  ? 23.656  52.232 104.793 1.00 26.28 ? 94  ILE C N     1 
ATOM   4943 C  CA    . ILE C 1 96  ? 23.385  52.131 106.214 1.00 28.04 ? 94  ILE C CA    1 
ATOM   4944 C  C     . ILE C 1 96  ? 24.185  53.294 106.791 1.00 27.09 ? 94  ILE C C     1 
ATOM   4945 O  O     . ILE C 1 96  ? 25.402  53.357 106.624 1.00 27.02 ? 94  ILE C O     1 
ATOM   4946 C  CB    . ILE C 1 96  ? 23.950  50.824 106.836 1.00 30.16 ? 94  ILE C CB    1 
ATOM   4947 C  CG1   . ILE C 1 96  ? 23.303  49.593 106.197 1.00 32.31 ? 94  ILE C CG1   1 
ATOM   4948 C  CG2   . ILE C 1 96  ? 23.721  50.835 108.344 1.00 33.11 ? 94  ILE C CG2   1 
ATOM   4949 C  CD1   . ILE C 1 96  ? 21.804  49.491 106.410 1.00 34.61 ? 94  ILE C CD1   1 
ATOM   4950 N  N     . ILE C 1 97  ? 23.501  54.225 107.441 1.00 25.12 ? 95  ILE C N     1 
ATOM   4951 C  CA    . ILE C 1 97  ? 24.175  55.355 108.051 1.00 26.66 ? 95  ILE C CA    1 
ATOM   4952 C  C     . ILE C 1 97  ? 24.147  55.133 109.562 1.00 27.49 ? 95  ILE C C     1 
ATOM   4953 O  O     . ILE C 1 97  ? 23.086  55.203 110.191 1.00 24.34 ? 95  ILE C O     1 
ATOM   4954 C  CB    . ILE C 1 97  ? 23.464  56.684 107.704 1.00 26.89 ? 95  ILE C CB    1 
ATOM   4955 C  CG1   . ILE C 1 97  ? 23.424  56.865 106.182 1.00 26.44 ? 95  ILE C CG1   1 
ATOM   4956 C  CG2   . ILE C 1 97  ? 24.200  57.849 108.344 1.00 27.54 ? 95  ILE C CG2   1 
ATOM   4957 C  CD1   . ILE C 1 97  ? 22.632  58.062 105.729 1.00 27.08 ? 95  ILE C CD1   1 
ATOM   4958 N  N     . LEU C 1 98  ? 25.311  54.837 110.134 1.00 28.83 ? 96  LEU C N     1 
ATOM   4959 C  CA    . LEU C 1 98  ? 25.409  54.598 111.569 1.00 30.86 ? 96  LEU C CA    1 
ATOM   4960 C  C     . LEU C 1 98  ? 25.693  55.916 112.275 1.00 31.24 ? 96  LEU C C     1 
ATOM   4961 O  O     . LEU C 1 98  ? 26.796  56.462 112.185 1.00 31.72 ? 96  LEU C O     1 
ATOM   4962 C  CB    . LEU C 1 98  ? 26.517  53.582 111.869 1.00 31.54 ? 96  LEU C CB    1 
ATOM   4963 C  CG    . LEU C 1 98  ? 26.374  52.195 111.230 1.00 32.29 ? 96  LEU C CG    1 
ATOM   4964 C  CD1   . LEU C 1 98  ? 27.558  51.329 111.614 1.00 34.83 ? 96  LEU C CD1   1 
ATOM   4965 C  CD2   . LEU C 1 98  ? 25.080  51.541 111.683 1.00 35.21 ? 96  LEU C CD2   1 
ATOM   4966 N  N     . ASN C 1 99  ? 24.676  56.431 112.958 1.00 32.39 ? 97  ASN C N     1 
ATOM   4967 C  CA    . ASN C 1 99  ? 24.778  57.688 113.685 1.00 32.35 ? 97  ASN C CA    1 
ATOM   4968 C  C     . ASN C 1 99  ? 24.976  57.444 115.176 1.00 33.71 ? 97  ASN C C     1 
ATOM   4969 O  O     . ASN C 1 99  ? 24.060  56.994 115.861 1.00 32.29 ? 97  ASN C O     1 
ATOM   4970 C  CB    . ASN C 1 99  ? 23.510  58.510 113.476 1.00 33.62 ? 97  ASN C CB    1 
ATOM   4971 C  CG    . ASN C 1 99  ? 23.479  59.755 114.334 1.00 33.74 ? 97  ASN C CG    1 
ATOM   4972 O  OD1   . ASN C 1 99  ? 24.303  60.653 114.174 1.00 36.56 ? 97  ASN C OD1   1 
ATOM   4973 N  ND2   . ASN C 1 99  ? 22.535  59.811 115.256 1.00 35.05 ? 97  ASN C ND2   1 
ATOM   4974 N  N     . SER C 1 100 ? 26.169  57.742 115.680 1.00 35.10 ? 98  SER C N     1 
ATOM   4975 C  CA    . SER C 1 100 ? 26.437  57.550 117.098 1.00 38.53 ? 98  SER C CA    1 
ATOM   4976 C  C     . SER C 1 100 ? 26.093  58.822 117.864 1.00 40.09 ? 98  SER C C     1 
ATOM   4977 O  O     . SER C 1 100 ? 26.080  59.912 117.296 1.00 39.93 ? 98  SER C O     1 
ATOM   4978 C  CB    . SER C 1 100 ? 27.902  57.159 117.318 1.00 38.94 ? 98  SER C CB    1 
ATOM   4979 O  OG    . SER C 1 100 ? 28.780  58.059 116.674 1.00 41.69 ? 98  SER C OG    1 
ATOM   4980 N  N     . ALA C 1 101 ? 25.783  58.677 119.147 1.00 43.93 ? 99  ALA C N     1 
ATOM   4981 C  CA    . ALA C 1 101 ? 25.432  59.823 119.971 1.00 46.29 ? 99  ALA C CA    1 
ATOM   4982 C  C     . ALA C 1 101 ? 26.526  60.886 119.962 1.00 47.99 ? 99  ALA C C     1 
ATOM   4983 O  O     . ALA C 1 101 ? 26.240  62.063 120.167 1.00 48.16 ? 99  ALA C O     1 
ATOM   4984 C  CB    . ALA C 1 101 ? 25.155  59.373 121.408 1.00 46.76 ? 99  ALA C CB    1 
ATOM   4985 N  N     . ASP C 1 102 ? 27.771  60.488 119.707 1.00 50.19 ? 100 ASP C N     1 
ATOM   4986 C  CA    . ASP C 1 102 ? 28.868  61.452 119.714 1.00 53.21 ? 100 ASP C CA    1 
ATOM   4987 C  C     . ASP C 1 102 ? 29.401  61.909 118.343 1.00 54.53 ? 100 ASP C C     1 
ATOM   4988 O  O     . ASP C 1 102 ? 28.823  62.803 117.712 1.00 55.92 ? 100 ASP C O     1 
ATOM   4989 C  CB    . ASP C 1 102 ? 30.021  60.911 120.576 1.00 55.03 ? 100 ASP C CB    1 
ATOM   4990 C  CG    . ASP C 1 102 ? 29.596  60.650 122.017 1.00 57.38 ? 100 ASP C CG    1 
ATOM   4991 O  OD1   . ASP C 1 102 ? 28.697  61.377 122.494 1.00 58.64 ? 100 ASP C OD1   1 
ATOM   4992 O  OD2   . ASP C 1 102 ? 30.145  59.731 122.676 1.00 57.30 ? 100 ASP C OD2   1 
ATOM   4993 N  N     . GLY C 1 103 ? 30.497  61.298 117.893 1.00 54.63 ? 101 GLY C N     1 
ATOM   4994 C  CA    . GLY C 1 103 ? 31.120  61.676 116.631 1.00 54.77 ? 101 GLY C CA    1 
ATOM   4995 C  C     . GLY C 1 103 ? 30.310  61.649 115.346 1.00 54.02 ? 101 GLY C C     1 
ATOM   4996 O  O     . GLY C 1 103 ? 29.078  61.613 115.355 1.00 53.43 ? 101 GLY C O     1 
ATOM   4997 N  N     . ASP C 1 104 ? 31.029  61.663 114.227 1.00 53.59 ? 102 ASP C N     1 
ATOM   4998 C  CA    . ASP C 1 104 ? 30.415  61.659 112.905 1.00 52.46 ? 102 ASP C CA    1 
ATOM   4999 C  C     . ASP C 1 104 ? 29.825  60.302 112.543 1.00 49.34 ? 102 ASP C C     1 
ATOM   5000 O  O     . ASP C 1 104 ? 30.165  59.278 113.139 1.00 50.76 ? 102 ASP C O     1 
ATOM   5001 C  CB    . ASP C 1 104 ? 31.447  62.051 111.846 1.00 54.84 ? 102 ASP C CB    1 
ATOM   5002 C  CG    . ASP C 1 104 ? 30.814  62.673 110.615 1.00 57.11 ? 102 ASP C CG    1 
ATOM   5003 O  OD1   . ASP C 1 104 ? 29.753  62.185 110.163 1.00 57.43 ? 102 ASP C OD1   1 
ATOM   5004 O  OD2   . ASP C 1 104 ? 31.387  63.653 110.094 1.00 60.03 ? 102 ASP C OD2   1 
ATOM   5005 N  N     . ASN C 1 105 ? 28.942  60.314 111.551 1.00 44.43 ? 103 ASN C N     1 
ATOM   5006 C  CA    . ASN C 1 105 ? 28.285  59.110 111.064 1.00 39.73 ? 103 ASN C CA    1 
ATOM   5007 C  C     . ASN C 1 105 ? 29.266  58.217 110.309 1.00 36.85 ? 103 ASN C C     1 
ATOM   5008 O  O     . ASN C 1 105 ? 30.264  58.695 109.763 1.00 36.11 ? 103 ASN C O     1 
ATOM   5009 C  CB    . ASN C 1 105 ? 27.144  59.483 110.110 1.00 38.85 ? 103 ASN C CB    1 
ATOM   5010 C  CG    . ASN C 1 105 ? 26.140  60.429 110.733 1.00 38.50 ? 103 ASN C CG    1 
ATOM   5011 O  OD1   . ASN C 1 105 ? 25.495  60.103 111.729 1.00 37.49 ? 103 ASN C OD1   1 
ATOM   5012 N  ND2   . ASN C 1 105 ? 25.999  61.610 110.143 1.00 39.72 ? 103 ASN C ND2   1 
ATOM   5013 N  N     . ALA C 1 106 ? 28.981  56.920 110.295 1.00 33.95 ? 104 ALA C N     1 
ATOM   5014 C  CA    . ALA C 1 106 ? 29.794  55.952 109.562 1.00 33.29 ? 104 ALA C CA    1 
ATOM   5015 C  C     . ALA C 1 106 ? 28.822  55.436 108.509 1.00 31.35 ? 104 ALA C C     1 
ATOM   5016 O  O     . ALA C 1 106 ? 27.651  55.227 108.812 1.00 31.14 ? 104 ALA C O     1 
ATOM   5017 C  CB    . ALA C 1 106 ? 30.246  54.816 110.479 1.00 32.90 ? 104 ALA C CB    1 
ATOM   5018 N  N     . ILE C 1 107 ? 29.287  55.241 107.279 1.00 29.69 ? 105 ILE C N     1 
ATOM   5019 C  CA    . ILE C 1 107 ? 28.390  54.782 106.221 1.00 28.02 ? 105 ILE C CA    1 
ATOM   5020 C  C     . ILE C 1 107 ? 28.883  53.553 105.481 1.00 27.66 ? 105 ILE C C     1 
ATOM   5021 O  O     . ILE C 1 107 ? 30.072  53.434 105.186 1.00 30.09 ? 105 ILE C O     1 
ATOM   5022 C  CB    . ILE C 1 107 ? 28.168  55.886 105.163 1.00 28.89 ? 105 ILE C CB    1 
ATOM   5023 C  CG1   . ILE C 1 107 ? 27.645  57.160 105.834 1.00 28.90 ? 105 ILE C CG1   1 
ATOM   5024 C  CG2   . ILE C 1 107 ? 27.199  55.394 104.086 1.00 30.30 ? 105 ILE C CG2   1 
ATOM   5025 C  CD1   . ILE C 1 107 ? 27.530  58.335 104.881 1.00 33.36 ? 105 ILE C CD1   1 
ATOM   5026 N  N     . ILE C 1 108 ? 27.952  52.646 105.186 1.00 26.91 ? 106 ILE C N     1 
ATOM   5027 C  CA    . ILE C 1 108 ? 28.241  51.430 104.431 1.00 26.18 ? 106 ILE C CA    1 
ATOM   5028 C  C     . ILE C 1 108 ? 27.241  51.452 103.279 1.00 25.32 ? 106 ILE C C     1 
ATOM   5029 O  O     . ILE C 1 108 ? 26.032  51.514 103.505 1.00 24.80 ? 106 ILE C O     1 
ATOM   5030 C  CB    . ILE C 1 108 ? 28.015  50.141 105.259 1.00 27.79 ? 106 ILE C CB    1 
ATOM   5031 C  CG1   . ILE C 1 108 ? 28.895  50.151 106.512 1.00 28.63 ? 106 ILE C CG1   1 
ATOM   5032 C  CG2   . ILE C 1 108 ? 28.380  48.928 104.422 1.00 26.53 ? 106 ILE C CG2   1 
ATOM   5033 C  CD1   . ILE C 1 108 ? 28.701  48.929 107.404 1.00 31.07 ? 106 ILE C CD1   1 
ATOM   5034 N  N     . THR C 1 109 ? 27.748  51.413 102.051 1.00 25.50 ? 107 THR C N     1 
ATOM   5035 C  CA    . THR C 1 109 ? 26.902  51.472 100.860 1.00 26.34 ? 107 THR C CA    1 
ATOM   5036 C  C     . THR C 1 109 ? 27.122  50.286 99.921  1.00 25.92 ? 107 THR C C     1 
ATOM   5037 O  O     . THR C 1 109 ? 28.264  49.889 99.681  1.00 26.56 ? 107 THR C O     1 
ATOM   5038 C  CB    . THR C 1 109 ? 27.194  52.774 100.072 1.00 28.63 ? 107 THR C CB    1 
ATOM   5039 O  OG1   . THR C 1 109 ? 27.017  53.900 100.940 1.00 28.43 ? 107 THR C OG1   1 
ATOM   5040 C  CG2   . THR C 1 109 ? 26.262  52.906 98.867  1.00 27.55 ? 107 THR C CG2   1 
ATOM   5041 N  N     . THR C 1 110 ? 26.031  49.722 99.401  1.00 25.52 ? 108 THR C N     1 
ATOM   5042 C  CA    . THR C 1 110 ? 26.120  48.605 98.458  1.00 26.27 ? 108 THR C CA    1 
ATOM   5043 C  C     . THR C 1 110 ? 26.354  49.183 97.067  1.00 28.33 ? 108 THR C C     1 
ATOM   5044 O  O     . THR C 1 110 ? 26.103  50.368 96.832  1.00 27.33 ? 108 THR C O     1 
ATOM   5045 C  CB    . THR C 1 110 ? 24.817  47.768 98.409  1.00 25.85 ? 108 THR C CB    1 
ATOM   5046 O  OG1   . THR C 1 110 ? 23.734  48.583 97.943  1.00 28.17 ? 108 THR C OG1   1 
ATOM   5047 C  CG2   . THR C 1 110 ? 24.479  47.226 99.785  1.00 26.11 ? 108 THR C CG2   1 
ATOM   5048 N  N     . THR C 1 111 ? 26.805  48.340 96.140  1.00 28.34 ? 109 THR C N     1 
ATOM   5049 C  CA    . THR C 1 111 ? 27.094  48.777 94.778  1.00 28.99 ? 109 THR C CA    1 
ATOM   5050 C  C     . THR C 1 111 ? 26.621  47.796 93.700  1.00 29.46 ? 109 THR C C     1 
ATOM   5051 O  O     . THR C 1 111 ? 26.921  47.979 92.524  1.00 28.23 ? 109 THR C O     1 
ATOM   5052 C  CB    . THR C 1 111 ? 28.601  48.966 94.598  1.00 31.79 ? 109 THR C CB    1 
ATOM   5053 O  OG1   . THR C 1 111 ? 29.257  47.707 94.815  1.00 32.47 ? 109 THR C OG1   1 
ATOM   5054 C  CG2   . THR C 1 111 ? 29.138  49.979 95.601  1.00 33.06 ? 109 THR C CG2   1 
ATOM   5055 N  N     . ALA C 1 112 ? 25.883  46.763 94.095  1.00 29.85 ? 110 ALA C N     1 
ATOM   5056 C  CA    . ALA C 1 112 ? 25.410  45.757 93.141  1.00 30.23 ? 110 ALA C CA    1 
ATOM   5057 C  C     . ALA C 1 112 ? 24.654  46.328 91.937  1.00 29.20 ? 110 ALA C C     1 
ATOM   5058 O  O     . ALA C 1 112 ? 24.806  45.835 90.818  1.00 29.96 ? 110 ALA C O     1 
ATOM   5059 C  CB    . ALA C 1 112 ? 24.548  44.717 93.861  1.00 28.91 ? 110 ALA C CB    1 
ATOM   5060 N  N     . ALA C 1 113 ? 23.839  47.356 92.155  1.00 29.18 ? 111 ALA C N     1 
ATOM   5061 C  CA    . ALA C 1 113 ? 23.089  47.961 91.055  1.00 28.83 ? 111 ALA C CA    1 
ATOM   5062 C  C     . ALA C 1 113 ? 24.021  48.768 90.159  1.00 29.35 ? 111 ALA C C     1 
ATOM   5063 O  O     . ALA C 1 113 ? 24.020  48.606 88.940  1.00 29.32 ? 111 ALA C O     1 
ATOM   5064 C  CB    . ALA C 1 113 ? 21.978  48.854 91.600  1.00 31.46 ? 111 ALA C CB    1 
ATOM   5065 N  N     . ALA C 1 114 ? 24.823  49.639 90.766  1.00 28.99 ? 112 ALA C N     1 
ATOM   5066 C  CA    . ALA C 1 114 ? 25.763  50.453 90.005  1.00 30.48 ? 112 ALA C CA    1 
ATOM   5067 C  C     . ALA C 1 114 ? 26.722  49.565 89.213  1.00 31.88 ? 112 ALA C C     1 
ATOM   5068 O  O     . ALA C 1 114 ? 27.026  49.847 88.054  1.00 31.17 ? 112 ALA C O     1 
ATOM   5069 C  CB    . ALA C 1 114 ? 26.558  51.356 90.941  1.00 28.27 ? 112 ALA C CB    1 
ATOM   5070 N  N     . ASP C 1 115 ? 27.196  48.498 89.850  1.00 33.33 ? 113 ASP C N     1 
ATOM   5071 C  CA    . ASP C 1 115 ? 28.132  47.574 89.212  1.00 35.53 ? 113 ASP C CA    1 
ATOM   5072 C  C     . ASP C 1 115 ? 27.577  46.898 87.962  1.00 35.70 ? 113 ASP C C     1 
ATOM   5073 O  O     . ASP C 1 115 ? 28.335  46.517 87.069  1.00 36.68 ? 113 ASP C O     1 
ATOM   5074 C  CB    . ASP C 1 115 ? 28.583  46.489 90.199  1.00 36.18 ? 113 ASP C CB    1 
ATOM   5075 C  CG    . ASP C 1 115 ? 29.411  47.042 91.343  1.00 38.12 ? 113 ASP C CG    1 
ATOM   5076 O  OD1   . ASP C 1 115 ? 30.097  48.064 91.140  1.00 36.82 ? 113 ASP C OD1   1 
ATOM   5077 O  OD2   . ASP C 1 115 ? 29.387  46.442 92.442  1.00 38.68 ? 113 ASP C OD2   1 
ATOM   5078 N  N     . THR C 1 116 ? 26.261  46.741 87.905  1.00 36.50 ? 114 THR C N     1 
ATOM   5079 C  CA    . THR C 1 116 ? 25.614  46.098 86.764  1.00 37.83 ? 114 THR C CA    1 
ATOM   5080 C  C     . THR C 1 116 ? 25.529  47.030 85.560  1.00 36.94 ? 114 THR C C     1 
ATOM   5081 O  O     . THR C 1 116 ? 25.482  46.582 84.412  1.00 36.55 ? 114 THR C O     1 
ATOM   5082 C  CB    . THR C 1 116 ? 24.191  45.655 87.129  1.00 38.25 ? 114 THR C CB    1 
ATOM   5083 O  OG1   . THR C 1 116 ? 24.249  44.764 88.248  1.00 41.62 ? 114 THR C OG1   1 
ATOM   5084 C  CG2   . THR C 1 116 ? 23.534  44.946 85.957  1.00 41.57 ? 114 THR C CG2   1 
ATOM   5085 N  N     . PHE C 1 117 ? 25.500  48.329 85.837  1.00 35.75 ? 115 PHE C N     1 
ATOM   5086 C  CA    . PHE C 1 117 ? 25.404  49.352 84.804  1.00 32.85 ? 115 PHE C CA    1 
ATOM   5087 C  C     . PHE C 1 117 ? 26.800  49.553 84.210  1.00 33.98 ? 115 PHE C C     1 
ATOM   5088 O  O     . PHE C 1 117 ? 27.573  50.404 84.663  1.00 31.30 ? 115 PHE C O     1 
ATOM   5089 C  CB    . PHE C 1 117 ? 24.878  50.640 85.446  1.00 32.16 ? 115 PHE C CB    1 
ATOM   5090 C  CG    . PHE C 1 117 ? 24.320  51.640 84.471  1.00 30.88 ? 115 PHE C CG    1 
ATOM   5091 C  CD1   . PHE C 1 117 ? 24.289  51.377 83.106  1.00 29.08 ? 115 PHE C CD1   1 
ATOM   5092 C  CD2   . PHE C 1 117 ? 23.817  52.857 84.933  1.00 30.53 ? 115 PHE C CD2   1 
ATOM   5093 C  CE1   . PHE C 1 117 ? 23.764  52.313 82.215  1.00 28.45 ? 115 PHE C CE1   1 
ATOM   5094 C  CE2   . PHE C 1 117 ? 23.292  53.796 84.055  1.00 28.22 ? 115 PHE C CE2   1 
ATOM   5095 C  CZ    . PHE C 1 117 ? 23.265  53.524 82.693  1.00 28.76 ? 115 PHE C CZ    1 
ATOM   5096 N  N     . SER C 1 118 ? 27.112  48.754 83.192  1.00 33.30 ? 116 SER C N     1 
ATOM   5097 C  CA    . SER C 1 118 ? 28.416  48.792 82.545  1.00 34.75 ? 116 SER C CA    1 
ATOM   5098 C  C     . SER C 1 118 ? 28.736  50.095 81.840  1.00 35.20 ? 116 SER C C     1 
ATOM   5099 O  O     . SER C 1 118 ? 27.853  50.860 81.455  1.00 34.88 ? 116 SER C O     1 
ATOM   5100 C  CB    . SER C 1 118 ? 28.551  47.647 81.534  1.00 36.23 ? 116 SER C CB    1 
ATOM   5101 O  OG    . SER C 1 118 ? 28.055  48.038 80.264  1.00 38.05 ? 116 SER C OG    1 
ATOM   5102 N  N     . LEU C 1 119 ? 30.029  50.320 81.665  1.00 35.92 ? 117 LEU C N     1 
ATOM   5103 C  CA    . LEU C 1 119 ? 30.542  51.504 81.008  1.00 37.45 ? 117 LEU C CA    1 
ATOM   5104 C  C     . LEU C 1 119 ? 29.975  51.662 79.595  1.00 38.14 ? 117 LEU C C     1 
ATOM   5105 O  O     . LEU C 1 119 ? 29.635  52.768 79.175  1.00 37.90 ? 117 LEU C O     1 
ATOM   5106 C  CB    . LEU C 1 119 ? 32.064  51.417 80.958  1.00 39.92 ? 117 LEU C CB    1 
ATOM   5107 C  CG    . LEU C 1 119 ? 32.807  52.690 80.595  1.00 42.07 ? 117 LEU C CG    1 
ATOM   5108 C  CD1   . LEU C 1 119 ? 32.451  53.790 81.582  1.00 42.39 ? 117 LEU C CD1   1 
ATOM   5109 C  CD2   . LEU C 1 119 ? 34.298  52.408 80.618  1.00 44.66 ? 117 LEU C CD2   1 
ATOM   5110 N  N     . ASP C 1 120 ? 29.870  50.559 78.861  1.00 38.43 ? 118 ASP C N     1 
ATOM   5111 C  CA    . ASP C 1 120 ? 29.333  50.615 77.503  1.00 39.40 ? 118 ASP C CA    1 
ATOM   5112 C  C     . ASP C 1 120 ? 27.880  51.081 77.486  1.00 38.12 ? 118 ASP C C     1 
ATOM   5113 O  O     . ASP C 1 120 ? 27.431  51.696 76.520  1.00 38.68 ? 118 ASP C O     1 
ATOM   5114 C  CB    . ASP C 1 120 ? 29.428  49.243 76.828  1.00 42.88 ? 118 ASP C CB    1 
ATOM   5115 C  CG    . ASP C 1 120 ? 30.863  48.822 76.551  1.00 47.00 ? 118 ASP C CG    1 
ATOM   5116 O  OD1   . ASP C 1 120 ? 31.060  47.728 75.977  1.00 49.84 ? 118 ASP C OD1   1 
ATOM   5117 O  OD2   . ASP C 1 120 ? 31.793  49.580 76.904  1.00 48.83 ? 118 ASP C OD2   1 
ATOM   5118 N  N     . GLU C 1 121 ? 27.148  50.789 78.555  1.00 35.64 ? 119 GLU C N     1 
ATOM   5119 C  CA    . GLU C 1 121 ? 25.744  51.172 78.644  1.00 34.10 ? 119 GLU C CA    1 
ATOM   5120 C  C     . GLU C 1 121 ? 25.554  52.617 79.107  1.00 32.01 ? 119 GLU C C     1 
ATOM   5121 O  O     . GLU C 1 121 ? 24.566  53.261 78.753  1.00 27.77 ? 119 GLU C O     1 
ATOM   5122 C  CB    . GLU C 1 121 ? 25.013  50.217 79.596  1.00 36.61 ? 119 GLU C CB    1 
ATOM   5123 C  CG    . GLU C 1 121 ? 25.150  48.753 79.198  1.00 40.15 ? 119 GLU C CG    1 
ATOM   5124 C  CD    . GLU C 1 121 ? 24.474  47.796 80.171  1.00 43.45 ? 119 GLU C CD    1 
ATOM   5125 O  OE1   . GLU C 1 121 ? 24.818  47.806 81.374  1.00 42.17 ? 119 GLU C OE1   1 
ATOM   5126 O  OE2   . GLU C 1 121 ? 23.599  47.023 79.728  1.00 45.88 ? 119 GLU C OE2   1 
HETATM 5127 N  N     . MSE C 1 122 ? 26.508  53.120 79.889  1.00 30.47 ? 120 MSE C N     1 
HETATM 5128 C  CA    . MSE C 1 122 ? 26.448  54.480 80.420  1.00 31.34 ? 120 MSE C CA    1 
HETATM 5129 C  C     . MSE C 1 122 ? 26.804  55.575 79.416  1.00 30.83 ? 120 MSE C C     1 
HETATM 5130 O  O     . MSE C 1 122 ? 26.101  56.576 79.304  1.00 31.23 ? 120 MSE C O     1 
HETATM 5131 C  CB    . MSE C 1 122 ? 27.379  54.617 81.636  1.00 33.51 ? 120 MSE C CB    1 
HETATM 5132 C  CG    . MSE C 1 122 ? 27.104  53.644 82.773  1.00 37.68 ? 120 MSE C CG    1 
HETATM 5133 SE SE    . MSE C 1 122 ? 28.197  54.031 84.348  1.00 46.41 ? 120 MSE C SE    1 
HETATM 5134 C  CE    . MSE C 1 122 ? 26.857  53.867 85.732  1.00 43.79 ? 120 MSE C CE    1 
ATOM   5135 N  N     . ILE C 1 123 ? 27.900  55.382 78.692  1.00 31.49 ? 121 ILE C N     1 
ATOM   5136 C  CA    . ILE C 1 123 ? 28.370  56.373 77.726  1.00 32.15 ? 121 ILE C CA    1 
ATOM   5137 C  C     . ILE C 1 123 ? 27.341  56.850 76.697  1.00 32.12 ? 121 ILE C C     1 
ATOM   5138 O  O     . ILE C 1 123 ? 27.320  58.029 76.334  1.00 30.39 ? 121 ILE C O     1 
ATOM   5139 C  CB    . ILE C 1 123 ? 29.648  55.858 77.019  1.00 32.96 ? 121 ILE C CB    1 
ATOM   5140 C  CG1   . ILE C 1 123 ? 30.775  55.753 78.051  1.00 33.57 ? 121 ILE C CG1   1 
ATOM   5141 C  CG2   . ILE C 1 123 ? 30.052  56.797 75.886  1.00 32.49 ? 121 ILE C CG2   1 
ATOM   5142 C  CD1   . ILE C 1 123 ? 32.009  55.063 77.558  1.00 33.04 ? 121 ILE C CD1   1 
ATOM   5143 N  N     . PRO C 1 124 ? 26.470  55.952 76.212  1.00 31.86 ? 122 PRO C N     1 
ATOM   5144 C  CA    . PRO C 1 124 ? 25.485  56.415 75.229  1.00 32.02 ? 122 PRO C CA    1 
ATOM   5145 C  C     . PRO C 1 124 ? 24.602  57.536 75.772  1.00 31.54 ? 122 PRO C C     1 
ATOM   5146 O  O     . PRO C 1 124 ? 24.041  58.317 75.006  1.00 28.55 ? 122 PRO C O     1 
ATOM   5147 C  CB    . PRO C 1 124 ? 24.694  55.150 74.913  1.00 33.54 ? 122 PRO C CB    1 
ATOM   5148 C  CG    . PRO C 1 124 ? 25.739  54.085 75.033  1.00 33.75 ? 122 PRO C CG    1 
ATOM   5149 C  CD    . PRO C 1 124 ? 26.461  54.481 76.307  1.00 32.64 ? 122 PRO C CD    1 
ATOM   5150 N  N     . HIS C 1 125 ? 24.487  57.617 77.097  1.00 30.52 ? 123 HIS C N     1 
ATOM   5151 C  CA    . HIS C 1 125 ? 23.672  58.655 77.722  1.00 29.98 ? 123 HIS C CA    1 
ATOM   5152 C  C     . HIS C 1 125 ? 24.344  60.031 77.744  1.00 30.63 ? 123 HIS C C     1 
ATOM   5153 O  O     . HIS C 1 125 ? 23.754  61.013 78.202  1.00 30.90 ? 123 HIS C O     1 
ATOM   5154 C  CB    . HIS C 1 125 ? 23.292  58.232 79.139  1.00 29.39 ? 123 HIS C CB    1 
ATOM   5155 C  CG    . HIS C 1 125 ? 22.442  57.005 79.182  1.00 29.62 ? 123 HIS C CG    1 
ATOM   5156 N  ND1   . HIS C 1 125 ? 21.173  56.962 78.643  1.00 30.02 ? 123 HIS C ND1   1 
ATOM   5157 C  CD2   . HIS C 1 125 ? 22.700  55.757 79.641  1.00 31.31 ? 123 HIS C CD2   1 
ATOM   5158 C  CE1   . HIS C 1 125 ? 20.688  55.740 78.766  1.00 31.96 ? 123 HIS C CE1   1 
ATOM   5159 N  NE2   . HIS C 1 125 ? 21.594  54.989 79.368  1.00 31.81 ? 123 HIS C NE2   1 
HETATM 5160 N  N     . MSE C 1 126 ? 25.582  60.094 77.264  1.00 31.98 ? 124 MSE C N     1 
HETATM 5161 C  CA    . MSE C 1 126 ? 26.316  61.352 77.196  1.00 34.80 ? 124 MSE C CA    1 
HETATM 5162 C  C     . MSE C 1 126 ? 26.512  61.711 75.728  1.00 35.86 ? 124 MSE C C     1 
HETATM 5163 O  O     . MSE C 1 126 ? 27.150  62.711 75.407  1.00 34.09 ? 124 MSE C O     1 
HETATM 5164 C  CB    . MSE C 1 126 ? 27.690  61.230 77.866  1.00 37.96 ? 124 MSE C CB    1 
HETATM 5165 C  CG    . MSE C 1 126 ? 27.672  61.159 79.383  1.00 41.08 ? 124 MSE C CG    1 
HETATM 5166 SE SE    . MSE C 1 126 ? 29.490  61.140 80.107  1.00 49.43 ? 124 MSE C SE    1 
HETATM 5167 C  CE    . MSE C 1 126 ? 29.735  59.235 80.190  1.00 43.34 ? 124 MSE C CE    1 
ATOM   5168 N  N     . ALA C 1 127 ? 25.946  60.888 74.848  1.00 36.70 ? 125 ALA C N     1 
ATOM   5169 C  CA    . ALA C 1 127 ? 26.061  61.076 73.403  1.00 38.00 ? 125 ALA C CA    1 
ATOM   5170 C  C     . ALA C 1 127 ? 25.771  62.496 72.943  1.00 37.74 ? 125 ALA C C     1 
ATOM   5171 O  O     . ALA C 1 127 ? 26.392  62.988 71.999  1.00 38.78 ? 125 ALA C O     1 
ATOM   5172 C  CB    . ALA C 1 127 ? 25.135  60.090 72.673  1.00 38.46 ? 125 ALA C CB    1 
ATOM   5173 N  N     . ASP C 1 128 ? 24.839  63.159 73.616  1.00 37.14 ? 126 ASP C N     1 
ATOM   5174 C  CA    . ASP C 1 128 ? 24.466  64.512 73.241  1.00 37.03 ? 126 ASP C CA    1 
ATOM   5175 C  C     . ASP C 1 128 ? 25.235  65.614 73.962  1.00 36.50 ? 126 ASP C C     1 
ATOM   5176 O  O     . ASP C 1 128 ? 24.838  66.780 73.926  1.00 35.67 ? 126 ASP C O     1 
ATOM   5177 C  CB    . ASP C 1 128 ? 22.970  64.700 73.459  1.00 39.74 ? 126 ASP C CB    1 
ATOM   5178 C  CG    . ASP C 1 128 ? 22.576  64.573 74.913  1.00 43.81 ? 126 ASP C CG    1 
ATOM   5179 O  OD1   . ASP C 1 128 ? 23.138  63.707 75.622  1.00 44.00 ? 126 ASP C OD1   1 
ATOM   5180 O  OD2   . ASP C 1 128 ? 21.690  65.338 75.341  1.00 45.33 ? 126 ASP C OD2   1 
ATOM   5181 N  N     . ALA C 1 129 ? 26.333  65.255 74.620  1.00 34.99 ? 127 ALA C N     1 
ATOM   5182 C  CA    . ALA C 1 129 ? 27.136  66.253 75.323  1.00 33.64 ? 127 ALA C CA    1 
ATOM   5183 C  C     . ALA C 1 129 ? 27.956  67.043 74.313  1.00 32.86 ? 127 ALA C C     1 
ATOM   5184 O  O     . ALA C 1 129 ? 28.231  66.562 73.220  1.00 32.83 ? 127 ALA C O     1 
ATOM   5185 C  CB    . ALA C 1 129 ? 28.065  65.576 76.328  1.00 33.71 ? 127 ALA C CB    1 
ATOM   5186 N  N     . VAL C 1 130 ? 28.348  68.257 74.683  1.00 32.92 ? 128 VAL C N     1 
ATOM   5187 C  CA    . VAL C 1 130 ? 29.146  69.100 73.801  1.00 31.94 ? 128 VAL C CA    1 
ATOM   5188 C  C     . VAL C 1 130 ? 30.309  69.723 74.568  1.00 31.28 ? 128 VAL C C     1 
ATOM   5189 O  O     . VAL C 1 130 ? 30.288  69.779 75.802  1.00 30.17 ? 128 VAL C O     1 
ATOM   5190 C  CB    . VAL C 1 130 ? 28.284  70.229 73.182  1.00 32.45 ? 128 VAL C CB    1 
ATOM   5191 C  CG1   . VAL C 1 130 ? 27.210  69.626 72.287  1.00 34.07 ? 128 VAL C CG1   1 
ATOM   5192 C  CG2   . VAL C 1 130 ? 27.641  71.058 74.279  1.00 33.70 ? 128 VAL C CG2   1 
ATOM   5193 N  N     . ALA C 1 131 ? 31.325  70.181 73.840  1.00 28.72 ? 129 ALA C N     1 
ATOM   5194 C  CA    . ALA C 1 131 ? 32.478  70.808 74.473  1.00 28.09 ? 129 ALA C CA    1 
ATOM   5195 C  C     . ALA C 1 131 ? 31.975  71.852 75.465  1.00 27.78 ? 129 ALA C C     1 
ATOM   5196 O  O     . ALA C 1 131 ? 31.073  72.627 75.155  1.00 27.24 ? 129 ALA C O     1 
ATOM   5197 C  CB    . ALA C 1 131 ? 33.364  71.466 73.420  1.00 30.82 ? 129 ALA C CB    1 
ATOM   5198 N  N     . GLY C 1 132 ? 32.547  71.861 76.662  1.00 26.76 ? 130 GLY C N     1 
ATOM   5199 C  CA    . GLY C 1 132 ? 32.117  72.818 77.668  1.00 26.79 ? 130 GLY C CA    1 
ATOM   5200 C  C     . GLY C 1 132 ? 31.225  72.179 78.721  1.00 26.96 ? 130 GLY C C     1 
ATOM   5201 O  O     . GLY C 1 132 ? 31.180  72.647 79.857  1.00 26.84 ? 130 GLY C O     1 
ATOM   5202 N  N     . ASP C 1 133 ? 30.503  71.121 78.354  1.00 24.39 ? 131 ASP C N     1 
ATOM   5203 C  CA    . ASP C 1 133 ? 29.646  70.453 79.326  1.00 23.82 ? 131 ASP C CA    1 
ATOM   5204 C  C     . ASP C 1 133 ? 30.523  69.852 80.421  1.00 21.73 ? 131 ASP C C     1 
ATOM   5205 O  O     . ASP C 1 133 ? 31.731  69.677 80.253  1.00 21.24 ? 131 ASP C O     1 
ATOM   5206 C  CB    . ASP C 1 133 ? 28.773  69.372 78.674  1.00 24.64 ? 131 ASP C CB    1 
ATOM   5207 C  CG    . ASP C 1 133 ? 27.622  69.957 77.849  1.00 27.48 ? 131 ASP C CG    1 
ATOM   5208 O  OD1   . ASP C 1 133 ? 27.251  71.136 78.059  1.00 29.67 ? 131 ASP C OD1   1 
ATOM   5209 O  OD2   . ASP C 1 133 ? 27.073  69.228 76.997  1.00 28.22 ? 131 ASP C OD2   1 
ATOM   5210 N  N     . ILE C 1 134 ? 29.905  69.542 81.548  1.00 21.93 ? 132 ILE C N     1 
ATOM   5211 C  CA    . ILE C 1 134 ? 30.623  69.019 82.695  1.00 20.69 ? 132 ILE C CA    1 
ATOM   5212 C  C     . ILE C 1 134 ? 30.294  67.568 83.027  1.00 20.19 ? 132 ILE C C     1 
ATOM   5213 O  O     . ILE C 1 134 ? 29.147  67.152 82.913  1.00 20.94 ? 132 ILE C O     1 
ATOM   5214 C  CB    . ILE C 1 134 ? 30.279  69.872 83.943  1.00 23.33 ? 132 ILE C CB    1 
ATOM   5215 C  CG1   . ILE C 1 134 ? 30.752  71.312 83.741  1.00 26.39 ? 132 ILE C CG1   1 
ATOM   5216 C  CG2   . ILE C 1 134 ? 30.872  69.253 85.198  1.00 21.40 ? 132 ILE C CG2   1 
ATOM   5217 C  CD1   . ILE C 1 134 ? 30.278  72.249 84.830  1.00 31.88 ? 132 ILE C CD1   1 
ATOM   5218 N  N     . LEU C 1 135 ? 31.309  66.805 83.429  1.00 19.58 ? 133 LEU C N     1 
ATOM   5219 C  CA    . LEU C 1 135 ? 31.096  65.430 83.880  1.00 18.53 ? 133 LEU C CA    1 
ATOM   5220 C  C     . LEU C 1 135 ? 31.474  65.458 85.353  1.00 18.43 ? 133 LEU C C     1 
ATOM   5221 O  O     . LEU C 1 135 ? 32.622  65.744 85.697  1.00 19.00 ? 133 LEU C O     1 
ATOM   5222 C  CB    . LEU C 1 135 ? 31.995  64.411 83.170  1.00 19.51 ? 133 LEU C CB    1 
ATOM   5223 C  CG    . LEU C 1 135 ? 31.890  63.017 83.821  1.00 21.36 ? 133 LEU C CG    1 
ATOM   5224 C  CD1   . LEU C 1 135 ? 30.453  62.498 83.720  1.00 23.14 ? 133 LEU C CD1   1 
ATOM   5225 C  CD2   . LEU C 1 135 ? 32.856  62.041 83.162  1.00 23.30 ? 133 LEU C CD2   1 
ATOM   5226 N  N     . LEU C 1 136 ? 30.507  65.168 86.213  1.00 18.45 ? 134 LEU C N     1 
ATOM   5227 C  CA    . LEU C 1 136 ? 30.736  65.163 87.652  1.00 18.21 ? 134 LEU C CA    1 
ATOM   5228 C  C     . LEU C 1 136 ? 30.655  63.737 88.165  1.00 18.79 ? 134 LEU C C     1 
ATOM   5229 O  O     . LEU C 1 136 ? 29.681  63.044 87.911  1.00 19.61 ? 134 LEU C O     1 
ATOM   5230 C  CB    . LEU C 1 136 ? 29.677  66.013 88.350  1.00 16.28 ? 134 LEU C CB    1 
ATOM   5231 C  CG    . LEU C 1 136 ? 29.498  65.796 89.859  1.00 18.23 ? 134 LEU C CG    1 
ATOM   5232 C  CD1   . LEU C 1 136 ? 30.817  66.126 90.577  1.00 19.01 ? 134 LEU C CD1   1 
ATOM   5233 C  CD2   . LEU C 1 136 ? 28.358  66.676 90.375  1.00 14.72 ? 134 LEU C CD2   1 
ATOM   5234 N  N     . GLN C 1 137 ? 31.686  63.302 88.883  1.00 18.60 ? 135 GLN C N     1 
ATOM   5235 C  CA    . GLN C 1 137 ? 31.706  61.963 89.441  1.00 19.37 ? 135 GLN C CA    1 
ATOM   5236 C  C     . GLN C 1 137 ? 32.069  61.985 90.914  1.00 19.18 ? 135 GLN C C     1 
ATOM   5237 O  O     . GLN C 1 137 ? 32.687  62.939 91.394  1.00 17.52 ? 135 GLN C O     1 
ATOM   5238 C  CB    . GLN C 1 137 ? 32.741  61.093 88.735  1.00 20.91 ? 135 GLN C CB    1 
ATOM   5239 C  CG    . GLN C 1 137 ? 32.485  60.805 87.277  1.00 22.74 ? 135 GLN C CG    1 
ATOM   5240 C  CD    . GLN C 1 137 ? 33.315  59.618 86.815  1.00 23.63 ? 135 GLN C CD    1 
ATOM   5241 O  OE1   . GLN C 1 137 ? 34.379  59.771 86.219  1.00 23.62 ? 135 GLN C OE1   1 
ATOM   5242 N  NE2   . GLN C 1 137 ? 32.839  58.427 87.125  1.00 22.15 ? 135 GLN C NE2   1 
ATOM   5243 N  N     . GLN C 1 138 ? 31.689  60.928 91.627  1.00 18.09 ? 136 GLN C N     1 
ATOM   5244 C  CA    . GLN C 1 138 ? 32.052  60.809 93.033  1.00 20.54 ? 136 GLN C CA    1 
ATOM   5245 C  C     . GLN C 1 138 ? 32.920  59.556 93.141  1.00 21.48 ? 136 GLN C C     1 
ATOM   5246 O  O     . GLN C 1 138 ? 33.573  59.185 92.167  1.00 22.31 ? 136 GLN C O     1 
ATOM   5247 C  CB    . GLN C 1 138 ? 30.811  60.713 93.928  1.00 18.10 ? 136 GLN C CB    1 
ATOM   5248 C  CG    . GLN C 1 138 ? 29.838  61.884 93.770  1.00 20.31 ? 136 GLN C CG    1 
ATOM   5249 C  CD    . GLN C 1 138 ? 28.948  61.733 92.551  1.00 20.65 ? 136 GLN C CD    1 
ATOM   5250 O  OE1   . GLN C 1 138 ? 28.515  60.633 92.237  1.00 23.78 ? 136 GLN C OE1   1 
ATOM   5251 N  NE2   . GLN C 1 138 ? 28.660  62.838 91.870  1.00 19.94 ? 136 GLN C NE2   1 
ATOM   5252 N  N     . GLY C 1 139 ? 32.935  58.901 94.299  1.00 21.69 ? 137 GLY C N     1 
ATOM   5253 C  CA    . GLY C 1 139 ? 33.768  57.718 94.454  1.00 24.64 ? 137 GLY C CA    1 
ATOM   5254 C  C     . GLY C 1 139 ? 33.042  56.383 94.422  1.00 26.78 ? 137 GLY C C     1 
ATOM   5255 O  O     . GLY C 1 139 ? 33.538  55.401 94.968  1.00 26.87 ? 137 GLY C O     1 
ATOM   5256 N  N     . ASN C 1 140 ? 31.883  56.351 93.767  1.00 27.79 ? 138 ASN C N     1 
ATOM   5257 C  CA    . ASN C 1 140 ? 31.044  55.159 93.655  1.00 28.83 ? 138 ASN C CA    1 
ATOM   5258 C  C     . ASN C 1 140 ? 31.663  54.024 92.825  1.00 30.02 ? 138 ASN C C     1 
ATOM   5259 O  O     . ASN C 1 140 ? 31.466  52.847 93.134  1.00 29.90 ? 138 ASN C O     1 
ATOM   5260 C  CB    . ASN C 1 140 ? 29.693  55.530 93.019  1.00 30.51 ? 138 ASN C CB    1 
ATOM   5261 C  CG    . ASN C 1 140 ? 29.020  56.721 93.698  1.00 34.01 ? 138 ASN C CG    1 
ATOM   5262 O  OD1   . ASN C 1 140 ? 28.635  57.699 93.033  1.00 31.58 ? 138 ASN C OD1   1 
ATOM   5263 N  ND2   . ASN C 1 140 ? 28.870  56.647 95.021  1.00 28.87 ? 138 ASN C ND2   1 
ATOM   5264 N  N     . PHE C 1 141 ? 32.406  54.377 91.779  1.00 27.43 ? 139 PHE C N     1 
ATOM   5265 C  CA    . PHE C 1 141 ? 32.994  53.369 90.899  1.00 27.92 ? 139 PHE C CA    1 
ATOM   5266 C  C     . PHE C 1 141 ? 34.451  53.000 91.158  1.00 28.23 ? 139 PHE C C     1 
ATOM   5267 O  O     . PHE C 1 141 ? 35.185  53.705 91.849  1.00 26.85 ? 139 PHE C O     1 
ATOM   5268 C  CB    . PHE C 1 141 ? 32.862  53.808 89.436  1.00 26.40 ? 139 PHE C CB    1 
ATOM   5269 C  CG    . PHE C 1 141 ? 31.494  54.305 89.068  1.00 27.80 ? 139 PHE C CG    1 
ATOM   5270 C  CD1   . PHE C 1 141 ? 30.352  53.626 89.487  1.00 27.98 ? 139 PHE C CD1   1 
ATOM   5271 C  CD2   . PHE C 1 141 ? 31.348  55.439 88.275  1.00 27.06 ? 139 PHE C CD2   1 
ATOM   5272 C  CE1   . PHE C 1 141 ? 29.079  54.071 89.116  1.00 29.56 ? 139 PHE C CE1   1 
ATOM   5273 C  CE2   . PHE C 1 141 ? 30.083  55.894 87.897  1.00 28.36 ? 139 PHE C CE2   1 
ATOM   5274 C  CZ    . PHE C 1 141 ? 28.945  55.208 88.319  1.00 28.40 ? 139 PHE C CZ    1 
ATOM   5275 N  N     . SER C 1 142 ? 34.866  51.884 90.568  1.00 28.85 ? 140 SER C N     1 
ATOM   5276 C  CA    . SER C 1 142 ? 36.234  51.411 90.705  1.00 29.04 ? 140 SER C CA    1 
ATOM   5277 C  C     . SER C 1 142 ? 37.151  52.396 90.000  1.00 29.22 ? 140 SER C C     1 
ATOM   5278 O  O     . SER C 1 142 ? 36.688  53.285 89.279  1.00 26.80 ? 140 SER C O     1 
ATOM   5279 C  CB    . SER C 1 142 ? 36.386  50.043 90.046  1.00 30.98 ? 140 SER C CB    1 
ATOM   5280 O  OG    . SER C 1 142 ? 36.184  50.159 88.649  1.00 32.20 ? 140 SER C OG    1 
ATOM   5281 N  N     . LEU C 1 143 ? 38.453  52.225 90.204  1.00 26.56 ? 141 LEU C N     1 
ATOM   5282 C  CA    . LEU C 1 143 ? 39.436  53.089 89.578  1.00 27.72 ? 141 LEU C CA    1 
ATOM   5283 C  C     . LEU C 1 143 ? 39.289  53.086 88.060  1.00 28.25 ? 141 LEU C C     1 
ATOM   5284 O  O     . LEU C 1 143 ? 39.220  54.146 87.435  1.00 25.85 ? 141 LEU C O     1 
ATOM   5285 C  CB    . LEU C 1 143 ? 40.846  52.627 89.936  1.00 29.04 ? 141 LEU C CB    1 
ATOM   5286 C  CG    . LEU C 1 143 ? 41.956  53.366 89.192  1.00 30.12 ? 141 LEU C CG    1 
ATOM   5287 C  CD1   . LEU C 1 143 ? 41.839  54.840 89.476  1.00 31.66 ? 141 LEU C CD1   1 
ATOM   5288 C  CD2   . LEU C 1 143 ? 43.323  52.846 89.628  1.00 32.53 ? 141 LEU C CD2   1 
ATOM   5289 N  N     . ASP C 1 144 ? 39.250  51.889 87.477  1.00 28.42 ? 142 ASP C N     1 
ATOM   5290 C  CA    . ASP C 1 144 ? 39.142  51.732 86.025  1.00 29.63 ? 142 ASP C CA    1 
ATOM   5291 C  C     . ASP C 1 144 ? 37.893  52.361 85.418  1.00 28.44 ? 142 ASP C C     1 
ATOM   5292 O  O     . ASP C 1 144 ? 37.965  53.021 84.383  1.00 27.35 ? 142 ASP C O     1 
ATOM   5293 C  CB    . ASP C 1 144 ? 39.171  50.251 85.636  1.00 32.50 ? 142 ASP C CB    1 
ATOM   5294 C  CG    . ASP C 1 144 ? 40.539  49.625 85.806  1.00 35.70 ? 142 ASP C CG    1 
ATOM   5295 O  OD1   . ASP C 1 144 ? 41.529  50.376 85.953  1.00 36.87 ? 142 ASP C OD1   1 
ATOM   5296 O  OD2   . ASP C 1 144 ? 40.622  48.378 85.776  1.00 37.81 ? 142 ASP C OD2   1 
ATOM   5297 N  N     . LYS C 1 145 ? 36.750  52.139 86.059  1.00 26.86 ? 143 LYS C N     1 
ATOM   5298 C  CA    . LYS C 1 145 ? 35.488  52.678 85.571  1.00 26.31 ? 143 LYS C CA    1 
ATOM   5299 C  C     . LYS C 1 145 ? 35.473  54.204 85.682  1.00 25.19 ? 143 LYS C C     1 
ATOM   5300 O  O     . LYS C 1 145 ? 35.070  54.896 84.748  1.00 24.36 ? 143 LYS C O     1 
ATOM   5301 C  CB    . LYS C 1 145 ? 34.330  52.063 86.365  1.00 26.79 ? 143 LYS C CB    1 
ATOM   5302 C  CG    . LYS C 1 145 ? 32.943  52.301 85.785  1.00 29.21 ? 143 LYS C CG    1 
ATOM   5303 C  CD    . LYS C 1 145 ? 31.915  51.442 86.527  1.00 32.04 ? 143 LYS C CD    1 
ATOM   5304 C  CE    . LYS C 1 145 ? 30.494  51.726 86.079  1.00 33.14 ? 143 LYS C CE    1 
ATOM   5305 N  NZ    . LYS C 1 145 ? 29.503  50.853 86.783  1.00 31.28 ? 143 LYS C NZ    1 
ATOM   5306 N  N     . THR C 1 146 ? 35.922  54.721 86.823  1.00 23.20 ? 144 THR C N     1 
ATOM   5307 C  CA    . THR C 1 146 ? 35.972  56.162 87.051  1.00 22.06 ? 144 THR C CA    1 
ATOM   5308 C  C     . THR C 1 146 ? 36.920  56.854 86.072  1.00 22.51 ? 144 THR C C     1 
ATOM   5309 O  O     . THR C 1 146 ? 36.584  57.885 85.479  1.00 23.40 ? 144 THR C O     1 
ATOM   5310 C  CB    . THR C 1 146 ? 36.436  56.473 88.491  1.00 20.39 ? 144 THR C CB    1 
ATOM   5311 O  OG1   . THR C 1 146 ? 35.547  55.848 89.420  1.00 20.92 ? 144 THR C OG1   1 
ATOM   5312 C  CG2   . THR C 1 146 ? 36.453  57.977 88.736  1.00 21.30 ? 144 THR C CG2   1 
ATOM   5313 N  N     . ARG C 1 147 ? 38.111  56.289 85.906  1.00 21.83 ? 145 ARG C N     1 
ATOM   5314 C  CA    . ARG C 1 147 ? 39.098  56.858 84.999  1.00 23.39 ? 145 ARG C CA    1 
ATOM   5315 C  C     . ARG C 1 147 ? 38.614  56.853 83.551  1.00 22.66 ? 145 ARG C C     1 
ATOM   5316 O  O     . ARG C 1 147 ? 38.829  57.817 82.811  1.00 21.46 ? 145 ARG C O     1 
ATOM   5317 C  CB    . ARG C 1 147 ? 40.407  56.080 85.096  1.00 25.72 ? 145 ARG C CB    1 
ATOM   5318 C  CG    . ARG C 1 147 ? 41.509  56.591 84.182  1.00 29.41 ? 145 ARG C CG    1 
ATOM   5319 C  CD    . ARG C 1 147 ? 42.783  55.825 84.459  1.00 34.03 ? 145 ARG C CD    1 
ATOM   5320 N  NE    . ARG C 1 147 ? 42.540  54.398 84.292  1.00 40.82 ? 145 ARG C NE    1 
ATOM   5321 C  CZ    . ARG C 1 147 ? 43.266  53.434 84.847  1.00 43.03 ? 145 ARG C CZ    1 
ATOM   5322 N  NH1   . ARG C 1 147 ? 44.303  53.733 85.623  1.00 41.10 ? 145 ARG C NH1   1 
ATOM   5323 N  NH2   . ARG C 1 147 ? 42.948  52.165 84.620  1.00 44.57 ? 145 ARG C NH2   1 
ATOM   5324 N  N     . ALA C 1 148 ? 37.974  55.758 83.154  1.00 22.29 ? 146 ALA C N     1 
ATOM   5325 C  CA    . ALA C 1 148 ? 37.457  55.622 81.791  1.00 23.27 ? 146 ALA C CA    1 
ATOM   5326 C  C     . ALA C 1 148 ? 36.443  56.715 81.475  1.00 22.61 ? 146 ALA C C     1 
ATOM   5327 O  O     . ALA C 1 148 ? 36.478  57.308 80.397  1.00 21.86 ? 146 ALA C O     1 
ATOM   5328 C  CB    . ALA C 1 148 ? 36.815  54.247 81.608  1.00 23.35 ? 146 ALA C CB    1 
ATOM   5329 N  N     . LEU C 1 149 ? 35.541  56.985 82.414  1.00 22.01 ? 147 LEU C N     1 
ATOM   5330 C  CA    . LEU C 1 149 ? 34.526  58.019 82.204  1.00 21.71 ? 147 LEU C CA    1 
ATOM   5331 C  C     . LEU C 1 149 ? 35.167  59.398 82.065  1.00 22.82 ? 147 LEU C C     1 
ATOM   5332 O  O     . LEU C 1 149 ? 34.761  60.191 81.211  1.00 21.57 ? 147 LEU C O     1 
ATOM   5333 C  CB    . LEU C 1 149 ? 33.497  58.003 83.349  1.00 21.68 ? 147 LEU C CB    1 
ATOM   5334 C  CG    . LEU C 1 149 ? 32.541  56.808 83.292  1.00 22.59 ? 147 LEU C CG    1 
ATOM   5335 C  CD1   . LEU C 1 149 ? 31.755  56.679 84.589  1.00 25.86 ? 147 LEU C CD1   1 
ATOM   5336 C  CD2   . LEU C 1 149 ? 31.605  56.982 82.102  1.00 24.82 ? 147 LEU C CD2   1 
ATOM   5337 N  N     . PHE C 1 150 ? 36.172  59.685 82.897  1.00 22.82 ? 148 PHE C N     1 
ATOM   5338 C  CA    . PHE C 1 150 ? 36.874  60.963 82.824  1.00 21.82 ? 148 PHE C CA    1 
ATOM   5339 C  C     . PHE C 1 150 ? 37.669  61.080 81.528  1.00 22.45 ? 148 PHE C C     1 
ATOM   5340 O  O     . PHE C 1 150 ? 37.765  62.159 80.955  1.00 22.59 ? 148 PHE C O     1 
ATOM   5341 C  CB    . PHE C 1 150 ? 37.825  61.133 84.014  1.00 23.31 ? 148 PHE C CB    1 
ATOM   5342 C  CG    . PHE C 1 150 ? 37.148  61.608 85.276  1.00 23.17 ? 148 PHE C CG    1 
ATOM   5343 C  CD1   . PHE C 1 150 ? 37.425  60.998 86.495  1.00 21.02 ? 148 PHE C CD1   1 
ATOM   5344 C  CD2   . PHE C 1 150 ? 36.245  62.670 85.245  1.00 24.23 ? 148 PHE C CD2   1 
ATOM   5345 C  CE1   . PHE C 1 150 ? 36.809  61.438 87.676  1.00 21.80 ? 148 PHE C CE1   1 
ATOM   5346 C  CE2   . PHE C 1 150 ? 35.623  63.116 86.422  1.00 22.75 ? 148 PHE C CE2   1 
ATOM   5347 C  CZ    . PHE C 1 150 ? 35.911  62.494 87.637  1.00 21.51 ? 148 PHE C CZ    1 
ATOM   5348 N  N     . GLN C 1 151 ? 38.250  59.975 81.064  1.00 24.16 ? 149 GLN C N     1 
ATOM   5349 C  CA    . GLN C 1 151 ? 39.012  60.013 79.818  1.00 23.38 ? 149 GLN C CA    1 
ATOM   5350 C  C     . GLN C 1 151 ? 38.040  60.245 78.669  1.00 22.72 ? 149 GLN C C     1 
ATOM   5351 O  O     . GLN C 1 151 ? 38.340  60.976 77.723  1.00 23.06 ? 149 GLN C O     1 
ATOM   5352 C  CB    . GLN C 1 151 ? 39.787  58.708 79.612  1.00 25.16 ? 149 GLN C CB    1 
ATOM   5353 C  CG    . GLN C 1 151 ? 40.810  58.448 80.708  1.00 28.76 ? 149 GLN C CG    1 
ATOM   5354 C  CD    . GLN C 1 151 ? 41.677  57.237 80.438  1.00 32.12 ? 149 GLN C CD    1 
ATOM   5355 O  OE1   . GLN C 1 151 ? 41.221  56.238 79.874  1.00 33.78 ? 149 GLN C OE1   1 
ATOM   5356 N  NE2   . GLN C 1 151 ? 42.936  57.311 80.859  1.00 31.75 ? 149 GLN C NE2   1 
ATOM   5357 N  N     . TYR C 1 152 ? 36.868  59.630 78.751  1.00 21.68 ? 150 TYR C N     1 
ATOM   5358 C  CA    . TYR C 1 152 ? 35.870  59.830 77.709  1.00 22.29 ? 150 TYR C CA    1 
ATOM   5359 C  C     . TYR C 1 152 ? 35.470  61.305 77.694  1.00 22.21 ? 150 TYR C C     1 
ATOM   5360 O  O     . TYR C 1 152 ? 35.434  61.943 76.640  1.00 21.49 ? 150 TYR C O     1 
ATOM   5361 C  CB    . TYR C 1 152 ? 34.635  58.980 77.964  1.00 21.06 ? 150 TYR C CB    1 
ATOM   5362 C  CG    . TYR C 1 152 ? 33.569  59.231 76.926  1.00 24.00 ? 150 TYR C CG    1 
ATOM   5363 C  CD1   . TYR C 1 152 ? 33.694  58.722 75.633  1.00 24.18 ? 150 TYR C CD1   1 
ATOM   5364 C  CD2   . TYR C 1 152 ? 32.470  60.037 77.214  1.00 22.56 ? 150 TYR C CD2   1 
ATOM   5365 C  CE1   . TYR C 1 152 ? 32.753  59.012 74.651  1.00 24.88 ? 150 TYR C CE1   1 
ATOM   5366 C  CE2   . TYR C 1 152 ? 31.524  60.335 76.241  1.00 25.29 ? 150 TYR C CE2   1 
ATOM   5367 C  CZ    . TYR C 1 152 ? 31.671  59.820 74.962  1.00 26.37 ? 150 TYR C CZ    1 
ATOM   5368 O  OH    . TYR C 1 152 ? 30.738  60.127 74.000  1.00 27.66 ? 150 TYR C OH    1 
ATOM   5369 N  N     . ALA C 1 153 ? 35.190  61.847 78.878  1.00 23.10 ? 151 ALA C N     1 
ATOM   5370 C  CA    . ALA C 1 153 ? 34.801  63.248 79.015  1.00 23.17 ? 151 ALA C CA    1 
ATOM   5371 C  C     . ALA C 1 153 ? 35.854  64.161 78.399  1.00 23.83 ? 151 ALA C C     1 
ATOM   5372 O  O     . ALA C 1 153 ? 35.528  65.088 77.652  1.00 23.80 ? 151 ALA C O     1 
ATOM   5373 C  CB    . ALA C 1 153 ? 34.606  63.602 80.497  1.00 23.60 ? 151 ALA C CB    1 
ATOM   5374 N  N     . ARG C 1 154 ? 37.116  63.900 78.730  1.00 23.79 ? 152 ARG C N     1 
ATOM   5375 C  CA    . ARG C 1 154 ? 38.219  64.688 78.207  1.00 27.09 ? 152 ARG C CA    1 
ATOM   5376 C  C     . ARG C 1 154 ? 38.273  64.613 76.684  1.00 27.05 ? 152 ARG C C     1 
ATOM   5377 O  O     . ARG C 1 154 ? 38.499  65.619 76.015  1.00 26.50 ? 152 ARG C O     1 
ATOM   5378 C  CB    . ARG C 1 154 ? 39.554  64.207 78.795  1.00 29.92 ? 152 ARG C CB    1 
ATOM   5379 C  CG    . ARG C 1 154 ? 39.801  64.652 80.236  1.00 37.02 ? 152 ARG C CG    1 
ATOM   5380 C  CD    . ARG C 1 154 ? 41.298  64.680 80.554  1.00 43.20 ? 152 ARG C CD    1 
ATOM   5381 N  NE    . ARG C 1 154 ? 41.640  65.799 81.434  1.00 48.14 ? 152 ARG C NE    1 
ATOM   5382 C  CZ    . ARG C 1 154 ? 42.871  66.279 81.593  1.00 49.48 ? 152 ARG C CZ    1 
ATOM   5383 N  NH1   . ARG C 1 154 ? 43.888  65.739 80.935  1.00 50.41 ? 152 ARG C NH1   1 
ATOM   5384 N  NH2   . ARG C 1 154 ? 43.082  67.313 82.398  1.00 52.26 ? 152 ARG C NH2   1 
ATOM   5385 N  N     . SER C 1 155 ? 38.060  63.422 76.135  1.00 25.85 ? 153 SER C N     1 
ATOM   5386 C  CA    . SER C 1 155 ? 38.096  63.262 74.687  1.00 25.62 ? 153 SER C CA    1 
ATOM   5387 C  C     . SER C 1 155 ? 36.993  64.074 74.012  1.00 26.87 ? 153 SER C C     1 
ATOM   5388 O  O     . SER C 1 155 ? 37.125  64.445 72.848  1.00 25.39 ? 153 SER C O     1 
ATOM   5389 C  CB    . SER C 1 155 ? 37.939  61.790 74.298  1.00 25.25 ? 153 SER C CB    1 
ATOM   5390 O  OG    . SER C 1 155 ? 36.627  61.318 74.534  1.00 28.36 ? 153 SER C OG    1 
ATOM   5391 N  N     . ARG C 1 156 ? 35.904  64.342 74.731  1.00 25.58 ? 154 ARG C N     1 
ATOM   5392 C  CA    . ARG C 1 156 ? 34.787  65.101 74.158  1.00 27.12 ? 154 ARG C CA    1 
ATOM   5393 C  C     . ARG C 1 156 ? 34.844  66.582 74.540  1.00 27.00 ? 154 ARG C C     1 
ATOM   5394 O  O     . ARG C 1 156 ? 33.876  67.325 74.349  1.00 26.16 ? 154 ARG C O     1 
ATOM   5395 C  CB    . ARG C 1 156 ? 33.451  64.496 74.610  1.00 30.89 ? 154 ARG C CB    1 
ATOM   5396 C  CG    . ARG C 1 156 ? 33.302  63.007 74.320  1.00 33.41 ? 154 ARG C CG    1 
ATOM   5397 C  CD    . ARG C 1 156 ? 32.890  62.719 72.887  1.00 38.90 ? 154 ARG C CD    1 
ATOM   5398 N  NE    . ARG C 1 156 ? 33.495  61.479 72.393  1.00 45.21 ? 154 ARG C NE    1 
ATOM   5399 C  CZ    . ARG C 1 156 ? 33.163  60.883 71.247  1.00 49.41 ? 154 ARG C CZ    1 
ATOM   5400 N  NH1   . ARG C 1 156 ? 32.219  61.407 70.471  1.00 51.35 ? 154 ARG C NH1   1 
ATOM   5401 N  NH2   . ARG C 1 156 ? 33.783  59.770 70.864  1.00 48.16 ? 154 ARG C NH2   1 
ATOM   5402 N  N     . GLY C 1 157 ? 35.986  66.998 75.080  1.00 24.66 ? 155 GLY C N     1 
ATOM   5403 C  CA    . GLY C 1 157 ? 36.178  68.385 75.467  1.00 24.55 ? 155 GLY C CA    1 
ATOM   5404 C  C     . GLY C 1 157 ? 35.334  68.855 76.635  1.00 23.05 ? 155 GLY C C     1 
ATOM   5405 O  O     . GLY C 1 157 ? 34.992  70.035 76.721  1.00 22.84 ? 155 GLY C O     1 
HETATM 5406 N  N     . MSE C 1 158 ? 34.995  67.943 77.537  1.00 22.15 ? 156 MSE C N     1 
HETATM 5407 C  CA    . MSE C 1 158 ? 34.177  68.299 78.696  1.00 22.27 ? 156 MSE C CA    1 
HETATM 5408 C  C     . MSE C 1 158 ? 35.037  68.668 79.901  1.00 23.54 ? 156 MSE C C     1 
HETATM 5409 O  O     . MSE C 1 158 ? 36.196  68.250 79.998  1.00 21.69 ? 156 MSE C O     1 
HETATM 5410 C  CB    . MSE C 1 158 ? 33.261  67.129 79.066  1.00 23.30 ? 156 MSE C CB    1 
HETATM 5411 C  CG    . MSE C 1 158 ? 32.326  66.682 77.942  1.00 25.74 ? 156 MSE C CG    1 
HETATM 5412 SE SE    . MSE C 1 158 ? 31.356  65.051 78.372  1.00 36.23 ? 156 MSE C SE    1 
HETATM 5413 C  CE    . MSE C 1 158 ? 30.099  65.770 79.671  1.00 28.67 ? 156 MSE C CE    1 
ATOM   5414 N  N     . THR C 1 159 ? 34.466  69.466 80.804  1.00 22.16 ? 157 THR C N     1 
ATOM   5415 C  CA    . THR C 1 159 ? 35.141  69.882 82.032  1.00 24.44 ? 157 THR C CA    1 
ATOM   5416 C  C     . THR C 1 159 ? 34.857  68.784 83.056  1.00 22.98 ? 157 THR C C     1 
ATOM   5417 O  O     . THR C 1 159 ? 33.734  68.293 83.141  1.00 23.10 ? 157 THR C O     1 
ATOM   5418 C  CB    . THR C 1 159 ? 34.569  71.217 82.559  1.00 24.56 ? 157 THR C CB    1 
ATOM   5419 O  OG1   . THR C 1 159 ? 34.973  72.285 81.691  1.00 26.49 ? 157 THR C OG1   1 
ATOM   5420 C  CG2   . THR C 1 159 ? 35.059  71.489 83.973  1.00 26.23 ? 157 THR C CG2   1 
ATOM   5421 N  N     . THR C 1 160 ? 35.856  68.404 83.839  1.00 21.97 ? 158 THR C N     1 
ATOM   5422 C  CA    . THR C 1 160 ? 35.666  67.335 84.819  1.00 21.25 ? 158 THR C CA    1 
ATOM   5423 C  C     . THR C 1 160 ? 35.701  67.796 86.277  1.00 21.86 ? 158 THR C C     1 
ATOM   5424 O  O     . THR C 1 160 ? 36.541  68.605 86.672  1.00 20.66 ? 158 THR C O     1 
ATOM   5425 C  CB    . THR C 1 160 ? 36.715  66.238 84.612  1.00 22.62 ? 158 THR C CB    1 
ATOM   5426 O  OG1   . THR C 1 160 ? 38.029  66.808 84.717  1.00 24.11 ? 158 THR C OG1   1 
ATOM   5427 C  CG2   . THR C 1 160 ? 36.553  65.607 83.217  1.00 19.29 ? 158 THR C CG2   1 
ATOM   5428 N  N     . VAL C 1 161 ? 34.776  67.264 87.073  1.00 21.66 ? 159 VAL C N     1 
ATOM   5429 C  CA    . VAL C 1 161 ? 34.680  67.603 88.486  1.00 20.19 ? 159 VAL C CA    1 
ATOM   5430 C  C     . VAL C 1 161 ? 34.717  66.286 89.240  1.00 20.54 ? 159 VAL C C     1 
ATOM   5431 O  O     . VAL C 1 161 ? 33.999  65.351 88.901  1.00 19.95 ? 159 VAL C O     1 
ATOM   5432 C  CB    . VAL C 1 161 ? 33.368  68.344 88.788  1.00 18.50 ? 159 VAL C CB    1 
ATOM   5433 C  CG1   . VAL C 1 161 ? 33.316  68.743 90.250  1.00 17.64 ? 159 VAL C CG1   1 
ATOM   5434 C  CG2   . VAL C 1 161 ? 33.256  69.569 87.894  1.00 16.33 ? 159 VAL C CG2   1 
ATOM   5435 N  N     . PHE C 1 162 ? 35.548  66.210 90.271  1.00 20.05 ? 160 PHE C N     1 
ATOM   5436 C  CA    . PHE C 1 162 ? 35.681  64.966 91.008  1.00 19.33 ? 160 PHE C CA    1 
ATOM   5437 C  C     . PHE C 1 162 ? 35.599  65.137 92.524  1.00 21.37 ? 160 PHE C C     1 
ATOM   5438 O  O     . PHE C 1 162 ? 36.268  65.995 93.101  1.00 19.74 ? 160 PHE C O     1 
ATOM   5439 C  CB    . PHE C 1 162 ? 37.018  64.321 90.597  1.00 21.22 ? 160 PHE C CB    1 
ATOM   5440 C  CG    . PHE C 1 162 ? 37.261  62.946 91.168  1.00 20.39 ? 160 PHE C CG    1 
ATOM   5441 C  CD1   . PHE C 1 162 ? 36.245  62.001 91.223  1.00 20.61 ? 160 PHE C CD1   1 
ATOM   5442 C  CD2   . PHE C 1 162 ? 38.540  62.580 91.583  1.00 22.11 ? 160 PHE C CD2   1 
ATOM   5443 C  CE1   . PHE C 1 162 ? 36.491  60.702 91.680  1.00 23.17 ? 160 PHE C CE1   1 
ATOM   5444 C  CE2   . PHE C 1 162 ? 38.805  61.286 92.043  1.00 24.08 ? 160 PHE C CE2   1 
ATOM   5445 C  CZ    . PHE C 1 162 ? 37.775  60.340 92.090  1.00 24.60 ? 160 PHE C CZ    1 
ATOM   5446 N  N     . ASN C 1 163 ? 34.762  64.311 93.149  1.00 19.71 ? 161 ASN C N     1 
ATOM   5447 C  CA    . ASN C 1 163 ? 34.579  64.290 94.596  1.00 20.83 ? 161 ASN C CA    1 
ATOM   5448 C  C     . ASN C 1 163 ? 34.877  62.838 94.976  1.00 22.11 ? 161 ASN C C     1 
ATOM   5449 O  O     . ASN C 1 163 ? 33.979  62.001 94.982  1.00 21.05 ? 161 ASN C O     1 
ATOM   5450 C  CB    . ASN C 1 163 ? 33.132  64.657 94.943  1.00 20.96 ? 161 ASN C CB    1 
ATOM   5451 C  CG    . ASN C 1 163 ? 32.826  64.507 96.423  1.00 21.50 ? 161 ASN C CG    1 
ATOM   5452 O  OD1   . ASN C 1 163 ? 33.603  64.938 97.286  1.00 22.38 ? 161 ASN C OD1   1 
ATOM   5453 N  ND2   . ASN C 1 163 ? 31.687  63.907 96.725  1.00 19.89 ? 161 ASN C ND2   1 
ATOM   5454 N  N     . PRO C 1 164 ? 36.151  62.521 95.292  1.00 23.40 ? 162 PRO C N     1 
ATOM   5455 C  CA    . PRO C 1 164 ? 36.584  61.164 95.657  1.00 23.22 ? 162 PRO C CA    1 
ATOM   5456 C  C     . PRO C 1 164 ? 36.014  60.603 96.951  1.00 25.56 ? 162 PRO C C     1 
ATOM   5457 O  O     . PRO C 1 164 ? 36.754  60.280 97.884  1.00 25.61 ? 162 PRO C O     1 
ATOM   5458 C  CB    . PRO C 1 164 ? 38.109  61.288 95.683  1.00 24.97 ? 162 PRO C CB    1 
ATOM   5459 C  CG    . PRO C 1 164 ? 38.305  62.672 96.198  1.00 25.36 ? 162 PRO C CG    1 
ATOM   5460 C  CD    . PRO C 1 164 ? 37.271  63.473 95.409  1.00 23.77 ? 162 PRO C CD    1 
ATOM   5461 N  N     . SER C 1 165 ? 34.693  60.457 96.983  1.00 25.05 ? 163 SER C N     1 
ATOM   5462 C  CA    . SER C 1 165 ? 33.992  59.960 98.158  1.00 25.79 ? 163 SER C CA    1 
ATOM   5463 C  C     . SER C 1 165 ? 32.871  59.011 97.740  1.00 25.95 ? 163 SER C C     1 
ATOM   5464 O  O     . SER C 1 165 ? 32.023  59.376 96.921  1.00 25.17 ? 163 SER C O     1 
ATOM   5465 C  CB    . SER C 1 165 ? 33.406  61.151 98.921  1.00 27.92 ? 163 SER C CB    1 
ATOM   5466 O  OG    . SER C 1 165 ? 32.599  60.735 100.001 1.00 32.08 ? 163 SER C OG    1 
ATOM   5467 N  N     . PRO C 1 166 ? 32.860  57.772 98.273  1.00 27.26 ? 164 PRO C N     1 
ATOM   5468 C  CA    . PRO C 1 166 ? 33.807  57.177 99.231  1.00 28.82 ? 164 PRO C CA    1 
ATOM   5469 C  C     . PRO C 1 166 ? 35.225  57.163 98.666  1.00 29.42 ? 164 PRO C C     1 
ATOM   5470 O  O     . PRO C 1 166 ? 35.420  57.052 97.451  1.00 27.67 ? 164 PRO C O     1 
ATOM   5471 C  CB    . PRO C 1 166 ? 33.266  55.758 99.427  1.00 29.32 ? 164 PRO C CB    1 
ATOM   5472 C  CG    . PRO C 1 166 ? 31.800  55.905 99.159  1.00 28.87 ? 164 PRO C CG    1 
ATOM   5473 C  CD    . PRO C 1 166 ? 31.766  56.832 97.972  1.00 26.91 ? 164 PRO C CD    1 
ATOM   5474 N  N     . VAL C 1 167 ? 36.216  57.244 99.549  1.00 30.13 ? 165 VAL C N     1 
ATOM   5475 C  CA    . VAL C 1 167 ? 37.603  57.267 99.109  1.00 31.42 ? 165 VAL C CA    1 
ATOM   5476 C  C     . VAL C 1 167 ? 38.104  55.900 98.643  1.00 31.72 ? 165 VAL C C     1 
ATOM   5477 O  O     . VAL C 1 167 ? 37.623  54.862 99.086  1.00 32.38 ? 165 VAL C O     1 
ATOM   5478 C  CB    . VAL C 1 167 ? 38.534  57.807 100.237 1.00 32.10 ? 165 VAL C CB    1 
ATOM   5479 C  CG1   . VAL C 1 167 ? 38.755  56.737 101.299 1.00 31.27 ? 165 VAL C CG1   1 
ATOM   5480 C  CG2   . VAL C 1 167 ? 39.857  58.266 99.649  1.00 33.45 ? 165 VAL C CG2   1 
ATOM   5481 N  N     . ASN C 1 168 ? 39.052  55.923 97.714  1.00 32.50 ? 166 ASN C N     1 
ATOM   5482 C  CA    . ASN C 1 168 ? 39.682  54.718 97.175  1.00 31.78 ? 166 ASN C CA    1 
ATOM   5483 C  C     . ASN C 1 168 ? 41.135  55.140 97.055  1.00 31.03 ? 166 ASN C C     1 
ATOM   5484 O  O     . ASN C 1 168 ? 41.444  56.112 96.362  1.00 29.11 ? 166 ASN C O     1 
ATOM   5485 C  CB    . ASN C 1 168 ? 39.136  54.366 95.785  1.00 32.21 ? 166 ASN C CB    1 
ATOM   5486 C  CG    . ASN C 1 168 ? 39.782  53.111 95.202  1.00 34.32 ? 166 ASN C CG    1 
ATOM   5487 O  OD1   . ASN C 1 168 ? 40.971  52.862 95.402  1.00 34.63 ? 166 ASN C OD1   1 
ATOM   5488 N  ND2   . ASN C 1 168 ? 39.001  52.325 94.468  1.00 33.84 ? 166 ASN C ND2   1 
ATOM   5489 N  N     . PRO C 1 169 ? 42.046  54.425 97.734  1.00 30.87 ? 167 PRO C N     1 
ATOM   5490 C  CA    . PRO C 1 169 ? 43.470  54.764 97.684  1.00 31.89 ? 167 PRO C CA    1 
ATOM   5491 C  C     . PRO C 1 169 ? 43.975  55.045 96.272  1.00 31.21 ? 167 PRO C C     1 
ATOM   5492 O  O     . PRO C 1 169 ? 44.730  55.990 96.052  1.00 32.04 ? 167 PRO C O     1 
ATOM   5493 C  CB    . PRO C 1 169 ? 44.143  53.533 98.293  1.00 31.53 ? 167 PRO C CB    1 
ATOM   5494 C  CG    . PRO C 1 169 ? 43.116  53.004 99.221  1.00 32.83 ? 167 PRO C CG    1 
ATOM   5495 C  CD    . PRO C 1 169 ? 41.843  53.140 98.425  1.00 32.19 ? 167 PRO C CD    1 
ATOM   5496 N  N     . ASP C 1 170 ? 43.539  54.231 95.319  1.00 31.50 ? 168 ASP C N     1 
ATOM   5497 C  CA    . ASP C 1 170 ? 43.972  54.360 93.931  1.00 32.27 ? 168 ASP C CA    1 
ATOM   5498 C  C     . ASP C 1 170 ? 43.500  55.601 93.184  1.00 31.28 ? 168 ASP C C     1 
ATOM   5499 O  O     . ASP C 1 170 ? 43.974  55.874 92.080  1.00 29.56 ? 168 ASP C O     1 
ATOM   5500 C  CB    . ASP C 1 170 ? 43.567  53.107 93.152  1.00 36.70 ? 168 ASP C CB    1 
ATOM   5501 C  CG    . ASP C 1 170 ? 44.243  51.857 93.678  1.00 41.02 ? 168 ASP C CG    1 
ATOM   5502 O  OD1   . ASP C 1 170 ? 45.492  51.825 93.703  1.00 42.59 ? 168 ASP C OD1   1 
ATOM   5503 O  OD2   . ASP C 1 170 ? 43.527  50.910 94.069  1.00 44.56 ? 168 ASP C OD2   1 
ATOM   5504 N  N     . PHE C 1 171 ? 42.574  56.353 93.777  1.00 30.05 ? 169 PHE C N     1 
ATOM   5505 C  CA    . PHE C 1 171 ? 42.070  57.568 93.146  1.00 29.31 ? 169 PHE C CA    1 
ATOM   5506 C  C     . PHE C 1 171 ? 43.171  58.614 93.031  1.00 30.89 ? 169 PHE C C     1 
ATOM   5507 O  O     . PHE C 1 171 ? 43.061  59.546 92.236  1.00 29.31 ? 169 PHE C O     1 
ATOM   5508 C  CB    . PHE C 1 171 ? 40.908  58.170 93.955  1.00 28.55 ? 169 PHE C CB    1 
ATOM   5509 C  CG    . PHE C 1 171 ? 39.577  57.483 93.751  1.00 26.45 ? 169 PHE C CG    1 
ATOM   5510 C  CD1   . PHE C 1 171 ? 38.537  57.690 94.656  1.00 26.01 ? 169 PHE C CD1   1 
ATOM   5511 C  CD2   . PHE C 1 171 ? 39.351  56.656 92.658  1.00 26.95 ? 169 PHE C CD2   1 
ATOM   5512 C  CE1   . PHE C 1 171 ? 37.291  57.082 94.475  1.00 26.05 ? 169 PHE C CE1   1 
ATOM   5513 C  CE2   . PHE C 1 171 ? 38.107  56.042 92.468  1.00 26.37 ? 169 PHE C CE2   1 
ATOM   5514 C  CZ    . PHE C 1 171 ? 37.077  56.254 93.377  1.00 26.31 ? 169 PHE C CZ    1 
ATOM   5515 N  N     . CYS C 1 172 ? 44.235  58.467 93.815  1.00 32.04 ? 170 CYS C N     1 
ATOM   5516 C  CA    . CYS C 1 172 ? 45.315  59.454 93.780  1.00 35.10 ? 170 CYS C CA    1 
ATOM   5517 C  C     . CYS C 1 172 ? 45.987  59.565 92.410  1.00 36.51 ? 170 CYS C C     1 
ATOM   5518 O  O     . CYS C 1 172 ? 46.697  60.533 92.142  1.00 36.67 ? 170 CYS C O     1 
ATOM   5519 C  CB    . CYS C 1 172 ? 46.367  59.145 94.854  1.00 36.78 ? 170 CYS C CB    1 
ATOM   5520 S  SG    . CYS C 1 172 ? 47.355  57.670 94.545  1.00 40.31 ? 170 CYS C SG    1 
ATOM   5521 N  N     . HIS C 1 173 ? 45.745  58.583 91.545  1.00 37.56 ? 171 HIS C N     1 
ATOM   5522 C  CA    . HIS C 1 173 ? 46.325  58.570 90.202  1.00 38.90 ? 171 HIS C CA    1 
ATOM   5523 C  C     . HIS C 1 173 ? 45.448  59.266 89.156  1.00 37.14 ? 171 HIS C C     1 
ATOM   5524 O  O     . HIS C 1 173 ? 45.774  59.257 87.970  1.00 36.77 ? 171 HIS C O     1 
ATOM   5525 C  CB    . HIS C 1 173 ? 46.560  57.123 89.752  1.00 42.03 ? 171 HIS C CB    1 
ATOM   5526 C  CG    . HIS C 1 173 ? 47.547  56.375 90.593  1.00 45.83 ? 171 HIS C CG    1 
ATOM   5527 N  ND1   . HIS C 1 173 ? 47.314  55.095 91.048  1.00 46.99 ? 171 HIS C ND1   1 
ATOM   5528 C  CD2   . HIS C 1 173 ? 48.774  56.721 91.053  1.00 46.46 ? 171 HIS C CD2   1 
ATOM   5529 C  CE1   . HIS C 1 173 ? 48.353  54.685 91.754  1.00 47.39 ? 171 HIS C CE1   1 
ATOM   5530 N  NE2   . HIS C 1 173 ? 49.253  55.653 91.772  1.00 46.96 ? 171 HIS C NE2   1 
ATOM   5531 N  N     . LEU C 1 174 ? 44.351  59.878 89.594  1.00 33.99 ? 172 LEU C N     1 
ATOM   5532 C  CA    . LEU C 1 174 ? 43.414  60.534 88.681  1.00 31.10 ? 172 LEU C CA    1 
ATOM   5533 C  C     . LEU C 1 174 ? 43.515  62.046 88.530  1.00 29.90 ? 172 LEU C C     1 
ATOM   5534 O  O     . LEU C 1 174 ? 42.976  62.611 87.579  1.00 26.69 ? 172 LEU C O     1 
ATOM   5535 C  CB    . LEU C 1 174 ? 41.980  60.203 89.108  1.00 32.61 ? 172 LEU C CB    1 
ATOM   5536 C  CG    . LEU C 1 174 ? 41.375  58.849 88.733  1.00 34.55 ? 172 LEU C CG    1 
ATOM   5537 C  CD1   . LEU C 1 174 ? 42.440  57.774 88.736  1.00 38.50 ? 172 LEU C CD1   1 
ATOM   5538 C  CD2   . LEU C 1 174 ? 40.250  58.524 89.701  1.00 35.62 ? 172 LEU C CD2   1 
ATOM   5539 N  N     . TRP C 1 175 ? 44.206  62.705 89.450  1.00 29.76 ? 173 TRP C N     1 
ATOM   5540 C  CA    . TRP C 1 175 ? 44.281  64.162 89.412  1.00 29.25 ? 173 TRP C CA    1 
ATOM   5541 C  C     . TRP C 1 175 ? 44.605  64.839 88.083  1.00 28.69 ? 173 TRP C C     1 
ATOM   5542 O  O     . TRP C 1 175 ? 44.040  65.886 87.783  1.00 26.96 ? 173 TRP C O     1 
ATOM   5543 C  CB    . TRP C 1 175 ? 45.218  64.663 90.520  1.00 28.97 ? 173 TRP C CB    1 
ATOM   5544 C  CG    . TRP C 1 175 ? 44.762  64.222 91.883  1.00 29.85 ? 173 TRP C CG    1 
ATOM   5545 C  CD1   . TRP C 1 175 ? 45.485  63.516 92.798  1.00 28.22 ? 173 TRP C CD1   1 
ATOM   5546 C  CD2   . TRP C 1 175 ? 43.456  64.401 92.457  1.00 29.58 ? 173 TRP C CD2   1 
ATOM   5547 N  NE1   . TRP C 1 175 ? 44.717  63.235 93.901  1.00 27.24 ? 173 TRP C NE1   1 
ATOM   5548 C  CE2   . TRP C 1 175 ? 43.466  63.765 93.719  1.00 30.51 ? 173 TRP C CE2   1 
ATOM   5549 C  CE3   . TRP C 1 175 ? 42.279  65.034 92.027  1.00 28.32 ? 173 TRP C CE3   1 
ATOM   5550 C  CZ2   . TRP C 1 175 ? 42.344  63.743 94.559  1.00 29.84 ? 173 TRP C CZ2   1 
ATOM   5551 C  CZ3   . TRP C 1 175 ? 41.159  65.010 92.866  1.00 29.23 ? 173 TRP C CZ3   1 
ATOM   5552 C  CH2   . TRP C 1 175 ? 41.205  64.368 94.115  1.00 30.27 ? 173 TRP C CH2   1 
ATOM   5553 N  N     . PRO C 1 176 ? 45.503  64.260 87.262  1.00 30.64 ? 174 PRO C N     1 
ATOM   5554 C  CA    . PRO C 1 176 ? 45.797  64.930 85.989  1.00 31.13 ? 174 PRO C CA    1 
ATOM   5555 C  C     . PRO C 1 176 ? 44.603  65.036 85.032  1.00 31.02 ? 174 PRO C C     1 
ATOM   5556 O  O     . PRO C 1 176 ? 44.624  65.829 84.084  1.00 30.82 ? 174 PRO C O     1 
ATOM   5557 C  CB    . PRO C 1 176 ? 46.949  64.097 85.413  1.00 33.51 ? 174 PRO C CB    1 
ATOM   5558 C  CG    . PRO C 1 176 ? 46.699  62.736 85.980  1.00 34.36 ? 174 PRO C CG    1 
ATOM   5559 C  CD    . PRO C 1 176 ? 46.321  63.044 87.415  1.00 30.65 ? 174 PRO C CD    1 
ATOM   5560 N  N     . LEU C 1 177 ? 43.564  64.250 85.289  1.00 29.65 ? 175 LEU C N     1 
ATOM   5561 C  CA    . LEU C 1 177 ? 42.358  64.271 84.456  1.00 28.99 ? 175 LEU C CA    1 
ATOM   5562 C  C     . LEU C 1 177 ? 41.270  65.168 85.051  1.00 29.77 ? 175 LEU C C     1 
ATOM   5563 O  O     . LEU C 1 177 ? 40.224  65.393 84.426  1.00 27.73 ? 175 LEU C O     1 
ATOM   5564 C  CB    . LEU C 1 177 ? 41.790  62.859 84.322  1.00 31.11 ? 175 LEU C CB    1 
ATOM   5565 C  CG    . LEU C 1 177 ? 42.652  61.776 83.674  1.00 30.64 ? 175 LEU C CG    1 
ATOM   5566 C  CD1   . LEU C 1 177 ? 41.944  60.437 83.777  1.00 30.90 ? 175 LEU C CD1   1 
ATOM   5567 C  CD2   . LEU C 1 177 ? 42.921  62.145 82.223  1.00 33.73 ? 175 LEU C CD2   1 
ATOM   5568 N  N     . ILE C 1 178 ? 41.529  65.691 86.248  1.00 28.19 ? 176 ILE C N     1 
ATOM   5569 C  CA    . ILE C 1 178 ? 40.552  66.511 86.963  1.00 26.82 ? 176 ILE C CA    1 
ATOM   5570 C  C     . ILE C 1 178 ? 40.728  68.019 86.863  1.00 26.60 ? 176 ILE C C     1 
ATOM   5571 O  O     . ILE C 1 178 ? 41.828  68.539 87.063  1.00 27.51 ? 176 ILE C O     1 
ATOM   5572 C  CB    . ILE C 1 178 ? 40.547  66.122 88.461  1.00 27.58 ? 176 ILE C CB    1 
ATOM   5573 C  CG1   . ILE C 1 178 ? 40.413  64.602 88.597  1.00 25.17 ? 176 ILE C CG1   1 
ATOM   5574 C  CG2   . ILE C 1 178 ? 39.434  66.867 89.203  1.00 27.47 ? 176 ILE C CG2   1 
ATOM   5575 C  CD1   . ILE C 1 178 ? 39.260  64.007 87.798  1.00 25.76 ? 176 ILE C CD1   1 
ATOM   5576 N  N     . ASP C 1 179 ? 39.637  68.721 86.557  1.00 24.54 ? 177 ASP C N     1 
ATOM   5577 C  CA    . ASP C 1 179 ? 39.660  70.177 86.470  1.00 23.76 ? 177 ASP C CA    1 
ATOM   5578 C  C     . ASP C 1 179 ? 39.303  70.804 87.820  1.00 25.51 ? 177 ASP C C     1 
ATOM   5579 O  O     . ASP C 1 179 ? 39.963  71.739 88.278  1.00 26.70 ? 177 ASP C O     1 
ATOM   5580 C  CB    . ASP C 1 179 ? 38.670  70.680 85.420  1.00 25.23 ? 177 ASP C CB    1 
ATOM   5581 C  CG    . ASP C 1 179 ? 39.098  70.340 84.002  1.00 28.58 ? 177 ASP C CG    1 
ATOM   5582 O  OD1   . ASP C 1 179 ? 40.303  70.460 83.709  1.00 28.65 ? 177 ASP C OD1   1 
ATOM   5583 O  OD2   . ASP C 1 179 ? 38.234  69.965 83.181  1.00 27.52 ? 177 ASP C OD2   1 
ATOM   5584 N  N     . ILE C 1 180 ? 38.244  70.294 88.443  1.00 23.29 ? 178 ILE C N     1 
ATOM   5585 C  CA    . ILE C 1 180 ? 37.787  70.802 89.733  1.00 22.13 ? 178 ILE C CA    1 
ATOM   5586 C  C     . ILE C 1 180 ? 37.695  69.633 90.695  1.00 22.98 ? 178 ILE C C     1 
ATOM   5587 O  O     . ILE C 1 180 ? 37.011  68.654 90.414  1.00 21.03 ? 178 ILE C O     1 
ATOM   5588 C  CB    . ILE C 1 180 ? 36.388  71.454 89.619  1.00 22.18 ? 178 ILE C CB    1 
ATOM   5589 C  CG1   . ILE C 1 180 ? 36.430  72.628 88.646  1.00 22.22 ? 178 ILE C CG1   1 
ATOM   5590 C  CG2   . ILE C 1 180 ? 35.915  71.943 90.990  1.00 21.06 ? 178 ILE C CG2   1 
ATOM   5591 C  CD1   . ILE C 1 180 ? 35.068  73.250 88.421  1.00 23.48 ? 178 ILE C CD1   1 
ATOM   5592 N  N     . ALA C 1 181 ? 38.385  69.737 91.825  1.00 21.73 ? 179 ALA C N     1 
ATOM   5593 C  CA    . ALA C 1 181 ? 38.365  68.674 92.819  1.00 21.47 ? 179 ALA C CA    1 
ATOM   5594 C  C     . ALA C 1 181 ? 37.806  69.189 94.138  1.00 20.71 ? 179 ALA C C     1 
ATOM   5595 O  O     . ALA C 1 181 ? 38.207  70.250 94.618  1.00 19.46 ? 179 ALA C O     1 
ATOM   5596 C  CB    . ALA C 1 181 ? 39.760  68.140 93.038  1.00 23.68 ? 179 ALA C CB    1 
ATOM   5597 N  N     . VAL C 1 182 ? 36.871  68.437 94.709  1.00 21.57 ? 180 VAL C N     1 
ATOM   5598 C  CA    . VAL C 1 182 ? 36.266  68.792 95.989  1.00 21.13 ? 180 VAL C CA    1 
ATOM   5599 C  C     . VAL C 1 182 ? 36.508  67.619 96.937  1.00 21.70 ? 180 VAL C C     1 
ATOM   5600 O  O     . VAL C 1 182 ? 36.107  66.481 96.668  1.00 22.39 ? 180 VAL C O     1 
ATOM   5601 C  CB    . VAL C 1 182 ? 34.741  69.067 95.860  1.00 21.33 ? 180 VAL C CB    1 
ATOM   5602 C  CG1   . VAL C 1 182 ? 34.146  69.355 97.228  1.00 20.77 ? 180 VAL C CG1   1 
ATOM   5603 C  CG2   . VAL C 1 182 ? 34.503  70.262 94.952  1.00 22.23 ? 180 VAL C CG2   1 
ATOM   5604 N  N     . VAL C 1 183 ? 37.182  67.903 98.044  1.00 19.67 ? 181 VAL C N     1 
ATOM   5605 C  CA    . VAL C 1 183 ? 37.511  66.883 99.024  1.00 21.34 ? 181 VAL C CA    1 
ATOM   5606 C  C     . VAL C 1 183 ? 37.342  67.432 100.433 1.00 22.24 ? 181 VAL C C     1 
ATOM   5607 O  O     . VAL C 1 183 ? 37.327  68.649 100.621 1.00 20.96 ? 181 VAL C O     1 
ATOM   5608 C  CB    . VAL C 1 183 ? 38.988  66.457 98.876  1.00 21.89 ? 181 VAL C CB    1 
ATOM   5609 C  CG1   . VAL C 1 183 ? 39.245  65.907 97.480  1.00 21.67 ? 181 VAL C CG1   1 
ATOM   5610 C  CG2   . VAL C 1 183 ? 39.898  67.668 99.113  1.00 21.29 ? 181 VAL C CG2   1 
ATOM   5611 N  N     . ASN C 1 184 ? 37.199  66.543 101.414 1.00 22.02 ? 182 ASN C N     1 
ATOM   5612 C  CA    . ASN C 1 184 ? 37.130  66.996 102.796 1.00 24.81 ? 182 ASN C CA    1 
ATOM   5613 C  C     . ASN C 1 184 ? 38.585  66.898 103.291 1.00 27.34 ? 182 ASN C C     1 
ATOM   5614 O  O     . ASN C 1 184 ? 39.458  66.447 102.547 1.00 24.57 ? 182 ASN C O     1 
ATOM   5615 C  CB    . ASN C 1 184 ? 36.186  66.126 103.643 1.00 24.92 ? 182 ASN C CB    1 
ATOM   5616 C  CG    . ASN C 1 184 ? 36.548  64.657 103.622 1.00 27.14 ? 182 ASN C CG    1 
ATOM   5617 O  OD1   . ASN C 1 184 ? 37.722  64.289 103.565 1.00 29.25 ? 182 ASN C OD1   1 
ATOM   5618 N  ND2   . ASN C 1 184 ? 35.535  63.806 103.692 1.00 29.09 ? 182 ASN C ND2   1 
ATOM   5619 N  N     . GLU C 1 185 ? 38.860  67.302 104.528 1.00 29.37 ? 183 GLU C N     1 
ATOM   5620 C  CA    . GLU C 1 185 ? 40.239  67.263 105.009 1.00 32.65 ? 183 GLU C CA    1 
ATOM   5621 C  C     . GLU C 1 185 ? 40.884  65.880 105.010 1.00 30.80 ? 183 GLU C C     1 
ATOM   5622 O  O     . GLU C 1 185 ? 42.073  65.752 104.728 1.00 30.90 ? 183 GLU C O     1 
ATOM   5623 C  CB    . GLU C 1 185 ? 40.345  67.916 106.395 1.00 36.97 ? 183 GLU C CB    1 
ATOM   5624 C  CG    . GLU C 1 185 ? 39.430  67.356 107.468 1.00 43.50 ? 183 GLU C CG    1 
ATOM   5625 C  CD    . GLU C 1 185 ? 39.165  68.369 108.583 1.00 47.50 ? 183 GLU C CD    1 
ATOM   5626 O  OE1   . GLU C 1 185 ? 39.924  69.360 108.686 1.00 50.26 ? 183 GLU C OE1   1 
ATOM   5627 O  OE2   . GLU C 1 185 ? 38.204  68.173 109.358 1.00 48.54 ? 183 GLU C OE2   1 
ATOM   5628 N  N     . SER C 1 186 ? 40.107  64.846 105.307 1.00 30.78 ? 184 SER C N     1 
ATOM   5629 C  CA    . SER C 1 186 ? 40.643  63.489 105.323 1.00 31.18 ? 184 SER C CA    1 
ATOM   5630 C  C     . SER C 1 186 ? 41.087  63.067 103.922 1.00 30.22 ? 184 SER C C     1 
ATOM   5631 O  O     . SER C 1 186 ? 42.184  62.544 103.737 1.00 29.15 ? 184 SER C O     1 
ATOM   5632 C  CB    . SER C 1 186 ? 39.593  62.505 105.847 1.00 33.14 ? 184 SER C CB    1 
ATOM   5633 O  OG    . SER C 1 186 ? 40.079  61.175 105.763 1.00 37.46 ? 184 SER C OG    1 
ATOM   5634 N  N     . GLU C 1 187 ? 40.227  63.301 102.937 1.00 27.71 ? 185 GLU C N     1 
ATOM   5635 C  CA    . GLU C 1 187 ? 40.528  62.945 101.551 1.00 27.98 ? 185 GLU C CA    1 
ATOM   5636 C  C     . GLU C 1 187 ? 41.721  63.711 100.998 1.00 26.82 ? 185 GLU C C     1 
ATOM   5637 O  O     . GLU C 1 187 ? 42.541  63.152 100.266 1.00 25.98 ? 185 GLU C O     1 
ATOM   5638 C  CB    . GLU C 1 187 ? 39.299  63.199 100.673 1.00 26.32 ? 185 GLU C CB    1 
ATOM   5639 C  CG    . GLU C 1 187 ? 38.194  62.178 100.877 1.00 26.91 ? 185 GLU C CG    1 
ATOM   5640 C  CD    . GLU C 1 187 ? 36.803  62.780 100.786 1.00 27.77 ? 185 GLU C CD    1 
ATOM   5641 O  OE1   . GLU C 1 187 ? 36.647  63.859 100.171 1.00 26.03 ? 185 GLU C OE1   1 
ATOM   5642 O  OE2   . GLU C 1 187 ? 35.862  62.162 101.323 1.00 27.17 ? 185 GLU C OE2   1 
ATOM   5643 N  N     . ALA C 1 188 ? 41.814  64.991 101.343 1.00 25.91 ? 186 ALA C N     1 
ATOM   5644 C  CA    . ALA C 1 188 ? 42.914  65.824 100.871 1.00 27.45 ? 186 ALA C CA    1 
ATOM   5645 C  C     . ALA C 1 188 ? 44.269  65.236 101.254 1.00 28.67 ? 186 ALA C C     1 
ATOM   5646 O  O     . ALA C 1 188 ? 45.190  65.201 100.440 1.00 29.92 ? 186 ALA C O     1 
ATOM   5647 C  CB    . ALA C 1 188 ? 42.785  67.232 101.435 1.00 25.98 ? 186 ALA C CB    1 
ATOM   5648 N  N     . GLU C 1 189 ? 44.381  64.758 102.486 1.00 29.71 ? 187 GLU C N     1 
ATOM   5649 C  CA    . GLU C 1 189 ? 45.642  64.201 102.958 1.00 32.13 ? 187 GLU C CA    1 
ATOM   5650 C  C     . GLU C 1 189 ? 45.845  62.799 102.417 1.00 33.16 ? 187 GLU C C     1 
ATOM   5651 O  O     . GLU C 1 189 ? 46.945  62.421 102.026 1.00 32.97 ? 187 GLU C O     1 
ATOM   5652 C  CB    . GLU C 1 189 ? 45.668  64.159 104.487 1.00 32.02 ? 187 GLU C CB    1 
ATOM   5653 C  CG    . GLU C 1 189 ? 47.036  63.823 105.063 1.00 35.91 ? 187 GLU C CG    1 
ATOM   5654 C  CD    . GLU C 1 189 ? 47.016  63.672 106.574 1.00 37.16 ? 187 GLU C CD    1 
ATOM   5655 O  OE1   . GLU C 1 189 ? 46.372  64.503 107.249 1.00 37.72 ? 187 GLU C OE1   1 
ATOM   5656 O  OE2   . GLU C 1 189 ? 47.651  62.728 107.087 1.00 39.23 ? 187 GLU C OE2   1 
ATOM   5657 N  N     . LEU C 1 190 ? 44.762  62.037 102.379 1.00 33.53 ? 188 LEU C N     1 
ATOM   5658 C  CA    . LEU C 1 190 ? 44.814  60.667 101.911 1.00 34.77 ? 188 LEU C CA    1 
ATOM   5659 C  C     . LEU C 1 190 ? 45.113  60.544 100.413 1.00 34.21 ? 188 LEU C C     1 
ATOM   5660 O  O     . LEU C 1 190 ? 45.826  59.631 99.995  1.00 35.11 ? 188 LEU C O     1 
ATOM   5661 C  CB    . LEU C 1 190 ? 43.488  59.984 102.248 1.00 37.20 ? 188 LEU C CB    1 
ATOM   5662 C  CG    . LEU C 1 190 ? 43.480  58.483 102.526 1.00 41.81 ? 188 LEU C CG    1 
ATOM   5663 C  CD1   . LEU C 1 190 ? 42.141  58.104 103.146 1.00 43.26 ? 188 LEU C CD1   1 
ATOM   5664 C  CD2   . LEU C 1 190 ? 43.734  57.706 101.247 1.00 43.09 ? 188 LEU C CD2   1 
ATOM   5665 N  N     . LEU C 1 191 ? 44.594  61.472 99.612  1.00 32.23 ? 189 LEU C N     1 
ATOM   5666 C  CA    . LEU C 1 191 ? 44.785  61.423 98.164  1.00 31.69 ? 189 LEU C CA    1 
ATOM   5667 C  C     . LEU C 1 191 ? 45.704  62.480 97.568  1.00 31.74 ? 189 LEU C C     1 
ATOM   5668 O  O     . LEU C 1 191 ? 45.967  62.462 96.372  1.00 32.89 ? 189 LEU C O     1 
ATOM   5669 C  CB    . LEU C 1 191 ? 43.423  61.483 97.462  1.00 29.69 ? 189 LEU C CB    1 
ATOM   5670 C  CG    . LEU C 1 191 ? 42.441  60.398 97.912  1.00 29.66 ? 189 LEU C CG    1 
ATOM   5671 C  CD1   . LEU C 1 191 ? 41.102  60.575 97.204  1.00 31.13 ? 189 LEU C CD1   1 
ATOM   5672 C  CD2   . LEU C 1 191 ? 43.026  59.027 97.609  1.00 31.24 ? 189 LEU C CD2   1 
ATOM   5673 N  N     . GLN C 1 192 ? 46.184  63.397 98.400  1.00 32.03 ? 190 GLN C N     1 
ATOM   5674 C  CA    . GLN C 1 192 ? 47.086  64.463 97.964  1.00 32.57 ? 190 GLN C CA    1 
ATOM   5675 C  C     . GLN C 1 192 ? 46.825  65.062 96.578  1.00 34.25 ? 190 GLN C C     1 
ATOM   5676 O  O     . GLN C 1 192 ? 47.603  64.853 95.649  1.00 33.29 ? 190 GLN C O     1 
ATOM   5677 C  CB    . GLN C 1 192 ? 48.538  63.973 98.020  1.00 32.08 ? 190 GLN C CB    1 
ATOM   5678 C  CG    . GLN C 1 192 ? 49.043  63.617 99.419  1.00 31.30 ? 190 GLN C CG    1 
ATOM   5679 C  CD    . GLN C 1 192 ? 48.970  64.785 100.389 1.00 31.14 ? 190 GLN C CD    1 
ATOM   5680 O  OE1   . GLN C 1 192 ? 49.140  65.943 100.001 1.00 29.35 ? 190 GLN C OE1   1 
ATOM   5681 N  NE2   . GLN C 1 192 ? 48.734  64.482 101.663 1.00 29.05 ? 190 GLN C NE2   1 
ATOM   5682 N  N     . PRO C 1 193 ? 45.724  65.814 96.420  1.00 36.03 ? 191 PRO C N     1 
ATOM   5683 C  CA    . PRO C 1 193 ? 45.417  66.428 95.124  1.00 36.45 ? 191 PRO C CA    1 
ATOM   5684 C  C     . PRO C 1 193 ? 46.543  67.385 94.752  1.00 38.36 ? 191 PRO C C     1 
ATOM   5685 O  O     . PRO C 1 193 ? 47.094  68.068 95.617  1.00 39.38 ? 191 PRO C O     1 
ATOM   5686 C  CB    . PRO C 1 193 ? 44.115  67.176 95.394  1.00 37.76 ? 191 PRO C CB    1 
ATOM   5687 C  CG    . PRO C 1 193 ? 43.468  66.351 96.462  1.00 38.27 ? 191 PRO C CG    1 
ATOM   5688 C  CD    . PRO C 1 193 ? 44.619  66.016 97.373  1.00 35.56 ? 191 PRO C CD    1 
ATOM   5689 N  N     . TYR C 1 194 ? 46.885  67.434 93.471  1.00 38.84 ? 192 TYR C N     1 
ATOM   5690 C  CA    . TYR C 1 194 ? 47.943  68.314 92.993  1.00 39.50 ? 192 TYR C CA    1 
ATOM   5691 C  C     . TYR C 1 194 ? 47.660  68.710 91.550  1.00 38.59 ? 192 TYR C C     1 
ATOM   5692 O  O     . TYR C 1 194 ? 46.985  67.984 90.822  1.00 37.98 ? 192 TYR C O     1 
ATOM   5693 C  CB    . TYR C 1 194 ? 49.301  67.605 93.053  1.00 42.09 ? 192 TYR C CB    1 
ATOM   5694 C  CG    . TYR C 1 194 ? 49.401  66.424 92.106  1.00 45.09 ? 192 TYR C CG    1 
ATOM   5695 C  CD1   . TYR C 1 194 ? 48.926  65.165 92.475  1.00 44.95 ? 192 TYR C CD1   1 
ATOM   5696 C  CD2   . TYR C 1 194 ? 49.926  66.579 90.819  1.00 45.28 ? 192 TYR C CD2   1 
ATOM   5697 C  CE1   . TYR C 1 194 ? 48.969  64.088 91.585  1.00 45.90 ? 192 TYR C CE1   1 
ATOM   5698 C  CE2   . TYR C 1 194 ? 49.971  65.510 89.922  1.00 45.37 ? 192 TYR C CE2   1 
ATOM   5699 C  CZ    . TYR C 1 194 ? 49.491  64.269 90.312  1.00 45.97 ? 192 TYR C CZ    1 
ATOM   5700 O  OH    . TYR C 1 194 ? 49.535  63.211 89.429  1.00 46.59 ? 192 TYR C OH    1 
ATOM   5701 N  N     . GLY C 1 195 ? 48.180  69.863 91.147  1.00 37.98 ? 193 GLY C N     1 
ATOM   5702 C  CA    . GLY C 1 195 ? 48.001  70.331 89.786  1.00 37.93 ? 193 GLY C CA    1 
ATOM   5703 C  C     . GLY C 1 195 ? 46.575  70.491 89.293  1.00 38.26 ? 193 GLY C C     1 
ATOM   5704 O  O     . GLY C 1 195 ? 46.340  70.488 88.083  1.00 38.42 ? 193 GLY C O     1 
ATOM   5705 N  N     . VAL C 1 196 ? 45.619  70.619 90.209  1.00 36.13 ? 194 VAL C N     1 
ATOM   5706 C  CA    . VAL C 1 196 ? 44.229  70.803 89.811  1.00 35.66 ? 194 VAL C CA    1 
ATOM   5707 C  C     . VAL C 1 196 ? 43.941  72.298 89.820  1.00 35.73 ? 194 VAL C C     1 
ATOM   5708 O  O     . VAL C 1 196 ? 44.221  72.978 90.807  1.00 37.21 ? 194 VAL C O     1 
ATOM   5709 C  CB    . VAL C 1 196 ? 43.255  70.094 90.782  1.00 35.50 ? 194 VAL C CB    1 
ATOM   5710 C  CG1   . VAL C 1 196 ? 41.823  70.337 90.345  1.00 34.45 ? 194 VAL C CG1   1 
ATOM   5711 C  CG2   . VAL C 1 196 ? 43.544  68.602 90.818  1.00 35.17 ? 194 VAL C CG2   1 
ATOM   5712 N  N     . LYS C 1 197 ? 43.394  72.807 88.722  1.00 34.66 ? 195 LYS C N     1 
ATOM   5713 C  CA    . LYS C 1 197 ? 43.085  74.227 88.608  1.00 35.83 ? 195 LYS C CA    1 
ATOM   5714 C  C     . LYS C 1 197 ? 42.305  74.759 89.806  1.00 34.74 ? 195 LYS C C     1 
ATOM   5715 O  O     . LYS C 1 197 ? 42.637  75.814 90.350  1.00 34.30 ? 195 LYS C O     1 
ATOM   5716 C  CB    . LYS C 1 197 ? 42.309  74.493 87.317  1.00 39.52 ? 195 LYS C CB    1 
ATOM   5717 C  CG    . LYS C 1 197 ? 43.141  74.307 86.052  1.00 43.37 ? 195 LYS C CG    1 
ATOM   5718 C  CD    . LYS C 1 197 ? 42.312  74.533 84.792  1.00 46.82 ? 195 LYS C CD    1 
ATOM   5719 C  CE    . LYS C 1 197 ? 41.318  73.401 84.578  1.00 47.64 ? 195 LYS C CE    1 
ATOM   5720 N  NZ    . LYS C 1 197 ? 42.020  72.088 84.442  1.00 47.56 ? 195 LYS C NZ    1 
ATOM   5721 N  N     . THR C 1 198 ? 41.268  74.032 90.214  1.00 31.96 ? 196 THR C N     1 
ATOM   5722 C  CA    . THR C 1 198 ? 40.459  74.441 91.356  1.00 29.23 ? 196 THR C CA    1 
ATOM   5723 C  C     . THR C 1 198 ? 40.392  73.320 92.384  1.00 28.07 ? 196 THR C C     1 
ATOM   5724 O  O     . THR C 1 198 ? 39.977  72.198 92.076  1.00 26.73 ? 196 THR C O     1 
ATOM   5725 C  CB    . THR C 1 198 ? 39.012  74.812 90.938  1.00 30.71 ? 196 THR C CB    1 
ATOM   5726 O  OG1   . THR C 1 198 ? 39.021  76.018 90.165  1.00 33.09 ? 196 THR C OG1   1 
ATOM   5727 C  CG2   . THR C 1 198 ? 38.136  75.021 92.176  1.00 31.37 ? 196 THR C CG2   1 
ATOM   5728 N  N     . LEU C 1 199 ? 40.815  73.624 93.607  1.00 25.02 ? 197 LEU C N     1 
ATOM   5729 C  CA    . LEU C 1 199 ? 40.784  72.643 94.678  1.00 24.75 ? 197 LEU C CA    1 
ATOM   5730 C  C     . LEU C 1 199 ? 39.987  73.206 95.842  1.00 25.23 ? 197 LEU C C     1 
ATOM   5731 O  O     . LEU C 1 199 ? 40.226  74.331 96.280  1.00 25.61 ? 197 LEU C O     1 
ATOM   5732 C  CB    . LEU C 1 199 ? 42.199  72.308 95.153  1.00 24.08 ? 197 LEU C CB    1 
ATOM   5733 C  CG    . LEU C 1 199 ? 42.279  71.428 96.404  1.00 25.84 ? 197 LEU C CG    1 
ATOM   5734 C  CD1   . LEU C 1 199 ? 41.691  70.055 96.100  1.00 25.64 ? 197 LEU C CD1   1 
ATOM   5735 C  CD2   . LEU C 1 199 ? 43.728  71.303 96.867  1.00 26.62 ? 197 LEU C CD2   1 
ATOM   5736 N  N     . VAL C 1 200 ? 39.035  72.423 96.334  1.00 23.62 ? 198 VAL C N     1 
ATOM   5737 C  CA    . VAL C 1 200 ? 38.224  72.839 97.465  1.00 21.79 ? 198 VAL C CA    1 
ATOM   5738 C  C     . VAL C 1 200 ? 38.381  71.796 98.557  1.00 21.29 ? 198 VAL C C     1 
ATOM   5739 O  O     . VAL C 1 200 ? 38.198  70.601 98.321  1.00 20.03 ? 198 VAL C O     1 
ATOM   5740 C  CB    . VAL C 1 200 ? 36.729  72.968 97.075  1.00 22.50 ? 198 VAL C CB    1 
ATOM   5741 C  CG1   . VAL C 1 200 ? 35.879  73.194 98.315  1.00 22.69 ? 198 VAL C CG1   1 
ATOM   5742 C  CG2   . VAL C 1 200 ? 36.549  74.117 96.094  1.00 23.57 ? 198 VAL C CG2   1 
ATOM   5743 N  N     . ILE C 1 201 ? 38.767  72.250 99.743  1.00 21.13 ? 199 ILE C N     1 
ATOM   5744 C  CA    . ILE C 1 201 ? 38.937  71.362 100.880 1.00 22.42 ? 199 ILE C CA    1 
ATOM   5745 C  C     . ILE C 1 201 ? 37.924  71.793 101.934 1.00 22.62 ? 199 ILE C C     1 
ATOM   5746 O  O     . ILE C 1 201 ? 38.037  72.877 102.498 1.00 21.52 ? 199 ILE C O     1 
ATOM   5747 C  CB    . ILE C 1 201 ? 40.357  71.478 101.485 1.00 26.00 ? 199 ILE C CB    1 
ATOM   5748 C  CG1   . ILE C 1 201 ? 41.413  71.231 100.401 1.00 26.02 ? 199 ILE C CG1   1 
ATOM   5749 C  CG2   . ILE C 1 201 ? 40.526  70.457 102.607 1.00 26.07 ? 199 ILE C CG2   1 
ATOM   5750 C  CD1   . ILE C 1 201 ? 42.849  71.418 100.890 1.00 28.61 ? 199 ILE C CD1   1 
ATOM   5751 N  N     . THR C 1 202 ? 36.922  70.956 102.180 1.00 22.13 ? 200 THR C N     1 
ATOM   5752 C  CA    . THR C 1 202 ? 35.908  71.275 103.175 1.00 21.57 ? 200 THR C CA    1 
ATOM   5753 C  C     . THR C 1 202 ? 36.333  70.756 104.550 1.00 22.40 ? 200 THR C C     1 
ATOM   5754 O  O     . THR C 1 202 ? 37.011  69.727 104.660 1.00 20.57 ? 200 THR C O     1 
ATOM   5755 C  CB    . THR C 1 202 ? 34.546  70.656 102.812 1.00 20.70 ? 200 THR C CB    1 
ATOM   5756 O  OG1   . THR C 1 202 ? 34.649  69.227 102.853 1.00 21.31 ? 200 THR C OG1   1 
ATOM   5757 C  CG2   . THR C 1 202 ? 34.112  71.104 101.422 1.00 20.34 ? 200 THR C CG2   1 
ATOM   5758 N  N     . GLN C 1 203 ? 35.912  71.467 105.593 1.00 21.18 ? 201 GLN C N     1 
ATOM   5759 C  CA    . GLN C 1 203 ? 36.265  71.107 106.966 1.00 24.99 ? 201 GLN C CA    1 
ATOM   5760 C  C     . GLN C 1 203 ? 35.085  71.205 107.933 1.00 25.57 ? 201 GLN C C     1 
ATOM   5761 O  O     . GLN C 1 203 ? 35.192  71.806 109.009 1.00 26.00 ? 201 GLN C O     1 
ATOM   5762 C  CB    . GLN C 1 203 ? 37.405  72.007 107.459 1.00 26.10 ? 201 GLN C CB    1 
ATOM   5763 C  CG    . GLN C 1 203 ? 38.685  71.875 106.653 1.00 30.17 ? 201 GLN C CG    1 
ATOM   5764 C  CD    . GLN C 1 203 ? 39.804  72.774 107.167 1.00 33.22 ? 201 GLN C CD    1 
ATOM   5765 O  OE1   . GLN C 1 203 ? 39.774  73.990 106.996 1.00 37.19 ? 201 GLN C OE1   1 
ATOM   5766 N  NE2   . GLN C 1 203 ? 40.789  72.171 107.810 1.00 37.76 ? 201 GLN C NE2   1 
ATOM   5767 N  N     . GLY C 1 204 ? 33.957  70.624 107.540 1.00 25.46 ? 202 GLY C N     1 
ATOM   5768 C  CA    . GLY C 1 204 ? 32.782  70.637 108.392 1.00 23.71 ? 202 GLY C CA    1 
ATOM   5769 C  C     . GLY C 1 204 ? 32.409  71.993 108.963 1.00 24.01 ? 202 GLY C C     1 
ATOM   5770 O  O     . GLY C 1 204 ? 32.428  73.013 108.264 1.00 22.77 ? 202 GLY C O     1 
ATOM   5771 N  N     . ALA C 1 205 ? 32.067  72.012 110.245 1.00 24.02 ? 203 ALA C N     1 
ATOM   5772 C  CA    . ALA C 1 205 ? 31.674  73.257 110.895 1.00 26.84 ? 203 ALA C CA    1 
ATOM   5773 C  C     . ALA C 1 205 ? 32.780  74.308 110.828 1.00 27.75 ? 203 ALA C C     1 
ATOM   5774 O  O     . ALA C 1 205 ? 32.523  75.491 111.055 1.00 30.48 ? 203 ALA C O     1 
ATOM   5775 C  CB    . ALA C 1 205 ? 31.290  72.987 112.348 1.00 26.97 ? 203 ALA C CB    1 
ATOM   5776 N  N     . ALA C 1 206 ? 33.998  73.867 110.512 1.00 27.82 ? 204 ALA C N     1 
ATOM   5777 C  CA    . ALA C 1 206 ? 35.161  74.747 110.413 1.00 29.02 ? 204 ALA C CA    1 
ATOM   5778 C  C     . ALA C 1 206 ? 35.401  75.321 109.009 1.00 29.43 ? 204 ALA C C     1 
ATOM   5779 O  O     . ALA C 1 206 ? 36.547  75.614 108.646 1.00 31.58 ? 204 ALA C O     1 
ATOM   5780 C  CB    . ALA C 1 206 ? 36.413  74.009 110.888 1.00 30.23 ? 204 ALA C CB    1 
ATOM   5781 N  N     . GLY C 1 207 ? 34.335  75.457 108.222 1.00 23.46 ? 205 GLY C N     1 
ATOM   5782 C  CA    . GLY C 1 207 ? 34.440  76.046 106.895 1.00 21.85 ? 205 GLY C CA    1 
ATOM   5783 C  C     . GLY C 1 207 ? 35.045  75.253 105.746 1.00 21.31 ? 205 GLY C C     1 
ATOM   5784 O  O     . GLY C 1 207 ? 35.047  74.025 105.740 1.00 20.70 ? 205 GLY C O     1 
ATOM   5785 N  N     . ALA C 1 208 ? 35.558  75.978 104.760 1.00 19.72 ? 206 ALA C N     1 
ATOM   5786 C  CA    . ALA C 1 208 ? 36.164  75.361 103.584 1.00 20.95 ? 206 ALA C CA    1 
ATOM   5787 C  C     . ALA C 1 208 ? 37.195  76.274 102.932 1.00 21.18 ? 206 ALA C C     1 
ATOM   5788 O  O     . ALA C 1 208 ? 37.072  77.497 102.957 1.00 20.56 ? 206 ALA C O     1 
ATOM   5789 C  CB    . ALA C 1 208 ? 35.080  75.010 102.574 1.00 20.85 ? 206 ALA C CB    1 
ATOM   5790 N  N     . TRP C 1 209 ? 38.208  75.661 102.335 1.00 21.78 ? 207 TRP C N     1 
ATOM   5791 C  CA    . TRP C 1 209 ? 39.256  76.404 101.654 1.00 23.70 ? 207 TRP C CA    1 
ATOM   5792 C  C     . TRP C 1 209 ? 39.106  76.312 100.142 1.00 24.68 ? 207 TRP C C     1 
ATOM   5793 O  O     . TRP C 1 209 ? 38.733  75.264 99.613  1.00 24.60 ? 207 TRP C O     1 
ATOM   5794 C  CB    . TRP C 1 209 ? 40.630  75.830 101.992 1.00 23.32 ? 207 TRP C CB    1 
ATOM   5795 C  CG    . TRP C 1 209 ? 41.136  76.135 103.346 1.00 24.14 ? 207 TRP C CG    1 
ATOM   5796 C  CD1   . TRP C 1 209 ? 41.005  75.367 104.467 1.00 25.50 ? 207 TRP C CD1   1 
ATOM   5797 C  CD2   . TRP C 1 209 ? 41.896  77.283 103.728 1.00 24.01 ? 207 TRP C CD2   1 
ATOM   5798 N  NE1   . TRP C 1 209 ? 41.646  75.968 105.525 1.00 25.30 ? 207 TRP C NE1   1 
ATOM   5799 C  CE2   . TRP C 1 209 ? 42.201  77.144 105.099 1.00 24.37 ? 207 TRP C CE2   1 
ATOM   5800 C  CE3   . TRP C 1 209 ? 42.353  78.418 103.042 1.00 24.77 ? 207 TRP C CE3   1 
ATOM   5801 C  CZ2   . TRP C 1 209 ? 42.947  78.101 105.804 1.00 25.83 ? 207 TRP C CZ2   1 
ATOM   5802 C  CZ3   . TRP C 1 209 ? 43.098  79.374 103.742 1.00 25.66 ? 207 TRP C CZ3   1 
ATOM   5803 C  CH2   . TRP C 1 209 ? 43.386  79.205 105.110 1.00 25.70 ? 207 TRP C CH2   1 
ATOM   5804 N  N     . LEU C 1 210 ? 39.398  77.413 99.459  1.00 24.86 ? 208 LEU C N     1 
ATOM   5805 C  CA    . LEU C 1 210 ? 39.403  77.441 98.003  1.00 25.49 ? 208 LEU C CA    1 
ATOM   5806 C  C     . LEU C 1 210 ? 40.884  77.637 97.639  1.00 28.59 ? 208 LEU C C     1 
ATOM   5807 O  O     . LEU C 1 210 ? 41.502  78.632 98.035  1.00 26.09 ? 208 LEU C O     1 
ATOM   5808 C  CB    . LEU C 1 210 ? 38.579  78.608 97.463  1.00 25.27 ? 208 LEU C CB    1 
ATOM   5809 C  CG    . LEU C 1 210 ? 38.744  78.878 95.962  1.00 25.61 ? 208 LEU C CG    1 
ATOM   5810 C  CD1   . LEU C 1 210 ? 38.420  77.619 95.161  1.00 27.27 ? 208 LEU C CD1   1 
ATOM   5811 C  CD2   . LEU C 1 210 ? 37.834  80.024 95.548  1.00 27.47 ? 208 LEU C CD2   1 
ATOM   5812 N  N     . VAL C 1 211 ? 41.455  76.685 96.910  1.00 27.82 ? 209 VAL C N     1 
ATOM   5813 C  CA    . VAL C 1 211 ? 42.860  76.769 96.519  1.00 30.81 ? 209 VAL C CA    1 
ATOM   5814 C  C     . VAL C 1 211 ? 42.982  76.835 94.996  1.00 32.50 ? 209 VAL C C     1 
ATOM   5815 O  O     . VAL C 1 211 ? 42.675  75.868 94.298  1.00 30.85 ? 209 VAL C O     1 
ATOM   5816 C  CB    . VAL C 1 211 ? 43.645  75.551 97.046  1.00 30.21 ? 209 VAL C CB    1 
ATOM   5817 C  CG1   . VAL C 1 211 ? 45.133  75.741 96.807  1.00 34.91 ? 209 VAL C CG1   1 
ATOM   5818 C  CG2   . VAL C 1 211 ? 43.371  75.363 98.523  1.00 31.84 ? 209 VAL C CG2   1 
ATOM   5819 N  N     . GLN C 1 212 ? 43.420  77.985 94.490  1.00 35.90 ? 210 GLN C N     1 
ATOM   5820 C  CA    . GLN C 1 212 ? 43.580  78.195 93.051  1.00 40.06 ? 210 GLN C CA    1 
ATOM   5821 C  C     . GLN C 1 212 ? 44.861  78.960 92.731  1.00 43.35 ? 210 GLN C C     1 
ATOM   5822 O  O     . GLN C 1 212 ? 45.273  79.829 93.495  1.00 44.78 ? 210 GLN C O     1 
ATOM   5823 C  CB    . GLN C 1 212 ? 42.406  78.999 92.495  1.00 40.33 ? 210 GLN C CB    1 
ATOM   5824 C  CG    . GLN C 1 212 ? 41.043  78.368 92.677  1.00 42.64 ? 210 GLN C CG    1 
ATOM   5825 C  CD    . GLN C 1 212 ? 39.943  79.237 92.105  1.00 43.01 ? 210 GLN C CD    1 
ATOM   5826 O  OE1   . GLN C 1 212 ? 39.853  80.423 92.429  1.00 44.90 ? 210 GLN C OE1   1 
ATOM   5827 N  NE2   . GLN C 1 212 ? 39.100  78.657 91.251  1.00 41.63 ? 210 GLN C NE2   1 
ATOM   5828 N  N     . GLU C 1 213 ? 45.466  78.644 91.589  1.00 46.65 ? 211 GLU C N     1 
ATOM   5829 C  CA    . GLU C 1 213 ? 46.696  79.296 91.134  1.00 49.52 ? 211 GLU C CA    1 
ATOM   5830 C  C     . GLU C 1 213 ? 47.478  79.961 92.264  1.00 49.52 ? 211 GLU C C     1 
ATOM   5831 O  O     . GLU C 1 213 ? 47.607  81.187 92.317  1.00 49.68 ? 211 GLU C O     1 
ATOM   5832 C  CB    . GLU C 1 213 ? 46.370  80.326 90.042  1.00 52.25 ? 211 GLU C CB    1 
ATOM   5833 C  CG    . GLU C 1 213 ? 47.588  81.071 89.489  1.00 56.66 ? 211 GLU C CG    1 
ATOM   5834 C  CD    . GLU C 1 213 ? 47.290  81.826 88.198  1.00 59.40 ? 211 GLU C CD    1 
ATOM   5835 O  OE1   . GLU C 1 213 ? 48.140  82.641 87.775  1.00 59.77 ? 211 GLU C OE1   1 
ATOM   5836 O  OE2   . GLU C 1 213 ? 46.213  81.594 87.602  1.00 61.59 ? 211 GLU C OE2   1 
ATOM   5837 N  N     . GLY C 1 214 ? 47.980  79.138 93.178  1.00 49.46 ? 212 GLY C N     1 
ATOM   5838 C  CA    . GLY C 1 214 ? 48.757  79.643 94.295  1.00 49.33 ? 212 GLY C CA    1 
ATOM   5839 C  C     . GLY C 1 214 ? 47.990  80.294 95.434  1.00 48.20 ? 212 GLY C C     1 
ATOM   5840 O  O     . GLY C 1 214 ? 48.430  80.233 96.584  1.00 49.14 ? 212 GLY C O     1 
ATOM   5841 N  N     . GLN C 1 215 ? 46.849  80.909 95.129  1.00 46.30 ? 213 GLN C N     1 
ATOM   5842 C  CA    . GLN C 1 215 ? 46.047  81.594 96.141  1.00 44.26 ? 213 GLN C CA    1 
ATOM   5843 C  C     . GLN C 1 215 ? 45.133  80.680 96.954  1.00 42.38 ? 213 GLN C C     1 
ATOM   5844 O  O     . GLN C 1 215 ? 44.538  79.744 96.424  1.00 41.92 ? 213 GLN C O     1 
ATOM   5845 C  CB    . GLN C 1 215 ? 45.197  82.689 95.490  1.00 46.64 ? 213 GLN C CB    1 
ATOM   5846 C  CG    . GLN C 1 215 ? 45.955  83.608 94.539  1.00 49.13 ? 213 GLN C CG    1 
ATOM   5847 C  CD    . GLN C 1 215 ? 47.331  83.996 95.057  1.00 50.47 ? 213 GLN C CD    1 
ATOM   5848 O  OE1   . GLN C 1 215 ? 48.284  83.222 94.956  1.00 49.96 ? 213 GLN C OE1   1 
ATOM   5849 N  NE2   . GLN C 1 215 ? 47.437  85.196 95.623  1.00 49.99 ? 213 GLN C NE2   1 
ATOM   5850 N  N     . ARG C 1 216 ? 45.028  80.970 98.247  1.00 39.26 ? 214 ARG C N     1 
ATOM   5851 C  CA    . ARG C 1 216 ? 44.180  80.201 99.148  1.00 37.81 ? 214 ARG C CA    1 
ATOM   5852 C  C     . ARG C 1 216 ? 43.215  81.161 99.824  1.00 36.79 ? 214 ARG C C     1 
ATOM   5853 O  O     . ARG C 1 216 ? 43.622  82.201 100.340 1.00 36.62 ? 214 ARG C O     1 
ATOM   5854 C  CB    . ARG C 1 216 ? 45.010  79.508 100.231 1.00 38.74 ? 214 ARG C CB    1 
ATOM   5855 C  CG    . ARG C 1 216 ? 46.244  78.776 99.737  1.00 43.75 ? 214 ARG C CG    1 
ATOM   5856 C  CD    . ARG C 1 216 ? 46.932  78.058 100.892 1.00 44.77 ? 214 ARG C CD    1 
ATOM   5857 N  NE    . ARG C 1 216 ? 48.245  77.531 100.533 1.00 46.53 ? 214 ARG C NE    1 
ATOM   5858 C  CZ    . ARG C 1 216 ? 49.329  78.283 100.360 1.00 46.50 ? 214 ARG C CZ    1 
ATOM   5859 N  NH1   . ARG C 1 216 ? 49.260  79.598 100.512 1.00 46.52 ? 214 ARG C NH1   1 
ATOM   5860 N  NH2   . ARG C 1 216 ? 50.484  77.717 100.038 1.00 47.70 ? 214 ARG C NH2   1 
ATOM   5861 N  N     . GLN C 1 217 ? 41.937  80.813 99.821  1.00 34.09 ? 215 GLN C N     1 
ATOM   5862 C  CA    . GLN C 1 217 ? 40.927  81.645 100.456 1.00 32.72 ? 215 GLN C CA    1 
ATOM   5863 C  C     . GLN C 1 217 ? 40.080  80.768 101.360 1.00 31.27 ? 215 GLN C C     1 
ATOM   5864 O  O     . GLN C 1 217 ? 39.644  79.689 100.964 1.00 29.78 ? 215 GLN C O     1 
ATOM   5865 C  CB    . GLN C 1 217 ? 40.042  82.312 99.405  1.00 34.24 ? 215 GLN C CB    1 
ATOM   5866 C  CG    . GLN C 1 217 ? 40.767  83.334 98.554  1.00 36.61 ? 215 GLN C CG    1 
ATOM   5867 C  CD    . GLN C 1 217 ? 39.871  83.948 97.498  1.00 38.34 ? 215 GLN C CD    1 
ATOM   5868 O  OE1   . GLN C 1 217 ? 39.439  83.271 96.566  1.00 39.82 ? 215 GLN C OE1   1 
ATOM   5869 N  NE2   . GLN C 1 217 ? 39.584  85.237 97.642  1.00 39.98 ? 215 GLN C NE2   1 
ATOM   5870 N  N     . PHE C 1 218 ? 39.850  81.234 102.579 1.00 29.69 ? 216 PHE C N     1 
ATOM   5871 C  CA    . PHE C 1 218 ? 39.062  80.472 103.521 1.00 28.73 ? 216 PHE C CA    1 
ATOM   5872 C  C     . PHE C 1 218 ? 37.648  81.008 103.660 1.00 29.37 ? 216 PHE C C     1 
ATOM   5873 O  O     . PHE C 1 218 ? 37.441  82.208 103.856 1.00 30.26 ? 216 PHE C O     1 
ATOM   5874 C  CB    . PHE C 1 218 ? 39.721  80.477 104.890 1.00 28.82 ? 216 PHE C CB    1 
ATOM   5875 C  CG    . PHE C 1 218 ? 38.930  79.751 105.928 1.00 29.68 ? 216 PHE C CG    1 
ATOM   5876 C  CD1   . PHE C 1 218 ? 38.855  78.369 105.914 1.00 25.94 ? 216 PHE C CD1   1 
ATOM   5877 C  CD2   . PHE C 1 218 ? 38.229  80.456 106.907 1.00 29.79 ? 216 PHE C CD2   1 
ATOM   5878 C  CE1   . PHE C 1 218 ? 38.095  77.690 106.861 1.00 30.77 ? 216 PHE C CE1   1 
ATOM   5879 C  CE2   . PHE C 1 218 ? 37.467  79.788 107.854 1.00 29.82 ? 216 PHE C CE2   1 
ATOM   5880 C  CZ    . PHE C 1 218 ? 37.399  78.403 107.833 1.00 28.17 ? 216 PHE C CZ    1 
ATOM   5881 N  N     . CYS C 1 219 ? 36.676  80.112 103.560 1.00 26.72 ? 217 CYS C N     1 
ATOM   5882 C  CA    . CYS C 1 219 ? 35.280  80.498 103.699 1.00 24.86 ? 217 CYS C CA    1 
ATOM   5883 C  C     . CYS C 1 219 ? 34.738  79.858 104.967 1.00 24.84 ? 217 CYS C C     1 
ATOM   5884 O  O     . CYS C 1 219 ? 34.660  78.638 105.077 1.00 24.04 ? 217 CYS C O     1 
ATOM   5885 C  CB    . CYS C 1 219 ? 34.457  80.027 102.503 1.00 24.90 ? 217 CYS C CB    1 
ATOM   5886 S  SG    . CYS C 1 219 ? 32.730  80.563 102.595 1.00 25.97 ? 217 CYS C SG    1 
ATOM   5887 N  N     . PRO C 1 220 ? 34.360  80.680 105.950 1.00 25.64 ? 218 PRO C N     1 
ATOM   5888 C  CA    . PRO C 1 220 ? 33.831  80.139 107.200 1.00 24.31 ? 218 PRO C CA    1 
ATOM   5889 C  C     . PRO C 1 220 ? 32.456  79.518 106.986 1.00 23.67 ? 218 PRO C C     1 
ATOM   5890 O  O     . PRO C 1 220 ? 31.725  79.909 106.077 1.00 25.08 ? 218 PRO C O     1 
ATOM   5891 C  CB    . PRO C 1 220 ? 33.775  81.367 108.102 1.00 25.70 ? 218 PRO C CB    1 
ATOM   5892 C  CG    . PRO C 1 220 ? 33.409  82.447 107.131 1.00 26.84 ? 218 PRO C CG    1 
ATOM   5893 C  CD    . PRO C 1 220 ? 34.307  82.154 105.947 1.00 26.14 ? 218 PRO C CD    1 
ATOM   5894 N  N     . ALA C 1 221 ? 32.116  78.544 107.820 1.00 24.06 ? 219 ALA C N     1 
ATOM   5895 C  CA    . ALA C 1 221 ? 30.820  77.887 107.736 1.00 24.07 ? 219 ALA C CA    1 
ATOM   5896 C  C     . ALA C 1 221 ? 29.767  78.817 108.331 1.00 25.21 ? 219 ALA C C     1 
ATOM   5897 O  O     . ALA C 1 221 ? 30.086  79.668 109.156 1.00 23.96 ? 219 ALA C O     1 
ATOM   5898 C  CB    . ALA C 1 221 ? 30.851  76.576 108.521 1.00 23.55 ? 219 ALA C CB    1 
ATOM   5899 N  N     . VAL C 1 222 ? 28.522  78.655 107.898 1.00 24.57 ? 220 VAL C N     1 
ATOM   5900 C  CA    . VAL C 1 222 ? 27.403  79.443 108.417 1.00 24.51 ? 220 VAL C CA    1 
ATOM   5901 C  C     . VAL C 1 222 ? 26.964  78.708 109.691 1.00 25.72 ? 220 VAL C C     1 
ATOM   5902 O  O     . VAL C 1 222 ? 26.634  77.524 109.643 1.00 24.33 ? 220 VAL C O     1 
ATOM   5903 C  CB    . VAL C 1 222 ? 26.239  79.465 107.389 1.00 24.32 ? 220 VAL C CB    1 
ATOM   5904 C  CG1   . VAL C 1 222 ? 25.010  80.125 107.985 1.00 25.71 ? 220 VAL C CG1   1 
ATOM   5905 C  CG2   . VAL C 1 222 ? 26.677  80.214 106.138 1.00 26.62 ? 220 VAL C CG2   1 
ATOM   5906 N  N     . PRO C 1 223 ? 26.957  79.390 110.848 1.00 25.50 ? 221 PRO C N     1 
ATOM   5907 C  CA    . PRO C 1 223 ? 26.540  78.649 112.047 1.00 25.41 ? 221 PRO C CA    1 
ATOM   5908 C  C     . PRO C 1 223 ? 25.185  77.958 111.889 1.00 24.25 ? 221 PRO C C     1 
ATOM   5909 O  O     . PRO C 1 223 ? 24.255  78.517 111.319 1.00 21.69 ? 221 PRO C O     1 
ATOM   5910 C  CB    . PRO C 1 223 ? 26.570  79.718 113.150 1.00 27.43 ? 221 PRO C CB    1 
ATOM   5911 C  CG    . PRO C 1 223 ? 26.356  81.008 112.398 1.00 30.29 ? 221 PRO C CG    1 
ATOM   5912 C  CD    . PRO C 1 223 ? 27.172  80.817 111.142 1.00 25.49 ? 221 PRO C CD    1 
ATOM   5913 N  N     . ALA C 1 224 ? 25.091  76.726 112.379 1.00 23.79 ? 222 ALA C N     1 
ATOM   5914 C  CA    . ALA C 1 224 ? 23.859  75.961 112.263 1.00 24.07 ? 222 ALA C CA    1 
ATOM   5915 C  C     . ALA C 1 224 ? 23.733  74.909 113.348 1.00 23.82 ? 222 ALA C C     1 
ATOM   5916 O  O     . ALA C 1 224 ? 24.726  74.456 113.904 1.00 24.70 ? 222 ALA C O     1 
ATOM   5917 C  CB    . ALA C 1 224 ? 23.797  75.283 110.891 1.00 23.99 ? 222 ALA C CB    1 
ATOM   5918 N  N     . GLU C 1 225 ? 22.496  74.535 113.656 1.00 24.96 ? 223 GLU C N     1 
ATOM   5919 C  CA    . GLU C 1 225 ? 22.261  73.490 114.634 1.00 26.56 ? 223 GLU C CA    1 
ATOM   5920 C  C     . GLU C 1 225 ? 22.340  72.207 113.810 1.00 26.66 ? 223 GLU C C     1 
ATOM   5921 O  O     . GLU C 1 225 ? 21.504  71.967 112.940 1.00 26.43 ? 223 GLU C O     1 
ATOM   5922 C  CB    . GLU C 1 225 ? 20.876  73.630 115.263 1.00 26.42 ? 223 GLU C CB    1 
ATOM   5923 C  CG    . GLU C 1 225 ? 20.551  72.533 116.260 1.00 30.79 ? 223 GLU C CG    1 
ATOM   5924 C  CD    . GLU C 1 225 ? 21.485  72.522 117.463 1.00 34.72 ? 223 GLU C CD    1 
ATOM   5925 O  OE1   . GLU C 1 225 ? 21.444  71.532 118.222 1.00 36.54 ? 223 GLU C OE1   1 
ATOM   5926 O  OE2   . GLU C 1 225 ? 22.248  73.495 117.658 1.00 34.71 ? 223 GLU C OE2   1 
ATOM   5927 N  N     . ALA C 1 226 ? 23.354  71.396 114.078 1.00 27.50 ? 224 ALA C N     1 
ATOM   5928 C  CA    . ALA C 1 226 ? 23.564  70.157 113.337 1.00 28.30 ? 224 ALA C CA    1 
ATOM   5929 C  C     . ALA C 1 226 ? 22.670  69.009 113.786 1.00 28.04 ? 224 ALA C C     1 
ATOM   5930 O  O     . ALA C 1 226 ? 23.102  68.157 114.556 1.00 30.31 ? 224 ALA C O     1 
ATOM   5931 C  CB    . ALA C 1 226 ? 25.027  69.741 113.443 1.00 28.42 ? 224 ALA C CB    1 
ATOM   5932 N  N     . LEU C 1 227 ? 21.432  68.981 113.301 1.00 26.48 ? 225 LEU C N     1 
ATOM   5933 C  CA    . LEU C 1 227 ? 20.515  67.910 113.665 1.00 26.82 ? 225 LEU C CA    1 
ATOM   5934 C  C     . LEU C 1 227 ? 20.869  66.643 112.895 1.00 27.28 ? 225 LEU C C     1 
ATOM   5935 O  O     . LEU C 1 227 ? 20.767  65.543 113.431 1.00 25.83 ? 225 LEU C O     1 
ATOM   5936 C  CB    . LEU C 1 227 ? 19.067  68.287 113.344 1.00 27.98 ? 225 LEU C CB    1 
ATOM   5937 C  CG    . LEU C 1 227 ? 18.451  69.542 113.980 1.00 30.84 ? 225 LEU C CG    1 
ATOM   5938 C  CD1   . LEU C 1 227 ? 16.946  69.555 113.695 1.00 29.52 ? 225 LEU C CD1   1 
ATOM   5939 C  CD2   . LEU C 1 227 ? 18.714  69.557 115.480 1.00 31.43 ? 225 LEU C CD2   1 
ATOM   5940 N  N     . ASP C 1 228 ? 21.272  66.810 111.634 1.00 24.38 ? 226 ASP C N     1 
ATOM   5941 C  CA    . ASP C 1 228 ? 21.642  65.682 110.770 1.00 23.67 ? 226 ASP C CA    1 
ATOM   5942 C  C     . ASP C 1 228 ? 22.583  66.223 109.695 1.00 21.68 ? 226 ASP C C     1 
ATOM   5943 O  O     . ASP C 1 228 ? 22.167  67.011 108.853 1.00 22.34 ? 226 ASP C O     1 
ATOM   5944 C  CB    . ASP C 1 228 ? 20.384  65.084 110.117 1.00 23.27 ? 226 ASP C CB    1 
ATOM   5945 C  CG    . ASP C 1 228 ? 20.659  63.760 109.412 1.00 25.33 ? 226 ASP C CG    1 
ATOM   5946 O  OD1   . ASP C 1 228 ? 21.840  63.464 109.137 1.00 23.06 ? 226 ASP C OD1   1 
ATOM   5947 O  OD2   . ASP C 1 228 ? 19.692  63.018 109.123 1.00 27.18 ? 226 ASP C OD2   1 
ATOM   5948 N  N     . THR C 1 229 ? 23.849  65.809 109.735 1.00 21.32 ? 227 THR C N     1 
ATOM   5949 C  CA    . THR C 1 229 ? 24.850  66.292 108.783 1.00 21.84 ? 227 THR C CA    1 
ATOM   5950 C  C     . THR C 1 229 ? 24.890  65.541 107.454 1.00 21.78 ? 227 THR C C     1 
ATOM   5951 O  O     . THR C 1 229 ? 25.623  65.923 106.542 1.00 19.30 ? 227 THR C O     1 
ATOM   5952 C  CB    . THR C 1 229 ? 26.265  66.256 109.409 1.00 21.74 ? 227 THR C CB    1 
ATOM   5953 O  OG1   . THR C 1 229 ? 26.578  64.912 109.801 1.00 23.52 ? 227 THR C OG1   1 
ATOM   5954 C  CG2   . THR C 1 229 ? 26.322  67.159 110.639 1.00 23.70 ? 227 THR C CG2   1 
ATOM   5955 N  N     . THR C 1 230 ? 24.095  64.483 107.334 1.00 19.86 ? 228 THR C N     1 
ATOM   5956 C  CA    . THR C 1 230 ? 24.079  63.710 106.096 1.00 20.80 ? 228 THR C CA    1 
ATOM   5957 C  C     . THR C 1 230 ? 23.821  64.580 104.866 1.00 19.95 ? 228 THR C C     1 
ATOM   5958 O  O     . THR C 1 230 ? 22.864  65.357 104.829 1.00 20.25 ? 228 THR C O     1 
ATOM   5959 C  CB    . THR C 1 230 ? 23.005  62.613 106.144 1.00 21.67 ? 228 THR C CB    1 
ATOM   5960 O  OG1   . THR C 1 230 ? 23.296  61.715 107.226 1.00 24.38 ? 228 THR C OG1   1 
ATOM   5961 C  CG2   . THR C 1 230 ? 22.984  61.837 104.824 1.00 21.42 ? 228 THR C CG2   1 
ATOM   5962 N  N     . GLY C 1 231 ? 24.681  64.443 103.863 1.00 19.52 ? 229 GLY C N     1 
ATOM   5963 C  CA    . GLY C 1 231 ? 24.518  65.206 102.636 1.00 20.27 ? 229 GLY C CA    1 
ATOM   5964 C  C     . GLY C 1 231 ? 25.059  66.628 102.645 1.00 19.81 ? 229 GLY C C     1 
ATOM   5965 O  O     . GLY C 1 231 ? 24.884  67.364 101.670 1.00 19.34 ? 229 GLY C O     1 
ATOM   5966 N  N     . ALA C 1 232 ? 25.715  67.018 103.733 1.00 20.36 ? 230 ALA C N     1 
ATOM   5967 C  CA    . ALA C 1 232 ? 26.280  68.361 103.836 1.00 21.32 ? 230 ALA C CA    1 
ATOM   5968 C  C     . ALA C 1 232 ? 27.300  68.605 102.721 1.00 20.56 ? 230 ALA C C     1 
ATOM   5969 O  O     . ALA C 1 232 ? 27.250  69.631 102.040 1.00 19.20 ? 230 ALA C O     1 
ATOM   5970 C  CB    . ALA C 1 232 ? 26.939  68.554 105.206 1.00 21.83 ? 230 ALA C CB    1 
ATOM   5971 N  N     . GLY C 1 233 ? 28.215  67.654 102.540 1.00 18.39 ? 231 GLY C N     1 
ATOM   5972 C  CA    . GLY C 1 233 ? 29.228  67.778 101.507 1.00 20.31 ? 231 GLY C CA    1 
ATOM   5973 C  C     . GLY C 1 233 ? 28.642  67.804 100.104 1.00 20.17 ? 231 GLY C C     1 
ATOM   5974 O  O     . GLY C 1 233 ? 29.105  68.547 99.235  1.00 18.88 ? 231 GLY C O     1 
ATOM   5975 N  N     . ASP C 1 234 ? 27.623  66.986 99.875  1.00 18.52 ? 232 ASP C N     1 
ATOM   5976 C  CA    . ASP C 1 234 ? 26.981  66.935 98.567  1.00 18.53 ? 232 ASP C CA    1 
ATOM   5977 C  C     . ASP C 1 234 ? 26.287  68.262 98.288  1.00 18.10 ? 232 ASP C C     1 
ATOM   5978 O  O     . ASP C 1 234 ? 26.309  68.776 97.163  1.00 17.27 ? 232 ASP C O     1 
ATOM   5979 C  CB    . ASP C 1 234 ? 25.962  65.794 98.521  1.00 19.06 ? 232 ASP C CB    1 
ATOM   5980 C  CG    . ASP C 1 234 ? 26.601  64.431 98.751  1.00 20.73 ? 232 ASP C CG    1 
ATOM   5981 O  OD1   . ASP C 1 234 ? 27.700  64.193 98.203  1.00 22.73 ? 232 ASP C OD1   1 
ATOM   5982 O  OD2   . ASP C 1 234 ? 26.000  63.595 99.466  1.00 20.51 ? 232 ASP C OD2   1 
ATOM   5983 N  N     . THR C 1 235 ? 25.678  68.829 99.320  1.00 17.77 ? 233 THR C N     1 
ATOM   5984 C  CA    . THR C 1 235 ? 24.989  70.094 99.154  1.00 18.60 ? 233 THR C CA    1 
ATOM   5985 C  C     . THR C 1 235 ? 25.994  71.181 98.813  1.00 17.72 ? 233 THR C C     1 
ATOM   5986 O  O     . THR C 1 235 ? 25.779  71.984 97.895  1.00 18.04 ? 233 THR C O     1 
ATOM   5987 C  CB    . THR C 1 235 ? 24.233  70.493 100.435 1.00 19.97 ? 233 THR C CB    1 
ATOM   5988 O  OG1   . THR C 1 235 ? 23.250  69.498 100.744 1.00 20.29 ? 233 THR C OG1   1 
ATOM   5989 C  CG2   . THR C 1 235 ? 23.526  71.822 100.231 1.00 21.41 ? 233 THR C CG2   1 
ATOM   5990 N  N     . PHE C 1 236 ? 27.099  71.189 99.550  1.00 18.08 ? 234 PHE C N     1 
ATOM   5991 C  CA    . PHE C 1 236 ? 28.152  72.177 99.355  1.00 19.78 ? 234 PHE C CA    1 
ATOM   5992 C  C     . PHE C 1 236 ? 28.715  72.112 97.938  1.00 17.52 ? 234 PHE C C     1 
ATOM   5993 O  O     . PHE C 1 236 ? 28.827  73.127 97.267  1.00 20.94 ? 234 PHE C O     1 
ATOM   5994 C  CB    . PHE C 1 236 ? 29.287  71.952 100.371 1.00 19.37 ? 234 PHE C CB    1 
ATOM   5995 C  CG    . PHE C 1 236 ? 30.299  73.068 100.403 1.00 20.74 ? 234 PHE C CG    1 
ATOM   5996 C  CD1   . PHE C 1 236 ? 30.173  74.116 101.320 1.00 21.80 ? 234 PHE C CD1   1 
ATOM   5997 C  CD2   . PHE C 1 236 ? 31.343  73.105 99.487  1.00 19.56 ? 234 PHE C CD2   1 
ATOM   5998 C  CE1   . PHE C 1 236 ? 31.076  75.186 101.320 1.00 21.07 ? 234 PHE C CE1   1 
ATOM   5999 C  CE2   . PHE C 1 236 ? 32.251  74.169 99.472  1.00 20.83 ? 234 PHE C CE2   1 
ATOM   6000 C  CZ    . PHE C 1 236 ? 32.115  75.214 100.393 1.00 21.33 ? 234 PHE C CZ    1 
ATOM   6001 N  N     . LEU C 1 237 ? 29.068  70.916 97.481  1.00 18.05 ? 235 LEU C N     1 
ATOM   6002 C  CA    . LEU C 1 237 ? 29.623  70.767 96.134  1.00 18.80 ? 235 LEU C CA    1 
ATOM   6003 C  C     . LEU C 1 237 ? 28.638  71.252 95.076  1.00 17.86 ? 235 LEU C C     1 
ATOM   6004 O  O     . LEU C 1 237 ? 28.984  72.059 94.218  1.00 19.43 ? 235 LEU C O     1 
ATOM   6005 C  CB    . LEU C 1 237 ? 29.989  69.299 95.856  1.00 16.84 ? 235 LEU C CB    1 
ATOM   6006 C  CG    . LEU C 1 237 ? 30.635  68.989 94.498  1.00 18.30 ? 235 LEU C CG    1 
ATOM   6007 C  CD1   . LEU C 1 237 ? 31.391  67.657 94.582  1.00 18.64 ? 235 LEU C CD1   1 
ATOM   6008 C  CD2   . LEU C 1 237 ? 29.565  68.930 93.407  1.00 20.52 ? 235 LEU C CD2   1 
ATOM   6009 N  N     . ALA C 1 238 ? 27.408  70.760 95.151  1.00 19.52 ? 236 ALA C N     1 
ATOM   6010 C  CA    . ALA C 1 238 ? 26.363  71.114 94.185  1.00 18.78 ? 236 ALA C CA    1 
ATOM   6011 C  C     . ALA C 1 238 ? 26.079  72.603 94.089  1.00 19.09 ? 236 ALA C C     1 
ATOM   6012 O  O     . ALA C 1 238 ? 26.007  73.161 92.991  1.00 18.47 ? 236 ALA C O     1 
ATOM   6013 C  CB    . ALA C 1 238 ? 25.068  70.381 94.525  1.00 16.82 ? 236 ALA C CB    1 
ATOM   6014 N  N     . VAL C 1 239 ? 25.891  73.249 95.233  1.00 17.61 ? 237 VAL C N     1 
ATOM   6015 C  CA    . VAL C 1 239 ? 25.581  74.672 95.218  1.00 19.23 ? 237 VAL C CA    1 
ATOM   6016 C  C     . VAL C 1 239 ? 26.781  75.522 94.807  1.00 19.44 ? 237 VAL C C     1 
ATOM   6017 O  O     . VAL C 1 239 ? 26.625  76.538 94.139  1.00 19.91 ? 237 VAL C O     1 
ATOM   6018 C  CB    . VAL C 1 239 ? 25.027  75.130 96.579  1.00 17.58 ? 237 VAL C CB    1 
ATOM   6019 C  CG1   . VAL C 1 239 ? 24.760  76.629 96.562  1.00 18.98 ? 237 VAL C CG1   1 
ATOM   6020 C  CG2   . VAL C 1 239 ? 23.721  74.387 96.870  1.00 16.87 ? 237 VAL C CG2   1 
HETATM 6021 N  N     . MSE C 1 240 ? 27.981  75.104 95.192  1.00 22.45 ? 238 MSE C N     1 
HETATM 6022 C  CA    . MSE C 1 240 ? 29.172  75.850 94.809  1.00 23.76 ? 238 MSE C CA    1 
HETATM 6023 C  C     . MSE C 1 240 ? 29.301  75.818 93.286  1.00 24.03 ? 238 MSE C C     1 
HETATM 6024 O  O     . MSE C 1 240 ? 29.531  76.850 92.644  1.00 22.89 ? 238 MSE C O     1 
HETATM 6025 C  CB    . MSE C 1 240 ? 30.415  75.224 95.428  1.00 27.89 ? 238 MSE C CB    1 
HETATM 6026 C  CG    . MSE C 1 240 ? 31.696  75.885 94.995  1.00 35.68 ? 238 MSE C CG    1 
HETATM 6027 SE SE    . MSE C 1 240 ? 33.163  74.645 95.094  1.00 49.28 ? 238 MSE C SE    1 
HETATM 6028 C  CE    . MSE C 1 240 ? 32.952  73.805 93.375  1.00 42.02 ? 238 MSE C CE    1 
ATOM   6029 N  N     . LEU C 1 241 ? 29.162  74.623 92.716  1.00 21.68 ? 239 LEU C N     1 
ATOM   6030 C  CA    . LEU C 1 241 ? 29.250  74.456 91.269  1.00 21.89 ? 239 LEU C CA    1 
ATOM   6031 C  C     . LEU C 1 241 ? 28.131  75.233 90.573  1.00 22.13 ? 239 LEU C C     1 
ATOM   6032 O  O     . LEU C 1 241 ? 28.364  75.902 89.565  1.00 22.31 ? 239 LEU C O     1 
ATOM   6033 C  CB    . LEU C 1 241 ? 29.153  72.973 90.895  1.00 22.05 ? 239 LEU C CB    1 
ATOM   6034 C  CG    . LEU C 1 241 ? 29.342  72.667 89.408  1.00 23.11 ? 239 LEU C CG    1 
ATOM   6035 C  CD1   . LEU C 1 241 ? 30.687  73.238 88.945  1.00 23.76 ? 239 LEU C CD1   1 
ATOM   6036 C  CD2   . LEU C 1 241 ? 29.290  71.165 89.173  1.00 24.92 ? 239 LEU C CD2   1 
ATOM   6037 N  N     . ALA C 1 242 ? 26.918  75.146 91.111  1.00 20.98 ? 240 ALA C N     1 
ATOM   6038 C  CA    . ALA C 1 242 ? 25.777  75.857 90.539  1.00 20.71 ? 240 ALA C CA    1 
ATOM   6039 C  C     . ALA C 1 242 ? 25.986  77.370 90.540  1.00 22.21 ? 240 ALA C C     1 
ATOM   6040 O  O     . ALA C 1 242 ? 25.731  78.048 89.535  1.00 22.88 ? 240 ALA C O     1 
ATOM   6041 C  CB    . ALA C 1 242 ? 24.504  75.517 91.313  1.00 18.76 ? 240 ALA C CB    1 
ATOM   6042 N  N     . SER C 1 243 ? 26.436  77.899 91.672  1.00 20.74 ? 241 SER C N     1 
ATOM   6043 C  CA    . SER C 1 243 ? 26.659  79.334 91.799  1.00 23.24 ? 241 SER C CA    1 
ATOM   6044 C  C     . SER C 1 243 ? 27.653  79.824 90.743  1.00 24.19 ? 241 SER C C     1 
ATOM   6045 O  O     . SER C 1 243 ? 27.409  80.823 90.061  1.00 22.39 ? 241 SER C O     1 
ATOM   6046 C  CB    . SER C 1 243 ? 27.174  79.661 93.200  1.00 22.95 ? 241 SER C CB    1 
ATOM   6047 O  OG    . SER C 1 243 ? 27.421  81.052 93.332  1.00 25.56 ? 241 SER C OG    1 
ATOM   6048 N  N     . ALA C 1 244 ? 28.767  79.112 90.611  1.00 23.37 ? 242 ALA C N     1 
ATOM   6049 C  CA    . ALA C 1 244 ? 29.785  79.470 89.626  1.00 25.78 ? 242 ALA C CA    1 
ATOM   6050 C  C     . ALA C 1 244 ? 29.193  79.418 88.219  1.00 27.53 ? 242 ALA C C     1 
ATOM   6051 O  O     . ALA C 1 244 ? 29.354  80.353 87.428  1.00 26.51 ? 242 ALA C O     1 
ATOM   6052 C  CB    . ALA C 1 244 ? 30.967  78.514 89.730  1.00 25.76 ? 242 ALA C CB    1 
ATOM   6053 N  N     . LEU C 1 245 ? 28.513  78.314 87.914  1.00 27.79 ? 243 LEU C N     1 
ATOM   6054 C  CA    . LEU C 1 245 ? 27.886  78.113 86.606  1.00 28.10 ? 243 LEU C CA    1 
ATOM   6055 C  C     . LEU C 1 245 ? 26.890  79.209 86.249  1.00 28.79 ? 243 LEU C C     1 
ATOM   6056 O  O     . LEU C 1 245 ? 26.891  79.718 85.123  1.00 29.03 ? 243 LEU C O     1 
ATOM   6057 C  CB    . LEU C 1 245 ? 27.168  76.761 86.574  1.00 28.76 ? 243 LEU C CB    1 
ATOM   6058 C  CG    . LEU C 1 245 ? 27.793  75.556 85.860  1.00 29.75 ? 243 LEU C CG    1 
ATOM   6059 C  CD1   . LEU C 1 245 ? 29.300  75.673 85.785  1.00 32.46 ? 243 LEU C CD1   1 
ATOM   6060 C  CD2   . LEU C 1 245 ? 27.368  74.286 86.592  1.00 27.33 ? 243 LEU C CD2   1 
ATOM   6061 N  N     . LEU C 1 246 ? 26.034  79.560 87.205  1.00 26.16 ? 244 LEU C N     1 
ATOM   6062 C  CA    . LEU C 1 246 ? 25.024  80.589 86.993  1.00 27.19 ? 244 LEU C CA    1 
ATOM   6063 C  C     . LEU C 1 246 ? 25.646  81.951 86.703  1.00 29.77 ? 244 LEU C C     1 
ATOM   6064 O  O     . LEU C 1 246 ? 25.093  82.739 85.936  1.00 30.58 ? 244 LEU C O     1 
ATOM   6065 C  CB    . LEU C 1 246 ? 24.100  80.683 88.212  1.00 26.40 ? 244 LEU C CB    1 
ATOM   6066 C  CG    . LEU C 1 246 ? 23.121  79.507 88.400  1.00 26.33 ? 244 LEU C CG    1 
ATOM   6067 C  CD1   . LEU C 1 246 ? 22.390  79.633 89.724  1.00 25.01 ? 244 LEU C CD1   1 
ATOM   6068 C  CD2   . LEU C 1 246 ? 22.126  79.483 87.246  1.00 27.65 ? 244 LEU C CD2   1 
ATOM   6069 N  N     . ARG C 1 247 ? 26.802  82.218 87.307  1.00 30.13 ? 245 ARG C N     1 
ATOM   6070 C  CA    . ARG C 1 247 ? 27.488  83.490 87.112  1.00 30.90 ? 245 ARG C CA    1 
ATOM   6071 C  C     . ARG C 1 247 ? 28.572  83.400 86.044  1.00 30.85 ? 245 ARG C C     1 
ATOM   6072 O  O     . ARG C 1 247 ? 29.264  84.376 85.766  1.00 31.74 ? 245 ARG C O     1 
ATOM   6073 C  CB    . ARG C 1 247 ? 28.073  83.976 88.442  1.00 29.80 ? 245 ARG C CB    1 
ATOM   6074 C  CG    . ARG C 1 247 ? 26.992  84.375 89.442  1.00 29.80 ? 245 ARG C CG    1 
ATOM   6075 C  CD    . ARG C 1 247 ? 27.560  84.794 90.792  1.00 29.22 ? 245 ARG C CD    1 
ATOM   6076 N  NE    . ARG C 1 247 ? 28.158  83.680 91.529  1.00 27.19 ? 245 ARG C NE    1 
ATOM   6077 C  CZ    . ARG C 1 247 ? 29.460  83.552 91.754  1.00 25.69 ? 245 ARG C CZ    1 
ATOM   6078 N  NH1   . ARG C 1 247 ? 30.302  84.470 91.299  1.00 24.78 ? 245 ARG C NH1   1 
ATOM   6079 N  NH2   . ARG C 1 247 ? 29.921  82.509 92.434  1.00 23.49 ? 245 ARG C NH2   1 
ATOM   6080 N  N     . GLY C 1 248 ? 28.703  82.222 85.444  1.00 33.06 ? 246 GLY C N     1 
ATOM   6081 C  CA    . GLY C 1 248 ? 29.681  82.016 84.390  1.00 33.66 ? 246 GLY C CA    1 
ATOM   6082 C  C     . GLY C 1 248 ? 31.131  82.256 84.767  1.00 35.16 ? 246 GLY C C     1 
ATOM   6083 O  O     . GLY C 1 248 ? 31.888  82.841 83.991  1.00 35.84 ? 246 GLY C O     1 
ATOM   6084 N  N     . VAL C 1 249 ? 31.531  81.800 85.946  1.00 33.94 ? 247 VAL C N     1 
ATOM   6085 C  CA    . VAL C 1 249 ? 32.909  81.976 86.387  1.00 33.76 ? 247 VAL C CA    1 
ATOM   6086 C  C     . VAL C 1 249 ? 33.442  80.685 86.984  1.00 33.03 ? 247 VAL C C     1 
ATOM   6087 O  O     . VAL C 1 249 ? 32.694  79.731 87.198  1.00 32.82 ? 247 VAL C O     1 
ATOM   6088 C  CB    . VAL C 1 249 ? 33.025  83.068 87.475  1.00 34.17 ? 247 VAL C CB    1 
ATOM   6089 C  CG1   . VAL C 1 249 ? 32.511  84.396 86.948  1.00 35.05 ? 247 VAL C CG1   1 
ATOM   6090 C  CG2   . VAL C 1 249 ? 32.249  82.650 88.716  1.00 34.02 ? 247 VAL C CG2   1 
ATOM   6091 N  N     . ALA C 1 250 ? 34.742  80.652 87.245  1.00 32.17 ? 248 ALA C N     1 
ATOM   6092 C  CA    . ALA C 1 250 ? 35.340  79.485 87.874  1.00 31.68 ? 248 ALA C CA    1 
ATOM   6093 C  C     . ALA C 1 250 ? 34.904  79.617 89.327  1.00 30.69 ? 248 ALA C C     1 
ATOM   6094 O  O     . ALA C 1 250 ? 34.586  80.716 89.774  1.00 29.22 ? 248 ALA C O     1 
ATOM   6095 C  CB    . ALA C 1 250 ? 36.859  79.551 87.778  1.00 33.78 ? 248 ALA C CB    1 
ATOM   6096 N  N     . PRO C 1 251 ? 34.876  78.507 90.083  1.00 30.11 ? 249 PRO C N     1 
ATOM   6097 C  CA    . PRO C 1 251 ? 34.462  78.626 91.483  1.00 28.87 ? 249 PRO C CA    1 
ATOM   6098 C  C     . PRO C 1 251 ? 35.250  79.752 92.145  1.00 29.99 ? 249 PRO C C     1 
ATOM   6099 O  O     . PRO C 1 251 ? 36.460  79.862 91.948  1.00 29.78 ? 249 PRO C O     1 
ATOM   6100 C  CB    . PRO C 1 251 ? 34.817  77.263 92.063  1.00 29.64 ? 249 PRO C CB    1 
ATOM   6101 C  CG    . PRO C 1 251 ? 34.653  76.345 90.886  1.00 30.34 ? 249 PRO C CG    1 
ATOM   6102 C  CD    . PRO C 1 251 ? 35.303  77.133 89.773  1.00 30.46 ? 249 PRO C CD    1 
ATOM   6103 N  N     . ASP C 1 252 ? 34.563  80.579 92.927  1.00 28.64 ? 250 ASP C N     1 
ATOM   6104 C  CA    . ASP C 1 252 ? 35.194  81.702 93.607  1.00 29.09 ? 250 ASP C CA    1 
ATOM   6105 C  C     . ASP C 1 252 ? 34.709  81.831 95.051  1.00 28.97 ? 250 ASP C C     1 
ATOM   6106 O  O     . ASP C 1 252 ? 33.941  80.996 95.541  1.00 27.57 ? 250 ASP C O     1 
ATOM   6107 C  CB    . ASP C 1 252 ? 34.902  82.997 92.837  1.00 28.25 ? 250 ASP C CB    1 
ATOM   6108 C  CG    . ASP C 1 252 ? 33.423  83.205 92.588  1.00 28.80 ? 250 ASP C CG    1 
ATOM   6109 O  OD1   . ASP C 1 252 ? 32.609  82.401 93.095  1.00 27.08 ? 250 ASP C OD1   1 
ATOM   6110 O  OD2   . ASP C 1 252 ? 33.068  84.173 91.886  1.00 28.97 ? 250 ASP C OD2   1 
ATOM   6111 N  N     . ALA C 1 253 ? 35.155  82.882 95.732  1.00 27.93 ? 251 ALA C N     1 
ATOM   6112 C  CA    . ALA C 1 253 ? 34.762  83.100 97.122  1.00 26.49 ? 251 ALA C CA    1 
ATOM   6113 C  C     . ALA C 1 253 ? 33.246  83.145 97.293  1.00 25.76 ? 251 ALA C C     1 
ATOM   6114 O  O     . ALA C 1 253 ? 32.707  82.587 98.248  1.00 24.56 ? 251 ALA C O     1 
ATOM   6115 C  CB    . ALA C 1 253 ? 35.379  84.393 97.650  1.00 27.33 ? 251 ALA C CB    1 
ATOM   6116 N  N     . LEU C 1 254 ? 32.556  83.813 96.375  1.00 25.20 ? 252 LEU C N     1 
ATOM   6117 C  CA    . LEU C 1 254 ? 31.109  83.912 96.473  1.00 23.85 ? 252 LEU C CA    1 
ATOM   6118 C  C     . LEU C 1 254 ? 30.441  82.539 96.346  1.00 24.41 ? 252 LEU C C     1 
ATOM   6119 O  O     . LEU C 1 254 ? 29.469  82.251 97.048  1.00 22.18 ? 252 LEU C O     1 
ATOM   6120 C  CB    . LEU C 1 254 ? 30.563  84.864 95.403  1.00 25.37 ? 252 LEU C CB    1 
ATOM   6121 C  CG    . LEU C 1 254 ? 29.042  85.082 95.382  1.00 26.03 ? 252 LEU C CG    1 
ATOM   6122 C  CD1   . LEU C 1 254 ? 28.571  85.604 96.736  1.00 27.93 ? 252 LEU C CD1   1 
ATOM   6123 C  CD2   . LEU C 1 254 ? 28.673  86.073 94.280  1.00 26.44 ? 252 LEU C CD2   1 
ATOM   6124 N  N     . ALA C 1 255 ? 30.956  81.693 95.455  1.00 22.49 ? 253 ALA C N     1 
ATOM   6125 C  CA    . ALA C 1 255 ? 30.381  80.363 95.285  1.00 22.29 ? 253 ALA C CA    1 
ATOM   6126 C  C     . ALA C 1 255 ? 30.466  79.589 96.605  1.00 23.47 ? 253 ALA C C     1 
ATOM   6127 O  O     . ALA C 1 255 ? 29.532  78.890 96.992  1.00 21.52 ? 253 ALA C O     1 
ATOM   6128 C  CB    . ALA C 1 255 ? 31.120  79.603 94.178  1.00 21.88 ? 253 ALA C CB    1 
ATOM   6129 N  N     . LEU C 1 256 ? 31.589  79.712 97.302  1.00 21.50 ? 254 LEU C N     1 
ATOM   6130 C  CA    . LEU C 1 256 ? 31.736  79.005 98.566  1.00 22.50 ? 254 LEU C CA    1 
ATOM   6131 C  C     . LEU C 1 256 ? 30.806  79.574 99.636  1.00 22.08 ? 254 LEU C C     1 
ATOM   6132 O  O     . LEU C 1 256 ? 30.322  78.839 100.505 1.00 21.19 ? 254 LEU C O     1 
ATOM   6133 C  CB    . LEU C 1 256 ? 33.194  79.042 99.045  1.00 23.72 ? 254 LEU C CB    1 
ATOM   6134 C  CG    . LEU C 1 256 ? 34.097  77.954 98.436  1.00 24.76 ? 254 LEU C CG    1 
ATOM   6135 C  CD1   . LEU C 1 256 ? 34.397  78.267 96.985  1.00 28.43 ? 254 LEU C CD1   1 
ATOM   6136 C  CD2   . LEU C 1 256 ? 35.389  77.868 99.227  1.00 28.92 ? 254 LEU C CD2   1 
ATOM   6137 N  N     . ALA C 1 257 ? 30.550  80.875 99.572  1.00 21.04 ? 255 ALA C N     1 
ATOM   6138 C  CA    . ALA C 1 257 ? 29.660  81.499 100.539 1.00 21.36 ? 255 ALA C CA    1 
ATOM   6139 C  C     . ALA C 1 257 ? 28.259  80.945 100.301 1.00 20.97 ? 255 ALA C C     1 
ATOM   6140 O  O     . ALA C 1 257 ? 27.571  80.555 101.239 1.00 21.68 ? 255 ALA C O     1 
ATOM   6141 C  CB    . ALA C 1 257 ? 29.670  83.019 100.372 1.00 23.29 ? 255 ALA C CB    1 
ATOM   6142 N  N     . HIS C 1 258 ? 27.839  80.908 99.042  1.00 21.31 ? 256 HIS C N     1 
ATOM   6143 C  CA    . HIS C 1 258 ? 26.519  80.368 98.705  1.00 21.60 ? 256 HIS C CA    1 
ATOM   6144 C  C     . HIS C 1 258 ? 26.438  78.918 99.197  1.00 20.83 ? 256 HIS C C     1 
ATOM   6145 O  O     . HIS C 1 258 ? 25.483  78.527 99.874  1.00 19.72 ? 256 HIS C O     1 
ATOM   6146 C  CB    . HIS C 1 258 ? 26.301  80.416 97.189  1.00 23.08 ? 256 HIS C CB    1 
ATOM   6147 C  CG    . HIS C 1 258 ? 25.985  81.782 96.668  1.00 24.03 ? 256 HIS C CG    1 
ATOM   6148 N  ND1   . HIS C 1 258 ? 26.259  82.166 95.373  1.00 24.81 ? 256 HIS C ND1   1 
ATOM   6149 C  CD2   . HIS C 1 258 ? 25.389  82.847 97.258  1.00 23.66 ? 256 HIS C CD2   1 
ATOM   6150 C  CE1   . HIS C 1 258 ? 25.845  83.407 95.186  1.00 23.03 ? 256 HIS C CE1   1 
ATOM   6151 N  NE2   . HIS C 1 258 ? 25.312  83.843 96.314  1.00 23.10 ? 256 HIS C NE2   1 
ATOM   6152 N  N     . ALA C 1 259 ? 27.460  78.136 98.867  1.00 20.52 ? 257 ALA C N     1 
ATOM   6153 C  CA    . ALA C 1 259 ? 27.517  76.727 99.262  1.00 21.65 ? 257 ALA C CA    1 
ATOM   6154 C  C     . ALA C 1 259 ? 27.410  76.544 100.772 1.00 20.14 ? 257 ALA C C     1 
ATOM   6155 O  O     . ALA C 1 259 ? 26.751  75.618 101.257 1.00 17.66 ? 257 ALA C O     1 
ATOM   6156 C  CB    . ALA C 1 259 ? 28.816  76.100 98.755  1.00 19.43 ? 257 ALA C CB    1 
ATOM   6157 N  N     . SER C 1 260 ? 28.065  77.428 101.518 1.00 19.77 ? 258 SER C N     1 
ATOM   6158 C  CA    . SER C 1 260 ? 28.053  77.353 102.977 1.00 20.56 ? 258 SER C CA    1 
ATOM   6159 C  C     . SER C 1 260 ? 26.650  77.569 103.539 1.00 20.60 ? 258 SER C C     1 
ATOM   6160 O  O     . SER C 1 260 ? 26.221  76.878 104.462 1.00 19.86 ? 258 SER C O     1 
ATOM   6161 C  CB    . SER C 1 260 ? 29.008  78.398 103.564 1.00 20.42 ? 258 SER C CB    1 
ATOM   6162 O  OG    . SER C 1 260 ? 30.340  78.150 103.151 1.00 23.16 ? 258 SER C OG    1 
ATOM   6163 N  N     . ARG C 1 261 ? 25.942  78.540 102.979 1.00 20.71 ? 259 ARG C N     1 
ATOM   6164 C  CA    . ARG C 1 261 ? 24.591  78.838 103.432 1.00 23.07 ? 259 ARG C CA    1 
ATOM   6165 C  C     . ARG C 1 261 ? 23.641  77.682 103.113 1.00 21.25 ? 259 ARG C C     1 
ATOM   6166 O  O     . ARG C 1 261 ? 22.730  77.379 103.879 1.00 20.07 ? 259 ARG C O     1 
ATOM   6167 C  CB    . ARG C 1 261 ? 24.092  80.125 102.770 1.00 24.48 ? 259 ARG C CB    1 
ATOM   6168 C  CG    . ARG C 1 261 ? 24.891  81.365 103.155 1.00 32.02 ? 259 ARG C CG    1 
ATOM   6169 C  CD    . ARG C 1 261 ? 24.385  82.599 102.420 1.00 34.53 ? 259 ARG C CD    1 
ATOM   6170 N  NE    . ARG C 1 261 ? 22.982  82.875 102.720 1.00 41.99 ? 259 ARG C NE    1 
ATOM   6171 C  CZ    . ARG C 1 261 ? 22.250  83.799 102.102 1.00 44.42 ? 259 ARG C CZ    1 
ATOM   6172 N  NH1   . ARG C 1 261 ? 22.789  84.542 101.143 1.00 47.29 ? 259 ARG C NH1   1 
ATOM   6173 N  NH2   . ARG C 1 261 ? 20.980  83.976 102.438 1.00 46.06 ? 259 ARG C NH2   1 
ATOM   6174 N  N     . ALA C 1 262 ? 23.866  77.028 101.981 1.00 19.87 ? 260 ALA C N     1 
ATOM   6175 C  CA    . ALA C 1 262 ? 23.013  75.912 101.579 1.00 19.70 ? 260 ALA C CA    1 
ATOM   6176 C  C     . ALA C 1 262 ? 23.279  74.691 102.440 1.00 19.11 ? 260 ALA C C     1 
ATOM   6177 O  O     . ALA C 1 262 ? 22.350  74.020 102.891 1.00 18.75 ? 260 ALA C O     1 
ATOM   6178 C  CB    . ALA C 1 262 ? 23.253  75.574 100.109 1.00 18.91 ? 260 ALA C CB    1 
ATOM   6179 N  N     . ALA C 1 263 ? 24.556  74.393 102.660 1.00 17.28 ? 261 ALA C N     1 
ATOM   6180 C  CA    . ALA C 1 263 ? 24.926  73.244 103.467 1.00 18.92 ? 261 ALA C CA    1 
ATOM   6181 C  C     . ALA C 1 263 ? 24.449  73.408 104.907 1.00 19.80 ? 261 ALA C C     1 
ATOM   6182 O  O     . ALA C 1 263 ? 24.182  72.421 105.588 1.00 16.91 ? 261 ALA C O     1 
ATOM   6183 C  CB    . ALA C 1 263 ? 26.445  73.037 103.423 1.00 20.29 ? 261 ALA C CB    1 
ATOM   6184 N  N     . ALA C 1 264 ? 24.346  74.651 105.374 1.00 20.36 ? 262 ALA C N     1 
ATOM   6185 C  CA    . ALA C 1 264 ? 23.886  74.899 106.739 1.00 21.32 ? 262 ALA C CA    1 
ATOM   6186 C  C     . ALA C 1 264 ? 22.429  74.449 106.844 1.00 20.39 ? 262 ALA C C     1 
ATOM   6187 O  O     . ALA C 1 264 ? 22.013  73.876 107.848 1.00 20.20 ? 262 ALA C O     1 
ATOM   6188 C  CB    . ALA C 1 264 ? 24.014  76.389 107.088 1.00 20.75 ? 262 ALA C CB    1 
ATOM   6189 N  N     . ILE C 1 265 ? 21.654  74.703 105.799 1.00 21.29 ? 263 ILE C N     1 
ATOM   6190 C  CA    . ILE C 1 265 ? 20.257  74.293 105.806 1.00 20.45 ? 263 ILE C CA    1 
ATOM   6191 C  C     . ILE C 1 265 ? 20.205  72.773 105.905 1.00 20.04 ? 263 ILE C C     1 
ATOM   6192 O  O     . ILE C 1 265 ? 19.494  72.216 106.740 1.00 18.94 ? 263 ILE C O     1 
ATOM   6193 C  CB    . ILE C 1 265 ? 19.542  74.748 104.528 1.00 22.55 ? 263 ILE C CB    1 
ATOM   6194 C  CG1   . ILE C 1 265 ? 19.502  76.280 104.489 1.00 24.66 ? 263 ILE C CG1   1 
ATOM   6195 C  CG2   . ILE C 1 265 ? 18.129  74.148 104.471 1.00 23.26 ? 263 ILE C CG2   1 
ATOM   6196 C  CD1   . ILE C 1 265 ? 18.915  76.851 103.217 1.00 29.85 ? 263 ILE C CD1   1 
ATOM   6197 N  N     . THR C 1 266 ? 20.979  72.104 105.058 1.00 18.44 ? 264 THR C N     1 
ATOM   6198 C  CA    . THR C 1 266 ? 21.014  70.651 105.069 1.00 19.97 ? 264 THR C CA    1 
ATOM   6199 C  C     . THR C 1 266 ? 21.364  70.069 106.444 1.00 18.75 ? 264 THR C C     1 
ATOM   6200 O  O     . THR C 1 266 ? 20.726  69.122 106.894 1.00 18.35 ? 264 THR C O     1 
ATOM   6201 C  CB    . THR C 1 266 ? 22.015  70.127 104.022 1.00 18.52 ? 264 THR C CB    1 
ATOM   6202 O  OG1   . THR C 1 266 ? 21.509  70.402 102.713 1.00 19.94 ? 264 THR C OG1   1 
ATOM   6203 C  CG2   . THR C 1 266 ? 22.225  68.632 104.175 1.00 19.10 ? 264 THR C CG2   1 
ATOM   6204 N  N     . VAL C 1 267 ? 22.369  70.622 107.118 1.00 19.89 ? 265 VAL C N     1 
ATOM   6205 C  CA    . VAL C 1 267 ? 22.736  70.080 108.430 1.00 19.45 ? 265 VAL C CA    1 
ATOM   6206 C  C     . VAL C 1 267 ? 21.666  70.366 109.479 1.00 19.33 ? 265 VAL C C     1 
ATOM   6207 O  O     . VAL C 1 267 ? 21.546  69.640 110.466 1.00 20.16 ? 265 VAL C O     1 
ATOM   6208 C  CB    . VAL C 1 267 ? 24.102  70.635 108.948 1.00 22.85 ? 265 VAL C CB    1 
ATOM   6209 C  CG1   . VAL C 1 267 ? 25.212  70.359 107.924 1.00 22.76 ? 265 VAL C CG1   1 
ATOM   6210 C  CG2   . VAL C 1 267 ? 23.988  72.111 109.250 1.00 25.49 ? 265 VAL C CG2   1 
ATOM   6211 N  N     . SER C 1 268 ? 20.883  71.419 109.271 1.00 19.63 ? 266 SER C N     1 
ATOM   6212 C  CA    . SER C 1 268 ? 19.841  71.760 110.229 1.00 21.05 ? 266 SER C CA    1 
ATOM   6213 C  C     . SER C 1 268 ? 18.588  70.901 110.053 1.00 21.71 ? 266 SER C C     1 
ATOM   6214 O  O     . SER C 1 268 ? 17.677  70.963 110.877 1.00 22.32 ? 266 SER C O     1 
ATOM   6215 C  CB    . SER C 1 268 ? 19.468  73.238 110.107 1.00 21.90 ? 266 SER C CB    1 
ATOM   6216 O  OG    . SER C 1 268 ? 18.769  73.506 108.899 1.00 22.20 ? 266 SER C OG    1 
ATOM   6217 N  N     . ARG C 1 269 ? 18.550  70.093 108.995 1.00 20.26 ? 267 ARG C N     1 
ATOM   6218 C  CA    . ARG C 1 269 ? 17.383  69.250 108.725 1.00 20.95 ? 267 ARG C CA    1 
ATOM   6219 C  C     . ARG C 1 269 ? 17.690  67.758 108.745 1.00 21.12 ? 267 ARG C C     1 
ATOM   6220 O  O     . ARG C 1 269 ? 18.825  67.346 108.523 1.00 21.85 ? 267 ARG C O     1 
ATOM   6221 C  CB    . ARG C 1 269 ? 16.760  69.645 107.384 1.00 19.28 ? 267 ARG C CB    1 
ATOM   6222 C  CG    . ARG C 1 269 ? 16.312  71.099 107.367 1.00 21.68 ? 267 ARG C CG    1 
ATOM   6223 C  CD    . ARG C 1 269 ? 15.715  71.498 106.040 1.00 21.83 ? 267 ARG C CD    1 
ATOM   6224 N  NE    . ARG C 1 269 ? 15.375  72.915 106.027 1.00 22.50 ? 267 ARG C NE    1 
ATOM   6225 C  CZ    . ARG C 1 269 ? 14.960  73.577 104.951 1.00 25.01 ? 267 ARG C CZ    1 
ATOM   6226 N  NH1   . ARG C 1 269 ? 14.831  72.947 103.790 1.00 23.83 ? 267 ARG C NH1   1 
ATOM   6227 N  NH2   . ARG C 1 269 ? 14.678  74.873 105.035 1.00 21.05 ? 267 ARG C NH2   1 
ATOM   6228 N  N     . ARG C 1 270 ? 16.662  66.954 109.012 1.00 21.97 ? 268 ARG C N     1 
ATOM   6229 C  CA    . ARG C 1 270 ? 16.811  65.501 109.091 1.00 22.71 ? 268 ARG C CA    1 
ATOM   6230 C  C     . ARG C 1 270 ? 16.541  64.761 107.780 1.00 21.93 ? 268 ARG C C     1 
ATOM   6231 O  O     . ARG C 1 270 ? 15.690  65.170 106.988 1.00 23.60 ? 268 ARG C O     1 
ATOM   6232 C  CB    . ARG C 1 270 ? 15.892  64.948 110.187 1.00 23.58 ? 268 ARG C CB    1 
ATOM   6233 C  CG    . ARG C 1 270 ? 16.231  65.466 111.593 1.00 27.56 ? 268 ARG C CG    1 
ATOM   6234 C  CD    . ARG C 1 270 ? 15.373  64.808 112.672 1.00 31.10 ? 268 ARG C CD    1 
ATOM   6235 N  NE    . ARG C 1 270 ? 15.776  65.205 114.025 1.00 37.20 ? 268 ARG C NE    1 
ATOM   6236 C  CZ    . ARG C 1 270 ? 16.923  64.862 114.606 1.00 38.96 ? 268 ARG C CZ    1 
ATOM   6237 N  NH1   . ARG C 1 270 ? 17.801  64.106 113.959 1.00 41.97 ? 268 ARG C NH1   1 
ATOM   6238 N  NH2   . ARG C 1 270 ? 17.196  65.274 115.839 1.00 41.44 ? 268 ARG C NH2   1 
ATOM   6239 N  N     . GLY C 1 271 ? 17.277  63.670 107.570 1.00 22.51 ? 269 GLY C N     1 
ATOM   6240 C  CA    . GLY C 1 271 ? 17.126  62.855 106.369 1.00 23.10 ? 269 GLY C CA    1 
ATOM   6241 C  C     . GLY C 1 271 ? 18.180  63.147 105.317 1.00 21.63 ? 269 GLY C C     1 
ATOM   6242 O  O     . GLY C 1 271 ? 19.243  63.697 105.620 1.00 21.49 ? 269 GLY C O     1 
ATOM   6243 N  N     . THR C 1 272 ? 17.902  62.755 104.078 1.00 19.77 ? 270 THR C N     1 
ATOM   6244 C  CA    . THR C 1 272 ? 18.829  63.021 102.990 1.00 20.17 ? 270 THR C CA    1 
ATOM   6245 C  C     . THR C 1 272 ? 18.108  63.948 102.011 1.00 21.65 ? 270 THR C C     1 
ATOM   6246 O  O     . THR C 1 272 ? 18.121  65.164 102.197 1.00 19.98 ? 270 THR C O     1 
ATOM   6247 C  CB    . THR C 1 272 ? 19.282  61.716 102.307 1.00 19.01 ? 270 THR C CB    1 
ATOM   6248 O  OG1   . THR C 1 272 ? 19.823  60.824 103.294 1.00 22.91 ? 270 THR C OG1   1 
ATOM   6249 C  CG2   . THR C 1 272 ? 20.381  62.005 101.285 1.00 18.13 ? 270 THR C CG2   1 
ATOM   6250 N  N     . LEU C 1 273 ? 17.448  63.395 100.998 1.00 21.46 ? 271 LEU C N     1 
ATOM   6251 C  CA    . LEU C 1 273 ? 16.728  64.234 100.040 1.00 23.00 ? 271 LEU C CA    1 
ATOM   6252 C  C     . LEU C 1 273 ? 15.764  65.187 100.744 1.00 23.77 ? 271 LEU C C     1 
ATOM   6253 O  O     . LEU C 1 273 ? 15.605  66.338 100.341 1.00 24.57 ? 271 LEU C O     1 
ATOM   6254 C  CB    . LEU C 1 273 ? 15.932  63.372 99.057  1.00 23.12 ? 271 LEU C CB    1 
ATOM   6255 C  CG    . LEU C 1 273 ? 15.014  64.125 98.083  1.00 26.15 ? 271 LEU C CG    1 
ATOM   6256 C  CD1   . LEU C 1 273 ? 15.844  65.068 97.211  1.00 24.99 ? 271 LEU C CD1   1 
ATOM   6257 C  CD2   . LEU C 1 273 ? 14.253  63.125 97.215  1.00 27.46 ? 271 LEU C CD2   1 
ATOM   6258 N  N     . SER C 1 274 ? 15.116  64.700 101.794 1.00 25.32 ? 272 SER C N     1 
ATOM   6259 C  CA    . SER C 1 274 ? 14.155  65.509 102.536 1.00 25.95 ? 272 SER C CA    1 
ATOM   6260 C  C     . SER C 1 274 ? 14.790  66.662 103.321 1.00 23.56 ? 272 SER C C     1 
ATOM   6261 O  O     . SER C 1 274 ? 14.097  67.575 103.753 1.00 22.81 ? 272 SER C O     1 
ATOM   6262 C  CB    . SER C 1 274 ? 13.361  64.614 103.494 1.00 27.33 ? 272 SER C CB    1 
ATOM   6263 O  OG    . SER C 1 274 ? 14.237  63.967 104.399 1.00 33.67 ? 272 SER C OG    1 
ATOM   6264 N  N     . ALA C 1 275 ? 16.106  66.629 103.493 1.00 22.98 ? 273 ALA C N     1 
ATOM   6265 C  CA    . ALA C 1 275 ? 16.802  67.681 104.237 1.00 21.30 ? 273 ALA C CA    1 
ATOM   6266 C  C     . ALA C 1 275 ? 17.375  68.771 103.336 1.00 21.00 ? 273 ALA C C     1 
ATOM   6267 O  O     . ALA C 1 275 ? 17.747  69.847 103.816 1.00 20.18 ? 273 ALA C O     1 
ATOM   6268 C  CB    . ALA C 1 275 ? 17.930  67.069 105.073 1.00 21.44 ? 273 ALA C CB    1 
ATOM   6269 N  N     . PHE C 1 276 ? 17.445  68.507 102.033 1.00 20.05 ? 274 PHE C N     1 
ATOM   6270 C  CA    . PHE C 1 276 ? 18.034  69.487 101.121 1.00 20.46 ? 274 PHE C CA    1 
ATOM   6271 C  C     . PHE C 1 276 ? 17.190  70.725 100.865 1.00 21.07 ? 274 PHE C C     1 
ATOM   6272 O  O     . PHE C 1 276 ? 15.958  70.676 100.904 1.00 21.85 ? 274 PHE C O     1 
ATOM   6273 C  CB    . PHE C 1 276 ? 18.371  68.843 99.766  1.00 19.57 ? 274 PHE C CB    1 
ATOM   6274 C  CG    . PHE C 1 276 ? 19.284  67.650 99.861  1.00 18.55 ? 274 PHE C CG    1 
ATOM   6275 C  CD1   . PHE C 1 276 ? 20.219  67.545 100.886 1.00 19.71 ? 274 PHE C CD1   1 
ATOM   6276 C  CD2   . PHE C 1 276 ? 19.227  66.643 98.902  1.00 20.58 ? 274 PHE C CD2   1 
ATOM   6277 C  CE1   . PHE C 1 276 ? 21.084  66.452 100.960 1.00 21.48 ? 274 PHE C CE1   1 
ATOM   6278 C  CE2   . PHE C 1 276 ? 20.088  65.542 98.963  1.00 19.12 ? 274 PHE C CE2   1 
ATOM   6279 C  CZ    . PHE C 1 276 ? 21.015  65.446 99.991  1.00 20.70 ? 274 PHE C CZ    1 
ATOM   6280 N  N     . PRO C 1 277 ? 17.851  71.867 100.601 1.00 22.22 ? 275 PRO C N     1 
ATOM   6281 C  CA    . PRO C 1 277 ? 17.132  73.111 100.324 1.00 21.33 ? 275 PRO C CA    1 
ATOM   6282 C  C     . PRO C 1 277 ? 16.279  72.903 99.068  1.00 21.79 ? 275 PRO C C     1 
ATOM   6283 O  O     . PRO C 1 277 ? 16.701  72.219 98.126  1.00 18.80 ? 275 PRO C O     1 
ATOM   6284 C  CB    . PRO C 1 277 ? 18.257  74.110 100.073 1.00 23.88 ? 275 PRO C CB    1 
ATOM   6285 C  CG    . PRO C 1 277 ? 19.376  73.584 100.906 1.00 26.05 ? 275 PRO C CG    1 
ATOM   6286 C  CD    . PRO C 1 277 ? 19.305  72.104 100.659 1.00 24.14 ? 275 PRO C CD    1 
ATOM   6287 N  N     . GLY C 1 278 ? 15.086  73.483 99.060  1.00 22.14 ? 276 GLY C N     1 
ATOM   6288 C  CA    . GLY C 1 278 ? 14.209  73.358 97.908  1.00 22.99 ? 276 GLY C CA    1 
ATOM   6289 C  C     . GLY C 1 278 ? 14.573  74.390 96.857  1.00 23.07 ? 276 GLY C C     1 
ATOM   6290 O  O     . GLY C 1 278 ? 15.324  75.321 97.144  1.00 21.11 ? 276 GLY C O     1 
ATOM   6291 N  N     . SER C 1 279 ? 14.032  74.238 95.652  1.00 22.80 ? 277 SER C N     1 
ATOM   6292 C  CA    . SER C 1 279 ? 14.327  75.157 94.553  1.00 23.95 ? 277 SER C CA    1 
ATOM   6293 C  C     . SER C 1 279 ? 14.170  76.630 94.908  1.00 24.62 ? 277 SER C C     1 
ATOM   6294 O  O     . SER C 1 279 ? 15.032  77.439 94.571  1.00 24.85 ? 277 SER C O     1 
ATOM   6295 C  CB    . SER C 1 279 ? 13.455  74.829 93.331  1.00 25.95 ? 277 SER C CB    1 
ATOM   6296 O  OG    . SER C 1 279 ? 13.778  73.547 92.808  1.00 29.58 ? 277 SER C OG    1 
ATOM   6297 N  N     . ARG C 1 280 ? 13.082  76.994 95.580  1.00 25.03 ? 278 ARG C N     1 
ATOM   6298 C  CA    . ARG C 1 280 ? 12.892  78.398 95.935  1.00 25.92 ? 278 ARG C CA    1 
ATOM   6299 C  C     . ARG C 1 280 ? 13.910  78.894 96.951  1.00 25.56 ? 278 ARG C C     1 
ATOM   6300 O  O     . ARG C 1 280 ? 14.434  80.002 96.829  1.00 25.37 ? 278 ARG C O     1 
ATOM   6301 C  CB    . ARG C 1 280 ? 11.469  78.638 96.446  1.00 28.93 ? 278 ARG C CB    1 
ATOM   6302 C  CG    . ARG C 1 280 ? 10.426  78.608 95.334  1.00 32.97 ? 278 ARG C CG    1 
ATOM   6303 C  CD    . ARG C 1 280 ? 9.054   78.981 95.863  1.00 34.13 ? 278 ARG C CD    1 
ATOM   6304 N  NE    . ARG C 1 280 ? 8.634   78.076 96.930  1.00 37.25 ? 278 ARG C NE    1 
ATOM   6305 C  CZ    . ARG C 1 280 ? 7.570   78.273 97.704  1.00 38.27 ? 278 ARG C CZ    1 
ATOM   6306 N  NH1   . ARG C 1 280 ? 6.807   79.345 97.537  1.00 36.15 ? 278 ARG C NH1   1 
ATOM   6307 N  NH2   . ARG C 1 280 ? 7.272   77.396 98.653  1.00 40.06 ? 278 ARG C NH2   1 
ATOM   6308 N  N     . GLU C 1 281 ? 14.196  78.076 97.956  1.00 25.45 ? 279 GLU C N     1 
ATOM   6309 C  CA    . GLU C 1 281 ? 15.169  78.458 98.970  1.00 25.78 ? 279 GLU C CA    1 
ATOM   6310 C  C     . GLU C 1 281 ? 16.523  78.687 98.311  1.00 23.77 ? 279 GLU C C     1 
ATOM   6311 O  O     . GLU C 1 281 ? 17.258  79.612 98.671  1.00 22.48 ? 279 GLU C O     1 
ATOM   6312 C  CB    . GLU C 1 281 ? 15.308  77.356 100.018 1.00 27.67 ? 279 GLU C CB    1 
ATOM   6313 C  CG    . GLU C 1 281 ? 14.021  77.032 100.740 1.00 31.89 ? 279 GLU C CG    1 
ATOM   6314 C  CD    . GLU C 1 281 ? 14.204  75.930 101.767 1.00 34.41 ? 279 GLU C CD    1 
ATOM   6315 O  OE1   . GLU C 1 281 ? 14.652  74.824 101.388 1.00 31.08 ? 279 GLU C OE1   1 
ATOM   6316 O  OE2   . GLU C 1 281 ? 13.894  76.177 102.951 1.00 36.74 ? 279 GLU C OE2   1 
ATOM   6317 N  N     . LEU C 1 282 ? 16.854  77.826 97.353  1.00 22.11 ? 280 LEU C N     1 
ATOM   6318 C  CA    . LEU C 1 282 ? 18.122  77.932 96.646  1.00 23.57 ? 280 LEU C CA    1 
ATOM   6319 C  C     . LEU C 1 282 ? 18.167  79.186 95.787  1.00 23.82 ? 280 LEU C C     1 
ATOM   6320 O  O     . LEU C 1 282 ? 19.175  79.883 95.762  1.00 23.49 ? 280 LEU C O     1 
ATOM   6321 C  CB    . LEU C 1 282 ? 18.347  76.693 95.770  1.00 24.16 ? 280 LEU C CB    1 
ATOM   6322 C  CG    . LEU C 1 282 ? 18.702  75.415 96.536  1.00 22.16 ? 280 LEU C CG    1 
ATOM   6323 C  CD1   . LEU C 1 282 ? 18.659  74.216 95.597  1.00 22.44 ? 280 LEU C CD1   1 
ATOM   6324 C  CD2   . LEU C 1 282 ? 20.084  75.574 97.168  1.00 23.25 ? 280 LEU C CD2   1 
ATOM   6325 N  N     . ALA C 1 283 ? 17.074  79.475 95.083  1.00 25.19 ? 281 ALA C N     1 
ATOM   6326 C  CA    . ALA C 1 283 ? 17.028  80.661 94.231  1.00 27.26 ? 281 ALA C CA    1 
ATOM   6327 C  C     . ALA C 1 283 ? 17.250  81.923 95.066  1.00 28.97 ? 281 ALA C C     1 
ATOM   6328 O  O     . ALA C 1 283 ? 18.084  82.758 94.725  1.00 29.81 ? 281 ALA C O     1 
ATOM   6329 C  CB    . ALA C 1 283 ? 15.686  80.738 93.497  1.00 25.97 ? 281 ALA C CB    1 
ATOM   6330 N  N     . ALA C 1 284 ? 16.516  82.048 96.167  1.00 30.18 ? 282 ALA C N     1 
ATOM   6331 C  CA    . ALA C 1 284 ? 16.646  83.214 97.036  1.00 32.22 ? 282 ALA C CA    1 
ATOM   6332 C  C     . ALA C 1 284 ? 18.059  83.288 97.602  1.00 35.09 ? 282 ALA C C     1 
ATOM   6333 O  O     . ALA C 1 284 ? 18.636  84.367 97.751  1.00 35.15 ? 282 ALA C O     1 
ATOM   6334 C  CB    . ALA C 1 284 ? 15.632  83.136 98.166  1.00 32.74 ? 282 ALA C CB    1 
ATOM   6335 N  N     . LEU C 1 285 ? 18.617  82.124 97.902  1.00 35.85 ? 283 LEU C N     1 
ATOM   6336 C  CA    . LEU C 1 285 ? 19.958  82.017 98.454  1.00 37.15 ? 283 LEU C CA    1 
ATOM   6337 C  C     . LEU C 1 285 ? 21.032  82.470 97.458  1.00 36.28 ? 283 LEU C C     1 
ATOM   6338 O  O     . LEU C 1 285 ? 21.981  83.166 97.823  1.00 35.84 ? 283 LEU C O     1 
ATOM   6339 C  CB    . LEU C 1 285 ? 20.203  80.561 98.854  1.00 38.95 ? 283 LEU C CB    1 
ATOM   6340 C  CG    . LEU C 1 285 ? 21.245  80.222 99.906  1.00 40.33 ? 283 LEU C CG    1 
ATOM   6341 C  CD1   . LEU C 1 285 ? 20.931  80.970 101.190 1.00 41.17 ? 283 LEU C CD1   1 
ATOM   6342 C  CD2   . LEU C 1 285 ? 21.226  78.721 100.154 1.00 38.76 ? 283 LEU C CD2   1 
ATOM   6343 N  N     . LEU C 1 286 ? 20.871  82.075 96.200  1.00 36.08 ? 284 LEU C N     1 
ATOM   6344 C  CA    . LEU C 1 286 ? 21.831  82.403 95.148  1.00 36.75 ? 284 LEU C CA    1 
ATOM   6345 C  C     . LEU C 1 286 ? 21.802  83.842 94.635  1.00 39.61 ? 284 LEU C C     1 
ATOM   6346 O  O     . LEU C 1 286 ? 22.723  84.272 93.937  1.00 39.72 ? 284 LEU C O     1 
ATOM   6347 C  CB    . LEU C 1 286 ? 21.646  81.448 93.969  1.00 35.63 ? 284 LEU C CB    1 
ATOM   6348 C  CG    . LEU C 1 286 ? 22.051  79.989 94.196  1.00 33.83 ? 284 LEU C CG    1 
ATOM   6349 C  CD1   . LEU C 1 286 ? 21.532  79.126 93.063  1.00 32.68 ? 284 LEU C CD1   1 
ATOM   6350 C  CD2   . LEU C 1 286 ? 23.570  79.892 94.311  1.00 34.45 ? 284 LEU C CD2   1 
ATOM   6351 N  N     . THR C 1 287 ? 20.756  84.585 94.970  1.00 41.56 ? 285 THR C N     1 
ATOM   6352 C  CA    . THR C 1 287 ? 20.656  85.967 94.515  1.00 44.73 ? 285 THR C CA    1 
ATOM   6353 C  C     . THR C 1 287 ? 21.043  86.932 95.629  1.00 46.28 ? 285 THR C C     1 
ATOM   6354 O  O     . THR C 1 287 ? 22.259  87.115 95.853  1.00 47.90 ? 285 THR C O     1 
ATOM   6355 C  CB    . THR C 1 287 ? 19.224  86.299 94.053  1.00 44.61 ? 285 THR C CB    1 
ATOM   6356 O  OG1   . THR C 1 287 ? 18.318  86.114 95.145  1.00 45.79 ? 285 THR C OG1   1 
ATOM   6357 C  CG2   . THR C 1 287 ? 18.808  85.393 92.903  1.00 45.27 ? 285 THR C CG2   1 
ATOM   6358 N  N     . SER D 1 2   ? -24.121 64.441 63.520  1.00 37.03 ? -2  SER D N     1 
ATOM   6359 C  CA    . SER D 1 2   ? -25.361 63.644 63.361  1.00 33.38 ? -2  SER D CA    1 
ATOM   6360 C  C     . SER D 1 2   ? -25.167 62.434 62.445  1.00 31.05 ? -2  SER D C     1 
ATOM   6361 O  O     . SER D 1 2   ? -25.957 61.491 62.496  1.00 28.48 ? -2  SER D O     1 
ATOM   6362 C  CB    . SER D 1 2   ? -26.488 64.520 62.841  1.00 35.73 ? -2  SER D CB    1 
ATOM   6363 O  OG    . SER D 1 2   ? -27.727 63.879 63.058  1.00 40.60 ? -2  SER D OG    1 
ATOM   6364 N  N     . LEU D 1 3   ? -24.144 62.469 61.594  1.00 27.15 ? -1  LEU D N     1 
ATOM   6365 C  CA    . LEU D 1 3   ? -23.843 61.311 60.759  1.00 25.20 ? -1  LEU D CA    1 
ATOM   6366 C  C     . LEU D 1 3   ? -23.176 60.361 61.750  1.00 24.42 ? -1  LEU D C     1 
ATOM   6367 O  O     . LEU D 1 3   ? -22.469 60.812 62.656  1.00 23.82 ? -1  LEU D O     1 
ATOM   6368 C  CB    . LEU D 1 3   ? -22.837 61.639 59.650  1.00 23.70 ? -1  LEU D CB    1 
ATOM   6369 C  CG    . LEU D 1 3   ? -23.268 62.526 58.479  1.00 22.23 ? -1  LEU D CG    1 
ATOM   6370 C  CD1   . LEU D 1 3   ? -22.136 62.587 57.460  1.00 21.55 ? -1  LEU D CD1   1 
ATOM   6371 C  CD2   . LEU D 1 3   ? -24.530 61.972 57.837  1.00 20.07 ? -1  LEU D CD2   1 
ATOM   6372 N  N     . ARG D 1 4   ? -23.400 59.064 61.583  1.00 23.34 ? 2   ARG D N     1 
ATOM   6373 C  CA    . ARG D 1 4   ? -22.819 58.057 62.467  1.00 22.00 ? 2   ARG D CA    1 
ATOM   6374 C  C     . ARG D 1 4   ? -21.846 57.162 61.703  1.00 22.19 ? 2   ARG D C     1 
ATOM   6375 O  O     . ARG D 1 4   ? -21.930 57.040 60.482  1.00 20.69 ? 2   ARG D O     1 
ATOM   6376 C  CB    . ARG D 1 4   ? -23.937 57.222 63.091  1.00 25.11 ? 2   ARG D CB    1 
ATOM   6377 C  CG    . ARG D 1 4   ? -24.858 58.044 63.998  1.00 26.51 ? 2   ARG D CG    1 
ATOM   6378 C  CD    . ARG D 1 4   ? -26.144 57.296 64.271  1.00 28.02 ? 2   ARG D CD    1 
ATOM   6379 N  NE    . ARG D 1 4   ? -26.853 57.038 63.023  1.00 30.05 ? 2   ARG D NE    1 
ATOM   6380 C  CZ    . ARG D 1 4   ? -27.788 56.109 62.876  1.00 31.00 ? 2   ARG D CZ    1 
ATOM   6381 N  NH1   . ARG D 1 4   ? -28.132 55.346 63.909  1.00 33.78 ? 2   ARG D NH1   1 
ATOM   6382 N  NH2   . ARG D 1 4   ? -28.359 55.927 61.692  1.00 31.07 ? 2   ARG D NH2   1 
ATOM   6383 N  N     . VAL D 1 5   ? -20.917 56.546 62.428  1.00 20.90 ? 3   VAL D N     1 
ATOM   6384 C  CA    . VAL D 1 5   ? -19.919 55.684 61.818  1.00 19.21 ? 3   VAL D CA    1 
ATOM   6385 C  C     . VAL D 1 5   ? -20.089 54.247 62.299  1.00 21.10 ? 3   VAL D C     1 
ATOM   6386 O  O     . VAL D 1 5   ? -20.288 53.997 63.486  1.00 20.48 ? 3   VAL D O     1 
ATOM   6387 C  CB    . VAL D 1 5   ? -18.482 56.173 62.160  1.00 20.97 ? 3   VAL D CB    1 
ATOM   6388 C  CG1   . VAL D 1 5   ? -17.435 55.276 61.497  1.00 20.27 ? 3   VAL D CG1   1 
ATOM   6389 C  CG2   . VAL D 1 5   ? -18.297 57.629 61.690  1.00 20.34 ? 3   VAL D CG2   1 
ATOM   6390 N  N     . TYR D 1 6   ? -20.041 53.313 61.358  1.00 19.30 ? 4   TYR D N     1 
ATOM   6391 C  CA    . TYR D 1 6   ? -20.147 51.900 61.662  1.00 21.73 ? 4   TYR D CA    1 
ATOM   6392 C  C     . TYR D 1 6   ? -18.808 51.329 61.244  1.00 21.63 ? 4   TYR D C     1 
ATOM   6393 O  O     . TYR D 1 6   ? -18.388 51.501 60.105  1.00 20.84 ? 4   TYR D O     1 
ATOM   6394 C  CB    . TYR D 1 6   ? -21.266 51.240 60.847  1.00 20.74 ? 4   TYR D CB    1 
ATOM   6395 C  CG    . TYR D 1 6   ? -22.634 51.771 61.178  1.00 22.68 ? 4   TYR D CG    1 
ATOM   6396 C  CD1   . TYR D 1 6   ? -23.059 53.016 60.704  1.00 21.45 ? 4   TYR D CD1   1 
ATOM   6397 C  CD2   . TYR D 1 6   ? -23.491 51.052 62.004  1.00 21.86 ? 4   TYR D CD2   1 
ATOM   6398 C  CE1   . TYR D 1 6   ? -24.310 53.525 61.053  1.00 23.08 ? 4   TYR D CE1   1 
ATOM   6399 C  CE2   . TYR D 1 6   ? -24.737 51.550 62.360  1.00 22.49 ? 4   TYR D CE2   1 
ATOM   6400 C  CZ    . TYR D 1 6   ? -25.142 52.784 61.884  1.00 24.68 ? 4   TYR D CZ    1 
ATOM   6401 O  OH    . TYR D 1 6   ? -26.371 53.276 62.249  1.00 25.40 ? 4   TYR D OH    1 
ATOM   6402 N  N     . VAL D 1 7   ? -18.120 50.683 62.171  1.00 22.00 ? 5   VAL D N     1 
ATOM   6403 C  CA    . VAL D 1 7   ? -16.830 50.106 61.847  1.00 22.60 ? 5   VAL D CA    1 
ATOM   6404 C  C     . VAL D 1 7   ? -16.925 48.591 61.926  1.00 22.61 ? 5   VAL D C     1 
ATOM   6405 O  O     . VAL D 1 7   ? -17.226 48.036 62.978  1.00 24.39 ? 5   VAL D O     1 
ATOM   6406 C  CB    . VAL D 1 7   ? -15.734 50.597 62.815  1.00 23.86 ? 5   VAL D CB    1 
ATOM   6407 C  CG1   . VAL D 1 7   ? -14.370 50.075 62.367  1.00 23.62 ? 5   VAL D CG1   1 
ATOM   6408 C  CG2   . VAL D 1 7   ? -15.739 52.120 62.881  1.00 22.69 ? 5   VAL D CG2   1 
ATOM   6409 N  N     . THR D 1 8   ? -16.709 47.934 60.793  1.00 23.15 ? 6   THR D N     1 
ATOM   6410 C  CA    . THR D 1 8   ? -16.735 46.480 60.736  1.00 26.18 ? 6   THR D CA    1 
ATOM   6411 C  C     . THR D 1 8   ? -15.276 46.079 60.617  1.00 24.57 ? 6   THR D C     1 
ATOM   6412 O  O     . THR D 1 8   ? -14.644 46.315 59.589  1.00 24.23 ? 6   THR D O     1 
ATOM   6413 C  CB    . THR D 1 8   ? -17.500 45.955 59.506  1.00 25.82 ? 6   THR D CB    1 
ATOM   6414 O  OG1   . THR D 1 8   ? -16.940 46.519 58.314  1.00 30.25 ? 6   THR D OG1   1 
ATOM   6415 C  CG2   . THR D 1 8   ? -18.968 46.310 59.601  1.00 26.73 ? 6   THR D CG2   1 
ATOM   6416 N  N     . GLY D 1 9   ? -14.738 45.497 61.683  1.00 24.21 ? 7   GLY D N     1 
ATOM   6417 C  CA    . GLY D 1 9   ? -13.346 45.101 61.674  1.00 23.16 ? 7   GLY D CA    1 
ATOM   6418 C  C     . GLY D 1 9   ? -13.026 44.121 62.782  1.00 25.50 ? 7   GLY D C     1 
ATOM   6419 O  O     . GLY D 1 9   ? -13.897 43.389 63.247  1.00 24.04 ? 7   GLY D O     1 
ATOM   6420 N  N     . ASN D 1 10  ? -11.777 44.112 63.221  1.00 26.24 ? 8   ASN D N     1 
ATOM   6421 C  CA    . ASN D 1 10  ? -11.376 43.186 64.265  1.00 26.81 ? 8   ASN D CA    1 
ATOM   6422 C  C     . ASN D 1 10  ? -11.013 43.884 65.569  1.00 27.13 ? 8   ASN D C     1 
ATOM   6423 O  O     . ASN D 1 10  ? -10.872 45.111 65.632  1.00 27.04 ? 8   ASN D O     1 
ATOM   6424 C  CB    . ASN D 1 10  ? -10.189 42.352 63.772  1.00 26.43 ? 8   ASN D CB    1 
ATOM   6425 C  CG    . ASN D 1 10  ? -8.883  43.126 63.793  1.00 27.90 ? 8   ASN D CG    1 
ATOM   6426 O  OD1   . ASN D 1 10  ? -8.868  44.346 63.660  1.00 29.55 ? 8   ASN D OD1   1 
ATOM   6427 N  ND2   . ASN D 1 10  ? -7.777  42.414 63.956  1.00 30.50 ? 8   ASN D ND2   1 
ATOM   6428 N  N     . ILE D 1 11  ? -10.890 43.086 66.621  1.00 25.62 ? 9   ILE D N     1 
ATOM   6429 C  CA    . ILE D 1 11  ? -10.501 43.590 67.926  1.00 25.42 ? 9   ILE D CA    1 
ATOM   6430 C  C     . ILE D 1 11  ? -9.568  42.514 68.474  1.00 27.36 ? 9   ILE D C     1 
ATOM   6431 O  O     . ILE D 1 11  ? -9.827  41.320 68.313  1.00 26.36 ? 9   ILE D O     1 
ATOM   6432 C  CB    . ILE D 1 11  ? -11.721 43.816 68.848  1.00 23.69 ? 9   ILE D CB    1 
ATOM   6433 C  CG1   . ILE D 1 11  ? -11.263 44.517 70.128  1.00 22.74 ? 9   ILE D CG1   1 
ATOM   6434 C  CG2   . ILE D 1 11  ? -12.419 42.489 69.159  1.00 24.74 ? 9   ILE D CG2   1 
ATOM   6435 C  CD1   . ILE D 1 11  ? -12.382 45.193 70.900  1.00 24.66 ? 9   ILE D CD1   1 
ATOM   6436 N  N     . THR D 1 12  ? -8.469  42.933 69.087  1.00 27.17 ? 10  THR D N     1 
ATOM   6437 C  CA    . THR D 1 12  ? -7.493  41.976 69.589  1.00 30.37 ? 10  THR D CA    1 
ATOM   6438 C  C     . THR D 1 12  ? -6.791  42.386 70.872  1.00 30.31 ? 10  THR D C     1 
ATOM   6439 O  O     . THR D 1 12  ? -7.048  43.439 71.454  1.00 28.68 ? 10  THR D O     1 
ATOM   6440 C  CB    . THR D 1 12  ? -6.352  41.774 68.573  1.00 32.05 ? 10  THR D CB    1 
ATOM   6441 O  OG1   . THR D 1 12  ? -5.532  42.955 68.556  1.00 35.31 ? 10  THR D OG1   1 
ATOM   6442 C  CG2   . THR D 1 12  ? -6.899  41.536 67.168  1.00 31.78 ? 10  THR D CG2   1 
ATOM   6443 N  N     . VAL D 1 13  ? -5.886  41.510 71.294  1.00 31.34 ? 11  VAL D N     1 
ATOM   6444 C  CA    . VAL D 1 13  ? -5.029  41.767 72.435  1.00 31.09 ? 11  VAL D CA    1 
ATOM   6445 C  C     . VAL D 1 13  ? -3.675  41.833 71.749  1.00 29.69 ? 11  VAL D C     1 
ATOM   6446 O  O     . VAL D 1 13  ? -3.270  40.866 71.107  1.00 30.34 ? 11  VAL D O     1 
ATOM   6447 C  CB    . VAL D 1 13  ? -5.018  40.605 73.449  1.00 32.41 ? 11  VAL D CB    1 
ATOM   6448 C  CG1   . VAL D 1 13  ? -3.850  40.784 74.425  1.00 32.57 ? 11  VAL D CG1   1 
ATOM   6449 C  CG2   . VAL D 1 13  ? -6.335  40.566 74.202  1.00 32.25 ? 11  VAL D CG2   1 
ATOM   6450 N  N     . ASP D 1 14  ? -3.008  42.981 71.840  1.00 28.97 ? 12  ASP D N     1 
ATOM   6451 C  CA    . ASP D 1 14  ? -1.695  43.165 71.232  1.00 30.72 ? 12  ASP D CA    1 
ATOM   6452 C  C     . ASP D 1 14  ? -0.605  42.799 72.232  1.00 32.29 ? 12  ASP D C     1 
ATOM   6453 O  O     . ASP D 1 14  ? -0.617  43.279 73.367  1.00 32.85 ? 12  ASP D O     1 
ATOM   6454 C  CB    . ASP D 1 14  ? -1.463  44.627 70.820  1.00 30.62 ? 12  ASP D CB    1 
ATOM   6455 C  CG    . ASP D 1 14  ? -2.360  45.080 69.678  1.00 32.32 ? 12  ASP D CG    1 
ATOM   6456 O  OD1   . ASP D 1 14  ? -2.946  44.216 68.998  1.00 31.56 ? 12  ASP D OD1   1 
ATOM   6457 O  OD2   . ASP D 1 14  ? -2.454  46.308 69.456  1.00 31.89 ? 12  ASP D OD2   1 
ATOM   6458 N  N     . GLU D 1 15  ? 0.328   41.955 71.808  1.00 32.81 ? 13  GLU D N     1 
ATOM   6459 C  CA    . GLU D 1 15  ? 1.454   41.559 72.654  1.00 33.91 ? 13  GLU D CA    1 
ATOM   6460 C  C     . GLU D 1 15  ? 2.677   42.144 71.978  1.00 33.11 ? 13  GLU D C     1 
ATOM   6461 O  O     . GLU D 1 15  ? 2.939   41.838 70.815  1.00 32.00 ? 13  GLU D O     1 
ATOM   6462 C  CB    . GLU D 1 15  ? 1.641   40.044 72.693  1.00 38.17 ? 13  GLU D CB    1 
ATOM   6463 C  CG    . GLU D 1 15  ? 0.456   39.226 73.124  1.00 46.23 ? 13  GLU D CG    1 
ATOM   6464 C  CD    . GLU D 1 15  ? 0.863   37.795 73.434  1.00 50.20 ? 13  GLU D CD    1 
ATOM   6465 O  OE1   . GLU D 1 15  ? 1.627   37.207 72.637  1.00 52.17 ? 13  GLU D OE1   1 
ATOM   6466 O  OE2   . GLU D 1 15  ? 0.423   37.259 74.474  1.00 54.81 ? 13  GLU D OE2   1 
ATOM   6467 N  N     . THR D 1 16  ? 3.429   42.977 72.687  1.00 31.86 ? 14  THR D N     1 
ATOM   6468 C  CA    . THR D 1 16  ? 4.614   43.566 72.091  1.00 32.39 ? 14  THR D CA    1 
ATOM   6469 C  C     . THR D 1 16  ? 5.881   42.875 72.583  1.00 33.50 ? 14  THR D C     1 
ATOM   6470 O  O     . THR D 1 16  ? 6.163   42.845 73.781  1.00 32.49 ? 14  THR D O     1 
ATOM   6471 C  CB    . THR D 1 16  ? 4.711   45.065 72.395  1.00 32.96 ? 14  THR D CB    1 
ATOM   6472 O  OG1   . THR D 1 16  ? 3.516   45.721 71.949  1.00 36.71 ? 14  THR D OG1   1 
ATOM   6473 C  CG2   . THR D 1 16  ? 5.902   45.665 71.672  1.00 34.12 ? 14  THR D CG2   1 
ATOM   6474 N  N     . TRP D 1 17  ? 6.627   42.311 71.641  1.00 33.09 ? 15  TRP D N     1 
ATOM   6475 C  CA    . TRP D 1 17  ? 7.866   41.615 71.944  1.00 35.02 ? 15  TRP D CA    1 
ATOM   6476 C  C     . TRP D 1 17  ? 9.039   42.433 71.448  1.00 35.41 ? 15  TRP D C     1 
ATOM   6477 O  O     . TRP D 1 17  ? 9.085   42.818 70.278  1.00 34.57 ? 15  TRP D O     1 
ATOM   6478 C  CB    . TRP D 1 17  ? 7.907   40.257 71.242  1.00 37.30 ? 15  TRP D CB    1 
ATOM   6479 C  CG    . TRP D 1 17  ? 6.919   39.261 71.737  1.00 39.33 ? 15  TRP D CG    1 
ATOM   6480 C  CD1   . TRP D 1 17  ? 5.565   39.408 71.812  1.00 40.53 ? 15  TRP D CD1   1 
ATOM   6481 C  CD2   . TRP D 1 17  ? 7.207   37.939 72.192  1.00 40.25 ? 15  TRP D CD2   1 
ATOM   6482 N  NE1   . TRP D 1 17  ? 4.989   38.253 72.286  1.00 41.74 ? 15  TRP D NE1   1 
ATOM   6483 C  CE2   . TRP D 1 17  ? 5.978   37.335 72.528  1.00 40.66 ? 15  TRP D CE2   1 
ATOM   6484 C  CE3   . TRP D 1 17  ? 8.388   37.203 72.347  1.00 41.56 ? 15  TRP D CE3   1 
ATOM   6485 C  CZ2   . TRP D 1 17  ? 5.894   36.029 73.011  1.00 40.93 ? 15  TRP D CZ2   1 
ATOM   6486 C  CZ3   . TRP D 1 17  ? 8.304   35.902 72.826  1.00 41.66 ? 15  TRP D CZ3   1 
ATOM   6487 C  CH2   . TRP D 1 17  ? 7.066   35.330 73.152  1.00 42.27 ? 15  TRP D CH2   1 
ATOM   6488 N  N     . SER D 1 18  ? 9.984   42.705 72.337  1.00 34.11 ? 16  SER D N     1 
ATOM   6489 C  CA    . SER D 1 18  ? 11.172  43.449 71.954  1.00 34.00 ? 16  SER D CA    1 
ATOM   6490 C  C     . SER D 1 18  ? 12.240  42.424 71.608  1.00 35.64 ? 16  SER D C     1 
ATOM   6491 O  O     . SER D 1 18  ? 12.544  41.545 72.414  1.00 33.81 ? 16  SER D O     1 
ATOM   6492 C  CB    . SER D 1 18  ? 11.652  44.327 73.107  1.00 34.50 ? 16  SER D CB    1 
ATOM   6493 O  OG    . SER D 1 18  ? 12.911  44.899 72.806  1.00 38.06 ? 16  SER D OG    1 
ATOM   6494 N  N     . ILE D 1 19  ? 12.787  42.530 70.402  1.00 36.03 ? 17  ILE D N     1 
ATOM   6495 C  CA    . ILE D 1 19  ? 13.822  41.616 69.935  1.00 38.85 ? 17  ILE D CA    1 
ATOM   6496 C  C     . ILE D 1 19  ? 14.922  42.413 69.243  1.00 41.26 ? 17  ILE D C     1 
ATOM   6497 O  O     . ILE D 1 19  ? 14.715  43.562 68.860  1.00 41.30 ? 17  ILE D O     1 
ATOM   6498 C  CB    . ILE D 1 19  ? 13.252  40.589 68.930  1.00 37.58 ? 17  ILE D CB    1 
ATOM   6499 C  CG1   . ILE D 1 19  ? 12.607  41.319 67.749  1.00 37.57 ? 17  ILE D CG1   1 
ATOM   6500 C  CG2   . ILE D 1 19  ? 12.243  39.685 69.626  1.00 38.29 ? 17  ILE D CG2   1 
ATOM   6501 C  CD1   . ILE D 1 19  ? 11.991  40.395 66.707  1.00 38.20 ? 17  ILE D CD1   1 
ATOM   6502 N  N     . PRO D 1 20  ? 16.112  41.816 69.080  1.00 43.66 ? 18  PRO D N     1 
ATOM   6503 C  CA    . PRO D 1 20  ? 17.205  42.531 68.421  1.00 46.13 ? 18  PRO D CA    1 
ATOM   6504 C  C     . PRO D 1 20  ? 16.955  42.693 66.926  1.00 48.08 ? 18  PRO D C     1 
ATOM   6505 O  O     . PRO D 1 20  ? 17.224  43.746 66.349  1.00 49.04 ? 18  PRO D O     1 
ATOM   6506 C  CB    . PRO D 1 20  ? 18.414  41.651 68.716  1.00 46.19 ? 18  PRO D CB    1 
ATOM   6507 C  CG    . PRO D 1 20  ? 17.822  40.285 68.737  1.00 46.00 ? 18  PRO D CG    1 
ATOM   6508 C  CD    . PRO D 1 20  ? 16.556  40.489 69.540  1.00 45.07 ? 18  PRO D CD    1 
ATOM   6509 N  N     . ASP D 1 21  ? 16.432  41.643 66.304  1.00 49.79 ? 19  ASP D N     1 
ATOM   6510 C  CA    . ASP D 1 21  ? 16.145  41.670 64.877  1.00 51.71 ? 19  ASP D CA    1 
ATOM   6511 C  C     . ASP D 1 21  ? 15.252  40.484 64.553  1.00 52.48 ? 19  ASP D C     1 
ATOM   6512 O  O     . ASP D 1 21  ? 15.265  39.481 65.267  1.00 51.52 ? 19  ASP D O     1 
ATOM   6513 C  CB    . ASP D 1 21  ? 17.445  41.569 64.076  1.00 53.18 ? 19  ASP D CB    1 
ATOM   6514 C  CG    . ASP D 1 21  ? 17.260  41.927 62.615  1.00 55.39 ? 19  ASP D CG    1 
ATOM   6515 O  OD1   . ASP D 1 21  ? 18.152  41.600 61.805  1.00 56.30 ? 19  ASP D OD1   1 
ATOM   6516 O  OD2   . ASP D 1 21  ? 16.228  42.546 62.278  1.00 56.01 ? 19  ASP D OD2   1 
ATOM   6517 N  N     . ILE D 1 22  ? 14.471  40.598 63.483  1.00 53.18 ? 20  ILE D N     1 
ATOM   6518 C  CA    . ILE D 1 22  ? 13.586  39.513 63.089  1.00 54.22 ? 20  ILE D CA    1 
ATOM   6519 C  C     . ILE D 1 22  ? 14.416  38.259 62.839  1.00 54.95 ? 20  ILE D C     1 
ATOM   6520 O  O     . ILE D 1 22  ? 15.408  38.296 62.114  1.00 55.18 ? 20  ILE D O     1 
ATOM   6521 C  CB    . ILE D 1 22  ? 12.806  39.863 61.811  1.00 54.77 ? 20  ILE D CB    1 
ATOM   6522 C  CG1   . ILE D 1 22  ? 11.893  41.062 62.072  1.00 55.41 ? 20  ILE D CG1   1 
ATOM   6523 C  CG2   . ILE D 1 22  ? 11.986  38.672 61.365  1.00 54.45 ? 20  ILE D CG2   1 
ATOM   6524 C  CD1   . ILE D 1 22  ? 11.173  41.555 60.843  1.00 55.99 ? 20  ILE D CD1   1 
ATOM   6525 N  N     . PRO D 1 23  ? 14.015  37.130 63.440  1.00 55.66 ? 21  PRO D N     1 
ATOM   6526 C  CA    . PRO D 1 23  ? 14.718  35.852 63.294  1.00 56.59 ? 21  PRO D CA    1 
ATOM   6527 C  C     . PRO D 1 23  ? 14.691  35.260 61.885  1.00 57.89 ? 21  PRO D C     1 
ATOM   6528 O  O     . PRO D 1 23  ? 13.683  35.346 61.182  1.00 57.61 ? 21  PRO D O     1 
ATOM   6529 C  CB    . PRO D 1 23  ? 14.002  34.958 64.300  1.00 56.19 ? 21  PRO D CB    1 
ATOM   6530 C  CG    . PRO D 1 23  ? 12.599  35.472 64.240  1.00 55.44 ? 21  PRO D CG    1 
ATOM   6531 C  CD    . PRO D 1 23  ? 12.812  36.968 64.276  1.00 55.13 ? 21  PRO D CD    1 
ATOM   6532 N  N     . LYS D 1 24  ? 15.812  34.664 61.483  1.00 59.20 ? 22  LYS D N     1 
ATOM   6533 C  CA    . LYS D 1 24  ? 15.929  34.022 60.178  1.00 60.33 ? 22  LYS D CA    1 
ATOM   6534 C  C     . LYS D 1 24  ? 15.226  32.679 60.361  1.00 60.78 ? 22  LYS D C     1 
ATOM   6535 O  O     . LYS D 1 24  ? 15.225  32.130 61.462  1.00 60.49 ? 22  LYS D O     1 
ATOM   6536 C  CB    . LYS D 1 24  ? 17.403  33.809 59.821  1.00 61.33 ? 22  LYS D CB    1 
ATOM   6537 C  CG    . LYS D 1 24  ? 18.274  35.051 59.997  1.00 62.51 ? 22  LYS D CG    1 
ATOM   6538 C  CD    . LYS D 1 24  ? 18.191  36.019 58.821  1.00 63.33 ? 22  LYS D CD    1 
ATOM   6539 C  CE    . LYS D 1 24  ? 19.136  35.607 57.697  1.00 64.13 ? 22  LYS D CE    1 
ATOM   6540 N  NZ    . LYS D 1 24  ? 19.253  36.654 56.638  1.00 64.49 ? 22  LYS D NZ    1 
ATOM   6541 N  N     . LYS D 1 25  ? 14.633  32.152 59.294  1.00 61.62 ? 23  LYS D N     1 
ATOM   6542 C  CA    . LYS D 1 25  ? 13.896  30.889 59.363  1.00 62.69 ? 23  LYS D CA    1 
ATOM   6543 C  C     . LYS D 1 25  ? 14.495  29.727 60.158  1.00 62.11 ? 23  LYS D C     1 
ATOM   6544 O  O     . LYS D 1 25  ? 13.767  28.820 60.561  1.00 62.67 ? 23  LYS D O     1 
ATOM   6545 C  CB    . LYS D 1 25  ? 13.555  30.399 57.953  1.00 64.11 ? 23  LYS D CB    1 
ATOM   6546 C  CG    . LYS D 1 25  ? 12.279  31.001 57.386  1.00 66.73 ? 23  LYS D CG    1 
ATOM   6547 C  CD    . LYS D 1 25  ? 12.012  30.492 55.982  1.00 69.32 ? 23  LYS D CD    1 
ATOM   6548 C  CE    . LYS D 1 25  ? 13.123  30.914 55.029  1.00 70.93 ? 23  LYS D CE    1 
ATOM   6549 N  NZ    . LYS D 1 25  ? 12.985  30.283 53.686  1.00 71.92 ? 23  LYS D NZ    1 
ATOM   6550 N  N     . GLY D 1 26  ? 15.802  29.737 60.391  1.00 60.89 ? 24  GLY D N     1 
ATOM   6551 C  CA    . GLY D 1 26  ? 16.397  28.645 61.142  1.00 59.84 ? 24  GLY D CA    1 
ATOM   6552 C  C     . GLY D 1 26  ? 16.878  29.043 62.526  1.00 58.77 ? 24  GLY D C     1 
ATOM   6553 O  O     . GLY D 1 26  ? 17.225  28.190 63.347  1.00 57.97 ? 24  GLY D O     1 
ATOM   6554 N  N     . ALA D 1 27  ? 16.886  30.345 62.788  1.00 57.31 ? 25  ALA D N     1 
ATOM   6555 C  CA    . ALA D 1 27  ? 17.348  30.873 64.064  1.00 54.84 ? 25  ALA D CA    1 
ATOM   6556 C  C     . ALA D 1 27  ? 16.343  30.776 65.207  1.00 53.25 ? 25  ALA D C     1 
ATOM   6557 O  O     . ALA D 1 27  ? 15.135  30.670 64.995  1.00 53.18 ? 25  ALA D O     1 
ATOM   6558 C  CB    . ALA D 1 27  ? 17.783  32.325 63.887  1.00 55.59 ? 25  ALA D CB    1 
ATOM   6559 N  N     . SER D 1 28  ? 16.874  30.807 66.423  1.00 50.27 ? 26  SER D N     1 
ATOM   6560 C  CA    . SER D 1 28  ? 16.087  30.761 67.649  1.00 48.07 ? 26  SER D CA    1 
ATOM   6561 C  C     . SER D 1 28  ? 16.639  31.925 68.468  1.00 46.02 ? 26  SER D C     1 
ATOM   6562 O  O     . SER D 1 28  ? 17.799  31.901 68.875  1.00 46.01 ? 26  SER D O     1 
ATOM   6563 C  CB    . SER D 1 28  ? 16.322  29.437 68.374  1.00 48.20 ? 26  SER D CB    1 
ATOM   6564 O  OG    . SER D 1 28  ? 15.578  29.369 69.574  1.00 48.77 ? 26  SER D OG    1 
ATOM   6565 N  N     . ILE D 1 29  ? 15.824  32.950 68.697  1.00 43.36 ? 27  ILE D N     1 
ATOM   6566 C  CA    . ILE D 1 29  ? 16.300  34.120 69.425  1.00 40.49 ? 27  ILE D CA    1 
ATOM   6567 C  C     . ILE D 1 29  ? 15.603  34.411 70.746  1.00 39.30 ? 27  ILE D C     1 
ATOM   6568 O  O     . ILE D 1 29  ? 14.526  33.889 71.038  1.00 37.72 ? 27  ILE D O     1 
ATOM   6569 C  CB    . ILE D 1 29  ? 16.199  35.393 68.557  1.00 42.07 ? 27  ILE D CB    1 
ATOM   6570 C  CG1   . ILE D 1 29  ? 14.732  35.791 68.376  1.00 40.47 ? 27  ILE D CG1   1 
ATOM   6571 C  CG2   . ILE D 1 29  ? 16.835  35.144 67.196  1.00 42.34 ? 27  ILE D CG2   1 
ATOM   6572 C  CD1   . ILE D 1 29  ? 14.549  37.130 67.713  1.00 42.26 ? 27  ILE D CD1   1 
ATOM   6573 N  N     . HIS D 1 30  ? 16.238  35.266 71.539  1.00 37.02 ? 28  HIS D N     1 
ATOM   6574 C  CA    . HIS D 1 30  ? 15.699  35.657 72.826  1.00 36.06 ? 28  HIS D CA    1 
ATOM   6575 C  C     . HIS D 1 30  ? 14.904  36.940 72.654  1.00 36.51 ? 28  HIS D C     1 
ATOM   6576 O  O     . HIS D 1 30  ? 15.246  37.786 71.829  1.00 37.93 ? 28  HIS D O     1 
ATOM   6577 C  CB    . HIS D 1 30  ? 16.833  35.862 73.838  1.00 36.78 ? 28  HIS D CB    1 
ATOM   6578 C  CG    . HIS D 1 30  ? 16.359  36.282 75.195  1.00 36.19 ? 28  HIS D CG    1 
ATOM   6579 N  ND1   . HIS D 1 30  ? 16.183  37.604 75.547  1.00 36.57 ? 28  HIS D ND1   1 
ATOM   6580 C  CD2   . HIS D 1 30  ? 15.967  35.553 76.267  1.00 34.72 ? 28  HIS D CD2   1 
ATOM   6581 C  CE1   . HIS D 1 30  ? 15.701  37.670 76.776  1.00 36.24 ? 28  HIS D CE1   1 
ATOM   6582 N  NE2   . HIS D 1 30  ? 15.560  36.439 77.234  1.00 35.73 ? 28  HIS D NE2   1 
ATOM   6583 N  N     . GLY D 1 31  ? 13.832  37.071 73.426  1.00 35.76 ? 29  GLY D N     1 
ATOM   6584 C  CA    . GLY D 1 31  ? 13.004  38.259 73.343  1.00 34.07 ? 29  GLY D CA    1 
ATOM   6585 C  C     . GLY D 1 31  ? 12.565  38.730 74.713  1.00 33.18 ? 29  GLY D C     1 
ATOM   6586 O  O     . GLY D 1 31  ? 12.886  38.106 75.724  1.00 29.29 ? 29  GLY D O     1 
ATOM   6587 N  N     . VAL D 1 32  ? 11.833  39.839 74.744  1.00 31.44 ? 30  VAL D N     1 
ATOM   6588 C  CA    . VAL D 1 32  ? 11.337  40.407 75.993  1.00 32.52 ? 30  VAL D CA    1 
ATOM   6589 C  C     . VAL D 1 32  ? 9.930   40.968 75.792  1.00 33.43 ? 30  VAL D C     1 
ATOM   6590 O  O     . VAL D 1 32  ? 9.742   41.900 75.009  1.00 32.46 ? 30  VAL D O     1 
ATOM   6591 C  CB    . VAL D 1 32  ? 12.248  41.553 76.479  1.00 32.45 ? 30  VAL D CB    1 
ATOM   6592 C  CG1   . VAL D 1 32  ? 11.648  42.206 77.718  1.00 32.90 ? 30  VAL D CG1   1 
ATOM   6593 C  CG2   . VAL D 1 32  ? 13.641  41.019 76.775  1.00 32.79 ? 30  VAL D CG2   1 
ATOM   6594 N  N     . LYS D 1 33  ? 8.947   40.400 76.484  1.00 33.70 ? 31  LYS D N     1 
ATOM   6595 C  CA    . LYS D 1 33  ? 7.579   40.895 76.363  1.00 36.11 ? 31  LYS D CA    1 
ATOM   6596 C  C     . LYS D 1 33  ? 7.539   42.235 77.069  1.00 36.22 ? 31  LYS D C     1 
ATOM   6597 O  O     . LYS D 1 33  ? 7.839   42.324 78.257  1.00 34.27 ? 31  LYS D O     1 
ATOM   6598 C  CB    . LYS D 1 33  ? 6.579   39.933 77.011  1.00 38.15 ? 31  LYS D CB    1 
ATOM   6599 C  CG    . LYS D 1 33  ? 6.404   38.621 76.259  1.00 42.91 ? 31  LYS D CG    1 
ATOM   6600 C  CD    . LYS D 1 33  ? 5.258   37.791 76.828  1.00 46.39 ? 31  LYS D CD    1 
ATOM   6601 C  CE    . LYS D 1 33  ? 3.906   38.444 76.564  1.00 48.87 ? 31  LYS D CE    1 
ATOM   6602 N  NZ    . LYS D 1 33  ? 3.597   38.521 75.106  1.00 51.06 ? 31  LYS D NZ    1 
ATOM   6603 N  N     . VAL D 1 34  ? 7.175   43.282 76.340  1.00 36.56 ? 32  VAL D N     1 
ATOM   6604 C  CA    . VAL D 1 34  ? 7.137   44.607 76.931  1.00 37.38 ? 32  VAL D CA    1 
ATOM   6605 C  C     . VAL D 1 34  ? 5.738   45.080 77.291  1.00 38.07 ? 32  VAL D C     1 
ATOM   6606 O  O     . VAL D 1 34  ? 5.583   45.979 78.115  1.00 39.13 ? 32  VAL D O     1 
ATOM   6607 C  CB    . VAL D 1 34  ? 7.811   45.642 76.003  1.00 38.33 ? 32  VAL D CB    1 
ATOM   6608 C  CG1   . VAL D 1 34  ? 9.291   45.320 75.860  1.00 39.59 ? 32  VAL D CG1   1 
ATOM   6609 C  CG2   . VAL D 1 34  ? 7.151   45.635 74.646  1.00 39.50 ? 32  VAL D CG2   1 
ATOM   6610 N  N     . SER D 1 35  ? 4.715   44.478 76.692  1.00 37.27 ? 33  SER D N     1 
ATOM   6611 C  CA    . SER D 1 35  ? 3.353   44.884 77.001  1.00 37.13 ? 33  SER D CA    1 
ATOM   6612 C  C     . SER D 1 35  ? 2.269   44.061 76.329  1.00 36.13 ? 33  SER D C     1 
ATOM   6613 O  O     . SER D 1 35  ? 2.518   43.317 75.380  1.00 34.54 ? 33  SER D O     1 
ATOM   6614 C  CB    . SER D 1 35  ? 3.142   46.355 76.634  1.00 37.32 ? 33  SER D CB    1 
ATOM   6615 O  OG    . SER D 1 35  ? 3.337   46.572 75.248  1.00 39.81 ? 33  SER D OG    1 
ATOM   6616 N  N     . GLN D 1 36  ? 1.063   44.212 76.866  1.00 35.67 ? 34  GLN D N     1 
ATOM   6617 C  CA    . GLN D 1 36  ? -0.144  43.574 76.370  1.00 35.54 ? 34  GLN D CA    1 
ATOM   6618 C  C     . GLN D 1 36  ? -1.203  44.656 76.513  1.00 35.08 ? 34  GLN D C     1 
ATOM   6619 O  O     . GLN D 1 36  ? -1.358  45.248 77.586  1.00 34.97 ? 34  GLN D O     1 
ATOM   6620 C  CB    . GLN D 1 36  ? -0.535  42.368 77.218  1.00 37.92 ? 34  GLN D CB    1 
ATOM   6621 C  CG    . GLN D 1 36  ? 0.432   41.208 77.153  1.00 42.95 ? 34  GLN D CG    1 
ATOM   6622 C  CD    . GLN D 1 36  ? -0.167  39.937 77.724  1.00 46.11 ? 34  GLN D CD    1 
ATOM   6623 O  OE1   . GLN D 1 36  ? -0.675  39.925 78.848  1.00 48.17 ? 34  GLN D OE1   1 
ATOM   6624 N  NE2   . GLN D 1 36  ? -0.109  38.859 76.951  1.00 47.73 ? 34  GLN D NE2   1 
ATOM   6625 N  N     . ASP D 1 37  ? -1.929  44.922 75.438  1.00 31.55 ? 35  ASP D N     1 
ATOM   6626 C  CA    . ASP D 1 37  ? -2.946  45.958 75.467  1.00 30.79 ? 35  ASP D CA    1 
ATOM   6627 C  C     . ASP D 1 37  ? -4.079  45.569 74.529  1.00 29.94 ? 35  ASP D C     1 
ATOM   6628 O  O     . ASP D 1 37  ? -3.952  44.617 73.762  1.00 28.30 ? 35  ASP D O     1 
ATOM   6629 C  CB    . ASP D 1 37  ? -2.328  47.280 74.999  1.00 32.20 ? 35  ASP D CB    1 
ATOM   6630 C  CG    . ASP D 1 37  ? -3.016  48.497 75.593  1.00 33.07 ? 35  ASP D CG    1 
ATOM   6631 O  OD1   . ASP D 1 37  ? -4.188  48.378 76.013  1.00 33.63 ? 35  ASP D OD1   1 
ATOM   6632 O  OD2   . ASP D 1 37  ? -2.382  49.576 75.625  1.00 33.70 ? 35  ASP D OD2   1 
ATOM   6633 N  N     . ILE D 1 38  ? -5.190  46.295 74.604  1.00 28.77 ? 36  ILE D N     1 
ATOM   6634 C  CA    . ILE D 1 38  ? -6.316  46.038 73.716  1.00 28.93 ? 36  ILE D CA    1 
ATOM   6635 C  C     . ILE D 1 38  ? -5.939  46.731 72.410  1.00 26.80 ? 36  ILE D C     1 
ATOM   6636 O  O     . ILE D 1 38  ? -5.419  47.845 72.434  1.00 25.17 ? 36  ILE D O     1 
ATOM   6637 C  CB    . ILE D 1 38  ? -7.622  46.654 74.259  1.00 30.62 ? 36  ILE D CB    1 
ATOM   6638 C  CG1   . ILE D 1 38  ? -7.869  46.170 75.692  1.00 34.19 ? 36  ILE D CG1   1 
ATOM   6639 C  CG2   . ILE D 1 38  ? -8.791  46.253 73.388  1.00 29.90 ? 36  ILE D CG2   1 
ATOM   6640 C  CD1   . ILE D 1 38  ? -7.874  44.656 75.835  1.00 36.78 ? 36  ILE D CD1   1 
ATOM   6641 N  N     . GLY D 1 39  ? -6.175  46.062 71.285  1.00 24.35 ? 37  GLY D N     1 
ATOM   6642 C  CA    . GLY D 1 39  ? -5.831  46.632 69.995  1.00 26.06 ? 37  GLY D CA    1 
ATOM   6643 C  C     . GLY D 1 39  ? -6.740  46.140 68.883  1.00 25.06 ? 37  GLY D C     1 
ATOM   6644 O  O     . GLY D 1 39  ? -7.855  45.698 69.140  1.00 26.39 ? 37  GLY D O     1 
ATOM   6645 N  N     . GLY D 1 40  ? -6.258  46.208 67.649  1.00 25.43 ? 38  GLY D N     1 
ATOM   6646 C  CA    . GLY D 1 40  ? -7.058  45.772 66.518  1.00 26.00 ? 38  GLY D CA    1 
ATOM   6647 C  C     . GLY D 1 40  ? -7.330  46.961 65.614  1.00 25.39 ? 38  GLY D C     1 
ATOM   6648 O  O     . GLY D 1 40  ? -7.725  48.018 66.095  1.00 24.89 ? 38  GLY D O     1 
ATOM   6649 N  N     . LYS D 1 41  ? -7.107  46.805 64.312  1.00 27.56 ? 39  LYS D N     1 
ATOM   6650 C  CA    . LYS D 1 41  ? -7.340  47.899 63.368  1.00 28.61 ? 39  LYS D CA    1 
ATOM   6651 C  C     . LYS D 1 41  ? -8.732  48.498 63.560  1.00 27.07 ? 39  LYS D C     1 
ATOM   6652 O  O     . LYS D 1 41  ? -8.890  49.721 63.626  1.00 25.32 ? 39  LYS D O     1 
ATOM   6653 C  CB    . LYS D 1 41  ? -7.209  47.403 61.926  1.00 32.66 ? 39  LYS D CB    1 
ATOM   6654 C  CG    . LYS D 1 41  ? -5.807  46.992 61.518  1.00 36.96 ? 39  LYS D CG    1 
ATOM   6655 C  CD    . LYS D 1 41  ? -4.896  48.186 61.363  1.00 38.85 ? 39  LYS D CD    1 
ATOM   6656 C  CE    . LYS D 1 41  ? -3.489  47.744 60.979  1.00 44.03 ? 39  LYS D CE    1 
ATOM   6657 N  NZ    . LYS D 1 41  ? -2.520  48.882 60.873  1.00 43.43 ? 39  LYS D NZ    1 
ATOM   6658 N  N     . GLY D 1 42  ? -9.731  47.628 63.656  1.00 23.79 ? 40  GLY D N     1 
ATOM   6659 C  CA    . GLY D 1 42  ? -11.100 48.082 63.827  1.00 23.49 ? 40  GLY D CA    1 
ATOM   6660 C  C     . GLY D 1 42  ? -11.364 48.788 65.143  1.00 22.39 ? 40  GLY D C     1 
ATOM   6661 O  O     . GLY D 1 42  ? -11.914 49.889 65.159  1.00 19.64 ? 40  GLY D O     1 
ATOM   6662 N  N     . ALA D 1 43  ? -10.974 48.160 66.251  1.00 21.62 ? 41  ALA D N     1 
ATOM   6663 C  CA    . ALA D 1 43  ? -11.190 48.750 67.567  1.00 21.40 ? 41  ALA D CA    1 
ATOM   6664 C  C     . ALA D 1 43  ? -10.467 50.085 67.761  1.00 20.96 ? 41  ALA D C     1 
ATOM   6665 O  O     . ALA D 1 43  ? -11.051 51.034 68.283  1.00 22.69 ? 41  ALA D O     1 
ATOM   6666 C  CB    . ALA D 1 43  ? -10.777 47.760 68.666  1.00 20.13 ? 41  ALA D CB    1 
ATOM   6667 N  N     . ASN D 1 44  ? -9.206  50.167 67.343  1.00 21.74 ? 42  ASN D N     1 
ATOM   6668 C  CA    . ASN D 1 44  ? -8.447  51.406 67.504  1.00 21.85 ? 42  ASN D CA    1 
ATOM   6669 C  C     . ASN D 1 44  ? -9.153  52.576 66.816  1.00 20.97 ? 42  ASN D C     1 
ATOM   6670 O  O     . ASN D 1 44  ? -9.366  53.633 67.414  1.00 18.67 ? 42  ASN D O     1 
ATOM   6671 C  CB    . ASN D 1 44  ? -7.038  51.270 66.916  1.00 21.50 ? 42  ASN D CB    1 
ATOM   6672 C  CG    . ASN D 1 44  ? -6.222  50.173 67.579  1.00 23.70 ? 42  ASN D CG    1 
ATOM   6673 O  OD1   . ASN D 1 44  ? -6.616  49.616 68.607  1.00 21.32 ? 42  ASN D OD1   1 
ATOM   6674 N  ND2   . ASN D 1 44  ? -5.076  49.861 66.994  1.00 21.80 ? 42  ASN D ND2   1 
ATOM   6675 N  N     . GLN D 1 45  ? -9.521  52.378 65.556  1.00 19.62 ? 43  GLN D N     1 
ATOM   6676 C  CA    . GLN D 1 45  ? -10.181 53.439 64.805  1.00 20.58 ? 43  GLN D CA    1 
ATOM   6677 C  C     . GLN D 1 45  ? -11.539 53.815 65.398  1.00 20.95 ? 43  GLN D C     1 
ATOM   6678 O  O     . GLN D 1 45  ? -11.857 54.998 65.517  1.00 20.98 ? 43  GLN D O     1 
ATOM   6679 C  CB    . GLN D 1 45  ? -10.273 53.036 63.322  1.00 19.31 ? 43  GLN D CB    1 
ATOM   6680 C  CG    . GLN D 1 45  ? -8.862  52.993 62.699  1.00 19.69 ? 43  GLN D CG    1 
ATOM   6681 C  CD    . GLN D 1 45  ? -8.786  52.452 61.280  1.00 19.89 ? 43  GLN D CD    1 
ATOM   6682 O  OE1   . GLN D 1 45  ? -7.700  52.081 60.814  1.00 20.94 ? 43  GLN D OE1   1 
ATOM   6683 N  NE2   . GLN D 1 45  ? -9.918  52.413 60.584  1.00 15.90 ? 43  GLN D NE2   1 
ATOM   6684 N  N     . ALA D 1 46  ? -12.314 52.819 65.816  1.00 18.64 ? 44  ALA D N     1 
ATOM   6685 C  CA    . ALA D 1 46  ? -13.629 53.077 66.398  1.00 21.11 ? 44  ALA D CA    1 
ATOM   6686 C  C     . ALA D 1 46  ? -13.525 53.784 67.753  1.00 21.02 ? 44  ALA D C     1 
ATOM   6687 O  O     . ALA D 1 46  ? -14.281 54.715 68.043  1.00 19.53 ? 44  ALA D O     1 
ATOM   6688 C  CB    . ALA D 1 46  ? -14.399 51.769 66.546  1.00 20.15 ? 44  ALA D CB    1 
ATOM   6689 N  N     . ILE D 1 47  ? -12.590 53.335 68.584  1.00 19.84 ? 45  ILE D N     1 
ATOM   6690 C  CA    . ILE D 1 47  ? -12.394 53.940 69.900  1.00 20.94 ? 45  ILE D CA    1 
ATOM   6691 C  C     . ILE D 1 47  ? -12.005 55.413 69.789  1.00 19.71 ? 45  ILE D C     1 
ATOM   6692 O  O     . ILE D 1 47  ? -12.562 56.270 70.471  1.00 19.60 ? 45  ILE D O     1 
ATOM   6693 C  CB    . ILE D 1 47  ? -11.295 53.193 70.699  1.00 22.02 ? 45  ILE D CB    1 
ATOM   6694 C  CG1   . ILE D 1 47  ? -11.802 51.805 71.098  1.00 23.62 ? 45  ILE D CG1   1 
ATOM   6695 C  CG2   . ILE D 1 47  ? -10.895 54.003 71.936  1.00 23.24 ? 45  ILE D CG2   1 
ATOM   6696 C  CD1   . ILE D 1 47  ? -10.722 50.897 71.658  1.00 26.36 ? 45  ILE D CD1   1 
ATOM   6697 N  N     . ILE D 1 48  ? -11.057 55.714 68.915  1.00 18.68 ? 46  ILE D N     1 
ATOM   6698 C  CA    . ILE D 1 48  ? -10.607 57.094 68.765  1.00 20.18 ? 46  ILE D CA    1 
ATOM   6699 C  C     . ILE D 1 48  ? -11.719 57.974 68.190  1.00 19.97 ? 46  ILE D C     1 
ATOM   6700 O  O     . ILE D 1 48  ? -11.904 59.117 68.620  1.00 19.37 ? 46  ILE D O     1 
ATOM   6701 C  CB    . ILE D 1 48  ? -9.312  57.138 67.919  1.00 20.08 ? 46  ILE D CB    1 
ATOM   6702 C  CG1   . ILE D 1 48  ? -8.218  56.372 68.673  1.00 20.86 ? 46  ILE D CG1   1 
ATOM   6703 C  CG2   . ILE D 1 48  ? -8.867  58.575 67.673  1.00 20.95 ? 46  ILE D CG2   1 
ATOM   6704 C  CD1   . ILE D 1 48  ? -6.927  56.218 67.920  1.00 23.26 ? 46  ILE D CD1   1 
ATOM   6705 N  N     . LEU D 1 49  ? -12.484 57.438 67.245  1.00 18.15 ? 47  LEU D N     1 
ATOM   6706 C  CA    . LEU D 1 49  ? -13.587 58.201 66.682  1.00 19.15 ? 47  LEU D CA    1 
ATOM   6707 C  C     . LEU D 1 49  ? -14.571 58.603 67.783  1.00 20.62 ? 47  LEU D C     1 
ATOM   6708 O  O     . LEU D 1 49  ? -14.999 59.759 67.862  1.00 20.77 ? 47  LEU D O     1 
ATOM   6709 C  CB    . LEU D 1 49  ? -14.325 57.383 65.611  1.00 18.19 ? 47  LEU D CB    1 
ATOM   6710 C  CG    . LEU D 1 49  ? -13.712 57.401 64.204  1.00 18.97 ? 47  LEU D CG    1 
ATOM   6711 C  CD1   . LEU D 1 49  ? -14.287 56.250 63.370  1.00 20.32 ? 47  LEU D CD1   1 
ATOM   6712 C  CD2   . LEU D 1 49  ? -13.998 58.749 63.541  1.00 21.04 ? 47  LEU D CD2   1 
ATOM   6713 N  N     . SER D 1 50  ? -14.932 57.652 68.638  1.00 20.91 ? 48  SER D N     1 
ATOM   6714 C  CA    . SER D 1 50  ? -15.884 57.948 69.689  1.00 22.07 ? 48  SER D CA    1 
ATOM   6715 C  C     . SER D 1 50  ? -15.336 58.957 70.691  1.00 22.68 ? 48  SER D C     1 
ATOM   6716 O  O     . SER D 1 50  ? -16.082 59.796 71.200  1.00 24.46 ? 48  SER D O     1 
ATOM   6717 C  CB    . SER D 1 50  ? -16.315 56.667 70.400  1.00 25.12 ? 48  SER D CB    1 
ATOM   6718 O  OG    . SER D 1 50  ? -17.468 56.926 71.182  1.00 29.40 ? 48  SER D OG    1 
ATOM   6719 N  N     . ARG D 1 51  ? -14.037 58.894 70.961  1.00 22.73 ? 49  ARG D N     1 
ATOM   6720 C  CA    . ARG D 1 51  ? -13.424 59.835 71.890  1.00 24.50 ? 49  ARG D CA    1 
ATOM   6721 C  C     . ARG D 1 51  ? -13.507 61.248 71.331  1.00 25.78 ? 49  ARG D C     1 
ATOM   6722 O  O     . ARG D 1 51  ? -13.519 62.228 72.081  1.00 26.27 ? 49  ARG D O     1 
ATOM   6723 C  CB    . ARG D 1 51  ? -11.962 59.465 72.150  1.00 24.05 ? 49  ARG D CB    1 
ATOM   6724 C  CG    . ARG D 1 51  ? -11.787 58.176 72.940  1.00 25.33 ? 49  ARG D CG    1 
ATOM   6725 C  CD    . ARG D 1 51  ? -10.331 57.994 73.380  1.00 24.72 ? 49  ARG D CD    1 
ATOM   6726 N  NE    . ARG D 1 51  ? -10.176 56.835 74.252  1.00 27.93 ? 49  ARG D NE    1 
ATOM   6727 C  CZ    . ARG D 1 51  ? -9.040  56.487 74.852  1.00 27.04 ? 49  ARG D CZ    1 
ATOM   6728 N  NH1   . ARG D 1 51  ? -7.945  57.211 74.678  1.00 26.86 ? 49  ARG D NH1   1 
ATOM   6729 N  NH2   . ARG D 1 51  ? -9.004  55.411 75.628  1.00 28.69 ? 49  ARG D NH2   1 
ATOM   6730 N  N     . CYS D 1 52  ? -13.567 61.347 70.008  1.00 23.63 ? 50  CYS D N     1 
ATOM   6731 C  CA    . CYS D 1 52  ? -13.665 62.642 69.348  1.00 24.13 ? 50  CYS D CA    1 
ATOM   6732 C  C     . CYS D 1 52  ? -15.102 63.145 69.362  1.00 24.73 ? 50  CYS D C     1 
ATOM   6733 O  O     . CYS D 1 52  ? -15.377 64.240 68.887  1.00 24.96 ? 50  CYS D O     1 
ATOM   6734 C  CB    . CYS D 1 52  ? -13.191 62.547 67.898  1.00 23.95 ? 50  CYS D CB    1 
ATOM   6735 S  SG    . CYS D 1 52  ? -11.434 62.279 67.718  1.00 26.77 ? 50  CYS D SG    1 
ATOM   6736 N  N     . GLY D 1 53  ? -16.016 62.332 69.886  1.00 23.12 ? 51  GLY D N     1 
ATOM   6737 C  CA    . GLY D 1 53  ? -17.411 62.733 69.955  1.00 24.64 ? 51  GLY D CA    1 
ATOM   6738 C  C     . GLY D 1 53  ? -18.305 62.239 68.832  1.00 24.79 ? 51  GLY D C     1 
ATOM   6739 O  O     . GLY D 1 53  ? -19.479 62.615 68.760  1.00 25.45 ? 51  GLY D O     1 
ATOM   6740 N  N     . ILE D 1 54  ? -17.766 61.412 67.944  1.00 23.25 ? 52  ILE D N     1 
ATOM   6741 C  CA    . ILE D 1 54  ? -18.566 60.883 66.843  1.00 23.04 ? 52  ILE D CA    1 
ATOM   6742 C  C     . ILE D 1 54  ? -19.306 59.646 67.338  1.00 22.65 ? 52  ILE D C     1 
ATOM   6743 O  O     . ILE D 1 54  ? -18.691 58.766 67.932  1.00 24.58 ? 52  ILE D O     1 
ATOM   6744 C  CB    . ILE D 1 54  ? -17.684 60.437 65.658  1.00 21.98 ? 52  ILE D CB    1 
ATOM   6745 C  CG1   . ILE D 1 54  ? -16.770 61.582 65.206  1.00 22.51 ? 52  ILE D CG1   1 
ATOM   6746 C  CG2   . ILE D 1 54  ? -18.577 59.931 64.524  1.00 23.05 ? 52  ILE D CG2   1 
ATOM   6747 C  CD1   . ILE D 1 54  ? -17.493 62.845 64.792  1.00 23.59 ? 52  ILE D CD1   1 
ATOM   6748 N  N     . GLU D 1 55  ? -20.613 59.567 67.099  1.00 22.84 ? 53  GLU D N     1 
ATOM   6749 C  CA    . GLU D 1 55  ? -21.366 58.390 67.530  1.00 24.26 ? 53  GLU D CA    1 
ATOM   6750 C  C     . GLU D 1 55  ? -20.861 57.256 66.657  1.00 25.19 ? 53  GLU D C     1 
ATOM   6751 O  O     . GLU D 1 55  ? -21.073 57.261 65.438  1.00 23.91 ? 53  GLU D O     1 
ATOM   6752 C  CB    . GLU D 1 55  ? -22.872 58.564 67.324  1.00 25.06 ? 53  GLU D CB    1 
ATOM   6753 C  CG    . GLU D 1 55  ? -23.670 57.473 68.028  1.00 28.09 ? 53  GLU D CG    1 
ATOM   6754 C  CD    . GLU D 1 55  ? -25.157 57.537 67.752  1.00 30.32 ? 53  GLU D CD    1 
ATOM   6755 O  OE1   . GLU D 1 55  ? -25.700 58.654 67.630  1.00 30.99 ? 53  GLU D OE1   1 
ATOM   6756 O  OE2   . GLU D 1 55  ? -25.784 56.464 67.672  1.00 33.51 ? 53  GLU D OE2   1 
ATOM   6757 N  N     . THR D 1 56  ? -20.209 56.283 67.288  1.00 23.85 ? 54  THR D N     1 
ATOM   6758 C  CA    . THR D 1 56  ? -19.597 55.171 66.570  1.00 24.06 ? 54  THR D CA    1 
ATOM   6759 C  C     . THR D 1 56  ? -20.036 53.820 67.101  1.00 25.19 ? 54  THR D C     1 
ATOM   6760 O  O     . THR D 1 56  ? -20.323 53.661 68.285  1.00 25.03 ? 54  THR D O     1 
ATOM   6761 C  CB    . THR D 1 56  ? -18.051 55.274 66.670  1.00 25.05 ? 54  THR D CB    1 
ATOM   6762 O  OG1   . THR D 1 56  ? -17.644 56.605 66.324  1.00 25.71 ? 54  THR D OG1   1 
ATOM   6763 C  CG2   . THR D 1 56  ? -17.372 54.295 65.724  1.00 24.43 ? 54  THR D CG2   1 
ATOM   6764 N  N     . ARG D 1 57  ? -20.085 52.845 66.211  1.00 24.01 ? 55  ARG D N     1 
ATOM   6765 C  CA    . ARG D 1 57  ? -20.493 51.508 66.592  1.00 26.54 ? 55  ARG D CA    1 
ATOM   6766 C  C     . ARG D 1 57  ? -19.459 50.534 66.040  1.00 25.48 ? 55  ARG D C     1 
ATOM   6767 O  O     . ARG D 1 57  ? -19.163 50.556 64.850  1.00 23.31 ? 55  ARG D O     1 
ATOM   6768 C  CB    . ARG D 1 57  ? -21.875 51.227 66.007  1.00 28.56 ? 55  ARG D CB    1 
ATOM   6769 C  CG    . ARG D 1 57  ? -22.472 49.915 66.408  1.00 36.81 ? 55  ARG D CG    1 
ATOM   6770 C  CD    . ARG D 1 57  ? -23.863 49.778 65.817  1.00 38.93 ? 55  ARG D CD    1 
ATOM   6771 N  NE    . ARG D 1 57  ? -24.748 50.842 66.278  1.00 40.06 ? 55  ARG D NE    1 
ATOM   6772 C  CZ    . ARG D 1 57  ? -25.996 51.005 65.852  1.00 41.74 ? 55  ARG D CZ    1 
ATOM   6773 N  NH1   . ARG D 1 57  ? -26.504 50.168 64.952  1.00 41.53 ? 55  ARG D NH1   1 
ATOM   6774 N  NH2   . ARG D 1 57  ? -26.731 52.005 66.322  1.00 41.29 ? 55  ARG D NH2   1 
ATOM   6775 N  N     . LEU D 1 58  ? -18.891 49.700 66.907  1.00 24.09 ? 56  LEU D N     1 
ATOM   6776 C  CA    . LEU D 1 58  ? -17.893 48.725 66.475  1.00 23.44 ? 56  LEU D CA    1 
ATOM   6777 C  C     . LEU D 1 58  ? -18.538 47.360 66.325  1.00 23.48 ? 56  LEU D C     1 
ATOM   6778 O  O     . LEU D 1 58  ? -19.108 46.825 67.277  1.00 24.46 ? 56  LEU D O     1 
ATOM   6779 C  CB    . LEU D 1 58  ? -16.747 48.639 67.492  1.00 22.21 ? 56  LEU D CB    1 
ATOM   6780 C  CG    . LEU D 1 58  ? -15.670 47.575 67.251  1.00 23.81 ? 56  LEU D CG    1 
ATOM   6781 C  CD1   . LEU D 1 58  ? -15.018 47.762 65.875  1.00 20.86 ? 56  LEU D CD1   1 
ATOM   6782 C  CD2   . LEU D 1 58  ? -14.621 47.672 68.357  1.00 25.87 ? 56  LEU D CD2   1 
ATOM   6783 N  N     . ILE D 1 59  ? -18.450 46.805 65.123  1.00 23.20 ? 57  ILE D N     1 
ATOM   6784 C  CA    . ILE D 1 59  ? -19.010 45.494 64.840  1.00 23.86 ? 57  ILE D CA    1 
ATOM   6785 C  C     . ILE D 1 59  ? -17.797 44.591 64.668  1.00 24.69 ? 57  ILE D C     1 
ATOM   6786 O  O     . ILE D 1 59  ? -17.141 44.605 63.636  1.00 23.40 ? 57  ILE D O     1 
ATOM   6787 C  CB    . ILE D 1 59  ? -19.852 45.528 63.547  1.00 25.27 ? 57  ILE D CB    1 
ATOM   6788 C  CG1   . ILE D 1 59  ? -20.924 46.615 63.673  1.00 25.15 ? 57  ILE D CG1   1 
ATOM   6789 C  CG2   . ILE D 1 59  ? -20.513 44.174 63.309  1.00 23.88 ? 57  ILE D CG2   1 
ATOM   6790 C  CD1   . ILE D 1 59  ? -21.724 46.836 62.405  1.00 24.97 ? 57  ILE D CD1   1 
ATOM   6791 N  N     . ALA D 1 60  ? -17.485 43.826 65.707  1.00 24.84 ? 58  ALA D N     1 
ATOM   6792 C  CA    . ALA D 1 60  ? -16.321 42.958 65.675  1.00 26.01 ? 58  ALA D CA    1 
ATOM   6793 C  C     . ALA D 1 60  ? -16.544 41.766 66.588  1.00 28.08 ? 58  ALA D C     1 
ATOM   6794 O  O     . ALA D 1 60  ? -17.352 41.823 67.517  1.00 28.91 ? 58  ALA D O     1 
ATOM   6795 C  CB    . ALA D 1 60  ? -15.090 43.742 66.115  1.00 23.03 ? 58  ALA D CB    1 
ATOM   6796 N  N     . ALA D 1 61  ? -15.806 40.694 66.336  1.00 29.45 ? 59  ALA D N     1 
ATOM   6797 C  CA    . ALA D 1 61  ? -15.955 39.474 67.119  1.00 31.59 ? 59  ALA D CA    1 
ATOM   6798 C  C     . ALA D 1 61  ? -14.944 39.323 68.258  1.00 32.09 ? 59  ALA D C     1 
ATOM   6799 O  O     . ALA D 1 61  ? -13.753 39.576 68.080  1.00 32.86 ? 59  ALA D O     1 
ATOM   6800 C  CB    . ALA D 1 61  ? -15.871 38.263 66.180  1.00 29.99 ? 59  ALA D CB    1 
ATOM   6801 N  N     . THR D 1 62  ? -15.432 38.927 69.433  1.00 34.25 ? 60  THR D N     1 
ATOM   6802 C  CA    . THR D 1 62  ? -14.565 38.682 70.586  1.00 35.54 ? 60  THR D CA    1 
ATOM   6803 C  C     . THR D 1 62  ? -14.750 37.202 70.924  1.00 37.24 ? 60  THR D C     1 
ATOM   6804 O  O     . THR D 1 62  ? -15.797 36.622 70.626  1.00 35.92 ? 60  THR D O     1 
ATOM   6805 C  CB    . THR D 1 62  ? -14.943 39.540 71.825  1.00 36.76 ? 60  THR D CB    1 
ATOM   6806 O  OG1   . THR D 1 62  ? -16.205 39.114 72.348  1.00 37.22 ? 60  THR D OG1   1 
ATOM   6807 C  CG2   . THR D 1 62  ? -15.022 41.013 71.453  1.00 38.11 ? 60  THR D CG2   1 
ATOM   6808 N  N     . GLY D 1 63  ? -13.738 36.594 71.539  1.00 39.23 ? 61  GLY D N     1 
ATOM   6809 C  CA    . GLY D 1 63  ? -13.808 35.178 71.864  1.00 41.39 ? 61  GLY D CA    1 
ATOM   6810 C  C     . GLY D 1 63  ? -14.390 34.770 73.206  1.00 43.73 ? 61  GLY D C     1 
ATOM   6811 O  O     . GLY D 1 63  ? -14.815 35.604 74.009  1.00 44.27 ? 61  GLY D O     1 
ATOM   6812 N  N     . ASN D 1 64  ? -14.399 33.460 73.442  1.00 45.98 ? 62  ASN D N     1 
ATOM   6813 C  CA    . ASN D 1 64  ? -14.928 32.881 74.673  1.00 46.72 ? 62  ASN D CA    1 
ATOM   6814 C  C     . ASN D 1 64  ? -13.820 32.537 75.664  1.00 47.23 ? 62  ASN D C     1 
ATOM   6815 O  O     . ASN D 1 64  ? -13.951 31.586 76.440  1.00 48.22 ? 62  ASN D O     1 
ATOM   6816 C  CB    . ASN D 1 64  ? -15.710 31.608 74.351  1.00 48.82 ? 62  ASN D CB    1 
ATOM   6817 C  CG    . ASN D 1 64  ? -14.880 30.600 73.584  1.00 50.89 ? 62  ASN D CG    1 
ATOM   6818 O  OD1   . ASN D 1 64  ? -13.727 30.341 73.928  1.00 53.70 ? 62  ASN D OD1   1 
ATOM   6819 N  ND2   . ASN D 1 64  ? -15.463 30.021 72.541  1.00 53.54 ? 62  ASN D ND2   1 
ATOM   6820 N  N     . ASP D 1 65  ? -12.733 33.300 75.634  1.00 45.42 ? 63  ASP D N     1 
ATOM   6821 C  CA    . ASP D 1 65  ? -11.606 33.071 76.530  1.00 44.06 ? 63  ASP D CA    1 
ATOM   6822 C  C     . ASP D 1 65  ? -11.436 34.243 77.490  1.00 44.22 ? 63  ASP D C     1 
ATOM   6823 O  O     . ASP D 1 65  ? -12.271 35.149 77.523  1.00 44.23 ? 63  ASP D O     1 
ATOM   6824 C  CB    . ASP D 1 65  ? -10.325 32.875 75.719  1.00 43.34 ? 63  ASP D CB    1 
ATOM   6825 C  CG    . ASP D 1 65  ? -10.174 33.902 74.610  1.00 43.20 ? 63  ASP D CG    1 
ATOM   6826 O  OD1   . ASP D 1 65  ? -10.713 35.021 74.752  1.00 41.18 ? 63  ASP D OD1   1 
ATOM   6827 O  OD2   . ASP D 1 65  ? -9.504  33.593 73.603  1.00 42.45 ? 63  ASP D OD2   1 
ATOM   6828 N  N     . SER D 1 66  ? -10.358 34.229 78.272  1.00 43.59 ? 64  SER D N     1 
ATOM   6829 C  CA    . SER D 1 66  ? -10.115 35.310 79.222  1.00 43.29 ? 64  SER D CA    1 
ATOM   6830 C  C     . SER D 1 66  ? -9.796  36.608 78.487  1.00 42.49 ? 64  SER D C     1 
ATOM   6831 O  O     . SER D 1 66  ? -10.146 37.692 78.954  1.00 42.57 ? 64  SER D O     1 
ATOM   6832 C  CB    . SER D 1 66  ? -8.974  34.952 80.187  1.00 42.86 ? 64  SER D CB    1 
ATOM   6833 O  OG    . SER D 1 66  ? -7.729  34.855 79.523  1.00 45.47 ? 64  SER D OG    1 
ATOM   6834 N  N     . ASN D 1 67  ? -9.128  36.502 77.342  1.00 41.45 ? 65  ASN D N     1 
ATOM   6835 C  CA    . ASN D 1 67  ? -8.806  37.691 76.558  1.00 40.19 ? 65  ASN D CA    1 
ATOM   6836 C  C     . ASN D 1 67  ? -10.106 38.376 76.154  1.00 38.65 ? 65  ASN D C     1 
ATOM   6837 O  O     . ASN D 1 67  ? -10.244 39.594 76.271  1.00 39.20 ? 65  ASN D O     1 
ATOM   6838 C  CB    . ASN D 1 67  ? -8.010  37.327 75.299  1.00 40.14 ? 65  ASN D CB    1 
ATOM   6839 C  CG    . ASN D 1 67  ? -6.541  37.075 75.588  1.00 41.18 ? 65  ASN D CG    1 
ATOM   6840 O  OD1   . ASN D 1 67  ? -5.979  37.632 76.532  1.00 41.24 ? 65  ASN D OD1   1 
ATOM   6841 N  ND2   . ASN D 1 67  ? -5.907  36.250 74.761  1.00 41.87 ? 65  ASN D ND2   1 
ATOM   6842 N  N     . GLY D 1 68  ? -11.061 37.580 75.687  1.00 37.12 ? 66  GLY D N     1 
ATOM   6843 C  CA    . GLY D 1 68  ? -12.343 38.121 75.279  1.00 37.13 ? 66  GLY D CA    1 
ATOM   6844 C  C     . GLY D 1 68  ? -13.016 38.872 76.409  1.00 37.87 ? 66  GLY D C     1 
ATOM   6845 O  O     . GLY D 1 68  ? -13.521 39.979 76.220  1.00 36.63 ? 66  GLY D O     1 
ATOM   6846 N  N     . ALA D 1 69  ? -13.017 38.274 77.596  1.00 37.26 ? 67  ALA D N     1 
ATOM   6847 C  CA    . ALA D 1 69  ? -13.634 38.908 78.748  1.00 37.34 ? 67  ALA D CA    1 
ATOM   6848 C  C     . ALA D 1 69  ? -12.927 40.224 79.042  1.00 36.49 ? 67  ALA D C     1 
ATOM   6849 O  O     . ALA D 1 69  ? -13.565 41.229 79.354  1.00 37.45 ? 67  ALA D O     1 
ATOM   6850 C  CB    . ALA D 1 69  ? -13.555 37.980 79.957  1.00 37.68 ? 67  ALA D CB    1 
ATOM   6851 N  N     . TRP D 1 70  ? -11.604 40.214 78.936  1.00 34.87 ? 68  TRP D N     1 
ATOM   6852 C  CA    . TRP D 1 70  ? -10.815 41.411 79.190  1.00 35.54 ? 68  TRP D CA    1 
ATOM   6853 C  C     . TRP D 1 70  ? -11.134 42.485 78.154  1.00 33.38 ? 68  TRP D C     1 
ATOM   6854 O  O     . TRP D 1 70  ? -11.322 43.652 78.492  1.00 32.19 ? 68  TRP D O     1 
ATOM   6855 C  CB    . TRP D 1 70  ? -9.322  41.072 79.161  1.00 35.45 ? 68  TRP D CB    1 
ATOM   6856 C  CG    . TRP D 1 70  ? -8.421  42.253 79.340  1.00 39.41 ? 68  TRP D CG    1 
ATOM   6857 C  CD1   . TRP D 1 70  ? -8.679  43.377 80.066  1.00 40.22 ? 68  TRP D CD1   1 
ATOM   6858 C  CD2   . TRP D 1 70  ? -7.094  42.407 78.822  1.00 41.31 ? 68  TRP D CD2   1 
ATOM   6859 N  NE1   . TRP D 1 70  ? -7.597  44.224 80.034  1.00 41.90 ? 68  TRP D NE1   1 
ATOM   6860 C  CE2   . TRP D 1 70  ? -6.609  43.653 79.278  1.00 42.46 ? 68  TRP D CE2   1 
ATOM   6861 C  CE3   . TRP D 1 70  ? -6.265  41.610 78.020  1.00 42.59 ? 68  TRP D CE3   1 
ATOM   6862 C  CZ2   . TRP D 1 70  ? -5.331  44.124 78.959  1.00 44.14 ? 68  TRP D CZ2   1 
ATOM   6863 C  CZ3   . TRP D 1 70  ? -4.992  42.078 77.702  1.00 44.88 ? 68  TRP D CZ3   1 
ATOM   6864 C  CH2   . TRP D 1 70  ? -4.539  43.325 78.173  1.00 45.05 ? 68  TRP D CH2   1 
ATOM   6865 N  N     . ILE D 1 71  ? -11.193 42.081 76.892  1.00 32.12 ? 69  ILE D N     1 
ATOM   6866 C  CA    . ILE D 1 71  ? -11.503 43.006 75.810  1.00 31.87 ? 69  ILE D CA    1 
ATOM   6867 C  C     . ILE D 1 71  ? -12.880 43.646 76.011  1.00 32.09 ? 69  ILE D C     1 
ATOM   6868 O  O     . ILE D 1 71  ? -13.003 44.872 76.027  1.00 30.73 ? 69  ILE D O     1 
ATOM   6869 C  CB    . ILE D 1 71  ? -11.482 42.281 74.448  1.00 30.61 ? 69  ILE D CB    1 
ATOM   6870 C  CG1   . ILE D 1 71  ? -10.048 41.866 74.106  1.00 28.91 ? 69  ILE D CG1   1 
ATOM   6871 C  CG2   . ILE D 1 71  ? -12.062 43.178 73.374  1.00 31.35 ? 69  ILE D CG2   1 
ATOM   6872 C  CD1   . ILE D 1 71  ? -9.928  40.972 72.881  1.00 27.41 ? 69  ILE D CD1   1 
ATOM   6873 N  N     . ARG D 1 72  ? -13.908 42.814 76.160  1.00 32.04 ? 70  ARG D N     1 
ATOM   6874 C  CA    . ARG D 1 72  ? -15.268 43.307 76.346  1.00 34.51 ? 70  ARG D CA    1 
ATOM   6875 C  C     . ARG D 1 72  ? -15.399 44.283 77.512  1.00 35.60 ? 70  ARG D C     1 
ATOM   6876 O  O     . ARG D 1 72  ? -16.145 45.262 77.431  1.00 34.72 ? 70  ARG D O     1 
ATOM   6877 C  CB    . ARG D 1 72  ? -16.241 42.138 76.534  1.00 35.16 ? 70  ARG D CB    1 
ATOM   6878 C  CG    . ARG D 1 72  ? -16.444 41.300 75.278  1.00 34.29 ? 70  ARG D CG    1 
ATOM   6879 C  CD    . ARG D 1 72  ? -17.637 40.361 75.414  1.00 35.91 ? 70  ARG D CD    1 
ATOM   6880 N  NE    . ARG D 1 72  ? -17.410 39.287 76.378  1.00 37.64 ? 70  ARG D NE    1 
ATOM   6881 C  CZ    . ARG D 1 72  ? -16.697 38.194 76.133  1.00 38.19 ? 70  ARG D CZ    1 
ATOM   6882 N  NH1   . ARG D 1 72  ? -16.131 38.016 74.948  1.00 38.90 ? 70  ARG D NH1   1 
ATOM   6883 N  NH2   . ARG D 1 72  ? -16.553 37.271 77.076  1.00 39.67 ? 70  ARG D NH2   1 
ATOM   6884 N  N     . GLN D 1 73  ? -14.666 44.021 78.590  1.00 36.85 ? 71  GLN D N     1 
ATOM   6885 C  CA    . GLN D 1 73  ? -14.704 44.879 79.769  1.00 37.66 ? 71  GLN D CA    1 
ATOM   6886 C  C     . GLN D 1 73  ? -14.056 46.230 79.479  1.00 36.75 ? 71  GLN D C     1 
ATOM   6887 O  O     . GLN D 1 73  ? -14.568 47.274 79.886  1.00 35.15 ? 71  GLN D O     1 
ATOM   6888 C  CB    . GLN D 1 73  ? -13.974 44.201 80.933  1.00 41.05 ? 71  GLN D CB    1 
ATOM   6889 C  CG    . GLN D 1 73  ? -14.047 44.955 82.254  1.00 46.21 ? 71  GLN D CG    1 
ATOM   6890 C  CD    . GLN D 1 73  ? -15.473 45.176 82.724  1.00 49.34 ? 71  GLN D CD    1 
ATOM   6891 O  OE1   . GLN D 1 73  ? -16.141 46.117 82.296  1.00 52.34 ? 71  GLN D OE1   1 
ATOM   6892 N  NE2   . GLN D 1 73  ? -15.951 44.298 83.602  1.00 51.98 ? 71  GLN D NE2   1 
ATOM   6893 N  N     . GLN D 1 74  ? -12.927 46.204 78.777  1.00 35.42 ? 72  GLN D N     1 
ATOM   6894 C  CA    . GLN D 1 74  ? -12.212 47.430 78.438  1.00 35.95 ? 72  GLN D CA    1 
ATOM   6895 C  C     . GLN D 1 74  ? -13.040 48.331 77.519  1.00 34.68 ? 72  GLN D C     1 
ATOM   6896 O  O     . GLN D 1 74  ? -13.034 49.557 77.660  1.00 35.73 ? 72  GLN D O     1 
ATOM   6897 C  CB    . GLN D 1 74  ? -10.879 47.089 77.769  1.00 37.03 ? 72  GLN D CB    1 
ATOM   6898 C  CG    . GLN D 1 74  ? -9.922  46.371 78.690  1.00 40.25 ? 72  GLN D CG    1 
ATOM   6899 C  CD    . GLN D 1 74  ? -9.682  47.152 79.959  1.00 41.06 ? 72  GLN D CD    1 
ATOM   6900 O  OE1   . GLN D 1 74  ? -9.105  48.238 79.931  1.00 44.08 ? 72  GLN D OE1   1 
ATOM   6901 N  NE2   . GLN D 1 74  ? -10.137 46.611 81.082  1.00 43.36 ? 72  GLN D NE2   1 
ATOM   6902 N  N     . ILE D 1 75  ? -13.749 47.716 76.582  1.00 32.73 ? 73  ILE D N     1 
ATOM   6903 C  CA    . ILE D 1 75  ? -14.582 48.459 75.647  1.00 32.00 ? 73  ILE D CA    1 
ATOM   6904 C  C     . ILE D 1 75  ? -15.784 49.073 76.352  1.00 33.21 ? 73  ILE D C     1 
ATOM   6905 O  O     . ILE D 1 75  ? -16.188 50.195 76.057  1.00 31.17 ? 73  ILE D O     1 
ATOM   6906 C  CB    . ILE D 1 75  ? -15.087 47.545 74.523  1.00 31.89 ? 73  ILE D CB    1 
ATOM   6907 C  CG1   . ILE D 1 75  ? -13.894 46.978 73.746  1.00 30.86 ? 73  ILE D CG1   1 
ATOM   6908 C  CG2   . ILE D 1 75  ? -16.024 48.320 73.608  1.00 30.49 ? 73  ILE D CG2   1 
ATOM   6909 C  CD1   . ILE D 1 75  ? -12.971 48.035 73.171  1.00 32.32 ? 73  ILE D CD1   1 
ATOM   6910 N  N     . LYS D 1 76  ? -16.350 48.310 77.278  1.00 33.65 ? 74  LYS D N     1 
ATOM   6911 C  CA    . LYS D 1 76  ? -17.493 48.759 78.050  1.00 36.48 ? 74  LYS D CA    1 
ATOM   6912 C  C     . LYS D 1 76  ? -17.065 49.980 78.888  1.00 36.84 ? 74  LYS D C     1 
ATOM   6913 O  O     . LYS D 1 76  ? -17.868 50.885 79.128  1.00 37.84 ? 74  LYS D O     1 
ATOM   6914 C  CB    . LYS D 1 76  ? -17.971 47.619 78.952  1.00 37.42 ? 74  LYS D CB    1 
ATOM   6915 C  CG    . LYS D 1 76  ? -19.372 47.786 79.495  1.00 42.01 ? 74  LYS D CG    1 
ATOM   6916 C  CD    . LYS D 1 76  ? -19.814 46.550 80.273  1.00 42.89 ? 74  LYS D CD    1 
ATOM   6917 C  CE    . LYS D 1 76  ? -19.027 46.378 81.567  1.00 45.50 ? 74  LYS D CE    1 
ATOM   6918 N  NZ    . LYS D 1 76  ? -19.540 45.242 82.395  1.00 47.35 ? 74  LYS D NZ    1 
ATOM   6919 N  N     . ASN D 1 77  ? -15.793 49.995 79.294  1.00 36.60 ? 75  ASN D N     1 
ATOM   6920 C  CA    . ASN D 1 77  ? -15.224 51.083 80.079  1.00 36.17 ? 75  ASN D CA    1 
ATOM   6921 C  C     . ASN D 1 77  ? -14.880 52.361 79.315  1.00 36.29 ? 75  ASN D C     1 
ATOM   6922 O  O     . ASN D 1 77  ? -14.565 53.376 79.931  1.00 36.02 ? 75  ASN D O     1 
ATOM   6923 C  CB    . ASN D 1 77  ? -13.968 50.603 80.843  1.00 38.14 ? 75  ASN D CB    1 
ATOM   6924 C  CG    . ASN D 1 77  ? -14.288 49.612 81.942  1.00 38.55 ? 75  ASN D CG    1 
ATOM   6925 O  OD1   . ASN D 1 77  ? -15.440 49.208 82.113  1.00 40.85 ? 75  ASN D OD1   1 
ATOM   6926 N  ND2   . ASN D 1 77  ? -13.257 49.210 82.693  1.00 40.09 ? 75  ASN D ND2   1 
ATOM   6927 N  N     . GLU D 1 78  ? -14.951 52.321 77.989  1.00 35.76 ? 76  GLU D N     1 
ATOM   6928 C  CA    . GLU D 1 78  ? -14.619 53.491 77.189  1.00 34.21 ? 76  GLU D CA    1 
ATOM   6929 C  C     . GLU D 1 78  ? -15.503 54.726 77.415  1.00 35.51 ? 76  GLU D C     1 
ATOM   6930 O  O     . GLU D 1 78  ? -15.000 55.777 77.782  1.00 35.87 ? 76  GLU D O     1 
ATOM   6931 C  CB    . GLU D 1 78  ? -14.567 53.141 75.696  1.00 33.80 ? 76  GLU D CB    1 
ATOM   6932 C  CG    . GLU D 1 78  ? -13.192 52.772 75.193  1.00 33.72 ? 76  GLU D CG    1 
ATOM   6933 C  CD    . GLU D 1 78  ? -12.171 53.904 75.413  1.00 34.21 ? 76  GLU D CD    1 
ATOM   6934 O  OE1   . GLU D 1 78  ? -11.182 53.664 76.117  1.00 32.86 ? 76  GLU D OE1   1 
ATOM   6935 O  OE2   . GLU D 1 78  ? -12.408 55.032 74.928  1.00 31.81 ? 76  GLU D OE2   1 
ATOM   6936 N  N     . PRO D 1 79  ? -16.822 54.647 77.184  1.00 35.05 ? 77  PRO D N     1 
ATOM   6937 C  CA    . PRO D 1 79  ? -17.527 53.456 76.722  1.00 34.77 ? 77  PRO D CA    1 
ATOM   6938 C  C     . PRO D 1 79  ? -17.715 53.519 75.195  1.00 34.29 ? 77  PRO D C     1 
ATOM   6939 O  O     . PRO D 1 79  ? -17.720 54.615 74.625  1.00 34.77 ? 77  PRO D O     1 
ATOM   6940 C  CB    . PRO D 1 79  ? -18.852 53.562 77.452  1.00 35.00 ? 77  PRO D CB    1 
ATOM   6941 C  CG    . PRO D 1 79  ? -19.113 55.006 77.341  1.00 35.30 ? 77  PRO D CG    1 
ATOM   6942 C  CD    . PRO D 1 79  ? -17.796 55.659 77.652  1.00 34.40 ? 77  PRO D CD    1 
ATOM   6943 N  N     . LEU D 1 80  ? -17.859 52.362 74.543  1.00 34.97 ? 78  LEU D N     1 
ATOM   6944 C  CA    . LEU D 1 80  ? -18.050 52.277 73.095  1.00 34.32 ? 78  LEU D CA    1 
ATOM   6945 C  C     . LEU D 1 80  ? -18.956 51.090 72.825  1.00 34.73 ? 78  LEU D C     1 
ATOM   6946 O  O     . LEU D 1 80  ? -18.769 50.018 73.410  1.00 34.37 ? 78  LEU D O     1 
ATOM   6947 C  CB    . LEU D 1 80  ? -16.711 52.056 72.372  1.00 34.88 ? 78  LEU D CB    1 
ATOM   6948 C  CG    . LEU D 1 80  ? -16.810 51.743 70.871  1.00 33.30 ? 78  LEU D CG    1 
ATOM   6949 C  CD1   . LEU D 1 80  ? -17.292 52.974 70.122  1.00 36.02 ? 78  LEU D CD1   1 
ATOM   6950 C  CD2   . LEU D 1 80  ? -15.455 51.299 70.348  1.00 30.60 ? 78  LEU D CD2   1 
HETATM 6951 N  N     . MSE D 1 81  ? -19.934 51.276 71.946  1.00 35.16 ? 79  MSE D N     1 
HETATM 6952 C  CA    . MSE D 1 81  ? -20.856 50.203 71.608  1.00 37.23 ? 79  MSE D CA    1 
HETATM 6953 C  C     . MSE D 1 81  ? -20.132 49.144 70.794  1.00 35.39 ? 79  MSE D C     1 
HETATM 6954 O  O     . MSE D 1 81  ? -19.673 49.411 69.681  1.00 33.14 ? 79  MSE D O     1 
HETATM 6955 C  CB    . MSE D 1 81  ? -22.028 50.746 70.790  1.00 43.46 ? 79  MSE D CB    1 
HETATM 6956 C  CG    . MSE D 1 81  ? -22.968 51.669 71.545  1.00 51.77 ? 79  MSE D CG    1 
HETATM 6957 SE SE    . MSE D 1 81  ? -24.435 52.255 70.407  1.00 66.37 ? 79  MSE D SE    1 
HETATM 6958 C  CE    . MSE D 1 81  ? -25.044 50.519 69.802  1.00 59.06 ? 79  MSE D CE    1 
ATOM   6959 N  N     . LEU D 1 82  ? -20.024 47.949 71.362  1.00 33.57 ? 80  LEU D N     1 
ATOM   6960 C  CA    . LEU D 1 82  ? -19.379 46.828 70.697  1.00 33.70 ? 80  LEU D CA    1 
ATOM   6961 C  C     . LEU D 1 82  ? -20.447 45.804 70.328  1.00 35.01 ? 80  LEU D C     1 
ATOM   6962 O  O     . LEU D 1 82  ? -21.173 45.317 71.197  1.00 34.90 ? 80  LEU D O     1 
ATOM   6963 C  CB    . LEU D 1 82  ? -18.345 46.181 71.622  1.00 34.15 ? 80  LEU D CB    1 
ATOM   6964 C  CG    . LEU D 1 82  ? -17.742 44.843 71.181  1.00 33.28 ? 80  LEU D CG    1 
ATOM   6965 C  CD1   . LEU D 1 82  ? -17.040 45.003 69.836  1.00 33.69 ? 80  LEU D CD1   1 
ATOM   6966 C  CD2   . LEU D 1 82  ? -16.764 44.348 72.241  1.00 32.72 ? 80  LEU D CD2   1 
ATOM   6967 N  N     . LEU D 1 83  ? -20.542 45.480 69.043  1.00 33.78 ? 81  LEU D N     1 
ATOM   6968 C  CA    . LEU D 1 83  ? -21.529 44.515 68.578  1.00 36.54 ? 81  LEU D CA    1 
ATOM   6969 C  C     . LEU D 1 83  ? -20.864 43.316 67.912  1.00 37.40 ? 81  LEU D C     1 
ATOM   6970 O  O     . LEU D 1 83  ? -19.869 43.464 67.203  1.00 37.63 ? 81  LEU D O     1 
ATOM   6971 C  CB    . LEU D 1 83  ? -22.488 45.179 67.588  1.00 37.43 ? 81  LEU D CB    1 
ATOM   6972 C  CG    . LEU D 1 83  ? -23.377 46.304 68.117  1.00 39.61 ? 81  LEU D CG    1 
ATOM   6973 C  CD1   . LEU D 1 83  ? -24.229 46.834 66.977  1.00 40.88 ? 81  LEU D CD1   1 
ATOM   6974 C  CD2   . LEU D 1 83  ? -24.260 45.789 69.242  1.00 41.05 ? 81  LEU D CD2   1 
ATOM   6975 N  N     . PRO D 1 84  ? -21.420 42.109 68.116  1.00 39.77 ? 82  PRO D N     1 
ATOM   6976 C  CA    . PRO D 1 84  ? -22.614 41.842 68.923  1.00 41.60 ? 82  PRO D CA    1 
ATOM   6977 C  C     . PRO D 1 84  ? -22.334 41.868 70.415  1.00 43.16 ? 82  PRO D C     1 
ATOM   6978 O  O     . PRO D 1 84  ? -21.212 42.122 70.854  1.00 43.26 ? 82  PRO D O     1 
ATOM   6979 C  CB    . PRO D 1 84  ? -23.047 40.449 68.463  1.00 41.66 ? 82  PRO D CB    1 
ATOM   6980 C  CG    . PRO D 1 84  ? -22.428 40.313 67.106  1.00 42.19 ? 82  PRO D CG    1 
ATOM   6981 C  CD    . PRO D 1 84  ? -21.074 40.918 67.330  1.00 40.22 ? 82  PRO D CD    1 
ATOM   6982 N  N     . ASP D 1 85  ? -23.374 41.567 71.181  1.00 46.64 ? 83  ASP D N     1 
ATOM   6983 C  CA    . ASP D 1 85  ? -23.309 41.550 72.632  1.00 49.87 ? 83  ASP D CA    1 
ATOM   6984 C  C     . ASP D 1 85  ? -22.697 40.252 73.163  1.00 50.53 ? 83  ASP D C     1 
ATOM   6985 O  O     . ASP D 1 85  ? -22.180 40.216 74.278  1.00 50.85 ? 83  ASP D O     1 
ATOM   6986 C  CB    . ASP D 1 85  ? -24.721 41.741 73.190  1.00 53.42 ? 83  ASP D CB    1 
ATOM   6987 C  CG    . ASP D 1 85  ? -24.724 42.322 74.586  1.00 57.15 ? 83  ASP D CG    1 
ATOM   6988 O  OD1   . ASP D 1 85  ? -23.933 43.258 74.837  1.00 59.50 ? 83  ASP D OD1   1 
ATOM   6989 O  OD2   . ASP D 1 85  ? -25.529 41.858 75.426  1.00 58.97 ? 83  ASP D OD2   1 
ATOM   6990 N  N     . GLY D 1 86  ? -22.755 39.192 72.363  1.00 50.91 ? 84  GLY D N     1 
ATOM   6991 C  CA    . GLY D 1 86  ? -22.198 37.919 72.789  1.00 52.96 ? 84  GLY D CA    1 
ATOM   6992 C  C     . GLY D 1 86  ? -20.895 37.575 72.091  1.00 53.62 ? 84  GLY D C     1 
ATOM   6993 O  O     . GLY D 1 86  ? -20.505 38.238 71.131  1.00 53.99 ? 84  GLY D O     1 
ATOM   6994 N  N     . HIS D 1 87  ? -20.217 36.539 72.573  1.00 53.50 ? 85  HIS D N     1 
ATOM   6995 C  CA    . HIS D 1 87  ? -18.952 36.115 71.985  1.00 53.73 ? 85  HIS D CA    1 
ATOM   6996 C  C     . HIS D 1 87  ? -19.154 34.948 71.026  1.00 53.38 ? 85  HIS D C     1 
ATOM   6997 O  O     . HIS D 1 87  ? -20.264 34.440 70.871  1.00 52.89 ? 85  HIS D O     1 
ATOM   6998 C  CB    . HIS D 1 87  ? -17.975 35.700 73.082  1.00 55.65 ? 85  HIS D CB    1 
ATOM   6999 C  CG    . HIS D 1 87  ? -18.507 34.636 73.989  1.00 57.13 ? 85  HIS D CG    1 
ATOM   7000 N  ND1   . HIS D 1 87  ? -18.883 34.888 75.291  1.00 57.69 ? 85  HIS D ND1   1 
ATOM   7001 C  CD2   . HIS D 1 87  ? -18.756 33.321 73.773  1.00 57.80 ? 85  HIS D CD2   1 
ATOM   7002 C  CE1   . HIS D 1 87  ? -19.341 33.776 75.838  1.00 58.09 ? 85  HIS D CE1   1 
ATOM   7003 N  NE2   . HIS D 1 87  ? -19.275 32.810 74.938  1.00 58.16 ? 85  HIS D NE2   1 
ATOM   7004 N  N     . PHE D 1 88  ? -18.070 34.528 70.381  1.00 53.34 ? 86  PHE D N     1 
ATOM   7005 C  CA    . PHE D 1 88  ? -18.124 33.414 69.445  1.00 53.79 ? 86  PHE D CA    1 
ATOM   7006 C  C     . PHE D 1 88  ? -17.373 32.219 70.020  1.00 55.05 ? 86  PHE D C     1 
ATOM   7007 O  O     . PHE D 1 88  ? -16.499 32.379 70.873  1.00 55.08 ? 86  PHE D O     1 
ATOM   7008 C  CB    . PHE D 1 88  ? -17.527 33.827 68.095  1.00 53.19 ? 86  PHE D CB    1 
ATOM   7009 C  CG    . PHE D 1 88  ? -18.351 34.849 67.361  1.00 52.25 ? 86  PHE D CG    1 
ATOM   7010 C  CD1   . PHE D 1 88  ? -18.490 36.140 67.860  1.00 51.36 ? 86  PHE D CD1   1 
ATOM   7011 C  CD2   . PHE D 1 88  ? -19.022 34.508 66.193  1.00 52.02 ? 86  PHE D CD2   1 
ATOM   7012 C  CE1   . PHE D 1 88  ? -19.289 37.077 67.206  1.00 51.98 ? 86  PHE D CE1   1 
ATOM   7013 C  CE2   . PHE D 1 88  ? -19.825 35.436 65.532  1.00 51.91 ? 86  PHE D CE2   1 
ATOM   7014 C  CZ    . PHE D 1 88  ? -19.958 36.722 66.039  1.00 51.30 ? 86  PHE D CZ    1 
ATOM   7015 N  N     . ASN D 1 89  ? -17.721 31.024 69.556  1.00 56.17 ? 87  ASN D N     1 
ATOM   7016 C  CA    . ASN D 1 89  ? -17.091 29.801 70.038  1.00 57.74 ? 87  ASN D CA    1 
ATOM   7017 C  C     . ASN D 1 89  ? -15.680 29.598 69.493  1.00 56.91 ? 87  ASN D C     1 
ATOM   7018 O  O     . ASN D 1 89  ? -15.394 28.597 68.838  1.00 57.49 ? 87  ASN D O     1 
ATOM   7019 C  CB    . ASN D 1 89  ? -17.969 28.586 69.703  1.00 60.21 ? 87  ASN D CB    1 
ATOM   7020 C  CG    . ASN D 1 89  ? -18.259 28.455 68.211  1.00 62.84 ? 87  ASN D CG    1 
ATOM   7021 O  OD1   . ASN D 1 89  ? -19.009 27.569 67.792  1.00 65.26 ? 87  ASN D OD1   1 
ATOM   7022 N  ND2   . ASN D 1 89  ? -17.665 29.331 67.405  1.00 63.28 ? 87  ASN D ND2   1 
ATOM   7023 N  N     . GLN D 1 90  ? -14.805 30.561 69.768  1.00 56.01 ? 88  GLN D N     1 
ATOM   7024 C  CA    . GLN D 1 90  ? -13.413 30.501 69.333  1.00 54.40 ? 88  GLN D CA    1 
ATOM   7025 C  C     . GLN D 1 90  ? -12.546 31.403 70.204  1.00 51.91 ? 88  GLN D C     1 
ATOM   7026 O  O     . GLN D 1 90  ? -13.046 32.103 71.082  1.00 51.39 ? 88  GLN D O     1 
ATOM   7027 C  CB    . GLN D 1 90  ? -13.276 30.928 67.867  1.00 57.09 ? 88  GLN D CB    1 
ATOM   7028 C  CG    . GLN D 1 90  ? -14.002 30.028 66.881  1.00 60.82 ? 88  GLN D CG    1 
ATOM   7029 C  CD    . GLN D 1 90  ? -13.447 30.128 65.476  1.00 62.88 ? 88  GLN D CD    1 
ATOM   7030 O  OE1   . GLN D 1 90  ? -13.983 29.531 64.540  1.00 64.19 ? 88  GLN D OE1   1 
ATOM   7031 N  NE2   . GLN D 1 90  ? -12.361 30.877 65.320  1.00 64.13 ? 88  GLN D NE2   1 
ATOM   7032 N  N     . HIS D 1 91  ? -11.241 31.372 69.960  1.00 49.64 ? 89  HIS D N     1 
ATOM   7033 C  CA    . HIS D 1 91  ? -10.294 32.192 70.707  1.00 48.02 ? 89  HIS D CA    1 
ATOM   7034 C  C     . HIS D 1 91  ? -10.348 33.635 70.208  1.00 45.62 ? 89  HIS D C     1 
ATOM   7035 O  O     . HIS D 1 91  ? -10.567 33.876 69.024  1.00 44.53 ? 89  HIS D O     1 
ATOM   7036 C  CB    . HIS D 1 91  ? -8.873  31.654 70.519  1.00 51.03 ? 89  HIS D CB    1 
ATOM   7037 C  CG    . HIS D 1 91  ? -8.552  30.466 71.372  1.00 54.16 ? 89  HIS D CG    1 
ATOM   7038 N  ND1   . HIS D 1 91  ? -9.393  29.380 71.489  1.00 55.90 ? 89  HIS D ND1   1 
ATOM   7039 C  CD2   . HIS D 1 91  ? -7.468  30.185 72.134  1.00 55.77 ? 89  HIS D CD2   1 
ATOM   7040 C  CE1   . HIS D 1 91  ? -8.842  28.482 72.287  1.00 55.61 ? 89  HIS D CE1   1 
ATOM   7041 N  NE2   . HIS D 1 91  ? -7.674  28.946 72.691  1.00 56.58 ? 89  HIS D NE2   1 
ATOM   7042 N  N     . SER D 1 92  ? -10.151 34.593 71.107  1.00 42.73 ? 90  SER D N     1 
ATOM   7043 C  CA    . SER D 1 92  ? -10.159 35.996 70.710  1.00 40.36 ? 90  SER D CA    1 
ATOM   7044 C  C     . SER D 1 92  ? -8.925  36.245 69.861  1.00 38.74 ? 90  SER D C     1 
ATOM   7045 O  O     . SER D 1 92  ? -7.857  35.692 70.130  1.00 38.69 ? 90  SER D O     1 
ATOM   7046 C  CB    . SER D 1 92  ? -10.126 36.907 71.937  1.00 39.82 ? 90  SER D CB    1 
ATOM   7047 O  OG    . SER D 1 92  ? -11.276 36.723 72.740  1.00 40.65 ? 90  SER D OG    1 
ATOM   7048 N  N     . ASP D 1 93  ? -9.064  37.066 68.826  1.00 36.14 ? 91  ASP D N     1 
ATOM   7049 C  CA    . ASP D 1 93  ? -7.923  37.350 67.975  1.00 34.53 ? 91  ASP D CA    1 
ATOM   7050 C  C     . ASP D 1 93  ? -6.850  38.065 68.778  1.00 33.04 ? 91  ASP D C     1 
ATOM   7051 O  O     . ASP D 1 93  ? -7.141  38.768 69.749  1.00 32.34 ? 91  ASP D O     1 
ATOM   7052 C  CB    . ASP D 1 93  ? -8.326  38.198 66.761  1.00 34.92 ? 91  ASP D CB    1 
ATOM   7053 C  CG    . ASP D 1 93  ? -9.160  37.418 65.752  1.00 38.06 ? 91  ASP D CG    1 
ATOM   7054 O  OD1   . ASP D 1 93  ? -8.853  36.227 65.518  1.00 38.58 ? 91  ASP D OD1   1 
ATOM   7055 O  OD2   . ASP D 1 93  ? -10.112 37.997 65.183  1.00 36.74 ? 91  ASP D OD2   1 
ATOM   7056 N  N     . THR D 1 94  ? -5.604  37.869 68.370  1.00 32.88 ? 92  THR D N     1 
ATOM   7057 C  CA    . THR D 1 94  ? -4.471  38.482 69.035  1.00 33.66 ? 92  THR D CA    1 
ATOM   7058 C  C     . THR D 1 94  ? -3.421  38.861 68.002  1.00 33.45 ? 92  THR D C     1 
ATOM   7059 O  O     . THR D 1 94  ? -3.371  38.299 66.902  1.00 34.88 ? 92  THR D O     1 
ATOM   7060 C  CB    . THR D 1 94  ? -3.848  37.514 70.072  1.00 36.40 ? 92  THR D CB    1 
ATOM   7061 O  OG1   . THR D 1 94  ? -3.393  36.333 69.407  1.00 38.06 ? 92  THR D OG1   1 
ATOM   7062 C  CG2   . THR D 1 94  ? -4.883  37.114 71.124  1.00 37.44 ? 92  THR D CG2   1 
ATOM   7063 N  N     . SER D 1 95  ? -2.590  39.834 68.347  1.00 32.87 ? 93  SER D N     1 
ATOM   7064 C  CA    . SER D 1 95  ? -1.542  40.277 67.447  1.00 33.15 ? 93  SER D CA    1 
ATOM   7065 C  C     . SER D 1 95  ? -0.186  40.239 68.131  1.00 33.81 ? 93  SER D C     1 
ATOM   7066 O  O     . SER D 1 95  ? -0.039  40.704 69.263  1.00 32.91 ? 93  SER D O     1 
ATOM   7067 C  CB    . SER D 1 95  ? -1.807  41.710 66.968  1.00 33.41 ? 93  SER D CB    1 
ATOM   7068 O  OG    . SER D 1 95  ? -2.932  41.785 66.104  1.00 33.87 ? 93  SER D OG    1 
ATOM   7069 N  N     . ILE D 1 96  ? 0.797   39.672 67.442  1.00 31.87 ? 94  ILE D N     1 
ATOM   7070 C  CA    . ILE D 1 96  ? 2.154   39.632 67.959  1.00 32.10 ? 94  ILE D CA    1 
ATOM   7071 C  C     . ILE D 1 96  ? 2.852   40.799 67.284  1.00 30.84 ? 94  ILE D C     1 
ATOM   7072 O  O     . ILE D 1 96  ? 2.913   40.874 66.054  1.00 30.46 ? 94  ILE D O     1 
ATOM   7073 C  CB    . ILE D 1 96  ? 2.890   38.338 67.576  1.00 33.53 ? 94  ILE D CB    1 
ATOM   7074 C  CG1   . ILE D 1 96  ? 2.261   37.144 68.292  1.00 35.04 ? 94  ILE D CG1   1 
ATOM   7075 C  CG2   . ILE D 1 96  ? 4.368   38.462 67.923  1.00 35.59 ? 94  ILE D CG2   1 
ATOM   7076 C  CD1   . ILE D 1 96  ? 2.907   35.821 67.935  1.00 38.94 ? 94  ILE D CD1   1 
ATOM   7077 N  N     . ILE D 1 97  ? 3.357   41.722 68.085  1.00 29.91 ? 95  ILE D N     1 
ATOM   7078 C  CA    . ILE D 1 97  ? 4.046   42.875 67.543  1.00 31.59 ? 95  ILE D CA    1 
ATOM   7079 C  C     . ILE D 1 97  ? 5.527   42.750 67.858  1.00 33.99 ? 95  ILE D C     1 
ATOM   7080 O  O     . ILE D 1 97  ? 5.950   42.970 68.997  1.00 33.16 ? 95  ILE D O     1 
ATOM   7081 C  CB    . ILE D 1 97  ? 3.495   44.176 68.151  1.00 32.89 ? 95  ILE D CB    1 
ATOM   7082 C  CG1   . ILE D 1 97  ? 1.999   44.290 67.843  1.00 34.51 ? 95  ILE D CG1   1 
ATOM   7083 C  CG2   . ILE D 1 97  ? 4.255   45.375 67.604  1.00 32.18 ? 95  ILE D CG2   1 
ATOM   7084 C  CD1   . ILE D 1 97  ? 1.317   45.460 68.527  1.00 36.36 ? 95  ILE D CD1   1 
ATOM   7085 N  N     . LEU D 1 98  ? 6.309   42.373 66.851  1.00 35.58 ? 96  LEU D N     1 
ATOM   7086 C  CA    . LEU D 1 98  ? 7.748   42.221 67.018  1.00 38.16 ? 96  LEU D CA    1 
ATOM   7087 C  C     . LEU D 1 98  ? 8.411   43.582 66.901  1.00 40.49 ? 96  LEU D C     1 
ATOM   7088 O  O     . LEU D 1 98  ? 8.615   44.096 65.799  1.00 39.61 ? 96  LEU D O     1 
ATOM   7089 C  CB    . LEU D 1 98  ? 8.311   41.272 65.958  1.00 37.28 ? 96  LEU D CB    1 
ATOM   7090 C  CG    . LEU D 1 98  ? 7.701   39.866 65.964  1.00 39.55 ? 96  LEU D CG    1 
ATOM   7091 C  CD1   . LEU D 1 98  ? 8.390   39.002 64.916  1.00 39.87 ? 96  LEU D CD1   1 
ATOM   7092 C  CD2   . LEU D 1 98  ? 7.854   39.246 67.346  1.00 39.17 ? 96  LEU D CD2   1 
ATOM   7093 N  N     . ASN D 1 99  ? 8.730   44.172 68.047  1.00 43.95 ? 97  ASN D N     1 
ATOM   7094 C  CA    . ASN D 1 99  ? 9.365   45.477 68.072  1.00 47.89 ? 97  ASN D CA    1 
ATOM   7095 C  C     . ASN D 1 99  ? 10.798  45.364 67.603  1.00 50.81 ? 97  ASN D C     1 
ATOM   7096 O  O     . ASN D 1 99  ? 11.689  44.936 68.341  1.00 50.08 ? 97  ASN D O     1 
ATOM   7097 C  CB    . ASN D 1 99  ? 9.312   46.087 69.472  1.00 49.23 ? 97  ASN D CB    1 
ATOM   7098 C  CG    . ASN D 1 99  ? 10.072  47.396 69.562  1.00 50.28 ? 97  ASN D CG    1 
ATOM   7099 O  OD1   . ASN D 1 99  ? 10.058  48.198 68.631  1.00 52.10 ? 97  ASN D OD1   1 
ATOM   7100 N  ND2   . ASN D 1 99  ? 10.732  47.623 70.692  1.00 52.93 ? 97  ASN D ND2   1 
ATOM   7101 N  N     . SER D 1 100 ? 10.980  45.746 66.347  1.00 54.92 ? 98  SER D N     1 
ATOM   7102 C  CA    . SER D 1 100 ? 12.253  45.740 65.648  1.00 59.07 ? 98  SER D CA    1 
ATOM   7103 C  C     . SER D 1 100 ? 13.483  45.725 66.547  1.00 60.67 ? 98  SER D C     1 
ATOM   7104 O  O     . SER D 1 100 ? 14.057  44.669 66.800  1.00 61.55 ? 98  SER D O     1 
ATOM   7105 C  CB    . SER D 1 100 ? 12.301  46.956 64.724  1.00 60.11 ? 98  SER D CB    1 
ATOM   7106 O  OG    . SER D 1 100 ? 11.032  47.599 64.693  1.00 60.35 ? 98  SER D OG    1 
ATOM   7107 N  N     . ALA D 1 101 ? 13.868  46.911 67.013  1.00 62.30 ? 99  ALA D N     1 
ATOM   7108 C  CA    . ALA D 1 101 ? 15.032  47.136 67.873  1.00 64.77 ? 99  ALA D CA    1 
ATOM   7109 C  C     . ALA D 1 101 ? 15.617  48.459 67.403  1.00 66.73 ? 99  ALA D C     1 
ATOM   7110 O  O     . ALA D 1 101 ? 16.385  49.110 68.112  1.00 66.89 ? 99  ALA D O     1 
ATOM   7111 C  CB    . ALA D 1 101 ? 16.065  46.033 67.704  1.00 64.28 ? 99  ALA D CB    1 
ATOM   7112 N  N     . ASP D 1 102 ? 15.236  48.836 66.186  1.00 68.48 ? 100 ASP D N     1 
ATOM   7113 C  CA    . ASP D 1 102 ? 15.681  50.074 65.564  1.00 69.54 ? 100 ASP D CA    1 
ATOM   7114 C  C     . ASP D 1 102 ? 14.808  50.372 64.346  1.00 69.14 ? 100 ASP D C     1 
ATOM   7115 O  O     . ASP D 1 102 ? 14.434  51.522 64.104  1.00 69.31 ? 100 ASP D O     1 
ATOM   7116 C  CB    . ASP D 1 102 ? 17.151  49.954 65.142  1.00 71.65 ? 100 ASP D CB    1 
ATOM   7117 C  CG    . ASP D 1 102 ? 17.349  50.124 63.644  1.00 73.77 ? 100 ASP D CG    1 
ATOM   7118 O  OD1   . ASP D 1 102 ? 16.856  49.269 62.874  1.00 74.41 ? 100 ASP D OD1   1 
ATOM   7119 O  OD2   . ASP D 1 102 ? 17.996  51.116 63.238  1.00 74.94 ? 100 ASP D OD2   1 
ATOM   7120 N  N     . GLY D 1 103 ? 14.482  49.325 63.591  1.00 67.91 ? 101 GLY D N     1 
ATOM   7121 C  CA    . GLY D 1 103 ? 13.666  49.487 62.399  1.00 66.15 ? 101 GLY D CA    1 
ATOM   7122 C  C     . GLY D 1 103 ? 12.169  49.468 62.647  1.00 64.84 ? 101 GLY D C     1 
ATOM   7123 O  O     . GLY D 1 103 ? 11.703  49.779 63.746  1.00 64.39 ? 101 GLY D O     1 
ATOM   7124 N  N     . ASP D 1 104 ? 11.412  49.100 61.616  1.00 63.36 ? 102 ASP D N     1 
ATOM   7125 C  CA    . ASP D 1 104 ? 9.954   49.042 61.706  1.00 61.10 ? 102 ASP D CA    1 
ATOM   7126 C  C     . ASP D 1 104 ? 9.456   47.766 62.370  1.00 57.98 ? 102 ASP D C     1 
ATOM   7127 O  O     . ASP D 1 104 ? 10.027  46.690 62.179  1.00 57.90 ? 102 ASP D O     1 
ATOM   7128 C  CB    . ASP D 1 104 ? 9.321   49.138 60.313  1.00 63.33 ? 102 ASP D CB    1 
ATOM   7129 C  CG    . ASP D 1 104 ? 9.486   50.505 59.684  1.00 65.41 ? 102 ASP D CG    1 
ATOM   7130 O  OD1   . ASP D 1 104 ? 10.614  50.839 59.263  1.00 66.91 ? 102 ASP D OD1   1 
ATOM   7131 O  OD2   . ASP D 1 104 ? 8.481   51.247 59.613  1.00 67.25 ? 102 ASP D OD2   1 
ATOM   7132 N  N     . ASN D 1 105 ? 8.382   47.892 63.144  1.00 53.20 ? 103 ASN D N     1 
ATOM   7133 C  CA    . ASN D 1 105 ? 7.794   46.742 63.814  1.00 49.35 ? 103 ASN D CA    1 
ATOM   7134 C  C     . ASN D 1 105 ? 7.179   45.820 62.765  1.00 47.62 ? 103 ASN D C     1 
ATOM   7135 O  O     . ASN D 1 105 ? 6.743   46.274 61.703  1.00 46.88 ? 103 ASN D O     1 
ATOM   7136 C  CB    . ASN D 1 105 ? 6.689   47.177 64.787  1.00 48.93 ? 103 ASN D CB    1 
ATOM   7137 C  CG    . ASN D 1 105 ? 7.175   48.160 65.833  1.00 48.92 ? 103 ASN D CG    1 
ATOM   7138 O  OD1   . ASN D 1 105 ? 8.224   47.969 66.446  1.00 50.33 ? 103 ASN D OD1   1 
ATOM   7139 N  ND2   . ASN D 1 105 ? 6.403   49.217 66.050  1.00 48.44 ? 103 ASN D ND2   1 
ATOM   7140 N  N     . ALA D 1 106 ? 7.161   44.526 63.059  1.00 44.85 ? 104 ALA D N     1 
ATOM   7141 C  CA    . ALA D 1 106 ? 6.561   43.543 62.166  1.00 41.74 ? 104 ALA D CA    1 
ATOM   7142 C  C     . ALA D 1 106 ? 5.383   43.003 62.961  1.00 39.78 ? 104 ALA D C     1 
ATOM   7143 O  O     . ALA D 1 106 ? 5.490   42.803 64.173  1.00 38.99 ? 104 ALA D O     1 
ATOM   7144 C  CB    . ALA D 1 106 ? 7.553   42.428 61.842  1.00 42.44 ? 104 ALA D CB    1 
ATOM   7145 N  N     . ILE D 1 107 ? 4.262   42.772 62.292  1.00 37.52 ? 105 ILE D N     1 
ATOM   7146 C  CA    . ILE D 1 107 ? 3.072   42.299 62.977  1.00 37.13 ? 105 ILE D CA    1 
ATOM   7147 C  C     . ILE D 1 107 ? 2.422   41.062 62.367  1.00 36.62 ? 105 ILE D C     1 
ATOM   7148 O  O     . ILE D 1 107 ? 2.341   40.924 61.150  1.00 36.64 ? 105 ILE D O     1 
ATOM   7149 C  CB    . ILE D 1 107 ? 2.008   43.411 63.025  1.00 37.86 ? 105 ILE D CB    1 
ATOM   7150 C  CG1   . ILE D 1 107 ? 2.611   44.679 63.633  1.00 38.64 ? 105 ILE D CG1   1 
ATOM   7151 C  CG2   . ILE D 1 107 ? 0.800   42.946 63.821  1.00 37.92 ? 105 ILE D CG2   1 
ATOM   7152 C  CD1   . ILE D 1 107 ? 1.678   45.874 63.610  1.00 41.18 ? 105 ILE D CD1   1 
ATOM   7153 N  N     . ILE D 1 108 ? 1.956   40.170 63.235  1.00 35.92 ? 106 ILE D N     1 
ATOM   7154 C  CA    . ILE D 1 108 ? 1.271   38.954 62.816  1.00 34.84 ? 106 ILE D CA    1 
ATOM   7155 C  C     . ILE D 1 108 ? -0.036  38.904 63.593  1.00 34.19 ? 106 ILE D C     1 
ATOM   7156 O  O     . ILE D 1 108 ? -0.030  38.864 64.823  1.00 34.03 ? 106 ILE D O     1 
ATOM   7157 C  CB    . ILE D 1 108 ? 2.083   37.686 63.140  1.00 34.71 ? 106 ILE D CB    1 
ATOM   7158 C  CG1   . ILE D 1 108 ? 3.457   37.760 62.475  1.00 35.50 ? 106 ILE D CG1   1 
ATOM   7159 C  CG2   . ILE D 1 108 ? 1.328   36.454 62.645  1.00 35.39 ? 106 ILE D CG2   1 
ATOM   7160 C  CD1   . ILE D 1 108 ? 4.336   36.551 62.743  1.00 34.32 ? 106 ILE D CD1   1 
ATOM   7161 N  N     . THR D 1 109 ? -1.153  38.910 62.873  1.00 33.34 ? 107 THR D N     1 
ATOM   7162 C  CA    . THR D 1 109 ? -2.471  38.894 63.499  1.00 33.06 ? 107 THR D CA    1 
ATOM   7163 C  C     . THR D 1 109 ? -3.313  37.682 63.126  1.00 33.69 ? 107 THR D C     1 
ATOM   7164 O  O     . THR D 1 109 ? -3.361  37.276 61.962  1.00 33.25 ? 107 THR D O     1 
ATOM   7165 C  CB    . THR D 1 109 ? -3.278  40.154 63.109  1.00 33.69 ? 107 THR D CB    1 
ATOM   7166 O  OG1   . THR D 1 109 ? -2.512  41.322 63.412  1.00 33.49 ? 107 THR D OG1   1 
ATOM   7167 C  CG2   . THR D 1 109 ? -4.597  40.205 63.865  1.00 32.72 ? 107 THR D CG2   1 
ATOM   7168 N  N     . THR D 1 110 ? -3.992  37.121 64.119  1.00 33.68 ? 108 THR D N     1 
ATOM   7169 C  CA    . THR D 1 110 ? -4.859  35.974 63.900  1.00 36.25 ? 108 THR D CA    1 
ATOM   7170 C  C     . THR D 1 110 ? -6.231  36.495 63.473  1.00 37.38 ? 108 THR D C     1 
ATOM   7171 O  O     . THR D 1 110 ? -6.592  37.631 63.780  1.00 34.87 ? 108 THR D O     1 
ATOM   7172 C  CB    . THR D 1 110 ? -5.011  35.137 65.180  1.00 37.21 ? 108 THR D CB    1 
ATOM   7173 O  OG1   . THR D 1 110 ? -5.885  34.031 64.927  1.00 42.82 ? 108 THR D OG1   1 
ATOM   7174 C  CG2   . THR D 1 110 ? -5.585  35.969 66.286  1.00 35.10 ? 108 THR D CG2   1 
ATOM   7175 N  N     . THR D 1 111 ? -6.994  35.661 62.777  1.00 38.39 ? 109 THR D N     1 
ATOM   7176 C  CA    . THR D 1 111 ? -8.306  36.068 62.286  1.00 41.46 ? 109 THR D CA    1 
ATOM   7177 C  C     . THR D 1 111 ? -9.415  35.058 62.585  1.00 41.93 ? 109 THR D C     1 
ATOM   7178 O  O     . THR D 1 111 ? -10.559 35.228 62.157  1.00 42.23 ? 109 THR D O     1 
ATOM   7179 C  CB    . THR D 1 111 ? -8.245  36.311 60.764  1.00 43.38 ? 109 THR D CB    1 
ATOM   7180 O  OG1   . THR D 1 111 ? -9.562  36.561 60.264  1.00 48.77 ? 109 THR D OG1   1 
ATOM   7181 C  CG2   . THR D 1 111 ? -7.652  35.100 60.052  1.00 42.41 ? 109 THR D CG2   1 
ATOM   7182 N  N     . ALA D 1 112 ? -9.077  34.018 63.336  1.00 41.86 ? 110 ALA D N     1 
ATOM   7183 C  CA    . ALA D 1 112 ? -10.039 32.977 63.680  1.00 41.59 ? 110 ALA D CA    1 
ATOM   7184 C  C     . ALA D 1 112 ? -11.390 33.523 64.138  1.00 41.02 ? 110 ALA D C     1 
ATOM   7185 O  O     . ALA D 1 112 ? -12.435 33.068 63.678  1.00 41.67 ? 110 ALA D O     1 
ATOM   7186 C  CB    . ALA D 1 112 ? -9.450  32.067 64.755  1.00 41.02 ? 110 ALA D CB    1 
ATOM   7187 N  N     . ALA D 1 113 ? -11.371 34.496 65.044  1.00 40.90 ? 111 ALA D N     1 
ATOM   7188 C  CA    . ALA D 1 113 ? -12.608 35.078 65.555  1.00 40.69 ? 111 ALA D CA    1 
ATOM   7189 C  C     . ALA D 1 113 ? -13.349 35.877 64.483  1.00 40.79 ? 111 ALA D C     1 
ATOM   7190 O  O     . ALA D 1 113 ? -14.546 35.680 64.266  1.00 40.62 ? 111 ALA D O     1 
ATOM   7191 C  CB    . ALA D 1 113 ? -12.310 35.966 66.753  1.00 40.49 ? 111 ALA D CB    1 
ATOM   7192 N  N     . ALA D 1 114 ? -12.633 36.778 63.819  1.00 41.16 ? 112 ALA D N     1 
ATOM   7193 C  CA    . ALA D 1 114 ? -13.221 37.603 62.771  1.00 42.38 ? 112 ALA D CA    1 
ATOM   7194 C  C     . ALA D 1 114 ? -13.830 36.746 61.666  1.00 43.09 ? 112 ALA D C     1 
ATOM   7195 O  O     . ALA D 1 114 ? -14.867 37.099 61.101  1.00 43.09 ? 112 ALA D O     1 
ATOM   7196 C  CB    . ALA D 1 114 ? -12.166 38.534 62.185  1.00 40.95 ? 112 ALA D CB    1 
ATOM   7197 N  N     . ASP D 1 115 ? -13.188 35.616 61.369  1.00 44.24 ? 113 ASP D N     1 
ATOM   7198 C  CA    . ASP D 1 115 ? -13.654 34.712 60.319  1.00 45.17 ? 113 ASP D CA    1 
ATOM   7199 C  C     . ASP D 1 115 ? -14.952 33.981 60.639  1.00 46.03 ? 113 ASP D C     1 
ATOM   7200 O  O     . ASP D 1 115 ? -15.658 33.541 59.733  1.00 47.19 ? 113 ASP D O     1 
ATOM   7201 C  CB    . ASP D 1 115 ? -12.582 33.670 59.989  1.00 45.90 ? 113 ASP D CB    1 
ATOM   7202 C  CG    . ASP D 1 115 ? -11.343 34.278 59.378  1.00 46.78 ? 113 ASP D CG    1 
ATOM   7203 O  OD1   . ASP D 1 115 ? -11.471 35.273 58.631  1.00 47.86 ? 113 ASP D OD1   1 
ATOM   7204 O  OD2   . ASP D 1 115 ? -10.241 33.749 59.631  1.00 47.47 ? 113 ASP D OD2   1 
ATOM   7205 N  N     . THR D 1 116 ? -15.264 33.842 61.921  1.00 46.27 ? 114 THR D N     1 
ATOM   7206 C  CA    . THR D 1 116 ? -16.479 33.144 62.326  1.00 46.99 ? 114 THR D CA    1 
ATOM   7207 C  C     . THR D 1 116 ? -17.706 34.047 62.333  1.00 47.15 ? 114 THR D C     1 
ATOM   7208 O  O     . THR D 1 116 ? -18.840 33.565 62.273  1.00 47.01 ? 114 THR D O     1 
ATOM   7209 C  CB    . THR D 1 116 ? -16.331 32.550 63.736  1.00 47.01 ? 114 THR D CB    1 
ATOM   7210 O  OG1   . THR D 1 116 ? -15.166 31.722 63.781  1.00 47.84 ? 114 THR D OG1   1 
ATOM   7211 C  CG2   . THR D 1 116 ? -17.551 31.713 64.090  1.00 48.30 ? 114 THR D CG2   1 
ATOM   7212 N  N     . PHE D 1 117 ? -17.480 35.353 62.406  1.00 46.16 ? 115 PHE D N     1 
ATOM   7213 C  CA    . PHE D 1 117 ? -18.578 36.307 62.450  1.00 45.44 ? 115 PHE D CA    1 
ATOM   7214 C  C     . PHE D 1 117 ? -19.556 36.068 61.297  1.00 45.58 ? 115 PHE D C     1 
ATOM   7215 O  O     . PHE D 1 117 ? -20.727 35.768 61.527  1.00 47.03 ? 115 PHE D O     1 
ATOM   7216 C  CB    . PHE D 1 117 ? -18.033 37.734 62.408  1.00 44.14 ? 115 PHE D CB    1 
ATOM   7217 C  CG    . PHE D 1 117 ? -18.922 38.742 63.076  1.00 42.14 ? 115 PHE D CG    1 
ATOM   7218 C  CD1   . PHE D 1 117 ? -20.307 38.649 62.972  1.00 41.89 ? 115 PHE D CD1   1 
ATOM   7219 C  CD2   . PHE D 1 117 ? -18.376 39.816 63.768  1.00 42.11 ? 115 PHE D CD2   1 
ATOM   7220 C  CE1   . PHE D 1 117 ? -21.131 39.611 63.542  1.00 41.89 ? 115 PHE D CE1   1 
ATOM   7221 C  CE2   . PHE D 1 117 ? -19.191 40.782 64.340  1.00 39.46 ? 115 PHE D CE2   1 
ATOM   7222 C  CZ    . PHE D 1 117 ? -20.569 40.682 64.227  1.00 41.35 ? 115 PHE D CZ    1 
ATOM   7223 N  N     . SER D 1 118 ? -19.064 36.199 60.068  1.00 44.74 ? 116 SER D N     1 
ATOM   7224 C  CA    . SER D 1 118 ? -19.853 35.988 58.848  1.00 43.76 ? 116 SER D CA    1 
ATOM   7225 C  C     . SER D 1 118 ? -20.651 37.207 58.400  1.00 42.98 ? 116 SER D C     1 
ATOM   7226 O  O     . SER D 1 118 ? -21.298 37.882 59.200  1.00 41.02 ? 116 SER D O     1 
ATOM   7227 C  CB    . SER D 1 118 ? -20.804 34.793 58.996  1.00 43.77 ? 116 SER D CB    1 
ATOM   7228 O  OG    . SER D 1 118 ? -22.095 35.205 59.414  1.00 44.59 ? 116 SER D OG    1 
ATOM   7229 N  N     . LEU D 1 119 ? -20.597 37.458 57.097  1.00 43.40 ? 117 LEU D N     1 
ATOM   7230 C  CA    . LEU D 1 119 ? -21.271 38.579 56.450  1.00 44.80 ? 117 LEU D CA    1 
ATOM   7231 C  C     . LEU D 1 119 ? -22.742 38.739 56.819  1.00 45.24 ? 117 LEU D C     1 
ATOM   7232 O  O     . LEU D 1 119 ? -23.183 39.822 57.205  1.00 44.52 ? 117 LEU D O     1 
ATOM   7233 C  CB    . LEU D 1 119 ? -21.151 38.424 54.933  1.00 46.12 ? 117 LEU D CB    1 
ATOM   7234 C  CG    . LEU D 1 119 ? -21.709 39.543 54.058  1.00 48.13 ? 117 LEU D CG    1 
ATOM   7235 C  CD1   . LEU D 1 119 ? -20.844 40.785 54.216  1.00 48.57 ? 117 LEU D CD1   1 
ATOM   7236 C  CD2   . LEU D 1 119 ? -21.730 39.088 52.605  1.00 48.89 ? 117 LEU D CD2   1 
ATOM   7237 N  N     . ASP D 1 120 ? -23.499 37.656 56.692  1.00 46.24 ? 118 ASP D N     1 
ATOM   7238 C  CA    . ASP D 1 120 ? -24.927 37.674 56.987  1.00 47.29 ? 118 ASP D CA    1 
ATOM   7239 C  C     . ASP D 1 120 ? -25.226 37.947 58.452  1.00 46.25 ? 118 ASP D C     1 
ATOM   7240 O  O     . ASP D 1 120 ? -26.361 38.258 58.815  1.00 46.69 ? 118 ASP D O     1 
ATOM   7241 C  CB    . ASP D 1 120 ? -25.559 36.344 56.571  1.00 51.10 ? 118 ASP D CB    1 
ATOM   7242 C  CG    . ASP D 1 120 ? -25.209 35.958 55.146  1.00 54.87 ? 118 ASP D CG    1 
ATOM   7243 O  OD1   . ASP D 1 120 ? -25.519 36.743 54.223  1.00 56.37 ? 118 ASP D OD1   1 
ATOM   7244 O  OD2   . ASP D 1 120 ? -24.621 34.870 54.950  1.00 57.88 ? 118 ASP D OD2   1 
ATOM   7245 N  N     . GLU D 1 121 ? -24.209 37.838 59.296  1.00 45.46 ? 119 GLU D N     1 
ATOM   7246 C  CA    . GLU D 1 121 ? -24.391 38.072 60.719  1.00 44.41 ? 119 GLU D CA    1 
ATOM   7247 C  C     . GLU D 1 121 ? -24.010 39.506 61.103  1.00 42.60 ? 119 GLU D C     1 
ATOM   7248 O  O     . GLU D 1 121 ? -24.504 40.040 62.095  1.00 39.83 ? 119 GLU D O     1 
ATOM   7249 C  CB    . GLU D 1 121 ? -23.549 37.075 61.513  1.00 47.40 ? 119 GLU D CB    1 
ATOM   7250 C  CG    . GLU D 1 121 ? -24.042 36.814 62.923  1.00 50.37 ? 119 GLU D CG    1 
ATOM   7251 C  CD    . GLU D 1 121 ? -23.156 35.827 63.668  1.00 53.13 ? 119 GLU D CD    1 
ATOM   7252 O  OE1   . GLU D 1 121 ? -22.817 34.773 63.082  1.00 52.75 ? 119 GLU D OE1   1 
ATOM   7253 O  OE2   . GLU D 1 121 ? -22.805 36.105 64.837  1.00 53.88 ? 119 GLU D OE2   1 
HETATM 7254 N  N     . MSE D 1 122 ? -23.131 40.121 60.315  1.00 41.36 ? 120 MSE D N     1 
HETATM 7255 C  CA    . MSE D 1 122 ? -22.686 41.491 60.580  1.00 41.68 ? 120 MSE D CA    1 
HETATM 7256 C  C     . MSE D 1 122 ? -23.695 42.532 60.099  1.00 40.30 ? 120 MSE D C     1 
HETATM 7257 O  O     . MSE D 1 122 ? -23.963 43.516 60.787  1.00 39.96 ? 120 MSE D O     1 
HETATM 7258 C  CB    . MSE D 1 122 ? -21.349 41.771 59.885  1.00 43.39 ? 120 MSE D CB    1 
HETATM 7259 C  CG    . MSE D 1 122 ? -20.185 40.897 60.319  1.00 47.69 ? 120 MSE D CG    1 
HETATM 7260 SE SE    . MSE D 1 122 ? -18.524 41.515 59.522  1.00 53.31 ? 120 MSE D SE    1 
HETATM 7261 C  CE    . MSE D 1 122 ? -17.271 40.555 60.642  1.00 52.71 ? 120 MSE D CE    1 
ATOM   7262 N  N     . ILE D 1 123 ? -24.241 42.308 58.910  1.00 39.72 ? 121 ILE D N     1 
ATOM   7263 C  CA    . ILE D 1 123 ? -25.200 43.226 58.304  1.00 40.65 ? 121 ILE D CA    1 
ATOM   7264 C  C     . ILE D 1 123 ? -26.342 43.675 59.213  1.00 40.32 ? 121 ILE D C     1 
ATOM   7265 O  O     . ILE D 1 123 ? -26.685 44.856 59.243  1.00 41.83 ? 121 ILE D O     1 
ATOM   7266 C  CB    . ILE D 1 123 ? -25.765 42.619 56.992  1.00 41.11 ? 121 ILE D CB    1 
ATOM   7267 C  CG1   . ILE D 1 123 ? -24.678 42.668 55.913  1.00 41.41 ? 121 ILE D CG1   1 
ATOM   7268 C  CG2   . ILE D 1 123 ? -27.010 43.372 56.539  1.00 39.48 ? 121 ILE D CG2   1 
ATOM   7269 C  CD1   . ILE D 1 123 ? -24.989 41.862 54.680  1.00 43.67 ? 121 ILE D CD1   1 
ATOM   7270 N  N     . PRO D 1 124 ? -26.944 42.747 59.968  1.00 40.35 ? 122 PRO D N     1 
ATOM   7271 C  CA    . PRO D 1 124 ? -28.045 43.133 60.856  1.00 39.80 ? 122 PRO D CA    1 
ATOM   7272 C  C     . PRO D 1 124 ? -27.695 44.283 61.803  1.00 39.46 ? 122 PRO D C     1 
ATOM   7273 O  O     . PRO D 1 124 ? -28.576 45.027 62.241  1.00 39.32 ? 122 PRO D O     1 
ATOM   7274 C  CB    . PRO D 1 124 ? -28.340 41.841 61.611  1.00 40.26 ? 122 PRO D CB    1 
ATOM   7275 C  CG    . PRO D 1 124 ? -28.015 40.791 60.592  1.00 38.70 ? 122 PRO D CG    1 
ATOM   7276 C  CD    . PRO D 1 124 ? -26.721 41.291 60.013  1.00 40.08 ? 122 PRO D CD    1 
ATOM   7277 N  N     . HIS D 1 125 ? -26.410 44.427 62.113  1.00 38.04 ? 123 HIS D N     1 
ATOM   7278 C  CA    . HIS D 1 125 ? -25.962 45.479 63.022  1.00 37.90 ? 123 HIS D CA    1 
ATOM   7279 C  C     . HIS D 1 125 ? -25.881 46.867 62.386  1.00 37.65 ? 123 HIS D C     1 
ATOM   7280 O  O     . HIS D 1 125 ? -25.585 47.847 63.066  1.00 37.77 ? 123 HIS D O     1 
ATOM   7281 C  CB    . HIS D 1 125 ? -24.620 45.078 63.636  1.00 37.83 ? 123 HIS D CB    1 
ATOM   7282 C  CG    . HIS D 1 125 ? -24.710 43.856 64.495  1.00 36.87 ? 123 HIS D CG    1 
ATOM   7283 N  ND1   . HIS D 1 125 ? -25.413 43.834 65.681  1.00 35.80 ? 123 HIS D ND1   1 
ATOM   7284 C  CD2   . HIS D 1 125 ? -24.256 42.595 64.304  1.00 38.09 ? 123 HIS D CD2   1 
ATOM   7285 C  CE1   . HIS D 1 125 ? -25.390 42.612 66.182  1.00 36.79 ? 123 HIS D CE1   1 
ATOM   7286 N  NE2   . HIS D 1 125 ? -24.695 41.840 65.365  1.00 37.57 ? 123 HIS D NE2   1 
HETATM 7287 N  N     . MSE D 1 126 ? -26.151 46.939 61.086  1.00 38.60 ? 124 MSE D N     1 
HETATM 7288 C  CA    . MSE D 1 126 ? -26.152 48.204 60.349  1.00 39.93 ? 124 MSE D CA    1 
HETATM 7289 C  C     . MSE D 1 126 ? -27.562 48.497 59.852  1.00 38.15 ? 124 MSE D C     1 
HETATM 7290 O  O     . MSE D 1 126 ? -27.760 49.339 58.980  1.00 38.07 ? 124 MSE D O     1 
HETATM 7291 C  CB    . MSE D 1 126 ? -25.227 48.131 59.140  1.00 42.84 ? 124 MSE D CB    1 
HETATM 7292 C  CG    . MSE D 1 126 ? -23.756 48.250 59.449  1.00 47.98 ? 124 MSE D CG    1 
HETATM 7293 SE SE    . MSE D 1 126 ? -22.766 47.812 57.862  1.00 56.93 ? 124 MSE D SE    1 
HETATM 7294 C  CE    . MSE D 1 126 ? -22.418 49.556 57.165  1.00 54.28 ? 124 MSE D CE    1 
ATOM   7295 N  N     . ALA D 1 127 ? -28.538 47.796 60.413  1.00 36.69 ? 125 ALA D N     1 
ATOM   7296 C  CA    . ALA D 1 127 ? -29.932 47.959 60.018  1.00 35.70 ? 125 ALA D CA    1 
ATOM   7297 C  C     . ALA D 1 127 ? -30.488 49.378 60.175  1.00 34.38 ? 125 ALA D C     1 
ATOM   7298 O  O     . ALA D 1 127 ? -31.290 49.824 59.349  1.00 33.01 ? 125 ALA D O     1 
ATOM   7299 C  CB    . ALA D 1 127 ? -30.802 46.975 60.795  1.00 36.27 ? 125 ALA D CB    1 
ATOM   7300 N  N     . ASP D 1 128 ? -30.068 50.086 61.222  1.00 31.72 ? 126 ASP D N     1 
ATOM   7301 C  CA    . ASP D 1 128 ? -30.567 51.436 61.464  1.00 29.95 ? 126 ASP D CA    1 
ATOM   7302 C  C     . ASP D 1 128 ? -29.734 52.541 60.821  1.00 28.52 ? 126 ASP D C     1 
ATOM   7303 O  O     . ASP D 1 128 ? -29.922 53.718 61.120  1.00 26.82 ? 126 ASP D O     1 
ATOM   7304 C  CB    . ASP D 1 128 ? -30.687 51.706 62.968  1.00 32.51 ? 126 ASP D CB    1 
ATOM   7305 C  CG    . ASP D 1 128 ? -29.346 51.674 63.682  1.00 37.07 ? 126 ASP D CG    1 
ATOM   7306 O  OD1   . ASP D 1 128 ? -29.280 52.151 64.835  1.00 39.68 ? 126 ASP D OD1   1 
ATOM   7307 O  OD2   . ASP D 1 128 ? -28.360 51.169 63.100  1.00 39.37 ? 126 ASP D OD2   1 
ATOM   7308 N  N     . ALA D 1 129 ? -28.812 52.158 59.944  1.00 26.35 ? 127 ALA D N     1 
ATOM   7309 C  CA    . ALA D 1 129 ? -27.968 53.127 59.255  1.00 26.18 ? 127 ALA D CA    1 
ATOM   7310 C  C     . ALA D 1 129 ? -28.810 53.839 58.195  1.00 25.72 ? 127 ALA D C     1 
ATOM   7311 O  O     . ALA D 1 129 ? -29.782 53.276 57.697  1.00 26.58 ? 127 ALA D O     1 
ATOM   7312 C  CB    . ALA D 1 129 ? -26.798 52.418 58.594  1.00 23.42 ? 127 ALA D CB    1 
ATOM   7313 N  N     . VAL D 1 130 ? -28.442 55.071 57.860  1.00 24.72 ? 128 VAL D N     1 
ATOM   7314 C  CA    . VAL D 1 130 ? -29.165 55.833 56.847  1.00 25.43 ? 128 VAL D CA    1 
ATOM   7315 C  C     . VAL D 1 130 ? -28.159 56.427 55.875  1.00 24.05 ? 128 VAL D C     1 
ATOM   7316 O  O     . VAL D 1 130 ? -26.955 56.370 56.118  1.00 25.05 ? 128 VAL D O     1 
ATOM   7317 C  CB    . VAL D 1 130 ? -30.010 56.976 57.480  1.00 25.82 ? 128 VAL D CB    1 
ATOM   7318 C  CG1   . VAL D 1 130 ? -30.983 56.399 58.503  1.00 27.21 ? 128 VAL D CG1   1 
ATOM   7319 C  CG2   . VAL D 1 130 ? -29.109 58.003 58.136  1.00 25.41 ? 128 VAL D CG2   1 
ATOM   7320 N  N     . ALA D 1 131 ? -28.644 56.975 54.762  1.00 24.13 ? 129 ALA D N     1 
ATOM   7321 C  CA    . ALA D 1 131 ? -27.754 57.589 53.777  1.00 24.32 ? 129 ALA D CA    1 
ATOM   7322 C  C     . ALA D 1 131 ? -26.965 58.700 54.467  1.00 23.87 ? 129 ALA D C     1 
ATOM   7323 O  O     . ALA D 1 131 ? -27.534 59.504 55.207  1.00 24.99 ? 129 ALA D O     1 
ATOM   7324 C  CB    . ALA D 1 131 ? -28.564 58.161 52.612  1.00 23.41 ? 129 ALA D CB    1 
ATOM   7325 N  N     . GLY D 1 132 ? -25.659 58.748 54.214  1.00 23.08 ? 130 GLY D N     1 
ATOM   7326 C  CA    . GLY D 1 132 ? -24.813 59.748 54.845  1.00 22.02 ? 130 GLY D CA    1 
ATOM   7327 C  C     . GLY D 1 132 ? -23.897 59.092 55.868  1.00 22.20 ? 130 GLY D C     1 
ATOM   7328 O  O     . GLY D 1 132 ? -22.755 59.507 56.070  1.00 21.70 ? 130 GLY D O     1 
ATOM   7329 N  N     . ASP D 1 133 ? -24.417 58.061 56.526  1.00 21.86 ? 131 ASP D N     1 
ATOM   7330 C  CA    . ASP D 1 133 ? -23.653 57.327 57.521  1.00 21.82 ? 131 ASP D CA    1 
ATOM   7331 C  C     . ASP D 1 133 ? -22.454 56.667 56.850  1.00 23.43 ? 131 ASP D C     1 
ATOM   7332 O  O     . ASP D 1 133 ? -22.457 56.385 55.647  1.00 23.56 ? 131 ASP D O     1 
ATOM   7333 C  CB    . ASP D 1 133 ? -24.537 56.285 58.223  1.00 20.01 ? 131 ASP D CB    1 
ATOM   7334 C  CG    . ASP D 1 133 ? -25.530 56.919 59.186  1.00 20.00 ? 131 ASP D CG    1 
ATOM   7335 O  OD1   . ASP D 1 133 ? -25.299 58.081 59.593  1.00 23.08 ? 131 ASP D OD1   1 
ATOM   7336 O  OD2   . ASP D 1 133 ? -26.533 56.263 59.546  1.00 20.69 ? 131 ASP D OD2   1 
ATOM   7337 N  N     . ILE D 1 134 ? -21.422 56.430 57.641  1.00 22.89 ? 132 ILE D N     1 
ATOM   7338 C  CA    . ILE D 1 134 ? -20.196 55.863 57.125  1.00 21.83 ? 132 ILE D CA    1 
ATOM   7339 C  C     . ILE D 1 134 ? -19.928 54.419 57.509  1.00 21.49 ? 132 ILE D C     1 
ATOM   7340 O  O     . ILE D 1 134 ? -20.196 54.010 58.634  1.00 21.75 ? 132 ILE D O     1 
ATOM   7341 C  CB    . ILE D 1 134 ? -18.991 56.691 57.618  1.00 24.88 ? 132 ILE D CB    1 
ATOM   7342 C  CG1   . ILE D 1 134 ? -19.073 58.115 57.056  1.00 25.82 ? 132 ILE D CG1   1 
ATOM   7343 C  CG2   . ILE D 1 134 ? -17.681 55.989 57.253  1.00 23.24 ? 132 ILE D CG2   1 
ATOM   7344 C  CD1   . ILE D 1 134 ? -17.930 59.012 57.501  1.00 29.72 ? 132 ILE D CD1   1 
ATOM   7345 N  N     . LEU D 1 135 ? -19.410 53.655 56.552  1.00 20.93 ? 133 LEU D N     1 
ATOM   7346 C  CA    . LEU D 1 135 ? -18.989 52.286 56.817  1.00 22.90 ? 133 LEU D CA    1 
ATOM   7347 C  C     . LEU D 1 135 ? -17.477 52.376 56.663  1.00 21.23 ? 133 LEU D C     1 
ATOM   7348 O  O     . LEU D 1 135 ? -16.970 52.719 55.592  1.00 20.58 ? 133 LEU D O     1 
ATOM   7349 C  CB    . LEU D 1 135 ? -19.531 51.272 55.799  1.00 21.87 ? 133 LEU D CB    1 
ATOM   7350 C  CG    . LEU D 1 135 ? -18.767 49.940 55.947  1.00 23.27 ? 133 LEU D CG    1 
ATOM   7351 C  CD1   . LEU D 1 135 ? -19.048 49.360 57.331  1.00 22.23 ? 133 LEU D CD1   1 
ATOM   7352 C  CD2   . LEU D 1 135 ? -19.158 48.946 54.850  1.00 24.83 ? 133 LEU D CD2   1 
ATOM   7353 N  N     . LEU D 1 136 ? -16.762 52.089 57.744  1.00 20.42 ? 134 LEU D N     1 
ATOM   7354 C  CA    . LEU D 1 136 ? -15.308 52.137 57.743  1.00 19.71 ? 134 LEU D CA    1 
ATOM   7355 C  C     . LEU D 1 136 ? -14.769 50.718 57.892  1.00 19.42 ? 134 LEU D C     1 
ATOM   7356 O  O     . LEU D 1 136 ? -15.182 49.993 58.795  1.00 19.36 ? 134 LEU D O     1 
ATOM   7357 C  CB    . LEU D 1 136 ? -14.815 53.010 58.912  1.00 17.26 ? 134 LEU D CB    1 
ATOM   7358 C  CG    . LEU D 1 136 ? -13.335 52.930 59.324  1.00 18.82 ? 134 LEU D CG    1 
ATOM   7359 C  CD1   . LEU D 1 136 ? -12.424 53.349 58.167  1.00 16.43 ? 134 LEU D CD1   1 
ATOM   7360 C  CD2   . LEU D 1 136 ? -13.096 53.843 60.530  1.00 17.61 ? 134 LEU D CD2   1 
ATOM   7361 N  N     . GLN D 1 137 ? -13.869 50.324 56.991  1.00 18.88 ? 135 GLN D N     1 
ATOM   7362 C  CA    . GLN D 1 137 ? -13.258 48.995 57.033  1.00 21.31 ? 135 GLN D CA    1 
ATOM   7363 C  C     . GLN D 1 137 ? -11.749 49.083 56.930  1.00 21.18 ? 135 GLN D C     1 
ATOM   7364 O  O     . GLN D 1 137 ? -11.204 50.076 56.449  1.00 21.51 ? 135 GLN D O     1 
ATOM   7365 C  CB    . GLN D 1 137 ? -13.740 48.113 55.878  1.00 21.03 ? 135 GLN D CB    1 
ATOM   7366 C  CG    . GLN D 1 137 ? -15.180 47.685 55.956  1.00 24.49 ? 135 GLN D CG    1 
ATOM   7367 C  CD    . GLN D 1 137 ? -15.486 46.564 54.984  1.00 25.73 ? 135 GLN D CD    1 
ATOM   7368 O  OE1   . GLN D 1 137 ? -16.034 46.790 53.906  1.00 27.96 ? 135 GLN D OE1   1 
ATOM   7369 N  NE2   . GLN D 1 137 ? -15.116 45.344 55.359  1.00 23.87 ? 135 GLN D NE2   1 
ATOM   7370 N  N     . GLN D 1 138 ? -11.079 48.033 57.397  1.00 21.79 ? 136 GLN D N     1 
ATOM   7371 C  CA    . GLN D 1 138 ? -9.634  47.951 57.300  1.00 23.16 ? 136 GLN D CA    1 
ATOM   7372 C  C     . GLN D 1 138 ? -9.369  46.717 56.452  1.00 24.41 ? 136 GLN D C     1 
ATOM   7373 O  O     . GLN D 1 138 ? -10.249 46.293 55.699  1.00 23.78 ? 136 GLN D O     1 
ATOM   7374 C  CB    . GLN D 1 138 ? -8.981  47.815 58.675  1.00 24.60 ? 136 GLN D CB    1 
ATOM   7375 C  CG    . GLN D 1 138 ? -9.275  48.965 59.623  1.00 24.58 ? 136 GLN D CG    1 
ATOM   7376 C  CD    . GLN D 1 138 ? -10.664 48.885 60.207  1.00 24.22 ? 136 GLN D CD    1 
ATOM   7377 O  OE1   . GLN D 1 138 ? -11.138 47.802 60.546  1.00 25.04 ? 136 GLN D OE1   1 
ATOM   7378 N  NE2   . GLN D 1 138 ? -11.319 50.035 60.351  1.00 24.16 ? 136 GLN D NE2   1 
ATOM   7379 N  N     . GLY D 1 139 ? -8.190  46.120 56.579  1.00 23.92 ? 137 GLY D N     1 
ATOM   7380 C  CA    . GLY D 1 139 ? -7.884  44.963 55.753  1.00 25.63 ? 137 GLY D CA    1 
ATOM   7381 C  C     . GLY D 1 139 ? -7.854  43.588 56.393  1.00 27.58 ? 137 GLY D C     1 
ATOM   7382 O  O     . GLY D 1 139 ? -7.130  42.713 55.920  1.00 27.54 ? 137 GLY D O     1 
ATOM   7383 N  N     . ASN D 1 140 ? -8.650  43.367 57.435  1.00 28.20 ? 138 ASN D N     1 
ATOM   7384 C  CA    . ASN D 1 140 ? -8.638  42.070 58.105  1.00 31.05 ? 138 ASN D CA    1 
ATOM   7385 C  C     . ASN D 1 140 ? -9.608  41.014 57.574  1.00 30.70 ? 138 ASN D C     1 
ATOM   7386 O  O     . ASN D 1 140 ? -9.568  39.869 58.016  1.00 32.29 ? 138 ASN D O     1 
ATOM   7387 C  CB    . ASN D 1 140 ? -8.842  42.257 59.615  1.00 30.40 ? 138 ASN D CB    1 
ATOM   7388 C  CG    . ASN D 1 140 ? -7.636  42.901 60.292  1.00 32.24 ? 138 ASN D CG    1 
ATOM   7389 O  OD1   . ASN D 1 140 ? -7.753  43.955 60.917  1.00 35.26 ? 138 ASN D OD1   1 
ATOM   7390 N  ND2   . ASN D 1 140 ? -6.472  42.265 60.172  1.00 28.41 ? 138 ASN D ND2   1 
ATOM   7391 N  N     . PHE D 1 141 ? -10.479 41.383 56.638  1.00 31.52 ? 139 PHE D N     1 
ATOM   7392 C  CA    . PHE D 1 141 ? -11.413 40.409 56.071  1.00 31.96 ? 139 PHE D CA    1 
ATOM   7393 C  C     . PHE D 1 141 ? -10.957 39.984 54.681  1.00 32.41 ? 139 PHE D C     1 
ATOM   7394 O  O     . PHE D 1 141 ? -10.086 40.613 54.075  1.00 30.95 ? 139 PHE D O     1 
ATOM   7395 C  CB    . PHE D 1 141 ? -12.837 40.977 55.953  1.00 31.36 ? 139 PHE D CB    1 
ATOM   7396 C  CG    . PHE D 1 141 ? -13.433 41.420 57.256  1.00 31.94 ? 139 PHE D CG    1 
ATOM   7397 C  CD1   . PHE D 1 141 ? -13.299 40.644 58.404  1.00 32.57 ? 139 PHE D CD1   1 
ATOM   7398 C  CD2   . PHE D 1 141 ? -14.157 42.604 57.330  1.00 31.71 ? 139 PHE D CD2   1 
ATOM   7399 C  CE1   . PHE D 1 141 ? -13.878 41.044 59.606  1.00 31.41 ? 139 PHE D CE1   1 
ATOM   7400 C  CE2   . PHE D 1 141 ? -14.741 43.012 58.523  1.00 30.71 ? 139 PHE D CE2   1 
ATOM   7401 C  CZ    . PHE D 1 141 ? -14.601 42.228 59.667  1.00 32.84 ? 139 PHE D CZ    1 
ATOM   7402 N  N     . SER D 1 142 ? -11.562 38.916 54.177  1.00 32.86 ? 140 SER D N     1 
ATOM   7403 C  CA    . SER D 1 142 ? -11.233 38.412 52.852  1.00 34.94 ? 140 SER D CA    1 
ATOM   7404 C  C     . SER D 1 142 ? -11.687 39.424 51.808  1.00 35.29 ? 140 SER D C     1 
ATOM   7405 O  O     . SER D 1 142 ? -12.408 40.374 52.120  1.00 36.03 ? 140 SER D O     1 
ATOM   7406 C  CB    . SER D 1 142 ? -11.933 37.070 52.605  1.00 35.98 ? 140 SER D CB    1 
ATOM   7407 O  OG    . SER D 1 142 ? -13.338 37.186 52.763  1.00 36.71 ? 140 SER D OG    1 
ATOM   7408 N  N     . LEU D 1 143 ? -11.254 39.229 50.571  1.00 34.40 ? 141 LEU D N     1 
ATOM   7409 C  CA    . LEU D 1 143 ? -11.653 40.123 49.497  1.00 35.59 ? 141 LEU D CA    1 
ATOM   7410 C  C     . LEU D 1 143 ? -13.171 40.091 49.350  1.00 35.78 ? 141 LEU D C     1 
ATOM   7411 O  O     . LEU D 1 143 ? -13.817 41.133 49.257  1.00 34.29 ? 141 LEU D O     1 
ATOM   7412 C  CB    . LEU D 1 143 ? -11.013 39.693 48.181  1.00 35.90 ? 141 LEU D CB    1 
ATOM   7413 C  CG    . LEU D 1 143 ? -11.658 40.288 46.926  1.00 37.24 ? 141 LEU D CG    1 
ATOM   7414 C  CD1   . LEU D 1 143 ? -11.491 41.793 46.931  1.00 38.23 ? 141 LEU D CD1   1 
ATOM   7415 C  CD2   . LEU D 1 143 ? -11.021 39.681 45.686  1.00 37.85 ? 141 LEU D CD2   1 
ATOM   7416 N  N     . ASP D 1 144 ? -13.731 38.884 49.336  1.00 37.01 ? 142 ASP D N     1 
ATOM   7417 C  CA    . ASP D 1 144 ? -15.171 38.712 49.181  1.00 37.58 ? 142 ASP D CA    1 
ATOM   7418 C  C     . ASP D 1 144 ? -15.989 39.346 50.300  1.00 36.64 ? 142 ASP D C     1 
ATOM   7419 O  O     . ASP D 1 144 ? -17.004 40.002 50.041  1.00 36.46 ? 142 ASP D O     1 
ATOM   7420 C  CB    . ASP D 1 144 ? -15.524 37.224 49.084  1.00 39.92 ? 142 ASP D CB    1 
ATOM   7421 C  CG    . ASP D 1 144 ? -15.013 36.586 47.806  1.00 42.88 ? 142 ASP D CG    1 
ATOM   7422 O  OD1   . ASP D 1 144 ? -14.986 37.279 46.769  1.00 45.02 ? 142 ASP D OD1   1 
ATOM   7423 O  OD2   . ASP D 1 144 ? -14.653 35.391 47.834  1.00 45.48 ? 142 ASP D OD2   1 
ATOM   7424 N  N     . LYS D 1 145 ? -15.554 39.141 51.539  1.00 33.86 ? 143 LYS D N     1 
ATOM   7425 C  CA    . LYS D 1 145 ? -16.259 39.684 52.693  1.00 33.01 ? 143 LYS D CA    1 
ATOM   7426 C  C     . LYS D 1 145 ? -16.189 41.211 52.704  1.00 31.06 ? 143 LYS D C     1 
ATOM   7427 O  O     . LYS D 1 145 ? -17.181 41.884 52.983  1.00 31.13 ? 143 LYS D O     1 
ATOM   7428 C  CB    . LYS D 1 145 ? -15.656 39.126 53.981  1.00 32.60 ? 143 LYS D CB    1 
ATOM   7429 C  CG    . LYS D 1 145 ? -16.492 39.366 55.224  1.00 34.35 ? 143 LYS D CG    1 
ATOM   7430 C  CD    . LYS D 1 145 ? -15.852 38.683 56.420  1.00 35.25 ? 143 LYS D CD    1 
ATOM   7431 C  CE    . LYS D 1 145 ? -16.788 38.617 57.606  1.00 36.30 ? 143 LYS D CE    1 
ATOM   7432 N  NZ    . LYS D 1 145 ? -16.169 37.816 58.707  1.00 36.13 ? 143 LYS D NZ    1 
ATOM   7433 N  N     . THR D 1 146 ? -15.012 41.746 52.396  1.00 30.61 ? 144 THR D N     1 
ATOM   7434 C  CA    . THR D 1 146 ? -14.804 43.188 52.362  1.00 29.04 ? 144 THR D CA    1 
ATOM   7435 C  C     . THR D 1 146 ? -15.667 43.814 51.265  1.00 29.57 ? 144 THR D C     1 
ATOM   7436 O  O     . THR D 1 146 ? -16.406 44.770 51.515  1.00 27.36 ? 144 THR D O     1 
ATOM   7437 C  CB    . THR D 1 146 ? -13.321 43.530 52.095  1.00 29.35 ? 144 THR D CB    1 
ATOM   7438 O  OG1   . THR D 1 146 ? -12.504 42.951 53.126  1.00 28.26 ? 144 THR D OG1   1 
ATOM   7439 C  CG2   . THR D 1 146 ? -13.112 45.044 52.072  1.00 25.99 ? 144 THR D CG2   1 
ATOM   7440 N  N     . ARG D 1 147 ? -15.577 43.272 50.053  1.00 29.50 ? 145 ARG D N     1 
ATOM   7441 C  CA    . ARG D 1 147 ? -16.365 43.804 48.948  1.00 31.11 ? 145 ARG D CA    1 
ATOM   7442 C  C     . ARG D 1 147 ? -17.859 43.757 49.243  1.00 29.59 ? 145 ARG D C     1 
ATOM   7443 O  O     . ARG D 1 147 ? -18.584 44.709 48.963  1.00 30.06 ? 145 ARG D O     1 
ATOM   7444 C  CB    . ARG D 1 147 ? -16.082 43.041 47.651  1.00 34.57 ? 145 ARG D CB    1 
ATOM   7445 C  CG    . ARG D 1 147 ? -16.983 43.499 46.508  1.00 37.99 ? 145 ARG D CG    1 
ATOM   7446 C  CD    . ARG D 1 147 ? -16.321 43.426 45.141  1.00 43.37 ? 145 ARG D CD    1 
ATOM   7447 N  NE    . ARG D 1 147 ? -16.203 42.067 44.626  1.00 47.38 ? 145 ARG D NE    1 
ATOM   7448 C  CZ    . ARG D 1 147 ? -15.256 41.205 44.980  1.00 50.78 ? 145 ARG D CZ    1 
ATOM   7449 N  NH1   . ARG D 1 147 ? -14.328 41.558 45.859  1.00 52.69 ? 145 ARG D NH1   1 
ATOM   7450 N  NH2   . ARG D 1 147 ? -15.233 39.987 44.452  1.00 51.56 ? 145 ARG D NH2   1 
ATOM   7451 N  N     . ALA D 1 148 ? -18.313 42.642 49.805  1.00 30.01 ? 146 ALA D N     1 
ATOM   7452 C  CA    . ALA D 1 148 ? -19.720 42.462 50.139  1.00 29.19 ? 146 ALA D CA    1 
ATOM   7453 C  C     . ALA D 1 148 ? -20.212 43.543 51.099  1.00 29.13 ? 146 ALA D C     1 
ATOM   7454 O  O     . ALA D 1 148 ? -21.269 44.148 50.889  1.00 29.28 ? 146 ALA D O     1 
ATOM   7455 C  CB    . ALA D 1 148 ? -19.928 41.092 50.752  1.00 30.51 ? 146 ALA D CB    1 
ATOM   7456 N  N     . LEU D 1 149 ? -19.448 43.787 52.157  1.00 28.06 ? 147 LEU D N     1 
ATOM   7457 C  CA    . LEU D 1 149 ? -19.826 44.810 53.129  1.00 27.47 ? 147 LEU D CA    1 
ATOM   7458 C  C     . LEU D 1 149 ? -19.915 46.179 52.460  1.00 24.48 ? 147 LEU D C     1 
ATOM   7459 O  O     . LEU D 1 149 ? -20.829 46.952 52.736  1.00 26.51 ? 147 LEU D O     1 
ATOM   7460 C  CB    . LEU D 1 149 ? -18.820 44.840 54.287  1.00 26.00 ? 147 LEU D CB    1 
ATOM   7461 C  CG    . LEU D 1 149 ? -18.900 43.656 55.257  1.00 29.37 ? 147 LEU D CG    1 
ATOM   7462 C  CD1   . LEU D 1 149 ? -17.793 43.766 56.300  1.00 28.58 ? 147 LEU D CD1   1 
ATOM   7463 C  CD2   . LEU D 1 149 ? -20.267 43.640 55.932  1.00 29.17 ? 147 LEU D CD2   1 
ATOM   7464 N  N     . PHE D 1 150 ? -18.968 46.477 51.578  1.00 25.23 ? 148 PHE D N     1 
ATOM   7465 C  CA    . PHE D 1 150 ? -18.985 47.751 50.871  1.00 25.37 ? 148 PHE D CA    1 
ATOM   7466 C  C     . PHE D 1 150 ? -20.172 47.846 49.907  1.00 26.79 ? 148 PHE D C     1 
ATOM   7467 O  O     . PHE D 1 150 ? -20.761 48.912 49.758  1.00 25.97 ? 148 PHE D O     1 
ATOM   7468 C  CB    . PHE D 1 150 ? -17.676 47.960 50.113  1.00 23.97 ? 148 PHE D CB    1 
ATOM   7469 C  CG    . PHE D 1 150 ? -16.553 48.482 50.973  1.00 23.66 ? 148 PHE D CG    1 
ATOM   7470 C  CD1   . PHE D 1 150 ? -15.264 47.978 50.839  1.00 20.56 ? 148 PHE D CD1   1 
ATOM   7471 C  CD2   . PHE D 1 150 ? -16.784 49.501 51.901  1.00 22.01 ? 148 PHE D CD2   1 
ATOM   7472 C  CE1   . PHE D 1 150 ? -14.214 48.476 51.612  1.00 21.91 ? 148 PHE D CE1   1 
ATOM   7473 C  CE2   . PHE D 1 150 ? -15.741 50.008 52.679  1.00 23.65 ? 148 PHE D CE2   1 
ATOM   7474 C  CZ    . PHE D 1 150 ? -14.453 49.494 52.533  1.00 19.24 ? 148 PHE D CZ    1 
ATOM   7475 N  N     . GLN D 1 151 ? -20.526 46.740 49.257  1.00 28.52 ? 149 GLN D N     1 
ATOM   7476 C  CA    . GLN D 1 151 ? -21.659 46.757 48.334  1.00 31.02 ? 149 GLN D CA    1 
ATOM   7477 C  C     . GLN D 1 151 ? -22.924 47.016 49.133  1.00 30.35 ? 149 GLN D C     1 
ATOM   7478 O  O     . GLN D 1 151 ? -23.816 47.730 48.680  1.00 30.56 ? 149 GLN D O     1 
ATOM   7479 C  CB    . GLN D 1 151 ? -21.776 45.431 47.578  1.00 32.53 ? 149 GLN D CB    1 
ATOM   7480 C  CG    . GLN D 1 151 ? -20.573 45.127 46.708  1.00 36.58 ? 149 GLN D CG    1 
ATOM   7481 C  CD    . GLN D 1 151 ? -20.705 43.812 45.971  1.00 38.98 ? 149 GLN D CD    1 
ATOM   7482 O  OE1   . GLN D 1 151 ? -21.033 42.786 46.565  1.00 40.12 ? 149 GLN D OE1   1 
ATOM   7483 N  NE2   . GLN D 1 151 ? -20.443 43.835 44.670  1.00 39.13 ? 149 GLN D NE2   1 
ATOM   7484 N  N     . TYR D 1 152 ? -22.999 46.440 50.327  1.00 30.69 ? 150 TYR D N     1 
ATOM   7485 C  CA    . TYR D 1 152 ? -24.155 46.656 51.185  1.00 29.96 ? 150 TYR D CA    1 
ATOM   7486 C  C     . TYR D 1 152 ? -24.220 48.133 51.563  1.00 29.34 ? 150 TYR D C     1 
ATOM   7487 O  O     . TYR D 1 152 ? -25.294 48.730 51.566  1.00 27.17 ? 150 TYR D O     1 
ATOM   7488 C  CB    . TYR D 1 152 ? -24.061 45.828 52.465  1.00 30.96 ? 150 TYR D CB    1 
ATOM   7489 C  CG    . TYR D 1 152 ? -25.227 46.078 53.391  1.00 33.50 ? 150 TYR D CG    1 
ATOM   7490 C  CD1   . TYR D 1 152 ? -26.465 45.479 53.157  1.00 34.32 ? 150 TYR D CD1   1 
ATOM   7491 C  CD2   . TYR D 1 152 ? -25.113 46.956 54.468  1.00 34.47 ? 150 TYR D CD2   1 
ATOM   7492 C  CE1   . TYR D 1 152 ? -27.556 45.747 53.967  1.00 36.76 ? 150 TYR D CE1   1 
ATOM   7493 C  CE2   . TYR D 1 152 ? -26.203 47.233 55.286  1.00 36.98 ? 150 TYR D CE2   1 
ATOM   7494 C  CZ    . TYR D 1 152 ? -27.420 46.622 55.028  1.00 37.76 ? 150 TYR D CZ    1 
ATOM   7495 O  OH    . TYR D 1 152 ? -28.501 46.866 55.839  1.00 40.82 ? 150 TYR D OH    1 
ATOM   7496 N  N     . ALA D 1 153 ? -23.064 48.711 51.887  1.00 27.27 ? 151 ALA D N     1 
ATOM   7497 C  CA    . ALA D 1 153 ? -22.979 50.125 52.260  1.00 27.68 ? 151 ALA D CA    1 
ATOM   7498 C  C     . ALA D 1 153 ? -23.566 50.943 51.113  1.00 28.31 ? 151 ALA D C     1 
ATOM   7499 O  O     . ALA D 1 153 ? -24.438 51.801 51.314  1.00 25.72 ? 151 ALA D O     1 
ATOM   7500 C  CB    . ALA D 1 153 ? -21.523 50.517 52.505  1.00 25.38 ? 151 ALA D CB    1 
ATOM   7501 N  N     . ARG D 1 154 ? -23.065 50.695 49.908  1.00 29.12 ? 152 ARG D N     1 
ATOM   7502 C  CA    . ARG D 1 154 ? -23.617 51.366 48.743  1.00 34.61 ? 152 ARG D CA    1 
ATOM   7503 C  C     . ARG D 1 154 ? -24.999 50.717 48.740  1.00 37.04 ? 152 ARG D C     1 
ATOM   7504 O  O     . ARG D 1 154 ? -25.202 49.727 49.426  1.00 40.59 ? 152 ARG D O     1 
ATOM   7505 C  CB    . ARG D 1 154 ? -22.836 50.993 47.474  1.00 35.08 ? 152 ARG D CB    1 
ATOM   7506 C  CG    . ARG D 1 154 ? -21.448 51.629 47.362  1.00 36.52 ? 152 ARG D CG    1 
ATOM   7507 C  CD    . ARG D 1 154 ? -21.536 53.151 47.238  1.00 36.62 ? 152 ARG D CD    1 
ATOM   7508 N  NE    . ARG D 1 154 ? -20.225 53.804 47.187  1.00 35.46 ? 152 ARG D NE    1 
ATOM   7509 C  CZ    . ARG D 1 154 ? -19.357 53.671 46.189  1.00 35.70 ? 152 ARG D CZ    1 
ATOM   7510 N  NH1   . ARG D 1 154 ? -19.655 52.903 45.148  1.00 36.60 ? 152 ARG D NH1   1 
ATOM   7511 N  NH2   . ARG D 1 154 ? -18.198 54.316 46.221  1.00 33.36 ? 152 ARG D NH2   1 
ATOM   7512 N  N     . SER D 1 155 ? -25.952 51.249 47.996  1.00 40.43 ? 153 SER D N     1 
ATOM   7513 C  CA    . SER D 1 155 ? -27.297 50.665 47.991  1.00 41.85 ? 153 SER D CA    1 
ATOM   7514 C  C     . SER D 1 155 ? -28.035 51.161 49.232  1.00 41.28 ? 153 SER D C     1 
ATOM   7515 O  O     . SER D 1 155 ? -29.248 51.344 49.198  1.00 42.65 ? 153 SER D O     1 
ATOM   7516 C  CB    . SER D 1 155 ? -27.256 49.129 47.990  1.00 42.51 ? 153 SER D CB    1 
ATOM   7517 O  OG    . SER D 1 155 ? -27.297 48.604 49.309  1.00 44.82 ? 153 SER D OG    1 
ATOM   7518 N  N     . ARG D 1 156 ? -27.309 51.361 50.330  1.00 38.72 ? 154 ARG D N     1 
ATOM   7519 C  CA    . ARG D 1 156 ? -27.916 51.905 51.544  1.00 36.33 ? 154 ARG D CA    1 
ATOM   7520 C  C     . ARG D 1 156 ? -27.619 53.406 51.525  1.00 32.98 ? 154 ARG D C     1 
ATOM   7521 O  O     . ARG D 1 156 ? -28.135 54.170 52.339  1.00 33.19 ? 154 ARG D O     1 
ATOM   7522 C  CB    . ARG D 1 156 ? -27.316 51.272 52.808  1.00 38.33 ? 154 ARG D CB    1 
ATOM   7523 C  CG    . ARG D 1 156 ? -27.764 49.838 53.098  1.00 41.53 ? 154 ARG D CG    1 
ATOM   7524 C  CD    . ARG D 1 156 ? -29.267 49.733 53.360  1.00 42.16 ? 154 ARG D CD    1 
ATOM   7525 N  NE    . ARG D 1 156 ? -29.711 50.519 54.511  1.00 46.60 ? 154 ARG D NE    1 
ATOM   7526 C  CZ    . ARG D 1 156 ? -29.381 50.271 55.778  1.00 46.55 ? 154 ARG D CZ    1 
ATOM   7527 N  NH1   . ARG D 1 156 ? -28.595 49.250 56.085  1.00 48.61 ? 154 ARG D NH1   1 
ATOM   7528 N  NH2   . ARG D 1 156 ? -29.841 51.048 56.746  1.00 46.83 ? 154 ARG D NH2   1 
ATOM   7529 N  N     . GLY D 1 157 ? -26.781 53.816 50.577  1.00 30.05 ? 155 GLY D N     1 
ATOM   7530 C  CA    . GLY D 1 157 ? -26.416 55.214 50.455  1.00 28.49 ? 155 GLY D CA    1 
ATOM   7531 C  C     . GLY D 1 157 ? -25.375 55.666 51.470  1.00 27.82 ? 155 GLY D C     1 
ATOM   7532 O  O     . GLY D 1 157 ? -25.268 56.853 51.756  1.00 24.25 ? 155 GLY D O     1 
HETATM 7533 N  N     . MSE D 1 158 ? -24.606 54.725 52.016  1.00 26.28 ? 156 MSE D N     1 
HETATM 7534 C  CA    . MSE D 1 158 ? -23.576 55.059 53.002  1.00 24.61 ? 156 MSE D CA    1 
HETATM 7535 C  C     . MSE D 1 158 ? -22.259 55.450 52.333  1.00 24.33 ? 156 MSE D C     1 
HETATM 7536 O  O     . MSE D 1 158 ? -21.966 55.026 51.216  1.00 23.69 ? 156 MSE D O     1 
HETATM 7537 C  CB    . MSE D 1 158 ? -23.329 53.866 53.934  1.00 25.08 ? 156 MSE D CB    1 
HETATM 7538 C  CG    . MSE D 1 158 ? -24.526 53.468 54.774  1.00 26.21 ? 156 MSE D CG    1 
HETATM 7539 SE SE    . MSE D 1 158 ? -24.260 51.798 55.727  1.00 36.39 ? 156 MSE D SE    1 
HETATM 7540 C  CE    . MSE D 1 158 ? -23.277 52.529 57.248  1.00 31.37 ? 156 MSE D CE    1 
ATOM   7541 N  N     . THR D 1 159 ? -21.481 56.285 53.015  1.00 23.65 ? 157 THR D N     1 
ATOM   7542 C  CA    . THR D 1 159 ? -20.177 56.707 52.521  1.00 23.36 ? 157 THR D CA    1 
ATOM   7543 C  C     . THR D 1 159 ? -19.213 55.586 52.909  1.00 23.93 ? 157 THR D C     1 
ATOM   7544 O  O     . THR D 1 159 ? -19.291 55.046 54.014  1.00 22.87 ? 157 THR D O     1 
ATOM   7545 C  CB    . THR D 1 159 ? -19.731 58.021 53.185  1.00 25.01 ? 157 THR D CB    1 
ATOM   7546 O  OG1   . THR D 1 159 ? -20.550 59.093 52.700  1.00 26.56 ? 157 THR D OG1   1 
ATOM   7547 C  CG2   . THR D 1 159 ? -18.261 58.326 52.877  1.00 24.72 ? 157 THR D CG2   1 
ATOM   7548 N  N     . THR D 1 160 ? -18.312 55.237 51.999  1.00 21.52 ? 158 THR D N     1 
ATOM   7549 C  CA    . THR D 1 160 ? -17.356 54.160 52.247  1.00 21.11 ? 158 THR D CA    1 
ATOM   7550 C  C     . THR D 1 160 ? -15.933 54.661 52.512  1.00 19.67 ? 158 THR D C     1 
ATOM   7551 O  O     . THR D 1 160 ? -15.412 55.497 51.774  1.00 20.35 ? 158 THR D O     1 
ATOM   7552 C  CB    . THR D 1 160 ? -17.332 53.198 51.050  1.00 21.55 ? 158 THR D CB    1 
ATOM   7553 O  OG1   . THR D 1 160 ? -17.119 53.950 49.855  1.00 21.64 ? 158 THR D OG1   1 
ATOM   7554 C  CG2   . THR D 1 160 ? -18.663 52.451 50.931  1.00 20.82 ? 158 THR D CG2   1 
ATOM   7555 N  N     . VAL D 1 161 ? -15.313 54.153 53.577  1.00 19.66 ? 159 VAL D N     1 
ATOM   7556 C  CA    . VAL D 1 161 ? -13.950 54.532 53.932  1.00 17.96 ? 159 VAL D CA    1 
ATOM   7557 C  C     . VAL D 1 161 ? -13.150 53.246 54.090  1.00 19.88 ? 159 VAL D C     1 
ATOM   7558 O  O     . VAL D 1 161 ? -13.561 52.324 54.810  1.00 17.17 ? 159 VAL D O     1 
ATOM   7559 C  CB    . VAL D 1 161 ? -13.896 55.334 55.247  1.00 20.25 ? 159 VAL D CB    1 
ATOM   7560 C  CG1   . VAL D 1 161 ? -12.469 55.787 55.517  1.00 17.61 ? 159 VAL D CG1   1 
ATOM   7561 C  CG2   . VAL D 1 161 ? -14.822 56.541 55.154  1.00 18.81 ? 159 VAL D CG2   1 
ATOM   7562 N  N     . PHE D 1 162 ? -12.005 53.197 53.421  1.00 19.77 ? 160 PHE D N     1 
ATOM   7563 C  CA    . PHE D 1 162 ? -11.180 51.996 53.411  1.00 21.38 ? 160 PHE D CA    1 
ATOM   7564 C  C     . PHE D 1 162 ? -9.703  52.237 53.710  1.00 22.15 ? 160 PHE D C     1 
ATOM   7565 O  O     . PHE D 1 162 ? -9.059  53.114 53.122  1.00 21.30 ? 160 PHE D O     1 
ATOM   7566 C  CB    . PHE D 1 162 ? -11.356 51.336 52.034  1.00 21.53 ? 160 PHE D CB    1 
ATOM   7567 C  CG    . PHE D 1 162 ? -10.731 49.973 51.896  1.00 22.67 ? 160 PHE D CG    1 
ATOM   7568 C  CD1   . PHE D 1 162 ? -10.840 49.025 52.907  1.00 23.54 ? 160 PHE D CD1   1 
ATOM   7569 C  CD2   . PHE D 1 162 ? -10.112 49.609 50.700  1.00 23.36 ? 160 PHE D CD2   1 
ATOM   7570 C  CE1   . PHE D 1 162 ? -10.345 47.730 52.724  1.00 23.30 ? 160 PHE D CE1   1 
ATOM   7571 C  CE2   . PHE D 1 162 ? -9.619  48.323 50.512  1.00 24.50 ? 160 PHE D CE2   1 
ATOM   7572 C  CZ    . PHE D 1 162 ? -9.737  47.384 51.525  1.00 25.19 ? 160 PHE D CZ    1 
ATOM   7573 N  N     . ASN D 1 163 ? -9.186  51.445 54.645  1.00 21.84 ? 161 ASN D N     1 
ATOM   7574 C  CA    . ASN D 1 163 ? -7.783  51.471 55.054  1.00 22.66 ? 161 ASN D CA    1 
ATOM   7575 C  C     . ASN D 1 163 ? -7.360  50.016 54.816  1.00 22.73 ? 161 ASN D C     1 
ATOM   7576 O  O     . ASN D 1 163 ? -7.518  49.169 55.692  1.00 23.79 ? 161 ASN D O     1 
ATOM   7577 C  CB    . ASN D 1 163 ? -7.680  51.836 56.539  1.00 22.09 ? 161 ASN D CB    1 
ATOM   7578 C  CG    . ASN D 1 163 ? -6.254  51.765 57.069  1.00 22.51 ? 161 ASN D CG    1 
ATOM   7579 O  OD1   . ASN D 1 163 ? -5.305  52.196 56.405  1.00 25.46 ? 161 ASN D OD1   1 
ATOM   7580 N  ND2   . ASN D 1 163 ? -6.101  51.236 58.278  1.00 20.28 ? 161 ASN D ND2   1 
ATOM   7581 N  N     . PRO D 1 164 ? -6.833  49.715 53.614  1.00 23.25 ? 162 PRO D N     1 
ATOM   7582 C  CA    . PRO D 1 164 ? -6.394  48.375 53.208  1.00 24.70 ? 162 PRO D CA    1 
ATOM   7583 C  C     . PRO D 1 164 ? -5.151  47.883 53.929  1.00 26.08 ? 162 PRO D C     1 
ATOM   7584 O  O     . PRO D 1 164 ? -4.115  47.629 53.314  1.00 27.30 ? 162 PRO D O     1 
ATOM   7585 C  CB    . PRO D 1 164 ? -6.181  48.532 51.708  1.00 23.72 ? 162 PRO D CB    1 
ATOM   7586 C  CG    . PRO D 1 164 ? -5.583  49.905 51.631  1.00 24.39 ? 162 PRO D CG    1 
ATOM   7587 C  CD    . PRO D 1 164 ? -6.484  50.708 52.581  1.00 24.07 ? 162 PRO D CD    1 
ATOM   7588 N  N     . SER D 1 165 ? -5.285  47.723 55.239  1.00 26.80 ? 163 SER D N     1 
ATOM   7589 C  CA    . SER D 1 165 ? -4.195  47.280 56.088  1.00 27.43 ? 163 SER D CA    1 
ATOM   7590 C  C     . SER D 1 165 ? -4.757  46.314 57.129  1.00 27.82 ? 163 SER D C     1 
ATOM   7591 O  O     . SER D 1 165 ? -5.723  46.634 57.803  1.00 25.19 ? 163 SER D O     1 
ATOM   7592 C  CB    . SER D 1 165 ? -3.571  48.503 56.770  1.00 28.81 ? 163 SER D CB    1 
ATOM   7593 O  OG    . SER D 1 165 ? -2.688  48.136 57.812  1.00 31.12 ? 163 SER D OG    1 
ATOM   7594 N  N     . PRO D 1 166 ? -4.177  45.105 57.247  1.00 29.94 ? 164 PRO D N     1 
ATOM   7595 C  CA    . PRO D 1 166 ? -3.043  44.633 56.450  1.00 31.11 ? 164 PRO D CA    1 
ATOM   7596 C  C     . PRO D 1 166 ? -3.430  44.524 54.983  1.00 31.95 ? 164 PRO D C     1 
ATOM   7597 O  O     . PRO D 1 166 ? -4.606  44.354 54.647  1.00 31.05 ? 164 PRO D O     1 
ATOM   7598 C  CB    . PRO D 1 166 ? -2.704  43.283 57.088  1.00 31.00 ? 164 PRO D CB    1 
ATOM   7599 C  CG    . PRO D 1 166 ? -4.009  42.818 57.611  1.00 32.44 ? 164 PRO D CG    1 
ATOM   7600 C  CD    . PRO D 1 166 ? -4.613  44.070 58.199  1.00 30.74 ? 164 PRO D CD    1 
ATOM   7601 N  N     . VAL D 1 167 ? -2.436  44.628 54.113  1.00 32.94 ? 165 VAL D N     1 
ATOM   7602 C  CA    . VAL D 1 167 ? -2.688  44.585 52.687  1.00 34.24 ? 165 VAL D CA    1 
ATOM   7603 C  C     . VAL D 1 167 ? -3.003  43.199 52.147  1.00 35.04 ? 165 VAL D C     1 
ATOM   7604 O  O     . VAL D 1 167 ? -2.568  42.181 52.685  1.00 36.14 ? 165 VAL D O     1 
ATOM   7605 C  CB    . VAL D 1 167 ? -1.494  45.167 51.903  1.00 34.81 ? 165 VAL D CB    1 
ATOM   7606 C  CG1   . VAL D 1 167 ? -0.292  44.217 51.994  1.00 33.54 ? 165 VAL D CG1   1 
ATOM   7607 C  CG2   . VAL D 1 167 ? -1.893  45.407 50.457  1.00 36.01 ? 165 VAL D CG2   1 
ATOM   7608 N  N     . ASN D 1 168 ? -3.802  43.189 51.088  1.00 34.59 ? 166 ASN D N     1 
ATOM   7609 C  CA    . ASN D 1 168 ? -4.195  41.984 50.377  1.00 33.25 ? 166 ASN D CA    1 
ATOM   7610 C  C     . ASN D 1 168 ? -4.112  42.473 48.935  1.00 33.82 ? 166 ASN D C     1 
ATOM   7611 O  O     . ASN D 1 168 ? -4.830  43.397 48.546  1.00 32.05 ? 166 ASN D O     1 
ATOM   7612 C  CB    . ASN D 1 168 ? -5.633  41.583 50.714  1.00 32.90 ? 166 ASN D CB    1 
ATOM   7613 C  CG    . ASN D 1 168 ? -6.081  40.332 49.965  1.00 33.00 ? 166 ASN D CG    1 
ATOM   7614 O  OD1   . ASN D 1 168 ? -5.738  40.139 48.796  1.00 34.37 ? 166 ASN D OD1   1 
ATOM   7615 N  ND2   . ASN D 1 168 ? -6.865  39.488 50.630  1.00 30.52 ? 166 ASN D ND2   1 
ATOM   7616 N  N     . PRO D 1 169 ? -3.225  41.876 48.128  1.00 33.72 ? 167 PRO D N     1 
ATOM   7617 C  CA    . PRO D 1 169 ? -3.082  42.301 46.731  1.00 34.41 ? 167 PRO D CA    1 
ATOM   7618 C  C     . PRO D 1 169 ? -4.390  42.401 45.948  1.00 32.95 ? 167 PRO D C     1 
ATOM   7619 O  O     . PRO D 1 169 ? -4.512  43.227 45.040  1.00 33.75 ? 167 PRO D O     1 
ATOM   7620 C  CB    . PRO D 1 169 ? -2.123  41.257 46.144  1.00 34.95 ? 167 PRO D CB    1 
ATOM   7621 C  CG    . PRO D 1 169 ? -2.403  40.031 46.972  1.00 36.09 ? 167 PRO D CG    1 
ATOM   7622 C  CD    . PRO D 1 169 ? -2.497  40.617 48.372  1.00 35.96 ? 167 PRO D CD    1 
ATOM   7623 N  N     . ASP D 1 170 ? -5.365  41.575 46.309  1.00 33.03 ? 168 ASP D N     1 
ATOM   7624 C  CA    . ASP D 1 170 ? -6.657  41.565 45.627  1.00 33.82 ? 168 ASP D CA    1 
ATOM   7625 C  C     . ASP D 1 170 ? -7.538  42.776 45.936  1.00 32.91 ? 168 ASP D C     1 
ATOM   7626 O  O     . ASP D 1 170 ? -8.562  42.991 45.288  1.00 31.70 ? 168 ASP D O     1 
ATOM   7627 C  CB    . ASP D 1 170 ? -7.417  40.281 45.969  1.00 36.45 ? 168 ASP D CB    1 
ATOM   7628 C  CG    . ASP D 1 170 ? -6.636  39.034 45.607  1.00 40.51 ? 168 ASP D CG    1 
ATOM   7629 O  OD1   . ASP D 1 170 ? -5.915  39.068 44.588  1.00 40.47 ? 168 ASP D OD1   1 
ATOM   7630 O  OD2   . ASP D 1 170 ? -6.748  38.019 46.331  1.00 44.86 ? 168 ASP D OD2   1 
ATOM   7631 N  N     . PHE D 1 171 ? -7.145  43.561 46.932  1.00 31.88 ? 169 PHE D N     1 
ATOM   7632 C  CA    . PHE D 1 171 ? -7.906  44.749 47.301  1.00 31.71 ? 169 PHE D CA    1 
ATOM   7633 C  C     . PHE D 1 171 ? -7.854  45.803 46.195  1.00 33.03 ? 169 PHE D C     1 
ATOM   7634 O  O     . PHE D 1 171 ? -8.647  46.737 46.187  1.00 33.82 ? 169 PHE D O     1 
ATOM   7635 C  CB    . PHE D 1 171 ? -7.341  45.358 48.581  1.00 27.84 ? 169 PHE D CB    1 
ATOM   7636 C  CG    . PHE D 1 171 ? -7.720  44.621 49.834  1.00 25.89 ? 169 PHE D CG    1 
ATOM   7637 C  CD1   . PHE D 1 171 ? -7.022  44.847 51.014  1.00 23.82 ? 169 PHE D CD1   1 
ATOM   7638 C  CD2   . PHE D 1 171 ? -8.795  43.739 49.852  1.00 26.23 ? 169 PHE D CD2   1 
ATOM   7639 C  CE1   . PHE D 1 171 ? -7.393  44.204 52.195  1.00 25.88 ? 169 PHE D CE1   1 
ATOM   7640 C  CE2   . PHE D 1 171 ? -9.171  43.093 51.030  1.00 24.71 ? 169 PHE D CE2   1 
ATOM   7641 C  CZ    . PHE D 1 171 ? -8.469  43.328 52.200  1.00 25.53 ? 169 PHE D CZ    1 
ATOM   7642 N  N     . CYS D 1 172 ? -6.916  45.653 45.265  1.00 33.93 ? 170 CYS D N     1 
ATOM   7643 C  CA    . CYS D 1 172 ? -6.766  46.624 44.183  1.00 36.13 ? 170 CYS D CA    1 
ATOM   7644 C  C     . CYS D 1 172 ? -7.985  46.664 43.264  1.00 36.83 ? 170 CYS D C     1 
ATOM   7645 O  O     . CYS D 1 172 ? -8.070  47.511 42.376  1.00 37.86 ? 170 CYS D O     1 
ATOM   7646 C  CB    . CYS D 1 172 ? -5.510  46.311 43.363  1.00 36.84 ? 170 CYS D CB    1 
ATOM   7647 S  SG    . CYS D 1 172 ? -5.617  44.802 42.361  1.00 39.53 ? 170 CYS D SG    1 
ATOM   7648 N  N     . HIS D 1 173 ? -8.928  45.755 43.487  1.00 37.41 ? 171 HIS D N     1 
ATOM   7649 C  CA    . HIS D 1 173 ? -10.139 45.687 42.672  1.00 39.19 ? 171 HIS D CA    1 
ATOM   7650 C  C     . HIS D 1 173 ? -11.324 46.407 43.315  1.00 38.02 ? 171 HIS D C     1 
ATOM   7651 O  O     . HIS D 1 173 ? -12.383 46.539 42.702  1.00 38.03 ? 171 HIS D O     1 
ATOM   7652 C  CB    . HIS D 1 173 ? -10.516 44.221 42.425  1.00 42.64 ? 171 HIS D CB    1 
ATOM   7653 C  CG    . HIS D 1 173 ? -9.549  43.486 41.549  1.00 46.75 ? 171 HIS D CG    1 
ATOM   7654 N  ND1   . HIS D 1 173 ? -9.551  42.112 41.427  1.00 48.36 ? 171 HIS D ND1   1 
ATOM   7655 C  CD2   . HIS D 1 173 ? -8.560  43.933 40.738  1.00 48.47 ? 171 HIS D CD2   1 
ATOM   7656 C  CE1   . HIS D 1 173 ? -8.605  41.746 40.580  1.00 49.96 ? 171 HIS D CE1   1 
ATOM   7657 N  NE2   . HIS D 1 173 ? -7.989  42.831 40.147  1.00 49.45 ? 171 HIS D NE2   1 
ATOM   7658 N  N     . LEU D 1 174 ? -11.131 46.880 44.542  1.00 34.81 ? 172 LEU D N     1 
ATOM   7659 C  CA    . LEU D 1 174 ? -12.184 47.557 45.303  1.00 33.21 ? 172 LEU D CA    1 
ATOM   7660 C  C     . LEU D 1 174 ? -12.364 49.056 45.102  1.00 30.79 ? 172 LEU D C     1 
ATOM   7661 O  O     . LEU D 1 174 ? -13.400 49.611 45.472  1.00 29.76 ? 172 LEU D O     1 
ATOM   7662 C  CB    . LEU D 1 174 ? -11.950 47.322 46.795  1.00 33.83 ? 172 LEU D CB    1 
ATOM   7663 C  CG    . LEU D 1 174 ? -12.481 46.044 47.431  1.00 34.55 ? 172 LEU D CG    1 
ATOM   7664 C  CD1   . LEU D 1 174 ? -12.293 44.885 46.495  1.00 37.31 ? 172 LEU D CD1   1 
ATOM   7665 C  CD2   . LEU D 1 174 ? -11.769 45.810 48.756  1.00 36.19 ? 172 LEU D CD2   1 
ATOM   7666 N  N     . TRP D 1 175 ? -11.361 49.716 44.539  1.00 30.12 ? 173 TRP D N     1 
ATOM   7667 C  CA    . TRP D 1 175 ? -11.410 51.162 44.378  1.00 30.39 ? 173 TRP D CA    1 
ATOM   7668 C  C     . TRP D 1 175 ? -12.721 51.789 43.917  1.00 29.82 ? 173 TRP D C     1 
ATOM   7669 O  O     . TRP D 1 175 ? -13.092 52.849 44.406  1.00 30.21 ? 173 TRP D O     1 
ATOM   7670 C  CB    . TRP D 1 175 ? -10.231 51.611 43.517  1.00 31.19 ? 173 TRP D CB    1 
ATOM   7671 C  CG    . TRP D 1 175 ? -8.930  51.241 44.179  1.00 32.93 ? 173 TRP D CG    1 
ATOM   7672 C  CD1   . TRP D 1 175 ? -7.871  50.606 43.602  1.00 32.79 ? 173 TRP D CD1   1 
ATOM   7673 C  CD2   . TRP D 1 175 ? -8.585  51.416 45.568  1.00 33.08 ? 173 TRP D CD2   1 
ATOM   7674 N  NE1   . TRP D 1 175 ? -6.893  50.366 44.540  1.00 33.48 ? 173 TRP D NE1   1 
ATOM   7675 C  CE2   . TRP D 1 175 ? -7.304  50.853 45.754  1.00 33.96 ? 173 TRP D CE2   1 
ATOM   7676 C  CE3   . TRP D 1 175 ? -9.236  51.991 46.671  1.00 32.38 ? 173 TRP D CE3   1 
ATOM   7677 C  CZ2   . TRP D 1 175 ? -6.658  50.845 46.998  1.00 33.06 ? 173 TRP D CZ2   1 
ATOM   7678 C  CZ3   . TRP D 1 175 ? -8.592  51.984 47.912  1.00 31.51 ? 173 TRP D CZ3   1 
ATOM   7679 C  CH2   . TRP D 1 175 ? -7.316  51.413 48.061  1.00 31.78 ? 173 TRP D CH2   1 
ATOM   7680 N  N     . PRO D 1 176 ? -13.450 51.141 42.993  1.00 30.95 ? 174 PRO D N     1 
ATOM   7681 C  CA    . PRO D 1 176 ? -14.724 51.708 42.524  1.00 30.69 ? 174 PRO D CA    1 
ATOM   7682 C  C     . PRO D 1 176 ? -15.763 51.881 43.642  1.00 30.14 ? 174 PRO D C     1 
ATOM   7683 O  O     . PRO D 1 176 ? -16.621 52.762 43.578  1.00 29.86 ? 174 PRO D O     1 
ATOM   7684 C  CB    . PRO D 1 176 ? -15.189 50.692 41.482  1.00 32.17 ? 174 PRO D CB    1 
ATOM   7685 C  CG    . PRO D 1 176 ? -13.900 50.187 40.918  1.00 32.79 ? 174 PRO D CG    1 
ATOM   7686 C  CD    . PRO D 1 176 ? -13.054 49.989 42.163  1.00 30.87 ? 174 PRO D CD    1 
ATOM   7687 N  N     . LEU D 1 177 ? -15.678 51.035 44.662  1.00 27.30 ? 175 LEU D N     1 
ATOM   7688 C  CA    . LEU D 1 177 ? -16.618 51.073 45.774  1.00 25.08 ? 175 LEU D CA    1 
ATOM   7689 C  C     . LEU D 1 177 ? -16.188 51.974 46.923  1.00 24.81 ? 175 LEU D C     1 
ATOM   7690 O  O     . LEU D 1 177 ? -16.912 52.115 47.904  1.00 22.60 ? 175 LEU D O     1 
ATOM   7691 C  CB    . LEU D 1 177 ? -16.821 49.660 46.319  1.00 27.58 ? 175 LEU D CB    1 
ATOM   7692 C  CG    . LEU D 1 177 ? -17.429 48.614 45.385  1.00 30.29 ? 175 LEU D CG    1 
ATOM   7693 C  CD1   . LEU D 1 177 ? -17.356 47.245 46.042  1.00 31.54 ? 175 LEU D CD1   1 
ATOM   7694 C  CD2   . LEU D 1 177 ? -18.870 48.984 45.070  1.00 30.84 ? 175 LEU D CD2   1 
ATOM   7695 N  N     . ILE D 1 178 ? -15.021 52.591 46.790  1.00 24.83 ? 176 ILE D N     1 
ATOM   7696 C  CA    . ILE D 1 178 ? -14.472 53.422 47.852  1.00 24.68 ? 176 ILE D CA    1 
ATOM   7697 C  C     . ILE D 1 178 ? -14.574 54.930 47.666  1.00 24.71 ? 176 ILE D C     1 
ATOM   7698 O  O     . ILE D 1 178 ? -14.163 55.457 46.636  1.00 24.04 ? 176 ILE D O     1 
ATOM   7699 C  CB    . ILE D 1 178 ? -12.986 53.077 48.059  1.00 25.13 ? 176 ILE D CB    1 
ATOM   7700 C  CG1   . ILE D 1 178 ? -12.826 51.563 48.193  1.00 22.92 ? 176 ILE D CG1   1 
ATOM   7701 C  CG2   . ILE D 1 178 ? -12.440 53.815 49.271  1.00 23.89 ? 176 ILE D CG2   1 
ATOM   7702 C  CD1   . ILE D 1 178 ? -13.736 50.920 49.231  1.00 24.82 ? 176 ILE D CD1   1 
ATOM   7703 N  N     . ASP D 1 179 ? -15.100 55.620 48.680  1.00 24.51 ? 177 ASP D N     1 
ATOM   7704 C  CA    . ASP D 1 179 ? -15.215 57.077 48.637  1.00 24.93 ? 177 ASP D CA    1 
ATOM   7705 C  C     . ASP D 1 179 ? -13.954 57.736 49.193  1.00 24.60 ? 177 ASP D C     1 
ATOM   7706 O  O     . ASP D 1 179 ? -13.459 58.721 48.643  1.00 24.25 ? 177 ASP D O     1 
ATOM   7707 C  CB    . ASP D 1 179 ? -16.417 57.561 49.457  1.00 26.79 ? 177 ASP D CB    1 
ATOM   7708 C  CG    . ASP D 1 179 ? -17.739 57.127 48.861  1.00 28.53 ? 177 ASP D CG    1 
ATOM   7709 O  OD1   . ASP D 1 179 ? -17.861 57.145 47.620  1.00 28.38 ? 177 ASP D OD1   1 
ATOM   7710 O  OD2   . ASP D 1 179 ? -18.657 56.778 49.632  1.00 28.66 ? 177 ASP D OD2   1 
ATOM   7711 N  N     . ILE D 1 180 ? -13.442 57.185 50.290  1.00 22.94 ? 178 ILE D N     1 
ATOM   7712 C  CA    . ILE D 1 180 ? -12.253 57.715 50.941  1.00 21.33 ? 178 ILE D CA    1 
ATOM   7713 C  C     . ILE D 1 180 ? -11.269 56.590 51.214  1.00 22.06 ? 178 ILE D C     1 
ATOM   7714 O  O     . ILE D 1 180 ? -11.592 55.625 51.907  1.00 21.89 ? 178 ILE D O     1 
ATOM   7715 C  CB    . ILE D 1 180 ? -12.605 58.389 52.292  1.00 22.68 ? 178 ILE D CB    1 
ATOM   7716 C  CG1   . ILE D 1 180 ? -13.520 59.593 52.051  1.00 22.77 ? 178 ILE D CG1   1 
ATOM   7717 C  CG2   . ILE D 1 180 ? -11.320 58.840 53.011  1.00 20.64 ? 178 ILE D CG2   1 
ATOM   7718 C  CD1   . ILE D 1 180 ? -14.126 60.177 53.326  1.00 21.77 ? 178 ILE D CD1   1 
ATOM   7719 N  N     . ALA D 1 181 ? -10.067 56.716 50.674  1.00 22.46 ? 179 ALA D N     1 
ATOM   7720 C  CA    . ALA D 1 181 ? -9.048  55.703 50.883  1.00 22.17 ? 179 ALA D CA    1 
ATOM   7721 C  C     . ALA D 1 181 ? -7.910  56.290 51.696  1.00 21.70 ? 179 ALA D C     1 
ATOM   7722 O  O     . ALA D 1 181 ? -7.482  57.415 51.456  1.00 22.58 ? 179 ALA D O     1 
ATOM   7723 C  CB    . ALA D 1 181 ? -8.532  55.191 49.540  1.00 20.29 ? 179 ALA D CB    1 
ATOM   7724 N  N     . VAL D 1 182 ? -7.446  55.535 52.685  1.00 20.77 ? 180 VAL D N     1 
ATOM   7725 C  CA    . VAL D 1 182 ? -6.332  55.969 53.516  1.00 22.09 ? 180 VAL D CA    1 
ATOM   7726 C  C     . VAL D 1 182 ? -5.298  54.847 53.471  1.00 22.78 ? 180 VAL D C     1 
ATOM   7727 O  O     . VAL D 1 182 ? -5.569  53.733 53.901  1.00 22.67 ? 180 VAL D O     1 
ATOM   7728 C  CB    . VAL D 1 182 ? -6.769  56.222 54.966  1.00 23.16 ? 180 VAL D CB    1 
ATOM   7729 C  CG1   . VAL D 1 182 ? -5.553  56.583 55.819  1.00 22.46 ? 180 VAL D CG1   1 
ATOM   7730 C  CG2   . VAL D 1 182 ? -7.791  57.364 54.999  1.00 23.13 ? 180 VAL D CG2   1 
ATOM   7731 N  N     . VAL D 1 183 ? -4.129  55.154 52.921  1.00 23.90 ? 181 VAL D N     1 
ATOM   7732 C  CA    . VAL D 1 183 ? -3.050  54.182 52.771  1.00 23.52 ? 181 VAL D CA    1 
ATOM   7733 C  C     . VAL D 1 183 ? -1.699  54.789 53.150  1.00 24.16 ? 181 VAL D C     1 
ATOM   7734 O  O     . VAL D 1 183 ? -1.582  56.003 53.301  1.00 23.77 ? 181 VAL D O     1 
ATOM   7735 C  CB    . VAL D 1 183 ? -2.962  53.712 51.295  1.00 23.50 ? 181 VAL D CB    1 
ATOM   7736 C  CG1   . VAL D 1 183 ? -4.228  52.972 50.898  1.00 22.40 ? 181 VAL D CG1   1 
ATOM   7737 C  CG2   . VAL D 1 183 ? -2.768  54.919 50.382  1.00 21.06 ? 181 VAL D CG2   1 
ATOM   7738 N  N     . ASN D 1 184 ? -0.687  53.938 53.329  1.00 24.92 ? 182 ASN D N     1 
ATOM   7739 C  CA    . ASN D 1 184 ? 0.667   54.421 53.613  1.00 25.40 ? 182 ASN D CA    1 
ATOM   7740 C  C     . ASN D 1 184 ? 1.384   54.293 52.262  1.00 25.85 ? 182 ASN D C     1 
ATOM   7741 O  O     . ASN D 1 184 ? 0.820   53.711 51.338  1.00 25.71 ? 182 ASN D O     1 
ATOM   7742 C  CB    . ASN D 1 184 ? 1.365   53.577 54.693  1.00 26.82 ? 182 ASN D CB    1 
ATOM   7743 C  CG    . ASN D 1 184 ? 1.439   52.105 54.336  1.00 28.43 ? 182 ASN D CG    1 
ATOM   7744 O  OD1   . ASN D 1 184 ? 1.475   51.739 53.162  1.00 27.50 ? 182 ASN D OD1   1 
ATOM   7745 N  ND2   . ASN D 1 184 ? 1.477   51.253 55.355  1.00 29.82 ? 182 ASN D ND2   1 
ATOM   7746 N  N     . GLU D 1 185 ? 2.603   54.817 52.124  1.00 27.40 ? 183 GLU D N     1 
ATOM   7747 C  CA    . GLU D 1 185 ? 3.268   54.745 50.820  1.00 29.80 ? 183 GLU D CA    1 
ATOM   7748 C  C     . GLU D 1 185 ? 3.403   53.345 50.232  1.00 29.59 ? 183 GLU D C     1 
ATOM   7749 O  O     . GLU D 1 185 ? 3.326   53.180 49.015  1.00 29.84 ? 183 GLU D O     1 
ATOM   7750 C  CB    . GLU D 1 185 ? 4.646   55.426 50.848  1.00 32.89 ? 183 GLU D CB    1 
ATOM   7751 C  CG    . GLU D 1 185 ? 5.631   54.823 51.810  1.00 38.36 ? 183 GLU D CG    1 
ATOM   7752 C  CD    . GLU D 1 185 ? 5.849   55.710 53.010  1.00 41.83 ? 183 GLU D CD    1 
ATOM   7753 O  OE1   . GLU D 1 185 ? 6.664   56.658 52.916  1.00 42.59 ? 183 GLU D OE1   1 
ATOM   7754 O  OE2   . GLU D 1 185 ? 5.186   55.469 54.040  1.00 42.64 ? 183 GLU D OE2   1 
ATOM   7755 N  N     . SER D 1 186 ? 3.600   52.341 51.082  1.00 30.04 ? 184 SER D N     1 
ATOM   7756 C  CA    . SER D 1 186 ? 3.737   50.961 50.616  1.00 30.52 ? 184 SER D CA    1 
ATOM   7757 C  C     . SER D 1 186 ? 2.443   50.478 49.964  1.00 29.80 ? 184 SER D C     1 
ATOM   7758 O  O     . SER D 1 186 ? 2.451   49.918 48.866  1.00 29.43 ? 184 SER D O     1 
ATOM   7759 C  CB    . SER D 1 186 ? 4.088   50.038 51.790  1.00 32.06 ? 184 SER D CB    1 
ATOM   7760 O  OG    . SER D 1 186 ? 4.125   48.686 51.368  1.00 34.33 ? 184 SER D OG    1 
ATOM   7761 N  N     . GLU D 1 187 ? 1.330   50.691 50.656  1.00 27.64 ? 185 GLU D N     1 
ATOM   7762 C  CA    . GLU D 1 187 ? 0.023   50.292 50.145  1.00 27.03 ? 185 GLU D CA    1 
ATOM   7763 C  C     . GLU D 1 187 ? -0.355  51.132 48.922  1.00 25.21 ? 185 GLU D C     1 
ATOM   7764 O  O     . GLU D 1 187 ? -0.987  50.637 47.996  1.00 26.65 ? 185 GLU D O     1 
ATOM   7765 C  CB    . GLU D 1 187 ? -1.022  50.437 51.260  1.00 26.05 ? 185 GLU D CB    1 
ATOM   7766 C  CG    . GLU D 1 187 ? -0.655  49.614 52.481  1.00 26.11 ? 185 GLU D CG    1 
ATOM   7767 C  CD    . GLU D 1 187 ? -1.336  50.077 53.758  1.00 29.07 ? 185 GLU D CD    1 
ATOM   7768 O  OE1   . GLU D 1 187 ? -1.844  51.221 53.790  1.00 27.23 ? 185 GLU D OE1   1 
ATOM   7769 O  OE2   . GLU D 1 187 ? -1.342  49.296 54.738  1.00 28.26 ? 185 GLU D OE2   1 
ATOM   7770 N  N     . ALA D 1 188 ? 0.050   52.398 48.910  1.00 24.85 ? 186 ALA D N     1 
ATOM   7771 C  CA    . ALA D 1 188 ? -0.262  53.275 47.783  1.00 25.48 ? 186 ALA D CA    1 
ATOM   7772 C  C     . ALA D 1 188 ? 0.350   52.736 46.496  1.00 27.10 ? 186 ALA D C     1 
ATOM   7773 O  O     . ALA D 1 188 ? -0.264  52.796 45.435  1.00 28.86 ? 186 ALA D O     1 
ATOM   7774 C  CB    . ALA D 1 188 ? 0.251   54.691 48.052  1.00 25.85 ? 186 ALA D CB    1 
ATOM   7775 N  N     . GLU D 1 189 ? 1.563   52.201 46.593  1.00 26.76 ? 187 GLU D N     1 
ATOM   7776 C  CA    . GLU D 1 189 ? 2.239   51.675 45.417  1.00 28.22 ? 187 GLU D CA    1 
ATOM   7777 C  C     . GLU D 1 189 ? 1.766   50.271 45.074  1.00 28.60 ? 187 GLU D C     1 
ATOM   7778 O  O     . GLU D 1 189 ? 1.582   49.941 43.909  1.00 29.77 ? 187 GLU D O     1 
ATOM   7779 C  CB    . GLU D 1 189 ? 3.759   51.659 45.630  1.00 29.66 ? 187 GLU D CB    1 
ATOM   7780 C  CG    . GLU D 1 189 ? 4.541   51.369 44.350  1.00 32.74 ? 187 GLU D CG    1 
ATOM   7781 C  CD    . GLU D 1 189 ? 6.037   51.268 44.581  1.00 34.88 ? 187 GLU D CD    1 
ATOM   7782 O  OE1   . GLU D 1 189 ? 6.575   52.081 45.364  1.00 32.53 ? 187 GLU D OE1   1 
ATOM   7783 O  OE2   . GLU D 1 189 ? 6.672   50.381 43.967  1.00 36.41 ? 187 GLU D OE2   1 
ATOM   7784 N  N     . LEU D 1 190 ? 1.568   49.445 46.092  1.00 29.54 ? 188 LEU D N     1 
ATOM   7785 C  CA    . LEU D 1 190 ? 1.135   48.071 45.872  1.00 30.10 ? 188 LEU D CA    1 
ATOM   7786 C  C     . LEU D 1 190 ? -0.284  47.955 45.325  1.00 30.12 ? 188 LEU D C     1 
ATOM   7787 O  O     . LEU D 1 190 ? -0.546  47.158 44.427  1.00 28.43 ? 188 LEU D O     1 
ATOM   7788 C  CB    . LEU D 1 190 ? 1.225   47.283 47.175  1.00 31.55 ? 188 LEU D CB    1 
ATOM   7789 C  CG    . LEU D 1 190 ? 0.996   45.779 47.014  1.00 35.32 ? 188 LEU D CG    1 
ATOM   7790 C  CD1   . LEU D 1 190 ? 2.218   45.155 46.347  1.00 35.43 ? 188 LEU D CD1   1 
ATOM   7791 C  CD2   . LEU D 1 190 ? 0.761   45.137 48.374  1.00 36.81 ? 188 LEU D CD2   1 
ATOM   7792 N  N     . LEU D 1 191 ? -1.197  48.756 45.865  1.00 29.23 ? 189 LEU D N     1 
ATOM   7793 C  CA    . LEU D 1 191 ? -2.592  48.699 45.451  1.00 29.98 ? 189 LEU D CA    1 
ATOM   7794 C  C     . LEU D 1 191 ? -2.986  49.741 44.410  1.00 30.26 ? 189 LEU D C     1 
ATOM   7795 O  O     . LEU D 1 191 ? -4.053  49.647 43.810  1.00 30.54 ? 189 LEU D O     1 
ATOM   7796 C  CB    . LEU D 1 191 ? -3.490  48.815 46.684  1.00 28.84 ? 189 LEU D CB    1 
ATOM   7797 C  CG    . LEU D 1 191 ? -3.176  47.788 47.779  1.00 29.12 ? 189 LEU D CG    1 
ATOM   7798 C  CD1   . LEU D 1 191 ? -4.059  48.022 48.996  1.00 28.98 ? 189 LEU D CD1   1 
ATOM   7799 C  CD2   . LEU D 1 191 ? -3.378  46.388 47.236  1.00 28.66 ? 189 LEU D CD2   1 
ATOM   7800 N  N     . GLN D 1 192 ? -2.131  50.735 44.202  1.00 30.60 ? 190 GLN D N     1 
ATOM   7801 C  CA    . GLN D 1 192 ? -2.398  51.779 43.215  1.00 32.72 ? 190 GLN D CA    1 
ATOM   7802 C  C     . GLN D 1 192 ? -3.837  52.310 43.210  1.00 34.29 ? 190 GLN D C     1 
ATOM   7803 O  O     . GLN D 1 192 ? -4.566  52.143 42.225  1.00 34.83 ? 190 GLN D O     1 
ATOM   7804 C  CB    . GLN D 1 192 ? -2.059  51.271 41.804  1.00 32.31 ? 190 GLN D CB    1 
ATOM   7805 C  CG    . GLN D 1 192 ? -0.584  50.965 41.548  1.00 32.71 ? 190 GLN D CG    1 
ATOM   7806 C  CD    . GLN D 1 192 ? 0.316   52.191 41.678  1.00 32.86 ? 190 GLN D CD    1 
ATOM   7807 O  OE1   . GLN D 1 192 ? -0.085  53.309 41.358  1.00 31.71 ? 190 GLN D OE1   1 
ATOM   7808 N  NE2   . GLN D 1 192 ? 1.546   51.976 42.132  1.00 33.24 ? 190 GLN D NE2   1 
ATOM   7809 N  N     . PRO D 1 193 ? -4.274  52.948 44.307  1.00 34.25 ? 191 PRO D N     1 
ATOM   7810 C  CA    . PRO D 1 193 ? -5.644  53.465 44.303  1.00 35.93 ? 191 PRO D CA    1 
ATOM   7811 C  C     . PRO D 1 193 ? -5.827  54.486 43.177  1.00 38.25 ? 191 PRO D C     1 
ATOM   7812 O  O     . PRO D 1 193 ? -4.956  55.324 42.938  1.00 39.13 ? 191 PRO D O     1 
ATOM   7813 C  CB    . PRO D 1 193 ? -5.788  54.083 45.696  1.00 35.25 ? 191 PRO D CB    1 
ATOM   7814 C  CG    . PRO D 1 193 ? -4.378  54.451 46.062  1.00 34.99 ? 191 PRO D CG    1 
ATOM   7815 C  CD    . PRO D 1 193 ? -3.598  53.254 45.578  1.00 34.42 ? 191 PRO D CD    1 
ATOM   7816 N  N     . TYR D 1 194 ? -6.958  54.407 42.487  1.00 39.37 ? 192 TYR D N     1 
ATOM   7817 C  CA    . TYR D 1 194 ? -7.246  55.311 41.377  1.00 41.89 ? 192 TYR D CA    1 
ATOM   7818 C  C     . TYR D 1 194 ? -8.708  55.739 41.386  1.00 40.89 ? 192 TYR D C     1 
ATOM   7819 O  O     . TYR D 1 194 ? -9.573  55.008 41.861  1.00 42.36 ? 192 TYR D O     1 
ATOM   7820 C  CB    . TYR D 1 194 ? -6.960  54.616 40.045  1.00 44.23 ? 192 TYR D CB    1 
ATOM   7821 C  CG    . TYR D 1 194 ? -7.870  53.427 39.790  1.00 47.39 ? 192 TYR D CG    1 
ATOM   7822 C  CD1   . TYR D 1 194 ? -7.565  52.165 40.304  1.00 48.11 ? 192 TYR D CD1   1 
ATOM   7823 C  CD2   . TYR D 1 194 ? -9.054  53.572 39.061  1.00 48.85 ? 192 TYR D CD2   1 
ATOM   7824 C  CE1   . TYR D 1 194 ? -8.415  51.075 40.098  1.00 49.06 ? 192 TYR D CE1   1 
ATOM   7825 C  CE2   . TYR D 1 194 ? -9.914  52.489 38.851  1.00 49.90 ? 192 TYR D CE2   1 
ATOM   7826 C  CZ    . TYR D 1 194 ? -9.587  51.244 39.372  1.00 50.21 ? 192 TYR D CZ    1 
ATOM   7827 O  OH    . TYR D 1 194 ? -10.424 50.168 39.164  1.00 50.45 ? 192 TYR D OH    1 
ATOM   7828 N  N     . GLY D 1 195 ? -8.972  56.924 40.851  1.00 40.60 ? 193 GLY D N     1 
ATOM   7829 C  CA    . GLY D 1 195 ? -10.332 57.427 40.775  1.00 39.67 ? 193 GLY D CA    1 
ATOM   7830 C  C     . GLY D 1 195 ? -11.066 57.620 42.087  1.00 39.34 ? 193 GLY D C     1 
ATOM   7831 O  O     . GLY D 1 195 ? -12.270 57.862 42.092  1.00 38.70 ? 193 GLY D O     1 
ATOM   7832 N  N     . VAL D 1 196 ? -10.361 57.514 43.205  1.00 38.65 ? 194 VAL D N     1 
ATOM   7833 C  CA    . VAL D 1 196 ? -11.006 57.694 44.497  1.00 36.23 ? 194 VAL D CA    1 
ATOM   7834 C  C     . VAL D 1 196 ? -11.108 59.184 44.784  1.00 36.34 ? 194 VAL D C     1 
ATOM   7835 O  O     . VAL D 1 196 ? -10.128 59.919 44.663  1.00 37.43 ? 194 VAL D O     1 
ATOM   7836 C  CB    . VAL D 1 196 ? -10.214 56.986 45.615  1.00 35.71 ? 194 VAL D CB    1 
ATOM   7837 C  CG1   . VAL D 1 196 ? -10.914 57.164 46.950  1.00 33.45 ? 194 VAL D CG1   1 
ATOM   7838 C  CG2   . VAL D 1 196 ? -10.092 55.507 45.287  1.00 32.80 ? 194 VAL D CG2   1 
ATOM   7839 N  N     . LYS D 1 197 ? -12.304 59.630 45.154  1.00 36.32 ? 195 LYS D N     1 
ATOM   7840 C  CA    . LYS D 1 197 ? -12.539 61.041 45.428  1.00 37.07 ? 195 LYS D CA    1 
ATOM   7841 C  C     . LYS D 1 197 ? -11.581 61.616 46.460  1.00 35.27 ? 195 LYS D C     1 
ATOM   7842 O  O     . LYS D 1 197 ? -11.071 62.724 46.292  1.00 35.34 ? 195 LYS D O     1 
ATOM   7843 C  CB    . LYS D 1 197 ? -13.986 61.252 45.869  1.00 40.06 ? 195 LYS D CB    1 
ATOM   7844 C  CG    . LYS D 1 197 ? -15.002 60.787 44.836  1.00 45.60 ? 195 LYS D CG    1 
ATOM   7845 C  CD    . LYS D 1 197 ? -14.648 61.287 43.433  1.00 49.48 ? 195 LYS D CD    1 
ATOM   7846 C  CE    . LYS D 1 197 ? -15.781 61.023 42.438  1.00 52.23 ? 195 LYS D CE    1 
ATOM   7847 N  NZ    . LYS D 1 197 ? -15.402 61.351 41.027  1.00 53.45 ? 195 LYS D NZ    1 
ATOM   7848 N  N     . THR D 1 198 ? -11.342 60.875 47.532  1.00 32.13 ? 196 THR D N     1 
ATOM   7849 C  CA    . THR D 1 198 ? -10.411 61.333 48.549  1.00 30.89 ? 196 THR D CA    1 
ATOM   7850 C  C     . THR D 1 198 ? -9.384  60.245 48.813  1.00 29.44 ? 196 THR D C     1 
ATOM   7851 O  O     . THR D 1 198 ? -9.733  59.123 49.191  1.00 27.33 ? 196 THR D O     1 
ATOM   7852 C  CB    . THR D 1 198 ? -11.108 61.676 49.879  1.00 30.17 ? 196 THR D CB    1 
ATOM   7853 O  OG1   . THR D 1 198 ? -12.002 62.777 49.683  1.00 31.86 ? 196 THR D OG1   1 
ATOM   7854 C  CG2   . THR D 1 198 ? -10.075 62.065 50.934  1.00 30.36 ? 196 THR D CG2   1 
ATOM   7855 N  N     . LEU D 1 199 ? -8.120  60.580 48.576  1.00 27.15 ? 197 LEU D N     1 
ATOM   7856 C  CA    . LEU D 1 199 ? -7.024  59.652 48.810  1.00 26.58 ? 197 LEU D CA    1 
ATOM   7857 C  C     . LEU D 1 199 ? -6.021  60.309 49.739  1.00 26.29 ? 197 LEU D C     1 
ATOM   7858 O  O     . LEU D 1 199 ? -5.564  61.420 49.488  1.00 27.06 ? 197 LEU D O     1 
ATOM   7859 C  CB    . LEU D 1 199 ? -6.319  59.281 47.499  1.00 27.22 ? 197 LEU D CB    1 
ATOM   7860 C  CG    . LEU D 1 199 ? -4.989  58.528 47.669  1.00 25.97 ? 197 LEU D CG    1 
ATOM   7861 C  CD1   . LEU D 1 199 ? -5.247  57.140 48.234  1.00 23.72 ? 197 LEU D CD1   1 
ATOM   7862 C  CD2   . LEU D 1 199 ? -4.273  58.426 46.320  1.00 26.07 ? 197 LEU D CD2   1 
ATOM   7863 N  N     . VAL D 1 200 ? -5.690  59.627 50.826  1.00 26.81 ? 198 VAL D N     1 
ATOM   7864 C  CA    . VAL D 1 200 ? -4.714  60.146 51.767  1.00 25.10 ? 198 VAL D CA    1 
ATOM   7865 C  C     . VAL D 1 200 ? -3.578  59.139 51.815  1.00 25.13 ? 198 VAL D C     1 
ATOM   7866 O  O     . VAL D 1 200 ? -3.810  57.943 51.955  1.00 23.88 ? 198 VAL D O     1 
ATOM   7867 C  CB    . VAL D 1 200 ? -5.318  60.317 53.179  1.00 25.66 ? 198 VAL D CB    1 
ATOM   7868 C  CG1   . VAL D 1 200 ? -4.230  60.712 54.171  1.00 26.86 ? 198 VAL D CG1   1 
ATOM   7869 C  CG2   . VAL D 1 200 ? -6.402  61.384 53.146  1.00 26.64 ? 198 VAL D CG2   1 
ATOM   7870 N  N     . ILE D 1 201 ? -2.351  59.626 51.668  1.00 26.17 ? 199 ILE D N     1 
ATOM   7871 C  CA    . ILE D 1 201 ? -1.178  58.760 51.698  1.00 25.87 ? 199 ILE D CA    1 
ATOM   7872 C  C     . ILE D 1 201 ? -0.303  59.195 52.858  1.00 25.33 ? 199 ILE D C     1 
ATOM   7873 O  O     . ILE D 1 201 ? 0.264   60.285 52.832  1.00 25.44 ? 199 ILE D O     1 
ATOM   7874 C  CB    . ILE D 1 201 ? -0.368  58.871 50.385  1.00 25.68 ? 199 ILE D CB    1 
ATOM   7875 C  CG1   . ILE D 1 201 ? -1.247  58.454 49.202  1.00 27.25 ? 199 ILE D CG1   1 
ATOM   7876 C  CG2   . ILE D 1 201 ? 0.876   57.981 50.455  1.00 23.80 ? 199 ILE D CG2   1 
ATOM   7877 C  CD1   . ILE D 1 201 ? -0.566  58.578 47.861  1.00 28.25 ? 199 ILE D CD1   1 
ATOM   7878 N  N     . THR D 1 202 ? -0.202  58.346 53.880  1.00 26.28 ? 200 THR D N     1 
ATOM   7879 C  CA    . THR D 1 202 ? 0.597   58.659 55.058  1.00 25.41 ? 200 THR D CA    1 
ATOM   7880 C  C     . THR D 1 202 ? 2.027   58.165 54.895  1.00 26.49 ? 200 THR D C     1 
ATOM   7881 O  O     . THR D 1 202 ? 2.269   57.103 54.314  1.00 25.33 ? 200 THR D O     1 
ATOM   7882 C  CB    . THR D 1 202 ? -0.009  58.026 56.346  1.00 25.98 ? 200 THR D CB    1 
ATOM   7883 O  OG1   . THR D 1 202 ? 0.077   56.596 56.270  1.00 24.17 ? 200 THR D OG1   1 
ATOM   7884 C  CG2   . THR D 1 202 ? -1.468  58.440 56.504  1.00 24.93 ? 200 THR D CG2   1 
ATOM   7885 N  N     . GLN D 1 203 ? 2.972   58.944 55.413  1.00 26.71 ? 201 GLN D N     1 
ATOM   7886 C  CA    . GLN D 1 203 ? 4.382   58.600 55.316  1.00 29.91 ? 201 GLN D CA    1 
ATOM   7887 C  C     . GLN D 1 203 ? 5.130   58.778 56.636  1.00 29.55 ? 201 GLN D C     1 
ATOM   7888 O  O     . GLN D 1 203 ? 6.191   59.396 56.687  1.00 29.54 ? 201 GLN D O     1 
ATOM   7889 C  CB    . GLN D 1 203 ? 5.040   59.436 54.212  1.00 28.45 ? 201 GLN D CB    1 
ATOM   7890 C  CG    . GLN D 1 203 ? 4.530   59.091 52.819  1.00 33.23 ? 201 GLN D CG    1 
ATOM   7891 C  CD    . GLN D 1 203 ? 5.276   59.827 51.726  1.00 33.88 ? 201 GLN D CD    1 
ATOM   7892 O  OE1   . GLN D 1 203 ? 4.826   60.860 51.238  1.00 35.12 ? 201 GLN D OE1   1 
ATOM   7893 N  NE2   . GLN D 1 203 ? 6.436   59.300 51.348  1.00 36.15 ? 201 GLN D NE2   1 
ATOM   7894 N  N     . GLY D 1 204 ? 4.563   58.227 57.702  1.00 30.20 ? 202 GLY D N     1 
ATOM   7895 C  CA    . GLY D 1 204 ? 5.185   58.317 59.008  1.00 30.50 ? 202 GLY D CA    1 
ATOM   7896 C  C     . GLY D 1 204 ? 5.618   59.712 59.417  1.00 31.61 ? 202 GLY D C     1 
ATOM   7897 O  O     . GLY D 1 204 ? 4.878   60.684 59.251  1.00 29.54 ? 202 GLY D O     1 
ATOM   7898 N  N     . ALA D 1 205 ? 6.831   59.805 59.954  1.00 31.69 ? 203 ALA D N     1 
ATOM   7899 C  CA    . ALA D 1 205 ? 7.381   61.079 60.405  1.00 32.81 ? 203 ALA D CA    1 
ATOM   7900 C  C     . ALA D 1 205 ? 7.528   62.065 59.249  1.00 33.69 ? 203 ALA D C     1 
ATOM   7901 O  O     . ALA D 1 205 ? 7.757   63.253 59.466  1.00 35.55 ? 203 ALA D O     1 
ATOM   7902 C  CB    . ALA D 1 205 ? 8.735   60.849 61.078  1.00 32.12 ? 203 ALA D CB    1 
ATOM   7903 N  N     . ALA D 1 206 ? 7.381   61.567 58.025  1.00 33.82 ? 204 ALA D N     1 
ATOM   7904 C  CA    . ALA D 1 206 ? 7.504   62.399 56.831  1.00 34.72 ? 204 ALA D CA    1 
ATOM   7905 C  C     . ALA D 1 206 ? 6.183   63.021 56.373  1.00 36.20 ? 204 ALA D C     1 
ATOM   7906 O  O     . ALA D 1 206 ? 6.050   63.416 55.209  1.00 38.05 ? 204 ALA D O     1 
ATOM   7907 C  CB    . ALA D 1 206 ? 8.105   61.582 55.695  1.00 36.13 ? 204 ALA D CB    1 
ATOM   7908 N  N     . GLY D 1 207 ? 5.213   63.104 57.279  1.00 32.71 ? 205 GLY D N     1 
ATOM   7909 C  CA    . GLY D 1 207 ? 3.933   63.701 56.938  1.00 31.02 ? 205 GLY D CA    1 
ATOM   7910 C  C     . GLY D 1 207 ? 2.933   62.815 56.216  1.00 29.28 ? 205 GLY D C     1 
ATOM   7911 O  O     . GLY D 1 207 ? 2.931   61.591 56.365  1.00 28.68 ? 205 GLY D O     1 
ATOM   7912 N  N     . ALA D 1 208 ? 2.073   63.447 55.422  1.00 28.67 ? 206 ALA D N     1 
ATOM   7913 C  CA    . ALA D 1 208 ? 1.045   62.728 54.678  1.00 26.15 ? 206 ALA D CA    1 
ATOM   7914 C  C     . ALA D 1 208 ? 0.494   63.605 53.562  1.00 26.74 ? 206 ALA D C     1 
ATOM   7915 O  O     . ALA D 1 208 ? 0.523   64.830 53.653  1.00 27.66 ? 206 ALA D O     1 
ATOM   7916 C  CB    . ALA D 1 208 ? -0.081  62.319 55.621  1.00 24.88 ? 206 ALA D CB    1 
ATOM   7917 N  N     . TRP D 1 209 ? -0.016  62.971 52.516  1.00 27.49 ? 207 TRP D N     1 
ATOM   7918 C  CA    . TRP D 1 209 ? -0.577  63.694 51.382  1.00 27.81 ? 207 TRP D CA    1 
ATOM   7919 C  C     . TRP D 1 209 ? -2.093  63.559 51.280  1.00 29.34 ? 207 TRP D C     1 
ATOM   7920 O  O     . TRP D 1 209 ? -2.661  62.541 51.675  1.00 27.26 ? 207 TRP D O     1 
ATOM   7921 C  CB    . TRP D 1 209 ? -0.004  63.156 50.074  1.00 28.38 ? 207 TRP D CB    1 
ATOM   7922 C  CG    . TRP D 1 209 ? 1.438   63.401 49.844  1.00 29.28 ? 207 TRP D CG    1 
ATOM   7923 C  CD1   . TRP D 1 209 ? 2.485   62.610 50.230  1.00 26.81 ? 207 TRP D CD1   1 
ATOM   7924 C  CD2   . TRP D 1 209 ? 2.003   64.486 49.104  1.00 30.08 ? 207 TRP D CD2   1 
ATOM   7925 N  NE1   . TRP D 1 209 ? 3.666   63.132 49.764  1.00 27.96 ? 207 TRP D NE1   1 
ATOM   7926 C  CE2   . TRP D 1 209 ? 3.399   64.286 49.070  1.00 29.59 ? 207 TRP D CE2   1 
ATOM   7927 C  CE3   . TRP D 1 209 ? 1.462   65.609 48.461  1.00 31.00 ? 207 TRP D CE3   1 
ATOM   7928 C  CZ2   . TRP D 1 209 ? 4.267   65.169 48.415  1.00 31.61 ? 207 TRP D CZ2   1 
ATOM   7929 C  CZ3   . TRP D 1 209 ? 2.325   66.487 47.808  1.00 32.86 ? 207 TRP D CZ3   1 
ATOM   7930 C  CH2   . TRP D 1 209 ? 3.713   66.259 47.792  1.00 32.20 ? 207 TRP D CH2   1 
ATOM   7931 N  N     . LEU D 1 210 ? -2.735  64.591 50.734  1.00 29.92 ? 208 LEU D N     1 
ATOM   7932 C  CA    . LEU D 1 210 ? -4.172  64.578 50.484  1.00 30.97 ? 208 LEU D CA    1 
ATOM   7933 C  C     . LEU D 1 210 ? -4.298  64.754 48.973  1.00 33.78 ? 208 LEU D C     1 
ATOM   7934 O  O     . LEU D 1 210 ? -3.860  65.769 48.421  1.00 33.27 ? 208 LEU D O     1 
ATOM   7935 C  CB    . LEU D 1 210 ? -4.892  65.727 51.186  1.00 30.51 ? 208 LEU D CB    1 
ATOM   7936 C  CG    . LEU D 1 210 ? -6.340  65.897 50.693  1.00 28.85 ? 208 LEU D CG    1 
ATOM   7937 C  CD1   . LEU D 1 210 ? -7.130  64.615 50.953  1.00 28.04 ? 208 LEU D CD1   1 
ATOM   7938 C  CD2   . LEU D 1 210 ? -6.992  67.084 51.393  1.00 31.72 ? 208 LEU D CD2   1 
ATOM   7939 N  N     . VAL D 1 211 ? -4.887  63.763 48.313  1.00 34.55 ? 209 VAL D N     1 
ATOM   7940 C  CA    . VAL D 1 211 ? -5.041  63.779 46.868  1.00 37.51 ? 209 VAL D CA    1 
ATOM   7941 C  C     . VAL D 1 211 ? -6.514  63.698 46.485  1.00 40.84 ? 209 VAL D C     1 
ATOM   7942 O  O     . VAL D 1 211 ? -7.204  62.743 46.835  1.00 39.79 ? 209 VAL D O     1 
ATOM   7943 C  CB    . VAL D 1 211 ? -4.288  62.586 46.233  1.00 38.01 ? 209 VAL D CB    1 
ATOM   7944 C  CG1   . VAL D 1 211 ? -4.389  62.642 44.716  1.00 38.10 ? 209 VAL D CG1   1 
ATOM   7945 C  CG2   . VAL D 1 211 ? -2.836  62.602 46.674  1.00 38.21 ? 209 VAL D CG2   1 
ATOM   7946 N  N     . GLN D 1 212 ? -6.992  64.704 45.761  1.00 44.26 ? 210 GLN D N     1 
ATOM   7947 C  CA    . GLN D 1 212 ? -8.387  64.727 45.347  1.00 48.76 ? 210 GLN D CA    1 
ATOM   7948 C  C     . GLN D 1 212 ? -8.532  64.923 43.838  1.00 51.88 ? 210 GLN D C     1 
ATOM   7949 O  O     . GLN D 1 212 ? -7.998  64.127 43.060  1.00 52.96 ? 210 GLN D O     1 
ATOM   7950 C  CB    . GLN D 1 212 ? -9.126  65.807 46.136  1.00 48.13 ? 210 GLN D CB    1 
ATOM   7951 C  CG    . GLN D 1 212 ? -9.032  65.570 47.638  1.00 49.11 ? 210 GLN D CG    1 
ATOM   7952 C  CD    . GLN D 1 212 ? -9.875  66.521 48.456  1.00 50.94 ? 210 GLN D CD    1 
ATOM   7953 O  OE1   . GLN D 1 212 ? -9.721  67.738 48.367  1.00 52.78 ? 210 GLN D OE1   1 
ATOM   7954 N  NE2   . GLN D 1 212 ? -10.772 65.968 49.270  1.00 51.39 ? 210 GLN D NE2   1 
ATOM   7955 N  N     . GLU D 1 213 ? -9.252  65.957 43.412  1.00 54.86 ? 211 GLU D N     1 
ATOM   7956 C  CA    . GLU D 1 213 ? -9.421  66.193 41.979  1.00 57.22 ? 211 GLU D CA    1 
ATOM   7957 C  C     . GLU D 1 213 ? -8.109  66.673 41.375  1.00 56.45 ? 211 GLU D C     1 
ATOM   7958 O  O     . GLU D 1 213 ? -8.012  67.803 40.898  1.00 56.96 ? 211 GLU D O     1 
ATOM   7959 C  CB    . GLU D 1 213 ? -10.506 67.240 41.715  1.00 59.86 ? 211 GLU D CB    1 
ATOM   7960 C  CG    . GLU D 1 213 ? -11.865 66.920 42.312  1.00 63.57 ? 211 GLU D CG    1 
ATOM   7961 C  CD    . GLU D 1 213 ? -12.958 67.823 41.767  1.00 66.24 ? 211 GLU D CD    1 
ATOM   7962 O  OE1   . GLU D 1 213 ? -13.522 67.502 40.695  1.00 66.91 ? 211 GLU D OE1   1 
ATOM   7963 O  OE2   . GLU D 1 213 ? -13.241 68.862 42.403  1.00 67.16 ? 211 GLU D OE2   1 
ATOM   7964 N  N     . GLY D 1 214 ? -7.100  65.810 41.405  1.00 55.78 ? 212 GLY D N     1 
ATOM   7965 C  CA    . GLY D 1 214 ? -5.804  66.172 40.861  1.00 54.11 ? 212 GLY D CA    1 
ATOM   7966 C  C     . GLY D 1 214 ? -5.010  67.070 41.791  1.00 52.08 ? 212 GLY D C     1 
ATOM   7967 O  O     . GLY D 1 214 ? -3.790  67.180 41.656  1.00 53.25 ? 212 GLY D O     1 
ATOM   7968 N  N     . GLN D 1 215 ? -5.694  67.717 42.731  1.00 48.83 ? 213 GLN D N     1 
ATOM   7969 C  CA    . GLN D 1 215 ? -5.032  68.599 43.687  1.00 45.70 ? 213 GLN D CA    1 
ATOM   7970 C  C     . GLN D 1 215 ? -4.216  67.800 44.702  1.00 43.73 ? 213 GLN D C     1 
ATOM   7971 O  O     . GLN D 1 215 ? -4.682  66.791 45.232  1.00 41.29 ? 213 GLN D O     1 
ATOM   7972 C  CB    . GLN D 1 215 ? -6.063  69.455 44.426  1.00 46.47 ? 213 GLN D CB    1 
ATOM   7973 C  CG    . GLN D 1 215 ? -6.734  70.510 43.570  1.00 48.20 ? 213 GLN D CG    1 
ATOM   7974 C  CD    . GLN D 1 215 ? -5.737  71.450 42.922  1.00 49.00 ? 213 GLN D CD    1 
ATOM   7975 O  OE1   . GLN D 1 215 ? -5.073  71.093 41.950  1.00 50.60 ? 213 GLN D OE1   1 
ATOM   7976 N  NE2   . GLN D 1 215 ? -5.618  72.655 43.468  1.00 49.60 ? 213 GLN D NE2   1 
ATOM   7977 N  N     . ARG D 1 216 ? -2.998  68.257 44.967  1.00 41.17 ? 214 ARG D N     1 
ATOM   7978 C  CA    . ARG D 1 216 ? -2.124  67.586 45.920  1.00 40.31 ? 214 ARG D CA    1 
ATOM   7979 C  C     . ARG D 1 216 ? -1.737  68.537 47.040  1.00 39.64 ? 214 ARG D C     1 
ATOM   7980 O  O     . ARG D 1 216 ? -1.241  69.636 46.787  1.00 39.78 ? 214 ARG D O     1 
ATOM   7981 C  CB    . ARG D 1 216 ? -0.850  67.090 45.231  1.00 40.43 ? 214 ARG D CB    1 
ATOM   7982 C  CG    . ARG D 1 216 ? -1.089  66.179 44.044  1.00 41.13 ? 214 ARG D CG    1 
ATOM   7983 C  CD    . ARG D 1 216 ? 0.206   65.518 43.586  1.00 41.96 ? 214 ARG D CD    1 
ATOM   7984 N  NE    . ARG D 1 216 ? 0.057   64.904 42.271  1.00 42.28 ? 214 ARG D NE    1 
ATOM   7985 C  CZ    . ARG D 1 216 ? -0.008  65.594 41.135  1.00 43.58 ? 214 ARG D CZ    1 
ATOM   7986 N  NH1   . ARG D 1 216 ? 0.073   66.920 41.153  1.00 44.29 ? 214 ARG D NH1   1 
ATOM   7987 N  NH2   . ARG D 1 216 ? -0.171  64.962 39.983  1.00 44.78 ? 214 ARG D NH2   1 
ATOM   7988 N  N     . GLN D 1 217 ? -1.968  68.112 48.277  1.00 38.16 ? 215 GLN D N     1 
ATOM   7989 C  CA    . GLN D 1 217 ? -1.627  68.920 49.437  1.00 37.71 ? 215 GLN D CA    1 
ATOM   7990 C  C     . GLN D 1 217 ? -0.814  68.075 50.406  1.00 37.08 ? 215 GLN D C     1 
ATOM   7991 O  O     . GLN D 1 217 ? -1.206  66.967 50.758  1.00 36.29 ? 215 GLN D O     1 
ATOM   7992 C  CB    . GLN D 1 217 ? -2.894  69.424 50.121  1.00 39.64 ? 215 GLN D CB    1 
ATOM   7993 C  CG    . GLN D 1 217 ? -3.797  70.234 49.205  1.00 43.58 ? 215 GLN D CG    1 
ATOM   7994 C  CD    . GLN D 1 217 ? -5.097  70.625 49.875  1.00 43.60 ? 215 GLN D CD    1 
ATOM   7995 O  OE1   . GLN D 1 217 ? -5.098  71.281 50.916  1.00 45.82 ? 215 GLN D OE1   1 
ATOM   7996 N  NE2   . GLN D 1 217 ? -6.215  70.224 49.280  1.00 44.71 ? 215 GLN D NE2   1 
ATOM   7997 N  N     . PHE D 1 218 ? 0.329   68.596 50.829  1.00 36.65 ? 216 PHE D N     1 
ATOM   7998 C  CA    . PHE D 1 218 ? 1.174   67.864 51.750  1.00 36.99 ? 216 PHE D CA    1 
ATOM   7999 C  C     . PHE D 1 218 ? 1.004   68.391 53.163  1.00 37.57 ? 216 PHE D C     1 
ATOM   8000 O  O     . PHE D 1 218 ? 0.933   69.604 53.374  1.00 37.35 ? 216 PHE D O     1 
ATOM   8001 C  CB    . PHE D 1 218 ? 2.640   67.976 51.334  1.00 37.43 ? 216 PHE D CB    1 
ATOM   8002 C  CG    . PHE D 1 218 ? 3.581   67.289 52.277  1.00 38.19 ? 216 PHE D CG    1 
ATOM   8003 C  CD1   . PHE D 1 218 ? 3.596   65.901 52.376  1.00 37.42 ? 216 PHE D CD1   1 
ATOM   8004 C  CD2   . PHE D 1 218 ? 4.426   68.028 53.093  1.00 39.14 ? 216 PHE D CD2   1 
ATOM   8005 C  CE1   . PHE D 1 218 ? 4.437   65.260 53.275  1.00 39.06 ? 216 PHE D CE1   1 
ATOM   8006 C  CE2   . PHE D 1 218 ? 5.272   67.396 53.997  1.00 39.73 ? 216 PHE D CE2   1 
ATOM   8007 C  CZ    . PHE D 1 218 ? 5.276   66.006 54.087  1.00 38.82 ? 216 PHE D CZ    1 
ATOM   8008 N  N     . CYS D 1 219 ? 0.934   67.476 54.127  1.00 37.03 ? 217 CYS D N     1 
ATOM   8009 C  CA    . CYS D 1 219 ? 0.779   67.854 55.526  1.00 37.78 ? 217 CYS D CA    1 
ATOM   8010 C  C     . CYS D 1 219 ? 1.943   67.351 56.372  1.00 38.78 ? 217 CYS D C     1 
ATOM   8011 O  O     . CYS D 1 219 ? 2.070   66.153 56.626  1.00 38.47 ? 217 CYS D O     1 
ATOM   8012 C  CB    . CYS D 1 219 ? -0.526  67.299 56.093  1.00 39.17 ? 217 CYS D CB    1 
ATOM   8013 S  SG    . CYS D 1 219 ? -0.777  67.734 57.830  1.00 42.22 ? 217 CYS D SG    1 
ATOM   8014 N  N     . PRO D 1 220 ? 2.810   68.268 56.824  1.00 39.31 ? 218 PRO D N     1 
ATOM   8015 C  CA    . PRO D 1 220 ? 3.968   67.909 57.646  1.00 39.31 ? 218 PRO D CA    1 
ATOM   8016 C  C     . PRO D 1 220 ? 3.543   67.214 58.931  1.00 39.75 ? 218 PRO D C     1 
ATOM   8017 O  O     . PRO D 1 220 ? 2.497   67.530 59.499  1.00 39.06 ? 218 PRO D O     1 
ATOM   8018 C  CB    . PRO D 1 220 ? 4.622   69.260 57.927  1.00 39.38 ? 218 PRO D CB    1 
ATOM   8019 C  CG    . PRO D 1 220 ? 4.243   70.078 56.742  1.00 39.78 ? 218 PRO D CG    1 
ATOM   8020 C  CD    . PRO D 1 220 ? 2.791   69.716 56.563  1.00 40.25 ? 218 PRO D CD    1 
ATOM   8021 N  N     . ALA D 1 221 ? 4.354   66.269 59.391  1.00 39.68 ? 219 ALA D N     1 
ATOM   8022 C  CA    . ALA D 1 221 ? 4.046   65.559 60.622  1.00 40.00 ? 219 ALA D CA    1 
ATOM   8023 C  C     . ALA D 1 221 ? 4.377   66.477 61.794  1.00 41.12 ? 219 ALA D C     1 
ATOM   8024 O  O     . ALA D 1 221 ? 5.134   67.435 61.647  1.00 41.05 ? 219 ALA D O     1 
ATOM   8025 C  CB    . ALA D 1 221 ? 4.867   64.278 60.708  1.00 40.56 ? 219 ALA D CB    1 
ATOM   8026 N  N     . VAL D 1 222 ? 3.796   66.192 62.950  1.00 41.35 ? 220 VAL D N     1 
ATOM   8027 C  CA    . VAL D 1 222 ? 4.056   66.987 64.139  1.00 43.14 ? 220 VAL D CA    1 
ATOM   8028 C  C     . VAL D 1 222 ? 5.240   66.370 64.871  1.00 44.56 ? 220 VAL D C     1 
ATOM   8029 O  O     . VAL D 1 222 ? 5.154   65.249 65.376  1.00 43.47 ? 220 VAL D O     1 
ATOM   8030 C  CB    . VAL D 1 222 ? 2.834   67.009 65.081  1.00 43.09 ? 220 VAL D CB    1 
ATOM   8031 C  CG1   . VAL D 1 222 ? 3.221   67.608 66.431  1.00 43.63 ? 220 VAL D CG1   1 
ATOM   8032 C  CG2   . VAL D 1 222 ? 1.709   67.821 64.446  1.00 43.81 ? 220 VAL D CG2   1 
ATOM   8033 N  N     . PRO D 1 223 ? 6.369   67.095 64.930  1.00 46.73 ? 221 PRO D N     1 
ATOM   8034 C  CA    . PRO D 1 223 ? 7.581   66.618 65.601  1.00 48.66 ? 221 PRO D CA    1 
ATOM   8035 C  C     . PRO D 1 223 ? 7.256   65.983 66.948  1.00 50.53 ? 221 PRO D C     1 
ATOM   8036 O  O     . PRO D 1 223 ? 6.718   66.641 67.841  1.00 51.29 ? 221 PRO D O     1 
ATOM   8037 C  CB    . PRO D 1 223 ? 8.415   67.888 65.736  1.00 48.84 ? 221 PRO D CB    1 
ATOM   8038 C  CG    . PRO D 1 223 ? 8.053   68.640 64.494  1.00 48.63 ? 221 PRO D CG    1 
ATOM   8039 C  CD    . PRO D 1 223 ? 6.549   68.475 64.443  1.00 47.22 ? 221 PRO D CD    1 
ATOM   8040 N  N     . ALA D 1 224 ? 7.571   64.700 67.090  1.00 51.71 ? 222 ALA D N     1 
ATOM   8041 C  CA    . ALA D 1 224 ? 7.294   63.993 68.334  1.00 52.96 ? 222 ALA D CA    1 
ATOM   8042 C  C     . ALA D 1 224 ? 8.473   63.132 68.748  1.00 53.98 ? 222 ALA D C     1 
ATOM   8043 O  O     . ALA D 1 224 ? 9.264   62.706 67.906  1.00 54.16 ? 222 ALA D O     1 
ATOM   8044 C  CB    . ALA D 1 224 ? 6.049   63.127 68.177  1.00 52.44 ? 222 ALA D CB    1 
ATOM   8045 N  N     . GLU D 1 225 ? 8.584   62.874 70.048  1.00 55.16 ? 223 GLU D N     1 
ATOM   8046 C  CA    . GLU D 1 225 ? 9.671   62.058 70.560  1.00 56.63 ? 223 GLU D CA    1 
ATOM   8047 C  C     . GLU D 1 225 ? 9.709   60.767 69.757  1.00 56.07 ? 223 GLU D C     1 
ATOM   8048 O  O     . GLU D 1 225 ? 10.544  60.617 68.865  1.00 58.12 ? 223 GLU D O     1 
ATOM   8049 C  CB    . GLU D 1 225 ? 9.462   61.742 72.045  1.00 59.14 ? 223 GLU D CB    1 
ATOM   8050 C  CG    . GLU D 1 225 ? 10.713  61.941 72.897  1.00 61.85 ? 223 GLU D CG    1 
ATOM   8051 C  CD    . GLU D 1 225 ? 10.629  63.173 73.789  1.00 63.83 ? 223 GLU D CD    1 
ATOM   8052 O  OE1   . GLU D 1 225 ? 10.108  63.058 74.922  1.00 64.45 ? 223 GLU D OE1   1 
ATOM   8053 O  OE2   . GLU D 1 225 ? 11.076  64.256 73.353  1.00 64.75 ? 223 GLU D OE2   1 
ATOM   8054 N  N     . ALA D 1 226 ? 8.788   59.858 70.077  1.00 54.62 ? 224 ALA D N     1 
ATOM   8055 C  CA    . ALA D 1 226 ? 8.647   58.548 69.428  1.00 51.42 ? 224 ALA D CA    1 
ATOM   8056 C  C     . ALA D 1 226 ? 9.077   57.442 70.374  1.00 50.03 ? 224 ALA D C     1 
ATOM   8057 O  O     . ALA D 1 226 ? 10.236  57.022 70.382  1.00 50.73 ? 224 ALA D O     1 
ATOM   8058 C  CB    . ALA D 1 226 ? 9.457   58.473 68.141  1.00 50.57 ? 224 ALA D CB    1 
ATOM   8059 N  N     . LEU D 1 227 ? 8.127   56.973 71.171  1.00 47.11 ? 225 LEU D N     1 
ATOM   8060 C  CA    . LEU D 1 227 ? 8.381   55.924 72.142  1.00 44.54 ? 225 LEU D CA    1 
ATOM   8061 C  C     . LEU D 1 227 ? 7.823   54.600 71.625  1.00 42.33 ? 225 LEU D C     1 
ATOM   8062 O  O     . LEU D 1 227 ? 8.443   53.549 71.777  1.00 40.75 ? 225 LEU D O     1 
ATOM   8063 C  CB    . LEU D 1 227 ? 7.708   56.291 73.467  1.00 46.57 ? 225 LEU D CB    1 
ATOM   8064 C  CG    . LEU D 1 227 ? 8.396   55.870 74.764  1.00 48.57 ? 225 LEU D CG    1 
ATOM   8065 C  CD1   . LEU D 1 227 ? 7.514   56.256 75.943  1.00 48.82 ? 225 LEU D CD1   1 
ATOM   8066 C  CD2   . LEU D 1 227 ? 8.660   54.376 74.752  1.00 49.54 ? 225 LEU D CD2   1 
ATOM   8067 N  N     . ASP D 1 228 ? 6.645   54.667 71.011  1.00 38.61 ? 226 ASP D N     1 
ATOM   8068 C  CA    . ASP D 1 228 ? 5.977   53.486 70.467  1.00 36.10 ? 226 ASP D CA    1 
ATOM   8069 C  C     . ASP D 1 228 ? 5.033   53.953 69.360  1.00 33.59 ? 226 ASP D C     1 
ATOM   8070 O  O     . ASP D 1 228 ? 4.056   54.647 69.625  1.00 32.03 ? 226 ASP D O     1 
ATOM   8071 C  CB    . ASP D 1 228 ? 5.187   52.778 71.573  1.00 36.41 ? 226 ASP D CB    1 
ATOM   8072 C  CG    . ASP D 1 228 ? 4.589   51.462 71.114  1.00 37.90 ? 226 ASP D CG    1 
ATOM   8073 O  OD1   . ASP D 1 228 ? 4.681   51.163 69.904  1.00 36.89 ? 226 ASP D OD1   1 
ATOM   8074 O  OD2   . ASP D 1 228 ? 4.020   50.731 71.959  1.00 37.09 ? 226 ASP D OD2   1 
ATOM   8075 N  N     . THR D 1 229 ? 5.339   53.577 68.121  1.00 32.12 ? 227 THR D N     1 
ATOM   8076 C  CA    . THR D 1 229 ? 4.538   53.977 66.966  1.00 31.44 ? 227 THR D CA    1 
ATOM   8077 C  C     . THR D 1 229 ? 3.277   53.160 66.709  1.00 30.45 ? 227 THR D C     1 
ATOM   8078 O  O     . THR D 1 229 ? 2.530   53.462 65.783  1.00 30.75 ? 227 THR D O     1 
ATOM   8079 C  CB    . THR D 1 229 ? 5.367   53.929 65.670  1.00 31.22 ? 227 THR D CB    1 
ATOM   8080 O  OG1   . THR D 1 229 ? 5.867   52.601 65.485  1.00 30.94 ? 227 THR D OG1   1 
ATOM   8081 C  CG2   . THR D 1 229 ? 6.523   54.913 65.730  1.00 30.80 ? 227 THR D CG2   1 
ATOM   8082 N  N     . THR D 1 230 ? 3.036   52.122 67.500  1.00 30.28 ? 228 THR D N     1 
ATOM   8083 C  CA    . THR D 1 230 ? 1.845   51.309 67.288  1.00 27.89 ? 228 THR D CA    1 
ATOM   8084 C  C     . THR D 1 230 ? 0.576   52.161 67.348  1.00 27.87 ? 228 THR D C     1 
ATOM   8085 O  O     . THR D 1 230 ? 0.428   53.013 68.226  1.00 26.34 ? 228 THR D O     1 
ATOM   8086 C  CB    . THR D 1 230 ? 1.736   50.174 68.333  1.00 29.22 ? 228 THR D CB    1 
ATOM   8087 O  OG1   . THR D 1 230 ? 2.930   49.379 68.307  1.00 28.66 ? 228 THR D OG1   1 
ATOM   8088 C  CG2   . THR D 1 230 ? 0.553   49.276 68.011  1.00 27.96 ? 228 THR D CG2   1 
ATOM   8089 N  N     . GLY D 1 231 ? -0.325  51.945 66.393  1.00 25.56 ? 229 GLY D N     1 
ATOM   8090 C  CA    . GLY D 1 231 ? -1.575  52.686 66.373  1.00 25.81 ? 229 GLY D CA    1 
ATOM   8091 C  C     . GLY D 1 231 ? -1.535  54.095 65.801  1.00 25.42 ? 229 GLY D C     1 
ATOM   8092 O  O     . GLY D 1 231 ? -2.561  54.772 65.777  1.00 26.20 ? 229 GLY D O     1 
ATOM   8093 N  N     . ALA D 1 232 ? -0.375  54.545 65.338  1.00 24.27 ? 230 ALA D N     1 
ATOM   8094 C  CA    . ALA D 1 232 ? -0.260  55.895 64.780  1.00 26.06 ? 230 ALA D CA    1 
ATOM   8095 C  C     . ALA D 1 232 ? -1.162  56.089 63.565  1.00 25.21 ? 230 ALA D C     1 
ATOM   8096 O  O     . ALA D 1 232 ? -1.854  57.098 63.454  1.00 25.76 ? 230 ALA D O     1 
ATOM   8097 C  CB    . ALA D 1 232 ? 1.186   56.191 64.401  1.00 26.36 ? 230 ALA D CB    1 
ATOM   8098 N  N     . GLY D 1 233 ? -1.146  55.123 62.653  1.00 25.81 ? 231 GLY D N     1 
ATOM   8099 C  CA    . GLY D 1 233 ? -1.974  55.220 61.460  1.00 25.00 ? 231 GLY D CA    1 
ATOM   8100 C  C     . GLY D 1 233 ? -3.453  55.195 61.780  1.00 24.13 ? 231 GLY D C     1 
ATOM   8101 O  O     . GLY D 1 233 ? -4.254  55.895 61.149  1.00 23.67 ? 231 GLY D O     1 
ATOM   8102 N  N     . ASP D 1 234 ? -3.830  54.384 62.765  1.00 23.23 ? 232 ASP D N     1 
ATOM   8103 C  CA    . ASP D 1 234 ? -5.232  54.285 63.150  1.00 23.09 ? 232 ASP D CA    1 
ATOM   8104 C  C     . ASP D 1 234 ? -5.685  55.587 63.794  1.00 22.80 ? 232 ASP D C     1 
ATOM   8105 O  O     . ASP D 1 234 ? -6.822  56.032 63.596  1.00 19.76 ? 232 ASP D O     1 
ATOM   8106 C  CB    . ASP D 1 234 ? -5.439  53.131 64.128  1.00 26.19 ? 232 ASP D CB    1 
ATOM   8107 C  CG    . ASP D 1 234 ? -5.054  51.789 63.538  1.00 26.52 ? 232 ASP D CG    1 
ATOM   8108 O  OD1   . ASP D 1 234 ? -5.266  51.580 62.321  1.00 25.17 ? 232 ASP D OD1   1 
ATOM   8109 O  OD2   . ASP D 1 234 ? -4.558  50.936 64.302  1.00 29.11 ? 232 ASP D OD2   1 
ATOM   8110 N  N     . THR D 1 235 ? -4.790  56.194 64.570  1.00 21.15 ? 233 THR D N     1 
ATOM   8111 C  CA    . THR D 1 235 ? -5.098  57.451 65.235  1.00 21.68 ? 233 THR D CA    1 
ATOM   8112 C  C     . THR D 1 235 ? -5.297  58.524 64.175  1.00 22.09 ? 233 THR D C     1 
ATOM   8113 O  O     . THR D 1 235 ? -6.245  59.316 64.232  1.00 22.46 ? 233 THR D O     1 
ATOM   8114 C  CB    . THR D 1 235 ? -3.949  57.888 66.180  1.00 21.69 ? 233 THR D CB    1 
ATOM   8115 O  OG1   . THR D 1 235 ? -3.743  56.882 67.182  1.00 22.70 ? 233 THR D OG1   1 
ATOM   8116 C  CG2   . THR D 1 235 ? -4.289  59.204 66.859  1.00 22.22 ? 233 THR D CG2   1 
ATOM   8117 N  N     . PHE D 1 236 ? -4.401  58.526 63.195  1.00 21.22 ? 234 PHE D N     1 
ATOM   8118 C  CA    . PHE D 1 236 ? -4.447  59.500 62.112  1.00 20.53 ? 234 PHE D CA    1 
ATOM   8119 C  C     . PHE D 1 236 ? -5.751  59.428 61.332  1.00 19.66 ? 234 PHE D C     1 
ATOM   8120 O  O     . PHE D 1 236 ? -6.415  60.444 61.121  1.00 19.34 ? 234 PHE D O     1 
ATOM   8121 C  CB    . PHE D 1 236 ? -3.277  59.273 61.155  1.00 22.61 ? 234 PHE D CB    1 
ATOM   8122 C  CG    . PHE D 1 236 ? -3.112  60.364 60.135  1.00 22.88 ? 234 PHE D CG    1 
ATOM   8123 C  CD1   . PHE D 1 236 ? -2.275  61.449 60.385  1.00 24.37 ? 234 PHE D CD1   1 
ATOM   8124 C  CD2   . PHE D 1 236 ? -3.807  60.317 58.938  1.00 22.14 ? 234 PHE D CD2   1 
ATOM   8125 C  CE1   . PHE D 1 236 ? -2.133  62.480 59.444  1.00 23.74 ? 234 PHE D CE1   1 
ATOM   8126 C  CE2   . PHE D 1 236 ? -3.675  61.340 57.993  1.00 23.38 ? 234 PHE D CE2   1 
ATOM   8127 C  CZ    . PHE D 1 236 ? -2.834  62.422 58.251  1.00 24.26 ? 234 PHE D CZ    1 
ATOM   8128 N  N     . LEU D 1 237 ? -6.120  58.226 60.899  1.00 19.90 ? 235 LEU D N     1 
ATOM   8129 C  CA    . LEU D 1 237 ? -7.344  58.050 60.132  1.00 20.51 ? 235 LEU D CA    1 
ATOM   8130 C  C     . LEU D 1 237 ? -8.583  58.472 60.909  1.00 20.20 ? 235 LEU D C     1 
ATOM   8131 O  O     . LEU D 1 237 ? -9.436  59.197 60.397  1.00 20.29 ? 235 LEU D O     1 
ATOM   8132 C  CB    . LEU D 1 237 ? -7.490  56.588 59.683  1.00 21.42 ? 235 LEU D CB    1 
ATOM   8133 C  CG    . LEU D 1 237 ? -8.716  56.233 58.823  1.00 22.31 ? 235 LEU D CG    1 
ATOM   8134 C  CD1   . LEU D 1 237 ? -8.414  54.997 57.973  1.00 22.11 ? 235 LEU D CD1   1 
ATOM   8135 C  CD2   . LEU D 1 237 ? -9.934  55.983 59.708  1.00 22.22 ? 235 LEU D CD2   1 
ATOM   8136 N  N     . ALA D 1 238 ? -8.687  58.005 62.146  1.00 19.38 ? 236 ALA D N     1 
ATOM   8137 C  CA    . ALA D 1 238 ? -9.843  58.311 62.973  1.00 19.86 ? 236 ALA D CA    1 
ATOM   8138 C  C     . ALA D 1 238 ? -10.057 59.803 63.210  1.00 22.01 ? 236 ALA D C     1 
ATOM   8139 O  O     . ALA D 1 238 ? -11.173 60.315 63.049  1.00 23.35 ? 236 ALA D O     1 
ATOM   8140 C  CB    . ALA D 1 238 ? -9.725  57.581 64.315  1.00 20.17 ? 236 ALA D CB    1 
ATOM   8141 N  N     . VAL D 1 239 ? -8.990  60.494 63.596  1.00 21.90 ? 237 VAL D N     1 
ATOM   8142 C  CA    . VAL D 1 239 ? -9.056  61.921 63.890  1.00 22.86 ? 237 VAL D CA    1 
ATOM   8143 C  C     . VAL D 1 239 ? -9.291  62.765 62.641  1.00 23.31 ? 237 VAL D C     1 
ATOM   8144 O  O     . VAL D 1 239 ? -9.981  63.778 62.703  1.00 22.49 ? 237 VAL D O     1 
ATOM   8145 C  CB    . VAL D 1 239 ? -7.782  62.391 64.625  1.00 23.34 ? 237 VAL D CB    1 
ATOM   8146 C  CG1   . VAL D 1 239 ? -7.803  63.901 64.807  1.00 23.47 ? 237 VAL D CG1   1 
ATOM   8147 C  CG2   . VAL D 1 239 ? -7.700  61.712 65.990  1.00 22.87 ? 237 VAL D CG2   1 
HETATM 8148 N  N     . MSE D 1 240 ? -8.725  62.348 61.513  1.00 22.23 ? 238 MSE D N     1 
HETATM 8149 C  CA    . MSE D 1 240 ? -8.931  63.063 60.257  1.00 24.69 ? 238 MSE D CA    1 
HETATM 8150 C  C     . MSE D 1 240 ? -10.414 62.984 59.877  1.00 23.80 ? 238 MSE D C     1 
HETATM 8151 O  O     . MSE D 1 240 ? -11.009 63.959 59.420  1.00 22.49 ? 238 MSE D O     1 
HETATM 8152 C  CB    . MSE D 1 240 ? -8.118  62.425 59.134  1.00 28.28 ? 238 MSE D CB    1 
HETATM 8153 C  CG    . MSE D 1 240 ? -8.455  62.987 57.761  1.00 34.14 ? 238 MSE D CG    1 
HETATM 8154 SE SE    . MSE D 1 240 ? -8.007  61.759 56.339  1.00 48.89 ? 238 MSE D SE    1 
HETATM 8155 C  CE    . MSE D 1 240 ? -9.519  60.564 56.489  1.00 42.15 ? 238 MSE D CE    1 
ATOM   8156 N  N     . LEU D 1 241 ? -10.997 61.806 60.054  1.00 21.92 ? 239 LEU D N     1 
ATOM   8157 C  CA    . LEU D 1 241 ? -12.399 61.591 59.725  1.00 22.92 ? 239 LEU D CA    1 
ATOM   8158 C  C     . LEU D 1 241 ? -13.305 62.350 60.700  1.00 23.49 ? 239 LEU D C     1 
ATOM   8159 O  O     . LEU D 1 241 ? -14.263 63.000 60.283  1.00 23.58 ? 239 LEU D O     1 
ATOM   8160 C  CB    . LEU D 1 241 ? -12.708 60.094 59.750  1.00 23.96 ? 239 LEU D CB    1 
ATOM   8161 C  CG    . LEU D 1 241 ? -14.100 59.582 59.361  1.00 27.23 ? 239 LEU D CG    1 
ATOM   8162 C  CD1   . LEU D 1 241 ? -14.530 60.140 57.995  1.00 29.38 ? 239 LEU D CD1   1 
ATOM   8163 C  CD2   . LEU D 1 241 ? -14.054 58.063 59.315  1.00 29.59 ? 239 LEU D CD2   1 
ATOM   8164 N  N     . ALA D 1 242 ? -12.996 62.270 61.992  1.00 23.15 ? 240 ALA D N     1 
ATOM   8165 C  CA    . ALA D 1 242 ? -13.788 62.966 63.006  1.00 23.29 ? 240 ALA D CA    1 
ATOM   8166 C  C     . ALA D 1 242 ? -13.749 64.468 62.730  1.00 24.08 ? 240 ALA D C     1 
ATOM   8167 O  O     . ALA D 1 242 ? -14.769 65.161 62.801  1.00 23.47 ? 240 ALA D O     1 
ATOM   8168 C  CB    . ALA D 1 242 ? -13.236 62.675 64.409  1.00 21.35 ? 240 ALA D CB    1 
ATOM   8169 N  N     . SER D 1 243 ? -12.564 64.967 62.405  1.00 25.07 ? 241 SER D N     1 
ATOM   8170 C  CA    . SER D 1 243 ? -12.398 66.389 62.126  1.00 26.89 ? 241 SER D CA    1 
ATOM   8171 C  C     . SER D 1 243 ? -13.270 66.850 60.968  1.00 27.04 ? 241 SER D C     1 
ATOM   8172 O  O     . SER D 1 243 ? -13.936 67.885 61.057  1.00 28.20 ? 241 SER D O     1 
ATOM   8173 C  CB    . SER D 1 243 ? -10.934 66.705 61.823  1.00 28.20 ? 241 SER D CB    1 
ATOM   8174 O  OG    . SER D 1 243 ? -10.771 68.086 61.555  1.00 28.25 ? 241 SER D OG    1 
ATOM   8175 N  N     . ALA D 1 244 ? -13.265 66.088 59.881  1.00 25.67 ? 242 ALA D N     1 
ATOM   8176 C  CA    . ALA D 1 244 ? -14.067 66.436 58.718  1.00 25.61 ? 242 ALA D CA    1 
ATOM   8177 C  C     . ALA D 1 244 ? -15.544 66.344 59.071  1.00 25.91 ? 242 ALA D C     1 
ATOM   8178 O  O     . ALA D 1 244 ? -16.342 67.195 58.673  1.00 26.80 ? 242 ALA D O     1 
ATOM   8179 C  CB    . ALA D 1 244 ? -13.749 65.503 57.559  1.00 24.57 ? 242 ALA D CB    1 
ATOM   8180 N  N     . LEU D 1 245 ? -15.906 65.303 59.817  1.00 24.40 ? 243 LEU D N     1 
ATOM   8181 C  CA    . LEU D 1 245 ? -17.295 65.104 60.218  1.00 26.07 ? 243 LEU D CA    1 
ATOM   8182 C  C     . LEU D 1 245 ? -17.803 66.273 61.062  1.00 27.39 ? 243 LEU D C     1 
ATOM   8183 O  O     . LEU D 1 245 ? -18.844 66.866 60.763  1.00 25.58 ? 243 LEU D O     1 
ATOM   8184 C  CB    . LEU D 1 245 ? -17.437 63.794 61.006  1.00 23.49 ? 243 LEU D CB    1 
ATOM   8185 C  CG    . LEU D 1 245 ? -17.342 62.500 60.186  1.00 27.33 ? 243 LEU D CG    1 
ATOM   8186 C  CD1   . LEU D 1 245 ? -17.281 61.280 61.103  1.00 24.05 ? 243 LEU D CD1   1 
ATOM   8187 C  CD2   . LEU D 1 245 ? -18.550 62.407 59.259  1.00 26.06 ? 243 LEU D CD2   1 
ATOM   8188 N  N     . LEU D 1 246 ? -17.056 66.603 62.109  1.00 26.44 ? 244 LEU D N     1 
ATOM   8189 C  CA    . LEU D 1 246 ? -17.442 67.681 62.999  1.00 30.32 ? 244 LEU D CA    1 
ATOM   8190 C  C     . LEU D 1 246 ? -17.626 69.015 62.277  1.00 32.96 ? 244 LEU D C     1 
ATOM   8191 O  O     . LEU D 1 246 ? -18.436 69.840 62.694  1.00 35.28 ? 244 LEU D O     1 
ATOM   8192 C  CB    . LEU D 1 246 ? -16.418 67.816 64.129  1.00 28.90 ? 244 LEU D CB    1 
ATOM   8193 C  CG    . LEU D 1 246 ? -16.370 66.622 65.086  1.00 28.92 ? 244 LEU D CG    1 
ATOM   8194 C  CD1   . LEU D 1 246 ? -15.143 66.697 65.949  1.00 30.45 ? 244 LEU D CD1   1 
ATOM   8195 C  CD2   . LEU D 1 246 ? -17.613 66.604 65.961  1.00 30.99 ? 244 LEU D CD2   1 
ATOM   8196 N  N     . ARG D 1 247 ? -16.897 69.225 61.189  1.00 33.85 ? 245 ARG D N     1 
ATOM   8197 C  CA    . ARG D 1 247 ? -17.018 70.471 60.445  1.00 36.31 ? 245 ARG D CA    1 
ATOM   8198 C  C     . ARG D 1 247 ? -17.881 70.344 59.185  1.00 37.06 ? 245 ARG D C     1 
ATOM   8199 O  O     . ARG D 1 247 ? -17.964 71.270 58.386  1.00 39.23 ? 245 ARG D O     1 
ATOM   8200 C  CB    . ARG D 1 247 ? -15.615 71.012 60.124  1.00 35.52 ? 245 ARG D CB    1 
ATOM   8201 C  CG    . ARG D 1 247 ? -14.869 71.480 61.376  1.00 34.95 ? 245 ARG D CG    1 
ATOM   8202 C  CD    . ARG D 1 247 ? -13.430 71.926 61.114  1.00 36.85 ? 245 ARG D CD    1 
ATOM   8203 N  NE    . ARG D 1 247 ? -12.586 70.840 60.612  1.00 36.80 ? 245 ARG D NE    1 
ATOM   8204 C  CZ    . ARG D 1 247 ? -12.234 70.687 59.339  1.00 35.78 ? 245 ARG D CZ    1 
ATOM   8205 N  NH1   . ARG D 1 247 ? -12.645 71.551 58.422  1.00 36.42 ? 245 ARG D NH1   1 
ATOM   8206 N  NH2   . ARG D 1 247 ? -11.475 69.660 58.981  1.00 35.00 ? 245 ARG D NH2   1 
ATOM   8207 N  N     . GLY D 1 248 ? -18.525 69.194 59.016  1.00 38.09 ? 246 GLY D N     1 
ATOM   8208 C  CA    . GLY D 1 248 ? -19.394 68.982 57.869  1.00 38.77 ? 246 GLY D CA    1 
ATOM   8209 C  C     . GLY D 1 248 ? -18.783 69.026 56.477  1.00 40.23 ? 246 GLY D C     1 
ATOM   8210 O  O     . GLY D 1 248 ? -19.459 69.423 55.524  1.00 40.25 ? 246 GLY D O     1 
ATOM   8211 N  N     . VAL D 1 249 ? -17.530 68.595 56.340  1.00 39.44 ? 247 VAL D N     1 
ATOM   8212 C  CA    . VAL D 1 249 ? -16.855 68.603 55.042  1.00 38.83 ? 247 VAL D CA    1 
ATOM   8213 C  C     . VAL D 1 249 ? -16.261 67.261 54.648  1.00 38.34 ? 247 VAL D C     1 
ATOM   8214 O  O     . VAL D 1 249 ? -16.349 66.287 55.383  1.00 37.59 ? 247 VAL D O     1 
ATOM   8215 C  CB    . VAL D 1 249 ? -15.689 69.607 55.027  1.00 38.70 ? 247 VAL D CB    1 
ATOM   8216 C  CG1   . VAL D 1 249 ? -16.191 70.992 55.266  1.00 41.47 ? 247 VAL D CG1   1 
ATOM   8217 C  CG2   . VAL D 1 249 ? -14.686 69.245 56.091  1.00 38.95 ? 247 VAL D CG2   1 
ATOM   8218 N  N     . ALA D 1 250 ? -15.668 67.228 53.461  1.00 36.84 ? 248 ALA D N     1 
ATOM   8219 C  CA    . ALA D 1 250 ? -14.993 66.032 52.991  1.00 36.08 ? 248 ALA D CA    1 
ATOM   8220 C  C     . ALA D 1 250 ? -13.588 66.265 53.549  1.00 34.99 ? 248 ALA D C     1 
ATOM   8221 O  O     . ALA D 1 250 ? -13.233 67.396 53.868  1.00 35.03 ? 248 ALA D O     1 
ATOM   8222 C  CB    . ALA D 1 250 ? -14.970 65.982 51.459  1.00 36.18 ? 248 ALA D CB    1 
ATOM   8223 N  N     . PRO D 1 251 ? -12.778 65.207 53.701  1.00 35.21 ? 249 PRO D N     1 
ATOM   8224 C  CA    . PRO D 1 251 ? -11.427 65.415 54.238  1.00 35.19 ? 249 PRO D CA    1 
ATOM   8225 C  C     . PRO D 1 251 ? -10.682 66.554 53.532  1.00 35.92 ? 249 PRO D C     1 
ATOM   8226 O  O     . PRO D 1 251 ? -10.644 66.618 52.303  1.00 36.22 ? 249 PRO D O     1 
ATOM   8227 C  CB    . PRO D 1 251 ? -10.764 64.060 54.014  1.00 35.89 ? 249 PRO D CB    1 
ATOM   8228 C  CG    . PRO D 1 251 ? -11.909 63.107 54.191  1.00 35.04 ? 249 PRO D CG    1 
ATOM   8229 C  CD    . PRO D 1 251 ? -13.017 63.782 53.412  1.00 35.42 ? 249 PRO D CD    1 
ATOM   8230 N  N     . ASP D 1 252 ? -10.103 67.453 54.318  1.00 35.12 ? 250 ASP D N     1 
ATOM   8231 C  CA    . ASP D 1 252 ? -9.367  68.584 53.772  1.00 37.86 ? 250 ASP D CA    1 
ATOM   8232 C  C     . ASP D 1 252 ? -8.058  68.799 54.521  1.00 37.23 ? 250 ASP D C     1 
ATOM   8233 O  O     . ASP D 1 252 ? -7.755  68.082 55.474  1.00 36.71 ? 250 ASP D O     1 
ATOM   8234 C  CB    . ASP D 1 252 ? -10.209 69.861 53.850  1.00 38.53 ? 250 ASP D CB    1 
ATOM   8235 C  CG    . ASP D 1 252 ? -10.733 70.128 55.244  1.00 38.96 ? 250 ASP D CG    1 
ATOM   8236 O  OD1   . ASP D 1 252 ? -10.179 69.570 56.215  1.00 36.72 ? 250 ASP D OD1   1 
ATOM   8237 O  OD2   . ASP D 1 252 ? -11.700 70.908 55.372  1.00 41.94 ? 250 ASP D OD2   1 
ATOM   8238 N  N     . ALA D 1 253 ? -7.300  69.804 54.091  1.00 37.60 ? 251 ALA D N     1 
ATOM   8239 C  CA    . ALA D 1 253 ? -6.010  70.123 54.690  1.00 38.26 ? 251 ALA D CA    1 
ATOM   8240 C  C     . ALA D 1 253 ? -6.015  70.251 56.210  1.00 37.46 ? 251 ALA D C     1 
ATOM   8241 O  O     . ALA D 1 253 ? -5.105  69.762 56.876  1.00 39.21 ? 251 ALA D O     1 
ATOM   8242 C  CB    . ALA D 1 253 ? -5.451  71.400 54.059  1.00 40.15 ? 251 ALA D CB    1 
ATOM   8243 N  N     . LEU D 1 254 ? -7.026  70.907 56.770  1.00 37.37 ? 252 LEU D N     1 
ATOM   8244 C  CA    . LEU D 1 254 ? -7.097  71.078 58.224  1.00 35.10 ? 252 LEU D CA    1 
ATOM   8245 C  C     . LEU D 1 254 ? -7.345  69.754 58.962  1.00 33.93 ? 252 LEU D C     1 
ATOM   8246 O  O     . LEU D 1 254 ? -6.886  69.559 60.086  1.00 31.87 ? 252 LEU D O     1 
ATOM   8247 C  CB    . LEU D 1 254 ? -8.201  72.079 58.580  1.00 36.27 ? 252 LEU D CB    1 
ATOM   8248 C  CG    . LEU D 1 254 ? -8.500  72.264 60.070  1.00 37.84 ? 252 LEU D CG    1 
ATOM   8249 C  CD1   . LEU D 1 254 ? -7.254  72.750 60.791  1.00 39.52 ? 252 LEU D CD1   1 
ATOM   8250 C  CD2   . LEU D 1 254 ? -9.637  73.260 60.244  1.00 39.56 ? 252 LEU D CD2   1 
ATOM   8251 N  N     . ALA D 1 255 ? -8.081  68.849 58.330  1.00 32.91 ? 253 ALA D N     1 
ATOM   8252 C  CA    . ALA D 1 255 ? -8.369  67.558 58.945  1.00 31.61 ? 253 ALA D CA    1 
ATOM   8253 C  C     . ALA D 1 255 ? -7.062  66.786 59.091  1.00 31.26 ? 253 ALA D C     1 
ATOM   8254 O  O     . ALA D 1 255 ? -6.830  66.128 60.102  1.00 30.86 ? 253 ALA D O     1 
ATOM   8255 C  CB    . ALA D 1 255 ? -9.350  66.785 58.094  1.00 28.94 ? 253 ALA D CB    1 
ATOM   8256 N  N     . LEU D 1 256 ? -6.203  66.882 58.080  1.00 32.89 ? 254 LEU D N     1 
ATOM   8257 C  CA    . LEU D 1 256 ? -4.914  66.201 58.117  1.00 33.03 ? 254 LEU D CA    1 
ATOM   8258 C  C     . LEU D 1 256 ? -4.021  66.805 59.198  1.00 33.75 ? 254 LEU D C     1 
ATOM   8259 O  O     . LEU D 1 256 ? -3.253  66.094 59.847  1.00 35.07 ? 254 LEU D O     1 
ATOM   8260 C  CB    . LEU D 1 256 ? -4.222  66.281 56.747  1.00 32.38 ? 254 LEU D CB    1 
ATOM   8261 C  CG    . LEU D 1 256 ? -4.447  65.087 55.809  1.00 31.83 ? 254 LEU D CG    1 
ATOM   8262 C  CD1   . LEU D 1 256 ? -5.903  65.006 55.370  1.00 32.44 ? 254 LEU D CD1   1 
ATOM   8263 C  CD2   . LEU D 1 256 ? -3.542  65.230 54.597  1.00 34.88 ? 254 LEU D CD2   1 
ATOM   8264 N  N     . ALA D 1 257 ? -4.136  68.116 59.396  1.00 33.74 ? 255 ALA D N     1 
ATOM   8265 C  CA    . ALA D 1 257 ? -3.350  68.819 60.403  1.00 32.38 ? 255 ALA D CA    1 
ATOM   8266 C  C     . ALA D 1 257 ? -3.740  68.335 61.796  1.00 31.67 ? 255 ALA D C     1 
ATOM   8267 O  O     . ALA D 1 257 ? -2.883  68.095 62.647  1.00 32.20 ? 255 ALA D O     1 
ATOM   8268 C  CB    . ALA D 1 257 ? -3.580  70.325 60.282  1.00 33.73 ? 255 ALA D CB    1 
ATOM   8269 N  N     . HIS D 1 258 ? -5.043  68.194 62.020  1.00 30.74 ? 256 HIS D N     1 
ATOM   8270 C  CA    . HIS D 1 258 ? -5.570  67.717 63.291  1.00 29.82 ? 256 HIS D CA    1 
ATOM   8271 C  C     . HIS D 1 258 ? -5.110  66.283 63.525  1.00 29.06 ? 256 HIS D C     1 
ATOM   8272 O  O     . HIS D 1 258 ? -4.678  65.924 64.620  1.00 27.44 ? 256 HIS D O     1 
ATOM   8273 C  CB    . HIS D 1 258 ? -7.106  67.759 63.272  1.00 32.96 ? 256 HIS D CB    1 
ATOM   8274 C  CG    . HIS D 1 258 ? -7.680  69.139 63.385  1.00 36.64 ? 256 HIS D CG    1 
ATOM   8275 N  ND1   . HIS D 1 258 ? -8.952  69.455 62.952  1.00 38.37 ? 256 HIS D ND1   1 
ATOM   8276 C  CD2   . HIS D 1 258 ? -7.169  70.278 63.911  1.00 38.93 ? 256 HIS D CD2   1 
ATOM   8277 C  CE1   . HIS D 1 258 ? -9.198  70.728 63.207  1.00 38.37 ? 256 HIS D CE1   1 
ATOM   8278 N  NE2   . HIS D 1 258 ? -8.133  71.251 63.789  1.00 39.85 ? 256 HIS D NE2   1 
ATOM   8279 N  N     . ALA D 1 259 ? -5.218  65.463 62.488  1.00 27.91 ? 257 ALA D N     1 
ATOM   8280 C  CA    . ALA D 1 259 ? -4.809  64.068 62.580  1.00 27.90 ? 257 ALA D CA    1 
ATOM   8281 C  C     . ALA D 1 259 ? -3.329  63.956 62.945  1.00 28.36 ? 257 ALA D C     1 
ATOM   8282 O  O     . ALA D 1 259 ? -2.935  63.080 63.714  1.00 27.68 ? 257 ALA D O     1 
ATOM   8283 C  CB    . ALA D 1 259 ? -5.084  63.359 61.259  1.00 25.71 ? 257 ALA D CB    1 
ATOM   8284 N  N     . SER D 1 260 ? -2.510  64.843 62.392  1.00 28.50 ? 258 SER D N     1 
ATOM   8285 C  CA    . SER D 1 260 ? -1.075  64.819 62.676  1.00 30.03 ? 258 SER D CA    1 
ATOM   8286 C  C     . SER D 1 260 ? -0.802  65.073 64.155  1.00 30.90 ? 258 SER D C     1 
ATOM   8287 O  O     . SER D 1 260 ? 0.017   64.384 64.771  1.00 32.13 ? 258 SER D O     1 
ATOM   8288 C  CB    . SER D 1 260 ? -0.349  65.852 61.814  1.00 28.81 ? 258 SER D CB    1 
ATOM   8289 O  OG    . SER D 1 260 ? -0.391  65.489 60.441  1.00 29.21 ? 258 SER D OG    1 
ATOM   8290 N  N     . ARG D 1 261 ? -1.499  66.054 64.729  1.00 31.72 ? 259 ARG D N     1 
ATOM   8291 C  CA    . ARG D 1 261 ? -1.337  66.377 66.146  1.00 32.23 ? 259 ARG D CA    1 
ATOM   8292 C  C     . ARG D 1 261 ? -1.662  65.170 67.017  1.00 31.32 ? 259 ARG D C     1 
ATOM   8293 O  O     . ARG D 1 261 ? -0.918  64.832 67.936  1.00 30.57 ? 259 ARG D O     1 
ATOM   8294 C  CB    . ARG D 1 261 ? -2.262  67.531 66.552  1.00 36.28 ? 259 ARG D CB    1 
ATOM   8295 C  CG    . ARG D 1 261 ? -1.727  68.930 66.296  1.00 41.85 ? 259 ARG D CG    1 
ATOM   8296 C  CD    . ARG D 1 261 ? -1.452  69.156 64.832  1.00 46.06 ? 259 ARG D CD    1 
ATOM   8297 N  NE    . ARG D 1 261 ? -1.089  70.540 64.543  1.00 51.18 ? 259 ARG D NE    1 
ATOM   8298 C  CZ    . ARG D 1 261 ? -0.625  70.956 63.368  1.00 52.38 ? 259 ARG D CZ    1 
ATOM   8299 N  NH1   . ARG D 1 261 ? -0.464  70.088 62.375  1.00 51.35 ? 259 ARG D NH1   1 
ATOM   8300 N  NH2   . ARG D 1 261 ? -0.323  72.236 63.183  1.00 53.08 ? 259 ARG D NH2   1 
ATOM   8301 N  N     . ALA D 1 262 ? -2.784  64.521 66.724  1.00 29.91 ? 260 ALA D N     1 
ATOM   8302 C  CA    . ALA D 1 262 ? -3.208  63.362 67.500  1.00 27.99 ? 260 ALA D CA    1 
ATOM   8303 C  C     . ALA D 1 262 ? -2.243  62.191 67.342  1.00 27.53 ? 260 ALA D C     1 
ATOM   8304 O  O     . ALA D 1 262 ? -1.867  61.555 68.325  1.00 27.30 ? 260 ALA D O     1 
ATOM   8305 C  CB    . ALA D 1 262 ? -4.613  62.943 67.084  1.00 27.56 ? 260 ALA D CB    1 
ATOM   8306 N  N     . ALA D 1 263 ? -1.850  61.901 66.106  1.00 27.46 ? 261 ALA D N     1 
ATOM   8307 C  CA    . ALA D 1 263 ? -0.930  60.793 65.854  1.00 28.19 ? 261 ALA D CA    1 
ATOM   8308 C  C     . ALA D 1 263 ? 0.360   60.996 66.638  1.00 28.76 ? 261 ALA D C     1 
ATOM   8309 O  O     . ALA D 1 263 ? 0.944   60.037 67.145  1.00 27.21 ? 261 ALA D O     1 
ATOM   8310 C  CB    . ALA D 1 263 ? -0.622  60.688 64.372  1.00 29.18 ? 261 ALA D CB    1 
ATOM   8311 N  N     . ALA D 1 264 ? 0.795   62.250 66.735  1.00 29.47 ? 262 ALA D N     1 
ATOM   8312 C  CA    . ALA D 1 264 ? 2.015   62.583 67.466  1.00 32.15 ? 262 ALA D CA    1 
ATOM   8313 C  C     . ALA D 1 264 ? 1.899   62.158 68.927  1.00 31.84 ? 262 ALA D C     1 
ATOM   8314 O  O     . ALA D 1 264 ? 2.870   61.704 69.527  1.00 32.22 ? 262 ALA D O     1 
ATOM   8315 C  CB    . ALA D 1 264 ? 2.291   64.080 67.374  1.00 31.67 ? 262 ALA D CB    1 
ATOM   8316 N  N     . ILE D 1 265 ? 0.710   62.305 69.502  1.00 32.10 ? 263 ILE D N     1 
ATOM   8317 C  CA    . ILE D 1 265 ? 0.505   61.916 70.890  1.00 31.64 ? 263 ILE D CA    1 
ATOM   8318 C  C     . ILE D 1 265 ? 0.666   60.406 71.022  1.00 32.31 ? 263 ILE D C     1 
ATOM   8319 O  O     . ILE D 1 265 ? 1.331   59.913 71.938  1.00 33.29 ? 263 ILE D O     1 
ATOM   8320 C  CB    . ILE D 1 265 ? -0.903  62.320 71.389  1.00 31.72 ? 263 ILE D CB    1 
ATOM   8321 C  CG1   . ILE D 1 265 ? -1.049  63.843 71.355  1.00 32.42 ? 263 ILE D CG1   1 
ATOM   8322 C  CG2   . ILE D 1 265 ? -1.125  61.811 72.808  1.00 32.87 ? 263 ILE D CG2   1 
ATOM   8323 C  CD1   . ILE D 1 265 ? -2.439  64.337 71.694  1.00 31.34 ? 263 ILE D CD1   1 
ATOM   8324 N  N     . THR D 1 266 ? 0.063   59.673 70.093  1.00 30.74 ? 264 THR D N     1 
ATOM   8325 C  CA    . THR D 1 266 ? 0.128   58.219 70.104  1.00 29.77 ? 264 THR D CA    1 
ATOM   8326 C  C     . THR D 1 266 ? 1.558   57.705 69.976  1.00 30.61 ? 264 THR D C     1 
ATOM   8327 O  O     . THR D 1 266 ? 1.958   56.796 70.706  1.00 30.95 ? 264 THR D O     1 
ATOM   8328 C  CB    . THR D 1 266 ? -0.738  57.626 68.969  1.00 30.30 ? 264 THR D CB    1 
ATOM   8329 O  OG1   . THR D 1 266 ? -2.106  57.998 69.184  1.00 30.85 ? 264 THR D OG1   1 
ATOM   8330 C  CG2   . THR D 1 266 ? -0.627  56.101 68.931  1.00 29.63 ? 264 THR D CG2   1 
ATOM   8331 N  N     . VAL D 1 267 ? 2.331   58.284 69.061  1.00 31.56 ? 265 VAL D N     1 
ATOM   8332 C  CA    . VAL D 1 267 ? 3.712   57.842 68.875  1.00 32.74 ? 265 VAL D CA    1 
ATOM   8333 C  C     . VAL D 1 267 ? 4.577   58.142 70.097  1.00 33.53 ? 265 VAL D C     1 
ATOM   8334 O  O     . VAL D 1 267 ? 5.569   57.458 70.340  1.00 32.96 ? 265 VAL D O     1 
ATOM   8335 C  CB    . VAL D 1 267 ? 4.371   58.494 67.631  1.00 34.48 ? 265 VAL D CB    1 
ATOM   8336 C  CG1   . VAL D 1 267 ? 3.638   58.066 66.368  1.00 34.50 ? 265 VAL D CG1   1 
ATOM   8337 C  CG2   . VAL D 1 267 ? 4.368   60.005 67.762  1.00 37.86 ? 265 VAL D CG2   1 
ATOM   8338 N  N     . SER D 1 268 ? 4.198   59.153 70.872  1.00 34.31 ? 266 SER D N     1 
ATOM   8339 C  CA    . SER D 1 268 ? 4.969   59.522 72.055  1.00 35.19 ? 266 SER D CA    1 
ATOM   8340 C  C     . SER D 1 268 ? 4.652   58.669 73.283  1.00 36.21 ? 266 SER D C     1 
ATOM   8341 O  O     . SER D 1 268 ? 5.307   58.809 74.323  1.00 35.73 ? 266 SER D O     1 
ATOM   8342 C  CB    . SER D 1 268 ? 4.752   61.000 72.389  1.00 36.07 ? 266 SER D CB    1 
ATOM   8343 O  OG    . SER D 1 268 ? 3.434   61.238 72.853  1.00 39.02 ? 266 SER D OG    1 
ATOM   8344 N  N     . ARG D 1 269 ? 3.668   57.778 73.167  1.00 35.07 ? 267 ARG D N     1 
ATOM   8345 C  CA    . ARG D 1 269 ? 3.287   56.920 74.289  1.00 35.89 ? 267 ARG D CA    1 
ATOM   8346 C  C     . ARG D 1 269 ? 3.386   55.437 73.955  1.00 36.78 ? 267 ARG D C     1 
ATOM   8347 O  O     . ARG D 1 269 ? 3.372   55.053 72.786  1.00 37.11 ? 267 ARG D O     1 
ATOM   8348 C  CB    . ARG D 1 269 ? 1.869   57.263 74.753  1.00 35.41 ? 267 ARG D CB    1 
ATOM   8349 C  CG    . ARG D 1 269 ? 1.731   58.707 75.207  1.00 35.36 ? 267 ARG D CG    1 
ATOM   8350 C  CD    . ARG D 1 269 ? 0.304   59.074 75.572  1.00 37.45 ? 267 ARG D CD    1 
ATOM   8351 N  NE    . ARG D 1 269 ? 0.200   60.495 75.888  1.00 37.80 ? 267 ARG D NE    1 
ATOM   8352 C  CZ    . ARG D 1 269 ? -0.945  61.146 76.064  1.00 38.84 ? 267 ARG D CZ    1 
ATOM   8353 N  NH1   . ARG D 1 269 ? -2.102  60.503 75.961  1.00 37.73 ? 267 ARG D NH1   1 
ATOM   8354 N  NH2   . ARG D 1 269 ? -0.930  62.447 76.324  1.00 37.66 ? 267 ARG D NH2   1 
ATOM   8355 N  N     . ARG D 1 270 ? 3.488   54.608 74.991  1.00 37.47 ? 268 ARG D N     1 
ATOM   8356 C  CA    . ARG D 1 270 ? 3.613   53.161 74.822  1.00 37.97 ? 268 ARG D CA    1 
ATOM   8357 C  C     . ARG D 1 270 ? 2.277   52.427 74.859  1.00 35.52 ? 268 ARG D C     1 
ATOM   8358 O  O     . ARG D 1 270 ? 1.343   52.851 75.534  1.00 36.33 ? 268 ARG D O     1 
ATOM   8359 C  CB    . ARG D 1 270 ? 4.516   52.577 75.914  1.00 41.42 ? 268 ARG D CB    1 
ATOM   8360 C  CG    . ARG D 1 270 ? 5.914   53.167 75.972  1.00 46.96 ? 268 ARG D CG    1 
ATOM   8361 C  CD    . ARG D 1 270 ? 6.691   52.633 77.172  1.00 50.59 ? 268 ARG D CD    1 
ATOM   8362 N  NE    . ARG D 1 270 ? 7.964   53.330 77.349  1.00 54.76 ? 268 ARG D NE    1 
ATOM   8363 C  CZ    . ARG D 1 270 ? 8.779   53.155 78.386  1.00 57.36 ? 268 ARG D CZ    1 
ATOM   8364 N  NH1   . ARG D 1 270 ? 8.459   52.299 79.349  1.00 58.97 ? 268 ARG D NH1   1 
ATOM   8365 N  NH2   . ARG D 1 270 ? 9.916   53.839 78.462  1.00 57.73 ? 268 ARG D NH2   1 
ATOM   8366 N  N     . GLY D 1 271 ? 2.208   51.312 74.138  1.00 32.76 ? 269 GLY D N     1 
ATOM   8367 C  CA    . GLY D 1 271 ? 1.000   50.510 74.103  1.00 31.63 ? 269 GLY D CA    1 
ATOM   8368 C  C     . GLY D 1 271 ? 0.119   50.815 72.907  1.00 30.84 ? 269 GLY D C     1 
ATOM   8369 O  O     . GLY D 1 271 ? 0.553   51.443 71.942  1.00 31.39 ? 269 GLY D O     1 
ATOM   8370 N  N     . THR D 1 272 ? -1.121  50.350 72.968  1.00 29.99 ? 270 THR D N     1 
ATOM   8371 C  CA    . THR D 1 272 ? -2.078  50.591 71.900  1.00 29.55 ? 270 THR D CA    1 
ATOM   8372 C  C     . THR D 1 272 ? -3.178  51.467 72.490  1.00 29.37 ? 270 THR D C     1 
ATOM   8373 O  O     . THR D 1 272 ? -3.073  52.695 72.476  1.00 29.10 ? 270 THR D O     1 
ATOM   8374 C  CB    . THR D 1 272 ? -2.666  49.266 71.366  1.00 28.58 ? 270 THR D CB    1 
ATOM   8375 O  OG1   . THR D 1 272 ? -1.598  48.418 70.926  1.00 28.73 ? 270 THR D OG1   1 
ATOM   8376 C  CG2   . THR D 1 272 ? -3.606  49.526 70.179  1.00 28.28 ? 270 THR D CG2   1 
ATOM   8377 N  N     . LEU D 1 273 ? -4.215  50.839 73.029  1.00 29.70 ? 271 LEU D N     1 
ATOM   8378 C  CA    . LEU D 1 273 ? -5.311  51.581 73.635  1.00 30.97 ? 271 LEU D CA    1 
ATOM   8379 C  C     . LEU D 1 273 ? -4.783  52.581 74.667  1.00 31.27 ? 271 LEU D C     1 
ATOM   8380 O  O     . LEU D 1 273 ? -5.177  53.748 74.668  1.00 31.92 ? 271 LEU D O     1 
ATOM   8381 C  CB    . LEU D 1 273 ? -6.297  50.609 74.292  1.00 30.10 ? 271 LEU D CB    1 
ATOM   8382 C  CG    . LEU D 1 273 ? -7.432  51.166 75.159  1.00 31.60 ? 271 LEU D CG    1 
ATOM   8383 C  CD1   . LEU D 1 273 ? -8.285  52.140 74.368  1.00 29.64 ? 271 LEU D CD1   1 
ATOM   8384 C  CD2   . LEU D 1 273 ? -8.278  50.012 75.660  1.00 31.73 ? 271 LEU D CD2   1 
ATOM   8385 N  N     . SER D 1 274 ? -3.873  52.130 75.526  1.00 32.45 ? 272 SER D N     1 
ATOM   8386 C  CA    . SER D 1 274 ? -3.318  52.993 76.571  1.00 33.04 ? 272 SER D CA    1 
ATOM   8387 C  C     . SER D 1 274 ? -2.467  54.129 76.016  1.00 33.08 ? 272 SER D C     1 
ATOM   8388 O  O     . SER D 1 274 ? -2.138  55.076 76.733  1.00 32.57 ? 272 SER D O     1 
ATOM   8389 C  CB    . SER D 1 274 ? -2.485  52.173 77.564  1.00 32.97 ? 272 SER D CB    1 
ATOM   8390 O  OG    . SER D 1 274 ? -1.269  51.735 76.982  1.00 35.93 ? 272 SER D OG    1 
ATOM   8391 N  N     . ALA D 1 275 ? -2.112  54.047 74.740  1.00 31.70 ? 273 ALA D N     1 
ATOM   8392 C  CA    . ALA D 1 275 ? -1.304  55.093 74.133  1.00 31.58 ? 273 ALA D CA    1 
ATOM   8393 C  C     . ALA D 1 275 ? -2.118  56.178 73.425  1.00 31.98 ? 273 ALA D C     1 
ATOM   8394 O  O     . ALA D 1 275 ? -1.589  57.254 73.128  1.00 31.20 ? 273 ALA D O     1 
ATOM   8395 C  CB    . ALA D 1 275 ? -0.305  54.475 73.157  1.00 32.13 ? 273 ALA D CB    1 
ATOM   8396 N  N     . PHE D 1 276 ? -3.398  55.917 73.165  1.00 31.68 ? 274 PHE D N     1 
ATOM   8397 C  CA    . PHE D 1 276 ? -4.225  56.897 72.455  1.00 31.45 ? 274 PHE D CA    1 
ATOM   8398 C  C     . PHE D 1 276 ? -4.593  58.133 73.265  1.00 32.17 ? 274 PHE D C     1 
ATOM   8399 O  O     . PHE D 1 276 ? -4.717  58.073 74.486  1.00 32.44 ? 274 PHE D O     1 
ATOM   8400 C  CB    . PHE D 1 276 ? -5.520  56.249 71.941  1.00 30.63 ? 274 PHE D CB    1 
ATOM   8401 C  CG    . PHE D 1 276 ? -5.302  55.026 71.100  1.00 28.59 ? 274 PHE D CG    1 
ATOM   8402 C  CD1   . PHE D 1 276 ? -4.214  54.939 70.234  1.00 28.00 ? 274 PHE D CD1   1 
ATOM   8403 C  CD2   . PHE D 1 276 ? -6.196  53.963 71.159  1.00 30.47 ? 274 PHE D CD2   1 
ATOM   8404 C  CE1   . PHE D 1 276 ? -4.024  53.808 69.441  1.00 28.43 ? 274 PHE D CE1   1 
ATOM   8405 C  CE2   . PHE D 1 276 ? -6.014  52.832 70.370  1.00 27.63 ? 274 PHE D CE2   1 
ATOM   8406 C  CZ    . PHE D 1 276 ? -4.926  52.756 69.510  1.00 28.86 ? 274 PHE D CZ    1 
ATOM   8407 N  N     . PRO D 1 277 ? -4.760  59.282 72.589  1.00 32.13 ? 275 PRO D N     1 
ATOM   8408 C  CA    . PRO D 1 277 ? -5.126  60.522 73.283  1.00 33.09 ? 275 PRO D CA    1 
ATOM   8409 C  C     . PRO D 1 277 ? -6.565  60.450 73.806  1.00 33.70 ? 275 PRO D C     1 
ATOM   8410 O  O     . PRO D 1 277 ? -7.402  59.736 73.244  1.00 32.26 ? 275 PRO D O     1 
ATOM   8411 C  CB    . PRO D 1 277 ? -4.952  61.589 72.205  1.00 32.39 ? 275 PRO D CB    1 
ATOM   8412 C  CG    . PRO D 1 277 ? -5.267  60.843 70.939  1.00 33.26 ? 275 PRO D CG    1 
ATOM   8413 C  CD    . PRO D 1 277 ? -4.540  59.532 71.153  1.00 32.24 ? 275 PRO D CD    1 
ATOM   8414 N  N     . GLY D 1 278 ? -6.843  61.184 74.883  1.00 33.90 ? 276 GLY D N     1 
ATOM   8415 C  CA    . GLY D 1 278 ? -8.177  61.179 75.467  1.00 35.32 ? 276 GLY D CA    1 
ATOM   8416 C  C     . GLY D 1 278 ? -9.112  62.207 74.850  1.00 35.34 ? 276 GLY D C     1 
ATOM   8417 O  O     . GLY D 1 278 ? -8.662  63.121 74.156  1.00 34.28 ? 276 GLY D O     1 
ATOM   8418 N  N     . SER D 1 279 ? -10.412 62.057 75.110  1.00 37.90 ? 277 SER D N     1 
ATOM   8419 C  CA    . SER D 1 279 ? -11.443 62.960 74.587  1.00 40.01 ? 277 SER D CA    1 
ATOM   8420 C  C     . SER D 1 279 ? -10.988 64.388 74.788  1.00 41.51 ? 277 SER D C     1 
ATOM   8421 O  O     . SER D 1 279 ? -11.109 65.261 73.926  1.00 42.64 ? 277 SER D O     1 
ATOM   8422 C  CB    . SER D 1 279 ? -12.759 62.733 75.333  1.00 39.81 ? 277 SER D CB    1 
ATOM   8423 O  OG    . SER D 1 279 ? -13.182 61.395 75.211  1.00 40.78 ? 277 SER D OG    1 
ATOM   8424 N  N     . ARG D 1 280 ? -10.461 64.578 75.977  1.00 43.95 ? 278 ARG D N     1 
ATOM   8425 C  CA    . ARG D 1 280 ? -9.901  65.812 76.473  1.00 44.99 ? 278 ARG D CA    1 
ATOM   8426 C  C     . ARG D 1 280 ? -8.969  66.467 75.455  1.00 44.83 ? 278 ARG D C     1 
ATOM   8427 O  O     . ARG D 1 280 ? -9.286  67.500 74.854  1.00 44.97 ? 278 ARG D O     1 
ATOM   8428 C  CB    . ARG D 1 280 ? -9.121  65.447 77.722  1.00 47.66 ? 278 ARG D CB    1 
ATOM   8429 C  CG    . ARG D 1 280 ? -9.497  64.049 78.237  1.00 46.37 ? 278 ARG D CG    1 
ATOM   8430 C  CD    . ARG D 1 280 ? -8.383  63.469 79.055  1.00 49.13 ? 278 ARG D CD    1 
ATOM   8431 N  NE    . ARG D 1 280 ? -7.485  64.533 79.492  1.00 53.43 ? 278 ARG D NE    1 
ATOM   8432 C  CZ    . ARG D 1 280 ? -6.585  64.420 80.465  1.00 55.11 ? 278 ARG D CZ    1 
ATOM   8433 N  NH1   . ARG D 1 280 ? -6.451  63.280 81.131  1.00 56.21 ? 278 ARG D NH1   1 
ATOM   8434 N  NH2   . ARG D 1 280 ? -5.802  65.448 80.761  1.00 55.13 ? 278 ARG D NH2   1 
ATOM   8435 N  N     . GLU D 1 281 ? -7.807  65.850 75.277  1.00 44.10 ? 279 GLU D N     1 
ATOM   8436 C  CA    . GLU D 1 281 ? -6.799  66.350 74.359  1.00 42.75 ? 279 GLU D CA    1 
ATOM   8437 C  C     . GLU D 1 281 ? -7.364  66.496 72.955  1.00 41.39 ? 279 GLU D C     1 
ATOM   8438 O  O     . GLU D 1 281 ? -7.016  67.430 72.237  1.00 41.25 ? 279 GLU D O     1 
ATOM   8439 C  CB    . GLU D 1 281 ? -5.600  65.400 74.351  1.00 44.57 ? 279 GLU D CB    1 
ATOM   8440 C  CG    . GLU D 1 281 ? -5.414  64.675 75.676  1.00 46.59 ? 279 GLU D CG    1 
ATOM   8441 C  CD    . GLU D 1 281 ? -4.180  63.787 75.715  1.00 48.00 ? 279 GLU D CD    1 
ATOM   8442 O  OE1   . GLU D 1 281 ? -3.051  64.324 75.691  1.00 48.40 ? 279 GLU D OE1   1 
ATOM   8443 O  OE2   . GLU D 1 281 ? -4.342  62.551 75.775  1.00 47.57 ? 279 GLU D OE2   1 
ATOM   8444 N  N     . LEU D 1 282 ? -8.244  65.576 72.572  1.00 39.48 ? 280 LEU D N     1 
ATOM   8445 C  CA    . LEU D 1 282 ? -8.847  65.600 71.245  1.00 38.17 ? 280 LEU D CA    1 
ATOM   8446 C  C     . LEU D 1 282 ? -9.710  66.838 70.999  1.00 38.45 ? 280 LEU D C     1 
ATOM   8447 O  O     . LEU D 1 282 ? -9.589  67.491 69.961  1.00 39.24 ? 280 LEU D O     1 
ATOM   8448 C  CB    . LEU D 1 282 ? -9.664  64.322 71.024  1.00 33.32 ? 280 LEU D CB    1 
ATOM   8449 C  CG    . LEU D 1 282 ? -8.813  63.055 70.873  1.00 32.00 ? 280 LEU D CG    1 
ATOM   8450 C  CD1   . LEU D 1 282 ? -9.679  61.804 70.940  1.00 29.64 ? 280 LEU D CD1   1 
ATOM   8451 C  CD2   . LEU D 1 282 ? -8.071  63.118 69.542  1.00 29.81 ? 280 LEU D CD2   1 
ATOM   8452 N  N     . ALA D 1 283 ? -10.571 67.163 71.955  1.00 41.23 ? 281 ALA D N     1 
ATOM   8453 C  CA    . ALA D 1 283 ? -11.442 68.328 71.828  1.00 41.84 ? 281 ALA D CA    1 
ATOM   8454 C  C     . ALA D 1 283 ? -10.612 69.595 71.625  1.00 43.25 ? 281 ALA D C     1 
ATOM   8455 O  O     . ALA D 1 283 ? -10.865 70.375 70.705  1.00 43.17 ? 281 ALA D O     1 
ATOM   8456 C  CB    . ALA D 1 283 ? -12.308 68.462 73.067  1.00 43.07 ? 281 ALA D CB    1 
ATOM   8457 N  N     . ALA D 1 284 ? -9.620  69.797 72.487  1.00 43.84 ? 282 ALA D N     1 
ATOM   8458 C  CA    . ALA D 1 284 ? -8.756  70.969 72.387  1.00 45.32 ? 282 ALA D CA    1 
ATOM   8459 C  C     . ALA D 1 284 ? -8.072  70.957 71.028  1.00 45.90 ? 282 ALA D C     1 
ATOM   8460 O  O     . ALA D 1 284 ? -8.026  71.967 70.322  1.00 46.14 ? 282 ALA D O     1 
ATOM   8461 C  CB    . ALA D 1 284 ? -7.715  70.942 73.495  1.00 45.13 ? 282 ALA D CB    1 
ATOM   8462 N  N     . LEU D 1 285 ? -7.551  69.787 70.676  1.00 46.03 ? 283 LEU D N     1 
ATOM   8463 C  CA    . LEU D 1 285 ? -6.860  69.557 69.418  1.00 45.60 ? 283 LEU D CA    1 
ATOM   8464 C  C     . LEU D 1 285 ? -7.741  69.893 68.216  1.00 46.05 ? 283 LEU D C     1 
ATOM   8465 O  O     . LEU D 1 285 ? -7.311  70.570 67.284  1.00 44.72 ? 283 LEU D O     1 
ATOM   8466 C  CB    . LEU D 1 285 ? -6.432  68.087 69.364  1.00 45.68 ? 283 LEU D CB    1 
ATOM   8467 C  CG    . LEU D 1 285 ? -5.779  67.447 68.140  1.00 44.73 ? 283 LEU D CG    1 
ATOM   8468 C  CD1   . LEU D 1 285 ? -5.253  66.086 68.554  1.00 44.16 ? 283 LEU D CD1   1 
ATOM   8469 C  CD2   . LEU D 1 285 ? -6.761  67.307 66.992  1.00 43.59 ? 283 LEU D CD2   1 
ATOM   8470 N  N     . LEU D 1 286 ? -8.978  69.414 68.251  1.00 46.50 ? 284 LEU D N     1 
ATOM   8471 C  CA    . LEU D 1 286 ? -9.918  69.628 67.160  1.00 48.09 ? 284 LEU D CA    1 
ATOM   8472 C  C     . LEU D 1 286 ? -10.395 71.067 66.991  1.00 49.77 ? 284 LEU D C     1 
ATOM   8473 O  O     . LEU D 1 286 ? -11.038 71.398 65.995  1.00 49.79 ? 284 LEU D O     1 
ATOM   8474 C  CB    . LEU D 1 286 ? -11.114 68.690 67.332  1.00 46.11 ? 284 LEU D CB    1 
ATOM   8475 C  CG    . LEU D 1 286 ? -10.763 67.215 67.106  1.00 45.74 ? 284 LEU D CG    1 
ATOM   8476 C  CD1   . LEU D 1 286 ? -11.910 66.318 67.534  1.00 45.09 ? 284 LEU D CD1   1 
ATOM   8477 C  CD2   . LEU D 1 286 ? -10.427 67.005 65.639  1.00 45.47 ? 284 LEU D CD2   1 
ATOM   8478 N  N     . THR D 1 287 ? -10.080 71.924 67.957  1.00 52.37 ? 285 THR D N     1 
ATOM   8479 C  CA    . THR D 1 287 ? -10.487 73.323 67.871  1.00 54.60 ? 285 THR D CA    1 
ATOM   8480 C  C     . THR D 1 287 ? -9.687  74.032 66.781  1.00 56.21 ? 285 THR D C     1 
ATOM   8481 O  O     . THR D 1 287 ? -10.323 74.537 65.829  1.00 57.27 ? 285 THR D O     1 
ATOM   8482 C  CB    . THR D 1 287 ? -10.270 74.066 69.205  1.00 55.10 ? 285 THR D CB    1 
ATOM   8483 O  OG1   . THR D 1 287 ? -11.176 73.558 70.193  1.00 54.65 ? 285 THR D OG1   1 
ATOM   8484 C  CG2   . THR D 1 287 ? -10.513 75.561 69.024  1.00 56.29 ? 285 THR D CG2   1 
HETATM 8485 P  PG    . ATP E 2 .   ? 21.996  31.218 121.744 1.00 61.08 ? 900 ATP A PG    1 
HETATM 8486 O  O1G   . ATP E 2 .   ? 21.597  32.173 122.837 1.00 61.07 ? 900 ATP A O1G   1 
HETATM 8487 O  O2G   . ATP E 2 .   ? 21.110  31.345 120.531 1.00 62.29 ? 900 ATP A O2G   1 
HETATM 8488 O  O3G   . ATP E 2 .   ? 23.469  31.439 121.365 1.00 61.63 ? 900 ATP A O3G   1 
HETATM 8489 P  PB    . ATP E 2 .   ? 21.724  29.230 123.901 1.00 53.24 ? 900 ATP A PB    1 
HETATM 8490 O  O1B   . ATP E 2 .   ? 22.836  29.828 124.748 1.00 52.49 ? 900 ATP A O1B   1 
HETATM 8491 O  O2B   . ATP E 2 .   ? 20.294  29.402 124.284 1.00 52.91 ? 900 ATP A O2B   1 
HETATM 8492 O  O3B   . ATP E 2 .   ? 21.783  29.738 122.366 1.00 57.08 ? 900 ATP A O3B   1 
HETATM 8493 P  PA    . ATP E 2 .   ? 23.304  26.734 124.142 1.00 46.48 ? 900 ATP A PA    1 
HETATM 8494 O  O1A   . ATP E 2 .   ? 24.534  27.228 123.432 1.00 43.80 ? 900 ATP A O1A   1 
HETATM 8495 O  O2A   . ATP E 2 .   ? 23.288  26.581 125.631 1.00 45.06 ? 900 ATP A O2A   1 
HETATM 8496 O  O3A   . ATP E 2 .   ? 22.009  27.649 123.697 1.00 49.35 ? 900 ATP A O3A   1 
HETATM 8497 O  "O5'" . ATP E 2 .   ? 22.341  25.348 123.438 1.00 46.45 ? 900 ATP A "O5'" 1 
HETATM 8498 C  "C5'" . ATP E 2 .   ? 21.339  24.683 122.777 1.00 43.45 ? 900 ATP A "C5'" 1 
HETATM 8499 C  "C4'" . ATP E 2 .   ? 21.612  23.201 122.796 1.00 40.76 ? 900 ATP A "C4'" 1 
HETATM 8500 O  "O4'" . ATP E 2 .   ? 22.049  23.144 121.427 1.00 39.21 ? 900 ATP A "O4'" 1 
HETATM 8501 C  "C3'" . ATP E 2 .   ? 22.850  22.578 123.501 1.00 39.67 ? 900 ATP A "C3'" 1 
HETATM 8502 O  "O3'" . ATP E 2 .   ? 22.588  22.114 124.828 1.00 36.61 ? 900 ATP A "O3'" 1 
HETATM 8503 C  "C2'" . ATP E 2 .   ? 23.243  21.527 122.529 1.00 39.88 ? 900 ATP A "C2'" 1 
HETATM 8504 O  "O2'" . ATP E 2 .   ? 22.491  20.312 122.679 1.00 40.92 ? 900 ATP A "O2'" 1 
HETATM 8505 C  "C1'" . ATP E 2 .   ? 23.031  22.161 121.197 1.00 38.01 ? 900 ATP A "C1'" 1 
HETATM 8506 N  N9    . ATP E 2 .   ? 24.341  22.733 120.709 1.00 36.22 ? 900 ATP A N9    1 
HETATM 8507 C  C8    . ATP E 2 .   ? 24.844  24.019 120.786 1.00 34.42 ? 900 ATP A C8    1 
HETATM 8508 N  N7    . ATP E 2 .   ? 26.069  24.112 120.209 1.00 35.33 ? 900 ATP A N7    1 
HETATM 8509 C  C5    . ATP E 2 .   ? 26.390  22.883 119.753 1.00 35.55 ? 900 ATP A C5    1 
HETATM 8510 C  C6    . ATP E 2 .   ? 27.525  22.219 119.011 1.00 36.01 ? 900 ATP A C6    1 
HETATM 8511 N  N6    . ATP E 2 .   ? 28.606  22.931 118.672 1.00 34.45 ? 900 ATP A N6    1 
HETATM 8512 N  N1    . ATP E 2 .   ? 27.439  20.852 118.712 1.00 38.32 ? 900 ATP A N1    1 
HETATM 8513 C  C2    . ATP E 2 .   ? 26.345  20.065 119.039 1.00 38.05 ? 900 ATP A C2    1 
HETATM 8514 N  N3    . ATP E 2 .   ? 25.265  20.607 119.713 1.00 36.35 ? 900 ATP A N3    1 
HETATM 8515 C  C4    . ATP E 2 .   ? 25.233  21.975 120.064 1.00 35.39 ? 900 ATP A C4    1 
HETATM 8516 P  PG    . ATP F 2 .   ? 17.081  19.139 73.068  1.00 50.31 ? 900 ATP B PG    1 
HETATM 8517 O  O1G   . ATP F 2 .   ? 18.208  20.084 72.736  1.00 49.14 ? 900 ATP B O1G   1 
HETATM 8518 O  O2G   . ATP F 2 .   ? 16.645  19.271 74.513  1.00 52.42 ? 900 ATP B O2G   1 
HETATM 8519 O  O3G   . ATP F 2 .   ? 15.899  19.372 72.117  1.00 51.87 ? 900 ATP B O3G   1 
HETATM 8520 P  PB    . ATP F 2 .   ? 19.102  16.987 73.280  1.00 37.06 ? 900 ATP B PB    1 
HETATM 8521 O  O1B   . ATP F 2 .   ? 20.230  17.401 72.348  1.00 37.11 ? 900 ATP B O1B   1 
HETATM 8522 O  O2B   . ATP F 2 .   ? 19.192  17.209 74.748  1.00 36.93 ? 900 ATP B O2B   1 
HETATM 8523 O  O3B   . ATP F 2 .   ? 17.686  17.649 72.853  1.00 43.97 ? 900 ATP B O3B   1 
HETATM 8524 P  PA    . ATP F 2 .   ? 19.221  14.478 71.809  1.00 30.84 ? 900 ATP B PA    1 
HETATM 8525 O  O1A   . ATP F 2 .   ? 18.758  15.080 70.509  1.00 30.68 ? 900 ATP B O1A   1 
HETATM 8526 O  O2A   . ATP F 2 .   ? 20.651  14.104 72.008  1.00 31.89 ? 900 ATP B O2A   1 
HETATM 8527 O  O3A   . ATP F 2 .   ? 18.768  15.439 73.038  1.00 34.54 ? 900 ATP B O3A   1 
HETATM 8528 O  "O5'" . ATP F 2 .   ? 18.231  13.224 72.668  1.00 32.07 ? 900 ATP B "O5'" 1 
HETATM 8529 C  "C5'" . ATP F 2 .   ? 17.323  12.677 73.529  1.00 33.20 ? 900 ATP B "C5'" 1 
HETATM 8530 C  "C4'" . ATP F 2 .   ? 17.333  11.183 73.353  1.00 30.51 ? 900 ATP B "C4'" 1 
HETATM 8531 O  "O4'" . ATP F 2 .   ? 16.122  11.175 72.599  1.00 27.87 ? 900 ATP B "O4'" 1 
HETATM 8532 C  "C3'" . ATP F 2 .   ? 18.279  10.458 72.349  1.00 31.36 ? 900 ATP B "C3'" 1 
HETATM 8533 O  "O3'" . ATP F 2 .   ? 19.474  9.939  72.943  1.00 31.39 ? 900 ATP B "O3'" 1 
HETATM 8534 C  "C2'" . ATP F 2 .   ? 17.363  9.440  71.777  1.00 28.85 ? 900 ATP B "C2'" 1 
HETATM 8535 O  "O2'" . ATP F 2 .   ? 17.232  8.294  72.632  1.00 29.49 ? 900 ATP B "O2'" 1 
HETATM 8536 C  "C1'" . ATP F 2 .   ? 16.074  10.159 71.623  1.00 28.11 ? 900 ATP B "C1'" 1 
HETATM 8537 N  N9    . ATP F 2 .   ? 15.938  10.726 70.230  1.00 24.31 ? 900 ATP B N9    1 
HETATM 8538 C  C8    . ATP F 2 .   ? 16.236  11.981 69.746  1.00 24.22 ? 900 ATP B C8    1 
HETATM 8539 N  N7    . ATP F 2 .   ? 15.967  12.084 68.424  1.00 25.96 ? 900 ATP B N7    1 
HETATM 8540 C  C5    . ATP F 2 .   ? 15.480  10.896 68.030  1.00 26.02 ? 900 ATP B C5    1 
HETATM 8541 C  C6    . ATP F 2 .   ? 14.996  10.260 66.761  1.00 26.99 ? 900 ATP B C6    1 
HETATM 8542 N  N6    . ATP F 2 .   ? 14.961  10.972 65.633  1.00 24.44 ? 900 ATP B N6    1 
HETATM 8543 N  N1    . ATP F 2 .   ? 14.562  8.926  66.790  1.00 27.36 ? 900 ATP B N1    1 
HETATM 8544 C  C2    . ATP F 2 .   ? 14.574  8.141  67.931  1.00 27.31 ? 900 ATP B C2    1 
HETATM 8545 N  N3    . ATP F 2 .   ? 15.013  8.662  69.132  1.00 28.48 ? 900 ATP B N3    1 
HETATM 8546 C  C4    . ATP F 2 .   ? 15.480  9.990  69.222  1.00 25.22 ? 900 ATP B C4    1 
HETATM 8547 P  PG    . ATP G 2 .   ? 29.582  64.196 103.932 1.00 43.22 ? 900 ATP C PG    1 
HETATM 8548 O  O1G   . ATP G 2 .   ? 30.349  63.580 102.801 1.00 46.05 ? 900 ATP C O1G   1 
HETATM 8549 O  O2G   . ATP G 2 .   ? 28.306  64.851 103.460 1.00 47.64 ? 900 ATP C O2G   1 
HETATM 8550 O  O3G   . ATP G 2 .   ? 29.276  63.142 105.002 1.00 44.41 ? 900 ATP C O3G   1 
HETATM 8551 P  PB    . ATP G 2 .   ? 31.979  65.920 104.057 1.00 30.66 ? 900 ATP C PB    1 
HETATM 8552 O  O1B   . ATP G 2 .   ? 33.100  65.475 104.972 1.00 32.75 ? 900 ATP C O1B   1 
HETATM 8553 O  O2B   . ATP G 2 .   ? 32.037  65.666 102.595 1.00 32.30 ? 900 ATP C O2B   1 
HETATM 8554 O  O3B   . ATP G 2 .   ? 30.551  65.335 104.534 1.00 38.84 ? 900 ATP C O3B   1 
HETATM 8555 P  PA    . ATP G 2 .   ? 32.076  68.436 105.551 1.00 27.11 ? 900 ATP C PA    1 
HETATM 8556 O  O1A   . ATP G 2 .   ? 31.567  67.803 106.810 1.00 25.34 ? 900 ATP C O1A   1 
HETATM 8557 O  O2A   . ATP G 2 .   ? 33.502  68.830 105.439 1.00 28.11 ? 900 ATP C O2A   1 
HETATM 8558 O  O3A   . ATP G 2 .   ? 31.701  67.489 104.273 1.00 29.14 ? 900 ATP C O3A   1 
HETATM 8559 O  "O5'" . ATP G 2 .   ? 31.146  69.725 104.679 1.00 27.69 ? 900 ATP C "O5'" 1 
HETATM 8560 C  "C5'" . ATP G 2 .   ? 30.304  70.336 103.807 1.00 28.30 ? 900 ATP C "C5'" 1 
HETATM 8561 C  "C4'" . ATP G 2 .   ? 30.348  71.823 104.062 1.00 24.23 ? 900 ATP C "C4'" 1 
HETATM 8562 O  "O4'" . ATP G 2 .   ? 29.118  71.804 104.786 1.00 24.12 ? 900 ATP C "O4'" 1 
HETATM 8563 C  "C3'" . ATP G 2 .   ? 31.270  72.469 105.142 1.00 23.37 ? 900 ATP C "C3'" 1 
HETATM 8564 O  "O3'" . ATP G 2 .   ? 32.485  72.999 104.623 1.00 24.43 ? 900 ATP C "O3'" 1 
HETATM 8565 C  "C2'" . ATP G 2 .   ? 30.357  73.467 105.743 1.00 23.52 ? 900 ATP C "C2'" 1 
HETATM 8566 O  "O2'" . ATP G 2 .   ? 30.262  74.668 104.960 1.00 23.74 ? 900 ATP C "O2'" 1 
HETATM 8567 C  "C1'" . ATP G 2 .   ? 29.058  72.756 105.826 1.00 22.68 ? 900 ATP C "C1'" 1 
HETATM 8568 N  N9    . ATP G 2 .   ? 28.938  72.107 107.178 1.00 22.28 ? 900 ATP C N9    1 
HETATM 8569 C  C8    . ATP G 2 .   ? 29.257  70.832 107.586 1.00 20.80 ? 900 ATP C C8    1 
HETATM 8570 N  N7    . ATP G 2 .   ? 29.001  70.647 108.891 1.00 22.62 ? 900 ATP C N7    1 
HETATM 8571 C  C5    . ATP G 2 .   ? 28.498  71.800 109.351 1.00 23.63 ? 900 ATP C C5    1 
HETATM 8572 C  C6    . ATP G 2 .   ? 28.014  72.344 110.651 1.00 24.31 ? 900 ATP C C6    1 
HETATM 8573 N  N6    . ATP G 2 .   ? 27.998  71.553 111.731 1.00 24.19 ? 900 ATP C N6    1 
HETATM 8574 N  N1    . ATP G 2 .   ? 27.562  73.665 110.702 1.00 23.75 ? 900 ATP C N1    1 
HETATM 8575 C  C2    . ATP G 2 .   ? 27.556  74.522 109.609 1.00 23.63 ? 900 ATP C C2    1 
HETATM 8576 N  N3    . ATP G 2 .   ? 27.996  74.077 108.382 1.00 23.42 ? 900 ATP C N3    1 
HETATM 8577 C  C4    . ATP G 2 .   ? 28.476  72.771 108.219 1.00 21.16 ? 900 ATP C C4    1 
HETATM 8578 C  C1    . GOL H 3 .   ? 24.663  57.612 101.157 1.00 33.41 ? 501 GOL C C1    1 
HETATM 8579 O  O1    . GOL H 3 .   ? 23.904  56.992 100.129 1.00 31.91 ? 501 GOL C O1    1 
HETATM 8580 C  C2    . GOL H 3 .   ? 24.858  59.089 100.813 1.00 36.13 ? 501 GOL C C2    1 
HETATM 8581 O  O2    . GOL H 3 .   ? 23.568  59.715 100.702 1.00 30.83 ? 501 GOL C O2    1 
HETATM 8582 C  C3    . GOL H 3 .   ? 25.685  59.758 101.917 1.00 39.61 ? 501 GOL C C3    1 
HETATM 8583 O  O3    . GOL H 3 .   ? 25.891  61.140 101.612 1.00 44.59 ? 501 GOL C O3    1 
HETATM 8584 P  PG    . ATP I 2 .   ? 0.439   51.684 61.360  1.00 51.11 ? 900 ATP D PG    1 
HETATM 8585 O  O1G   . ATP I 2 .   ? 0.607   50.312 60.777  1.00 53.08 ? 900 ATP D O1G   1 
HETATM 8586 O  O2G   . ATP I 2 .   ? -0.999  52.144 61.328  1.00 52.25 ? 900 ATP D O2G   1 
HETATM 8587 O  O3G   . ATP I 2 .   ? 0.990   51.727 62.791  1.00 52.88 ? 900 ATP D O3G   1 
HETATM 8588 P  PB    . ATP I 2 .   ? 0.966   53.320 58.991  1.00 39.48 ? 900 ATP D PB    1 
HETATM 8589 O  O1B   . ATP I 2 .   ? 2.027   53.013 57.960  1.00 40.87 ? 900 ATP D O1B   1 
HETATM 8590 O  O2B   . ATP I 2 .   ? -0.465  52.992 58.741  1.00 40.29 ? 900 ATP D O2B   1 
HETATM 8591 O  O3B   . ATP I 2 .   ? 1.302   52.639 60.408  1.00 45.90 ? 900 ATP D O3B   1 
HETATM 8592 P  PA    . ATP I 2 .   ? 2.356   55.883 59.190  1.00 33.32 ? 900 ATP D PA    1 
HETATM 8593 O  O1A   . ATP I 2 .   ? 3.588   55.331 59.869  1.00 34.33 ? 900 ATP D O1A   1 
HETATM 8594 O  O2A   . ATP I 2 .   ? 2.400   56.251 57.746  1.00 36.09 ? 900 ATP D O2A   1 
HETATM 8595 O  O3A   . ATP I 2 .   ? 1.090   54.870 59.416  1.00 36.34 ? 900 ATP D O3A   1 
HETATM 8596 O  "O5'" . ATP I 2 .   ? 1.352   57.145 60.019  1.00 35.17 ? 900 ATP D "O5'" 1 
HETATM 8597 C  "C5'" . ATP I 2 .   ? 0.366   57.721 60.761  1.00 35.09 ? 900 ATP D "C5'" 1 
HETATM 8598 C  "C4'" . ATP I 2 .   ? 0.576   59.214 60.773  1.00 34.67 ? 900 ATP D "C4'" 1 
HETATM 8599 O  "O4'" . ATP I 2 .   ? 1.109   59.234 62.099  1.00 34.32 ? 900 ATP D "O4'" 1 
HETATM 8600 C  "C3'" . ATP I 2 .   ? 1.741   59.913 60.013  1.00 34.61 ? 900 ATP D "C3'" 1 
HETATM 8601 O  "O3'" . ATP I 2 .   ? 1.385   60.401 58.728  1.00 36.93 ? 900 ATP D "O3'" 1 
HETATM 8602 C  "C2'" . ATP I 2 .   ? 2.144   60.951 60.985  1.00 36.06 ? 900 ATP D "C2'" 1 
HETATM 8603 O  "O2'" . ATP I 2 .   ? 1.296   62.110 60.928  1.00 35.50 ? 900 ATP D "O2'" 1 
HETATM 8604 C  "C1'" . ATP I 2 .   ? 2.067   60.254 62.299  1.00 35.65 ? 900 ATP D "C1'" 1 
HETATM 8605 N  N9    . ATP I 2 .   ? 3.422   59.702 62.659  1.00 36.23 ? 900 ATP D N9    1 
HETATM 8606 C  C8    . ATP I 2 .   ? 3.969   58.462 62.422  1.00 36.31 ? 900 ATP D C8    1 
HETATM 8607 N  N7    . ATP I 2 .   ? 5.223   58.367 62.914  1.00 37.60 ? 900 ATP D N7    1 
HETATM 8608 C  C5    . ATP I 2 .   ? 5.513   59.549 63.483  1.00 38.95 ? 900 ATP D C5    1 
HETATM 8609 C  C6    . ATP I 2 .   ? 6.668   60.183 64.209  1.00 39.68 ? 900 ATP D C6    1 
HETATM 8610 N  N6    . ATP I 2 .   ? 7.789   59.485 64.417  1.00 39.72 ? 900 ATP D N6    1 
HETATM 8611 N  N1    . ATP I 2 .   ? 6.545   61.502 64.655  1.00 40.04 ? 900 ATP D N1    1 
HETATM 8612 C  C2    . ATP I 2 .   ? 5.412   62.274 64.470  1.00 40.47 ? 900 ATP D C2    1 
HETATM 8613 N  N3    . ATP I 2 .   ? 4.318   61.754 63.812  1.00 38.92 ? 900 ATP D N3    1 
HETATM 8614 C  C4    . ATP I 2 .   ? 4.320   60.434 63.315  1.00 37.52 ? 900 ATP D C4    1 
HETATM 8615 C  C1    . GOL J 3 .   ? -2.701  45.308 65.899  1.00 33.10 ? 501 GOL D C1    1 
HETATM 8616 O  O1    . GOL J 3 .   ? -3.759  44.555 66.495  1.00 32.57 ? 501 GOL D O1    1 
HETATM 8617 C  C2    . GOL J 3 .   ? -3.137  46.770 65.721  1.00 36.94 ? 501 GOL D C2    1 
HETATM 8618 O  O2    . GOL J 3 .   ? -3.452  47.339 66.999  1.00 33.10 ? 501 GOL D O2    1 
HETATM 8619 C  C3    . GOL J 3 .   ? -2.007  47.569 65.074  1.00 38.66 ? 501 GOL D C3    1 
HETATM 8620 O  O3    . GOL J 3 .   ? -2.419  48.928 64.900  1.00 43.98 ? 501 GOL D O3    1 
HETATM 8621 O  O     . HOH K 4 .   ? 0.954   25.583 113.327 1.00 28.51 ? 298 HOH A O     1 
HETATM 8622 O  O     . HOH K 4 .   ? 22.225  28.133 112.146 1.00 20.95 ? 299 HOH A O     1 
HETATM 8623 O  O     . HOH K 4 .   ? 0.209   16.354 124.745 1.00 25.31 ? 300 HOH A O     1 
HETATM 8624 O  O     . HOH K 4 .   ? 11.077  28.594 104.773 1.00 23.27 ? 301 HOH A O     1 
HETATM 8625 O  O     . HOH K 4 .   ? 10.342  21.829 106.655 1.00 27.29 ? 302 HOH A O     1 
HETATM 8626 O  O     . HOH K 4 .   ? 10.462  31.262 104.037 1.00 25.10 ? 303 HOH A O     1 
HETATM 8627 O  O     . HOH K 4 .   ? 0.239   21.674 129.130 1.00 23.11 ? 304 HOH A O     1 
HETATM 8628 O  O     . HOH K 4 .   ? 2.490   31.451 107.876 1.00 33.39 ? 305 HOH A O     1 
HETATM 8629 O  O     . HOH K 4 .   ? 23.499  18.531 120.232 1.00 28.38 ? 306 HOH A O     1 
HETATM 8630 O  O     . HOH K 4 .   ? 13.061  47.282 109.634 1.00 37.41 ? 307 HOH A O     1 
HETATM 8631 O  O     . HOH K 4 .   ? 6.950   41.541 118.726 1.00 24.48 ? 308 HOH A O     1 
HETATM 8632 O  O     . HOH K 4 .   ? -1.108  20.844 118.297 1.00 29.27 ? 309 HOH A O     1 
HETATM 8633 O  O     . HOH K 4 .   ? 15.247  24.082 106.745 1.00 25.11 ? 310 HOH A O     1 
HETATM 8634 O  O     . HOH K 4 .   ? 2.263   42.756 103.330 1.00 38.94 ? 311 HOH A O     1 
HETATM 8635 O  O     . HOH K 4 .   ? 26.071  22.836 106.049 1.00 27.53 ? 312 HOH A O     1 
HETATM 8636 O  O     . HOH K 4 .   ? 0.668   23.203 133.565 1.00 34.91 ? 313 HOH A O     1 
HETATM 8637 O  O     . HOH K 4 .   ? 18.790  12.059 127.305 1.00 34.39 ? 314 HOH A O     1 
HETATM 8638 O  O     . HOH K 4 .   ? 8.971   41.728 116.745 1.00 25.11 ? 315 HOH A O     1 
HETATM 8639 O  O     . HOH K 4 .   ? 18.112  17.737 104.213 1.00 27.97 ? 316 HOH A O     1 
HETATM 8640 O  O     . HOH K 4 .   ? 29.829  26.973 104.111 1.00 51.46 ? 317 HOH A O     1 
HETATM 8641 O  O     . HOH K 4 .   ? 8.791   24.361 106.526 1.00 34.21 ? 318 HOH A O     1 
HETATM 8642 O  O     . HOH K 4 .   ? 18.623  14.979 106.265 1.00 31.53 ? 319 HOH A O     1 
HETATM 8643 O  O     . HOH K 4 .   ? 24.802  25.357 105.494 1.00 23.39 ? 320 HOH A O     1 
HETATM 8644 O  O     . HOH K 4 .   ? -4.120  28.416 116.239 1.00 45.22 ? 321 HOH A O     1 
HETATM 8645 O  O     . HOH K 4 .   ? 38.696  43.279 108.807 1.00 43.35 ? 322 HOH A O     1 
HETATM 8646 O  O     . HOH K 4 .   ? 13.385  11.931 132.416 1.00 33.37 ? 323 HOH A O     1 
HETATM 8647 O  O     . HOH K 4 .   ? 20.667  12.722 121.255 1.00 34.87 ? 324 HOH A O     1 
HETATM 8648 O  O     . HOH K 4 .   ? 1.624   40.113 110.077 1.00 42.02 ? 325 HOH A O     1 
HETATM 8649 O  O     . HOH K 4 .   ? 27.220  30.401 134.905 1.00 41.67 ? 326 HOH A O     1 
HETATM 8650 O  O     . HOH K 4 .   ? 22.213  18.196 124.985 1.00 34.28 ? 327 HOH A O     1 
HETATM 8651 O  O     . HOH K 4 .   ? 21.554  32.001 118.067 1.00 43.41 ? 328 HOH A O     1 
HETATM 8652 O  O     . HOH K 4 .   ? 2.118   40.216 113.086 1.00 32.30 ? 329 HOH A O     1 
HETATM 8653 O  O     . HOH K 4 .   ? 10.268  11.679 108.114 1.00 34.08 ? 330 HOH A O     1 
HETATM 8654 O  O     . HOH K 4 .   ? 18.765  30.358 126.639 1.00 30.78 ? 331 HOH A O     1 
HETATM 8655 O  O     . HOH K 4 .   ? 3.465   17.823 127.365 1.00 43.66 ? 332 HOH A O     1 
HETATM 8656 O  O     . HOH K 4 .   ? -5.822  22.865 122.474 1.00 28.81 ? 333 HOH A O     1 
HETATM 8657 O  O     . HOH K 4 .   ? 18.450  33.042 118.148 1.00 41.59 ? 334 HOH A O     1 
HETATM 8658 O  O     . HOH K 4 .   ? 0.248   18.906 121.124 1.00 32.90 ? 335 HOH A O     1 
HETATM 8659 O  O     . HOH K 4 .   ? 17.855  43.302 100.232 1.00 41.03 ? 336 HOH A O     1 
HETATM 8660 O  O     . HOH K 4 .   ? 21.193  14.901 114.480 1.00 36.39 ? 337 HOH A O     1 
HETATM 8661 O  O     . HOH K 4 .   ? 18.195  45.694 99.465  1.00 39.01 ? 338 HOH A O     1 
HETATM 8662 O  O     . HOH K 4 .   ? 21.248  27.396 104.785 1.00 27.46 ? 339 HOH A O     1 
HETATM 8663 O  O     . HOH K 4 .   ? 24.009  18.522 108.350 1.00 34.34 ? 340 HOH A O     1 
HETATM 8664 O  O     . HOH K 4 .   ? 12.984  47.780 106.065 1.00 34.01 ? 341 HOH A O     1 
HETATM 8665 O  O     . HOH K 4 .   ? 6.887   25.432 138.571 1.00 34.58 ? 342 HOH A O     1 
HETATM 8666 O  O     . HOH K 4 .   ? 17.306  30.236 123.585 1.00 33.13 ? 343 HOH A O     1 
HETATM 8667 O  O     . HOH K 4 .   ? 9.371   42.990 113.302 1.00 29.04 ? 344 HOH A O     1 
HETATM 8668 O  O     . HOH K 4 .   ? 15.561  37.425 119.433 1.00 34.92 ? 345 HOH A O     1 
HETATM 8669 O  O     . HOH K 4 .   ? 19.119  27.676 126.034 1.00 26.77 ? 346 HOH A O     1 
HETATM 8670 O  O     . HOH K 4 .   ? -7.148  25.954 116.855 1.00 29.52 ? 347 HOH A O     1 
HETATM 8671 O  O     . HOH K 4 .   ? 12.586  52.553 115.480 1.00 41.97 ? 348 HOH A O     1 
HETATM 8672 O  O     . HOH K 4 .   ? 18.314  31.051 106.404 1.00 37.31 ? 349 HOH A O     1 
HETATM 8673 O  O     . HOH K 4 .   ? 7.460   27.852 140.311 1.00 34.24 ? 350 HOH A O     1 
HETATM 8674 O  O     . HOH K 4 .   ? 11.988  16.918 136.311 1.00 39.46 ? 351 HOH A O     1 
HETATM 8675 O  O     . HOH K 4 .   ? 23.653  32.999 110.238 1.00 40.51 ? 352 HOH A O     1 
HETATM 8676 O  O     . HOH K 4 .   ? 4.225   40.981 102.356 1.00 35.37 ? 353 HOH A O     1 
HETATM 8677 O  O     . HOH K 4 .   ? 25.144  44.105 97.859  1.00 28.35 ? 354 HOH A O     1 
HETATM 8678 O  O     . HOH K 4 .   ? 28.657  29.959 114.754 1.00 31.48 ? 355 HOH A O     1 
HETATM 8679 O  O     . HOH K 4 .   ? 14.995  33.165 106.323 1.00 32.25 ? 356 HOH A O     1 
HETATM 8680 O  O     . HOH K 4 .   ? 15.710  33.401 141.997 1.00 40.25 ? 357 HOH A O     1 
HETATM 8681 O  O     . HOH K 4 .   ? 16.965  27.642 124.456 1.00 35.31 ? 358 HOH A O     1 
HETATM 8682 O  O     . HOH K 4 .   ? 9.943   38.768 127.337 1.00 36.01 ? 359 HOH A O     1 
HETATM 8683 O  O     . HOH K 4 .   ? 19.285  30.034 119.652 1.00 29.62 ? 360 HOH A O     1 
HETATM 8684 O  O     . HOH K 4 .   ? 21.271  34.832 110.233 1.00 45.25 ? 361 HOH A O     1 
HETATM 8685 O  O     . HOH K 4 .   ? 16.162  13.020 110.813 1.00 33.86 ? 362 HOH A O     1 
HETATM 8686 O  O     . HOH K 4 .   ? 13.998  28.199 104.283 1.00 28.56 ? 363 HOH A O     1 
HETATM 8687 O  O     . HOH K 4 .   ? 2.086   36.294 106.550 1.00 42.91 ? 364 HOH A O     1 
HETATM 8688 O  O     . HOH K 4 .   ? -2.353  39.818 132.792 1.00 36.22 ? 365 HOH A O     1 
HETATM 8689 O  O     . HOH K 4 .   ? 3.255   20.307 128.463 1.00 41.59 ? 366 HOH A O     1 
HETATM 8690 O  O     . HOH K 4 .   ? -8.828  31.449 127.596 1.00 51.17 ? 367 HOH A O     1 
HETATM 8691 O  O     . HOH K 4 .   ? 5.189   46.955 104.737 1.00 37.03 ? 368 HOH A O     1 
HETATM 8692 O  O     . HOH K 4 .   ? 7.568   16.839 111.523 1.00 27.52 ? 369 HOH A O     1 
HETATM 8693 O  O     . HOH K 4 .   ? 15.319  30.430 103.825 1.00 32.43 ? 370 HOH A O     1 
HETATM 8694 O  O     . HOH K 4 .   ? 0.503   16.699 127.226 1.00 43.16 ? 371 HOH A O     1 
HETATM 8695 O  O     . HOH K 4 .   ? -1.848  23.795 132.493 1.00 35.90 ? 372 HOH A O     1 
HETATM 8696 O  O     . HOH K 4 .   ? 15.591  40.804 128.201 1.00 39.71 ? 373 HOH A O     1 
HETATM 8697 O  O     . HOH K 4 .   ? 15.284  42.414 118.013 1.00 35.80 ? 374 HOH A O     1 
HETATM 8698 O  O     . HOH K 4 .   ? -3.226  34.895 137.097 1.00 33.57 ? 375 HOH A O     1 
HETATM 8699 O  O     . HOH K 4 .   ? 27.785  17.282 125.582 1.00 42.36 ? 376 HOH A O     1 
HETATM 8700 O  O     . HOH K 4 .   ? 14.988  49.754 118.196 1.00 33.53 ? 377 HOH A O     1 
HETATM 8701 O  O     . HOH K 4 .   ? 26.778  31.325 108.215 1.00 42.06 ? 378 HOH A O     1 
HETATM 8702 O  O     . HOH K 4 .   ? -11.001 26.600 121.481 1.00 42.03 ? 379 HOH A O     1 
HETATM 8703 O  O     . HOH K 4 .   ? 0.012   36.213 140.101 1.00 40.44 ? 380 HOH A O     1 
HETATM 8704 O  O     . HOH K 4 .   ? -0.173  43.226 111.945 1.00 47.54 ? 381 HOH A O     1 
HETATM 8705 O  O     . HOH K 4 .   ? 12.915  42.117 118.854 1.00 40.86 ? 382 HOH A O     1 
HETATM 8706 O  O     . HOH K 4 .   ? 8.522   9.632  129.924 1.00 40.83 ? 383 HOH A O     1 
HETATM 8707 O  O     . HOH K 4 .   ? 18.399  34.562 114.999 1.00 39.74 ? 384 HOH A O     1 
HETATM 8708 O  O     . HOH K 4 .   ? 22.089  32.760 105.645 1.00 53.76 ? 385 HOH A O     1 
HETATM 8709 O  O     . HOH K 4 .   ? 28.304  18.471 108.680 1.00 40.05 ? 386 HOH A O     1 
HETATM 8710 O  O     . HOH K 4 .   ? 35.311  57.550 102.381 1.00 33.13 ? 387 HOH A O     1 
HETATM 8711 O  O     . HOH K 4 .   ? 19.462  47.179 104.986 1.00 37.48 ? 388 HOH A O     1 
HETATM 8712 O  O     . HOH K 4 .   ? -2.284  46.868 109.222 1.00 44.62 ? 389 HOH A O     1 
HETATM 8713 O  O     . HOH K 4 .   ? 24.683  28.894 120.680 1.00 53.25 ? 390 HOH A O     1 
HETATM 8714 O  O     . HOH K 4 .   ? 24.967  31.411 118.193 1.00 39.70 ? 391 HOH A O     1 
HETATM 8715 O  O     . HOH K 4 .   ? 33.400  38.806 110.670 1.00 47.60 ? 392 HOH A O     1 
HETATM 8716 O  O     . HOH L 4 .   ? -5.269  29.547 87.037  1.00 40.97 ? 298 HOH B O     1 
HETATM 8717 O  O     . HOH L 4 .   ? 7.621   16.845 70.625  1.00 20.27 ? 299 HOH B O     1 
HETATM 8718 O  O     . HOH L 4 .   ? 12.790  17.727 106.174 1.00 22.21 ? 300 HOH B O     1 
HETATM 8719 O  O     . HOH L 4 .   ? 17.913  18.102 77.671  1.00 42.55 ? 301 HOH B O     1 
HETATM 8720 O  O     . HOH L 4 .   ? 15.091  6.522  71.123  1.00 22.97 ? 302 HOH B O     1 
HETATM 8721 O  O     . HOH L 4 .   ? 13.121  6.595  61.327  1.00 49.79 ? 303 HOH B O     1 
HETATM 8722 O  O     . HOH L 4 .   ? 31.798  15.184 90.738  1.00 36.52 ? 304 HOH B O     1 
HETATM 8723 O  O     . HOH L 4 .   ? 36.419  2.132  76.652  1.00 49.43 ? 305 HOH B O     1 
HETATM 8724 O  O     . HOH L 4 .   ? 6.791   31.463 83.447  1.00 23.56 ? 306 HOH B O     1 
HETATM 8725 O  O     . HOH L 4 .   ? 14.856  24.918 83.600  1.00 29.79 ? 307 HOH B O     1 
HETATM 8726 O  O     . HOH L 4 .   ? 19.397  6.159  73.228  1.00 27.64 ? 308 HOH B O     1 
HETATM 8727 O  O     . HOH L 4 .   ? 11.511  29.737 86.861  1.00 22.91 ? 309 HOH B O     1 
HETATM 8728 O  O     . HOH L 4 .   ? 2.223   15.369 61.005  1.00 30.97 ? 310 HOH B O     1 
HETATM 8729 O  O     . HOH L 4 .   ? 20.686  15.388 76.461  1.00 26.07 ? 311 HOH B O     1 
HETATM 8730 O  O     . HOH L 4 .   ? 9.725   23.492 75.870  1.00 27.78 ? 312 HOH B O     1 
HETATM 8731 O  O     . HOH L 4 .   ? 3.271   8.271  68.972  1.00 25.57 ? 313 HOH B O     1 
HETATM 8732 O  O     . HOH L 4 .   ? 0.953   14.575 77.085  1.00 31.40 ? 314 HOH B O     1 
HETATM 8733 O  O     . HOH L 4 .   ? 25.480  33.755 84.254  1.00 45.17 ? 315 HOH B O     1 
HETATM 8734 O  O     . HOH L 4 .   ? 23.628  -0.009 77.029  1.00 33.77 ? 316 HOH B O     1 
HETATM 8735 O  O     . HOH L 4 .   ? 14.441  19.687 69.643  1.00 39.69 ? 317 HOH B O     1 
HETATM 8736 O  O     . HOH L 4 .   ? 17.792  33.513 80.756  1.00 42.96 ? 318 HOH B O     1 
HETATM 8737 O  O     . HOH L 4 .   ? 14.490  18.321 75.210  1.00 32.38 ? 319 HOH B O     1 
HETATM 8738 O  O     . HOH L 4 .   ? -2.023  35.497 86.105  1.00 46.26 ? 320 HOH B O     1 
HETATM 8739 O  O     . HOH L 4 .   ? 9.861   30.132 84.499  1.00 23.80 ? 321 HOH B O     1 
HETATM 8740 O  O     . HOH L 4 .   ? 1.298   12.415 74.289  1.00 26.89 ? 322 HOH B O     1 
HETATM 8741 O  O     . HOH L 4 .   ? 18.614  15.238 78.168  1.00 32.49 ? 323 HOH B O     1 
HETATM 8742 O  O     . HOH L 4 .   ? 13.729  20.422 72.706  1.00 31.75 ? 324 HOH B O     1 
HETATM 8743 O  O     . HOH L 4 .   ? 5.162   19.631 65.303  1.00 33.18 ? 325 HOH B O     1 
HETATM 8744 O  O     . HOH L 4 .   ? 17.494  25.610 84.611  1.00 30.84 ? 326 HOH B O     1 
HETATM 8745 O  O     . HOH L 4 .   ? 6.273   21.852 68.901  1.00 29.89 ? 327 HOH B O     1 
HETATM 8746 O  O     . HOH L 4 .   ? 27.252  23.000 100.167 1.00 28.59 ? 328 HOH B O     1 
HETATM 8747 O  O     . HOH L 4 .   ? 10.623  21.260 100.749 1.00 26.78 ? 329 HOH B O     1 
HETATM 8748 O  O     . HOH L 4 .   ? 13.967  39.331 91.906  1.00 35.30 ? 330 HOH B O     1 
HETATM 8749 O  O     . HOH L 4 .   ? 20.620  26.859 85.415  1.00 30.37 ? 331 HOH B O     1 
HETATM 8750 O  O     . HOH L 4 .   ? 13.217  21.278 75.695  1.00 32.85 ? 332 HOH B O     1 
HETATM 8751 O  O     . HOH L 4 .   ? 21.201  18.132 76.976  1.00 26.27 ? 333 HOH B O     1 
HETATM 8752 O  O     . HOH L 4 .   ? 18.811  35.869 93.257  1.00 35.72 ? 334 HOH B O     1 
HETATM 8753 O  O     . HOH L 4 .   ? 10.675  1.412  66.660  1.00 31.79 ? 335 HOH B O     1 
HETATM 8754 O  O     . HOH L 4 .   ? 12.176  30.466 78.435  1.00 28.79 ? 336 HOH B O     1 
HETATM 8755 O  O     . HOH L 4 .   ? 13.476  25.810 78.400  1.00 27.04 ? 337 HOH B O     1 
HETATM 8756 O  O     . HOH L 4 .   ? 6.518   17.148 105.720 1.00 27.13 ? 338 HOH B O     1 
HETATM 8757 O  O     . HOH L 4 .   ? 12.747  30.578 81.229  1.00 28.86 ? 339 HOH B O     1 
HETATM 8758 O  O     . HOH L 4 .   ? 4.613   16.391 94.806  1.00 29.04 ? 340 HOH B O     1 
HETATM 8759 O  O     . HOH L 4 .   ? 15.728  31.046 81.355  1.00 36.13 ? 341 HOH B O     1 
HETATM 8760 O  O     . HOH L 4 .   ? 4.849   13.798 92.552  1.00 38.20 ? 342 HOH B O     1 
HETATM 8761 O  O     . HOH L 4 .   ? 28.733  2.226  81.683  1.00 40.17 ? 343 HOH B O     1 
HETATM 8762 O  O     . HOH L 4 .   ? 14.732  7.176  64.750  1.00 36.02 ? 344 HOH B O     1 
HETATM 8763 O  O     . HOH L 4 .   ? 24.087  6.627  68.856  1.00 48.43 ? 345 HOH B O     1 
HETATM 8764 O  O     . HOH L 4 .   ? 3.396   5.835  85.456  1.00 27.66 ? 346 HOH B O     1 
HETATM 8765 O  O     . HOH L 4 .   ? 15.845  26.156 77.278  1.00 32.85 ? 347 HOH B O     1 
HETATM 8766 O  O     . HOH L 4 .   ? -0.797  32.437 74.872  1.00 51.97 ? 348 HOH B O     1 
HETATM 8767 O  O     . HOH L 4 .   ? 23.485  30.414 82.607  1.00 31.16 ? 349 HOH B O     1 
HETATM 8768 O  O     . HOH L 4 .   ? 17.415  32.812 84.283  1.00 33.70 ? 350 HOH B O     1 
HETATM 8769 O  O     . HOH L 4 .   ? 17.742  24.809 86.868  1.00 30.81 ? 351 HOH B O     1 
HETATM 8770 O  O     . HOH L 4 .   ? 17.440  36.588 90.325  1.00 35.32 ? 352 HOH B O     1 
HETATM 8771 O  O     . HOH L 4 .   ? 0.165   0.953  81.930  1.00 34.02 ? 353 HOH B O     1 
HETATM 8772 O  O     . HOH L 4 .   ? 5.368   22.852 71.147  1.00 30.65 ? 354 HOH B O     1 
HETATM 8773 O  O     . HOH L 4 .   ? 22.280  18.237 106.363 1.00 39.05 ? 355 HOH B O     1 
HETATM 8774 O  O     . HOH L 4 .   ? 1.883   12.002 65.754  1.00 31.36 ? 356 HOH B O     1 
HETATM 8775 O  O     . HOH L 4 .   ? -0.136  36.166 78.918  1.00 37.08 ? 357 HOH B O     1 
HETATM 8776 O  O     . HOH L 4 .   ? 15.917  13.316 64.861  1.00 37.81 ? 358 HOH B O     1 
HETATM 8777 O  O     . HOH L 4 .   ? 17.089  29.969 79.348  1.00 34.94 ? 359 HOH B O     1 
HETATM 8778 O  O     . HOH L 4 .   ? 30.248  12.667 90.981  1.00 32.19 ? 360 HOH B O     1 
HETATM 8779 O  O     . HOH L 4 .   ? 3.946   11.367 90.923  1.00 35.06 ? 361 HOH B O     1 
HETATM 8780 O  O     . HOH L 4 .   ? 15.198  25.921 102.849 1.00 23.42 ? 362 HOH B O     1 
HETATM 8781 O  O     . HOH L 4 .   ? 18.743  33.431 86.640  1.00 29.84 ? 363 HOH B O     1 
HETATM 8782 O  O     . HOH L 4 .   ? 20.616  0.110  77.213  1.00 39.87 ? 364 HOH B O     1 
HETATM 8783 O  O     . HOH L 4 .   ? 0.526   12.567 63.639  1.00 36.26 ? 365 HOH B O     1 
HETATM 8784 O  O     . HOH L 4 .   ? 19.994  9.931  96.504  1.00 32.03 ? 366 HOH B O     1 
HETATM 8785 O  O     . HOH L 4 .   ? 22.342  11.953 98.400  1.00 30.27 ? 367 HOH B O     1 
HETATM 8786 O  O     . HOH L 4 .   ? 1.855   9.720  67.041  1.00 30.24 ? 368 HOH B O     1 
HETATM 8787 O  O     . HOH L 4 .   ? 1.195   14.300 66.917  1.00 29.50 ? 369 HOH B O     1 
HETATM 8788 O  O     . HOH L 4 .   ? 22.422  15.374 70.502  1.00 29.87 ? 370 HOH B O     1 
HETATM 8789 O  O     . HOH L 4 .   ? 8.784   36.287 80.555  1.00 34.50 ? 371 HOH B O     1 
HETATM 8790 O  O     . HOH L 4 .   ? 23.769  28.156 98.600  1.00 31.82 ? 372 HOH B O     1 
HETATM 8791 O  O     . HOH L 4 .   ? 15.153  0.748  74.245  1.00 32.51 ? 373 HOH B O     1 
HETATM 8792 O  O     . HOH L 4 .   ? 9.240   0.971  72.336  1.00 43.09 ? 374 HOH B O     1 
HETATM 8793 O  O     . HOH L 4 .   ? 19.921  20.105 75.251  1.00 43.76 ? 375 HOH B O     1 
HETATM 8794 O  O     . HOH L 4 .   ? 17.322  0.805  72.754  1.00 37.73 ? 376 HOH B O     1 
HETATM 8795 O  O     . HOH L 4 .   ? 3.104   24.526 71.008  1.00 34.48 ? 377 HOH B O     1 
HETATM 8796 O  O     . HOH L 4 .   ? 15.770  32.445 75.355  1.00 39.53 ? 378 HOH B O     1 
HETATM 8797 O  O     . HOH L 4 .   ? 10.020  35.924 88.628  1.00 36.24 ? 379 HOH B O     1 
HETATM 8798 O  O     . HOH L 4 .   ? 25.884  34.580 87.341  1.00 30.82 ? 380 HOH B O     1 
HETATM 8799 O  O     . HOH L 4 .   ? 7.121   19.126 102.237 1.00 40.67 ? 381 HOH B O     1 
HETATM 8800 O  O     . HOH L 4 .   ? 9.480   24.763 71.861  1.00 39.80 ? 382 HOH B O     1 
HETATM 8801 O  O     . HOH L 4 .   ? 27.809  21.229 102.073 1.00 39.47 ? 383 HOH B O     1 
HETATM 8802 O  O     . HOH L 4 .   ? -0.513  11.288 81.938  1.00 34.99 ? 384 HOH B O     1 
HETATM 8803 O  O     . HOH L 4 .   ? 1.907   35.045 74.581  1.00 42.27 ? 385 HOH B O     1 
HETATM 8804 O  O     . HOH L 4 .   ? 17.848  36.104 96.660  1.00 32.36 ? 386 HOH B O     1 
HETATM 8805 O  O     . HOH L 4 .   ? 9.577   29.717 60.260  1.00 45.42 ? 387 HOH B O     1 
HETATM 8806 O  O     . HOH L 4 .   ? 5.019   28.819 90.689  1.00 32.87 ? 388 HOH B O     1 
HETATM 8807 O  O     . HOH L 4 .   ? 11.561  18.551 64.962  1.00 33.92 ? 389 HOH B O     1 
HETATM 8808 O  O     . HOH L 4 .   ? -0.044  20.122 89.948  1.00 37.72 ? 390 HOH B O     1 
HETATM 8809 O  O     . HOH L 4 .   ? 8.239   3.807  71.993  1.00 31.98 ? 391 HOH B O     1 
HETATM 8810 O  O     . HOH L 4 .   ? 15.263  4.992  94.767  1.00 42.95 ? 392 HOH B O     1 
HETATM 8811 O  O     . HOH L 4 .   ? 25.447  1.182  85.917  1.00 41.31 ? 393 HOH B O     1 
HETATM 8812 O  O     . HOH L 4 .   ? 9.354   9.002  94.777  1.00 38.53 ? 394 HOH B O     1 
HETATM 8813 O  O     . HOH L 4 .   ? 16.504  15.949 69.697  1.00 48.67 ? 395 HOH B O     1 
HETATM 8814 O  O     . HOH L 4 .   ? 8.805   23.339 69.553  1.00 36.73 ? 396 HOH B O     1 
HETATM 8815 O  O     . HOH L 4 .   ? 25.608  20.520 105.598 1.00 38.24 ? 397 HOH B O     1 
HETATM 8816 O  O     . HOH L 4 .   ? 25.042  -2.088 77.918  1.00 37.68 ? 398 HOH B O     1 
HETATM 8817 O  O     . HOH L 4 .   ? 0.956   22.584 92.673  1.00 46.46 ? 399 HOH B O     1 
HETATM 8818 O  O     . HOH L 4 .   ? 3.728   43.116 88.270  1.00 44.93 ? 400 HOH B O     1 
HETATM 8819 O  O     . HOH L 4 .   ? 20.846  -2.489 83.075  1.00 38.59 ? 401 HOH B O     1 
HETATM 8820 O  O     . HOH L 4 .   ? -0.654  13.079 83.919  1.00 32.45 ? 402 HOH B O     1 
HETATM 8821 O  O     . HOH L 4 .   ? 4.029   2.327  76.553  1.00 40.55 ? 403 HOH B O     1 
HETATM 8822 O  O     . HOH L 4 .   ? 10.115  26.946 75.697  1.00 34.93 ? 404 HOH B O     1 
HETATM 8823 O  O     . HOH L 4 .   ? 1.869   28.980 90.709  1.00 36.82 ? 405 HOH B O     1 
HETATM 8824 O  O     . HOH L 4 .   ? 22.596  28.844 80.176  1.00 33.57 ? 406 HOH B O     1 
HETATM 8825 O  O     . HOH M 4 .   ? 20.773  65.848 106.504 1.00 18.91 ? 298 HOH C O     1 
HETATM 8826 O  O     . HOH M 4 .   ? 11.134  50.374 103.828 1.00 34.15 ? 299 HOH C O     1 
HETATM 8827 O  O     . HOH M 4 .   ? 33.447  67.660 100.975 1.00 27.86 ? 300 HOH C O     1 
HETATM 8828 O  O     . HOH M 4 .   ? 23.062  53.117 91.711  1.00 23.86 ? 301 HOH C O     1 
HETATM 8829 O  O     . HOH M 4 .   ? 49.421  63.163 109.191 1.00 41.26 ? 302 HOH C O     1 
HETATM 8830 O  O     . HOH M 4 .   ? 27.705  75.416 112.767 1.00 26.45 ? 303 HOH C O     1 
HETATM 8831 O  O     . HOH M 4 .   ? 27.973  76.276 106.440 1.00 23.93 ? 304 HOH C O     1 
HETATM 8832 O  O     . HOH M 4 .   ? 24.699  53.661 89.203  1.00 25.49 ? 305 HOH C O     1 
HETATM 8833 O  O     . HOH M 4 .   ? 20.464  60.773 107.958 1.00 26.65 ? 306 HOH C O     1 
HETATM 8834 O  O     . HOH M 4 .   ? 29.437  55.005 96.623  1.00 32.01 ? 307 HOH C O     1 
HETATM 8835 O  O     . HOH M 4 .   ? 33.625  85.933 94.415  1.00 32.74 ? 308 HOH C O     1 
HETATM 8836 O  O     . HOH M 4 .   ? 22.221  74.462 82.684  1.00 31.00 ? 309 HOH C O     1 
HETATM 8837 O  O     . HOH M 4 .   ? 31.217  59.088 101.209 1.00 30.65 ? 310 HOH C O     1 
HETATM 8838 O  O     . HOH M 4 .   ? 42.037  60.017 107.126 1.00 50.77 ? 311 HOH C O     1 
HETATM 8839 O  O     . HOH M 4 .   ? 14.883  54.642 86.030  1.00 36.85 ? 312 HOH C O     1 
HETATM 8840 O  O     . HOH M 4 .   ? 33.401  56.801 90.996  1.00 30.02 ? 313 HOH C O     1 
HETATM 8841 O  O     . HOH M 4 .   ? 44.831  58.665 85.572  1.00 42.67 ? 314 HOH C O     1 
HETATM 8842 O  O     . HOH M 4 .   ? 20.015  51.848 93.125  1.00 25.23 ? 315 HOH C O     1 
HETATM 8843 O  O     . HOH M 4 .   ? 34.124  64.910 100.280 1.00 26.88 ? 316 HOH C O     1 
HETATM 8844 O  O     . HOH M 4 .   ? 16.016  74.254 108.471 1.00 23.04 ? 317 HOH C O     1 
HETATM 8845 O  O     . HOH M 4 .   ? 17.085  47.743 97.724  1.00 25.49 ? 318 HOH C O     1 
HETATM 8846 O  O     . HOH M 4 .   ? 14.213  70.161 103.074 1.00 25.89 ? 319 HOH C O     1 
HETATM 8847 O  O     . HOH M 4 .   ? 33.215  62.575 101.850 1.00 29.39 ? 320 HOH C O     1 
HETATM 8848 O  O     . HOH M 4 .   ? 14.158  68.292 109.810 1.00 26.80 ? 321 HOH C O     1 
HETATM 8849 O  O     . HOH M 4 .   ? 24.423  63.859 111.831 1.00 25.49 ? 322 HOH C O     1 
HETATM 8850 O  O     . HOH M 4 .   ? 33.556  83.405 100.713 1.00 29.99 ? 323 HOH C O     1 
HETATM 8851 O  O     . HOH M 4 .   ? 18.027  54.964 86.028  1.00 23.21 ? 324 HOH C O     1 
HETATM 8852 O  O     . HOH M 4 .   ? 40.241  53.205 82.660  1.00 27.34 ? 325 HOH C O     1 
HETATM 8853 O  O     . HOH M 4 .   ? 27.167  45.477 96.749  1.00 27.65 ? 326 HOH C O     1 
HETATM 8854 O  O     . HOH M 4 .   ? 26.046  52.564 95.056  1.00 26.28 ? 327 HOH C O     1 
HETATM 8855 O  O     . HOH M 4 .   ? 30.269  65.300 108.642 1.00 41.98 ? 328 HOH C O     1 
HETATM 8856 O  O     . HOH M 4 .   ? 17.785  69.792 85.060  1.00 31.11 ? 329 HOH C O     1 
HETATM 8857 O  O     . HOH M 4 .   ? 26.605  62.625 104.020 1.00 28.90 ? 330 HOH C O     1 
HETATM 8858 O  O     . HOH M 4 .   ? 49.463  71.915 92.985  1.00 51.69 ? 331 HOH C O     1 
HETATM 8859 O  O     . HOH M 4 .   ? 19.110  60.193 105.773 1.00 25.21 ? 332 HOH C O     1 
HETATM 8860 O  O     . HOH M 4 .   ? 43.192  70.882 86.559  1.00 34.35 ? 333 HOH C O     1 
HETATM 8861 O  O     . HOH M 4 .   ? 31.686  67.344 98.938  1.00 26.92 ? 334 HOH C O     1 
HETATM 8862 O  O     . HOH M 4 .   ? 17.640  52.337 86.461  1.00 25.39 ? 335 HOH C O     1 
HETATM 8863 O  O     . HOH M 4 .   ? 35.372  67.416 107.021 1.00 29.25 ? 336 HOH C O     1 
HETATM 8864 O  O     . HOH M 4 .   ? 35.565  54.108 96.473  1.00 31.69 ? 337 HOH C O     1 
HETATM 8865 O  O     . HOH M 4 .   ? 20.737  47.043 98.620  1.00 27.41 ? 338 HOH C O     1 
HETATM 8866 O  O     . HOH M 4 .   ? 39.162  68.433 81.105  1.00 40.67 ? 339 HOH C O     1 
HETATM 8867 O  O     . HOH M 4 .   ? 44.785  68.341 86.551  1.00 36.32 ? 340 HOH C O     1 
HETATM 8868 O  O     . HOH M 4 .   ? 34.219  77.461 109.778 1.00 45.38 ? 341 HOH C O     1 
HETATM 8869 O  O     . HOH M 4 .   ? 14.910  70.629 111.165 1.00 35.86 ? 342 HOH C O     1 
HETATM 8870 O  O     . HOH M 4 .   ? 22.264  46.802 95.309  1.00 27.37 ? 343 HOH C O     1 
HETATM 8871 O  O     . HOH M 4 .   ? 28.082  82.146 103.618 1.00 27.63 ? 344 HOH C O     1 
HETATM 8872 O  O     . HOH M 4 .   ? 12.955  82.058 95.663  1.00 32.57 ? 345 HOH C O     1 
HETATM 8873 O  O     . HOH M 4 .   ? 16.421  77.488 92.105  1.00 30.19 ? 346 HOH C O     1 
HETATM 8874 O  O     . HOH M 4 .   ? 10.983  48.118 90.868  1.00 32.34 ? 347 HOH C O     1 
HETATM 8875 O  O     . HOH M 4 .   ? 36.256  60.202 102.925 1.00 37.75 ? 348 HOH C O     1 
HETATM 8876 O  O     . HOH M 4 .   ? 13.923  68.172 99.939  1.00 29.36 ? 349 HOH C O     1 
HETATM 8877 O  O     . HOH M 4 .   ? 30.692  58.336 90.525  1.00 31.56 ? 350 HOH C O     1 
HETATM 8878 O  O     . HOH M 4 .   ? 17.948  67.520 82.291  1.00 36.77 ? 351 HOH C O     1 
HETATM 8879 O  O     . HOH M 4 .   ? 12.478  71.732 95.400  1.00 29.81 ? 352 HOH C O     1 
HETATM 8880 O  O     . HOH M 4 .   ? 13.996  50.602 115.512 1.00 35.98 ? 353 HOH C O     1 
HETATM 8881 O  O     . HOH M 4 .   ? 23.481  42.433 88.722  1.00 55.12 ? 354 HOH C O     1 
HETATM 8882 O  O     . HOH M 4 .   ? 10.808  44.425 96.825  1.00 37.69 ? 355 HOH C O     1 
HETATM 8883 O  O     . HOH M 4 .   ? 26.324  43.423 90.576  1.00 40.42 ? 356 HOH C O     1 
HETATM 8884 O  O     . HOH M 4 .   ? 13.036  47.264 98.071  1.00 39.27 ? 357 HOH C O     1 
HETATM 8885 O  O     . HOH M 4 .   ? 12.435  69.926 93.477  1.00 31.12 ? 358 HOH C O     1 
HETATM 8886 O  O     . HOH M 4 .   ? 13.426  48.220 82.587  1.00 33.74 ? 359 HOH C O     1 
HETATM 8887 O  O     . HOH M 4 .   ? 29.880  61.451 101.566 1.00 33.84 ? 360 HOH C O     1 
HETATM 8888 O  O     . HOH M 4 .   ? 45.726  75.147 101.680 1.00 38.26 ? 361 HOH C O     1 
HETATM 8889 O  O     . HOH M 4 .   ? 22.473  45.129 97.383  1.00 31.16 ? 362 HOH C O     1 
HETATM 8890 O  O     . HOH M 4 .   ? 17.013  72.406 86.216  1.00 34.78 ? 363 HOH C O     1 
HETATM 8891 O  O     . HOH M 4 .   ? 14.441  72.828 110.081 1.00 30.19 ? 364 HOH C O     1 
HETATM 8892 O  O     . HOH M 4 .   ? 22.857  52.468 76.984  1.00 35.39 ? 365 HOH C O     1 
HETATM 8893 O  O     . HOH M 4 .   ? 37.609  84.277 94.691  1.00 34.65 ? 366 HOH C O     1 
HETATM 8894 O  O     . HOH M 4 .   ? 26.016  56.773 98.084  1.00 28.37 ? 367 HOH C O     1 
HETATM 8895 O  O     . HOH M 4 .   ? 47.824  74.891 99.741  1.00 45.65 ? 368 HOH C O     1 
HETATM 8896 O  O     . HOH M 4 .   ? 12.743  63.681 86.845  1.00 32.39 ? 369 HOH C O     1 
HETATM 8897 O  O     . HOH M 4 .   ? 17.996  57.931 106.442 1.00 28.84 ? 370 HOH C O     1 
HETATM 8898 O  O     . HOH M 4 .   ? 36.005  52.776 94.209  1.00 32.13 ? 371 HOH C O     1 
HETATM 8899 O  O     . HOH M 4 .   ? 15.122  66.986 115.735 1.00 34.01 ? 372 HOH C O     1 
HETATM 8900 O  O     . HOH M 4 .   ? 25.230  71.651 116.232 1.00 33.89 ? 373 HOH C O     1 
HETATM 8901 O  O     . HOH M 4 .   ? 30.372  73.502 72.912  1.00 38.81 ? 374 HOH C O     1 
HETATM 8902 O  O     . HOH M 4 .   ? 28.076  59.430 73.891  1.00 41.11 ? 375 HOH C O     1 
HETATM 8903 O  O     . HOH M 4 .   ? 30.190  47.034 97.415  1.00 34.35 ? 376 HOH C O     1 
HETATM 8904 O  O     . HOH M 4 .   ? 27.147  72.971 114.040 1.00 36.47 ? 377 HOH C O     1 
HETATM 8905 O  O     . HOH M 4 .   ? 29.089  56.681 113.870 1.00 37.10 ? 378 HOH C O     1 
HETATM 8906 O  O     . HOH M 4 .   ? 23.392  81.126 110.900 1.00 30.50 ? 379 HOH C O     1 
HETATM 8907 O  O     . HOH M 4 .   ? 30.543  82.191 104.549 1.00 32.06 ? 380 HOH C O     1 
HETATM 8908 O  O     . HOH M 4 .   ? 19.175  39.340 84.416  1.00 36.21 ? 381 HOH C O     1 
HETATM 8909 O  O     . HOH M 4 .   ? 12.297  58.621 87.623  1.00 37.13 ? 382 HOH C O     1 
HETATM 8910 O  O     . HOH M 4 .   ? 27.563  59.671 113.857 1.00 43.79 ? 383 HOH C O     1 
HETATM 8911 O  O     . HOH M 4 .   ? 31.862  48.200 83.646  1.00 47.63 ? 384 HOH C O     1 
HETATM 8912 O  O     . HOH M 4 .   ? 28.586  55.938 98.864  1.00 37.69 ? 385 HOH C O     1 
HETATM 8913 O  O     . HOH M 4 .   ? 39.923  49.413 89.026  1.00 35.85 ? 386 HOH C O     1 
HETATM 8914 O  O     . HOH M 4 .   ? 29.619  68.133 109.701 1.00 41.35 ? 387 HOH C O     1 
HETATM 8915 O  O     . HOH M 4 .   ? 31.058  64.718 100.170 1.00 37.82 ? 388 HOH C O     1 
HETATM 8916 O  O     . HOH M 4 .   ? 22.663  86.420 98.743  1.00 49.99 ? 389 HOH C O     1 
HETATM 8917 O  O     . HOH M 4 .   ? 19.779  43.809 84.457  1.00 38.15 ? 390 HOH C O     1 
HETATM 8918 O  O     . HOH M 4 .   ? 32.305  76.750 104.404 1.00 29.83 ? 391 HOH C O     1 
HETATM 8919 O  O     . HOH M 4 .   ? 13.465  67.237 106.657 1.00 40.17 ? 392 HOH C O     1 
HETATM 8920 O  O     . HOH M 4 .   ? 28.673  68.994 112.869 1.00 35.62 ? 393 HOH C O     1 
HETATM 8921 O  O     . HOH M 4 .   ? 34.698  85.601 90.384  1.00 33.40 ? 394 HOH C O     1 
HETATM 8922 O  O     . HOH M 4 .   ? 44.642  74.556 92.977  1.00 33.56 ? 395 HOH C O     1 
HETATM 8923 O  O     . HOH M 4 .   ? 24.757  86.590 96.478  1.00 38.35 ? 396 HOH C O     1 
HETATM 8924 O  O     . HOH M 4 .   ? 26.245  61.039 106.874 1.00 30.51 ? 397 HOH C O     1 
HETATM 8925 O  O     . HOH M 4 .   ? 49.027  62.183 94.670  1.00 39.24 ? 398 HOH C O     1 
HETATM 8926 O  O     . HOH N 4 .   ? -26.978 59.250 61.152  1.00 24.52 ? 298 HOH D O     1 
HETATM 8927 O  O     . HOH N 4 .   ? -22.226 61.226 65.391  1.00 26.86 ? 299 HOH D O     1 
HETATM 8928 O  O     . HOH N 4 .   ? 9.032   62.443 64.989  1.00 45.23 ? 300 HOH D O     1 
HETATM 8929 O  O     . HOH N 4 .   ? -11.278 43.753 55.491  1.00 30.99 ? 301 HOH D O     1 
HETATM 8930 O  O     . HOH N 4 .   ? -20.939 60.811 54.563  1.00 22.91 ? 302 HOH D O     1 
HETATM 8931 O  O     . HOH N 4 .   ? -22.669 64.801 61.140  1.00 30.03 ? 303 HOH D O     1 
HETATM 8932 O  O     . HOH N 4 .   ? -19.927 56.537 70.189  1.00 30.19 ? 304 HOH D O     1 
HETATM 8933 O  O     . HOH N 4 .   ? -11.882 40.365 65.786  1.00 30.77 ? 305 HOH D O     1 
HETATM 8934 O  O     . HOH N 4 .   ? -8.002  61.275 44.588  1.00 36.13 ? 306 HOH D O     1 
HETATM 8935 O  O     . HOH N 4 .   ? -14.476 57.513 44.943  1.00 27.06 ? 307 HOH D O     1 
HETATM 8936 O  O     . HOH N 4 .   ? -20.661 55.467 49.002  1.00 42.71 ? 308 HOH D O     1 
HETATM 8937 O  O     . HOH N 4 .   ? -16.300 56.457 73.539  1.00 36.74 ? 309 HOH D O     1 
HETATM 8938 O  O     . HOH N 4 .   ? 1.625   53.356 70.712  1.00 34.67 ? 310 HOH D O     1 
HETATM 8939 O  O     . HOH N 4 .   ? -18.570 60.109 72.148  1.00 29.76 ? 311 HOH D O     1 
HETATM 8940 O  O     . HOH N 4 .   ? -21.128 66.027 59.297  1.00 31.79 ? 312 HOH D O     1 
HETATM 8941 O  O     . HOH N 4 .   ? -6.307  32.907 62.564  1.00 33.62 ? 313 HOH D O     1 
HETATM 8942 O  O     . HOH N 4 .   ? -4.108  54.619 58.522  1.00 30.57 ? 314 HOH D O     1 
HETATM 8943 O  O     . HOH N 4 .   ? 12.742  37.757 78.418  1.00 27.00 ? 315 HOH D O     1 
HETATM 8944 O  O     . HOH N 4 .   ? 4.147   54.836 56.192  1.00 36.03 ? 316 HOH D O     1 
HETATM 8945 O  O     . HOH N 4 .   ? -7.589  40.021 53.563  1.00 33.60 ? 317 HOH D O     1 
HETATM 8946 O  O     . HOH N 4 .   ? -2.627  57.834 76.522  1.00 36.22 ? 318 HOH D O     1 
HETATM 8947 O  O     . HOH N 4 .   ? -5.326  41.413 54.298  1.00 33.69 ? 319 HOH D O     1 
HETATM 8948 O  O     . HOH N 4 .   ? -12.632 45.710 57.990  1.00 31.47 ? 320 HOH D O     1 
HETATM 8949 O  O     . HOH N 4 .   ? -13.947 55.469 43.340  1.00 30.79 ? 321 HOH D O     1 
HETATM 8950 O  O     . HOH N 4 .   ? 1.178   45.491 73.303  1.00 37.76 ? 322 HOH D O     1 
HETATM 8951 O  O     . HOH N 4 .   ? 3.233   48.359 71.033  1.00 35.87 ? 323 HOH D O     1 
HETATM 8952 O  O     . HOH N 4 .   ? -5.577  31.494 65.183  1.00 36.84 ? 324 HOH D O     1 
HETATM 8953 O  O     . HOH N 4 .   ? -24.562 47.950 46.008  1.00 34.98 ? 325 HOH D O     1 
HETATM 8954 O  O     . HOH N 4 .   ? -24.855 61.180 66.463  1.00 34.85 ? 326 HOH D O     1 
HETATM 8955 O  O     . HOH N 4 .   ? -8.808  33.962 67.106  1.00 36.66 ? 327 HOH D O     1 
HETATM 8956 O  O     . HOH N 4 .   ? -2.015  52.195 63.497  1.00 40.13 ? 328 HOH D O     1 
HETATM 8957 O  O     . HOH N 4 .   ? -21.502 47.346 73.715  1.00 34.24 ? 329 HOH D O     1 
HETATM 8958 O  O     . HOH N 4 .   ? -2.356  52.288 56.361  1.00 27.46 ? 330 HOH D O     1 
HETATM 8959 O  O     . HOH N 4 .   ? -14.095 55.392 72.695  1.00 28.48 ? 331 HOH D O     1 
HETATM 8960 O  O     . HOH N 4 .   ? -28.175 55.806 66.992  1.00 34.64 ? 332 HOH D O     1 
HETATM 8961 O  O     . HOH N 4 .   ? -13.985 40.860 64.078  1.00 32.06 ? 333 HOH D O     1 
HETATM 8962 O  O     . HOH N 4 .   ? -1.815  54.925 57.047  1.00 37.84 ? 334 HOH D O     1 
HETATM 8963 O  O     . HOH N 4 .   ? 9.879   38.941 78.830  1.00 31.24 ? 335 HOH D O     1 
HETATM 8964 O  O     . HOH N 4 .   ? -31.298 52.620 49.079  1.00 36.77 ? 336 HOH D O     1 
HETATM 8965 O  O     . HOH N 4 .   ? -5.492  34.306 69.119  1.00 46.83 ? 337 HOH D O     1 
HETATM 8966 O  O     . HOH N 4 .   ? -2.603  38.781 80.171  1.00 47.27 ? 338 HOH D O     1 
HETATM 8967 O  O     . HOH N 4 .   ? 6.790   50.416 62.553  1.00 49.33 ? 339 HOH D O     1 
HETATM 8968 O  O     . HOH N 4 .   ? -23.634 42.843 49.978  1.00 34.96 ? 340 HOH D O     1 
HETATM 8969 O  O     . HOH N 4 .   ? 9.521   41.062 80.507  1.00 43.64 ? 341 HOH D O     1 
HETATM 8970 O  O     . HOH N 4 .   ? 0.852   47.865 72.081  1.00 40.42 ? 342 HOH D O     1 
HETATM 8971 O  O     . HOH N 4 .   ? -0.904  41.463 54.588  1.00 31.09 ? 343 HOH D O     1 
HETATM 8972 O  O     . HOH N 4 .   ? -13.444 64.780 72.445  1.00 36.28 ? 344 HOH D O     1 
HETATM 8973 O  O     . HOH N 4 .   ? -14.002 74.073 57.817  1.00 44.00 ? 345 HOH D O     1 
HETATM 8974 O  O     . HOH N 4 .   ? -5.546  44.018 63.937  1.00 39.47 ? 346 HOH D O     1 
HETATM 8975 O  O     . HOH N 4 .   ? -20.813 63.400 62.594  1.00 31.81 ? 347 HOH D O     1 
HETATM 8976 O  O     . HOH N 4 .   ? -6.876  35.021 72.925  1.00 42.06 ? 348 HOH D O     1 
HETATM 8977 O  O     . HOH N 4 .   ? -7.169  34.147 76.545  1.00 37.40 ? 349 HOH D O     1 
HETATM 8978 O  O     . HOH N 4 .   ? -11.304 39.060 69.129  1.00 36.56 ? 350 HOH D O     1 
HETATM 8979 O  O     . HOH N 4 .   ? -20.185 57.618 46.583  1.00 37.15 ? 351 HOH D O     1 
HETATM 8980 O  O     . HOH N 4 .   ? -18.136 39.210 70.409  1.00 44.08 ? 352 HOH D O     1 
HETATM 8981 O  O     . HOH N 4 .   ? -0.546  50.189 57.476  1.00 38.89 ? 353 HOH D O     1 
HETATM 8982 O  O     . HOH N 4 .   ? 0.200   45.008 55.506  1.00 34.12 ? 354 HOH D O     1 
HETATM 8983 O  O     . HOH N 4 .   ? -8.568  72.943 55.217  1.00 40.88 ? 355 HOH D O     1 
HETATM 8984 O  O     . HOH N 4 .   ? 0.294   49.931 64.595  1.00 37.69 ? 356 HOH D O     1 
HETATM 8985 O  O     . HOH N 4 .   ? 6.610   48.904 69.176  1.00 38.56 ? 357 HOH D O     1 
HETATM 8986 O  O     . HOH N 4 .   ? 1.125   64.096 58.912  1.00 35.55 ? 358 HOH D O     1 
HETATM 8987 O  O     . HOH N 4 .   ? -10.283 44.981 60.656  1.00 33.22 ? 359 HOH D O     1 
HETATM 8988 O  O     . HOH N 4 .   ? -8.085  71.087 51.415  1.00 44.41 ? 360 HOH D O     1 
HETATM 8989 O  O     . HOH N 4 .   ? 2.444   63.870 63.142  1.00 33.96 ? 361 HOH D O     1 
HETATM 8990 O  O     . HOH N 4 .   ? -24.797 53.719 66.670  1.00 40.15 ? 362 HOH D O     1 
HETATM 8991 O  O     . HOH N 4 .   ? -23.101 53.971 64.396  1.00 35.00 ? 363 HOH D O     1 
HETATM 8992 O  O     . HOH N 4 .   ? -19.233 31.269 67.604  1.00 45.40 ? 364 HOH D O     1 
HETATM 8993 O  O     . HOH N 4 .   ? -6.550  32.398 67.502  1.00 36.64 ? 365 HOH D O     1 
HETATM 8994 O  O     . HOH N 4 .   ? 7.633   51.494 67.922  1.00 37.44 ? 366 HOH D O     1 
HETATM 8995 O  O     . HOH N 4 .   ? 7.852   48.795 71.489  1.00 41.94 ? 377 HOH D O     1 
HETATM 8996 O  O     . HOH N 4 .   ? -18.551 41.608 69.742  1.00 42.30 ? 379 HOH D O     1 
HETATM 8997 O  O     . HOH N 4 .   ? -18.462 60.823 41.179  1.00 25.01 ? 386 HOH D O     1 
HETATM 8998 O  O     . HOH N 4 .   ? -17.626 62.456 55.215  1.00 45.95 ? 387 HOH D O     1 
HETATM 8999 O  O     . HOH N 4 .   ? -17.357 61.504 39.064  1.00 40.60 ? 388 HOH D O     1 
HETATM 9000 O  O     . HOH N 4 .   ? -18.059 64.752 56.392  1.00 38.07 ? 389 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   -3  ?   ?   ?   A . n 
A 1 2   SER 2   -2  -2  SER SER A . n 
A 1 3   LEU 3   -1  -1  LEU LEU A . n 
A 1 4   ARG 4   2   2   ARG ARG A . n 
A 1 5   VAL 5   3   3   VAL VAL A . n 
A 1 6   TYR 6   4   4   TYR TYR A . n 
A 1 7   VAL 7   5   5   VAL VAL A . n 
A 1 8   THR 8   6   6   THR THR A . n 
A 1 9   GLY 9   7   7   GLY GLY A . n 
A 1 10  ASN 10  8   8   ASN ASN A . n 
A 1 11  ILE 11  9   9   ILE ILE A . n 
A 1 12  THR 12  10  10  THR THR A . n 
A 1 13  VAL 13  11  11  VAL VAL A . n 
A 1 14  ASP 14  12  12  ASP ASP A . n 
A 1 15  GLU 15  13  13  GLU GLU A . n 
A 1 16  THR 16  14  14  THR THR A . n 
A 1 17  TRP 17  15  15  TRP TRP A . n 
A 1 18  SER 18  16  16  SER SER A . n 
A 1 19  ILE 19  17  17  ILE ILE A . n 
A 1 20  PRO 20  18  18  PRO PRO A . n 
A 1 21  ASP 21  19  19  ASP ASP A . n 
A 1 22  ILE 22  20  20  ILE ILE A . n 
A 1 23  PRO 23  21  21  PRO PRO A . n 
A 1 24  LYS 24  22  22  LYS LYS A . n 
A 1 25  LYS 25  23  23  LYS LYS A . n 
A 1 26  GLY 26  24  24  GLY GLY A . n 
A 1 27  ALA 27  25  25  ALA ALA A . n 
A 1 28  SER 28  26  26  SER SER A . n 
A 1 29  ILE 29  27  27  ILE ILE A . n 
A 1 30  HIS 30  28  28  HIS HIS A . n 
A 1 31  GLY 31  29  29  GLY GLY A . n 
A 1 32  VAL 32  30  30  VAL VAL A . n 
A 1 33  LYS 33  31  31  LYS LYS A . n 
A 1 34  VAL 34  32  32  VAL VAL A . n 
A 1 35  SER 35  33  33  SER SER A . n 
A 1 36  GLN 36  34  34  GLN GLN A . n 
A 1 37  ASP 37  35  35  ASP ASP A . n 
A 1 38  ILE 38  36  36  ILE ILE A . n 
A 1 39  GLY 39  37  37  GLY GLY A . n 
A 1 40  GLY 40  38  38  GLY GLY A . n 
A 1 41  LYS 41  39  39  LYS LYS A . n 
A 1 42  GLY 42  40  40  GLY GLY A . n 
A 1 43  ALA 43  41  41  ALA ALA A . n 
A 1 44  ASN 44  42  42  ASN ASN A . n 
A 1 45  GLN 45  43  43  GLN GLN A . n 
A 1 46  ALA 46  44  44  ALA ALA A . n 
A 1 47  ILE 47  45  45  ILE ILE A . n 
A 1 48  ILE 48  46  46  ILE ILE A . n 
A 1 49  LEU 49  47  47  LEU LEU A . n 
A 1 50  SER 50  48  48  SER SER A . n 
A 1 51  ARG 51  49  49  ARG ARG A . n 
A 1 52  CYS 52  50  50  CYS CYS A . n 
A 1 53  GLY 53  51  51  GLY GLY A . n 
A 1 54  ILE 54  52  52  ILE ILE A . n 
A 1 55  GLU 55  53  53  GLU GLU A . n 
A 1 56  THR 56  54  54  THR THR A . n 
A 1 57  ARG 57  55  55  ARG ARG A . n 
A 1 58  LEU 58  56  56  LEU LEU A . n 
A 1 59  ILE 59  57  57  ILE ILE A . n 
A 1 60  ALA 60  58  58  ALA ALA A . n 
A 1 61  ALA 61  59  59  ALA ALA A . n 
A 1 62  THR 62  60  60  THR THR A . n 
A 1 63  GLY 63  61  61  GLY GLY A . n 
A 1 64  ASN 64  62  62  ASN ASN A . n 
A 1 65  ASP 65  63  63  ASP ASP A . n 
A 1 66  SER 66  64  64  SER SER A . n 
A 1 67  ASN 67  65  65  ASN ASN A . n 
A 1 68  GLY 68  66  66  GLY GLY A . n 
A 1 69  ALA 69  67  67  ALA ALA A . n 
A 1 70  TRP 70  68  68  TRP TRP A . n 
A 1 71  ILE 71  69  69  ILE ILE A . n 
A 1 72  ARG 72  70  70  ARG ARG A . n 
A 1 73  GLN 73  71  71  GLN GLN A . n 
A 1 74  GLN 74  72  72  GLN GLN A . n 
A 1 75  ILE 75  73  73  ILE ILE A . n 
A 1 76  LYS 76  74  74  LYS LYS A . n 
A 1 77  ASN 77  75  75  ASN ASN A . n 
A 1 78  GLU 78  76  76  GLU GLU A . n 
A 1 79  PRO 79  77  77  PRO PRO A . n 
A 1 80  LEU 80  78  78  LEU LEU A . n 
A 1 81  MSE 81  79  79  MSE MSE A . n 
A 1 82  LEU 82  80  80  LEU LEU A . n 
A 1 83  LEU 83  81  81  LEU LEU A . n 
A 1 84  PRO 84  82  82  PRO PRO A . n 
A 1 85  ASP 85  83  83  ASP ASP A . n 
A 1 86  GLY 86  84  84  GLY GLY A . n 
A 1 87  HIS 87  85  85  HIS HIS A . n 
A 1 88  PHE 88  86  86  PHE PHE A . n 
A 1 89  ASN 89  87  87  ASN ASN A . n 
A 1 90  GLN 90  88  88  GLN GLN A . n 
A 1 91  HIS 91  89  89  HIS HIS A . n 
A 1 92  SER 92  90  90  SER SER A . n 
A 1 93  ASP 93  91  91  ASP ASP A . n 
A 1 94  THR 94  92  92  THR THR A . n 
A 1 95  SER 95  93  93  SER SER A . n 
A 1 96  ILE 96  94  94  ILE ILE A . n 
A 1 97  ILE 97  95  95  ILE ILE A . n 
A 1 98  LEU 98  96  96  LEU LEU A . n 
A 1 99  ASN 99  97  97  ASN ASN A . n 
A 1 100 SER 100 98  98  SER SER A . n 
A 1 101 ALA 101 99  99  ALA ALA A . n 
A 1 102 ASP 102 100 100 ASP ASP A . n 
A 1 103 GLY 103 101 101 GLY GLY A . n 
A 1 104 ASP 104 102 102 ASP ASP A . n 
A 1 105 ASN 105 103 103 ASN ASN A . n 
A 1 106 ALA 106 104 104 ALA ALA A . n 
A 1 107 ILE 107 105 105 ILE ILE A . n 
A 1 108 ILE 108 106 106 ILE ILE A . n 
A 1 109 THR 109 107 107 THR THR A . n 
A 1 110 THR 110 108 108 THR THR A . n 
A 1 111 THR 111 109 109 THR THR A . n 
A 1 112 ALA 112 110 110 ALA ALA A . n 
A 1 113 ALA 113 111 111 ALA ALA A . n 
A 1 114 ALA 114 112 112 ALA ALA A . n 
A 1 115 ASP 115 113 113 ASP ASP A . n 
A 1 116 THR 116 114 114 THR THR A . n 
A 1 117 PHE 117 115 115 PHE PHE A . n 
A 1 118 SER 118 116 116 SER SER A . n 
A 1 119 LEU 119 117 117 LEU LEU A . n 
A 1 120 ASP 120 118 118 ASP ASP A . n 
A 1 121 GLU 121 119 119 GLU GLU A . n 
A 1 122 MSE 122 120 120 MSE MSE A . n 
A 1 123 ILE 123 121 121 ILE ILE A . n 
A 1 124 PRO 124 122 122 PRO PRO A . n 
A 1 125 HIS 125 123 123 HIS HIS A . n 
A 1 126 MSE 126 124 124 MSE MSE A . n 
A 1 127 ALA 127 125 125 ALA ALA A . n 
A 1 128 ASP 128 126 126 ASP ASP A . n 
A 1 129 ALA 129 127 127 ALA ALA A . n 
A 1 130 VAL 130 128 128 VAL VAL A . n 
A 1 131 ALA 131 129 129 ALA ALA A . n 
A 1 132 GLY 132 130 130 GLY GLY A . n 
A 1 133 ASP 133 131 131 ASP ASP A . n 
A 1 134 ILE 134 132 132 ILE ILE A . n 
A 1 135 LEU 135 133 133 LEU LEU A . n 
A 1 136 LEU 136 134 134 LEU LEU A . n 
A 1 137 GLN 137 135 135 GLN GLN A . n 
A 1 138 GLN 138 136 136 GLN GLN A . n 
A 1 139 GLY 139 137 137 GLY GLY A . n 
A 1 140 ASN 140 138 138 ASN ASN A . n 
A 1 141 PHE 141 139 139 PHE PHE A . n 
A 1 142 SER 142 140 140 SER SER A . n 
A 1 143 LEU 143 141 141 LEU LEU A . n 
A 1 144 ASP 144 142 142 ASP ASP A . n 
A 1 145 LYS 145 143 143 LYS LYS A . n 
A 1 146 THR 146 144 144 THR THR A . n 
A 1 147 ARG 147 145 145 ARG ARG A . n 
A 1 148 ALA 148 146 146 ALA ALA A . n 
A 1 149 LEU 149 147 147 LEU LEU A . n 
A 1 150 PHE 150 148 148 PHE PHE A . n 
A 1 151 GLN 151 149 149 GLN GLN A . n 
A 1 152 TYR 152 150 150 TYR TYR A . n 
A 1 153 ALA 153 151 151 ALA ALA A . n 
A 1 154 ARG 154 152 152 ARG ARG A . n 
A 1 155 SER 155 153 153 SER SER A . n 
A 1 156 ARG 156 154 154 ARG ARG A . n 
A 1 157 GLY 157 155 155 GLY GLY A . n 
A 1 158 MSE 158 156 156 MSE MSE A . n 
A 1 159 THR 159 157 157 THR THR A . n 
A 1 160 THR 160 158 158 THR THR A . n 
A 1 161 VAL 161 159 159 VAL VAL A . n 
A 1 162 PHE 162 160 160 PHE PHE A . n 
A 1 163 ASN 163 161 161 ASN ASN A . n 
A 1 164 PRO 164 162 162 PRO PRO A . n 
A 1 165 SER 165 163 163 SER SER A . n 
A 1 166 PRO 166 164 164 PRO PRO A . n 
A 1 167 VAL 167 165 165 VAL VAL A . n 
A 1 168 ASN 168 166 166 ASN ASN A . n 
A 1 169 PRO 169 167 167 PRO PRO A . n 
A 1 170 ASP 170 168 168 ASP ASP A . n 
A 1 171 PHE 171 169 169 PHE PHE A . n 
A 1 172 CYS 172 170 170 CYS CYS A . n 
A 1 173 HIS 173 171 171 HIS HIS A . n 
A 1 174 LEU 174 172 172 LEU LEU A . n 
A 1 175 TRP 175 173 173 TRP TRP A . n 
A 1 176 PRO 176 174 174 PRO PRO A . n 
A 1 177 LEU 177 175 175 LEU LEU A . n 
A 1 178 ILE 178 176 176 ILE ILE A . n 
A 1 179 ASP 179 177 177 ASP ASP A . n 
A 1 180 ILE 180 178 178 ILE ILE A . n 
A 1 181 ALA 181 179 179 ALA ALA A . n 
A 1 182 VAL 182 180 180 VAL VAL A . n 
A 1 183 VAL 183 181 181 VAL VAL A . n 
A 1 184 ASN 184 182 182 ASN ASN A . n 
A 1 185 GLU 185 183 183 GLU GLU A . n 
A 1 186 SER 186 184 184 SER SER A . n 
A 1 187 GLU 187 185 185 GLU GLU A . n 
A 1 188 ALA 188 186 186 ALA ALA A . n 
A 1 189 GLU 189 187 187 GLU GLU A . n 
A 1 190 LEU 190 188 188 LEU LEU A . n 
A 1 191 LEU 191 189 189 LEU LEU A . n 
A 1 192 GLN 192 190 190 GLN GLN A . n 
A 1 193 PRO 193 191 191 PRO PRO A . n 
A 1 194 TYR 194 192 192 TYR TYR A . n 
A 1 195 GLY 195 193 193 GLY GLY A . n 
A 1 196 VAL 196 194 194 VAL VAL A . n 
A 1 197 LYS 197 195 195 LYS LYS A . n 
A 1 198 THR 198 196 196 THR THR A . n 
A 1 199 LEU 199 197 197 LEU LEU A . n 
A 1 200 VAL 200 198 198 VAL VAL A . n 
A 1 201 ILE 201 199 199 ILE ILE A . n 
A 1 202 THR 202 200 200 THR THR A . n 
A 1 203 GLN 203 201 201 GLN GLN A . n 
A 1 204 GLY 204 202 202 GLY GLY A . n 
A 1 205 ALA 205 203 203 ALA ALA A . n 
A 1 206 ALA 206 204 204 ALA ALA A . n 
A 1 207 GLY 207 205 205 GLY GLY A . n 
A 1 208 ALA 208 206 206 ALA ALA A . n 
A 1 209 TRP 209 207 207 TRP TRP A . n 
A 1 210 LEU 210 208 208 LEU LEU A . n 
A 1 211 VAL 211 209 209 VAL VAL A . n 
A 1 212 GLN 212 210 210 GLN GLN A . n 
A 1 213 GLU 213 211 211 GLU GLU A . n 
A 1 214 GLY 214 212 212 GLY GLY A . n 
A 1 215 GLN 215 213 213 GLN GLN A . n 
A 1 216 ARG 216 214 214 ARG ARG A . n 
A 1 217 GLN 217 215 215 GLN GLN A . n 
A 1 218 PHE 218 216 216 PHE PHE A . n 
A 1 219 CYS 219 217 217 CYS CYS A . n 
A 1 220 PRO 220 218 218 PRO PRO A . n 
A 1 221 ALA 221 219 219 ALA ALA A . n 
A 1 222 VAL 222 220 220 VAL VAL A . n 
A 1 223 PRO 223 221 221 PRO PRO A . n 
A 1 224 ALA 224 222 222 ALA ALA A . n 
A 1 225 GLU 225 223 223 GLU GLU A . n 
A 1 226 ALA 226 224 224 ALA ALA A . n 
A 1 227 LEU 227 225 225 LEU LEU A . n 
A 1 228 ASP 228 226 226 ASP ASP A . n 
A 1 229 THR 229 227 227 THR THR A . n 
A 1 230 THR 230 228 228 THR THR A . n 
A 1 231 GLY 231 229 229 GLY GLY A . n 
A 1 232 ALA 232 230 230 ALA ALA A . n 
A 1 233 GLY 233 231 231 GLY GLY A . n 
A 1 234 ASP 234 232 232 ASP ASP A . n 
A 1 235 THR 235 233 233 THR THR A . n 
A 1 236 PHE 236 234 234 PHE PHE A . n 
A 1 237 LEU 237 235 235 LEU LEU A . n 
A 1 238 ALA 238 236 236 ALA ALA A . n 
A 1 239 VAL 239 237 237 VAL VAL A . n 
A 1 240 MSE 240 238 238 MSE MSE A . n 
A 1 241 LEU 241 239 239 LEU LEU A . n 
A 1 242 ALA 242 240 240 ALA ALA A . n 
A 1 243 SER 243 241 241 SER SER A . n 
A 1 244 ALA 244 242 242 ALA ALA A . n 
A 1 245 LEU 245 243 243 LEU LEU A . n 
A 1 246 LEU 246 244 244 LEU LEU A . n 
A 1 247 ARG 247 245 245 ARG ARG A . n 
A 1 248 GLY 248 246 246 GLY GLY A . n 
A 1 249 VAL 249 247 247 VAL VAL A . n 
A 1 250 ALA 250 248 248 ALA ALA A . n 
A 1 251 PRO 251 249 249 PRO PRO A . n 
A 1 252 ASP 252 250 250 ASP ASP A . n 
A 1 253 ALA 253 251 251 ALA ALA A . n 
A 1 254 LEU 254 252 252 LEU LEU A . n 
A 1 255 ALA 255 253 253 ALA ALA A . n 
A 1 256 LEU 256 254 254 LEU LEU A . n 
A 1 257 ALA 257 255 255 ALA ALA A . n 
A 1 258 HIS 258 256 256 HIS HIS A . n 
A 1 259 ALA 259 257 257 ALA ALA A . n 
A 1 260 SER 260 258 258 SER SER A . n 
A 1 261 ARG 261 259 259 ARG ARG A . n 
A 1 262 ALA 262 260 260 ALA ALA A . n 
A 1 263 ALA 263 261 261 ALA ALA A . n 
A 1 264 ALA 264 262 262 ALA ALA A . n 
A 1 265 ILE 265 263 263 ILE ILE A . n 
A 1 266 THR 266 264 264 THR THR A . n 
A 1 267 VAL 267 265 265 VAL VAL A . n 
A 1 268 SER 268 266 266 SER SER A . n 
A 1 269 ARG 269 267 267 ARG ARG A . n 
A 1 270 ARG 270 268 268 ARG ARG A . n 
A 1 271 GLY 271 269 269 GLY GLY A . n 
A 1 272 THR 272 270 270 THR THR A . n 
A 1 273 LEU 273 271 271 LEU LEU A . n 
A 1 274 SER 274 272 272 SER SER A . n 
A 1 275 ALA 275 273 273 ALA ALA A . n 
A 1 276 PHE 276 274 274 PHE PHE A . n 
A 1 277 PRO 277 275 275 PRO PRO A . n 
A 1 278 GLY 278 276 276 GLY GLY A . n 
A 1 279 SER 279 277 277 SER SER A . n 
A 1 280 ARG 280 278 278 ARG ARG A . n 
A 1 281 GLU 281 279 279 GLU GLU A . n 
A 1 282 LEU 282 280 280 LEU LEU A . n 
A 1 283 ALA 283 281 281 ALA ALA A . n 
A 1 284 ALA 284 282 282 ALA ALA A . n 
A 1 285 LEU 285 283 283 LEU LEU A . n 
A 1 286 LEU 286 284 284 LEU LEU A . n 
A 1 287 THR 287 285 285 THR THR A . n 
A 1 288 THR 288 286 ?   ?   ?   A . n 
A 1 289 ASP 289 287 ?   ?   ?   A . n 
A 1 290 GLY 290 288 ?   ?   ?   A . n 
A 1 291 ALA 291 289 ?   ?   ?   A . n 
A 1 292 GLU 292 290 ?   ?   ?   A . n 
A 1 293 GLY 293 291 ?   ?   ?   A . n 
A 1 294 HIS 294 292 ?   ?   ?   A . n 
A 1 295 HIS 295 293 ?   ?   ?   A . n 
A 1 296 HIS 296 294 ?   ?   ?   A . n 
A 1 297 HIS 297 295 ?   ?   ?   A . n 
A 1 298 HIS 298 296 ?   ?   ?   A . n 
A 1 299 HIS 299 297 ?   ?   ?   A . n 
B 1 1   MSE 1   -3  ?   ?   ?   B . n 
B 1 2   SER 2   -2  ?   ?   ?   B . n 
B 1 3   LEU 3   -1  -1  LEU LEU B . n 
B 1 4   ARG 4   2   2   ARG ARG B . n 
B 1 5   VAL 5   3   3   VAL VAL B . n 
B 1 6   TYR 6   4   4   TYR TYR B . n 
B 1 7   VAL 7   5   5   VAL VAL B . n 
B 1 8   THR 8   6   6   THR THR B . n 
B 1 9   GLY 9   7   7   GLY GLY B . n 
B 1 10  ASN 10  8   8   ASN ASN B . n 
B 1 11  ILE 11  9   9   ILE ILE B . n 
B 1 12  THR 12  10  10  THR THR B . n 
B 1 13  VAL 13  11  11  VAL VAL B . n 
B 1 14  ASP 14  12  12  ASP ASP B . n 
B 1 15  GLU 15  13  13  GLU GLU B . n 
B 1 16  THR 16  14  14  THR THR B . n 
B 1 17  TRP 17  15  15  TRP TRP B . n 
B 1 18  SER 18  16  16  SER SER B . n 
B 1 19  ILE 19  17  17  ILE ILE B . n 
B 1 20  PRO 20  18  18  PRO PRO B . n 
B 1 21  ASP 21  19  19  ASP ASP B . n 
B 1 22  ILE 22  20  20  ILE ILE B . n 
B 1 23  PRO 23  21  21  PRO PRO B . n 
B 1 24  LYS 24  22  22  LYS LYS B . n 
B 1 25  LYS 25  23  23  LYS LYS B . n 
B 1 26  GLY 26  24  24  GLY GLY B . n 
B 1 27  ALA 27  25  25  ALA ALA B . n 
B 1 28  SER 28  26  26  SER SER B . n 
B 1 29  ILE 29  27  27  ILE ILE B . n 
B 1 30  HIS 30  28  28  HIS HIS B . n 
B 1 31  GLY 31  29  29  GLY GLY B . n 
B 1 32  VAL 32  30  30  VAL VAL B . n 
B 1 33  LYS 33  31  31  LYS LYS B . n 
B 1 34  VAL 34  32  32  VAL VAL B . n 
B 1 35  SER 35  33  33  SER SER B . n 
B 1 36  GLN 36  34  34  GLN GLN B . n 
B 1 37  ASP 37  35  35  ASP ASP B . n 
B 1 38  ILE 38  36  36  ILE ILE B . n 
B 1 39  GLY 39  37  37  GLY GLY B . n 
B 1 40  GLY 40  38  38  GLY GLY B . n 
B 1 41  LYS 41  39  39  LYS LYS B . n 
B 1 42  GLY 42  40  40  GLY GLY B . n 
B 1 43  ALA 43  41  41  ALA ALA B . n 
B 1 44  ASN 44  42  42  ASN ASN B . n 
B 1 45  GLN 45  43  43  GLN GLN B . n 
B 1 46  ALA 46  44  44  ALA ALA B . n 
B 1 47  ILE 47  45  45  ILE ILE B . n 
B 1 48  ILE 48  46  46  ILE ILE B . n 
B 1 49  LEU 49  47  47  LEU LEU B . n 
B 1 50  SER 50  48  48  SER SER B . n 
B 1 51  ARG 51  49  49  ARG ARG B . n 
B 1 52  CYS 52  50  50  CYS CYS B . n 
B 1 53  GLY 53  51  51  GLY GLY B . n 
B 1 54  ILE 54  52  52  ILE ILE B . n 
B 1 55  GLU 55  53  53  GLU GLU B . n 
B 1 56  THR 56  54  54  THR THR B . n 
B 1 57  ARG 57  55  55  ARG ARG B . n 
B 1 58  LEU 58  56  56  LEU LEU B . n 
B 1 59  ILE 59  57  57  ILE ILE B . n 
B 1 60  ALA 60  58  58  ALA ALA B . n 
B 1 61  ALA 61  59  59  ALA ALA B . n 
B 1 62  THR 62  60  60  THR THR B . n 
B 1 63  GLY 63  61  61  GLY GLY B . n 
B 1 64  ASN 64  62  62  ASN ASN B . n 
B 1 65  ASP 65  63  63  ASP ASP B . n 
B 1 66  SER 66  64  64  SER SER B . n 
B 1 67  ASN 67  65  65  ASN ASN B . n 
B 1 68  GLY 68  66  66  GLY GLY B . n 
B 1 69  ALA 69  67  67  ALA ALA B . n 
B 1 70  TRP 70  68  68  TRP TRP B . n 
B 1 71  ILE 71  69  69  ILE ILE B . n 
B 1 72  ARG 72  70  70  ARG ARG B . n 
B 1 73  GLN 73  71  71  GLN GLN B . n 
B 1 74  GLN 74  72  72  GLN GLN B . n 
B 1 75  ILE 75  73  73  ILE ILE B . n 
B 1 76  LYS 76  74  74  LYS LYS B . n 
B 1 77  ASN 77  75  75  ASN ASN B . n 
B 1 78  GLU 78  76  76  GLU GLU B . n 
B 1 79  PRO 79  77  77  PRO PRO B . n 
B 1 80  LEU 80  78  78  LEU LEU B . n 
B 1 81  MSE 81  79  79  MSE MSE B . n 
B 1 82  LEU 82  80  80  LEU LEU B . n 
B 1 83  LEU 83  81  81  LEU LEU B . n 
B 1 84  PRO 84  82  82  PRO PRO B . n 
B 1 85  ASP 85  83  83  ASP ASP B . n 
B 1 86  GLY 86  84  84  GLY GLY B . n 
B 1 87  HIS 87  85  85  HIS HIS B . n 
B 1 88  PHE 88  86  86  PHE PHE B . n 
B 1 89  ASN 89  87  87  ASN ASN B . n 
B 1 90  GLN 90  88  88  GLN GLN B . n 
B 1 91  HIS 91  89  89  HIS HIS B . n 
B 1 92  SER 92  90  90  SER SER B . n 
B 1 93  ASP 93  91  91  ASP ASP B . n 
B 1 94  THR 94  92  92  THR THR B . n 
B 1 95  SER 95  93  93  SER SER B . n 
B 1 96  ILE 96  94  94  ILE ILE B . n 
B 1 97  ILE 97  95  95  ILE ILE B . n 
B 1 98  LEU 98  96  96  LEU LEU B . n 
B 1 99  ASN 99  97  97  ASN ASN B . n 
B 1 100 SER 100 98  98  SER SER B . n 
B 1 101 ALA 101 99  99  ALA ALA B . n 
B 1 102 ASP 102 100 ?   ?   ?   B . n 
B 1 103 GLY 103 101 ?   ?   ?   B . n 
B 1 104 ASP 104 102 102 ASP ASP B . n 
B 1 105 ASN 105 103 103 ASN ASN B . n 
B 1 106 ALA 106 104 104 ALA ALA B . n 
B 1 107 ILE 107 105 105 ILE ILE B . n 
B 1 108 ILE 108 106 106 ILE ILE B . n 
B 1 109 THR 109 107 107 THR THR B . n 
B 1 110 THR 110 108 108 THR THR B . n 
B 1 111 THR 111 109 109 THR THR B . n 
B 1 112 ALA 112 110 110 ALA ALA B . n 
B 1 113 ALA 113 111 111 ALA ALA B . n 
B 1 114 ALA 114 112 112 ALA ALA B . n 
B 1 115 ASP 115 113 113 ASP ASP B . n 
B 1 116 THR 116 114 114 THR THR B . n 
B 1 117 PHE 117 115 115 PHE PHE B . n 
B 1 118 SER 118 116 116 SER SER B . n 
B 1 119 LEU 119 117 117 LEU LEU B . n 
B 1 120 ASP 120 118 118 ASP ASP B . n 
B 1 121 GLU 121 119 119 GLU GLU B . n 
B 1 122 MSE 122 120 120 MSE MSE B . n 
B 1 123 ILE 123 121 121 ILE ILE B . n 
B 1 124 PRO 124 122 122 PRO PRO B . n 
B 1 125 HIS 125 123 123 HIS HIS B . n 
B 1 126 MSE 126 124 124 MSE MSE B . n 
B 1 127 ALA 127 125 125 ALA ALA B . n 
B 1 128 ASP 128 126 126 ASP ASP B . n 
B 1 129 ALA 129 127 127 ALA ALA B . n 
B 1 130 VAL 130 128 128 VAL VAL B . n 
B 1 131 ALA 131 129 129 ALA ALA B . n 
B 1 132 GLY 132 130 130 GLY GLY B . n 
B 1 133 ASP 133 131 131 ASP ASP B . n 
B 1 134 ILE 134 132 132 ILE ILE B . n 
B 1 135 LEU 135 133 133 LEU LEU B . n 
B 1 136 LEU 136 134 134 LEU LEU B . n 
B 1 137 GLN 137 135 135 GLN GLN B . n 
B 1 138 GLN 138 136 136 GLN GLN B . n 
B 1 139 GLY 139 137 137 GLY GLY B . n 
B 1 140 ASN 140 138 138 ASN ASN B . n 
B 1 141 PHE 141 139 139 PHE PHE B . n 
B 1 142 SER 142 140 140 SER SER B . n 
B 1 143 LEU 143 141 141 LEU LEU B . n 
B 1 144 ASP 144 142 142 ASP ASP B . n 
B 1 145 LYS 145 143 143 LYS LYS B . n 
B 1 146 THR 146 144 144 THR THR B . n 
B 1 147 ARG 147 145 145 ARG ARG B . n 
B 1 148 ALA 148 146 146 ALA ALA B . n 
B 1 149 LEU 149 147 147 LEU LEU B . n 
B 1 150 PHE 150 148 148 PHE PHE B . n 
B 1 151 GLN 151 149 149 GLN GLN B . n 
B 1 152 TYR 152 150 150 TYR TYR B . n 
B 1 153 ALA 153 151 151 ALA ALA B . n 
B 1 154 ARG 154 152 152 ARG ARG B . n 
B 1 155 SER 155 153 153 SER SER B . n 
B 1 156 ARG 156 154 154 ARG ARG B . n 
B 1 157 GLY 157 155 155 GLY GLY B . n 
B 1 158 MSE 158 156 156 MSE MSE B . n 
B 1 159 THR 159 157 157 THR THR B . n 
B 1 160 THR 160 158 158 THR THR B . n 
B 1 161 VAL 161 159 159 VAL VAL B . n 
B 1 162 PHE 162 160 160 PHE PHE B . n 
B 1 163 ASN 163 161 161 ASN ASN B . n 
B 1 164 PRO 164 162 162 PRO PRO B . n 
B 1 165 SER 165 163 163 SER SER B . n 
B 1 166 PRO 166 164 164 PRO PRO B . n 
B 1 167 VAL 167 165 165 VAL VAL B . n 
B 1 168 ASN 168 166 166 ASN ASN B . n 
B 1 169 PRO 169 167 167 PRO PRO B . n 
B 1 170 ASP 170 168 168 ASP ASP B . n 
B 1 171 PHE 171 169 169 PHE PHE B . n 
B 1 172 CYS 172 170 170 CYS CYS B . n 
B 1 173 HIS 173 171 171 HIS HIS B . n 
B 1 174 LEU 174 172 172 LEU LEU B . n 
B 1 175 TRP 175 173 173 TRP TRP B . n 
B 1 176 PRO 176 174 174 PRO PRO B . n 
B 1 177 LEU 177 175 175 LEU LEU B . n 
B 1 178 ILE 178 176 176 ILE ILE B . n 
B 1 179 ASP 179 177 177 ASP ASP B . n 
B 1 180 ILE 180 178 178 ILE ILE B . n 
B 1 181 ALA 181 179 179 ALA ALA B . n 
B 1 182 VAL 182 180 180 VAL VAL B . n 
B 1 183 VAL 183 181 181 VAL VAL B . n 
B 1 184 ASN 184 182 182 ASN ASN B . n 
B 1 185 GLU 185 183 183 GLU GLU B . n 
B 1 186 SER 186 184 184 SER SER B . n 
B 1 187 GLU 187 185 185 GLU GLU B . n 
B 1 188 ALA 188 186 186 ALA ALA B . n 
B 1 189 GLU 189 187 187 GLU GLU B . n 
B 1 190 LEU 190 188 188 LEU LEU B . n 
B 1 191 LEU 191 189 189 LEU LEU B . n 
B 1 192 GLN 192 190 190 GLN GLN B . n 
B 1 193 PRO 193 191 191 PRO PRO B . n 
B 1 194 TYR 194 192 192 TYR TYR B . n 
B 1 195 GLY 195 193 193 GLY GLY B . n 
B 1 196 VAL 196 194 194 VAL VAL B . n 
B 1 197 LYS 197 195 195 LYS LYS B . n 
B 1 198 THR 198 196 196 THR THR B . n 
B 1 199 LEU 199 197 197 LEU LEU B . n 
B 1 200 VAL 200 198 198 VAL VAL B . n 
B 1 201 ILE 201 199 199 ILE ILE B . n 
B 1 202 THR 202 200 200 THR THR B . n 
B 1 203 GLN 203 201 201 GLN GLN B . n 
B 1 204 GLY 204 202 202 GLY GLY B . n 
B 1 205 ALA 205 203 203 ALA ALA B . n 
B 1 206 ALA 206 204 204 ALA ALA B . n 
B 1 207 GLY 207 205 205 GLY GLY B . n 
B 1 208 ALA 208 206 206 ALA ALA B . n 
B 1 209 TRP 209 207 207 TRP TRP B . n 
B 1 210 LEU 210 208 208 LEU LEU B . n 
B 1 211 VAL 211 209 209 VAL VAL B . n 
B 1 212 GLN 212 210 210 GLN GLN B . n 
B 1 213 GLU 213 211 211 GLU GLU B . n 
B 1 214 GLY 214 212 212 GLY GLY B . n 
B 1 215 GLN 215 213 213 GLN GLN B . n 
B 1 216 ARG 216 214 214 ARG ARG B . n 
B 1 217 GLN 217 215 215 GLN GLN B . n 
B 1 218 PHE 218 216 216 PHE PHE B . n 
B 1 219 CYS 219 217 217 CYS CYS B . n 
B 1 220 PRO 220 218 218 PRO PRO B . n 
B 1 221 ALA 221 219 219 ALA ALA B . n 
B 1 222 VAL 222 220 220 VAL VAL B . n 
B 1 223 PRO 223 221 221 PRO PRO B . n 
B 1 224 ALA 224 222 222 ALA ALA B . n 
B 1 225 GLU 225 223 223 GLU GLU B . n 
B 1 226 ALA 226 224 224 ALA ALA B . n 
B 1 227 LEU 227 225 225 LEU LEU B . n 
B 1 228 ASP 228 226 226 ASP ASP B . n 
B 1 229 THR 229 227 227 THR THR B . n 
B 1 230 THR 230 228 228 THR THR B . n 
B 1 231 GLY 231 229 229 GLY GLY B . n 
B 1 232 ALA 232 230 230 ALA ALA B . n 
B 1 233 GLY 233 231 231 GLY GLY B . n 
B 1 234 ASP 234 232 232 ASP ASP B . n 
B 1 235 THR 235 233 233 THR THR B . n 
B 1 236 PHE 236 234 234 PHE PHE B . n 
B 1 237 LEU 237 235 235 LEU LEU B . n 
B 1 238 ALA 238 236 236 ALA ALA B . n 
B 1 239 VAL 239 237 237 VAL VAL B . n 
B 1 240 MSE 240 238 238 MSE MSE B . n 
B 1 241 LEU 241 239 239 LEU LEU B . n 
B 1 242 ALA 242 240 240 ALA ALA B . n 
B 1 243 SER 243 241 241 SER SER B . n 
B 1 244 ALA 244 242 242 ALA ALA B . n 
B 1 245 LEU 245 243 243 LEU LEU B . n 
B 1 246 LEU 246 244 244 LEU LEU B . n 
B 1 247 ARG 247 245 245 ARG ARG B . n 
B 1 248 GLY 248 246 246 GLY GLY B . n 
B 1 249 VAL 249 247 247 VAL VAL B . n 
B 1 250 ALA 250 248 248 ALA ALA B . n 
B 1 251 PRO 251 249 249 PRO PRO B . n 
B 1 252 ASP 252 250 250 ASP ASP B . n 
B 1 253 ALA 253 251 251 ALA ALA B . n 
B 1 254 LEU 254 252 252 LEU LEU B . n 
B 1 255 ALA 255 253 253 ALA ALA B . n 
B 1 256 LEU 256 254 254 LEU LEU B . n 
B 1 257 ALA 257 255 255 ALA ALA B . n 
B 1 258 HIS 258 256 256 HIS HIS B . n 
B 1 259 ALA 259 257 257 ALA ALA B . n 
B 1 260 SER 260 258 258 SER SER B . n 
B 1 261 ARG 261 259 259 ARG ARG B . n 
B 1 262 ALA 262 260 260 ALA ALA B . n 
B 1 263 ALA 263 261 261 ALA ALA B . n 
B 1 264 ALA 264 262 262 ALA ALA B . n 
B 1 265 ILE 265 263 263 ILE ILE B . n 
B 1 266 THR 266 264 264 THR THR B . n 
B 1 267 VAL 267 265 265 VAL VAL B . n 
B 1 268 SER 268 266 266 SER SER B . n 
B 1 269 ARG 269 267 267 ARG ARG B . n 
B 1 270 ARG 270 268 268 ARG ARG B . n 
B 1 271 GLY 271 269 269 GLY GLY B . n 
B 1 272 THR 272 270 270 THR THR B . n 
B 1 273 LEU 273 271 271 LEU LEU B . n 
B 1 274 SER 274 272 272 SER SER B . n 
B 1 275 ALA 275 273 273 ALA ALA B . n 
B 1 276 PHE 276 274 274 PHE PHE B . n 
B 1 277 PRO 277 275 275 PRO PRO B . n 
B 1 278 GLY 278 276 276 GLY GLY B . n 
B 1 279 SER 279 277 277 SER SER B . n 
B 1 280 ARG 280 278 278 ARG ARG B . n 
B 1 281 GLU 281 279 279 GLU GLU B . n 
B 1 282 LEU 282 280 280 LEU LEU B . n 
B 1 283 ALA 283 281 281 ALA ALA B . n 
B 1 284 ALA 284 282 282 ALA ALA B . n 
B 1 285 LEU 285 283 283 LEU LEU B . n 
B 1 286 LEU 286 284 284 LEU LEU B . n 
B 1 287 THR 287 285 285 THR THR B . n 
B 1 288 THR 288 286 ?   ?   ?   B . n 
B 1 289 ASP 289 287 ?   ?   ?   B . n 
B 1 290 GLY 290 288 ?   ?   ?   B . n 
B 1 291 ALA 291 289 ?   ?   ?   B . n 
B 1 292 GLU 292 290 ?   ?   ?   B . n 
B 1 293 GLY 293 291 ?   ?   ?   B . n 
B 1 294 HIS 294 292 ?   ?   ?   B . n 
B 1 295 HIS 295 293 ?   ?   ?   B . n 
B 1 296 HIS 296 294 ?   ?   ?   B . n 
B 1 297 HIS 297 295 ?   ?   ?   B . n 
B 1 298 HIS 298 296 ?   ?   ?   B . n 
B 1 299 HIS 299 297 ?   ?   ?   B . n 
C 1 1   MSE 1   -3  ?   ?   ?   C . n 
C 1 2   SER 2   -2  ?   ?   ?   C . n 
C 1 3   LEU 3   -1  -1  LEU LEU C . n 
C 1 4   ARG 4   2   2   ARG ARG C . n 
C 1 5   VAL 5   3   3   VAL VAL C . n 
C 1 6   TYR 6   4   4   TYR TYR C . n 
C 1 7   VAL 7   5   5   VAL VAL C . n 
C 1 8   THR 8   6   6   THR THR C . n 
C 1 9   GLY 9   7   7   GLY GLY C . n 
C 1 10  ASN 10  8   8   ASN ASN C . n 
C 1 11  ILE 11  9   9   ILE ILE C . n 
C 1 12  THR 12  10  10  THR THR C . n 
C 1 13  VAL 13  11  11  VAL VAL C . n 
C 1 14  ASP 14  12  12  ASP ASP C . n 
C 1 15  GLU 15  13  13  GLU GLU C . n 
C 1 16  THR 16  14  14  THR THR C . n 
C 1 17  TRP 17  15  15  TRP TRP C . n 
C 1 18  SER 18  16  16  SER SER C . n 
C 1 19  ILE 19  17  17  ILE ILE C . n 
C 1 20  PRO 20  18  18  PRO PRO C . n 
C 1 21  ASP 21  19  19  ASP ASP C . n 
C 1 22  ILE 22  20  20  ILE ILE C . n 
C 1 23  PRO 23  21  21  PRO PRO C . n 
C 1 24  LYS 24  22  22  LYS LYS C . n 
C 1 25  LYS 25  23  23  LYS LYS C . n 
C 1 26  GLY 26  24  24  GLY GLY C . n 
C 1 27  ALA 27  25  25  ALA ALA C . n 
C 1 28  SER 28  26  26  SER SER C . n 
C 1 29  ILE 29  27  27  ILE ILE C . n 
C 1 30  HIS 30  28  28  HIS HIS C . n 
C 1 31  GLY 31  29  29  GLY GLY C . n 
C 1 32  VAL 32  30  30  VAL VAL C . n 
C 1 33  LYS 33  31  31  LYS LYS C . n 
C 1 34  VAL 34  32  32  VAL VAL C . n 
C 1 35  SER 35  33  33  SER SER C . n 
C 1 36  GLN 36  34  34  GLN GLN C . n 
C 1 37  ASP 37  35  35  ASP ASP C . n 
C 1 38  ILE 38  36  36  ILE ILE C . n 
C 1 39  GLY 39  37  37  GLY GLY C . n 
C 1 40  GLY 40  38  38  GLY GLY C . n 
C 1 41  LYS 41  39  39  LYS LYS C . n 
C 1 42  GLY 42  40  40  GLY GLY C . n 
C 1 43  ALA 43  41  41  ALA ALA C . n 
C 1 44  ASN 44  42  42  ASN ASN C . n 
C 1 45  GLN 45  43  43  GLN GLN C . n 
C 1 46  ALA 46  44  44  ALA ALA C . n 
C 1 47  ILE 47  45  45  ILE ILE C . n 
C 1 48  ILE 48  46  46  ILE ILE C . n 
C 1 49  LEU 49  47  47  LEU LEU C . n 
C 1 50  SER 50  48  48  SER SER C . n 
C 1 51  ARG 51  49  49  ARG ARG C . n 
C 1 52  CYS 52  50  50  CYS CYS C . n 
C 1 53  GLY 53  51  51  GLY GLY C . n 
C 1 54  ILE 54  52  52  ILE ILE C . n 
C 1 55  GLU 55  53  53  GLU GLU C . n 
C 1 56  THR 56  54  54  THR THR C . n 
C 1 57  ARG 57  55  55  ARG ARG C . n 
C 1 58  LEU 58  56  56  LEU LEU C . n 
C 1 59  ILE 59  57  57  ILE ILE C . n 
C 1 60  ALA 60  58  58  ALA ALA C . n 
C 1 61  ALA 61  59  59  ALA ALA C . n 
C 1 62  THR 62  60  60  THR THR C . n 
C 1 63  GLY 63  61  61  GLY GLY C . n 
C 1 64  ASN 64  62  62  ASN ASN C . n 
C 1 65  ASP 65  63  63  ASP ASP C . n 
C 1 66  SER 66  64  64  SER SER C . n 
C 1 67  ASN 67  65  65  ASN ASN C . n 
C 1 68  GLY 68  66  66  GLY GLY C . n 
C 1 69  ALA 69  67  67  ALA ALA C . n 
C 1 70  TRP 70  68  68  TRP TRP C . n 
C 1 71  ILE 71  69  69  ILE ILE C . n 
C 1 72  ARG 72  70  70  ARG ARG C . n 
C 1 73  GLN 73  71  71  GLN GLN C . n 
C 1 74  GLN 74  72  72  GLN GLN C . n 
C 1 75  ILE 75  73  73  ILE ILE C . n 
C 1 76  LYS 76  74  74  LYS LYS C . n 
C 1 77  ASN 77  75  75  ASN ASN C . n 
C 1 78  GLU 78  76  76  GLU GLU C . n 
C 1 79  PRO 79  77  77  PRO PRO C . n 
C 1 80  LEU 80  78  78  LEU LEU C . n 
C 1 81  MSE 81  79  79  MSE MSE C . n 
C 1 82  LEU 82  80  80  LEU LEU C . n 
C 1 83  LEU 83  81  81  LEU LEU C . n 
C 1 84  PRO 84  82  82  PRO PRO C . n 
C 1 85  ASP 85  83  83  ASP ASP C . n 
C 1 86  GLY 86  84  84  GLY GLY C . n 
C 1 87  HIS 87  85  85  HIS HIS C . n 
C 1 88  PHE 88  86  86  PHE PHE C . n 
C 1 89  ASN 89  87  87  ASN ASN C . n 
C 1 90  GLN 90  88  88  GLN GLN C . n 
C 1 91  HIS 91  89  89  HIS HIS C . n 
C 1 92  SER 92  90  90  SER SER C . n 
C 1 93  ASP 93  91  91  ASP ASP C . n 
C 1 94  THR 94  92  92  THR THR C . n 
C 1 95  SER 95  93  93  SER SER C . n 
C 1 96  ILE 96  94  94  ILE ILE C . n 
C 1 97  ILE 97  95  95  ILE ILE C . n 
C 1 98  LEU 98  96  96  LEU LEU C . n 
C 1 99  ASN 99  97  97  ASN ASN C . n 
C 1 100 SER 100 98  98  SER SER C . n 
C 1 101 ALA 101 99  99  ALA ALA C . n 
C 1 102 ASP 102 100 100 ASP ASP C . n 
C 1 103 GLY 103 101 101 GLY GLY C . n 
C 1 104 ASP 104 102 102 ASP ASP C . n 
C 1 105 ASN 105 103 103 ASN ASN C . n 
C 1 106 ALA 106 104 104 ALA ALA C . n 
C 1 107 ILE 107 105 105 ILE ILE C . n 
C 1 108 ILE 108 106 106 ILE ILE C . n 
C 1 109 THR 109 107 107 THR THR C . n 
C 1 110 THR 110 108 108 THR THR C . n 
C 1 111 THR 111 109 109 THR THR C . n 
C 1 112 ALA 112 110 110 ALA ALA C . n 
C 1 113 ALA 113 111 111 ALA ALA C . n 
C 1 114 ALA 114 112 112 ALA ALA C . n 
C 1 115 ASP 115 113 113 ASP ASP C . n 
C 1 116 THR 116 114 114 THR THR C . n 
C 1 117 PHE 117 115 115 PHE PHE C . n 
C 1 118 SER 118 116 116 SER SER C . n 
C 1 119 LEU 119 117 117 LEU LEU C . n 
C 1 120 ASP 120 118 118 ASP ASP C . n 
C 1 121 GLU 121 119 119 GLU GLU C . n 
C 1 122 MSE 122 120 120 MSE MSE C . n 
C 1 123 ILE 123 121 121 ILE ILE C . n 
C 1 124 PRO 124 122 122 PRO PRO C . n 
C 1 125 HIS 125 123 123 HIS HIS C . n 
C 1 126 MSE 126 124 124 MSE MSE C . n 
C 1 127 ALA 127 125 125 ALA ALA C . n 
C 1 128 ASP 128 126 126 ASP ASP C . n 
C 1 129 ALA 129 127 127 ALA ALA C . n 
C 1 130 VAL 130 128 128 VAL VAL C . n 
C 1 131 ALA 131 129 129 ALA ALA C . n 
C 1 132 GLY 132 130 130 GLY GLY C . n 
C 1 133 ASP 133 131 131 ASP ASP C . n 
C 1 134 ILE 134 132 132 ILE ILE C . n 
C 1 135 LEU 135 133 133 LEU LEU C . n 
C 1 136 LEU 136 134 134 LEU LEU C . n 
C 1 137 GLN 137 135 135 GLN GLN C . n 
C 1 138 GLN 138 136 136 GLN GLN C . n 
C 1 139 GLY 139 137 137 GLY GLY C . n 
C 1 140 ASN 140 138 138 ASN ASN C . n 
C 1 141 PHE 141 139 139 PHE PHE C . n 
C 1 142 SER 142 140 140 SER SER C . n 
C 1 143 LEU 143 141 141 LEU LEU C . n 
C 1 144 ASP 144 142 142 ASP ASP C . n 
C 1 145 LYS 145 143 143 LYS LYS C . n 
C 1 146 THR 146 144 144 THR THR C . n 
C 1 147 ARG 147 145 145 ARG ARG C . n 
C 1 148 ALA 148 146 146 ALA ALA C . n 
C 1 149 LEU 149 147 147 LEU LEU C . n 
C 1 150 PHE 150 148 148 PHE PHE C . n 
C 1 151 GLN 151 149 149 GLN GLN C . n 
C 1 152 TYR 152 150 150 TYR TYR C . n 
C 1 153 ALA 153 151 151 ALA ALA C . n 
C 1 154 ARG 154 152 152 ARG ARG C . n 
C 1 155 SER 155 153 153 SER SER C . n 
C 1 156 ARG 156 154 154 ARG ARG C . n 
C 1 157 GLY 157 155 155 GLY GLY C . n 
C 1 158 MSE 158 156 156 MSE MSE C . n 
C 1 159 THR 159 157 157 THR THR C . n 
C 1 160 THR 160 158 158 THR THR C . n 
C 1 161 VAL 161 159 159 VAL VAL C . n 
C 1 162 PHE 162 160 160 PHE PHE C . n 
C 1 163 ASN 163 161 161 ASN ASN C . n 
C 1 164 PRO 164 162 162 PRO PRO C . n 
C 1 165 SER 165 163 163 SER SER C . n 
C 1 166 PRO 166 164 164 PRO PRO C . n 
C 1 167 VAL 167 165 165 VAL VAL C . n 
C 1 168 ASN 168 166 166 ASN ASN C . n 
C 1 169 PRO 169 167 167 PRO PRO C . n 
C 1 170 ASP 170 168 168 ASP ASP C . n 
C 1 171 PHE 171 169 169 PHE PHE C . n 
C 1 172 CYS 172 170 170 CYS CYS C . n 
C 1 173 HIS 173 171 171 HIS HIS C . n 
C 1 174 LEU 174 172 172 LEU LEU C . n 
C 1 175 TRP 175 173 173 TRP TRP C . n 
C 1 176 PRO 176 174 174 PRO PRO C . n 
C 1 177 LEU 177 175 175 LEU LEU C . n 
C 1 178 ILE 178 176 176 ILE ILE C . n 
C 1 179 ASP 179 177 177 ASP ASP C . n 
C 1 180 ILE 180 178 178 ILE ILE C . n 
C 1 181 ALA 181 179 179 ALA ALA C . n 
C 1 182 VAL 182 180 180 VAL VAL C . n 
C 1 183 VAL 183 181 181 VAL VAL C . n 
C 1 184 ASN 184 182 182 ASN ASN C . n 
C 1 185 GLU 185 183 183 GLU GLU C . n 
C 1 186 SER 186 184 184 SER SER C . n 
C 1 187 GLU 187 185 185 GLU GLU C . n 
C 1 188 ALA 188 186 186 ALA ALA C . n 
C 1 189 GLU 189 187 187 GLU GLU C . n 
C 1 190 LEU 190 188 188 LEU LEU C . n 
C 1 191 LEU 191 189 189 LEU LEU C . n 
C 1 192 GLN 192 190 190 GLN GLN C . n 
C 1 193 PRO 193 191 191 PRO PRO C . n 
C 1 194 TYR 194 192 192 TYR TYR C . n 
C 1 195 GLY 195 193 193 GLY GLY C . n 
C 1 196 VAL 196 194 194 VAL VAL C . n 
C 1 197 LYS 197 195 195 LYS LYS C . n 
C 1 198 THR 198 196 196 THR THR C . n 
C 1 199 LEU 199 197 197 LEU LEU C . n 
C 1 200 VAL 200 198 198 VAL VAL C . n 
C 1 201 ILE 201 199 199 ILE ILE C . n 
C 1 202 THR 202 200 200 THR THR C . n 
C 1 203 GLN 203 201 201 GLN GLN C . n 
C 1 204 GLY 204 202 202 GLY GLY C . n 
C 1 205 ALA 205 203 203 ALA ALA C . n 
C 1 206 ALA 206 204 204 ALA ALA C . n 
C 1 207 GLY 207 205 205 GLY GLY C . n 
C 1 208 ALA 208 206 206 ALA ALA C . n 
C 1 209 TRP 209 207 207 TRP TRP C . n 
C 1 210 LEU 210 208 208 LEU LEU C . n 
C 1 211 VAL 211 209 209 VAL VAL C . n 
C 1 212 GLN 212 210 210 GLN GLN C . n 
C 1 213 GLU 213 211 211 GLU GLU C . n 
C 1 214 GLY 214 212 212 GLY GLY C . n 
C 1 215 GLN 215 213 213 GLN GLN C . n 
C 1 216 ARG 216 214 214 ARG ARG C . n 
C 1 217 GLN 217 215 215 GLN GLN C . n 
C 1 218 PHE 218 216 216 PHE PHE C . n 
C 1 219 CYS 219 217 217 CYS CYS C . n 
C 1 220 PRO 220 218 218 PRO PRO C . n 
C 1 221 ALA 221 219 219 ALA ALA C . n 
C 1 222 VAL 222 220 220 VAL VAL C . n 
C 1 223 PRO 223 221 221 PRO PRO C . n 
C 1 224 ALA 224 222 222 ALA ALA C . n 
C 1 225 GLU 225 223 223 GLU GLU C . n 
C 1 226 ALA 226 224 224 ALA ALA C . n 
C 1 227 LEU 227 225 225 LEU LEU C . n 
C 1 228 ASP 228 226 226 ASP ASP C . n 
C 1 229 THR 229 227 227 THR THR C . n 
C 1 230 THR 230 228 228 THR THR C . n 
C 1 231 GLY 231 229 229 GLY GLY C . n 
C 1 232 ALA 232 230 230 ALA ALA C . n 
C 1 233 GLY 233 231 231 GLY GLY C . n 
C 1 234 ASP 234 232 232 ASP ASP C . n 
C 1 235 THR 235 233 233 THR THR C . n 
C 1 236 PHE 236 234 234 PHE PHE C . n 
C 1 237 LEU 237 235 235 LEU LEU C . n 
C 1 238 ALA 238 236 236 ALA ALA C . n 
C 1 239 VAL 239 237 237 VAL VAL C . n 
C 1 240 MSE 240 238 238 MSE MSE C . n 
C 1 241 LEU 241 239 239 LEU LEU C . n 
C 1 242 ALA 242 240 240 ALA ALA C . n 
C 1 243 SER 243 241 241 SER SER C . n 
C 1 244 ALA 244 242 242 ALA ALA C . n 
C 1 245 LEU 245 243 243 LEU LEU C . n 
C 1 246 LEU 246 244 244 LEU LEU C . n 
C 1 247 ARG 247 245 245 ARG ARG C . n 
C 1 248 GLY 248 246 246 GLY GLY C . n 
C 1 249 VAL 249 247 247 VAL VAL C . n 
C 1 250 ALA 250 248 248 ALA ALA C . n 
C 1 251 PRO 251 249 249 PRO PRO C . n 
C 1 252 ASP 252 250 250 ASP ASP C . n 
C 1 253 ALA 253 251 251 ALA ALA C . n 
C 1 254 LEU 254 252 252 LEU LEU C . n 
C 1 255 ALA 255 253 253 ALA ALA C . n 
C 1 256 LEU 256 254 254 LEU LEU C . n 
C 1 257 ALA 257 255 255 ALA ALA C . n 
C 1 258 HIS 258 256 256 HIS HIS C . n 
C 1 259 ALA 259 257 257 ALA ALA C . n 
C 1 260 SER 260 258 258 SER SER C . n 
C 1 261 ARG 261 259 259 ARG ARG C . n 
C 1 262 ALA 262 260 260 ALA ALA C . n 
C 1 263 ALA 263 261 261 ALA ALA C . n 
C 1 264 ALA 264 262 262 ALA ALA C . n 
C 1 265 ILE 265 263 263 ILE ILE C . n 
C 1 266 THR 266 264 264 THR THR C . n 
C 1 267 VAL 267 265 265 VAL VAL C . n 
C 1 268 SER 268 266 266 SER SER C . n 
C 1 269 ARG 269 267 267 ARG ARG C . n 
C 1 270 ARG 270 268 268 ARG ARG C . n 
C 1 271 GLY 271 269 269 GLY GLY C . n 
C 1 272 THR 272 270 270 THR THR C . n 
C 1 273 LEU 273 271 271 LEU LEU C . n 
C 1 274 SER 274 272 272 SER SER C . n 
C 1 275 ALA 275 273 273 ALA ALA C . n 
C 1 276 PHE 276 274 274 PHE PHE C . n 
C 1 277 PRO 277 275 275 PRO PRO C . n 
C 1 278 GLY 278 276 276 GLY GLY C . n 
C 1 279 SER 279 277 277 SER SER C . n 
C 1 280 ARG 280 278 278 ARG ARG C . n 
C 1 281 GLU 281 279 279 GLU GLU C . n 
C 1 282 LEU 282 280 280 LEU LEU C . n 
C 1 283 ALA 283 281 281 ALA ALA C . n 
C 1 284 ALA 284 282 282 ALA ALA C . n 
C 1 285 LEU 285 283 283 LEU LEU C . n 
C 1 286 LEU 286 284 284 LEU LEU C . n 
C 1 287 THR 287 285 285 THR THR C . n 
C 1 288 THR 288 286 ?   ?   ?   C . n 
C 1 289 ASP 289 287 ?   ?   ?   C . n 
C 1 290 GLY 290 288 ?   ?   ?   C . n 
C 1 291 ALA 291 289 ?   ?   ?   C . n 
C 1 292 GLU 292 290 ?   ?   ?   C . n 
C 1 293 GLY 293 291 ?   ?   ?   C . n 
C 1 294 HIS 294 292 ?   ?   ?   C . n 
C 1 295 HIS 295 293 ?   ?   ?   C . n 
C 1 296 HIS 296 294 ?   ?   ?   C . n 
C 1 297 HIS 297 295 ?   ?   ?   C . n 
C 1 298 HIS 298 296 ?   ?   ?   C . n 
C 1 299 HIS 299 297 ?   ?   ?   C . n 
D 1 1   MSE 1   -3  ?   ?   ?   D . n 
D 1 2   SER 2   -2  -2  SER SER D . n 
D 1 3   LEU 3   -1  -1  LEU LEU D . n 
D 1 4   ARG 4   2   2   ARG ARG D . n 
D 1 5   VAL 5   3   3   VAL VAL D . n 
D 1 6   TYR 6   4   4   TYR TYR D . n 
D 1 7   VAL 7   5   5   VAL VAL D . n 
D 1 8   THR 8   6   6   THR THR D . n 
D 1 9   GLY 9   7   7   GLY GLY D . n 
D 1 10  ASN 10  8   8   ASN ASN D . n 
D 1 11  ILE 11  9   9   ILE ILE D . n 
D 1 12  THR 12  10  10  THR THR D . n 
D 1 13  VAL 13  11  11  VAL VAL D . n 
D 1 14  ASP 14  12  12  ASP ASP D . n 
D 1 15  GLU 15  13  13  GLU GLU D . n 
D 1 16  THR 16  14  14  THR THR D . n 
D 1 17  TRP 17  15  15  TRP TRP D . n 
D 1 18  SER 18  16  16  SER SER D . n 
D 1 19  ILE 19  17  17  ILE ILE D . n 
D 1 20  PRO 20  18  18  PRO PRO D . n 
D 1 21  ASP 21  19  19  ASP ASP D . n 
D 1 22  ILE 22  20  20  ILE ILE D . n 
D 1 23  PRO 23  21  21  PRO PRO D . n 
D 1 24  LYS 24  22  22  LYS LYS D . n 
D 1 25  LYS 25  23  23  LYS LYS D . n 
D 1 26  GLY 26  24  24  GLY GLY D . n 
D 1 27  ALA 27  25  25  ALA ALA D . n 
D 1 28  SER 28  26  26  SER SER D . n 
D 1 29  ILE 29  27  27  ILE ILE D . n 
D 1 30  HIS 30  28  28  HIS HIS D . n 
D 1 31  GLY 31  29  29  GLY GLY D . n 
D 1 32  VAL 32  30  30  VAL VAL D . n 
D 1 33  LYS 33  31  31  LYS LYS D . n 
D 1 34  VAL 34  32  32  VAL VAL D . n 
D 1 35  SER 35  33  33  SER SER D . n 
D 1 36  GLN 36  34  34  GLN GLN D . n 
D 1 37  ASP 37  35  35  ASP ASP D . n 
D 1 38  ILE 38  36  36  ILE ILE D . n 
D 1 39  GLY 39  37  37  GLY GLY D . n 
D 1 40  GLY 40  38  38  GLY GLY D . n 
D 1 41  LYS 41  39  39  LYS LYS D . n 
D 1 42  GLY 42  40  40  GLY GLY D . n 
D 1 43  ALA 43  41  41  ALA ALA D . n 
D 1 44  ASN 44  42  42  ASN ASN D . n 
D 1 45  GLN 45  43  43  GLN GLN D . n 
D 1 46  ALA 46  44  44  ALA ALA D . n 
D 1 47  ILE 47  45  45  ILE ILE D . n 
D 1 48  ILE 48  46  46  ILE ILE D . n 
D 1 49  LEU 49  47  47  LEU LEU D . n 
D 1 50  SER 50  48  48  SER SER D . n 
D 1 51  ARG 51  49  49  ARG ARG D . n 
D 1 52  CYS 52  50  50  CYS CYS D . n 
D 1 53  GLY 53  51  51  GLY GLY D . n 
D 1 54  ILE 54  52  52  ILE ILE D . n 
D 1 55  GLU 55  53  53  GLU GLU D . n 
D 1 56  THR 56  54  54  THR THR D . n 
D 1 57  ARG 57  55  55  ARG ARG D . n 
D 1 58  LEU 58  56  56  LEU LEU D . n 
D 1 59  ILE 59  57  57  ILE ILE D . n 
D 1 60  ALA 60  58  58  ALA ALA D . n 
D 1 61  ALA 61  59  59  ALA ALA D . n 
D 1 62  THR 62  60  60  THR THR D . n 
D 1 63  GLY 63  61  61  GLY GLY D . n 
D 1 64  ASN 64  62  62  ASN ASN D . n 
D 1 65  ASP 65  63  63  ASP ASP D . n 
D 1 66  SER 66  64  64  SER SER D . n 
D 1 67  ASN 67  65  65  ASN ASN D . n 
D 1 68  GLY 68  66  66  GLY GLY D . n 
D 1 69  ALA 69  67  67  ALA ALA D . n 
D 1 70  TRP 70  68  68  TRP TRP D . n 
D 1 71  ILE 71  69  69  ILE ILE D . n 
D 1 72  ARG 72  70  70  ARG ARG D . n 
D 1 73  GLN 73  71  71  GLN GLN D . n 
D 1 74  GLN 74  72  72  GLN GLN D . n 
D 1 75  ILE 75  73  73  ILE ILE D . n 
D 1 76  LYS 76  74  74  LYS LYS D . n 
D 1 77  ASN 77  75  75  ASN ASN D . n 
D 1 78  GLU 78  76  76  GLU GLU D . n 
D 1 79  PRO 79  77  77  PRO PRO D . n 
D 1 80  LEU 80  78  78  LEU LEU D . n 
D 1 81  MSE 81  79  79  MSE MSE D . n 
D 1 82  LEU 82  80  80  LEU LEU D . n 
D 1 83  LEU 83  81  81  LEU LEU D . n 
D 1 84  PRO 84  82  82  PRO PRO D . n 
D 1 85  ASP 85  83  83  ASP ASP D . n 
D 1 86  GLY 86  84  84  GLY GLY D . n 
D 1 87  HIS 87  85  85  HIS HIS D . n 
D 1 88  PHE 88  86  86  PHE PHE D . n 
D 1 89  ASN 89  87  87  ASN ASN D . n 
D 1 90  GLN 90  88  88  GLN GLN D . n 
D 1 91  HIS 91  89  89  HIS HIS D . n 
D 1 92  SER 92  90  90  SER SER D . n 
D 1 93  ASP 93  91  91  ASP ASP D . n 
D 1 94  THR 94  92  92  THR THR D . n 
D 1 95  SER 95  93  93  SER SER D . n 
D 1 96  ILE 96  94  94  ILE ILE D . n 
D 1 97  ILE 97  95  95  ILE ILE D . n 
D 1 98  LEU 98  96  96  LEU LEU D . n 
D 1 99  ASN 99  97  97  ASN ASN D . n 
D 1 100 SER 100 98  98  SER SER D . n 
D 1 101 ALA 101 99  99  ALA ALA D . n 
D 1 102 ASP 102 100 100 ASP ASP D . n 
D 1 103 GLY 103 101 101 GLY GLY D . n 
D 1 104 ASP 104 102 102 ASP ASP D . n 
D 1 105 ASN 105 103 103 ASN ASN D . n 
D 1 106 ALA 106 104 104 ALA ALA D . n 
D 1 107 ILE 107 105 105 ILE ILE D . n 
D 1 108 ILE 108 106 106 ILE ILE D . n 
D 1 109 THR 109 107 107 THR THR D . n 
D 1 110 THR 110 108 108 THR THR D . n 
D 1 111 THR 111 109 109 THR THR D . n 
D 1 112 ALA 112 110 110 ALA ALA D . n 
D 1 113 ALA 113 111 111 ALA ALA D . n 
D 1 114 ALA 114 112 112 ALA ALA D . n 
D 1 115 ASP 115 113 113 ASP ASP D . n 
D 1 116 THR 116 114 114 THR THR D . n 
D 1 117 PHE 117 115 115 PHE PHE D . n 
D 1 118 SER 118 116 116 SER SER D . n 
D 1 119 LEU 119 117 117 LEU LEU D . n 
D 1 120 ASP 120 118 118 ASP ASP D . n 
D 1 121 GLU 121 119 119 GLU GLU D . n 
D 1 122 MSE 122 120 120 MSE MSE D . n 
D 1 123 ILE 123 121 121 ILE ILE D . n 
D 1 124 PRO 124 122 122 PRO PRO D . n 
D 1 125 HIS 125 123 123 HIS HIS D . n 
D 1 126 MSE 126 124 124 MSE MSE D . n 
D 1 127 ALA 127 125 125 ALA ALA D . n 
D 1 128 ASP 128 126 126 ASP ASP D . n 
D 1 129 ALA 129 127 127 ALA ALA D . n 
D 1 130 VAL 130 128 128 VAL VAL D . n 
D 1 131 ALA 131 129 129 ALA ALA D . n 
D 1 132 GLY 132 130 130 GLY GLY D . n 
D 1 133 ASP 133 131 131 ASP ASP D . n 
D 1 134 ILE 134 132 132 ILE ILE D . n 
D 1 135 LEU 135 133 133 LEU LEU D . n 
D 1 136 LEU 136 134 134 LEU LEU D . n 
D 1 137 GLN 137 135 135 GLN GLN D . n 
D 1 138 GLN 138 136 136 GLN GLN D . n 
D 1 139 GLY 139 137 137 GLY GLY D . n 
D 1 140 ASN 140 138 138 ASN ASN D . n 
D 1 141 PHE 141 139 139 PHE PHE D . n 
D 1 142 SER 142 140 140 SER SER D . n 
D 1 143 LEU 143 141 141 LEU LEU D . n 
D 1 144 ASP 144 142 142 ASP ASP D . n 
D 1 145 LYS 145 143 143 LYS LYS D . n 
D 1 146 THR 146 144 144 THR THR D . n 
D 1 147 ARG 147 145 145 ARG ARG D . n 
D 1 148 ALA 148 146 146 ALA ALA D . n 
D 1 149 LEU 149 147 147 LEU LEU D . n 
D 1 150 PHE 150 148 148 PHE PHE D . n 
D 1 151 GLN 151 149 149 GLN GLN D . n 
D 1 152 TYR 152 150 150 TYR TYR D . n 
D 1 153 ALA 153 151 151 ALA ALA D . n 
D 1 154 ARG 154 152 152 ARG ARG D . n 
D 1 155 SER 155 153 153 SER SER D . n 
D 1 156 ARG 156 154 154 ARG ARG D . n 
D 1 157 GLY 157 155 155 GLY GLY D . n 
D 1 158 MSE 158 156 156 MSE MSE D . n 
D 1 159 THR 159 157 157 THR THR D . n 
D 1 160 THR 160 158 158 THR THR D . n 
D 1 161 VAL 161 159 159 VAL VAL D . n 
D 1 162 PHE 162 160 160 PHE PHE D . n 
D 1 163 ASN 163 161 161 ASN ASN D . n 
D 1 164 PRO 164 162 162 PRO PRO D . n 
D 1 165 SER 165 163 163 SER SER D . n 
D 1 166 PRO 166 164 164 PRO PRO D . n 
D 1 167 VAL 167 165 165 VAL VAL D . n 
D 1 168 ASN 168 166 166 ASN ASN D . n 
D 1 169 PRO 169 167 167 PRO PRO D . n 
D 1 170 ASP 170 168 168 ASP ASP D . n 
D 1 171 PHE 171 169 169 PHE PHE D . n 
D 1 172 CYS 172 170 170 CYS CYS D . n 
D 1 173 HIS 173 171 171 HIS HIS D . n 
D 1 174 LEU 174 172 172 LEU LEU D . n 
D 1 175 TRP 175 173 173 TRP TRP D . n 
D 1 176 PRO 176 174 174 PRO PRO D . n 
D 1 177 LEU 177 175 175 LEU LEU D . n 
D 1 178 ILE 178 176 176 ILE ILE D . n 
D 1 179 ASP 179 177 177 ASP ASP D . n 
D 1 180 ILE 180 178 178 ILE ILE D . n 
D 1 181 ALA 181 179 179 ALA ALA D . n 
D 1 182 VAL 182 180 180 VAL VAL D . n 
D 1 183 VAL 183 181 181 VAL VAL D . n 
D 1 184 ASN 184 182 182 ASN ASN D . n 
D 1 185 GLU 185 183 183 GLU GLU D . n 
D 1 186 SER 186 184 184 SER SER D . n 
D 1 187 GLU 187 185 185 GLU GLU D . n 
D 1 188 ALA 188 186 186 ALA ALA D . n 
D 1 189 GLU 189 187 187 GLU GLU D . n 
D 1 190 LEU 190 188 188 LEU LEU D . n 
D 1 191 LEU 191 189 189 LEU LEU D . n 
D 1 192 GLN 192 190 190 GLN GLN D . n 
D 1 193 PRO 193 191 191 PRO PRO D . n 
D 1 194 TYR 194 192 192 TYR TYR D . n 
D 1 195 GLY 195 193 193 GLY GLY D . n 
D 1 196 VAL 196 194 194 VAL VAL D . n 
D 1 197 LYS 197 195 195 LYS LYS D . n 
D 1 198 THR 198 196 196 THR THR D . n 
D 1 199 LEU 199 197 197 LEU LEU D . n 
D 1 200 VAL 200 198 198 VAL VAL D . n 
D 1 201 ILE 201 199 199 ILE ILE D . n 
D 1 202 THR 202 200 200 THR THR D . n 
D 1 203 GLN 203 201 201 GLN GLN D . n 
D 1 204 GLY 204 202 202 GLY GLY D . n 
D 1 205 ALA 205 203 203 ALA ALA D . n 
D 1 206 ALA 206 204 204 ALA ALA D . n 
D 1 207 GLY 207 205 205 GLY GLY D . n 
D 1 208 ALA 208 206 206 ALA ALA D . n 
D 1 209 TRP 209 207 207 TRP TRP D . n 
D 1 210 LEU 210 208 208 LEU LEU D . n 
D 1 211 VAL 211 209 209 VAL VAL D . n 
D 1 212 GLN 212 210 210 GLN GLN D . n 
D 1 213 GLU 213 211 211 GLU GLU D . n 
D 1 214 GLY 214 212 212 GLY GLY D . n 
D 1 215 GLN 215 213 213 GLN GLN D . n 
D 1 216 ARG 216 214 214 ARG ARG D . n 
D 1 217 GLN 217 215 215 GLN GLN D . n 
D 1 218 PHE 218 216 216 PHE PHE D . n 
D 1 219 CYS 219 217 217 CYS CYS D . n 
D 1 220 PRO 220 218 218 PRO PRO D . n 
D 1 221 ALA 221 219 219 ALA ALA D . n 
D 1 222 VAL 222 220 220 VAL VAL D . n 
D 1 223 PRO 223 221 221 PRO PRO D . n 
D 1 224 ALA 224 222 222 ALA ALA D . n 
D 1 225 GLU 225 223 223 GLU GLU D . n 
D 1 226 ALA 226 224 224 ALA ALA D . n 
D 1 227 LEU 227 225 225 LEU LEU D . n 
D 1 228 ASP 228 226 226 ASP ASP D . n 
D 1 229 THR 229 227 227 THR THR D . n 
D 1 230 THR 230 228 228 THR THR D . n 
D 1 231 GLY 231 229 229 GLY GLY D . n 
D 1 232 ALA 232 230 230 ALA ALA D . n 
D 1 233 GLY 233 231 231 GLY GLY D . n 
D 1 234 ASP 234 232 232 ASP ASP D . n 
D 1 235 THR 235 233 233 THR THR D . n 
D 1 236 PHE 236 234 234 PHE PHE D . n 
D 1 237 LEU 237 235 235 LEU LEU D . n 
D 1 238 ALA 238 236 236 ALA ALA D . n 
D 1 239 VAL 239 237 237 VAL VAL D . n 
D 1 240 MSE 240 238 238 MSE MSE D . n 
D 1 241 LEU 241 239 239 LEU LEU D . n 
D 1 242 ALA 242 240 240 ALA ALA D . n 
D 1 243 SER 243 241 241 SER SER D . n 
D 1 244 ALA 244 242 242 ALA ALA D . n 
D 1 245 LEU 245 243 243 LEU LEU D . n 
D 1 246 LEU 246 244 244 LEU LEU D . n 
D 1 247 ARG 247 245 245 ARG ARG D . n 
D 1 248 GLY 248 246 246 GLY GLY D . n 
D 1 249 VAL 249 247 247 VAL VAL D . n 
D 1 250 ALA 250 248 248 ALA ALA D . n 
D 1 251 PRO 251 249 249 PRO PRO D . n 
D 1 252 ASP 252 250 250 ASP ASP D . n 
D 1 253 ALA 253 251 251 ALA ALA D . n 
D 1 254 LEU 254 252 252 LEU LEU D . n 
D 1 255 ALA 255 253 253 ALA ALA D . n 
D 1 256 LEU 256 254 254 LEU LEU D . n 
D 1 257 ALA 257 255 255 ALA ALA D . n 
D 1 258 HIS 258 256 256 HIS HIS D . n 
D 1 259 ALA 259 257 257 ALA ALA D . n 
D 1 260 SER 260 258 258 SER SER D . n 
D 1 261 ARG 261 259 259 ARG ARG D . n 
D 1 262 ALA 262 260 260 ALA ALA D . n 
D 1 263 ALA 263 261 261 ALA ALA D . n 
D 1 264 ALA 264 262 262 ALA ALA D . n 
D 1 265 ILE 265 263 263 ILE ILE D . n 
D 1 266 THR 266 264 264 THR THR D . n 
D 1 267 VAL 267 265 265 VAL VAL D . n 
D 1 268 SER 268 266 266 SER SER D . n 
D 1 269 ARG 269 267 267 ARG ARG D . n 
D 1 270 ARG 270 268 268 ARG ARG D . n 
D 1 271 GLY 271 269 269 GLY GLY D . n 
D 1 272 THR 272 270 270 THR THR D . n 
D 1 273 LEU 273 271 271 LEU LEU D . n 
D 1 274 SER 274 272 272 SER SER D . n 
D 1 275 ALA 275 273 273 ALA ALA D . n 
D 1 276 PHE 276 274 274 PHE PHE D . n 
D 1 277 PRO 277 275 275 PRO PRO D . n 
D 1 278 GLY 278 276 276 GLY GLY D . n 
D 1 279 SER 279 277 277 SER SER D . n 
D 1 280 ARG 280 278 278 ARG ARG D . n 
D 1 281 GLU 281 279 279 GLU GLU D . n 
D 1 282 LEU 282 280 280 LEU LEU D . n 
D 1 283 ALA 283 281 281 ALA ALA D . n 
D 1 284 ALA 284 282 282 ALA ALA D . n 
D 1 285 LEU 285 283 283 LEU LEU D . n 
D 1 286 LEU 286 284 284 LEU LEU D . n 
D 1 287 THR 287 285 285 THR THR D . n 
D 1 288 THR 288 286 ?   ?   ?   D . n 
D 1 289 ASP 289 287 ?   ?   ?   D . n 
D 1 290 GLY 290 288 ?   ?   ?   D . n 
D 1 291 ALA 291 289 ?   ?   ?   D . n 
D 1 292 GLU 292 290 ?   ?   ?   D . n 
D 1 293 GLY 293 291 ?   ?   ?   D . n 
D 1 294 HIS 294 292 ?   ?   ?   D . n 
D 1 295 HIS 295 293 ?   ?   ?   D . n 
D 1 296 HIS 296 294 ?   ?   ?   D . n 
D 1 297 HIS 297 295 ?   ?   ?   D . n 
D 1 298 HIS 298 296 ?   ?   ?   D . n 
D 1 299 HIS 299 297 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'New York SGX Research Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     NYSGXRC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 ATP 1   900 900 ATP ATP A . 
F 2 ATP 1   900 900 ATP ATP B . 
G 2 ATP 1   900 900 ATP ATP C . 
H 3 GOL 1   501 501 GOL GOL C . 
I 2 ATP 1   900 900 ATP ATP D . 
J 3 GOL 1   501 501 GOL GOL D . 
K 4 HOH 1   298 5   HOH TIP A . 
K 4 HOH 2   299 6   HOH TIP A . 
K 4 HOH 3   300 13  HOH TIP A . 
K 4 HOH 4   301 16  HOH TIP A . 
K 4 HOH 5   302 39  HOH TIP A . 
K 4 HOH 6   303 43  HOH TIP A . 
K 4 HOH 7   304 45  HOH TIP A . 
K 4 HOH 8   305 48  HOH TIP A . 
K 4 HOH 9   306 57  HOH TIP A . 
K 4 HOH 10  307 307 HOH TIP A . 
K 4 HOH 11  308 59  HOH TIP A . 
K 4 HOH 12  309 64  HOH TIP A . 
K 4 HOH 13  310 66  HOH TIP A . 
K 4 HOH 14  311 68  HOH TIP A . 
K 4 HOH 15  312 74  HOH TIP A . 
K 4 HOH 16  313 313 HOH TIP A . 
K 4 HOH 17  314 79  HOH TIP A . 
K 4 HOH 18  315 81  HOH TIP A . 
K 4 HOH 19  316 86  HOH TIP A . 
K 4 HOH 20  317 317 HOH TIP A . 
K 4 HOH 21  318 90  HOH TIP A . 
K 4 HOH 22  319 91  HOH TIP A . 
K 4 HOH 23  320 96  HOH TIP A . 
K 4 HOH 24  321 321 HOH TIP A . 
K 4 HOH 25  322 322 HOH TIP A . 
K 4 HOH 26  323 104 HOH TIP A . 
K 4 HOH 27  324 324 HOH TIP A . 
K 4 HOH 28  325 325 HOH TIP A . 
K 4 HOH 29  326 106 HOH TIP A . 
K 4 HOH 30  327 327 HOH TIP A . 
K 4 HOH 31  328 111 HOH TIP A . 
K 4 HOH 32  329 113 HOH TIP A . 
K 4 HOH 33  330 116 HOH TIP A . 
K 4 HOH 34  331 117 HOH TIP A . 
K 4 HOH 35  332 332 HOH TIP A . 
K 4 HOH 36  333 123 HOH TIP A . 
K 4 HOH 37  334 334 HOH TIP A . 
K 4 HOH 38  335 128 HOH TIP A . 
K 4 HOH 39  336 336 HOH TIP A . 
K 4 HOH 40  337 130 HOH TIP A . 
K 4 HOH 41  338 338 HOH TIP A . 
K 4 HOH 42  339 131 HOH TIP A . 
K 4 HOH 43  340 133 HOH TIP A . 
K 4 HOH 44  341 136 HOH TIP A . 
K 4 HOH 45  342 138 HOH TIP A . 
K 4 HOH 46  343 140 HOH TIP A . 
K 4 HOH 47  344 144 HOH TIP A . 
K 4 HOH 48  345 345 HOH TIP A . 
K 4 HOH 49  346 146 HOH TIP A . 
K 4 HOH 50  347 154 HOH TIP A . 
K 4 HOH 51  348 157 HOH TIP A . 
K 4 HOH 52  349 349 HOH TIP A . 
K 4 HOH 53  350 159 HOH TIP A . 
K 4 HOH 54  351 161 HOH TIP A . 
K 4 HOH 55  352 352 HOH TIP A . 
K 4 HOH 56  353 162 HOH TIP A . 
K 4 HOH 57  354 168 HOH TIP A . 
K 4 HOH 58  355 175 HOH TIP A . 
K 4 HOH 59  356 179 HOH TIP A . 
K 4 HOH 60  357 183 HOH TIP A . 
K 4 HOH 61  358 358 HOH TIP A . 
K 4 HOH 62  359 185 HOH TIP A . 
K 4 HOH 63  360 360 HOH TIP A . 
K 4 HOH 64  361 187 HOH TIP A . 
K 4 HOH 65  362 194 HOH TIP A . 
K 4 HOH 66  363 363 HOH TIP A . 
K 4 HOH 67  364 200 HOH TIP A . 
K 4 HOH 68  365 202 HOH TIP A . 
K 4 HOH 69  366 366 HOH TIP A . 
K 4 HOH 70  367 367 HOH TIP A . 
K 4 HOH 71  368 219 HOH TIP A . 
K 4 HOH 72  369 369 HOH TIP A . 
K 4 HOH 73  370 370 HOH TIP A . 
K 4 HOH 74  371 371 HOH TIP A . 
K 4 HOH 75  372 221 HOH TIP A . 
K 4 HOH 76  373 231 HOH TIP A . 
K 4 HOH 77  374 374 HOH TIP A . 
K 4 HOH 78  375 375 HOH TIP A . 
K 4 HOH 79  376 376 HOH TIP A . 
K 4 HOH 80  377 242 HOH TIP A . 
K 4 HOH 81  378 243 HOH TIP A . 
K 4 HOH 82  379 247 HOH TIP A . 
K 4 HOH 83  380 380 HOH TIP A . 
K 4 HOH 84  381 254 HOH TIP A . 
K 4 HOH 85  382 256 HOH TIP A . 
K 4 HOH 86  383 262 HOH TIP A . 
K 4 HOH 87  384 266 HOH TIP A . 
K 4 HOH 88  385 272 HOH TIP A . 
K 4 HOH 89  386 273 HOH TIP A . 
K 4 HOH 90  387 274 HOH TIP A . 
K 4 HOH 91  388 284 HOH TIP A . 
K 4 HOH 92  389 285 HOH TIP A . 
K 4 HOH 93  390 390 HOH TIP A . 
K 4 HOH 94  391 286 HOH TIP A . 
K 4 HOH 95  392 295 HOH TIP A . 
L 4 HOH 1   298 298 HOH TIP B . 
L 4 HOH 2   299 3   HOH TIP B . 
L 4 HOH 3   300 9   HOH TIP B . 
L 4 HOH 4   301 301 HOH TIP B . 
L 4 HOH 5   302 10  HOH TIP B . 
L 4 HOH 6   303 303 HOH TIP B . 
L 4 HOH 7   304 304 HOH TIP B . 
L 4 HOH 8   305 305 HOH TIP B . 
L 4 HOH 9   306 11  HOH TIP B . 
L 4 HOH 10  307 14  HOH TIP B . 
L 4 HOH 11  308 18  HOH TIP B . 
L 4 HOH 12  309 19  HOH TIP B . 
L 4 HOH 13  310 27  HOH TIP B . 
L 4 HOH 14  311 36  HOH TIP B . 
L 4 HOH 15  312 40  HOH TIP B . 
L 4 HOH 16  313 41  HOH TIP B . 
L 4 HOH 17  314 49  HOH TIP B . 
L 4 HOH 18  315 315 HOH TIP B . 
L 4 HOH 19  316 316 HOH TIP B . 
L 4 HOH 20  317 50  HOH TIP B . 
L 4 HOH 21  318 318 HOH TIP B . 
L 4 HOH 22  319 51  HOH TIP B . 
L 4 HOH 23  320 320 HOH TIP B . 
L 4 HOH 24  321 52  HOH TIP B . 
L 4 HOH 25  322 53  HOH TIP B . 
L 4 HOH 26  323 323 HOH TIP B . 
L 4 HOH 27  324 55  HOH TIP B . 
L 4 HOH 28  325 60  HOH TIP B . 
L 4 HOH 29  326 326 HOH TIP B . 
L 4 HOH 30  327 67  HOH TIP B . 
L 4 HOH 31  328 73  HOH TIP B . 
L 4 HOH 32  329 82  HOH TIP B . 
L 4 HOH 33  330 330 HOH TIP B . 
L 4 HOH 34  331 83  HOH TIP B . 
L 4 HOH 35  332 85  HOH TIP B . 
L 4 HOH 36  333 88  HOH TIP B . 
L 4 HOH 37  334 89  HOH TIP B . 
L 4 HOH 38  335 335 HOH TIP B . 
L 4 HOH 39  336 95  HOH TIP B . 
L 4 HOH 40  337 97  HOH TIP B . 
L 4 HOH 41  338 98  HOH TIP B . 
L 4 HOH 42  339 100 HOH TIP B . 
L 4 HOH 43  340 101 HOH TIP B . 
L 4 HOH 44  341 105 HOH TIP B . 
L 4 HOH 45  342 119 HOH TIP B . 
L 4 HOH 46  343 343 HOH TIP B . 
L 4 HOH 47  344 121 HOH TIP B . 
L 4 HOH 48  345 125 HOH TIP B . 
L 4 HOH 49  346 127 HOH TIP B . 
L 4 HOH 50  347 347 HOH TIP B . 
L 4 HOH 51  348 348 HOH TIP B . 
L 4 HOH 52  349 129 HOH TIP B . 
L 4 HOH 53  350 132 HOH TIP B . 
L 4 HOH 54  351 134 HOH TIP B . 
L 4 HOH 55  352 143 HOH TIP B . 
L 4 HOH 56  353 147 HOH TIP B . 
L 4 HOH 57  354 151 HOH TIP B . 
L 4 HOH 58  355 355 HOH TIP B . 
L 4 HOH 59  356 152 HOH TIP B . 
L 4 HOH 60  357 158 HOH TIP B . 
L 4 HOH 61  358 160 HOH TIP B . 
L 4 HOH 62  359 163 HOH TIP B . 
L 4 HOH 63  360 164 HOH TIP B . 
L 4 HOH 64  361 166 HOH TIP B . 
L 4 HOH 65  362 171 HOH TIP B . 
L 4 HOH 66  363 174 HOH TIP B . 
L 4 HOH 67  364 180 HOH TIP B . 
L 4 HOH 68  365 365 HOH TIP B . 
L 4 HOH 69  366 181 HOH TIP B . 
L 4 HOH 70  367 182 HOH TIP B . 
L 4 HOH 71  368 368 HOH TIP B . 
L 4 HOH 72  369 186 HOH TIP B . 
L 4 HOH 73  370 189 HOH TIP B . 
L 4 HOH 74  371 190 HOH TIP B . 
L 4 HOH 75  372 191 HOH TIP B . 
L 4 HOH 76  373 373 HOH TIP B . 
L 4 HOH 77  374 196 HOH TIP B . 
L 4 HOH 78  375 207 HOH TIP B . 
L 4 HOH 79  376 209 HOH TIP B . 
L 4 HOH 80  377 213 HOH TIP B . 
L 4 HOH 81  378 378 HOH TIP B . 
L 4 HOH 82  379 214 HOH TIP B . 
L 4 HOH 83  380 216 HOH TIP B . 
L 4 HOH 84  381 381 HOH TIP B . 
L 4 HOH 85  382 382 HOH TIP B . 
L 4 HOH 86  383 383 HOH TIP B . 
L 4 HOH 87  384 218 HOH TIP B . 
L 4 HOH 88  385 223 HOH TIP B . 
L 4 HOH 89  386 224 HOH TIP B . 
L 4 HOH 90  387 227 HOH TIP B . 
L 4 HOH 91  388 229 HOH TIP B . 
L 4 HOH 92  389 232 HOH TIP B . 
L 4 HOH 93  390 236 HOH TIP B . 
L 4 HOH 94  391 240 HOH TIP B . 
L 4 HOH 95  392 248 HOH TIP B . 
L 4 HOH 96  393 250 HOH TIP B . 
L 4 HOH 97  394 251 HOH TIP B . 
L 4 HOH 98  395 261 HOH TIP B . 
L 4 HOH 99  396 265 HOH TIP B . 
L 4 HOH 100 397 269 HOH TIP B . 
L 4 HOH 101 398 270 HOH TIP B . 
L 4 HOH 102 399 275 HOH TIP B . 
L 4 HOH 103 400 280 HOH TIP B . 
L 4 HOH 104 401 281 HOH TIP B . 
L 4 HOH 105 402 283 HOH TIP B . 
L 4 HOH 106 403 287 HOH TIP B . 
L 4 HOH 107 404 290 HOH TIP B . 
L 4 HOH 108 405 292 HOH TIP B . 
L 4 HOH 109 406 293 HOH TIP B . 
M 4 HOH 1   298 2   HOH TIP C . 
M 4 HOH 2   299 299 HOH TIP C . 
M 4 HOH 3   300 7   HOH TIP C . 
M 4 HOH 4   301 8   HOH TIP C . 
M 4 HOH 5   302 302 HOH TIP C . 
M 4 HOH 6   303 12  HOH TIP C . 
M 4 HOH 7   304 15  HOH TIP C . 
M 4 HOH 8   305 17  HOH TIP C . 
M 4 HOH 9   306 20  HOH TIP C . 
M 4 HOH 10  307 21  HOH TIP C . 
M 4 HOH 11  308 22  HOH TIP C . 
M 4 HOH 12  309 25  HOH TIP C . 
M 4 HOH 13  310 310 HOH TIP C . 
M 4 HOH 14  311 311 HOH TIP C . 
M 4 HOH 15  312 312 HOH TIP C . 
M 4 HOH 16  313 26  HOH TIP C . 
M 4 HOH 17  314 314 HOH TIP C . 
M 4 HOH 18  315 28  HOH TIP C . 
M 4 HOH 19  316 29  HOH TIP C . 
M 4 HOH 20  317 31  HOH TIP C . 
M 4 HOH 21  318 33  HOH TIP C . 
M 4 HOH 22  319 34  HOH TIP C . 
M 4 HOH 23  320 35  HOH TIP C . 
M 4 HOH 24  321 37  HOH TIP C . 
M 4 HOH 25  322 38  HOH TIP C . 
M 4 HOH 26  323 42  HOH TIP C . 
M 4 HOH 27  324 44  HOH TIP C . 
M 4 HOH 28  325 46  HOH TIP C . 
M 4 HOH 29  326 47  HOH TIP C . 
M 4 HOH 30  327 54  HOH TIP C . 
M 4 HOH 31  328 328 HOH TIP C . 
M 4 HOH 32  329 58  HOH TIP C . 
M 4 HOH 33  330 62  HOH TIP C . 
M 4 HOH 34  331 331 HOH TIP C . 
M 4 HOH 35  332 69  HOH TIP C . 
M 4 HOH 36  333 70  HOH TIP C . 
M 4 HOH 37  334 71  HOH TIP C . 
M 4 HOH 38  335 76  HOH TIP C . 
M 4 HOH 39  336 77  HOH TIP C . 
M 4 HOH 40  337 78  HOH TIP C . 
M 4 HOH 41  338 80  HOH TIP C . 
M 4 HOH 42  339 84  HOH TIP C . 
M 4 HOH 43  340 340 HOH TIP C . 
M 4 HOH 44  341 87  HOH TIP C . 
M 4 HOH 45  342 342 HOH TIP C . 
M 4 HOH 46  343 103 HOH TIP C . 
M 4 HOH 47  344 107 HOH TIP C . 
M 4 HOH 48  345 110 HOH TIP C . 
M 4 HOH 49  346 115 HOH TIP C . 
M 4 HOH 50  347 118 HOH TIP C . 
M 4 HOH 51  348 120 HOH TIP C . 
M 4 HOH 52  349 122 HOH TIP C . 
M 4 HOH 53  350 124 HOH TIP C . 
M 4 HOH 54  351 351 HOH TIP C . 
M 4 HOH 55  352 126 HOH TIP C . 
M 4 HOH 56  353 135 HOH TIP C . 
M 4 HOH 57  354 354 HOH TIP C . 
M 4 HOH 58  355 145 HOH TIP C . 
M 4 HOH 59  356 356 HOH TIP C . 
M 4 HOH 60  357 156 HOH TIP C . 
M 4 HOH 61  358 167 HOH TIP C . 
M 4 HOH 62  359 169 HOH TIP C . 
M 4 HOH 63  360 173 HOH TIP C . 
M 4 HOH 64  361 361 HOH TIP C . 
M 4 HOH 65  362 362 HOH TIP C . 
M 4 HOH 66  363 176 HOH TIP C . 
M 4 HOH 67  364 364 HOH TIP C . 
M 4 HOH 68  365 177 HOH TIP C . 
M 4 HOH 69  366 178 HOH TIP C . 
M 4 HOH 70  367 184 HOH TIP C . 
M 4 HOH 71  368 192 HOH TIP C . 
M 4 HOH 72  369 195 HOH TIP C . 
M 4 HOH 73  370 198 HOH TIP C . 
M 4 HOH 74  371 199 HOH TIP C . 
M 4 HOH 75  372 203 HOH TIP C . 
M 4 HOH 76  373 206 HOH TIP C . 
M 4 HOH 77  374 208 HOH TIP C . 
M 4 HOH 78  375 210 HOH TIP C . 
M 4 HOH 79  376 211 HOH TIP C . 
M 4 HOH 80  377 215 HOH TIP C . 
M 4 HOH 81  378 228 HOH TIP C . 
M 4 HOH 82  379 230 HOH TIP C . 
M 4 HOH 83  380 234 HOH TIP C . 
M 4 HOH 84  381 237 HOH TIP C . 
M 4 HOH 85  382 238 HOH TIP C . 
M 4 HOH 86  383 241 HOH TIP C . 
M 4 HOH 87  384 384 HOH TIP C . 
M 4 HOH 88  385 385 HOH TIP C . 
M 4 HOH 89  386 246 HOH TIP C . 
M 4 HOH 90  387 249 HOH TIP C . 
M 4 HOH 91  388 252 HOH TIP C . 
M 4 HOH 92  389 253 HOH TIP C . 
M 4 HOH 93  390 255 HOH TIP C . 
M 4 HOH 94  391 258 HOH TIP C . 
M 4 HOH 95  392 259 HOH TIP C . 
M 4 HOH 96  393 271 HOH TIP C . 
M 4 HOH 97  394 276 HOH TIP C . 
M 4 HOH 98  395 279 HOH TIP C . 
M 4 HOH 99  396 291 HOH TIP C . 
M 4 HOH 100 397 294 HOH TIP C . 
M 4 HOH 101 398 297 HOH TIP C . 
N 4 HOH 1   298 4   HOH TIP D . 
N 4 HOH 2   299 23  HOH TIP D . 
N 4 HOH 3   300 300 HOH TIP D . 
N 4 HOH 4   301 24  HOH TIP D . 
N 4 HOH 5   302 30  HOH TIP D . 
N 4 HOH 6   303 32  HOH TIP D . 
N 4 HOH 7   304 56  HOH TIP D . 
N 4 HOH 8   305 61  HOH TIP D . 
N 4 HOH 9   306 65  HOH TIP D . 
N 4 HOH 10  307 72  HOH TIP D . 
N 4 HOH 11  308 308 HOH TIP D . 
N 4 HOH 12  309 309 HOH TIP D . 
N 4 HOH 13  310 75  HOH TIP D . 
N 4 HOH 14  311 92  HOH TIP D . 
N 4 HOH 15  312 93  HOH TIP D . 
N 4 HOH 16  313 94  HOH TIP D . 
N 4 HOH 17  314 99  HOH TIP D . 
N 4 HOH 18  315 102 HOH TIP D . 
N 4 HOH 19  316 108 HOH TIP D . 
N 4 HOH 20  317 109 HOH TIP D . 
N 4 HOH 21  318 112 HOH TIP D . 
N 4 HOH 22  319 319 HOH TIP D . 
N 4 HOH 23  320 114 HOH TIP D . 
N 4 HOH 24  321 137 HOH TIP D . 
N 4 HOH 25  322 141 HOH TIP D . 
N 4 HOH 26  323 148 HOH TIP D . 
N 4 HOH 27  324 149 HOH TIP D . 
N 4 HOH 28  325 150 HOH TIP D . 
N 4 HOH 29  326 153 HOH TIP D . 
N 4 HOH 30  327 155 HOH TIP D . 
N 4 HOH 31  328 165 HOH TIP D . 
N 4 HOH 32  329 329 HOH TIP D . 
N 4 HOH 33  330 170 HOH TIP D . 
N 4 HOH 34  331 172 HOH TIP D . 
N 4 HOH 35  332 188 HOH TIP D . 
N 4 HOH 36  333 333 HOH TIP D . 
N 4 HOH 37  334 193 HOH TIP D . 
N 4 HOH 38  335 197 HOH TIP D . 
N 4 HOH 39  336 201 HOH TIP D . 
N 4 HOH 40  337 205 HOH TIP D . 
N 4 HOH 41  338 212 HOH TIP D . 
N 4 HOH 42  339 339 HOH TIP D . 
N 4 HOH 43  340 217 HOH TIP D . 
N 4 HOH 44  341 341 HOH TIP D . 
N 4 HOH 45  342 220 HOH TIP D . 
N 4 HOH 46  343 222 HOH TIP D . 
N 4 HOH 47  344 344 HOH TIP D . 
N 4 HOH 48  345 225 HOH TIP D . 
N 4 HOH 49  346 346 HOH TIP D . 
N 4 HOH 50  347 226 HOH TIP D . 
N 4 HOH 51  348 233 HOH TIP D . 
N 4 HOH 52  349 235 HOH TIP D . 
N 4 HOH 53  350 350 HOH TIP D . 
N 4 HOH 54  351 239 HOH TIP D . 
N 4 HOH 55  352 244 HOH TIP D . 
N 4 HOH 56  353 353 HOH TIP D . 
N 4 HOH 57  354 245 HOH TIP D . 
N 4 HOH 58  355 257 HOH TIP D . 
N 4 HOH 59  356 260 HOH TIP D . 
N 4 HOH 60  357 357 HOH TIP D . 
N 4 HOH 61  358 263 HOH TIP D . 
N 4 HOH 62  359 264 HOH TIP D . 
N 4 HOH 63  360 267 HOH TIP D . 
N 4 HOH 64  361 268 HOH TIP D . 
N 4 HOH 65  362 277 HOH TIP D . 
N 4 HOH 66  363 278 HOH TIP D . 
N 4 HOH 67  364 288 HOH TIP D . 
N 4 HOH 68  365 289 HOH TIP D . 
N 4 HOH 69  366 296 HOH TIP D . 
N 4 HOH 70  377 377 HOH TIP D . 
N 4 HOH 71  379 379 HOH TIP D . 
N 4 HOH 72  386 386 HOH TIP D . 
N 4 HOH 73  387 387 HOH TIP D . 
N 4 HOH 74  388 388 HOH TIP D . 
N 4 HOH 75  389 389 HOH TIP D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 81  A MSE 79  ? MET SELENOMETHIONINE 
2  A MSE 122 A MSE 120 ? MET SELENOMETHIONINE 
3  A MSE 126 A MSE 124 ? MET SELENOMETHIONINE 
4  A MSE 158 A MSE 156 ? MET SELENOMETHIONINE 
5  A MSE 240 A MSE 238 ? MET SELENOMETHIONINE 
6  B MSE 81  B MSE 79  ? MET SELENOMETHIONINE 
7  B MSE 122 B MSE 120 ? MET SELENOMETHIONINE 
8  B MSE 126 B MSE 124 ? MET SELENOMETHIONINE 
9  B MSE 158 B MSE 156 ? MET SELENOMETHIONINE 
10 B MSE 240 B MSE 238 ? MET SELENOMETHIONINE 
11 C MSE 81  C MSE 79  ? MET SELENOMETHIONINE 
12 C MSE 122 C MSE 120 ? MET SELENOMETHIONINE 
13 C MSE 126 C MSE 124 ? MET SELENOMETHIONINE 
14 C MSE 158 C MSE 156 ? MET SELENOMETHIONINE 
15 C MSE 240 C MSE 238 ? MET SELENOMETHIONINE 
16 D MSE 81  D MSE 79  ? MET SELENOMETHIONINE 
17 D MSE 122 D MSE 120 ? MET SELENOMETHIONINE 
18 D MSE 126 D MSE 124 ? MET SELENOMETHIONINE 
19 D MSE 158 D MSE 156 ? MET SELENOMETHIONINE 
20 D MSE 240 D MSE 238 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,H,K,M 
2 1 B,D,F,I,J,L,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4690  ? 
1 MORE         -17   ? 
1 'SSA (A^2)'  22830 ? 
2 'ABSA (A^2)' 4900  ? 
2 MORE         -21   ? 
2 'SSA (A^2)'  22290 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-08-18 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-02-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' audit_author    
2 3 'Structure model' citation_author 
3 3 'Structure model' struct_conn     
4 3 'Structure model' struct_site     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_audit_author.identifier_ORCID'      
2 3 'Structure model' '_citation_author.identifier_ORCID'   
3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 3 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 3 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 3 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS    'data collection' .   ? 1 
MOLREP   phasing           .   ? 2 
CNS      refinement        1.1 ? 3 
DENZO    'data reduction'  .   ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N A HIS 89  ? ? CA A HIS 89  ? ? C A HIS 89  ? ? 137.13 111.00 26.13 2.70 N 
2 1 N A GLN 210 ? ? CA A GLN 210 ? ? C A GLN 210 ? ? 130.41 111.00 19.41 2.70 N 
3 1 N B ASN 87  ? ? CA B ASN 87  ? ? C B ASN 87  ? ? 129.03 111.00 18.03 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 62  ? ? -98.41  44.29   
2  1 PRO A 77  ? ? -72.93  38.53   
3  1 PHE A 86  ? ? -115.67 -134.87 
4  1 GLN A 88  ? ? 107.88  -80.44  
5  1 HIS A 89  ? ? 99.04   95.01   
6  1 SER A 98  ? ? -83.98  -111.84 
7  1 GLN A 136 ? ? -109.87 -151.86 
8  1 PRO A 162 ? ? -66.17  72.14   
9  1 GLN A 210 ? ? 138.51  -32.02  
10 1 GLU A 211 ? ? -76.06  39.49   
11 1 ALA A 224 ? ? -68.13  65.19   
12 1 ASP A 226 ? ? -162.27 106.72  
13 1 THR A 270 ? ? -117.67 -94.25  
14 1 ASN B 62  ? ? -100.85 43.30   
15 1 PRO B 77  ? ? -74.71  43.36   
16 1 PHE B 86  ? ? -137.08 -127.75 
17 1 ASN B 87  ? ? -40.04  -155.93 
18 1 HIS B 89  ? ? 113.65  116.13  
19 1 GLN B 136 ? ? -116.55 -150.51 
20 1 PRO B 162 ? ? -63.34  63.14   
21 1 GLN B 190 ? ? 37.37   63.93   
22 1 GLU B 211 ? ? 37.33   56.92   
23 1 THR B 270 ? ? -110.88 -97.91  
24 1 PRO C 77  ? ? -75.79  29.55   
25 1 ASP C 100 ? ? -103.33 -97.98  
26 1 GLN C 136 ? ? -117.84 -152.62 
27 1 PRO C 162 ? ? -65.38  62.26   
28 1 GLN C 190 ? ? 37.01   69.93   
29 1 GLU C 211 ? ? 21.15   65.55   
30 1 THR C 270 ? ? -116.64 -92.82  
31 1 ASN D 62  ? ? -99.55  30.75   
32 1 SER D 98  ? ? -20.30  -82.87  
33 1 ALA D 99  ? ? 142.72  -18.96  
34 1 ASP D 100 ? ? -166.05 -40.24  
35 1 SER D 116 ? ? 84.62   135.88  
36 1 GLN D 136 ? ? -118.91 -156.48 
37 1 SER D 153 ? ? 80.55   -33.60  
38 1 PRO D 162 ? ? -69.44  63.59   
39 1 GLN D 210 ? ? -126.86 -123.09 
40 1 GLU D 223 ? ? -51.32  -77.60  
41 1 ALA D 224 ? ? 109.17  87.93   
42 1 THR D 270 ? ? -114.72 -90.62  
43 1 ARG D 278 ? ? -46.31  -71.78  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE -3  ? A MSE 1   
2  1 Y 1 A THR 286 ? A THR 288 
3  1 Y 1 A ASP 287 ? A ASP 289 
4  1 Y 1 A GLY 288 ? A GLY 290 
5  1 Y 1 A ALA 289 ? A ALA 291 
6  1 Y 1 A GLU 290 ? A GLU 292 
7  1 Y 1 A GLY 291 ? A GLY 293 
8  1 Y 1 A HIS 292 ? A HIS 294 
9  1 Y 1 A HIS 293 ? A HIS 295 
10 1 Y 1 A HIS 294 ? A HIS 296 
11 1 Y 1 A HIS 295 ? A HIS 297 
12 1 Y 1 A HIS 296 ? A HIS 298 
13 1 Y 1 A HIS 297 ? A HIS 299 
14 1 Y 1 B MSE -3  ? B MSE 1   
15 1 Y 1 B SER -2  ? B SER 2   
16 1 Y 1 B ASP 100 ? B ASP 102 
17 1 Y 1 B GLY 101 ? B GLY 103 
18 1 Y 1 B THR 286 ? B THR 288 
19 1 Y 1 B ASP 287 ? B ASP 289 
20 1 Y 1 B GLY 288 ? B GLY 290 
21 1 Y 1 B ALA 289 ? B ALA 291 
22 1 Y 1 B GLU 290 ? B GLU 292 
23 1 Y 1 B GLY 291 ? B GLY 293 
24 1 Y 1 B HIS 292 ? B HIS 294 
25 1 Y 1 B HIS 293 ? B HIS 295 
26 1 Y 1 B HIS 294 ? B HIS 296 
27 1 Y 1 B HIS 295 ? B HIS 297 
28 1 Y 1 B HIS 296 ? B HIS 298 
29 1 Y 1 B HIS 297 ? B HIS 299 
30 1 Y 1 C MSE -3  ? C MSE 1   
31 1 Y 1 C SER -2  ? C SER 2   
32 1 Y 1 C THR 286 ? C THR 288 
33 1 Y 1 C ASP 287 ? C ASP 289 
34 1 Y 1 C GLY 288 ? C GLY 290 
35 1 Y 1 C ALA 289 ? C ALA 291 
36 1 Y 1 C GLU 290 ? C GLU 292 
37 1 Y 1 C GLY 291 ? C GLY 293 
38 1 Y 1 C HIS 292 ? C HIS 294 
39 1 Y 1 C HIS 293 ? C HIS 295 
40 1 Y 1 C HIS 294 ? C HIS 296 
41 1 Y 1 C HIS 295 ? C HIS 297 
42 1 Y 1 C HIS 296 ? C HIS 298 
43 1 Y 1 C HIS 297 ? C HIS 299 
44 1 Y 1 D MSE -3  ? D MSE 1   
45 1 Y 1 D THR 286 ? D THR 288 
46 1 Y 1 D ASP 287 ? D ASP 289 
47 1 Y 1 D GLY 288 ? D GLY 290 
48 1 Y 1 D ALA 289 ? D ALA 291 
49 1 Y 1 D GLU 290 ? D GLU 292 
50 1 Y 1 D GLY 291 ? D GLY 293 
51 1 Y 1 D HIS 292 ? D HIS 294 
52 1 Y 1 D HIS 293 ? D HIS 295 
53 1 Y 1 D HIS 294 ? D HIS 296 
54 1 Y 1 D HIS 295 ? D HIS 297 
55 1 Y 1 D HIS 296 ? D HIS 298 
56 1 Y 1 D HIS 297 ? D HIS 299 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
3 GLYCEROL                    GOL 
4 water                       HOH 
#